data_2WW9
# 
_entry.id   2WW9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WW9         
PDBE  EBI-41337    
WWPDB D_1290041337 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  1K5Y     unspecified            
;STRUCTURE OF THE TRANSLATING 80S RIBOSOME FROM YEAST, OBTAINED BY DOCKING ATOMIC MODELS FOR RNA AND PROTEINCOMPONENTS INTO A 15A CRYO-EM MAP. THIS FILE 1K5Y CONTAINSTHE 60S RIBOSOMAL SUBUNIT. THE FILE 1K5X CONTAINS THE 40SRIBOSOMAL SUBUNIT, THE P-SITE BOUND TRNA AND THE MRNA CODON.
;
PDB  1S1I     unspecified            
;STRUCTURE OF THE RIBOSOMAL 80S-EEF2-SORDARIN COMPLEX FROMYEAST OBTAINED BY DOCKING ATOMIC MODELS FOR RNA ANDPROTEIN COMPONENTS INTO A 11.7 A CRYO-EM MAP. THIS FILE,1S1I, CONTAINS 60S SUBUNIT. THE 40S RIBOSOMAL SUBUNIT ISIN FILE 1S1H.
;
PDB  2WWA     unspecified            'CRYO-EM STRUCTURES OF IDLE YEAST SSH1 COMPLEX BOUND TO THE YEAST 80S RIBOSOME' 
PDB  2WWB     unspecified            
'CRYO-EM STRUCTURE OF THE MAMMALIAN SEC61 COMPLEX BOUND TO THE ACTIVELY TRANSLATING WHEAT GERM 80S RIBOSOME' 
EMDB EMD-1651 'other EM volume'      'CRYO-EM STRUCTURE OF THE PROGRAMMED YEAST 80 RIBOSOME BOUND THE SSH1 COMPLEX' 
EMDB EMD-1652 'other EM volume'      
'CRYO-EM STRUCTURE OF THE MAMMALIAN SEC61 COMPLEX BOUND TO THE ACTIVELY TRANSLATING WHEAT GERM 80S RIBOSOME' 
EMDB EMD-1667 'associated EM volume' 
'CRYO-EM STRUCTURE OF THE ACTIVE YEAST SSH1 COMPLEX BOUND TO THE PROGRAMMED YEAST 80S RIBOSOME BEARING A P-SITE TRNA' 
EMDB EMD-1668 'other EM volume'      
;CRYO-EM STRUCTURE OF THE ACTIVE YEAST 80S RIBOSOME BEARING A P-SITE TRNA AND WITH THE RRNA EXPANSION SEGMENT ES27 IN THE EXIT CONFORMATION
;
EMDB EMD-1669 'other EM volume'      'CRYO-EM STRUCTURES OF THE IDLE YEAST SSH1 COMPLEX BOUND TO THE YEAST 80S RIBOSOME' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WW9 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, T.'        1  
'Mandon, E.'        2  
'Bhushan, S.'       3  
'Jarasch, A.'       4  
'Armache, J.P.'     5  
'Funes, S.'         6  
'Jossinet, F.'      7  
'Gumbart, J.'       8  
'Mielke, T.'        9  
'Berninghausen, O.' 10 
'Schulten, K.'      11 
'Westhof, E.'       12 
'Gilmore, R.'       13 
'Beckmann, R.'      14 
# 
_citation.id                        primary 
_citation.title                     
'Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            326 
_citation.page_first                1369 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19933108 
_citation.pdbx_database_id_DOI      10.1126/SCIENCE.1178535 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Becker, T.'        1  ? 
primary 'Bhushan, S.'       2  ? 
primary 'Jarasch, A.'       3  ? 
primary 'Armache, J.P.'     4  ? 
primary 'Funes, S.'         5  ? 
primary 'Jossinet, F.'      6  ? 
primary 'Gumbart, J.'       7  ? 
primary 'Mielke, T.'        8  ? 
primary 'Berninghausen, O.' 9  ? 
primary 'Schulten, K.'      10 ? 
primary 'Westhof, E.'       11 ? 
primary 'Gilmore, R.'       12 ? 
primary 'Mandon, E.'        13 ? 
primary 'Beckmann, R.'      14 ? 
# 
_cell.entry_id           2WW9 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WW9 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer nat 'SEC SIXTY-ONE PROTEIN HOMOLOG'  53350.344 1 ? ? ?               ?                   
2  polymer nat 'PROTEIN TRANSPORT PROTEIN SSS1' 8958.641  1 ? ? ?               ?                   
3  polymer nat 'PROTEIN TRANSPORT PROTEIN SEB2' 9505.979  1 ? ? 'RESIDUES 1-87' ?                   
4  polymer nat '25S RRNA'                       20302.104 1 ? ? ?               'H5_H6_H7 FRAGMENT' 
5  polymer nat '25S RRNA'                       11089.751 1 ? ? ?               'H24 FRAGMENT'      
6  polymer nat '25S RRNA'                       8052.861  1 ? ? ?               'H50 FRAGMENT'      
7  polymer nat '25S RRNA'                       5700.419  1 ? ? ?               'H59 FRAGMENT'      
8  polymer nat '60S RIBOSOMAL PROTEIN L4-B'     39129.102 1 ? ? ?               ?                   
9  polymer nat '60S RIBOSOMAL PROTEIN L17-A'    20589.518 1 ? ? ?               ?                   
10 polymer nat '60S RIBOSOMAL PROTEIN L19'      21762.316 1 ? ? ?               ?                   
11 polymer nat '60S RIBOSOMAL PROTEIN L25'      15787.612 1 ? ? ?               ?                   
12 polymer nat '60S RIBOSOMAL PROTEIN L26-A'    14265.784 1 ? ? ?               ?                   
13 polymer nat '60S RIBOSOMAL PROTEIN L31-A'    12980.158 1 ? ? ?               ?                   
14 polymer nat '60S RIBOSOMAL PROTEIN L35'      13942.640 1 ? ? ?               ?                   
15 polymer nat '60S RIBOSOMAL PROTEIN L39'      6358.640  1 ? ? ?               ?                   
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'SSH1P, SSH1 COMPLEX SUBUNIT SSH1, SSH1 COMPLEX SUBUNIT ALPHA'                                                          
2  'SSS1P, SEC61 COMPLEX SUBUNIT SSS1, SEC61 COMPLEX SUBUNIT GAMMA, SSH1 COMPLEX SUBUNIT SSS1, SSH1 COMPLEX SUBUNIT GAMMA' 
3  'SBH2P, SSH1 COMPLEX SUBUNIT SEB2, SSH1 COMPLEX SUBUNIT BETA'                                                           
8  '60S RIBOSOMAL PROTEIN L4, L2, YL2, RP2'                                                                                
9  '60S RIBOSOMAL PROTEIN L17, L20A, YL17'                                                                                 
10 'L23, YL14, RP15L, RP33'                                                                                                
11 
;YL25, RP16L, YP42'
;
12 '60S RIBOSOMAL PROTEIN L26, L33, YL33'                                                                                  
13 '60S RIBOSOMAL PROTEIN L31, L34, YL28'                                                                                  
15 'L46, YL40'                                                                                                             
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'   no no 
;MSGFRLIDIVKPILPILPEVELPFEKLPFDDKIVYTIFAGLIYLFAQFPLVGLPKATTPNVNDPIYFLRGVFGCEPRTLL
EFGLFPNISSGLILQLLAGLKVIKVNFKIQSDRELFQSLTKVFAIVQYVILTNIFIFAGYFGDDLSVVQIGLINFQLVGA
GIFTTLLAEVIDKGFGFSSGAMIINTVVIATNLVADTFGVSQIKVGEDDQTEAQGALINLIQGLRSKHKTFIGGIISAFN
RDYLPNLTTTIIVLAIAIIVCYLQSVRVELPIRSTRARGTNNVYPIKLLYTGCLSVLFSYTILFYIHIFAFVLIQLVAKN
EPTHIICKIMGHYENANNLLAVPTFPLSLLAPPTSFFKGVTQQPLTFITYSAFILVTGIWFADKWQAISGSSARDVALEF
KDQGITLMGRREQNVAKELNKVIPIAAVTGASVLSLITVIGESLGLKGKAAGIVVGIAGGFSLLEVITIEYQQSGGQSAL
NQVLGVPGAM
;
;MSGFRLIDIVKPILPILPEVELPFEKLPFDDKIVYTIFAGLIYLFAQFPLVGLPKATTPNVNDPIYFLRGVFGCEPRTLL
EFGLFPNISSGLILQLLAGLKVIKVNFKIQSDRELFQSLTKVFAIVQYVILTNIFIFAGYFGDDLSVVQIGLINFQLVGA
GIFTTLLAEVIDKGFGFSSGAMIINTVVIATNLVADTFGVSQIKVGEDDQTEAQGALINLIQGLRSKHKTFIGGIISAFN
RDYLPNLTTTIIVLAIAIIVCYLQSVRVELPIRSTRARGTNNVYPIKLLYTGCLSVLFSYTILFYIHIFAFVLIQLVAKN
EPTHIICKIMGHYENANNLLAVPTFPLSLLAPPTSFFKGVTQQPLTFITYSAFILVTGIWFADKWQAISGSSARDVALEF
KDQGITLMGRREQNVAKELNKVIPIAAVTGASVLSLITVIGESLGLKGKAAGIVVGIAGGFSLLEVITIEYQQSGGQSAL
NQVLGVPGAM
;
A ? 
2  'polypeptide(L)'   no no MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV 
MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV B ? 
3  'polypeptide(L)'   no no 
;MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLSVGFIFSVIALHL
LTKFTHI
;
;MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLSVGFIFSVIALHL
LTKFTHI
;
C ? 
4  polyribonucleotide no no AGAACGCAGCGAAAUGCGAUACGUAAUGUGAAUUGCAGAAUUCCGUGAAUCAUCGAAUCUUUG 
AGAACGCAGCGAAAUGCGAUACGUAAUGUGAAUUGCAGAAUUCCGUGAAUCAUCGAAUCUUUG D ? 
5  polyribonucleotide no no UGAAAAGAACUUUGAAAAGAGAGUGAAAAAGUAC UGAAAAGAACUUUGAAAAGAGAGUGAAAAAGUAC E ? 
6  polyribonucleotide no no CCACGUCAACAGCAGUUGGACGUGG CCACGUCAACAGCAGUUGGACGUGG F ? 
7  polyribonucleotide no no GCCAGCACCUUUGCUGGC GCCAGCACCUUUGCUGGC G ? 
8  'polypeptide(L)'   no no 
;MSRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGG
GTGRSGQGAFGNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVVSTDLESIQ
KTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAP
GAHLGRFVIWTEAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRPAGQATQKRTHVLKKNPLKN
KQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPAAVFAETLKHD
;
;MSRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGG
GTGRSGQGAFGNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVVSTDLESIQ
KTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAP
GAHLGRFVIWTEAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRPAGQATQKRTHVLKKNPLKN
KQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPAAVFAETLKHD
;
H ? 
9  'polypeptide(L)'   no no 
;MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIPFRRFNSSIGRTAQGKEFGVTK
ARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKA
AEKKVVRLTSRQRGRIAAQKRIAA
;
;MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIPFRRFNSSIGRTAQGKEFGVTK
ARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKA
AEKKVVRLTSRQRGRIAAQKRIAA
;
I ? 
10 'polypeptide(L)'   no no 
;MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSKREGRHSGYGK
RKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAE
ARRLKNRAARDRRAQRVAEKRDALLKEDA
;
;MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSKREGRHSGYGK
RKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAE
ARRLKNRAARDRRAQRVAEKRDALLKEDA
;
J ? 
11 'polypeptide(L)'   no no 
;MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETAMKKVEDGN
ILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI
;
;MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETAMKKVEDGN
ILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI
;
K ? 
12 'polypeptide(L)'   no no 
;MAKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAV
QVDKVTKEKVNGASVPINLHPSKLVITKLHLDKDRKALIQRKGGKLE
;
;MAKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAV
QVDKVTKEKVNGASVPINLHPSKLVITKLHLDKDRKALIQRKGGKLE
;
L ? 
13 'polypeptide(L)'   no no 
;MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIWKRGVKGVEYRLRLRISRKRN
EEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA
;
;MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIWKRGVKGVEYRLRLRISRKRN
EEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA
;
M ? 
14 'polypeptide(L)'   no no 
;MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIACVLTVINEQQREAVRQLYKGKKYQPKDL
RAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIKA
;
;MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIACVLTVINEQQREAVRQLYKGKKYQPKDL
RAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIKA
;
N ? 
15 'polypeptide(L)'   no no MAAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI 
MAAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI O ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   SER n 
1  3   GLY n 
1  4   PHE n 
1  5   ARG n 
1  6   LEU n 
1  7   ILE n 
1  8   ASP n 
1  9   ILE n 
1  10  VAL n 
1  11  LYS n 
1  12  PRO n 
1  13  ILE n 
1  14  LEU n 
1  15  PRO n 
1  16  ILE n 
1  17  LEU n 
1  18  PRO n 
1  19  GLU n 
1  20  VAL n 
1  21  GLU n 
1  22  LEU n 
1  23  PRO n 
1  24  PHE n 
1  25  GLU n 
1  26  LYS n 
1  27  LEU n 
1  28  PRO n 
1  29  PHE n 
1  30  ASP n 
1  31  ASP n 
1  32  LYS n 
1  33  ILE n 
1  34  VAL n 
1  35  TYR n 
1  36  THR n 
1  37  ILE n 
1  38  PHE n 
1  39  ALA n 
1  40  GLY n 
1  41  LEU n 
1  42  ILE n 
1  43  TYR n 
1  44  LEU n 
1  45  PHE n 
1  46  ALA n 
1  47  GLN n 
1  48  PHE n 
1  49  PRO n 
1  50  LEU n 
1  51  VAL n 
1  52  GLY n 
1  53  LEU n 
1  54  PRO n 
1  55  LYS n 
1  56  ALA n 
1  57  THR n 
1  58  THR n 
1  59  PRO n 
1  60  ASN n 
1  61  VAL n 
1  62  ASN n 
1  63  ASP n 
1  64  PRO n 
1  65  ILE n 
1  66  TYR n 
1  67  PHE n 
1  68  LEU n 
1  69  ARG n 
1  70  GLY n 
1  71  VAL n 
1  72  PHE n 
1  73  GLY n 
1  74  CYS n 
1  75  GLU n 
1  76  PRO n 
1  77  ARG n 
1  78  THR n 
1  79  LEU n 
1  80  LEU n 
1  81  GLU n 
1  82  PHE n 
1  83  GLY n 
1  84  LEU n 
1  85  PHE n 
1  86  PRO n 
1  87  ASN n 
1  88  ILE n 
1  89  SER n 
1  90  SER n 
1  91  GLY n 
1  92  LEU n 
1  93  ILE n 
1  94  LEU n 
1  95  GLN n 
1  96  LEU n 
1  97  LEU n 
1  98  ALA n 
1  99  GLY n 
1  100 LEU n 
1  101 LYS n 
1  102 VAL n 
1  103 ILE n 
1  104 LYS n 
1  105 VAL n 
1  106 ASN n 
1  107 PHE n 
1  108 LYS n 
1  109 ILE n 
1  110 GLN n 
1  111 SER n 
1  112 ASP n 
1  113 ARG n 
1  114 GLU n 
1  115 LEU n 
1  116 PHE n 
1  117 GLN n 
1  118 SER n 
1  119 LEU n 
1  120 THR n 
1  121 LYS n 
1  122 VAL n 
1  123 PHE n 
1  124 ALA n 
1  125 ILE n 
1  126 VAL n 
1  127 GLN n 
1  128 TYR n 
1  129 VAL n 
1  130 ILE n 
1  131 LEU n 
1  132 THR n 
1  133 ASN n 
1  134 ILE n 
1  135 PHE n 
1  136 ILE n 
1  137 PHE n 
1  138 ALA n 
1  139 GLY n 
1  140 TYR n 
1  141 PHE n 
1  142 GLY n 
1  143 ASP n 
1  144 ASP n 
1  145 LEU n 
1  146 SER n 
1  147 VAL n 
1  148 VAL n 
1  149 GLN n 
1  150 ILE n 
1  151 GLY n 
1  152 LEU n 
1  153 ILE n 
1  154 ASN n 
1  155 PHE n 
1  156 GLN n 
1  157 LEU n 
1  158 VAL n 
1  159 GLY n 
1  160 ALA n 
1  161 GLY n 
1  162 ILE n 
1  163 PHE n 
1  164 THR n 
1  165 THR n 
1  166 LEU n 
1  167 LEU n 
1  168 ALA n 
1  169 GLU n 
1  170 VAL n 
1  171 ILE n 
1  172 ASP n 
1  173 LYS n 
1  174 GLY n 
1  175 PHE n 
1  176 GLY n 
1  177 PHE n 
1  178 SER n 
1  179 SER n 
1  180 GLY n 
1  181 ALA n 
1  182 MET n 
1  183 ILE n 
1  184 ILE n 
1  185 ASN n 
1  186 THR n 
1  187 VAL n 
1  188 VAL n 
1  189 ILE n 
1  190 ALA n 
1  191 THR n 
1  192 ASN n 
1  193 LEU n 
1  194 VAL n 
1  195 ALA n 
1  196 ASP n 
1  197 THR n 
1  198 PHE n 
1  199 GLY n 
1  200 VAL n 
1  201 SER n 
1  202 GLN n 
1  203 ILE n 
1  204 LYS n 
1  205 VAL n 
1  206 GLY n 
1  207 GLU n 
1  208 ASP n 
1  209 ASP n 
1  210 GLN n 
1  211 THR n 
1  212 GLU n 
1  213 ALA n 
1  214 GLN n 
1  215 GLY n 
1  216 ALA n 
1  217 LEU n 
1  218 ILE n 
1  219 ASN n 
1  220 LEU n 
1  221 ILE n 
1  222 GLN n 
1  223 GLY n 
1  224 LEU n 
1  225 ARG n 
1  226 SER n 
1  227 LYS n 
1  228 HIS n 
1  229 LYS n 
1  230 THR n 
1  231 PHE n 
1  232 ILE n 
1  233 GLY n 
1  234 GLY n 
1  235 ILE n 
1  236 ILE n 
1  237 SER n 
1  238 ALA n 
1  239 PHE n 
1  240 ASN n 
1  241 ARG n 
1  242 ASP n 
1  243 TYR n 
1  244 LEU n 
1  245 PRO n 
1  246 ASN n 
1  247 LEU n 
1  248 THR n 
1  249 THR n 
1  250 THR n 
1  251 ILE n 
1  252 ILE n 
1  253 VAL n 
1  254 LEU n 
1  255 ALA n 
1  256 ILE n 
1  257 ALA n 
1  258 ILE n 
1  259 ILE n 
1  260 VAL n 
1  261 CYS n 
1  262 TYR n 
1  263 LEU n 
1  264 GLN n 
1  265 SER n 
1  266 VAL n 
1  267 ARG n 
1  268 VAL n 
1  269 GLU n 
1  270 LEU n 
1  271 PRO n 
1  272 ILE n 
1  273 ARG n 
1  274 SER n 
1  275 THR n 
1  276 ARG n 
1  277 ALA n 
1  278 ARG n 
1  279 GLY n 
1  280 THR n 
1  281 ASN n 
1  282 ASN n 
1  283 VAL n 
1  284 TYR n 
1  285 PRO n 
1  286 ILE n 
1  287 LYS n 
1  288 LEU n 
1  289 LEU n 
1  290 TYR n 
1  291 THR n 
1  292 GLY n 
1  293 CYS n 
1  294 LEU n 
1  295 SER n 
1  296 VAL n 
1  297 LEU n 
1  298 PHE n 
1  299 SER n 
1  300 TYR n 
1  301 THR n 
1  302 ILE n 
1  303 LEU n 
1  304 PHE n 
1  305 TYR n 
1  306 ILE n 
1  307 HIS n 
1  308 ILE n 
1  309 PHE n 
1  310 ALA n 
1  311 PHE n 
1  312 VAL n 
1  313 LEU n 
1  314 ILE n 
1  315 GLN n 
1  316 LEU n 
1  317 VAL n 
1  318 ALA n 
1  319 LYS n 
1  320 ASN n 
1  321 GLU n 
1  322 PRO n 
1  323 THR n 
1  324 HIS n 
1  325 ILE n 
1  326 ILE n 
1  327 CYS n 
1  328 LYS n 
1  329 ILE n 
1  330 MET n 
1  331 GLY n 
1  332 HIS n 
1  333 TYR n 
1  334 GLU n 
1  335 ASN n 
1  336 ALA n 
1  337 ASN n 
1  338 ASN n 
1  339 LEU n 
1  340 LEU n 
1  341 ALA n 
1  342 VAL n 
1  343 PRO n 
1  344 THR n 
1  345 PHE n 
1  346 PRO n 
1  347 LEU n 
1  348 SER n 
1  349 LEU n 
1  350 LEU n 
1  351 ALA n 
1  352 PRO n 
1  353 PRO n 
1  354 THR n 
1  355 SER n 
1  356 PHE n 
1  357 PHE n 
1  358 LYS n 
1  359 GLY n 
1  360 VAL n 
1  361 THR n 
1  362 GLN n 
1  363 GLN n 
1  364 PRO n 
1  365 LEU n 
1  366 THR n 
1  367 PHE n 
1  368 ILE n 
1  369 THR n 
1  370 TYR n 
1  371 SER n 
1  372 ALA n 
1  373 PHE n 
1  374 ILE n 
1  375 LEU n 
1  376 VAL n 
1  377 THR n 
1  378 GLY n 
1  379 ILE n 
1  380 TRP n 
1  381 PHE n 
1  382 ALA n 
1  383 ASP n 
1  384 LYS n 
1  385 TRP n 
1  386 GLN n 
1  387 ALA n 
1  388 ILE n 
1  389 SER n 
1  390 GLY n 
1  391 SER n 
1  392 SER n 
1  393 ALA n 
1  394 ARG n 
1  395 ASP n 
1  396 VAL n 
1  397 ALA n 
1  398 LEU n 
1  399 GLU n 
1  400 PHE n 
1  401 LYS n 
1  402 ASP n 
1  403 GLN n 
1  404 GLY n 
1  405 ILE n 
1  406 THR n 
1  407 LEU n 
1  408 MET n 
1  409 GLY n 
1  410 ARG n 
1  411 ARG n 
1  412 GLU n 
1  413 GLN n 
1  414 ASN n 
1  415 VAL n 
1  416 ALA n 
1  417 LYS n 
1  418 GLU n 
1  419 LEU n 
1  420 ASN n 
1  421 LYS n 
1  422 VAL n 
1  423 ILE n 
1  424 PRO n 
1  425 ILE n 
1  426 ALA n 
1  427 ALA n 
1  428 VAL n 
1  429 THR n 
1  430 GLY n 
1  431 ALA n 
1  432 SER n 
1  433 VAL n 
1  434 LEU n 
1  435 SER n 
1  436 LEU n 
1  437 ILE n 
1  438 THR n 
1  439 VAL n 
1  440 ILE n 
1  441 GLY n 
1  442 GLU n 
1  443 SER n 
1  444 LEU n 
1  445 GLY n 
1  446 LEU n 
1  447 LYS n 
1  448 GLY n 
1  449 LYS n 
1  450 ALA n 
1  451 ALA n 
1  452 GLY n 
1  453 ILE n 
1  454 VAL n 
1  455 VAL n 
1  456 GLY n 
1  457 ILE n 
1  458 ALA n 
1  459 GLY n 
1  460 GLY n 
1  461 PHE n 
1  462 SER n 
1  463 LEU n 
1  464 LEU n 
1  465 GLU n 
1  466 VAL n 
1  467 ILE n 
1  468 THR n 
1  469 ILE n 
1  470 GLU n 
1  471 TYR n 
1  472 GLN n 
1  473 GLN n 
1  474 SER n 
1  475 GLY n 
1  476 GLY n 
1  477 GLN n 
1  478 SER n 
1  479 ALA n 
1  480 LEU n 
1  481 ASN n 
1  482 GLN n 
1  483 VAL n 
1  484 LEU n 
1  485 GLY n 
1  486 VAL n 
1  487 PRO n 
1  488 GLY n 
1  489 ALA n 
1  490 MET n 
2  1   MET n 
2  2   ALA n 
2  3   ARG n 
2  4   ALA n 
2  5   SER n 
2  6   GLU n 
2  7   LYS n 
2  8   GLY n 
2  9   GLU n 
2  10  GLU n 
2  11  LYS n 
2  12  LYS n 
2  13  GLN n 
2  14  SER n 
2  15  ASN n 
2  16  ASN n 
2  17  GLN n 
2  18  VAL n 
2  19  GLU n 
2  20  LYS n 
2  21  LEU n 
2  22  VAL n 
2  23  GLU n 
2  24  ALA n 
2  25  PRO n 
2  26  VAL n 
2  27  GLU n 
2  28  PHE n 
2  29  VAL n 
2  30  ARG n 
2  31  GLU n 
2  32  GLY n 
2  33  THR n 
2  34  GLN n 
2  35  PHE n 
2  36  LEU n 
2  37  ALA n 
2  38  LYS n 
2  39  CYS n 
2  40  LYS n 
2  41  LYS n 
2  42  PRO n 
2  43  ASP n 
2  44  LEU n 
2  45  LYS n 
2  46  GLU n 
2  47  TYR n 
2  48  THR n 
2  49  LYS n 
2  50  ILE n 
2  51  VAL n 
2  52  LYS n 
2  53  ALA n 
2  54  VAL n 
2  55  GLY n 
2  56  ILE n 
2  57  GLY n 
2  58  PHE n 
2  59  ILE n 
2  60  ALA n 
2  61  VAL n 
2  62  GLY n 
2  63  ILE n 
2  64  ILE n 
2  65  GLY n 
2  66  TYR n 
2  67  ALA n 
2  68  ILE n 
2  69  LYS n 
2  70  LEU n 
2  71  ILE n 
2  72  HIS n 
2  73  ILE n 
2  74  PRO n 
2  75  ILE n 
2  76  ARG n 
2  77  TYR n 
2  78  VAL n 
2  79  ILE n 
2  80  VAL n 
3  1   MET n 
3  2   ALA n 
3  3   ALA n 
3  4   SER n 
3  5   VAL n 
3  6   PRO n 
3  7   PRO n 
3  8   GLY n 
3  9   GLY n 
3  10  GLN n 
3  11  ARG n 
3  12  ILE n 
3  13  LEU n 
3  14  GLN n 
3  15  LYS n 
3  16  ARG n 
3  17  ARG n 
3  18  GLN n 
3  19  ALA n 
3  20  GLN n 
3  21  SER n 
3  22  ILE n 
3  23  LYS n 
3  24  GLU n 
3  25  LYS n 
3  26  GLN n 
3  27  ALA n 
3  28  LYS n 
3  29  GLN n 
3  30  THR n 
3  31  PRO n 
3  32  THR n 
3  33  SER n 
3  34  THR n 
3  35  ARG n 
3  36  GLN n 
3  37  ALA n 
3  38  GLY n 
3  39  TYR n 
3  40  GLY n 
3  41  GLY n 
3  42  SER n 
3  43  SER n 
3  44  SER n 
3  45  SER n 
3  46  ILE n 
3  47  LEU n 
3  48  LYS n 
3  49  LEU n 
3  50  TYR n 
3  51  THR n 
3  52  ASP n 
3  53  GLU n 
3  54  ALA n 
3  55  ASN n 
3  56  GLY n 
3  57  PHE n 
3  58  ARG n 
3  59  VAL n 
3  60  ASP n 
3  61  SER n 
3  62  LEU n 
3  63  VAL n 
3  64  VAL n 
3  65  LEU n 
3  66  PHE n 
3  67  LEU n 
3  68  SER n 
3  69  VAL n 
3  70  GLY n 
3  71  PHE n 
3  72  ILE n 
3  73  PHE n 
3  74  SER n 
3  75  VAL n 
3  76  ILE n 
3  77  ALA n 
3  78  LEU n 
3  79  HIS n 
3  80  LEU n 
3  81  LEU n 
3  82  THR n 
3  83  LYS n 
3  84  PHE n 
3  85  THR n 
3  86  HIS n 
3  87  ILE n 
4  1   A   n 
4  2   G   n 
4  3   A   n 
4  4   A   n 
4  5   C   n 
4  6   G   n 
4  7   C   n 
4  8   A   n 
4  9   G   n 
4  10  C   n 
4  11  G   n 
4  12  A   n 
4  13  A   n 
4  14  A   n 
4  15  U   n 
4  16  G   n 
4  17  C   n 
4  18  G   n 
4  19  A   n 
4  20  U   n 
4  21  A   n 
4  22  C   n 
4  23  G   n 
4  24  U   n 
4  25  A   n 
4  26  A   n 
4  27  U   n 
4  28  G   n 
4  29  U   n 
4  30  G   n 
4  31  A   n 
4  32  A   n 
4  33  U   n 
4  34  U   n 
4  35  G   n 
4  36  C   n 
4  37  A   n 
4  38  G   n 
4  39  A   n 
4  40  A   n 
4  41  U   n 
4  42  U   n 
4  43  C   n 
4  44  C   n 
4  45  G   n 
4  46  U   n 
4  47  G   n 
4  48  A   n 
4  49  A   n 
4  50  U   n 
4  51  C   n 
4  52  A   n 
4  53  U   n 
4  54  C   n 
4  55  G   n 
4  56  A   n 
4  57  A   n 
4  58  U   n 
4  59  C   n 
4  60  U   n 
4  61  U   n 
4  62  U   n 
4  63  G   n 
5  1   U   n 
5  2   G   n 
5  3   A   n 
5  4   A   n 
5  5   A   n 
5  6   A   n 
5  7   G   n 
5  8   A   n 
5  9   A   n 
5  10  C   n 
5  11  U   n 
5  12  U   n 
5  13  U   n 
5  14  G   n 
5  15  A   n 
5  16  A   n 
5  17  A   n 
5  18  A   n 
5  19  G   n 
5  20  A   n 
5  21  G   n 
5  22  A   n 
5  23  G   n 
5  24  U   n 
5  25  G   n 
5  26  A   n 
5  27  A   n 
5  28  A   n 
5  29  A   n 
5  30  A   n 
5  31  G   n 
5  32  U   n 
5  33  A   n 
5  34  C   n 
6  1   C   n 
6  2   C   n 
6  3   A   n 
6  4   C   n 
6  5   G   n 
6  6   U   n 
6  7   C   n 
6  8   A   n 
6  9   A   n 
6  10  C   n 
6  11  A   n 
6  12  G   n 
6  13  C   n 
6  14  A   n 
6  15  G   n 
6  16  U   n 
6  17  U   n 
6  18  G   n 
6  19  G   n 
6  20  A   n 
6  21  C   n 
6  22  G   n 
6  23  U   n 
6  24  G   n 
6  25  G   n 
7  1   G   n 
7  2   C   n 
7  3   C   n 
7  4   A   n 
7  5   G   n 
7  6   C   n 
7  7   A   n 
7  8   C   n 
7  9   C   n 
7  10  U   n 
7  11  U   n 
7  12  U   n 
7  13  G   n 
7  14  C   n 
7  15  U   n 
7  16  G   n 
7  17  G   n 
7  18  C   n 
8  1   MET n 
8  2   SER n 
8  3   ARG n 
8  4   PRO n 
8  5   GLN n 
8  6   VAL n 
8  7   THR n 
8  8   VAL n 
8  9   HIS n 
8  10  SER n 
8  11  LEU n 
8  12  THR n 
8  13  GLY n 
8  14  GLU n 
8  15  ALA n 
8  16  THR n 
8  17  ALA n 
8  18  ASN n 
8  19  ALA n 
8  20  LEU n 
8  21  PRO n 
8  22  LEU n 
8  23  PRO n 
8  24  ALA n 
8  25  VAL n 
8  26  PHE n 
8  27  SER n 
8  28  ALA n 
8  29  PRO n 
8  30  ILE n 
8  31  ARG n 
8  32  PRO n 
8  33  ASP n 
8  34  ILE n 
8  35  VAL n 
8  36  HIS n 
8  37  THR n 
8  38  VAL n 
8  39  PHE n 
8  40  THR n 
8  41  SER n 
8  42  VAL n 
8  43  ASN n 
8  44  LYS n 
8  45  ASN n 
8  46  LYS n 
8  47  ARG n 
8  48  GLN n 
8  49  ALA n 
8  50  TYR n 
8  51  ALA n 
8  52  VAL n 
8  53  SER n 
8  54  GLU n 
8  55  LYS n 
8  56  ALA n 
8  57  GLY n 
8  58  HIS n 
8  59  GLN n 
8  60  THR n 
8  61  SER n 
8  62  ALA n 
8  63  GLU n 
8  64  SER n 
8  65  TRP n 
8  66  GLY n 
8  67  THR n 
8  68  GLY n 
8  69  ARG n 
8  70  ALA n 
8  71  VAL n 
8  72  ALA n 
8  73  ARG n 
8  74  ILE n 
8  75  PRO n 
8  76  ARG n 
8  77  VAL n 
8  78  GLY n 
8  79  GLY n 
8  80  GLY n 
8  81  GLY n 
8  82  THR n 
8  83  GLY n 
8  84  ARG n 
8  85  SER n 
8  86  GLY n 
8  87  GLN n 
8  88  GLY n 
8  89  ALA n 
8  90  PHE n 
8  91  GLY n 
8  92  ASN n 
8  93  MET n 
8  94  CYS n 
8  95  ARG n 
8  96  GLY n 
8  97  GLY n 
8  98  ARG n 
8  99  MET n 
8  100 PHE n 
8  101 ALA n 
8  102 PRO n 
8  103 THR n 
8  104 LYS n 
8  105 THR n 
8  106 TRP n 
8  107 ARG n 
8  108 LYS n 
8  109 TRP n 
8  110 ASN n 
8  111 VAL n 
8  112 LYS n 
8  113 VAL n 
8  114 ASN n 
8  115 HIS n 
8  116 ASN n 
8  117 GLU n 
8  118 LYS n 
8  119 ARG n 
8  120 TYR n 
8  121 ALA n 
8  122 THR n 
8  123 ALA n 
8  124 SER n 
8  125 ALA n 
8  126 ILE n 
8  127 ALA n 
8  128 ALA n 
8  129 THR n 
8  130 ALA n 
8  131 VAL n 
8  132 ALA n 
8  133 SER n 
8  134 LEU n 
8  135 VAL n 
8  136 LEU n 
8  137 ALA n 
8  138 ARG n 
8  139 GLY n 
8  140 HIS n 
8  141 ARG n 
8  142 VAL n 
8  143 GLU n 
8  144 LYS n 
8  145 ILE n 
8  146 PRO n 
8  147 GLU n 
8  148 ILE n 
8  149 PRO n 
8  150 LEU n 
8  151 VAL n 
8  152 VAL n 
8  153 SER n 
8  154 THR n 
8  155 ASP n 
8  156 LEU n 
8  157 GLU n 
8  158 SER n 
8  159 ILE n 
8  160 GLN n 
8  161 LYS n 
8  162 THR n 
8  163 LYS n 
8  164 GLU n 
8  165 ALA n 
8  166 VAL n 
8  167 ALA n 
8  168 ALA n 
8  169 LEU n 
8  170 LYS n 
8  171 ALA n 
8  172 VAL n 
8  173 GLY n 
8  174 ALA n 
8  175 HIS n 
8  176 SER n 
8  177 ASP n 
8  178 LEU n 
8  179 LEU n 
8  180 LYS n 
8  181 VAL n 
8  182 LEU n 
8  183 LYS n 
8  184 SER n 
8  185 LYS n 
8  186 LYS n 
8  187 LEU n 
8  188 ARG n 
8  189 ALA n 
8  190 GLY n 
8  191 LYS n 
8  192 GLY n 
8  193 LYS n 
8  194 TYR n 
8  195 ARG n 
8  196 ASN n 
8  197 ARG n 
8  198 ARG n 
8  199 TRP n 
8  200 THR n 
8  201 GLN n 
8  202 ARG n 
8  203 ARG n 
8  204 GLY n 
8  205 PRO n 
8  206 LEU n 
8  207 VAL n 
8  208 VAL n 
8  209 TYR n 
8  210 ALA n 
8  211 GLU n 
8  212 ASP n 
8  213 ASN n 
8  214 GLY n 
8  215 ILE n 
8  216 VAL n 
8  217 LYS n 
8  218 ALA n 
8  219 LEU n 
8  220 ARG n 
8  221 ASN n 
8  222 VAL n 
8  223 PRO n 
8  224 GLY n 
8  225 VAL n 
8  226 GLU n 
8  227 THR n 
8  228 ALA n 
8  229 ASN n 
8  230 VAL n 
8  231 ALA n 
8  232 SER n 
8  233 LEU n 
8  234 ASN n 
8  235 LEU n 
8  236 LEU n 
8  237 GLN n 
8  238 LEU n 
8  239 ALA n 
8  240 PRO n 
8  241 GLY n 
8  242 ALA n 
8  243 HIS n 
8  244 LEU n 
8  245 GLY n 
8  246 ARG n 
8  247 PHE n 
8  248 VAL n 
8  249 ILE n 
8  250 TRP n 
8  251 THR n 
8  252 GLU n 
8  253 ALA n 
8  254 ALA n 
8  255 PHE n 
8  256 THR n 
8  257 LYS n 
8  258 LEU n 
8  259 ASP n 
8  260 GLN n 
8  261 VAL n 
8  262 TRP n 
8  263 GLY n 
8  264 SER n 
8  265 GLU n 
8  266 THR n 
8  267 VAL n 
8  268 ALA n 
8  269 SER n 
8  270 SER n 
8  271 LYS n 
8  272 VAL n 
8  273 GLY n 
8  274 TYR n 
8  275 THR n 
8  276 LEU n 
8  277 PRO n 
8  278 SER n 
8  279 HIS n 
8  280 ILE n 
8  281 ILE n 
8  282 SER n 
8  283 THR n 
8  284 SER n 
8  285 ASP n 
8  286 VAL n 
8  287 THR n 
8  288 ARG n 
8  289 ILE n 
8  290 ILE n 
8  291 ASN n 
8  292 SER n 
8  293 SER n 
8  294 GLU n 
8  295 ILE n 
8  296 GLN n 
8  297 SER n 
8  298 ALA n 
8  299 ILE n 
8  300 ARG n 
8  301 PRO n 
8  302 ALA n 
8  303 GLY n 
8  304 GLN n 
8  305 ALA n 
8  306 THR n 
8  307 GLN n 
8  308 LYS n 
8  309 ARG n 
8  310 THR n 
8  311 HIS n 
8  312 VAL n 
8  313 LEU n 
8  314 LYS n 
8  315 LYS n 
8  316 ASN n 
8  317 PRO n 
8  318 LEU n 
8  319 LYS n 
8  320 ASN n 
8  321 LYS n 
8  322 GLN n 
8  323 VAL n 
8  324 LEU n 
8  325 LEU n 
8  326 ARG n 
8  327 LEU n 
8  328 ASN n 
8  329 PRO n 
8  330 TYR n 
8  331 ALA n 
8  332 LYS n 
8  333 VAL n 
8  334 PHE n 
8  335 ALA n 
8  336 ALA n 
8  337 GLU n 
8  338 LYS n 
8  339 LEU n 
8  340 GLY n 
8  341 SER n 
8  342 LYS n 
8  343 LYS n 
8  344 ALA n 
8  345 GLU n 
8  346 LYS n 
8  347 THR n 
8  348 GLY n 
8  349 THR n 
8  350 LYS n 
8  351 PRO n 
8  352 ALA n 
8  353 ALA n 
8  354 VAL n 
8  355 PHE n 
8  356 ALA n 
8  357 GLU n 
8  358 THR n 
8  359 LEU n 
8  360 LYS n 
8  361 HIS n 
8  362 ASP n 
9  1   MET n 
9  2   ALA n 
9  3   ARG n 
9  4   TYR n 
9  5   GLY n 
9  6   ALA n 
9  7   THR n 
9  8   SER n 
9  9   THR n 
9  10  ASN n 
9  11  PRO n 
9  12  ALA n 
9  13  LYS n 
9  14  SER n 
9  15  ALA n 
9  16  SER n 
9  17  ALA n 
9  18  ARG n 
9  19  GLY n 
9  20  SER n 
9  21  TYR n 
9  22  LEU n 
9  23  ARG n 
9  24  VAL n 
9  25  SER n 
9  26  PHE n 
9  27  LYS n 
9  28  ASN n 
9  29  THR n 
9  30  ARG n 
9  31  GLU n 
9  32  THR n 
9  33  ALA n 
9  34  GLN n 
9  35  ALA n 
9  36  ILE n 
9  37  ASN n 
9  38  GLY n 
9  39  TRP n 
9  40  GLU n 
9  41  LEU n 
9  42  THR n 
9  43  LYS n 
9  44  ALA n 
9  45  GLN n 
9  46  LYS n 
9  47  TYR n 
9  48  LEU n 
9  49  GLU n 
9  50  GLN n 
9  51  VAL n 
9  52  LEU n 
9  53  ASP n 
9  54  HIS n 
9  55  GLN n 
9  56  ARG n 
9  57  ALA n 
9  58  ILE n 
9  59  PRO n 
9  60  PHE n 
9  61  ARG n 
9  62  ARG n 
9  63  PHE n 
9  64  ASN n 
9  65  SER n 
9  66  SER n 
9  67  ILE n 
9  68  GLY n 
9  69  ARG n 
9  70  THR n 
9  71  ALA n 
9  72  GLN n 
9  73  GLY n 
9  74  LYS n 
9  75  GLU n 
9  76  PHE n 
9  77  GLY n 
9  78  VAL n 
9  79  THR n 
9  80  LYS n 
9  81  ALA n 
9  82  ARG n 
9  83  TRP n 
9  84  PRO n 
9  85  ALA n 
9  86  LYS n 
9  87  SER n 
9  88  VAL n 
9  89  LYS n 
9  90  PHE n 
9  91  VAL n 
9  92  GLN n 
9  93  GLY n 
9  94  LEU n 
9  95  LEU n 
9  96  GLN n 
9  97  ASN n 
9  98  ALA n 
9  99  ALA n 
9  100 ALA n 
9  101 ASN n 
9  102 ALA n 
9  103 GLU n 
9  104 ALA n 
9  105 LYS n 
9  106 GLY n 
9  107 LEU n 
9  108 ASP n 
9  109 ALA n 
9  110 THR n 
9  111 LYS n 
9  112 LEU n 
9  113 TYR n 
9  114 VAL n 
9  115 SER n 
9  116 HIS n 
9  117 ILE n 
9  118 GLN n 
9  119 VAL n 
9  120 ASN n 
9  121 GLN n 
9  122 ALA n 
9  123 PRO n 
9  124 LYS n 
9  125 GLN n 
9  126 ARG n 
9  127 ARG n 
9  128 ARG n 
9  129 THR n 
9  130 TYR n 
9  131 ARG n 
9  132 ALA n 
9  133 HIS n 
9  134 GLY n 
9  135 ARG n 
9  136 ILE n 
9  137 ASN n 
9  138 LYS n 
9  139 TYR n 
9  140 GLU n 
9  141 SER n 
9  142 SER n 
9  143 PRO n 
9  144 SER n 
9  145 HIS n 
9  146 ILE n 
9  147 GLU n 
9  148 LEU n 
9  149 VAL n 
9  150 VAL n 
9  151 THR n 
9  152 GLU n 
9  153 LYS n 
9  154 GLU n 
9  155 GLU n 
9  156 ALA n 
9  157 VAL n 
9  158 ALA n 
9  159 LYS n 
9  160 ALA n 
9  161 ALA n 
9  162 GLU n 
9  163 LYS n 
9  164 LYS n 
9  165 VAL n 
9  166 VAL n 
9  167 ARG n 
9  168 LEU n 
9  169 THR n 
9  170 SER n 
9  171 ARG n 
9  172 GLN n 
9  173 ARG n 
9  174 GLY n 
9  175 ARG n 
9  176 ILE n 
9  177 ALA n 
9  178 ALA n 
9  179 GLN n 
9  180 LYS n 
9  181 ARG n 
9  182 ILE n 
9  183 ALA n 
9  184 ALA n 
10 1   MET n 
10 2   ALA n 
10 3   ASN n 
10 4   LEU n 
10 5   ARG n 
10 6   THR n 
10 7   GLN n 
10 8   LYS n 
10 9   ARG n 
10 10  LEU n 
10 11  ALA n 
10 12  ALA n 
10 13  SER n 
10 14  VAL n 
10 15  VAL n 
10 16  GLY n 
10 17  VAL n 
10 18  GLY n 
10 19  LYS n 
10 20  ARG n 
10 21  LYS n 
10 22  VAL n 
10 23  TRP n 
10 24  LEU n 
10 25  ASP n 
10 26  PRO n 
10 27  ASN n 
10 28  GLU n 
10 29  THR n 
10 30  SER n 
10 31  GLU n 
10 32  ILE n 
10 33  ALA n 
10 34  GLN n 
10 35  ALA n 
10 36  ASN n 
10 37  SER n 
10 38  ARG n 
10 39  ASN n 
10 40  ALA n 
10 41  ILE n 
10 42  ARG n 
10 43  LYS n 
10 44  LEU n 
10 45  VAL n 
10 46  LYS n 
10 47  ASN n 
10 48  GLY n 
10 49  THR n 
10 50  ILE n 
10 51  VAL n 
10 52  LYS n 
10 53  LYS n 
10 54  ALA n 
10 55  VAL n 
10 56  THR n 
10 57  VAL n 
10 58  HIS n 
10 59  SER n 
10 60  LYS n 
10 61  SER n 
10 62  ARG n 
10 63  THR n 
10 64  ARG n 
10 65  ALA n 
10 66  HIS n 
10 67  ALA n 
10 68  GLN n 
10 69  SER n 
10 70  LYS n 
10 71  ARG n 
10 72  GLU n 
10 73  GLY n 
10 74  ARG n 
10 75  HIS n 
10 76  SER n 
10 77  GLY n 
10 78  TYR n 
10 79  GLY n 
10 80  LYS n 
10 81  ARG n 
10 82  LYS n 
10 83  GLY n 
10 84  THR n 
10 85  ARG n 
10 86  GLU n 
10 87  ALA n 
10 88  ARG n 
10 89  LEU n 
10 90  PRO n 
10 91  SER n 
10 92  GLN n 
10 93  VAL n 
10 94  VAL n 
10 95  TRP n 
10 96  ILE n 
10 97  ARG n 
10 98  ARG n 
10 99  LEU n 
10 100 ARG n 
10 101 VAL n 
10 102 LEU n 
10 103 ARG n 
10 104 ARG n 
10 105 LEU n 
10 106 LEU n 
10 107 ALA n 
10 108 LYS n 
10 109 TYR n 
10 110 ARG n 
10 111 ASP n 
10 112 ALA n 
10 113 GLY n 
10 114 LYS n 
10 115 ILE n 
10 116 ASP n 
10 117 LYS n 
10 118 HIS n 
10 119 LEU n 
10 120 TYR n 
10 121 HIS n 
10 122 VAL n 
10 123 LEU n 
10 124 TYR n 
10 125 LYS n 
10 126 GLU n 
10 127 SER n 
10 128 LYS n 
10 129 GLY n 
10 130 ASN n 
10 131 ALA n 
10 132 PHE n 
10 133 LYS n 
10 134 HIS n 
10 135 LYS n 
10 136 ARG n 
10 137 ALA n 
10 138 LEU n 
10 139 VAL n 
10 140 GLU n 
10 141 HIS n 
10 142 ILE n 
10 143 ILE n 
10 144 GLN n 
10 145 ALA n 
10 146 LYS n 
10 147 ALA n 
10 148 ASP n 
10 149 ALA n 
10 150 GLN n 
10 151 ARG n 
10 152 GLU n 
10 153 LYS n 
10 154 ALA n 
10 155 LEU n 
10 156 ASN n 
10 157 GLU n 
10 158 GLU n 
10 159 ALA n 
10 160 GLU n 
10 161 ALA n 
10 162 ARG n 
10 163 ARG n 
10 164 LEU n 
10 165 LYS n 
10 166 ASN n 
10 167 ARG n 
10 168 ALA n 
10 169 ALA n 
10 170 ARG n 
10 171 ASP n 
10 172 ARG n 
10 173 ARG n 
10 174 ALA n 
10 175 GLN n 
10 176 ARG n 
10 177 VAL n 
10 178 ALA n 
10 179 GLU n 
10 180 LYS n 
10 181 ARG n 
10 182 ASP n 
10 183 ALA n 
10 184 LEU n 
10 185 LEU n 
10 186 LYS n 
10 187 GLU n 
10 188 ASP n 
10 189 ALA n 
11 1   MET n 
11 2   ALA n 
11 3   PRO n 
11 4   SER n 
11 5   ALA n 
11 6   LYS n 
11 7   ALA n 
11 8   THR n 
11 9   ALA n 
11 10  ALA n 
11 11  LYS n 
11 12  LYS n 
11 13  ALA n 
11 14  VAL n 
11 15  VAL n 
11 16  LYS n 
11 17  GLY n 
11 18  THR n 
11 19  ASN n 
11 20  GLY n 
11 21  LYS n 
11 22  LYS n 
11 23  ALA n 
11 24  LEU n 
11 25  LYS n 
11 26  VAL n 
11 27  ARG n 
11 28  THR n 
11 29  SER n 
11 30  ALA n 
11 31  THR n 
11 32  PHE n 
11 33  ARG n 
11 34  LEU n 
11 35  PRO n 
11 36  LYS n 
11 37  THR n 
11 38  LEU n 
11 39  LYS n 
11 40  LEU n 
11 41  ALA n 
11 42  ARG n 
11 43  ALA n 
11 44  PRO n 
11 45  LYS n 
11 46  TYR n 
11 47  ALA n 
11 48  SER n 
11 49  LYS n 
11 50  ALA n 
11 51  VAL n 
11 52  PRO n 
11 53  HIS n 
11 54  TYR n 
11 55  ASN n 
11 56  ARG n 
11 57  LEU n 
11 58  ASP n 
11 59  SER n 
11 60  TYR n 
11 61  LYS n 
11 62  VAL n 
11 63  ILE n 
11 64  GLU n 
11 65  GLN n 
11 66  PRO n 
11 67  ILE n 
11 68  THR n 
11 69  SER n 
11 70  GLU n 
11 71  THR n 
11 72  ALA n 
11 73  MET n 
11 74  LYS n 
11 75  LYS n 
11 76  VAL n 
11 77  GLU n 
11 78  ASP n 
11 79  GLY n 
11 80  ASN n 
11 81  ILE n 
11 82  LEU n 
11 83  VAL n 
11 84  PHE n 
11 85  GLN n 
11 86  VAL n 
11 87  SER n 
11 88  MET n 
11 89  LYS n 
11 90  ALA n 
11 91  ASN n 
11 92  LYS n 
11 93  TYR n 
11 94  GLN n 
11 95  ILE n 
11 96  LYS n 
11 97  LYS n 
11 98  ALA n 
11 99  VAL n 
11 100 LYS n 
11 101 GLU n 
11 102 LEU n 
11 103 TYR n 
11 104 GLU n 
11 105 VAL n 
11 106 ASP n 
11 107 VAL n 
11 108 LEU n 
11 109 LYS n 
11 110 VAL n 
11 111 ASN n 
11 112 THR n 
11 113 LEU n 
11 114 VAL n 
11 115 ARG n 
11 116 PRO n 
11 117 ASN n 
11 118 GLY n 
11 119 THR n 
11 120 LYS n 
11 121 LYS n 
11 122 ALA n 
11 123 TYR n 
11 124 VAL n 
11 125 ARG n 
11 126 LEU n 
11 127 THR n 
11 128 ALA n 
11 129 ASP n 
11 130 TYR n 
11 131 ASP n 
11 132 ALA n 
11 133 LEU n 
11 134 ASP n 
11 135 ILE n 
11 136 ALA n 
11 137 ASN n 
11 138 ARG n 
11 139 ILE n 
11 140 GLY n 
11 141 TYR n 
11 142 ILE n 
12 1   MET n 
12 2   ALA n 
12 3   LYS n 
12 4   GLN n 
12 5   SER n 
12 6   LEU n 
12 7   ASP n 
12 8   VAL n 
12 9   SER n 
12 10  SER n 
12 11  ASP n 
12 12  ARG n 
12 13  ARG n 
12 14  LYS n 
12 15  ALA n 
12 16  ARG n 
12 17  LYS n 
12 18  ALA n 
12 19  TYR n 
12 20  PHE n 
12 21  THR n 
12 22  ALA n 
12 23  PRO n 
12 24  SER n 
12 25  SER n 
12 26  GLN n 
12 27  ARG n 
12 28  ARG n 
12 29  VAL n 
12 30  LEU n 
12 31  LEU n 
12 32  SER n 
12 33  ALA n 
12 34  PRO n 
12 35  LEU n 
12 36  SER n 
12 37  LYS n 
12 38  GLU n 
12 39  LEU n 
12 40  ARG n 
12 41  ALA n 
12 42  GLN n 
12 43  TYR n 
12 44  GLY n 
12 45  ILE n 
12 46  LYS n 
12 47  ALA n 
12 48  LEU n 
12 49  PRO n 
12 50  ILE n 
12 51  ARG n 
12 52  ARG n 
12 53  ASP n 
12 54  ASP n 
12 55  GLU n 
12 56  VAL n 
12 57  LEU n 
12 58  VAL n 
12 59  VAL n 
12 60  ARG n 
12 61  GLY n 
12 62  SER n 
12 63  LYS n 
12 64  LYS n 
12 65  GLY n 
12 66  GLN n 
12 67  GLU n 
12 68  GLY n 
12 69  LYS n 
12 70  ILE n 
12 71  SER n 
12 72  SER n 
12 73  VAL n 
12 74  TYR n 
12 75  ARG n 
12 76  LEU n 
12 77  LYS n 
12 78  PHE n 
12 79  ALA n 
12 80  VAL n 
12 81  GLN n 
12 82  VAL n 
12 83  ASP n 
12 84  LYS n 
12 85  VAL n 
12 86  THR n 
12 87  LYS n 
12 88  GLU n 
12 89  LYS n 
12 90  VAL n 
12 91  ASN n 
12 92  GLY n 
12 93  ALA n 
12 94  SER n 
12 95  VAL n 
12 96  PRO n 
12 97  ILE n 
12 98  ASN n 
12 99  LEU n 
12 100 HIS n 
12 101 PRO n 
12 102 SER n 
12 103 LYS n 
12 104 LEU n 
12 105 VAL n 
12 106 ILE n 
12 107 THR n 
12 108 LYS n 
12 109 LEU n 
12 110 HIS n 
12 111 LEU n 
12 112 ASP n 
12 113 LYS n 
12 114 ASP n 
12 115 ARG n 
12 116 LYS n 
12 117 ALA n 
12 118 LEU n 
12 119 ILE n 
12 120 GLN n 
12 121 ARG n 
12 122 LYS n 
12 123 GLY n 
12 124 GLY n 
12 125 LYS n 
12 126 LEU n 
12 127 GLU n 
13 1   MET n 
13 2   ALA n 
13 3   GLY n 
13 4   LEU n 
13 5   LYS n 
13 6   ASP n 
13 7   VAL n 
13 8   VAL n 
13 9   THR n 
13 10  ARG n 
13 11  GLU n 
13 12  TYR n 
13 13  THR n 
13 14  ILE n 
13 15  ASN n 
13 16  LEU n 
13 17  HIS n 
13 18  LYS n 
13 19  ARG n 
13 20  LEU n 
13 21  HIS n 
13 22  GLY n 
13 23  VAL n 
13 24  SER n 
13 25  PHE n 
13 26  LYS n 
13 27  LYS n 
13 28  ARG n 
13 29  ALA n 
13 30  PRO n 
13 31  ARG n 
13 32  ALA n 
13 33  VAL n 
13 34  LYS n 
13 35  GLU n 
13 36  ILE n 
13 37  LYS n 
13 38  LYS n 
13 39  PHE n 
13 40  ALA n 
13 41  LYS n 
13 42  LEU n 
13 43  HIS n 
13 44  MET n 
13 45  GLY n 
13 46  THR n 
13 47  ASP n 
13 48  ASP n 
13 49  VAL n 
13 50  ARG n 
13 51  LEU n 
13 52  ALA n 
13 53  PRO n 
13 54  GLU n 
13 55  LEU n 
13 56  ASN n 
13 57  GLN n 
13 58  ALA n 
13 59  ILE n 
13 60  TRP n 
13 61  LYS n 
13 62  ARG n 
13 63  GLY n 
13 64  VAL n 
13 65  LYS n 
13 66  GLY n 
13 67  VAL n 
13 68  GLU n 
13 69  TYR n 
13 70  ARG n 
13 71  LEU n 
13 72  ARG n 
13 73  LEU n 
13 74  ARG n 
13 75  ILE n 
13 76  SER n 
13 77  ARG n 
13 78  LYS n 
13 79  ARG n 
13 80  ASN n 
13 81  GLU n 
13 82  GLU n 
13 83  GLU n 
13 84  ASP n 
13 85  ALA n 
13 86  LYS n 
13 87  ASN n 
13 88  PRO n 
13 89  LEU n 
13 90  PHE n 
13 91  SER n 
13 92  TYR n 
13 93  VAL n 
13 94  GLU n 
13 95  PRO n 
13 96  VAL n 
13 97  LEU n 
13 98  VAL n 
13 99  ALA n 
13 100 SER n 
13 101 ALA n 
13 102 LYS n 
13 103 GLY n 
13 104 LEU n 
13 105 GLN n 
13 106 THR n 
13 107 VAL n 
13 108 VAL n 
13 109 VAL n 
13 110 GLU n 
13 111 GLU n 
13 112 ASP n 
13 113 ALA n 
14 1   MET n 
14 2   ALA n 
14 3   GLY n 
14 4   VAL n 
14 5   LYS n 
14 6   ALA n 
14 7   TYR n 
14 8   GLU n 
14 9   LEU n 
14 10  ARG n 
14 11  THR n 
14 12  LYS n 
14 13  SER n 
14 14  LYS n 
14 15  GLU n 
14 16  GLN n 
14 17  LEU n 
14 18  ALA n 
14 19  SER n 
14 20  GLN n 
14 21  LEU n 
14 22  VAL n 
14 23  ASP n 
14 24  LEU n 
14 25  LYS n 
14 26  LYS n 
14 27  GLU n 
14 28  LEU n 
14 29  ALA n 
14 30  GLU n 
14 31  LEU n 
14 32  LYS n 
14 33  VAL n 
14 34  GLN n 
14 35  LYS n 
14 36  LEU n 
14 37  SER n 
14 38  ARG n 
14 39  PRO n 
14 40  SER n 
14 41  LEU n 
14 42  PRO n 
14 43  LYS n 
14 44  ILE n 
14 45  LYS n 
14 46  THR n 
14 47  VAL n 
14 48  ARG n 
14 49  LYS n 
14 50  SER n 
14 51  ILE n 
14 52  ALA n 
14 53  CYS n 
14 54  VAL n 
14 55  LEU n 
14 56  THR n 
14 57  VAL n 
14 58  ILE n 
14 59  ASN n 
14 60  GLU n 
14 61  GLN n 
14 62  GLN n 
14 63  ARG n 
14 64  GLU n 
14 65  ALA n 
14 66  VAL n 
14 67  ARG n 
14 68  GLN n 
14 69  LEU n 
14 70  TYR n 
14 71  LYS n 
14 72  GLY n 
14 73  LYS n 
14 74  LYS n 
14 75  TYR n 
14 76  GLN n 
14 77  PRO n 
14 78  LYS n 
14 79  ASP n 
14 80  LEU n 
14 81  ARG n 
14 82  ALA n 
14 83  LYS n 
14 84  LYS n 
14 85  THR n 
14 86  ARG n 
14 87  ALA n 
14 88  LEU n 
14 89  ARG n 
14 90  ARG n 
14 91  ALA n 
14 92  LEU n 
14 93  THR n 
14 94  LYS n 
14 95  PHE n 
14 96  GLU n 
14 97  ALA n 
14 98  SER n 
14 99  GLN n 
14 100 VAL n 
14 101 THR n 
14 102 GLU n 
14 103 LYS n 
14 104 GLN n 
14 105 ARG n 
14 106 LYS n 
14 107 LYS n 
14 108 GLN n 
14 109 ILE n 
14 110 ALA n 
14 111 PHE n 
14 112 PRO n 
14 113 GLN n 
14 114 ARG n 
14 115 LYS n 
14 116 TYR n 
14 117 ALA n 
14 118 ILE n 
14 119 LYS n 
14 120 ALA n 
15 1   MET n 
15 2   ALA n 
15 3   ALA n 
15 4   GLN n 
15 5   LYS n 
15 6   SER n 
15 7   PHE n 
15 8   ARG n 
15 9   ILE n 
15 10  LYS n 
15 11  GLN n 
15 12  LYS n 
15 13  MET n 
15 14  ALA n 
15 15  LYS n 
15 16  ALA n 
15 17  LYS n 
15 18  LYS n 
15 19  GLN n 
15 20  ASN n 
15 21  ARG n 
15 22  PRO n 
15 23  LEU n 
15 24  PRO n 
15 25  GLN n 
15 26  TRP n 
15 27  ILE n 
15 28  ARG n 
15 29  LEU n 
15 30  ARG n 
15 31  THR n 
15 32  ASN n 
15 33  ASN n 
15 34  THR n 
15 35  ILE n 
15 36  ARG n 
15 37  TYR n 
15 38  ASN n 
15 39  ALA n 
15 40  LYS n 
15 41  ARG n 
15 42  ARG n 
15 43  ASN n 
15 44  TRP n 
15 45  ARG n 
15 46  ARG n 
15 47  THR n 
15 48  LYS n 
15 49  MET n 
15 50  ASN n 
15 51  ILE n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP SSH1_YEAST  1  ? ? P38353 ? 
2  UNP SC61G_YEAST 2  ? ? P35179 ? 
3  UNP SC6B2_YEAST 3  ? ? P52871 ? 
4  PDB 2WW9        4  ? ? 2WW9   ? 
5  PDB 2WW9        5  ? ? 2WW9   ? 
6  PDB 2WW9        6  ? ? 2WW9   ? 
7  PDB 2WW9        7  ? ? 2WW9   ? 
8  UNP RL4B_YEAST  8  ? ? P49626 ? 
9  UNP RL17A_YEAST 9  ? ? P05740 ? 
10 UNP RL19_YEAST  10 ? ? P05735 ? 
11 UNP RL25_YEAST  11 ? ? P04456 ? 
12 UNP RL26A_YEAST 12 ? ? P05743 ? 
13 UNP RL31A_YEAST 13 ? ? P0C2H8 ? 
14 UNP RL35_YEAST  14 ? ? P39741 ? 
15 UNP RL39_YEAST  15 ? ? P04650 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  2WW9 A 1 ? 490 ? P38353 1    ? 490  ? 1    490  
2  2  2WW9 B 1 ? 80  ? P35179 1    ? 80   ? 1    80   
3  3  2WW9 C 1 ? 87  ? P52871 1    ? 87   ? 1    87   
4  4  2WW9 D 1 ? 63  ? 2WW9   41   ? 103  ? 41   103  
5  5  2WW9 E 1 ? 34  ? 2WW9   528  ? 561  ? 528  561  
6  6  2WW9 F 1 ? 25  ? 2WW9   1654 ? 1678 ? 1654 1678 
7  7  2WW9 G 1 ? 18  ? 2WW9   912  ? 929  ? 912  929  
8  8  2WW9 H 1 ? 362 ? P49626 1    ? 362  ? 1    362  
9  9  2WW9 I 1 ? 184 ? P05740 1    ? 184  ? 1    184  
10 10 2WW9 J 1 ? 189 ? P05735 1    ? 189  ? 1    189  
11 11 2WW9 K 1 ? 142 ? P04456 1    ? 142  ? 1    142  
12 12 2WW9 L 1 ? 127 ? P05743 1    ? 127  ? 1    127  
13 13 2WW9 M 1 ? 113 ? P0C2H8 1    ? 113  ? 1    113  
14 14 2WW9 N 1 ? 120 ? P39741 1    ? 120  ? 1    120  
15 15 2WW9 O 1 ? 51  ? P04650 1    ? 51   ? 1    51   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2WW9 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 2WW9 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            8.60 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11299 
_refine_hist.pdbx_number_atoms_nucleic_acid   3002 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               14301 
_refine_hist.d_res_high                       8.60 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  2WW9 
_struct.title                     'Cryo-EM structure of the active yeast Ssh1 complex bound to the yeast 80S ribosome' 
_struct.pdbx_descriptor           
;SEC SIXTY-ONE PROTEIN HOMOLOG, PROTEIN TRANSPORT PROTEIN SSS1, PROTEIN TRANSPORT PROTEIN SEB2, 60S RIBOSOMAL PROTEIN L4-B, 60S RIBOSOMAL PROTEIN L17-A, 60S RIBOSOMAL PROTEIN L19, 60S RIBOSOMAL PROTEIN L25, 60S RIBOSOMAL PROTEIN L26-A, 60S RIBOSOMAL PROTEIN L31-A, 60S RIBOSOMAL PROTEIN L35, 60S RIBOSOMAL PROTEIN L39
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WW9 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            
;RIBOSOMAL PROTEIN, RIBONUCLEOPROTEIN, TRANSMEMBRANE, PHOSPHOPROTEIN, SIGNAL SEQUENCE, MEMBRANE, RIBOSOME, TRANSPORT, RNA-BINDING, RRNA-BINDING, TRANSLOCATION, PROTEIN CONDUCTING CHANNEL, PROTEIN EXIT TUNNEL, ENDOPLASMIC RETICULUM, COTRANSLATIONAL PROTEIN TRANSLOCATION, ISOPEPTIDE BOND, PROTEIN TRANSPORT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 13  ? LEU A 17  ? ILE A 13  LEU A 17  5 ? 5  
HELX_P HELX_P2  2  PHE A 29  ? TYR A 43  ? PHE A 29  TYR A 43  1 ? 15 
HELX_P HELX_P3  3  GLY A 52  ? THR A 57  ? GLY A 52  THR A 57  1 ? 6  
HELX_P HELX_P4  4  LEU A 68  ? GLY A 73  ? LEU A 68  GLY A 73  1 ? 6  
HELX_P HELX_P5  5  LEU A 84  ? LEU A 100 ? LEU A 84  LEU A 100 1 ? 17 
HELX_P HELX_P6  6  GLN A 110 ? GLY A 139 ? GLN A 110 GLY A 139 1 ? 30 
HELX_P HELX_P7  7  VAL A 148 ? LYS A 173 ? VAL A 148 LYS A 173 1 ? 26 
HELX_P HELX_P8  8  SER A 179 ? PHE A 198 ? SER A 179 PHE A 198 1 ? 20 
HELX_P HELX_P9  9  GLY A 215 ? SER A 226 ? GLY A 215 SER A 226 1 ? 12 
HELX_P HELX_P10 10 ASN A 246 ? GLN A 264 ? ASN A 246 GLN A 264 1 ? 19 
HELX_P HELX_P11 11 LYS A 287 ? GLY A 292 ? LYS A 287 GLY A 292 1 ? 6  
HELX_P HELX_P12 12 GLY A 292 ? ILE A 306 ? GLY A 292 ILE A 306 1 ? 15 
HELX_P HELX_P13 13 ILE A 314 ? ASN A 320 ? ILE A 314 ASN A 320 1 ? 7  
HELX_P HELX_P14 14 PRO A 364 ? ILE A 388 ? PRO A 364 ILE A 388 1 ? 25 
HELX_P HELX_P15 15 SER A 392 ? THR A 406 ? SER A 392 THR A 406 1 ? 15 
HELX_P HELX_P16 16 LYS A 417 ? GLY A 445 ? LYS A 417 GLY A 445 1 ? 29 
HELX_P HELX_P17 17 LYS A 449 ? GLN A 473 ? LYS A 449 GLN A 473 1 ? 25 
HELX_P HELX_P18 18 VAL B 22  ? LYS B 38  ? VAL B 22  LYS B 38  1 ? 17 
HELX_P HELX_P19 19 ASP B 43  ? ILE B 79  ? ASP B 43  ILE B 79  1 ? 37 
HELX_P HELX_P20 20 ASP C 60  ? LEU C 78  ? ASP C 60  LEU C 78  1 ? 19 
HELX_P HELX_P21 21 ARG H 31  ? ARG H 47  ? ARG H 31  ARG H 47  1 ? 17 
HELX_P HELX_P22 22 ASN H 114 ? ALA H 127 ? ASN H 114 ALA H 127 1 ? 14 
HELX_P HELX_P23 23 SER H 133 ? GLY H 139 ? SER H 133 GLY H 139 1 ? 7  
HELX_P HELX_P24 24 SER H 153 ? GLU H 157 ? SER H 153 GLU H 157 5 ? 5  
HELX_P HELX_P25 25 THR H 162 ? GLY H 173 ? THR H 162 GLY H 173 1 ? 12 
HELX_P HELX_P26 26 HIS H 175 ? LEU H 182 ? HIS H 175 LEU H 182 1 ? 8  
HELX_P HELX_P27 27 GLY H 190 ? TYR H 194 ? GLY H 190 TYR H 194 5 ? 5  
HELX_P HELX_P28 28 ASN H 234 ? ALA H 239 ? ASN H 234 ALA H 239 1 ? 6  
HELX_P HELX_P29 29 ALA H 253 ? GLN H 260 ? ALA H 253 GLN H 260 1 ? 8  
HELX_P HELX_P30 30 ASN I 10  ? ALA I 12  ? ASN I 10  ALA I 12  5 ? 3  
HELX_P HELX_P31 31 SER I 25  ? ALA I 35  ? SER I 25  ALA I 35  1 ? 11 
HELX_P HELX_P32 32 GLU I 40  ? HIS I 54  ? GLU I 40  HIS I 54  1 ? 15 
HELX_P HELX_P33 33 ALA I 85  ? ALA I 102 ? ALA I 85  ALA I 102 1 ? 18 
HELX_P HELX_P34 34 LEU J 4   ? VAL J 15  ? LEU J 4   VAL J 15  1 ? 12 
HELX_P HELX_P35 35 GLU J 28  ? GLN J 34  ? GLU J 28  GLN J 34  1 ? 7  
HELX_P HELX_P36 36 ASN J 39  ? GLY J 48  ? ASN J 39  GLY J 48  1 ? 10 
HELX_P HELX_P37 37 SER K 69  ? ASN K 80  ? SER K 69  ASN K 80  1 ? 12 
HELX_P HELX_P38 38 ASN K 91  ? GLU K 104 ? ASN K 91  GLU K 104 1 ? 14 
HELX_P HELX_P39 39 ASP L 11  ? THR L 21  ? ASP L 11  THR L 21  1 ? 11 
HELX_P HELX_P40 40 LYS L 37  ? GLY L 44  ? LYS L 37  GLY L 44  1 ? 8  
HELX_P HELX_P41 41 HIS L 100 ? SER L 102 ? HIS L 100 SER L 102 5 ? 3  
HELX_P HELX_P42 42 ASP L 114 ? GLN L 120 ? ASP L 114 GLN L 120 1 ? 7  
HELX_P HELX_P43 43 ARG M 28  ? GLY M 45  ? ARG M 28  GLY M 45  1 ? 18 
HELX_P HELX_P44 44 ALA M 52  ? LYS M 61  ? ALA M 52  LYS M 61  1 ? 10 
HELX_P HELX_P45 45 LYS N 14  ? LEU N 31  ? LYS N 14  LEU N 31  1 ? 18 
HELX_P HELX_P46 46 LEU N 41  ? VAL N 66  ? LEU N 41  VAL N 66  1 ? 26 
HELX_P HELX_P47 47 SER O 6   ? ASN O 20  ? SER O 6   ASN O 20  1 ? 15 
HELX_P HELX_P48 48 GLN O 25  ? THR O 31  ? GLN O 25  THR O 31  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? D A 1  N6 ? ? ? 1_555 D G 63 N3 ? ? D A 41   D G 103  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog2   hydrog ? ? D A 1  N7 ? ? ? 1_555 D G 63 N2 ? ? D A 41   D G 103  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog3   hydrog ? ? D G 2  N1 ? ? ? 1_555 D U 62 O2 ? ? D G 42   D U 102  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog4   hydrog ? ? D G 2  O6 ? ? ? 1_555 D U 62 N3 ? ? D G 42   D U 102  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog5   hydrog ? ? D A 3  N1 ? ? ? 1_555 D U 61 N3 ? ? D A 43   D U 101  1_555 ? ? ? ? ? ? 'A-U PAIR'           ? ? 
hydrog6   hydrog ? ? D A 4  N1 ? ? ? 1_555 D U 60 N3 ? ? D A 44   D U 100  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog7   hydrog ? ? D A 4  N6 ? ? ? 1_555 D U 60 O4 ? ? D A 44   D U 100  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog8   hydrog ? ? D C 5  N3 ? ? ? 1_555 D G 18 N1 ? ? D C 45   D G 58   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog9   hydrog ? ? D C 5  N4 ? ? ? 1_555 D G 18 O6 ? ? D C 45   D G 58   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog10  hydrog ? ? D C 5  O2 ? ? ? 1_555 D G 18 N2 ? ? D C 45   D G 58   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog11  hydrog ? ? D G 6  N1 ? ? ? 1_555 D C 17 N3 ? ? D G 46   D C 57   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog12  hydrog ? ? D G 6  N2 ? ? ? 1_555 D C 17 O2 ? ? D G 46   D C 57   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog13  hydrog ? ? D G 6  O6 ? ? ? 1_555 D C 17 N4 ? ? D G 46   D C 57   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog14  hydrog ? ? D G 6  N2 ? ? ? 1_555 D A 21 N3 ? ? D G 46   D A 61   1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ? ? 
hydrog15  hydrog ? ? D C 7  O2 ? ? ? 1_555 D G 16 N2 ? ? D C 47   D G 56   1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog16  hydrog ? ? D A 8  N1 ? ? ? 1_555 D C 22 N4 ? ? D A 48   D C 62   1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ? ? 
hydrog17  hydrog ? ? D G 9  N2 ? ? ? 1_555 D A 37 N7 ? ? D G 49   D A 77   1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog18  hydrog ? ? D G 9  N3 ? ? ? 1_555 D A 37 N6 ? ? D G 49   D A 77   1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog19  hydrog ? ? D C 10 O2 ? ? ? 1_555 D G 35 N1 ? ? D C 50   D G 75   1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog20  hydrog ? ? D C 10 N3 ? ? ? 1_555 D C 36 N4 ? ? D C 50   D C 76   1_555 ? ? ? ? ? ? 'C-C MISPAIR'        ? ? 
hydrog21  hydrog ? ? D G 11 N2 ? ? ? 1_555 D A 13 N1 ? ? D G 51   D A 53   1_555 ? ? ? ? ? ? TYPE_10_PAIR         ? ? 
hydrog22  hydrog ? ? D G 11 N3 ? ? ? 1_555 D A 13 N6 ? ? D G 51   D A 53   1_555 ? ? ? ? ? ? TYPE_10_PAIR         ? ? 
hydrog23  hydrog ? ? D A 14 N1 ? ? ? 1_555 D C 22 N4 ? ? D A 54   D C 62   1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ? ? 
hydrog24  hydrog ? ? D U 15 O4 ? ? ? 1_555 D C 22 N4 ? ? D U 55   D C 62   1_555 ? ? ? ? ? ? 'U-C MISPAIR'        ? ? 
hydrog25  hydrog ? ? D G 23 N1 ? ? ? 1_555 D A 57 N1 ? ? D G 63   D A 97   1_555 ? ? ? ? ? ? TYPE_8_PAIR          ? ? 
hydrog26  hydrog ? ? D G 23 O6 ? ? ? 1_555 D A 57 N6 ? ? D G 63   D A 97   1_555 ? ? ? ? ? ? TYPE_8_PAIR          ? ? 
hydrog27  hydrog ? ? D U 24 N3 ? ? ? 1_555 D A 56 N1 ? ? D U 64   D A 96   1_555 ? ? ? ? ? ? 'U-A PAIR'           ? ? 
hydrog28  hydrog ? ? D A 25 N1 ? ? ? 1_555 D G 55 N2 ? ? D A 65   D G 95   1_555 ? ? ? ? ? ? 'A-G MISPAIR'        ? ? 
hydrog29  hydrog ? ? D A 26 N1 ? ? ? 1_555 D U 53 N3 ? ? D A 66   D U 93   1_555 ? ? ? ? ? ? 'A-U PAIR'           ? ? 
hydrog30  hydrog ? ? D U 27 N3 ? ? ? 1_555 D A 52 N1 ? ? D U 67   D A 92   1_555 ? ? ? ? ? ? 'U-A PAIR'           ? ? 
hydrog31  hydrog ? ? D G 28 N3 ? ? ? 1_555 D A 49 N6 ? ? D G 68   D A 89   1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ? ? 
hydrog32  hydrog ? ? D U 29 N3 ? ? ? 1_555 D A 48 N1 ? ? D U 69   D A 88   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog33  hydrog ? ? D U 29 O4 ? ? ? 1_555 D A 48 N6 ? ? D U 69   D A 88   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog34  hydrog ? ? D A 32 N1 ? ? ? 1_555 D U 41 N3 ? ? D A 72   D U 81   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog35  hydrog ? ? D A 32 N6 ? ? ? 1_555 D U 41 O4 ? ? D A 72   D U 81   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog36  hydrog ? ? D A 32 N3 ? ? ? 1_555 D G 47 N2 ? ? D A 72   D G 87   1_555 ? ? ? ? ? ? 'A-G MISPAIR'        ? ? 
hydrog37  hydrog ? ? D U 33 N3 ? ? ? 1_555 D A 40 N1 ? ? D U 73   D A 80   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog38  hydrog ? ? D U 33 O4 ? ? ? 1_555 D A 40 N6 ? ? D U 73   D A 80   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog39  hydrog ? ? D U 34 N3 ? ? ? 1_555 D A 39 N1 ? ? D U 74   D A 79   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog40  hydrog ? ? D U 34 O4 ? ? ? 1_555 D A 39 N6 ? ? D U 74   D A 79   1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog41  hydrog ? ? E U 1  N3 ? ? ? 1_555 E A 5  N7 ? ? E U 528  E A 532  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog42  hydrog ? ? E U 1  O2 ? ? ? 1_555 E A 5  N6 ? ? E U 528  E A 532  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog43  hydrog ? ? E G 2  N2 ? ? ? 1_555 E A 6  N7 ? ? E G 529  E A 533  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog44  hydrog ? ? E G 2  N3 ? ? ? 1_555 E A 6  N6 ? ? E G 529  E A 533  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog45  hydrog ? ? E A 3  N6 ? ? ? 1_555 E A 26 N7 ? ? E A 530  E A 553  1_555 ? ? ? ? ? ? TYPE_2_PAIR          ? ? 
hydrog46  hydrog ? ? E A 3  N7 ? ? ? 1_555 E A 26 N6 ? ? E A 530  E A 553  1_555 ? ? ? ? ? ? TYPE_2_PAIR          ? ? 
hydrog47  hydrog ? ? E A 5  N1 ? ? ? 1_555 E A 28 N6 ? ? E A 532  E A 555  1_555 ? ? ? ? ? ? TYPE_1_PAIR          ? ? 
hydrog48  hydrog ? ? E A 5  N6 ? ? ? 1_555 E A 28 N1 ? ? E A 532  E A 555  1_555 ? ? ? ? ? ? TYPE_1_PAIR          ? ? 
hydrog49  hydrog ? ? E A 6  N1 ? ? ? 1_555 E A 30 N6 ? ? E A 533  E A 557  1_555 ? ? ? ? ? ? TYPE_1_PAIR          ? ? 
hydrog50  hydrog ? ? E A 6  N6 ? ? ? 1_555 E A 30 N1 ? ? E A 533  E A 557  1_555 ? ? ? ? ? ? TYPE_1_PAIR          ? ? 
hydrog51  hydrog ? ? E G 7  N1 ? ? ? 1_555 E C 34 N3 ? ? E G 534  E C 561  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog52  hydrog ? ? E G 7  N2 ? ? ? 1_555 E C 34 O2 ? ? E G 534  E C 561  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog53  hydrog ? ? E G 7  O6 ? ? ? 1_555 E C 34 N4 ? ? E G 534  E C 561  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog54  hydrog ? ? E A 9  N6 ? ? ? 1_555 E A 22 N3 ? ? E A 536  E A 549  1_555 ? ? ? ? ? ? 'A-A MISPAIR'        ? ? 
hydrog55  hydrog ? ? E C 10 N3 ? ? ? 1_555 E G 21 N2 ? ? E C 537  E G 548  1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog56  hydrog ? ? E U 11 N3 ? ? ? 1_555 E A 20 N1 ? ? E U 538  E A 547  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog57  hydrog ? ? E U 11 O4 ? ? ? 1_555 E A 20 N6 ? ? E U 538  E A 547  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog58  hydrog ? ? E U 12 N3 ? ? ? 1_555 E G 19 O6 ? ? E U 539  E G 546  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog59  hydrog ? ? E U 12 O2 ? ? ? 1_555 E G 19 N1 ? ? E U 539  E G 546  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog60  hydrog ? ? E U 13 N3 ? ? ? 1_555 E A 18 N1 ? ? E U 540  E A 545  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog61  hydrog ? ? E U 13 O4 ? ? ? 1_555 E A 18 N6 ? ? E U 540  E A 545  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog62  hydrog ? ? E G 14 N2 ? ? ? 1_555 E A 17 N7 ? ? E G 541  E A 544  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog63  hydrog ? ? E G 14 N3 ? ? ? 1_555 E A 17 N6 ? ? E G 541  E A 544  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog64  hydrog ? ? E G 23 N1 ? ? ? 1_555 E G 31 O6 ? ? E G 550  E G 558  1_555 ? ? ? ? ? ? 'G-G MISPAIR'        ? ? 
hydrog65  hydrog ? ? E U 24 N3 ? ? ? 1_555 E A 28 N7 ? ? E U 551  E A 555  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog66  hydrog ? ? E U 24 O2 ? ? ? 1_555 E A 28 N6 ? ? E U 551  E A 555  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog67  hydrog ? ? E G 25 N2 ? ? ? 1_555 E A 30 N7 ? ? E G 552  E A 557  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog68  hydrog ? ? E G 25 N3 ? ? ? 1_555 E A 30 N6 ? ? E G 552  E A 557  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ? ? 
hydrog69  hydrog ? ? F C 1  N3 ? ? ? 1_555 F G 25 N1 ? ? F C 1654 F G 1678 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog70  hydrog ? ? F C 1  N4 ? ? ? 1_555 F G 25 O6 ? ? F C 1654 F G 1678 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog71  hydrog ? ? F C 1  O2 ? ? ? 1_555 F G 25 N2 ? ? F C 1654 F G 1678 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog72  hydrog ? ? F C 2  N3 ? ? ? 1_555 F G 24 N1 ? ? F C 1655 F G 1677 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog73  hydrog ? ? F C 2  N4 ? ? ? 1_555 F G 24 O6 ? ? F C 1655 F G 1677 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog74  hydrog ? ? F C 2  O2 ? ? ? 1_555 F G 24 N2 ? ? F C 1655 F G 1677 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog75  hydrog ? ? F A 3  N1 ? ? ? 1_555 F U 23 N3 ? ? F A 1656 F U 1676 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog76  hydrog ? ? F A 3  N6 ? ? ? 1_555 F U 23 O4 ? ? F A 1656 F U 1676 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog77  hydrog ? ? F C 4  N3 ? ? ? 1_555 F G 22 N1 ? ? F C 1657 F G 1675 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog78  hydrog ? ? F C 4  N4 ? ? ? 1_555 F G 22 O6 ? ? F C 1657 F G 1675 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog79  hydrog ? ? F C 4  O2 ? ? ? 1_555 F G 22 N2 ? ? F C 1657 F G 1675 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog80  hydrog ? ? F G 5  N1 ? ? ? 1_555 F C 21 N3 ? ? F G 1658 F C 1674 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog81  hydrog ? ? F G 5  N2 ? ? ? 1_555 F C 21 O2 ? ? F G 1658 F C 1674 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog82  hydrog ? ? F G 5  O6 ? ? ? 1_555 F C 21 N4 ? ? F G 1658 F C 1674 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog83  hydrog ? ? F U 6  N3 ? ? ? 1_555 F A 20 N1 ? ? F U 1659 F A 1673 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog84  hydrog ? ? F U 6  O4 ? ? ? 1_555 F A 20 N6 ? ? F U 1659 F A 1673 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog85  hydrog ? ? F C 7  O2 ? ? ? 1_555 F C 10 N4 ? ? F C 1660 F C 1663 1_555 ? ? ? ? ? ? 'C-C MISPAIR'        ? ? 
hydrog86  hydrog ? ? F C 7  N4 ? ? ? 1_555 F G 18 N7 ? ? F C 1660 F G 1671 1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog87  hydrog ? ? F A 9  N6 ? ? ? 1_555 F A 20 N3 ? ? F A 1662 F A 1673 1_555 ? ? ? ? ? ? 'A-A MISPAIR'        ? ? 
hydrog88  hydrog ? ? F C 10 N3 ? ? ? 1_555 F G 18 N1 ? ? F C 1663 F G 1671 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog89  hydrog ? ? F C 10 N4 ? ? ? 1_555 F G 18 O6 ? ? F C 1663 F G 1671 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog90  hydrog ? ? F C 10 O2 ? ? ? 1_555 F G 18 N2 ? ? F C 1663 F G 1671 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog91  hydrog ? ? F A 11 N1 ? ? ? 1_555 F U 17 N3 ? ? F A 1664 F U 1670 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog92  hydrog ? ? F A 11 N6 ? ? ? 1_555 F U 17 O4 ? ? F A 1664 F U 1670 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog93  hydrog ? ? G G 1  N1 ? ? ? 1_555 G C 18 N3 ? ? G G 912  G C 929  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog94  hydrog ? ? G G 1  N2 ? ? ? 1_555 G C 18 O2 ? ? G G 912  G C 929  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog95  hydrog ? ? G G 1  O6 ? ? ? 1_555 G C 18 N4 ? ? G G 912  G C 929  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog96  hydrog ? ? G C 2  N3 ? ? ? 1_555 G G 17 N1 ? ? G C 913  G G 928  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog97  hydrog ? ? G C 2  N4 ? ? ? 1_555 G G 17 O6 ? ? G C 913  G G 928  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog98  hydrog ? ? G C 2  O2 ? ? ? 1_555 G G 17 N2 ? ? G C 913  G G 928  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog99  hydrog ? ? G C 3  N3 ? ? ? 1_555 G G 16 N1 ? ? G C 914  G G 927  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog100 hydrog ? ? G C 3  N4 ? ? ? 1_555 G G 16 O6 ? ? G C 914  G G 927  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog101 hydrog ? ? G C 3  O2 ? ? ? 1_555 G G 16 N2 ? ? G C 914  G G 927  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog102 hydrog ? ? G A 4  N1 ? ? ? 1_555 G U 15 N3 ? ? G A 915  G U 926  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog103 hydrog ? ? G A 4  N6 ? ? ? 1_555 G U 15 O4 ? ? G A 915  G U 926  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog104 hydrog ? ? G G 5  N1 ? ? ? 1_555 G C 14 N3 ? ? G G 916  G C 925  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog105 hydrog ? ? G G 5  N2 ? ? ? 1_555 G C 14 O2 ? ? G G 916  G C 925  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog106 hydrog ? ? G G 5  O6 ? ? ? 1_555 G C 14 N4 ? ? G G 916  G C 925  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog107 hydrog ? ? G C 6  N3 ? ? ? 1_555 G G 13 N1 ? ? G C 917  G G 924  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog108 hydrog ? ? G C 6  N4 ? ? ? 1_555 G G 13 O6 ? ? G C 917  G G 924  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog109 hydrog ? ? G C 6  O2 ? ? ? 1_555 G G 13 N2 ? ? G C 917  G G 924  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog110 hydrog ? ? G A 7  N1 ? ? ? 1_555 G U 12 N3 ? ? G A 918  G U 923  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog111 hydrog ? ? G A 7  N6 ? ? ? 1_555 G U 12 O4 ? ? G A 918  G U 923  1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog112 hydrog ? ? G C 8  O2 ? ? ? 1_555 G U 12 N3 ? ? G C 919  G U 923  1_555 ? ? ? ? ? ? 'C-U MISPAIR'        ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PRO 23  A . ? PRO 23  A PHE 24  A ? PHE 24  A 1 12.87  
2  PRO 28  A . ? PRO 28  A PHE 29  A ? PHE 29  A 1 -18.02 
3  THR 12  H . ? THR 12  H GLY 13  H ? GLY 13  H 1 -4.95  
4  GLY 13  H . ? GLY 13  H GLU 14  H ? GLU 14  H 1 -5.82  
5  GLU 54  H . ? GLU 54  H LYS 55  H ? LYS 55  H 1 11.77  
6  GLY 57  H . ? GLY 57  H HIS 58  H ? HIS 58  H 1 -7.96  
7  ALA 70  H . ? ALA 70  H VAL 71  H ? VAL 71  H 1 10.54  
8  PRO 75  H . ? PRO 75  H ARG 76  H ? ARG 76  H 1 -1.55  
9  GLY 79  H . ? GLY 79  H GLY 80  H ? GLY 80  H 1 -2.26  
10 GLY 83  H . ? GLY 83  H ARG 84  H ? ARG 84  H 1 16.37  
11 GLY 86  H . ? GLY 86  H GLN 87  H ? GLN 87  H 1 -10.14 
12 GLY 88  H . ? GLY 88  H ALA 89  H ? ALA 89  H 1 10.94  
13 GLY 91  H . ? GLY 91  H ASN 92  H ? ASN 92  H 1 16.25  
14 THR 105 H . ? THR 105 H TRP 106 H ? TRP 106 H 1 6.76   
15 ILE 145 H . ? ILE 145 H PRO 146 H ? PRO 146 H 1 11.16  
16 ILE 148 H . ? ILE 148 H PRO 149 H ? PRO 149 H 1 -28.71 
17 ILE 159 H . ? ILE 159 H GLN 160 H ? GLN 160 H 1 -9.98  
18 GLY 173 H . ? GLY 173 H ALA 174 H ? ALA 174 H 1 9.14   
19 SER 184 H . ? SER 184 H LYS 185 H ? LYS 185 H 1 -5.74  
20 TRP 199 H . ? TRP 199 H THR 200 H ? THR 200 H 1 7.33   
21 ASP 212 H . ? ASP 212 H ASN 213 H ? ASN 213 H 1 -24.98 
22 ASN 213 H . ? ASN 213 H GLY 214 H ? GLY 214 H 1 -5.11  
23 GLY 214 H . ? GLY 214 H ILE 215 H ? ILE 215 H 1 -5.11  
24 TRP 262 H . ? TRP 262 H GLY 263 H ? GLY 263 H 1 -10.52 
25 ARG 3   I . ? ARG 3   I TYR 4   I ? TYR 4   I 1 -1.94  
26 TYR 4   I . ? TYR 4   I GLY 5   I ? GLY 5   I 1 2.91   
27 THR 9   I . ? THR 9   I ASN 10  I ? ASN 10  I 1 12.49  
28 ILE 36  I . ? ILE 36  I ASN 37  I ? ASN 37  I 1 -19.38 
29 ASN 37  I . ? ASN 37  I GLY 38  I ? GLY 38  I 1 -5.64  
30 GLY 38  I . ? GLY 38  I TRP 39  I ? TRP 39  I 1 -4.55  
31 ARG 56  I . ? ARG 56  I ALA 57  I ? ALA 57  I 1 -22.34 
32 SER 66  I . ? SER 66  I ILE 67  I ? ILE 67  I 1 -1.68  
33 THR 70  I . ? THR 70  I ALA 71  I ? ALA 71  I 1 -5.46  
34 GLY 73  I . ? GLY 73  I LYS 74  I ? LYS 74  I 1 12.41  
35 LYS 105 I . ? LYS 105 I GLY 106 I ? GLY 106 I 1 -1.29  
36 ASP 108 I . ? ASP 108 I ALA 109 I ? ALA 109 I 1 9.99   
37 GLN 4   L . ? GLN 4   L SER 5   L ? SER 5   L 1 -2.26  
38 SER 10  L . ? SER 10  L ASP 11  L ? ASP 11  L 1 3.72   
39 ASP 83  L . ? ASP 83  L LYS 84  L ? LYS 84  L 1 -6.19  
40 LYS 84  L . ? LYS 84  L VAL 85  L ? VAL 85  L 1 -3.94  
41 VAL 85  L . ? VAL 85  L THR 86  L ? THR 86  L 1 8.21   
42 GLY 124 L . ? GLY 124 L LYS 125 L ? LYS 125 L 1 -1.95  
43 SER 24  M . ? SER 24  M PHE 25  M ? PHE 25  M 1 -9.88  
44 LYS 65  M . ? LYS 65  M GLY 66  M ? GLY 66  M 1 6.08   
45 ARG 77  M . ? ARG 77  M LYS 78  M ? LYS 78  M 1 0.11   
46 ASN 80  M . ? ASN 80  M GLU 81  M ? GLU 81  M 1 -0.90  
47 GLY 3   N . ? GLY 3   N VAL 4   N ? VAL 4   N 1 4.63   
48 LYS 5   N . ? LYS 5   N ALA 6   N ? ALA 6   N 1 3.94   
49 SER 13  N . ? SER 13  N LYS 14  N ? LYS 14  N 1 -1.39  
50 VAL 33  N . ? VAL 33  N GLN 34  N ? GLN 34  N 1 -10.08 
51 GLN 34  N . ? GLN 34  N LYS 35  N ? LYS 35  N 1 -18.55 
52 SER 37  N . ? SER 37  N ARG 38  N ? ARG 38  N 1 -7.97  
53 PRO 39  N . ? PRO 39  N SER 40  N ? SER 40  N 1 10.86  
54 SER 40  N . ? SER 40  N LEU 41  N ? LEU 41  N 1 -26.06 
55 LYS 5   O . ? LYS 5   O SER 6   O ? SER 6   O 1 26.59  
56 ARG 21  O . ? ARG 21  O PRO 22  O ? PRO 22  O 1 11.64  
57 PRO 22  O . ? PRO 22  O LEU 23  O ? LEU 23  O 1 11.47  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
HA ? 4 ? 
IA ? 3 ? 
IB ? 2 ? 
JA ? 2 ? 
KA ? 4 ? 
LA ? 2 ? 
LB ? 4 ? 
MA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
HA 1 2 ? parallel      
HA 2 3 ? parallel      
HA 3 4 ? parallel      
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IB 1 2 ? anti-parallel 
JA 1 2 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
LA 1 2 ? anti-parallel 
LB 1 2 ? anti-parallel 
LB 2 3 ? anti-parallel 
LB 3 4 ? anti-parallel 
MA 1 2 ? anti-parallel 
MA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 268 ? GLU A 269 ? VAL A 268 GLU A 269 
AA 2 PRO A 285 ? ILE A 286 ? PRO A 285 ILE A 286 
HA 1 LEU H 150 ? VAL H 152 ? LEU H 150 VAL H 152 
HA 2 VAL H 248 ? THR H 251 ? VAL H 248 THR H 251 
HA 3 LEU H 206 ? TYR H 209 ? LEU H 206 TYR H 209 
HA 4 GLU H 226 ? ASN H 229 ? GLU H 226 ASN H 229 
IA 1 SER I 14  ? LEU I 22  ? SER I 14  LEU I 22  
IA 2 SER I 144 ? THR I 151 ? SER I 144 THR I 151 
IA 3 VAL I 114 ? ASN I 120 ? VAL I 114 ASN I 120 
IB 1 GLN I 125 ? ALA I 132 ? GLN I 125 ALA I 132 
IB 2 ARG I 135 ? SER I 141 ? ARG I 135 SER I 141 
JA 1 VAL J 22  ? LEU J 24  ? VAL J 22  LEU J 24  
JA 2 ILE J 50  ? LYS J 52  ? ILE J 50  LYS J 52  
KA 1 ILE K 63  ? PRO K 66  ? ILE K 63  PRO K 66  
KA 2 ILE K 81  ? VAL K 86  ? ILE K 81  VAL K 86  
KA 3 LYS K 120 ? LEU K 126 ? LYS K 120 LEU K 126 
KA 4 VAL K 107 ? LEU K 113 ? VAL K 107 LEU K 113 
LA 1 SER L 32  ? PRO L 34  ? SER L 32  PRO L 34  
LA 2 ALA L 47  ? PRO L 49  ? ALA L 47  PRO L 49  
LB 1 ALA L 79  ? VAL L 82  ? ALA L 79  VAL L 82  
LB 2 GLU L 67  ? TYR L 74  ? GLU L 67  TYR L 74  
LB 3 GLU L 55  ? VAL L 58  ? GLU L 55  VAL L 58  
LB 4 LEU L 104 ? LYS L 108 ? LEU L 104 LYS L 108 
MA 1 ARG M 10  ? ILE M 14  ? ARG M 10  ILE M 14  
MA 2 LEU M 71  ? ILE M 75  ? LEU M 71  ILE M 75  
MA 3 LEU M 89  ? PHE M 90  ? LEU M 89  PHE M 90  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 268 ? N VAL A 268 O ILE A 286 ? O ILE A 286 
HA 1 2 N LEU H 150 ? N LEU H 150 O VAL H 248 ? O VAL H 248 
HA 2 3 N ILE H 249 ? N ILE H 249 O LEU H 206 ? O LEU H 206 
HA 3 4 N VAL H 207 ? N VAL H 207 O GLU H 226 ? O GLU H 226 
IA 1 2 N LEU I 22  ? N LEU I 22  O SER I 144 ? O SER I 144 
IA 2 3 N VAL I 149 ? N VAL I 149 O HIS I 116 ? O HIS I 116 
IB 1 2 N ALA I 132 ? N ALA I 132 O ARG I 135 ? O ARG I 135 
JA 1 2 N TRP J 23  ? N TRP J 23  O VAL J 51  ? O VAL J 51  
KA 1 2 N GLU K 64  ? N GLU K 64  O GLN K 85  ? O GLN K 85  
KA 2 3 N VAL K 86  ? N VAL K 86  O LYS K 120 ? O LYS K 120 
KA 3 4 O ARG K 125 ? O ARG K 125 N LEU K 108 ? N LEU K 108 
LA 1 2 N ALA L 33  ? N ALA L 33  O LEU L 48  ? O LEU L 48  
LB 1 2 O GLN L 81  ? O GLN L 81  N SER L 71  ? N SER L 71  
LB 2 3 N GLY L 68  ? N GLY L 68  O VAL L 56  ? O VAL L 56  
LB 3 4 N LEU L 57  ? N LEU L 57  O VAL L 105 ? O VAL L 105 
MA 1 2 N ILE M 14  ? N ILE M 14  O LEU M 71  ? O LEU M 71  
MA 2 3 N ARG M 74  ? N ARG M 74  O PHE M 90  ? O PHE M 90  
# 
_database_PDB_matrix.entry_id          2WW9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WW9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . MET A 1  1   ? 111.453 42.479   20.730  1.00 0.00 ? 1    MET A N     1 
ATOM 2     C CA    . MET A 1  1   ? 110.294 43.351   21.049  1.00 0.00 ? 1    MET A CA    1 
ATOM 3     C C     . MET A 1  1   ? 109.595 42.890   22.295  1.00 0.00 ? 1    MET A C     1 
ATOM 4     O O     . MET A 1  1   ? 109.761 41.755   22.742  1.00 0.00 ? 1    MET A O     1 
ATOM 5     C CB    . MET A 1  1   ? 109.284 43.392   19.874  1.00 0.00 ? 1    MET A CB    1 
ATOM 6     C CG    . MET A 1  1   ? 109.896 43.881   18.547  1.00 0.00 ? 1    MET A CG    1 
ATOM 7     S SD    . MET A 1  1   ? 108.701 43.949   17.178  1.00 0.00 ? 1    MET A SD    1 
ATOM 8     C CE    . MET A 1  1   ? 109.912 44.436   15.914  1.00 0.00 ? 1    MET A CE    1 
ATOM 9     N N     . SER A 1  2   ? 108.781 43.795   22.884  1.00 0.00 ? 2    SER A N     1 
ATOM 10    C CA    . SER A 1  2   ? 108.002 43.524   24.066  1.00 0.00 ? 2    SER A CA    1 
ATOM 11    C C     . SER A 1  2   ? 106.573 43.847   23.727  1.00 0.00 ? 2    SER A C     1 
ATOM 12    O O     . SER A 1  2   ? 105.788 42.934   23.473  1.00 0.00 ? 2    SER A O     1 
ATOM 13    C CB    . SER A 1  2   ? 108.494 44.269   25.342  1.00 0.00 ? 2    SER A CB    1 
ATOM 14    O OG    . SER A 1  2   ? 108.803 45.639   25.113  1.00 0.00 ? 2    SER A OG    1 
ATOM 15    N N     . GLY A 1  3   ? 106.189 45.151   23.713  1.00 0.00 ? 3    GLY A N     1 
ATOM 16    C CA    . GLY A 1  3   ? 104.805 45.567   23.639  1.00 0.00 ? 3    GLY A CA    1 
ATOM 17    C C     . GLY A 1  3   ? 104.091 45.167   24.904  1.00 0.00 ? 3    GLY A C     1 
ATOM 18    O O     . GLY A 1  3   ? 104.713 45.075   25.963  1.00 0.00 ? 3    GLY A O     1 
ATOM 19    N N     . PHE A 1  4   ? 102.765 44.912   24.816  1.00 0.00 ? 4    PHE A N     1 
ATOM 20    C CA    . PHE A 1  4   ? 102.035 44.369   25.933  1.00 0.00 ? 4    PHE A CA    1 
ATOM 21    C C     . PHE A 1  4   ? 101.160 43.282   25.377  1.00 0.00 ? 4    PHE A C     1 
ATOM 22    O O     . PHE A 1  4   ? 100.099 43.545   24.812  1.00 0.00 ? 4    PHE A O     1 
ATOM 23    C CB    . PHE A 1  4   ? 101.181 45.427   26.685  1.00 0.00 ? 4    PHE A CB    1 
ATOM 24    C CG    . PHE A 1  4   ? 100.779 44.905   28.043  1.00 0.00 ? 4    PHE A CG    1 
ATOM 25    C CD1   . PHE A 1  4   ? 101.701 44.945   29.104  1.00 0.00 ? 4    PHE A CD1   1 
ATOM 26    C CD2   . PHE A 1  4   ? 99.513  44.330   28.261  1.00 0.00 ? 4    PHE A CD2   1 
ATOM 27    C CE1   . PHE A 1  4   ? 101.370 44.415   30.357  1.00 0.00 ? 4    PHE A CE1   1 
ATOM 28    C CE2   . PHE A 1  4   ? 99.181  43.798   29.513  1.00 0.00 ? 4    PHE A CE2   1 
ATOM 29    C CZ    . PHE A 1  4   ? 100.110 43.840   30.561  1.00 0.00 ? 4    PHE A CZ    1 
ATOM 30    N N     . ARG A 1  5   ? 101.607 42.023   25.577  1.00 0.00 ? 5    ARG A N     1 
ATOM 31    C CA    . ARG A 1  5   ? 100.865 40.821   25.304  1.00 0.00 ? 5    ARG A CA    1 
ATOM 32    C C     . ARG A 1  5   ? 101.475 39.833   26.250  1.00 0.00 ? 5    ARG A C     1 
ATOM 33    O O     . ARG A 1  5   ? 102.613 40.001   26.689  1.00 0.00 ? 5    ARG A O     1 
ATOM 34    C CB    . ARG A 1  5   ? 101.007 40.250   23.864  1.00 0.00 ? 5    ARG A CB    1 
ATOM 35    C CG    . ARG A 1  5   ? 100.179 40.982   22.790  1.00 0.00 ? 5    ARG A CG    1 
ATOM 36    C CD    . ARG A 1  5   ? 98.658  40.803   22.929  1.00 0.00 ? 5    ARG A CD    1 
ATOM 37    N NE    . ARG A 1  5   ? 98.306  39.403   22.517  1.00 0.00 ? 5    ARG A NE    1 
ATOM 38    C CZ    . ARG A 1  5   ? 97.016  39.021   22.278  1.00 0.00 ? 5    ARG A CZ    1 
ATOM 39    N NH1   . ARG A 1  5   ? 95.976  39.838   22.617  1.00 0.00 ? 5    ARG A NH1   1 
ATOM 40    N NH2   . ARG A 1  5   ? 96.772  37.814   21.688  1.00 0.00 ? 5    ARG A NH2   1 
ATOM 41    N N     . LEU A 1  6   ? 100.710 38.772   26.597  1.00 0.00 ? 6    LEU A N     1 
ATOM 42    C CA    . LEU A 1  6   ? 101.142 37.764   27.532  1.00 0.00 ? 6    LEU A CA    1 
ATOM 43    C C     . LEU A 1  6   ? 101.694 36.654   26.688  1.00 0.00 ? 6    LEU A C     1 
ATOM 44    O O     . LEU A 1  6   ? 100.950 35.897   26.066  1.00 0.00 ? 6    LEU A O     1 
ATOM 45    C CB    . LEU A 1  6   ? 99.963  37.267   28.412  1.00 0.00 ? 6    LEU A CB    1 
ATOM 46    C CG    . LEU A 1  6   ? 100.311 36.433   29.678  1.00 0.00 ? 6    LEU A CG    1 
ATOM 47    C CD1   . LEU A 1  6   ? 100.826 35.007   29.394  1.00 0.00 ? 6    LEU A CD1   1 
ATOM 48    C CD2   . LEU A 1  6   ? 101.240 37.186   30.650  1.00 0.00 ? 6    LEU A CD2   1 
ATOM 49    N N     . ILE A 1  7   ? 103.042 36.556   26.651  1.00 0.00 ? 7    ILE A N     1 
ATOM 50    C CA    . ILE A 1  7   ? 103.755 35.568   25.882  1.00 0.00 ? 7    ILE A CA    1 
ATOM 51    C C     . ILE A 1  7   ? 104.994 35.238   26.677  1.00 0.00 ? 7    ILE A C     1 
ATOM 52    O O     . ILE A 1  7   ? 105.402 35.981   27.572  1.00 0.00 ? 7    ILE A O     1 
ATOM 53    C CB    . ILE A 1  7   ? 104.155 36.002   24.460  1.00 0.00 ? 7    ILE A CB    1 
ATOM 54    C CG1   . ILE A 1  7   ? 104.907 37.360   24.431  1.00 0.00 ? 7    ILE A CG1   1 
ATOM 55    C CG2   . ILE A 1  7   ? 102.897 35.996   23.559  1.00 0.00 ? 7    ILE A CG2   1 
ATOM 56    C CD1   . ILE A 1  7   ? 105.508 37.703   23.062  1.00 0.00 ? 7    ILE A CD1   1 
ATOM 57    N N     . ASP A 1  8   ? 105.605 34.082   26.341  1.00 0.00 ? 8    ASP A N     1 
ATOM 58    C CA    . ASP A 1  8   ? 106.889 33.648   26.841  1.00 0.00 ? 8    ASP A CA    1 
ATOM 59    C C     . ASP A 1  8   ? 107.428 32.663   25.829  1.00 0.00 ? 8    ASP A C     1 
ATOM 60    O O     . ASP A 1  8   ? 108.424 31.984   26.076  1.00 0.00 ? 8    ASP A O     1 
ATOM 61    C CB    . ASP A 1  8   ? 106.875 33.043   28.286  1.00 0.00 ? 8    ASP A CB    1 
ATOM 62    C CG    . ASP A 1  8   ? 105.903 31.876   28.535  1.00 0.00 ? 8    ASP A CG    1 
ATOM 63    O OD1   . ASP A 1  8   ? 105.215 31.418   27.585  1.00 0.00 ? 8    ASP A OD1   1 
ATOM 64    O OD2   . ASP A 1  8   ? 105.847 31.429   29.713  1.00 0.00 ? 8    ASP A OD2   1 
ATOM 65    N N     . ILE A 1  9   ? 106.770 32.589   24.643  1.00 0.00 ? 9    ILE A N     1 
ATOM 66    C CA    . ILE A 1  9   ? 107.160 31.773   23.519  1.00 0.00 ? 9    ILE A CA    1 
ATOM 67    C C     . ILE A 1  9   ? 108.150 32.573   22.705  1.00 0.00 ? 9    ILE A C     1 
ATOM 68    O O     . ILE A 1  9   ? 108.008 33.787   22.548  1.00 0.00 ? 9    ILE A O     1 
ATOM 69    C CB    . ILE A 1  9   ? 105.955 31.310   22.682  1.00 0.00 ? 9    ILE A CB    1 
ATOM 70    C CG1   . ILE A 1  9   ? 106.367 30.375   21.515  1.00 0.00 ? 9    ILE A CG1   1 
ATOM 71    C CG2   . ILE A 1  9   ? 105.096 32.513   22.219  1.00 0.00 ? 9    ILE A CG2   1 
ATOM 72    C CD1   . ILE A 1  9   ? 105.188 29.695   20.809  1.00 0.00 ? 9    ILE A CD1   1 
ATOM 73    N N     . VAL A 1  10  ? 109.200 31.889   22.184  1.00 0.00 ? 10   VAL A N     1 
ATOM 74    C CA    . VAL A 1  10  ? 110.171 32.468   21.289  1.00 0.00 ? 10   VAL A CA    1 
ATOM 75    C C     . VAL A 1  10  ? 109.610 32.145   19.935  1.00 0.00 ? 10   VAL A C     1 
ATOM 76    O O     . VAL A 1  10  ? 109.626 30.994   19.499  1.00 0.00 ? 10   VAL A O     1 
ATOM 77    C CB    . VAL A 1  10  ? 111.572 31.893   21.452  1.00 0.00 ? 10   VAL A CB    1 
ATOM 78    C CG1   . VAL A 1  10  ? 112.537 32.555   20.446  1.00 0.00 ? 10   VAL A CG1   1 
ATOM 79    C CG2   . VAL A 1  10  ? 112.032 32.129   22.907  1.00 0.00 ? 10   VAL A CG2   1 
ATOM 80    N N     . LYS A 1  11  ? 109.038 33.179   19.282  1.00 0.00 ? 11   LYS A N     1 
ATOM 81    C CA    . LYS A 1  11  ? 108.183 33.011   18.137  1.00 0.00 ? 11   LYS A CA    1 
ATOM 82    C C     . LYS A 1  11  ? 108.588 33.945   17.022  1.00 0.00 ? 11   LYS A C     1 
ATOM 83    O O     . LYS A 1  11  ? 108.495 33.487   15.884  1.00 0.00 ? 11   LYS A O     1 
ATOM 84    C CB    . LYS A 1  11  ? 106.701 33.254   18.522  1.00 0.00 ? 11   LYS A CB    1 
ATOM 85    C CG    . LYS A 1  11  ? 105.677 32.712   17.515  1.00 0.00 ? 11   LYS A CG    1 
ATOM 86    C CD    . LYS A 1  11  ? 104.243 32.751   18.069  1.00 0.00 ? 11   LYS A CD    1 
ATOM 87    C CE    . LYS A 1  11  ? 103.224 32.004   17.196  1.00 0.00 ? 11   LYS A CE    1 
ATOM 88    N NZ    . LYS A 1  11  ? 101.889 31.962   17.843  1.00 0.00 ? 11   LYS A NZ    1 
ATOM 89    N N     . PRO A 1  12  ? 109.097 35.179   17.186  1.00 0.00 ? 12   PRO A N     1 
ATOM 90    C CA    . PRO A 1  12  ? 109.549 35.937   16.030  1.00 0.00 ? 12   PRO A CA    1 
ATOM 91    C C     . PRO A 1  12  ? 110.956 35.552   15.661  1.00 0.00 ? 12   PRO A C     1 
ATOM 92    O O     . PRO A 1  12  ? 111.278 35.670   14.484  1.00 0.00 ? 12   PRO A O     1 
ATOM 93    C CB    . PRO A 1  12  ? 109.485 37.417   16.447  1.00 0.00 ? 12   PRO A CB    1 
ATOM 94    C CG    . PRO A 1  12  ? 109.425 37.404   17.977  1.00 0.00 ? 12   PRO A CG    1 
ATOM 95    C CD    . PRO A 1  12  ? 108.715 36.085   18.278  1.00 0.00 ? 12   PRO A CD    1 
ATOM 96    N N     . ILE A 1  13  ? 111.810 35.127   16.625  1.00 0.00 ? 13   ILE A N     1 
ATOM 97    C CA    . ILE A 1  13  ? 113.211 34.854   16.374  1.00 0.00 ? 13   ILE A CA    1 
ATOM 98    C C     . ILE A 1  13  ? 113.372 33.483   15.753  1.00 0.00 ? 13   ILE A C     1 
ATOM 99    O O     . ILE A 1  13  ? 114.337 33.235   15.031  1.00 0.00 ? 13   ILE A O     1 
ATOM 100   C CB    . ILE A 1  13  ? 114.049 34.960   17.652  1.00 0.00 ? 13   ILE A CB    1 
ATOM 101   C CG1   . ILE A 1  13  ? 113.885 36.356   18.309  1.00 0.00 ? 13   ILE A CG1   1 
ATOM 102   C CG2   . ILE A 1  13  ? 115.543 34.684   17.362  1.00 0.00 ? 13   ILE A CG2   1 
ATOM 103   C CD1   . ILE A 1  13  ? 112.925 36.377   19.503  1.00 0.00 ? 13   ILE A CD1   1 
ATOM 104   N N     . LEU A 1  14  ? 112.405 32.562   15.995  1.00 0.00 ? 14   LEU A N     1 
ATOM 105   C CA    . LEU A 1  14  ? 112.489 31.182   15.562  1.00 0.00 ? 14   LEU A CA    1 
ATOM 106   C C     . LEU A 1  14  ? 112.539 31.029   14.042  1.00 0.00 ? 14   LEU A C     1 
ATOM 107   O O     . LEU A 1  14  ? 113.396 30.263   13.603  1.00 0.00 ? 14   LEU A O     1 
ATOM 108   C CB    . LEU A 1  14  ? 111.414 30.293   16.246  1.00 0.00 ? 14   LEU A CB    1 
ATOM 109   C CG    . LEU A 1  14  ? 111.473 28.771   15.958  1.00 0.00 ? 14   LEU A CG    1 
ATOM 110   C CD1   . LEU A 1  14  ? 112.806 28.115   16.370  1.00 0.00 ? 14   LEU A CD1   1 
ATOM 111   C CD2   . LEU A 1  14  ? 110.290 28.059   16.642  1.00 0.00 ? 14   LEU A CD2   1 
ATOM 112   N N     . PRO A 1  15  ? 111.770 31.705   13.171  1.00 0.00 ? 15   PRO A N     1 
ATOM 113   C CA    . PRO A 1  15  ? 111.946 31.582   11.727  1.00 0.00 ? 15   PRO A CA    1 
ATOM 114   C C     . PRO A 1  15  ? 113.099 32.393   11.177  1.00 0.00 ? 15   PRO A C     1 
ATOM 115   O O     . PRO A 1  15  ? 113.421 32.199   10.007  1.00 0.00 ? 15   PRO A O     1 
ATOM 116   C CB    . PRO A 1  15  ? 110.643 32.127   11.122  1.00 0.00 ? 15   PRO A CB    1 
ATOM 117   C CG    . PRO A 1  15  ? 109.609 31.940   12.231  1.00 0.00 ? 15   PRO A CG    1 
ATOM 118   C CD    . PRO A 1  15  ? 110.434 32.224   13.484  1.00 0.00 ? 15   PRO A CD    1 
ATOM 119   N N     . ILE A 1  16  ? 113.703 33.323   11.965  1.00 0.00 ? 16   ILE A N     1 
ATOM 120   C CA    . ILE A 1  16  ? 114.728 34.244   11.500  1.00 0.00 ? 16   ILE A CA    1 
ATOM 121   C C     . ILE A 1  16  ? 116.060 33.530   11.428  1.00 0.00 ? 16   ILE A C     1 
ATOM 122   O O     . ILE A 1  16  ? 116.957 33.942   10.691  1.00 0.00 ? 16   ILE A O     1 
ATOM 123   C CB    . ILE A 1  16  ? 114.781 35.516   12.347  1.00 0.00 ? 16   ILE A CB    1 
ATOM 124   C CG1   . ILE A 1  16  ? 113.438 36.270   12.176  1.00 0.00 ? 16   ILE A CG1   1 
ATOM 125   C CG2   . ILE A 1  16  ? 115.977 36.420   11.963  1.00 0.00 ? 16   ILE A CG2   1 
ATOM 126   C CD1   . ILE A 1  16  ? 113.315 37.545   13.019  1.00 0.00 ? 16   ILE A CD1   1 
ATOM 127   N N     . LEU A 1  17  ? 116.174 32.362   12.102  1.00 0.00 ? 17   LEU A N     1 
ATOM 128   C CA    . LEU A 1  17  ? 117.178 31.389   11.759  1.00 0.00 ? 17   LEU A CA    1 
ATOM 129   C C     . LEU A 1  17  ? 116.419 30.285   11.075  1.00 0.00 ? 17   LEU A C     1 
ATOM 130   O O     . LEU A 1  17  ? 115.694 29.562   11.755  1.00 0.00 ? 17   LEU A O     1 
ATOM 131   C CB    . LEU A 1  17  ? 117.912 30.783   12.982  1.00 0.00 ? 17   LEU A CB    1 
ATOM 132   C CG    . LEU A 1  17  ? 118.769 31.804   13.768  1.00 0.00 ? 17   LEU A CG    1 
ATOM 133   C CD1   . LEU A 1  17  ? 119.303 31.177   15.070  1.00 0.00 ? 17   LEU A CD1   1 
ATOM 134   C CD2   . LEU A 1  17  ? 119.928 32.390   12.936  1.00 0.00 ? 17   LEU A CD2   1 
ATOM 135   N N     . PRO A 1  18  ? 116.542 30.055   9.760   1.00 0.00 ? 18   PRO A N     1 
ATOM 136   C CA    . PRO A 1  18  ? 117.609 29.223   9.228   1.00 0.00 ? 18   PRO A CA    1 
ATOM 137   C C     . PRO A 1  18  ? 118.220 28.170   10.112  1.00 0.00 ? 18   PRO A C     1 
ATOM 138   O O     . PRO A 1  18  ? 119.433 28.183   10.333  1.00 0.00 ? 18   PRO A O     1 
ATOM 139   C CB    . PRO A 1  18  ? 118.638 30.235   8.720   1.00 0.00 ? 18   PRO A CB    1 
ATOM 140   C CG    . PRO A 1  18  ? 117.763 31.343   8.116   1.00 0.00 ? 18   PRO A CG    1 
ATOM 141   C CD    . PRO A 1  18  ? 116.401 31.165   8.812   1.00 0.00 ? 18   PRO A CD    1 
ATOM 142   N N     . GLU A 1  19  ? 117.371 27.205   10.531  1.00 0.00 ? 19   GLU A N     1 
ATOM 143   C CA    . GLU A 1  19  ? 117.784 25.868   10.835  1.00 0.00 ? 19   GLU A CA    1 
ATOM 144   C C     . GLU A 1  19  ? 117.410 25.130   9.571   1.00 0.00 ? 19   GLU A C     1 
ATOM 145   O O     . GLU A 1  19  ? 117.690 25.618   8.475   1.00 0.00 ? 19   GLU A O     1 
ATOM 146   C CB    . GLU A 1  19  ? 117.133 25.285   12.117  1.00 0.00 ? 19   GLU A CB    1 
ATOM 147   C CG    . GLU A 1  19  ? 115.607 25.503   12.225  1.00 0.00 ? 19   GLU A CG    1 
ATOM 148   C CD    . GLU A 1  19  ? 114.991 24.430   13.122  1.00 0.00 ? 19   GLU A CD    1 
ATOM 149   O OE1   . GLU A 1  19  ? 114.358 24.786   14.150  1.00 0.00 ? 19   GLU A OE1   1 
ATOM 150   O OE2   . GLU A 1  19  ? 115.141 23.226   12.777  1.00 0.00 ? 19   GLU A OE2   1 
ATOM 151   N N     . VAL A 1  20  ? 116.792 23.933   9.667   1.00 0.00 ? 20   VAL A N     1 
ATOM 152   C CA    . VAL A 1  20  ? 116.529 23.128   8.502   1.00 0.00 ? 20   VAL A CA    1 
ATOM 153   C C     . VAL A 1  20  ? 115.193 22.473   8.648   1.00 0.00 ? 20   VAL A C     1 
ATOM 154   O O     . VAL A 1  20  ? 114.567 22.497   9.705   1.00 0.00 ? 20   VAL A O     1 
ATOM 155   C CB    . VAL A 1  20  ? 117.581 22.053   8.250   1.00 0.00 ? 20   VAL A CB    1 
ATOM 156   C CG1   . VAL A 1  20  ? 118.884 22.746   7.800   1.00 0.00 ? 20   VAL A CG1   1 
ATOM 157   C CG2   . VAL A 1  20  ? 117.755 21.149   9.491   1.00 0.00 ? 20   VAL A CG2   1 
ATOM 158   N N     . GLU A 1  21  ? 114.751 21.864   7.530   1.00 0.00 ? 21   GLU A N     1 
ATOM 159   C CA    . GLU A 1  21  ? 113.617 20.993   7.468   1.00 0.00 ? 21   GLU A CA    1 
ATOM 160   C C     . GLU A 1  21  ? 114.006 19.998   6.392   1.00 0.00 ? 21   GLU A C     1 
ATOM 161   O O     . GLU A 1  21  ? 115.108 20.072   5.847   1.00 0.00 ? 21   GLU A O     1 
ATOM 162   C CB    . GLU A 1  21  ? 112.277 21.735   7.221   1.00 0.00 ? 21   GLU A CB    1 
ATOM 163   C CG    . GLU A 1  21  ? 111.027 20.977   7.713   1.00 0.00 ? 21   GLU A CG    1 
ATOM 164   C CD    . GLU A 1  21  ? 110.008 20.795   6.590   1.00 0.00 ? 21   GLU A CD    1 
ATOM 165   O OE1   . GLU A 1  21  ? 108.903 21.394   6.680   1.00 0.00 ? 21   GLU A OE1   1 
ATOM 166   O OE2   . GLU A 1  21  ? 110.322 20.041   5.630   1.00 0.00 ? 21   GLU A OE2   1 
ATOM 167   N N     . LEU A 1  22  ? 113.159 18.979   6.136   1.00 0.00 ? 22   LEU A N     1 
ATOM 168   C CA    . LEU A 1  22  ? 113.621 17.665   5.742   1.00 0.00 ? 22   LEU A CA    1 
ATOM 169   C C     . LEU A 1  22  ? 112.770 17.155   4.570   1.00 0.00 ? 22   LEU A C     1 
ATOM 170   O O     . LEU A 1  22  ? 111.958 17.952   4.100   1.00 0.00 ? 22   LEU A O     1 
ATOM 171   C CB    . LEU A 1  22  ? 113.753 16.791   7.029   1.00 0.00 ? 22   LEU A CB    1 
ATOM 172   C CG    . LEU A 1  22  ? 112.499 16.548   7.922   1.00 0.00 ? 22   LEU A CG    1 
ATOM 173   C CD1   . LEU A 1  22  ? 112.553 17.417   9.196   1.00 0.00 ? 22   LEU A CD1   1 
ATOM 174   C CD2   . LEU A 1  22  ? 111.121 16.643   7.231   1.00 0.00 ? 22   LEU A CD2   1 
ATOM 175   N N     . PRO A 1  23  ? 112.923 15.941   3.977   1.00 0.00 ? 23   PRO A N     1 
ATOM 176   C CA    . PRO A 1  23  ? 112.457 15.606   2.628   1.00 0.00 ? 23   PRO A CA    1 
ATOM 177   C C     . PRO A 1  23  ? 110.936 15.575   2.550   1.00 0.00 ? 23   PRO A C     1 
ATOM 178   O O     . PRO A 1  23  ? 110.319 15.479   3.611   1.00 0.00 ? 23   PRO A O     1 
ATOM 179   C CB    . PRO A 1  23  ? 113.068 14.218   2.376   1.00 0.00 ? 23   PRO A CB    1 
ATOM 180   C CG    . PRO A 1  23  ? 113.141 13.568   3.750   1.00 0.00 ? 23   PRO A CG    1 
ATOM 181   C CD    . PRO A 1  23  ? 113.486 14.757   4.635   1.00 0.00 ? 23   PRO A CD    1 
ATOM 182   N N     . PHE A 1  24  ? 110.257 15.688   1.367   1.00 0.00 ? 24   PHE A N     1 
ATOM 183   C CA    . PHE A 1  24  ? 110.672 15.614   -0.022  1.00 0.00 ? 24   PHE A CA    1 
ATOM 184   C C     . PHE A 1  24  ? 110.898 14.195   -0.492  1.00 0.00 ? 24   PHE A C     1 
ATOM 185   O O     . PHE A 1  24  ? 110.584 13.240   0.218   1.00 0.00 ? 24   PHE A O     1 
ATOM 186   C CB    . PHE A 1  24  ? 111.762 16.626   -0.488  1.00 0.00 ? 24   PHE A CB    1 
ATOM 187   C CG    . PHE A 1  24  ? 111.272 17.539   -1.587  1.00 0.00 ? 24   PHE A CG    1 
ATOM 188   C CD1   . PHE A 1  24  ? 110.811 18.823   -1.259  1.00 0.00 ? 24   PHE A CD1   1 
ATOM 189   C CD2   . PHE A 1  24  ? 111.303 17.165   -2.941  1.00 0.00 ? 24   PHE A CD2   1 
ATOM 190   C CE1   . PHE A 1  24  ? 110.348 19.699   -2.247  1.00 0.00 ? 24   PHE A CE1   1 
ATOM 191   C CE2   . PHE A 1  24  ? 110.830 18.031   -3.936  1.00 0.00 ? 24   PHE A CE2   1 
ATOM 192   C CZ    . PHE A 1  24  ? 110.340 19.295   -3.587  1.00 0.00 ? 24   PHE A CZ    1 
ATOM 193   N N     . GLU A 1  25  ? 111.359 14.046   -1.760  1.00 0.00 ? 25   GLU A N     1 
ATOM 194   C CA    . GLU A 1  25  ? 111.335 12.820   -2.523  1.00 0.00 ? 25   GLU A CA    1 
ATOM 195   C C     . GLU A 1  25  ? 112.192 11.705   -1.981  1.00 0.00 ? 25   GLU A C     1 
ATOM 196   O O     . GLU A 1  25  ? 113.231 11.926   -1.361  1.00 0.00 ? 25   GLU A O     1 
ATOM 197   C CB    . GLU A 1  25  ? 111.697 12.998   -4.020  1.00 0.00 ? 25   GLU A CB    1 
ATOM 198   C CG    . GLU A 1  25  ? 110.677 13.809   -4.850  1.00 0.00 ? 25   GLU A CG    1 
ATOM 199   C CD    . GLU A 1  25  ? 109.258 13.256   -4.712  1.00 0.00 ? 25   GLU A CD    1 
ATOM 200   O OE1   . GLU A 1  25  ? 108.380 13.999   -4.194  1.00 0.00 ? 25   GLU A OE1   1 
ATOM 201   O OE2   . GLU A 1  25  ? 109.034 12.085   -5.121  1.00 0.00 ? 25   GLU A OE2   1 
ATOM 202   N N     . LYS A 1  26  ? 111.721 10.461   -2.246  1.00 0.00 ? 26   LYS A N     1 
ATOM 203   C CA    . LYS A 1  26  ? 112.352 9.220    -1.900  1.00 0.00 ? 26   LYS A CA    1 
ATOM 204   C C     . LYS A 1  26  ? 111.919 8.236    -2.964  1.00 0.00 ? 26   LYS A C     1 
ATOM 205   O O     . LYS A 1  26  ? 110.913 8.470    -3.630  1.00 0.00 ? 26   LYS A O     1 
ATOM 206   C CB    . LYS A 1  26  ? 111.933 8.690    -0.499  1.00 0.00 ? 26   LYS A CB    1 
ATOM 207   C CG    . LYS A 1  26  ? 110.474 8.203    -0.298  1.00 0.00 ? 26   LYS A CG    1 
ATOM 208   C CD    . LYS A 1  26  ? 109.414 9.194    0.242   1.00 0.00 ? 26   LYS A CD    1 
ATOM 209   C CE    . LYS A 1  26  ? 108.909 10.302   -0.697  1.00 0.00 ? 26   LYS A CE    1 
ATOM 210   N NZ    . LYS A 1  26  ? 108.517 9.771    -2.023  1.00 0.00 ? 26   LYS A NZ    1 
ATOM 211   N N     . LEU A 1  27  ? 112.661 7.111    -3.152  1.00 0.00 ? 27   LEU A N     1 
ATOM 212   C CA    . LEU A 1  27  ? 112.254 6.040    -4.045  1.00 0.00 ? 27   LEU A CA    1 
ATOM 213   C C     . LEU A 1  27  ? 112.965 4.788    -3.563  1.00 0.00 ? 27   LEU A C     1 
ATOM 214   O O     . LEU A 1  27  ? 114.068 4.913    -3.040  1.00 0.00 ? 27   LEU A O     1 
ATOM 215   C CB    . LEU A 1  27  ? 112.658 6.241    -5.540  1.00 0.00 ? 27   LEU A CB    1 
ATOM 216   C CG    . LEU A 1  27  ? 111.633 6.998    -6.423  1.00 0.00 ? 27   LEU A CG    1 
ATOM 217   C CD1   . LEU A 1  27  ? 112.259 7.436    -7.763  1.00 0.00 ? 27   LEU A CD1   1 
ATOM 218   C CD2   . LEU A 1  27  ? 110.347 6.173    -6.647  1.00 0.00 ? 27   LEU A CD2   1 
ATOM 219   N N     . PRO A 1  28  ? 112.422 3.577    -3.745  1.00 0.00 ? 28   PRO A N     1 
ATOM 220   C CA    . PRO A 1  28  ? 113.115 2.328    -3.444  1.00 0.00 ? 28   PRO A CA    1 
ATOM 221   C C     . PRO A 1  28  ? 113.377 1.636    -4.768  1.00 0.00 ? 28   PRO A C     1 
ATOM 222   O O     . PRO A 1  28  ? 112.963 2.175    -5.794  1.00 0.00 ? 28   PRO A O     1 
ATOM 223   C CB    . PRO A 1  28  ? 112.041 1.541    -2.678  1.00 0.00 ? 28   PRO A CB    1 
ATOM 224   C CG    . PRO A 1  28  ? 110.729 1.916    -3.380  1.00 0.00 ? 28   PRO A CG    1 
ATOM 225   C CD    . PRO A 1  28  ? 110.963 3.381    -3.765  1.00 0.00 ? 28   PRO A CD    1 
ATOM 226   N N     . PHE A 1  29  ? 114.034 0.442    -4.824  1.00 0.00 ? 29   PHE A N     1 
ATOM 227   C CA    . PHE A 1  29  ? 114.873 -0.191   -3.831  1.00 0.00 ? 29   PHE A CA    1 
ATOM 228   C C     . PHE A 1  29  ? 116.255 0.296    -4.150  1.00 0.00 ? 29   PHE A C     1 
ATOM 229   O O     . PHE A 1  29  ? 117.069 0.539    -3.261  1.00 0.00 ? 29   PHE A O     1 
ATOM 230   C CB    . PHE A 1  29  ? 114.859 -1.743   -4.008  1.00 0.00 ? 29   PHE A CB    1 
ATOM 231   C CG    . PHE A 1  29  ? 115.704 -2.510   -3.007  1.00 0.00 ? 29   PHE A CG    1 
ATOM 232   C CD1   . PHE A 1  29  ? 117.091 -2.676   -3.201  1.00 0.00 ? 29   PHE A CD1   1 
ATOM 233   C CD2   . PHE A 1  29  ? 115.108 -3.113   -1.886  1.00 0.00 ? 29   PHE A CD2   1 
ATOM 234   C CE1   . PHE A 1  29  ? 117.864 -3.388   -2.277  1.00 0.00 ? 29   PHE A CE1   1 
ATOM 235   C CE2   . PHE A 1  29  ? 115.878 -3.835   -0.964  1.00 0.00 ? 29   PHE A CE2   1 
ATOM 236   C CZ    . PHE A 1  29  ? 117.258 -3.965   -1.155  1.00 0.00 ? 29   PHE A CZ    1 
ATOM 237   N N     . ASP A 1  30  ? 116.519 0.433    -5.475  1.00 0.00 ? 30   ASP A N     1 
ATOM 238   C CA    . ASP A 1  30  ? 117.777 0.794    -6.077  1.00 0.00 ? 30   ASP A CA    1 
ATOM 239   C C     . ASP A 1  30  ? 118.160 2.181    -5.666  1.00 0.00 ? 30   ASP A C     1 
ATOM 240   O O     . ASP A 1  30  ? 119.316 2.445    -5.356  1.00 0.00 ? 30   ASP A O     1 
ATOM 241   C CB    . ASP A 1  30  ? 117.712 0.777    -7.625  1.00 0.00 ? 30   ASP A CB    1 
ATOM 242   C CG    . ASP A 1  30  ? 117.402 -0.640   -8.119  1.00 0.00 ? 30   ASP A CG    1 
ATOM 243   O OD1   . ASP A 1  30  ? 116.226 -0.889   -8.505  1.00 0.00 ? 30   ASP A OD1   1 
ATOM 244   O OD2   . ASP A 1  30  ? 118.340 -1.481   -8.125  1.00 0.00 ? 30   ASP A OD2   1 
ATOM 245   N N     . ASP A 1  31  ? 117.171 3.102    -5.641  1.00 0.00 ? 31   ASP A N     1 
ATOM 246   C CA    . ASP A 1  31  ? 117.356 4.468    -5.230  1.00 0.00 ? 31   ASP A CA    1 
ATOM 247   C C     . ASP A 1  31  ? 117.696 4.544    -3.764  1.00 0.00 ? 31   ASP A C     1 
ATOM 248   O O     . ASP A 1  31  ? 118.582 5.311    -3.405  1.00 0.00 ? 31   ASP A O     1 
ATOM 249   C CB    . ASP A 1  31  ? 116.102 5.327    -5.506  1.00 0.00 ? 31   ASP A CB    1 
ATOM 250   C CG    . ASP A 1  31  ? 116.088 5.846    -6.946  1.00 0.00 ? 31   ASP A CG    1 
ATOM 251   O OD1   . ASP A 1  31  ? 116.151 5.012    -7.885  1.00 0.00 ? 31   ASP A OD1   1 
ATOM 252   O OD2   . ASP A 1  31  ? 116.004 7.093    -7.122  1.00 0.00 ? 31   ASP A OD2   1 
ATOM 253   N N     . LYS A 1  32  ? 117.034 3.742    -2.885  1.00 0.00 ? 32   LYS A N     1 
ATOM 254   C CA    . LYS A 1  32  ? 117.292 3.739    -1.456  1.00 0.00 ? 32   LYS A CA    1 
ATOM 255   C C     . LYS A 1  32  ? 118.704 3.317    -1.132  1.00 0.00 ? 32   LYS A C     1 
ATOM 256   O O     . LYS A 1  32  ? 119.330 3.938    -0.279  1.00 0.00 ? 32   LYS A O     1 
ATOM 257   C CB    . LYS A 1  32  ? 116.343 2.817    -0.642  1.00 0.00 ? 32   LYS A CB    1 
ATOM 258   C CG    . LYS A 1  32  ? 115.074 3.486    -0.089  1.00 0.00 ? 32   LYS A CG    1 
ATOM 259   C CD    . LYS A 1  32  ? 114.117 2.450    0.524   1.00 0.00 ? 32   LYS A CD    1 
ATOM 260   C CE    . LYS A 1  32  ? 112.865 3.033    1.190   1.00 0.00 ? 32   LYS A CE    1 
ATOM 261   N NZ    . LYS A 1  32  ? 113.164 3.537    2.550   1.00 0.00 ? 32   LYS A NZ    1 
ATOM 262   N N     . ILE A 1  33  ? 119.242 2.257    -1.789  1.00 0.00 ? 33   ILE A N     1 
ATOM 263   C CA    . ILE A 1  33  ? 120.583 1.766    -1.524  1.00 0.00 ? 33   ILE A CA    1 
ATOM 264   C C     . ILE A 1  33  ? 121.649 2.719    -2.011  1.00 0.00 ? 33   ILE A C     1 
ATOM 265   O O     . ILE A 1  33  ? 122.690 2.840    -1.370  1.00 0.00 ? 33   ILE A O     1 
ATOM 266   C CB    . ILE A 1  33  ? 120.874 0.349    -2.015  1.00 0.00 ? 33   ILE A CB    1 
ATOM 267   C CG1   . ILE A 1  33  ? 120.627 0.166    -3.529  1.00 0.00 ? 33   ILE A CG1   1 
ATOM 268   C CG2   . ILE A 1  33  ? 120.032 -0.622   -1.160  1.00 0.00 ? 33   ILE A CG2   1 
ATOM 269   C CD1   . ILE A 1  33  ? 121.024 -1.210   -4.071  1.00 0.00 ? 33   ILE A CD1   1 
ATOM 270   N N     . VAL A 1  34  ? 121.413 3.421    -3.150  1.00 0.00 ? 34   VAL A N     1 
ATOM 271   C CA    . VAL A 1  34  ? 122.317 4.403    -3.709  1.00 0.00 ? 34   VAL A CA    1 
ATOM 272   C C     . VAL A 1  34  ? 122.366 5.629    -2.831  1.00 0.00 ? 34   VAL A C     1 
ATOM 273   O O     . VAL A 1  34  ? 123.438 6.189    -2.627  1.00 0.00 ? 34   VAL A O     1 
ATOM 274   C CB    . VAL A 1  34  ? 121.969 4.757    -5.154  1.00 0.00 ? 34   VAL A CB    1 
ATOM 275   C CG1   . VAL A 1  34  ? 122.760 5.982    -5.667  1.00 0.00 ? 34   VAL A CG1   1 
ATOM 276   C CG2   . VAL A 1  34  ? 122.285 3.523    -6.026  1.00 0.00 ? 34   VAL A CG2   1 
ATOM 277   N N     . TYR A 1  35  ? 121.212 6.073    -2.283  1.00 0.00 ? 35   TYR A N     1 
ATOM 278   C CA    . TYR A 1  35  ? 121.140 7.264    -1.469  1.00 0.00 ? 35   TYR A CA    1 
ATOM 279   C C     . TYR A 1  35  ? 121.652 7.031    -0.075  1.00 0.00 ? 35   TYR A C     1 
ATOM 280   O O     . TYR A 1  35  ? 122.159 7.967    0.540   1.00 0.00 ? 35   TYR A O     1 
ATOM 281   C CB    . TYR A 1  35  ? 119.701 7.829    -1.336  1.00 0.00 ? 35   TYR A CB    1 
ATOM 282   C CG    . TYR A 1  35  ? 119.145 8.348    -2.644  1.00 0.00 ? 35   TYR A CG    1 
ATOM 283   C CD1   . TYR A 1  35  ? 119.936 9.055    -3.574  1.00 0.00 ? 35   TYR A CD1   1 
ATOM 284   C CD2   . TYR A 1  35  ? 117.776 8.177    -2.927  1.00 0.00 ? 35   TYR A CD2   1 
ATOM 285   C CE1   . TYR A 1  35  ? 119.382 9.539    -4.764  1.00 0.00 ? 35   TYR A CE1   1 
ATOM 286   C CE2   . TYR A 1  35  ? 117.219 8.665    -4.114  1.00 0.00 ? 35   TYR A CE2   1 
ATOM 287   C CZ    . TYR A 1  35  ? 118.024 9.339    -5.040  1.00 0.00 ? 35   TYR A CZ    1 
ATOM 288   O OH    . TYR A 1  35  ? 117.471 9.827    -6.245  1.00 0.00 ? 35   TYR A OH    1 
ATOM 289   N N     . THR A 1  36  ? 121.534 5.791    0.467   1.00 0.00 ? 36   THR A N     1 
ATOM 290   C CA    . THR A 1  36  ? 121.973 5.493    1.814   1.00 0.00 ? 36   THR A CA    1 
ATOM 291   C C     . THR A 1  36  ? 123.476 5.372    1.863   1.00 0.00 ? 36   THR A C     1 
ATOM 292   O O     . THR A 1  36  ? 124.091 5.771    2.851   1.00 0.00 ? 36   THR A O     1 
ATOM 293   C CB    . THR A 1  36  ? 121.267 4.296    2.456   1.00 0.00 ? 36   THR A CB    1 
ATOM 294   O OG1   . THR A 1  36  ? 121.229 4.436    3.870   1.00 0.00 ? 36   THR A OG1   1 
ATOM 295   C CG2   . THR A 1  36  ? 121.862 2.919    2.092   1.00 0.00 ? 36   THR A CG2   1 
ATOM 296   N N     . ILE A 1  37  ? 124.107 4.839    0.778   1.00 0.00 ? 37   ILE A N     1 
ATOM 297   C CA    . ILE A 1  37  ? 125.548 4.773    0.660   1.00 0.00 ? 37   ILE A CA    1 
ATOM 298   C C     . ILE A 1  37  ? 126.092 6.154    0.393   1.00 0.00 ? 37   ILE A C     1 
ATOM 299   O O     . ILE A 1  37  ? 127.170 6.474    0.878   1.00 0.00 ? 37   ILE A O     1 
ATOM 300   C CB    . ILE A 1  37  ? 126.085 3.729    -0.329  1.00 0.00 ? 37   ILE A CB    1 
ATOM 301   C CG1   . ILE A 1  37  ? 127.606 3.500    -0.128  1.00 0.00 ? 37   ILE A CG1   1 
ATOM 302   C CG2   . ILE A 1  37  ? 125.747 4.087    -1.789  1.00 0.00 ? 37   ILE A CG2   1 
ATOM 303   C CD1   . ILE A 1  37  ? 128.174 2.319    -0.921  1.00 0.00 ? 37   ILE A CD1   1 
ATOM 304   N N     . PHE A 1  38  ? 125.343 7.021    -0.348  1.00 0.00 ? 38   PHE A N     1 
ATOM 305   C CA    . PHE A 1  38  ? 125.741 8.379    -0.664  1.00 0.00 ? 38   PHE A CA    1 
ATOM 306   C C     . PHE A 1  38  ? 125.806 9.207    0.589   1.00 0.00 ? 38   PHE A C     1 
ATOM 307   O O     . PHE A 1  38  ? 126.719 10.009   0.750   1.00 0.00 ? 38   PHE A O     1 
ATOM 308   C CB    . PHE A 1  38  ? 124.809 9.093    -1.685  1.00 0.00 ? 38   PHE A CB    1 
ATOM 309   C CG    . PHE A 1  38  ? 125.590 10.066   -2.538  1.00 0.00 ? 38   PHE A CG    1 
ATOM 310   C CD1   . PHE A 1  38  ? 126.005 11.313   -2.036  1.00 0.00 ? 38   PHE A CD1   1 
ATOM 311   C CD2   . PHE A 1  38  ? 125.951 9.715    -3.852  1.00 0.00 ? 38   PHE A CD2   1 
ATOM 312   C CE1   . PHE A 1  38  ? 126.796 12.169   -2.811  1.00 0.00 ? 38   PHE A CE1   1 
ATOM 313   C CE2   . PHE A 1  38  ? 126.721 10.580   -4.639  1.00 0.00 ? 38   PHE A CE2   1 
ATOM 314   C CZ    . PHE A 1  38  ? 127.150 11.806   -4.115  1.00 0.00 ? 38   PHE A CZ    1 
ATOM 315   N N     . ALA A 1  39  ? 124.845 9.002    1.522   1.00 0.00 ? 39   ALA A N     1 
ATOM 316   C CA    . ALA A 1  39  ? 124.794 9.657    2.809   1.00 0.00 ? 39   ALA A CA    1 
ATOM 317   C C     . ALA A 1  39  ? 125.989 9.284    3.646   1.00 0.00 ? 39   ALA A C     1 
ATOM 318   O O     . ALA A 1  39  ? 126.516 10.110   4.390   1.00 0.00 ? 39   ALA A O     1 
ATOM 319   C CB    . ALA A 1  39  ? 123.526 9.289    3.600   1.00 0.00 ? 39   ALA A CB    1 
ATOM 320   N N     . GLY A 1  40  ? 126.443 8.014    3.518   1.00 0.00 ? 40   GLY A N     1 
ATOM 321   C CA    . GLY A 1  40  ? 127.595 7.503    4.210   1.00 0.00 ? 40   GLY A CA    1 
ATOM 322   C C     . GLY A 1  40  ? 128.890 7.856    3.525   1.00 0.00 ? 40   GLY A C     1 
ATOM 323   O O     . GLY A 1  40  ? 129.949 7.591    4.088   1.00 0.00 ? 40   GLY A O     1 
ATOM 324   N N     . LEU A 1  41  ? 128.846 8.462    2.306   1.00 0.00 ? 41   LEU A N     1 
ATOM 325   C CA    . LEU A 1  41  ? 130.022 8.899    1.583   1.00 0.00 ? 41   LEU A CA    1 
ATOM 326   C C     . LEU A 1  41  ? 130.270 10.349   1.896   1.00 0.00 ? 41   LEU A C     1 
ATOM 327   O O     . LEU A 1  41  ? 131.405 10.807   1.788   1.00 0.00 ? 41   LEU A O     1 
ATOM 328   C CB    . LEU A 1  41  ? 129.891 8.825    0.034   1.00 0.00 ? 41   LEU A CB    1 
ATOM 329   C CG    . LEU A 1  41  ? 130.001 7.411    -0.585  1.00 0.00 ? 41   LEU A CG    1 
ATOM 330   C CD1   . LEU A 1  41  ? 129.616 7.430    -2.078  1.00 0.00 ? 41   LEU A CD1   1 
ATOM 331   C CD2   . LEU A 1  41  ? 131.395 6.786    -0.392  1.00 0.00 ? 41   LEU A CD2   1 
ATOM 332   N N     . ILE A 1  42  ? 129.228 11.110   2.321   1.00 0.00 ? 42   ILE A N     1 
ATOM 333   C CA    . ILE A 1  42  ? 129.382 12.488   2.743   1.00 0.00 ? 42   ILE A CA    1 
ATOM 334   C C     . ILE A 1  42  ? 129.969 12.476   4.138   1.00 0.00 ? 42   ILE A C     1 
ATOM 335   O O     . ILE A 1  42  ? 130.816 13.302   4.477   1.00 0.00 ? 42   ILE A O     1 
ATOM 336   C CB    . ILE A 1  42  ? 128.094 13.301   2.697   1.00 0.00 ? 42   ILE A CB    1 
ATOM 337   C CG1   . ILE A 1  42  ? 127.447 13.257   1.290   1.00 0.00 ? 42   ILE A CG1   1 
ATOM 338   C CG2   . ILE A 1  42  ? 128.426 14.761   3.068   1.00 0.00 ? 42   ILE A CG2   1 
ATOM 339   C CD1   . ILE A 1  42  ? 126.001 13.767   1.273   1.00 0.00 ? 42   ILE A CD1   1 
ATOM 340   N N     . TYR A 1  43  ? 129.553 11.471   4.952   1.00 0.00 ? 43   TYR A N     1 
ATOM 341   C CA    . TYR A 1  43  ? 130.103 11.142   6.250   1.00 0.00 ? 43   TYR A CA    1 
ATOM 342   C C     . TYR A 1  43  ? 131.565 10.745   6.108   1.00 0.00 ? 43   TYR A C     1 
ATOM 343   O O     . TYR A 1  43  ? 132.373 11.069   6.978   1.00 0.00 ? 43   TYR A O     1 
ATOM 344   C CB    . TYR A 1  43  ? 129.260 10.017   6.947   1.00 0.00 ? 43   TYR A CB    1 
ATOM 345   C CG    . TYR A 1  43  ? 130.011 9.298    8.047   1.00 0.00 ? 43   TYR A CG    1 
ATOM 346   C CD1   . TYR A 1  43  ? 130.264 9.923    9.280   1.00 0.00 ? 43   TYR A CD1   1 
ATOM 347   C CD2   . TYR A 1  43  ? 130.659 8.085    7.749   1.00 0.00 ? 43   TYR A CD2   1 
ATOM 348   C CE1   . TYR A 1  43  ? 131.197 9.377    10.170  1.00 0.00 ? 43   TYR A CE1   1 
ATOM 349   C CE2   . TYR A 1  43  ? 131.598 7.543    8.632   1.00 0.00 ? 43   TYR A CE2   1 
ATOM 350   C CZ    . TYR A 1  43  ? 131.884 8.201    9.833   1.00 0.00 ? 43   TYR A CZ    1 
ATOM 351   O OH    . TYR A 1  43  ? 132.890 7.696    10.681  1.00 0.00 ? 43   TYR A OH    1 
ATOM 352   N N     . LEU A 1  44  ? 131.920 10.027   5.010   1.00 0.00 ? 44   LEU A N     1 
ATOM 353   C CA    . LEU A 1  44  ? 133.214 9.413    4.790   1.00 0.00 ? 44   LEU A CA    1 
ATOM 354   C C     . LEU A 1  44  ? 134.294 10.450   4.613   1.00 0.00 ? 44   LEU A C     1 
ATOM 355   O O     . LEU A 1  44  ? 135.477 10.160   4.782   1.00 0.00 ? 44   LEU A O     1 
ATOM 356   C CB    . LEU A 1  44  ? 133.188 8.521    3.522   1.00 0.00 ? 44   LEU A CB    1 
ATOM 357   C CG    . LEU A 1  44  ? 134.409 7.609    3.274   1.00 0.00 ? 44   LEU A CG    1 
ATOM 358   C CD1   . LEU A 1  44  ? 134.615 6.607    4.415   1.00 0.00 ? 44   LEU A CD1   1 
ATOM 359   C CD2   . LEU A 1  44  ? 134.271 6.857    1.939   1.00 0.00 ? 44   LEU A CD2   1 
ATOM 360   N N     . PHE A 1  45  ? 133.895 11.708   4.308   1.00 0.00 ? 45   PHE A N     1 
ATOM 361   C CA    . PHE A 1  45  ? 134.767 12.854   4.281   1.00 0.00 ? 45   PHE A CA    1 
ATOM 362   C C     . PHE A 1  45  ? 134.925 13.414   5.678   1.00 0.00 ? 45   PHE A C     1 
ATOM 363   O O     . PHE A 1  45  ? 134.646 14.585   5.932   1.00 0.00 ? 45   PHE A O     1 
ATOM 364   C CB    . PHE A 1  45  ? 134.244 13.961   3.335   1.00 0.00 ? 45   PHE A CB    1 
ATOM 365   C CG    . PHE A 1  45  ? 134.178 13.441   1.923   1.00 0.00 ? 45   PHE A CG    1 
ATOM 366   C CD1   . PHE A 1  45  ? 135.333 12.944   1.291   1.00 0.00 ? 45   PHE A CD1   1 
ATOM 367   C CD2   . PHE A 1  45  ? 132.964 13.428   1.217   1.00 0.00 ? 45   PHE A CD2   1 
ATOM 368   C CE1   . PHE A 1  45  ? 135.271 12.415   -0.003  1.00 0.00 ? 45   PHE A CE1   1 
ATOM 369   C CE2   . PHE A 1  45  ? 132.895 12.894   -0.077  1.00 0.00 ? 45   PHE A CE2   1 
ATOM 370   C CZ    . PHE A 1  45  ? 134.048 12.382   -0.684  1.00 0.00 ? 45   PHE A CZ    1 
ATOM 371   N N     . ALA A 1  46  ? 135.415 12.562   6.612   1.00 0.00 ? 46   ALA A N     1 
ATOM 372   C CA    . ALA A 1  46  ? 135.765 12.904   7.968   1.00 0.00 ? 46   ALA A CA    1 
ATOM 373   C C     . ALA A 1  46  ? 137.263 13.059   8.036   1.00 0.00 ? 46   ALA A C     1 
ATOM 374   O O     . ALA A 1  46  ? 137.841 13.204   9.113   1.00 0.00 ? 46   ALA A O     1 
ATOM 375   C CB    . ALA A 1  46  ? 135.371 11.786   8.953   1.00 0.00 ? 46   ALA A CB    1 
ATOM 376   N N     . GLN A 1  47  ? 137.919 13.029   6.856   1.00 0.00 ? 47   GLN A N     1 
ATOM 377   C CA    . GLN A 1  47  ? 139.344 13.093   6.695   1.00 0.00 ? 47   GLN A CA    1 
ATOM 378   C C     . GLN A 1  47  ? 139.784 14.516   6.500   1.00 0.00 ? 47   GLN A C     1 
ATOM 379   O O     . GLN A 1  47  ? 140.970 14.812   6.641   1.00 0.00 ? 47   GLN A O     1 
ATOM 380   C CB    . GLN A 1  47  ? 139.779 12.241   5.475   1.00 0.00 ? 47   GLN A CB    1 
ATOM 381   C CG    . GLN A 1  47  ? 138.909 12.360   4.193   1.00 0.00 ? 47   GLN A CG    1 
ATOM 382   C CD    . GLN A 1  47  ? 139.361 13.405   3.154   1.00 0.00 ? 47   GLN A CD    1 
ATOM 383   O OE1   . GLN A 1  47  ? 138.734 13.497   2.092   1.00 0.00 ? 47   GLN A OE1   1 
ATOM 384   N NE2   . GLN A 1  47  ? 140.462 14.157   3.431   1.00 0.00 ? 47   GLN A NE2   1 
ATOM 385   N N     . PHE A 1  48  ? 138.836 15.445   6.208   1.00 0.00 ? 48   PHE A N     1 
ATOM 386   C CA    . PHE A 1  48  ? 139.149 16.842   6.010   1.00 0.00 ? 48   PHE A CA    1 
ATOM 387   C C     . PHE A 1  48  ? 139.165 17.513   7.365   1.00 0.00 ? 48   PHE A C     1 
ATOM 388   O O     . PHE A 1  48  ? 138.352 17.144   8.210   1.00 0.00 ? 48   PHE A O     1 
ATOM 389   C CB    . PHE A 1  48  ? 138.109 17.604   5.147   1.00 0.00 ? 48   PHE A CB    1 
ATOM 390   C CG    . PHE A 1  48  ? 138.116 17.136   3.716   1.00 0.00 ? 48   PHE A CG    1 
ATOM 391   C CD1   . PHE A 1  48  ? 136.935 16.662   3.124   1.00 0.00 ? 48   PHE A CD1   1 
ATOM 392   C CD2   . PHE A 1  48  ? 139.277 17.220   2.927   1.00 0.00 ? 48   PHE A CD2   1 
ATOM 393   C CE1   . PHE A 1  48  ? 136.910 16.276   1.777   1.00 0.00 ? 48   PHE A CE1   1 
ATOM 394   C CE2   . PHE A 1  48  ? 139.256 16.842   1.577   1.00 0.00 ? 48   PHE A CE2   1 
ATOM 395   C CZ    . PHE A 1  48  ? 138.071 16.368   1.002   1.00 0.00 ? 48   PHE A CZ    1 
ATOM 396   N N     . PRO A 1  49  ? 140.039 18.478   7.643   1.00 0.00 ? 49   PRO A N     1 
ATOM 397   C CA    . PRO A 1  49  ? 140.122 19.095   8.952   1.00 0.00 ? 49   PRO A CA    1 
ATOM 398   C C     . PRO A 1  49  ? 139.216 20.296   8.985   1.00 0.00 ? 49   PRO A C     1 
ATOM 399   O O     . PRO A 1  49  ? 138.846 20.818   7.934   1.00 0.00 ? 49   PRO A O     1 
ATOM 400   C CB    . PRO A 1  49  ? 141.586 19.539   9.054   1.00 0.00 ? 49   PRO A CB    1 
ATOM 401   C CG    . PRO A 1  49  ? 141.989 19.852   7.610   1.00 0.00 ? 49   PRO A CG    1 
ATOM 402   C CD    . PRO A 1  49  ? 141.203 18.807   6.812   1.00 0.00 ? 49   PRO A CD    1 
ATOM 403   N N     . LEU A 1  50  ? 138.850 20.720   10.212  1.00 0.00 ? 50   LEU A N     1 
ATOM 404   C CA    . LEU A 1  50  ? 138.069 21.895   10.512  1.00 0.00 ? 50   LEU A CA    1 
ATOM 405   C C     . LEU A 1  50  ? 138.932 23.133   10.444  1.00 0.00 ? 50   LEU A C     1 
ATOM 406   O O     . LEU A 1  50  ? 140.154 23.058   10.576  1.00 0.00 ? 50   LEU A O     1 
ATOM 407   C CB    . LEU A 1  50  ? 137.357 21.787   11.885  1.00 0.00 ? 50   LEU A CB    1 
ATOM 408   C CG    . LEU A 1  50  ? 138.221 21.845   13.178  1.00 0.00 ? 50   LEU A CG    1 
ATOM 409   C CD1   . LEU A 1  50  ? 137.347 21.538   14.404  1.00 0.00 ? 50   LEU A CD1   1 
ATOM 410   C CD2   . LEU A 1  50  ? 139.454 20.919   13.216  1.00 0.00 ? 50   LEU A CD2   1 
ATOM 411   N N     . VAL A 1  51  ? 138.303 24.310   10.186  1.00 0.00 ? 51   VAL A N     1 
ATOM 412   C CA    . VAL A 1  51  ? 138.979 25.591   10.104  1.00 0.00 ? 51   VAL A CA    1 
ATOM 413   C C     . VAL A 1  51  ? 139.526 25.979   11.454  1.00 0.00 ? 51   VAL A C     1 
ATOM 414   O O     . VAL A 1  51  ? 138.851 25.851   12.476  1.00 0.00 ? 51   VAL A O     1 
ATOM 415   C CB    . VAL A 1  51  ? 138.094 26.730   9.591   1.00 0.00 ? 51   VAL A CB    1 
ATOM 416   C CG1   . VAL A 1  51  ? 138.882 28.044   9.400   1.00 0.00 ? 51   VAL A CG1   1 
ATOM 417   C CG2   . VAL A 1  51  ? 137.399 26.296   8.286   1.00 0.00 ? 51   VAL A CG2   1 
ATOM 418   N N     . GLY A 1  52  ? 140.766 26.501   11.444  1.00 0.00 ? 52   GLY A N     1 
ATOM 419   C CA    . GLY A 1  52  ? 141.390 27.131   12.565  1.00 0.00 ? 52   GLY A CA    1 
ATOM 420   C C     . GLY A 1  52  ? 142.829 26.861   12.328  1.00 0.00 ? 52   GLY A C     1 
ATOM 421   O O     . GLY A 1  52  ? 143.302 25.756   12.579  1.00 0.00 ? 52   GLY A O     1 
ATOM 422   N N     . LEU A 1  53  ? 143.572 27.873   11.826  1.00 0.00 ? 53   LEU A N     1 
ATOM 423   C CA    . LEU A 1  53  ? 144.985 27.732   11.554  1.00 0.00 ? 53   LEU A CA    1 
ATOM 424   C C     . LEU A 1  53  ? 145.890 27.704   12.774  1.00 0.00 ? 53   LEU A C     1 
ATOM 425   O O     . LEU A 1  53  ? 146.877 26.982   12.658  1.00 0.00 ? 53   LEU A O     1 
ATOM 426   C CB    . LEU A 1  53  ? 145.529 28.657   10.433  1.00 0.00 ? 53   LEU A CB    1 
ATOM 427   C CG    . LEU A 1  53  ? 145.429 30.183   10.657  1.00 0.00 ? 53   LEU A CG    1 
ATOM 428   C CD1   . LEU A 1  53  ? 146.727 30.771   11.246  1.00 0.00 ? 53   LEU A CD1   1 
ATOM 429   C CD2   . LEU A 1  53  ? 145.053 30.896   9.343   1.00 0.00 ? 53   LEU A CD2   1 
ATOM 430   N N     . PRO A 1  54  ? 145.721 28.351   13.944  1.00 0.00 ? 54   PRO A N     1 
ATOM 431   C CA    . PRO A 1  54  ? 146.750 28.302   14.976  1.00 0.00 ? 54   PRO A CA    1 
ATOM 432   C C     . PRO A 1  54  ? 146.674 27.012   15.752  1.00 0.00 ? 54   PRO A C     1 
ATOM 433   O O     . PRO A 1  54  ? 147.710 26.571   16.246  1.00 0.00 ? 54   PRO A O     1 
ATOM 434   C CB    . PRO A 1  54  ? 146.460 29.494   15.899  1.00 0.00 ? 54   PRO A CB    1 
ATOM 435   C CG    . PRO A 1  54  ? 144.984 29.823   15.660  1.00 0.00 ? 54   PRO A CG    1 
ATOM 436   C CD    . PRO A 1  54  ? 144.779 29.448   14.194  1.00 0.00 ? 54   PRO A CD    1 
ATOM 437   N N     . LYS A 1  55  ? 145.468 26.412   15.889  1.00 0.00 ? 55   LYS A N     1 
ATOM 438   C CA    . LYS A 1  55  ? 145.276 25.121   16.505  1.00 0.00 ? 55   LYS A CA    1 
ATOM 439   C C     . LYS A 1  55  ? 145.752 24.023   15.589  1.00 0.00 ? 55   LYS A C     1 
ATOM 440   O O     . LYS A 1  55  ? 146.241 23.002   16.066  1.00 0.00 ? 55   LYS A O     1 
ATOM 441   C CB    . LYS A 1  55  ? 143.804 24.843   16.901  1.00 0.00 ? 55   LYS A CB    1 
ATOM 442   C CG    . LYS A 1  55  ? 142.777 25.527   15.986  1.00 0.00 ? 55   LYS A CG    1 
ATOM 443   C CD    . LYS A 1  55  ? 141.352 24.961   16.088  1.00 0.00 ? 55   LYS A CD    1 
ATOM 444   C CE    . LYS A 1  55  ? 141.154 23.620   15.364  1.00 0.00 ? 55   LYS A CE    1 
ATOM 445   N NZ    . LYS A 1  55  ? 141.280 23.780   13.898  1.00 0.00 ? 55   LYS A NZ    1 
ATOM 446   N N     . ALA A 1  56  ? 145.622 24.205   14.251  1.00 0.00 ? 56   ALA A N     1 
ATOM 447   C CA    . ALA A 1  56  ? 145.960 23.187   13.283  1.00 0.00 ? 56   ALA A CA    1 
ATOM 448   C C     . ALA A 1  56  ? 147.448 23.016   13.120  1.00 0.00 ? 56   ALA A C     1 
ATOM 449   O O     . ALA A 1  56  ? 147.896 21.950   12.699  1.00 0.00 ? 56   ALA A O     1 
ATOM 450   C CB    . ALA A 1  56  ? 145.401 23.509   11.883  1.00 0.00 ? 56   ALA A CB    1 
ATOM 451   N N     . THR A 1  57  ? 148.247 24.061   13.451  1.00 0.00 ? 57   THR A N     1 
ATOM 452   C CA    . THR A 1  57  ? 149.669 24.075   13.200  1.00 0.00 ? 57   THR A CA    1 
ATOM 453   C C     . THR A 1  57  ? 150.411 23.420   14.350  1.00 0.00 ? 57   THR A C     1 
ATOM 454   O O     . THR A 1  57  ? 150.515 22.194   14.388  1.00 0.00 ? 57   THR A O     1 
ATOM 455   C CB    . THR A 1  57  ? 150.210 25.468   12.870  1.00 0.00 ? 57   THR A CB    1 
ATOM 456   O OG1   . THR A 1  57  ? 149.710 26.465   13.756  1.00 0.00 ? 57   THR A OG1   1 
ATOM 457   C CG2   . THR A 1  57  ? 149.801 25.819   11.423  1.00 0.00 ? 57   THR A CG2   1 
ATOM 458   N N     . THR A 1  58  ? 150.972 24.224   15.289  1.00 0.00 ? 58   THR A N     1 
ATOM 459   C CA    . THR A 1  58  ? 151.913 23.776   16.297  1.00 0.00 ? 58   THR A CA    1 
ATOM 460   C C     . THR A 1  58  ? 151.350 22.788   17.311  1.00 0.00 ? 58   THR A C     1 
ATOM 461   O O     . THR A 1  58  ? 152.020 21.773   17.501  1.00 0.00 ? 58   THR A O     1 
ATOM 462   C CB    . THR A 1  58  ? 152.619 24.934   17.000  1.00 0.00 ? 58   THR A CB    1 
ATOM 463   O OG1   . THR A 1  58  ? 153.076 25.880   16.040  1.00 0.00 ? 58   THR A OG1   1 
ATOM 464   C CG2   . THR A 1  58  ? 153.836 24.420   17.801  1.00 0.00 ? 58   THR A CG2   1 
ATOM 465   N N     . PRO A 1  59  ? 150.182 22.915   17.960  1.00 0.00 ? 59   PRO A N     1 
ATOM 466   C CA    . PRO A 1  59  ? 149.767 21.936   18.955  1.00 0.00 ? 59   PRO A CA    1 
ATOM 467   C C     . PRO A 1  59  ? 149.113 20.776   18.252  1.00 0.00 ? 59   PRO A C     1 
ATOM 468   O O     . PRO A 1  59  ? 149.109 19.687   18.825  1.00 0.00 ? 59   PRO A O     1 
ATOM 469   C CB    . PRO A 1  59  ? 148.760 22.679   19.851  1.00 0.00 ? 59   PRO A CB    1 
ATOM 470   C CG    . PRO A 1  59  ? 148.220 23.815   18.977  1.00 0.00 ? 59   PRO A CG    1 
ATOM 471   C CD    . PRO A 1  59  ? 149.414 24.158   18.082  1.00 0.00 ? 59   PRO A CD    1 
ATOM 472   N N     . ASN A 1  60  ? 148.529 21.016   17.046  1.00 0.00 ? 60   ASN A N     1 
ATOM 473   C CA    . ASN A 1  60  ? 147.901 20.035   16.186  1.00 0.00 ? 60   ASN A CA    1 
ATOM 474   C C     . ASN A 1  60  ? 146.598 19.559   16.804  1.00 0.00 ? 60   ASN A C     1 
ATOM 475   O O     . ASN A 1  60  ? 146.091 18.500   16.442  1.00 0.00 ? 60   ASN A O     1 
ATOM 476   C CB    . ASN A 1  60  ? 148.880 18.876   15.801  1.00 0.00 ? 60   ASN A CB    1 
ATOM 477   C CG    . ASN A 1  60  ? 148.340 17.932   14.711  1.00 0.00 ? 60   ASN A CG    1 
ATOM 478   O OD1   . ASN A 1  60  ? 147.977 18.371   13.614  1.00 0.00 ? 60   ASN A OD1   1 
ATOM 479   N ND2   . ASN A 1  60  ? 148.285 16.607   15.055  1.00 0.00 ? 60   ASN A ND2   1 
ATOM 480   N N     . VAL A 1  61  ? 146.038 20.349   17.767  1.00 0.00 ? 61   VAL A N     1 
ATOM 481   C CA    . VAL A 1  61  ? 144.931 20.001   18.640  1.00 0.00 ? 61   VAL A CA    1 
ATOM 482   C C     . VAL A 1  61  ? 145.425 19.005   19.682  1.00 0.00 ? 61   VAL A C     1 
ATOM 483   O O     . VAL A 1  61  ? 146.356 18.241   19.435  1.00 0.00 ? 61   VAL A O     1 
ATOM 484   C CB    . VAL A 1  61  ? 143.643 19.598   17.906  1.00 0.00 ? 61   VAL A CB    1 
ATOM 485   C CG1   . VAL A 1  61  ? 142.501 19.199   18.863  1.00 0.00 ? 61   VAL A CG1   1 
ATOM 486   C CG2   . VAL A 1  61  ? 143.212 20.774   17.001  1.00 0.00 ? 61   VAL A CG2   1 
ATOM 487   N N     . ASN A 1  62  ? 144.844 19.016   20.911  1.00 0.00 ? 62   ASN A N     1 
ATOM 488   C CA    . ASN A 1  62  ? 145.212 18.103   21.978  1.00 0.00 ? 62   ASN A CA    1 
ATOM 489   C C     . ASN A 1  62  ? 144.748 16.693   21.695  1.00 0.00 ? 62   ASN A C     1 
ATOM 490   O O     . ASN A 1  62  ? 143.965 16.439   20.781  1.00 0.00 ? 62   ASN A O     1 
ATOM 491   C CB    . ASN A 1  62  ? 144.691 18.517   23.382  1.00 0.00 ? 62   ASN A CB    1 
ATOM 492   C CG    . ASN A 1  62  ? 145.496 19.715   23.900  1.00 0.00 ? 62   ASN A CG    1 
ATOM 493   O OD1   . ASN A 1  62  ? 145.024 20.855   23.860  1.00 0.00 ? 62   ASN A OD1   1 
ATOM 494   N ND2   . ASN A 1  62  ? 146.735 19.425   24.406  1.00 0.00 ? 62   ASN A ND2   1 
ATOM 495   N N     . ASP A 1  63  ? 145.310 15.749   22.492  1.00 0.00 ? 63   ASP A N     1 
ATOM 496   C CA    . ASP A 1  63  ? 145.248 14.304   22.398  1.00 0.00 ? 63   ASP A CA    1 
ATOM 497   C C     . ASP A 1  63  ? 143.858 13.754   22.135  1.00 0.00 ? 63   ASP A C     1 
ATOM 498   O O     . ASP A 1  63  ? 142.894 14.327   22.642  1.00 0.00 ? 63   ASP A O     1 
ATOM 499   C CB    . ASP A 1  63  ? 145.742 13.657   23.724  1.00 0.00 ? 63   ASP A CB    1 
ATOM 500   C CG    . ASP A 1  63  ? 147.145 14.156   24.078  1.00 0.00 ? 63   ASP A CG    1 
ATOM 501   O OD1   . ASP A 1  63  ? 147.265 14.910   25.084  1.00 0.00 ? 63   ASP A OD1   1 
ATOM 502   O OD2   . ASP A 1  63  ? 148.110 13.799   23.354  1.00 0.00 ? 63   ASP A OD2   1 
ATOM 503   N N     . PRO A 1  64  ? 143.694 12.667   21.373  1.00 0.00 ? 64   PRO A N     1 
ATOM 504   C CA    . PRO A 1  64  ? 142.397 12.185   20.928  1.00 0.00 ? 64   PRO A CA    1 
ATOM 505   C C     . PRO A 1  64  ? 141.634 11.600   22.084  1.00 0.00 ? 64   PRO A C     1 
ATOM 506   O O     . PRO A 1  64  ? 142.236 11.016   22.986  1.00 0.00 ? 64   PRO A O     1 
ATOM 507   C CB    . PRO A 1  64  ? 142.711 11.098   19.891  1.00 0.00 ? 64   PRO A CB    1 
ATOM 508   C CG    . PRO A 1  64  ? 144.110 10.608   20.267  1.00 0.00 ? 64   PRO A CG    1 
ATOM 509   C CD    . PRO A 1  64  ? 144.786 11.855   20.835  1.00 0.00 ? 64   PRO A CD    1 
ATOM 510   N N     . ILE A 1  65  ? 140.300 11.788   22.064  1.00 0.00 ? 65   ILE A N     1 
ATOM 511   C CA    . ILE A 1  65  ? 139.417 11.394   23.124  1.00 0.00 ? 65   ILE A CA    1 
ATOM 512   C C     . ILE A 1  65  ? 138.764 10.118   22.667  1.00 0.00 ? 65   ILE A C     1 
ATOM 513   O O     . ILE A 1  65  ? 137.992 10.076   21.709  1.00 0.00 ? 65   ILE A O     1 
ATOM 514   C CB    . ILE A 1  65  ? 138.426 12.493   23.503  1.00 0.00 ? 65   ILE A CB    1 
ATOM 515   C CG1   . ILE A 1  65  ? 137.713 13.130   22.278  1.00 0.00 ? 65   ILE A CG1   1 
ATOM 516   C CG2   . ILE A 1  65  ? 139.225 13.530   24.327  1.00 0.00 ? 65   ILE A CG2   1 
ATOM 517   C CD1   . ILE A 1  65  ? 136.975 14.431   22.598  1.00 0.00 ? 65   ILE A CD1   1 
ATOM 518   N N     . TYR A 1  66  ? 139.138 9.018    23.357  1.00 0.00 ? 66   TYR A N     1 
ATOM 519   C CA    . TYR A 1  66  ? 138.720 7.676    23.058  1.00 0.00 ? 66   TYR A CA    1 
ATOM 520   C C     . TYR A 1  66  ? 137.762 7.293    24.140  1.00 0.00 ? 66   TYR A C     1 
ATOM 521   O O     . TYR A 1  66  ? 138.081 6.478    25.003  1.00 0.00 ? 66   TYR A O     1 
ATOM 522   C CB    . TYR A 1  66  ? 139.887 6.657    23.091  1.00 0.00 ? 66   TYR A CB    1 
ATOM 523   C CG    . TYR A 1  66  ? 140.849 6.881    21.959  1.00 0.00 ? 66   TYR A CG    1 
ATOM 524   C CD1   . TYR A 1  66  ? 140.430 6.765    20.621  1.00 0.00 ? 66   TYR A CD1   1 
ATOM 525   C CD2   . TYR A 1  66  ? 142.202 7.149    22.224  1.00 0.00 ? 66   TYR A CD2   1 
ATOM 526   C CE1   . TYR A 1  66  ? 141.346 6.909    19.572  1.00 0.00 ? 66   TYR A CE1   1 
ATOM 527   C CE2   . TYR A 1  66  ? 143.124 7.278    21.180  1.00 0.00 ? 66   TYR A CE2   1 
ATOM 528   C CZ    . TYR A 1  66  ? 142.697 7.162    19.849  1.00 0.00 ? 66   TYR A CZ    1 
ATOM 529   O OH    . TYR A 1  66  ? 143.628 7.292    18.792  1.00 0.00 ? 66   TYR A OH    1 
ATOM 530   N N     . PHE A 1  67  ? 136.553 7.890    24.113  1.00 0.00 ? 67   PHE A N     1 
ATOM 531   C CA    . PHE A 1  67  ? 135.548 7.618    25.101  1.00 0.00 ? 67   PHE A CA    1 
ATOM 532   C C     . PHE A 1  67  ? 134.271 8.221    24.595  1.00 0.00 ? 67   PHE A C     1 
ATOM 533   O O     . PHE A 1  67  ? 133.235 7.558    24.594  1.00 0.00 ? 67   PHE A O     1 
ATOM 534   C CB    . PHE A 1  67  ? 135.874 8.082    26.560  1.00 0.00 ? 67   PHE A CB    1 
ATOM 535   C CG    . PHE A 1  67  ? 136.472 9.457    26.711  1.00 0.00 ? 67   PHE A CG    1 
ATOM 536   C CD1   . PHE A 1  67  ? 135.650 10.561   26.980  1.00 0.00 ? 67   PHE A CD1   1 
ATOM 537   C CD2   . PHE A 1  67  ? 137.867 9.646    26.689  1.00 0.00 ? 67   PHE A CD2   1 
ATOM 538   C CE1   . PHE A 1  67  ? 136.199 11.835   27.172  1.00 0.00 ? 67   PHE A CE1   1 
ATOM 539   C CE2   . PHE A 1  67  ? 138.422 10.914   26.896  1.00 0.00 ? 67   PHE A CE2   1 
ATOM 540   C CZ    . PHE A 1  67  ? 137.586 12.013   27.131  1.00 0.00 ? 67   PHE A CZ    1 
ATOM 541   N N     . LEU A 1  68  ? 134.324 9.480    24.099  1.00 0.00 ? 68   LEU A N     1 
ATOM 542   C CA    . LEU A 1  68  ? 133.192 10.148   23.493  1.00 0.00 ? 68   LEU A CA    1 
ATOM 543   C C     . LEU A 1  68  ? 132.885 9.580    22.133  1.00 0.00 ? 68   LEU A C     1 
ATOM 544   O O     . LEU A 1  68  ? 131.733 9.571    21.710  1.00 0.00 ? 68   LEU A O     1 
ATOM 545   C CB    . LEU A 1  68  ? 133.432 11.666   23.295  1.00 0.00 ? 68   LEU A CB    1 
ATOM 546   C CG    . LEU A 1  68  ? 133.713 12.453   24.597  1.00 0.00 ? 68   LEU A CG    1 
ATOM 547   C CD1   . LEU A 1  68  ? 133.759 13.969   24.336  1.00 0.00 ? 68   LEU A CD1   1 
ATOM 548   C CD2   . LEU A 1  68  ? 132.720 12.142   25.735  1.00 0.00 ? 68   LEU A CD2   1 
ATOM 549   N N     . ARG A 1  69  ? 133.932 9.095    21.431  1.00 0.00 ? 69   ARG A N     1 
ATOM 550   C CA    . ARG A 1  69  ? 133.970 8.899    20.004  1.00 0.00 ? 69   ARG A CA    1 
ATOM 551   C C     . ARG A 1  69  ? 132.904 7.990    19.434  1.00 0.00 ? 69   ARG A C     1 
ATOM 552   O O     . ARG A 1  69  ? 132.375 8.277    18.362  1.00 0.00 ? 69   ARG A O     1 
ATOM 553   C CB    . ARG A 1  69  ? 135.382 8.427    19.601  1.00 0.00 ? 69   ARG A CB    1 
ATOM 554   C CG    . ARG A 1  69  ? 135.631 8.218    18.100  1.00 0.00 ? 69   ARG A CG    1 
ATOM 555   C CD    . ARG A 1  69  ? 137.132 8.067    17.823  1.00 0.00 ? 69   ARG A CD    1 
ATOM 556   N NE    . ARG A 1  69  ? 137.324 7.544    16.432  1.00 0.00 ? 69   ARG A NE    1 
ATOM 557   C CZ    . ARG A 1  69  ? 138.426 7.817    15.666  1.00 0.00 ? 69   ARG A CZ    1 
ATOM 558   N NH1   . ARG A 1  69  ? 139.342 8.749    16.055  1.00 0.00 ? 69   ARG A NH1   1 
ATOM 559   N NH2   . ARG A 1  69  ? 138.602 7.158    14.484  1.00 0.00 ? 69   ARG A NH2   1 
ATOM 560   N N     . GLY A 1  70  ? 132.556 6.877    20.122  1.00 0.00 ? 70   GLY A N     1 
ATOM 561   C CA    . GLY A 1  70  ? 131.646 5.895    19.578  1.00 0.00 ? 70   GLY A CA    1 
ATOM 562   C C     . GLY A 1  70  ? 130.196 6.246    19.736  1.00 0.00 ? 70   GLY A C     1 
ATOM 563   O O     . GLY A 1  70  ? 129.411 6.016    18.816  1.00 0.00 ? 70   GLY A O     1 
ATOM 564   N N     . VAL A 1  71  ? 129.792 6.791    20.917  1.00 0.00 ? 71   VAL A N     1 
ATOM 565   C CA    . VAL A 1  71  ? 128.399 7.080    21.208  1.00 0.00 ? 71   VAL A CA    1 
ATOM 566   C C     . VAL A 1  71  ? 127.961 8.322    20.481  1.00 0.00 ? 71   VAL A C     1 
ATOM 567   O O     . VAL A 1  71  ? 126.814 8.427    20.047  1.00 0.00 ? 71   VAL A O     1 
ATOM 568   C CB    . VAL A 1  71  ? 128.089 7.164    22.698  1.00 0.00 ? 71   VAL A CB    1 
ATOM 569   C CG1   . VAL A 1  71  ? 128.634 8.439    23.371  1.00 0.00 ? 71   VAL A CG1   1 
ATOM 570   C CG2   . VAL A 1  71  ? 126.575 6.983    22.937  1.00 0.00 ? 71   VAL A CG2   1 
ATOM 571   N N     . PHE A 1  72  ? 128.905 9.281    20.301  1.00 0.00 ? 72   PHE A N     1 
ATOM 572   C CA    . PHE A 1  72  ? 128.712 10.482   19.531  1.00 0.00 ? 72   PHE A CA    1 
ATOM 573   C C     . PHE A 1  72  ? 128.518 10.099   18.096  1.00 0.00 ? 72   PHE A C     1 
ATOM 574   O O     . PHE A 1  72  ? 127.619 10.596   17.435  1.00 0.00 ? 72   PHE A O     1 
ATOM 575   C CB    . PHE A 1  72  ? 129.955 11.413   19.531  1.00 0.00 ? 72   PHE A CB    1 
ATOM 576   C CG    . PHE A 1  72  ? 130.096 12.320   20.729  1.00 0.00 ? 72   PHE A CG    1 
ATOM 577   C CD1   . PHE A 1  72  ? 129.852 11.913   22.052  1.00 0.00 ? 72   PHE A CD1   1 
ATOM 578   C CD2   . PHE A 1  72  ? 130.541 13.636   20.511  1.00 0.00 ? 72   PHE A CD2   1 
ATOM 579   C CE1   . PHE A 1  72  ? 130.050 12.794   23.120  1.00 0.00 ? 72   PHE A CE1   1 
ATOM 580   C CE2   . PHE A 1  72  ? 130.723 14.530   21.570  1.00 0.00 ? 72   PHE A CE2   1 
ATOM 581   C CZ    . PHE A 1  72  ? 130.473 14.107   22.878  1.00 0.00 ? 72   PHE A CZ    1 
ATOM 582   N N     . GLY A 1  73  ? 129.363 9.181    17.578  1.00 0.00 ? 73   GLY A N     1 
ATOM 583   C CA    . GLY A 1  73  ? 129.393 8.910    16.169  1.00 0.00 ? 73   GLY A CA    1 
ATOM 584   C C     . GLY A 1  73  ? 130.243 9.953    15.500  1.00 0.00 ? 73   GLY A C     1 
ATOM 585   O O     . GLY A 1  73  ? 129.885 10.460   14.437  1.00 0.00 ? 73   GLY A O     1 
ATOM 586   N N     . CYS A 1  74  ? 131.379 10.317   16.144  1.00 0.00 ? 74   CYS A N     1 
ATOM 587   C CA    . CYS A 1  74  ? 132.213 11.405   15.707  1.00 0.00 ? 74   CYS A CA    1 
ATOM 588   C C     . CYS A 1  74  ? 133.570 10.882   15.298  1.00 0.00 ? 74   CYS A C     1 
ATOM 589   O O     . CYS A 1  74  ? 133.700 9.768    14.794  1.00 0.00 ? 74   CYS A O     1 
ATOM 590   C CB    . CYS A 1  74  ? 132.304 12.554   16.753  1.00 0.00 ? 74   CYS A CB    1 
ATOM 591   S SG    . CYS A 1  74  ? 133.116 12.192   18.348  1.00 0.00 ? 74   CYS A SG    1 
ATOM 592   N N     . GLU A 1  75  ? 134.588 11.743   15.486  1.00 0.00 ? 75   GLU A N     1 
ATOM 593   C CA    . GLU A 1  75  ? 135.929 11.671   14.987  1.00 0.00 ? 75   GLU A CA    1 
ATOM 594   C C     . GLU A 1  75  ? 136.403 13.023   15.452  1.00 0.00 ? 75   GLU A C     1 
ATOM 595   O O     . GLU A 1  75  ? 135.686 13.994   15.214  1.00 0.00 ? 75   GLU A O     1 
ATOM 596   C CB    . GLU A 1  75  ? 136.040 11.679   13.434  1.00 0.00 ? 75   GLU A CB    1 
ATOM 597   C CG    . GLU A 1  75  ? 136.282 10.313   12.762  1.00 0.00 ? 75   GLU A CG    1 
ATOM 598   C CD    . GLU A 1  75  ? 137.770 9.954    12.686  1.00 0.00 ? 75   GLU A CD    1 
ATOM 599   O OE1   . GLU A 1  75  ? 138.605 10.629   13.346  1.00 0.00 ? 75   GLU A OE1   1 
ATOM 600   O OE2   . GLU A 1  75  ? 138.087 8.984    11.947  1.00 0.00 ? 75   GLU A OE2   1 
ATOM 601   N N     . PRO A 1  76  ? 137.541 13.193   16.109  1.00 0.00 ? 76   PRO A N     1 
ATOM 602   C CA    . PRO A 1  76  ? 138.032 14.509   16.475  1.00 0.00 ? 76   PRO A CA    1 
ATOM 603   C C     . PRO A 1  76  ? 138.766 15.104   15.300  1.00 0.00 ? 76   PRO A C     1 
ATOM 604   O O     . PRO A 1  76  ? 139.207 14.350   14.431  1.00 0.00 ? 76   PRO A O     1 
ATOM 605   C CB    . PRO A 1  76  ? 138.987 14.248   17.643  1.00 0.00 ? 76   PRO A CB    1 
ATOM 606   C CG    . PRO A 1  76  ? 139.475 12.808   17.450  1.00 0.00 ? 76   PRO A CG    1 
ATOM 607   C CD    . PRO A 1  76  ? 138.283 12.122   16.775  1.00 0.00 ? 76   PRO A CD    1 
ATOM 608   N N     . ARG A 1  77  ? 138.862 16.458   15.261  1.00 0.00 ? 77   ARG A N     1 
ATOM 609   C CA    . ARG A 1  77  ? 139.580 17.226   14.267  1.00 0.00 ? 77   ARG A CA    1 
ATOM 610   C C     . ARG A 1  77  ? 138.945 17.120   12.903  1.00 0.00 ? 77   ARG A C     1 
ATOM 611   O O     . ARG A 1  77  ? 139.616 16.790   11.924  1.00 0.00 ? 77   ARG A O     1 
ATOM 612   C CB    . ARG A 1  77  ? 141.088 16.888   14.160  1.00 0.00 ? 77   ARG A CB    1 
ATOM 613   C CG    . ARG A 1  77  ? 141.854 16.982   15.487  1.00 0.00 ? 77   ARG A CG    1 
ATOM 614   C CD    . ARG A 1  77  ? 143.259 16.367   15.376  1.00 0.00 ? 77   ARG A CD    1 
ATOM 615   N NE    . ARG A 1  77  ? 143.325 15.134   16.240  1.00 0.00 ? 77   ARG A NE    1 
ATOM 616   C CZ    . ARG A 1  77  ? 144.033 15.065   17.408  1.00 0.00 ? 77   ARG A CZ    1 
ATOM 617   N NH1   . ARG A 1  77  ? 144.840 16.083   17.815  1.00 0.00 ? 77   ARG A NH1   1 
ATOM 618   N NH2   . ARG A 1  77  ? 143.937 13.953   18.191  1.00 0.00 ? 77   ARG A NH2   1 
ATOM 619   N N     . THR A 1  78  ? 137.621 17.387   12.820  1.00 0.00 ? 78   THR A N     1 
ATOM 620   C CA    . THR A 1  78  ? 136.897 17.261   11.583  1.00 0.00 ? 78   THR A CA    1 
ATOM 621   C C     . THR A 1  78  ? 135.604 18.026   11.753  1.00 0.00 ? 78   THR A C     1 
ATOM 622   O O     . THR A 1  78  ? 135.388 18.689   12.764  1.00 0.00 ? 78   THR A O     1 
ATOM 623   C CB    . THR A 1  78  ? 136.730 15.808   11.131  1.00 0.00 ? 78   THR A CB    1 
ATOM 624   O OG1   . THR A 1  78  ? 136.229 15.694   9.806   1.00 0.00 ? 78   THR A OG1   1 
ATOM 625   C CG2   . THR A 1  78  ? 135.843 15.019   12.108  1.00 0.00 ? 78   THR A CG2   1 
ATOM 626   N N     . LEU A 1  79  ? 134.742 17.998   10.709  1.00 0.00 ? 79   LEU A N     1 
ATOM 627   C CA    . LEU A 1  79  ? 133.465 18.661   10.612  1.00 0.00 ? 79   LEU A CA    1 
ATOM 628   C C     . LEU A 1  79  ? 132.470 18.178   11.646  1.00 0.00 ? 79   LEU A C     1 
ATOM 629   O O     . LEU A 1  79  ? 131.653 18.960   12.127  1.00 0.00 ? 79   LEU A O     1 
ATOM 630   C CB    . LEU A 1  79  ? 132.776 18.430   9.236   1.00 0.00 ? 79   LEU A CB    1 
ATOM 631   C CG    . LEU A 1  79  ? 133.588 18.769   7.956   1.00 0.00 ? 79   LEU A CG    1 
ATOM 632   C CD1   . LEU A 1  79  ? 134.303 20.127   8.034   1.00 0.00 ? 79   LEU A CD1   1 
ATOM 633   C CD2   . LEU A 1  79  ? 134.542 17.646   7.500   1.00 0.00 ? 79   LEU A CD2   1 
ATOM 634   N N     . LEU A 1  80  ? 132.494 16.861   11.968  1.00 0.00 ? 80   LEU A N     1 
ATOM 635   C CA    . LEU A 1  80  ? 131.410 16.169   12.624  1.00 0.00 ? 80   LEU A CA    1 
ATOM 636   C C     . LEU A 1  80  ? 131.799 15.716   14.011  1.00 0.00 ? 80   LEU A C     1 
ATOM 637   O O     . LEU A 1  80  ? 131.499 14.593   14.409  1.00 0.00 ? 80   LEU A O     1 
ATOM 638   C CB    . LEU A 1  80  ? 130.802 15.002   11.774  1.00 0.00 ? 80   LEU A CB    1 
ATOM 639   C CG    . LEU A 1  80  ? 131.721 13.924   11.109  1.00 0.00 ? 80   LEU A CG    1 
ATOM 640   C CD1   . LEU A 1  80  ? 132.591 14.453   9.950   1.00 0.00 ? 80   LEU A CD1   1 
ATOM 641   C CD2   . LEU A 1  80  ? 132.560 13.071   12.081  1.00 0.00 ? 80   LEU A CD2   1 
ATOM 642   N N     . GLU A 1  81  ? 132.447 16.599   14.816  1.00 0.00 ? 81   GLU A N     1 
ATOM 643   C CA    . GLU A 1  81  ? 132.960 16.247   16.129  1.00 0.00 ? 81   GLU A CA    1 
ATOM 644   C C     . GLU A 1  81  ? 131.887 16.023   17.176  1.00 0.00 ? 81   GLU A C     1 
ATOM 645   O O     . GLU A 1  81  ? 132.216 15.537   18.257  1.00 0.00 ? 81   GLU A O     1 
ATOM 646   C CB    . GLU A 1  81  ? 133.920 17.293   16.750  1.00 0.00 ? 81   GLU A CB    1 
ATOM 647   C CG    . GLU A 1  81  ? 135.207 17.531   15.947  1.00 0.00 ? 81   GLU A CG    1 
ATOM 648   C CD    . GLU A 1  81  ? 136.029 18.605   16.659  1.00 0.00 ? 81   GLU A CD    1 
ATOM 649   O OE1   . GLU A 1  81  ? 137.116 18.267   17.202  1.00 0.00 ? 81   GLU A OE1   1 
ATOM 650   O OE2   . GLU A 1  81  ? 135.571 19.777   16.675  1.00 0.00 ? 81   GLU A OE2   1 
ATOM 651   N N     . PHE A 1  82  ? 130.600 16.365   16.908  1.00 0.00 ? 82   PHE A N     1 
ATOM 652   C CA    . PHE A 1  82  ? 129.543 16.190   17.883  1.00 0.00 ? 82   PHE A CA    1 
ATOM 653   C C     . PHE A 1  82  ? 128.657 15.044   17.506  1.00 0.00 ? 82   PHE A C     1 
ATOM 654   O O     . PHE A 1  82  ? 128.125 14.380   18.393  1.00 0.00 ? 82   PHE A O     1 
ATOM 655   C CB    . PHE A 1  82  ? 128.620 17.421   17.984  1.00 0.00 ? 82   PHE A CB    1 
ATOM 656   C CG    . PHE A 1  82  ? 129.368 18.530   18.647  1.00 0.00 ? 82   PHE A CG    1 
ATOM 657   C CD1   . PHE A 1  82  ? 129.802 19.648   17.916  1.00 0.00 ? 82   PHE A CD1   1 
ATOM 658   C CD2   . PHE A 1  82  ? 129.678 18.437   20.015  1.00 0.00 ? 82   PHE A CD2   1 
ATOM 659   C CE1   . PHE A 1  82  ? 130.546 20.650   18.543  1.00 0.00 ? 82   PHE A CE1   1 
ATOM 660   C CE2   . PHE A 1  82  ? 130.430 19.437   20.639  1.00 0.00 ? 82   PHE A CE2   1 
ATOM 661   C CZ    . PHE A 1  82  ? 130.864 20.538   19.894  1.00 0.00 ? 82   PHE A CZ    1 
ATOM 662   N N     . GLY A 1  83  ? 128.501 14.758   16.191  1.00 0.00 ? 83   GLY A N     1 
ATOM 663   C CA    . GLY A 1  83  ? 127.673 13.681   15.687  1.00 0.00 ? 83   GLY A CA    1 
ATOM 664   C C     . GLY A 1  83  ? 126.245 13.694   16.189  1.00 0.00 ? 83   GLY A C     1 
ATOM 665   O O     . GLY A 1  83  ? 125.568 14.719   16.179  1.00 0.00 ? 83   GLY A O     1 
ATOM 666   N N     . LEU A 1  84  ? 125.774 12.512   16.643  1.00 0.00 ? 84   LEU A N     1 
ATOM 667   C CA    . LEU A 1  84  ? 124.456 12.255   17.164  1.00 0.00 ? 84   LEU A CA    1 
ATOM 668   C C     . LEU A 1  84  ? 124.288 12.698   18.581  1.00 0.00 ? 84   LEU A C     1 
ATOM 669   O O     . LEU A 1  84  ? 123.154 12.713   19.041  1.00 0.00 ? 84   LEU A O     1 
ATOM 670   C CB    . LEU A 1  84  ? 124.131 10.744   17.256  1.00 0.00 ? 84   LEU A CB    1 
ATOM 671   C CG    . LEU A 1  84  ? 123.969 10.026   15.912  1.00 0.00 ? 84   LEU A CG    1 
ATOM 672   C CD1   . LEU A 1  84  ? 123.797 8.522    16.190  1.00 0.00 ? 84   LEU A CD1   1 
ATOM 673   C CD2   . LEU A 1  84  ? 122.793 10.599   15.093  1.00 0.00 ? 84   LEU A CD2   1 
ATOM 674   N N     . PHE A 1  85  ? 125.375 13.042   19.313  1.00 0.00 ? 85   PHE A N     1 
ATOM 675   C CA    . PHE A 1  85  ? 125.347 13.311   20.740  1.00 0.00 ? 85   PHE A CA    1 
ATOM 676   C C     . PHE A 1  85  ? 124.306 14.337   21.175  1.00 0.00 ? 85   PHE A C     1 
ATOM 677   O O     . PHE A 1  85  ? 123.680 14.062   22.195  1.00 0.00 ? 85   PHE A O     1 
ATOM 678   C CB    . PHE A 1  85  ? 126.745 13.713   21.278  1.00 0.00 ? 85   PHE A CB    1 
ATOM 679   C CG    . PHE A 1  85  ? 126.898 13.624   22.783  1.00 0.00 ? 85   PHE A CG    1 
ATOM 680   C CD1   . PHE A 1  85  ? 126.719 12.409   23.473  1.00 0.00 ? 85   PHE A CD1   1 
ATOM 681   C CD2   . PHE A 1  85  ? 127.354 14.745   23.499  1.00 0.00 ? 85   PHE A CD2   1 
ATOM 682   C CE1   . PHE A 1  85  ? 127.025 12.314   24.839  1.00 0.00 ? 85   PHE A CE1   1 
ATOM 683   C CE2   . PHE A 1  85  ? 127.663 14.652   24.861  1.00 0.00 ? 85   PHE A CE2   1 
ATOM 684   C CZ    . PHE A 1  85  ? 127.504 13.434   25.530  1.00 0.00 ? 85   PHE A CZ    1 
ATOM 685   N N     . PRO A 1  86  ? 124.010 15.458   20.511  1.00 0.00 ? 86   PRO A N     1 
ATOM 686   C CA    . PRO A 1  86  ? 122.948 16.353   20.949  1.00 0.00 ? 86   PRO A CA    1 
ATOM 687   C C     . PRO A 1  86  ? 121.582 15.889   20.508  1.00 0.00 ? 86   PRO A C     1 
ATOM 688   O O     . PRO A 1  86  ? 120.608 16.262   21.160  1.00 0.00 ? 86   PRO A O     1 
ATOM 689   C CB    . PRO A 1  86  ? 123.255 17.691   20.272  1.00 0.00 ? 86   PRO A CB    1 
ATOM 690   C CG    . PRO A 1  86  ? 124.137 17.336   19.079  1.00 0.00 ? 86   PRO A CG    1 
ATOM 691   C CD    . PRO A 1  86  ? 124.893 16.100   19.535  1.00 0.00 ? 86   PRO A CD    1 
ATOM 692   N N     . ASN A 1  87  ? 121.475 15.135   19.389  1.00 0.00 ? 87   ASN A N     1 
ATOM 693   C CA    . ASN A 1  87  ? 120.223 14.651   18.852  1.00 0.00 ? 87   ASN A CA    1 
ATOM 694   C C     . ASN A 1  87  ? 119.640 13.577   19.737  1.00 0.00 ? 87   ASN A C     1 
ATOM 695   O O     . ASN A 1  87  ? 118.435 13.546   19.978  1.00 0.00 ? 87   ASN A O     1 
ATOM 696   C CB    . ASN A 1  87  ? 120.397 14.114   17.408  1.00 0.00 ? 87   ASN A CB    1 
ATOM 697   C CG    . ASN A 1  87  ? 119.049 14.060   16.669  1.00 0.00 ? 87   ASN A CG    1 
ATOM 698   O OD1   . ASN A 1  87  ? 118.634 15.052   16.058  1.00 0.00 ? 87   ASN A OD1   1 
ATOM 699   N ND2   . ASN A 1  87  ? 118.361 12.881   16.741  1.00 0.00 ? 87   ASN A ND2   1 
ATOM 700   N N     . ILE A 1  88  ? 120.505 12.666   20.248  1.00 0.00 ? 88   ILE A N     1 
ATOM 701   C CA    . ILE A 1  88  ? 120.122 11.613   21.157  1.00 0.00 ? 88   ILE A CA    1 
ATOM 702   C C     . ILE A 1  88  ? 119.805 12.199   22.512  1.00 0.00 ? 88   ILE A C     1 
ATOM 703   O O     . ILE A 1  88  ? 118.888 11.724   23.171  1.00 0.00 ? 88   ILE A O     1 
ATOM 704   C CB    . ILE A 1  88  ? 121.117 10.451   21.221  1.00 0.00 ? 88   ILE A CB    1 
ATOM 705   C CG1   . ILE A 1  88  ? 120.523 9.254    22.002  1.00 0.00 ? 88   ILE A CG1   1 
ATOM 706   C CG2   . ILE A 1  88  ? 122.483 10.892   21.787  1.00 0.00 ? 88   ILE A CG2   1 
ATOM 707   C CD1   . ILE A 1  88  ? 121.288 7.941    21.825  1.00 0.00 ? 88   ILE A CD1   1 
ATOM 708   N N     . SER A 1  89  ? 120.536 13.267   22.935  1.00 0.00 ? 89   SER A N     1 
ATOM 709   C CA    . SER A 1  89  ? 120.394 13.935   24.211  1.00 0.00 ? 89   SER A CA    1 
ATOM 710   C C     . SER A 1  89  ? 119.071 14.622   24.369  1.00 0.00 ? 89   SER A C     1 
ATOM 711   O O     . SER A 1  89  ? 118.513 14.624   25.460  1.00 0.00 ? 89   SER A O     1 
ATOM 712   C CB    . SER A 1  89  ? 121.490 14.991   24.431  1.00 0.00 ? 89   SER A CB    1 
ATOM 713   O OG    . SER A 1  89  ? 121.487 15.532   25.750  1.00 0.00 ? 89   SER A OG    1 
ATOM 714   N N     . SER A 1  90  ? 118.536 15.232   23.288  1.00 0.00 ? 90   SER A N     1 
ATOM 715   C CA    . SER A 1  90  ? 117.226 15.845   23.299  1.00 0.00 ? 90   SER A CA    1 
ATOM 716   C C     . SER A 1  90  ? 116.168 14.786   23.478  1.00 0.00 ? 90   SER A C     1 
ATOM 717   O O     . SER A 1  90  ? 115.146 15.020   24.117  1.00 0.00 ? 90   SER A O     1 
ATOM 718   C CB    . SER A 1  90  ? 116.940 16.698   22.044  1.00 0.00 ? 90   SER A CB    1 
ATOM 719   O OG    . SER A 1  90  ? 117.198 15.993   20.838  1.00 0.00 ? 90   SER A OG    1 
ATOM 720   N N     . GLY A 1  91  ? 116.440 13.570   22.947  1.00 0.00 ? 91   GLY A N     1 
ATOM 721   C CA    . GLY A 1  91  ? 115.641 12.396   23.162  1.00 0.00 ? 91   GLY A CA    1 
ATOM 722   C C     . GLY A 1  91  ? 115.724 11.886   24.577  1.00 0.00 ? 91   GLY A C     1 
ATOM 723   O O     . GLY A 1  91  ? 114.727 11.373   25.063  1.00 0.00 ? 91   GLY A O     1 
ATOM 724   N N     . LEU A 1  92  ? 116.889 12.019   25.279  1.00 0.00 ? 92   LEU A N     1 
ATOM 725   C CA    . LEU A 1  92  ? 117.062 11.636   26.674  1.00 0.00 ? 92   LEU A CA    1 
ATOM 726   C C     . LEU A 1  92  ? 116.257 12.528   27.574  1.00 0.00 ? 92   LEU A C     1 
ATOM 727   O O     . LEU A 1  92  ? 115.681 12.048   28.544  1.00 0.00 ? 92   LEU A O     1 
ATOM 728   C CB    . LEU A 1  92  ? 118.517 11.721   27.233  1.00 0.00 ? 92   LEU A CB    1 
ATOM 729   C CG    . LEU A 1  92  ? 119.382 10.450   27.077  1.00 0.00 ? 92   LEU A CG    1 
ATOM 730   C CD1   . LEU A 1  92  ? 119.832 10.190   25.637  1.00 0.00 ? 92   LEU A CD1   1 
ATOM 731   C CD2   . LEU A 1  92  ? 120.605 10.521   28.008  1.00 0.00 ? 92   LEU A CD2   1 
ATOM 732   N N     . ILE A 1  93  ? 116.239 13.853   27.288  1.00 0.00 ? 93   ILE A N     1 
ATOM 733   C CA    . ILE A 1  93  ? 115.604 14.872   28.093  1.00 0.00 ? 93   ILE A CA    1 
ATOM 734   C C     . ILE A 1  93  ? 114.113 14.683   28.061  1.00 0.00 ? 93   ILE A C     1 
ATOM 735   O O     . ILE A 1  93  ? 113.451 14.818   29.084  1.00 0.00 ? 93   ILE A O     1 
ATOM 736   C CB    . ILE A 1  93  ? 116.002 16.282   27.651  1.00 0.00 ? 93   ILE A CB    1 
ATOM 737   C CG1   . ILE A 1  93  ? 117.509 16.507   27.945  1.00 0.00 ? 93   ILE A CG1   1 
ATOM 738   C CG2   . ILE A 1  93  ? 115.141 17.362   28.351  1.00 0.00 ? 93   ILE A CG2   1 
ATOM 739   C CD1   . ILE A 1  93  ? 118.104 17.724   27.230  1.00 0.00 ? 93   ILE A CD1   1 
ATOM 740   N N     . LEU A 1  94  ? 113.548 14.340   26.882  1.00 0.00 ? 94   LEU A N     1 
ATOM 741   C CA    . LEU A 1  94  ? 112.122 14.232   26.711  1.00 0.00 ? 94   LEU A CA    1 
ATOM 742   C C     . LEU A 1  94  ? 111.649 12.838   27.044  1.00 0.00 ? 94   LEU A C     1 
ATOM 743   O O     . LEU A 1  94  ? 110.469 12.638   27.324  1.00 0.00 ? 94   LEU A O     1 
ATOM 744   C CB    . LEU A 1  94  ? 111.730 14.582   25.260  1.00 0.00 ? 94   LEU A CB    1 
ATOM 745   C CG    . LEU A 1  94  ? 112.090 16.034   24.858  1.00 0.00 ? 94   LEU A CG    1 
ATOM 746   C CD1   . LEU A 1  94  ? 112.025 16.226   23.331  1.00 0.00 ? 94   LEU A CD1   1 
ATOM 747   C CD2   . LEU A 1  94  ? 111.216 17.069   25.590  1.00 0.00 ? 94   LEU A CD2   1 
ATOM 748   N N     . GLN A 1  95  ? 112.578 11.848   27.082  1.00 0.00 ? 95   GLN A N     1 
ATOM 749   C CA    . GLN A 1  95  ? 112.350 10.513   27.595  1.00 0.00 ? 95   GLN A CA    1 
ATOM 750   C C     . GLN A 1  95  ? 112.247 10.581   29.095  1.00 0.00 ? 95   GLN A C     1 
ATOM 751   O O     . GLN A 1  95  ? 111.445 9.878    29.700  1.00 0.00 ? 95   GLN A O     1 
ATOM 752   C CB    . GLN A 1  95  ? 113.500 9.539    27.218  1.00 0.00 ? 95   GLN A CB    1 
ATOM 753   C CG    . GLN A 1  95  ? 113.338 8.058    27.626  1.00 0.00 ? 95   GLN A CG    1 
ATOM 754   C CD    . GLN A 1  95  ? 112.337 7.244    26.782  1.00 0.00 ? 95   GLN A CD    1 
ATOM 755   O OE1   . GLN A 1  95  ? 112.067 6.090    27.135  1.00 0.00 ? 95   GLN A OE1   1 
ATOM 756   N NE2   . GLN A 1  95  ? 111.805 7.817    25.663  1.00 0.00 ? 95   GLN A NE2   1 
ATOM 757   N N     . LEU A 1  96  ? 113.084 11.448   29.715  1.00 0.00 ? 96   LEU A N     1 
ATOM 758   C CA    . LEU A 1  96  ? 113.163 11.676   31.135  1.00 0.00 ? 96   LEU A CA    1 
ATOM 759   C C     . LEU A 1  96  ? 111.946 12.394   31.645  1.00 0.00 ? 96   LEU A C     1 
ATOM 760   O O     . LEU A 1  96  ? 111.426 12.025   32.689  1.00 0.00 ? 96   LEU A O     1 
ATOM 761   C CB    . LEU A 1  96  ? 114.420 12.503   31.504  1.00 0.00 ? 96   LEU A CB    1 
ATOM 762   C CG    . LEU A 1  96  ? 114.655 12.770   33.011  1.00 0.00 ? 96   LEU A CG    1 
ATOM 763   C CD1   . LEU A 1  96  ? 114.833 11.477   33.829  1.00 0.00 ? 96   LEU A CD1   1 
ATOM 764   C CD2   . LEU A 1  96  ? 115.854 13.717   33.206  1.00 0.00 ? 96   LEU A CD2   1 
ATOM 765   N N     . LEU A 1  97  ? 111.462 13.440   30.931  1.00 0.00 ? 97   LEU A N     1 
ATOM 766   C CA    . LEU A 1  97  ? 110.323 14.231   31.345  1.00 0.00 ? 97   LEU A CA    1 
ATOM 767   C C     . LEU A 1  97  ? 109.042 13.451   31.226  1.00 0.00 ? 97   LEU A C     1 
ATOM 768   O O     . LEU A 1  97  ? 108.194 13.509   32.114  1.00 0.00 ? 97   LEU A O     1 
ATOM 769   C CB    . LEU A 1  97  ? 110.181 15.549   30.545  1.00 0.00 ? 97   LEU A CB    1 
ATOM 770   C CG    . LEU A 1  97  ? 111.287 16.592   30.850  1.00 0.00 ? 97   LEU A CG    1 
ATOM 771   C CD1   . LEU A 1  97  ? 111.297 17.729   29.809  1.00 0.00 ? 97   LEU A CD1   1 
ATOM 772   C CD2   . LEU A 1  97  ? 111.195 17.163   32.279  1.00 0.00 ? 97   LEU A CD2   1 
ATOM 773   N N     . ALA A 1  98  ? 108.874 12.673   30.132  1.00 0.00 ? 98   ALA A N     1 
ATOM 774   C CA    . ALA A 1  98  ? 107.655 11.933   29.903  1.00 0.00 ? 98   ALA A CA    1 
ATOM 775   C C     . ALA A 1  98  ? 107.676 10.611   30.625  1.00 0.00 ? 98   ALA A C     1 
ATOM 776   O O     . ALA A 1  98  ? 106.636 9.972    30.778  1.00 0.00 ? 98   ALA A O     1 
ATOM 777   C CB    . ALA A 1  98  ? 107.409 11.671   28.404  1.00 0.00 ? 98   ALA A CB    1 
ATOM 778   N N     . GLY A 1  99  ? 108.865 10.187   31.110  1.00 0.00 ? 99   GLY A N     1 
ATOM 779   C CA    . GLY A 1  99  ? 109.054 8.921    31.767  1.00 0.00 ? 99   GLY A CA    1 
ATOM 780   C C     . GLY A 1  99  ? 109.129 9.099    33.254  1.00 0.00 ? 99   GLY A C     1 
ATOM 781   O O     . GLY A 1  99  ? 109.008 8.132    34.002  1.00 0.00 ? 99   GLY A O     1 
ATOM 782   N N     . LEU A 1  100 ? 109.299 10.350   33.737  1.00 0.00 ? 100  LEU A N     1 
ATOM 783   C CA    . LEU A 1  100 ? 109.224 10.669   35.145  1.00 0.00 ? 100  LEU A CA    1 
ATOM 784   C C     . LEU A 1  100 ? 107.776 10.971   35.437  1.00 0.00 ? 100  LEU A C     1 
ATOM 785   O O     . LEU A 1  100 ? 107.334 10.921   36.584  1.00 0.00 ? 100  LEU A O     1 
ATOM 786   C CB    . LEU A 1  100 ? 110.095 11.907   35.479  1.00 0.00 ? 100  LEU A CB    1 
ATOM 787   C CG    . LEU A 1  100 ? 110.190 12.323   36.966  1.00 0.00 ? 100  LEU A CG    1 
ATOM 788   C CD1   . LEU A 1  100 ? 110.799 11.219   37.853  1.00 0.00 ? 100  LEU A CD1   1 
ATOM 789   C CD2   . LEU A 1  100 ? 110.980 13.639   37.093  1.00 0.00 ? 100  LEU A CD2   1 
ATOM 790   N N     . LYS A 1  101 ? 107.008 11.250   34.351  1.00 0.00 ? 101  LYS A N     1 
ATOM 791   C CA    . LYS A 1  101 ? 105.591 11.501   34.313  1.00 0.00 ? 101  LYS A CA    1 
ATOM 792   C C     . LYS A 1  101 ? 105.282 12.855   34.893  1.00 0.00 ? 101  LYS A C     1 
ATOM 793   O O     . LYS A 1  101 ? 104.208 13.067   35.451  1.00 0.00 ? 101  LYS A O     1 
ATOM 794   C CB    . LYS A 1  101 ? 104.676 10.398   34.918  1.00 0.00 ? 101  LYS A CB    1 
ATOM 795   C CG    . LYS A 1  101 ? 104.772 9.025    34.219  1.00 0.00 ? 101  LYS A CG    1 
ATOM 796   C CD    . LYS A 1  101 ? 105.742 8.023    34.867  1.00 0.00 ? 101  LYS A CD    1 
ATOM 797   C CE    . LYS A 1  101 ? 105.920 6.743    34.039  1.00 0.00 ? 101  LYS A CE    1 
ATOM 798   N NZ    . LYS A 1  101 ? 106.922 5.837    34.646  1.00 0.00 ? 101  LYS A NZ    1 
ATOM 799   N N     . VAL A 1  102 ? 106.231 13.818   34.754  1.00 0.00 ? 102  VAL A N     1 
ATOM 800   C CA    . VAL A 1  102 ? 106.032 15.206   35.104  1.00 0.00 ? 102  VAL A CA    1 
ATOM 801   C C     . VAL A 1  102 ? 105.227 15.870   34.010  1.00 0.00 ? 102  VAL A C     1 
ATOM 802   O O     . VAL A 1  102 ? 104.351 16.687   34.294  1.00 0.00 ? 102  VAL A O     1 
ATOM 803   C CB    . VAL A 1  102 ? 107.332 15.949   35.429  1.00 0.00 ? 102  VAL A CB    1 
ATOM 804   C CG1   . VAL A 1  102 ? 108.417 15.739   34.355  1.00 0.00 ? 102  VAL A CG1   1 
ATOM 805   C CG2   . VAL A 1  102 ? 107.061 17.445   35.703  1.00 0.00 ? 102  VAL A CG2   1 
ATOM 806   N N     . ILE A 1  103 ? 105.482 15.495   32.733  1.00 0.00 ? 103  ILE A N     1 
ATOM 807   C CA    . ILE A 1  103 ? 104.751 16.001   31.598  1.00 0.00 ? 103  ILE A CA    1 
ATOM 808   C C     . ILE A 1  103 ? 104.153 14.764   30.996  1.00 0.00 ? 103  ILE A C     1 
ATOM 809   O O     . ILE A 1  103 ? 104.867 13.896   30.499  1.00 0.00 ? 103  ILE A O     1 
ATOM 810   C CB    . ILE A 1  103 ? 105.621 16.737   30.579  1.00 0.00 ? 103  ILE A CB    1 
ATOM 811   C CG1   . ILE A 1  103 ? 106.371 17.913   31.264  1.00 0.00 ? 103  ILE A CG1   1 
ATOM 812   C CG2   . ILE A 1  103 ? 104.729 17.227   29.414  1.00 0.00 ? 103  ILE A CG2   1 
ATOM 813   C CD1   . ILE A 1  103 ? 107.305 18.698   30.333  1.00 0.00 ? 103  ILE A CD1   1 
ATOM 814   N N     . LYS A 1  104 ? 102.806 14.653   31.054  1.00 0.00 ? 104  LYS A N     1 
ATOM 815   C CA    . LYS A 1  104 ? 102.093 13.470   30.642  1.00 0.00 ? 104  LYS A CA    1 
ATOM 816   C C     . LYS A 1  104 ? 101.554 13.725   29.263  1.00 0.00 ? 104  LYS A C     1 
ATOM 817   O O     . LYS A 1  104 ? 100.979 14.778   28.987  1.00 0.00 ? 104  LYS A O     1 
ATOM 818   C CB    . LYS A 1  104 ? 100.922 13.133   31.590  1.00 0.00 ? 104  LYS A CB    1 
ATOM 819   C CG    . LYS A 1  104 ? 101.381 12.739   33.009  1.00 0.00 ? 104  LYS A CG    1 
ATOM 820   C CD    . LYS A 1  104 ? 100.536 13.390   34.117  1.00 0.00 ? 104  LYS A CD    1 
ATOM 821   C CE    . LYS A 1  104 ? 100.902 14.861   34.394  1.00 0.00 ? 104  LYS A CE    1 
ATOM 822   N NZ    . LYS A 1  104 ? 101.886 14.986   35.497  1.00 0.00 ? 104  LYS A NZ    1 
ATOM 823   N N     . VAL A 1  105 ? 101.777 12.744   28.360  1.00 0.00 ? 105  VAL A N     1 
ATOM 824   C CA    . VAL A 1  105 ? 101.499 12.837   26.948  1.00 0.00 ? 105  VAL A CA    1 
ATOM 825   C C     . VAL A 1  105 ? 101.034 11.446   26.603  1.00 0.00 ? 105  VAL A C     1 
ATOM 826   O O     . VAL A 1  105 ? 101.603 10.467   27.087  1.00 0.00 ? 105  VAL A O     1 
ATOM 827   C CB    . VAL A 1  105 ? 102.752 13.197   26.138  1.00 0.00 ? 105  VAL A CB    1 
ATOM 828   C CG1   . VAL A 1  105 ? 102.506 13.137   24.617  1.00 0.00 ? 105  VAL A CG1   1 
ATOM 829   C CG2   . VAL A 1  105 ? 103.219 14.617   26.522  1.00 0.00 ? 105  VAL A CG2   1 
ATOM 830   N N     . ASN A 1  106 ? 99.976  11.330   25.758  1.00 0.00 ? 106  ASN A N     1 
ATOM 831   C CA    . ASN A 1  106 ? 99.443  10.064   25.308  1.00 0.00 ? 106  ASN A CA    1 
ATOM 832   C C     . ASN A 1  106 ? 99.773  10.012   23.839  1.00 0.00 ? 106  ASN A C     1 
ATOM 833   O O     . ASN A 1  106 ? 99.361  10.868   23.061  1.00 0.00 ? 106  ASN A O     1 
ATOM 834   C CB    . ASN A 1  106 ? 97.910  9.963    25.537  1.00 0.00 ? 106  ASN A CB    1 
ATOM 835   C CG    . ASN A 1  106 ? 97.381  8.523    25.395  1.00 0.00 ? 106  ASN A CG    1 
ATOM 836   O OD1   . ASN A 1  106 ? 98.107  7.596    25.017  1.00 0.00 ? 106  ASN A OD1   1 
ATOM 837   N ND2   . ASN A 1  106 ? 96.067  8.351    25.735  1.00 0.00 ? 106  ASN A ND2   1 
ATOM 838   N N     . PHE A 1  107 ? 100.571 8.998    23.438  1.00 0.00 ? 107  PHE A N     1 
ATOM 839   C CA    . PHE A 1  107 ? 101.329 9.022    22.211  1.00 0.00 ? 107  PHE A CA    1 
ATOM 840   C C     . PHE A 1  107 ? 100.614 8.302    21.106  1.00 0.00 ? 107  PHE A C     1 
ATOM 841   O O     . PHE A 1  107 ? 101.124 8.251    19.988  1.00 0.00 ? 107  PHE A O     1 
ATOM 842   C CB    . PHE A 1  107 ? 102.681 8.283    22.391  1.00 0.00 ? 107  PHE A CB    1 
ATOM 843   C CG    . PHE A 1  107 ? 103.701 9.163    23.055  1.00 0.00 ? 107  PHE A CG    1 
ATOM 844   C CD1   . PHE A 1  107 ? 103.649 9.438    24.433  1.00 0.00 ? 107  PHE A CD1   1 
ATOM 845   C CD2   . PHE A 1  107 ? 104.751 9.700    22.292  1.00 0.00 ? 107  PHE A CD2   1 
ATOM 846   C CE1   . PHE A 1  107 ? 104.610 10.263   25.028  1.00 0.00 ? 107  PHE A CE1   1 
ATOM 847   C CE2   . PHE A 1  107 ? 105.720 10.510   22.889  1.00 0.00 ? 107  PHE A CE2   1 
ATOM 848   C CZ    . PHE A 1  107 ? 105.642 10.806   24.254  1.00 0.00 ? 107  PHE A CZ    1 
ATOM 849   N N     . LYS A 1  108 ? 99.407  7.751    21.369  1.00 0.00 ? 108  LYS A N     1 
ATOM 850   C CA    . LYS A 1  108 ? 98.643  7.080    20.347  1.00 0.00 ? 108  LYS A CA    1 
ATOM 851   C C     . LYS A 1  108 ? 97.618  8.031    19.791  1.00 0.00 ? 108  LYS A C     1 
ATOM 852   O O     . LYS A 1  108 ? 96.904  7.698    18.846  1.00 0.00 ? 108  LYS A O     1 
ATOM 853   C CB    . LYS A 1  108 ? 97.978  5.779    20.852  1.00 0.00 ? 108  LYS A CB    1 
ATOM 854   C CG    . LYS A 1  108 ? 96.902  5.949    21.937  1.00 0.00 ? 108  LYS A CG    1 
ATOM 855   C CD    . LYS A 1  108 ? 96.552  4.630    22.653  1.00 0.00 ? 108  LYS A CD    1 
ATOM 856   C CE    . LYS A 1  108 ? 96.023  3.524    21.726  1.00 0.00 ? 108  LYS A CE    1 
ATOM 857   N NZ    . LYS A 1  108 ? 95.745  2.285    22.490  1.00 0.00 ? 108  LYS A NZ    1 
ATOM 858   N N     . ILE A 1  109 ? 97.584  9.279    20.329  1.00 0.00 ? 109  ILE A N     1 
ATOM 859   C CA    . ILE A 1  109 ? 96.897  10.397   19.729  1.00 0.00 ? 109  ILE A CA    1 
ATOM 860   C C     . ILE A 1  109 ? 97.878  10.966   18.726  1.00 0.00 ? 109  ILE A C     1 
ATOM 861   O O     . ILE A 1  109 ? 99.082  10.968   18.975  1.00 0.00 ? 109  ILE A O     1 
ATOM 862   C CB    . ILE A 1  109 ? 96.485  11.465   20.745  1.00 0.00 ? 109  ILE A CB    1 
ATOM 863   C CG1   . ILE A 1  109 ? 95.723  10.821   21.935  1.00 0.00 ? 109  ILE A CG1   1 
ATOM 864   C CG2   . ILE A 1  109 ? 95.643  12.555   20.040  1.00 0.00 ? 109  ILE A CG2   1 
ATOM 865   C CD1   . ILE A 1  109 ? 95.275  11.834   22.997  1.00 0.00 ? 109  ILE A CD1   1 
ATOM 866   N N     . GLN A 1  110 ? 97.375  11.431   17.554  1.00 0.00 ? 110  GLN A N     1 
ATOM 867   C CA    . GLN A 1  110 ? 98.154  11.974   16.466  1.00 0.00 ? 110  GLN A CA    1 
ATOM 868   C C     . GLN A 1  110 ? 98.869  13.241   16.857  1.00 0.00 ? 110  GLN A C     1 
ATOM 869   O O     . GLN A 1  110 ? 100.062 13.379   16.607  1.00 0.00 ? 110  GLN A O     1 
ATOM 870   C CB    . GLN A 1  110 ? 97.210  12.347   15.287  1.00 0.00 ? 110  GLN A CB    1 
ATOM 871   C CG    . GLN A 1  110 ? 97.878  12.869   13.993  1.00 0.00 ? 110  GLN A CG    1 
ATOM 872   C CD    . GLN A 1  110 ? 98.507  11.733   13.177  1.00 0.00 ? 110  GLN A CD    1 
ATOM 873   O OE1   . GLN A 1  110 ? 98.273  10.546   13.431  1.00 0.00 ? 110  GLN A OE1   1 
ATOM 874   N NE2   . GLN A 1  110 ? 99.323  12.130   12.151  1.00 0.00 ? 110  GLN A NE2   1 
ATOM 875   N N     . SER A 1  111 ? 98.133  14.194   17.481  1.00 0.00 ? 111  SER A N     1 
ATOM 876   C CA    . SER A 1  111 ? 98.529  15.582   17.595  1.00 0.00 ? 111  SER A CA    1 
ATOM 877   C C     . SER A 1  111 ? 99.779  15.811   18.407  1.00 0.00 ? 111  SER A C     1 
ATOM 878   O O     . SER A 1  111 ? 100.661 16.562   17.990  1.00 0.00 ? 111  SER A O     1 
ATOM 879   C CB    . SER A 1  111 ? 97.386  16.470   18.159  1.00 0.00 ? 111  SER A CB    1 
ATOM 880   O OG    . SER A 1  111 ? 96.850  15.955   19.374  1.00 0.00 ? 111  SER A OG    1 
ATOM 881   N N     . ASP A 1  112 ? 99.883  15.142   19.577  1.00 0.00 ? 112  ASP A N     1 
ATOM 882   C CA    . ASP A 1  112 ? 100.930 15.385   20.542  1.00 0.00 ? 112  ASP A CA    1 
ATOM 883   C C     . ASP A 1  112 ? 102.005 14.333   20.429  1.00 0.00 ? 112  ASP A C     1 
ATOM 884   O O     . ASP A 1  112 ? 102.991 14.368   21.165  1.00 0.00 ? 112  ASP A O     1 
ATOM 885   C CB    . ASP A 1  112 ? 100.412 15.522   22.007  1.00 0.00 ? 112  ASP A CB    1 
ATOM 886   C CG    . ASP A 1  112 ? 99.340  14.496   22.395  1.00 0.00 ? 112  ASP A CG    1 
ATOM 887   O OD1   . ASP A 1  112 ? 98.191  14.608   21.887  1.00 0.00 ? 112  ASP A OD1   1 
ATOM 888   O OD2   . ASP A 1  112 ? 99.642  13.611   23.233  1.00 0.00 ? 112  ASP A OD2   1 
ATOM 889   N N     . ARG A 1  113 ? 101.868 13.405   19.450  1.00 0.00 ? 113  ARG A N     1 
ATOM 890   C CA    . ARG A 1  113 ? 102.913 12.492   19.055  1.00 0.00 ? 113  ARG A CA    1 
ATOM 891   C C     . ARG A 1  113 ? 103.846 13.221   18.129  1.00 0.00 ? 113  ARG A C     1 
ATOM 892   O O     . ARG A 1  113 ? 105.065 13.113   18.257  1.00 0.00 ? 113  ARG A O     1 
ATOM 893   C CB    . ARG A 1  113 ? 102.334 11.279   18.299  1.00 0.00 ? 113  ARG A CB    1 
ATOM 894   C CG    . ARG A 1  113 ? 103.337 10.163   17.969  1.00 0.00 ? 113  ARG A CG    1 
ATOM 895   C CD    . ARG A 1  113 ? 102.725 9.073    17.072  1.00 0.00 ? 113  ARG A CD    1 
ATOM 896   N NE    . ARG A 1  113 ? 102.555 9.633    15.684  1.00 0.00 ? 113  ARG A NE    1 
ATOM 897   C CZ    . ARG A 1  113 ? 101.450 9.448    14.897  1.00 0.00 ? 113  ARG A CZ    1 
ATOM 898   N NH1   . ARG A 1  113 ? 100.351 8.770    15.338  1.00 0.00 ? 113  ARG A NH1   1 
ATOM 899   N NH2   . ARG A 1  113 ? 101.438 9.970    13.634  1.00 0.00 ? 113  ARG A NH2   1 
ATOM 900   N N     . GLU A 1  114 ? 103.271 14.010   17.180  1.00 0.00 ? 114  GLU A N     1 
ATOM 901   C CA    . GLU A 1  114 ? 104.014 14.789   16.213  1.00 0.00 ? 114  GLU A CA    1 
ATOM 902   C C     . GLU A 1  114 ? 104.732 15.919   16.889  1.00 0.00 ? 114  GLU A C     1 
ATOM 903   O O     . GLU A 1  114 ? 105.828 16.288   16.476  1.00 0.00 ? 114  GLU A O     1 
ATOM 904   C CB    . GLU A 1  114 ? 103.167 15.422   15.079  1.00 0.00 ? 114  GLU A CB    1 
ATOM 905   C CG    . GLU A 1  114 ? 102.278 14.469   14.254  1.00 0.00 ? 114  GLU A CG    1 
ATOM 906   C CD    . GLU A 1  114 ? 103.075 13.360   13.565  1.00 0.00 ? 114  GLU A CD    1 
ATOM 907   O OE1   . GLU A 1  114 ? 103.467 12.383   14.257  1.00 0.00 ? 114  GLU A OE1   1 
ATOM 908   O OE2   . GLU A 1  114 ? 103.275 13.460   12.325  1.00 0.00 ? 114  GLU A OE2   1 
ATOM 909   N N     . LEU A 1  115 ? 104.111 16.489   17.954  1.00 0.00 ? 115  LEU A N     1 
ATOM 910   C CA    . LEU A 1  115 ? 104.651 17.562   18.754  1.00 0.00 ? 115  LEU A CA    1 
ATOM 911   C C     . LEU A 1  115 ? 105.919 17.133   19.434  1.00 0.00 ? 115  LEU A C     1 
ATOM 912   O O     . LEU A 1  115 ? 106.867 17.907   19.497  1.00 0.00 ? 115  LEU A O     1 
ATOM 913   C CB    . LEU A 1  115 ? 103.659 18.036   19.846  1.00 0.00 ? 115  LEU A CB    1 
ATOM 914   C CG    . LEU A 1  115 ? 104.118 19.247   20.698  1.00 0.00 ? 115  LEU A CG    1 
ATOM 915   C CD1   . LEU A 1  115 ? 104.417 20.507   19.860  1.00 0.00 ? 115  LEU A CD1   1 
ATOM 916   C CD2   . LEU A 1  115 ? 103.085 19.547   21.800  1.00 0.00 ? 115  LEU A CD2   1 
ATOM 917   N N     . PHE A 1  116 ? 105.964 15.874   19.941  1.00 0.00 ? 116  PHE A N     1 
ATOM 918   C CA    . PHE A 1  116 ? 107.104 15.311   20.629  1.00 0.00 ? 116  PHE A CA    1 
ATOM 919   C C     . PHE A 1  116 ? 108.293 15.229   19.705  1.00 0.00 ? 116  PHE A C     1 
ATOM 920   O O     . PHE A 1  116 ? 109.389 15.626   20.085  1.00 0.00 ? 116  PHE A O     1 
ATOM 921   C CB    . PHE A 1  116 ? 106.766 13.889   21.159  1.00 0.00 ? 116  PHE A CB    1 
ATOM 922   C CG    . PHE A 1  116 ? 107.839 13.291   22.040  1.00 0.00 ? 116  PHE A CG    1 
ATOM 923   C CD1   . PHE A 1  116 ? 107.824 13.505   23.428  1.00 0.00 ? 116  PHE A CD1   1 
ATOM 924   C CD2   . PHE A 1  116 ? 108.822 12.443   21.494  1.00 0.00 ? 116  PHE A CD2   1 
ATOM 925   C CE1   . PHE A 1  116 ? 108.750 12.859   24.258  1.00 0.00 ? 116  PHE A CE1   1 
ATOM 926   C CE2   . PHE A 1  116 ? 109.760 11.812   22.320  1.00 0.00 ? 116  PHE A CE2   1 
ATOM 927   C CZ    . PHE A 1  116 ? 109.720 12.014   23.705  1.00 0.00 ? 116  PHE A CZ    1 
ATOM 928   N N     . GLN A 1  117 ? 108.078 14.728   18.465  1.00 0.00 ? 117  GLN A N     1 
ATOM 929   C CA    . GLN A 1  117 ? 109.102 14.505   17.471  1.00 0.00 ? 117  GLN A CA    1 
ATOM 930   C C     . GLN A 1  117 ? 109.684 15.784   16.937  1.00 0.00 ? 117  GLN A C     1 
ATOM 931   O O     . GLN A 1  117 ? 110.895 15.876   16.744  1.00 0.00 ? 117  GLN A O     1 
ATOM 932   C CB    . GLN A 1  117 ? 108.562 13.693   16.276  1.00 0.00 ? 117  GLN A CB    1 
ATOM 933   C CG    . GLN A 1  117 ? 108.204 12.255   16.676  1.00 0.00 ? 117  GLN A CG    1 
ATOM 934   C CD    . GLN A 1  117 ? 107.552 11.560   15.479  1.00 0.00 ? 117  GLN A CD    1 
ATOM 935   O OE1   . GLN A 1  117 ? 108.244 11.054   14.588  1.00 0.00 ? 117  GLN A OE1   1 
ATOM 936   N NE2   . GLN A 1  117 ? 106.184 11.549   15.469  1.00 0.00 ? 117  GLN A NE2   1 
ATOM 937   N N     . SER A 1  118 ? 108.826 16.802   16.682  1.00 0.00 ? 118  SER A N     1 
ATOM 938   C CA    . SER A 1  118 ? 109.234 18.097   16.184  1.00 0.00 ? 118  SER A CA    1 
ATOM 939   C C     . SER A 1  118 ? 110.022 18.849   17.226  1.00 0.00 ? 118  SER A C     1 
ATOM 940   O O     . SER A 1  118 ? 110.991 19.531   16.904  1.00 0.00 ? 118  SER A O     1 
ATOM 941   C CB    . SER A 1  118 ? 108.056 18.960   15.658  1.00 0.00 ? 118  SER A CB    1 
ATOM 942   O OG    . SER A 1  118 ? 107.055 19.192   16.642  1.00 0.00 ? 118  SER A OG    1 
ATOM 943   N N     . LEU A 1  119 ? 109.621 18.714   18.513  1.00 0.00 ? 119  LEU A N     1 
ATOM 944   C CA    . LEU A 1  119 ? 110.262 19.327   19.651  1.00 0.00 ? 119  LEU A CA    1 
ATOM 945   C C     . LEU A 1  119 ? 111.631 18.737   19.863  1.00 0.00 ? 119  LEU A C     1 
ATOM 946   O O     . LEU A 1  119 ? 112.548 19.461   20.234  1.00 0.00 ? 119  LEU A O     1 
ATOM 947   C CB    . LEU A 1  119 ? 109.385 19.221   20.925  1.00 0.00 ? 119  LEU A CB    1 
ATOM 948   C CG    . LEU A 1  119 ? 109.718 20.196   22.083  1.00 0.00 ? 119  LEU A CG    1 
ATOM 949   C CD1   . LEU A 1  119 ? 108.443 20.525   22.885  1.00 0.00 ? 119  LEU A CD1   1 
ATOM 950   C CD2   . LEU A 1  119 ? 110.796 19.672   23.045  1.00 0.00 ? 119  LEU A CD2   1 
ATOM 951   N N     . THR A 1  120 ? 111.807 17.414   19.596  1.00 0.00 ? 120  THR A N     1 
ATOM 952   C CA    . THR A 1  120 ? 113.067 16.706   19.720  1.00 0.00 ? 120  THR A CA    1 
ATOM 953   C C     . THR A 1  120 ? 114.097 17.264   18.769  1.00 0.00 ? 120  THR A C     1 
ATOM 954   O O     . THR A 1  120 ? 115.242 17.450   19.166  1.00 0.00 ? 120  THR A O     1 
ATOM 955   C CB    . THR A 1  120 ? 112.952 15.199   19.483  1.00 0.00 ? 120  THR A CB    1 
ATOM 956   O OG1   . THR A 1  120 ? 112.016 14.625   20.385  1.00 0.00 ? 120  THR A OG1   1 
ATOM 957   C CG2   . THR A 1  120 ? 114.309 14.494   19.704  1.00 0.00 ? 120  THR A CG2   1 
ATOM 958   N N     . LYS A 1  121 ? 113.725 17.567   17.499  1.00 0.00 ? 121  LYS A N     1 
ATOM 959   C CA    . LYS A 1  121 ? 114.685 18.019   16.513  1.00 0.00 ? 121  LYS A CA    1 
ATOM 960   C C     . LYS A 1  121 ? 114.949 19.503   16.605  1.00 0.00 ? 121  LYS A C     1 
ATOM 961   O O     . LYS A 1  121 ? 115.939 19.978   16.051  1.00 0.00 ? 121  LYS A O     1 
ATOM 962   C CB    . LYS A 1  121 ? 114.322 17.604   15.062  1.00 0.00 ? 121  LYS A CB    1 
ATOM 963   C CG    . LYS A 1  121 ? 112.936 18.019   14.530  1.00 0.00 ? 121  LYS A CG    1 
ATOM 964   C CD    . LYS A 1  121 ? 112.820 19.445   13.959  1.00 0.00 ? 121  LYS A CD    1 
ATOM 965   C CE    . LYS A 1  121 ? 113.674 19.677   12.704  1.00 0.00 ? 121  LYS A CE    1 
ATOM 966   N NZ    . LYS A 1  121 ? 113.298 20.944   12.041  1.00 0.00 ? 121  LYS A NZ    1 
ATOM 967   N N     . VAL A 1  122 ? 114.094 20.269   17.331  1.00 0.00 ? 122  VAL A N     1 
ATOM 968   C CA    . VAL A 1  122 ? 114.338 21.663   17.636  1.00 0.00 ? 122  VAL A CA    1 
ATOM 969   C C     . VAL A 1  122 ? 115.290 21.721   18.799  1.00 0.00 ? 122  VAL A C     1 
ATOM 970   O O     . VAL A 1  122 ? 116.227 22.514   18.786  1.00 0.00 ? 122  VAL A O     1 
ATOM 971   C CB    . VAL A 1  122 ? 113.059 22.434   17.946  1.00 0.00 ? 122  VAL A CB    1 
ATOM 972   C CG1   . VAL A 1  122 ? 113.352 23.826   18.555  1.00 0.00 ? 122  VAL A CG1   1 
ATOM 973   C CG2   . VAL A 1  122 ? 112.268 22.585   16.630  1.00 0.00 ? 122  VAL A CG2   1 
ATOM 974   N N     . PHE A 1  123 ? 115.088 20.846   19.817  1.00 0.00 ? 123  PHE A N     1 
ATOM 975   C CA    . PHE A 1  123 ? 115.879 20.798   21.026  1.00 0.00 ? 123  PHE A CA    1 
ATOM 976   C C     . PHE A 1  123 ? 117.196 20.131   20.756  1.00 0.00 ? 123  PHE A C     1 
ATOM 977   O O     . PHE A 1  123 ? 118.112 20.265   21.559  1.00 0.00 ? 123  PHE A O     1 
ATOM 978   C CB    . PHE A 1  123 ? 115.195 20.019   22.191  1.00 0.00 ? 123  PHE A CB    1 
ATOM 979   C CG    . PHE A 1  123 ? 114.428 20.929   23.122  1.00 0.00 ? 123  PHE A CG    1 
ATOM 980   C CD1   . PHE A 1  123 ? 113.521 21.896   22.650  1.00 0.00 ? 123  PHE A CD1   1 
ATOM 981   C CD2   . PHE A 1  123 ? 114.622 20.811   24.513  1.00 0.00 ? 123  PHE A CD2   1 
ATOM 982   C CE1   . PHE A 1  123 ? 112.841 22.735   23.544  1.00 0.00 ? 123  PHE A CE1   1 
ATOM 983   C CE2   . PHE A 1  123 ? 113.944 21.647   25.407  1.00 0.00 ? 123  PHE A CE2   1 
ATOM 984   C CZ    . PHE A 1  123 ? 113.056 22.613   24.922  1.00 0.00 ? 123  PHE A CZ    1 
ATOM 985   N N     . ALA A 1  124 ? 117.331 19.409   19.618  1.00 0.00 ? 124  ALA A N     1 
ATOM 986   C CA    . ALA A 1  124 ? 118.574 18.846   19.154  1.00 0.00 ? 124  ALA A CA    1 
ATOM 987   C C     . ALA A 1  124 ? 119.503 19.941   18.726  1.00 0.00 ? 124  ALA A C     1 
ATOM 988   O O     . ALA A 1  124 ? 120.705 19.854   18.949  1.00 0.00 ? 124  ALA A O     1 
ATOM 989   C CB    . ALA A 1  124 ? 118.387 17.897   17.957  1.00 0.00 ? 124  ALA A CB    1 
ATOM 990   N N     . ILE A 1  125 ? 118.940 20.996   18.089  1.00 0.00 ? 125  ILE A N     1 
ATOM 991   C CA    . ILE A 1  125 ? 119.664 22.130   17.572  1.00 0.00 ? 125  ILE A CA    1 
ATOM 992   C C     . ILE A 1  125 ? 119.972 23.109   18.692  1.00 0.00 ? 125  ILE A C     1 
ATOM 993   O O     . ILE A 1  125 ? 121.013 23.764   18.667  1.00 0.00 ? 125  ILE A O     1 
ATOM 994   C CB    . ILE A 1  125 ? 118.937 22.749   16.382  1.00 0.00 ? 125  ILE A CB    1 
ATOM 995   C CG1   . ILE A 1  125 ? 118.879 21.676   15.259  1.00 0.00 ? 125  ILE A CG1   1 
ATOM 996   C CG2   . ILE A 1  125 ? 119.656 24.034   15.911  1.00 0.00 ? 125  ILE A CG2   1 
ATOM 997   C CD1   . ILE A 1  125 ? 118.160 22.117   13.983  1.00 0.00 ? 125  ILE A CD1   1 
ATOM 998   N N     . VAL A 1  126 ? 119.097 23.200   19.730  1.00 0.00 ? 126  VAL A N     1 
ATOM 999   C CA    . VAL A 1  126 ? 119.329 23.984   20.934  1.00 0.00 ? 126  VAL A CA    1 
ATOM 1000  C C     . VAL A 1  126 ? 120.439 23.350   21.738  1.00 0.00 ? 126  VAL A C     1 
ATOM 1001  O O     . VAL A 1  126 ? 121.296 24.041   22.284  1.00 0.00 ? 126  VAL A O     1 
ATOM 1002  C CB    . VAL A 1  126 ? 118.078 24.142   21.798  1.00 0.00 ? 126  VAL A CB    1 
ATOM 1003  C CG1   . VAL A 1  126 ? 118.390 24.846   23.139  1.00 0.00 ? 126  VAL A CG1   1 
ATOM 1004  C CG2   . VAL A 1  126 ? 117.038 24.958   21.004  1.00 0.00 ? 126  VAL A CG2   1 
ATOM 1005  N N     . GLN A 1  127 ? 120.451 21.997   21.801  1.00 0.00 ? 127  GLN A N     1 
ATOM 1006  C CA    . GLN A 1  127 ? 121.464 21.213   22.461  1.00 0.00 ? 127  GLN A CA    1 
ATOM 1007  C C     . GLN A 1  127 ? 122.776 21.329   21.724  1.00 0.00 ? 127  GLN A C     1 
ATOM 1008  O O     . GLN A 1  127 ? 123.832 21.306   22.345  1.00 0.00 ? 127  GLN A O     1 
ATOM 1009  C CB    . GLN A 1  127 ? 121.061 19.727   22.598  1.00 0.00 ? 127  GLN A CB    1 
ATOM 1010  C CG    . GLN A 1  127 ? 122.036 18.847   23.406  1.00 0.00 ? 127  GLN A CG    1 
ATOM 1011  C CD    . GLN A 1  127 ? 122.112 19.263   24.879  1.00 0.00 ? 127  GLN A CD    1 
ATOM 1012  O OE1   . GLN A 1  127 ? 121.108 19.205   25.599  1.00 0.00 ? 127  GLN A OE1   1 
ATOM 1013  N NE2   . GLN A 1  127 ? 123.339 19.666   25.331  1.00 0.00 ? 127  GLN A NE2   1 
ATOM 1014  N N     . TYR A 1  128 ? 122.731 21.470   20.375  1.00 0.00 ? 128  TYR A N     1 
ATOM 1015  C CA    . TYR A 1  128 ? 123.885 21.596   19.511  1.00 0.00 ? 128  TYR A CA    1 
ATOM 1016  C C     . TYR A 1  128 ? 124.657 22.857   19.787  1.00 0.00 ? 128  TYR A C     1 
ATOM 1017  O O     . TYR A 1  128 ? 125.883 22.824   19.837  1.00 0.00 ? 128  TYR A O     1 
ATOM 1018  C CB    . TYR A 1  128 ? 123.483 21.619   18.004  1.00 0.00 ? 128  TYR A CB    1 
ATOM 1019  C CG    . TYR A 1  128 ? 124.214 20.568   17.223  1.00 0.00 ? 128  TYR A CG    1 
ATOM 1020  C CD1   . TYR A 1  128 ? 125.611 20.628   17.091  1.00 0.00 ? 128  TYR A CD1   1 
ATOM 1021  C CD2   . TYR A 1  128 ? 123.518 19.492   16.641  1.00 0.00 ? 128  TYR A CD2   1 
ATOM 1022  C CE1   . TYR A 1  128 ? 126.306 19.598   16.453  1.00 0.00 ? 128  TYR A CE1   1 
ATOM 1023  C CE2   . TYR A 1  128 ? 124.216 18.452   16.016  1.00 0.00 ? 128  TYR A CE2   1 
ATOM 1024  C CZ    . TYR A 1  128 ? 125.615 18.486   15.956  1.00 0.00 ? 128  TYR A CZ    1 
ATOM 1025  O OH    . TYR A 1  128 ? 126.325 17.419   15.365  1.00 0.00 ? 128  TYR A OH    1 
ATOM 1026  N N     . VAL A 1  129 ? 123.950 24.002   19.961  1.00 0.00 ? 129  VAL A N     1 
ATOM 1027  C CA    . VAL A 1  129 ? 124.580 25.288   20.147  1.00 0.00 ? 129  VAL A CA    1 
ATOM 1028  C C     . VAL A 1  129 ? 125.146 25.419   21.542  1.00 0.00 ? 129  VAL A C     1 
ATOM 1029  O O     . VAL A 1  129 ? 126.183 26.051   21.727  1.00 0.00 ? 129  VAL A O     1 
ATOM 1030  C CB    . VAL A 1  129 ? 123.704 26.472   19.740  1.00 0.00 ? 129  VAL A CB    1 
ATOM 1031  C CG1   . VAL A 1  129 ? 122.420 26.566   20.584  1.00 0.00 ? 129  VAL A CG1   1 
ATOM 1032  C CG2   . VAL A 1  129 ? 124.523 27.782   19.762  1.00 0.00 ? 129  VAL A CG2   1 
ATOM 1033  N N     . ILE A 1  130 ? 124.517 24.797   22.573  1.00 0.00 ? 130  ILE A N     1 
ATOM 1034  C CA    . ILE A 1  130 ? 125.094 24.804   23.901  1.00 0.00 ? 130  ILE A CA    1 
ATOM 1035  C C     . ILE A 1  130 ? 126.265 23.854   23.970  1.00 0.00 ? 130  ILE A C     1 
ATOM 1036  O O     . ILE A 1  130 ? 127.226 24.156   24.666  1.00 0.00 ? 130  ILE A O     1 
ATOM 1037  C CB    . ILE A 1  130 ? 124.122 24.607   25.060  1.00 0.00 ? 130  ILE A CB    1 
ATOM 1038  C CG1   . ILE A 1  130 ? 123.412 23.236   25.044  1.00 0.00 ? 130  ILE A CG1   1 
ATOM 1039  C CG2   . ILE A 1  130 ? 123.134 25.796   25.031  1.00 0.00 ? 130  ILE A CG2   1 
ATOM 1040  C CD1   . ILE A 1  130 ? 122.466 23.012   26.228  1.00 0.00 ? 130  ILE A CD1   1 
ATOM 1041  N N     . LEU A 1  131 ? 126.240 22.720   23.213  1.00 0.00 ? 131  LEU A N     1 
ATOM 1042  C CA    . LEU A 1  131 ? 127.330 21.768   23.124  1.00 0.00 ? 131  LEU A CA    1 
ATOM 1043  C C     . LEU A 1  131 ? 128.545 22.360   22.479  1.00 0.00 ? 131  LEU A C     1 
ATOM 1044  O O     . LEU A 1  131 ? 129.660 21.985   22.831  1.00 0.00 ? 131  LEU A O     1 
ATOM 1045  C CB    . LEU A 1  131 ? 127.048 20.481   22.309  1.00 0.00 ? 131  LEU A CB    1 
ATOM 1046  C CG    . LEU A 1  131 ? 126.424 19.297   23.079  1.00 0.00 ? 131  LEU A CG    1 
ATOM 1047  C CD1   . LEU A 1  131 ? 126.358 18.110   22.110  1.00 0.00 ? 131  LEU A CD1   1 
ATOM 1048  C CD2   . LEU A 1  131 ? 127.197 18.889   24.349  1.00 0.00 ? 131  LEU A CD2   1 
ATOM 1049  N N     . THR A 1  132 ? 128.369 23.257   21.482  1.00 0.00 ? 132  THR A N     1 
ATOM 1050  C CA    . THR A 1  132 ? 129.488 23.788   20.747  1.00 0.00 ? 132  THR A CA    1 
ATOM 1051  C C     . THR A 1  132 ? 130.251 24.780   21.595  1.00 0.00 ? 132  THR A C     1 
ATOM 1052  O O     . THR A 1  132 ? 131.467 24.900   21.462  1.00 0.00 ? 132  THR A O     1 
ATOM 1053  C CB    . THR A 1  132 ? 129.118 24.298   19.361  1.00 0.00 ? 132  THR A CB    1 
ATOM 1054  O OG1   . THR A 1  132 ? 130.251 24.245   18.504  1.00 0.00 ? 132  THR A OG1   1 
ATOM 1055  C CG2   . THR A 1  132 ? 128.505 25.717   19.373  1.00 0.00 ? 132  THR A CG2   1 
ATOM 1056  N N     . ASN A 1  133 ? 129.540 25.469   22.528  1.00 0.00 ? 133  ASN A N     1 
ATOM 1057  C CA    . ASN A 1  133 ? 130.131 26.333   23.523  1.00 0.00 ? 133  ASN A CA    1 
ATOM 1058  C C     . ASN A 1  133 ? 130.757 25.527   24.636  1.00 0.00 ? 133  ASN A C     1 
ATOM 1059  O O     . ASN A 1  133 ? 131.744 25.956   25.225  1.00 0.00 ? 133  ASN A O     1 
ATOM 1060  C CB    . ASN A 1  133 ? 129.114 27.311   24.162  1.00 0.00 ? 133  ASN A CB    1 
ATOM 1061  C CG    . ASN A 1  133 ? 128.558 28.283   23.112  1.00 0.00 ? 133  ASN A CG    1 
ATOM 1062  O OD1   . ASN A 1  133 ? 127.337 28.402   22.957  1.00 0.00 ? 133  ASN A OD1   1 
ATOM 1063  N ND2   . ASN A 1  133 ? 129.479 29.001   22.398  1.00 0.00 ? 133  ASN A ND2   1 
ATOM 1064  N N     . ILE A 1  134 ? 130.206 24.325   24.939  1.00 0.00 ? 134  ILE A N     1 
ATOM 1065  C CA    . ILE A 1  134 ? 130.705 23.390   25.926  1.00 0.00 ? 134  ILE A CA    1 
ATOM 1066  C C     . ILE A 1  134 ? 132.056 22.859   25.497  1.00 0.00 ? 134  ILE A C     1 
ATOM 1067  O O     . ILE A 1  134 ? 132.956 22.738   26.317  1.00 0.00 ? 134  ILE A O     1 
ATOM 1068  C CB    . ILE A 1  134 ? 129.671 22.283   26.185  1.00 0.00 ? 134  ILE A CB    1 
ATOM 1069  C CG1   . ILE A 1  134 ? 128.585 22.808   27.163  1.00 0.00 ? 134  ILE A CG1   1 
ATOM 1070  C CG2   . ILE A 1  134 ? 130.267 20.929   26.640  1.00 0.00 ? 134  ILE A CG2   1 
ATOM 1071  C CD1   . ILE A 1  134 ? 127.349 21.908   27.279  1.00 0.00 ? 134  ILE A CD1   1 
ATOM 1072  N N     . PHE A 1  135 ? 132.253 22.541   24.199  1.00 0.00 ? 135  PHE A N     1 
ATOM 1073  C CA    . PHE A 1  135 ? 133.460 21.905   23.716  1.00 0.00 ? 135  PHE A CA    1 
ATOM 1074  C C     . PHE A 1  135 ? 134.640 22.849   23.677  1.00 0.00 ? 135  PHE A C     1 
ATOM 1075  O O     . PHE A 1  135 ? 135.775 22.421   23.880  1.00 0.00 ? 135  PHE A O     1 
ATOM 1076  C CB    . PHE A 1  135 ? 133.223 21.315   22.312  1.00 0.00 ? 135  PHE A CB    1 
ATOM 1077  C CG    . PHE A 1  135 ? 134.100 20.135   21.972  1.00 0.00 ? 135  PHE A CG    1 
ATOM 1078  C CD1   . PHE A 1  135 ? 134.034 18.944   22.720  1.00 0.00 ? 135  PHE A CD1   1 
ATOM 1079  C CD2   . PHE A 1  135 ? 134.926 20.174   20.837  1.00 0.00 ? 135  PHE A CD2   1 
ATOM 1080  C CE1   . PHE A 1  135 ? 134.787 17.823   22.347  1.00 0.00 ? 135  PHE A CE1   1 
ATOM 1081  C CE2   . PHE A 1  135 ? 135.680 19.056   20.462  1.00 0.00 ? 135  PHE A CE2   1 
ATOM 1082  C CZ    . PHE A 1  135 ? 135.613 17.880   21.218  1.00 0.00 ? 135  PHE A CZ    1 
ATOM 1083  N N     . ILE A 1  136 ? 134.398 24.164   23.436  1.00 0.00 ? 136  ILE A N     1 
ATOM 1084  C CA    . ILE A 1  136 ? 135.446 25.166   23.445  1.00 0.00 ? 136  ILE A CA    1 
ATOM 1085  C C     . ILE A 1  136 ? 135.744 25.599   24.867  1.00 0.00 ? 136  ILE A C     1 
ATOM 1086  O O     . ILE A 1  136 ? 136.803 26.169   25.126  1.00 0.00 ? 136  ILE A O     1 
ATOM 1087  C CB    . ILE A 1  136 ? 135.137 26.404   22.602  1.00 0.00 ? 136  ILE A CB    1 
ATOM 1088  C CG1   . ILE A 1  136 ? 133.808 27.079   23.008  1.00 0.00 ? 136  ILE A CG1   1 
ATOM 1089  C CG2   . ILE A 1  136 ? 135.164 26.005   21.110  1.00 0.00 ? 136  ILE A CG2   1 
ATOM 1090  C CD1   . ILE A 1  136 ? 133.531 28.414   22.312  1.00 0.00 ? 136  ILE A CD1   1 
ATOM 1091  N N     . PHE A 1  137 ? 134.829 25.298   25.828  1.00 0.00 ? 137  PHE A N     1 
ATOM 1092  C CA    . PHE A 1  137 ? 135.015 25.560   27.240  1.00 0.00 ? 137  PHE A CA    1 
ATOM 1093  C C     . PHE A 1  137 ? 135.760 24.403   27.856  1.00 0.00 ? 137  PHE A C     1 
ATOM 1094  O O     . PHE A 1  137 ? 136.267 24.529   28.968  1.00 0.00 ? 137  PHE A O     1 
ATOM 1095  C CB    . PHE A 1  137 ? 133.665 25.670   28.019  1.00 0.00 ? 137  PHE A CB    1 
ATOM 1096  C CG    . PHE A 1  137 ? 133.155 27.085   28.187  1.00 0.00 ? 137  PHE A CG    1 
ATOM 1097  C CD1   . PHE A 1  137 ? 133.097 28.004   27.122  1.00 0.00 ? 137  PHE A CD1   1 
ATOM 1098  C CD2   . PHE A 1  137 ? 132.660 27.485   29.444  1.00 0.00 ? 137  PHE A CD2   1 
ATOM 1099  C CE1   . PHE A 1  137 ? 132.546 29.280   27.304  1.00 0.00 ? 137  PHE A CE1   1 
ATOM 1100  C CE2   . PHE A 1  137 ? 132.119 28.762   29.632  1.00 0.00 ? 137  PHE A CE2   1 
ATOM 1101  C CZ    . PHE A 1  137 ? 132.061 29.660   28.560  1.00 0.00 ? 137  PHE A CZ    1 
ATOM 1102  N N     . ALA A 1  138 ? 135.844 23.245   27.151  1.00 0.00 ? 138  ALA A N     1 
ATOM 1103  C CA    . ALA A 1  138 ? 136.549 22.074   27.613  1.00 0.00 ? 138  ALA A CA    1 
ATOM 1104  C C     . ALA A 1  138 ? 138.028 22.286   27.464  1.00 0.00 ? 138  ALA A C     1 
ATOM 1105  O O     . ALA A 1  138 ? 138.815 21.815   28.284  1.00 0.00 ? 138  ALA A O     1 
ATOM 1106  C CB    . ALA A 1  138 ? 136.149 20.797   26.848  1.00 0.00 ? 138  ALA A CB    1 
ATOM 1107  N N     . GLY A 1  139 ? 138.423 23.037   26.405  1.00 0.00 ? 139  GLY A N     1 
ATOM 1108  C CA    . GLY A 1  139 ? 139.795 23.384   26.138  1.00 0.00 ? 139  GLY A CA    1 
ATOM 1109  C C     . GLY A 1  139 ? 140.423 22.338   25.272  1.00 0.00 ? 139  GLY A C     1 
ATOM 1110  O O     . GLY A 1  139 ? 141.620 22.075   25.387  1.00 0.00 ? 139  GLY A O     1 
ATOM 1111  N N     . TYR A 1  140 ? 139.609 21.701   24.391  1.00 0.00 ? 140  TYR A N     1 
ATOM 1112  C CA    . TYR A 1  140 ? 140.020 20.618   23.529  1.00 0.00 ? 140  TYR A CA    1 
ATOM 1113  C C     . TYR A 1  140 ? 141.049 21.064   22.512  1.00 0.00 ? 140  TYR A C     1 
ATOM 1114  O O     . TYR A 1  140 ? 141.997 20.336   22.225  1.00 0.00 ? 140  TYR A O     1 
ATOM 1115  C CB    . TYR A 1  140 ? 138.808 19.981   22.780  1.00 0.00 ? 140  TYR A CB    1 
ATOM 1116  C CG    . TYR A 1  140 ? 139.219 18.717   22.058  1.00 0.00 ? 140  TYR A CG    1 
ATOM 1117  C CD1   . TYR A 1  140 ? 139.761 17.638   22.778  1.00 0.00 ? 140  TYR A CD1   1 
ATOM 1118  C CD2   . TYR A 1  140 ? 139.179 18.644   20.654  1.00 0.00 ? 140  TYR A CD2   1 
ATOM 1119  C CE1   . TYR A 1  140 ? 140.316 16.543   22.108  1.00 0.00 ? 140  TYR A CE1   1 
ATOM 1120  C CE2   . TYR A 1  140 ? 139.710 17.535   19.982  1.00 0.00 ? 140  TYR A CE2   1 
ATOM 1121  C CZ    . TYR A 1  140 ? 140.308 16.497   20.710  1.00 0.00 ? 140  TYR A CZ    1 
ATOM 1122  O OH    . TYR A 1  140 ? 140.938 15.424   20.046  1.00 0.00 ? 140  TYR A OH    1 
ATOM 1123  N N     . PHE A 1  141 ? 140.861 22.272   21.934  1.00 0.00 ? 141  PHE A N     1 
ATOM 1124  C CA    . PHE A 1  141 ? 141.581 22.710   20.760  1.00 0.00 ? 141  PHE A CA    1 
ATOM 1125  C C     . PHE A 1  141 ? 142.980 23.162   21.061  1.00 0.00 ? 141  PHE A C     1 
ATOM 1126  O O     . PHE A 1  141 ? 143.817 23.214   20.160  1.00 0.00 ? 141  PHE A O     1 
ATOM 1127  C CB    . PHE A 1  141 ? 140.834 23.855   20.043  1.00 0.00 ? 141  PHE A CB    1 
ATOM 1128  C CG    . PHE A 1  141 ? 139.519 23.313   19.548  1.00 0.00 ? 141  PHE A CG    1 
ATOM 1129  C CD1   . PHE A 1  141 ? 139.504 22.331   18.541  1.00 0.00 ? 141  PHE A CD1   1 
ATOM 1130  C CD2   . PHE A 1  141 ? 138.302 23.709   20.132  1.00 0.00 ? 141  PHE A CD2   1 
ATOM 1131  C CE1   . PHE A 1  141 ? 138.299 21.754   18.127  1.00 0.00 ? 141  PHE A CE1   1 
ATOM 1132  C CE2   . PHE A 1  141 ? 137.095 23.138   19.710  1.00 0.00 ? 141  PHE A CE2   1 
ATOM 1133  C CZ    . PHE A 1  141 ? 137.093 22.168   18.701  1.00 0.00 ? 141  PHE A CZ    1 
ATOM 1134  N N     . GLY A 1  142 ? 143.276 23.471   22.344  1.00 0.00 ? 142  GLY A N     1 
ATOM 1135  C CA    . GLY A 1  142 ? 144.593 23.859   22.787  1.00 0.00 ? 142  GLY A CA    1 
ATOM 1136  C C     . GLY A 1  142 ? 144.789 25.339   22.664  1.00 0.00 ? 142  GLY A C     1 
ATOM 1137  O O     . GLY A 1  142 ? 145.826 25.866   23.064  1.00 0.00 ? 142  GLY A O     1 
ATOM 1138  N N     . ASP A 1  143 ? 143.764 26.043   22.136  1.00 0.00 ? 143  ASP A N     1 
ATOM 1139  C CA    . ASP A 1  143 ? 143.687 27.472   22.158  1.00 0.00 ? 143  ASP A CA    1 
ATOM 1140  C C     . ASP A 1  143 ? 142.294 27.777   22.618  1.00 0.00 ? 143  ASP A C     1 
ATOM 1141  O O     . ASP A 1  143 ? 141.302 27.377   22.011  1.00 0.00 ? 143  ASP A O     1 
ATOM 1142  C CB    . ASP A 1  143 ? 144.044 28.208   20.825  1.00 0.00 ? 143  ASP A CB    1 
ATOM 1143  C CG    . ASP A 1  143 ? 143.267 27.808   19.556  1.00 0.00 ? 143  ASP A CG    1 
ATOM 1144  O OD1   . ASP A 1  143 ? 142.525 26.792   19.560  1.00 0.00 ? 143  ASP A OD1   1 
ATOM 1145  O OD2   . ASP A 1  143 ? 143.429 28.543   18.545  1.00 0.00 ? 143  ASP A OD2   1 
ATOM 1146  N N     . ASP A 1  144 ? 142.213 28.517   23.738  1.00 0.00 ? 144  ASP A N     1 
ATOM 1147  C CA    . ASP A 1  144 ? 141.001 29.122   24.210  1.00 0.00 ? 144  ASP A CA    1 
ATOM 1148  C C     . ASP A 1  144 ? 141.263 30.578   23.991  1.00 0.00 ? 144  ASP A C     1 
ATOM 1149  O O     . ASP A 1  144 ? 142.329 31.097   24.320  1.00 0.00 ? 144  ASP A O     1 
ATOM 1150  C CB    . ASP A 1  144 ? 140.642 28.820   25.691  1.00 0.00 ? 144  ASP A CB    1 
ATOM 1151  C CG    . ASP A 1  144 ? 141.831 29.000   26.645  1.00 0.00 ? 144  ASP A CG    1 
ATOM 1152  O OD1   . ASP A 1  144 ? 142.738 28.125   26.645  1.00 0.00 ? 144  ASP A OD1   1 
ATOM 1153  O OD2   . ASP A 1  144 ? 141.836 30.011   27.396  1.00 0.00 ? 144  ASP A OD2   1 
ATOM 1154  N N     . LEU A 1  145 ? 140.287 31.249   23.362  1.00 0.00 ? 145  LEU A N     1 
ATOM 1155  C CA    . LEU A 1  145 ? 140.454 32.574   22.846  1.00 0.00 ? 145  LEU A CA    1 
ATOM 1156  C C     . LEU A 1  145 ? 139.271 33.340   23.349  1.00 0.00 ? 145  LEU A C     1 
ATOM 1157  O O     . LEU A 1  145 ? 138.291 32.766   23.825  1.00 0.00 ? 145  LEU A O     1 
ATOM 1158  C CB    . LEU A 1  145 ? 140.417 32.616   21.294  1.00 0.00 ? 145  LEU A CB    1 
ATOM 1159  C CG    . LEU A 1  145 ? 141.479 31.753   20.568  1.00 0.00 ? 145  LEU A CG    1 
ATOM 1160  C CD1   . LEU A 1  145 ? 141.165 31.679   19.061  1.00 0.00 ? 145  LEU A CD1   1 
ATOM 1161  C CD2   . LEU A 1  145 ? 142.919 32.256   20.786  1.00 0.00 ? 145  LEU A CD2   1 
ATOM 1162  N N     . SER A 1  146 ? 139.348 34.684   23.219  1.00 0.00 ? 146  SER A N     1 
ATOM 1163  C CA    . SER A 1  146 ? 138.226 35.582   23.352  1.00 0.00 ? 146  SER A CA    1 
ATOM 1164  C C     . SER A 1  146 ? 137.546 35.586   21.996  1.00 0.00 ? 146  SER A C     1 
ATOM 1165  O O     . SER A 1  146 ? 137.971 34.863   21.098  1.00 0.00 ? 146  SER A O     1 
ATOM 1166  C CB    . SER A 1  146 ? 138.673 37.000   23.790  1.00 0.00 ? 146  SER A CB    1 
ATOM 1167  O OG    . SER A 1  146 ? 137.580 37.779   24.262  1.00 0.00 ? 146  SER A OG    1 
ATOM 1168  N N     . VAL A 1  147 ? 136.434 36.343   21.824  1.00 0.00 ? 147  VAL A N     1 
ATOM 1169  C CA    . VAL A 1  147 ? 135.634 36.345   20.614  1.00 0.00 ? 147  VAL A CA    1 
ATOM 1170  C C     . VAL A 1  147 ? 136.416 36.801   19.386  1.00 0.00 ? 147  VAL A C     1 
ATOM 1171  O O     . VAL A 1  147 ? 136.686 37.983   19.188  1.00 0.00 ? 147  VAL A O     1 
ATOM 1172  C CB    . VAL A 1  147 ? 134.312 37.099   20.797  1.00 0.00 ? 147  VAL A CB    1 
ATOM 1173  C CG1   . VAL A 1  147 ? 134.520 38.556   21.275  1.00 0.00 ? 147  VAL A CG1   1 
ATOM 1174  C CG2   . VAL A 1  147 ? 133.440 37.003   19.526  1.00 0.00 ? 147  VAL A CG2   1 
ATOM 1175  N N     . VAL A 1  148 ? 136.787 35.811   18.537  1.00 0.00 ? 148  VAL A N     1 
ATOM 1176  C CA    . VAL A 1  148 ? 137.470 35.973   17.277  1.00 0.00 ? 148  VAL A CA    1 
ATOM 1177  C C     . VAL A 1  148 ? 137.103 34.701   16.550  1.00 0.00 ? 148  VAL A C     1 
ATOM 1178  O O     . VAL A 1  148 ? 135.927 34.488   16.261  1.00 0.00 ? 148  VAL A O     1 
ATOM 1179  C CB    . VAL A 1  148 ? 138.995 36.210   17.317  1.00 0.00 ? 148  VAL A CB    1 
ATOM 1180  C CG1   . VAL A 1  148 ? 139.282 37.725   17.394  1.00 0.00 ? 148  VAL A CG1   1 
ATOM 1181  C CG2   . VAL A 1  148 ? 139.687 35.455   18.472  1.00 0.00 ? 148  VAL A CG2   1 
ATOM 1182  N N     . GLN A 1  149 ? 138.092 33.821   16.245  1.00 0.00 ? 149  GLN A N     1 
ATOM 1183  C CA    . GLN A 1  149 ? 137.943 32.636   15.435  1.00 0.00 ? 149  GLN A CA    1 
ATOM 1184  C C     . GLN A 1  149 ? 137.377 31.496   16.246  1.00 0.00 ? 149  GLN A C     1 
ATOM 1185  O O     . GLN A 1  149 ? 136.948 30.491   15.684  1.00 0.00 ? 149  GLN A O     1 
ATOM 1186  C CB    . GLN A 1  149 ? 139.301 32.221   14.807  1.00 0.00 ? 149  GLN A CB    1 
ATOM 1187  C CG    . GLN A 1  149 ? 139.206 31.106   13.743  1.00 0.00 ? 149  GLN A CG    1 
ATOM 1188  C CD    . GLN A 1  149 ? 140.550 30.950   13.020  1.00 0.00 ? 149  GLN A CD    1 
ATOM 1189  O OE1   . GLN A 1  149 ? 141.603 30.860   13.661  1.00 0.00 ? 149  GLN A OE1   1 
ATOM 1190  N NE2   . GLN A 1  149 ? 140.497 30.906   11.653  1.00 0.00 ? 149  GLN A NE2   1 
ATOM 1191  N N     . ILE A 1  150 ? 137.309 31.636   17.596  1.00 0.00 ? 150  ILE A N     1 
ATOM 1192  C CA    . ILE A 1  150 ? 136.719 30.632   18.455  1.00 0.00 ? 150  ILE A CA    1 
ATOM 1193  C C     . ILE A 1  150 ? 135.208 30.672   18.351  1.00 0.00 ? 150  ILE A C     1 
ATOM 1194  O O     . ILE A 1  150 ? 134.531 29.701   18.682  1.00 0.00 ? 150  ILE A O     1 
ATOM 1195  C CB    . ILE A 1  150 ? 137.188 30.750   19.898  1.00 0.00 ? 150  ILE A CB    1 
ATOM 1196  C CG1   . ILE A 1  150 ? 136.983 29.425   20.672  1.00 0.00 ? 150  ILE A CG1   1 
ATOM 1197  C CG2   . ILE A 1  150 ? 136.563 31.980   20.594  1.00 0.00 ? 150  ILE A CG2   1 
ATOM 1198  C CD1   . ILE A 1  150 ? 137.780 29.360   21.976  1.00 0.00 ? 150  ILE A CD1   1 
ATOM 1199  N N     . GLY A 1  151 ? 134.656 31.797   17.828  1.00 0.00 ? 151  GLY A N     1 
ATOM 1200  C CA    . GLY A 1  151 ? 133.257 31.940   17.525  1.00 0.00 ? 151  GLY A CA    1 
ATOM 1201  C C     . GLY A 1  151 ? 132.931 31.275   16.218  1.00 0.00 ? 151  GLY A C     1 
ATOM 1202  O O     . GLY A 1  151 ? 131.854 30.702   16.065  1.00 0.00 ? 151  GLY A O     1 
ATOM 1203  N N     . LEU A 1  152 ? 133.863 31.357   15.236  1.00 0.00 ? 152  LEU A N     1 
ATOM 1204  C CA    . LEU A 1  152 ? 133.689 30.840   13.897  1.00 0.00 ? 152  LEU A CA    1 
ATOM 1205  C C     . LEU A 1  152 ? 133.778 29.339   13.860  1.00 0.00 ? 152  LEU A C     1 
ATOM 1206  O O     . LEU A 1  152 ? 133.018 28.710   13.130  1.00 0.00 ? 152  LEU A O     1 
ATOM 1207  C CB    . LEU A 1  152 ? 134.701 31.412   12.868  1.00 0.00 ? 152  LEU A CB    1 
ATOM 1208  C CG    . LEU A 1  152 ? 134.367 32.827   12.320  1.00 0.00 ? 152  LEU A CG    1 
ATOM 1209  C CD1   . LEU A 1  152 ? 133.040 32.860   11.532  1.00 0.00 ? 152  LEU A CD1   1 
ATOM 1210  C CD2   . LEU A 1  152 ? 134.421 33.942   13.382  1.00 0.00 ? 152  LEU A CD2   1 
ATOM 1211  N N     . ILE A 1  153 ? 134.701 28.721   14.642  1.00 0.00 ? 153  ILE A N     1 
ATOM 1212  C CA    . ILE A 1  153 ? 134.861 27.281   14.712  1.00 0.00 ? 153  ILE A CA    1 
ATOM 1213  C C     . ILE A 1  153 ? 133.634 26.648   15.314  1.00 0.00 ? 153  ILE A C     1 
ATOM 1214  O O     . ILE A 1  153 ? 133.193 25.598   14.854  1.00 0.00 ? 153  ILE A O     1 
ATOM 1215  C CB    . ILE A 1  153 ? 136.137 26.828   15.427  1.00 0.00 ? 153  ILE A CB    1 
ATOM 1216  C CG1   . ILE A 1  153 ? 136.338 25.292   15.369  1.00 0.00 ? 153  ILE A CG1   1 
ATOM 1217  C CG2   . ILE A 1  153 ? 136.172 27.353   16.875  1.00 0.00 ? 153  ILE A CG2   1 
ATOM 1218  C CD1   . ILE A 1  153 ? 137.700 24.849   15.905  1.00 0.00 ? 153  ILE A CD1   1 
ATOM 1219  N N     . ASN A 1  154 ? 133.025 27.293   16.344  1.00 0.00 ? 154  ASN A N     1 
ATOM 1220  C CA    . ASN A 1  154 ? 131.854 26.768   16.997  1.00 0.00 ? 154  ASN A CA    1 
ATOM 1221  C C     . ASN A 1  154 ? 130.643 26.830   16.085  1.00 0.00 ? 154  ASN A C     1 
ATOM 1222  O O     . ASN A 1  154 ? 129.802 25.936   16.106  1.00 0.00 ? 154  ASN A O     1 
ATOM 1223  C CB    . ASN A 1  154 ? 131.647 27.297   18.455  1.00 0.00 ? 154  ASN A CB    1 
ATOM 1224  C CG    . ASN A 1  154 ? 131.083 28.714   18.673  1.00 0.00 ? 154  ASN A CG    1 
ATOM 1225  O OD1   . ASN A 1  154 ? 131.740 29.533   19.324  1.00 0.00 ? 154  ASN A OD1   1 
ATOM 1226  N ND2   . ASN A 1  154 ? 129.825 28.970   18.206  1.00 0.00 ? 154  ASN A ND2   1 
ATOM 1227  N N     . PHE A 1  155 ? 130.562 27.879   15.225  1.00 0.00 ? 155  PHE A N     1 
ATOM 1228  C CA    . PHE A 1  155 ? 129.528 28.069   14.227  1.00 0.00 ? 155  PHE A CA    1 
ATOM 1229  C C     . PHE A 1  155 ? 129.561 26.973   13.179  1.00 0.00 ? 155  PHE A C     1 
ATOM 1230  O O     . PHE A 1  155 ? 128.510 26.470   12.788  1.00 0.00 ? 155  PHE A O     1 
ATOM 1231  C CB    . PHE A 1  155 ? 129.667 29.477   13.559  1.00 0.00 ? 155  PHE A CB    1 
ATOM 1232  C CG    . PHE A 1  155 ? 128.844 29.668   12.302  1.00 0.00 ? 155  PHE A CG    1 
ATOM 1233  C CD1   . PHE A 1  155 ? 127.439 29.657   12.337  1.00 0.00 ? 155  PHE A CD1   1 
ATOM 1234  C CD2   . PHE A 1  155 ? 129.493 29.776   11.057  1.00 0.00 ? 155  PHE A CD2   1 
ATOM 1235  C CE1   . PHE A 1  155 ? 126.697 29.748   11.151  1.00 0.00 ? 155  PHE A CE1   1 
ATOM 1236  C CE2   . PHE A 1  155 ? 128.754 29.867   9.872   1.00 0.00 ? 155  PHE A CE2   1 
ATOM 1237  C CZ    . PHE A 1  155 ? 127.355 29.852   9.919   1.00 0.00 ? 155  PHE A CZ    1 
ATOM 1238  N N     . GLN A 1  156 ? 130.772 26.598   12.703  1.00 0.00 ? 156  GLN A N     1 
ATOM 1239  C CA    . GLN A 1  156 ? 130.996 25.623   11.657  1.00 0.00 ? 156  GLN A CA    1 
ATOM 1240  C C     . GLN A 1  156 ? 130.551 24.253   12.066  1.00 0.00 ? 156  GLN A C     1 
ATOM 1241  O O     . GLN A 1  156 ? 129.988 23.512   11.267  1.00 0.00 ? 156  GLN A O     1 
ATOM 1242  C CB    . GLN A 1  156 ? 132.499 25.490   11.346  1.00 0.00 ? 156  GLN A CB    1 
ATOM 1243  C CG    . GLN A 1  156 ? 133.072 26.697   10.587  1.00 0.00 ? 156  GLN A CG    1 
ATOM 1244  C CD    . GLN A 1  156 ? 134.576 26.851   10.849  1.00 0.00 ? 156  GLN A CD    1 
ATOM 1245  O OE1   . GLN A 1  156 ? 135.093 27.973   10.771  1.00 0.00 ? 156  GLN A OE1   1 
ATOM 1246  N NE2   . GLN A 1  156 ? 135.272 25.720   11.182  1.00 0.00 ? 156  GLN A NE2   1 
ATOM 1247  N N     . LEU A 1  157 ? 130.832 23.898   13.338  1.00 0.00 ? 157  LEU A N     1 
ATOM 1248  C CA    . LEU A 1  157 ? 130.546 22.620   13.932  1.00 0.00 ? 157  LEU A CA    1 
ATOM 1249  C C     . LEU A 1  157 ? 129.063 22.403   14.069  1.00 0.00 ? 157  LEU A C     1 
ATOM 1250  O O     . LEU A 1  157 ? 128.585 21.289   13.861  1.00 0.00 ? 157  LEU A O     1 
ATOM 1251  C CB    . LEU A 1  157 ? 131.242 22.492   15.306  1.00 0.00 ? 157  LEU A CB    1 
ATOM 1252  C CG    . LEU A 1  157 ? 132.614 21.770   15.266  1.00 0.00 ? 157  LEU A CG    1 
ATOM 1253  C CD1   . LEU A 1  157 ? 132.427 20.247   15.183  1.00 0.00 ? 157  LEU A CD1   1 
ATOM 1254  C CD2   . LEU A 1  157 ? 133.579 22.256   14.165  1.00 0.00 ? 157  LEU A CD2   1 
ATOM 1255  N N     . VAL A 1  158 ? 128.304 23.474   14.408  1.00 0.00 ? 158  VAL A N     1 
ATOM 1256  C CA    . VAL A 1  158 ? 126.859 23.467   14.446  1.00 0.00 ? 158  VAL A CA    1 
ATOM 1257  C C     . VAL A 1  158 ? 126.305 23.360   13.048  1.00 0.00 ? 158  VAL A C     1 
ATOM 1258  O O     . VAL A 1  158 ? 125.308 22.681   12.847  1.00 0.00 ? 158  VAL A O     1 
ATOM 1259  C CB    . VAL A 1  158 ? 126.274 24.677   15.166  1.00 0.00 ? 158  VAL A CB    1 
ATOM 1260  C CG1   . VAL A 1  158 ? 124.731 24.691   15.098  1.00 0.00 ? 158  VAL A CG1   1 
ATOM 1261  C CG2   . VAL A 1  158 ? 126.721 24.609   16.634  1.00 0.00 ? 158  VAL A CG2   1 
ATOM 1262  N N     . GLY A 1  159 ? 126.932 24.011   12.039  1.00 0.00 ? 159  GLY A N     1 
ATOM 1263  C CA    . GLY A 1  159 ? 126.447 24.010   10.675  1.00 0.00 ? 159  GLY A CA    1 
ATOM 1264  C C     . GLY A 1  159 ? 126.628 22.685   9.985   1.00 0.00 ? 159  GLY A C     1 
ATOM 1265  O O     . GLY A 1  159 ? 125.844 22.327   9.107   1.00 0.00 ? 159  GLY A O     1 
ATOM 1266  N N     . ALA A 1  160 ? 127.658 21.911   10.400  1.00 0.00 ? 160  ALA A N     1 
ATOM 1267  C CA    . ALA A 1  160 ? 127.949 20.599   9.877   1.00 0.00 ? 160  ALA A CA    1 
ATOM 1268  C C     . ALA A 1  160 ? 127.222 19.573   10.697  1.00 0.00 ? 160  ALA A C     1 
ATOM 1269  O O     . ALA A 1  160 ? 127.154 18.399   10.334  1.00 0.00 ? 160  ALA A O     1 
ATOM 1270  C CB    . ALA A 1  160 ? 129.442 20.277   10.043  1.00 0.00 ? 160  ALA A CB    1 
ATOM 1271  N N     . GLY A 1  161 ? 126.651 20.022   11.833  1.00 0.00 ? 161  GLY A N     1 
ATOM 1272  C CA    . GLY A 1  161 ? 125.944 19.194   12.757  1.00 0.00 ? 161  GLY A CA    1 
ATOM 1273  C C     . GLY A 1  161 ? 124.469 19.270   12.528  1.00 0.00 ? 161  GLY A C     1 
ATOM 1274  O O     . GLY A 1  161 ? 123.727 18.364   12.898  1.00 0.00 ? 161  GLY A O     1 
ATOM 1275  N N     . ILE A 1  162 ? 124.002 20.362   11.884  1.00 0.00 ? 162  ILE A N     1 
ATOM 1276  C CA    . ILE A 1  162 ? 122.640 20.529   11.446  1.00 0.00 ? 162  ILE A CA    1 
ATOM 1277  C C     . ILE A 1  162 ? 122.498 19.713   10.186  1.00 0.00 ? 162  ILE A C     1 
ATOM 1278  O O     . ILE A 1  162 ? 121.423 19.193   9.901   1.00 0.00 ? 162  ILE A O     1 
ATOM 1279  C CB    . ILE A 1  162 ? 122.296 22.005   11.251  1.00 0.00 ? 162  ILE A CB    1 
ATOM 1280  C CG1   . ILE A 1  162 ? 122.089 22.666   12.637  1.00 0.00 ? 162  ILE A CG1   1 
ATOM 1281  C CG2   . ILE A 1  162 ? 121.036 22.176   10.383  1.00 0.00 ? 162  ILE A CG2   1 
ATOM 1282  C CD1   . ILE A 1  162 ? 121.939 24.190   12.583  1.00 0.00 ? 162  ILE A CD1   1 
ATOM 1283  N N     . PHE A 1  163 ? 123.619 19.526   9.444   1.00 0.00 ? 163  PHE A N     1 
ATOM 1284  C CA    . PHE A 1  163 ? 123.720 18.608   8.342   1.00 0.00 ? 163  PHE A CA    1 
ATOM 1285  C C     . PHE A 1  163 ? 123.588 17.174   8.817   1.00 0.00 ? 163  PHE A C     1 
ATOM 1286  O O     . PHE A 1  163 ? 122.917 16.393   8.148   1.00 0.00 ? 163  PHE A O     1 
ATOM 1287  C CB    . PHE A 1  163 ? 125.044 18.818   7.546   1.00 0.00 ? 163  PHE A CB    1 
ATOM 1288  C CG    . PHE A 1  163 ? 125.277 17.740   6.519   1.00 0.00 ? 163  PHE A CG    1 
ATOM 1289  C CD1   . PHE A 1  163 ? 124.374 17.567   5.458   1.00 0.00 ? 163  PHE A CD1   1 
ATOM 1290  C CD2   . PHE A 1  163 ? 126.310 16.803   6.701   1.00 0.00 ? 163  PHE A CD2   1 
ATOM 1291  C CE1   . PHE A 1  163 ? 124.499 16.474   4.593   1.00 0.00 ? 163  PHE A CE1   1 
ATOM 1292  C CE2   . PHE A 1  163 ? 126.438 15.713   5.835   1.00 0.00 ? 163  PHE A CE2   1 
ATOM 1293  C CZ    . PHE A 1  163 ? 125.535 15.555   4.777   1.00 0.00 ? 163  PHE A CZ    1 
ATOM 1294  N N     . THR A 1  164 ? 124.227 16.774   9.951   1.00 0.00 ? 164  THR A N     1 
ATOM 1295  C CA    . THR A 1  164 ? 124.251 15.374   10.334  1.00 0.00 ? 164  THR A CA    1 
ATOM 1296  C C     . THR A 1  164 ? 122.950 14.968   10.988  1.00 0.00 ? 164  THR A C     1 
ATOM 1297  O O     . THR A 1  164 ? 122.603 13.787   10.983  1.00 0.00 ? 164  THR A O     1 
ATOM 1298  C CB    . THR A 1  164 ? 125.461 14.976   11.188  1.00 0.00 ? 164  THR A CB    1 
ATOM 1299  O OG1   . THR A 1  164 ? 125.727 13.584   11.054  1.00 0.00 ? 164  THR A OG1   1 
ATOM 1300  C CG2   . THR A 1  164 ? 125.297 15.311   12.686  1.00 0.00 ? 164  THR A CG2   1 
ATOM 1301  N N     . THR A 1  165 ? 122.172 15.947   11.524  1.00 0.00 ? 165  THR A N     1 
ATOM 1302  C CA    . THR A 1  165 ? 120.836 15.708   12.022  1.00 0.00 ? 165  THR A CA    1 
ATOM 1303  C C     . THR A 1  165 ? 119.882 15.623   10.860  1.00 0.00 ? 165  THR A C     1 
ATOM 1304  O O     . THR A 1  165 ? 118.913 14.877   10.930  1.00 0.00 ? 165  THR A O     1 
ATOM 1305  C CB    . THR A 1  165 ? 120.329 16.727   13.038  1.00 0.00 ? 165  THR A CB    1 
ATOM 1306  O OG1   . THR A 1  165 ? 120.422 18.064   12.562  1.00 0.00 ? 165  THR A OG1   1 
ATOM 1307  C CG2   . THR A 1  165 ? 121.146 16.581   14.337  1.00 0.00 ? 165  THR A CG2   1 
ATOM 1308  N N     . LEU A 1  166 ? 120.142 16.370   9.756   1.00 0.00 ? 166  LEU A N     1 
ATOM 1309  C CA    . LEU A 1  166 ? 119.346 16.326   8.550   1.00 0.00 ? 166  LEU A CA    1 
ATOM 1310  C C     . LEU A 1  166 ? 119.541 15.010   7.841   1.00 0.00 ? 166  LEU A C     1 
ATOM 1311  O O     . LEU A 1  166 ? 118.585 14.482   7.294   1.00 0.00 ? 166  LEU A O     1 
ATOM 1312  C CB    . LEU A 1  166 ? 119.615 17.507   7.584   1.00 0.00 ? 166  LEU A CB    1 
ATOM 1313  C CG    . LEU A 1  166 ? 118.365 18.068   6.853   1.00 0.00 ? 166  LEU A CG    1 
ATOM 1314  C CD1   . LEU A 1  166 ? 118.708 19.403   6.173   1.00 0.00 ? 166  LEU A CD1   1 
ATOM 1315  C CD2   . LEU A 1  166 ? 117.696 17.113   5.846   1.00 0.00 ? 166  LEU A CD2   1 
ATOM 1316  N N     . LEU A 1  167 ? 120.769 14.424   7.855   1.00 0.00 ? 167  LEU A N     1 
ATOM 1317  C CA    . LEU A 1  167 ? 121.025 13.094   7.332   1.00 0.00 ? 167  LEU A CA    1 
ATOM 1318  C C     . LEU A 1  167 ? 120.324 12.052   8.155   1.00 0.00 ? 167  LEU A C     1 
ATOM 1319  O O     . LEU A 1  167 ? 119.827 11.068   7.612   1.00 0.00 ? 167  LEU A O     1 
ATOM 1320  C CB    . LEU A 1  167 ? 122.512 12.651   7.309   1.00 0.00 ? 167  LEU A CB    1 
ATOM 1321  C CG    . LEU A 1  167 ? 123.389 13.234   6.179   1.00 0.00 ? 167  LEU A CG    1 
ATOM 1322  C CD1   . LEU A 1  167 ? 124.777 12.562   6.229   1.00 0.00 ? 167  LEU A CD1   1 
ATOM 1323  C CD2   . LEU A 1  167 ? 122.770 13.074   4.774   1.00 0.00 ? 167  LEU A CD2   1 
ATOM 1324  N N     . ALA A 1  168 ? 120.276 12.242   9.495   1.00 0.00 ? 168  ALA A N     1 
ATOM 1325  C CA    . ALA A 1  168 ? 119.622 11.330   10.400  1.00 0.00 ? 168  ALA A CA    1 
ATOM 1326  C C     . ALA A 1  168 ? 118.143 11.274   10.117  1.00 0.00 ? 168  ALA A C     1 
ATOM 1327  O O     . ALA A 1  168 ? 117.548 10.199   10.128  1.00 0.00 ? 168  ALA A O     1 
ATOM 1328  C CB    . ALA A 1  168 ? 119.838 11.686   11.883  1.00 0.00 ? 168  ALA A CB    1 
ATOM 1329  N N     . GLU A 1  169 ? 117.542 12.452   9.817   1.00 0.00 ? 169  GLU A N     1 
ATOM 1330  C CA    . GLU A 1  169 ? 116.173 12.602   9.398   1.00 0.00 ? 169  GLU A CA    1 
ATOM 1331  C C     . GLU A 1  169 ? 115.940 12.016   8.024   1.00 0.00 ? 169  GLU A C     1 
ATOM 1332  O O     . GLU A 1  169 ? 114.954 11.314   7.844   1.00 0.00 ? 169  GLU A O     1 
ATOM 1333  C CB    . GLU A 1  169 ? 115.727 14.089   9.363   1.00 0.00 ? 169  GLU A CB    1 
ATOM 1334  C CG    . GLU A 1  169 ? 115.669 14.786   10.739  1.00 0.00 ? 169  GLU A CG    1 
ATOM 1335  C CD    . GLU A 1  169 ? 114.454 14.331   11.544  1.00 0.00 ? 169  GLU A CD    1 
ATOM 1336  O OE1   . GLU A 1  169 ? 114.625 13.466   12.445  1.00 0.00 ? 169  GLU A OE1   1 
ATOM 1337  O OE2   . GLU A 1  169 ? 113.342 14.857   11.276  1.00 0.00 ? 169  GLU A OE2   1 
ATOM 1338  N N     . VAL A 1  170 ? 116.830 12.275   7.024   1.00 0.00 ? 170  VAL A N     1 
ATOM 1339  C CA    . VAL A 1  170 ? 116.581 11.995   5.618   1.00 0.00 ? 170  VAL A CA    1 
ATOM 1340  C C     . VAL A 1  170 ? 116.451 10.508   5.382   1.00 0.00 ? 170  VAL A C     1 
ATOM 1341  O O     . VAL A 1  170 ? 115.521 10.067   4.713   1.00 0.00 ? 170  VAL A O     1 
ATOM 1342  C CB    . VAL A 1  170 ? 117.574 12.682   4.653   1.00 0.00 ? 170  VAL A CB    1 
ATOM 1343  C CG1   . VAL A 1  170 ? 118.842 11.859   4.329   1.00 0.00 ? 170  VAL A CG1   1 
ATOM 1344  C CG2   . VAL A 1  170 ? 116.858 13.112   3.354   1.00 0.00 ? 170  VAL A CG2   1 
ATOM 1345  N N     . ILE A 1  171 ? 117.355 9.708    6.005   1.00 0.00 ? 171  ILE A N     1 
ATOM 1346  C CA    . ILE A 1  171 ? 117.416 8.267    5.944   1.00 0.00 ? 171  ILE A CA    1 
ATOM 1347  C C     . ILE A 1  171 ? 116.203 7.678    6.620   1.00 0.00 ? 171  ILE A C     1 
ATOM 1348  O O     . ILE A 1  171 ? 115.609 6.722    6.123   1.00 0.00 ? 171  ILE A O     1 
ATOM 1349  C CB    . ILE A 1  171 ? 118.702 7.759    6.595   1.00 0.00 ? 171  ILE A CB    1 
ATOM 1350  C CG1   . ILE A 1  171 ? 119.948 8.248    5.808   1.00 0.00 ? 171  ILE A CG1   1 
ATOM 1351  C CG2   . ILE A 1  171 ? 118.694 6.221    6.710   1.00 0.00 ? 171  ILE A CG2   1 
ATOM 1352  C CD1   . ILE A 1  171 ? 121.276 8.004    6.536   1.00 0.00 ? 171  ILE A CD1   1 
ATOM 1353  N N     . ASP A 1  172 ? 115.809 8.267    7.775   1.00 0.00 ? 172  ASP A N     1 
ATOM 1354  C CA    . ASP A 1  172 ? 114.710 7.828    8.600   1.00 0.00 ? 172  ASP A CA    1 
ATOM 1355  C C     . ASP A 1  172 ? 113.371 7.967    7.901   1.00 0.00 ? 172  ASP A C     1 
ATOM 1356  O O     . ASP A 1  172 ? 112.488 7.134    8.111   1.00 0.00 ? 172  ASP A O     1 
ATOM 1357  C CB    . ASP A 1  172 ? 114.688 8.581    9.959   1.00 0.00 ? 172  ASP A CB    1 
ATOM 1358  C CG    . ASP A 1  172 ? 113.689 7.969    10.947  1.00 0.00 ? 172  ASP A CG    1 
ATOM 1359  O OD1   . ASP A 1  172 ? 113.817 6.750    11.235  1.00 0.00 ? 172  ASP A OD1   1 
ATOM 1360  O OD2   . ASP A 1  172 ? 112.788 8.712    11.420  1.00 0.00 ? 172  ASP A OD2   1 
ATOM 1361  N N     . LYS A 1  173 ? 113.191 9.010    7.040   1.00 0.00 ? 173  LYS A N     1 
ATOM 1362  C CA    . LYS A 1  173 ? 111.906 9.292    6.423   1.00 0.00 ? 173  LYS A CA    1 
ATOM 1363  C C     . LYS A 1  173 ? 111.818 8.579    5.097   1.00 0.00 ? 173  LYS A C     1 
ATOM 1364  O O     . LYS A 1  173 ? 110.797 8.663    4.415   1.00 0.00 ? 173  LYS A O     1 
ATOM 1365  C CB    . LYS A 1  173 ? 111.584 10.789   6.150   1.00 0.00 ? 173  LYS A CB    1 
ATOM 1366  C CG    . LYS A 1  173 ? 111.794 11.791   7.303   1.00 0.00 ? 173  LYS A CG    1 
ATOM 1367  C CD    . LYS A 1  173 ? 111.413 11.318   8.715   1.00 0.00 ? 173  LYS A CD    1 
ATOM 1368  C CE    . LYS A 1  173 ? 111.918 12.297   9.783   1.00 0.00 ? 173  LYS A CE    1 
ATOM 1369  N NZ    . LYS A 1  173 ? 111.756 11.751   11.149  1.00 0.00 ? 173  LYS A NZ    1 
ATOM 1370  N N     . GLY A 1  174 ? 112.870 7.806    4.740   1.00 0.00 ? 174  GLY A N     1 
ATOM 1371  C CA    . GLY A 1  174 ? 112.780 6.785    3.732   1.00 0.00 ? 174  GLY A CA    1 
ATOM 1372  C C     . GLY A 1  174 ? 113.586 7.087    2.513   1.00 0.00 ? 174  GLY A C     1 
ATOM 1373  O O     . GLY A 1  174 ? 113.412 6.419    1.495   1.00 0.00 ? 174  GLY A O     1 
ATOM 1374  N N     . PHE A 1  175 ? 114.506 8.080    2.572   1.00 0.00 ? 175  PHE A N     1 
ATOM 1375  C CA    . PHE A 1  175 ? 115.416 8.384    1.486   1.00 0.00 ? 175  PHE A CA    1 
ATOM 1376  C C     . PHE A 1  175 ? 116.409 7.259    1.337   1.00 0.00 ? 175  PHE A C     1 
ATOM 1377  O O     . PHE A 1  175 ? 116.706 6.836    0.223   1.00 0.00 ? 175  PHE A O     1 
ATOM 1378  C CB    . PHE A 1  175 ? 116.161 9.724    1.721   1.00 0.00 ? 175  PHE A CB    1 
ATOM 1379  C CG    . PHE A 1  175 ? 116.825 10.300   0.494   1.00 0.00 ? 175  PHE A CG    1 
ATOM 1380  C CD1   . PHE A 1  175 ? 116.089 10.515   -0.683  1.00 0.00 ? 175  PHE A CD1   1 
ATOM 1381  C CD2   . PHE A 1  175 ? 118.169 10.713   0.537   1.00 0.00 ? 175  PHE A CD2   1 
ATOM 1382  C CE1   . PHE A 1  175 ? 116.678 11.130   -1.793  1.00 0.00 ? 175  PHE A CE1   1 
ATOM 1383  C CE2   . PHE A 1  175 ? 118.763 11.325   -0.573  1.00 0.00 ? 175  PHE A CE2   1 
ATOM 1384  C CZ    . PHE A 1  175 ? 118.018 11.531   -1.740  1.00 0.00 ? 175  PHE A CZ    1 
ATOM 1385  N N     . GLY A 1  176 ? 116.905 6.737    2.485   1.00 0.00 ? 176  GLY A N     1 
ATOM 1386  C CA    . GLY A 1  176 ? 117.788 5.604    2.531   1.00 0.00 ? 176  GLY A CA    1 
ATOM 1387  C C     . GLY A 1  176 ? 117.109 4.504    3.287   1.00 0.00 ? 176  GLY A C     1 
ATOM 1388  O O     . GLY A 1  176 ? 115.953 4.632    3.692   1.00 0.00 ? 176  GLY A O     1 
ATOM 1389  N N     . PHE A 1  177 ? 117.840 3.381    3.496   1.00 0.00 ? 177  PHE A N     1 
ATOM 1390  C CA    . PHE A 1  177 ? 117.385 2.240    4.261   1.00 0.00 ? 177  PHE A CA    1 
ATOM 1391  C C     . PHE A 1  177 ? 117.830 2.428    5.684   1.00 0.00 ? 177  PHE A C     1 
ATOM 1392  O O     . PHE A 1  177 ? 118.698 3.249    5.964   1.00 0.00 ? 177  PHE A O     1 
ATOM 1393  C CB    . PHE A 1  177 ? 117.967 0.890    3.754   1.00 0.00 ? 177  PHE A CB    1 
ATOM 1394  C CG    . PHE A 1  177 ? 117.043 0.260    2.750   1.00 0.00 ? 177  PHE A CG    1 
ATOM 1395  C CD1   . PHE A 1  177 ? 115.781 -0.205   3.163   1.00 0.00 ? 177  PHE A CD1   1 
ATOM 1396  C CD2   . PHE A 1  177 ? 117.426 0.092    1.410   1.00 0.00 ? 177  PHE A CD2   1 
ATOM 1397  C CE1   . PHE A 1  177 ? 114.906 -0.801   2.249   1.00 0.00 ? 177  PHE A CE1   1 
ATOM 1398  C CE2   . PHE A 1  177 ? 116.551 -0.503   0.491   1.00 0.00 ? 177  PHE A CE2   1 
ATOM 1399  C CZ    . PHE A 1  177 ? 115.288 -0.939   0.910   1.00 0.00 ? 177  PHE A CZ    1 
ATOM 1400  N N     . SER A 1  178 ? 117.215 1.649    6.616   1.00 0.00 ? 178  SER A N     1 
ATOM 1401  C CA    . SER A 1  178 ? 117.409 1.715    8.051   1.00 0.00 ? 178  SER A CA    1 
ATOM 1402  C C     . SER A 1  178 ? 117.012 3.079    8.594   1.00 0.00 ? 178  SER A C     1 
ATOM 1403  O O     . SER A 1  178 ? 116.248 3.804    7.958   1.00 0.00 ? 178  SER A O     1 
ATOM 1404  C CB    . SER A 1  178 ? 118.844 1.282    8.475   1.00 0.00 ? 178  SER A CB    1 
ATOM 1405  O OG    . SER A 1  178 ? 118.913 0.820    9.820   1.00 0.00 ? 178  SER A OG    1 
ATOM 1406  N N     . SER A 1  179 ? 117.513 3.437    9.798   1.00 0.00 ? 179  SER A N     1 
ATOM 1407  C CA    . SER A 1  179 ? 117.291 4.711    10.438  1.00 0.00 ? 179  SER A CA    1 
ATOM 1408  C C     . SER A 1  179 ? 118.642 5.365    10.394  1.00 0.00 ? 179  SER A C     1 
ATOM 1409  O O     . SER A 1  179 ? 119.662 4.680    10.401  1.00 0.00 ? 179  SER A O     1 
ATOM 1410  C CB    . SER A 1  179 ? 116.804 4.557    11.904  1.00 0.00 ? 179  SER A CB    1 
ATOM 1411  O OG    . SER A 1  179 ? 116.523 5.812    12.513  1.00 0.00 ? 179  SER A OG    1 
ATOM 1412  N N     . GLY A 1  180 ? 118.684 6.715    10.296  1.00 0.00 ? 180  GLY A N     1 
ATOM 1413  C CA    . GLY A 1  180 ? 119.916 7.411    10.026  1.00 0.00 ? 180  GLY A CA    1 
ATOM 1414  C C     . GLY A 1  180 ? 120.793 7.554    11.231  1.00 0.00 ? 180  GLY A C     1 
ATOM 1415  O O     . GLY A 1  180 ? 121.999 7.745    11.088  1.00 0.00 ? 180  GLY A O     1 
ATOM 1416  N N     . ALA A 1  181 ? 120.210 7.435    12.451  1.00 0.00 ? 181  ALA A N     1 
ATOM 1417  C CA    . ALA A 1  181 ? 120.948 7.376    13.691  1.00 0.00 ? 181  ALA A CA    1 
ATOM 1418  C C     . ALA A 1  181 ? 121.666 6.059    13.809  1.00 0.00 ? 181  ALA A C     1 
ATOM 1419  O O     . ALA A 1  181 ? 122.807 6.004    14.261  1.00 0.00 ? 181  ALA A O     1 
ATOM 1420  C CB    . ALA A 1  181 ? 120.053 7.548    14.932  1.00 0.00 ? 181  ALA A CB    1 
ATOM 1421  N N     . MET A 1  182 ? 121.003 4.956    13.387  1.00 0.00 ? 182  MET A N     1 
ATOM 1422  C CA    . MET A 1  182 ? 121.560 3.627    13.428  1.00 0.00 ? 182  MET A CA    1 
ATOM 1423  C C     . MET A 1  182 ? 122.738 3.505    12.491  1.00 0.00 ? 182  MET A C     1 
ATOM 1424  O O     . MET A 1  182 ? 123.746 2.905    12.853  1.00 0.00 ? 182  MET A O     1 
ATOM 1425  C CB    . MET A 1  182 ? 120.504 2.549    13.082  1.00 0.00 ? 182  MET A CB    1 
ATOM 1426  C CG    . MET A 1  182 ? 120.869 1.109    13.506  1.00 0.00 ? 182  MET A CG    1 
ATOM 1427  S SD    . MET A 1  182 ? 120.812 0.799    15.306  1.00 0.00 ? 182  MET A SD    1 
ATOM 1428  C CE    . MET A 1  182 ? 122.594 0.823    15.663  1.00 0.00 ? 182  MET A CE    1 
ATOM 1429  N N     . ILE A 1  183 ? 122.638 4.100    11.269  1.00 0.00 ? 183  ILE A N     1 
ATOM 1430  C CA    . ILE A 1  183 ? 123.671 4.048    10.256  1.00 0.00 ? 183  ILE A CA    1 
ATOM 1431  C C     . ILE A 1  183 ? 124.908 4.795    10.666  1.00 0.00 ? 183  ILE A C     1 
ATOM 1432  O O     . ILE A 1  183 ? 125.996 4.252    10.506  1.00 0.00 ? 183  ILE A O     1 
ATOM 1433  C CB    . ILE A 1  183 ? 123.195 4.491    8.870   1.00 0.00 ? 183  ILE A CB    1 
ATOM 1434  C CG1   . ILE A 1  183 ? 122.241 3.391    8.343   1.00 0.00 ? 183  ILE A CG1   1 
ATOM 1435  C CG2   . ILE A 1  183 ? 124.379 4.736    7.894   1.00 0.00 ? 183  ILE A CG2   1 
ATOM 1436  C CD1   . ILE A 1  183 ? 121.799 3.567    6.891   1.00 0.00 ? 183  ILE A CD1   1 
ATOM 1437  N N     . ILE A 1  184 ? 124.800 6.034    11.217  1.00 0.00 ? 184  ILE A N     1 
ATOM 1438  C CA    . ILE A 1  184 ? 125.978 6.815    11.546  1.00 0.00 ? 184  ILE A CA    1 
ATOM 1439  C C     . ILE A 1  184 ? 126.712 6.210    12.725  1.00 0.00 ? 184  ILE A C     1 
ATOM 1440  O O     . ILE A 1  184 ? 127.936 6.266    12.787  1.00 0.00 ? 184  ILE A O     1 
ATOM 1441  C CB    . ILE A 1  184 ? 125.762 8.319    11.674  1.00 0.00 ? 184  ILE A CB    1 
ATOM 1442  C CG1   . ILE A 1  184 ? 127.115 9.075    11.784  1.00 0.00 ? 184  ILE A CG1   1 
ATOM 1443  C CG2   . ILE A 1  184 ? 124.818 8.624    12.842  1.00 0.00 ? 184  ILE A CG2   1 
ATOM 1444  C CD1   . ILE A 1  184 ? 126.997 10.598   11.695  1.00 0.00 ? 184  ILE A CD1   1 
ATOM 1445  N N     . ASN A 1  185 ? 125.983 5.553    13.666  1.00 0.00 ? 185  ASN A N     1 
ATOM 1446  C CA    . ASN A 1  185 ? 126.572 4.830    14.774  1.00 0.00 ? 185  ASN A CA    1 
ATOM 1447  C C     . ASN A 1  185 ? 127.391 3.668    14.255  1.00 0.00 ? 185  ASN A C     1 
ATOM 1448  O O     . ASN A 1  185 ? 128.523 3.472    14.691  1.00 0.00 ? 185  ASN A O     1 
ATOM 1449  C CB    . ASN A 1  185 ? 125.481 4.291    15.749  1.00 0.00 ? 185  ASN A CB    1 
ATOM 1450  C CG    . ASN A 1  185 ? 125.986 4.023    17.182  1.00 0.00 ? 185  ASN A CG    1 
ATOM 1451  O OD1   . ASN A 1  185 ? 125.436 4.586    18.137  1.00 0.00 ? 185  ASN A OD1   1 
ATOM 1452  N ND2   . ASN A 1  185 ? 127.024 3.147    17.333  1.00 0.00 ? 185  ASN A ND2   1 
ATOM 1453  N N     . THR A 1  186 ? 126.842 2.896    13.280  1.00 0.00 ? 186  THR A N     1 
ATOM 1454  C CA    . THR A 1  186 ? 127.460 1.680    12.799  1.00 0.00 ? 186  THR A CA    1 
ATOM 1455  C C     . THR A 1  186 ? 128.640 1.931    11.889  1.00 0.00 ? 186  THR A C     1 
ATOM 1456  O O     . THR A 1  186 ? 129.509 1.068    11.797  1.00 0.00 ? 186  THR A O     1 
ATOM 1457  C CB    . THR A 1  186 ? 126.508 0.692    12.131  1.00 0.00 ? 186  THR A CB    1 
ATOM 1458  O OG1   . THR A 1  186 ? 125.758 1.289    11.080  1.00 0.00 ? 186  THR A OG1   1 
ATOM 1459  C CG2   . THR A 1  186 ? 125.561 0.087    13.188  1.00 0.00 ? 186  THR A CG2   1 
ATOM 1460  N N     . VAL A 1  187 ? 128.730 3.108    11.218  1.00 0.00 ? 187  VAL A N     1 
ATOM 1461  C CA    . VAL A 1  187 ? 129.833 3.376    10.318  1.00 0.00 ? 187  VAL A CA    1 
ATOM 1462  C C     . VAL A 1  187 ? 130.976 4.034    11.050  1.00 0.00 ? 187  VAL A C     1 
ATOM 1463  O O     . VAL A 1  187 ? 132.082 4.070    10.519  1.00 0.00 ? 187  VAL A O     1 
ATOM 1464  C CB    . VAL A 1  187 ? 129.475 4.238    9.111   1.00 0.00 ? 187  VAL A CB    1 
ATOM 1465  C CG1   . VAL A 1  187 ? 128.486 3.462    8.216   1.00 0.00 ? 187  VAL A CG1   1 
ATOM 1466  C CG2   . VAL A 1  187 ? 128.924 5.606    9.550   1.00 0.00 ? 187  VAL A CG2   1 
ATOM 1467  N N     . VAL A 1  188 ? 130.753 4.549    12.287  1.00 0.00 ? 188  VAL A N     1 
ATOM 1468  C CA    . VAL A 1  188 ? 131.783 5.197    13.074  1.00 0.00 ? 188  VAL A CA    1 
ATOM 1469  C C     . VAL A 1  188 ? 132.540 4.159    13.834  1.00 0.00 ? 188  VAL A C     1 
ATOM 1470  O O     . VAL A 1  188 ? 133.765 4.210    13.890  1.00 0.00 ? 188  VAL A O     1 
ATOM 1471  C CB    . VAL A 1  188 ? 131.217 6.238    14.020  1.00 0.00 ? 188  VAL A CB    1 
ATOM 1472  C CG1   . VAL A 1  188 ? 132.267 6.692    15.066  1.00 0.00 ? 188  VAL A CG1   1 
ATOM 1473  C CG2   . VAL A 1  188 ? 130.755 7.415    13.140  1.00 0.00 ? 188  VAL A CG2   1 
ATOM 1474  N N     . ILE A 1  189 ? 131.828 3.158    14.403  1.00 0.00 ? 189  ILE A N     1 
ATOM 1475  C CA    . ILE A 1  189 ? 132.432 2.040    15.095  1.00 0.00 ? 189  ILE A CA    1 
ATOM 1476  C C     . ILE A 1  189 ? 133.187 1.193    14.090  1.00 0.00 ? 189  ILE A C     1 
ATOM 1477  O O     . ILE A 1  189 ? 134.169 0.536    14.432  1.00 0.00 ? 189  ILE A O     1 
ATOM 1478  C CB    . ILE A 1  189 ? 131.417 1.211    15.889  1.00 0.00 ? 189  ILE A CB    1 
ATOM 1479  C CG1   . ILE A 1  189 ? 130.334 0.580    14.976  1.00 0.00 ? 189  ILE A CG1   1 
ATOM 1480  C CG2   . ILE A 1  189 ? 130.828 2.138    16.978  1.00 0.00 ? 189  ILE A CG2   1 
ATOM 1481  C CD1   . ILE A 1  189 ? 129.186 -0.143   15.686  1.00 0.00 ? 189  ILE A CD1   1 
ATOM 1482  N N     . ALA A 1  190 ? 132.737 1.233    12.809  1.00 0.00 ? 190  ALA A N     1 
ATOM 1483  C CA    . ALA A 1  190 ? 133.356 0.591    11.683  1.00 0.00 ? 190  ALA A CA    1 
ATOM 1484  C C     . ALA A 1  190 ? 134.646 1.240    11.240  1.00 0.00 ? 190  ALA A C     1 
ATOM 1485  O O     . ALA A 1  190 ? 135.584 0.539    10.862  1.00 0.00 ? 190  ALA A O     1 
ATOM 1486  C CB    . ALA A 1  190 ? 132.411 0.529    10.471  1.00 0.00 ? 190  ALA A CB    1 
ATOM 1487  N N     . THR A 1  191 ? 134.723 2.600    11.267  1.00 0.00 ? 191  THR A N     1 
ATOM 1488  C CA    . THR A 1  191 ? 135.885 3.378    10.860  1.00 0.00 ? 191  THR A CA    1 
ATOM 1489  C C     . THR A 1  191 ? 137.032 3.063    11.769  1.00 0.00 ? 191  THR A C     1 
ATOM 1490  O O     . THR A 1  191 ? 138.161 2.864    11.324  1.00 0.00 ? 191  THR A O     1 
ATOM 1491  C CB    . THR A 1  191 ? 135.650 4.886    10.965  1.00 0.00 ? 191  THR A CB    1 
ATOM 1492  O OG1   . THR A 1  191 ? 134.622 5.280    10.075  1.00 0.00 ? 191  THR A OG1   1 
ATOM 1493  C CG2   . THR A 1  191 ? 136.921 5.701    10.631  1.00 0.00 ? 191  THR A CG2   1 
ATOM 1494  N N     . ASN A 1  192 ? 136.716 3.010    13.081  1.00 0.00 ? 192  ASN A N     1 
ATOM 1495  C CA    . ASN A 1  192 ? 137.631 2.850    14.178  1.00 0.00 ? 192  ASN A CA    1 
ATOM 1496  C C     . ASN A 1  192 ? 138.290 1.499    14.112  1.00 0.00 ? 192  ASN A C     1 
ATOM 1497  O O     . ASN A 1  192 ? 139.468 1.371    14.439  1.00 0.00 ? 192  ASN A O     1 
ATOM 1498  C CB    . ASN A 1  192 ? 136.908 2.950    15.546  1.00 0.00 ? 192  ASN A CB    1 
ATOM 1499  C CG    . ASN A 1  192 ? 136.195 4.296    15.745  1.00 0.00 ? 192  ASN A CG    1 
ATOM 1500  O OD1   . ASN A 1  192 ? 136.285 5.215    14.925  1.00 0.00 ? 192  ASN A OD1   1 
ATOM 1501  N ND2   . ASN A 1  192 ? 135.444 4.393    16.885  1.00 0.00 ? 192  ASN A ND2   1 
ATOM 1502  N N     . LEU A 1  193 ? 137.519 0.463    13.692  1.00 0.00 ? 193  LEU A N     1 
ATOM 1503  C CA    . LEU A 1  193 ? 137.950 -0.911   13.665  1.00 0.00 ? 193  LEU A CA    1 
ATOM 1504  C C     . LEU A 1  193 ? 139.073 -1.165   12.696  1.00 0.00 ? 193  LEU A C     1 
ATOM 1505  O O     . LEU A 1  193 ? 140.048 -1.801   13.084  1.00 0.00 ? 193  LEU A O     1 
ATOM 1506  C CB    . LEU A 1  193 ? 136.774 -1.868   13.340  1.00 0.00 ? 193  LEU A CB    1 
ATOM 1507  C CG    . LEU A 1  193 ? 137.080 -3.384   13.468  1.00 0.00 ? 193  LEU A CG    1 
ATOM 1508  C CD1   . LEU A 1  193 ? 137.744 -3.773   14.804  1.00 0.00 ? 193  LEU A CD1   1 
ATOM 1509  C CD2   . LEU A 1  193 ? 135.806 -4.224   13.258  1.00 0.00 ? 193  LEU A CD2   1 
ATOM 1510  N N     . VAL A 1  194 ? 138.994 -0.654   11.437  1.00 0.00 ? 194  VAL A N     1 
ATOM 1511  C CA    . VAL A 1  194 ? 140.013 -0.933   10.442  1.00 0.00 ? 194  VAL A CA    1 
ATOM 1512  C C     . VAL A 1  194 ? 141.067 0.124    10.445  1.00 0.00 ? 194  VAL A C     1 
ATOM 1513  O O     . VAL A 1  194 ? 142.160 -0.112   9.942   1.00 0.00 ? 194  VAL A O     1 
ATOM 1514  C CB    . VAL A 1  194 ? 139.450 -1.186   9.039   1.00 0.00 ? 194  VAL A CB    1 
ATOM 1515  C CG1   . VAL A 1  194 ? 140.034 -0.303   7.906   1.00 0.00 ? 194  VAL A CG1   1 
ATOM 1516  C CG2   . VAL A 1  194 ? 139.650 -2.691   8.753   1.00 0.00 ? 194  VAL A CG2   1 
ATOM 1517  N N     . ALA A 1  195 ? 140.820 1.301    11.067  1.00 0.00 ? 195  ALA A N     1 
ATOM 1518  C CA    . ALA A 1  195 ? 141.867 2.278    11.254  1.00 0.00 ? 195  ALA A CA    1 
ATOM 1519  C C     . ALA A 1  195 ? 142.897 1.713    12.193  1.00 0.00 ? 195  ALA A C     1 
ATOM 1520  O O     . ALA A 1  195 ? 144.091 1.785    11.925  1.00 0.00 ? 195  ALA A O     1 
ATOM 1521  C CB    . ALA A 1  195 ? 141.353 3.614    11.820  1.00 0.00 ? 195  ALA A CB    1 
ATOM 1522  N N     . ASP A 1  196 ? 142.429 1.078    13.291  1.00 0.00 ? 196  ASP A N     1 
ATOM 1523  C CA    . ASP A 1  196 ? 143.278 0.472    14.277  1.00 0.00 ? 196  ASP A CA    1 
ATOM 1524  C C     . ASP A 1  196 ? 143.890 -0.821   13.777  1.00 0.00 ? 196  ASP A C     1 
ATOM 1525  O O     . ASP A 1  196 ? 145.091 -1.029   13.947  1.00 0.00 ? 196  ASP A O     1 
ATOM 1526  C CB    . ASP A 1  196 ? 142.465 0.217    15.580  1.00 0.00 ? 196  ASP A CB    1 
ATOM 1527  C CG    . ASP A 1  196 ? 143.332 0.015    16.830  1.00 0.00 ? 196  ASP A CG    1 
ATOM 1528  O OD1   . ASP A 1  196 ? 144.584 -0.013   16.718  1.00 0.00 ? 196  ASP A OD1   1 
ATOM 1529  O OD2   . ASP A 1  196 ? 142.730 -0.097   17.932  1.00 0.00 ? 196  ASP A OD2   1 
ATOM 1530  N N     . THR A 1  197 ? 143.080 -1.727   13.163  1.00 0.00 ? 197  THR A N     1 
ATOM 1531  C CA    . THR A 1  197 ? 143.511 -3.092   12.931  1.00 0.00 ? 197  THR A CA    1 
ATOM 1532  C C     . THR A 1  197 ? 144.208 -3.247   11.595  1.00 0.00 ? 197  THR A C     1 
ATOM 1533  O O     . THR A 1  197 ? 145.282 -3.832   11.552  1.00 0.00 ? 197  THR A O     1 
ATOM 1534  C CB    . THR A 1  197 ? 142.415 -4.137   13.204  1.00 0.00 ? 197  THR A CB    1 
ATOM 1535  O OG1   . THR A 1  197 ? 142.972 -5.349   13.702  1.00 0.00 ? 197  THR A OG1   1 
ATOM 1536  C CG2   . THR A 1  197 ? 141.526 -4.464   11.984  1.00 0.00 ? 197  THR A CG2   1 
ATOM 1537  N N     . PHE A 1  198 ? 143.670 -2.714   10.464  1.00 0.00 ? 198  PHE A N     1 
ATOM 1538  C CA    . PHE A 1  198 ? 144.323 -2.871   9.173   1.00 0.00 ? 198  PHE A CA    1 
ATOM 1539  C C     . PHE A 1  198 ? 145.342 -1.773   9.011   1.00 0.00 ? 198  PHE A C     1 
ATOM 1540  O O     . PHE A 1  198 ? 146.501 -2.058   8.722   1.00 0.00 ? 198  PHE A O     1 
ATOM 1541  C CB    . PHE A 1  198 ? 143.319 -2.851   7.987   1.00 0.00 ? 198  PHE A CB    1 
ATOM 1542  C CG    . PHE A 1  198 ? 143.964 -3.127   6.647   1.00 0.00 ? 198  PHE A CG    1 
ATOM 1543  C CD1   . PHE A 1  198 ? 144.432 -2.067   5.848   1.00 0.00 ? 198  PHE A CD1   1 
ATOM 1544  C CD2   . PHE A 1  198 ? 144.108 -4.445   6.176   1.00 0.00 ? 198  PHE A CD2   1 
ATOM 1545  C CE1   . PHE A 1  198 ? 145.053 -2.320   4.619   1.00 0.00 ? 198  PHE A CE1   1 
ATOM 1546  C CE2   . PHE A 1  198 ? 144.719 -4.699   4.941   1.00 0.00 ? 198  PHE A CE2   1 
ATOM 1547  C CZ    . PHE A 1  198 ? 145.196 -3.636   4.164   1.00 0.00 ? 198  PHE A CZ    1 
ATOM 1548  N N     . GLY A 1  199 ? 144.912 -0.507   9.241   1.00 0.00 ? 199  GLY A N     1 
ATOM 1549  C CA    . GLY A 1  199 ? 145.678 0.720    9.271   1.00 0.00 ? 199  GLY A CA    1 
ATOM 1550  C C     . GLY A 1  199 ? 146.748 0.880    8.231   1.00 0.00 ? 199  GLY A C     1 
ATOM 1551  O O     . GLY A 1  199 ? 146.707 0.291    7.151   1.00 0.00 ? 199  GLY A O     1 
ATOM 1552  N N     . VAL A 1  200 ? 147.753 1.709    8.583   1.00 0.00 ? 200  VAL A N     1 
ATOM 1553  C CA    . VAL A 1  200 ? 148.999 1.810    7.869   1.00 0.00 ? 200  VAL A CA    1 
ATOM 1554  C C     . VAL A 1  200 ? 149.917 2.443    8.882   1.00 0.00 ? 200  VAL A C     1 
ATOM 1555  O O     . VAL A 1  200 ? 149.460 3.097    9.818   1.00 0.00 ? 200  VAL A O     1 
ATOM 1556  C CB    . VAL A 1  200 ? 148.924 2.578    6.542   1.00 0.00 ? 200  VAL A CB    1 
ATOM 1557  C CG1   . VAL A 1  200 ? 148.599 4.071    6.748   1.00 0.00 ? 200  VAL A CG1   1 
ATOM 1558  C CG2   . VAL A 1  200 ? 150.201 2.348    5.709   1.00 0.00 ? 200  VAL A CG2   1 
ATOM 1559  N N     . SER A 1  201 ? 151.242 2.228    8.742   1.00 0.00 ? 201  SER A N     1 
ATOM 1560  C CA    . SER A 1  201 ? 152.227 2.715    9.675   1.00 0.00 ? 201  SER A CA    1 
ATOM 1561  C C     . SER A 1  201 ? 153.105 3.685    8.938   1.00 0.00 ? 201  SER A C     1 
ATOM 1562  O O     . SER A 1  201 ? 153.256 3.608    7.720   1.00 0.00 ? 201  SER A O     1 
ATOM 1563  C CB    . SER A 1  201 ? 153.058 1.581    10.331  1.00 0.00 ? 201  SER A CB    1 
ATOM 1564  O OG    . SER A 1  201 ? 153.621 0.697    9.369   1.00 0.00 ? 201  SER A OG    1 
ATOM 1565  N N     . GLN A 1  202 ? 153.675 4.653    9.690   1.00 0.00 ? 202  GLN A N     1 
ATOM 1566  C CA    . GLN A 1  202 ? 154.453 5.731    9.141   1.00 0.00 ? 202  GLN A CA    1 
ATOM 1567  C C     . GLN A 1  202 ? 155.500 6.061    10.161  1.00 0.00 ? 202  GLN A C     1 
ATOM 1568  O O     . GLN A 1  202 ? 155.278 5.948    11.365  1.00 0.00 ? 202  GLN A O     1 
ATOM 1569  C CB    . GLN A 1  202 ? 153.606 6.991    8.815   1.00 0.00 ? 202  GLN A CB    1 
ATOM 1570  C CG    . GLN A 1  202 ? 152.694 7.467    9.966   1.00 0.00 ? 202  GLN A CG    1 
ATOM 1571  C CD    . GLN A 1  202 ? 151.873 8.698    9.552   1.00 0.00 ? 202  GLN A CD    1 
ATOM 1572  O OE1   . GLN A 1  202 ? 151.941 9.745    10.206  1.00 0.00 ? 202  GLN A OE1   1 
ATOM 1573  N NE2   . GLN A 1  202 ? 151.075 8.555    8.451   1.00 0.00 ? 202  GLN A NE2   1 
ATOM 1574  N N     . ILE A 1  203 ? 156.703 6.452    9.678   1.00 0.00 ? 203  ILE A N     1 
ATOM 1575  C CA    . ILE A 1  203 ? 157.860 6.653    10.517  1.00 0.00 ? 203  ILE A CA    1 
ATOM 1576  C C     . ILE A 1  203 ? 157.938 8.116    10.888  1.00 0.00 ? 203  ILE A C     1 
ATOM 1577  O O     . ILE A 1  203 ? 157.955 9.005    10.038  1.00 0.00 ? 203  ILE A O     1 
ATOM 1578  C CB    . ILE A 1  203 ? 159.157 6.134    9.896   1.00 0.00 ? 203  ILE A CB    1 
ATOM 1579  C CG1   . ILE A 1  203 ? 159.415 6.678    8.465   1.00 0.00 ? 203  ILE A CG1   1 
ATOM 1580  C CG2   . ILE A 1  203 ? 159.074 4.590    9.922   1.00 0.00 ? 203  ILE A CG2   1 
ATOM 1581  C CD1   . ILE A 1  203 ? 160.765 6.253    7.875   1.00 0.00 ? 203  ILE A CD1   1 
ATOM 1582  N N     . LYS A 1  204 ? 157.934 8.377    12.214  1.00 0.00 ? 204  LYS A N     1 
ATOM 1583  C CA    . LYS A 1  204 ? 157.977 9.702    12.774  1.00 0.00 ? 204  LYS A CA    1 
ATOM 1584  C C     . LYS A 1  204 ? 158.352 9.488    14.225  1.00 0.00 ? 204  LYS A C     1 
ATOM 1585  O O     . LYS A 1  204 ? 158.355 8.355    14.705  1.00 0.00 ? 204  LYS A O     1 
ATOM 1586  C CB    . LYS A 1  204 ? 156.610 10.433   12.667  1.00 0.00 ? 204  LYS A CB    1 
ATOM 1587  C CG    . LYS A 1  204 ? 156.657 11.969   12.765  1.00 0.00 ? 204  LYS A CG    1 
ATOM 1588  C CD    . LYS A 1  204 ? 155.404 12.609   13.397  1.00 0.00 ? 204  LYS A CD    1 
ATOM 1589  C CE    . LYS A 1  204 ? 154.133 12.637   12.529  1.00 0.00 ? 204  LYS A CE    1 
ATOM 1590  N NZ    . LYS A 1  204 ? 153.531 11.297   12.349  1.00 0.00 ? 204  LYS A NZ    1 
ATOM 1591  N N     . VAL A 1  205 ? 158.665 10.580   14.961  1.00 0.00 ? 205  VAL A N     1 
ATOM 1592  C CA    . VAL A 1  205 ? 158.808 10.579   16.400  1.00 0.00 ? 205  VAL A CA    1 
ATOM 1593  C C     . VAL A 1  205 ? 157.825 11.613   16.886  1.00 0.00 ? 205  VAL A C     1 
ATOM 1594  O O     . VAL A 1  205 ? 157.462 12.533   16.154  1.00 0.00 ? 205  VAL A O     1 
ATOM 1595  C CB    . VAL A 1  205 ? 160.213 10.890   16.908  1.00 0.00 ? 205  VAL A CB    1 
ATOM 1596  C CG1   . VAL A 1  205 ? 161.127 9.693    16.574  1.00 0.00 ? 205  VAL A CG1   1 
ATOM 1597  C CG2   . VAL A 1  205 ? 160.749 12.210   16.312  1.00 0.00 ? 205  VAL A CG2   1 
ATOM 1598  N N     . GLY A 1  206 ? 157.337 11.470   18.139  1.00 0.00 ? 206  GLY A N     1 
ATOM 1599  C CA    . GLY A 1  206 ? 156.336 12.376   18.637  1.00 0.00 ? 206  GLY A CA    1 
ATOM 1600  C C     . GLY A 1  206 ? 156.140 12.110   20.092  1.00 0.00 ? 206  GLY A C     1 
ATOM 1601  O O     . GLY A 1  206 ? 155.896 10.976   20.504  1.00 0.00 ? 206  GLY A O     1 
ATOM 1602  N N     . GLU A 1  207 ? 156.248 13.190   20.905  1.00 0.00 ? 207  GLU A N     1 
ATOM 1603  C CA    . GLU A 1  207 ? 156.017 13.186   22.332  1.00 0.00 ? 207  GLU A CA    1 
ATOM 1604  C C     . GLU A 1  207 ? 154.545 13.041   22.611  1.00 0.00 ? 207  GLU A C     1 
ATOM 1605  O O     . GLU A 1  207 ? 154.137 12.261   23.471  1.00 0.00 ? 207  GLU A O     1 
ATOM 1606  C CB    . GLU A 1  207 ? 156.510 14.487   23.007  1.00 0.00 ? 207  GLU A CB    1 
ATOM 1607  C CG    . GLU A 1  207 ? 158.026 14.711   22.851  1.00 0.00 ? 207  GLU A CG    1 
ATOM 1608  C CD    . GLU A 1  207 ? 158.426 15.998   23.570  1.00 0.00 ? 207  GLU A CD    1 
ATOM 1609  O OE1   . GLU A 1  207 ? 158.272 16.051   24.820  1.00 0.00 ? 207  GLU A OE1   1 
ATOM 1610  O OE2   . GLU A 1  207 ? 158.887 16.946   22.881  1.00 0.00 ? 207  GLU A OE2   1 
ATOM 1611  N N     . ASP A 1  208 ? 153.715 13.782   21.835  1.00 0.00 ? 208  ASP A N     1 
ATOM 1612  C CA    . ASP A 1  208 ? 152.274 13.716   21.882  1.00 0.00 ? 208  ASP A CA    1 
ATOM 1613  C C     . ASP A 1  208 ? 151.809 12.490   21.145  1.00 0.00 ? 208  ASP A C     1 
ATOM 1614  O O     . ASP A 1  208 ? 152.588 11.838   20.447  1.00 0.00 ? 208  ASP A O     1 
ATOM 1615  C CB    . ASP A 1  208 ? 151.568 14.993   21.331  1.00 0.00 ? 208  ASP A CB    1 
ATOM 1616  C CG    . ASP A 1  208 ? 151.780 15.223   19.826  1.00 0.00 ? 208  ASP A CG    1 
ATOM 1617  O OD1   . ASP A 1  208 ? 152.945 15.465   19.414  1.00 0.00 ? 208  ASP A OD1   1 
ATOM 1618  O OD2   . ASP A 1  208 ? 150.769 15.157   19.075  1.00 0.00 ? 208  ASP A OD2   1 
ATOM 1619  N N     . ASP A 1  209 ? 150.507 12.146   21.301  1.00 0.00 ? 209  ASP A N     1 
ATOM 1620  C CA    . ASP A 1  209 ? 149.918 11.011   20.640  1.00 0.00 ? 209  ASP A CA    1 
ATOM 1621  C C     . ASP A 1  209 ? 149.815 11.313   19.164  1.00 0.00 ? 209  ASP A C     1 
ATOM 1622  O O     . ASP A 1  209 ? 149.174 12.279   18.746  1.00 0.00 ? 209  ASP A O     1 
ATOM 1623  C CB    . ASP A 1  209 ? 148.525 10.627   21.210  1.00 0.00 ? 209  ASP A CB    1 
ATOM 1624  C CG    . ASP A 1  209 ? 148.101 9.238    20.718  1.00 0.00 ? 209  ASP A CG    1 
ATOM 1625  O OD1   . ASP A 1  209 ? 148.810 8.252    21.053  1.00 0.00 ? 209  ASP A OD1   1 
ATOM 1626  O OD2   . ASP A 1  209 ? 147.071 9.148    19.998  1.00 0.00 ? 209  ASP A OD2   1 
ATOM 1627  N N     . GLN A 1  210 ? 150.486 10.460   18.368  1.00 0.00 ? 210  GLN A N     1 
ATOM 1628  C CA    . GLN A 1  210 ? 150.551 10.544   16.938  1.00 0.00 ? 210  GLN A CA    1 
ATOM 1629  C C     . GLN A 1  210 ? 150.321 9.135    16.498  1.00 0.00 ? 210  GLN A C     1 
ATOM 1630  O O     . GLN A 1  210 ? 150.436 8.197    17.287  1.00 0.00 ? 210  GLN A O     1 
ATOM 1631  C CB    . GLN A 1  210 ? 151.939 10.987   16.410  1.00 0.00 ? 210  GLN A CB    1 
ATOM 1632  C CG    . GLN A 1  210 ? 152.271 12.484   16.572  1.00 0.00 ? 210  GLN A CG    1 
ATOM 1633  C CD    . GLN A 1  210 ? 151.414 13.339   15.623  1.00 0.00 ? 210  GLN A CD    1 
ATOM 1634  O OE1   . GLN A 1  210 ? 150.984 12.879   14.559  1.00 0.00 ? 210  GLN A OE1   1 
ATOM 1635  N NE2   . GLN A 1  210 ? 151.185 14.628   16.022  1.00 0.00 ? 210  GLN A NE2   1 
ATOM 1636  N N     . THR A 1  211 ? 149.962 8.967    15.207  1.00 0.00 ? 211  THR A N     1 
ATOM 1637  C CA    . THR A 1  211 ? 149.524 7.708    14.660  1.00 0.00 ? 211  THR A CA    1 
ATOM 1638  C C     . THR A 1  211 ? 150.689 7.089    13.914  1.00 0.00 ? 211  THR A C     1 
ATOM 1639  O O     . THR A 1  211 ? 150.642 6.810    12.716  1.00 0.00 ? 211  THR A O     1 
ATOM 1640  C CB    . THR A 1  211 ? 148.229 7.881    13.870  1.00 0.00 ? 211  THR A CB    1 
ATOM 1641  O OG1   . THR A 1  211 ? 147.710 6.629    13.445  1.00 0.00 ? 211  THR A OG1   1 
ATOM 1642  C CG2   . THR A 1  211 ? 148.360 8.866    12.682  1.00 0.00 ? 211  THR A CG2   1 
ATOM 1643  N N     . GLU A 1  212 ? 151.786 6.850    14.675  1.00 0.00 ? 212  GLU A N     1 
ATOM 1644  C CA    . GLU A 1  212 ? 153.022 6.247    14.234  1.00 0.00 ? 212  GLU A CA    1 
ATOM 1645  C C     . GLU A 1  212 ? 152.781 4.815    13.850  1.00 0.00 ? 212  GLU A C     1 
ATOM 1646  O O     . GLU A 1  212 ? 153.263 4.336    12.826  1.00 0.00 ? 212  GLU A O     1 
ATOM 1647  C CB    . GLU A 1  212 ? 154.113 6.241    15.345  1.00 0.00 ? 212  GLU A CB    1 
ATOM 1648  C CG    . GLU A 1  212 ? 154.167 7.478    16.269  1.00 0.00 ? 212  GLU A CG    1 
ATOM 1649  C CD    . GLU A 1  212 ? 154.585 8.753    15.540  1.00 0.00 ? 212  GLU A CD    1 
ATOM 1650  O OE1   . GLU A 1  212 ? 153.889 9.158    14.568  1.00 0.00 ? 212  GLU A OE1   1 
ATOM 1651  O OE2   . GLU A 1  212 ? 155.598 9.359    15.971  1.00 0.00 ? 212  GLU A OE2   1 
ATOM 1652  N N     . ALA A 1  213 ? 151.987 4.118    14.695  1.00 0.00 ? 213  ALA A N     1 
ATOM 1653  C CA    . ALA A 1  213 ? 151.688 2.728    14.540  1.00 0.00 ? 213  ALA A CA    1 
ATOM 1654  C C     . ALA A 1  213 ? 150.199 2.608    14.547  1.00 0.00 ? 213  ALA A C     1 
ATOM 1655  O O     . ALA A 1  213 ? 149.527 2.952    15.518  1.00 0.00 ? 213  ALA A O     1 
ATOM 1656  C CB    . ALA A 1  213 ? 152.251 1.863    15.683  1.00 0.00 ? 213  ALA A CB    1 
ATOM 1657  N N     . GLN A 1  214 ? 149.680 2.081    13.426  1.00 0.00 ? 214  GLN A N     1 
ATOM 1658  C CA    . GLN A 1  214 ? 148.346 1.577    13.290  1.00 0.00 ? 214  GLN A CA    1 
ATOM 1659  C C     . GLN A 1  214 ? 148.558 0.502    12.275  1.00 0.00 ? 214  GLN A C     1 
ATOM 1660  O O     . GLN A 1  214 ? 149.518 0.537    11.506  1.00 0.00 ? 214  GLN A O     1 
ATOM 1661  C CB    . GLN A 1  214 ? 147.287 2.583    12.780  1.00 0.00 ? 214  GLN A CB    1 
ATOM 1662  C CG    . GLN A 1  214 ? 146.548 3.299    13.928  1.00 0.00 ? 214  GLN A CG    1 
ATOM 1663  C CD    . GLN A 1  214 ? 145.426 4.189    13.377  1.00 0.00 ? 214  GLN A CD    1 
ATOM 1664  O OE1   . GLN A 1  214 ? 145.353 4.456    12.173  1.00 0.00 ? 214  GLN A OE1   1 
ATOM 1665  N NE2   . GLN A 1  214 ? 144.527 4.657    14.298  1.00 0.00 ? 214  GLN A NE2   1 
ATOM 1666  N N     . GLY A 1  215 ? 147.686 -0.524   12.295  1.00 0.00 ? 215  GLY A N     1 
ATOM 1667  C CA    . GLY A 1  215 ? 147.879 -1.688   11.478  1.00 0.00 ? 215  GLY A CA    1 
ATOM 1668  C C     . GLY A 1  215 ? 148.400 -2.788   12.328  1.00 0.00 ? 215  GLY A C     1 
ATOM 1669  O O     . GLY A 1  215 ? 149.405 -3.411   12.001  1.00 0.00 ? 215  GLY A O     1 
ATOM 1670  N N     . ALA A 1  216 ? 147.721 -3.020   13.472  1.00 0.00 ? 216  ALA A N     1 
ATOM 1671  C CA    . ALA A 1  216 ? 148.041 -4.024   14.451  1.00 0.00 ? 216  ALA A CA    1 
ATOM 1672  C C     . ALA A 1  216 ? 147.940 -5.423   13.904  1.00 0.00 ? 216  ALA A C     1 
ATOM 1673  O O     . ALA A 1  216 ? 148.765 -6.268   14.233  1.00 0.00 ? 216  ALA A O     1 
ATOM 1674  C CB    . ALA A 1  216 ? 147.092 -3.921   15.648  1.00 0.00 ? 216  ALA A CB    1 
ATOM 1675  N N     . LEU A 1  217 ? 146.922 -5.690   13.047  1.00 0.00 ? 217  LEU A N     1 
ATOM 1676  C CA    . LEU A 1  217 ? 146.691 -6.958   12.391  1.00 0.00 ? 217  LEU A CA    1 
ATOM 1677  C C     . LEU A 1  217 ? 147.826 -7.294   11.459  1.00 0.00 ? 217  LEU A C     1 
ATOM 1678  O O     . LEU A 1  217 ? 148.308 -8.422   11.451  1.00 0.00 ? 217  LEU A O     1 
ATOM 1679  C CB    . LEU A 1  217 ? 145.394 -6.922   11.541  1.00 0.00 ? 217  LEU A CB    1 
ATOM 1680  C CG    . LEU A 1  217 ? 144.878 -8.283   11.023  1.00 0.00 ? 217  LEU A CG    1 
ATOM 1681  C CD1   . LEU A 1  217 ? 144.261 -9.134   12.150  1.00 0.00 ? 217  LEU A CD1   1 
ATOM 1682  C CD2   . LEU A 1  217 ? 143.867 -8.082   9.876   1.00 0.00 ? 217  LEU A CD2   1 
ATOM 1683  N N     . ILE A 1  218 ? 148.285 -6.299   10.658  1.00 0.00 ? 218  ILE A N     1 
ATOM 1684  C CA    . ILE A 1  218 ? 149.343 -6.464   9.687   1.00 0.00 ? 218  ILE A CA    1 
ATOM 1685  C C     . ILE A 1  218 ? 150.661 -6.691   10.383  1.00 0.00 ? 218  ILE A C     1 
ATOM 1686  O O     . ILE A 1  218 ? 151.412 -7.585   10.006  1.00 0.00 ? 218  ILE A O     1 
ATOM 1687  C CB    . ILE A 1  218 ? 149.446 -5.275   8.726   1.00 0.00 ? 218  ILE A CB    1 
ATOM 1688  C CG1   . ILE A 1  218 ? 148.097 -5.096   7.980   1.00 0.00 ? 218  ILE A CG1   1 
ATOM 1689  C CG2   . ILE A 1  218 ? 150.630 -5.469   7.745   1.00 0.00 ? 218  ILE A CG2   1 
ATOM 1690  C CD1   . ILE A 1  218 ? 148.110 -4.004   6.903   1.00 0.00 ? 218  ILE A CD1   1 
ATOM 1691  N N     . ASN A 1  219 ? 150.963 -5.886   11.430  1.00 0.00 ? 219  ASN A N     1 
ATOM 1692  C CA    . ASN A 1  219 ? 152.236 -5.891   12.108  1.00 0.00 ? 219  ASN A CA    1 
ATOM 1693  C C     . ASN A 1  219 ? 152.438 -7.173   12.881  1.00 0.00 ? 219  ASN A C     1 
ATOM 1694  O O     . ASN A 1  219 ? 153.523 -7.752   12.856  1.00 0.00 ? 219  ASN A O     1 
ATOM 1695  C CB    . ASN A 1  219 ? 152.365 -4.663   13.051  1.00 0.00 ? 219  ASN A CB    1 
ATOM 1696  C CG    . ASN A 1  219 ? 153.828 -4.382   13.437  1.00 0.00 ? 219  ASN A CG    1 
ATOM 1697  O OD1   . ASN A 1  219 ? 154.754 -4.646   12.661  1.00 0.00 ? 219  ASN A OD1   1 
ATOM 1698  N ND2   . ASN A 1  219 ? 154.020 -3.806   14.661  1.00 0.00 ? 219  ASN A ND2   1 
ATOM 1699  N N     . LEU A 1  220 ? 151.370 -7.643   13.572  1.00 0.00 ? 220  LEU A N     1 
ATOM 1700  C CA    . LEU A 1  220 ? 151.394 -8.837   14.377  1.00 0.00 ? 220  LEU A CA    1 
ATOM 1701  C C     . LEU A 1  220 ? 151.504 -10.075  13.539  1.00 0.00 ? 220  LEU A C     1 
ATOM 1702  O O     . LEU A 1  220 ? 152.394 -10.890  13.766  1.00 0.00 ? 220  LEU A O     1 
ATOM 1703  C CB    . LEU A 1  220 ? 150.068 -8.986   15.162  1.00 0.00 ? 220  LEU A CB    1 
ATOM 1704  C CG    . LEU A 1  220 ? 149.909 -10.280  15.998  1.00 0.00 ? 220  LEU A CG    1 
ATOM 1705  C CD1   . LEU A 1  220 ? 150.769 -10.265  17.275  1.00 0.00 ? 220  LEU A CD1   1 
ATOM 1706  C CD2   . LEU A 1  220 ? 148.420 -10.539  16.278  1.00 0.00 ? 220  LEU A CD2   1 
ATOM 1707  N N     . ILE A 1  221 ? 150.574 -10.244  12.564  1.00 0.00 ? 221  ILE A N     1 
ATOM 1708  C CA    . ILE A 1  221 ? 150.371 -11.494  11.870  1.00 0.00 ? 221  ILE A CA    1 
ATOM 1709  C C     . ILE A 1  221 ? 151.488 -11.723  10.901  1.00 0.00 ? 221  ILE A C     1 
ATOM 1710  O O     . ILE A 1  221 ? 151.949 -12.850  10.773  1.00 0.00 ? 221  ILE A O     1 
ATOM 1711  C CB    . ILE A 1  221 ? 148.989 -11.627  11.226  1.00 0.00 ? 221  ILE A CB    1 
ATOM 1712  C CG1   . ILE A 1  221 ? 147.920 -11.573  12.352  1.00 0.00 ? 221  ILE A CG1   1 
ATOM 1713  C CG2   . ILE A 1  221 ? 148.886 -12.936  10.404  1.00 0.00 ? 221  ILE A CG2   1 
ATOM 1714  C CD1   . ILE A 1  221 ? 146.482 -11.818  11.886  1.00 0.00 ? 221  ILE A CD1   1 
ATOM 1715  N N     . GLN A 1  222 ? 151.981 -10.668  10.213  1.00 0.00 ? 222  GLN A N     1 
ATOM 1716  C CA    . GLN A 1  222 ? 153.036 -10.817  9.238   1.00 0.00 ? 222  GLN A CA    1 
ATOM 1717  C C     . GLN A 1  222 ? 154.389 -10.928  9.906   1.00 0.00 ? 222  GLN A C     1 
ATOM 1718  O O     . GLN A 1  222 ? 155.323 -11.476  9.325   1.00 0.00 ? 222  GLN A O     1 
ATOM 1719  C CB    . GLN A 1  222 ? 153.041 -9.643   8.234   1.00 0.00 ? 222  GLN A CB    1 
ATOM 1720  C CG    . GLN A 1  222 ? 153.996 -9.789   7.036   1.00 0.00 ? 222  GLN A CG    1 
ATOM 1721  C CD    . GLN A 1  222 ? 153.701 -11.054  6.217   1.00 0.00 ? 222  GLN A CD    1 
ATOM 1722  O OE1   . GLN A 1  222 ? 152.650 -11.155  5.573   1.00 0.00 ? 222  GLN A OE1   1 
ATOM 1723  N NE2   . GLN A 1  222 ? 154.664 -12.026  6.240   1.00 0.00 ? 222  GLN A NE2   1 
ATOM 1724  N N     . GLY A 1  223 ? 154.519 -10.463  11.174  1.00 0.00 ? 223  GLY A N     1 
ATOM 1725  C CA    . GLY A 1  223 ? 155.729 -10.621  11.954  1.00 0.00 ? 223  GLY A CA    1 
ATOM 1726  C C     . GLY A 1  223 ? 155.843 -12.037  12.454  1.00 0.00 ? 223  GLY A C     1 
ATOM 1727  O O     . GLY A 1  223 ? 156.925 -12.622  12.464  1.00 0.00 ? 223  GLY A O     1 
ATOM 1728  N N     . LEU A 1  224 ? 154.686 -12.615  12.857  1.00 0.00 ? 224  LEU A N     1 
ATOM 1729  C CA    . LEU A 1  224 ? 154.494 -13.981  13.285  1.00 0.00 ? 224  LEU A CA    1 
ATOM 1730  C C     . LEU A 1  224 ? 154.767 -14.933  12.145  1.00 0.00 ? 224  LEU A C     1 
ATOM 1731  O O     . LEU A 1  224 ? 155.376 -15.984  12.342  1.00 0.00 ? 224  LEU A O     1 
ATOM 1732  C CB    . LEU A 1  224 ? 153.039 -14.127  13.823  1.00 0.00 ? 224  LEU A CB    1 
ATOM 1733  C CG    . LEU A 1  224 ? 152.504 -15.509  14.290  1.00 0.00 ? 224  LEU A CG    1 
ATOM 1734  C CD1   . LEU A 1  224 ? 151.992 -16.407  13.141  1.00 0.00 ? 224  LEU A CD1   1 
ATOM 1735  C CD2   . LEU A 1  224 ? 153.450 -16.254  15.248  1.00 0.00 ? 224  LEU A CD2   1 
ATOM 1736  N N     . ARG A 1  225 ? 154.309 -14.571  10.923  1.00 0.00 ? 225  ARG A N     1 
ATOM 1737  C CA    . ARG A 1  225 ? 154.245 -15.448  9.783   1.00 0.00 ? 225  ARG A CA    1 
ATOM 1738  C C     . ARG A 1  225 ? 155.588 -15.609  9.122   1.00 0.00 ? 225  ARG A C     1 
ATOM 1739  O O     . ARG A 1  225 ? 156.142 -16.708  9.133   1.00 0.00 ? 225  ARG A O     1 
ATOM 1740  C CB    . ARG A 1  225 ? 153.240 -14.867  8.757   1.00 0.00 ? 225  ARG A CB    1 
ATOM 1741  C CG    . ARG A 1  225 ? 152.953 -15.699  7.500   1.00 0.00 ? 225  ARG A CG    1 
ATOM 1742  C CD    . ARG A 1  225 ? 151.961 -14.969  6.583   1.00 0.00 ? 225  ARG A CD    1 
ATOM 1743  N NE    . ARG A 1  225 ? 151.678 -15.815  5.379   1.00 0.00 ? 225  ARG A NE    1 
ATOM 1744  C CZ    . ARG A 1  225 ? 151.036 -15.324  4.276   1.00 0.00 ? 225  ARG A CZ    1 
ATOM 1745  N NH1   . ARG A 1  225 ? 150.661 -14.013  4.205   1.00 0.00 ? 225  ARG A NH1   1 
ATOM 1746  N NH2   . ARG A 1  225 ? 150.768 -16.155  3.226   1.00 0.00 ? 225  ARG A NH2   1 
ATOM 1747  N N     . SER A 1  226 ? 156.142 -14.519  8.534   1.00 0.00 ? 226  SER A N     1 
ATOM 1748  C CA    . SER A 1  226 ? 157.326 -14.602  7.709   1.00 0.00 ? 226  SER A CA    1 
ATOM 1749  C C     . SER A 1  226 ? 157.924 -13.216  7.657   1.00 0.00 ? 226  SER A C     1 
ATOM 1750  O O     . SER A 1  226 ? 157.926 -12.489  8.649   1.00 0.00 ? 226  SER A O     1 
ATOM 1751  C CB    . SER A 1  226 ? 157.039 -15.088  6.253   1.00 0.00 ? 226  SER A CB    1 
ATOM 1752  O OG    . SER A 1  226 ? 156.478 -16.392  6.221   1.00 0.00 ? 226  SER A OG    1 
ATOM 1753  N N     . LYS A 1  227 ? 158.457 -12.839  6.470   1.00 0.00 ? 227  LYS A N     1 
ATOM 1754  C CA    . LYS A 1  227 ? 158.954 -11.530  6.143   1.00 0.00 ? 227  LYS A CA    1 
ATOM 1755  C C     . LYS A 1  227 ? 158.174 -11.167  4.907   1.00 0.00 ? 227  LYS A C     1 
ATOM 1756  O O     . LYS A 1  227 ? 157.668 -12.042  4.205   1.00 0.00 ? 227  LYS A O     1 
ATOM 1757  C CB    . LYS A 1  227 ? 160.471 -11.526  5.824   1.00 0.00 ? 227  LYS A CB    1 
ATOM 1758  C CG    . LYS A 1  227 ? 161.134 -10.139  5.909   1.00 0.00 ? 227  LYS A CG    1 
ATOM 1759  C CD    . LYS A 1  227 ? 162.571 -10.095  5.363   1.00 0.00 ? 227  LYS A CD    1 
ATOM 1760  C CE    . LYS A 1  227 ? 162.685 -9.493   3.953   1.00 0.00 ? 227  LYS A CE    1 
ATOM 1761  N NZ    . LYS A 1  227 ? 161.890 -10.253  2.964   1.00 0.00 ? 227  LYS A NZ    1 
ATOM 1762  N N     . HIS A 1  228 ? 158.028 -9.854   4.636   1.00 0.00 ? 228  HIS A N     1 
ATOM 1763  C CA    . HIS A 1  228 ? 157.165 -9.342   3.603   1.00 0.00 ? 228  HIS A CA    1 
ATOM 1764  C C     . HIS A 1  228 ? 158.030 -8.527   2.681   1.00 0.00 ? 228  HIS A C     1 
ATOM 1765  O O     . HIS A 1  228 ? 159.226 -8.778   2.549   1.00 0.00 ? 228  HIS A O     1 
ATOM 1766  C CB    . HIS A 1  228 ? 156.072 -8.454   4.252   1.00 0.00 ? 228  HIS A CB    1 
ATOM 1767  C CG    . HIS A 1  228 ? 154.927 -8.047   3.365   1.00 0.00 ? 228  HIS A CG    1 
ATOM 1768  N ND1   . HIS A 1  228 ? 154.115 -8.928   2.685   1.00 0.00 ? 228  HIS A ND1   1 
ATOM 1769  C CD2   . HIS A 1  228 ? 154.465 -6.803   3.061   1.00 0.00 ? 228  HIS A CD2   1 
ATOM 1770  C CE1   . HIS A 1  228 ? 153.209 -8.178   2.008   1.00 0.00 ? 228  HIS A CE1   1 
ATOM 1771  N NE2   . HIS A 1  228 ? 153.383 -6.884   2.203   1.00 0.00 ? 228  HIS A NE2   1 
ATOM 1772  N N     . LYS A 1  229 ? 157.426 -7.505   2.029   1.00 0.00 ? 229  LYS A N     1 
ATOM 1773  C CA    . LYS A 1  229 ? 158.084 -6.423   1.334   1.00 0.00 ? 229  LYS A CA    1 
ATOM 1774  C C     . LYS A 1  229 ? 158.878 -5.630   2.349   1.00 0.00 ? 229  LYS A C     1 
ATOM 1775  O O     . LYS A 1  229 ? 160.037 -5.281   2.126   1.00 0.00 ? 229  LYS A O     1 
ATOM 1776  C CB    . LYS A 1  229 ? 157.011 -5.515   0.675   1.00 0.00 ? 229  LYS A CB    1 
ATOM 1777  C CG    . LYS A 1  229 ? 157.494 -4.280   -0.112  1.00 0.00 ? 229  LYS A CG    1 
ATOM 1778  C CD    . LYS A 1  229 ? 158.004 -4.541   -1.542  1.00 0.00 ? 229  LYS A CD    1 
ATOM 1779  C CE    . LYS A 1  229 ? 159.458 -5.022   -1.631  1.00 0.00 ? 229  LYS A CE    1 
ATOM 1780  N NZ    . LYS A 1  229 ? 159.910 -5.074   -3.043  1.00 0.00 ? 229  LYS A NZ    1 
ATOM 1781  N N     . THR A 1  230 ? 158.243 -5.389   3.523   1.00 0.00 ? 230  THR A N     1 
ATOM 1782  C CA    . THR A 1  230 ? 158.822 -4.824   4.721   1.00 0.00 ? 230  THR A CA    1 
ATOM 1783  C C     . THR A 1  230 ? 159.761 -5.832   5.351   1.00 0.00 ? 230  THR A C     1 
ATOM 1784  O O     . THR A 1  230 ? 159.534 -7.036   5.245   1.00 0.00 ? 230  THR A O     1 
ATOM 1785  C CB    . THR A 1  230 ? 157.755 -4.431   5.742   1.00 0.00 ? 230  THR A CB    1 
ATOM 1786  O OG1   . THR A 1  230 ? 156.609 -3.899   5.088   1.00 0.00 ? 230  THR A OG1   1 
ATOM 1787  C CG2   . THR A 1  230 ? 158.311 -3.358   6.699   1.00 0.00 ? 230  THR A CG2   1 
ATOM 1788  N N     . PHE A 1  231 ? 160.832 -5.357   6.032   1.00 0.00 ? 231  PHE A N     1 
ATOM 1789  C CA    . PHE A 1  231 ? 161.753 -6.203   6.754   1.00 0.00 ? 231  PHE A CA    1 
ATOM 1790  C C     . PHE A 1  231 ? 161.294 -6.201   8.186   1.00 0.00 ? 231  PHE A C     1 
ATOM 1791  O O     . PHE A 1  231 ? 161.474 -5.220   8.906   1.00 0.00 ? 231  PHE A O     1 
ATOM 1792  C CB    . PHE A 1  231 ? 163.220 -5.696   6.735   1.00 0.00 ? 231  PHE A CB    1 
ATOM 1793  C CG    . PHE A 1  231 ? 163.863 -5.917   5.390   1.00 0.00 ? 231  PHE A CG    1 
ATOM 1794  C CD1   . PHE A 1  231 ? 164.829 -6.927   5.226   1.00 0.00 ? 231  PHE A CD1   1 
ATOM 1795  C CD2   . PHE A 1  231 ? 163.548 -5.100   4.287   1.00 0.00 ? 231  PHE A CD2   1 
ATOM 1796  C CE1   . PHE A 1  231 ? 165.457 -7.125   3.990   1.00 0.00 ? 231  PHE A CE1   1 
ATOM 1797  C CE2   . PHE A 1  231 ? 164.168 -5.301   3.048   1.00 0.00 ? 231  PHE A CE2   1 
ATOM 1798  C CZ    . PHE A 1  231 ? 165.122 -6.314   2.899   1.00 0.00 ? 231  PHE A CZ    1 
ATOM 1799  N N     . ILE A 1  232 ? 160.687 -7.332   8.615   1.00 0.00 ? 232  ILE A N     1 
ATOM 1800  C CA    . ILE A 1  232 ? 160.186 -7.556   9.953   1.00 0.00 ? 232  ILE A CA    1 
ATOM 1801  C C     . ILE A 1  232 ? 160.375 -9.032   10.193  1.00 0.00 ? 232  ILE A C     1 
ATOM 1802  O O     . ILE A 1  232 ? 160.998 -9.729   9.394   1.00 0.00 ? 232  ILE A O     1 
ATOM 1803  C CB    . ILE A 1  232 ? 158.726 -7.154   10.206  1.00 0.00 ? 232  ILE A CB    1 
ATOM 1804  C CG1   . ILE A 1  232 ? 157.741 -7.805   9.202   1.00 0.00 ? 232  ILE A CG1   1 
ATOM 1805  C CG2   . ILE A 1  232 ? 158.629 -5.612   10.231  1.00 0.00 ? 232  ILE A CG2   1 
ATOM 1806  C CD1   . ILE A 1  232 ? 156.274 -7.533   9.544   1.00 0.00 ? 232  ILE A CD1   1 
ATOM 1807  N N     . GLY A 1  233 ? 159.864 -9.536   11.336  1.00 0.00 ? 233  GLY A N     1 
ATOM 1808  C CA    . GLY A 1  233 ? 159.996 -10.912  11.720  1.00 0.00 ? 233  GLY A CA    1 
ATOM 1809  C C     . GLY A 1  233 ? 160.129 -10.915  13.206  1.00 0.00 ? 233  GLY A C     1 
ATOM 1810  O O     . GLY A 1  233 ? 160.529 -9.918   13.808  1.00 0.00 ? 233  GLY A O     1 
ATOM 1811  N N     . GLY A 1  234 ? 159.784 -12.061  13.836  1.00 0.00 ? 234  GLY A N     1 
ATOM 1812  C CA    . GLY A 1  234 ? 159.778 -12.205  15.270  1.00 0.00 ? 234  GLY A CA    1 
ATOM 1813  C C     . GLY A 1  234 ? 158.394 -11.953  15.785  1.00 0.00 ? 234  GLY A C     1 
ATOM 1814  O O     . GLY A 1  234 ? 157.599 -11.241  15.171  1.00 0.00 ? 234  GLY A O     1 
ATOM 1815  N N     . ILE A 1  235 ? 158.081 -12.566  16.949  1.00 0.00 ? 235  ILE A N     1 
ATOM 1816  C CA    . ILE A 1  235 ? 156.752 -12.598  17.503  1.00 0.00 ? 235  ILE A CA    1 
ATOM 1817  C C     . ILE A 1  235 ? 156.778 -11.669  18.683  1.00 0.00 ? 235  ILE A C     1 
ATOM 1818  O O     . ILE A 1  235 ? 157.660 -11.759  19.536  1.00 0.00 ? 235  ILE A O     1 
ATOM 1819  C CB    . ILE A 1  235 ? 156.336 -13.994  17.977  1.00 0.00 ? 235  ILE A CB    1 
ATOM 1820  C CG1   . ILE A 1  235 ? 156.628 -15.056  16.884  1.00 0.00 ? 235  ILE A CG1   1 
ATOM 1821  C CG2   . ILE A 1  235 ? 154.841 -13.970  18.378  1.00 0.00 ? 235  ILE A CG2   1 
ATOM 1822  C CD1   . ILE A 1  235 ? 156.372 -16.499  17.335  1.00 0.00 ? 235  ILE A CD1   1 
ATOM 1823  N N     . ILE A 1  236 ? 155.779 -10.759  18.749  1.00 0.00 ? 236  ILE A N     1 
ATOM 1824  C CA    . ILE A 1  236 ? 155.521 -9.938   19.903  1.00 0.00 ? 236  ILE A CA    1 
ATOM 1825  C C     . ILE A 1  236 ? 154.170 -10.420  20.352  1.00 0.00 ? 236  ILE A C     1 
ATOM 1826  O O     . ILE A 1  236 ? 153.168 -10.274  19.653  1.00 0.00 ? 236  ILE A O     1 
ATOM 1827  C CB    . ILE A 1  236 ? 155.578 -8.431   19.637  1.00 0.00 ? 236  ILE A CB    1 
ATOM 1828  C CG1   . ILE A 1  236 ? 155.132 -7.628   20.886  1.00 0.00 ? 236  ILE A CG1   1 
ATOM 1829  C CG2   . ILE A 1  236 ? 154.825 -8.033   18.342  1.00 0.00 ? 236  ILE A CG2   1 
ATOM 1830  C CD1   . ILE A 1  236 ? 155.408 -6.124   20.798  1.00 0.00 ? 236  ILE A CD1   1 
ATOM 1831  N N     . SER A 1  237 ? 154.135 -11.084  21.532  1.00 0.00 ? 237  SER A N     1 
ATOM 1832  C CA    . SER A 1  237 ? 152.959 -11.783  21.985  1.00 0.00 ? 237  SER A CA    1 
ATOM 1833  C C     . SER A 1  237 ? 152.182 -10.881  22.903  1.00 0.00 ? 237  SER A C     1 
ATOM 1834  O O     . SER A 1  237 ? 151.068 -10.488  22.574  1.00 0.00 ? 237  SER A O     1 
ATOM 1835  C CB    . SER A 1  237 ? 153.295 -13.136  22.669  1.00 0.00 ? 237  SER A CB    1 
ATOM 1836  O OG    . SER A 1  237 ? 154.308 -13.021  23.663  1.00 0.00 ? 237  SER A OG    1 
ATOM 1837  N N     . ALA A 1  238 ? 152.754 -10.484  24.059  1.00 0.00 ? 238  ALA A N     1 
ATOM 1838  C CA    . ALA A 1  238 ? 152.051 -9.614   24.962  1.00 0.00 ? 238  ALA A CA    1 
ATOM 1839  C C     . ALA A 1  238 ? 153.065 -8.991   25.859  1.00 0.00 ? 238  ALA A C     1 
ATOM 1840  O O     . ALA A 1  238 ? 154.124 -9.565   26.107  1.00 0.00 ? 238  ALA A O     1 
ATOM 1841  C CB    . ALA A 1  238 ? 151.004 -10.336  25.838  1.00 0.00 ? 238  ALA A CB    1 
ATOM 1842  N N     . PHE A 1  239 ? 152.727 -7.789   26.370  1.00 0.00 ? 239  PHE A N     1 
ATOM 1843  C CA    . PHE A 1  239 ? 153.575 -7.023   27.238  1.00 0.00 ? 239  PHE A CA    1 
ATOM 1844  C C     . PHE A 1  239 ? 152.668 -6.068   27.955  1.00 0.00 ? 239  PHE A C     1 
ATOM 1845  O O     . PHE A 1  239 ? 151.497 -5.908   27.610  1.00 0.00 ? 239  PHE A O     1 
ATOM 1846  C CB    . PHE A 1  239 ? 154.644 -6.165   26.499  1.00 0.00 ? 239  PHE A CB    1 
ATOM 1847  C CG    . PHE A 1  239 ? 155.797 -6.985   25.989  1.00 0.00 ? 239  PHE A CG    1 
ATOM 1848  C CD1   . PHE A 1  239 ? 156.620 -7.687   26.890  1.00 0.00 ? 239  PHE A CD1   1 
ATOM 1849  C CD2   . PHE A 1  239 ? 156.103 -7.028   24.617  1.00 0.00 ? 239  PHE A CD2   1 
ATOM 1850  C CE1   . PHE A 1  239 ? 157.711 -8.431   26.428  1.00 0.00 ? 239  PHE A CE1   1 
ATOM 1851  C CE2   . PHE A 1  239 ? 157.202 -7.764   24.155  1.00 0.00 ? 239  PHE A CE2   1 
ATOM 1852  C CZ    . PHE A 1  239 ? 158.002 -8.470   25.059  1.00 0.00 ? 239  PHE A CZ    1 
ATOM 1853  N N     . ASN A 1  240 ? 153.230 -5.400   28.989  1.00 0.00 ? 240  ASN A N     1 
ATOM 1854  C CA    . ASN A 1  240 ? 152.596 -4.326   29.719  1.00 0.00 ? 240  ASN A CA    1 
ATOM 1855  C C     . ASN A 1  240 ? 153.185 -3.023   29.213  1.00 0.00 ? 240  ASN A C     1 
ATOM 1856  O O     . ASN A 1  240 ? 152.772 -1.944   29.636  1.00 0.00 ? 240  ASN A O     1 
ATOM 1857  C CB    . ASN A 1  240 ? 152.917 -4.387   31.239  1.00 0.00 ? 240  ASN A CB    1 
ATOM 1858  C CG    . ASN A 1  240 ? 152.358 -5.652   31.911  1.00 0.00 ? 240  ASN A CG    1 
ATOM 1859  O OD1   . ASN A 1  240 ? 151.428 -6.302   31.419  1.00 0.00 ? 240  ASN A OD1   1 
ATOM 1860  N ND2   . ASN A 1  240 ? 152.959 -5.981   33.098  1.00 0.00 ? 240  ASN A ND2   1 
ATOM 1861  N N     . ARG A 1  241 ? 154.167 -3.124   28.281  1.00 0.00 ? 241  ARG A N     1 
ATOM 1862  C CA    . ARG A 1  241 ? 154.955 -2.067   27.692  1.00 0.00 ? 241  ARG A CA    1 
ATOM 1863  C C     . ARG A 1  241 ? 154.181 -0.965   27.034  1.00 0.00 ? 241  ARG A C     1 
ATOM 1864  O O     . ARG A 1  241 ? 153.049 -1.138   26.580  1.00 0.00 ? 241  ARG A O     1 
ATOM 1865  C CB    . ARG A 1  241 ? 155.945 -2.613   26.640  1.00 0.00 ? 241  ARG A CB    1 
ATOM 1866  C CG    . ARG A 1  241 ? 157.117 -3.378   27.274  1.00 0.00 ? 241  ARG A CG    1 
ATOM 1867  C CD    . ARG A 1  241 ? 158.457 -2.635   27.175  1.00 0.00 ? 241  ARG A CD    1 
ATOM 1868  N NE    . ARG A 1  241 ? 158.384 -1.320   27.904  1.00 0.00 ? 241  ARG A NE    1 
ATOM 1869  C CZ    . ARG A 1  241 ? 159.085 -1.054   29.048  1.00 0.00 ? 241  ARG A CZ    1 
ATOM 1870  N NH1   . ARG A 1  241 ? 159.846 -2.014   29.651  1.00 0.00 ? 241  ARG A NH1   1 
ATOM 1871  N NH2   . ARG A 1  241 ? 159.039 0.199    29.586  1.00 0.00 ? 241  ARG A NH2   1 
ATOM 1872  N N     . ASP A 1  242 ? 154.859 0.207    26.970  1.00 0.00 ? 242  ASP A N     1 
ATOM 1873  C CA    . ASP A 1  242 ? 154.465 1.400    26.265  1.00 0.00 ? 242  ASP A CA    1 
ATOM 1874  C C     . ASP A 1  242 ? 154.369 1.155    24.780  1.00 0.00 ? 242  ASP A C     1 
ATOM 1875  O O     . ASP A 1  242 ? 153.423 1.630    24.153  1.00 0.00 ? 242  ASP A O     1 
ATOM 1876  C CB    . ASP A 1  242 ? 155.394 2.614    26.560  1.00 0.00 ? 242  ASP A CB    1 
ATOM 1877  C CG    . ASP A 1  242 ? 156.872 2.223    26.709  1.00 0.00 ? 242  ASP A CG    1 
ATOM 1878  O OD1   . ASP A 1  242 ? 157.490 1.789    25.701  1.00 0.00 ? 242  ASP A OD1   1 
ATOM 1879  O OD2   . ASP A 1  242 ? 157.396 2.355    27.846  1.00 0.00 ? 242  ASP A OD2   1 
ATOM 1880  N N     . TYR A 1  243 ? 155.316 0.378    24.179  1.00 0.00 ? 243  TYR A N     1 
ATOM 1881  C CA    . TYR A 1  243 ? 155.158 -0.078   22.815  1.00 0.00 ? 243  TYR A CA    1 
ATOM 1882  C C     . TYR A 1  243 ? 154.081 -1.132   22.797  1.00 0.00 ? 243  TYR A C     1 
ATOM 1883  O O     . TYR A 1  243 ? 154.086 -2.062   23.604  1.00 0.00 ? 243  TYR A O     1 
ATOM 1884  C CB    . TYR A 1  243 ? 156.445 -0.504   22.049  1.00 0.00 ? 243  TYR A CB    1 
ATOM 1885  C CG    . TYR A 1  243 ? 157.283 -1.600   22.667  1.00 0.00 ? 243  TYR A CG    1 
ATOM 1886  C CD1   . TYR A 1  243 ? 158.541 -1.298   23.220  1.00 0.00 ? 243  TYR A CD1   1 
ATOM 1887  C CD2   . TYR A 1  243 ? 156.898 -2.950   22.566  1.00 0.00 ? 243  TYR A CD2   1 
ATOM 1888  C CE1   . TYR A 1  243 ? 159.397 -2.319   23.652  1.00 0.00 ? 243  TYR A CE1   1 
ATOM 1889  C CE2   . TYR A 1  243 ? 157.737 -3.971   23.028  1.00 0.00 ? 243  TYR A CE2   1 
ATOM 1890  C CZ    . TYR A 1  243 ? 158.989 -3.658   23.571  1.00 0.00 ? 243  TYR A CZ    1 
ATOM 1891  O OH    . TYR A 1  243 ? 159.837 -4.688   24.035  1.00 0.00 ? 243  TYR A OH    1 
ATOM 1892  N N     . LEU A 1  244 ? 153.078 -0.939   21.908  1.00 0.00 ? 244  LEU A N     1 
ATOM 1893  C CA    . LEU A 1  244 ? 151.857 -1.706   21.907  1.00 0.00 ? 244  LEU A CA    1 
ATOM 1894  C C     . LEU A 1  244 ? 152.119 -3.151   21.523  1.00 0.00 ? 244  LEU A C     1 
ATOM 1895  O O     . LEU A 1  244 ? 152.941 -3.378   20.634  1.00 0.00 ? 244  LEU A O     1 
ATOM 1896  C CB    . LEU A 1  244 ? 150.772 -1.097   20.991  1.00 0.00 ? 244  LEU A CB    1 
ATOM 1897  C CG    . LEU A 1  244 ? 150.415 0.373    21.343  1.00 0.00 ? 244  LEU A CG    1 
ATOM 1898  C CD1   . LEU A 1  244 ? 149.414 0.956    20.326  1.00 0.00 ? 244  LEU A CD1   1 
ATOM 1899  C CD2   . LEU A 1  244 ? 149.890 0.556    22.785  1.00 0.00 ? 244  LEU A CD2   1 
ATOM 1900  N N     . PRO A 1  245 ? 151.477 -4.151   22.140  1.00 0.00 ? 245  PRO A N     1 
ATOM 1901  C CA    . PRO A 1  245 ? 151.702 -5.553   21.828  1.00 0.00 ? 245  PRO A CA    1 
ATOM 1902  C C     . PRO A 1  245 ? 151.345 -5.956   20.425  1.00 0.00 ? 245  PRO A C     1 
ATOM 1903  O O     . PRO A 1  245 ? 151.954 -6.903   19.933  1.00 0.00 ? 245  PRO A O     1 
ATOM 1904  C CB    . PRO A 1  245 ? 150.807 -6.307   22.814  1.00 0.00 ? 245  PRO A CB    1 
ATOM 1905  C CG    . PRO A 1  245 ? 150.835 -5.426   24.061  1.00 0.00 ? 245  PRO A CG    1 
ATOM 1906  C CD    . PRO A 1  245 ? 150.873 -4.013   23.472  1.00 0.00 ? 245  PRO A CD    1 
ATOM 1907  N N     . ASN A 1  246 ? 150.321 -5.298   19.818  1.00 0.00 ? 246  ASN A N     1 
ATOM 1908  C CA    . ASN A 1  246 ? 149.779 -5.553   18.495  1.00 0.00 ? 246  ASN A CA    1 
ATOM 1909  C C     . ASN A 1  246 ? 148.786 -6.688   18.530  1.00 0.00 ? 246  ASN A C     1 
ATOM 1910  O O     . ASN A 1  246 ? 147.841 -6.710   17.744  1.00 0.00 ? 246  ASN A O     1 
ATOM 1911  C CB    . ASN A 1  246 ? 150.803 -5.801   17.353  1.00 0.00 ? 246  ASN A CB    1 
ATOM 1912  C CG    . ASN A 1  246 ? 151.755 -4.605   17.236  1.00 0.00 ? 246  ASN A CG    1 
ATOM 1913  O OD1   . ASN A 1  246 ? 151.345 -3.522   16.802  1.00 0.00 ? 246  ASN A OD1   1 
ATOM 1914  N ND2   . ASN A 1  246 ? 153.046 -4.817   17.634  1.00 0.00 ? 246  ASN A ND2   1 
ATOM 1915  N N     . LEU A 1  247 ? 148.961 -7.645   19.473  1.00 0.00 ? 247  LEU A N     1 
ATOM 1916  C CA    . LEU A 1  247 ? 148.049 -8.732   19.720  1.00 0.00 ? 247  LEU A CA    1 
ATOM 1917  C C     . LEU A 1  247 ? 146.912 -8.236   20.559  1.00 0.00 ? 247  LEU A C     1 
ATOM 1918  O O     . LEU A 1  247 ? 145.825 -8.809   20.525  1.00 0.00 ? 247  LEU A O     1 
ATOM 1919  C CB    . LEU A 1  247 ? 148.743 -9.870   20.510  1.00 0.00 ? 247  LEU A CB    1 
ATOM 1920  C CG    . LEU A 1  247 ? 147.912 -11.162  20.726  1.00 0.00 ? 247  LEU A CG    1 
ATOM 1921  C CD1   . LEU A 1  247 ? 147.567 -11.883  19.413  1.00 0.00 ? 247  LEU A CD1   1 
ATOM 1922  C CD2   . LEU A 1  247 ? 148.603 -12.137  21.696  1.00 0.00 ? 247  LEU A CD2   1 
ATOM 1923  N N     . THR A 1  248 ? 147.140 -7.142   21.334  1.00 0.00 ? 248  THR A N     1 
ATOM 1924  C CA    . THR A 1  248 ? 146.196 -6.665   22.313  1.00 0.00 ? 248  THR A CA    1 
ATOM 1925  C C     . THR A 1  248 ? 144.915 -6.212   21.658  1.00 0.00 ? 248  THR A C     1 
ATOM 1926  O O     . THR A 1  248 ? 143.854 -6.624   22.109  1.00 0.00 ? 248  THR A O     1 
ATOM 1927  C CB    . THR A 1  248 ? 146.776 -5.615   23.267  1.00 0.00 ? 248  THR A CB    1 
ATOM 1928  O OG1   . THR A 1  248 ? 145.904 -5.367   24.367  1.00 0.00 ? 248  THR A OG1   1 
ATOM 1929  C CG2   . THR A 1  248 ? 147.148 -4.283   22.578  1.00 0.00 ? 248  THR A CG2   1 
ATOM 1930  N N     . THR A 1  249 ? 144.970 -5.422   20.552  1.00 0.00 ? 249  THR A N     1 
ATOM 1931  C CA    . THR A 1  249 ? 143.764 -4.904   19.941  1.00 0.00 ? 249  THR A CA    1 
ATOM 1932  C C     . THR A 1  249 ? 143.139 -5.935   19.026  1.00 0.00 ? 249  THR A C     1 
ATOM 1933  O O     . THR A 1  249 ? 141.939 -5.877   18.772  1.00 0.00 ? 249  THR A O     1 
ATOM 1934  C CB    . THR A 1  249 ? 143.944 -3.556   19.244  1.00 0.00 ? 249  THR A CB    1 
ATOM 1935  O OG1   . THR A 1  249 ? 142.687 -2.972   18.912  1.00 0.00 ? 249  THR A OG1   1 
ATOM 1936  C CG2   . THR A 1  249 ? 144.814 -3.686   17.983  1.00 0.00 ? 249  THR A CG2   1 
ATOM 1937  N N     . THR A 1  250 ? 143.932 -6.918   18.531  1.00 0.00 ? 250  THR A N     1 
ATOM 1938  C CA    . THR A 1  250 ? 143.463 -7.943   17.625  1.00 0.00 ? 250  THR A CA    1 
ATOM 1939  C C     . THR A 1  250 ? 142.580 -8.931   18.355  1.00 0.00 ? 250  THR A C     1 
ATOM 1940  O O     . THR A 1  250 ? 141.527 -9.313   17.845  1.00 0.00 ? 250  THR A O     1 
ATOM 1941  C CB    . THR A 1  250 ? 144.614 -8.660   16.932  1.00 0.00 ? 250  THR A CB    1 
ATOM 1942  O OG1   . THR A 1  250 ? 145.429 -7.707   16.258  1.00 0.00 ? 250  THR A OG1   1 
ATOM 1943  C CG2   . THR A 1  250 ? 144.088 -9.674   15.892  1.00 0.00 ? 250  THR A CG2   1 
ATOM 1944  N N     . ILE A 1  251 ? 142.986 -9.355   19.580  1.00 0.00 ? 251  ILE A N     1 
ATOM 1945  C CA    . ILE A 1  251 ? 142.232 -10.287  20.390  1.00 0.00 ? 251  ILE A CA    1 
ATOM 1946  C C     . ILE A 1  251 ? 140.997 -9.640   20.947  1.00 0.00 ? 251  ILE A C     1 
ATOM 1947  O O     . ILE A 1  251 ? 139.945 -10.265  20.922  1.00 0.00 ? 251  ILE A O     1 
ATOM 1948  C CB    . ILE A 1  251 ? 143.051 -10.936  21.511  1.00 0.00 ? 251  ILE A CB    1 
ATOM 1949  C CG1   . ILE A 1  251 ? 144.078 -11.898  20.863  1.00 0.00 ? 251  ILE A CG1   1 
ATOM 1950  C CG2   . ILE A 1  251 ? 142.145 -11.683  22.525  1.00 0.00 ? 251  ILE A CG2   1 
ATOM 1951  C CD1   . ILE A 1  251 ? 144.891 -12.728  21.862  1.00 0.00 ? 251  ILE A CD1   1 
ATOM 1952  N N     . ILE A 1  252 ? 141.079 -8.392   21.472  1.00 0.00 ? 252  ILE A N     1 
ATOM 1953  C CA    . ILE A 1  252 ? 139.983 -7.795   22.213  1.00 0.00 ? 252  ILE A CA    1 
ATOM 1954  C C     . ILE A 1  252 ? 138.799 -7.462   21.344  1.00 0.00 ? 252  ILE A C     1 
ATOM 1955  O O     . ILE A 1  252 ? 137.675 -7.567   21.817  1.00 0.00 ? 252  ILE A O     1 
ATOM 1956  C CB    . ILE A 1  252 ? 140.363 -6.611   23.093  1.00 0.00 ? 252  ILE A CB    1 
ATOM 1957  C CG1   . ILE A 1  252 ? 140.883 -5.418   22.256  1.00 0.00 ? 252  ILE A CG1   1 
ATOM 1958  C CG2   . ILE A 1  252 ? 141.346 -7.145   24.161  1.00 0.00 ? 252  ILE A CG2   1 
ATOM 1959  C CD1   . ILE A 1  252 ? 141.722 -4.395   23.029  1.00 0.00 ? 252  ILE A CD1   1 
ATOM 1960  N N     . VAL A 1  253 ? 138.997 -7.082   20.053  1.00 0.00 ? 253  VAL A N     1 
ATOM 1961  C CA    . VAL A 1  253 ? 137.897 -6.839   19.137  1.00 0.00 ? 253  VAL A CA    1 
ATOM 1962  C C     . VAL A 1  253 ? 137.157 -8.115   18.819  1.00 0.00 ? 253  VAL A C     1 
ATOM 1963  O O     . VAL A 1  253 ? 135.934 -8.101   18.708  1.00 0.00 ? 253  VAL A O     1 
ATOM 1964  C CB    . VAL A 1  253 ? 138.265 -6.105   17.852  1.00 0.00 ? 253  VAL A CB    1 
ATOM 1965  C CG1   . VAL A 1  253 ? 138.770 -4.703   18.241  1.00 0.00 ? 253  VAL A CG1   1 
ATOM 1966  C CG2   . VAL A 1  253 ? 139.285 -6.881   16.992  1.00 0.00 ? 253  VAL A CG2   1 
ATOM 1967  N N     . LEU A 1  254 ? 137.893 -9.247   18.682  1.00 0.00 ? 254  LEU A N     1 
ATOM 1968  C CA    . LEU A 1  254 ? 137.351 -10.560  18.433  1.00 0.00 ? 254  LEU A CA    1 
ATOM 1969  C C     . LEU A 1  254 ? 136.643 -11.096  19.653  1.00 0.00 ? 254  LEU A C     1 
ATOM 1970  O O     . LEU A 1  254 ? 135.614 -11.751  19.534  1.00 0.00 ? 254  LEU A O     1 
ATOM 1971  C CB    . LEU A 1  254 ? 138.459 -11.552  18.001  1.00 0.00 ? 254  LEU A CB    1 
ATOM 1972  C CG    . LEU A 1  254 ? 137.976 -12.964  17.585  1.00 0.00 ? 254  LEU A CG    1 
ATOM 1973  C CD1   . LEU A 1  254 ? 136.962 -12.946  16.422  1.00 0.00 ? 254  LEU A CD1   1 
ATOM 1974  C CD2   . LEU A 1  254 ? 139.173 -13.874  17.251  1.00 0.00 ? 254  LEU A CD2   1 
ATOM 1975  N N     . ALA A 1  255 ? 137.192 -10.827  20.862  1.00 0.00 ? 255  ALA A N     1 
ATOM 1976  C CA    . ALA A 1  255 ? 136.690 -11.281  22.138  1.00 0.00 ? 255  ALA A CA    1 
ATOM 1977  C C     . ALA A 1  255 ? 135.365 -10.655  22.447  1.00 0.00 ? 255  ALA A C     1 
ATOM 1978  O O     . ALA A 1  255 ? 134.455 -11.331  22.922  1.00 0.00 ? 255  ALA A O     1 
ATOM 1979  C CB    . ALA A 1  255 ? 137.648 -10.948  23.299  1.00 0.00 ? 255  ALA A CB    1 
ATOM 1980  N N     . ILE A 1  256 ? 135.235 -9.338   22.145  1.00 0.00 ? 256  ILE A N     1 
ATOM 1981  C CA    . ILE A 1  256 ? 134.011 -8.580   22.244  1.00 0.00 ? 256  ILE A CA    1 
ATOM 1982  C C     . ILE A 1  256 ? 133.026 -9.148   21.264  1.00 0.00 ? 256  ILE A C     1 
ATOM 1983  O O     . ILE A 1  256 ? 131.887 -9.423   21.629  1.00 0.00 ? 256  ILE A O     1 
ATOM 1984  C CB    . ILE A 1  256 ? 134.244 -7.099   21.933  1.00 0.00 ? 256  ILE A CB    1 
ATOM 1985  C CG1   . ILE A 1  256 ? 135.013 -6.437   23.099  1.00 0.00 ? 256  ILE A CG1   1 
ATOM 1986  C CG2   . ILE A 1  256 ? 132.914 -6.356   21.669  1.00 0.00 ? 256  ILE A CG2   1 
ATOM 1987  C CD1   . ILE A 1  256 ? 135.563 -5.047   22.759  1.00 0.00 ? 256  ILE A CD1   1 
ATOM 1988  N N     . ALA A 1  257 ? 133.476 -9.376   20.005  1.00 0.00 ? 257  ALA A N     1 
ATOM 1989  C CA    . ALA A 1  257 ? 132.631 -9.753   18.903  1.00 0.00 ? 257  ALA A CA    1 
ATOM 1990  C C     . ALA A 1  257 ? 131.962 -11.070  19.135  1.00 0.00 ? 257  ALA A C     1 
ATOM 1991  O O     . ALA A 1  257 ? 130.783 -11.196  18.852  1.00 0.00 ? 257  ALA A O     1 
ATOM 1992  C CB    . ALA A 1  257 ? 133.382 -9.831   17.561  1.00 0.00 ? 257  ALA A CB    1 
ATOM 1993  N N     . ILE A 1  258 ? 132.673 -12.084  19.671  1.00 0.00 ? 258  ILE A N     1 
ATOM 1994  C CA    . ILE A 1  258 ? 132.112 -13.396  19.891  1.00 0.00 ? 258  ILE A CA    1 
ATOM 1995  C C     . ILE A 1  258 ? 131.089 -13.372  21.007  1.00 0.00 ? 258  ILE A C     1 
ATOM 1996  O O     . ILE A 1  258 ? 130.009 -13.937  20.842  1.00 0.00 ? 258  ILE A O     1 
ATOM 1997  C CB    . ILE A 1  258 ? 133.203 -14.441  20.129  1.00 0.00 ? 258  ILE A CB    1 
ATOM 1998  C CG1   . ILE A 1  258 ? 134.021 -14.611  18.820  1.00 0.00 ? 258  ILE A CG1   1 
ATOM 1999  C CG2   . ILE A 1  258 ? 132.601 -15.790  20.593  1.00 0.00 ? 258  ILE A CG2   1 
ATOM 2000  C CD1   . ILE A 1  258 ? 135.273 -15.482  18.967  1.00 0.00 ? 258  ILE A CD1   1 
ATOM 2001  N N     . ILE A 1  259 ? 131.387 -12.718  22.164  1.00 0.00 ? 259  ILE A N     1 
ATOM 2002  C CA    . ILE A 1  259 ? 130.534 -12.839  23.331  1.00 0.00 ? 259  ILE A CA    1 
ATOM 2003  C C     . ILE A 1  259 ? 129.247 -12.057  23.233  1.00 0.00 ? 259  ILE A C     1 
ATOM 2004  O O     . ILE A 1  259 ? 128.208 -12.581  23.633  1.00 0.00 ? 259  ILE A O     1 
ATOM 2005  C CB    . ILE A 1  259 ? 131.200 -12.640  24.691  1.00 0.00 ? 259  ILE A CB    1 
ATOM 2006  C CG1   . ILE A 1  259 ? 131.602 -11.182  25.026  1.00 0.00 ? 259  ILE A CG1   1 
ATOM 2007  C CG2   . ILE A 1  259 ? 132.378 -13.637  24.784  1.00 0.00 ? 259  ILE A CG2   1 
ATOM 2008  C CD1   . ILE A 1  259 ? 131.993 -11.001  26.497  1.00 0.00 ? 259  ILE A CD1   1 
ATOM 2009  N N     . VAL A 1  260 ? 129.254 -10.805  22.690  1.00 0.00 ? 260  VAL A N     1 
ATOM 2010  C CA    . VAL A 1  260 ? 128.029 -10.037  22.584  1.00 0.00 ? 260  VAL A CA    1 
ATOM 2011  C C     . VAL A 1  260 ? 127.287 -10.434  21.338  1.00 0.00 ? 260  VAL A C     1 
ATOM 2012  O O     . VAL A 1  260 ? 126.074 -10.273  21.286  1.00 0.00 ? 260  VAL A O     1 
ATOM 2013  C CB    . VAL A 1  260 ? 128.180 -8.515   22.660  1.00 0.00 ? 260  VAL A CB    1 
ATOM 2014  C CG1   . VAL A 1  260 ? 129.080 -7.968   21.536  1.00 0.00 ? 260  VAL A CG1   1 
ATOM 2015  C CG2   . VAL A 1  260 ? 126.786 -7.835   22.670  1.00 0.00 ? 260  VAL A CG2   1 
ATOM 2016  N N     . CYS A 1  261 ? 127.958 -11.029  20.316  1.00 0.00 ? 261  CYS A N     1 
ATOM 2017  C CA    . CYS A 1  261 ? 127.246 -11.462  19.134  1.00 0.00 ? 261  CYS A CA    1 
ATOM 2018  C C     . CYS A 1  261 ? 126.548 -12.765  19.395  1.00 0.00 ? 261  CYS A C     1 
ATOM 2019  O O     . CYS A 1  261 ? 125.643 -13.128  18.645  1.00 0.00 ? 261  CYS A O     1 
ATOM 2020  C CB    . CYS A 1  261 ? 128.090 -11.537  17.840  1.00 0.00 ? 261  CYS A CB    1 
ATOM 2021  S SG    . CYS A 1  261 ? 127.134 -11.479  16.294  1.00 0.00 ? 261  CYS A SG    1 
ATOM 2022  N N     . TYR A 1  262 ? 126.907 -13.469  20.502  1.00 0.00 ? 262  TYR A N     1 
ATOM 2023  C CA    . TYR A 1  262 ? 126.137 -14.605  20.927  1.00 0.00 ? 262  TYR A CA    1 
ATOM 2024  C C     . TYR A 1  262 ? 125.053 -14.170  21.891  1.00 0.00 ? 262  TYR A C     1 
ATOM 2025  O O     . TYR A 1  262 ? 124.011 -14.812  21.934  1.00 0.00 ? 262  TYR A O     1 
ATOM 2026  C CB    . TYR A 1  262 ? 126.976 -15.772  21.532  1.00 0.00 ? 262  TYR A CB    1 
ATOM 2027  C CG    . TYR A 1  262 ? 126.147 -17.013  21.320  1.00 0.00 ? 262  TYR A CG    1 
ATOM 2028  C CD1   . TYR A 1  262 ? 126.012 -17.504  20.009  1.00 0.00 ? 262  TYR A CD1   1 
ATOM 2029  C CD2   . TYR A 1  262 ? 125.245 -17.439  22.309  1.00 0.00 ? 262  TYR A CD2   1 
ATOM 2030  C CE1   . TYR A 1  262 ? 124.900 -18.274  19.656  1.00 0.00 ? 262  TYR A CE1   1 
ATOM 2031  C CE2   . TYR A 1  262 ? 124.125 -18.198  21.953  1.00 0.00 ? 262  TYR A CE2   1 
ATOM 2032  C CZ    . TYR A 1  262 ? 123.926 -18.576  20.615  1.00 0.00 ? 262  TYR A CZ    1 
ATOM 2033  O OH    . TYR A 1  262 ? 122.739 -19.221  20.206  1.00 0.00 ? 262  TYR A OH    1 
ATOM 2034  N N     . LEU A 1  263 ? 125.219 -13.048  22.642  1.00 0.00 ? 263  LEU A N     1 
ATOM 2035  C CA    . LEU A 1  263 ? 124.186 -12.498  23.513  1.00 0.00 ? 263  LEU A CA    1 
ATOM 2036  C C     . LEU A 1  263 ? 123.044 -11.962  22.681  1.00 0.00 ? 263  LEU A C     1 
ATOM 2037  O O     . LEU A 1  263 ? 121.879 -11.990  23.065  1.00 0.00 ? 263  LEU A O     1 
ATOM 2038  C CB    . LEU A 1  263 ? 124.707 -11.339  24.400  1.00 0.00 ? 263  LEU A CB    1 
ATOM 2039  C CG    . LEU A 1  263 ? 123.665 -10.732  25.377  1.00 0.00 ? 263  LEU A CG    1 
ATOM 2040  C CD1   . LEU A 1  263 ? 123.194 -11.720  26.463  1.00 0.00 ? 263  LEU A CD1   1 
ATOM 2041  C CD2   . LEU A 1  263 ? 124.182 -9.414   25.977  1.00 0.00 ? 263  LEU A CD2   1 
ATOM 2042  N N     . GLN A 1  264 ? 123.403 -11.476  21.485  1.00 0.00 ? 264  GLN A N     1 
ATOM 2043  C CA    . GLN A 1  264 ? 122.580 -10.944  20.439  1.00 0.00 ? 264  GLN A CA    1 
ATOM 2044  C C     . GLN A 1  264 ? 121.816 -12.053  19.755  1.00 0.00 ? 264  GLN A C     1 
ATOM 2045  O O     . GLN A 1  264 ? 120.762 -11.815  19.167  1.00 0.00 ? 264  GLN A O     1 
ATOM 2046  C CB    . GLN A 1  264 ? 123.609 -10.303  19.496  1.00 0.00 ? 264  GLN A CB    1 
ATOM 2047  C CG    . GLN A 1  264 ? 123.206 -9.857   18.095  1.00 0.00 ? 264  GLN A CG    1 
ATOM 2048  C CD    . GLN A 1  264 ? 124.462 -9.377   17.340  1.00 0.00 ? 264  GLN A CD    1 
ATOM 2049  O OE1   . GLN A 1  264 ? 124.592 -9.575   16.128  1.00 0.00 ? 264  GLN A OE1   1 
ATOM 2050  N NE2   . GLN A 1  264 ? 125.419 -8.732   18.070  1.00 0.00 ? 264  GLN A NE2   1 
ATOM 2051  N N     . SER A 1  265 ? 122.321 -13.303  19.886  1.00 0.00 ? 265  SER A N     1 
ATOM 2052  C CA    . SER A 1  265 ? 121.716 -14.510  19.385  1.00 0.00 ? 265  SER A CA    1 
ATOM 2053  C C     . SER A 1  265 ? 121.084 -15.257  20.551  1.00 0.00 ? 265  SER A C     1 
ATOM 2054  O O     . SER A 1  265 ? 120.694 -16.416  20.413  1.00 0.00 ? 265  SER A O     1 
ATOM 2055  C CB    . SER A 1  265 ? 122.785 -15.380  18.674  1.00 0.00 ? 265  SER A CB    1 
ATOM 2056  O OG    . SER A 1  265 ? 122.216 -16.446  17.924  1.00 0.00 ? 265  SER A OG    1 
ATOM 2057  N N     . VAL A 1  266 ? 120.936 -14.590  21.729  1.00 0.00 ? 266  VAL A N     1 
ATOM 2058  C CA    . VAL A 1  266 ? 120.128 -15.074  22.828  1.00 0.00 ? 266  VAL A CA    1 
ATOM 2059  C C     . VAL A 1  266 ? 118.827 -14.350  22.679  1.00 0.00 ? 266  VAL A C     1 
ATOM 2060  O O     . VAL A 1  266 ? 118.780 -13.121  22.622  1.00 0.00 ? 266  VAL A O     1 
ATOM 2061  C CB    . VAL A 1  266 ? 120.673 -14.820  24.236  1.00 0.00 ? 266  VAL A CB    1 
ATOM 2062  C CG1   . VAL A 1  266 ? 119.604 -15.130  25.312  1.00 0.00 ? 266  VAL A CG1   1 
ATOM 2063  C CG2   . VAL A 1  266 ? 121.922 -15.694  24.444  1.00 0.00 ? 266  VAL A CG2   1 
ATOM 2064  N N     . ARG A 1  267 ? 117.739 -15.142  22.624  1.00 0.00 ? 267  ARG A N     1 
ATOM 2065  C CA    . ARG A 1  267 ? 116.392 -14.667  22.527  1.00 0.00 ? 267  ARG A CA    1 
ATOM 2066  C C     . ARG A 1  267 ? 115.632 -15.537  23.481  1.00 0.00 ? 267  ARG A C     1 
ATOM 2067  O O     . ARG A 1  267 ? 116.130 -16.573  23.924  1.00 0.00 ? 267  ARG A O     1 
ATOM 2068  C CB    . ARG A 1  267 ? 115.828 -14.855  21.103  1.00 0.00 ? 267  ARG A CB    1 
ATOM 2069  C CG    . ARG A 1  267 ? 116.479 -13.921  20.065  1.00 0.00 ? 267  ARG A CG    1 
ATOM 2070  C CD    . ARG A 1  267 ? 116.712 -14.582  18.703  1.00 0.00 ? 267  ARG A CD    1 
ATOM 2071  N NE    . ARG A 1  267 ? 117.746 -15.649  18.856  1.00 0.00 ? 267  ARG A NE    1 
ATOM 2072  C CZ    . ARG A 1  267 ? 117.987 -16.583  17.889  1.00 0.00 ? 267  ARG A CZ    1 
ATOM 2073  N NH1   . ARG A 1  267 ? 117.279 -16.600  16.724  1.00 0.00 ? 267  ARG A NH1   1 
ATOM 2074  N NH2   . ARG A 1  267 ? 118.964 -17.510  18.096  1.00 0.00 ? 267  ARG A NH2   1 
ATOM 2075  N N     . VAL A 1  268 ? 114.396 -15.117  23.831  1.00 0.00 ? 268  VAL A N     1 
ATOM 2076  C CA    . VAL A 1  268 ? 113.533 -15.865  24.712  1.00 0.00 ? 268  VAL A CA    1 
ATOM 2077  C C     . VAL A 1  268 ? 112.465 -16.379  23.805  1.00 0.00 ? 268  VAL A C     1 
ATOM 2078  O O     . VAL A 1  268 ? 111.850 -15.622  23.059  1.00 0.00 ? 268  VAL A O     1 
ATOM 2079  C CB    . VAL A 1  268 ? 112.921 -15.035  25.833  1.00 0.00 ? 268  VAL A CB    1 
ATOM 2080  C CG1   . VAL A 1  268 ? 111.923 -15.876  26.662  1.00 0.00 ? 268  VAL A CG1   1 
ATOM 2081  C CG2   . VAL A 1  268 ? 114.072 -14.520  26.717  1.00 0.00 ? 268  VAL A CG2   1 
ATOM 2082  N N     . GLU A 1  269 ? 112.255 -17.711  23.843  1.00 0.00 ? 269  GLU A N     1 
ATOM 2083  C CA    . GLU A 1  269 ? 111.325 -18.401  22.994  1.00 0.00 ? 269  GLU A CA    1 
ATOM 2084  C C     . GLU A 1  269 ? 110.018 -18.499  23.720  1.00 0.00 ? 269  GLU A C     1 
ATOM 2085  O O     . GLU A 1  269 ? 109.976 -18.811  24.911  1.00 0.00 ? 269  GLU A O     1 
ATOM 2086  C CB    . GLU A 1  269 ? 111.858 -19.792  22.583  1.00 0.00 ? 269  GLU A CB    1 
ATOM 2087  C CG    . GLU A 1  269 ? 112.144 -20.764  23.743  1.00 0.00 ? 269  GLU A CG    1 
ATOM 2088  C CD    . GLU A 1  269 ? 113.091 -21.864  23.256  1.00 0.00 ? 269  GLU A CD    1 
ATOM 2089  O OE1   . GLU A 1  269 ? 114.275 -21.536  22.977  1.00 0.00 ? 269  GLU A OE1   1 
ATOM 2090  O OE2   . GLU A 1  269 ? 112.649 -23.039  23.162  1.00 0.00 ? 269  GLU A OE2   1 
ATOM 2091  N N     . LEU A 1  270 ? 108.913 -18.173  23.011  1.00 0.00 ? 270  LEU A N     1 
ATOM 2092  C CA    . LEU A 1  270 ? 107.590 -18.207  23.580  1.00 0.00 ? 270  LEU A CA    1 
ATOM 2093  C C     . LEU A 1  270 ? 106.747 -18.930  22.566  1.00 0.00 ? 270  LEU A C     1 
ATOM 2094  O O     . LEU A 1  270 ? 106.575 -18.403  21.467  1.00 0.00 ? 270  LEU A O     1 
ATOM 2095  C CB    . LEU A 1  270 ? 106.964 -16.820  23.867  1.00 0.00 ? 270  LEU A CB    1 
ATOM 2096  C CG    . LEU A 1  270 ? 107.874 -15.932  24.748  1.00 0.00 ? 270  LEU A CG    1 
ATOM 2097  C CD1   . LEU A 1  270 ? 108.722 -14.974  23.902  1.00 0.00 ? 270  LEU A CD1   1 
ATOM 2098  C CD2   . LEU A 1  270 ? 107.100 -15.141  25.812  1.00 0.00 ? 270  LEU A CD2   1 
ATOM 2099  N N     . PRO A 1  271 ? 106.214 -20.117  22.840  1.00 0.00 ? 271  PRO A N     1 
ATOM 2100  C CA    . PRO A 1  271 ? 105.534 -20.902  21.828  1.00 0.00 ? 271  PRO A CA    1 
ATOM 2101  C C     . PRO A 1  271 ? 104.139 -20.385  21.581  1.00 0.00 ? 271  PRO A C     1 
ATOM 2102  O O     . PRO A 1  271 ? 103.549 -19.759  22.462  1.00 0.00 ? 271  PRO A O     1 
ATOM 2103  C CB    . PRO A 1  271 ? 105.499 -22.338  22.380  1.00 0.00 ? 271  PRO A CB    1 
ATOM 2104  C CG    . PRO A 1  271 ? 105.768 -22.211  23.884  1.00 0.00 ? 271  PRO A CG    1 
ATOM 2105  C CD    . PRO A 1  271 ? 106.586 -20.930  23.999  1.00 0.00 ? 271  PRO A CD    1 
ATOM 2106  N N     . ILE A 1  272 ? 103.623 -20.652  20.359  1.00 0.00 ? 272  ILE A N     1 
ATOM 2107  C CA    . ILE A 1  272 ? 102.267 -20.382  19.951  1.00 0.00 ? 272  ILE A CA    1 
ATOM 2108  C C     . ILE A 1  272 ? 101.757 -21.735  19.520  1.00 0.00 ? 272  ILE A C     1 
ATOM 2109  O O     . ILE A 1  272 ? 102.557 -22.649  19.310  1.00 0.00 ? 272  ILE A O     1 
ATOM 2110  C CB    . ILE A 1  272 ? 102.117 -19.314  18.854  1.00 0.00 ? 272  ILE A CB    1 
ATOM 2111  C CG1   . ILE A 1  272 ? 102.283 -19.864  17.412  1.00 0.00 ? 272  ILE A CG1   1 
ATOM 2112  C CG2   . ILE A 1  272 ? 103.094 -18.146  19.149  1.00 0.00 ? 272  ILE A CG2   1 
ATOM 2113  C CD1   . ILE A 1  272 ? 102.193 -18.803  16.313  1.00 0.00 ? 272  ILE A CD1   1 
ATOM 2114  N N     . ARG A 1  273 ? 100.415 -21.910  19.412  1.00 0.00 ? 273  ARG A N     1 
ATOM 2115  C CA    . ARG A 1  273 ? 99.805  -23.203  19.178  1.00 0.00 ? 273  ARG A CA    1 
ATOM 2116  C C     . ARG A 1  273 ? 99.082  -23.200  17.861  1.00 0.00 ? 273  ARG A C     1 
ATOM 2117  O O     . ARG A 1  273 ? 98.974  -22.158  17.218  1.00 0.00 ? 273  ARG A O     1 
ATOM 2118  C CB    . ARG A 1  273 ? 98.809  -23.640  20.282  1.00 0.00 ? 273  ARG A CB    1 
ATOM 2119  C CG    . ARG A 1  273 ? 99.327  -23.510  21.726  1.00 0.00 ? 273  ARG A CG    1 
ATOM 2120  C CD    . ARG A 1  273 ? 100.660 -24.218  22.040  1.00 0.00 ? 273  ARG A CD    1 
ATOM 2121  N NE    . ARG A 1  273 ? 101.611 -23.186  22.588  1.00 0.00 ? 273  ARG A NE    1 
ATOM 2122  C CZ    . ARG A 1  273 ? 101.921 -23.070  23.916  1.00 0.00 ? 273  ARG A CZ    1 
ATOM 2123  N NH1   . ARG A 1  273 ? 102.328 -21.859  24.400  1.00 0.00 ? 273  ARG A NH1   1 
ATOM 2124  N NH2   . ARG A 1  273 ? 101.788 -24.112  24.785  1.00 0.00 ? 273  ARG A NH2   1 
ATOM 2125  N N     . SER A 1  274 ? 98.586  -24.417  17.490  1.00 0.00 ? 274  SER A N     1 
ATOM 2126  C CA    . SER A 1  274 ? 97.999  -24.935  16.261  1.00 0.00 ? 274  SER A CA    1 
ATOM 2127  C C     . SER A 1  274 ? 98.137  -24.161  14.966  1.00 0.00 ? 274  SER A C     1 
ATOM 2128  O O     . SER A 1  274 ? 97.953  -22.950  14.902  1.00 0.00 ? 274  SER A O     1 
ATOM 2129  C CB    . SER A 1  274 ? 96.529  -25.413  16.410  1.00 0.00 ? 274  SER A CB    1 
ATOM 2130  O OG    . SER A 1  274 ? 96.376  -26.270  17.533  1.00 0.00 ? 274  SER A OG    1 
ATOM 2131  N N     . THR A 1  275 ? 98.507  -24.892  13.884  1.00 0.00 ? 275  THR A N     1 
ATOM 2132  C CA    . THR A 1  275 ? 98.799  -24.353  12.572  1.00 0.00 ? 275  THR A CA    1 
ATOM 2133  C C     . THR A 1  275 ? 97.589  -24.473  11.661  1.00 0.00 ? 275  THR A C     1 
ATOM 2134  O O     . THR A 1  275 ? 97.604  -23.897  10.577  1.00 0.00 ? 275  THR A O     1 
ATOM 2135  C CB    . THR A 1  275 ? 99.983  -25.117  11.964  1.00 0.00 ? 275  THR A CB    1 
ATOM 2136  O OG1   . THR A 1  275 ? 100.465 -24.527  10.760  1.00 0.00 ? 275  THR A OG1   1 
ATOM 2137  C CG2   . THR A 1  275 ? 99.655  -26.614  11.730  1.00 0.00 ? 275  THR A CG2   1 
ATOM 2138  N N     . ARG A 1  276 ? 96.544  -25.207  12.127  1.00 0.00 ? 276  ARG A N     1 
ATOM 2139  C CA    . ARG A 1  276 ? 95.347  -25.707  11.467  1.00 0.00 ? 276  ARG A CA    1 
ATOM 2140  C C     . ARG A 1  276 ? 95.465  -27.163  11.817  1.00 0.00 ? 276  ARG A C     1 
ATOM 2141  O O     . ARG A 1  276 ? 95.774  -28.007  10.976  1.00 0.00 ? 276  ARG A O     1 
ATOM 2142  C CB    . ARG A 1  276 ? 95.141  -25.514  9.925   1.00 0.00 ? 276  ARG A CB    1 
ATOM 2143  C CG    . ARG A 1  276 ? 93.895  -24.693  9.520   1.00 0.00 ? 276  ARG A CG    1 
ATOM 2144  C CD    . ARG A 1  276 ? 93.740  -23.276  10.106  1.00 0.00 ? 276  ARG A CD    1 
ATOM 2145  N NE    . ARG A 1  276 ? 94.995  -22.489  9.913   1.00 0.00 ? 276  ARG A NE    1 
ATOM 2146  C CZ    . ARG A 1  276 ? 95.152  -21.229  10.426  1.00 0.00 ? 276  ARG A CZ    1 
ATOM 2147  N NH1   . ARG A 1  276 ? 94.094  -20.520  10.919  1.00 0.00 ? 276  ARG A NH1   1 
ATOM 2148  N NH2   . ARG A 1  276 ? 96.405  -20.688  10.488  1.00 0.00 ? 276  ARG A NH2   1 
ATOM 2149  N N     . ALA A 1  277 ? 95.287  -27.478  13.121  1.00 0.00 ? 277  ALA A N     1 
ATOM 2150  C CA    . ALA A 1  277 ? 95.691  -28.761  13.619  1.00 0.00 ? 277  ALA A CA    1 
ATOM 2151  C C     . ALA A 1  277 ? 95.066  -28.998  14.968  1.00 0.00 ? 277  ALA A C     1 
ATOM 2152  O O     . ALA A 1  277 ? 93.848  -29.005  15.118  1.00 0.00 ? 277  ALA A O     1 
ATOM 2153  C CB    . ALA A 1  277 ? 97.233  -28.879  13.702  1.00 0.00 ? 277  ALA A CB    1 
ATOM 2154  N N     . ARG A 1  278 ? 95.942  -29.236  15.962  1.00 0.00 ? 278  ARG A N     1 
ATOM 2155  C CA    . ARG A 1  278 ? 95.725  -29.815  17.256  1.00 0.00 ? 278  ARG A CA    1 
ATOM 2156  C C     . ARG A 1  278 ? 97.172  -29.949  17.638  1.00 0.00 ? 278  ARG A C     1 
ATOM 2157  O O     . ARG A 1  278 ? 98.000  -30.333  16.811  1.00 0.00 ? 278  ARG A O     1 
ATOM 2158  C CB    . ARG A 1  278 ? 95.136  -31.258  17.310  1.00 0.00 ? 278  ARG A CB    1 
ATOM 2159  C CG    . ARG A 1  278 ? 93.601  -31.403  17.260  1.00 0.00 ? 278  ARG A CG    1 
ATOM 2160  C CD    . ARG A 1  278 ? 93.189  -32.873  17.452  1.00 0.00 ? 278  ARG A CD    1 
ATOM 2161  N NE    . ARG A 1  278 ? 91.700  -33.033  17.341  1.00 0.00 ? 278  ARG A NE    1 
ATOM 2162  C CZ    . ARG A 1  278 ? 91.100  -34.252  17.515  1.00 0.00 ? 278  ARG A CZ    1 
ATOM 2163  N NH1   . ARG A 1  278 ? 91.828  -35.337  17.900  1.00 0.00 ? 278  ARG A NH1   1 
ATOM 2164  N NH2   . ARG A 1  278 ? 89.764  -34.395  17.285  1.00 0.00 ? 278  ARG A NH2   1 
ATOM 2165  N N     . GLY A 1  279 ? 97.530  -29.609  18.894  1.00 0.00 ? 279  GLY A N     1 
ATOM 2166  C CA    . GLY A 1  279 ? 98.905  -29.681  19.327  1.00 0.00 ? 279  GLY A CA    1 
ATOM 2167  C C     . GLY A 1  279 ? 99.575  -28.349  19.207  1.00 0.00 ? 279  GLY A C     1 
ATOM 2168  O O     . GLY A 1  279 ? 98.944  -27.325  18.950  1.00 0.00 ? 279  GLY A O     1 
ATOM 2169  N N     . THR A 1  280 ? 100.907 -28.361  19.444  1.00 0.00 ? 280  THR A N     1 
ATOM 2170  C CA    . THR A 1  280 ? 101.759 -27.198  19.511  1.00 0.00 ? 280  THR A CA    1 
ATOM 2171  C C     . THR A 1  280 ? 102.137 -26.745  18.108  1.00 0.00 ? 280  THR A C     1 
ATOM 2172  O O     . THR A 1  280 ? 101.874 -27.442  17.127  1.00 0.00 ? 280  THR A O     1 
ATOM 2173  C CB    . THR A 1  280 ? 102.973 -27.479  20.399  1.00 0.00 ? 280  THR A CB    1 
ATOM 2174  O OG1   . THR A 1  280 ? 103.643 -26.284  20.787  1.00 0.00 ? 280  THR A OG1   1 
ATOM 2175  C CG2   . THR A 1  280 ? 103.960 -28.457  19.720  1.00 0.00 ? 280  THR A CG2   1 
ATOM 2176  N N     . ASN A 1  281 ? 102.740 -25.536  17.992  1.00 0.00 ? 281  ASN A N     1 
ATOM 2177  C CA    . ASN A 1  281 ? 103.090 -24.943  16.723  1.00 0.00 ? 281  ASN A CA    1 
ATOM 2178  C C     . ASN A 1  281 ? 104.409 -24.228  16.924  1.00 0.00 ? 281  ASN A C     1 
ATOM 2179  O O     . ASN A 1  281 ? 105.340 -24.806  17.484  1.00 0.00 ? 281  ASN A O     1 
ATOM 2180  C CB    . ASN A 1  281 ? 101.955 -24.012  16.209  1.00 0.00 ? 281  ASN A CB    1 
ATOM 2181  C CG    . ASN A 1  281 ? 102.105 -23.596  14.738  1.00 0.00 ? 281  ASN A CG    1 
ATOM 2182  O OD1   . ASN A 1  281 ? 102.804 -24.249  13.956  1.00 0.00 ? 281  ASN A OD1   1 
ATOM 2183  N ND2   . ASN A 1  281 ? 101.425 -22.466  14.378  1.00 0.00 ? 281  ASN A ND2   1 
ATOM 2184  N N     . ASN A 1  282 ? 104.526 -22.970  16.417  1.00 0.00 ? 282  ASN A N     1 
ATOM 2185  C CA    . ASN A 1  282 ? 105.744 -22.194  16.292  1.00 0.00 ? 282  ASN A CA    1 
ATOM 2186  C C     . ASN A 1  282 ? 106.393 -21.916  17.622  1.00 0.00 ? 282  ASN A C     1 
ATOM 2187  O O     . ASN A 1  282 ? 105.746 -21.941  18.667  1.00 0.00 ? 282  ASN A O     1 
ATOM 2188  C CB    . ASN A 1  282 ? 105.585 -20.838  15.543  1.00 0.00 ? 282  ASN A CB    1 
ATOM 2189  C CG    . ASN A 1  282 ? 104.880 -20.964  14.180  1.00 0.00 ? 282  ASN A CG    1 
ATOM 2190  O OD1   . ASN A 1  282 ? 104.131 -20.057  13.798  1.00 0.00 ? 282  ASN A OD1   1 
ATOM 2191  N ND2   . ASN A 1  282 ? 105.133 -22.082  13.436  1.00 0.00 ? 282  ASN A ND2   1 
ATOM 2192  N N     . VAL A 1  283 ? 107.724 -21.685  17.584  1.00 0.00 ? 283  VAL A N     1 
ATOM 2193  C CA    . VAL A 1  283 ? 108.566 -21.525  18.743  1.00 0.00 ? 283  VAL A CA    1 
ATOM 2194  C C     . VAL A 1  283 ? 108.767 -20.049  19.034  1.00 0.00 ? 283  VAL A C     1 
ATOM 2195  O O     . VAL A 1  283 ? 109.179 -19.694  20.137  1.00 0.00 ? 283  VAL A O     1 
ATOM 2196  C CB    . VAL A 1  283 ? 109.894 -22.244  18.486  1.00 0.00 ? 283  VAL A CB    1 
ATOM 2197  C CG1   . VAL A 1  283 ? 110.639 -21.653  17.265  1.00 0.00 ? 283  VAL A CG1   1 
ATOM 2198  C CG2   . VAL A 1  283 ? 110.774 -22.288  19.752  1.00 0.00 ? 283  VAL A CG2   1 
ATOM 2199  N N     . TYR A 1  284 ? 108.408 -19.175  18.051  1.00 0.00 ? 284  TYR A N     1 
ATOM 2200  C CA    . TYR A 1  284 ? 108.487 -17.723  18.000  1.00 0.00 ? 284  TYR A CA    1 
ATOM 2201  C C     . TYR A 1  284 ? 109.413 -17.040  19.002  1.00 0.00 ? 284  TYR A C     1 
ATOM 2202  O O     . TYR A 1  284 ? 108.951 -16.675  20.084  1.00 0.00 ? 284  TYR A O     1 
ATOM 2203  C CB    . TYR A 1  284 ? 107.083 -17.055  18.028  1.00 0.00 ? 284  TYR A CB    1 
ATOM 2204  C CG    . TYR A 1  284 ? 107.132 -15.662  17.438  1.00 0.00 ? 284  TYR A CG    1 
ATOM 2205  C CD1   . TYR A 1  284 ? 107.214 -14.520  18.256  1.00 0.00 ? 284  TYR A CD1   1 
ATOM 2206  C CD2   . TYR A 1  284 ? 107.143 -15.498  16.042  1.00 0.00 ? 284  TYR A CD2   1 
ATOM 2207  C CE1   . TYR A 1  284 ? 107.315 -13.244  17.688  1.00 0.00 ? 284  TYR A CE1   1 
ATOM 2208  C CE2   . TYR A 1  284 ? 107.240 -14.223  15.472  1.00 0.00 ? 284  TYR A CE2   1 
ATOM 2209  C CZ    . TYR A 1  284 ? 107.339 -13.094  16.295  1.00 0.00 ? 284  TYR A CZ    1 
ATOM 2210  O OH    . TYR A 1  284 ? 107.463 -11.807  15.724  1.00 0.00 ? 284  TYR A OH    1 
ATOM 2211  N N     . PRO A 1  285 ? 110.696 -16.832  18.719  1.00 0.00 ? 285  PRO A N     1 
ATOM 2212  C CA    . PRO A 1  285 ? 111.588 -16.079  19.585  1.00 0.00 ? 285  PRO A CA    1 
ATOM 2213  C C     . PRO A 1  285 ? 111.313 -14.600  19.440  1.00 0.00 ? 285  PRO A C     1 
ATOM 2214  O O     . PRO A 1  285 ? 110.841 -14.182  18.382  1.00 0.00 ? 285  PRO A O     1 
ATOM 2215  C CB    . PRO A 1  285 ? 112.988 -16.443  19.074  1.00 0.00 ? 285  PRO A CB    1 
ATOM 2216  C CG    . PRO A 1  285 ? 112.789 -16.753  17.588  1.00 0.00 ? 285  PRO A CG    1 
ATOM 2217  C CD    . PRO A 1  285 ? 111.389 -17.365  17.544  1.00 0.00 ? 285  PRO A CD    1 
ATOM 2218  N N     . ILE A 1  286 ? 111.577 -13.809  20.508  1.00 0.00 ? 286  ILE A N     1 
ATOM 2219  C CA    . ILE A 1  286 ? 111.361 -12.380  20.517  1.00 0.00 ? 286  ILE A CA    1 
ATOM 2220  C C     . ILE A 1  286 ? 112.694 -11.732  20.743  1.00 0.00 ? 286  ILE A C     1 
ATOM 2221  O O     . ILE A 1  286 ? 113.638 -12.348  21.235  1.00 0.00 ? 286  ILE A O     1 
ATOM 2222  C CB    . ILE A 1  286 ? 110.343 -11.876  21.534  1.00 0.00 ? 286  ILE A CB    1 
ATOM 2223  C CG1   . ILE A 1  286 ? 110.746 -12.183  22.999  1.00 0.00 ? 286  ILE A CG1   1 
ATOM 2224  C CG2   . ILE A 1  286 ? 108.972 -12.470  21.141  1.00 0.00 ? 286  ILE A CG2   1 
ATOM 2225  C CD1   . ILE A 1  286 ? 109.830 -11.542  24.046  1.00 0.00 ? 286  ILE A CD1   1 
ATOM 2226  N N     . LYS A 1  287 ? 112.790 -10.455  20.324  1.00 0.00 ? 287  LYS A N     1 
ATOM 2227  C CA    . LYS A 1  287 ? 114.031 -9.762   20.142  1.00 0.00 ? 287  LYS A CA    1 
ATOM 2228  C C     . LYS A 1  287 ? 114.194 -8.840   21.314  1.00 0.00 ? 287  LYS A C     1 
ATOM 2229  O O     . LYS A 1  287 ? 113.545 -7.798   21.397  1.00 0.00 ? 287  LYS A O     1 
ATOM 2230  C CB    . LYS A 1  287 ? 114.030 -8.947   18.823  1.00 0.00 ? 287  LYS A CB    1 
ATOM 2231  C CG    . LYS A 1  287 ? 113.719 -9.793   17.571  1.00 0.00 ? 287  LYS A CG    1 
ATOM 2232  C CD    . LYS A 1  287 ? 112.220 -9.884   17.222  1.00 0.00 ? 287  LYS A CD    1 
ATOM 2233  C CE    . LYS A 1  287 ? 111.915 -10.778  16.016  1.00 0.00 ? 287  LYS A CE    1 
ATOM 2234  N NZ    . LYS A 1  287 ? 112.204 -12.193  16.330  1.00 0.00 ? 287  LYS A NZ    1 
ATOM 2235  N N     . LEU A 1  288 ? 115.071 -9.237   22.267  1.00 0.00 ? 288  LEU A N     1 
ATOM 2236  C CA    . LEU A 1  288 ? 115.284 -8.539   23.514  1.00 0.00 ? 288  LEU A CA    1 
ATOM 2237  C C     . LEU A 1  288 ? 116.216 -7.379   23.319  1.00 0.00 ? 288  LEU A C     1 
ATOM 2238  O O     . LEU A 1  288 ? 116.079 -6.366   24.001  1.00 0.00 ? 288  LEU A O     1 
ATOM 2239  C CB    . LEU A 1  288 ? 115.910 -9.437   24.614  1.00 0.00 ? 288  LEU A CB    1 
ATOM 2240  C CG    . LEU A 1  288 ? 114.900 -10.290  25.416  1.00 0.00 ? 288  LEU A CG    1 
ATOM 2241  C CD1   . LEU A 1  288 ? 114.149 -11.335  24.575  1.00 0.00 ? 288  LEU A CD1   1 
ATOM 2242  C CD2   . LEU A 1  288 ? 115.610 -10.976  26.594  1.00 0.00 ? 288  LEU A CD2   1 
ATOM 2243  N N     . LEU A 1  289 ? 117.203 -7.509   22.400  1.00 0.00 ? 289  LEU A N     1 
ATOM 2244  C CA    . LEU A 1  289 ? 118.328 -6.607   22.378  1.00 0.00 ? 289  LEU A CA    1 
ATOM 2245  C C     . LEU A 1  289 ? 118.131 -5.492   21.391  1.00 0.00 ? 289  LEU A C     1 
ATOM 2246  O O     . LEU A 1  289 ? 118.953 -4.578   21.361  1.00 0.00 ? 289  LEU A O     1 
ATOM 2247  C CB    . LEU A 1  289 ? 119.659 -7.313   22.021  1.00 0.00 ? 289  LEU A CB    1 
ATOM 2248  C CG    . LEU A 1  289 ? 120.197 -8.220   23.153  1.00 0.00 ? 289  LEU A CG    1 
ATOM 2249  C CD1   . LEU A 1  289 ? 119.676 -9.667   23.078  1.00 0.00 ? 289  LEU A CD1   1 
ATOM 2250  C CD2   . LEU A 1  289 ? 121.735 -8.174   23.206  1.00 0.00 ? 289  LEU A CD2   1 
ATOM 2251  N N     . TYR A 1  290 ? 117.023 -5.498   20.603  1.00 0.00 ? 290  TYR A N     1 
ATOM 2252  C CA    . TYR A 1  290 ? 116.669 -4.358   19.784  1.00 0.00 ? 290  TYR A CA    1 
ATOM 2253  C C     . TYR A 1  290 ? 115.716 -3.496   20.581  1.00 0.00 ? 290  TYR A C     1 
ATOM 2254  O O     . TYR A 1  290 ? 115.639 -2.288   20.360  1.00 0.00 ? 290  TYR A O     1 
ATOM 2255  C CB    . TYR A 1  290 ? 116.008 -4.763   18.435  1.00 0.00 ? 290  TYR A CB    1 
ATOM 2256  C CG    . TYR A 1  290 ? 115.734 -3.573   17.546  1.00 0.00 ? 290  TYR A CG    1 
ATOM 2257  C CD1   . TYR A 1  290 ? 116.786 -2.758   17.089  1.00 0.00 ? 290  TYR A CD1   1 
ATOM 2258  C CD2   . TYR A 1  290 ? 114.416 -3.235   17.201  1.00 0.00 ? 290  TYR A CD2   1 
ATOM 2259  C CE1   . TYR A 1  290 ? 116.525 -1.625   16.311  1.00 0.00 ? 290  TYR A CE1   1 
ATOM 2260  C CE2   . TYR A 1  290 ? 114.150 -2.100   16.427  1.00 0.00 ? 290  TYR A CE2   1 
ATOM 2261  C CZ    . TYR A 1  290 ? 115.205 -1.289   15.984  1.00 0.00 ? 290  TYR A CZ    1 
ATOM 2262  O OH    . TYR A 1  290 ? 114.943 -0.132   15.215  1.00 0.00 ? 290  TYR A OH    1 
ATOM 2263  N N     . THR A 1  291 ? 114.995 -4.097   21.562  1.00 0.00 ? 291  THR A N     1 
ATOM 2264  C CA    . THR A 1  291 ? 114.133 -3.384   22.481  1.00 0.00 ? 291  THR A CA    1 
ATOM 2265  C C     . THR A 1  291 ? 114.991 -2.606   23.450  1.00 0.00 ? 291  THR A C     1 
ATOM 2266  O O     . THR A 1  291 ? 114.720 -1.442   23.750  1.00 0.00 ? 291  THR A O     1 
ATOM 2267  C CB    . THR A 1  291 ? 113.209 -4.325   23.240  1.00 0.00 ? 291  THR A CB    1 
ATOM 2268  O OG1   . THR A 1  291 ? 112.426 -5.070   22.315  1.00 0.00 ? 291  THR A OG1   1 
ATOM 2269  C CG2   . THR A 1  291 ? 112.263 -3.539   24.177  1.00 0.00 ? 291  THR A CG2   1 
ATOM 2270  N N     . GLY A 1  292 ? 116.081 -3.256   23.925  1.00 0.00 ? 292  GLY A N     1 
ATOM 2271  C CA    . GLY A 1  292 ? 117.020 -2.702   24.862  1.00 0.00 ? 292  GLY A CA    1 
ATOM 2272  C C     . GLY A 1  292 ? 118.085 -1.886   24.192  1.00 0.00 ? 292  GLY A C     1 
ATOM 2273  O O     . GLY A 1  292 ? 118.941 -1.342   24.883  1.00 0.00 ? 292  GLY A O     1 
ATOM 2274  N N     . CYS A 1  293 ? 118.076 -1.793   22.834  1.00 0.00 ? 293  CYS A N     1 
ATOM 2275  C CA    . CYS A 1  293 ? 119.071 -1.081   22.057  1.00 0.00 ? 293  CYS A CA    1 
ATOM 2276  C C     . CYS A 1  293 ? 119.055 0.389    22.375  1.00 0.00 ? 293  CYS A C     1 
ATOM 2277  O O     . CYS A 1  293 ? 120.104 0.966    22.642  1.00 0.00 ? 293  CYS A O     1 
ATOM 2278  C CB    . CYS A 1  293 ? 118.839 -1.249   20.526  1.00 0.00 ? 293  CYS A CB    1 
ATOM 2279  S SG    . CYS A 1  293 ? 120.102 -0.505   19.433  1.00 0.00 ? 293  CYS A SG    1 
ATOM 2280  N N     . LEU A 1  294 ? 117.855 1.020    22.394  1.00 0.00 ? 294  LEU A N     1 
ATOM 2281  C CA    . LEU A 1  294 ? 117.747 2.446    22.596  1.00 0.00 ? 294  LEU A CA    1 
ATOM 2282  C C     . LEU A 1  294 ? 117.810 2.755    24.066  1.00 0.00 ? 294  LEU A C     1 
ATOM 2283  O O     . LEU A 1  294 ? 118.164 3.870    24.436  1.00 0.00 ? 294  LEU A O     1 
ATOM 2284  C CB    . LEU A 1  294 ? 116.454 3.069    22.007  1.00 0.00 ? 294  LEU A CB    1 
ATOM 2285  C CG    . LEU A 1  294 ? 116.486 3.260    20.465  1.00 0.00 ? 294  LEU A CG    1 
ATOM 2286  C CD1   . LEU A 1  294 ? 116.404 1.945    19.662  1.00 0.00 ? 294  LEU A CD1   1 
ATOM 2287  C CD2   . LEU A 1  294 ? 115.389 4.237    19.996  1.00 0.00 ? 294  LEU A CD2   1 
ATOM 2288  N N     . SER A 1  295 ? 117.514 1.759    24.939  1.00 0.00 ? 295  SER A N     1 
ATOM 2289  C CA    . SER A 1  295 ? 117.603 1.877    26.375  1.00 0.00 ? 295  SER A CA    1 
ATOM 2290  C C     . SER A 1  295 ? 119.041 2.006    26.826  1.00 0.00 ? 295  SER A C     1 
ATOM 2291  O O     . SER A 1  295 ? 119.327 2.779    27.739  1.00 0.00 ? 295  SER A O     1 
ATOM 2292  C CB    . SER A 1  295 ? 116.935 0.677    27.097  1.00 0.00 ? 295  SER A CB    1 
ATOM 2293  O OG    . SER A 1  295 ? 116.831 0.886    28.501  1.00 0.00 ? 295  SER A OG    1 
ATOM 2294  N N     . VAL A 1  296 ? 119.976 1.249    26.190  1.00 0.00 ? 296  VAL A N     1 
ATOM 2295  C CA    . VAL A 1  296 ? 121.360 1.195    26.611  1.00 0.00 ? 296  VAL A CA    1 
ATOM 2296  C C     . VAL A 1  296 ? 122.175 2.166    25.792  1.00 0.00 ? 296  VAL A C     1 
ATOM 2297  O O     . VAL A 1  296 ? 123.306 2.486    26.150  1.00 0.00 ? 296  VAL A O     1 
ATOM 2298  C CB    . VAL A 1  296 ? 121.943 -0.219   26.537  1.00 0.00 ? 296  VAL A CB    1 
ATOM 2299  C CG1   . VAL A 1  296 ? 122.239 -0.642   25.087  1.00 0.00 ? 296  VAL A CG1   1 
ATOM 2300  C CG2   . VAL A 1  296 ? 123.197 -0.341   27.431  1.00 0.00 ? 296  VAL A CG2   1 
ATOM 2301  N N     . LEU A 1  297 ? 121.601 2.718    24.690  1.00 0.00 ? 297  LEU A N     1 
ATOM 2302  C CA    . LEU A 1  297 ? 122.176 3.843    23.986  1.00 0.00 ? 297  LEU A CA    1 
ATOM 2303  C C     . LEU A 1  297 ? 121.999 5.068    24.838  1.00 0.00 ? 297  LEU A C     1 
ATOM 2304  O O     . LEU A 1  297 ? 122.926 5.862    24.962  1.00 0.00 ? 297  LEU A O     1 
ATOM 2305  C CB    . LEU A 1  297 ? 121.549 4.119    22.595  1.00 0.00 ? 297  LEU A CB    1 
ATOM 2306  C CG    . LEU A 1  297 ? 122.107 3.228    21.459  1.00 0.00 ? 297  LEU A CG    1 
ATOM 2307  C CD1   . LEU A 1  297 ? 121.187 3.253    20.222  1.00 0.00 ? 297  LEU A CD1   1 
ATOM 2308  C CD2   . LEU A 1  297 ? 123.547 3.620    21.071  1.00 0.00 ? 297  LEU A CD2   1 
ATOM 2309  N N     . PHE A 1  298 ? 120.806 5.217    25.474  1.00 0.00 ? 298  PHE A N     1 
ATOM 2310  C CA    . PHE A 1  298 ? 120.501 6.292    26.395  1.00 0.00 ? 298  PHE A CA    1 
ATOM 2311  C C     . PHE A 1  298 ? 121.346 6.189    27.638  1.00 0.00 ? 298  PHE A C     1 
ATOM 2312  O O     . PHE A 1  298 ? 121.787 7.204    28.173  1.00 0.00 ? 298  PHE A O     1 
ATOM 2313  C CB    . PHE A 1  298 ? 119.018 6.340    26.866  1.00 0.00 ? 298  PHE A CB    1 
ATOM 2314  C CG    . PHE A 1  298 ? 117.988 6.586    25.786  1.00 0.00 ? 298  PHE A CG    1 
ATOM 2315  C CD1   . PHE A 1  298 ? 116.666 6.157    26.018  1.00 0.00 ? 298  PHE A CD1   1 
ATOM 2316  C CD2   . PHE A 1  298 ? 118.269 7.258    24.580  1.00 0.00 ? 298  PHE A CD2   1 
ATOM 2317  C CE1   . PHE A 1  298 ? 115.661 6.371    25.068  1.00 0.00 ? 298  PHE A CE1   1 
ATOM 2318  C CE2   . PHE A 1  298 ? 117.261 7.485    23.634  1.00 0.00 ? 298  PHE A CE2   1 
ATOM 2319  C CZ    . PHE A 1  298 ? 115.958 7.037    23.875  1.00 0.00 ? 298  PHE A CZ    1 
ATOM 2320  N N     . SER A 1  299 ? 121.588 4.946    28.125  1.00 0.00 ? 299  SER A N     1 
ATOM 2321  C CA    . SER A 1  299 ? 122.376 4.663    29.300  1.00 0.00 ? 299  SER A CA    1 
ATOM 2322  C C     . SER A 1  299 ? 123.821 5.044    29.100  1.00 0.00 ? 299  SER A C     1 
ATOM 2323  O O     . SER A 1  299 ? 124.441 5.592    30.005  1.00 0.00 ? 299  SER A O     1 
ATOM 2324  C CB    . SER A 1  299 ? 122.293 3.165    29.698  1.00 0.00 ? 299  SER A CB    1 
ATOM 2325  O OG    . SER A 1  299 ? 122.873 2.897    30.969  1.00 0.00 ? 299  SER A OG    1 
ATOM 2326  N N     . TYR A 1  300 ? 124.392 4.756    27.905  1.00 0.00 ? 300  TYR A N     1 
ATOM 2327  C CA    . TYR A 1  300 ? 125.774 5.037    27.596  1.00 0.00 ? 300  TYR A CA    1 
ATOM 2328  C C     . TYR A 1  300 ? 125.989 6.526    27.410  1.00 0.00 ? 300  TYR A C     1 
ATOM 2329  O O     . TYR A 1  300 ? 127.010 7.058    27.837  1.00 0.00 ? 300  TYR A O     1 
ATOM 2330  C CB    . TYR A 1  300 ? 126.274 4.229    26.363  1.00 0.00 ? 300  TYR A CB    1 
ATOM 2331  C CG    . TYR A 1  300 ? 127.783 4.225    26.202  1.00 0.00 ? 300  TYR A CG    1 
ATOM 2332  C CD1   . TYR A 1  300 ? 128.669 4.006    27.277  1.00 0.00 ? 300  TYR A CD1   1 
ATOM 2333  C CD2   . TYR A 1  300 ? 128.326 4.411    24.922  1.00 0.00 ? 300  TYR A CD2   1 
ATOM 2334  C CE1   . TYR A 1  300 ? 130.058 4.046    27.085  1.00 0.00 ? 300  TYR A CE1   1 
ATOM 2335  C CE2   . TYR A 1  300 ? 129.712 4.456    24.722  1.00 0.00 ? 300  TYR A CE2   1 
ATOM 2336  C CZ    . TYR A 1  300 ? 130.581 4.279    25.803  1.00 0.00 ? 300  TYR A CZ    1 
ATOM 2337  O OH    . TYR A 1  300 ? 131.973 4.258    25.580  1.00 0.00 ? 300  TYR A OH    1 
ATOM 2338  N N     . THR A 1  301 ? 125.004 7.224    26.784  1.00 0.00 ? 301  THR A N     1 
ATOM 2339  C CA    . THR A 1  301 ? 125.011 8.649    26.507  1.00 0.00 ? 301  THR A CA    1 
ATOM 2340  C C     . THR A 1  301 ? 125.042 9.464    27.778  1.00 0.00 ? 301  THR A C     1 
ATOM 2341  O O     . THR A 1  301 ? 125.766 10.457   27.844  1.00 0.00 ? 301  THR A O     1 
ATOM 2342  C CB    . THR A 1  301 ? 123.802 9.062    25.663  1.00 0.00 ? 301  THR A CB    1 
ATOM 2343  O OG1   . THR A 1  301 ? 123.919 8.510    24.359  1.00 0.00 ? 301  THR A OG1   1 
ATOM 2344  C CG2   . THR A 1  301 ? 123.661 10.594   25.520  1.00 0.00 ? 301  THR A CG2   1 
ATOM 2345  N N     . ILE A 1  302 ? 124.263 9.064    28.820  1.00 0.00 ? 302  ILE A N     1 
ATOM 2346  C CA    . ILE A 1  302 ? 124.069 9.874    30.005  1.00 0.00 ? 302  ILE A CA    1 
ATOM 2347  C C     . ILE A 1  302 ? 125.311 9.896    30.871  1.00 0.00 ? 302  ILE A C     1 
ATOM 2348  O O     . ILE A 1  302 ? 125.501 10.820   31.654  1.00 0.00 ? 302  ILE A O     1 
ATOM 2349  C CB    . ILE A 1  302 ? 122.836 9.459    30.820  1.00 0.00 ? 302  ILE A CB    1 
ATOM 2350  C CG1   . ILE A 1  302 ? 122.213 10.676   31.549  1.00 0.00 ? 302  ILE A CG1   1 
ATOM 2351  C CG2   . ILE A 1  302 ? 123.138 8.286    31.782  1.00 0.00 ? 302  ILE A CG2   1 
ATOM 2352  C CD1   . ILE A 1  302 ? 120.907 10.352   32.282  1.00 0.00 ? 302  ILE A CD1   1 
ATOM 2353  N N     . LEU A 1  303 ? 126.222 8.902    30.713  1.00 0.00 ? 303  LEU A N     1 
ATOM 2354  C CA    . LEU A 1  303 ? 127.430 8.778    31.498  1.00 0.00 ? 303  LEU A CA    1 
ATOM 2355  C C     . LEU A 1  303 ? 128.448 9.812    31.122  1.00 0.00 ? 303  LEU A C     1 
ATOM 2356  O O     . LEU A 1  303 ? 129.417 10.006   31.853  1.00 0.00 ? 303  LEU A O     1 
ATOM 2357  C CB    . LEU A 1  303 ? 128.154 7.445    31.230  1.00 0.00 ? 303  LEU A CB    1 
ATOM 2358  C CG    . LEU A 1  303 ? 127.356 6.199    31.642  1.00 0.00 ? 303  LEU A CG    1 
ATOM 2359  C CD1   . LEU A 1  303 ? 127.921 4.990    30.884  1.00 0.00 ? 303  LEU A CD1   1 
ATOM 2360  C CD2   . LEU A 1  303 ? 127.338 5.998    33.168  1.00 0.00 ? 303  LEU A CD2   1 
ATOM 2361  N N     . PHE A 1  304 ? 128.259 10.473   29.957  1.00 0.00 ? 304  PHE A N     1 
ATOM 2362  C CA    . PHE A 1  304 ? 129.177 11.457   29.462  1.00 0.00 ? 304  PHE A CA    1 
ATOM 2363  C C     . PHE A 1  304 ? 128.611 12.829   29.713  1.00 0.00 ? 304  PHE A C     1 
ATOM 2364  O O     . PHE A 1  304 ? 129.374 13.787   29.706  1.00 0.00 ? 304  PHE A O     1 
ATOM 2365  C CB    . PHE A 1  304 ? 129.408 11.318   27.938  1.00 0.00 ? 304  PHE A CB    1 
ATOM 2366  C CG    . PHE A 1  304 ? 130.061 9.999    27.637  1.00 0.00 ? 304  PHE A CG    1 
ATOM 2367  C CD1   . PHE A 1  304 ? 131.391 9.766    28.019  1.00 0.00 ? 304  PHE A CD1   1 
ATOM 2368  C CD2   . PHE A 1  304 ? 129.355 8.975    26.986  1.00 0.00 ? 304  PHE A CD2   1 
ATOM 2369  C CE1   . PHE A 1  304 ? 131.998 8.528    27.786  1.00 0.00 ? 304  PHE A CE1   1 
ATOM 2370  C CE2   . PHE A 1  304 ? 129.961 7.736    26.743  1.00 0.00 ? 304  PHE A CE2   1 
ATOM 2371  C CZ    . PHE A 1  304 ? 131.280 7.510    27.153  1.00 0.00 ? 304  PHE A CZ    1 
ATOM 2372  N N     . TYR A 1  305 ? 127.287 12.966   29.987  1.00 0.00 ? 305  TYR A N     1 
ATOM 2373  C CA    . TYR A 1  305 ? 126.644 14.257   30.136  1.00 0.00 ? 305  TYR A CA    1 
ATOM 2374  C C     . TYR A 1  305 ? 126.710 14.863   31.518  1.00 0.00 ? 305  TYR A C     1 
ATOM 2375  O O     . TYR A 1  305 ? 126.940 16.065   31.625  1.00 0.00 ? 305  TYR A O     1 
ATOM 2376  C CB    . TYR A 1  305 ? 125.139 14.202   29.753  1.00 0.00 ? 305  TYR A CB    1 
ATOM 2377  C CG    . TYR A 1  305 ? 124.960 14.709   28.353  1.00 0.00 ? 305  TYR A CG    1 
ATOM 2378  C CD1   . TYR A 1  305 ? 125.141 16.078   28.085  1.00 0.00 ? 305  TYR A CD1   1 
ATOM 2379  C CD2   . TYR A 1  305 ? 124.618 13.846   27.303  1.00 0.00 ? 305  TYR A CD2   1 
ATOM 2380  C CE1   . TYR A 1  305 ? 124.993 16.576   26.787  1.00 0.00 ? 305  TYR A CE1   1 
ATOM 2381  C CE2   . TYR A 1  305 ? 124.479 14.339   26.002  1.00 0.00 ? 305  TYR A CE2   1 
ATOM 2382  C CZ    . TYR A 1  305 ? 124.667 15.706   25.742  1.00 0.00 ? 305  TYR A CZ    1 
ATOM 2383  O OH    . TYR A 1  305 ? 124.523 16.209   24.431  1.00 0.00 ? 305  TYR A OH    1 
ATOM 2384  N N     . ILE A 1  306 ? 126.452 14.070   32.589  1.00 0.00 ? 306  ILE A N     1 
ATOM 2385  C CA    . ILE A 1  306 ? 126.076 14.545   33.918  1.00 0.00 ? 306  ILE A CA    1 
ATOM 2386  C C     . ILE A 1  306 ? 127.103 15.480   34.541  1.00 0.00 ? 306  ILE A C     1 
ATOM 2387  O O     . ILE A 1  306 ? 128.300 15.208   34.549  1.00 0.00 ? 306  ILE A O     1 
ATOM 2388  C CB    . ILE A 1  306 ? 125.775 13.372   34.860  1.00 0.00 ? 306  ILE A CB    1 
ATOM 2389  C CG1   . ILE A 1  306 ? 124.661 12.461   34.292  1.00 0.00 ? 306  ILE A CG1   1 
ATOM 2390  C CG2   . ILE A 1  306 ? 125.377 13.849   36.273  1.00 0.00 ? 306  ILE A CG2   1 
ATOM 2391  C CD1   . ILE A 1  306 ? 124.746 11.027   34.828  1.00 0.00 ? 306  ILE A CD1   1 
ATOM 2392  N N     . HIS A 1  307 ? 126.640 16.635   35.082  1.00 0.00 ? 307  HIS A N     1 
ATOM 2393  C CA    . HIS A 1  307 ? 127.490 17.632   35.702  1.00 0.00 ? 307  HIS A CA    1 
ATOM 2394  C C     . HIS A 1  307 ? 128.116 17.137   36.983  1.00 0.00 ? 307  HIS A C     1 
ATOM 2395  O O     . HIS A 1  307 ? 129.256 17.474   37.291  1.00 0.00 ? 307  HIS A O     1 
ATOM 2396  C CB    . HIS A 1  307 ? 126.744 18.953   36.012  1.00 0.00 ? 307  HIS A CB    1 
ATOM 2397  C CG    . HIS A 1  307 ? 127.647 20.049   36.527  1.00 0.00 ? 307  HIS A CG    1 
ATOM 2398  N ND1   . HIS A 1  307 ? 128.854 20.400   35.958  1.00 0.00 ? 307  HIS A ND1   1 
ATOM 2399  C CD2   . HIS A 1  307 ? 127.507 20.854   37.614  1.00 0.00 ? 307  HIS A CD2   1 
ATOM 2400  C CE1   . HIS A 1  307 ? 129.378 21.388   36.725  1.00 0.00 ? 307  HIS A CE1   1 
ATOM 2401  N NE2   . HIS A 1  307 ? 128.596 21.697   37.739  1.00 0.00 ? 307  HIS A NE2   1 
ATOM 2402  N N     . ILE A 1  308 ? 127.360 16.340   37.769  1.00 0.00 ? 308  ILE A N     1 
ATOM 2403  C CA    . ILE A 1  308 ? 127.786 15.784   39.032  1.00 0.00 ? 308  ILE A CA    1 
ATOM 2404  C C     . ILE A 1  308 ? 128.872 14.745   38.829  1.00 0.00 ? 308  ILE A C     1 
ATOM 2405  O O     . ILE A 1  308 ? 129.849 14.719   39.575  1.00 0.00 ? 308  ILE A O     1 
ATOM 2406  C CB    . ILE A 1  308 ? 126.630 15.189   39.835  1.00 0.00 ? 308  ILE A CB    1 
ATOM 2407  C CG1   . ILE A 1  308 ? 125.369 16.092   39.749  1.00 0.00 ? 308  ILE A CG1   1 
ATOM 2408  C CG2   . ILE A 1  308 ? 127.102 15.000   41.296  1.00 0.00 ? 308  ILE A CG2   1 
ATOM 2409  C CD1   . ILE A 1  308 ? 124.160 15.557   40.526  1.00 0.00 ? 308  ILE A CD1   1 
ATOM 2410  N N     . PHE A 1  309 ? 128.736 13.877   37.792  1.00 0.00 ? 309  PHE A N     1 
ATOM 2411  C CA    . PHE A 1  309 ? 129.648 12.769   37.591  1.00 0.00 ? 309  PHE A CA    1 
ATOM 2412  C C     . PHE A 1  309 ? 129.617 12.335   36.140  1.00 0.00 ? 309  PHE A C     1 
ATOM 2413  O O     . PHE A 1  309 ? 128.822 11.484   35.748  1.00 0.00 ? 309  PHE A O     1 
ATOM 2414  C CB    . PHE A 1  309 ? 129.416 11.553   38.546  1.00 0.00 ? 309  PHE A CB    1 
ATOM 2415  C CG    . PHE A 1  309 ? 128.037 11.466   39.176  1.00 0.00 ? 309  PHE A CG    1 
ATOM 2416  C CD1   . PHE A 1  309 ? 126.867 11.305   38.411  1.00 0.00 ? 309  PHE A CD1   1 
ATOM 2417  C CD2   . PHE A 1  309 ? 127.911 11.532   40.578  1.00 0.00 ? 309  PHE A CD2   1 
ATOM 2418  C CE1   . PHE A 1  309 ? 125.613 11.204   39.023  1.00 0.00 ? 309  PHE A CE1   1 
ATOM 2419  C CE2   . PHE A 1  309 ? 126.656 11.445   41.194  1.00 0.00 ? 309  PHE A CE2   1 
ATOM 2420  C CZ    . PHE A 1  309 ? 125.505 11.280   40.416  1.00 0.00 ? 309  PHE A CZ    1 
ATOM 2421  N N     . ALA A 1  310 ? 130.504 12.930   35.299  1.00 0.00 ? 310  ALA A N     1 
ATOM 2422  C CA    . ALA A 1  310 ? 130.660 12.554   33.912  1.00 0.00 ? 310  ALA A CA    1 
ATOM 2423  C C     . ALA A 1  310 ? 131.922 13.145   33.338  1.00 0.00 ? 310  ALA A C     1 
ATOM 2424  O O     . ALA A 1  310 ? 132.690 13.799   34.035  1.00 0.00 ? 310  ALA A O     1 
ATOM 2425  C CB    . ALA A 1  310 ? 129.505 12.971   33.004  1.00 0.00 ? 310  ALA A CB    1 
ATOM 2426  N N     . PHE A 1  311 ? 132.183 12.890   32.031  1.00 0.00 ? 311  PHE A N     1 
ATOM 2427  C CA    . PHE A 1  311 ? 133.334 13.418   31.338  1.00 0.00 ? 311  PHE A CA    1 
ATOM 2428  C C     . PHE A 1  311 ? 133.147 14.845   30.873  1.00 0.00 ? 311  PHE A C     1 
ATOM 2429  O O     . PHE A 1  311 ? 133.946 15.702   31.246  1.00 0.00 ? 311  PHE A O     1 
ATOM 2430  C CB    . PHE A 1  311 ? 133.639 12.598   30.057  1.00 0.00 ? 311  PHE A CB    1 
ATOM 2431  C CG    . PHE A 1  311 ? 134.478 11.383   30.356  1.00 0.00 ? 311  PHE A CG    1 
ATOM 2432  C CD1   . PHE A 1  311 ? 133.914 10.103   30.503  1.00 0.00 ? 311  PHE A CD1   1 
ATOM 2433  C CD2   . PHE A 1  311 ? 135.876 11.517   30.407  1.00 0.00 ? 311  PHE A CD2   1 
ATOM 2434  C CE1   . PHE A 1  311 ? 134.736 8.977    30.641  1.00 0.00 ? 311  PHE A CE1   1 
ATOM 2435  C CE2   . PHE A 1  311 ? 136.699 10.396   30.563  1.00 0.00 ? 311  PHE A CE2   1 
ATOM 2436  C CZ    . PHE A 1  311 ? 136.128 9.122    30.669  1.00 0.00 ? 311  PHE A CZ    1 
ATOM 2437  N N     . VAL A 1  312 ? 132.119 15.130   30.023  1.00 0.00 ? 312  VAL A N     1 
ATOM 2438  C CA    . VAL A 1  312 ? 132.096 16.338   29.209  1.00 0.00 ? 312  VAL A CA    1 
ATOM 2439  C C     . VAL A 1  312 ? 131.881 17.602   29.995  1.00 0.00 ? 312  VAL A C     1 
ATOM 2440  O O     . VAL A 1  312 ? 132.486 18.626   29.687  1.00 0.00 ? 312  VAL A O     1 
ATOM 2441  C CB    . VAL A 1  312 ? 131.165 16.320   27.987  1.00 0.00 ? 312  VAL A CB    1 
ATOM 2442  C CG1   . VAL A 1  312 ? 131.359 14.991   27.232  1.00 0.00 ? 312  VAL A CG1   1 
ATOM 2443  C CG2   . VAL A 1  312 ? 129.682 16.627   28.312  1.00 0.00 ? 312  VAL A CG2   1 
ATOM 2444  N N     . LEU A 1  313 ? 131.001 17.554   31.025  1.00 0.00 ? 313  LEU A N     1 
ATOM 2445  C CA    . LEU A 1  313 ? 130.481 18.733   31.675  1.00 0.00 ? 313  LEU A CA    1 
ATOM 2446  C C     . LEU A 1  313 ? 131.235 18.956   32.965  1.00 0.00 ? 313  LEU A C     1 
ATOM 2447  O O     . LEU A 1  313 ? 130.959 19.899   33.703  1.00 0.00 ? 313  LEU A O     1 
ATOM 2448  C CB    . LEU A 1  313 ? 128.956 18.557   31.902  1.00 0.00 ? 313  LEU A CB    1 
ATOM 2449  C CG    . LEU A 1  313 ? 128.127 19.799   32.320  1.00 0.00 ? 313  LEU A CG    1 
ATOM 2450  C CD1   . LEU A 1  313 ? 128.415 21.061   31.485  1.00 0.00 ? 313  LEU A CD1   1 
ATOM 2451  C CD2   . LEU A 1  313 ? 126.622 19.473   32.286  1.00 0.00 ? 313  LEU A CD2   1 
ATOM 2452  N N     . ILE A 1  314 ? 132.254 18.100   33.232  1.00 0.00 ? 314  ILE A N     1 
ATOM 2453  C CA    . ILE A 1  314 ? 133.138 18.210   34.367  1.00 0.00 ? 314  ILE A CA    1 
ATOM 2454  C C     . ILE A 1  314 ? 134.487 18.618   33.856  1.00 0.00 ? 314  ILE A C     1 
ATOM 2455  O O     . ILE A 1  314 ? 135.301 19.167   34.596  1.00 0.00 ? 314  ILE A O     1 
ATOM 2456  C CB    . ILE A 1  314 ? 133.246 16.880   35.095  1.00 0.00 ? 314  ILE A CB    1 
ATOM 2457  C CG1   . ILE A 1  314 ? 131.867 16.599   35.722  1.00 0.00 ? 314  ILE A CG1   1 
ATOM 2458  C CG2   . ILE A 1  314 ? 134.371 16.868   36.154  1.00 0.00 ? 314  ILE A CG2   1 
ATOM 2459  C CD1   . ILE A 1  314 ? 131.871 15.479   36.755  1.00 0.00 ? 314  ILE A CD1   1 
ATOM 2460  N N     . GLN A 1  315 ? 134.751 18.425   32.544  1.00 0.00 ? 315  GLN A N     1 
ATOM 2461  C CA    . GLN A 1  315 ? 136.002 18.830   31.954  1.00 0.00 ? 315  GLN A CA    1 
ATOM 2462  C C     . GLN A 1  315 ? 135.997 20.330   31.802  1.00 0.00 ? 315  GLN A C     1 
ATOM 2463  O O     . GLN A 1  315 ? 137.050 20.965   31.767  1.00 0.00 ? 315  GLN A O     1 
ATOM 2464  C CB    . GLN A 1  315 ? 136.238 18.164   30.577  1.00 0.00 ? 315  GLN A CB    1 
ATOM 2465  C CG    . GLN A 1  315 ? 137.643 18.424   30.004  1.00 0.00 ? 315  GLN A CG    1 
ATOM 2466  C CD    . GLN A 1  315 ? 137.862 17.622   28.716  1.00 0.00 ? 315  GLN A CD    1 
ATOM 2467  O OE1   . GLN A 1  315 ? 137.197 16.610   28.466  1.00 0.00 ? 315  GLN A OE1   1 
ATOM 2468  N NE2   . GLN A 1  315 ? 138.838 18.101   27.885  1.00 0.00 ? 315  GLN A NE2   1 
ATOM 2469  N N     . LEU A 1  316 ? 134.781 20.933   31.760  1.00 0.00 ? 316  LEU A N     1 
ATOM 2470  C CA    . LEU A 1  316 ? 134.607 22.358   31.660  1.00 0.00 ? 316  LEU A CA    1 
ATOM 2471  C C     . LEU A 1  316 ? 134.966 23.023   32.940  1.00 0.00 ? 316  LEU A C     1 
ATOM 2472  O O     . LEU A 1  316 ? 135.625 24.053   32.922  1.00 0.00 ? 316  LEU A O     1 
ATOM 2473  C CB    . LEU A 1  316 ? 133.165 22.826   31.369  1.00 0.00 ? 316  LEU A CB    1 
ATOM 2474  C CG    . LEU A 1  316 ? 132.414 22.002   30.313  1.00 0.00 ? 316  LEU A CG    1 
ATOM 2475  C CD1   . LEU A 1  316 ? 131.116 22.735   29.944  1.00 0.00 ? 316  LEU A CD1   1 
ATOM 2476  C CD2   . LEU A 1  316 ? 133.257 21.690   29.069  1.00 0.00 ? 316  LEU A CD2   1 
ATOM 2477  N N     . VAL A 1  317 ? 134.522 22.443   34.083  1.00 0.00 ? 317  VAL A N     1 
ATOM 2478  C CA    . VAL A 1  317 ? 134.632 23.083   35.369  1.00 0.00 ? 317  VAL A CA    1 
ATOM 2479  C C     . VAL A 1  317 ? 135.999 22.797   35.950  1.00 0.00 ? 317  VAL A C     1 
ATOM 2480  O O     . VAL A 1  317 ? 136.461 23.494   36.851  1.00 0.00 ? 317  VAL A O     1 
ATOM 2481  C CB    . VAL A 1  317 ? 133.485 22.680   36.296  1.00 0.00 ? 317  VAL A CB    1 
ATOM 2482  C CG1   . VAL A 1  317 ? 133.664 21.264   36.885  1.00 0.00 ? 317  VAL A CG1   1 
ATOM 2483  C CG2   . VAL A 1  317 ? 133.297 23.756   37.383  1.00 0.00 ? 317  VAL A CG2   1 
ATOM 2484  N N     . ALA A 1  318 ? 136.698 21.777   35.389  1.00 0.00 ? 318  ALA A N     1 
ATOM 2485  C CA    . ALA A 1  318 ? 138.084 21.483   35.655  1.00 0.00 ? 318  ALA A CA    1 
ATOM 2486  C C     . ALA A 1  318 ? 138.975 22.500   34.988  1.00 0.00 ? 318  ALA A C     1 
ATOM 2487  O O     . ALA A 1  318 ? 139.954 22.958   35.573  1.00 0.00 ? 318  ALA A O     1 
ATOM 2488  C CB    . ALA A 1  318 ? 138.485 20.086   35.157  1.00 0.00 ? 318  ALA A CB    1 
ATOM 2489  N N     . LYS A 1  319 ? 138.634 22.883   33.732  1.00 0.00 ? 319  LYS A N     1 
ATOM 2490  C CA    . LYS A 1  319 ? 139.293 23.927   32.978  1.00 0.00 ? 319  LYS A CA    1 
ATOM 2491  C C     . LYS A 1  319 ? 139.036 25.276   33.613  1.00 0.00 ? 319  LYS A C     1 
ATOM 2492  O O     . LYS A 1  319 ? 139.960 26.073   33.768  1.00 0.00 ? 319  LYS A O     1 
ATOM 2493  C CB    . LYS A 1  319 ? 138.821 23.910   31.496  1.00 0.00 ? 319  LYS A CB    1 
ATOM 2494  C CG    . LYS A 1  319 ? 139.053 25.185   30.656  1.00 0.00 ? 319  LYS A CG    1 
ATOM 2495  C CD    . LYS A 1  319 ? 140.510 25.645   30.496  1.00 0.00 ? 319  LYS A CD    1 
ATOM 2496  C CE    . LYS A 1  319 ? 140.589 27.051   29.883  1.00 0.00 ? 319  LYS A CE    1 
ATOM 2497  N NZ    . LYS A 1  319 ? 141.985 27.541   29.824  1.00 0.00 ? 319  LYS A NZ    1 
ATOM 2498  N N     . ASN A 1  320 ? 137.769 25.552   34.015  1.00 0.00 ? 320  ASN A N     1 
ATOM 2499  C CA    . ASN A 1  320 ? 137.359 26.836   34.535  1.00 0.00 ? 320  ASN A CA    1 
ATOM 2500  C C     . ASN A 1  320 ? 137.907 27.026   35.920  1.00 0.00 ? 320  ASN A C     1 
ATOM 2501  O O     . ASN A 1  320 ? 137.638 26.255   36.840  1.00 0.00 ? 320  ASN A O     1 
ATOM 2502  C CB    . ASN A 1  320 ? 135.822 27.074   34.574  1.00 0.00 ? 320  ASN A CB    1 
ATOM 2503  C CG    . ASN A 1  320 ? 135.185 27.101   33.172  1.00 0.00 ? 320  ASN A CG    1 
ATOM 2504  O OD1   . ASN A 1  320 ? 134.122 26.505   32.962  1.00 0.00 ? 320  ASN A OD1   1 
ATOM 2505  N ND2   . ASN A 1  320 ? 135.833 27.830   32.214  1.00 0.00 ? 320  ASN A ND2   1 
ATOM 2506  N N     . GLU A 1  321 ? 138.727 28.089   36.044  1.00 0.00 ? 321  GLU A N     1 
ATOM 2507  C CA    . GLU A 1  321 ? 139.449 28.502   37.217  1.00 0.00 ? 321  GLU A CA    1 
ATOM 2508  C C     . GLU A 1  321 ? 138.585 28.913   38.402  1.00 0.00 ? 321  GLU A C     1 
ATOM 2509  O O     . GLU A 1  321 ? 138.935 28.474   39.497  1.00 0.00 ? 321  GLU A O     1 
ATOM 2510  C CB    . GLU A 1  321 ? 140.473 29.638   36.922  1.00 0.00 ? 321  GLU A CB    1 
ATOM 2511  C CG    . GLU A 1  321 ? 141.029 29.670   35.477  1.00 0.00 ? 321  GLU A CG    1 
ATOM 2512  C CD    . GLU A 1  321 ? 140.079 30.403   34.520  1.00 0.00 ? 321  GLU A CD    1 
ATOM 2513  O OE1   . GLU A 1  321 ? 139.781 31.597   34.783  1.00 0.00 ? 321  GLU A OE1   1 
ATOM 2514  O OE2   . GLU A 1  321 ? 139.643 29.778   33.515  1.00 0.00 ? 321  GLU A OE2   1 
ATOM 2515  N N     . PRO A 1  322 ? 137.490 29.700   38.328  1.00 0.00 ? 322  PRO A N     1 
ATOM 2516  C CA    . PRO A 1  322 ? 136.846 30.244   39.521  1.00 0.00 ? 322  PRO A CA    1 
ATOM 2517  C C     . PRO A 1  322 ? 136.095 29.177   40.276  1.00 0.00 ? 322  PRO A C     1 
ATOM 2518  O O     . PRO A 1  322 ? 135.553 28.262   39.655  1.00 0.00 ? 322  PRO A O     1 
ATOM 2519  C CB    . PRO A 1  322 ? 135.894 31.336   39.006  1.00 0.00 ? 322  PRO A CB    1 
ATOM 2520  C CG    . PRO A 1  322 ? 135.704 31.035   37.520  1.00 0.00 ? 322  PRO A CG    1 
ATOM 2521  C CD    . PRO A 1  322 ? 137.041 30.418   37.129  1.00 0.00 ? 322  PRO A CD    1 
ATOM 2522  N N     . THR A 1  323 ? 136.116 29.279   41.626  1.00 0.00 ? 323  THR A N     1 
ATOM 2523  C CA    . THR A 1  323 ? 135.645 28.260   42.528  1.00 0.00 ? 323  THR A CA    1 
ATOM 2524  C C     . THR A 1  323 ? 134.498 28.873   43.291  1.00 0.00 ? 323  THR A C     1 
ATOM 2525  O O     . THR A 1  323 ? 134.655 29.888   43.970  1.00 0.00 ? 323  THR A O     1 
ATOM 2526  C CB    . THR A 1  323 ? 136.741 27.748   43.467  1.00 0.00 ? 323  THR A CB    1 
ATOM 2527  O OG1   . THR A 1  323 ? 137.346 28.786   44.237  1.00 0.00 ? 323  THR A OG1   1 
ATOM 2528  C CG2   . THR A 1  323 ? 137.843 27.068   42.623  1.00 0.00 ? 323  THR A CG2   1 
ATOM 2529  N N     . HIS A 1  324 ? 133.296 28.273   43.150  1.00 0.00 ? 324  HIS A N     1 
ATOM 2530  C CA    . HIS A 1  324 ? 132.076 28.796   43.715  1.00 0.00 ? 324  HIS A CA    1 
ATOM 2531  C C     . HIS A 1  324 ? 131.222 27.586   43.977  1.00 0.00 ? 324  HIS A C     1 
ATOM 2532  O O     . HIS A 1  324 ? 131.715 26.575   44.477  1.00 0.00 ? 324  HIS A O     1 
ATOM 2533  C CB    . HIS A 1  324 ? 131.331 29.799   42.788  1.00 0.00 ? 324  HIS A CB    1 
ATOM 2534  C CG    . HIS A 1  324 ? 132.114 31.052   42.505  1.00 0.00 ? 324  HIS A CG    1 
ATOM 2535  N ND1   . HIS A 1  324 ? 133.006 31.199   41.463  1.00 0.00 ? 324  HIS A ND1   1 
ATOM 2536  C CD2   . HIS A 1  324 ? 132.151 32.227   43.192  1.00 0.00 ? 324  HIS A CD2   1 
ATOM 2537  C CE1   . HIS A 1  324 ? 133.536 32.443   41.577  1.00 0.00 ? 324  HIS A CE1   1 
ATOM 2538  N NE2   . HIS A 1  324 ? 133.048 33.104   42.609  1.00 0.00 ? 324  HIS A NE2   1 
ATOM 2539  N N     . ILE A 1  325 ? 129.907 27.672   43.639  1.00 0.00 ? 325  ILE A N     1 
ATOM 2540  C CA    . ILE A 1  325 ? 128.935 26.602   43.703  1.00 0.00 ? 325  ILE A CA    1 
ATOM 2541  C C     . ILE A 1  325 ? 129.335 25.485   42.764  1.00 0.00 ? 325  ILE A C     1 
ATOM 2542  O O     . ILE A 1  325 ? 129.243 24.311   43.121  1.00 0.00 ? 325  ILE A O     1 
ATOM 2543  C CB    . ILE A 1  325 ? 127.505 27.099   43.450  1.00 0.00 ? 325  ILE A CB    1 
ATOM 2544  C CG1   . ILE A 1  325 ? 126.467 25.955   43.594  1.00 0.00 ? 325  ILE A CG1   1 
ATOM 2545  C CG2   . ILE A 1  325 ? 127.388 27.857   42.105  1.00 0.00 ? 325  ILE A CG2   1 
ATOM 2546  C CD1   . ILE A 1  325 ? 125.010 26.429   43.606  1.00 0.00 ? 325  ILE A CD1   1 
ATOM 2547  N N     . ILE A 1  326 ? 129.858 25.847   41.567  1.00 0.00 ? 326  ILE A N     1 
ATOM 2548  C CA    . ILE A 1  326 ? 130.444 24.918   40.639  1.00 0.00 ? 326  ILE A CA    1 
ATOM 2549  C C     . ILE A 1  326 ? 131.929 25.109   40.773  1.00 0.00 ? 326  ILE A C     1 
ATOM 2550  O O     . ILE A 1  326 ? 132.430 26.227   40.893  1.00 0.00 ? 326  ILE A O     1 
ATOM 2551  C CB    . ILE A 1  326 ? 129.951 25.057   39.202  1.00 0.00 ? 326  ILE A CB    1 
ATOM 2552  C CG1   . ILE A 1  326 ? 130.238 26.444   38.569  1.00 0.00 ? 326  ILE A CG1   1 
ATOM 2553  C CG2   . ILE A 1  326 ? 128.443 24.716   39.217  1.00 0.00 ? 326  ILE A CG2   1 
ATOM 2554  C CD1   . ILE A 1  326 ? 129.818 26.538   37.097  1.00 0.00 ? 326  ILE A CD1   1 
ATOM 2555  N N     . CYS A 1  327 ? 132.653 23.975   40.824  1.00 0.00 ? 327  CYS A N     1 
ATOM 2556  C CA    . CYS A 1  327 ? 134.048 23.928   41.166  1.00 0.00 ? 327  CYS A CA    1 
ATOM 2557  C C     . CYS A 1  327 ? 134.483 22.588   40.627  1.00 0.00 ? 327  CYS A C     1 
ATOM 2558  O O     . CYS A 1  327 ? 133.655 21.803   40.168  1.00 0.00 ? 327  CYS A O     1 
ATOM 2559  C CB    . CYS A 1  327 ? 134.252 24.043   42.710  1.00 0.00 ? 327  CYS A CB    1 
ATOM 2560  S SG    . CYS A 1  327 ? 135.979 24.117   43.294  1.00 0.00 ? 327  CYS A SG    1 
ATOM 2561  N N     . LYS A 1  328 ? 135.805 22.291   40.653  1.00 0.00 ? 328  LYS A N     1 
ATOM 2562  C CA    . LYS A 1  328 ? 136.368 21.046   40.174  1.00 0.00 ? 328  LYS A CA    1 
ATOM 2563  C C     . LYS A 1  328 ? 136.343 19.990   41.256  1.00 0.00 ? 328  LYS A C     1 
ATOM 2564  O O     . LYS A 1  328 ? 137.115 19.032   41.234  1.00 0.00 ? 328  LYS A O     1 
ATOM 2565  C CB    . LYS A 1  328 ? 137.798 21.233   39.623  1.00 0.00 ? 328  LYS A CB    1 
ATOM 2566  C CG    . LYS A 1  328 ? 138.826 21.802   40.617  1.00 0.00 ? 328  LYS A CG    1 
ATOM 2567  C CD    . LYS A 1  328 ? 140.235 21.918   40.007  1.00 0.00 ? 328  LYS A CD    1 
ATOM 2568  C CE    . LYS A 1  328 ? 140.349 22.987   38.910  1.00 0.00 ? 328  LYS A CE    1 
ATOM 2569  N NZ    . LYS A 1  328 ? 141.694 22.974   38.292  1.00 0.00 ? 328  LYS A NZ    1 
ATOM 2570  N N     . ILE A 1  329 ? 135.388 20.138   42.210  1.00 0.00 ? 329  ILE A N     1 
ATOM 2571  C CA    . ILE A 1  329 ? 134.997 19.152   43.188  1.00 0.00 ? 329  ILE A CA    1 
ATOM 2572  C C     . ILE A 1  329 ? 134.230 18.049   42.502  1.00 0.00 ? 329  ILE A C     1 
ATOM 2573  O O     . ILE A 1  329 ? 134.195 16.919   42.988  1.00 0.00 ? 329  ILE A O     1 
ATOM 2574  C CB    . ILE A 1  329 ? 134.120 19.746   44.291  1.00 0.00 ? 329  ILE A CB    1 
ATOM 2575  C CG1   . ILE A 1  329 ? 132.825 20.416   43.744  1.00 0.00 ? 329  ILE A CG1   1 
ATOM 2576  C CG2   . ILE A 1  329 ? 135.011 20.711   45.102  1.00 0.00 ? 329  ILE A CG2   1 
ATOM 2577  C CD1   . ILE A 1  329 ? 131.953 21.084   44.811  1.00 0.00 ? 329  ILE A CD1   1 
ATOM 2578  N N     . MET A 1  330 ? 133.619 18.368   41.328  1.00 0.00 ? 330  MET A N     1 
ATOM 2579  C CA    . MET A 1  330 ? 132.908 17.450   40.476  1.00 0.00 ? 330  MET A CA    1 
ATOM 2580  C C     . MET A 1  330 ? 133.873 16.447   39.906  1.00 0.00 ? 330  MET A C     1 
ATOM 2581  O O     . MET A 1  330 ? 133.575 15.258   39.829  1.00 0.00 ? 330  MET A O     1 
ATOM 2582  C CB    . MET A 1  330 ? 132.166 18.159   39.318  1.00 0.00 ? 330  MET A CB    1 
ATOM 2583  C CG    . MET A 1  330 ? 131.236 19.301   39.767  1.00 0.00 ? 330  MET A CG    1 
ATOM 2584  S SD    . MET A 1  330 ? 129.948 18.814   40.956  1.00 0.00 ? 330  MET A SD    1 
ATOM 2585  C CE    . MET A 1  330 ? 129.400 20.519   41.261  1.00 0.00 ? 330  MET A CE    1 
ATOM 2586  N N     . GLY A 1  331 ? 135.084 16.916   39.533  1.00 0.00 ? 331  GLY A N     1 
ATOM 2587  C CA    . GLY A 1  331 ? 136.119 16.019   39.119  1.00 0.00 ? 331  GLY A CA    1 
ATOM 2588  C C     . GLY A 1  331 ? 137.258 16.821   38.605  1.00 0.00 ? 331  GLY A C     1 
ATOM 2589  O O     . GLY A 1  331 ? 137.082 17.909   38.056  1.00 0.00 ? 331  GLY A O     1 
ATOM 2590  N N     . HIS A 1  332 ? 138.476 16.268   38.791  1.00 0.00 ? 332  HIS A N     1 
ATOM 2591  C CA    . HIS A 1  332 ? 139.710 16.928   38.470  1.00 0.00 ? 332  HIS A CA    1 
ATOM 2592  C C     . HIS A 1  332 ? 140.199 16.294   37.203  1.00 0.00 ? 332  HIS A C     1 
ATOM 2593  O O     . HIS A 1  332 ? 140.560 15.120   37.198  1.00 0.00 ? 332  HIS A O     1 
ATOM 2594  C CB    . HIS A 1  332 ? 140.790 16.728   39.565  1.00 0.00 ? 332  HIS A CB    1 
ATOM 2595  C CG    . HIS A 1  332 ? 140.372 17.230   40.925  1.00 0.00 ? 332  HIS A CG    1 
ATOM 2596  N ND1   . HIS A 1  332 ? 139.572 16.529   41.804  1.00 0.00 ? 332  HIS A ND1   1 
ATOM 2597  C CD2   . HIS A 1  332 ? 140.663 18.403   41.551  1.00 0.00 ? 332  HIS A CD2   1 
ATOM 2598  C CE1   . HIS A 1  332 ? 139.424 17.305   42.906  1.00 0.00 ? 332  HIS A CE1   1 
ATOM 2599  N NE2   . HIS A 1  332 ? 140.067 18.451   42.799  1.00 0.00 ? 332  HIS A NE2   1 
ATOM 2600  N N     . TYR A 1  333 ? 140.219 17.075   36.097  1.00 0.00 ? 333  TYR A N     1 
ATOM 2601  C CA    . TYR A 1  333 ? 140.741 16.641   34.823  1.00 0.00 ? 333  TYR A CA    1 
ATOM 2602  C C     . TYR A 1  333 ? 141.905 17.554   34.618  1.00 0.00 ? 333  TYR A C     1 
ATOM 2603  O O     . TYR A 1  333 ? 141.743 18.736   34.316  1.00 0.00 ? 333  TYR A O     1 
ATOM 2604  C CB    . TYR A 1  333 ? 139.751 16.821   33.641  1.00 0.00 ? 333  TYR A CB    1 
ATOM 2605  C CG    . TYR A 1  333 ? 138.733 15.710   33.631  1.00 0.00 ? 333  TYR A CG    1 
ATOM 2606  C CD1   . TYR A 1  333 ? 137.688 15.662   34.572  1.00 0.00 ? 333  TYR A CD1   1 
ATOM 2607  C CD2   . TYR A 1  333 ? 138.825 14.689   32.670  1.00 0.00 ? 333  TYR A CD2   1 
ATOM 2608  C CE1   . TYR A 1  333 ? 136.769 14.605   34.564  1.00 0.00 ? 333  TYR A CE1   1 
ATOM 2609  C CE2   . TYR A 1  333 ? 137.901 13.639   32.651  1.00 0.00 ? 333  TYR A CE2   1 
ATOM 2610  C CZ    . TYR A 1  333 ? 136.875 13.590   33.605  1.00 0.00 ? 333  TYR A CZ    1 
ATOM 2611  O OH    . TYR A 1  333 ? 135.974 12.501   33.626  1.00 0.00 ? 333  TYR A OH    1 
ATOM 2612  N N     . GLU A 1  334 ? 143.118 17.003   34.834  1.00 0.00 ? 334  GLU A N     1 
ATOM 2613  C CA    . GLU A 1  334 ? 144.317 17.788   34.920  1.00 0.00 ? 334  GLU A CA    1 
ATOM 2614  C C     . GLU A 1  334 ? 145.454 16.816   34.798  1.00 0.00 ? 334  GLU A C     1 
ATOM 2615  O O     . GLU A 1  334 ? 145.238 15.605   34.742  1.00 0.00 ? 334  GLU A O     1 
ATOM 2616  C CB    . GLU A 1  334 ? 144.397 18.583   36.252  1.00 0.00 ? 334  GLU A CB    1 
ATOM 2617  C CG    . GLU A 1  334 ? 144.906 20.027   36.073  1.00 0.00 ? 334  GLU A CG    1 
ATOM 2618  C CD    . GLU A 1  334 ? 144.682 20.864   37.338  1.00 0.00 ? 334  GLU A CD    1 
ATOM 2619  O OE1   . GLU A 1  334 ? 144.165 20.320   38.353  1.00 0.00 ? 334  GLU A OE1   1 
ATOM 2620  O OE2   . GLU A 1  334 ? 145.018 22.077   37.294  1.00 0.00 ? 334  GLU A OE2   1 
ATOM 2621  N N     . ASN A 1  335 ? 146.710 17.330   34.756  1.00 0.00 ? 335  ASN A N     1 
ATOM 2622  C CA    . ASN A 1  335 ? 147.920 16.535   34.857  1.00 0.00 ? 335  ASN A CA    1 
ATOM 2623  C C     . ASN A 1  335 ? 147.981 15.807   36.182  1.00 0.00 ? 335  ASN A C     1 
ATOM 2624  O O     . ASN A 1  335 ? 147.415 16.255   37.180  1.00 0.00 ? 335  ASN A O     1 
ATOM 2625  C CB    . ASN A 1  335 ? 149.230 17.348   34.690  1.00 0.00 ? 335  ASN A CB    1 
ATOM 2626  C CG    . ASN A 1  335 ? 149.294 17.906   33.263  1.00 0.00 ? 335  ASN A CG    1 
ATOM 2627  O OD1   . ASN A 1  335 ? 149.592 17.160   32.322  1.00 0.00 ? 335  ASN A OD1   1 
ATOM 2628  N ND2   . ASN A 1  335 ? 149.002 19.233   33.108  1.00 0.00 ? 335  ASN A ND2   1 
ATOM 2629  N N     . ALA A 1  336 ? 148.654 14.632   36.191  1.00 0.00 ? 336  ALA A N     1 
ATOM 2630  C CA    . ALA A 1  336 ? 148.673 13.744   37.325  1.00 0.00 ? 336  ALA A CA    1 
ATOM 2631  C C     . ALA A 1  336 ? 150.094 13.342   37.578  1.00 0.00 ? 336  ALA A C     1 
ATOM 2632  O O     . ALA A 1  336 ? 150.960 13.469   36.712  1.00 0.00 ? 336  ALA A O     1 
ATOM 2633  C CB    . ALA A 1  336 ? 147.860 12.457   37.080  1.00 0.00 ? 336  ALA A CB    1 
ATOM 2634  N N     . ASN A 1  337 ? 150.347 12.848   38.816  1.00 0.00 ? 337  ASN A N     1 
ATOM 2635  C CA    . ASN A 1  337 ? 151.614 12.312   39.268  1.00 0.00 ? 337  ASN A CA    1 
ATOM 2636  C C     . ASN A 1  337 ? 151.906 11.017   38.555  1.00 0.00 ? 337  ASN A C     1 
ATOM 2637  O O     . ASN A 1  337 ? 153.057 10.729   38.230  1.00 0.00 ? 337  ASN A O     1 
ATOM 2638  C CB    . ASN A 1  337 ? 151.625 12.007   40.789  1.00 0.00 ? 337  ASN A CB    1 
ATOM 2639  C CG    . ASN A 1  337 ? 151.489 13.290   41.626  1.00 0.00 ? 337  ASN A CG    1 
ATOM 2640  O OD1   . ASN A 1  337 ? 151.570 14.415   41.119  1.00 0.00 ? 337  ASN A OD1   1 
ATOM 2641  N ND2   . ASN A 1  337 ? 151.286 13.088   42.966  1.00 0.00 ? 337  ASN A ND2   1 
ATOM 2642  N N     . ASN A 1  338 ? 150.834 10.221   38.309  1.00 0.00 ? 338  ASN A N     1 
ATOM 2643  C CA    . ASN A 1  338 ? 150.818 8.940    37.635  1.00 0.00 ? 338  ASN A CA    1 
ATOM 2644  C C     . ASN A 1  338 ? 151.505 8.949    36.290  1.00 0.00 ? 338  ASN A C     1 
ATOM 2645  O O     . ASN A 1  338 ? 151.652 9.992    35.651  1.00 0.00 ? 338  ASN A O     1 
ATOM 2646  C CB    . ASN A 1  338 ? 149.379 8.405    37.408  1.00 0.00 ? 338  ASN A CB    1 
ATOM 2647  C CG    . ASN A 1  338 ? 148.607 8.347    38.737  1.00 0.00 ? 338  ASN A CG    1 
ATOM 2648  O OD1   . ASN A 1  338 ? 149.112 7.822    39.736  1.00 0.00 ? 338  ASN A OD1   1 
ATOM 2649  N ND2   . ASN A 1  338 ? 147.355 8.901    38.729  1.00 0.00 ? 338  ASN A ND2   1 
ATOM 2650  N N     . LEU A 1  339 ? 151.938 7.742    35.844  1.00 0.00 ? 339  LEU A N     1 
ATOM 2651  C CA    . LEU A 1  339 ? 152.622 7.494    34.594  1.00 0.00 ? 339  LEU A CA    1 
ATOM 2652  C C     . LEU A 1  339 ? 151.748 7.841    33.413  1.00 0.00 ? 339  LEU A C     1 
ATOM 2653  O O     . LEU A 1  339 ? 152.219 8.421    32.435  1.00 0.00 ? 339  LEU A O     1 
ATOM 2654  C CB    . LEU A 1  339 ? 153.047 6.010    34.449  1.00 0.00 ? 339  LEU A CB    1 
ATOM 2655  C CG    . LEU A 1  339 ? 153.989 5.492    35.565  1.00 0.00 ? 339  LEU A CG    1 
ATOM 2656  C CD1   . LEU A 1  339 ? 154.232 3.975    35.423  1.00 0.00 ? 339  LEU A CD1   1 
ATOM 2657  C CD2   . LEU A 1  339 ? 155.331 6.249    35.620  1.00 0.00 ? 339  LEU A CD2   1 
ATOM 2658  N N     . LEU A 1  340 ? 150.439 7.511    33.512  1.00 0.00 ? 340  LEU A N     1 
ATOM 2659  C CA    . LEU A 1  340 ? 149.446 7.798    32.510  1.00 0.00 ? 340  LEU A CA    1 
ATOM 2660  C C     . LEU A 1  340 ? 148.465 8.687    33.218  1.00 0.00 ? 340  LEU A C     1 
ATOM 2661  O O     . LEU A 1  340 ? 147.985 8.349    34.300  1.00 0.00 ? 340  LEU A O     1 
ATOM 2662  C CB    . LEU A 1  340 ? 148.796 6.484    31.998  1.00 0.00 ? 340  LEU A CB    1 
ATOM 2663  C CG    . LEU A 1  340 ? 147.711 6.583    30.891  1.00 0.00 ? 340  LEU A CG    1 
ATOM 2664  C CD1   . LEU A 1  340 ? 146.301 6.867    31.445  1.00 0.00 ? 340  LEU A CD1   1 
ATOM 2665  C CD2   . LEU A 1  340 ? 148.092 7.537    29.741  1.00 0.00 ? 340  LEU A CD2   1 
ATOM 2666  N N     . ALA A 1  341 ? 148.171 9.868    32.619  1.00 0.00 ? 341  ALA A N     1 
ATOM 2667  C CA    . ALA A 1  341 ? 147.404 10.906   33.259  1.00 0.00 ? 341  ALA A CA    1 
ATOM 2668  C C     . ALA A 1  341 ? 146.096 11.062   32.539  1.00 0.00 ? 341  ALA A C     1 
ATOM 2669  O O     . ALA A 1  341 ? 146.045 11.403   31.359  1.00 0.00 ? 341  ALA A O     1 
ATOM 2670  C CB    . ALA A 1  341 ? 148.126 12.266   33.255  1.00 0.00 ? 341  ALA A CB    1 
ATOM 2671  N N     . VAL A 1  342 ? 145.011 10.801   33.298  1.00 0.00 ? 342  VAL A N     1 
ATOM 2672  C CA    . VAL A 1  342 ? 143.609 10.889   32.951  1.00 0.00 ? 342  VAL A CA    1 
ATOM 2673  C C     . VAL A 1  342 ? 143.015 11.306   34.303  1.00 0.00 ? 342  VAL A C     1 
ATOM 2674  O O     . VAL A 1  342 ? 143.842 11.477   35.201  1.00 0.00 ? 342  VAL A O     1 
ATOM 2675  C CB    . VAL A 1  342 ? 143.055 9.591    32.353  1.00 0.00 ? 342  VAL A CB    1 
ATOM 2676  C CG1   . VAL A 1  342 ? 143.659 9.351    30.951  1.00 0.00 ? 342  VAL A CG1   1 
ATOM 2677  C CG2   . VAL A 1  342 ? 143.273 8.405    33.318  1.00 0.00 ? 342  VAL A CG2   1 
ATOM 2678  N N     . PRO A 1  343 ? 141.721 11.577   34.596  1.00 0.00 ? 343  PRO A N     1 
ATOM 2679  C CA    . PRO A 1  343 ? 141.302 12.228   35.841  1.00 0.00 ? 343  PRO A CA    1 
ATOM 2680  C C     . PRO A 1  343 ? 141.744 11.487   37.085  1.00 0.00 ? 343  PRO A C     1 
ATOM 2681  O O     . PRO A 1  343 ? 141.475 10.291   37.198  1.00 0.00 ? 343  PRO A O     1 
ATOM 2682  C CB    . PRO A 1  343 ? 139.774 12.324   35.753  1.00 0.00 ? 343  PRO A CB    1 
ATOM 2683  C CG    . PRO A 1  343 ? 139.378 11.173   34.830  1.00 0.00 ? 343  PRO A CG    1 
ATOM 2684  C CD    . PRO A 1  343 ? 140.553 11.098   33.850  1.00 0.00 ? 343  PRO A CD    1 
ATOM 2685  N N     . THR A 1  344 ? 142.472 12.191   37.990  1.00 0.00 ? 344  THR A N     1 
ATOM 2686  C CA    . THR A 1  344 ? 143.190 11.590   39.095  1.00 0.00 ? 344  THR A CA    1 
ATOM 2687  C C     . THR A 1  344 ? 142.237 11.064   40.136  1.00 0.00 ? 344  THR A C     1 
ATOM 2688  O O     . THR A 1  344 ? 142.321 9.901    40.532  1.00 0.00 ? 344  THR A O     1 
ATOM 2689  C CB    . THR A 1  344 ? 144.146 12.579   39.747  1.00 0.00 ? 344  THR A CB    1 
ATOM 2690  O OG1   . THR A 1  344 ? 144.984 13.160   38.755  1.00 0.00 ? 344  THR A OG1   1 
ATOM 2691  C CG2   . THR A 1  344 ? 145.030 11.864   40.792  1.00 0.00 ? 344  THR A CG2   1 
ATOM 2692  N N     . PHE A 1  345 ? 141.266 11.907   40.554  1.00 0.00 ? 345  PHE A N     1 
ATOM 2693  C CA    . PHE A 1  345 ? 140.188 11.481   41.404  1.00 0.00 ? 345  PHE A CA    1 
ATOM 2694  C C     . PHE A 1  345 ? 139.030 12.346   40.990  1.00 0.00 ? 345  PHE A C     1 
ATOM 2695  O O     . PHE A 1  345 ? 139.029 13.538   41.295  1.00 0.00 ? 345  PHE A O     1 
ATOM 2696  C CB    . PHE A 1  345 ? 140.453 11.680   42.924  1.00 0.00 ? 345  PHE A CB    1 
ATOM 2697  C CG    . PHE A 1  345 ? 139.308 11.117   43.738  1.00 0.00 ? 345  PHE A CG    1 
ATOM 2698  C CD1   . PHE A 1  345 ? 139.134 9.726    43.845  1.00 0.00 ? 345  PHE A CD1   1 
ATOM 2699  C CD2   . PHE A 1  345 ? 138.359 11.968   44.334  1.00 0.00 ? 345  PHE A CD2   1 
ATOM 2700  C CE1   . PHE A 1  345 ? 138.037 9.195    44.535  1.00 0.00 ? 345  PHE A CE1   1 
ATOM 2701  C CE2   . PHE A 1  345 ? 137.260 11.440   45.024  1.00 0.00 ? 345  PHE A CE2   1 
ATOM 2702  C CZ    . PHE A 1  345 ? 137.100 10.052   45.126  1.00 0.00 ? 345  PHE A CZ    1 
ATOM 2703  N N     . PRO A 1  346 ? 138.027 11.793   40.331  1.00 0.00 ? 346  PRO A N     1 
ATOM 2704  C CA    . PRO A 1  346 ? 136.817 12.535   40.051  1.00 0.00 ? 346  PRO A CA    1 
ATOM 2705  C C     . PRO A 1  346 ? 135.726 11.904   40.876  1.00 0.00 ? 346  PRO A C     1 
ATOM 2706  O O     . PRO A 1  346 ? 135.994 10.946   41.601  1.00 0.00 ? 346  PRO A O     1 
ATOM 2707  C CB    . PRO A 1  346 ? 136.627 12.282   38.552  1.00 0.00 ? 346  PRO A CB    1 
ATOM 2708  C CG    . PRO A 1  346 ? 137.093 10.836   38.357  1.00 0.00 ? 346  PRO A CG    1 
ATOM 2709  C CD    . PRO A 1  346 ? 138.254 10.725   39.343  1.00 0.00 ? 346  PRO A CD    1 
ATOM 2710  N N     . LEU A 1  347 ? 134.477 12.417   40.746  1.00 0.00 ? 347  LEU A N     1 
ATOM 2711  C CA    . LEU A 1  347 ? 133.288 11.763   41.255  1.00 0.00 ? 347  LEU A CA    1 
ATOM 2712  C C     . LEU A 1  347 ? 132.771 10.871   40.156  1.00 0.00 ? 347  LEU A C     1 
ATOM 2713  O O     . LEU A 1  347 ? 131.837 10.098   40.365  1.00 0.00 ? 347  LEU A O     1 
ATOM 2714  C CB    . LEU A 1  347 ? 132.133 12.750   41.571  1.00 0.00 ? 347  LEU A CB    1 
ATOM 2715  C CG    . LEU A 1  347 ? 132.420 13.762   42.702  1.00 0.00 ? 347  LEU A CG    1 
ATOM 2716  C CD1   . LEU A 1  347 ? 131.230 14.730   42.862  1.00 0.00 ? 347  LEU A CD1   1 
ATOM 2717  C CD2   . LEU A 1  347 ? 132.750 13.074   44.041  1.00 0.00 ? 347  LEU A CD2   1 
ATOM 2718  N N     . SER A 1  348 ? 133.411 10.959   38.962  1.00 0.00 ? 348  SER A N     1 
ATOM 2719  C CA    . SER A 1  348 ? 133.154 10.180   37.783  1.00 0.00 ? 348  SER A CA    1 
ATOM 2720  C C     . SER A 1  348 ? 133.774 8.820    37.943  1.00 0.00 ? 348  SER A C     1 
ATOM 2721  O O     . SER A 1  348 ? 134.802 8.508    37.347  1.00 0.00 ? 348  SER A O     1 
ATOM 2722  C CB    . SER A 1  348 ? 133.720 10.833   36.502  1.00 0.00 ? 348  SER A CB    1 
ATOM 2723  O OG    . SER A 1  348 ? 133.344 12.197   36.433  1.00 0.00 ? 348  SER A OG    1 
ATOM 2724  N N     . LEU A 1  349 ? 133.112 7.963    38.747  1.00 0.00 ? 349  LEU A N     1 
ATOM 2725  C CA    . LEU A 1  349 ? 133.403 6.556    38.845  1.00 0.00 ? 349  LEU A CA    1 
ATOM 2726  C C     . LEU A 1  349 ? 132.415 5.888    37.916  1.00 0.00 ? 349  LEU A C     1 
ATOM 2727  O O     . LEU A 1  349 ? 132.407 4.670    37.760  1.00 0.00 ? 349  LEU A O     1 
ATOM 2728  C CB    . LEU A 1  349 ? 133.183 5.978    40.265  1.00 0.00 ? 349  LEU A CB    1 
ATOM 2729  C CG    . LEU A 1  349 ? 134.230 6.370    41.340  1.00 0.00 ? 349  LEU A CG    1 
ATOM 2730  C CD1   . LEU A 1  349 ? 134.200 7.853    41.761  1.00 0.00 ? 349  LEU A CD1   1 
ATOM 2731  C CD2   . LEU A 1  349 ? 134.072 5.464    42.579  1.00 0.00 ? 349  LEU A CD2   1 
ATOM 2732  N N     . LEU A 1  350 ? 131.595 6.729    37.238  1.00 0.00 ? 350  LEU A N     1 
ATOM 2733  C CA    . LEU A 1  350 ? 130.682 6.397    36.185  1.00 0.00 ? 350  LEU A CA    1 
ATOM 2734  C C     . LEU A 1  350 ? 131.455 6.441    34.895  1.00 0.00 ? 350  LEU A C     1 
ATOM 2735  O O     . LEU A 1  350 ? 130.937 6.011    33.870  1.00 0.00 ? 350  LEU A O     1 
ATOM 2736  C CB    . LEU A 1  350 ? 129.573 7.468    36.036  1.00 0.00 ? 350  LEU A CB    1 
ATOM 2737  C CG    . LEU A 1  350 ? 128.394 7.360    37.027  1.00 0.00 ? 350  LEU A CG    1 
ATOM 2738  C CD1   . LEU A 1  350 ? 128.777 7.521    38.511  1.00 0.00 ? 350  LEU A CD1   1 
ATOM 2739  C CD2   . LEU A 1  350 ? 127.322 8.385    36.625  1.00 0.00 ? 350  LEU A CD2   1 
ATOM 2740  N N     . ALA A 1  351 ? 132.715 6.957    34.927  1.00 0.00 ? 351  ALA A N     1 
ATOM 2741  C CA    . ALA A 1  351 ? 133.617 6.985    33.805  1.00 0.00 ? 351  ALA A CA    1 
ATOM 2742  C C     . ALA A 1  351 ? 134.205 5.604    33.602  1.00 0.00 ? 351  ALA A C     1 
ATOM 2743  O O     . ALA A 1  351 ? 134.851 5.106    34.525  1.00 0.00 ? 351  ALA A O     1 
ATOM 2744  C CB    . ALA A 1  351 ? 134.804 7.945    34.018  1.00 0.00 ? 351  ALA A CB    1 
ATOM 2745  N N     . PRO A 1  352 ? 134.039 4.947    32.451  1.00 0.00 ? 352  PRO A N     1 
ATOM 2746  C CA    . PRO A 1  352 ? 134.551 3.602    32.246  1.00 0.00 ? 352  PRO A CA    1 
ATOM 2747  C C     . PRO A 1  352 ? 136.071 3.576    32.180  1.00 0.00 ? 352  PRO A C     1 
ATOM 2748  O O     . PRO A 1  352 ? 136.619 4.554    31.670  1.00 0.00 ? 352  PRO A O     1 
ATOM 2749  C CB    . PRO A 1  352 ? 133.955 3.131    30.910  1.00 0.00 ? 352  PRO A CB    1 
ATOM 2750  C CG    . PRO A 1  352 ? 133.059 4.269    30.398  1.00 0.00 ? 352  PRO A CG    1 
ATOM 2751  C CD    . PRO A 1  352 ? 132.890 5.194    31.586  1.00 0.00 ? 352  PRO A CD    1 
ATOM 2752  N N     . PRO A 1  353 ? 136.774 2.551    32.664  1.00 0.00 ? 353  PRO A N     1 
ATOM 2753  C CA    . PRO A 1  353 ? 138.204 2.647    32.922  1.00 0.00 ? 353  PRO A CA    1 
ATOM 2754  C C     . PRO A 1  353 ? 139.016 2.168    31.744  1.00 0.00 ? 353  PRO A C     1 
ATOM 2755  O O     . PRO A 1  353 ? 140.239 2.295    31.798  1.00 0.00 ? 353  PRO A O     1 
ATOM 2756  C CB    . PRO A 1  353 ? 138.435 1.689    34.104  1.00 0.00 ? 353  PRO A CB    1 
ATOM 2757  C CG    . PRO A 1  353 ? 137.319 0.647    33.982  1.00 0.00 ? 353  PRO A CG    1 
ATOM 2758  C CD    . PRO A 1  353 ? 136.156 1.487    33.463  1.00 0.00 ? 353  PRO A CD    1 
ATOM 2759  N N     . THR A 1  354 ? 138.385 1.583    30.699  1.00 0.00 ? 354  THR A N     1 
ATOM 2760  C CA    . THR A 1  354 ? 139.083 0.924    29.615  1.00 0.00 ? 354  THR A CA    1 
ATOM 2761  C C     . THR A 1  354 ? 139.688 1.934    28.648  1.00 0.00 ? 354  THR A C     1 
ATOM 2762  O O     . THR A 1  354 ? 139.354 3.117    28.670  1.00 0.00 ? 354  THR A O     1 
ATOM 2763  C CB    . THR A 1  354 ? 138.194 -0.117   28.936  1.00 0.00 ? 354  THR A CB    1 
ATOM 2764  O OG1   . THR A 1  354 ? 138.927 -0.955   28.049  1.00 0.00 ? 354  THR A OG1   1 
ATOM 2765  C CG2   . THR A 1  354 ? 137.015 0.542    28.191  1.00 0.00 ? 354  THR A CG2   1 
ATOM 2766  N N     . SER A 1  355 ? 140.640 1.463    27.809  1.00 0.00 ? 355  SER A N     1 
ATOM 2767  C CA    . SER A 1  355 ? 141.343 2.223    26.800  1.00 0.00 ? 355  SER A CA    1 
ATOM 2768  C C     . SER A 1  355 ? 141.857 1.180    25.843  1.00 0.00 ? 355  SER A C     1 
ATOM 2769  O O     . SER A 1  355 ? 141.601 -0.007   26.040  1.00 0.00 ? 355  SER A O     1 
ATOM 2770  C CB    . SER A 1  355 ? 142.528 3.069    27.332  1.00 0.00 ? 355  SER A CB    1 
ATOM 2771  O OG    . SER A 1  355 ? 142.056 4.216    28.024  1.00 0.00 ? 355  SER A OG    1 
ATOM 2772  N N     . PHE A 1  356 ? 142.563 1.617    24.762  1.00 0.00 ? 356  PHE A N     1 
ATOM 2773  C CA    . PHE A 1  356 ? 143.180 0.801    23.725  1.00 0.00 ? 356  PHE A CA    1 
ATOM 2774  C C     . PHE A 1  356 ? 144.430 0.109    24.246  1.00 0.00 ? 356  PHE A C     1 
ATOM 2775  O O     . PHE A 1  356 ? 145.552 0.331    23.795  1.00 0.00 ? 356  PHE A O     1 
ATOM 2776  C CB    . PHE A 1  356 ? 143.480 1.612    22.418  1.00 0.00 ? 356  PHE A CB    1 
ATOM 2777  C CG    . PHE A 1  356 ? 144.392 2.813    22.601  1.00 0.00 ? 356  PHE A CG    1 
ATOM 2778  C CD1   . PHE A 1  356 ? 143.953 3.973    23.267  1.00 0.00 ? 356  PHE A CD1   1 
ATOM 2779  C CD2   . PHE A 1  356 ? 145.704 2.794    22.085  1.00 0.00 ? 356  PHE A CD2   1 
ATOM 2780  C CE1   . PHE A 1  356 ? 144.816 5.056    23.466  1.00 0.00 ? 356  PHE A CE1   1 
ATOM 2781  C CE2   . PHE A 1  356 ? 146.566 3.881    22.273  1.00 0.00 ? 356  PHE A CE2   1 
ATOM 2782  C CZ    . PHE A 1  356 ? 146.124 5.011    22.970  1.00 0.00 ? 356  PHE A CZ    1 
ATOM 2783  N N     . PHE A 1  357 ? 144.227 -0.754   25.256  1.00 0.00 ? 357  PHE A N     1 
ATOM 2784  C CA    . PHE A 1  357 ? 145.237 -1.216   26.155  1.00 0.00 ? 357  PHE A CA    1 
ATOM 2785  C C     . PHE A 1  357 ? 144.667 -2.516   26.655  1.00 0.00 ? 357  PHE A C     1 
ATOM 2786  O O     . PHE A 1  357 ? 143.870 -3.165   25.976  1.00 0.00 ? 357  PHE A O     1 
ATOM 2787  C CB    . PHE A 1  357 ? 145.432 -0.190   27.319  1.00 0.00 ? 357  PHE A CB    1 
ATOM 2788  C CG    . PHE A 1  357 ? 146.568 0.750    27.021  1.00 0.00 ? 357  PHE A CG    1 
ATOM 2789  C CD1   . PHE A 1  357 ? 146.375 1.982    26.369  1.00 0.00 ? 357  PHE A CD1   1 
ATOM 2790  C CD2   . PHE A 1  357 ? 147.863 0.398    27.437  1.00 0.00 ? 357  PHE A CD2   1 
ATOM 2791  C CE1   . PHE A 1  357 ? 147.461 2.835    26.128  1.00 0.00 ? 357  PHE A CE1   1 
ATOM 2792  C CE2   . PHE A 1  357 ? 148.946 1.251    27.207  1.00 0.00 ? 357  PHE A CE2   1 
ATOM 2793  C CZ    . PHE A 1  357 ? 148.747 2.470    26.549  1.00 0.00 ? 357  PHE A CZ    1 
ATOM 2794  N N     . LYS A 1  358 ? 145.083 -2.922   27.873  1.00 0.00 ? 358  LYS A N     1 
ATOM 2795  C CA    . LYS A 1  358 ? 144.572 -4.048   28.601  1.00 0.00 ? 358  LYS A CA    1 
ATOM 2796  C C     . LYS A 1  358 ? 143.587 -3.460   29.578  1.00 0.00 ? 358  LYS A C     1 
ATOM 2797  O O     . LYS A 1  358 ? 143.623 -2.261   29.860  1.00 0.00 ? 358  LYS A O     1 
ATOM 2798  C CB    . LYS A 1  358 ? 145.667 -4.793   29.409  1.00 0.00 ? 358  LYS A CB    1 
ATOM 2799  C CG    . LYS A 1  358 ? 146.714 -5.562   28.571  1.00 0.00 ? 358  LYS A CG    1 
ATOM 2800  C CD    . LYS A 1  358 ? 147.742 -4.733   27.770  1.00 0.00 ? 358  LYS A CD    1 
ATOM 2801  C CE    . LYS A 1  358 ? 148.617 -3.801   28.624  1.00 0.00 ? 358  LYS A CE    1 
ATOM 2802  N NZ    . LYS A 1  358 ? 149.633 -3.117   27.787  1.00 0.00 ? 358  LYS A NZ    1 
ATOM 2803  N N     . GLY A 1  359 ? 142.664 -4.300   30.112  1.00 0.00 ? 359  GLY A N     1 
ATOM 2804  C CA    . GLY A 1  359 ? 141.724 -3.917   31.145  1.00 0.00 ? 359  GLY A CA    1 
ATOM 2805  C C     . GLY A 1  359 ? 142.416 -3.541   32.431  1.00 0.00 ? 359  GLY A C     1 
ATOM 2806  O O     . GLY A 1  359 ? 143.614 -3.772   32.597  1.00 0.00 ? 359  GLY A O     1 
ATOM 2807  N N     . VAL A 1  360 ? 141.651 -2.965   33.388  1.00 0.00 ? 360  VAL A N     1 
ATOM 2808  C CA    . VAL A 1  360 ? 142.198 -2.441   34.617  1.00 0.00 ? 360  VAL A CA    1 
ATOM 2809  C C     . VAL A 1  360 ? 141.618 -3.289   35.711  1.00 0.00 ? 360  VAL A C     1 
ATOM 2810  O O     . VAL A 1  360 ? 140.401 -3.362   35.880  1.00 0.00 ? 360  VAL A O     1 
ATOM 2811  C CB    . VAL A 1  360 ? 141.870 -0.968   34.853  1.00 0.00 ? 360  VAL A CB    1 
ATOM 2812  C CG1   . VAL A 1  360 ? 142.547 -0.475   36.153  1.00 0.00 ? 360  VAL A CG1   1 
ATOM 2813  C CG2   . VAL A 1  360 ? 142.358 -0.156   33.634  1.00 0.00 ? 360  VAL A CG2   1 
ATOM 2814  N N     . THR A 1  361 ? 142.515 -3.963   36.467  1.00 0.00 ? 361  THR A N     1 
ATOM 2815  C CA    . THR A 1  361 ? 142.176 -4.842   37.562  1.00 0.00 ? 361  THR A CA    1 
ATOM 2816  C C     . THR A 1  361 ? 142.514 -4.142   38.856  1.00 0.00 ? 361  THR A C     1 
ATOM 2817  O O     . THR A 1  361 ? 142.228 -4.660   39.935  1.00 0.00 ? 361  THR A O     1 
ATOM 2818  C CB    . THR A 1  361 ? 142.974 -6.149   37.517  1.00 0.00 ? 361  THR A CB    1 
ATOM 2819  O OG1   . THR A 1  361 ? 144.363 -5.916   37.292  1.00 0.00 ? 361  THR A OG1   1 
ATOM 2820  C CG2   . THR A 1  361 ? 142.431 -7.056   36.392  1.00 0.00 ? 361  THR A CG2   1 
ATOM 2821  N N     . GLN A 1  362 ? 143.141 -2.943   38.770  1.00 0.00 ? 362  GLN A N     1 
ATOM 2822  C CA    . GLN A 1  362 ? 143.767 -2.287   39.891  1.00 0.00 ? 362  GLN A CA    1 
ATOM 2823  C C     . GLN A 1  362 ? 142.781 -1.523   40.733  1.00 0.00 ? 362  GLN A C     1 
ATOM 2824  O O     . GLN A 1  362 ? 143.077 -1.217   41.887  1.00 0.00 ? 362  GLN A O     1 
ATOM 2825  C CB    . GLN A 1  362 ? 144.861 -1.296   39.426  1.00 0.00 ? 362  GLN A CB    1 
ATOM 2826  C CG    . GLN A 1  362 ? 145.956 -1.931   38.544  1.00 0.00 ? 362  GLN A CG    1 
ATOM 2827  C CD    . GLN A 1  362 ? 146.674 -3.066   39.287  1.00 0.00 ? 362  GLN A CD    1 
ATOM 2828  O OE1   . GLN A 1  362 ? 146.474 -4.247   38.975  1.00 0.00 ? 362  GLN A OE1   1 
ATOM 2829  N NE2   . GLN A 1  362 ? 147.531 -2.691   40.286  1.00 0.00 ? 362  GLN A NE2   1 
ATOM 2830  N N     . GLN A 1  363 ? 141.572 -1.232   40.193  1.00 0.00 ? 363  GLN A N     1 
ATOM 2831  C CA    . GLN A 1  363 ? 140.504 -0.646   40.964  1.00 0.00 ? 363  GLN A CA    1 
ATOM 2832  C C     . GLN A 1  363 ? 139.289 -1.513   40.745  1.00 0.00 ? 363  GLN A C     1 
ATOM 2833  O O     . GLN A 1  363 ? 138.659 -1.406   39.694  1.00 0.00 ? 363  GLN A O     1 
ATOM 2834  C CB    . GLN A 1  363 ? 140.156 0.796    40.519  1.00 0.00 ? 363  GLN A CB    1 
ATOM 2835  C CG    . GLN A 1  363 ? 141.278 1.812    40.802  1.00 0.00 ? 363  GLN A CG    1 
ATOM 2836  C CD    . GLN A 1  363 ? 140.804 3.222    40.417  1.00 0.00 ? 363  GLN A CD    1 
ATOM 2837  O OE1   . GLN A 1  363 ? 139.717 3.651    40.824  1.00 0.00 ? 363  GLN A OE1   1 
ATOM 2838  N NE2   . GLN A 1  363 ? 141.646 3.953    39.624  1.00 0.00 ? 363  GLN A NE2   1 
ATOM 2839  N N     . PRO A 1  364 ? 138.894 -2.355   41.702  1.00 0.00 ? 364  PRO A N     1 
ATOM 2840  C CA    . PRO A 1  364 ? 137.655 -3.108   41.598  1.00 0.00 ? 364  PRO A CA    1 
ATOM 2841  C C     . PRO A 1  364 ? 136.498 -2.267   42.054  1.00 0.00 ? 364  PRO A C     1 
ATOM 2842  O O     . PRO A 1  364 ? 135.371 -2.587   41.694  1.00 0.00 ? 364  PRO A O     1 
ATOM 2843  C CB    . PRO A 1  364 ? 137.822 -4.288   42.571  1.00 0.00 ? 364  PRO A CB    1 
ATOM 2844  C CG    . PRO A 1  364 ? 139.337 -4.458   42.689  1.00 0.00 ? 364  PRO A CG    1 
ATOM 2845  C CD    . PRO A 1  364 ? 139.833 -3.015   42.617  1.00 0.00 ? 364  PRO A CD    1 
ATOM 2846  N N     . LEU A 1  365 ? 136.748 -1.237   42.898  1.00 0.00 ? 365  LEU A N     1 
ATOM 2847  C CA    . LEU A 1  365 ? 135.720 -0.423   43.507  1.00 0.00 ? 365  LEU A CA    1 
ATOM 2848  C C     . LEU A 1  365 ? 135.049 0.454    42.488  1.00 0.00 ? 365  LEU A C     1 
ATOM 2849  O O     . LEU A 1  365 ? 133.833 0.627    42.541  1.00 0.00 ? 365  LEU A O     1 
ATOM 2850  C CB    . LEU A 1  365 ? 136.220 0.474    44.668  1.00 0.00 ? 365  LEU A CB    1 
ATOM 2851  C CG    . LEU A 1  365 ? 136.527 -0.288   45.983  1.00 0.00 ? 365  LEU A CG    1 
ATOM 2852  C CD1   . LEU A 1  365 ? 137.827 -1.117   45.935  1.00 0.00 ? 365  LEU A CD1   1 
ATOM 2853  C CD2   . LEU A 1  365 ? 136.545 0.679    47.183  1.00 0.00 ? 365  LEU A CD2   1 
ATOM 2854  N N     . THR A 1  366 ? 135.826 1.014    41.524  1.00 0.00 ? 366  THR A N     1 
ATOM 2855  C CA    . THR A 1  366 ? 135.287 1.877    40.494  1.00 0.00 ? 366  THR A CA    1 
ATOM 2856  C C     . THR A 1  366 ? 134.540 1.049    39.474  1.00 0.00 ? 366  THR A C     1 
ATOM 2857  O O     . THR A 1  366 ? 133.658 1.563    38.790  1.00 0.00 ? 366  THR A O     1 
ATOM 2858  C CB    . THR A 1  366 ? 136.352 2.742    39.816  1.00 0.00 ? 366  THR A CB    1 
ATOM 2859  O OG1   . THR A 1  366 ? 135.760 3.838    39.125  1.00 0.00 ? 366  THR A OG1   1 
ATOM 2860  C CG2   . THR A 1  366 ? 137.227 1.930    38.834  1.00 0.00 ? 366  THR A CG2   1 
ATOM 2861  N N     . PHE A 1  367 ? 134.877 -0.262   39.371  1.00 0.00 ? 367  PHE A N     1 
ATOM 2862  C CA    . PHE A 1  367 ? 134.253 -1.199   38.475  1.00 0.00 ? 367  PHE A CA    1 
ATOM 2863  C C     . PHE A 1  367 ? 132.855 -1.516   38.942  1.00 0.00 ? 367  PHE A C     1 
ATOM 2864  O O     . PHE A 1  367 ? 131.933 -1.563   38.134  1.00 0.00 ? 367  PHE A O     1 
ATOM 2865  C CB    . PHE A 1  367 ? 135.075 -2.511   38.382  1.00 0.00 ? 367  PHE A CB    1 
ATOM 2866  C CG    . PHE A 1  367 ? 134.725 -3.284   37.141  1.00 0.00 ? 367  PHE A CG    1 
ATOM 2867  C CD1   . PHE A 1  367 ? 133.729 -4.277   37.159  1.00 0.00 ? 367  PHE A CD1   1 
ATOM 2868  C CD2   . PHE A 1  367 ? 135.387 -3.002   35.936  1.00 0.00 ? 367  PHE A CD2   1 
ATOM 2869  C CE1   . PHE A 1  367 ? 133.407 -4.981   35.991  1.00 0.00 ? 367  PHE A CE1   1 
ATOM 2870  C CE2   . PHE A 1  367 ? 135.068 -3.704   34.771  1.00 0.00 ? 367  PHE A CE2   1 
ATOM 2871  C CZ    . PHE A 1  367 ? 134.081 -4.698   34.797  1.00 0.00 ? 367  PHE A CZ    1 
ATOM 2872  N N     . ILE A 1  368 ? 132.685 -1.735   40.271  1.00 0.00 ? 368  ILE A N     1 
ATOM 2873  C CA    . ILE A 1  368 ? 131.440 -2.113   40.905  1.00 0.00 ? 368  ILE A CA    1 
ATOM 2874  C C     . ILE A 1  368 ? 130.450 -0.981   40.826  1.00 0.00 ? 368  ILE A C     1 
ATOM 2875  O O     . ILE A 1  368 ? 129.282 -1.208   40.520  1.00 0.00 ? 368  ILE A O     1 
ATOM 2876  C CB    . ILE A 1  368 ? 131.652 -2.552   42.354  1.00 0.00 ? 368  ILE A CB    1 
ATOM 2877  C CG1   . ILE A 1  368 ? 132.438 -3.887   42.376  1.00 0.00 ? 368  ILE A CG1   1 
ATOM 2878  C CG2   . ILE A 1  368 ? 130.309 -2.701   43.111  1.00 0.00 ? 368  ILE A CG2   1 
ATOM 2879  C CD1   . ILE A 1  368 ? 133.042 -4.222   43.743  1.00 0.00 ? 368  ILE A CD1   1 
ATOM 2880  N N     . THR A 1  369 ? 130.905 0.269    41.088  1.00 0.00 ? 369  THR A N     1 
ATOM 2881  C CA    . THR A 1  369 ? 130.076 1.454    41.051  1.00 0.00 ? 369  THR A CA    1 
ATOM 2882  C C     . THR A 1  369 ? 129.655 1.791    39.638  1.00 0.00 ? 369  THR A C     1 
ATOM 2883  O O     . THR A 1  369 ? 128.535 2.250    39.429  1.00 0.00 ? 369  THR A O     1 
ATOM 2884  C CB    . THR A 1  369 ? 130.717 2.665    41.711  1.00 0.00 ? 369  THR A CB    1 
ATOM 2885  O OG1   . THR A 1  369 ? 132.016 2.914    41.192  1.00 0.00 ? 369  THR A OG1   1 
ATOM 2886  C CG2   . THR A 1  369 ? 130.814 2.420    43.232  1.00 0.00 ? 369  THR A CG2   1 
ATOM 2887  N N     . TYR A 1  370 ? 130.548 1.560    38.639  1.00 0.00 ? 370  TYR A N     1 
ATOM 2888  C CA    . TYR A 1  370 ? 130.283 1.792    37.235  1.00 0.00 ? 370  TYR A CA    1 
ATOM 2889  C C     . TYR A 1  370 ? 129.221 0.839    36.741  1.00 0.00 ? 370  TYR A C     1 
ATOM 2890  O O     . TYR A 1  370 ? 128.291 1.254    36.052  1.00 0.00 ? 370  TYR A O     1 
ATOM 2891  C CB    . TYR A 1  370 ? 131.573 1.623    36.368  1.00 0.00 ? 370  TYR A CB    1 
ATOM 2892  C CG    . TYR A 1  370 ? 131.346 1.773    34.880  1.00 0.00 ? 370  TYR A CG    1 
ATOM 2893  C CD1   . TYR A 1  370 ? 130.475 2.755    34.375  1.00 0.00 ? 370  TYR A CD1   1 
ATOM 2894  C CD2   . TYR A 1  370 ? 131.934 0.865    33.982  1.00 0.00 ? 370  TYR A CD2   1 
ATOM 2895  C CE1   . TYR A 1  370 ? 130.135 2.772    33.022  1.00 0.00 ? 370  TYR A CE1   1 
ATOM 2896  C CE2   . TYR A 1  370 ? 131.607 0.895    32.620  1.00 0.00 ? 370  TYR A CE2   1 
ATOM 2897  C CZ    . TYR A 1  370 ? 130.685 1.836    32.143  1.00 0.00 ? 370  TYR A CZ    1 
ATOM 2898  O OH    . TYR A 1  370 ? 130.297 1.845    30.785  1.00 0.00 ? 370  TYR A OH    1 
ATOM 2899  N N     . SER A 1  371 ? 129.342 -0.461   37.105  1.00 0.00 ? 371  SER A N     1 
ATOM 2900  C CA    . SER A 1  371 ? 128.438 -1.510   36.696  1.00 0.00 ? 371  SER A CA    1 
ATOM 2901  C C     . SER A 1  371 ? 127.084 -1.276   37.294  1.00 0.00 ? 371  SER A C     1 
ATOM 2902  O O     . SER A 1  371 ? 126.074 -1.380   36.607  1.00 0.00 ? 371  SER A O     1 
ATOM 2903  C CB    . SER A 1  371 ? 128.898 -2.920   37.137  1.00 0.00 ? 371  SER A CB    1 
ATOM 2904  O OG    . SER A 1  371 ? 130.113 -3.276   36.495  1.00 0.00 ? 371  SER A OG    1 
ATOM 2905  N N     . ALA A 1  372 ? 127.048 -0.902   38.594  1.00 0.00 ? 372  ALA A N     1 
ATOM 2906  C CA    . ALA A 1  372 ? 125.840 -0.667   39.343  1.00 0.00 ? 372  ALA A CA    1 
ATOM 2907  C C     . ALA A 1  372 ? 125.052 0.471    38.769  1.00 0.00 ? 372  ALA A C     1 
ATOM 2908  O O     . ALA A 1  372 ? 123.831 0.384    38.682  1.00 0.00 ? 372  ALA A O     1 
ATOM 2909  C CB    . ALA A 1  372 ? 126.115 -0.342   40.823  1.00 0.00 ? 372  ALA A CB    1 
ATOM 2910  N N     . PHE A 1  373 ? 125.744 1.561    38.347  1.00 0.00 ? 373  PHE A N     1 
ATOM 2911  C CA    . PHE A 1  373 ? 125.114 2.743    37.815  1.00 0.00 ? 373  PHE A CA    1 
ATOM 2912  C C     . PHE A 1  373 ? 124.424 2.452    36.507  1.00 0.00 ? 373  PHE A C     1 
ATOM 2913  O O     . PHE A 1  373 ? 123.303 2.908    36.310  1.00 0.00 ? 373  PHE A O     1 
ATOM 2914  C CB    . PHE A 1  373 ? 126.101 3.929    37.623  1.00 0.00 ? 373  PHE A CB    1 
ATOM 2915  C CG    . PHE A 1  373 ? 125.352 5.241    37.530  1.00 0.00 ? 373  PHE A CG    1 
ATOM 2916  C CD1   . PHE A 1  373 ? 124.952 5.762    36.286  1.00 0.00 ? 373  PHE A CD1   1 
ATOM 2917  C CD2   . PHE A 1  373 ? 125.012 5.945    38.699  1.00 0.00 ? 373  PHE A CD2   1 
ATOM 2918  C CE1   . PHE A 1  373 ? 124.216 6.953    36.213  1.00 0.00 ? 373  PHE A CE1   1 
ATOM 2919  C CE2   . PHE A 1  373 ? 124.281 7.138    38.629  1.00 0.00 ? 373  PHE A CE2   1 
ATOM 2920  C CZ    . PHE A 1  373 ? 123.877 7.639    37.385  1.00 0.00 ? 373  PHE A CZ    1 
ATOM 2921  N N     . ILE A 1  374 ? 125.063 1.681    35.588  1.00 0.00 ? 374  ILE A N     1 
ATOM 2922  C CA    . ILE A 1  374 ? 124.526 1.477    34.258  1.00 0.00 ? 374  ILE A CA    1 
ATOM 2923  C C     . ILE A 1  374 ? 123.442 0.431    34.233  1.00 0.00 ? 374  ILE A C     1 
ATOM 2924  O O     . ILE A 1  374 ? 122.644 0.418    33.299  1.00 0.00 ? 374  ILE A O     1 
ATOM 2925  C CB    . ILE A 1  374 ? 125.569 1.138    33.199  1.00 0.00 ? 374  ILE A CB    1 
ATOM 2926  C CG1   . ILE A 1  374 ? 126.311 -0.192   33.460  1.00 0.00 ? 374  ILE A CG1   1 
ATOM 2927  C CG2   . ILE A 1  374 ? 126.522 2.342    33.083  1.00 0.00 ? 374  ILE A CG2   1 
ATOM 2928  C CD1   . ILE A 1  374 ? 127.301 -0.559   32.355  1.00 0.00 ? 374  ILE A CD1   1 
ATOM 2929  N N     . LEU A 1  375 ? 123.362 -0.452   35.262  1.00 0.00 ? 375  LEU A N     1 
ATOM 2930  C CA    . LEU A 1  375 ? 122.273 -1.393   35.416  1.00 0.00 ? 375  LEU A CA    1 
ATOM 2931  C C     . LEU A 1  375 ? 121.051 -0.665   35.908  1.00 0.00 ? 375  LEU A C     1 
ATOM 2932  O O     . LEU A 1  375 ? 119.945 -0.952   35.456  1.00 0.00 ? 375  LEU A O     1 
ATOM 2933  C CB    . LEU A 1  375 ? 122.574 -2.568   36.385  1.00 0.00 ? 375  LEU A CB    1 
ATOM 2934  C CG    . LEU A 1  375 ? 123.165 -3.818   35.684  1.00 0.00 ? 375  LEU A CG    1 
ATOM 2935  C CD1   . LEU A 1  375 ? 124.627 -3.663   35.239  1.00 0.00 ? 375  LEU A CD1   1 
ATOM 2936  C CD2   . LEU A 1  375 ? 123.012 -5.079   36.556  1.00 0.00 ? 375  LEU A CD2   1 
ATOM 2937  N N     . VAL A 1  376 ? 121.239 0.300    36.844  1.00 0.00 ? 376  VAL A N     1 
ATOM 2938  C CA    . VAL A 1  376 ? 120.200 1.135    37.413  1.00 0.00 ? 376  VAL A CA    1 
ATOM 2939  C C     . VAL A 1  376 ? 119.640 2.063    36.363  1.00 0.00 ? 376  VAL A C     1 
ATOM 2940  O O     . VAL A 1  376 ? 118.434 2.292    36.322  1.00 0.00 ? 376  VAL A O     1 
ATOM 2941  C CB    . VAL A 1  376 ? 120.686 1.894    38.646  1.00 0.00 ? 376  VAL A CB    1 
ATOM 2942  C CG1   . VAL A 1  376 ? 119.705 3.007    39.078  1.00 0.00 ? 376  VAL A CG1   1 
ATOM 2943  C CG2   . VAL A 1  376 ? 120.858 0.867    39.786  1.00 0.00 ? 376  VAL A CG2   1 
ATOM 2944  N N     . THR A 1  377 ? 120.505 2.599    35.470  1.00 0.00 ? 377  THR A N     1 
ATOM 2945  C CA    . THR A 1  377 ? 120.122 3.488    34.395  1.00 0.00 ? 377  THR A CA    1 
ATOM 2946  C C     . THR A 1  377 ? 119.488 2.683    33.279  1.00 0.00 ? 377  THR A C     1 
ATOM 2947  O O     . THR A 1  377 ? 118.688 3.199    32.500  1.00 0.00 ? 377  THR A O     1 
ATOM 2948  C CB    . THR A 1  377 ? 121.328 4.258    33.875  1.00 0.00 ? 377  THR A CB    1 
ATOM 2949  O OG1   . THR A 1  377 ? 121.891 5.029    34.928  1.00 0.00 ? 377  THR A OG1   1 
ATOM 2950  C CG2   . THR A 1  377 ? 120.951 5.222    32.735  1.00 0.00 ? 377  THR A CG2   1 
ATOM 2951  N N     . GLY A 1  378 ? 119.795 1.367    33.210  1.00 0.00 ? 378  GLY A N     1 
ATOM 2952  C CA    . GLY A 1  378 ? 119.267 0.476    32.210  1.00 0.00 ? 378  GLY A CA    1 
ATOM 2953  C C     . GLY A 1  378 ? 117.848 0.092    32.512  1.00 0.00 ? 378  GLY A C     1 
ATOM 2954  O O     . GLY A 1  378 ? 117.063 -0.097   31.586  1.00 0.00 ? 378  GLY A O     1 
ATOM 2955  N N     . ILE A 1  379 ? 117.482 -0.011   33.818  1.00 0.00 ? 379  ILE A N     1 
ATOM 2956  C CA    . ILE A 1  379 ? 116.136 -0.351   34.232  1.00 0.00 ? 379  ILE A CA    1 
ATOM 2957  C C     . ILE A 1  379 ? 115.321 0.908    34.395  1.00 0.00 ? 379  ILE A C     1 
ATOM 2958  O O     . ILE A 1  379 ? 114.093 0.849    34.399  1.00 0.00 ? 379  ILE A O     1 
ATOM 2959  C CB    . ILE A 1  379 ? 116.066 -1.163   35.527  1.00 0.00 ? 379  ILE A CB    1 
ATOM 2960  C CG1   . ILE A 1  379 ? 116.688 -0.433   36.745  1.00 0.00 ? 379  ILE A CG1   1 
ATOM 2961  C CG2   . ILE A 1  379 ? 116.725 -2.532   35.251  1.00 0.00 ? 379  ILE A CG2   1 
ATOM 2962  C CD1   . ILE A 1  379 ? 116.546 -1.181   38.075  1.00 0.00 ? 379  ILE A CD1   1 
ATOM 2963  N N     . TRP A 1  380 ? 115.997 2.083    34.498  1.00 0.00 ? 380  TRP A N     1 
ATOM 2964  C CA    . TRP A 1  380 ? 115.380 3.387    34.559  1.00 0.00 ? 380  TRP A CA    1 
ATOM 2965  C C     . TRP A 1  380 ? 114.808 3.711    33.210  1.00 0.00 ? 380  TRP A C     1 
ATOM 2966  O O     . TRP A 1  380 ? 113.649 4.096    33.116  1.00 0.00 ? 380  TRP A O     1 
ATOM 2967  C CB    . TRP A 1  380 ? 116.412 4.472    34.977  1.00 0.00 ? 380  TRP A CB    1 
ATOM 2968  C CG    . TRP A 1  380 ? 115.966 5.926    35.020  1.00 0.00 ? 380  TRP A CG    1 
ATOM 2969  C CD1   . TRP A 1  380 ? 116.241 6.921    34.120  1.00 0.00 ? 380  TRP A CD1   1 
ATOM 2970  C CD2   . TRP A 1  380 ? 115.213 6.537    36.084  1.00 0.00 ? 380  TRP A CD2   1 
ATOM 2971  N NE1   . TRP A 1  380 ? 115.707 8.114    34.549  1.00 0.00 ? 380  TRP A NE1   1 
ATOM 2972  C CE2   . TRP A 1  380 ? 115.075 7.905    35.757  1.00 0.00 ? 380  TRP A CE2   1 
ATOM 2973  C CE3   . TRP A 1  380 ? 114.674 6.018    37.258  1.00 0.00 ? 380  TRP A CE3   1 
ATOM 2974  C CZ2   . TRP A 1  380 ? 114.389 8.775    36.600  1.00 0.00 ? 380  TRP A CZ2   1 
ATOM 2975  C CZ3   . TRP A 1  380 ? 113.974 6.895    38.101  1.00 0.00 ? 380  TRP A CZ3   1 
ATOM 2976  C CH2   . TRP A 1  380 ? 113.833 8.253    37.777  1.00 0.00 ? 380  TRP A CH2   1 
ATOM 2977  N N     . PHE A 1  381 ? 115.594 3.494    32.126  1.00 0.00 ? 381  PHE A N     1 
ATOM 2978  C CA    . PHE A 1  381 ? 115.166 3.781    30.777  1.00 0.00 ? 381  PHE A CA    1 
ATOM 2979  C C     . PHE A 1  381 ? 114.328 2.654    30.231  1.00 0.00 ? 381  PHE A C     1 
ATOM 2980  O O     . PHE A 1  381 ? 113.635 2.848    29.235  1.00 0.00 ? 381  PHE A O     1 
ATOM 2981  C CB    . PHE A 1  381 ? 116.348 4.045    29.802  1.00 0.00 ? 381  PHE A CB    1 
ATOM 2982  C CG    . PHE A 1  381 ? 116.910 5.438    29.981  1.00 0.00 ? 381  PHE A CG    1 
ATOM 2983  C CD1   . PHE A 1  381 ? 118.270 5.644    30.276  1.00 0.00 ? 381  PHE A CD1   1 
ATOM 2984  C CD2   . PHE A 1  381 ? 116.087 6.565    29.788  1.00 0.00 ? 381  PHE A CD2   1 
ATOM 2985  C CE1   . PHE A 1  381 ? 118.788 6.939    30.408  1.00 0.00 ? 381  PHE A CE1   1 
ATOM 2986  C CE2   . PHE A 1  381 ? 116.602 7.861    29.911  1.00 0.00 ? 381  PHE A CE2   1 
ATOM 2987  C CZ    . PHE A 1  381 ? 117.953 8.048    30.227  1.00 0.00 ? 381  PHE A CZ    1 
ATOM 2988  N N     . ALA A 1  382 ? 114.337 1.461    30.883  1.00 0.00 ? 382  ALA A N     1 
ATOM 2989  C CA    . ALA A 1  382 ? 113.476 0.355    30.526  1.00 0.00 ? 382  ALA A CA    1 
ATOM 2990  C C     . ALA A 1  382 ? 112.041 0.642    30.871  1.00 0.00 ? 382  ALA A C     1 
ATOM 2991  O O     . ALA A 1  382 ? 111.147 0.306    30.096  1.00 0.00 ? 382  ALA A O     1 
ATOM 2992  C CB    . ALA A 1  382 ? 113.847 -0.971   31.215  1.00 0.00 ? 382  ALA A CB    1 
ATOM 2993  N N     . ASP A 1  383 ? 111.782 1.272    32.050  1.00 0.00 ? 383  ASP A N     1 
ATOM 2994  C CA    . ASP A 1  383 ? 110.429 1.528    32.491  1.00 0.00 ? 383  ASP A CA    1 
ATOM 2995  C C     . ASP A 1  383 ? 109.887 2.763    31.823  1.00 0.00 ? 383  ASP A C     1 
ATOM 2996  O O     . ASP A 1  383 ? 108.674 2.955    31.779  1.00 0.00 ? 383  ASP A O     1 
ATOM 2997  C CB    . ASP A 1  383 ? 110.259 1.601    34.043  1.00 0.00 ? 383  ASP A CB    1 
ATOM 2998  C CG    . ASP A 1  383 ? 110.790 2.878    34.711  1.00 0.00 ? 383  ASP A CG    1 
ATOM 2999  O OD1   . ASP A 1  383 ? 110.025 3.882    34.752  1.00 0.00 ? 383  ASP A OD1   1 
ATOM 3000  O OD2   . ASP A 1  383 ? 111.946 2.862    35.207  1.00 0.00 ? 383  ASP A OD2   1 
ATOM 3001  N N     . LYS A 1  384 ? 110.783 3.621    31.267  1.00 0.00 ? 384  LYS A N     1 
ATOM 3002  C CA    . LYS A 1  384 ? 110.391 4.803    30.536  1.00 0.00 ? 384  LYS A CA    1 
ATOM 3003  C C     . LYS A 1  384 ? 109.931 4.383    29.170  1.00 0.00 ? 384  LYS A C     1 
ATOM 3004  O O     . LYS A 1  384 ? 109.018 4.980    28.612  1.00 0.00 ? 384  LYS A O     1 
ATOM 3005  C CB    . LYS A 1  384 ? 111.502 5.864    30.301  1.00 0.00 ? 384  LYS A CB    1 
ATOM 3006  C CG    . LYS A 1  384 ? 112.206 6.484    31.526  1.00 0.00 ? 384  LYS A CG    1 
ATOM 3007  C CD    . LYS A 1  384 ? 111.497 6.343    32.877  1.00 0.00 ? 384  LYS A CD    1 
ATOM 3008  C CE    . LYS A 1  384 ? 112.256 7.042    34.008  1.00 0.00 ? 384  LYS A CE    1 
ATOM 3009  N NZ    . LYS A 1  384 ? 111.674 6.711    35.328  1.00 0.00 ? 384  LYS A NZ    1 
ATOM 3010  N N     . TRP A 1  385 ? 110.584 3.340    28.599  1.00 0.00 ? 385  TRP A N     1 
ATOM 3011  C CA    . TRP A 1  385 ? 110.312 2.803    27.287  1.00 0.00 ? 385  TRP A CA    1 
ATOM 3012  C C     . TRP A 1  385 ? 108.945 2.165    27.232  1.00 0.00 ? 385  TRP A C     1 
ATOM 3013  O O     . TRP A 1  385 ? 108.230 2.307    26.242  1.00 0.00 ? 385  TRP A O     1 
ATOM 3014  C CB    . TRP A 1  385 ? 111.391 1.770    26.858  1.00 0.00 ? 385  TRP A CB    1 
ATOM 3015  C CG    . TRP A 1  385 ? 111.436 1.453    25.373  1.00 0.00 ? 385  TRP A CG    1 
ATOM 3016  C CD1   . TRP A 1  385 ? 111.137 0.293    24.713  1.00 0.00 ? 385  TRP A CD1   1 
ATOM 3017  C CD2   . TRP A 1  385 ? 111.807 2.411    24.366  1.00 0.00 ? 385  TRP A CD2   1 
ATOM 3018  N NE1   . TRP A 1  385 ? 111.282 0.466    23.354  1.00 0.00 ? 385  TRP A NE1   1 
ATOM 3019  C CE2   . TRP A 1  385 ? 111.683 1.765    23.117  1.00 0.00 ? 385  TRP A CE2   1 
ATOM 3020  C CE3   . TRP A 1  385 ? 112.217 3.739    24.452  1.00 0.00 ? 385  TRP A CE3   1 
ATOM 3021  C CZ2   . TRP A 1  385 ? 111.946 2.448    21.933  1.00 0.00 ? 385  TRP A CZ2   1 
ATOM 3022  C CZ3   . TRP A 1  385 ? 112.469 4.430    23.260  1.00 0.00 ? 385  TRP A CZ3   1 
ATOM 3023  C CH2   . TRP A 1  385 ? 112.323 3.797    22.018  1.00 0.00 ? 385  TRP A CH2   1 
ATOM 3024  N N     . GLN A 1  386 ? 108.559 1.450    28.321  1.00 0.00 ? 386  GLN A N     1 
ATOM 3025  C CA    . GLN A 1  386 ? 107.268 0.820    28.466  1.00 0.00 ? 386  GLN A CA    1 
ATOM 3026  C C     . GLN A 1  386 ? 106.174 1.849    28.620  1.00 0.00 ? 386  GLN A C     1 
ATOM 3027  O O     . GLN A 1  386 ? 105.120 1.739    27.994  1.00 0.00 ? 386  GLN A O     1 
ATOM 3028  C CB    . GLN A 1  386 ? 107.248 -0.125   29.694  1.00 0.00 ? 386  GLN A CB    1 
ATOM 3029  C CG    . GLN A 1  386 ? 105.939 -0.930   29.872  1.00 0.00 ? 386  GLN A CG    1 
ATOM 3030  C CD    . GLN A 1  386 ? 105.969 -1.897   31.072  1.00 0.00 ? 386  GLN A CD    1 
ATOM 3031  O OE1   . GLN A 1  386 ? 104.979 -2.602   31.308  1.00 0.00 ? 386  GLN A OE1   1 
ATOM 3032  N NE2   . GLN A 1  386 ? 107.104 -1.930   31.834  1.00 0.00 ? 386  GLN A NE2   1 
ATOM 3033  N N     . ALA A 1  387 ? 106.428 2.885    29.461  1.00 0.00 ? 387  ALA A N     1 
ATOM 3034  C CA    . ALA A 1  387 ? 105.487 3.927    29.804  1.00 0.00 ? 387  ALA A CA    1 
ATOM 3035  C C     . ALA A 1  387 ? 105.148 4.804    28.633  1.00 0.00 ? 387  ALA A C     1 
ATOM 3036  O O     . ALA A 1  387 ? 103.988 5.163    28.433  1.00 0.00 ? 387  ALA A O     1 
ATOM 3037  C CB    . ALA A 1  387 ? 106.034 4.842    30.915  1.00 0.00 ? 387  ALA A CB    1 
ATOM 3038  N N     . ILE A 1  388 ? 106.178 5.157    27.830  1.00 0.00 ? 388  ILE A N     1 
ATOM 3039  C CA    . ILE A 1  388 ? 106.063 5.998    26.667  1.00 0.00 ? 388  ILE A CA    1 
ATOM 3040  C C     . ILE A 1  388 ? 105.840 5.038    25.531  1.00 0.00 ? 388  ILE A C     1 
ATOM 3041  O O     . ILE A 1  388 ? 106.796 4.557    24.924  1.00 0.00 ? 388  ILE A O     1 
ATOM 3042  C CB    . ILE A 1  388 ? 107.321 6.837    26.449  1.00 0.00 ? 388  ILE A CB    1 
ATOM 3043  C CG1   . ILE A 1  388 ? 107.564 7.766    27.668  1.00 0.00 ? 388  ILE A CG1   1 
ATOM 3044  C CG2   . ILE A 1  388 ? 107.217 7.645    25.136  1.00 0.00 ? 388  ILE A CG2   1 
ATOM 3045  C CD1   . ILE A 1  388 ? 108.963 8.387    27.678  1.00 0.00 ? 388  ILE A CD1   1 
ATOM 3046  N N     . SER A 1  389 ? 104.539 4.740    25.266  1.00 0.00 ? 389  SER A N     1 
ATOM 3047  C CA    . SER A 1  389 ? 103.972 3.822    24.295  1.00 0.00 ? 389  SER A CA    1 
ATOM 3048  C C     . SER A 1  389 ? 104.886 2.718    23.804  1.00 0.00 ? 389  SER A C     1 
ATOM 3049  O O     . SER A 1  389 ? 105.210 1.801    24.557  1.00 0.00 ? 389  SER A O     1 
ATOM 3050  C CB    . SER A 1  389 ? 103.234 4.563    23.150  1.00 0.00 ? 389  SER A CB    1 
ATOM 3051  O OG    . SER A 1  389 ? 102.343 3.711    22.436  1.00 0.00 ? 389  SER A OG    1 
ATOM 3052  N N     . GLY A 1  390 ? 105.286 2.775    22.506  1.00 0.00 ? 390  GLY A N     1 
ATOM 3053  C CA    . GLY A 1  390 ? 105.920 1.676    21.820  1.00 0.00 ? 390  GLY A CA    1 
ATOM 3054  C C     . GLY A 1  390 ? 104.826 0.708    21.493  1.00 0.00 ? 390  GLY A C     1 
ATOM 3055  O O     . GLY A 1  390 ? 103.757 1.114    21.038  1.00 0.00 ? 390  GLY A O     1 
ATOM 3056  N N     . SER A 1  391 ? 105.067 -0.596   21.762  1.00 0.00 ? 391  SER A N     1 
ATOM 3057  C CA    . SER A 1  391 ? 103.995 -1.548   21.895  1.00 0.00 ? 391  SER A CA    1 
ATOM 3058  C C     . SER A 1  391 ? 103.796 -1.629   23.384  1.00 0.00 ? 391  SER A C     1 
ATOM 3059  O O     . SER A 1  391 ? 104.628 -2.167   24.115  1.00 0.00 ? 391  SER A O     1 
ATOM 3060  C CB    . SER A 1  391 ? 104.271 -2.939   21.263  1.00 0.00 ? 391  SER A CB    1 
ATOM 3061  O OG    . SER A 1  391 ? 105.532 -3.480   21.639  1.00 0.00 ? 391  SER A OG    1 
ATOM 3062  N N     . SER A 1  392 ? 102.682 -1.029   23.864  1.00 0.00 ? 392  SER A N     1 
ATOM 3063  C CA    . SER A 1  392 ? 102.425 -0.832   25.268  1.00 0.00 ? 392  SER A CA    1 
ATOM 3064  C C     . SER A 1  392 ? 101.853 -2.120   25.786  1.00 0.00 ? 392  SER A C     1 
ATOM 3065  O O     . SER A 1  392 ? 101.034 -2.748   25.122  1.00 0.00 ? 392  SER A O     1 
ATOM 3066  C CB    . SER A 1  392 ? 101.439 0.343    25.494  1.00 0.00 ? 392  SER A CB    1 
ATOM 3067  O OG    . SER A 1  392 ? 101.166 0.590    26.869  1.00 0.00 ? 392  SER A OG    1 
ATOM 3068  N N     . ALA A 1  393 ? 102.311 -2.557   26.983  1.00 0.00 ? 393  ALA A N     1 
ATOM 3069  C CA    . ALA A 1  393 ? 101.927 -3.817   27.577  1.00 0.00 ? 393  ALA A CA    1 
ATOM 3070  C C     . ALA A 1  393 ? 100.472 -3.841   27.956  1.00 0.00 ? 393  ALA A C     1 
ATOM 3071  O O     . ALA A 1  393 ? 99.791  -4.842   27.739  1.00 0.00 ? 393  ALA A O     1 
ATOM 3072  C CB    . ALA A 1  393 ? 102.748 -4.135   28.838  1.00 0.00 ? 393  ALA A CB    1 
ATOM 3073  N N     . ARG A 1  394 ? 99.967  -2.715   28.527  1.00 0.00 ? 394  ARG A N     1 
ATOM 3074  C CA    . ARG A 1  394 ? 98.587  -2.572   28.917  1.00 0.00 ? 394  ARG A CA    1 
ATOM 3075  C C     . ARG A 1  394 ? 97.697  -2.523   27.712  1.00 0.00 ? 394  ARG A C     1 
ATOM 3076  O O     . ARG A 1  394 ? 96.695  -3.234   27.651  1.00 0.00 ? 394  ARG A O     1 
ATOM 3077  C CB    . ARG A 1  394 ? 98.346  -1.261   29.708  1.00 0.00 ? 394  ARG A CB    1 
ATOM 3078  C CG    . ARG A 1  394 ? 96.912  -1.065   30.256  1.00 0.00 ? 394  ARG A CG    1 
ATOM 3079  C CD    . ARG A 1  394 ? 96.453  -2.127   31.270  1.00 0.00 ? 394  ARG A CD    1 
ATOM 3080  N NE    . ARG A 1  394 ? 97.466  -2.151   32.373  1.00 0.00 ? 394  ARG A NE    1 
ATOM 3081  C CZ    . ARG A 1  394 ? 97.242  -2.685   33.610  1.00 0.00 ? 394  ARG A CZ    1 
ATOM 3082  N NH1   . ARG A 1  394 ? 96.037  -3.228   33.946  1.00 0.00 ? 394  ARG A NH1   1 
ATOM 3083  N NH2   . ARG A 1  394 ? 98.257  -2.663   34.522  1.00 0.00 ? 394  ARG A NH2   1 
ATOM 3084  N N     . ASP A 1  395 ? 98.065  -1.672   26.718  1.00 0.00 ? 395  ASP A N     1 
ATOM 3085  C CA    . ASP A 1  395 ? 97.210  -1.392   25.587  1.00 0.00 ? 395  ASP A CA    1 
ATOM 3086  C C     . ASP A 1  395 ? 97.091  -2.577   24.676  1.00 0.00 ? 395  ASP A C     1 
ATOM 3087  O O     . ASP A 1  395 ? 95.974  -2.942   24.352  1.00 0.00 ? 395  ASP A O     1 
ATOM 3088  C CB    . ASP A 1  395 ? 97.674  -0.209   24.699  1.00 0.00 ? 395  ASP A CB    1 
ATOM 3089  C CG    . ASP A 1  395 ? 97.708  1.123    25.456  1.00 0.00 ? 395  ASP A CG    1 
ATOM 3090  O OD1   . ASP A 1  395 ? 97.238  1.187    26.622  1.00 0.00 ? 395  ASP A OD1   1 
ATOM 3091  O OD2   . ASP A 1  395 ? 98.206  2.112    24.852  1.00 0.00 ? 395  ASP A OD2   1 
ATOM 3092  N N     . VAL A 1  396 ? 98.213  -3.226   24.273  1.00 0.00 ? 396  VAL A N     1 
ATOM 3093  C CA    . VAL A 1  396 ? 98.213  -4.290   23.285  1.00 0.00 ? 396  VAL A CA    1 
ATOM 3094  C C     . VAL A 1  396 ? 97.504  -5.526   23.781  1.00 0.00 ? 396  VAL A C     1 
ATOM 3095  O O     . VAL A 1  396 ? 96.742  -6.134   23.032  1.00 0.00 ? 396  VAL A O     1 
ATOM 3096  C CB    . VAL A 1  396 ? 99.613  -4.609   22.771  1.00 0.00 ? 396  VAL A CB    1 
ATOM 3097  C CG1   . VAL A 1  396 ? 99.636  -5.833   21.822  1.00 0.00 ? 396  VAL A CG1   1 
ATOM 3098  C CG2   . VAL A 1  396 ? 100.127 -3.353   22.033  1.00 0.00 ? 396  VAL A CG2   1 
ATOM 3099  N N     . ALA A 1  397 ? 97.707  -5.912   25.066  1.00 0.00 ? 397  ALA A N     1 
ATOM 3100  C CA    . ALA A 1  397 ? 97.051  -7.058   25.657  1.00 0.00 ? 397  ALA A CA    1 
ATOM 3101  C C     . ALA A 1  397 ? 95.547  -6.892   25.720  1.00 0.00 ? 397  ALA A C     1 
ATOM 3102  O O     . ALA A 1  397 ? 94.817  -7.809   25.355  1.00 0.00 ? 397  ALA A O     1 
ATOM 3103  C CB    . ALA A 1  397 ? 97.570  -7.322   27.081  1.00 0.00 ? 397  ALA A CB    1 
ATOM 3104  N N     . LEU A 1  398 ? 95.075  -5.697   26.154  1.00 0.00 ? 398  LEU A N     1 
ATOM 3105  C CA    . LEU A 1  398 ? 93.687  -5.304   26.269  1.00 0.00 ? 398  LEU A CA    1 
ATOM 3106  C C     . LEU A 1  398 ? 92.998  -5.147   24.927  1.00 0.00 ? 398  LEU A C     1 
ATOM 3107  O O     . LEU A 1  398 ? 91.853  -5.561   24.749  1.00 0.00 ? 398  LEU A O     1 
ATOM 3108  C CB    . LEU A 1  398 ? 93.640  -3.952   27.030  1.00 0.00 ? 398  LEU A CB    1 
ATOM 3109  C CG    . LEU A 1  398 ? 92.271  -3.253   27.218  1.00 0.00 ? 398  LEU A CG    1 
ATOM 3110  C CD1   . LEU A 1  398 ? 91.241  -4.143   27.927  1.00 0.00 ? 398  LEU A CD1   1 
ATOM 3111  C CD2   . LEU A 1  398 ? 92.453  -1.919   27.972  1.00 0.00 ? 398  LEU A CD2   1 
ATOM 3112  N N     . GLU A 1  399 ? 93.698  -4.506   23.964  1.00 0.00 ? 399  GLU A N     1 
ATOM 3113  C CA    . GLU A 1  399 ? 93.186  -4.081   22.683  1.00 0.00 ? 399  GLU A CA    1 
ATOM 3114  C C     . GLU A 1  399 ? 92.979  -5.249   21.765  1.00 0.00 ? 399  GLU A C     1 
ATOM 3115  O O     . GLU A 1  399 ? 91.918  -5.352   21.155  1.00 0.00 ? 399  GLU A O     1 
ATOM 3116  C CB    . GLU A 1  399 ? 94.146  -3.053   22.046  1.00 0.00 ? 399  GLU A CB    1 
ATOM 3117  C CG    . GLU A 1  399 ? 93.729  -2.441   20.702  1.00 0.00 ? 399  GLU A CG    1 
ATOM 3118  C CD    . GLU A 1  399 ? 94.739  -1.346   20.344  1.00 0.00 ? 399  GLU A CD    1 
ATOM 3119  O OE1   . GLU A 1  399 ? 95.919  -1.692   20.073  1.00 0.00 ? 399  GLU A OE1   1 
ATOM 3120  O OE2   . GLU A 1  399 ? 94.343  -0.148   20.350  1.00 0.00 ? 399  GLU A OE2   1 
ATOM 3121  N N     . PHE A 1  400 ? 93.970  -6.182   21.701  1.00 0.00 ? 400  PHE A N     1 
ATOM 3122  C CA    . PHE A 1  400 ? 93.876  -7.426   20.959  1.00 0.00 ? 400  PHE A CA    1 
ATOM 3123  C C     . PHE A 1  400 ? 92.803  -8.303   21.542  1.00 0.00 ? 400  PHE A C     1 
ATOM 3124  O O     . PHE A 1  400 ? 92.105  -8.992   20.802  1.00 0.00 ? 400  PHE A O     1 
ATOM 3125  C CB    . PHE A 1  400 ? 95.178  -8.284   20.949  1.00 0.00 ? 400  PHE A CB    1 
ATOM 3126  C CG    . PHE A 1  400 ? 96.123  -7.883   19.836  1.00 0.00 ? 400  PHE A CG    1 
ATOM 3127  C CD1   . PHE A 1  400 ? 96.538  -6.550   19.649  1.00 0.00 ? 400  PHE A CD1   1 
ATOM 3128  C CD2   . PHE A 1  400 ? 96.609  -8.866   18.949  1.00 0.00 ? 400  PHE A CD2   1 
ATOM 3129  C CE1   . PHE A 1  400 ? 97.391  -6.207   18.592  1.00 0.00 ? 400  PHE A CE1   1 
ATOM 3130  C CE2   . PHE A 1  400 ? 97.464  -8.526   17.895  1.00 0.00 ? 400  PHE A CE2   1 
ATOM 3131  C CZ    . PHE A 1  400 ? 97.852  -7.194   17.713  1.00 0.00 ? 400  PHE A CZ    1 
ATOM 3132  N N     . LYS A 1  401 ? 92.668  -8.300   22.889  1.00 0.00 ? 401  LYS A N     1 
ATOM 3133  C CA    . LYS A 1  401 ? 91.736  -9.130   23.601  1.00 0.00 ? 401  LYS A CA    1 
ATOM 3134  C C     . LYS A 1  401 ? 90.296  -8.808   23.281  1.00 0.00 ? 401  LYS A C     1 
ATOM 3135  O O     . LYS A 1  401 ? 89.565  -9.706   22.877  1.00 0.00 ? 401  LYS A O     1 
ATOM 3136  C CB    . LYS A 1  401 ? 91.994  -9.012   25.109  1.00 0.00 ? 401  LYS A CB    1 
ATOM 3137  C CG    . LYS A 1  401 ? 91.057  -9.746   26.077  1.00 0.00 ? 401  LYS A CG    1 
ATOM 3138  C CD    . LYS A 1  401 ? 90.865  -8.918   27.352  1.00 0.00 ? 401  LYS A CD    1 
ATOM 3139  C CE    . LYS A 1  401 ? 89.879  -7.767   27.109  1.00 0.00 ? 401  LYS A CE    1 
ATOM 3140  N NZ    . LYS A 1  401 ? 89.635  -6.975   28.326  1.00 0.00 ? 401  LYS A NZ    1 
ATOM 3141  N N     . ASP A 1  402 ? 89.852  -7.526   23.386  1.00 0.00 ? 402  ASP A N     1 
ATOM 3142  C CA    . ASP A 1  402 ? 88.473  -7.161   23.105  1.00 0.00 ? 402  ASP A CA    1 
ATOM 3143  C C     . ASP A 1  402 ? 88.177  -7.264   21.631  1.00 0.00 ? 402  ASP A C     1 
ATOM 3144  O O     . ASP A 1  402 ? 87.093  -7.705   21.253  1.00 0.00 ? 402  ASP A O     1 
ATOM 3145  C CB    . ASP A 1  402 ? 88.065  -5.741   23.574  1.00 0.00 ? 402  ASP A CB    1 
ATOM 3146  C CG    . ASP A 1  402 ? 87.909  -5.699   25.099  1.00 0.00 ? 402  ASP A CG    1 
ATOM 3147  O OD1   . ASP A 1  402 ? 87.075  -6.484   25.628  1.00 0.00 ? 402  ASP A OD1   1 
ATOM 3148  O OD2   . ASP A 1  402 ? 88.611  -4.877   25.749  1.00 0.00 ? 402  ASP A OD2   1 
ATOM 3149  N N     . GLN A 1  403 ? 89.154  -6.868   20.774  1.00 0.00 ? 403  GLN A N     1 
ATOM 3150  C CA    . GLN A 1  403 ? 89.052  -6.849   19.330  1.00 0.00 ? 403  GLN A CA    1 
ATOM 3151  C C     . GLN A 1  403 ? 88.819  -8.231   18.785  1.00 0.00 ? 403  GLN A C     1 
ATOM 3152  O O     . GLN A 1  403 ? 87.965  -8.424   17.922  1.00 0.00 ? 403  GLN A O     1 
ATOM 3153  C CB    . GLN A 1  403 ? 90.349  -6.278   18.702  1.00 0.00 ? 403  GLN A CB    1 
ATOM 3154  C CG    . GLN A 1  403 ? 90.531  -6.354   17.162  1.00 0.00 ? 403  GLN A CG    1 
ATOM 3155  C CD    . GLN A 1  403 ? 89.589  -5.461   16.334  1.00 0.00 ? 403  GLN A CD    1 
ATOM 3156  O OE1   . GLN A 1  403 ? 89.600  -5.559   15.100  1.00 0.00 ? 403  GLN A OE1   1 
ATOM 3157  N NE2   . GLN A 1  403 ? 88.791  -4.574   16.998  1.00 0.00 ? 403  GLN A NE2   1 
ATOM 3158  N N     . GLY A 1  404 ? 89.567  -9.226   19.318  1.00 0.00 ? 404  GLY A N     1 
ATOM 3159  C CA    . GLY A 1  404 ? 89.530  -10.597  18.877  1.00 0.00 ? 404  GLY A CA    1 
ATOM 3160  C C     . GLY A 1  404 ? 88.284  -11.287  19.336  1.00 0.00 ? 404  GLY A C     1 
ATOM 3161  O O     . GLY A 1  404 ? 87.675  -12.016  18.560  1.00 0.00 ? 404  GLY A O     1 
ATOM 3162  N N     . ILE A 1  405 ? 87.843  -11.026  20.596  1.00 0.00 ? 405  ILE A N     1 
ATOM 3163  C CA    . ILE A 1  405 ? 86.669  -11.623  21.213  1.00 0.00 ? 405  ILE A CA    1 
ATOM 3164  C C     . ILE A 1  405 ? 85.426  -11.264  20.432  1.00 0.00 ? 405  ILE A C     1 
ATOM 3165  O O     . ILE A 1  405 ? 84.475  -12.038  20.431  1.00 0.00 ? 405  ILE A O     1 
ATOM 3166  C CB    . ILE A 1  405 ? 86.519  -11.249  22.702  1.00 0.00 ? 405  ILE A CB    1 
ATOM 3167  C CG1   . ILE A 1  405 ? 87.583  -11.988  23.550  1.00 0.00 ? 405  ILE A CG1   1 
ATOM 3168  C CG2   . ILE A 1  405 ? 85.111  -11.565  23.269  1.00 0.00 ? 405  ILE A CG2   1 
ATOM 3169  C CD1   . ILE A 1  405 ? 87.728  -11.423  24.967  1.00 0.00 ? 405  ILE A CD1   1 
ATOM 3170  N N     . THR A 1  406 ? 85.403  -10.089  19.758  1.00 0.00 ? 406  THR A N     1 
ATOM 3171  C CA    . THR A 1  406 ? 84.217  -9.579   19.111  1.00 0.00 ? 406  THR A CA    1 
ATOM 3172  C C     . THR A 1  406 ? 84.499  -9.267   17.650  1.00 0.00 ? 406  THR A C     1 
ATOM 3173  O O     . THR A 1  406 ? 84.005  -8.268   17.126  1.00 0.00 ? 406  THR A O     1 
ATOM 3174  C CB    . THR A 1  406 ? 83.622  -8.364   19.829  1.00 0.00 ? 406  THR A CB    1 
ATOM 3175  O OG1   . THR A 1  406 ? 84.484  -7.229   19.831  1.00 0.00 ? 406  THR A OG1   1 
ATOM 3176  C CG2   . THR A 1  406 ? 83.290  -8.722   21.289  1.00 0.00 ? 406  THR A CG2   1 
ATOM 3177  N N     . LEU A 1  407 ? 85.290  -10.124  16.943  1.00 0.00 ? 407  LEU A N     1 
ATOM 3178  C CA    . LEU A 1  407 ? 85.687  -9.891   15.562  1.00 0.00 ? 407  LEU A CA    1 
ATOM 3179  C C     . LEU A 1  407 ? 84.694  -10.504  14.589  1.00 0.00 ? 407  LEU A C     1 
ATOM 3180  O O     . LEU A 1  407 ? 85.068  -11.004  13.531  1.00 0.00 ? 407  LEU A O     1 
ATOM 3181  C CB    . LEU A 1  407 ? 87.116  -10.435  15.283  1.00 0.00 ? 407  LEU A CB    1 
ATOM 3182  C CG    . LEU A 1  407 ? 87.846  -9.849   14.045  1.00 0.00 ? 407  LEU A CG    1 
ATOM 3183  C CD1   . LEU A 1  407 ? 87.943  -8.311   14.054  1.00 0.00 ? 407  LEU A CD1   1 
ATOM 3184  C CD2   . LEU A 1  407 ? 89.245  -10.473  13.904  1.00 0.00 ? 407  LEU A CD2   1 
ATOM 3185  N N     . MET A 1  408 ? 83.395  -10.472  14.956  1.00 0.00 ? 408  MET A N     1 
ATOM 3186  C CA    . MET A 1  408 ? 82.250  -11.016  14.277  1.00 0.00 ? 408  MET A CA    1 
ATOM 3187  C C     . MET A 1  408 ? 81.954  -12.345  14.894  1.00 0.00 ? 408  MET A C     1 
ATOM 3188  O O     . MET A 1  408 ? 82.741  -13.289  14.808  1.00 0.00 ? 408  MET A O     1 
ATOM 3189  C CB    . MET A 1  408 ? 82.069  -10.858  12.739  1.00 0.00 ? 408  MET A CB    1 
ATOM 3190  C CG    . MET A 1  408 ? 82.503  -12.016  11.823  1.00 0.00 ? 408  MET A CG    1 
ATOM 3191  S SD    . MET A 1  408 ? 82.295  -11.653  10.044  1.00 0.00 ? 408  MET A SD    1 
ATOM 3192  C CE    . MET A 1  408 ? 80.486  -11.442  9.966   1.00 0.00 ? 408  MET A CE    1 
ATOM 3193  N N     . GLY A 1  409 ? 80.846  -12.366  15.681  1.00 0.00 ? 409  GLY A N     1 
ATOM 3194  C CA    . GLY A 1  409 ? 80.773  -13.181  16.866  1.00 0.00 ? 409  GLY A CA    1 
ATOM 3195  C C     . GLY A 1  409 ? 81.672  -12.499  17.881  1.00 0.00 ? 409  GLY A C     1 
ATOM 3196  O O     . GLY A 1  409 ? 81.279  -11.444  18.372  1.00 0.00 ? 409  GLY A O     1 
ATOM 3197  N N     . ARG A 1  410 ? 82.921  -12.950  18.200  1.00 0.00 ? 410  ARG A N     1 
ATOM 3198  C CA    . ARG A 1  410 ? 83.479  -14.271  18.394  1.00 0.00 ? 410  ARG A CA    1 
ATOM 3199  C C     . ARG A 1  410 ? 84.837  -14.405  17.748  1.00 0.00 ? 410  ARG A C     1 
ATOM 3200  O O     . ARG A 1  410 ? 85.148  -13.667  16.818  1.00 0.00 ? 410  ARG A O     1 
ATOM 3201  C CB    . ARG A 1  410 ? 82.604  -15.531  18.228  1.00 0.00 ? 410  ARG A CB    1 
ATOM 3202  C CG    . ARG A 1  410 ? 82.656  -16.246  16.871  1.00 0.00 ? 410  ARG A CG    1 
ATOM 3203  C CD    . ARG A 1  410 ? 81.890  -17.558  17.001  1.00 0.00 ? 410  ARG A CD    1 
ATOM 3204  N NE    . ARG A 1  410 ? 82.670  -18.654  16.387  1.00 0.00 ? 410  ARG A NE    1 
ATOM 3205  C CZ    . ARG A 1  410 ? 83.809  -19.192  16.903  1.00 0.00 ? 410  ARG A CZ    1 
ATOM 3206  N NH1   . ARG A 1  410 ? 84.421  -18.638  17.985  1.00 0.00 ? 410  ARG A NH1   1 
ATOM 3207  N NH2   . ARG A 1  410 ? 84.306  -20.319  16.316  1.00 0.00 ? 410  ARG A NH2   1 
ATOM 3208  N N     . ARG A 1  411 ? 85.632  -15.382  18.268  1.00 0.00 ? 411  ARG A N     1 
ATOM 3209  C CA    . ARG A 1  411 ? 86.912  -15.912  17.833  1.00 0.00 ? 411  ARG A CA    1 
ATOM 3210  C C     . ARG A 1  411 ? 87.394  -16.649  19.051  1.00 0.00 ? 411  ARG A C     1 
ATOM 3211  O O     . ARG A 1  411 ? 86.937  -16.398  20.166  1.00 0.00 ? 411  ARG A O     1 
ATOM 3212  C CB    . ARG A 1  411 ? 88.117  -14.981  17.466  1.00 0.00 ? 411  ARG A CB    1 
ATOM 3213  C CG    . ARG A 1  411 ? 88.122  -14.257  16.105  1.00 0.00 ? 411  ARG A CG    1 
ATOM 3214  C CD    . ARG A 1  411 ? 88.080  -15.206  14.896  1.00 0.00 ? 411  ARG A CD    1 
ATOM 3215  N NE    . ARG A 1  411 ? 88.082  -14.394  13.628  1.00 0.00 ? 411  ARG A NE    1 
ATOM 3216  C CZ    . ARG A 1  411 ? 86.945  -13.855  13.091  1.00 0.00 ? 411  ARG A CZ    1 
ATOM 3217  N NH1   . ARG A 1  411 ? 85.721  -14.102  13.642  1.00 0.00 ? 411  ARG A NH1   1 
ATOM 3218  N NH2   . ARG A 1  411 ? 87.030  -13.054  11.988  1.00 0.00 ? 411  ARG A NH2   1 
ATOM 3219  N N     . GLU A 1  412 ? 88.378  -17.562  18.850  1.00 0.00 ? 412  GLU A N     1 
ATOM 3220  C CA    . GLU A 1  412 ? 89.131  -18.155  19.927  1.00 0.00 ? 412  GLU A CA    1 
ATOM 3221  C C     . GLU A 1  412 ? 90.472  -17.483  19.932  1.00 0.00 ? 412  GLU A C     1 
ATOM 3222  O O     . GLU A 1  412 ? 90.874  -16.800  18.989  1.00 0.00 ? 412  GLU A O     1 
ATOM 3223  C CB    . GLU A 1  412 ? 89.211  -19.704  19.930  1.00 0.00 ? 412  GLU A CB    1 
ATOM 3224  C CG    . GLU A 1  412 ? 89.979  -20.405  21.077  1.00 0.00 ? 412  GLU A CG    1 
ATOM 3225  C CD    . GLU A 1  412 ? 89.488  -20.038  22.476  1.00 0.00 ? 412  GLU A CD    1 
ATOM 3226  O OE1   . GLU A 1  412 ? 90.260  -20.278  23.442  1.00 0.00 ? 412  GLU A OE1   1 
ATOM 3227  O OE2   . GLU A 1  412 ? 88.351  -19.517  22.597  1.00 0.00 ? 412  GLU A OE2   1 
ATOM 3228  N N     . GLN A 1  413 ? 91.111  -17.593  21.111  1.00 0.00 ? 413  GLN A N     1 
ATOM 3229  C CA    . GLN A 1  413 ? 91.704  -16.513  21.818  1.00 0.00 ? 413  GLN A CA    1 
ATOM 3230  C C     . GLN A 1  413 ? 93.203  -16.533  21.583  1.00 0.00 ? 413  GLN A C     1 
ATOM 3231  O O     . GLN A 1  413 ? 93.606  -16.915  20.486  1.00 0.00 ? 413  GLN A O     1 
ATOM 3232  C CB    . GLN A 1  413 ? 91.106  -16.554  23.248  1.00 0.00 ? 413  GLN A CB    1 
ATOM 3233  C CG    . GLN A 1  413 ? 89.589  -16.178  23.159  1.00 0.00 ? 413  GLN A CG    1 
ATOM 3234  C CD    . GLN A 1  413 ? 88.760  -16.183  24.458  1.00 0.00 ? 413  GLN A CD    1 
ATOM 3235  O OE1   . GLN A 1  413 ? 88.456  -15.121  25.013  1.00 0.00 ? 413  GLN A OE1   1 
ATOM 3236  N NE2   . GLN A 1  413 ? 88.328  -17.402  24.903  1.00 0.00 ? 413  GLN A NE2   1 
ATOM 3237  N N     . ASN A 1  414 ? 94.074  -16.062  22.517  1.00 0.00 ? 414  ASN A N     1 
ATOM 3238  C CA    . ASN A 1  414 ? 95.444  -15.747  22.132  1.00 0.00 ? 414  ASN A CA    1 
ATOM 3239  C C     . ASN A 1  414 ? 96.470  -16.219  23.119  1.00 0.00 ? 414  ASN A C     1 
ATOM 3240  O O     . ASN A 1  414 ? 96.150  -16.729  24.191  1.00 0.00 ? 414  ASN A O     1 
ATOM 3241  C CB    . ASN A 1  414 ? 95.682  -14.248  21.742  1.00 0.00 ? 414  ASN A CB    1 
ATOM 3242  C CG    . ASN A 1  414 ? 95.473  -13.150  22.809  1.00 0.00 ? 414  ASN A CG    1 
ATOM 3243  O OD1   . ASN A 1  414 ? 95.304  -11.984  22.428  1.00 0.00 ? 414  ASN A OD1   1 
ATOM 3244  N ND2   . ASN A 1  414 ? 95.505  -13.493  24.130  1.00 0.00 ? 414  ASN A ND2   1 
ATOM 3245  N N     . VAL A 1  415 ? 97.756  -16.067  22.708  1.00 0.00 ? 415  VAL A N     1 
ATOM 3246  C CA    . VAL A 1  415 ? 98.933  -16.314  23.503  1.00 0.00 ? 415  VAL A CA    1 
ATOM 3247  C C     . VAL A 1  415 ? 99.432  -14.992  24.054  1.00 0.00 ? 415  VAL A C     1 
ATOM 3248  O O     . VAL A 1  415 ? 100.594 -14.899  24.423  1.00 0.00 ? 415  VAL A O     1 
ATOM 3249  C CB    . VAL A 1  415 ? 100.088 -16.987  22.747  1.00 0.00 ? 415  VAL A CB    1 
ATOM 3250  C CG1   . VAL A 1  415 ? 99.795  -18.492  22.586  1.00 0.00 ? 415  VAL A CG1   1 
ATOM 3251  C CG2   . VAL A 1  415 ? 100.355 -16.276  21.401  1.00 0.00 ? 415  VAL A CG2   1 
ATOM 3252  N N     . ALA A 1  416 ? 98.601  -13.920  24.133  1.00 0.00 ? 416  ALA A N     1 
ATOM 3253  C CA    . ALA A 1  416 ? 99.087  -12.594  24.478  1.00 0.00 ? 416  ALA A CA    1 
ATOM 3254  C C     . ALA A 1  416 ? 98.983  -12.306  25.955  1.00 0.00 ? 416  ALA A C     1 
ATOM 3255  O O     . ALA A 1  416 ? 99.401  -11.233  26.390  1.00 0.00 ? 416  ALA A O     1 
ATOM 3256  C CB    . ALA A 1  416 ? 98.339  -11.451  23.759  1.00 0.00 ? 416  ALA A CB    1 
ATOM 3257  N N     . LYS A 1  417 ? 98.466  -13.264  26.767  1.00 0.00 ? 417  LYS A N     1 
ATOM 3258  C CA    . LYS A 1  417 ? 98.515  -13.192  28.215  1.00 0.00 ? 417  LYS A CA    1 
ATOM 3259  C C     . LYS A 1  417 ? 99.617  -14.122  28.643  1.00 0.00 ? 417  LYS A C     1 
ATOM 3260  O O     . LYS A 1  417 ? 100.185 -14.007  29.727  1.00 0.00 ? 417  LYS A O     1 
ATOM 3261  C CB    . LYS A 1  417 ? 97.189  -13.643  28.873  1.00 0.00 ? 417  LYS A CB    1 
ATOM 3262  C CG    . LYS A 1  417 ? 96.965  -13.162  30.327  1.00 0.00 ? 417  LYS A CG    1 
ATOM 3263  C CD    . LYS A 1  417 ? 97.519  -13.996  31.506  1.00 0.00 ? 417  LYS A CD    1 
ATOM 3264  C CE    . LYS A 1  417 ? 97.116  -15.481  31.565  1.00 0.00 ? 417  LYS A CE    1 
ATOM 3265  N NZ    . LYS A 1  417 ? 98.009  -16.336  30.747  1.00 0.00 ? 417  LYS A NZ    1 
ATOM 3266  N N     . GLU A 1  418 ? 99.984  -15.049  27.734  1.00 0.00 ? 418  GLU A N     1 
ATOM 3267  C CA    . GLU A 1  418 ? 101.059 -15.991  27.873  1.00 0.00 ? 418  GLU A CA    1 
ATOM 3268  C C     . GLU A 1  418 ? 102.342 -15.242  27.598  1.00 0.00 ? 418  GLU A C     1 
ATOM 3269  O O     . GLU A 1  418 ? 103.357 -15.479  28.251  1.00 0.00 ? 418  GLU A O     1 
ATOM 3270  C CB    . GLU A 1  418 ? 100.903 -17.186  26.897  1.00 0.00 ? 418  GLU A CB    1 
ATOM 3271  C CG    . GLU A 1  418 ? 99.775  -18.199  27.227  1.00 0.00 ? 418  GLU A CG    1 
ATOM 3272  C CD    . GLU A 1  418 ? 98.351  -17.634  27.347  1.00 0.00 ? 418  GLU A CD    1 
ATOM 3273  O OE1   . GLU A 1  418 ? 97.961  -16.756  26.542  1.00 0.00 ? 418  GLU A OE1   1 
ATOM 3274  O OE2   . GLU A 1  418 ? 97.621  -18.098  28.262  1.00 0.00 ? 418  GLU A OE2   1 
ATOM 3275  N N     . LEU A 1  419 ? 102.288 -14.268  26.649  1.00 0.00 ? 419  LEU A N     1 
ATOM 3276  C CA    . LEU A 1  419 ? 103.303 -13.271  26.399  1.00 0.00 ? 419  LEU A CA    1 
ATOM 3277  C C     . LEU A 1  419 ? 103.384 -12.316  27.566  1.00 0.00 ? 419  LEU A C     1 
ATOM 3278  O O     . LEU A 1  419 ? 104.473 -11.878  27.912  1.00 0.00 ? 419  LEU A O     1 
ATOM 3279  C CB    . LEU A 1  419 ? 103.033 -12.388  25.143  1.00 0.00 ? 419  LEU A CB    1 
ATOM 3280  C CG    . LEU A 1  419 ? 103.219 -13.048  23.750  1.00 0.00 ? 419  LEU A CG    1 
ATOM 3281  C CD1   . LEU A 1  419 ? 102.812 -12.071  22.629  1.00 0.00 ? 419  LEU A CD1   1 
ATOM 3282  C CD2   . LEU A 1  419 ? 104.640 -13.579  23.497  1.00 0.00 ? 419  LEU A CD2   1 
ATOM 3283  N N     . ASN A 1  420 ? 102.231 -11.954  28.188  1.00 0.00 ? 420  ASN A N     1 
ATOM 3284  C CA    . ASN A 1  420 ? 102.129 -10.907  29.188  1.00 0.00 ? 420  ASN A CA    1 
ATOM 3285  C C     . ASN A 1  420 ? 102.939 -11.190  30.428  1.00 0.00 ? 420  ASN A C     1 
ATOM 3286  O O     . ASN A 1  420 ? 103.493 -10.257  31.003  1.00 0.00 ? 420  ASN A O     1 
ATOM 3287  C CB    . ASN A 1  420 ? 100.655 -10.606  29.593  1.00 0.00 ? 420  ASN A CB    1 
ATOM 3288  C CG    . ASN A 1  420 ? 100.480 -9.423   30.566  1.00 0.00 ? 420  ASN A CG    1 
ATOM 3289  O OD1   . ASN A 1  420 ? 99.904  -9.595   31.647  1.00 0.00 ? 420  ASN A OD1   1 
ATOM 3290  N ND2   . ASN A 1  420 ? 100.988 -8.219   30.167  1.00 0.00 ? 420  ASN A ND2   1 
ATOM 3291  N N     . LYS A 1  421 ? 103.027 -12.462  30.890  1.00 0.00 ? 421  LYS A N     1 
ATOM 3292  C CA    . LYS A 1  421 ? 103.867 -12.779  32.024  1.00 0.00 ? 421  LYS A CA    1 
ATOM 3293  C C     . LYS A 1  421 ? 105.336 -12.678  31.676  1.00 0.00 ? 421  LYS A C     1 
ATOM 3294  O O     . LYS A 1  421 ? 106.106 -12.092  32.434  1.00 0.00 ? 421  LYS A O     1 
ATOM 3295  C CB    . LYS A 1  421 ? 103.581 -14.175  32.639  1.00 0.00 ? 421  LYS A CB    1 
ATOM 3296  C CG    . LYS A 1  421 ? 104.556 -14.551  33.775  1.00 0.00 ? 421  LYS A CG    1 
ATOM 3297  C CD    . LYS A 1  421 ? 103.907 -15.091  35.055  1.00 0.00 ? 421  LYS A CD    1 
ATOM 3298  C CE    . LYS A 1  421 ? 104.958 -15.293  36.157  1.00 0.00 ? 421  LYS A CE    1 
ATOM 3299  N NZ    . LYS A 1  421 ? 104.340 -15.533  37.481  1.00 0.00 ? 421  LYS A NZ    1 
ATOM 3300  N N     . VAL A 1  422 ? 105.752 -13.241  30.519  1.00 0.00 ? 422  VAL A N     1 
ATOM 3301  C CA    . VAL A 1  422 ? 107.143 -13.523  30.247  1.00 0.00 ? 422  VAL A CA    1 
ATOM 3302  C C     . VAL A 1  422 ? 107.845 -12.336  29.611  1.00 0.00 ? 422  VAL A C     1 
ATOM 3303  O O     . VAL A 1  422 ? 109.060 -12.205  29.731  1.00 0.00 ? 422  VAL A O     1 
ATOM 3304  C CB    . VAL A 1  422 ? 107.257 -14.759  29.357  1.00 0.00 ? 422  VAL A CB    1 
ATOM 3305  C CG1   . VAL A 1  422 ? 108.728 -15.159  29.102  1.00 0.00 ? 422  VAL A CG1   1 
ATOM 3306  C CG2   . VAL A 1  422 ? 106.493 -15.933  30.013  1.00 0.00 ? 422  VAL A CG2   1 
ATOM 3307  N N     . ILE A 1  423 ? 107.112 -11.407  28.948  1.00 0.00 ? 423  ILE A N     1 
ATOM 3308  C CA    . ILE A 1  423 ? 107.691 -10.222  28.336  1.00 0.00 ? 423  ILE A CA    1 
ATOM 3309  C C     . ILE A 1  423 ? 108.274 -9.263   29.361  1.00 0.00 ? 423  ILE A C     1 
ATOM 3310  O O     . ILE A 1  423 ? 109.387 -8.823   29.098  1.00 0.00 ? 423  ILE A O     1 
ATOM 3311  C CB    . ILE A 1  423 ? 106.779 -9.538   27.308  1.00 0.00 ? 423  ILE A CB    1 
ATOM 3312  C CG1   . ILE A 1  423 ? 106.736 -10.423  26.035  1.00 0.00 ? 423  ILE A CG1   1 
ATOM 3313  C CG2   . ILE A 1  423 ? 107.248 -8.097   26.977  1.00 0.00 ? 423  ILE A CG2   1 
ATOM 3314  C CD1   . ILE A 1  423 ? 105.891 -9.854   24.891  1.00 0.00 ? 423  ILE A CD1   1 
ATOM 3315  N N     . PRO A 1  424 ? 107.695 -8.903   30.511  1.00 0.00 ? 424  PRO A N     1 
ATOM 3316  C CA    . PRO A 1  424 ? 108.333 -8.016   31.477  1.00 0.00 ? 424  PRO A CA    1 
ATOM 3317  C C     . PRO A 1  424 ? 109.591 -8.574   32.095  1.00 0.00 ? 424  PRO A C     1 
ATOM 3318  O O     . PRO A 1  424 ? 110.451 -7.781   32.474  1.00 0.00 ? 424  PRO A O     1 
ATOM 3319  C CB    . PRO A 1  424 ? 107.266 -7.794   32.553  1.00 0.00 ? 424  PRO A CB    1 
ATOM 3320  C CG    . PRO A 1  424 ? 105.957 -7.863   31.767  1.00 0.00 ? 424  PRO A CG    1 
ATOM 3321  C CD    . PRO A 1  424 ? 106.251 -8.946   30.728  1.00 0.00 ? 424  PRO A CD    1 
ATOM 3322  N N     . ILE A 1  425 ? 109.704 -9.920   32.233  1.00 0.00 ? 425  ILE A N     1 
ATOM 3323  C CA    . ILE A 1  425 ? 110.869 -10.576  32.796  1.00 0.00 ? 425  ILE A CA    1 
ATOM 3324  C C     . ILE A 1  425 ? 112.002 -10.500  31.801  1.00 0.00 ? 425  ILE A C     1 
ATOM 3325  O O     . ILE A 1  425 ? 113.168 -10.418  32.176  1.00 0.00 ? 425  ILE A O     1 
ATOM 3326  C CB    . ILE A 1  425 ? 110.610 -12.011  33.291  1.00 0.00 ? 425  ILE A CB    1 
ATOM 3327  C CG1   . ILE A 1  425 ? 111.040 -13.148  32.318  1.00 0.00 ? 425  ILE A CG1   1 
ATOM 3328  C CG2   . ILE A 1  425 ? 109.127 -12.108  33.712  1.00 0.00 ? 425  ILE A CG2   1 
ATOM 3329  C CD1   . ILE A 1  425 ? 110.512 -14.544  32.668  1.00 0.00 ? 425  ILE A CD1   1 
ATOM 3330  N N     . ALA A 1  426 ? 111.655 -10.514  30.491  1.00 0.00 ? 426  ALA A N     1 
ATOM 3331  C CA    . ALA A 1  426 ? 112.584 -10.494  29.396  1.00 0.00 ? 426  ALA A CA    1 
ATOM 3332  C C     . ALA A 1  426 ? 113.006 -9.091   29.050  1.00 0.00 ? 426  ALA A C     1 
ATOM 3333  O O     . ALA A 1  426 ? 114.110 -8.897   28.554  1.00 0.00 ? 426  ALA A O     1 
ATOM 3334  C CB    . ALA A 1  426 ? 111.947 -11.107  28.130  1.00 0.00 ? 426  ALA A CB    1 
ATOM 3335  N N     . ALA A 1  427 ? 112.133 -8.081   29.275  1.00 0.00 ? 427  ALA A N     1 
ATOM 3336  C CA    . ALA A 1  427 ? 112.319 -6.754   28.739  1.00 0.00 ? 427  ALA A CA    1 
ATOM 3337  C C     . ALA A 1  427 ? 113.144 -5.904   29.656  1.00 0.00 ? 427  ALA A C     1 
ATOM 3338  O O     . ALA A 1  427 ? 114.106 -5.273   29.220  1.00 0.00 ? 427  ALA A O     1 
ATOM 3339  C CB    . ALA A 1  427 ? 110.972 -6.033   28.529  1.00 0.00 ? 427  ALA A CB    1 
ATOM 3340  N N     . VAL A 1  428 ? 112.771 -5.866   30.959  1.00 0.00 ? 428  VAL A N     1 
ATOM 3341  C CA    . VAL A 1  428 ? 113.408 -5.036   31.957  1.00 0.00 ? 428  VAL A CA    1 
ATOM 3342  C C     . VAL A 1  428 ? 114.757 -5.609   32.297  1.00 0.00 ? 428  VAL A C     1 
ATOM 3343  O O     . VAL A 1  428 ? 115.741 -4.879   32.405  1.00 0.00 ? 428  VAL A O     1 
ATOM 3344  C CB    . VAL A 1  428 ? 112.577 -4.899   33.229  1.00 0.00 ? 428  VAL A CB    1 
ATOM 3345  C CG1   . VAL A 1  428 ? 113.281 -3.972   34.246  1.00 0.00 ? 428  VAL A CG1   1 
ATOM 3346  C CG2   . VAL A 1  428 ? 111.180 -4.354   32.865  1.00 0.00 ? 428  VAL A CG2   1 
ATOM 3347  N N     . THR A 1  429 ? 114.826 -6.956   32.444  1.00 0.00 ? 429  THR A N     1 
ATOM 3348  C CA    . THR A 1  429 ? 116.035 -7.642   32.838  1.00 0.00 ? 429  THR A CA    1 
ATOM 3349  C C     . THR A 1  429 ? 116.904 -7.828   31.623  1.00 0.00 ? 429  THR A C     1 
ATOM 3350  O O     . THR A 1  429 ? 118.103 -8.039   31.750  1.00 0.00 ? 429  THR A O     1 
ATOM 3351  C CB    . THR A 1  429 ? 115.770 -8.998   33.484  1.00 0.00 ? 429  THR A CB    1 
ATOM 3352  O OG1   . THR A 1  429 ? 114.697 -8.894   34.412  1.00 0.00 ? 429  THR A OG1   1 
ATOM 3353  C CG2   . THR A 1  429 ? 117.026 -9.499   34.232  1.00 0.00 ? 429  THR A CG2   1 
ATOM 3354  N N     . GLY A 1  430 ? 116.337 -7.706   30.400  1.00 0.00 ? 430  GLY A N     1 
ATOM 3355  C CA    . GLY A 1  430 ? 117.098 -7.865   29.184  1.00 0.00 ? 430  GLY A CA    1 
ATOM 3356  C C     . GLY A 1  430 ? 117.830 -6.607   28.844  1.00 0.00 ? 430  GLY A C     1 
ATOM 3357  O O     . GLY A 1  430 ? 118.869 -6.663   28.193  1.00 0.00 ? 430  GLY A O     1 
ATOM 3358  N N     . ALA A 1  431 ? 117.319 -5.441   29.315  1.00 0.00 ? 431  ALA A N     1 
ATOM 3359  C CA    . ALA A 1  431 ? 117.997 -4.170   29.233  1.00 0.00 ? 431  ALA A CA    1 
ATOM 3360  C C     . ALA A 1  431 ? 119.112 -4.118   30.246  1.00 0.00 ? 431  ALA A C     1 
ATOM 3361  O O     . ALA A 1  431 ? 120.167 -3.550   29.976  1.00 0.00 ? 431  ALA A O     1 
ATOM 3362  C CB    . ALA A 1  431 ? 117.054 -2.979   29.498  1.00 0.00 ? 431  ALA A CB    1 
ATOM 3363  N N     . SER A 1  432 ? 118.872 -4.709   31.442  1.00 0.00 ? 432  SER A N     1 
ATOM 3364  C CA    . SER A 1  432 ? 119.786 -4.744   32.557  1.00 0.00 ? 432  SER A CA    1 
ATOM 3365  C C     . SER A 1  432 ? 120.971 -5.650   32.296  1.00 0.00 ? 432  SER A C     1 
ATOM 3366  O O     . SER A 1  432 ? 122.095 -5.312   32.656  1.00 0.00 ? 432  SER A O     1 
ATOM 3367  C CB    . SER A 1  432 ? 119.061 -5.203   33.847  1.00 0.00 ? 432  SER A CB    1 
ATOM 3368  O OG    . SER A 1  432 ? 119.817 -4.912   35.018  1.00 0.00 ? 432  SER A OG    1 
ATOM 3369  N N     . VAL A 1  433 ? 120.736 -6.832   31.673  1.00 0.00 ? 433  VAL A N     1 
ATOM 3370  C CA    . VAL A 1  433 ? 121.754 -7.816   31.369  1.00 0.00 ? 433  VAL A CA    1 
ATOM 3371  C C     . VAL A 1  433 ? 122.525 -7.370   30.155  1.00 0.00 ? 433  VAL A C     1 
ATOM 3372  O O     . VAL A 1  433 ? 123.710 -7.674   30.025  1.00 0.00 ? 433  VAL A O     1 
ATOM 3373  C CB    . VAL A 1  433 ? 121.152 -9.203   31.161  1.00 0.00 ? 433  VAL A CB    1 
ATOM 3374  C CG1   . VAL A 1  433 ? 122.107 -10.190  30.445  1.00 0.00 ? 433  VAL A CG1   1 
ATOM 3375  C CG2   . VAL A 1  433 ? 120.755 -9.754   32.549  1.00 0.00 ? 433  VAL A CG2   1 
ATOM 3376  N N     . LEU A 1  434 ? 121.886 -6.580   29.255  1.00 0.00 ? 434  LEU A N     1 
ATOM 3377  C CA    . LEU A 1  434 ? 122.553 -5.949   28.139  1.00 0.00 ? 434  LEU A CA    1 
ATOM 3378  C C     . LEU A 1  434 ? 123.535 -4.933   28.658  1.00 0.00 ? 434  LEU A C     1 
ATOM 3379  O O     . LEU A 1  434 ? 124.660 -4.888   28.180  1.00 0.00 ? 434  LEU A O     1 
ATOM 3380  C CB    . LEU A 1  434 ? 121.548 -5.303   27.159  1.00 0.00 ? 434  LEU A CB    1 
ATOM 3381  C CG    . LEU A 1  434 ? 122.121 -4.467   25.987  1.00 0.00 ? 434  LEU A CG    1 
ATOM 3382  C CD1   . LEU A 1  434 ? 123.249 -5.146   25.183  1.00 0.00 ? 434  LEU A CD1   1 
ATOM 3383  C CD2   . LEU A 1  434 ? 120.967 -4.058   25.052  1.00 0.00 ? 434  LEU A CD2   1 
ATOM 3384  N N     . SER A 1  435 ? 123.150 -4.147   29.695  1.00 0.00 ? 435  SER A N     1 
ATOM 3385  C CA    . SER A 1  435 ? 124.011 -3.192   30.359  1.00 0.00 ? 435  SER A CA    1 
ATOM 3386  C C     . SER A 1  435 ? 125.158 -3.865   31.076  1.00 0.00 ? 435  SER A C     1 
ATOM 3387  O O     . SER A 1  435 ? 126.264 -3.332   31.104  1.00 0.00 ? 435  SER A O     1 
ATOM 3388  C CB    . SER A 1  435 ? 123.273 -2.294   31.380  1.00 0.00 ? 435  SER A CB    1 
ATOM 3389  O OG    . SER A 1  435 ? 122.270 -1.518   30.739  1.00 0.00 ? 435  SER A OG    1 
ATOM 3390  N N     . LEU A 1  436 ? 124.921 -5.056   31.676  1.00 0.00 ? 436  LEU A N     1 
ATOM 3391  C CA    . LEU A 1  436 ? 125.921 -5.824   32.382  1.00 0.00 ? 436  LEU A CA    1 
ATOM 3392  C C     . LEU A 1  436 ? 126.988 -6.364   31.466  1.00 0.00 ? 436  LEU A C     1 
ATOM 3393  O O     . LEU A 1  436 ? 128.151 -6.432   31.848  1.00 0.00 ? 436  LEU A O     1 
ATOM 3394  C CB    . LEU A 1  436 ? 125.314 -6.998   33.189  1.00 0.00 ? 436  LEU A CB    1 
ATOM 3395  C CG    . LEU A 1  436 ? 126.306 -7.759   34.110  1.00 0.00 ? 436  LEU A CG    1 
ATOM 3396  C CD1   . LEU A 1  436 ? 127.048 -6.850   35.114  1.00 0.00 ? 436  LEU A CD1   1 
ATOM 3397  C CD2   . LEU A 1  436 ? 125.589 -8.908   34.839  1.00 0.00 ? 436  LEU A CD2   1 
ATOM 3398  N N     . ILE A 1  437 ? 126.625 -6.758   30.225  1.00 0.00 ? 437  ILE A N     1 
ATOM 3399  C CA    . ILE A 1  437 ? 127.544 -7.390   29.304  1.00 0.00 ? 437  ILE A CA    1 
ATOM 3400  C C     . ILE A 1  437 ? 128.090 -6.307   28.396  1.00 0.00 ? 437  ILE A C     1 
ATOM 3401  O O     . ILE A 1  437 ? 129.027 -6.524   27.631  1.00 0.00 ? 437  ILE A O     1 
ATOM 3402  C CB    . ILE A 1  437 ? 126.855 -8.545   28.572  1.00 0.00 ? 437  ILE A CB    1 
ATOM 3403  C CG1   . ILE A 1  437 ? 126.491 -9.635   29.619  1.00 0.00 ? 437  ILE A CG1   1 
ATOM 3404  C CG2   . ILE A 1  437 ? 127.736 -9.131   27.441  1.00 0.00 ? 437  ILE A CG2   1 
ATOM 3405  C CD1   . ILE A 1  437 ? 125.624 -10.775  29.081  1.00 0.00 ? 437  ILE A CD1   1 
ATOM 3406  N N     . THR A 1  438 ? 127.570 -5.061   28.528  1.00 0.00 ? 438  THR A N     1 
ATOM 3407  C CA    . THR A 1  438 ? 128.145 -3.885   27.923  1.00 0.00 ? 438  THR A CA    1 
ATOM 3408  C C     . THR A 1  438 ? 129.412 -3.529   28.658  1.00 0.00 ? 438  THR A C     1 
ATOM 3409  O O     . THR A 1  438 ? 130.422 -3.275   28.009  1.00 0.00 ? 438  THR A O     1 
ATOM 3410  C CB    . THR A 1  438 ? 127.172 -2.713   27.866  1.00 0.00 ? 438  THR A CB    1 
ATOM 3411  O OG1   . THR A 1  438 ? 126.191 -2.956   26.866  1.00 0.00 ? 438  THR A OG1   1 
ATOM 3412  C CG2   . THR A 1  438 ? 127.877 -1.391   27.521  1.00 0.00 ? 438  THR A CG2   1 
ATOM 3413  N N     . VAL A 1  439 ? 129.410 -3.550   30.020  1.00 0.00 ? 439  VAL A N     1 
ATOM 3414  C CA    . VAL A 1  439 ? 130.587 -3.255   30.820  1.00 0.00 ? 439  VAL A CA    1 
ATOM 3415  C C     . VAL A 1  439 ? 131.593 -4.379   30.737  1.00 0.00 ? 439  VAL A C     1 
ATOM 3416  O O     . VAL A 1  439 ? 132.792 -4.128   30.815  1.00 0.00 ? 439  VAL A O     1 
ATOM 3417  C CB    . VAL A 1  439 ? 130.285 -2.851   32.268  1.00 0.00 ? 439  VAL A CB    1 
ATOM 3418  C CG1   . VAL A 1  439 ? 129.367 -3.859   32.980  1.00 0.00 ? 439  VAL A CG1   1 
ATOM 3419  C CG2   . VAL A 1  439 ? 131.576 -2.600   33.078  1.00 0.00 ? 439  VAL A CG2   1 
ATOM 3420  N N     . ILE A 1  440 ? 131.144 -5.644   30.525  1.00 0.00 ? 440  ILE A N     1 
ATOM 3421  C CA    . ILE A 1  440 ? 132.025 -6.775   30.297  1.00 0.00 ? 440  ILE A CA    1 
ATOM 3422  C C     . ILE A 1  440 ? 132.702 -6.629   28.955  1.00 0.00 ? 440  ILE A C     1 
ATOM 3423  O O     . ILE A 1  440 ? 133.880 -6.949   28.812  1.00 0.00 ? 440  ILE A O     1 
ATOM 3424  C CB    . ILE A 1  440 ? 131.328 -8.125   30.432  1.00 0.00 ? 440  ILE A CB    1 
ATOM 3425  C CG1   . ILE A 1  440 ? 130.858 -8.293   31.899  1.00 0.00 ? 440  ILE A CG1   1 
ATOM 3426  C CG2   . ILE A 1  440 ? 132.274 -9.278   30.022  1.00 0.00 ? 440  ILE A CG2   1 
ATOM 3427  C CD1   . ILE A 1  440 ? 129.917 -9.481   32.122  1.00 0.00 ? 440  ILE A CD1   1 
ATOM 3428  N N     . GLY A 1  441 ? 131.979 -6.106   27.937  1.00 0.00 ? 441  GLY A N     1 
ATOM 3429  C CA    . GLY A 1  441 ? 132.524 -5.877   26.620  1.00 0.00 ? 441  GLY A CA    1 
ATOM 3430  C C     . GLY A 1  441 ? 133.549 -4.775   26.634  1.00 0.00 ? 441  GLY A C     1 
ATOM 3431  O O     . GLY A 1  441 ? 134.518 -4.810   25.879  1.00 0.00 ? 441  GLY A O     1 
ATOM 3432  N N     . GLU A 1  442 ? 133.371 -3.773   27.526  1.00 0.00 ? 442  GLU A N     1 
ATOM 3433  C CA    . GLU A 1  442 ? 134.324 -2.715   27.733  1.00 0.00 ? 442  GLU A CA    1 
ATOM 3434  C C     . GLU A 1  442 ? 135.558 -3.210   28.444  1.00 0.00 ? 442  GLU A C     1 
ATOM 3435  O O     . GLU A 1  442 ? 136.665 -2.808   28.100  1.00 0.00 ? 442  GLU A O     1 
ATOM 3436  C CB    . GLU A 1  442 ? 133.728 -1.513   28.497  1.00 0.00 ? 442  GLU A CB    1 
ATOM 3437  C CG    . GLU A 1  442 ? 132.563 -0.872   27.721  1.00 0.00 ? 442  GLU A CG    1 
ATOM 3438  C CD    . GLU A 1  442 ? 132.620 0.649    27.790  1.00 0.00 ? 442  GLU A CD    1 
ATOM 3439  O OE1   . GLU A 1  442 ? 132.828 1.286    26.721  1.00 0.00 ? 442  GLU A OE1   1 
ATOM 3440  O OE2   . GLU A 1  442 ? 132.442 1.194    28.907  1.00 0.00 ? 442  GLU A OE2   1 
ATOM 3441  N N     . SER A 1  443 ? 135.394 -4.108   29.447  1.00 0.00 ? 443  SER A N     1 
ATOM 3442  C CA    . SER A 1  443 ? 136.456 -4.528   30.337  1.00 0.00 ? 443  SER A CA    1 
ATOM 3443  C C     . SER A 1  443 ? 137.476 -5.411   29.665  1.00 0.00 ? 443  SER A C     1 
ATOM 3444  O O     . SER A 1  443 ? 138.629 -5.448   30.092  1.00 0.00 ? 443  SER A O     1 
ATOM 3445  C CB    . SER A 1  443 ? 135.928 -5.246   31.605  1.00 0.00 ? 443  SER A CB    1 
ATOM 3446  O OG    . SER A 1  443 ? 135.328 -6.509   31.346  1.00 0.00 ? 443  SER A OG    1 
ATOM 3447  N N     . LEU A 1  444 ? 137.070 -6.113   28.572  1.00 0.00 ? 444  LEU A N     1 
ATOM 3448  C CA    . LEU A 1  444 ? 137.930 -6.942   27.757  1.00 0.00 ? 444  LEU A CA    1 
ATOM 3449  C C     . LEU A 1  444 ? 138.999 -6.089   27.133  1.00 0.00 ? 444  LEU A C     1 
ATOM 3450  O O     . LEU A 1  444 ? 140.169 -6.468   27.119  1.00 0.00 ? 444  LEU A O     1 
ATOM 3451  C CB    . LEU A 1  444 ? 137.154 -7.667   26.630  1.00 0.00 ? 444  LEU A CB    1 
ATOM 3452  C CG    . LEU A 1  444 ? 136.244 -8.812   27.137  1.00 0.00 ? 444  LEU A CG    1 
ATOM 3453  C CD1   . LEU A 1  444 ? 135.240 -9.237   26.050  1.00 0.00 ? 444  LEU A CD1   1 
ATOM 3454  C CD2   . LEU A 1  444 ? 137.047 -10.030  27.638  1.00 0.00 ? 444  LEU A CD2   1 
ATOM 3455  N N     . GLY A 1  445 ? 138.613 -4.881   26.668  1.00 0.00 ? 445  GLY A N     1 
ATOM 3456  C CA    . GLY A 1  445 ? 139.574 -3.898   26.266  1.00 0.00 ? 445  GLY A CA    1 
ATOM 3457  C C     . GLY A 1  445 ? 138.959 -3.019   25.234  1.00 0.00 ? 445  GLY A C     1 
ATOM 3458  O O     . GLY A 1  445 ? 137.789 -3.168   24.881  1.00 0.00 ? 445  GLY A O     1 
ATOM 3459  N N     . LEU A 1  446 ? 139.787 -2.061   24.749  1.00 0.00 ? 446  LEU A N     1 
ATOM 3460  C CA    . LEU A 1  446 ? 139.514 -1.108   23.703  1.00 0.00 ? 446  LEU A CA    1 
ATOM 3461  C C     . LEU A 1  446 ? 138.576 -0.039   24.180  1.00 0.00 ? 446  LEU A C     1 
ATOM 3462  O O     . LEU A 1  446 ? 137.762 -0.255   25.075  1.00 0.00 ? 446  LEU A O     1 
ATOM 3463  C CB    . LEU A 1  446 ? 139.084 -1.738   22.350  1.00 0.00 ? 446  LEU A CB    1 
ATOM 3464  C CG    . LEU A 1  446 ? 139.196 -0.837   21.092  1.00 0.00 ? 446  LEU A CG    1 
ATOM 3465  C CD1   . LEU A 1  446 ? 140.582 -0.184   20.915  1.00 0.00 ? 446  LEU A CD1   1 
ATOM 3466  C CD2   . LEU A 1  446 ? 138.844 -1.644   19.833  1.00 0.00 ? 446  LEU A CD2   1 
ATOM 3467  N N     . LYS A 1  447 ? 138.695 1.167    23.596  1.00 0.00 ? 447  LYS A N     1 
ATOM 3468  C CA    . LYS A 1  447 ? 137.755 2.215    23.847  1.00 0.00 ? 447  LYS A CA    1 
ATOM 3469  C C     . LYS A 1  447 ? 137.801 3.131    22.665  1.00 0.00 ? 447  LYS A C     1 
ATOM 3470  O O     . LYS A 1  447 ? 138.575 2.938    21.726  1.00 0.00 ? 447  LYS A O     1 
ATOM 3471  C CB    . LYS A 1  447 ? 137.974 2.994    25.166  1.00 0.00 ? 447  LYS A CB    1 
ATOM 3472  C CG    . LYS A 1  447 ? 136.649 3.522    25.739  1.00 0.00 ? 447  LYS A CG    1 
ATOM 3473  C CD    . LYS A 1  447 ? 136.760 4.115    27.145  1.00 0.00 ? 447  LYS A CD    1 
ATOM 3474  C CE    . LYS A 1  447 ? 135.432 4.691    27.621  1.00 0.00 ? 447  LYS A CE    1 
ATOM 3475  N NZ    . LYS A 1  447 ? 134.376 3.669    27.517  1.00 0.00 ? 447  LYS A NZ    1 
ATOM 3476  N N     . GLY A 1  448 ? 136.889 4.124    22.682  1.00 0.00 ? 448  GLY A N     1 
ATOM 3477  C CA    . GLY A 1  448 ? 136.577 4.973    21.580  1.00 0.00 ? 448  GLY A CA    1 
ATOM 3478  C C     . GLY A 1  448 ? 135.324 4.459    20.948  1.00 0.00 ? 448  GLY A C     1 
ATOM 3479  O O     . GLY A 1  448 ? 134.906 5.014    19.936  1.00 0.00 ? 448  GLY A O     1 
ATOM 3480  N N     . LYS A 1  449 ? 134.713 3.388    21.530  1.00 0.00 ? 449  LYS A N     1 
ATOM 3481  C CA    . LYS A 1  449 ? 133.538 2.770    20.977  1.00 0.00 ? 449  LYS A CA    1 
ATOM 3482  C C     . LYS A 1  449 ? 133.151 1.515    21.703  1.00 0.00 ? 449  LYS A C     1 
ATOM 3483  O O     . LYS A 1  449 ? 132.296 0.806    21.192  1.00 0.00 ? 449  LYS A O     1 
ATOM 3484  C CB    . LYS A 1  449 ? 133.725 2.273    19.517  1.00 0.00 ? 449  LYS A CB    1 
ATOM 3485  C CG    . LYS A 1  449 ? 134.859 1.243    19.368  1.00 0.00 ? 449  LYS A CG    1 
ATOM 3486  C CD    . LYS A 1  449 ? 134.957 0.659    17.962  1.00 0.00 ? 449  LYS A CD    1 
ATOM 3487  C CE    . LYS A 1  449 ? 135.937 -0.513   17.928  1.00 0.00 ? 449  LYS A CE    1 
ATOM 3488  N NZ    . LYS A 1  449 ? 136.182 -0.948   16.546  1.00 0.00 ? 449  LYS A NZ    1 
ATOM 3489  N N     . ALA A 1  450 ? 133.753 1.134    22.856  1.00 0.00 ? 450  ALA A N     1 
ATOM 3490  C CA    . ALA A 1  450 ? 133.605 -0.240   23.316  1.00 0.00 ? 450  ALA A CA    1 
ATOM 3491  C C     . ALA A 1  450 ? 132.208 -0.634   23.738  1.00 0.00 ? 450  ALA A C     1 
ATOM 3492  O O     . ALA A 1  450 ? 131.843 -1.798   23.600  1.00 0.00 ? 450  ALA A O     1 
ATOM 3493  C CB    . ALA A 1  450 ? 134.592 -0.648   24.417  1.00 0.00 ? 450  ALA A CB    1 
ATOM 3494  N N     . ALA A 1  451 ? 131.383 0.326    24.218  1.00 0.00 ? 451  ALA A N     1 
ATOM 3495  C CA    . ALA A 1  451 ? 130.003 0.050    24.541  1.00 0.00 ? 451  ALA A CA    1 
ATOM 3496  C C     . ALA A 1  451 ? 129.105 0.441    23.397  1.00 0.00 ? 451  ALA A C     1 
ATOM 3497  O O     . ALA A 1  451 ? 127.923 0.103    23.401  1.00 0.00 ? 451  ALA A O     1 
ATOM 3498  C CB    . ALA A 1  451 ? 129.523 0.896    25.723  1.00 0.00 ? 451  ALA A CB    1 
ATOM 3499  N N     . GLY A 1  452 ? 129.650 1.162    22.391  1.00 0.00 ? 452  GLY A N     1 
ATOM 3500  C CA    . GLY A 1  452 ? 128.907 1.625    21.250  1.00 0.00 ? 452  GLY A CA    1 
ATOM 3501  C C     . GLY A 1  452 ? 128.917 0.600    20.152  1.00 0.00 ? 452  GLY A C     1 
ATOM 3502  O O     . GLY A 1  452 ? 128.023 0.596    19.308  1.00 0.00 ? 452  GLY A O     1 
ATOM 3503  N N     . ILE A 1  453 ? 129.942 -0.291   20.132  1.00 0.00 ? 453  ILE A N     1 
ATOM 3504  C CA    . ILE A 1  453 ? 130.061 -1.356   19.167  1.00 0.00 ? 453  ILE A CA    1 
ATOM 3505  C C     . ILE A 1  453 ? 129.161 -2.485   19.563  1.00 0.00 ? 453  ILE A C     1 
ATOM 3506  O O     . ILE A 1  453 ? 128.512 -3.068   18.701  1.00 0.00 ? 453  ILE A O     1 
ATOM 3507  C CB    . ILE A 1  453 ? 131.492 -1.823   18.872  1.00 0.00 ? 453  ILE A CB    1 
ATOM 3508  C CG1   . ILE A 1  453 ? 131.529 -2.829   17.692  1.00 0.00 ? 453  ILE A CG1   1 
ATOM 3509  C CG2   . ILE A 1  453 ? 132.197 -2.394   20.121  1.00 0.00 ? 453  ILE A CG2   1 
ATOM 3510  C CD1   . ILE A 1  453 ? 132.915 -3.001   17.065  1.00 0.00 ? 453  ILE A CD1   1 
ATOM 3511  N N     . VAL A 1  454 ? 129.078 -2.799   20.884  1.00 0.00 ? 454  VAL A N     1 
ATOM 3512  C CA    . VAL A 1  454 ? 128.310 -3.912   21.390  1.00 0.00 ? 454  VAL A CA    1 
ATOM 3513  C C     . VAL A 1  454 ? 126.834 -3.709   21.186  1.00 0.00 ? 454  VAL A C     1 
ATOM 3514  O O     . VAL A 1  454 ? 126.152 -4.659   20.822  1.00 0.00 ? 454  VAL A O     1 
ATOM 3515  C CB    . VAL A 1  454 ? 128.623 -4.319   22.826  1.00 0.00 ? 454  VAL A CB    1 
ATOM 3516  C CG1   . VAL A 1  454 ? 130.104 -4.730   22.899  1.00 0.00 ? 454  VAL A CG1   1 
ATOM 3517  C CG2   . VAL A 1  454 ? 128.282 -3.220   23.845  1.00 0.00 ? 454  VAL A CG2   1 
ATOM 3518  N N     . VAL A 1  455 ? 126.318 -2.465   21.372  1.00 0.00 ? 455  VAL A N     1 
ATOM 3519  C CA    . VAL A 1  455 ? 124.925 -2.135   21.156  1.00 0.00 ? 455  VAL A CA    1 
ATOM 3520  C C     . VAL A 1  455 ? 124.630 -2.008   19.679  1.00 0.00 ? 455  VAL A C     1 
ATOM 3521  O O     . VAL A 1  455 ? 123.508 -2.256   19.239  1.00 0.00 ? 455  VAL A O     1 
ATOM 3522  C CB    . VAL A 1  455 ? 124.502 -0.871   21.903  1.00 0.00 ? 455  VAL A CB    1 
ATOM 3523  C CG1   . VAL A 1  455 ? 125.272 0.374    21.419  1.00 0.00 ? 455  VAL A CG1   1 
ATOM 3524  C CG2   . VAL A 1  455 ? 122.978 -0.670   21.801  1.00 0.00 ? 455  VAL A CG2   1 
ATOM 3525  N N     . GLY A 1  456 ? 125.653 -1.643   18.867  1.00 0.00 ? 456  GLY A N     1 
ATOM 3526  C CA    . GLY A 1  456 ? 125.490 -1.379   17.460  1.00 0.00 ? 456  GLY A CA    1 
ATOM 3527  C C     . GLY A 1  456 ? 125.260 -2.645   16.696  1.00 0.00 ? 456  GLY A C     1 
ATOM 3528  O O     . GLY A 1  456 ? 124.436 -2.672   15.782  1.00 0.00 ? 456  GLY A O     1 
ATOM 3529  N N     . ILE A 1  457 ? 125.972 -3.735   17.079  1.00 0.00 ? 457  ILE A N     1 
ATOM 3530  C CA    . ILE A 1  457 ? 125.796 -5.027   16.464  1.00 0.00 ? 457  ILE A CA    1 
ATOM 3531  C C     . ILE A 1  457 ? 124.653 -5.762   17.117  1.00 0.00 ? 457  ILE A C     1 
ATOM 3532  O O     . ILE A 1  457 ? 123.988 -6.547   16.444  1.00 0.00 ? 457  ILE A O     1 
ATOM 3533  C CB    . ILE A 1  457 ? 127.057 -5.896   16.422  1.00 0.00 ? 457  ILE A CB    1 
ATOM 3534  C CG1   . ILE A 1  457 ? 127.672 -6.229   17.807  1.00 0.00 ? 457  ILE A CG1   1 
ATOM 3535  C CG2   . ILE A 1  457 ? 128.074 -5.188   15.498  1.00 0.00 ? 457  ILE A CG2   1 
ATOM 3536  C CD1   . ILE A 1  457 ? 128.764 -7.304   17.736  1.00 0.00 ? 457  ILE A CD1   1 
ATOM 3537  N N     . ALA A 1  458 ? 124.381 -5.514   18.430  1.00 0.00 ? 458  ALA A N     1 
ATOM 3538  C CA    . ALA A 1  458 ? 123.363 -6.198   19.208  1.00 0.00 ? 458  ALA A CA    1 
ATOM 3539  C C     . ALA A 1  458 ? 121.988 -5.915   18.701  1.00 0.00 ? 458  ALA A C     1 
ATOM 3540  O O     . ALA A 1  458 ? 121.157 -6.816   18.593  1.00 0.00 ? 458  ALA A O     1 
ATOM 3541  C CB    . ALA A 1  458 ? 123.373 -5.839   20.702  1.00 0.00 ? 458  ALA A CB    1 
ATOM 3542  N N     . GLY A 1  459 ? 121.733 -4.636   18.352  1.00 0.00 ? 459  GLY A N     1 
ATOM 3543  C CA    . GLY A 1  459 ? 120.479 -4.228   17.789  1.00 0.00 ? 459  GLY A CA    1 
ATOM 3544  C C     . GLY A 1  459 ? 120.437 -4.488   16.313  1.00 0.00 ? 459  GLY A C     1 
ATOM 3545  O O     . GLY A 1  459 ? 119.392 -4.304   15.708  1.00 0.00 ? 459  GLY A O     1 
ATOM 3546  N N     . GLY A 1  460 ? 121.564 -4.912   15.690  1.00 0.00 ? 460  GLY A N     1 
ATOM 3547  C CA    . GLY A 1  460 ? 121.674 -5.056   14.258  1.00 0.00 ? 460  GLY A CA    1 
ATOM 3548  C C     . GLY A 1  460 ? 121.194 -6.388   13.752  1.00 0.00 ? 460  GLY A C     1 
ATOM 3549  O O     . GLY A 1  460 ? 120.650 -6.455   12.651  1.00 0.00 ? 460  GLY A O     1 
ATOM 3550  N N     . PHE A 1  461 ? 121.373 -7.480   14.539  1.00 0.00 ? 461  PHE A N     1 
ATOM 3551  C CA    . PHE A 1  461 ? 120.973 -8.821   14.149  1.00 0.00 ? 461  PHE A CA    1 
ATOM 3552  C C     . PHE A 1  461 ? 119.619 -9.091   14.735  1.00 0.00 ? 461  PHE A C     1 
ATOM 3553  O O     . PHE A 1  461 ? 118.930 -10.013  14.307  1.00 0.00 ? 461  PHE A O     1 
ATOM 3554  C CB    . PHE A 1  461 ? 121.971 -9.874   14.705  1.00 0.00 ? 461  PHE A CB    1 
ATOM 3555  C CG    . PHE A 1  461 ? 121.625 -11.349  14.583  1.00 0.00 ? 461  PHE A CG    1 
ATOM 3556  C CD1   . PHE A 1  461 ? 122.064 -12.114  13.489  1.00 0.00 ? 461  PHE A CD1   1 
ATOM 3557  C CD2   . PHE A 1  461 ? 120.917 -11.996  15.616  1.00 0.00 ? 461  PHE A CD2   1 
ATOM 3558  C CE1   . PHE A 1  461 ? 121.795 -13.488  13.424  1.00 0.00 ? 461  PHE A CE1   1 
ATOM 3559  C CE2   . PHE A 1  461 ? 120.635 -13.365  15.549  1.00 0.00 ? 461  PHE A CE2   1 
ATOM 3560  C CZ    . PHE A 1  461 ? 121.078 -14.113  14.452  1.00 0.00 ? 461  PHE A CZ    1 
ATOM 3561  N N     . SER A 1  462 ? 119.187 -8.270   15.714  1.00 0.00 ? 462  SER A N     1 
ATOM 3562  C CA    . SER A 1  462 ? 117.862 -8.362   16.260  1.00 0.00 ? 462  SER A CA    1 
ATOM 3563  C C     . SER A 1  462 ? 116.925 -7.576   15.373  1.00 0.00 ? 462  SER A C     1 
ATOM 3564  O O     . SER A 1  462 ? 115.756 -7.928   15.260  1.00 0.00 ? 462  SER A O     1 
ATOM 3565  C CB    . SER A 1  462 ? 117.821 -7.828   17.704  1.00 0.00 ? 462  SER A CB    1 
ATOM 3566  O OG    . SER A 1  462 ? 118.450 -8.739   18.596  1.00 0.00 ? 462  SER A OG    1 
ATOM 3567  N N     . LEU A 1  463 ? 117.438 -6.529   14.670  1.00 0.00 ? 463  LEU A N     1 
ATOM 3568  C CA    . LEU A 1  463 ? 116.747 -5.815   13.607  1.00 0.00 ? 463  LEU A CA    1 
ATOM 3569  C C     . LEU A 1  463 ? 116.657 -6.711   12.402  1.00 0.00 ? 463  LEU A C     1 
ATOM 3570  O O     . LEU A 1  463 ? 115.630 -6.752   11.730  1.00 0.00 ? 463  LEU A O     1 
ATOM 3571  C CB    . LEU A 1  463 ? 117.472 -4.492   13.237  1.00 0.00 ? 463  LEU A CB    1 
ATOM 3572  C CG    . LEU A 1  463 ? 116.704 -3.395   12.448  1.00 0.00 ? 463  LEU A CG    1 
ATOM 3573  C CD1   . LEU A 1  463 ? 117.500 -2.074   12.518  1.00 0.00 ? 463  LEU A CD1   1 
ATOM 3574  C CD2   . LEU A 1  463 ? 116.386 -3.724   10.976  1.00 0.00 ? 463  LEU A CD2   1 
ATOM 3575  N N     . LEU A 1  464 ? 117.738 -7.488   12.127  1.00 0.00 ? 464  LEU A N     1 
ATOM 3576  C CA    . LEU A 1  464 ? 117.808 -8.456   11.056  1.00 0.00 ? 464  LEU A CA    1 
ATOM 3577  C C     . LEU A 1  464 ? 116.804 -9.552   11.281  1.00 0.00 ? 464  LEU A C     1 
ATOM 3578  O O     . LEU A 1  464 ? 116.212 -10.052  10.332  1.00 0.00 ? 464  LEU A O     1 
ATOM 3579  C CB    . LEU A 1  464 ? 119.209 -9.100   10.910  1.00 0.00 ? 464  LEU A CB    1 
ATOM 3580  C CG    . LEU A 1  464 ? 119.409 -10.079  9.724   1.00 0.00 ? 464  LEU A CG    1 
ATOM 3581  C CD1   . LEU A 1  464 ? 119.223 -9.414   8.347   1.00 0.00 ? 464  LEU A CD1   1 
ATOM 3582  C CD2   . LEU A 1  464 ? 120.785 -10.769  9.816   1.00 0.00 ? 464  LEU A CD2   1 
ATOM 3583  N N     . GLU A 1  465 ? 116.576 -9.960   12.552  1.00 0.00 ? 465  GLU A N     1 
ATOM 3584  C CA    . GLU A 1  465 ? 115.628 -10.999  12.861  1.00 0.00 ? 465  GLU A CA    1 
ATOM 3585  C C     . GLU A 1  465 ? 114.207 -10.548  12.642  1.00 0.00 ? 465  GLU A C     1 
ATOM 3586  O O     . GLU A 1  465 ? 113.370 -11.342  12.220  1.00 0.00 ? 465  GLU A O     1 
ATOM 3587  C CB    . GLU A 1  465 ? 115.751 -11.607  14.270  1.00 0.00 ? 465  GLU A CB    1 
ATOM 3588  C CG    . GLU A 1  465 ? 115.480 -13.124  14.207  1.00 0.00 ? 465  GLU A CG    1 
ATOM 3589  C CD    . GLU A 1  465 ? 115.150 -13.704  15.575  1.00 0.00 ? 465  GLU A CD    1 
ATOM 3590  O OE1   . GLU A 1  465 ? 115.202 -12.947  16.582  1.00 0.00 ? 465  GLU A OE1   1 
ATOM 3591  O OE2   . GLU A 1  465 ? 114.818 -14.917  15.626  1.00 0.00 ? 465  GLU A OE2   1 
ATOM 3592  N N     . VAL A 1  466 ? 113.903 -9.250   12.911  1.00 0.00 ? 466  VAL A N     1 
ATOM 3593  C CA    . VAL A 1  466 ? 112.610 -8.668   12.621  1.00 0.00 ? 466  VAL A CA    1 
ATOM 3594  C C     . VAL A 1  466 ? 112.387 -8.664   11.131  1.00 0.00 ? 466  VAL A C     1 
ATOM 3595  O O     . VAL A 1  466 ? 111.326 -9.084   10.682  1.00 0.00 ? 466  VAL A O     1 
ATOM 3596  C CB    . VAL A 1  466 ? 112.445 -7.242   13.158  1.00 0.00 ? 466  VAL A CB    1 
ATOM 3597  C CG1   . VAL A 1  466 ? 111.123 -6.604   12.670  1.00 0.00 ? 466  VAL A CG1   1 
ATOM 3598  C CG2   . VAL A 1  466 ? 112.465 -7.279   14.696  1.00 0.00 ? 466  VAL A CG2   1 
ATOM 3599  N N     . ILE A 1  467 ? 113.391 -8.223   10.328  1.00 0.00 ? 467  ILE A N     1 
ATOM 3600  C CA    . ILE A 1  467 ? 113.221 -8.033   8.905   1.00 0.00 ? 467  ILE A CA    1 
ATOM 3601  C C     . ILE A 1  467 ? 113.110 -9.351   8.176   1.00 0.00 ? 467  ILE A C     1 
ATOM 3602  O O     . ILE A 1  467 ? 112.394 -9.426   7.185   1.00 0.00 ? 467  ILE A O     1 
ATOM 3603  C CB    . ILE A 1  467 ? 114.229 -7.074   8.263   1.00 0.00 ? 467  ILE A CB    1 
ATOM 3604  C CG1   . ILE A 1  467 ? 113.590 -6.354   7.049   1.00 0.00 ? 467  ILE A CG1   1 
ATOM 3605  C CG2   . ILE A 1  467 ? 115.557 -7.769   7.895   1.00 0.00 ? 467  ILE A CG2   1 
ATOM 3606  C CD1   . ILE A 1  467 ? 114.471 -5.258   6.442   1.00 0.00 ? 467  ILE A CD1   1 
ATOM 3607  N N     . THR A 1  468 ? 113.786 -10.428  8.665   1.00 0.00 ? 468  THR A N     1 
ATOM 3608  C CA    . THR A 1  468 ? 113.691 -11.768  8.120   1.00 0.00 ? 468  THR A CA    1 
ATOM 3609  C C     . THR A 1  468 ? 112.331 -12.367  8.371   1.00 0.00 ? 468  THR A C     1 
ATOM 3610  O O     . THR A 1  468 ? 111.824 -13.074  7.509   1.00 0.00 ? 468  THR A O     1 
ATOM 3611  C CB    . THR A 1  468 ? 114.766 -12.754  8.569   1.00 0.00 ? 468  THR A CB    1 
ATOM 3612  O OG1   . THR A 1  468 ? 114.900 -12.802  9.985   1.00 0.00 ? 468  THR A OG1   1 
ATOM 3613  C CG2   . THR A 1  468 ? 116.117 -12.365  7.930   1.00 0.00 ? 468  THR A CG2   1 
ATOM 3614  N N     . ILE A 1  469 ? 111.710 -12.100  9.550   1.00 0.00 ? 469  ILE A N     1 
ATOM 3615  C CA    . ILE A 1  469 ? 110.370 -12.545  9.884   1.00 0.00 ? 469  ILE A CA    1 
ATOM 3616  C C     . ILE A 1  469 ? 109.349 -11.858  9.011   1.00 0.00 ? 469  ILE A C     1 
ATOM 3617  O O     . ILE A 1  469 ? 108.411 -12.500  8.546   1.00 0.00 ? 469  ILE A O     1 
ATOM 3618  C CB    . ILE A 1  469 ? 110.052 -12.412  11.376  1.00 0.00 ? 469  ILE A CB    1 
ATOM 3619  C CG1   . ILE A 1  469 ? 110.834 -13.529  12.116  1.00 0.00 ? 469  ILE A CG1   1 
ATOM 3620  C CG2   . ILE A 1  469 ? 108.530 -12.482  11.657  1.00 0.00 ? 469  ILE A CG2   1 
ATOM 3621  C CD1   . ILE A 1  469 ? 110.615 -13.565  13.628  1.00 0.00 ? 469  ILE A CD1   1 
ATOM 3622  N N     . GLU A 1  470 ? 109.518 -10.542  8.733   1.00 0.00 ? 470  GLU A N     1 
ATOM 3623  C CA    . GLU A 1  470 ? 108.627 -9.811   7.859   1.00 0.00 ? 470  GLU A CA    1 
ATOM 3624  C C     . GLU A 1  470 ? 108.806 -10.256  6.427   1.00 0.00 ? 470  GLU A C     1 
ATOM 3625  O O     . GLU A 1  470 ? 107.862 -10.244  5.644   1.00 0.00 ? 470  GLU A O     1 
ATOM 3626  C CB    . GLU A 1  470 ? 108.816 -8.274   7.914   1.00 0.00 ? 470  GLU A CB    1 
ATOM 3627  C CG    . GLU A 1  470 ? 108.578 -7.633   9.297   1.00 0.00 ? 470  GLU A CG    1 
ATOM 3628  C CD    . GLU A 1  470 ? 107.204 -8.005   9.851   1.00 0.00 ? 470  GLU A CD    1 
ATOM 3629  O OE1   . GLU A 1  470 ? 106.185 -7.567   9.252   1.00 0.00 ? 470  GLU A OE1   1 
ATOM 3630  O OE2   . GLU A 1  470 ? 107.155 -8.731   10.879  1.00 0.00 ? 470  GLU A OE2   1 
ATOM 3631  N N     . TYR A 1  471 ? 110.033 -10.676  6.050   1.00 0.00 ? 471  TYR A N     1 
ATOM 3632  C CA    . TYR A 1  471 ? 110.330 -11.166  4.729   1.00 0.00 ? 471  TYR A CA    1 
ATOM 3633  C C     . TYR A 1  471 ? 109.656 -12.497  4.473   1.00 0.00 ? 471  TYR A C     1 
ATOM 3634  O O     . TYR A 1  471 ? 108.997 -12.657  3.448   1.00 0.00 ? 471  TYR A O     1 
ATOM 3635  C CB    . TYR A 1  471 ? 111.864 -11.346  4.522   1.00 0.00 ? 471  TYR A CB    1 
ATOM 3636  C CG    . TYR A 1  471 ? 112.651 -10.082  4.237   1.00 0.00 ? 471  TYR A CG    1 
ATOM 3637  C CD1   . TYR A 1  471 ? 112.088 -8.898   3.715   1.00 0.00 ? 471  TYR A CD1   1 
ATOM 3638  C CD2   . TYR A 1  471 ? 114.044 -10.120  4.439   1.00 0.00 ? 471  TYR A CD2   1 
ATOM 3639  C CE1   . TYR A 1  471 ? 112.894 -7.800   3.394   1.00 0.00 ? 471  TYR A CE1   1 
ATOM 3640  C CE2   . TYR A 1  471 ? 114.852 -9.019   4.130   1.00 0.00 ? 471  TYR A CE2   1 
ATOM 3641  C CZ    . TYR A 1  471 ? 114.278 -7.858   3.599   1.00 0.00 ? 471  TYR A CZ    1 
ATOM 3642  O OH    . TYR A 1  471 ? 115.088 -6.750   3.263   1.00 0.00 ? 471  TYR A OH    1 
ATOM 3643  N N     . GLN A 1  472 ? 109.784 -13.475  5.404   1.00 0.00 ? 472  GLN A N     1 
ATOM 3644  C CA    . GLN A 1  472 ? 109.340 -14.828  5.159   1.00 0.00 ? 472  GLN A CA    1 
ATOM 3645  C C     . GLN A 1  472 ? 107.881 -15.035  5.475   1.00 0.00 ? 472  GLN A C     1 
ATOM 3646  O O     . GLN A 1  472 ? 107.173 -15.660  4.686   1.00 0.00 ? 472  GLN A O     1 
ATOM 3647  C CB    . GLN A 1  472 ? 110.219 -15.889  5.869   1.00 0.00 ? 472  GLN A CB    1 
ATOM 3648  C CG    . GLN A 1  472 ? 110.190 -15.907  7.406   1.00 0.00 ? 472  GLN A CG    1 
ATOM 3649  C CD    . GLN A 1  472 ? 111.384 -16.712  7.932   1.00 0.00 ? 472  GLN A CD    1 
ATOM 3650  O OE1   . GLN A 1  472 ? 112.317 -16.144  8.513   1.00 0.00 ? 472  GLN A OE1   1 
ATOM 3651  N NE2   . GLN A 1  472 ? 111.343 -18.063  7.713   1.00 0.00 ? 472  GLN A NE2   1 
ATOM 3652  N N     . GLN A 1  473 ? 107.385 -14.515  6.627   1.00 0.00 ? 473  GLN A N     1 
ATOM 3653  C CA    . GLN A 1  473 ? 106.030 -14.752  7.067   1.00 0.00 ? 473  GLN A CA    1 
ATOM 3654  C C     . GLN A 1  473 ? 105.076 -13.781  6.425   1.00 0.00 ? 473  GLN A C     1 
ATOM 3655  O O     . GLN A 1  473 ? 104.038 -14.196  5.911   1.00 0.00 ? 473  GLN A O     1 
ATOM 3656  C CB    . GLN A 1  473 ? 105.863 -14.666  8.608   1.00 0.00 ? 473  GLN A CB    1 
ATOM 3657  C CG    . GLN A 1  473 ? 106.635 -15.780  9.347   1.00 0.00 ? 473  GLN A CG    1 
ATOM 3658  C CD    . GLN A 1  473 ? 106.448 -15.727  10.873  1.00 0.00 ? 473  GLN A CD    1 
ATOM 3659  O OE1   . GLN A 1  473 ? 107.432 -15.822  11.618  1.00 0.00 ? 473  GLN A OE1   1 
ATOM 3660  N NE2   . GLN A 1  473 ? 105.169 -15.594  11.337  1.00 0.00 ? 473  GLN A NE2   1 
ATOM 3661  N N     . SER A 1  474 ? 105.401 -12.461  6.433   1.00 0.00 ? 474  SER A N     1 
ATOM 3662  C CA    . SER A 1  474 ? 104.486 -11.442  5.953   1.00 0.00 ? 474  SER A CA    1 
ATOM 3663  C C     . SER A 1  474 ? 104.468 -11.387  4.445   1.00 0.00 ? 474  SER A C     1 
ATOM 3664  O O     . SER A 1  474 ? 103.404 -11.194  3.857   1.00 0.00 ? 474  SER A O     1 
ATOM 3665  C CB    . SER A 1  474 ? 104.732 -10.032  6.533   1.00 0.00 ? 474  SER A CB    1 
ATOM 3666  O OG    . SER A 1  474 ? 104.745 -10.078  7.952   1.00 0.00 ? 474  SER A OG    1 
ATOM 3667  N N     . GLY A 1  475 ? 105.637 -11.601  3.788   1.00 0.00 ? 475  GLY A N     1 
ATOM 3668  C CA    . GLY A 1  475 ? 105.713 -11.756  2.351   1.00 0.00 ? 475  GLY A CA    1 
ATOM 3669  C C     . GLY A 1  475 ? 106.575 -10.693  1.745   1.00 0.00 ? 475  GLY A C     1 
ATOM 3670  O O     . GLY A 1  475 ? 107.409 -10.085  2.417   1.00 0.00 ? 475  GLY A O     1 
ATOM 3671  N N     . GLY A 1  476 ? 106.378 -10.465  0.419   1.00 0.00 ? 476  GLY A N     1 
ATOM 3672  C CA    . GLY A 1  476 ? 107.164 -9.551   -0.377  1.00 0.00 ? 476  GLY A CA    1 
ATOM 3673  C C     . GLY A 1  476 ? 108.419 -10.236  -0.819  1.00 0.00 ? 476  GLY A C     1 
ATOM 3674  O O     . GLY A 1  476 ? 108.401 -11.415  -1.169  1.00 0.00 ? 476  GLY A O     1 
ATOM 3675  N N     . GLN A 1  477 ? 109.555 -9.490   -0.794  1.00 0.00 ? 477  GLN A N     1 
ATOM 3676  C CA    . GLN A 1  477 ? 110.903 -10.019  -0.873  1.00 0.00 ? 477  GLN A CA    1 
ATOM 3677  C C     . GLN A 1  477 ? 111.103 -10.890  0.345   1.00 0.00 ? 477  GLN A C     1 
ATOM 3678  O O     . GLN A 1  477 ? 110.679 -10.504  1.432   1.00 0.00 ? 477  GLN A O     1 
ATOM 3679  C CB    . GLN A 1  477 ? 111.935 -8.863   -0.881  1.00 0.00 ? 477  GLN A CB    1 
ATOM 3680  C CG    . GLN A 1  477 ? 113.410 -9.285   -0.986  1.00 0.00 ? 477  GLN A CG    1 
ATOM 3681  C CD    . GLN A 1  477 ? 114.300 -8.034   -1.035  1.00 0.00 ? 477  GLN A CD    1 
ATOM 3682  O OE1   . GLN A 1  477 ? 113.822 -6.898   -0.931  1.00 0.00 ? 477  GLN A OE1   1 
ATOM 3683  N NE2   . GLN A 1  477 ? 115.638 -8.265   -1.200  1.00 0.00 ? 477  GLN A NE2   1 
ATOM 3684  N N     . SER A 1  478 ? 111.681 -12.106  0.183   1.00 0.00 ? 478  SER A N     1 
ATOM 3685  C CA    . SER A 1  478 ? 111.493 -13.135  1.179   1.00 0.00 ? 478  SER A CA    1 
ATOM 3686  C C     . SER A 1  478 ? 112.773 -13.837  1.518   1.00 0.00 ? 478  SER A C     1 
ATOM 3687  O O     . SER A 1  478 ? 113.776 -13.731  0.813   1.00 0.00 ? 478  SER A O     1 
ATOM 3688  C CB    . SER A 1  478 ? 110.466 -14.209  0.774   1.00 0.00 ? 478  SER A CB    1 
ATOM 3689  O OG    . SER A 1  478 ? 109.183 -13.639  0.555   1.00 0.00 ? 478  SER A OG    1 
ATOM 3690  N N     . ALA A 1  479 ? 112.722 -14.569  2.659   1.00 0.00 ? 479  ALA A N     1 
ATOM 3691  C CA    . ALA A 1  479 ? 113.817 -15.311  3.219   1.00 0.00 ? 479  ALA A CA    1 
ATOM 3692  C C     . ALA A 1  479 ? 113.423 -16.761  3.370   1.00 0.00 ? 479  ALA A C     1 
ATOM 3693  O O     . ALA A 1  479 ? 114.174 -17.530  3.969   1.00 0.00 ? 479  ALA A O     1 
ATOM 3694  C CB    . ALA A 1  479 ? 114.179 -14.775  4.621   1.00 0.00 ? 479  ALA A CB    1 
ATOM 3695  N N     . LEU A 1  480 ? 112.251 -17.192  2.815   1.00 0.00 ? 480  LEU A N     1 
ATOM 3696  C CA    . LEU A 1  480 ? 111.773 -18.555  2.999   1.00 0.00 ? 480  LEU A CA    1 
ATOM 3697  C C     . LEU A 1  480 ? 112.309 -19.457  1.930   1.00 0.00 ? 480  LEU A C     1 
ATOM 3698  O O     . LEU A 1  480 ? 112.129 -20.673  1.997   1.00 0.00 ? 480  LEU A O     1 
ATOM 3699  C CB    . LEU A 1  480 ? 110.224 -18.738  3.103   1.00 0.00 ? 480  LEU A CB    1 
ATOM 3700  C CG    . LEU A 1  480 ? 109.269 -18.671  1.866   1.00 0.00 ? 480  LEU A CG    1 
ATOM 3701  C CD1   . LEU A 1  480 ? 109.277 -17.315  1.160   1.00 0.00 ? 480  LEU A CD1   1 
ATOM 3702  C CD2   . LEU A 1  480 ? 109.358 -19.827  0.845   1.00 0.00 ? 480  LEU A CD2   1 
ATOM 3703  N N     . ASN A 1  481 ? 113.010 -18.874  0.926   1.00 0.00 ? 481  ASN A N     1 
ATOM 3704  C CA    . ASN A 1  481 ? 113.569 -19.574  -0.206  1.00 0.00 ? 481  ASN A CA    1 
ATOM 3705  C C     . ASN A 1  481 ? 114.617 -20.576  0.221   1.00 0.00 ? 481  ASN A C     1 
ATOM 3706  O O     . ASN A 1  481 ? 114.768 -21.621  -0.409  1.00 0.00 ? 481  ASN A O     1 
ATOM 3707  C CB    . ASN A 1  481 ? 114.118 -18.623  -1.311  1.00 0.00 ? 481  ASN A CB    1 
ATOM 3708  C CG    . ASN A 1  481 ? 115.268 -17.715  -0.834  1.00 0.00 ? 481  ASN A CG    1 
ATOM 3709  O OD1   . ASN A 1  481 ? 115.083 -16.858  0.038   1.00 0.00 ? 481  ASN A OD1   1 
ATOM 3710  N ND2   . ASN A 1  481 ? 116.479 -17.918  -1.440  1.00 0.00 ? 481  ASN A ND2   1 
ATOM 3711  N N     . GLN A 1  482 ? 115.352 -20.262  1.321   1.00 0.00 ? 482  GLN A N     1 
ATOM 3712  C CA    . GLN A 1  482 ? 116.376 -21.099  1.892   1.00 0.00 ? 482  GLN A CA    1 
ATOM 3713  C C     . GLN A 1  482 ? 115.826 -22.422  2.376   1.00 0.00 ? 482  GLN A C     1 
ATOM 3714  O O     . GLN A 1  482 ? 116.250 -23.466  1.883   1.00 0.00 ? 482  GLN A O     1 
ATOM 3715  C CB    . GLN A 1  482 ? 117.051 -20.381  3.087   1.00 0.00 ? 482  GLN A CB    1 
ATOM 3716  C CG    . GLN A 1  482 ? 117.765 -19.083  2.667   1.00 0.00 ? 482  GLN A CG    1 
ATOM 3717  C CD    . GLN A 1  482 ? 118.292 -18.360  3.912   1.00 0.00 ? 482  GLN A CD    1 
ATOM 3718  O OE1   . GLN A 1  482 ? 119.448 -18.547  4.310   1.00 0.00 ? 482  GLN A OE1   1 
ATOM 3719  N NE2   . GLN A 1  482 ? 117.410 -17.517  4.531   1.00 0.00 ? 482  GLN A NE2   1 
ATOM 3720  N N     . VAL A 1  483 ? 114.834 -22.402  3.307   1.00 0.00 ? 483  VAL A N     1 
ATOM 3721  C CA    . VAL A 1  483 ? 114.145 -23.592  3.767   1.00 0.00 ? 483  VAL A CA    1 
ATOM 3722  C C     . VAL A 1  483 ? 112.757 -23.137  4.141   1.00 0.00 ? 483  VAL A C     1 
ATOM 3723  O O     . VAL A 1  483 ? 112.605 -22.151  4.860   1.00 0.00 ? 483  VAL A O     1 
ATOM 3724  C CB    . VAL A 1  483 ? 114.762 -24.286  4.997   1.00 0.00 ? 483  VAL A CB    1 
ATOM 3725  C CG1   . VAL A 1  483 ? 113.942 -25.538  5.394   1.00 0.00 ? 483  VAL A CG1   1 
ATOM 3726  C CG2   . VAL A 1  483 ? 116.226 -24.693  4.725   1.00 0.00 ? 483  VAL A CG2   1 
ATOM 3727  N N     . LEU A 1  484 ? 111.736 -23.905  3.683   1.00 0.00 ? 484  LEU A N     1 
ATOM 3728  C CA    . LEU A 1  484 ? 110.357 -23.863  4.118   1.00 0.00 ? 484  LEU A CA    1 
ATOM 3729  C C     . LEU A 1  484 ? 109.732 -24.924  3.240   1.00 0.00 ? 484  LEU A C     1 
ATOM 3730  O O     . LEU A 1  484 ? 110.319 -25.991  3.060   1.00 0.00 ? 484  LEU A O     1 
ATOM 3731  C CB    . LEU A 1  484 ? 109.628 -22.489  3.986   1.00 0.00 ? 484  LEU A CB    1 
ATOM 3732  C CG    . LEU A 1  484 ? 108.356 -22.323  4.863   1.00 0.00 ? 484  LEU A CG    1 
ATOM 3733  C CD1   . LEU A 1  484 ? 108.691 -22.234  6.365   1.00 0.00 ? 484  LEU A CD1   1 
ATOM 3734  C CD2   . LEU A 1  484 ? 107.526 -21.099  4.428   1.00 0.00 ? 484  LEU A CD2   1 
ATOM 3735  N N     . GLY A 1  485 ? 108.542 -24.654  2.651   1.00 0.00 ? 485  GLY A N     1 
ATOM 3736  C CA    . GLY A 1  485 ? 108.002 -25.409  1.549   1.00 0.00 ? 485  GLY A CA    1 
ATOM 3737  C C     . GLY A 1  485 ? 106.838 -26.257  1.945   1.00 0.00 ? 485  GLY A C     1 
ATOM 3738  O O     . GLY A 1  485 ? 105.821 -26.249  1.252   1.00 0.00 ? 485  GLY A O     1 
ATOM 3739  N N     . VAL A 1  486 ? 106.961 -27.037  3.046   1.00 0.00 ? 486  VAL A N     1 
ATOM 3740  C CA    . VAL A 1  486 ? 105.996 -28.073  3.333   1.00 0.00 ? 486  VAL A CA    1 
ATOM 3741  C C     . VAL A 1  486 ? 105.640 -28.072  4.811   1.00 0.00 ? 486  VAL A C     1 
ATOM 3742  O O     . VAL A 1  486 ? 106.310 -28.703  5.627   1.00 0.00 ? 486  VAL A O     1 
ATOM 3743  C CB    . VAL A 1  486 ? 106.467 -29.435  2.804   1.00 0.00 ? 486  VAL A CB    1 
ATOM 3744  C CG1   . VAL A 1  486 ? 107.881 -29.837  3.287   1.00 0.00 ? 486  VAL A CG1   1 
ATOM 3745  C CG2   . VAL A 1  486 ? 105.407 -30.519  3.067   1.00 0.00 ? 486  VAL A CG2   1 
ATOM 3746  N N     . PRO A 1  487 ? 104.555 -27.394  5.196   1.00 0.00 ? 487  PRO A N     1 
ATOM 3747  C CA    . PRO A 1  487 ? 103.885 -27.621  6.463   1.00 0.00 ? 487  PRO A CA    1 
ATOM 3748  C C     . PRO A 1  487 ? 102.720 -28.537  6.157   1.00 0.00 ? 487  PRO A C     1 
ATOM 3749  O O     . PRO A 1  487 ? 102.634 -29.023  5.029   1.00 0.00 ? 487  PRO A O     1 
ATOM 3750  C CB    . PRO A 1  487 ? 103.431 -26.214  6.876   1.00 0.00 ? 487  PRO A CB    1 
ATOM 3751  C CG    . PRO A 1  487 ? 103.183 -25.460  5.564   1.00 0.00 ? 487  PRO A CG    1 
ATOM 3752  C CD    . PRO A 1  487 ? 104.113 -26.147  4.557   1.00 0.00 ? 487  PRO A CD    1 
ATOM 3753  N N     . GLY A 1  488 ? 101.825 -28.795  7.141   1.00 0.00 ? 488  GLY A N     1 
ATOM 3754  C CA    . GLY A 1  488 ? 100.712 -29.693  6.951   1.00 0.00 ? 488  GLY A CA    1 
ATOM 3755  C C     . GLY A 1  488 ? 99.466  -29.079  7.512   1.00 0.00 ? 488  GLY A C     1 
ATOM 3756  O O     . GLY A 1  488 ? 99.508  -28.187  8.360   1.00 0.00 ? 488  GLY A O     1 
ATOM 3757  N N     . ALA A 1  489 ? 98.311  -29.604  7.041   1.00 0.00 ? 489  ALA A N     1 
ATOM 3758  C CA    . ALA A 1  489 ? 97.006  -29.362  7.600   1.00 0.00 ? 489  ALA A CA    1 
ATOM 3759  C C     . ALA A 1  489 ? 96.558  -30.735  7.990   1.00 0.00 ? 489  ALA A C     1 
ATOM 3760  O O     . ALA A 1  489 ? 96.789  -31.692  7.250   1.00 0.00 ? 489  ALA A O     1 
ATOM 3761  C CB    . ALA A 1  489 ? 95.978  -28.799  6.599   1.00 0.00 ? 489  ALA A CB    1 
ATOM 3762  N N     . MET A 1  490 ? 95.933  -30.877  9.184   1.00 0.00 ? 490  MET A N     1 
ATOM 3763  C CA    . MET A 1  490 ? 95.521  -32.176  9.665   1.00 0.00 ? 490  MET A CA    1 
ATOM 3764  C C     . MET A 1  490 ? 94.222  -32.614  8.957   1.00 0.00 ? 490  MET A C     1 
ATOM 3765  O O     . MET A 1  490 ? 93.345  -31.745  8.709   1.00 0.00 ? 490  MET A O     1 
ATOM 3766  C CB    . MET A 1  490 ? 95.393  -32.275  11.208  1.00 0.00 ? 490  MET A CB    1 
ATOM 3767  C CG    . MET A 1  490 ? 94.047  -31.855  11.827  1.00 0.00 ? 490  MET A CG    1 
ATOM 3768  S SD    . MET A 1  490 ? 93.901  -32.309  13.582  1.00 0.00 ? 490  MET A SD    1 
ATOM 3769  C CE    . MET A 1  490 ? 92.092  -32.162  13.654  1.00 0.00 ? 490  MET A CE    1 
ATOM 3770  O OXT   . MET A 1  490 ? 94.100  -33.831  8.650   1.00 0.00 ? 490  MET A OXT   1 
ATOM 3771  N N     . LEU B 2  21  ? 116.834 -6.570   50.947  1.00 0.00 ? 21   LEU B N     1 
ATOM 3772  C CA    . LEU B 2  21  ? 116.112 -7.448   49.991  1.00 0.00 ? 21   LEU B CA    1 
ATOM 3773  C C     . LEU B 2  21  ? 114.799 -7.818   50.616  1.00 0.00 ? 21   LEU B C     1 
ATOM 3774  O O     . LEU B 2  21  ? 114.760 -8.439   51.677  1.00 0.00 ? 21   LEU B O     1 
ATOM 3775  C CB    . LEU B 2  21  ? 116.903 -8.741   49.648  1.00 0.00 ? 21   LEU B CB    1 
ATOM 3776  C CG    . LEU B 2  21  ? 118.131 -8.567   48.709  1.00 0.00 ? 21   LEU B CG    1 
ATOM 3777  C CD1   . LEU B 2  21  ? 119.290 -7.737   49.304  1.00 0.00 ? 21   LEU B CD1   1 
ATOM 3778  C CD2   . LEU B 2  21  ? 118.655 -9.945   48.249  1.00 0.00 ? 21   LEU B CD2   1 
ATOM 3779  N N     . VAL B 2  22  ? 113.685 -7.410   49.960  1.00 0.00 ? 22   VAL B N     1 
ATOM 3780  C CA    . VAL B 2  22  ? 112.336 -7.640   50.429  1.00 0.00 ? 22   VAL B CA    1 
ATOM 3781  C C     . VAL B 2  22  ? 111.616 -8.365   49.320  1.00 0.00 ? 22   VAL B C     1 
ATOM 3782  O O     . VAL B 2  22  ? 112.239 -8.799   48.352  1.00 0.00 ? 22   VAL B O     1 
ATOM 3783  C CB    . VAL B 2  22  ? 111.600 -6.384   50.901  1.00 0.00 ? 22   VAL B CB    1 
ATOM 3784  C CG1   . VAL B 2  22  ? 112.334 -5.822   52.138  1.00 0.00 ? 22   VAL B CG1   1 
ATOM 3785  C CG2   . VAL B 2  22  ? 111.478 -5.324   49.787  1.00 0.00 ? 22   VAL B CG2   1 
ATOM 3786  N N     . GLU B 2  23  ? 110.287 -8.575   49.489  1.00 0.00 ? 23   GLU B N     1 
ATOM 3787  C CA    . GLU B 2  23  ? 109.450 -9.450   48.698  1.00 0.00 ? 23   GLU B CA    1 
ATOM 3788  C C     . GLU B 2  23  ? 109.374 -9.082   47.235  1.00 0.00 ? 23   GLU B C     1 
ATOM 3789  O O     . GLU B 2  23  ? 109.430 -9.962   46.378  1.00 0.00 ? 23   GLU B O     1 
ATOM 3790  C CB    . GLU B 2  23  ? 108.016 -9.490   49.278  1.00 0.00 ? 23   GLU B CB    1 
ATOM 3791  C CG    . GLU B 2  23  ? 107.107 -10.567  48.659  1.00 0.00 ? 23   GLU B CG    1 
ATOM 3792  C CD    . GLU B 2  23  ? 105.765 -10.592  49.392  1.00 0.00 ? 23   GLU B CD    1 
ATOM 3793  O OE1   . GLU B 2  23  ? 105.761 -10.919  50.609  1.00 0.00 ? 23   GLU B OE1   1 
ATOM 3794  O OE2   . GLU B 2  23  ? 104.727 -10.287  48.747  1.00 0.00 ? 23   GLU B OE2   1 
ATOM 3795  N N     . ALA B 2  24  ? 109.246 -7.774   46.908  1.00 0.00 ? 24   ALA B N     1 
ATOM 3796  C CA    . ALA B 2  24  ? 109.157 -7.318   45.537  1.00 0.00 ? 24   ALA B CA    1 
ATOM 3797  C C     . ALA B 2  24  ? 110.427 -7.514   44.723  1.00 0.00 ? 24   ALA B C     1 
ATOM 3798  O O     . ALA B 2  24  ? 110.285 -8.017   43.609  1.00 0.00 ? 24   ALA B O     1 
ATOM 3799  C CB    . ALA B 2  24  ? 108.670 -5.860   45.409  1.00 0.00 ? 24   ALA B CB    1 
ATOM 3800  N N     . PRO B 2  25  ? 111.664 -7.216   45.151  1.00 0.00 ? 25   PRO B N     1 
ATOM 3801  C CA    . PRO B 2  25  ? 112.820 -7.377   44.284  1.00 0.00 ? 25   PRO B CA    1 
ATOM 3802  C C     . PRO B 2  25  ? 113.297 -8.805   44.259  1.00 0.00 ? 25   PRO B C     1 
ATOM 3803  O O     . PRO B 2  25  ? 114.006 -9.138   43.312  1.00 0.00 ? 25   PRO B O     1 
ATOM 3804  C CB    . PRO B 2  25  ? 113.905 -6.460   44.873  1.00 0.00 ? 25   PRO B CB    1 
ATOM 3805  C CG    . PRO B 2  25  ? 113.476 -6.228   46.322  1.00 0.00 ? 25   PRO B CG    1 
ATOM 3806  C CD    . PRO B 2  25  ? 111.955 -6.255   46.216  1.00 0.00 ? 25   PRO B CD    1 
ATOM 3807  N N     . VAL B 2  26  ? 112.958 -9.661   45.265  1.00 0.00 ? 26   VAL B N     1 
ATOM 3808  C CA    . VAL B 2  26  ? 113.311 -11.067  45.213  1.00 0.00 ? 26   VAL B CA    1 
ATOM 3809  C C     . VAL B 2  26  ? 112.453 -11.763  44.183  1.00 0.00 ? 26   VAL B C     1 
ATOM 3810  O O     . VAL B 2  26  ? 112.943 -12.617  43.451  1.00 0.00 ? 26   VAL B O     1 
ATOM 3811  C CB    . VAL B 2  26  ? 113.350 -11.801  46.556  1.00 0.00 ? 26   VAL B CB    1 
ATOM 3812  C CG1   . VAL B 2  26  ? 111.958 -11.966  47.192  1.00 0.00 ? 26   VAL B CG1   1 
ATOM 3813  C CG2   . VAL B 2  26  ? 114.062 -13.161  46.381  1.00 0.00 ? 26   VAL B CG2   1 
ATOM 3814  N N     . GLU B 2  27  ? 111.156 -11.374  44.072  1.00 0.00 ? 27   GLU B N     1 
ATOM 3815  C CA    . GLU B 2  27  ? 110.230 -11.897  43.094  1.00 0.00 ? 27   GLU B CA    1 
ATOM 3816  C C     . GLU B 2  27  ? 110.658 -11.526  41.700  1.00 0.00 ? 27   GLU B C     1 
ATOM 3817  O O     . GLU B 2  27  ? 110.607 -12.357  40.798  1.00 0.00 ? 27   GLU B O     1 
ATOM 3818  C CB    . GLU B 2  27  ? 108.782 -11.390  43.337  1.00 0.00 ? 27   GLU B CB    1 
ATOM 3819  C CG    . GLU B 2  27  ? 107.734 -11.742  42.255  1.00 0.00 ? 27   GLU B CG    1 
ATOM 3820  C CD    . GLU B 2  27  ? 107.517 -13.247  42.070  1.00 0.00 ? 27   GLU B CD    1 
ATOM 3821  O OE1   . GLU B 2  27  ? 107.909 -14.044  42.965  1.00 0.00 ? 27   GLU B OE1   1 
ATOM 3822  O OE2   . GLU B 2  27  ? 106.930 -13.617  41.019  1.00 0.00 ? 27   GLU B OE2   1 
ATOM 3823  N N     . PHE B 2  28  ? 111.107 -10.265  41.491  1.00 0.00 ? 28   PHE B N     1 
ATOM 3824  C CA    . PHE B 2  28  ? 111.492 -9.786   40.187  1.00 0.00 ? 28   PHE B CA    1 
ATOM 3825  C C     . PHE B 2  28  ? 112.764 -10.444  39.708  1.00 0.00 ? 28   PHE B C     1 
ATOM 3826  O O     . PHE B 2  28  ? 112.882 -10.743  38.522  1.00 0.00 ? 28   PHE B O     1 
ATOM 3827  C CB    . PHE B 2  28  ? 111.636 -8.241   40.131  1.00 0.00 ? 28   PHE B CB    1 
ATOM 3828  C CG    . PHE B 2  28  ? 111.454 -7.766   38.709  1.00 0.00 ? 28   PHE B CG    1 
ATOM 3829  C CD1   . PHE B 2  28  ? 110.158 -7.636   38.177  1.00 0.00 ? 28   PHE B CD1   1 
ATOM 3830  C CD2   . PHE B 2  28  ? 112.559 -7.528   37.873  1.00 0.00 ? 28   PHE B CD2   1 
ATOM 3831  C CE1   . PHE B 2  28  ? 109.969 -7.286   36.835  1.00 0.00 ? 28   PHE B CE1   1 
ATOM 3832  C CE2   . PHE B 2  28  ? 112.371 -7.179   36.529  1.00 0.00 ? 28   PHE B CE2   1 
ATOM 3833  C CZ    . PHE B 2  28  ? 111.076 -7.063   36.010  1.00 0.00 ? 28   PHE B CZ    1 
ATOM 3834  N N     . VAL B 2  29  ? 113.748 -10.676  40.616  1.00 0.00 ? 29   VAL B N     1 
ATOM 3835  C CA    . VAL B 2  29  ? 115.024 -11.245  40.247  1.00 0.00 ? 29   VAL B CA    1 
ATOM 3836  C C     . VAL B 2  29  ? 114.912 -12.710  39.905  1.00 0.00 ? 29   VAL B C     1 
ATOM 3837  O O     . VAL B 2  29  ? 115.565 -13.143  38.961  1.00 0.00 ? 29   VAL B O     1 
ATOM 3838  C CB    . VAL B 2  29  ? 116.174 -10.957  41.215  1.00 0.00 ? 29   VAL B CB    1 
ATOM 3839  C CG1   . VAL B 2  29  ? 116.084 -11.783  42.511  1.00 0.00 ? 29   VAL B CG1   1 
ATOM 3840  C CG2   . VAL B 2  29  ? 117.522 -11.183  40.496  1.00 0.00 ? 29   VAL B CG2   1 
ATOM 3841  N N     . ARG B 2  30  ? 114.075 -13.521  40.619  1.00 0.00 ? 30   ARG B N     1 
ATOM 3842  C CA    . ARG B 2  30  ? 113.966 -14.929  40.283  1.00 0.00 ? 30   ARG B CA    1 
ATOM 3843  C C     . ARG B 2  30  ? 113.097 -15.149  39.071  1.00 0.00 ? 30   ARG B C     1 
ATOM 3844  O O     . ARG B 2  30  ? 113.205 -16.194  38.435  1.00 0.00 ? 30   ARG B O     1 
ATOM 3845  C CB    . ARG B 2  30  ? 113.641 -15.940  41.425  1.00 0.00 ? 30   ARG B CB    1 
ATOM 3846  C CG    . ARG B 2  30  ? 112.410 -15.753  42.338  1.00 0.00 ? 30   ARG B CG    1 
ATOM 3847  C CD    . ARG B 2  30  ? 111.020 -15.698  41.689  1.00 0.00 ? 30   ARG B CD    1 
ATOM 3848  N NE    . ARG B 2  30  ? 110.838 -16.855  40.755  1.00 0.00 ? 30   ARG B NE    1 
ATOM 3849  C CZ    . ARG B 2  30  ? 109.629 -17.108  40.171  1.00 0.00 ? 30   ARG B CZ    1 
ATOM 3850  N NH1   . ARG B 2  30  ? 108.487 -16.525  40.640  1.00 0.00 ? 30   ARG B NH1   1 
ATOM 3851  N NH2   . ARG B 2  30  ? 109.563 -17.929  39.085  1.00 0.00 ? 30   ARG B NH2   1 
ATOM 3852  N N     . GLU B 2  31  ? 112.259 -14.153  38.684  1.00 0.00 ? 31   GLU B N     1 
ATOM 3853  C CA    . GLU B 2  31  ? 111.609 -14.134  37.393  1.00 0.00 ? 31   GLU B CA    1 
ATOM 3854  C C     . GLU B 2  31  ? 112.616 -13.863  36.304  1.00 0.00 ? 31   GLU B C     1 
ATOM 3855  O O     . GLU B 2  31  ? 112.573 -14.486  35.247  1.00 0.00 ? 31   GLU B O     1 
ATOM 3856  C CB    . GLU B 2  31  ? 110.495 -13.062  37.292  1.00 0.00 ? 31   GLU B CB    1 
ATOM 3857  C CG    . GLU B 2  31  ? 109.184 -13.463  37.997  1.00 0.00 ? 31   GLU B CG    1 
ATOM 3858  C CD    . GLU B 2  31  ? 108.449 -14.588  37.264  1.00 0.00 ? 31   GLU B CD    1 
ATOM 3859  O OE1   . GLU B 2  31  ? 108.627 -14.737  36.028  1.00 0.00 ? 31   GLU B OE1   1 
ATOM 3860  O OE2   . GLU B 2  31  ? 107.669 -15.311  37.946  1.00 0.00 ? 31   GLU B OE2   1 
ATOM 3861  N N     . GLY B 2  32  ? 113.553 -12.916  36.539  1.00 0.00 ? 32   GLY B N     1 
ATOM 3862  C CA    . GLY B 2  32  ? 114.461 -12.427  35.529  1.00 0.00 ? 32   GLY B CA    1 
ATOM 3863  C C     . GLY B 2  32  ? 115.669 -13.299  35.337  1.00 0.00 ? 32   GLY B C     1 
ATOM 3864  O O     . GLY B 2  32  ? 116.446 -13.070  34.411  1.00 0.00 ? 32   GLY B O     1 
ATOM 3865  N N     . THR B 2  33  ? 115.852 -14.341  36.187  1.00 0.00 ? 33   THR B N     1 
ATOM 3866  C CA    . THR B 2  33  ? 116.933 -15.291  36.029  1.00 0.00 ? 33   THR B CA    1 
ATOM 3867  C C     . THR B 2  33  ? 116.448 -16.427  35.166  1.00 0.00 ? 33   THR B C     1 
ATOM 3868  O O     . THR B 2  33  ? 117.259 -17.227  34.705  1.00 0.00 ? 33   THR B O     1 
ATOM 3869  C CB    . THR B 2  33  ? 117.468 -15.871  37.339  1.00 0.00 ? 33   THR B CB    1 
ATOM 3870  O OG1   . THR B 2  33  ? 116.420 -16.317  38.193  1.00 0.00 ? 33   THR B OG1   1 
ATOM 3871  C CG2   . THR B 2  33  ? 118.322 -14.806  38.060  1.00 0.00 ? 33   THR B CG2   1 
ATOM 3872  N N     . GLN B 2  34  ? 115.119 -16.506  34.900  1.00 0.00 ? 34   GLN B N     1 
ATOM 3873  C CA    . GLN B 2  34  ? 114.545 -17.503  34.030  1.00 0.00 ? 34   GLN B CA    1 
ATOM 3874  C C     . GLN B 2  34  ? 114.738 -17.130  32.588  1.00 0.00 ? 34   GLN B C     1 
ATOM 3875  O O     . GLN B 2  34  ? 114.773 -18.017  31.741  1.00 0.00 ? 34   GLN B O     1 
ATOM 3876  C CB    . GLN B 2  34  ? 113.028 -17.694  34.246  1.00 0.00 ? 34   GLN B CB    1 
ATOM 3877  C CG    . GLN B 2  34  ? 112.694 -18.225  35.649  1.00 0.00 ? 34   GLN B CG    1 
ATOM 3878  C CD    . GLN B 2  34  ? 111.181 -18.421  35.796  1.00 0.00 ? 34   GLN B CD    1 
ATOM 3879  O OE1   . GLN B 2  34  ? 110.711 -19.547  36.000  1.00 0.00 ? 34   GLN B OE1   1 
ATOM 3880  N NE2   . GLN B 2  34  ? 110.414 -17.293  35.693  1.00 0.00 ? 34   GLN B NE2   1 
ATOM 3881  N N     . PHE B 2  35  ? 114.893 -15.816  32.271  1.00 0.00 ? 35   PHE B N     1 
ATOM 3882  C CA    . PHE B 2  35  ? 115.244 -15.352  30.944  1.00 0.00 ? 35   PHE B CA    1 
ATOM 3883  C C     . PHE B 2  35  ? 116.676 -15.746  30.654  1.00 0.00 ? 35   PHE B C     1 
ATOM 3884  O O     . PHE B 2  35  ? 116.989 -16.193  29.553  1.00 0.00 ? 35   PHE B O     1 
ATOM 3885  C CB    . PHE B 2  35  ? 114.944 -13.818  30.745  1.00 0.00 ? 35   PHE B CB    1 
ATOM 3886  C CG    . PHE B 2  35  ? 116.092 -12.945  30.267  1.00 0.00 ? 35   PHE B CG    1 
ATOM 3887  C CD1   . PHE B 2  35  ? 116.668 -13.127  28.994  1.00 0.00 ? 35   PHE B CD1   1 
ATOM 3888  C CD2   . PHE B 2  35  ? 116.662 -11.999  31.131  1.00 0.00 ? 35   PHE B CD2   1 
ATOM 3889  C CE1   . PHE B 2  35  ? 117.813 -12.416  28.615  1.00 0.00 ? 35   PHE B CE1   1 
ATOM 3890  C CE2   . PHE B 2  35  ? 117.794 -11.274  30.747  1.00 0.00 ? 35   PHE B CE2   1 
ATOM 3891  C CZ    . PHE B 2  35  ? 118.373 -11.481  29.491  1.00 0.00 ? 35   PHE B CZ    1 
ATOM 3892  N N     . LEU B 2  36  ? 117.579 -15.569  31.650  1.00 0.00 ? 36   LEU B N     1 
ATOM 3893  C CA    . LEU B 2  36  ? 118.999 -15.758  31.474  1.00 0.00 ? 36   LEU B CA    1 
ATOM 3894  C C     . LEU B 2  36  ? 119.328 -17.230  31.445  1.00 0.00 ? 36   LEU B C     1 
ATOM 3895  O O     . LEU B 2  36  ? 120.302 -17.643  30.819  1.00 0.00 ? 36   LEU B O     1 
ATOM 3896  C CB    . LEU B 2  36  ? 119.792 -15.055  32.604  1.00 0.00 ? 36   LEU B CB    1 
ATOM 3897  C CG    . LEU B 2  36  ? 121.326 -14.957  32.397  1.00 0.00 ? 36   LEU B CG    1 
ATOM 3898  C CD1   . LEU B 2  36  ? 121.719 -14.252  31.082  1.00 0.00 ? 36   LEU B CD1   1 
ATOM 3899  C CD2   . LEU B 2  36  ? 121.997 -14.263  33.597  1.00 0.00 ? 36   LEU B CD2   1 
ATOM 3900  N N     . ALA B 2  37  ? 118.478 -18.065  32.093  1.00 0.00 ? 37   ALA B N     1 
ATOM 3901  C CA    . ALA B 2  37  ? 118.537 -19.504  32.024  1.00 0.00 ? 37   ALA B CA    1 
ATOM 3902  C C     . ALA B 2  37  ? 118.076 -19.986  30.672  1.00 0.00 ? 37   ALA B C     1 
ATOM 3903  O O     . ALA B 2  37  ? 118.680 -20.893  30.100  1.00 0.00 ? 37   ALA B O     1 
ATOM 3904  C CB    . ALA B 2  37  ? 117.665 -20.180  33.099  1.00 0.00 ? 37   ALA B CB    1 
ATOM 3905  N N     . LYS B 2  38  ? 116.993 -19.362  30.140  1.00 0.00 ? 38   LYS B N     1 
ATOM 3906  C CA    . LYS B 2  38  ? 116.431 -19.621  28.833  1.00 0.00 ? 38   LYS B CA    1 
ATOM 3907  C C     . LYS B 2  38  ? 117.192 -18.870  27.784  1.00 0.00 ? 38   LYS B C     1 
ATOM 3908  O O     . LYS B 2  38  ? 116.709 -17.891  27.214  1.00 0.00 ? 38   LYS B O     1 
ATOM 3909  C CB    . LYS B 2  38  ? 114.937 -19.223  28.714  1.00 0.00 ? 38   LYS B CB    1 
ATOM 3910  C CG    . LYS B 2  38  ? 113.964 -20.228  29.355  1.00 0.00 ? 38   LYS B CG    1 
ATOM 3911  C CD    . LYS B 2  38  ? 113.964 -21.621  28.696  1.00 0.00 ? 38   LYS B CD    1 
ATOM 3912  C CE    . LYS B 2  38  ? 113.620 -21.614  27.198  1.00 0.00 ? 38   LYS B CE    1 
ATOM 3913  N NZ    . LYS B 2  38  ? 113.703 -22.981  26.638  1.00 0.00 ? 38   LYS B NZ    1 
ATOM 3914  N N     . CYS B 2  39  ? 118.404 -19.364  27.481  1.00 0.00 ? 39   CYS B N     1 
ATOM 3915  C CA    . CYS B 2  39  ? 119.166 -18.927  26.354  1.00 0.00 ? 39   CYS B CA    1 
ATOM 3916  C C     . CYS B 2  39  ? 118.941 -19.965  25.307  1.00 0.00 ? 39   CYS B C     1 
ATOM 3917  O O     . CYS B 2  39  ? 118.936 -21.164  25.583  1.00 0.00 ? 39   CYS B O     1 
ATOM 3918  C CB    . CYS B 2  39  ? 120.691 -18.841  26.617  1.00 0.00 ? 39   CYS B CB    1 
ATOM 3919  S SG    . CYS B 2  39  ? 121.125 -17.475  27.736  1.00 0.00 ? 39   CYS B SG    1 
ATOM 3920  N N     . LYS B 2  40  ? 118.783 -19.494  24.053  1.00 0.00 ? 40   LYS B N     1 
ATOM 3921  C CA    . LYS B 2  40  ? 118.997 -20.301  22.881  1.00 0.00 ? 40   LYS B CA    1 
ATOM 3922  C C     . LYS B 2  40  ? 120.494 -20.330  22.744  1.00 0.00 ? 40   LYS B C     1 
ATOM 3923  O O     . LYS B 2  40  ? 121.120 -19.283  22.597  1.00 0.00 ? 40   LYS B O     1 
ATOM 3924  C CB    . LYS B 2  40  ? 118.311 -19.696  21.630  1.00 0.00 ? 40   LYS B CB    1 
ATOM 3925  C CG    . LYS B 2  40  ? 118.751 -20.269  20.271  1.00 0.00 ? 40   LYS B CG    1 
ATOM 3926  C CD    . LYS B 2  40  ? 118.584 -21.789  20.101  1.00 0.00 ? 40   LYS B CD    1 
ATOM 3927  C CE    . LYS B 2  40  ? 119.035 -22.286  18.720  1.00 0.00 ? 40   LYS B CE    1 
ATOM 3928  N NZ    . LYS B 2  40  ? 120.459 -21.963  18.474  1.00 0.00 ? 40   LYS B NZ    1 
ATOM 3929  N N     . LYS B 2  41  ? 121.076 -21.547  22.875  1.00 0.00 ? 41   LYS B N     1 
ATOM 3930  C CA    . LYS B 2  41  ? 122.494 -21.771  23.043  1.00 0.00 ? 41   LYS B CA    1 
ATOM 3931  C C     . LYS B 2  41  ? 123.073 -22.161  21.704  1.00 0.00 ? 41   LYS B C     1 
ATOM 3932  O O     . LYS B 2  41  ? 122.317 -22.696  20.894  1.00 0.00 ? 41   LYS B O     1 
ATOM 3933  C CB    . LYS B 2  41  ? 122.775 -22.883  24.082  1.00 0.00 ? 41   LYS B CB    1 
ATOM 3934  C CG    . LYS B 2  41  ? 122.432 -22.448  25.513  1.00 0.00 ? 41   LYS B CG    1 
ATOM 3935  C CD    . LYS B 2  41  ? 122.856 -23.492  26.555  1.00 0.00 ? 41   LYS B CD    1 
ATOM 3936  C CE    . LYS B 2  41  ? 122.590 -23.036  27.994  1.00 0.00 ? 41   LYS B CE    1 
ATOM 3937  N NZ    . LYS B 2  41  ? 123.028 -24.065  28.966  1.00 0.00 ? 41   LYS B NZ    1 
ATOM 3938  N N     . PRO B 2  42  ? 124.363 -21.884  21.410  1.00 0.00 ? 42   PRO B N     1 
ATOM 3939  C CA    . PRO B 2  42  ? 124.956 -21.895  20.076  1.00 0.00 ? 42   PRO B CA    1 
ATOM 3940  C C     . PRO B 2  42  ? 124.589 -23.054  19.189  1.00 0.00 ? 42   PRO B C     1 
ATOM 3941  O O     . PRO B 2  42  ? 124.654 -24.203  19.625  1.00 0.00 ? 42   PRO B O     1 
ATOM 3942  C CB    . PRO B 2  42  ? 126.474 -21.809  20.305  1.00 0.00 ? 42   PRO B CB    1 
ATOM 3943  C CG    . PRO B 2  42  ? 126.601 -21.055  21.630  1.00 0.00 ? 42   PRO B CG    1 
ATOM 3944  C CD    . PRO B 2  42  ? 125.376 -21.538  22.414  1.00 0.00 ? 42   PRO B CD    1 
ATOM 3945  N N     . ASP B 2  43  ? 124.236 -22.726  17.929  1.00 0.00 ? 43   ASP B N     1 
ATOM 3946  C CA    . ASP B 2  43  ? 124.022 -23.648  16.853  1.00 0.00 ? 43   ASP B CA    1 
ATOM 3947  C C     . ASP B 2  43  ? 125.053 -23.214  15.852  1.00 0.00 ? 43   ASP B C     1 
ATOM 3948  O O     . ASP B 2  43  ? 125.364 -22.028  15.751  1.00 0.00 ? 43   ASP B O     1 
ATOM 3949  C CB    . ASP B 2  43  ? 122.576 -23.533  16.294  1.00 0.00 ? 43   ASP B CB    1 
ATOM 3950  C CG    . ASP B 2  43  ? 122.303 -24.428  15.081  1.00 0.00 ? 43   ASP B CG    1 
ATOM 3951  O OD1   . ASP B 2  43  ? 122.588 -25.651  15.166  1.00 0.00 ? 43   ASP B OD1   1 
ATOM 3952  O OD2   . ASP B 2  43  ? 121.799 -23.893  14.059  1.00 0.00 ? 43   ASP B OD2   1 
ATOM 3953  N N     . LEU B 2  44  ? 125.641 -24.191  15.118  1.00 0.00 ? 44   LEU B N     1 
ATOM 3954  C CA    . LEU B 2  44  ? 126.686 -23.982  14.141  1.00 0.00 ? 44   LEU B CA    1 
ATOM 3955  C C     . LEU B 2  44  ? 126.196 -23.196  12.959  1.00 0.00 ? 44   LEU B C     1 
ATOM 3956  O O     . LEU B 2  44  ? 126.964 -22.446  12.362  1.00 0.00 ? 44   LEU B O     1 
ATOM 3957  C CB    . LEU B 2  44  ? 127.271 -25.310  13.601  1.00 0.00 ? 44   LEU B CB    1 
ATOM 3958  C CG    . LEU B 2  44  ? 127.974 -26.178  14.671  1.00 0.00 ? 44   LEU B CG    1 
ATOM 3959  C CD1   . LEU B 2  44  ? 128.391 -27.540  14.082  1.00 0.00 ? 44   LEU B CD1   1 
ATOM 3960  C CD2   . LEU B 2  44  ? 129.186 -25.472  15.315  1.00 0.00 ? 44   LEU B CD2   1 
ATOM 3961  N N     . LYS B 2  45  ? 124.901 -23.356  12.592  1.00 0.00 ? 45   LYS B N     1 
ATOM 3962  C CA    . LYS B 2  45  ? 124.314 -22.711  11.442  1.00 0.00 ? 45   LYS B CA    1 
ATOM 3963  C C     . LYS B 2  45  ? 123.945 -21.285  11.750  1.00 0.00 ? 45   LYS B C     1 
ATOM 3964  O O     . LYS B 2  45  ? 123.805 -20.481  10.830  1.00 0.00 ? 45   LYS B O     1 
ATOM 3965  C CB    . LYS B 2  45  ? 123.028 -23.416  10.946  1.00 0.00 ? 45   LYS B CB    1 
ATOM 3966  C CG    . LYS B 2  45  ? 123.140 -24.949  10.849  1.00 0.00 ? 45   LYS B CG    1 
ATOM 3967  C CD    . LYS B 2  45  ? 124.164 -25.466  9.822   1.00 0.00 ? 45   LYS B CD    1 
ATOM 3968  C CE    . LYS B 2  45  ? 123.739 -25.301  8.354   1.00 0.00 ? 45   LYS B CE    1 
ATOM 3969  N NZ    . LYS B 2  45  ? 122.530 -26.105  8.048   1.00 0.00 ? 45   LYS B NZ    1 
ATOM 3970  N N     . GLU B 2  46  ? 123.817 -20.927  13.055  1.00 0.00 ? 46   GLU B N     1 
ATOM 3971  C CA    . GLU B 2  46  ? 123.568 -19.564  13.459  1.00 0.00 ? 46   GLU B CA    1 
ATOM 3972  C C     . GLU B 2  46  ? 124.872 -18.896  13.776  1.00 0.00 ? 46   GLU B C     1 
ATOM 3973  O O     . GLU B 2  46  ? 124.928 -17.671  13.842  1.00 0.00 ? 46   GLU B O     1 
ATOM 3974  C CB    . GLU B 2  46  ? 122.693 -19.433  14.727  1.00 0.00 ? 46   GLU B CB    1 
ATOM 3975  C CG    . GLU B 2  46  ? 121.294 -20.056  14.574  1.00 0.00 ? 46   GLU B CG    1 
ATOM 3976  C CD    . GLU B 2  46  ? 120.371 -19.518  15.664  1.00 0.00 ? 46   GLU B CD    1 
ATOM 3977  O OE1   . GLU B 2  46  ? 120.811 -19.476  16.843  1.00 0.00 ? 46   GLU B OE1   1 
ATOM 3978  O OE2   . GLU B 2  46  ? 119.217 -19.134  15.330  1.00 0.00 ? 46   GLU B OE2   1 
ATOM 3979  N N     . TYR B 2  47  ? 125.967 -19.679  13.928  1.00 0.00 ? 47   TYR B N     1 
ATOM 3980  C CA    . TYR B 2  47  ? 127.302 -19.149  14.036  1.00 0.00 ? 47   TYR B CA    1 
ATOM 3981  C C     . TYR B 2  47  ? 127.785 -18.836  12.640  1.00 0.00 ? 47   TYR B C     1 
ATOM 3982  O O     . TYR B 2  47  ? 128.620 -17.958  12.466  1.00 0.00 ? 47   TYR B O     1 
ATOM 3983  C CB    . TYR B 2  47  ? 128.263 -20.149  14.739  1.00 0.00 ? 47   TYR B CB    1 
ATOM 3984  C CG    . TYR B 2  47  ? 129.665 -19.601  14.882  1.00 0.00 ? 47   TYR B CG    1 
ATOM 3985  C CD1   . TYR B 2  47  ? 129.915 -18.431  15.621  1.00 0.00 ? 47   TYR B CD1   1 
ATOM 3986  C CD2   . TYR B 2  47  ? 130.733 -20.229  14.220  1.00 0.00 ? 47   TYR B CD2   1 
ATOM 3987  C CE1   . TYR B 2  47  ? 131.209 -17.897  15.692  1.00 0.00 ? 47   TYR B CE1   1 
ATOM 3988  C CE2   . TYR B 2  47  ? 132.027 -19.699  14.289  1.00 0.00 ? 47   TYR B CE2   1 
ATOM 3989  C CZ    . TYR B 2  47  ? 132.267 -18.531  15.025  1.00 0.00 ? 47   TYR B CZ    1 
ATOM 3990  O OH    . TYR B 2  47  ? 133.570 -17.988  15.082  1.00 0.00 ? 47   TYR B OH    1 
ATOM 3991  N N     . THR B 2  48  ? 127.237 -19.523  11.605  1.00 0.00 ? 48   THR B N     1 
ATOM 3992  C CA    . THR B 2  48  ? 127.509 -19.252  10.210  1.00 0.00 ? 48   THR B CA    1 
ATOM 3993  C C     . THR B 2  48  ? 126.871 -17.941  9.827   1.00 0.00 ? 48   THR B C     1 
ATOM 3994  O O     . THR B 2  48  ? 127.465 -17.170  9.077   1.00 0.00 ? 48   THR B O     1 
ATOM 3995  C CB    . THR B 2  48  ? 127.054 -20.368  9.279   1.00 0.00 ? 48   THR B CB    1 
ATOM 3996  O OG1   . THR B 2  48  ? 127.676 -21.589  9.658   1.00 0.00 ? 48   THR B OG1   1 
ATOM 3997  C CG2   . THR B 2  48  ? 127.446 -20.062  7.816   1.00 0.00 ? 48   THR B CG2   1 
ATOM 3998  N N     . LYS B 2  49  ? 125.658 -17.644  10.372  1.00 0.00 ? 49   LYS B N     1 
ATOM 3999  C CA    . LYS B 2  49  ? 124.982 -16.374  10.202  1.00 0.00 ? 49   LYS B CA    1 
ATOM 4000  C C     . LYS B 2  49  ? 125.766 -15.247  10.818  1.00 0.00 ? 49   LYS B C     1 
ATOM 4001  O O     . LYS B 2  49  ? 125.827 -14.163  10.248  1.00 0.00 ? 49   LYS B O     1 
ATOM 4002  C CB    . LYS B 2  49  ? 123.568 -16.301  10.824  1.00 0.00 ? 49   LYS B CB    1 
ATOM 4003  C CG    . LYS B 2  49  ? 122.508 -17.133  10.088  1.00 0.00 ? 49   LYS B CG    1 
ATOM 4004  C CD    . LYS B 2  49  ? 121.077 -16.825  10.569  1.00 0.00 ? 49   LYS B CD    1 
ATOM 4005  C CE    . LYS B 2  49  ? 120.788 -17.290  12.003  1.00 0.00 ? 49   LYS B CE    1 
ATOM 4006  N NZ    . LYS B 2  49  ? 119.421 -16.912  12.434  1.00 0.00 ? 49   LYS B NZ    1 
ATOM 4007  N N     . ILE B 2  50  ? 126.379 -15.485  12.004  1.00 0.00 ? 50   ILE B N     1 
ATOM 4008  C CA    . ILE B 2  50  ? 127.202 -14.528  12.706  1.00 0.00 ? 50   ILE B CA    1 
ATOM 4009  C C     . ILE B 2  50  ? 128.459 -14.227  11.928  1.00 0.00 ? 50   ILE B C     1 
ATOM 4010  O O     . ILE B 2  50  ? 128.827 -13.065  11.807  1.00 0.00 ? 50   ILE B O     1 
ATOM 4011  C CB    . ILE B 2  50  ? 127.515 -14.998  14.127  1.00 0.00 ? 50   ILE B CB    1 
ATOM 4012  C CG1   . ILE B 2  50  ? 126.230 -14.850  14.983  1.00 0.00 ? 50   ILE B CG1   1 
ATOM 4013  C CG2   . ILE B 2  50  ? 128.724 -14.242  14.732  1.00 0.00 ? 50   ILE B CG2   1 
ATOM 4014  C CD1   . ILE B 2  50  ? 126.328 -15.479  16.376  1.00 0.00 ? 50   ILE B CD1   1 
ATOM 4015  N N     . VAL B 2  51  ? 129.138 -15.255  11.363  1.00 0.00 ? 51   VAL B N     1 
ATOM 4016  C CA    . VAL B 2  51  ? 130.392 -15.109  10.653  1.00 0.00 ? 51   VAL B CA    1 
ATOM 4017  C C     . VAL B 2  51  ? 130.203 -14.302  9.393   1.00 0.00 ? 51   VAL B C     1 
ATOM 4018  O O     . VAL B 2  51  ? 131.025 -13.436  9.097   1.00 0.00 ? 51   VAL B O     1 
ATOM 4019  C CB    . VAL B 2  51  ? 131.049 -16.459  10.368  1.00 0.00 ? 51   VAL B CB    1 
ATOM 4020  C CG1   . VAL B 2  51  ? 132.200 -16.357  9.341   1.00 0.00 ? 51   VAL B CG1   1 
ATOM 4021  C CG2   . VAL B 2  51  ? 131.591 -17.014  11.703  1.00 0.00 ? 51   VAL B CG2   1 
ATOM 4022  N N     . LYS B 2  52  ? 129.105 -14.546  8.633   1.00 0.00 ? 52   LYS B N     1 
ATOM 4023  C CA    . LYS B 2  52  ? 128.821 -13.801  7.429   1.00 0.00 ? 52   LYS B CA    1 
ATOM 4024  C C     . LYS B 2  52  ? 128.353 -12.403  7.727   1.00 0.00 ? 52   LYS B C     1 
ATOM 4025  O O     . LYS B 2  52  ? 128.689 -11.495  6.981   1.00 0.00 ? 52   LYS B O     1 
ATOM 4026  C CB    . LYS B 2  52  ? 127.852 -14.492  6.437   1.00 0.00 ? 52   LYS B CB    1 
ATOM 4027  C CG    . LYS B 2  52  ? 126.404 -14.686  6.915   1.00 0.00 ? 52   LYS B CG    1 
ATOM 4028  C CD    . LYS B 2  52  ? 125.455 -15.334  5.887   1.00 0.00 ? 52   LYS B CD    1 
ATOM 4029  C CE    . LYS B 2  52  ? 125.628 -16.849  5.672   1.00 0.00 ? 52   LYS B CE    1 
ATOM 4030  N NZ    . LYS B 2  52  ? 126.820 -17.181  4.854   1.00 0.00 ? 52   LYS B NZ    1 
ATOM 4031  N N     . ALA B 2  53  ? 127.574 -12.184  8.816   1.00 0.00 ? 53   ALA B N     1 
ATOM 4032  C CA    . ALA B 2  53  ? 127.052 -10.884  9.186   1.00 0.00 ? 53   ALA B CA    1 
ATOM 4033  C C     . ALA B 2  53  ? 128.146 -9.953   9.632   1.00 0.00 ? 53   ALA B C     1 
ATOM 4034  O O     . ALA B 2  53  ? 128.151 -8.777   9.277   1.00 0.00 ? 53   ALA B O     1 
ATOM 4035  C CB    . ALA B 2  53  ? 126.013 -10.965  10.321  1.00 0.00 ? 53   ALA B CB    1 
ATOM 4036  N N     . VAL B 2  54  ? 129.109 -10.492  10.418  1.00 0.00 ? 54   VAL B N     1 
ATOM 4037  C CA    . VAL B 2  54  ? 130.270 -9.798   10.922  1.00 0.00 ? 54   VAL B CA    1 
ATOM 4038  C C     . VAL B 2  54  ? 131.230 -9.545   9.787   1.00 0.00 ? 54   VAL B C     1 
ATOM 4039  O O     . VAL B 2  54  ? 131.945 -8.550   9.816   1.00 0.00 ? 54   VAL B O     1 
ATOM 4040  C CB    . VAL B 2  54  ? 130.939 -10.573  12.062  1.00 0.00 ? 54   VAL B CB    1 
ATOM 4041  C CG1   . VAL B 2  54  ? 132.325 -10.008  12.443  1.00 0.00 ? 54   VAL B CG1   1 
ATOM 4042  C CG2   . VAL B 2  54  ? 130.001 -10.529  13.290  1.00 0.00 ? 54   VAL B CG2   1 
ATOM 4043  N N     . GLY B 2  55  ? 131.253 -10.424  8.753   1.00 0.00 ? 55   GLY B N     1 
ATOM 4044  C CA    . GLY B 2  55  ? 132.169 -10.328  7.639   1.00 0.00 ? 55   GLY B CA    1 
ATOM 4045  C C     . GLY B 2  55  ? 131.675 -9.407   6.555   1.00 0.00 ? 55   GLY B C     1 
ATOM 4046  O O     . GLY B 2  55  ? 132.474 -8.876   5.786   1.00 0.00 ? 55   GLY B O     1 
ATOM 4047  N N     . ILE B 2  56  ? 130.337 -9.180   6.489   1.00 0.00 ? 56   ILE B N     1 
ATOM 4048  C CA    . ILE B 2  56  ? 129.678 -8.182   5.666   1.00 0.00 ? 56   ILE B CA    1 
ATOM 4049  C C     . ILE B 2  56  ? 129.948 -6.853   6.311   1.00 0.00 ? 56   ILE B C     1 
ATOM 4050  O O     . ILE B 2  56  ? 130.145 -5.839   5.641   1.00 0.00 ? 56   ILE B O     1 
ATOM 4051  C CB    . ILE B 2  56  ? 128.174 -8.440   5.540   1.00 0.00 ? 56   ILE B CB    1 
ATOM 4052  C CG1   . ILE B 2  56  ? 127.939 -9.615   4.559   1.00 0.00 ? 56   ILE B CG1   1 
ATOM 4053  C CG2   . ILE B 2  56  ? 127.395 -7.181   5.083   1.00 0.00 ? 56   ILE B CG2   1 
ATOM 4054  C CD1   . ILE B 2  56  ? 126.539 -10.229  4.665   1.00 0.00 ? 56   ILE B CD1   1 
ATOM 4055  N N     . GLY B 2  57  ? 129.994 -6.857   7.661   1.00 0.00 ? 57   GLY B N     1 
ATOM 4056  C CA    . GLY B 2  57  ? 130.356 -5.716   8.444   1.00 0.00 ? 57   GLY B CA    1 
ATOM 4057  C C     . GLY B 2  57  ? 131.814 -5.405   8.303   1.00 0.00 ? 57   GLY B C     1 
ATOM 4058  O O     . GLY B 2  57  ? 132.169 -4.240   8.394   1.00 0.00 ? 57   GLY B O     1 
ATOM 4059  N N     . PHE B 2  58  ? 132.690 -6.422   8.072   1.00 0.00 ? 58   PHE B N     1 
ATOM 4060  C CA    . PHE B 2  58  ? 134.128 -6.258   8.119   1.00 0.00 ? 58   PHE B CA    1 
ATOM 4061  C C     . PHE B 2  58  ? 134.659 -5.752   6.797   1.00 0.00 ? 58   PHE B C     1 
ATOM 4062  O O     . PHE B 2  58  ? 135.754 -5.193   6.750   1.00 0.00 ? 58   PHE B O     1 
ATOM 4063  C CB    . PHE B 2  58  ? 134.878 -7.569   8.497   1.00 0.00 ? 58   PHE B CB    1 
ATOM 4064  C CG    . PHE B 2  58  ? 136.270 -7.290   9.025   1.00 0.00 ? 58   PHE B CG    1 
ATOM 4065  C CD1   . PHE B 2  58  ? 136.455 -6.867   10.355  1.00 0.00 ? 58   PHE B CD1   1 
ATOM 4066  C CD2   . PHE B 2  58  ? 137.400 -7.430   8.198   1.00 0.00 ? 58   PHE B CD2   1 
ATOM 4067  C CE1   . PHE B 2  58  ? 137.737 -6.584   10.844  1.00 0.00 ? 58   PHE B CE1   1 
ATOM 4068  C CE2   . PHE B 2  58  ? 138.682 -7.138   8.682   1.00 0.00 ? 58   PHE B CE2   1 
ATOM 4069  C CZ    . PHE B 2  58  ? 138.850 -6.715   10.006  1.00 0.00 ? 58   PHE B CZ    1 
ATOM 4070  N N     . ILE B 2  59  ? 133.889 -5.902   5.690   1.00 0.00 ? 59   ILE B N     1 
ATOM 4071  C CA    . ILE B 2  59  ? 134.280 -5.370   4.401   1.00 0.00 ? 59   ILE B CA    1 
ATOM 4072  C C     . ILE B 2  59  ? 133.784 -3.944   4.301   1.00 0.00 ? 59   ILE B C     1 
ATOM 4073  O O     . ILE B 2  59  ? 134.408 -3.116   3.641   1.00 0.00 ? 59   ILE B O     1 
ATOM 4074  C CB    . ILE B 2  59  ? 133.817 -6.233   3.224   1.00 0.00 ? 59   ILE B CB    1 
ATOM 4075  C CG1   . ILE B 2  59  ? 134.389 -5.723   1.877   1.00 0.00 ? 59   ILE B CG1   1 
ATOM 4076  C CG2   . ILE B 2  59  ? 132.281 -6.381   3.209   1.00 0.00 ? 59   ILE B CG2   1 
ATOM 4077  C CD1   . ILE B 2  59  ? 134.189 -6.696   0.712   1.00 0.00 ? 59   ILE B CD1   1 
ATOM 4078  N N     . ALA B 2  60  ? 132.674 -3.611   5.015   1.00 0.00 ? 60   ALA B N     1 
ATOM 4079  C CA    . ALA B 2  60  ? 132.156 -2.266   5.150   1.00 0.00 ? 60   ALA B CA    1 
ATOM 4080  C C     . ALA B 2  60  ? 133.072 -1.437   6.011   1.00 0.00 ? 60   ALA B C     1 
ATOM 4081  O O     . ALA B 2  60  ? 133.316 -0.268   5.730   1.00 0.00 ? 60   ALA B O     1 
ATOM 4082  C CB    . ALA B 2  60  ? 130.747 -2.237   5.770   1.00 0.00 ? 60   ALA B CB    1 
ATOM 4083  N N     . VAL B 2  61  ? 133.632 -2.076   7.065   1.00 0.00 ? 61   VAL B N     1 
ATOM 4084  C CA    . VAL B 2  61  ? 134.651 -1.591   7.967   1.00 0.00 ? 61   VAL B CA    1 
ATOM 4085  C C     . VAL B 2  61  ? 135.896 -1.285   7.181   1.00 0.00 ? 61   VAL B C     1 
ATOM 4086  O O     . VAL B 2  61  ? 136.559 -0.280   7.432   1.00 0.00 ? 61   VAL B O     1 
ATOM 4087  C CB    . VAL B 2  61  ? 134.920 -2.672   9.020   1.00 0.00 ? 61   VAL B CB    1 
ATOM 4088  C CG1   . VAL B 2  61  ? 136.333 -2.668   9.616   1.00 0.00 ? 61   VAL B CG1   1 
ATOM 4089  C CG2   . VAL B 2  61  ? 133.878 -2.614   10.149  1.00 0.00 ? 61   VAL B CG2   1 
ATOM 4090  N N     . GLY B 2  62  ? 136.218 -2.156   6.194   1.00 0.00 ? 62   GLY B N     1 
ATOM 4091  C CA    . GLY B 2  62  ? 137.457 -2.123   5.469   1.00 0.00 ? 62   GLY B CA    1 
ATOM 4092  C C     . GLY B 2  62  ? 137.533 -0.974   4.519   1.00 0.00 ? 62   GLY B C     1 
ATOM 4093  O O     . GLY B 2  62  ? 138.563 -0.313   4.454   1.00 0.00 ? 62   GLY B O     1 
ATOM 4094  N N     . ILE B 2  63  ? 136.448 -0.695   3.761   1.00 0.00 ? 63   ILE B N     1 
ATOM 4095  C CA    . ILE B 2  63  ? 136.424 0.376    2.790   1.00 0.00 ? 63   ILE B CA    1 
ATOM 4096  C C     . ILE B 2  63  ? 136.363 1.731    3.465   1.00 0.00 ? 63   ILE B C     1 
ATOM 4097  O O     . ILE B 2  63  ? 137.034 2.665    3.030   1.00 0.00 ? 63   ILE B O     1 
ATOM 4098  C CB    . ILE B 2  63  ? 135.346 0.182    1.722   1.00 0.00 ? 63   ILE B CB    1 
ATOM 4099  C CG1   . ILE B 2  63  ? 135.477 1.224    0.583   1.00 0.00 ? 63   ILE B CG1   1 
ATOM 4100  C CG2   . ILE B 2  63  ? 133.930 0.132    2.337   1.00 0.00 ? 63   ILE B CG2   1 
ATOM 4101  C CD1   . ILE B 2  63  ? 134.621 0.904    -0.646  1.00 0.00 ? 63   ILE B CD1   1 
ATOM 4102  N N     . ILE B 2  64  ? 135.567 1.857    4.557   1.00 0.00 ? 64   ILE B N     1 
ATOM 4103  C CA    . ILE B 2  64  ? 135.323 3.101    5.253   1.00 0.00 ? 64   ILE B CA    1 
ATOM 4104  C C     . ILE B 2  64  ? 136.555 3.597    5.978   1.00 0.00 ? 64   ILE B C     1 
ATOM 4105  O O     . ILE B 2  64  ? 136.882 4.780    5.905   1.00 0.00 ? 64   ILE B O     1 
ATOM 4106  C CB    . ILE B 2  64  ? 134.115 2.980    6.186   1.00 0.00 ? 64   ILE B CB    1 
ATOM 4107  C CG1   . ILE B 2  64  ? 132.833 2.862    5.322   1.00 0.00 ? 64   ILE B CG1   1 
ATOM 4108  C CG2   . ILE B 2  64  ? 134.012 4.165    7.171   1.00 0.00 ? 64   ILE B CG2   1 
ATOM 4109  C CD1   . ILE B 2  64  ? 131.553 2.604    6.122   1.00 0.00 ? 64   ILE B CD1   1 
ATOM 4110  N N     . GLY B 2  65  ? 137.285 2.707    6.689   1.00 0.00 ? 65   GLY B N     1 
ATOM 4111  C CA    . GLY B 2  65  ? 138.360 3.137    7.553   1.00 0.00 ? 65   GLY B CA    1 
ATOM 4112  C C     . GLY B 2  65  ? 139.651 3.310    6.806   1.00 0.00 ? 65   GLY B C     1 
ATOM 4113  O O     . GLY B 2  65  ? 140.514 4.078    7.230   1.00 0.00 ? 65   GLY B O     1 
ATOM 4114  N N     . TYR B 2  66  ? 139.805 2.595    5.662   1.00 0.00 ? 66   TYR B N     1 
ATOM 4115  C CA    . TYR B 2  66  ? 140.950 2.684    4.784   1.00 0.00 ? 66   TYR B CA    1 
ATOM 4116  C C     . TYR B 2  66  ? 140.912 3.996    4.050   1.00 0.00 ? 66   TYR B C     1 
ATOM 4117  O O     . TYR B 2  66  ? 141.934 4.662    3.914   1.00 0.00 ? 66   TYR B O     1 
ATOM 4118  C CB    . TYR B 2  66  ? 140.949 1.508    3.769   1.00 0.00 ? 66   TYR B CB    1 
ATOM 4119  C CG    . TYR B 2  66  ? 142.212 1.301    2.965   1.00 0.00 ? 66   TYR B CG    1 
ATOM 4120  C CD1   . TYR B 2  66  ? 143.479 1.256    3.574   1.00 0.00 ? 66   TYR B CD1   1 
ATOM 4121  C CD2   . TYR B 2  66  ? 142.113 1.005    1.593   1.00 0.00 ? 66   TYR B CD2   1 
ATOM 4122  C CE1   . TYR B 2  66  ? 144.617 0.915    2.831   1.00 0.00 ? 66   TYR B CE1   1 
ATOM 4123  C CE2   . TYR B 2  66  ? 143.245 0.653    0.850   1.00 0.00 ? 66   TYR B CE2   1 
ATOM 4124  C CZ    . TYR B 2  66  ? 144.502 0.602    1.469   1.00 0.00 ? 66   TYR B CZ    1 
ATOM 4125  O OH    . TYR B 2  66  ? 145.649 0.254    0.721   1.00 0.00 ? 66   TYR B OH    1 
ATOM 4126  N N     . ALA B 2  67  ? 139.703 4.399    3.583   1.00 0.00 ? 67   ALA B N     1 
ATOM 4127  C CA    . ALA B 2  67  ? 139.482 5.597    2.809   1.00 0.00 ? 67   ALA B CA    1 
ATOM 4128  C C     . ALA B 2  67  ? 139.799 6.843    3.586   1.00 0.00 ? 67   ALA B C     1 
ATOM 4129  O O     . ALA B 2  67  ? 140.410 7.759    3.042   1.00 0.00 ? 67   ALA B O     1 
ATOM 4130  C CB    . ALA B 2  67  ? 138.027 5.709    2.319   1.00 0.00 ? 67   ALA B CB    1 
ATOM 4131  N N     . ILE B 2  68  ? 139.395 6.894    4.882   1.00 0.00 ? 68   ILE B N     1 
ATOM 4132  C CA    . ILE B 2  68  ? 139.586 8.035    5.750   1.00 0.00 ? 68   ILE B CA    1 
ATOM 4133  C C     . ILE B 2  68  ? 141.056 8.277    6.010   1.00 0.00 ? 68   ILE B C     1 
ATOM 4134  O O     . ILE B 2  68  ? 141.508 9.419    5.922   1.00 0.00 ? 68   ILE B O     1 
ATOM 4135  C CB    . ILE B 2  68  ? 138.778 7.898    7.047   1.00 0.00 ? 68   ILE B CB    1 
ATOM 4136  C CG1   . ILE B 2  68  ? 137.288 8.149    6.706   1.00 0.00 ? 68   ILE B CG1   1 
ATOM 4137  C CG2   . ILE B 2  68  ? 139.259 8.878    8.147   1.00 0.00 ? 68   ILE B CG2   1 
ATOM 4138  C CD1   . ILE B 2  68  ? 136.292 7.793    7.813   1.00 0.00 ? 68   ILE B CD1   1 
ATOM 4139  N N     . LYS B 2  69  ? 141.848 7.217    6.313   1.00 0.00 ? 69   LYS B N     1 
ATOM 4140  C CA    . LYS B 2  69  ? 143.238 7.402    6.659   1.00 0.00 ? 69   LYS B CA    1 
ATOM 4141  C C     . LYS B 2  69  ? 144.107 7.777    5.483   1.00 0.00 ? 69   LYS B C     1 
ATOM 4142  O O     . LYS B 2  69  ? 144.971 8.641    5.622   1.00 0.00 ? 69   LYS B O     1 
ATOM 4143  C CB    . LYS B 2  69  ? 143.882 6.211    7.408   1.00 0.00 ? 69   LYS B CB    1 
ATOM 4144  C CG    . LYS B 2  69  ? 145.296 6.571    7.895   1.00 0.00 ? 69   LYS B CG    1 
ATOM 4145  C CD    . LYS B 2  69  ? 145.876 5.716    9.020   1.00 0.00 ? 69   LYS B CD    1 
ATOM 4146  C CE    . LYS B 2  69  ? 147.206 6.318    9.498   1.00 0.00 ? 69   LYS B CE    1 
ATOM 4147  N NZ    . LYS B 2  69  ? 147.841 5.487    10.535  1.00 0.00 ? 69   LYS B NZ    1 
ATOM 4148  N N     . LEU B 2  70  ? 143.910 7.139    4.299   1.00 0.00 ? 70   LEU B N     1 
ATOM 4149  C CA    . LEU B 2  70  ? 144.832 7.241    3.185   1.00 0.00 ? 70   LEU B CA    1 
ATOM 4150  C C     . LEU B 2  70  ? 144.991 8.638    2.661   1.00 0.00 ? 70   LEU B C     1 
ATOM 4151  O O     . LEU B 2  70  ? 146.114 9.043    2.381   1.00 0.00 ? 70   LEU B O     1 
ATOM 4152  C CB    . LEU B 2  70  ? 144.421 6.391    1.959   1.00 0.00 ? 70   LEU B CB    1 
ATOM 4153  C CG    . LEU B 2  70  ? 144.703 4.876    2.063   1.00 0.00 ? 70   LEU B CG    1 
ATOM 4154  C CD1   . LEU B 2  70  ? 144.179 4.194    0.786   1.00 0.00 ? 70   LEU B CD1   1 
ATOM 4155  C CD2   . LEU B 2  70  ? 146.194 4.542    2.284   1.00 0.00 ? 70   LEU B CD2   1 
ATOM 4156  N N     . ILE B 2  71  ? 143.874 9.390    2.516   1.00 0.00 ? 71   ILE B N     1 
ATOM 4157  C CA    . ILE B 2  71  ? 143.855 10.696   1.897   1.00 0.00 ? 71   ILE B CA    1 
ATOM 4158  C C     . ILE B 2  71  ? 144.224 11.769   2.904   1.00 0.00 ? 71   ILE B C     1 
ATOM 4159  O O     . ILE B 2  71  ? 144.620 12.868   2.521   1.00 0.00 ? 71   ILE B O     1 
ATOM 4160  C CB    . ILE B 2  71  ? 142.503 10.962   1.238   1.00 0.00 ? 71   ILE B CB    1 
ATOM 4161  C CG1   . ILE B 2  71  ? 142.473 12.284   0.426   1.00 0.00 ? 71   ILE B CG1   1 
ATOM 4162  C CG2   . ILE B 2  71  ? 141.393 10.886   2.300   1.00 0.00 ? 71   ILE B CG2   1 
ATOM 4163  C CD1   . ILE B 2  71  ? 141.243 12.439   -0.475  1.00 0.00 ? 71   ILE B CD1   1 
ATOM 4164  N N     . HIS B 2  72  ? 144.174 11.450   4.225   1.00 0.00 ? 72   HIS B N     1 
ATOM 4165  C CA    . HIS B 2  72  ? 144.618 12.320   5.296   1.00 0.00 ? 72   HIS B CA    1 
ATOM 4166  C C     . HIS B 2  72  ? 146.115 12.529   5.217   1.00 0.00 ? 72   HIS B C     1 
ATOM 4167  O O     . HIS B 2  72  ? 146.608 13.622   5.481   1.00 0.00 ? 72   HIS B O     1 
ATOM 4168  C CB    . HIS B 2  72  ? 144.250 11.759   6.698   1.00 0.00 ? 72   HIS B CB    1 
ATOM 4169  C CG    . HIS B 2  72  ? 144.267 12.745   7.847   1.00 0.00 ? 72   HIS B CG    1 
ATOM 4170  N ND1   . HIS B 2  72  ? 145.267 13.654   8.126   1.00 0.00 ? 72   HIS B ND1   1 
ATOM 4171  C CD2   . HIS B 2  72  ? 143.357 12.890   8.849   1.00 0.00 ? 72   HIS B CD2   1 
ATOM 4172  C CE1   . HIS B 2  72  ? 144.909 14.301   9.263   1.00 0.00 ? 72   HIS B CE1   1 
ATOM 4173  N NE2   . HIS B 2  72  ? 143.758 13.871   9.740   1.00 0.00 ? 72   HIS B NE2   1 
ATOM 4174  N N     . ILE B 2  73  ? 146.871 11.466   4.842   1.00 0.00 ? 73   ILE B N     1 
ATOM 4175  C CA    . ILE B 2  73  ? 148.317 11.480   4.748   1.00 0.00 ? 73   ILE B CA    1 
ATOM 4176  C C     . ILE B 2  73  ? 148.808 12.472   3.692   1.00 0.00 ? 73   ILE B C     1 
ATOM 4177  O O     . ILE B 2  73  ? 149.718 13.226   4.029   1.00 0.00 ? 73   ILE B O     1 
ATOM 4178  C CB    . ILE B 2  73  ? 148.907 10.069   4.613   1.00 0.00 ? 73   ILE B CB    1 
ATOM 4179  C CG1   . ILE B 2  73  ? 148.466 9.199    5.820   1.00 0.00 ? 73   ILE B CG1   1 
ATOM 4180  C CG2   . ILE B 2  73  ? 150.447 10.137   4.490   1.00 0.00 ? 73   ILE B CG2   1 
ATOM 4181  C CD1   . ILE B 2  73  ? 148.829 7.715    5.694   1.00 0.00 ? 73   ILE B CD1   1 
ATOM 4182  N N     . PRO B 2  74  ? 148.270 12.606   2.473   1.00 0.00 ? 74   PRO B N     1 
ATOM 4183  C CA    . PRO B 2  74  ? 148.588 13.706   1.576   1.00 0.00 ? 74   PRO B CA    1 
ATOM 4184  C C     . PRO B 2  74  ? 148.230 15.096   2.048   1.00 0.00 ? 74   PRO B C     1 
ATOM 4185  O O     . PRO B 2  74  ? 148.816 16.024   1.504   1.00 0.00 ? 74   PRO B O     1 
ATOM 4186  C CB    . PRO B 2  74  ? 147.848 13.375   0.278   1.00 0.00 ? 74   PRO B CB    1 
ATOM 4187  C CG    . PRO B 2  74  ? 147.931 11.855   0.227   1.00 0.00 ? 74   PRO B CG    1 
ATOM 4188  C CD    . PRO B 2  74  ? 147.763 11.474   1.699   1.00 0.00 ? 74   PRO B CD    1 
ATOM 4189  N N     . ILE B 2  75  ? 147.278 15.303   2.998   1.00 0.00 ? 75   ILE B N     1 
ATOM 4190  C CA    . ILE B 2  75  ? 146.990 16.626   3.541   1.00 0.00 ? 75   ILE B CA    1 
ATOM 4191  C C     . ILE B 2  75  ? 148.185 17.099   4.345   1.00 0.00 ? 75   ILE B C     1 
ATOM 4192  O O     . ILE B 2  75  ? 148.608 18.250   4.229   1.00 0.00 ? 75   ILE B O     1 
ATOM 4193  C CB    . ILE B 2  75  ? 145.715 16.688   4.388   1.00 0.00 ? 75   ILE B CB    1 
ATOM 4194  C CG1   . ILE B 2  75  ? 144.501 16.268   3.523   1.00 0.00 ? 75   ILE B CG1   1 
ATOM 4195  C CG2   . ILE B 2  75  ? 145.521 18.110   4.972   1.00 0.00 ? 75   ILE B CG2   1 
ATOM 4196  C CD1   . ILE B 2  75  ? 143.166 16.239   4.276   1.00 0.00 ? 75   ILE B CD1   1 
ATOM 4197  N N     . ARG B 2  76  ? 148.773 16.174   5.143   1.00 0.00 ? 76   ARG B N     1 
ATOM 4198  C CA    . ARG B 2  76  ? 149.963 16.374   5.929   1.00 0.00 ? 76   ARG B CA    1 
ATOM 4199  C C     . ARG B 2  76  ? 151.179 16.586   5.051   1.00 0.00 ? 76   ARG B C     1 
ATOM 4200  O O     . ARG B 2  76  ? 152.077 17.348   5.398   1.00 0.00 ? 76   ARG B O     1 
ATOM 4201  C CB    . ARG B 2  76  ? 150.197 15.160   6.863   1.00 0.00 ? 76   ARG B CB    1 
ATOM 4202  C CG    . ARG B 2  76  ? 151.373 15.268   7.855   1.00 0.00 ? 76   ARG B CG    1 
ATOM 4203  C CD    . ARG B 2  76  ? 151.080 15.992   9.181   1.00 0.00 ? 76   ARG B CD    1 
ATOM 4204  N NE    . ARG B 2  76  ? 150.689 17.421   8.953   1.00 0.00 ? 76   ARG B NE    1 
ATOM 4205  C CZ    . ARG B 2  76  ? 151.596 18.410   8.685   1.00 0.00 ? 76   ARG B CZ    1 
ATOM 4206  N NH1   . ARG B 2  76  ? 152.908 18.110   8.456   1.00 0.00 ? 76   ARG B NH1   1 
ATOM 4207  N NH2   . ARG B 2  76  ? 151.168 19.705   8.645   1.00 0.00 ? 76   ARG B NH2   1 
ATOM 4208  N N     . TYR B 2  77  ? 151.241 15.894   3.889   1.00 0.00 ? 77   TYR B N     1 
ATOM 4209  C CA    . TYR B 2  77  ? 152.347 15.964   2.959   1.00 0.00 ? 77   TYR B CA    1 
ATOM 4210  C C     . TYR B 2  77  ? 152.378 17.304   2.242   1.00 0.00 ? 77   TYR B C     1 
ATOM 4211  O O     . TYR B 2  77  ? 153.431 17.931   2.137   1.00 0.00 ? 77   TYR B O     1 
ATOM 4212  C CB    . TYR B 2  77  ? 152.233 14.807   1.923   1.00 0.00 ? 77   TYR B CB    1 
ATOM 4213  C CG    . TYR B 2  77  ? 153.525 14.290   1.317   1.00 0.00 ? 77   TYR B CG    1 
ATOM 4214  C CD1   . TYR B 2  77  ? 153.466 13.054   0.646   1.00 0.00 ? 77   TYR B CD1   1 
ATOM 4215  C CD2   . TYR B 2  77  ? 154.769 14.949   1.390   1.00 0.00 ? 77   TYR B CD2   1 
ATOM 4216  C CE1   . TYR B 2  77  ? 154.608 12.488   0.069   1.00 0.00 ? 77   TYR B CE1   1 
ATOM 4217  C CE2   . TYR B 2  77  ? 155.914 14.389   0.807   1.00 0.00 ? 77   TYR B CE2   1 
ATOM 4218  C CZ    . TYR B 2  77  ? 155.836 13.155   0.148   1.00 0.00 ? 77   TYR B CZ    1 
ATOM 4219  O OH    . TYR B 2  77  ? 156.990 12.581   -0.434  1.00 0.00 ? 77   TYR B OH    1 
ATOM 4220  N N     . VAL B 2  78  ? 151.202 17.774   1.747   1.00 0.00 ? 78   VAL B N     1 
ATOM 4221  C CA    . VAL B 2  78  ? 151.042 18.983   0.959   1.00 0.00 ? 78   VAL B CA    1 
ATOM 4222  C C     . VAL B 2  78  ? 151.319 20.220   1.778   1.00 0.00 ? 78   VAL B C     1 
ATOM 4223  O O     . VAL B 2  78  ? 152.018 21.120   1.312   1.00 0.00 ? 78   VAL B O     1 
ATOM 4224  C CB    . VAL B 2  78  ? 149.652 19.045   0.316   1.00 0.00 ? 78   VAL B CB    1 
ATOM 4225  C CG1   . VAL B 2  78  ? 149.296 20.442   -0.243  1.00 0.00 ? 78   VAL B CG1   1 
ATOM 4226  C CG2   . VAL B 2  78  ? 149.599 18.002   -0.822  1.00 0.00 ? 78   VAL B CG2   1 
ATOM 4227  N N     . ILE B 2  79  ? 150.800 20.282   3.028   1.00 0.00 ? 79   ILE B N     1 
ATOM 4228  C CA    . ILE B 2  79  ? 150.913 21.451   3.871   1.00 0.00 ? 79   ILE B CA    1 
ATOM 4229  C C     . ILE B 2  79  ? 151.917 21.072   4.918   1.00 0.00 ? 79   ILE B C     1 
ATOM 4230  O O     . ILE B 2  79  ? 151.759 20.062   5.596   1.00 0.00 ? 79   ILE B O     1 
ATOM 4231  C CB    . ILE B 2  79  ? 149.590 21.861   4.517   1.00 0.00 ? 79   ILE B CB    1 
ATOM 4232  C CG1   . ILE B 2  79  ? 148.522 22.094   3.416   1.00 0.00 ? 79   ILE B CG1   1 
ATOM 4233  C CG2   . ILE B 2  79  ? 149.817 23.118   5.390   1.00 0.00 ? 79   ILE B CG2   1 
ATOM 4234  C CD1   . ILE B 2  79  ? 147.148 22.525   3.939   1.00 0.00 ? 79   ILE B CD1   1 
ATOM 4235  N N     . VAL B 2  80  ? 152.995 21.879   5.052   1.00 0.00 ? 80   VAL B N     1 
ATOM 4236  C CA    . VAL B 2  80  ? 154.123 21.600   5.912   1.00 0.00 ? 80   VAL B CA    1 
ATOM 4237  C C     . VAL B 2  80  ? 153.740 21.737   7.404   1.00 0.00 ? 80   VAL B C     1 
ATOM 4238  O O     . VAL B 2  80  ? 152.844 22.560   7.731   1.00 0.00 ? 80   VAL B O     1 
ATOM 4239  C CB    . VAL B 2  80  ? 155.322 22.482   5.556   1.00 0.00 ? 80   VAL B CB    1 
ATOM 4240  C CG1   . VAL B 2  80  ? 155.067 23.955   5.945   1.00 0.00 ? 80   VAL B CG1   1 
ATOM 4241  C CG2   . VAL B 2  80  ? 156.624 21.914   6.161   1.00 0.00 ? 80   VAL B CG2   1 
ATOM 4242  O OXT   . VAL B 2  80  ? 154.343 21.005   8.233   1.00 0.00 ? 80   VAL B OXT   1 
ATOM 4243  N N     . ARG C 3  58  ? 108.475 21.190   3.438   1.00 0.00 ? 58   ARG C N     1 
ATOM 4244  C CA    . ARG C 3  58  ? 109.362 20.629   2.397   1.00 0.00 ? 58   ARG C CA    1 
ATOM 4245  C C     . ARG C 3  58  ? 110.505 21.550   2.081   1.00 0.00 ? 58   ARG C C     1 
ATOM 4246  O O     . ARG C 3  58  ? 110.323 22.759   1.946   1.00 0.00 ? 58   ARG C O     1 
ATOM 4247  C CB    . ARG C 3  58  ? 108.528 20.342   1.131   1.00 0.00 ? 58   ARG C CB    1 
ATOM 4248  C CG    . ARG C 3  58  ? 107.936 18.926   1.143   1.00 0.00 ? 58   ARG C CG    1 
ATOM 4249  C CD    . ARG C 3  58  ? 107.255 18.589   -0.185  1.00 0.00 ? 58   ARG C CD    1 
ATOM 4250  N NE    . ARG C 3  58  ? 106.938 17.120   -0.203  1.00 0.00 ? 58   ARG C NE    1 
ATOM 4251  C CZ    . ARG C 3  58  ? 107.151 16.327   -1.299  1.00 0.00 ? 58   ARG C CZ    1 
ATOM 4252  N NH1   . ARG C 3  58  ? 107.628 16.847   -2.466  1.00 0.00 ? 58   ARG C NH1   1 
ATOM 4253  N NH2   . ARG C 3  58  ? 106.907 14.987   -1.222  1.00 0.00 ? 58   ARG C NH2   1 
ATOM 4254  N N     . VAL C 3  59  ? 111.724 20.968   1.945   1.00 0.00 ? 59   VAL C N     1 
ATOM 4255  C CA    . VAL C 3  59  ? 112.914 21.672   1.521   1.00 0.00 ? 59   VAL C CA    1 
ATOM 4256  C C     . VAL C 3  59  ? 113.273 20.973   0.241   1.00 0.00 ? 59   VAL C C     1 
ATOM 4257  O O     . VAL C 3  59  ? 112.792 21.388   -0.812  1.00 0.00 ? 59   VAL C O     1 
ATOM 4258  C CB    . VAL C 3  59  ? 114.045 21.677   2.553   1.00 0.00 ? 59   VAL C CB    1 
ATOM 4259  C CG1   . VAL C 3  59  ? 115.325 22.335   1.991   1.00 0.00 ? 59   VAL C CG1   1 
ATOM 4260  C CG2   . VAL C 3  59  ? 113.552 22.475   3.775   1.00 0.00 ? 59   VAL C CG2   1 
ATOM 4261  N N     . ASP C 3  60  ? 114.066 19.875   0.325   1.00 0.00 ? 60   ASP C N     1 
ATOM 4262  C CA    . ASP C 3  60  ? 114.498 19.058   -0.784  1.00 0.00 ? 60   ASP C CA    1 
ATOM 4263  C C     . ASP C 3  60  ? 115.628 18.232   -0.245  1.00 0.00 ? 60   ASP C C     1 
ATOM 4264  O O     . ASP C 3  60  ? 116.392 18.683   0.609   1.00 0.00 ? 60   ASP C O     1 
ATOM 4265  C CB    . ASP C 3  60  ? 114.998 19.762   -2.089  1.00 0.00 ? 60   ASP C CB    1 
ATOM 4266  C CG    . ASP C 3  60  ? 114.462 19.046   -3.335  1.00 0.00 ? 60   ASP C CG    1 
ATOM 4267  O OD1   . ASP C 3  60  ? 114.769 17.834   -3.509  1.00 0.00 ? 60   ASP C OD1   1 
ATOM 4268  O OD2   . ASP C 3  60  ? 113.736 19.706   -4.122  1.00 0.00 ? 60   ASP C OD2   1 
ATOM 4269  N N     . SER C 3  61  ? 115.753 16.983   -0.760  1.00 0.00 ? 61   SER C N     1 
ATOM 4270  C CA    . SER C 3  61  ? 116.863 16.101   -0.485  1.00 0.00 ? 61   SER C CA    1 
ATOM 4271  C C     . SER C 3  61  ? 118.059 16.509   -1.312  1.00 0.00 ? 61   SER C C     1 
ATOM 4272  O O     . SER C 3  61  ? 119.196 16.182   -0.978  1.00 0.00 ? 61   SER C O     1 
ATOM 4273  C CB    . SER C 3  61  ? 116.552 14.636   -0.860  1.00 0.00 ? 61   SER C CB    1 
ATOM 4274  O OG    . SER C 3  61  ? 115.426 14.156   -0.144  1.00 0.00 ? 61   SER C OG    1 
ATOM 4275  N N     . LEU C 3  62  ? 117.815 17.258   -2.414  1.00 0.00 ? 62   LEU C N     1 
ATOM 4276  C CA    . LEU C 3  62  ? 118.829 17.807   -3.278  1.00 0.00 ? 62   LEU C CA    1 
ATOM 4277  C C     . LEU C 3  62  ? 119.504 18.989   -2.636  1.00 0.00 ? 62   LEU C C     1 
ATOM 4278  O O     . LEU C 3  62  ? 120.706 19.167   -2.800  1.00 0.00 ? 62   LEU C O     1 
ATOM 4279  C CB    . LEU C 3  62  ? 118.245 18.264   -4.636  1.00 0.00 ? 62   LEU C CB    1 
ATOM 4280  C CG    . LEU C 3  62  ? 117.663 17.109   -5.487  1.00 0.00 ? 62   LEU C CG    1 
ATOM 4281  C CD1   . LEU C 3  62  ? 116.890 17.659   -6.700  1.00 0.00 ? 62   LEU C CD1   1 
ATOM 4282  C CD2   . LEU C 3  62  ? 118.739 16.100   -5.939  1.00 0.00 ? 62   LEU C CD2   1 
ATOM 4283  N N     . VAL C 3  63  ? 118.741 19.830   -1.895  1.00 0.00 ? 63   VAL C N     1 
ATOM 4284  C CA    . VAL C 3  63  ? 119.226 21.036   -1.258  1.00 0.00 ? 63   VAL C CA    1 
ATOM 4285  C C     . VAL C 3  63  ? 120.213 20.715   -0.165  1.00 0.00 ? 63   VAL C C     1 
ATOM 4286  O O     . VAL C 3  63  ? 121.241 21.380   -0.065  1.00 0.00 ? 63   VAL C O     1 
ATOM 4287  C CB    . VAL C 3  63  ? 118.081 21.896   -0.730  1.00 0.00 ? 63   VAL C CB    1 
ATOM 4288  C CG1   . VAL C 3  63  ? 118.570 23.019   0.215   1.00 0.00 ? 63   VAL C CG1   1 
ATOM 4289  C CG2   . VAL C 3  63  ? 117.343 22.500   -1.943  1.00 0.00 ? 63   VAL C CG2   1 
ATOM 4290  N N     . VAL C 3  64  ? 119.942 19.673   0.662   1.00 0.00 ? 64   VAL C N     1 
ATOM 4291  C CA    . VAL C 3  64  ? 120.830 19.238   1.723   1.00 0.00 ? 64   VAL C CA    1 
ATOM 4292  C C     . VAL C 3  64  ? 122.116 18.669   1.158   1.00 0.00 ? 64   VAL C C     1 
ATOM 4293  O O     . VAL C 3  64  ? 123.192 18.886   1.714   1.00 0.00 ? 64   VAL C O     1 
ATOM 4294  C CB    . VAL C 3  64  ? 120.153 18.297   2.721   1.00 0.00 ? 64   VAL C CB    1 
ATOM 4295  C CG1   . VAL C 3  64  ? 119.535 17.062   2.045   1.00 0.00 ? 64   VAL C CG1   1 
ATOM 4296  C CG2   . VAL C 3  64  ? 121.130 17.896   3.842   1.00 0.00 ? 64   VAL C CG2   1 
ATOM 4297  N N     . LEU C 3  65  ? 122.025 17.949   0.013   1.00 0.00 ? 65   LEU C N     1 
ATOM 4298  C CA    . LEU C 3  65  ? 123.137 17.362   -0.696  1.00 0.00 ? 65   LEU C CA    1 
ATOM 4299  C C     . LEU C 3  65  ? 124.070 18.423   -1.242  1.00 0.00 ? 65   LEU C C     1 
ATOM 4300  O O     . LEU C 3  65  ? 125.284 18.306   -1.092  1.00 0.00 ? 65   LEU C O     1 
ATOM 4301  C CB    . LEU C 3  65  ? 122.605 16.474   -1.850  1.00 0.00 ? 65   LEU C CB    1 
ATOM 4302  C CG    . LEU C 3  65  ? 123.647 15.850   -2.807  1.00 0.00 ? 65   LEU C CG    1 
ATOM 4303  C CD1   . LEU C 3  65  ? 124.670 14.951   -2.092  1.00 0.00 ? 65   LEU C CD1   1 
ATOM 4304  C CD2   . LEU C 3  65  ? 122.940 15.076   -3.936  1.00 0.00 ? 65   LEU C CD2   1 
ATOM 4305  N N     . PHE C 3  66  ? 123.510 19.496   -1.861  1.00 0.00 ? 66   PHE C N     1 
ATOM 4306  C CA    . PHE C 3  66  ? 124.246 20.606   -2.436  1.00 0.00 ? 66   PHE C CA    1 
ATOM 4307  C C     . PHE C 3  66  ? 124.924 21.438   -1.381  1.00 0.00 ? 66   PHE C C     1 
ATOM 4308  O O     . PHE C 3  66  ? 126.045 21.902   -1.585  1.00 0.00 ? 66   PHE C O     1 
ATOM 4309  C CB    . PHE C 3  66  ? 123.358 21.582   -3.259  1.00 0.00 ? 66   PHE C CB    1 
ATOM 4310  C CG    . PHE C 3  66  ? 122.941 21.006   -4.589  1.00 0.00 ? 66   PHE C CG    1 
ATOM 4311  C CD1   . PHE C 3  66  ? 123.895 20.499   -5.493  1.00 0.00 ? 66   PHE C CD1   1 
ATOM 4312  C CD2   . PHE C 3  66  ? 121.591 21.038   -4.985  1.00 0.00 ? 66   PHE C CD2   1 
ATOM 4313  C CE1   . PHE C 3  66  ? 123.503 19.999   -6.741  1.00 0.00 ? 66   PHE C CE1   1 
ATOM 4314  C CE2   . PHE C 3  66  ? 121.196 20.531   -6.229  1.00 0.00 ? 66   PHE C CE2   1 
ATOM 4315  C CZ    . PHE C 3  66  ? 122.152 20.007   -7.106  1.00 0.00 ? 66   PHE C CZ    1 
ATOM 4316  N N     . LEU C 3  67  ? 124.239 21.652   -0.232  1.00 0.00 ? 67   LEU C N     1 
ATOM 4317  C CA    . LEU C 3  67  ? 124.688 22.469   0.871   1.00 0.00 ? 67   LEU C CA    1 
ATOM 4318  C C     . LEU C 3  67  ? 125.925 21.879   1.479   1.00 0.00 ? 67   LEU C C     1 
ATOM 4319  O O     . LEU C 3  67  ? 126.883 22.597   1.759   1.00 0.00 ? 67   LEU C O     1 
ATOM 4320  C CB    . LEU C 3  67  ? 123.561 22.584   1.936   1.00 0.00 ? 67   LEU C CB    1 
ATOM 4321  C CG    . LEU C 3  67  ? 123.805 23.442   3.210   1.00 0.00 ? 67   LEU C CG    1 
ATOM 4322  C CD1   . LEU C 3  67  ? 124.526 22.685   4.348   1.00 0.00 ? 67   LEU C CD1   1 
ATOM 4323  C CD2   . LEU C 3  67  ? 124.448 24.813   2.922   1.00 0.00 ? 67   LEU C CD2   1 
ATOM 4324  N N     . SER C 3  68  ? 125.925 20.541   1.677   1.00 0.00 ? 68   SER C N     1 
ATOM 4325  C CA    . SER C 3  68  ? 126.984 19.840   2.348   1.00 0.00 ? 68   SER C CA    1 
ATOM 4326  C C     . SER C 3  68  ? 128.251 19.781   1.546   1.00 0.00 ? 68   SER C C     1 
ATOM 4327  O O     . SER C 3  68  ? 129.327 19.953   2.108   1.00 0.00 ? 68   SER C O     1 
ATOM 4328  C CB    . SER C 3  68  ? 126.585 18.403   2.720   1.00 0.00 ? 68   SER C CB    1 
ATOM 4329  O OG    . SER C 3  68  ? 127.492 17.862   3.674   1.00 0.00 ? 68   SER C OG    1 
ATOM 4330  N N     . VAL C 3  69  ? 128.162 19.522   0.217   1.00 0.00 ? 69   VAL C N     1 
ATOM 4331  C CA    . VAL C 3  69  ? 129.334 19.390   -0.623  1.00 0.00 ? 69   VAL C CA    1 
ATOM 4332  C C     . VAL C 3  69  ? 130.035 20.714   -0.770  1.00 0.00 ? 69   VAL C C     1 
ATOM 4333  O O     . VAL C 3  69  ? 131.262 20.756   -0.802  1.00 0.00 ? 69   VAL C O     1 
ATOM 4334  C CB    . VAL C 3  69  ? 129.096 18.730   -1.976  1.00 0.00 ? 69   VAL C CB    1 
ATOM 4335  C CG1   . VAL C 3  69  ? 128.659 17.271   -1.721  1.00 0.00 ? 69   VAL C CG1   1 
ATOM 4336  C CG2   . VAL C 3  69  ? 128.078 19.505   -2.837  1.00 0.00 ? 69   VAL C CG2   1 
ATOM 4337  N N     . GLY C 3  70  ? 129.264 21.829   -0.815  1.00 0.00 ? 70   GLY C N     1 
ATOM 4338  C CA    . GLY C 3  70  ? 129.800 23.165   -0.893  1.00 0.00 ? 70   GLY C CA    1 
ATOM 4339  C C     . GLY C 3  70  ? 130.420 23.603   0.407   1.00 0.00 ? 70   GLY C C     1 
ATOM 4340  O O     . GLY C 3  70  ? 131.334 24.424   0.404   1.00 0.00 ? 70   GLY C O     1 
ATOM 4341  N N     . PHE C 3  71  ? 129.936 23.050   1.550   1.00 0.00 ? 71   PHE C N     1 
ATOM 4342  C CA    . PHE C 3  71  ? 130.457 23.288   2.879   1.00 0.00 ? 71   PHE C CA    1 
ATOM 4343  C C     . PHE C 3  71  ? 131.807 22.625   3.035   1.00 0.00 ? 71   PHE C C     1 
ATOM 4344  O O     . PHE C 3  71  ? 132.711 23.194   3.640   1.00 0.00 ? 71   PHE C O     1 
ATOM 4345  C CB    . PHE C 3  71  ? 129.482 22.774   3.978   1.00 0.00 ? 71   PHE C CB    1 
ATOM 4346  C CG    . PHE C 3  71  ? 129.893 23.204   5.364   1.00 0.00 ? 71   PHE C CG    1 
ATOM 4347  C CD1   . PHE C 3  71  ? 129.654 24.517   5.804   1.00 0.00 ? 71   PHE C CD1   1 
ATOM 4348  C CD2   . PHE C 3  71  ? 130.539 22.302   6.228   1.00 0.00 ? 71   PHE C CD2   1 
ATOM 4349  C CE1   . PHE C 3  71  ? 130.062 24.925   7.080   1.00 0.00 ? 71   PHE C CE1   1 
ATOM 4350  C CE2   . PHE C 3  71  ? 130.955 22.711   7.500   1.00 0.00 ? 71   PHE C CE2   1 
ATOM 4351  C CZ    . PHE C 3  71  ? 130.716 24.022   7.926   1.00 0.00 ? 71   PHE C CZ    1 
ATOM 4352  N N     . ILE C 3  72  ? 131.959 21.396   2.482   1.00 0.00 ? 72   ILE C N     1 
ATOM 4353  C CA    . ILE C 3  72  ? 133.168 20.601   2.518   1.00 0.00 ? 72   ILE C CA    1 
ATOM 4354  C C     . ILE C 3  72  ? 134.264 21.292   1.739   1.00 0.00 ? 72   ILE C C     1 
ATOM 4355  O O     . ILE C 3  72  ? 135.404 21.352   2.200   1.00 0.00 ? 72   ILE C O     1 
ATOM 4356  C CB    . ILE C 3  72  ? 132.903 19.179   2.015   1.00 0.00 ? 72   ILE C CB    1 
ATOM 4357  C CG1   . ILE C 3  72  ? 132.086 18.409   3.086   1.00 0.00 ? 72   ILE C CG1   1 
ATOM 4358  C CG2   . ILE C 3  72  ? 134.214 18.438   1.672   1.00 0.00 ? 72   ILE C CG2   1 
ATOM 4359  C CD1   . ILE C 3  72  ? 131.514 17.075   2.596   1.00 0.00 ? 72   ILE C CD1   1 
ATOM 4360  N N     . PHE C 3  73  ? 133.925 21.859   0.552   1.00 0.00 ? 73   PHE C N     1 
ATOM 4361  C CA    . PHE C 3  73  ? 134.842 22.589   -0.296  1.00 0.00 ? 73   PHE C CA    1 
ATOM 4362  C C     . PHE C 3  73  ? 135.288 23.889   0.334   1.00 0.00 ? 73   PHE C C     1 
ATOM 4363  O O     . PHE C 3  73  ? 136.420 24.318   0.118   1.00 0.00 ? 73   PHE C O     1 
ATOM 4364  C CB    . PHE C 3  73  ? 134.255 22.904   -1.703  1.00 0.00 ? 73   PHE C CB    1 
ATOM 4365  C CG    . PHE C 3  73  ? 134.242 21.679   -2.589  1.00 0.00 ? 73   PHE C CG    1 
ATOM 4366  C CD1   . PHE C 3  73  ? 133.054 21.232   -3.199  1.00 0.00 ? 73   PHE C CD1   1 
ATOM 4367  C CD2   . PHE C 3  73  ? 135.439 20.992   -2.869  1.00 0.00 ? 73   PHE C CD2   1 
ATOM 4368  C CE1   . PHE C 3  73  ? 133.053 20.098   -4.021  1.00 0.00 ? 73   PHE C CE1   1 
ATOM 4369  C CE2   . PHE C 3  73  ? 135.442 19.865   -3.699  1.00 0.00 ? 73   PHE C CE2   1 
ATOM 4370  C CZ    . PHE C 3  73  ? 134.247 19.411   -4.268  1.00 0.00 ? 73   PHE C CZ    1 
ATOM 4371  N N     . SER C 3  74  ? 134.403 24.554   1.117   1.00 0.00 ? 74   SER C N     1 
ATOM 4372  C CA    . SER C 3  74  ? 134.700 25.801   1.787   1.00 0.00 ? 74   SER C CA    1 
ATOM 4373  C C     . SER C 3  74  ? 135.708 25.621   2.907   1.00 0.00 ? 74   SER C C     1 
ATOM 4374  O O     . SER C 3  74  ? 136.651 26.403   3.032   1.00 0.00 ? 74   SER C O     1 
ATOM 4375  C CB    . SER C 3  74  ? 133.402 26.428   2.368   1.00 0.00 ? 74   SER C CB    1 
ATOM 4376  O OG    . SER C 3  74  ? 133.605 27.750   2.854   1.00 0.00 ? 74   SER C OG    1 
ATOM 4377  N N     . VAL C 3  75  ? 135.504 24.579   3.749   1.00 0.00 ? 75   VAL C N     1 
ATOM 4378  C CA    . VAL C 3  75  ? 136.223 24.354   4.983   1.00 0.00 ? 75   VAL C CA    1 
ATOM 4379  C C     . VAL C 3  75  ? 137.656 23.915   4.763   1.00 0.00 ? 75   VAL C C     1 
ATOM 4380  O O     . VAL C 3  75  ? 138.537 24.334   5.514   1.00 0.00 ? 75   VAL C O     1 
ATOM 4381  C CB    . VAL C 3  75  ? 135.468 23.381   5.886   1.00 0.00 ? 75   VAL C CB    1 
ATOM 4382  C CG1   . VAL C 3  75  ? 136.346 22.847   7.038   1.00 0.00 ? 75   VAL C CG1   1 
ATOM 4383  C CG2   . VAL C 3  75  ? 134.231 24.114   6.449   1.00 0.00 ? 75   VAL C CG2   1 
ATOM 4384  N N     . ILE C 3  76  ? 137.917 23.060   3.740   1.00 0.00 ? 76   ILE C N     1 
ATOM 4385  C CA    . ILE C 3  76  ? 139.164 22.333   3.574   1.00 0.00 ? 76   ILE C CA    1 
ATOM 4386  C C     . ILE C 3  76  ? 140.371 23.239   3.463   1.00 0.00 ? 76   ILE C C     1 
ATOM 4387  O O     . ILE C 3  76  ? 141.391 22.983   4.102   1.00 0.00 ? 76   ILE C O     1 
ATOM 4388  C CB    . ILE C 3  76  ? 139.096 21.333   2.409   1.00 0.00 ? 76   ILE C CB    1 
ATOM 4389  C CG1   . ILE C 3  76  ? 140.372 20.462   2.212   1.00 0.00 ? 76   ILE C CG1   1 
ATOM 4390  C CG2   . ILE C 3  76  ? 138.610 21.994   1.098   1.00 0.00 ? 76   ILE C CG2   1 
ATOM 4391  C CD1   . ILE C 3  76  ? 141.481 21.026   1.311   1.00 0.00 ? 76   ILE C CD1   1 
ATOM 4392  N N     . ALA C 3  77  ? 140.269 24.332   2.667   1.00 0.00 ? 77   ALA C N     1 
ATOM 4393  C CA    . ALA C 3  77  ? 141.351 25.251   2.404   1.00 0.00 ? 77   ALA C CA    1 
ATOM 4394  C C     . ALA C 3  77  ? 141.691 26.110   3.588   1.00 0.00 ? 77   ALA C C     1 
ATOM 4395  O O     . ALA C 3  77  ? 142.862 26.383   3.850   1.00 0.00 ? 77   ALA C O     1 
ATOM 4396  C CB    . ALA C 3  77  ? 141.003 26.227   1.263   1.00 0.00 ? 77   ALA C CB    1 
ATOM 4397  N N     . LEU C 3  78  ? 140.646 26.587   4.298   1.00 0.00 ? 78   LEU C N     1 
ATOM 4398  C CA    . LEU C 3  78  ? 140.766 27.654   5.256   1.00 0.00 ? 78   LEU C CA    1 
ATOM 4399  C C     . LEU C 3  78  ? 141.324 27.118   6.585   1.00 0.00 ? 78   LEU C C     1 
ATOM 4400  O O     . LEU C 3  78  ? 140.838 26.057   7.061   1.00 0.00 ? 78   LEU C O     1 
ATOM 4401  C CB    . LEU C 3  78  ? 139.399 28.347   5.470   1.00 0.00 ? 78   LEU C CB    1 
ATOM 4402  C CG    . LEU C 3  78  ? 139.440 29.758   6.108   1.00 0.00 ? 78   LEU C CG    1 
ATOM 4403  C CD1   . LEU C 3  78  ? 140.256 30.783   5.289   1.00 0.00 ? 78   LEU C CD1   1 
ATOM 4404  C CD2   . LEU C 3  78  ? 138.003 30.271   6.330   1.00 0.00 ? 78   LEU C CD2   1 
ATOM 4405  P P     . A   D 4  1   ? 59.278  -38.299  35.191  1.00 0.00 ? 41   A   D P     1 
ATOM 4406  O OP1   . A   D 4  1   ? 60.612  -38.809  34.798  1.00 0.00 ? 41   A   D OP1   1 
ATOM 4407  O OP2   . A   D 4  1   ? 59.161  -37.031  35.945  1.00 0.00 ? 41   A   D OP2   1 
ATOM 4408  O "O5'" . A   D 4  1   ? 58.250  -38.347  33.991  1.00 0.00 ? 41   A   D "O5'" 1 
ATOM 4409  C "C5'" . A   D 4  1   ? 58.152  -39.552  33.220  1.00 0.00 ? 41   A   D "C5'" 1 
ATOM 4410  C "C4'" . A   D 4  1   ? 56.939  -39.480  32.287  1.00 0.00 ? 41   A   D "C4'" 1 
ATOM 4411  O "O4'" . A   D 4  1   ? 55.722  -39.428  33.069  1.00 0.00 ? 41   A   D "O4'" 1 
ATOM 4412  C "C3'" . A   D 4  1   ? 56.862  -38.243  31.377  1.00 0.00 ? 41   A   D "C3'" 1 
ATOM 4413  O "O3'" . A   D 4  1   ? 57.562  -38.509  30.156  1.00 0.00 ? 41   A   D "O3'" 1 
ATOM 4414  C "C2'" . A   D 4  1   ? 55.366  -38.054  31.194  1.00 0.00 ? 41   A   D "C2'" 1 
ATOM 4415  O "O2'" . A   D 4  1   ? 54.840  -38.934  30.227  1.00 0.00 ? 41   A   D "O2'" 1 
ATOM 4416  C "C1'" . A   D 4  1   ? 54.846  -38.440  32.556  1.00 0.00 ? 41   A   D "C1'" 1 
ATOM 4417  N N9    . A   D 4  1   ? 54.710  -37.287  33.478  1.00 0.00 ? 41   A   D N9    1 
ATOM 4418  C C8    . A   D 4  1   ? 55.271  -37.139  34.727  1.00 0.00 ? 41   A   D C8    1 
ATOM 4419  N N7    . A   D 4  1   ? 54.931  -36.034  35.326  1.00 0.00 ? 41   A   D N7    1 
ATOM 4420  C C5    . A   D 4  1   ? 54.082  -35.402  34.465  1.00 0.00 ? 41   A   D C5    1 
ATOM 4421  C C6    . A   D 4  1   ? 53.383  -34.194  34.616  1.00 0.00 ? 41   A   D C6    1 
ATOM 4422  N N6    . A   D 4  1   ? 53.505  -33.505  35.794  1.00 0.00 ? 41   A   D N6    1 
ATOM 4423  N N1    . A   D 4  1   ? 52.582  -33.848  33.554  1.00 0.00 ? 41   A   D N1    1 
ATOM 4424  C C2    . A   D 4  1   ? 52.537  -34.665  32.488  1.00 0.00 ? 41   A   D C2    1 
ATOM 4425  N N3    . A   D 4  1   ? 53.149  -35.839  32.268  1.00 0.00 ? 41   A   D N3    1 
ATOM 4426  C C4    . A   D 4  1   ? 53.928  -36.162  33.309  1.00 0.00 ? 41   A   D C4    1 
ATOM 4427  P P     . G   D 4  2   ? 58.892  -37.735  29.794  1.00 0.00 ? 42   G   D P     1 
ATOM 4428  O OP1   . G   D 4  2   ? 59.484  -38.365  28.593  1.00 0.00 ? 42   G   D OP1   1 
ATOM 4429  O OP2   . G   D 4  2   ? 59.745  -37.634  31.000  1.00 0.00 ? 42   G   D OP2   1 
ATOM 4430  O "O5'" . G   D 4  2   ? 58.376  -36.291  29.419  1.00 0.00 ? 42   G   D "O5'" 1 
ATOM 4431  C "C5'" . G   D 4  2   ? 57.355  -36.113  28.424  1.00 0.00 ? 42   G   D "C5'" 1 
ATOM 4432  C "C4'" . G   D 4  2   ? 56.551  -34.845  28.723  1.00 0.00 ? 42   G   D "C4'" 1 
ATOM 4433  O "O4'" . G   D 4  2   ? 56.140  -34.803  30.115  1.00 0.00 ? 42   G   D "O4'" 1 
ATOM 4434  C "C3'" . G   D 4  2   ? 57.296  -33.525  28.526  1.00 0.00 ? 42   G   D "C3'" 1 
ATOM 4435  O "O3'" . G   D 4  2   ? 57.309  -33.183  27.139  1.00 0.00 ? 42   G   D "O3'" 1 
ATOM 4436  C "C2'" . G   D 4  2   ? 56.479  -32.589  29.400  1.00 0.00 ? 42   G   D "C2'" 1 
ATOM 4437  O "O2'" . G   D 4  2   ? 55.270  -32.214  28.783  1.00 0.00 ? 42   G   D "O2'" 1 
ATOM 4438  C "C1'" . G   D 4  2   ? 56.180  -33.471  30.589  1.00 0.00 ? 42   G   D "C1'" 1 
ATOM 4439  N N9    . G   D 4  2   ? 57.177  -33.274  31.668  1.00 0.00 ? 42   G   D N9    1 
ATOM 4440  C C8    . G   D 4  2   ? 58.201  -34.106  32.083  1.00 0.00 ? 42   G   D C8    1 
ATOM 4441  N N7    . G   D 4  2   ? 58.917  -33.594  33.048  1.00 0.00 ? 42   G   D N7    1 
ATOM 4442  C C5    . G   D 4  2   ? 58.351  -32.364  33.287  1.00 0.00 ? 42   G   D C5    1 
ATOM 4443  C C6    . G   D 4  2   ? 58.768  -31.363  34.189  1.00 0.00 ? 42   G   D C6    1 
ATOM 4444  O O6    . G   D 4  2   ? 59.720  -31.471  34.967  1.00 0.00 ? 42   G   D O6    1 
ATOM 4445  N N1    . G   D 4  2   ? 57.940  -30.221  34.074  1.00 0.00 ? 42   G   D N1    1 
ATOM 4446  C C2    . G   D 4  2   ? 56.851  -30.073  33.197  1.00 0.00 ? 42   G   D C2    1 
ATOM 4447  N N2    . G   D 4  2   ? 56.209  -28.872  33.239  1.00 0.00 ? 42   G   D N2    1 
ATOM 4448  N N3    . G   D 4  2   ? 56.476  -31.065  32.359  1.00 0.00 ? 42   G   D N3    1 
ATOM 4449  C C4    . G   D 4  2   ? 57.269  -32.148  32.447  1.00 0.00 ? 42   G   D C4    1 
ATOM 4450  P P     . A   D 4  3   ? 58.500  -32.320  26.547  1.00 0.00 ? 43   A   D P     1 
ATOM 4451  O OP1   . A   D 4  3   ? 58.252  -32.109  25.102  1.00 0.00 ? 43   A   D OP1   1 
ATOM 4452  O OP2   . A   D 4  3   ? 59.781  -32.960  26.921  1.00 0.00 ? 43   A   D OP2   1 
ATOM 4453  O "O5'" . A   D 4  3   ? 58.389  -30.928  27.305  1.00 0.00 ? 43   A   D "O5'" 1 
ATOM 4454  C "C5'" . A   D 4  3   ? 57.411  -29.985  26.846  1.00 0.00 ? 43   A   D "C5'" 1 
ATOM 4455  C "C4'" . A   D 4  3   ? 57.352  -28.760  27.770  1.00 0.00 ? 43   A   D "C4'" 1 
ATOM 4456  O "O4'" . A   D 4  3   ? 57.203  -29.153  29.158  1.00 0.00 ? 43   A   D "O4'" 1 
ATOM 4457  C "C3'" . A   D 4  3   ? 58.599  -27.872  27.797  1.00 0.00 ? 43   A   D "C3'" 1 
ATOM 4458  O "O3'" . A   D 4  3   ? 58.638  -27.050  26.630  1.00 0.00 ? 43   A   D "O3'" 1 
ATOM 4459  C "C2'" . A   D 4  3   ? 58.367  -27.118  29.097  1.00 0.00 ? 43   A   D "C2'" 1 
ATOM 4460  O "O2'" . A   D 4  3   ? 57.356  -26.144  28.975  1.00 0.00 ? 43   A   D "O2'" 1 
ATOM 4461  C "C1'" . A   D 4  3   ? 57.864  -28.217  29.991  1.00 0.00 ? 43   A   D "C1'" 1 
ATOM 4462  N N9    . A   D 4  3   ? 58.967  -28.820  30.761  1.00 0.00 ? 43   A   D N9    1 
ATOM 4463  C C8    . A   D 4  3   ? 59.562  -30.051  30.623  1.00 0.00 ? 43   A   D C8    1 
ATOM 4464  N N7    . A   D 4  3   ? 60.532  -30.252  31.474  1.00 0.00 ? 43   A   D N7    1 
ATOM 4465  C C5    . A   D 4  3   ? 60.610  -29.107  32.216  1.00 0.00 ? 43   A   D C5    1 
ATOM 4466  C C6    . A   D 4  3   ? 61.466  -28.767  33.279  1.00 0.00 ? 43   A   D C6    1 
ATOM 4467  N N6    . A   D 4  3   ? 62.408  -29.661  33.708  1.00 0.00 ? 43   A   D N6    1 
ATOM 4468  N N1    . A   D 4  3   ? 61.288  -27.502  33.783  1.00 0.00 ? 43   A   D N1    1 
ATOM 4469  C C2    . A   D 4  3   ? 60.328  -26.724  33.258  1.00 0.00 ? 43   A   D C2    1 
ATOM 4470  N N3    . A   D 4  3   ? 59.452  -26.973  32.275  1.00 0.00 ? 43   A   D N3    1 
ATOM 4471  C C4    . A   D 4  3   ? 59.645  -28.201  31.783  1.00 0.00 ? 43   A   D C4    1 
ATOM 4472  P P     . A   D 4  4   ? 59.983  -26.284  26.263  1.00 0.00 ? 44   A   D P     1 
ATOM 4473  O OP1   . A   D 4  4   ? 59.829  -25.694  24.913  1.00 0.00 ? 44   A   D OP1   1 
ATOM 4474  O OP2   . A   D 4  4   ? 61.124  -27.204  26.468  1.00 0.00 ? 44   A   D OP2   1 
ATOM 4475  O "O5'" . A   D 4  4   ? 60.096  -25.110  27.324  1.00 0.00 ? 44   A   D "O5'" 1 
ATOM 4476  C "C5'" . A   D 4  4   ? 59.240  -23.964  27.185  1.00 0.00 ? 44   A   D "C5'" 1 
ATOM 4477  C "C4'" . A   D 4  4   ? 59.399  -23.012  28.379  1.00 0.00 ? 44   A   D "C4'" 1 
ATOM 4478  O "O4'" . A   D 4  4   ? 59.309  -23.731  29.638  1.00 0.00 ? 44   A   D "O4'" 1 
ATOM 4479  C "C3'" . A   D 4  4   ? 60.733  -22.265  28.486  1.00 0.00 ? 44   A   D "C3'" 1 
ATOM 4480  O "O3'" . A   D 4  4   ? 60.726  -21.122  27.626  1.00 0.00 ? 44   A   D "O3'" 1 
ATOM 4481  C "C2'" . A   D 4  4   ? 60.762  -21.907  29.958  1.00 0.00 ? 44   A   D "C2'" 1 
ATOM 4482  O "O2'" . A   D 4  4   ? 59.909  -20.826  30.252  1.00 0.00 ? 44   A   D "O2'" 1 
ATOM 4483  C "C1'" . A   D 4  4   ? 60.214  -23.166  30.577  1.00 0.00 ? 44   A   D "C1'" 1 
ATOM 4484  N N9    . A   D 4  4   ? 61.302  -24.095  30.952  1.00 0.00 ? 44   A   D N9    1 
ATOM 4485  C C8    . A   D 4  4   ? 61.648  -25.292  30.373  1.00 0.00 ? 44   A   D C8    1 
ATOM 4486  N N7    . A   D 4  4   ? 62.660  -25.877  30.949  1.00 0.00 ? 44   A   D N7    1 
ATOM 4487  C C5    . A   D 4  4   ? 63.028  -25.039  31.965  1.00 0.00 ? 44   A   D C5    1 
ATOM 4488  C C6    . A   D 4  4   ? 64.042  -25.174  32.926  1.00 0.00 ? 44   A   D C6    1 
ATOM 4489  N N6    . A   D 4  4   ? 64.782  -26.323  32.950  1.00 0.00 ? 44   A   D N6    1 
ATOM 4490  N N1    . A   D 4  4   ? 64.186  -24.108  33.781  1.00 0.00 ? 44   A   D N1    1 
ATOM 4491  C C2    . A   D 4  4   ? 63.347  -23.066  33.655  1.00 0.00 ? 44   A   D C2    1 
ATOM 4492  N N3    . A   D 4  4   ? 62.311  -22.885  32.820  1.00 0.00 ? 44   A   D N3    1 
ATOM 4493  C C4    . A   D 4  4   ? 62.202  -23.921  31.978  1.00 0.00 ? 44   A   D C4    1 
ATOM 4494  P P     . C   D 4  5   ? 61.942  -20.838  26.652  1.00 0.00 ? 45   C   D P     1 
ATOM 4495  O OP1   . C   D 4  5   ? 61.631  -19.633  25.848  1.00 0.00 ? 45   C   D OP1   1 
ATOM 4496  O OP2   . C   D 4  5   ? 62.271  -22.080  25.915  1.00 0.00 ? 45   C   D OP2   1 
ATOM 4497  O "O5'" . C   D 4  5   ? 63.130  -20.504  27.650  1.00 0.00 ? 45   C   D "O5'" 1 
ATOM 4498  C "C5'" . C   D 4  5   ? 63.121  -19.247  28.344  1.00 0.00 ? 45   C   D "C5'" 1 
ATOM 4499  C "C4'" . C   D 4  5   ? 64.115  -19.270  29.512  1.00 0.00 ? 45   C   D "C4'" 1 
ATOM 4500  O "O4'" . C   D 4  5   ? 63.843  -20.391  30.395  1.00 0.00 ? 45   C   D "O4'" 1 
ATOM 4501  C "C3'" . C   D 4  5   ? 65.595  -19.440  29.166  1.00 0.00 ? 45   C   D "C3'" 1 
ATOM 4502  O "O3'" . C   D 4  5   ? 66.137  -18.204  28.682  1.00 0.00 ? 45   C   D "O3'" 1 
ATOM 4503  C "C2'" . C   D 4  5   ? 66.127  -19.905  30.520  1.00 0.00 ? 45   C   D "C2'" 1 
ATOM 4504  O "O2'" . C   D 4  5   ? 66.241  -18.848  31.443  1.00 0.00 ? 45   C   D "O2'" 1 
ATOM 4505  C "C1'" . C   D 4  5   ? 65.053  -20.849  30.973  1.00 0.00 ? 45   C   D "C1'" 1 
ATOM 4506  N N1    . C   D 4  5   ? 65.415  -22.265  30.641  1.00 0.00 ? 45   C   D N1    1 
ATOM 4507  C C2    . C   D 4  5   ? 66.361  -22.940  31.421  1.00 0.00 ? 45   C   D C2    1 
ATOM 4508  O O2    . C   D 4  5   ? 66.853  -22.361  32.408  1.00 0.00 ? 45   C   D O2    1 
ATOM 4509  N N3    . C   D 4  5   ? 66.711  -24.213  31.075  1.00 0.00 ? 45   C   D N3    1 
ATOM 4510  C C4    . C   D 4  5   ? 66.183  -24.822  29.973  1.00 0.00 ? 45   C   D C4    1 
ATOM 4511  N N4    . C   D 4  5   ? 66.535  -26.092  29.601  1.00 0.00 ? 45   C   D N4    1 
ATOM 4512  C C5    . C   D 4  5   ? 65.230  -24.119  29.165  1.00 0.00 ? 45   C   D C5    1 
ATOM 4513  C C6    . C   D 4  5   ? 64.896  -22.869  29.515  1.00 0.00 ? 45   C   D C6    1 
ATOM 4514  P P     . G   D 4  6   ? 67.632  -18.193  28.134  1.00 0.00 ? 46   G   D P     1 
ATOM 4515  O OP1   . G   D 4  6   ? 67.881  -16.901  27.458  1.00 0.00 ? 46   G   D OP1   1 
ATOM 4516  O OP2   . G   D 4  6   ? 67.872  -19.424  27.344  1.00 0.00 ? 46   G   D OP2   1 
ATOM 4517  O "O5'" . G   D 4  6   ? 68.482  -18.230  29.467  1.00 0.00 ? 46   G   D "O5'" 1 
ATOM 4518  C "C5'" . G   D 4  6   ? 69.819  -18.738  29.454  1.00 0.00 ? 46   G   D "C5'" 1 
ATOM 4519  C "C4'" . G   D 4  6   ? 70.250  -19.054  30.892  1.00 0.00 ? 46   G   D "C4'" 1 
ATOM 4520  O "O4'" . G   D 4  6   ? 69.320  -19.995  31.493  1.00 0.00 ? 46   G   D "O4'" 1 
ATOM 4521  C "C3'" . G   D 4  6   ? 71.602  -19.783  30.947  1.00 0.00 ? 46   G   D "C3'" 1 
ATOM 4522  O "O3'" . G   D 4  6   ? 72.647  -18.850  31.225  1.00 0.00 ? 46   G   D "O3'" 1 
ATOM 4523  C "C2'" . G   D 4  6   ? 71.408  -20.812  32.039  1.00 0.00 ? 46   G   D "C2'" 1 
ATOM 4524  O "O2'" . G   D 4  6   ? 71.537  -20.241  33.324  1.00 0.00 ? 46   G   D "O2'" 1 
ATOM 4525  C "C1'" . G   D 4  6   ? 69.979  -21.198  31.806  1.00 0.00 ? 46   G   D "C1'" 1 
ATOM 4526  N N9    . G   D 4  6   ? 69.819  -22.227  30.735  1.00 0.00 ? 46   G   D N9    1 
ATOM 4527  C C8    . G   D 4  6   ? 69.093  -22.104  29.562  1.00 0.00 ? 46   G   D C8    1 
ATOM 4528  N N7    . G   D 4  6   ? 69.112  -23.176  28.827  1.00 0.00 ? 46   G   D N7    1 
ATOM 4529  C C5    . G   D 4  6   ? 69.874  -24.067  29.531  1.00 0.00 ? 46   G   D C5    1 
ATOM 4530  C C6    . G   D 4  6   ? 70.160  -25.403  29.206  1.00 0.00 ? 46   G   D C6    1 
ATOM 4531  O O6    . G   D 4  6   ? 69.751  -25.969  28.189  1.00 0.00 ? 46   G   D O6    1 
ATOM 4532  N N1    . G   D 4  6   ? 70.985  -25.984  30.195  1.00 0.00 ? 46   G   D N1    1 
ATOM 4533  C C2    . G   D 4  6   ? 71.439  -25.351  31.364  1.00 0.00 ? 46   G   D C2    1 
ATOM 4534  N N2    . G   D 4  6   ? 72.217  -26.115  32.174  1.00 0.00 ? 46   G   D N2    1 
ATOM 4535  N N3    . G   D 4  6   ? 71.115  -24.067  31.656  1.00 0.00 ? 46   G   D N3    1 
ATOM 4536  C C4    . G   D 4  6   ? 70.345  -23.502  30.709  1.00 0.00 ? 46   G   D C4    1 
ATOM 4537  P P     . C   D 4  7   ? 73.884  -18.700  30.260  1.00 0.00 ? 47   C   D P     1 
ATOM 4538  O OP1   . C   D 4  7   ? 74.457  -17.344  30.421  1.00 0.00 ? 47   C   D OP1   1 
ATOM 4539  O OP2   . C   D 4  7   ? 73.496  -19.124  28.899  1.00 0.00 ? 47   C   D OP2   1 
ATOM 4540  O "O5'" . C   D 4  7   ? 74.912  -19.750  30.799  1.00 0.00 ? 47   C   D "O5'" 1 
ATOM 4541  C "C5'" . C   D 4  7   ? 75.164  -20.031  32.168  1.00 0.00 ? 47   C   D "C5'" 1 
ATOM 4542  C "C4'" . C   D 4  7   ? 75.619  -21.489  32.269  1.00 0.00 ? 47   C   D "C4'" 1 
ATOM 4543  O "O4'" . C   D 4  7   ? 74.550  -22.389  31.886  1.00 0.00 ? 47   C   D "O4'" 1 
ATOM 4544  C "C3'" . C   D 4  7   ? 76.780  -21.894  31.368  1.00 0.00 ? 47   C   D "C3'" 1 
ATOM 4545  O "O3'" . C   D 4  7   ? 78.004  -21.487  31.984  1.00 0.00 ? 47   C   D "O3'" 1 
ATOM 4546  C "C2'" . C   D 4  7   ? 76.597  -23.402  31.271  1.00 0.00 ? 47   C   D "C2'" 1 
ATOM 4547  O "O2'" . C   D 4  7   ? 77.138  -24.062  32.394  1.00 0.00 ? 47   C   D "O2'" 1 
ATOM 4548  C "C1'" . C   D 4  7   ? 75.087  -23.539  31.256  1.00 0.00 ? 47   C   D "C1'" 1 
ATOM 4549  N N1    . C   D 4  7   ? 74.543  -23.778  29.879  1.00 0.00 ? 47   C   D N1    1 
ATOM 4550  C C2    . C   D 4  7   ? 74.418  -25.075  29.382  1.00 0.00 ? 47   C   D C2    1 
ATOM 4551  O O2    . C   D 4  7   ? 74.728  -26.026  30.123  1.00 0.00 ? 47   C   D O2    1 
ATOM 4552  N N3    . C   D 4  7   ? 73.942  -25.259  28.111  1.00 0.00 ? 47   C   D N3    1 
ATOM 4553  C C4    . C   D 4  7   ? 73.557  -24.199  27.338  1.00 0.00 ? 47   C   D C4    1 
ATOM 4554  N N4    . C   D 4  7   ? 73.044  -24.364  26.081  1.00 0.00 ? 47   C   D N4    1 
ATOM 4555  C C5    . C   D 4  7   ? 73.684  -22.865  27.855  1.00 0.00 ? 47   C   D C5    1 
ATOM 4556  C C6    . C   D 4  7   ? 74.183  -22.707  29.088  1.00 0.00 ? 47   C   D C6    1 
ATOM 4557  P P     . A   D 4  8   ? 78.912  -20.374  31.320  1.00 0.00 ? 48   A   D P     1 
ATOM 4558  O OP1   . A   D 4  8   ? 79.861  -19.868  32.335  1.00 0.00 ? 48   A   D OP1   1 
ATOM 4559  O OP2   . A   D 4  8   ? 78.067  -19.372  30.630  1.00 0.00 ? 48   A   D OP2   1 
ATOM 4560  O "O5'" . A   D 4  8   ? 79.702  -21.196  30.229  1.00 0.00 ? 48   A   D "O5'" 1 
ATOM 4561  C "C5'" . A   D 4  8   ? 80.439  -22.362  30.636  1.00 0.00 ? 48   A   D "C5'" 1 
ATOM 4562  C "C4'" . A   D 4  8   ? 80.843  -23.190  29.418  1.00 0.00 ? 48   A   D "C4'" 1 
ATOM 4563  O "O4'" . A   D 4  8   ? 79.694  -23.407  28.568  1.00 0.00 ? 48   A   D "O4'" 1 
ATOM 4564  C "C3'" . A   D 4  8   ? 81.887  -22.509  28.526  1.00 0.00 ? 48   A   D "C3'" 1 
ATOM 4565  O "O3'" . A   D 4  8   ? 83.150  -23.178  28.639  1.00 0.00 ? 48   A   D "O3'" 1 
ATOM 4566  C "C2'" . A   D 4  8   ? 81.265  -22.472  27.120  1.00 0.00 ? 48   A   D "C2'" 1 
ATOM 4567  O "O2'" . A   D 4  8   ? 82.142  -22.902  26.107  1.00 0.00 ? 48   A   D "O2'" 1 
ATOM 4568  C "C1'" . A   D 4  8   ? 80.099  -23.410  27.229  1.00 0.00 ? 48   A   D "C1'" 1 
ATOM 4569  N N9    . A   D 4  8   ? 78.987  -23.028  26.336  1.00 0.00 ? 48   A   D N9    1 
ATOM 4570  C C8    . A   D 4  8   ? 78.497  -21.782  26.015  1.00 0.00 ? 48   A   D C8    1 
ATOM 4571  N N7    . A   D 4  8   ? 77.482  -21.817  25.191  1.00 0.00 ? 48   A   D N7    1 
ATOM 4572  C C5    . A   D 4  8   ? 77.272  -23.145  24.940  1.00 0.00 ? 48   A   D C5    1 
ATOM 4573  C C6    . A   D 4  8   ? 76.348  -23.781  24.090  1.00 0.00 ? 48   A   D C6    1 
ATOM 4574  N N6    . A   D 4  8   ? 75.405  -23.031  23.441  1.00 0.00 ? 48   A   D N6    1 
ATOM 4575  N N1    . A   D 4  8   ? 76.498  -25.143  23.989  1.00 0.00 ? 48   A   D N1    1 
ATOM 4576  C C2    . A   D 4  8   ? 77.457  -25.732  24.721  1.00 0.00 ? 48   A   D C2    1 
ATOM 4577  N N3    . A   D 4  8   ? 78.309  -25.233  25.619  1.00 0.00 ? 48   A   D N3    1 
ATOM 4578  C C4    . A   D 4  8   ? 78.193  -23.907  25.656  1.00 0.00 ? 48   A   D C4    1 
ATOM 4579  P P     . G   D 4  9   ? 84.359  -22.507  29.421  1.00 0.00 ? 49   G   D P     1 
ATOM 4580  O OP1   . G   D 4  9   ? 85.221  -23.579  29.966  1.00 0.00 ? 49   G   D OP1   1 
ATOM 4581  O OP2   . G   D 4  9   ? 83.852  -21.499  30.383  1.00 0.00 ? 49   G   D OP2   1 
ATOM 4582  O "O5'" . G   D 4  9   ? 85.136  -21.783  28.249  1.00 0.00 ? 49   G   D "O5'" 1 
ATOM 4583  C "C5'" . G   D 4  9   ? 85.117  -20.355  28.116  1.00 0.00 ? 49   G   D "C5'" 1 
ATOM 4584  C "C4'" . G   D 4  9   ? 85.562  -19.915  26.705  1.00 0.00 ? 49   G   D "C4'" 1 
ATOM 4585  O "O4'" . G   D 4  9   ? 86.645  -20.749  26.213  1.00 0.00 ? 49   G   D "O4'" 1 
ATOM 4586  C "C3'" . G   D 4  9   ? 84.472  -20.013  25.628  1.00 0.00 ? 49   G   D "C3'" 1 
ATOM 4587  O "O3'" . G   D 4  9   ? 83.701  -18.811  25.644  1.00 0.00 ? 49   G   D "O3'" 1 
ATOM 4588  C "C2'" . G   D 4  9   ? 85.293  -20.234  24.361  1.00 0.00 ? 49   G   D "C2'" 1 
ATOM 4589  O "O2'" . G   D 4  9   ? 85.803  -19.018  23.873  1.00 0.00 ? 49   G   D "O2'" 1 
ATOM 4590  C "C1'" . G   D 4  9   ? 86.432  -21.074  24.857  1.00 0.00 ? 49   G   D "C1'" 1 
ATOM 4591  N N9    . G   D 4  9   ? 86.210  -22.521  24.653  1.00 0.00 ? 49   G   D N9    1 
ATOM 4592  C C8    . G   D 4  9   ? 85.366  -23.337  25.370  1.00 0.00 ? 49   G   D C8    1 
ATOM 4593  N N7    . G   D 4  9   ? 85.406  -24.583  24.996  1.00 0.00 ? 49   G   D N7    1 
ATOM 4594  C C5    . G   D 4  9   ? 86.302  -24.604  23.965  1.00 0.00 ? 49   G   D C5    1 
ATOM 4595  C C6    . G   D 4  9   ? 86.744  -25.713  23.233  1.00 0.00 ? 49   G   D C6    1 
ATOM 4596  O O6    . G   D 4  9   ? 86.388  -26.875  23.440  1.00 0.00 ? 49   G   D O6    1 
ATOM 4597  N N1    . G   D 4  9   ? 87.642  -25.306  22.228  1.00 0.00 ? 49   G   D N1    1 
ATOM 4598  C C2    . G   D 4  9   ? 88.023  -23.993  21.939  1.00 0.00 ? 49   G   D C2    1 
ATOM 4599  N N2    . G   D 4  9   ? 88.765  -23.858  20.804  1.00 0.00 ? 49   G   D N2    1 
ATOM 4600  N N3    . G   D 4  9   ? 87.647  -22.949  22.730  1.00 0.00 ? 49   G   D N3    1 
ATOM 4601  C C4    . G   D 4  9   ? 86.788  -23.331  23.699  1.00 0.00 ? 49   G   D C4    1 
ATOM 4602  P P     . C   D 4  10  ? 82.314  -18.626  24.905  1.00 0.00 ? 50   C   D P     1 
ATOM 4603  O OP1   . C   D 4  10  ? 82.055  -17.173  24.770  1.00 0.00 ? 50   C   D OP1   1 
ATOM 4604  O OP2   . C   D 4  10  ? 81.293  -19.419  25.621  1.00 0.00 ? 50   C   D OP2   1 
ATOM 4605  O "O5'" . C   D 4  10  ? 82.514  -19.262  23.470  1.00 0.00 ? 50   C   D "O5'" 1 
ATOM 4606  C "C5'" . C   D 4  10  ? 82.891  -18.424  22.366  1.00 0.00 ? 50   C   D "C5'" 1 
ATOM 4607  C "C4'" . C   D 4  10  ? 82.859  -19.239  21.070  1.00 0.00 ? 50   C   D "C4'" 1 
ATOM 4608  O "O4'" . C   D 4  10  ? 83.735  -20.386  21.139  1.00 0.00 ? 50   C   D "O4'" 1 
ATOM 4609  C "C3'" . C   D 4  10  ? 81.512  -19.843  20.725  1.00 0.00 ? 50   C   D "C3'" 1 
ATOM 4610  O "O3'" . C   D 4  10  ? 80.731  -18.878  20.051  1.00 0.00 ? 50   C   D "O3'" 1 
ATOM 4611  C "C2'" . C   D 4  10  ? 81.839  -21.068  19.869  1.00 0.00 ? 50   C   D "C2'" 1 
ATOM 4612  O "O2'" . C   D 4  10  ? 81.742  -20.823  18.490  1.00 0.00 ? 50   C   D "O2'" 1 
ATOM 4613  C "C1'" . C   D 4  10  ? 83.271  -21.384  20.245  1.00 0.00 ? 50   C   D "C1'" 1 
ATOM 4614  N N1    . C   D 4  10  ? 83.355  -22.768  20.760  1.00 0.00 ? 50   C   D N1    1 
ATOM 4615  C C2    . C   D 4  10  ? 83.393  -23.833  19.860  1.00 0.00 ? 50   C   D C2    1 
ATOM 4616  O O2    . C   D 4  10  ? 83.424  -23.591  18.632  1.00 0.00 ? 50   C   D O2    1 
ATOM 4617  N N3    . C   D 4  10  ? 83.389  -25.103  20.356  1.00 0.00 ? 50   C   D N3    1 
ATOM 4618  C C4    . C   D 4  10  ? 83.294  -25.340  21.695  1.00 0.00 ? 50   C   D C4    1 
ATOM 4619  N N4    . C   D 4  10  ? 83.267  -26.609  22.192  1.00 0.00 ? 50   C   D N4    1 
ATOM 4620  C C5    . C   D 4  10  ? 83.217  -24.233  22.605  1.00 0.00 ? 50   C   D C5    1 
ATOM 4621  C C6    . C   D 4  10  ? 83.213  -22.996  22.109  1.00 0.00 ? 50   C   D C6    1 
ATOM 4622  P P     . G   D 4  11  ? 79.477  -18.132  20.614  1.00 0.00 ? 51   G   D P     1 
ATOM 4623  O OP1   . G   D 4  11  ? 79.760  -16.680  20.585  1.00 0.00 ? 51   G   D OP1   1 
ATOM 4624  O OP2   . G   D 4  11  ? 79.067  -18.716  21.912  1.00 0.00 ? 51   G   D OP2   1 
ATOM 4625  O "O5'" . G   D 4  11  ? 78.364  -18.440  19.540  1.00 0.00 ? 51   G   D "O5'" 1 
ATOM 4626  C "C5'" . G   D 4  11  ? 78.559  -19.077  18.274  1.00 0.00 ? 51   G   D "C5'" 1 
ATOM 4627  C "C4'" . G   D 4  11  ? 77.839  -20.430  18.231  1.00 0.00 ? 51   G   D "C4'" 1 
ATOM 4628  O "O4'" . G   D 4  11  ? 78.603  -21.460  18.912  1.00 0.00 ? 51   G   D "O4'" 1 
ATOM 4629  C "C3'" . G   D 4  11  ? 76.448  -20.455  18.891  1.00 0.00 ? 51   G   D "C3'" 1 
ATOM 4630  O "O3'" . G   D 4  11  ? 75.464  -20.958  17.968  1.00 0.00 ? 51   G   D "O3'" 1 
ATOM 4631  C "C2'" . G   D 4  11  ? 76.656  -21.321  20.144  1.00 0.00 ? 51   G   D "C2'" 1 
ATOM 4632  O "O2'" . G   D 4  11  ? 75.497  -22.024  20.506  1.00 0.00 ? 51   G   D "O2'" 1 
ATOM 4633  C "C1'" . G   D 4  11  ? 77.749  -22.253  19.709  1.00 0.00 ? 51   G   D "C1'" 1 
ATOM 4634  N N9    . G   D 4  11  ? 78.491  -22.857  20.850  1.00 0.00 ? 51   G   D N9    1 
ATOM 4635  C C8    . G   D 4  11  ? 79.131  -22.165  21.860  1.00 0.00 ? 51   G   D C8    1 
ATOM 4636  N N7    . G   D 4  11  ? 79.756  -22.940  22.702  1.00 0.00 ? 51   G   D N7    1 
ATOM 4637  C C5    . G   D 4  11  ? 79.508  -24.214  22.254  1.00 0.00 ? 51   G   D C5    1 
ATOM 4638  C C6    . G   D 4  11  ? 79.979  -25.435  22.784  1.00 0.00 ? 51   G   D C6    1 
ATOM 4639  O O6    . G   D 4  11  ? 80.716  -25.535  23.770  1.00 0.00 ? 51   G   D O6    1 
ATOM 4640  N N1    . G   D 4  11  ? 79.472  -26.526  22.043  1.00 0.00 ? 51   G   D N1    1 
ATOM 4641  C C2    . G   D 4  11  ? 78.626  -26.441  20.928  1.00 0.00 ? 51   G   D C2    1 
ATOM 4642  N N2    . G   D 4  11  ? 78.253  -27.643  20.403  1.00 0.00 ? 51   G   D N2    1 
ATOM 4643  N N3    . G   D 4  11  ? 78.224  -25.241  20.422  1.00 0.00 ? 51   G   D N3    1 
ATOM 4644  C C4    . G   D 4  11  ? 78.699  -24.194  21.125  1.00 0.00 ? 51   G   D C4    1 
ATOM 4645  P P     . A   D 4  12  ? 74.801  -19.878  16.998  1.00 0.00 ? 52   A   D P     1 
ATOM 4646  O OP1   . A   D 4  12  ? 75.855  -19.244  16.176  1.00 0.00 ? 52   A   D OP1   1 
ATOM 4647  O OP2   . A   D 4  12  ? 73.939  -18.984  17.804  1.00 0.00 ? 52   A   D OP2   1 
ATOM 4648  O "O5'" . A   D 4  12  ? 73.899  -20.772  16.050  1.00 0.00 ? 52   A   D "O5'" 1 
ATOM 4649  C "C5'" . A   D 4  12  ? 73.449  -20.249  14.786  1.00 0.00 ? 52   A   D "C5'" 1 
ATOM 4650  C "C4'" . A   D 4  12  ? 73.693  -21.258  13.656  1.00 0.00 ? 52   A   D "C4'" 1 
ATOM 4651  O "O4'" . A   D 4  12  ? 75.095  -21.610  13.585  1.00 0.00 ? 52   A   D "O4'" 1 
ATOM 4652  C "C3'" . A   D 4  12  ? 72.971  -22.602  13.793  1.00 0.00 ? 52   A   D "C3'" 1 
ATOM 4653  O "O3'" . A   D 4  12  ? 71.652  -22.492  13.245  1.00 0.00 ? 52   A   D "O3'" 1 
ATOM 4654  C "C2'" . A   D 4  12  ? 73.873  -23.551  13.023  1.00 0.00 ? 52   A   D "C2'" 1 
ATOM 4655  O "O2'" . A   D 4  12  ? 73.647  -23.479  11.635  1.00 0.00 ? 52   A   D "O2'" 1 
ATOM 4656  C "C1'" . A   D 4  12  ? 75.244  -23.002  13.336  1.00 0.00 ? 52   A   D "C1'" 1 
ATOM 4657  N N9    . A   D 4  12  ? 75.904  -23.702  14.466  1.00 0.00 ? 52   A   D N9    1 
ATOM 4658  C C8    . A   D 4  12  ? 76.427  -23.124  15.601  1.00 0.00 ? 52   A   D C8    1 
ATOM 4659  N N7    . A   D 4  12  ? 77.004  -23.970  16.403  1.00 0.00 ? 52   A   D N7    1 
ATOM 4660  C C5    . A   D 4  12  ? 76.898  -25.184  15.790  1.00 0.00 ? 52   A   D C5    1 
ATOM 4661  C C6    . A   D 4  12  ? 77.400  -26.439  16.179  1.00 0.00 ? 52   A   D C6    1 
ATOM 4662  N N6    . A   D 4  12  ? 78.152  -26.522  17.320  1.00 0.00 ? 52   A   D N6    1 
ATOM 4663  N N1    . A   D 4  12  ? 77.111  -27.475  15.321  1.00 0.00 ? 52   A   D N1    1 
ATOM 4664  C C2    . A   D 4  12  ? 76.416  -27.210  14.201  1.00 0.00 ? 52   A   D C2    1 
ATOM 4665  N N3    . A   D 4  12  ? 75.946  -26.046  13.726  1.00 0.00 ? 52   A   D N3    1 
ATOM 4666  C C4    . A   D 4  12  ? 76.213  -25.048  14.583  1.00 0.00 ? 52   A   D C4    1 
ATOM 4667  P P     . A   D 4  13  ? 70.384  -22.834  14.122  1.00 0.00 ? 53   A   D P     1 
ATOM 4668  O OP1   . A   D 4  13  ? 69.167  -22.553  13.324  1.00 0.00 ? 53   A   D OP1   1 
ATOM 4669  O OP2   . A   D 4  13  ? 70.507  -22.154  15.429  1.00 0.00 ? 53   A   D OP2   1 
ATOM 4670  O "O5'" . A   D 4  13  ? 70.539  -24.406  14.325  1.00 0.00 ? 53   A   D "O5'" 1 
ATOM 4671  C "C5'" . A   D 4  13  ? 70.152  -25.234  13.212  1.00 0.00 ? 53   A   D "C5'" 1 
ATOM 4672  C "C4'" . A   D 4  13  ? 70.631  -26.679  13.374  1.00 0.00 ? 53   A   D "C4'" 1 
ATOM 4673  O "O4'" . A   D 4  13  ? 72.078  -26.739  13.394  1.00 0.00 ? 53   A   D "O4'" 1 
ATOM 4674  C "C3'" . A   D 4  13  ? 70.222  -27.399  14.664  1.00 0.00 ? 53   A   D "C3'" 1 
ATOM 4675  O "O3'" . A   D 4  13  ? 68.865  -27.844  14.555  1.00 0.00 ? 53   A   D "O3'" 1 
ATOM 4676  C "C2'" . A   D 4  13  ? 71.258  -28.509  14.699  1.00 0.00 ? 53   A   D "C2'" 1 
ATOM 4677  O "O2'" . A   D 4  13  ? 70.980  -29.527  13.766  1.00 0.00 ? 53   A   D "O2'" 1 
ATOM 4678  C "C1'" . A   D 4  13  ? 72.495  -27.765  14.284  1.00 0.00 ? 53   A   D "C1'" 1 
ATOM 4679  N N9    . A   D 4  13  ? 73.180  -27.228  15.462  1.00 0.00 ? 53   A   D N9    1 
ATOM 4680  C C8    . A   D 4  13  ? 73.131  -25.946  15.939  1.00 0.00 ? 53   A   D C8    1 
ATOM 4681  N N7    . A   D 4  13  ? 73.822  -25.774  17.019  1.00 0.00 ? 53   A   D N7    1 
ATOM 4682  C C5    . A   D 4  13  ? 74.356  -26.989  17.314  1.00 0.00 ? 53   A   D C5    1 
ATOM 4683  C C6    . A   D 4  13  ? 75.185  -27.368  18.376  1.00 0.00 ? 53   A   D C6    1 
ATOM 4684  N N6    . A   D 4  13  ? 75.489  -26.428  19.325  1.00 0.00 ? 53   A   D N6    1 
ATOM 4685  N N1    . A   D 4  13  ? 75.610  -28.675  18.339  1.00 0.00 ? 53   A   D N1    1 
ATOM 4686  C C2    . A   D 4  13  ? 75.175  -29.467  17.341  1.00 0.00 ? 53   A   D C2    1 
ATOM 4687  N N3    . A   D 4  13  ? 74.345  -29.198  16.318  1.00 0.00 ? 53   A   D N3    1 
ATOM 4688  C C4    . A   D 4  13  ? 73.971  -27.914  16.353  1.00 0.00 ? 53   A   D C4    1 
ATOM 4689  P P     . A   D 4  14  ? 68.033  -28.087  15.884  1.00 0.00 ? 54   A   D P     1 
ATOM 4690  O OP1   . A   D 4  14  ? 66.634  -28.392  15.514  1.00 0.00 ? 54   A   D OP1   1 
ATOM 4691  O OP2   . A   D 4  14  ? 68.251  -26.948  16.805  1.00 0.00 ? 54   A   D OP2   1 
ATOM 4692  O "O5'" . A   D 4  14  ? 68.689  -29.379  16.516  1.00 0.00 ? 54   A   D "O5'" 1 
ATOM 4693  C "C5'" . A   D 4  14  ? 68.444  -30.666  15.937  1.00 0.00 ? 54   A   D "C5'" 1 
ATOM 4694  C "C4'" . A   D 4  14  ? 69.412  -31.713  16.514  1.00 0.00 ? 54   A   D "C4'" 1 
ATOM 4695  O "O4'" . A   D 4  14  ? 70.786  -31.255  16.408  1.00 0.00 ? 54   A   D "O4'" 1 
ATOM 4696  C "C3'" . A   D 4  14  ? 69.264  -32.040  18.006  1.00 0.00 ? 54   A   D "C3'" 1 
ATOM 4697  O "O3'" . A   D 4  14  ? 68.200  -32.979  18.196  1.00 0.00 ? 54   A   D "O3'" 1 
ATOM 4698  C "C2'" . A   D 4  14  ? 70.645  -32.595  18.313  1.00 0.00 ? 54   A   D "C2'" 1 
ATOM 4699  O "O2'" . A   D 4  14  ? 70.822  -33.889  17.783  1.00 0.00 ? 54   A   D "O2'" 1 
ATOM 4700  C "C1'" . A   D 4  14  ? 71.510  -31.635  17.562  1.00 0.00 ? 54   A   D "C1'" 1 
ATOM 4701  N N9    . A   D 4  14  ? 71.864  -30.492  18.421  1.00 0.00 ? 54   A   D N9    1 
ATOM 4702  C C8    . A   D 4  14  ? 71.309  -29.232  18.505  1.00 0.00 ? 54   A   D C8    1 
ATOM 4703  N N7    . A   D 4  14  ? 71.863  -28.483  19.415  1.00 0.00 ? 54   A   D N7    1 
ATOM 4704  C C5    . A   D 4  14  ? 72.822  -29.266  19.990  1.00 0.00 ? 54   A   D C5    1 
ATOM 4705  C C6    . A   D 4  14  ? 73.732  -28.974  21.014  1.00 0.00 ? 54   A   D C6    1 
ATOM 4706  N N6    . A   D 4  14  ? 73.693  -27.734  21.598  1.00 0.00 ? 54   A   D N6    1 
ATOM 4707  N N1    . A   D 4  14  ? 74.603  -29.996  21.324  1.00 0.00 ? 54   A   D N1    1 
ATOM 4708  C C2    . A   D 4  14  ? 74.487  -31.170  20.687  1.00 0.00 ? 54   A   D C2    1 
ATOM 4709  N N3    . A   D 4  14  ? 73.643  -31.538  19.718  1.00 0.00 ? 54   A   D N3    1 
ATOM 4710  C C4    . A   D 4  14  ? 72.826  -30.525  19.397  1.00 0.00 ? 54   A   D C4    1 
ATOM 4711  P P     . U   D 4  15  ? 67.449  -33.042  19.594  1.00 0.00 ? 55   U   D P     1 
ATOM 4712  O OP1   . U   D 4  15  ? 66.458  -34.141  19.541  1.00 0.00 ? 55   U   D OP1   1 
ATOM 4713  O OP2   . U   D 4  15  ? 66.935  -31.693  19.915  1.00 0.00 ? 55   U   D OP2   1 
ATOM 4714  O "O5'" . U   D 4  15  ? 68.575  -33.405  20.654  1.00 0.00 ? 55   U   D "O5'" 1 
ATOM 4715  C "C5'" . U   D 4  15  ? 69.084  -34.746  20.677  1.00 0.00 ? 55   U   D "C5'" 1 
ATOM 4716  C "C4'" . U   D 4  15  ? 70.105  -34.956  21.812  1.00 0.00 ? 55   U   D "C4'" 1 
ATOM 4717  O "O4'" . U   D 4  15  ? 71.070  -33.857  21.912  1.00 0.00 ? 55   U   D "O4'" 1 
ATOM 4718  C "C3'" . U   D 4  15  ? 69.457  -35.058  23.214  1.00 0.00 ? 55   U   D "C3'" 1 
ATOM 4719  O "O3'" . U   D 4  15  ? 69.866  -36.184  23.988  1.00 0.00 ? 55   U   D "O3'" 1 
ATOM 4720  C "C2'" . U   D 4  15  ? 69.755  -33.691  23.819  1.00 0.00 ? 55   U   D "C2'" 1 
ATOM 4721  O "O2'" . U   D 4  15  ? 69.731  -33.708  25.224  1.00 0.00 ? 55   U   D "O2'" 1 
ATOM 4722  C "C1'" . U   D 4  15  ? 71.127  -33.424  23.254  1.00 0.00 ? 55   U   D "C1'" 1 
ATOM 4723  N N1    . U   D 4  15  ? 71.588  -32.013  23.428  1.00 0.00 ? 55   U   D N1    1 
ATOM 4724  C C2    . U   D 4  15  ? 72.917  -31.794  23.793  1.00 0.00 ? 55   U   D C2    1 
ATOM 4725  O O2    . U   D 4  15  ? 73.736  -32.711  23.877  1.00 0.00 ? 55   U   D O2    1 
ATOM 4726  N N3    . U   D 4  15  ? 73.229  -30.462  24.084  1.00 0.00 ? 55   U   D N3    1 
ATOM 4727  C C4    . U   D 4  15  ? 72.347  -29.366  24.082  1.00 0.00 ? 55   U   D C4    1 
ATOM 4728  O O4    . U   D 4  15  ? 72.698  -28.263  24.501  1.00 0.00 ? 55   U   D O4    1 
ATOM 4729  C C5    . U   D 4  15  ? 71.036  -29.685  23.569  1.00 0.00 ? 55   U   D C5    1 
ATOM 4730  C C6    . U   D 4  15  ? 70.720  -30.956  23.260  1.00 0.00 ? 55   U   D C6    1 
ATOM 4731  P P     . G   D 4  16  ? 71.241  -36.875  24.317  1.00 0.00 ? 56   G   D P     1 
ATOM 4732  O OP1   . G   D 4  16  ? 72.187  -36.751  23.185  1.00 0.00 ? 56   G   D OP1   1 
ATOM 4733  O OP2   . G   D 4  16  ? 70.944  -38.246  24.792  1.00 0.00 ? 56   G   D OP2   1 
ATOM 4734  O "O5'" . G   D 4  16  ? 71.826  -36.040  25.546  1.00 0.00 ? 56   G   D "O5'" 1 
ATOM 4735  C "C5'" . G   D 4  16  ? 72.938  -36.678  26.212  1.00 0.00 ? 56   G   D "C5'" 1 
ATOM 4736  C "C4'" . G   D 4  16  ? 73.679  -35.719  27.153  1.00 0.00 ? 56   G   D "C4'" 1 
ATOM 4737  O "O4'" . G   D 4  16  ? 73.952  -34.434  26.537  1.00 0.00 ? 56   G   D "O4'" 1 
ATOM 4738  C "C3'" . G   D 4  16  ? 72.993  -35.332  28.458  1.00 0.00 ? 56   G   D "C3'" 1 
ATOM 4739  O "O3'" . G   D 4  16  ? 72.985  -36.434  29.367  1.00 0.00 ? 56   G   D "O3'" 1 
ATOM 4740  C "C2'" . G   D 4  16  ? 73.894  -34.177  28.876  1.00 0.00 ? 56   G   D "C2'" 1 
ATOM 4741  O "O2'" . G   D 4  16  ? 75.112  -34.631  29.412  1.00 0.00 ? 56   G   D "O2'" 1 
ATOM 4742  C "C1'" . G   D 4  16  ? 74.158  -33.478  27.573  1.00 0.00 ? 56   G   D "C1'" 1 
ATOM 4743  N N9    . G   D 4  16  ? 73.320  -32.279  27.446  1.00 0.00 ? 56   G   D N9    1 
ATOM 4744  C C8    . G   D 4  16  ? 72.113  -32.160  26.805  1.00 0.00 ? 56   G   D C8    1 
ATOM 4745  N N7    . G   D 4  16  ? 71.609  -30.961  26.868  1.00 0.00 ? 56   G   D N7    1 
ATOM 4746  C C5    . G   D 4  16  ? 72.515  -30.252  27.614  1.00 0.00 ? 56   G   D C5    1 
ATOM 4747  C C6    . G   D 4  16  ? 72.467  -28.892  27.982  1.00 0.00 ? 56   G   D C6    1 
ATOM 4748  O O6    . G   D 4  16  ? 71.601  -28.096  27.598  1.00 0.00 ? 56   G   D O6    1 
ATOM 4749  N N1    . G   D 4  16  ? 73.514  -28.597  28.884  1.00 0.00 ? 56   G   D N1    1 
ATOM 4750  C C2    . G   D 4  16  ? 74.496  -29.498  29.324  1.00 0.00 ? 56   G   D C2    1 
ATOM 4751  N N2    . G   D 4  16  ? 75.332  -29.027  30.278  1.00 0.00 ? 56   G   D N2    1 
ATOM 4752  N N3    . G   D 4  16  ? 74.578  -30.759  28.838  1.00 0.00 ? 56   G   D N3    1 
ATOM 4753  C C4    . G   D 4  16  ? 73.553  -31.065  28.031  1.00 0.00 ? 56   G   D C4    1 
ATOM 4754  P P     . C   D 4  17  ? 71.962  -36.426  30.588  1.00 0.00 ? 57   C   D P     1 
ATOM 4755  O OP1   . C   D 4  17  ? 72.197  -37.640  31.402  1.00 0.00 ? 57   C   D OP1   1 
ATOM 4756  O OP2   . C   D 4  17  ? 70.593  -36.231  30.060  1.00 0.00 ? 57   C   D OP2   1 
ATOM 4757  O "O5'" . C   D 4  17  ? 72.354  -35.153  31.446  1.00 0.00 ? 57   C   D "O5'" 1 
ATOM 4758  C "C5'" . C   D 4  17  ? 73.466  -35.246  32.352  1.00 0.00 ? 57   C   D "C5'" 1 
ATOM 4759  C "C4'" . C   D 4  17  ? 73.836  -33.862  32.897  1.00 0.00 ? 57   C   D "C4'" 1 
ATOM 4760  O "O4'" . C   D 4  17  ? 73.999  -32.878  31.842  1.00 0.00 ? 57   C   D "O4'" 1 
ATOM 4761  C "C3'" . C   D 4  17  ? 72.839  -33.192  33.844  1.00 0.00 ? 57   C   D "C3'" 1 
ATOM 4762  O "O3'" . C   D 4  17  ? 72.874  -33.813  35.133  1.00 0.00 ? 57   C   D "O3'" 1 
ATOM 4763  C "C2'" . C   D 4  17  ? 73.355  -31.758  33.797  1.00 0.00 ? 57   C   D "C2'" 1 
ATOM 4764  O "O2'" . C   D 4  17  ? 74.569  -31.608  34.499  1.00 0.00 ? 57   C   D "O2'" 1 
ATOM 4765  C "C1'" . C   D 4  17  ? 73.620  -31.602  32.325  1.00 0.00 ? 57   C   D "C1'" 1 
ATOM 4766  N N1    . C   D 4  17  ? 72.446  -30.988  31.622  1.00 0.00 ? 57   C   D N1    1 
ATOM 4767  C C2    . C   D 4  17  ? 72.181  -29.627  31.800  1.00 0.00 ? 57   C   D C2    1 
ATOM 4768  O O2    . C   D 4  17  ? 72.935  -28.956  32.526  1.00 0.00 ? 57   C   D O2    1 
ATOM 4769  N N3    . C   D 4  17  ? 71.105  -29.075  31.166  1.00 0.00 ? 57   C   D N3    1 
ATOM 4770  C C4    . C   D 4  17  ? 70.274  -29.828  30.389  1.00 0.00 ? 57   C   D C4    1 
ATOM 4771  N N4    . C   D 4  17  ? 69.206  -29.286  29.729  1.00 0.00 ? 57   C   D N4    1 
ATOM 4772  C C5    . C   D 4  17  ? 70.515  -31.232  30.251  1.00 0.00 ? 57   C   D C5    1 
ATOM 4773  C C6    . C   D 4  17  ? 71.581  -31.756  30.871  1.00 0.00 ? 57   C   D C6    1 
ATOM 4774  P P     . G   D 4  18  ? 71.893  -33.241  36.251  1.00 0.00 ? 58   G   D P     1 
ATOM 4775  O OP1   . G   D 4  18  ? 71.683  -34.282  37.280  1.00 0.00 ? 58   G   D OP1   1 
ATOM 4776  O OP2   . G   D 4  18  ? 70.679  -32.696  35.604  1.00 0.00 ? 58   G   D OP2   1 
ATOM 4777  O "O5'" . G   D 4  18  ? 72.770  -32.069  36.860  1.00 0.00 ? 58   G   D "O5'" 1 
ATOM 4778  C "C5'" . G   D 4  18  ? 72.210  -31.033  37.667  1.00 0.00 ? 58   G   D "C5'" 1 
ATOM 4779  C "C4'" . G   D 4  18  ? 72.953  -29.713  37.402  1.00 0.00 ? 58   G   D "C4'" 1 
ATOM 4780  O "O4'" . G   D 4  18  ? 72.690  -29.208  36.069  1.00 0.00 ? 58   G   D "O4'" 1 
ATOM 4781  C "C3'" . G   D 4  18  ? 72.411  -28.609  38.302  1.00 0.00 ? 58   G   D "C3'" 1 
ATOM 4782  O "O3'" . G   D 4  18  ? 73.383  -27.569  38.508  1.00 0.00 ? 58   G   D "O3'" 1 
ATOM 4783  C "C2'" . G   D 4  18  ? 71.184  -28.147  37.540  1.00 0.00 ? 58   G   D "C2'" 1 
ATOM 4784  O "O2'" . G   D 4  18  ? 70.775  -26.857  37.925  1.00 0.00 ? 58   G   D "O2'" 1 
ATOM 4785  C "C1'" . G   D 4  18  ? 71.695  -28.190  36.122  1.00 0.00 ? 58   G   D "C1'" 1 
ATOM 4786  N N9    . G   D 4  18  ? 70.612  -28.421  35.149  1.00 0.00 ? 58   G   D N9    1 
ATOM 4787  C C8    . G   D 4  18  ? 70.187  -29.636  34.669  1.00 0.00 ? 58   G   D C8    1 
ATOM 4788  N N7    . G   D 4  18  ? 69.215  -29.541  33.807  1.00 0.00 ? 58   G   D N7    1 
ATOM 4789  C C5    . G   D 4  18  ? 68.971  -28.198  33.709  1.00 0.00 ? 58   G   D C5    1 
ATOM 4790  C C6    . G   D 4  18  ? 68.050  -27.540  32.874  1.00 0.00 ? 58   G   D C6    1 
ATOM 4791  O O6    . G   D 4  18  ? 67.298  -28.111  32.079  1.00 0.00 ? 58   G   D O6    1 
ATOM 4792  N N1    . G   D 4  18  ? 68.103  -26.145  33.090  1.00 0.00 ? 58   G   D N1    1 
ATOM 4793  C C2    . G   D 4  18  ? 68.955  -25.478  33.986  1.00 0.00 ? 58   G   D C2    1 
ATOM 4794  N N2    . G   D 4  18  ? 68.809  -24.126  34.033  1.00 0.00 ? 58   G   D N2    1 
ATOM 4795  N N3    . G   D 4  18  ? 69.860  -26.148  34.745  1.00 0.00 ? 58   G   D N3    1 
ATOM 4796  C C4    . G   D 4  18  ? 69.808  -27.480  34.551  1.00 0.00 ? 58   G   D C4    1 
ATOM 4797  P P     . A   D 4  19  ? 73.949  -27.354  39.970  1.00 0.00 ? 59   A   D P     1 
ATOM 4798  O OP1   . A   D 4  19  ? 74.768  -28.528  40.341  1.00 0.00 ? 59   A   D OP1   1 
ATOM 4799  O OP2   . A   D 4  19  ? 72.827  -26.987  40.863  1.00 0.00 ? 59   A   D OP2   1 
ATOM 4800  O "O5'" . A   D 4  19  ? 74.900  -26.100  39.820  1.00 0.00 ? 59   A   D "O5'" 1 
ATOM 4801  C "C5'" . A   D 4  19  ? 74.521  -25.009  38.980  1.00 0.00 ? 59   A   D "C5'" 1 
ATOM 4802  C "C4'" . A   D 4  19  ? 75.343  -23.784  39.380  1.00 0.00 ? 59   A   D "C4'" 1 
ATOM 4803  O "O4'" . A   D 4  19  ? 74.972  -22.653  38.551  1.00 0.00 ? 59   A   D "O4'" 1 
ATOM 4804  C "C3'" . A   D 4  19  ? 75.021  -23.320  40.808  1.00 0.00 ? 59   A   D "C3'" 1 
ATOM 4805  O "O3'" . A   D 4  19  ? 76.138  -22.642  41.410  1.00 0.00 ? 59   A   D "O3'" 1 
ATOM 4806  C "C2'" . A   D 4  19  ? 73.820  -22.417  40.579  1.00 0.00 ? 59   A   D "C2'" 1 
ATOM 4807  O "O2'" . A   D 4  19  ? 73.618  -21.519  41.641  1.00 0.00 ? 59   A   D "O2'" 1 
ATOM 4808  C "C1'" . A   D 4  19  ? 74.226  -21.717  39.310  1.00 0.00 ? 59   A   D "C1'" 1 
ATOM 4809  N N9    . A   D 4  19  ? 73.077  -21.172  38.551  1.00 0.00 ? 59   A   D N9    1 
ATOM 4810  C C8    . A   D 4  19  ? 72.860  -19.846  38.274  1.00 0.00 ? 59   A   D C8    1 
ATOM 4811  N N7    . A   D 4  19  ? 71.792  -19.626  37.558  1.00 0.00 ? 59   A   D N7    1 
ATOM 4812  C C5    . A   D 4  19  ? 71.248  -20.858  37.331  1.00 0.00 ? 59   A   D C5    1 
ATOM 4813  C C6    . A   D 4  19  ? 70.108  -21.220  36.589  1.00 0.00 ? 59   A   D C6    1 
ATOM 4814  N N6    . A   D 4  19  ? 69.373  -20.244  35.963  1.00 0.00 ? 59   A   D N6    1 
ATOM 4815  N N1    . A   D 4  19  ? 69.845  -22.568  36.549  1.00 0.00 ? 59   A   D N1    1 
ATOM 4816  C C2    . A   D 4  19  ? 70.660  -23.406  37.209  1.00 0.00 ? 59   A   D C2    1 
ATOM 4817  N N3    . A   D 4  19  ? 71.761  -23.154  37.935  1.00 0.00 ? 59   A   D N3    1 
ATOM 4818  C C4    . A   D 4  19  ? 72.020  -21.838  37.956  1.00 0.00 ? 59   A   D C4    1 
ATOM 4819  P P     . U   D 4  20  ? 76.943  -23.352  42.578  1.00 0.00 ? 60   U   D P     1 
ATOM 4820  O OP1   . U   D 4  20  ? 75.997  -24.071  43.464  1.00 0.00 ? 60   U   D OP1   1 
ATOM 4821  O OP2   . U   D 4  20  ? 77.833  -22.363  43.218  1.00 0.00 ? 60   U   D OP2   1 
ATOM 4822  O "O5'" . U   D 4  20  ? 77.816  -24.414  41.805  1.00 0.00 ? 60   U   D "O5'" 1 
ATOM 4823  C "C5'" . U   D 4  20  ? 79.006  -24.035  41.104  1.00 0.00 ? 60   U   D "C5'" 1 
ATOM 4824  C "C4'" . U   D 4  20  ? 79.781  -25.267  40.585  1.00 0.00 ? 60   U   D "C4'" 1 
ATOM 4825  O "O4'" . U   D 4  20  ? 79.768  -26.382  41.527  1.00 0.00 ? 60   U   D "O4'" 1 
ATOM 4826  C "C3'" . U   D 4  20  ? 79.203  -25.862  39.292  1.00 0.00 ? 60   U   D "C3'" 1 
ATOM 4827  O "O3'" . U   D 4  20  ? 80.253  -26.404  38.481  1.00 0.00 ? 60   U   D "O3'" 1 
ATOM 4828  C "C2'" . U   D 4  20  ? 78.238  -26.921  39.815  1.00 0.00 ? 60   U   D "C2'" 1 
ATOM 4829  O "O2'" . U   D 4  20  ? 77.981  -27.944  38.887  1.00 0.00 ? 60   U   D "O2'" 1 
ATOM 4830  C "C1'" . U   D 4  20  ? 78.982  -27.448  41.016  1.00 0.00 ? 60   U   D "C1'" 1 
ATOM 4831  N N1    . U   D 4  20  ? 78.088  -28.038  42.064  1.00 0.00 ? 60   U   D N1    1 
ATOM 4832  C C2    . U   D 4  20  ? 78.445  -29.245  42.652  1.00 0.00 ? 60   U   D C2    1 
ATOM 4833  O O2    . U   D 4  20  ? 79.432  -29.887  42.292  1.00 0.00 ? 60   U   D O2    1 
ATOM 4834  N N3    . U   D 4  20  ? 77.603  -29.671  43.683  1.00 0.00 ? 60   U   D N3    1 
ATOM 4835  C C4    . U   D 4  20  ? 76.482  -28.988  44.190  1.00 0.00 ? 60   U   D C4    1 
ATOM 4836  O O4    . U   D 4  20  ? 75.881  -29.395  45.186  1.00 0.00 ? 60   U   D O4    1 
ATOM 4837  C C5    . U   D 4  20  ? 76.150  -27.795  43.459  1.00 0.00 ? 60   U   D C5    1 
ATOM 4838  C C6    . U   D 4  20  ? 76.940  -27.379  42.457  1.00 0.00 ? 60   U   D C6    1 
ATOM 4839  P P     . A   D 4  21  ? 80.693  -25.660  37.150  1.00 0.00 ? 61   A   D P     1 
ATOM 4840  O OP1   . A   D 4  21  ? 82.001  -26.190  36.707  1.00 0.00 ? 61   A   D OP1   1 
ATOM 4841  O OP2   . A   D 4  21  ? 80.582  -24.195  37.336  1.00 0.00 ? 61   A   D OP2   1 
ATOM 4842  O "O5'" . A   D 4  21  ? 79.591  -26.130  36.121  1.00 0.00 ? 61   A   D "O5'" 1 
ATOM 4843  C "C5'" . A   D 4  21  ? 79.479  -27.529  35.807  1.00 0.00 ? 61   A   D "C5'" 1 
ATOM 4844  C "C4'" . A   D 4  21  ? 78.108  -27.818  35.201  1.00 0.00 ? 61   A   D "C4'" 1 
ATOM 4845  O "O4'" . A   D 4  21  ? 77.041  -27.274  36.024  1.00 0.00 ? 61   A   D "O4'" 1 
ATOM 4846  C "C3'" . A   D 4  21  ? 77.867  -27.188  33.821  1.00 0.00 ? 61   A   D "C3'" 1 
ATOM 4847  O "O3'" . A   D 4  21  ? 78.512  -27.988  32.830  1.00 0.00 ? 61   A   D "O3'" 1 
ATOM 4848  C "C2'" . A   D 4  21  ? 76.344  -27.173  33.781  1.00 0.00 ? 61   A   D "C2'" 1 
ATOM 4849  O "O2'" . A   D 4  21  ? 75.820  -28.457  33.536  1.00 0.00 ? 61   A   D "O2'" 1 
ATOM 4850  C "C1'" . A   D 4  21  ? 76.013  -26.761  35.196  1.00 0.00 ? 61   A   D "C1'" 1 
ATOM 4851  N N9    . A   D 4  21  ? 75.878  -25.294  35.327  1.00 0.00 ? 61   A   D N9    1 
ATOM 4852  C C8    . A   D 4  21  ? 76.841  -24.350  35.618  1.00 0.00 ? 61   A   D C8    1 
ATOM 4853  N N7    . A   D 4  21  ? 76.384  -23.127  35.644  1.00 0.00 ? 61   A   D N7    1 
ATOM 4854  C C5    . A   D 4  21  ? 75.054  -23.233  35.360  1.00 0.00 ? 61   A   D C5    1 
ATOM 4855  C C6    . A   D 4  21  ? 74.073  -22.234  35.233  1.00 0.00 ? 61   A   D C6    1 
ATOM 4856  N N6    . A   D 4  21  ? 74.406  -20.924  35.466  1.00 0.00 ? 61   A   D N6    1 
ATOM 4857  N N1    . A   D 4  21  ? 72.832  -22.691  34.866  1.00 0.00 ? 61   A   D N1    1 
ATOM 4858  C C2    . A   D 4  21  ? 72.649  -24.010  34.702  1.00 0.00 ? 61   A   D C2    1 
ATOM 4859  N N3    . A   D 4  21  ? 73.509  -25.026  34.838  1.00 0.00 ? 61   A   D N3    1 
ATOM 4860  C C4    . A   D 4  21  ? 74.723  -24.569  35.153  1.00 0.00 ? 61   A   D C4    1 
ATOM 4861  P P     . C   D 4  22  ? 78.511  -27.595  31.299  1.00 0.00 ? 62   C   D P     1 
ATOM 4862  O OP1   . C   D 4  22  ? 79.831  -27.040  30.930  1.00 0.00 ? 62   C   D OP1   1 
ATOM 4863  O OP2   . C   D 4  22  ? 77.332  -26.766  30.974  1.00 0.00 ? 62   C   D OP2   1 
ATOM 4864  O "O5'" . C   D 4  22  ? 78.314  -29.024  30.650  1.00 0.00 ? 62   C   D "O5'" 1 
ATOM 4865  C "C5'" . C   D 4  22  ? 79.398  -29.687  30.002  1.00 0.00 ? 62   C   D "C5'" 1 
ATOM 4866  C "C4'" . C   D 4  22  ? 79.003  -31.131  29.654  1.00 0.00 ? 62   C   D "C4'" 1 
ATOM 4867  O "O4'" . C   D 4  22  ? 77.766  -31.206  28.890  1.00 0.00 ? 62   C   D "O4'" 1 
ATOM 4868  C "C3'" . C   D 4  22  ? 80.032  -31.777  28.727  1.00 0.00 ? 62   C   D "C3'" 1 
ATOM 4869  O "O3'" . C   D 4  22  ? 80.081  -33.201  28.916  1.00 0.00 ? 62   C   D "O3'" 1 
ATOM 4870  C "C2'" . C   D 4  22  ? 79.536  -31.386  27.356  1.00 0.00 ? 62   C   D "C2'" 1 
ATOM 4871  O "O2'" . C   D 4  22  ? 80.034  -32.231  26.346  1.00 0.00 ? 62   C   D "O2'" 1 
ATOM 4872  C "C1'" . C   D 4  22  ? 78.049  -31.520  27.530  1.00 0.00 ? 62   C   D "C1'" 1 
ATOM 4873  N N1    . C   D 4  22  ? 77.348  -30.661  26.551  1.00 0.00 ? 62   C   D N1    1 
ATOM 4874  C C2    . C   D 4  22  ? 77.030  -29.305  26.716  1.00 0.00 ? 62   C   D C2    1 
ATOM 4875  O O2    . C   D 4  22  ? 77.276  -28.731  27.794  1.00 0.00 ? 62   C   D O2    1 
ATOM 4876  N N3    . C   D 4  22  ? 76.488  -28.638  25.663  1.00 0.00 ? 62   C   D N3    1 
ATOM 4877  C C4    . C   D 4  22  ? 76.453  -29.196  24.420  1.00 0.00 ? 62   C   D C4    1 
ATOM 4878  N N4    . C   D 4  22  ? 76.206  -28.444  23.315  1.00 0.00 ? 62   C   D N4    1 
ATOM 4879  C C5    . C   D 4  22  ? 76.779  -30.582  24.252  1.00 0.00 ? 62   C   D C5    1 
ATOM 4880  C C6    . C   D 4  22  ? 77.232  -31.253  25.317  1.00 0.00 ? 62   C   D C6    1 
ATOM 4881  P P     . G   D 4  23  ? 81.387  -33.866  29.498  1.00 0.00 ? 63   G   D P     1 
ATOM 4882  O OP1   . G   D 4  23  ? 82.426  -33.867  28.445  1.00 0.00 ? 63   G   D OP1   1 
ATOM 4883  O OP2   . G   D 4  23  ? 81.021  -35.167  30.101  1.00 0.00 ? 63   G   D OP2   1 
ATOM 4884  O "O5'" . G   D 4  23  ? 81.805  -32.834  30.618  1.00 0.00 ? 63   G   D "O5'" 1 
ATOM 4885  C "C5'" . G   D 4  23  ? 82.029  -33.255  31.957  1.00 0.00 ? 63   G   D "C5'" 1 
ATOM 4886  C "C4'" . G   D 4  23  ? 81.956  -32.032  32.873  1.00 0.00 ? 63   G   D "C4'" 1 
ATOM 4887  O "O4'" . G   D 4  23  ? 80.617  -31.470  32.778  1.00 0.00 ? 63   G   D "O4'" 1 
ATOM 4888  C "C3'" . G   D 4  23  ? 82.110  -32.446  34.347  1.00 0.00 ? 63   G   D "C3'" 1 
ATOM 4889  O "O3'" . G   D 4  23  ? 83.422  -32.247  34.872  1.00 0.00 ? 63   G   D "O3'" 1 
ATOM 4890  C "C2'" . G   D 4  23  ? 81.038  -31.635  35.070  1.00 0.00 ? 63   G   D "C2'" 1 
ATOM 4891  O "O2'" . G   D 4  23  ? 81.493  -30.346  35.410  1.00 0.00 ? 63   G   D "O2'" 1 
ATOM 4892  C "C1'" . G   D 4  23  ? 79.961  -31.514  34.025  1.00 0.00 ? 63   G   D "C1'" 1 
ATOM 4893  N N9    . G   D 4  23  ? 78.946  -32.600  34.109  1.00 0.00 ? 63   G   D N9    1 
ATOM 4894  C C8    . G   D 4  23  ? 78.728  -33.633  33.212  1.00 0.00 ? 63   G   D C8    1 
ATOM 4895  N N7    . G   D 4  23  ? 77.759  -34.425  33.568  1.00 0.00 ? 63   G   D N7    1 
ATOM 4896  C C5    . G   D 4  23  ? 77.293  -33.900  34.750  1.00 0.00 ? 63   G   D C5    1 
ATOM 4897  C C6    . G   D 4  23  ? 76.244  -34.375  35.563  1.00 0.00 ? 63   G   D C6    1 
ATOM 4898  O O6    . G   D 4  23  ? 75.576  -35.383  35.312  1.00 0.00 ? 63   G   D O6    1 
ATOM 4899  N N1    . G   D 4  23  ? 76.059  -33.527  36.685  1.00 0.00 ? 63   G   D N1    1 
ATOM 4900  C C2    . G   D 4  23  ? 76.829  -32.390  36.995  1.00 0.00 ? 63   G   D C2    1 
ATOM 4901  N N2    . G   D 4  23  ? 76.508  -31.757  38.161  1.00 0.00 ? 63   G   D N2    1 
ATOM 4902  N N3    . G   D 4  23  ? 77.829  -31.964  36.177  1.00 0.00 ? 63   G   D N3    1 
ATOM 4903  C C4    . G   D 4  23  ? 78.000  -32.762  35.102  1.00 0.00 ? 63   G   D C4    1 
ATOM 4904  P P     . U   D 4  24  ? 84.859  -32.448  34.247  1.00 0.00 ? 64   U   D P     1 
ATOM 4905  O OP1   . U   D 4  24  ? 85.844  -32.368  35.350  1.00 0.00 ? 64   U   D OP1   1 
ATOM 4906  O OP2   . U   D 4  24  ? 85.052  -31.503  33.126  1.00 0.00 ? 64   U   D OP2   1 
ATOM 4907  O "O5'" . U   D 4  24  ? 84.846  -33.906  33.636  1.00 0.00 ? 64   U   D "O5'" 1 
ATOM 4908  C "C5'" . U   D 4  24  ? 85.343  -35.043  34.342  1.00 0.00 ? 64   U   D "C5'" 1 
ATOM 4909  C "C4'" . U   D 4  24  ? 84.423  -35.487  35.473  1.00 0.00 ? 64   U   D "C4'" 1 
ATOM 4910  O "O4'" . U   D 4  24  ? 83.047  -35.501  35.079  1.00 0.00 ? 64   U   D "O4'" 1 
ATOM 4911  C "C3'" . U   D 4  24  ? 84.634  -36.910  35.931  1.00 0.00 ? 64   U   D "C3'" 1 
ATOM 4912  O "O3'" . U   D 4  24  ? 85.831  -36.953  36.704  1.00 0.00 ? 64   U   D "O3'" 1 
ATOM 4913  C "C2'" . U   D 4  24  ? 83.338  -37.186  36.699  1.00 0.00 ? 64   U   D "C2'" 1 
ATOM 4914  O "O2'" . U   D 4  24  ? 83.429  -36.763  38.038  1.00 0.00 ? 64   U   D "O2'" 1 
ATOM 4915  C "C1'" . U   D 4  24  ? 82.321  -36.318  35.972  1.00 0.00 ? 64   U   D "C1'" 1 
ATOM 4916  N N1    . U   D 4  24  ? 81.233  -37.107  35.323  1.00 0.00 ? 64   U   D N1    1 
ATOM 4917  C C2    . U   D 4  24  ? 80.198  -37.587  36.119  1.00 0.00 ? 64   U   D C2    1 
ATOM 4918  O O2    . U   D 4  24  ? 80.173  -37.405  37.335  1.00 0.00 ? 64   U   D O2    1 
ATOM 4919  N N3    . U   D 4  24  ? 79.197  -38.281  35.426  1.00 0.00 ? 64   U   D N3    1 
ATOM 4920  C C4    . U   D 4  24  ? 79.136  -38.515  34.040  1.00 0.00 ? 64   U   D C4    1 
ATOM 4921  O O4    . U   D 4  24  ? 78.186  -39.115  33.534  1.00 0.00 ? 64   U   D O4    1 
ATOM 4922  C C5    . U   D 4  24  ? 80.269  -37.997  33.312  1.00 0.00 ? 64   U   D C5    1 
ATOM 4923  C C6    . U   D 4  24  ? 81.248  -37.345  33.962  1.00 0.00 ? 64   U   D C6    1 
ATOM 4924  P P     . A   D 4  25  ? 86.767  -38.218  36.692  1.00 0.00 ? 65   A   D P     1 
ATOM 4925  O OP1   . A   D 4  25  ? 87.993  -37.904  37.460  1.00 0.00 ? 65   A   D OP1   1 
ATOM 4926  O OP2   . A   D 4  25  ? 86.946  -38.679  35.296  1.00 0.00 ? 65   A   D OP2   1 
ATOM 4927  O "O5'" . A   D 4  25  ? 85.892  -39.280  37.483  1.00 0.00 ? 65   A   D "O5'" 1 
ATOM 4928  C "C5'" . A   D 4  25  ? 85.841  -39.131  38.911  1.00 0.00 ? 65   A   D "C5'" 1 
ATOM 4929  C "C4'" . A   D 4  25  ? 84.808  -40.087  39.512  1.00 0.00 ? 65   A   D "C4'" 1 
ATOM 4930  O "O4'" . A   D 4  25  ? 83.462  -39.766  39.084  1.00 0.00 ? 65   A   D "O4'" 1 
ATOM 4931  C "C3'" . A   D 4  25  ? 84.920  -41.562  39.149  1.00 0.00 ? 65   A   D "C3'" 1 
ATOM 4932  O "O3'" . A   D 4  25  ? 86.121  -42.105  39.687  1.00 0.00 ? 65   A   D "O3'" 1 
ATOM 4933  C "C2'" . A   D 4  25  ? 83.538  -42.081  39.591  1.00 0.00 ? 65   A   D "C2'" 1 
ATOM 4934  O "O2'" . A   D 4  25  ? 83.391  -42.255  40.979  1.00 0.00 ? 65   A   D "O2'" 1 
ATOM 4935  C "C1'" . A   D 4  25  ? 82.647  -40.918  39.208  1.00 0.00 ? 65   A   D "C1'" 1 
ATOM 4936  N N9    . A   D 4  25  ? 81.811  -41.192  38.020  1.00 0.00 ? 65   A   D N9    1 
ATOM 4937  C C8    . A   D 4  25  ? 81.882  -40.716  36.732  1.00 0.00 ? 65   A   D C8    1 
ATOM 4938  N N7    . A   D 4  25  ? 80.911  -41.142  35.966  1.00 0.00 ? 65   A   D N7    1 
ATOM 4939  C C5    . A   D 4  25  ? 80.147  -41.943  36.764  1.00 0.00 ? 65   A   D C5    1 
ATOM 4940  C C6    . A   D 4  25  ? 78.975  -42.665  36.475  1.00 0.00 ? 65   A   D C6    1 
ATOM 4941  N N6    . A   D 4  25  ? 78.356  -42.500  35.263  1.00 0.00 ? 65   A   D N6    1 
ATOM 4942  N N1    . A   D 4  25  ? 78.520  -43.463  37.498  1.00 0.00 ? 65   A   D N1    1 
ATOM 4943  C C2    . A   D 4  25  ? 79.181  -43.460  38.668  1.00 0.00 ? 65   A   D C2    1 
ATOM 4944  N N3    . A   D 4  25  ? 80.246  -42.742  39.055  1.00 0.00 ? 65   A   D N3    1 
ATOM 4945  C C4    . A   D 4  25  ? 80.708  -42.009  38.037  1.00 0.00 ? 65   A   D C4    1 
ATOM 4946  P P     . A   D 4  26  ? 86.494  -42.824  41.026  1.00 0.00 ? 66   A   D P     1 
ATOM 4947  O OP1   . A   D 4  26  ? 85.970  -42.039  42.163  1.00 0.00 ? 66   A   D OP1   1 
ATOM 4948  O OP2   . A   D 4  26  ? 87.945  -43.117  41.030  1.00 0.00 ? 66   A   D OP2   1 
ATOM 4949  O "O5'" . A   D 4  26  ? 85.701  -44.185  40.885  1.00 0.00 ? 66   A   D "O5'" 1 
ATOM 4950  C "C5'" . A   D 4  26  ? 85.175  -44.798  42.067  1.00 0.00 ? 66   A   D "C5'" 1 
ATOM 4951  C "C4'" . A   D 4  26  ? 84.259  -45.960  41.680  1.00 0.00 ? 66   A   D "C4'" 1 
ATOM 4952  O "O4'" . A   D 4  26  ? 83.236  -45.532  40.752  1.00 0.00 ? 66   A   D "O4'" 1 
ATOM 4953  C "C3'" . A   D 4  26  ? 84.949  -47.105  40.951  1.00 0.00 ? 66   A   D "C3'" 1 
ATOM 4954  O "O3'" . A   D 4  26  ? 85.664  -47.888  41.908  1.00 0.00 ? 66   A   D "O3'" 1 
ATOM 4955  C "C2'" . A   D 4  26  ? 83.758  -47.792  40.299  1.00 0.00 ? 66   A   D "C2'" 1 
ATOM 4956  O "O2'" . A   D 4  26  ? 83.075  -48.638  41.197  1.00 0.00 ? 66   A   D "O2'" 1 
ATOM 4957  C "C1'" . A   D 4  26  ? 82.875  -46.622  39.932  1.00 0.00 ? 66   A   D "C1'" 1 
ATOM 4958  N N9    . A   D 4  26  ? 82.950  -46.312  38.501  1.00 0.00 ? 66   A   D N9    1 
ATOM 4959  C C8    . A   D 4  26  ? 83.727  -45.399  37.826  1.00 0.00 ? 66   A   D C8    1 
ATOM 4960  N N7    . A   D 4  26  ? 83.516  -45.397  36.539  1.00 0.00 ? 66   A   D N7    1 
ATOM 4961  C C5    . A   D 4  26  ? 82.561  -46.355  36.330  1.00 0.00 ? 66   A   D C5    1 
ATOM 4962  C C6    . A   D 4  26  ? 81.943  -46.775  35.144  1.00 0.00 ? 66   A   D C6    1 
ATOM 4963  N N6    . A   D 4  26  ? 82.242  -46.104  33.986  1.00 0.00 ? 66   A   D N6    1 
ATOM 4964  N N1    . A   D 4  26  ? 81.057  -47.818  35.288  1.00 0.00 ? 66   A   D N1    1 
ATOM 4965  C C2    . A   D 4  26  ? 80.840  -48.322  36.514  1.00 0.00 ? 66   A   D C2    1 
ATOM 4966  N N3    . A   D 4  26  ? 81.351  -47.956  37.698  1.00 0.00 ? 66   A   D N3    1 
ATOM 4967  C C4    . A   D 4  26  ? 82.221  -46.953  37.536  1.00 0.00 ? 66   A   D C4    1 
ATOM 4968  P P     . U   D 4  27  ? 86.726  -48.967  41.440  1.00 0.00 ? 67   U   D P     1 
ATOM 4969  O OP1   . U   D 4  27  ? 87.290  -49.617  42.645  1.00 0.00 ? 67   U   D OP1   1 
ATOM 4970  O OP2   . U   D 4  27  ? 87.681  -48.326  40.505  1.00 0.00 ? 67   U   D OP2   1 
ATOM 4971  O "O5'" . U   D 4  27  ? 85.843  -50.031  40.659  1.00 0.00 ? 67   U   D "O5'" 1 
ATOM 4972  C "C5'" . U   D 4  27  ? 86.420  -50.697  39.528  1.00 0.00 ? 67   U   D "C5'" 1 
ATOM 4973  C "C4'" . U   D 4  27  ? 85.362  -51.561  38.830  1.00 0.00 ? 67   U   D "C4'" 1 
ATOM 4974  O "O4'" . U   D 4  27  ? 84.231  -50.742  38.422  1.00 0.00 ? 67   U   D "O4'" 1 
ATOM 4975  C "C3'" . U   D 4  27  ? 85.809  -52.214  37.520  1.00 0.00 ? 67   U   D "C3'" 1 
ATOM 4976  O "O3'" . U   D 4  27  ? 86.594  -53.377  37.781  1.00 0.00 ? 67   U   D "O3'" 1 
ATOM 4977  C "C2'" . U   D 4  27  ? 84.464  -52.472  36.861  1.00 0.00 ? 67   U   D "C2'" 1 
ATOM 4978  O "O2'" . U   D 4  27  ? 83.773  -53.531  37.486  1.00 0.00 ? 67   U   D "O2'" 1 
ATOM 4979  C "C1'" . U   D 4  27  ? 83.754  -51.172  37.153  1.00 0.00 ? 67   U   D "C1'" 1 
ATOM 4980  N N1    . U   D 4  27  ? 83.970  -50.184  36.047  1.00 0.00 ? 67   U   D N1    1 
ATOM 4981  C C2    . U   D 4  27  ? 83.262  -50.389  34.865  1.00 0.00 ? 67   U   D C2    1 
ATOM 4982  O O2    . U   D 4  27  ? 82.457  -51.312  34.731  1.00 0.00 ? 67   U   D O2    1 
ATOM 4983  N N3    . U   D 4  27  ? 83.551  -49.476  33.845  1.00 0.00 ? 67   U   D N3    1 
ATOM 4984  C C4    . U   D 4  27  ? 84.507  -48.446  33.873  1.00 0.00 ? 67   U   D C4    1 
ATOM 4985  O O4    . U   D 4  27  ? 84.687  -47.711  32.899  1.00 0.00 ? 67   U   D O4    1 
ATOM 4986  C C5    . U   D 4  27  ? 85.220  -48.345  35.121  1.00 0.00 ? 67   U   D C5    1 
ATOM 4987  C C6    . U   D 4  27  ? 84.915  -49.173  36.138  1.00 0.00 ? 67   U   D C6    1 
ATOM 4988  P P     . G   D 4  28  ? 87.180  -54.228  36.567  1.00 0.00 ? 68   G   D P     1 
ATOM 4989  O OP1   . G   D 4  28  ? 86.171  -55.231  36.156  1.00 0.00 ? 68   G   D OP1   1 
ATOM 4990  O OP2   . G   D 4  28  ? 88.514  -54.739  36.955  1.00 0.00 ? 68   G   D OP2   1 
ATOM 4991  O "O5'" . G   D 4  28  ? 87.363  -53.172  35.393  1.00 0.00 ? 68   G   D "O5'" 1 
ATOM 4992  C "C5'" . G   D 4  28  ? 87.545  -53.654  34.046  1.00 0.00 ? 68   G   D "C5'" 1 
ATOM 4993  C "C4'" . G   D 4  28  ? 87.227  -52.592  32.957  1.00 0.00 ? 68   G   D "C4'" 1 
ATOM 4994  O "O4'" . G   D 4  28  ? 86.840  -51.300  33.518  1.00 0.00 ? 68   G   D "O4'" 1 
ATOM 4995  C "C3'" . G   D 4  28  ? 88.405  -52.239  32.038  1.00 0.00 ? 68   G   D "C3'" 1 
ATOM 4996  O "O3'" . G   D 4  28  ? 88.522  -53.224  31.002  1.00 0.00 ? 68   G   D "O3'" 1 
ATOM 4997  C "C2'" . G   D 4  28  ? 88.025  -50.861  31.534  1.00 0.00 ? 68   G   D "C2'" 1 
ATOM 4998  O "O2'" . G   D 4  28  ? 87.050  -50.926  30.519  1.00 0.00 ? 68   G   D "O2'" 1 
ATOM 4999  C "C1'" . G   D 4  28  ? 87.432  -50.251  32.772  1.00 0.00 ? 68   G   D "C1'" 1 
ATOM 5000  N N9    . G   D 4  28  ? 88.458  -49.534  33.556  1.00 0.00 ? 68   G   D N9    1 
ATOM 5001  C C8    . G   D 4  28  ? 89.343  -50.070  34.468  1.00 0.00 ? 68   G   D C8    1 
ATOM 5002  N N7    . G   D 4  28  ? 90.145  -49.182  34.987  1.00 0.00 ? 68   G   D N7    1 
ATOM 5003  C C5    . G   D 4  28  ? 89.787  -47.998  34.390  1.00 0.00 ? 68   G   D C5    1 
ATOM 5004  C C6    . G   D 4  28  ? 90.364  -46.726  34.557  1.00 0.00 ? 68   G   D C6    1 
ATOM 5005  O O6    . G   D 4  28  ? 91.291  -46.481  35.334  1.00 0.00 ? 68   G   D O6    1 
ATOM 5006  N N1    . G   D 4  28  ? 89.734  -45.782  33.709  1.00 0.00 ? 68   G   D N1    1 
ATOM 5007  C C2    . G   D 4  28  ? 88.659  -46.043  32.839  1.00 0.00 ? 68   G   D C2    1 
ATOM 5008  N N2    . G   D 4  28  ? 88.160  -44.972  32.160  1.00 0.00 ? 68   G   D N2    1 
ATOM 5009  N N3    . G   D 4  28  ? 88.134  -47.285  32.708  1.00 0.00 ? 68   G   D N3    1 
ATOM 5010  C C4    . G   D 4  28  ? 88.743  -48.191  33.497  1.00 0.00 ? 68   G   D C4    1 
ATOM 5011  P P     . U   D 4  29  ? 89.933  -53.826  30.603  1.00 0.00 ? 69   U   D P     1 
ATOM 5012  O OP1   . U   D 4  29  ? 89.738  -55.189  30.059  1.00 0.00 ? 69   U   D OP1   1 
ATOM 5013  O OP2   . U   D 4  29  ? 90.876  -53.687  31.737  1.00 0.00 ? 69   U   D OP2   1 
ATOM 5014  O "O5'" . U   D 4  29  ? 90.403  -52.864  29.435  1.00 0.00 ? 69   U   D "O5'" 1 
ATOM 5015  C "C5'" . U   D 4  29  ? 89.778  -52.953  28.146  1.00 0.00 ? 69   U   D "C5'" 1 
ATOM 5016  C "C4'" . U   D 4  29  ? 90.118  -51.721  27.296  1.00 0.00 ? 69   U   D "C4'" 1 
ATOM 5017  O "O4'" . U   D 4  29  ? 89.668  -50.511  27.969  1.00 0.00 ? 69   U   D "O4'" 1 
ATOM 5018  C "C3'" . U   D 4  29  ? 91.603  -51.456  27.014  1.00 0.00 ? 69   U   D "C3'" 1 
ATOM 5019  O "O3'" . U   D 4  29  ? 92.096  -52.359  26.029  1.00 0.00 ? 69   U   D "O3'" 1 
ATOM 5020  C "C2'" . U   D 4  29  ? 91.593  -49.957  26.731  1.00 0.00 ? 69   U   D "C2'" 1 
ATOM 5021  O "O2'" . U   D 4  29  ? 91.084  -49.625  25.469  1.00 0.00 ? 69   U   D "O2'" 1 
ATOM 5022  C "C1'" . U   D 4  29  ? 90.600  -49.458  27.756  1.00 0.00 ? 69   U   D "C1'" 1 
ATOM 5023  N N1    . U   D 4  29  ? 91.278  -48.967  28.996  1.00 0.00 ? 69   U   D N1    1 
ATOM 5024  C C2    . U   D 4  29  ? 91.977  -47.765  28.916  1.00 0.00 ? 69   U   D C2    1 
ATOM 5025  O O2    . U   D 4  29  ? 92.065  -47.123  27.870  1.00 0.00 ? 69   U   D O2    1 
ATOM 5026  N N3    . U   D 4  29  ? 92.546  -47.337  30.121  1.00 0.00 ? 69   U   D N3    1 
ATOM 5027  C C4    . U   D 4  29  ? 92.402  -47.934  31.384  1.00 0.00 ? 69   U   D C4    1 
ATOM 5028  O O4    . U   D 4  29  ? 92.857  -47.407  32.401  1.00 0.00 ? 69   U   D O4    1 
ATOM 5029  C C5    . U   D 4  29  ? 91.694  -49.188  31.356  1.00 0.00 ? 69   U   D C5    1 
ATOM 5030  C C6    . U   D 4  29  ? 91.192  -49.649  30.196  1.00 0.00 ? 69   U   D C6    1 
ATOM 5031  P P     . G   D 4  30  ? 92.467  -52.317  24.501  1.00 0.00 ? 70   G   D P     1 
ATOM 5032  O OP1   . G   D 4  30  ? 91.277  -51.901  23.728  1.00 0.00 ? 70   G   D OP1   1 
ATOM 5033  O OP2   . G   D 4  30  ? 93.075  -53.617  24.136  1.00 0.00 ? 70   G   D OP2   1 
ATOM 5034  O "O5'" . G   D 4  30  ? 93.592  -51.199  24.411  1.00 0.00 ? 70   G   D "O5'" 1 
ATOM 5035  C "C5'" . G   D 4  30  ? 93.491  -50.177  23.396  1.00 0.00 ? 70   G   D "C5'" 1 
ATOM 5036  C "C4'" . G   D 4  30  ? 94.339  -48.941  23.742  1.00 0.00 ? 70   G   D "C4'" 1 
ATOM 5037  O "O4'" . G   D 4  30  ? 94.399  -48.690  25.166  1.00 0.00 ? 70   G   D "O4'" 1 
ATOM 5038  C "C3'" . G   D 4  30  ? 95.797  -48.981  23.291  1.00 0.00 ? 70   G   D "C3'" 1 
ATOM 5039  O "O3'" . G   D 4  30  ? 95.819  -48.693  21.894  1.00 0.00 ? 70   G   D "O3'" 1 
ATOM 5040  C "C2'" . G   D 4  30  ? 96.414  -47.932  24.213  1.00 0.00 ? 70   G   D "C2'" 1 
ATOM 5041  O "O2'" . G   D 4  30  ? 96.129  -46.625  23.774  1.00 0.00 ? 70   G   D "O2'" 1 
ATOM 5042  C "C1'" . G   D 4  30  ? 95.671  -48.186  25.504  1.00 0.00 ? 70   G   D "C1'" 1 
ATOM 5043  N N9    . G   D 4  30  ? 96.401  -49.103  26.396  1.00 0.00 ? 70   G   D N9    1 
ATOM 5044  C C8    . G   D 4  30  ? 96.400  -50.483  26.383  1.00 0.00 ? 70   G   D C8    1 
ATOM 5045  N N7    . G   D 4  30  ? 97.139  -51.000  27.324  1.00 0.00 ? 70   G   D N7    1 
ATOM 5046  C C5    . G   D 4  30  ? 97.669  -49.915  27.983  1.00 0.00 ? 70   G   D C5    1 
ATOM 5047  C C6    . G   D 4  30  ? 98.541  -49.900  29.091  1.00 0.00 ? 70   G   D C6    1 
ATOM 5048  O O6    . G   D 4  30  ? 98.969  -50.915  29.648  1.00 0.00 ? 70   G   D O6    1 
ATOM 5049  N N1    . G   D 4  30  ? 98.857  -48.567  29.458  1.00 0.00 ? 70   G   D N1    1 
ATOM 5050  C C2    . G   D 4  30  ? 98.371  -47.403  28.829  1.00 0.00 ? 70   G   D C2    1 
ATOM 5051  N N2    . G   D 4  30  ? 98.802  -46.214  29.338  1.00 0.00 ? 70   G   D N2    1 
ATOM 5052  N N3    . G   D 4  30  ? 97.517  -47.467  27.779  1.00 0.00 ? 70   G   D N3    1 
ATOM 5053  C C4    . G   D 4  30  ? 97.226  -48.730  27.421  1.00 0.00 ? 70   G   D C4    1 
ATOM 5054  P P     . A   D 4  31  ? 97.131  -48.599  21.026  1.00 0.00 ? 71   A   D P     1 
ATOM 5055  O OP1   . A   D 4  31  ? 97.158  -49.753  20.099  1.00 0.00 ? 71   A   D OP1   1 
ATOM 5056  O OP2   . A   D 4  31  ? 98.308  -48.405  21.898  1.00 0.00 ? 71   A   D OP2   1 
ATOM 5057  O "O5'" . A   D 4  31  ? 96.960  -47.287  20.174  1.00 0.00 ? 71   A   D "O5'" 1 
ATOM 5058  C "C5'" . A   D 4  31  ? 95.790  -46.489  20.029  1.00 0.00 ? 71   A   D "C5'" 1 
ATOM 5059  C "C4'" . A   D 4  31  ? 96.165  -45.006  20.146  1.00 0.00 ? 71   A   D "C4'" 1 
ATOM 5060  O "O4'" . A   D 4  31  ? 96.371  -44.631  21.530  1.00 0.00 ? 71   A   D "O4'" 1 
ATOM 5061  C "C3'" . A   D 4  31  ? 97.475  -44.594  19.428  1.00 0.00 ? 71   A   D "C3'" 1 
ATOM 5062  O "O3'" . A   D 4  31  ? 97.341  -43.375  18.698  1.00 0.00 ? 71   A   D "O3'" 1 
ATOM 5063  C "C2'" . A   D 4  31  ? 98.458  -44.437  20.573  1.00 0.00 ? 71   A   D "C2'" 1 
ATOM 5064  O "O2'" . A   D 4  31  ? 99.505  -43.545  20.265  1.00 0.00 ? 71   A   D "O2'" 1 
ATOM 5065  C "C1'" . A   D 4  31  ? 97.560  -43.887  21.633  1.00 0.00 ? 71   A   D "C1'" 1 
ATOM 5066  N N9    . A   D 4  31  ? 98.150  -43.975  22.978  1.00 0.00 ? 71   A   D N9    1 
ATOM 5067  C C8    . A   D 4  31  ? 98.934  -44.975  23.504  1.00 0.00 ? 71   A   D C8    1 
ATOM 5068  N N7    . A   D 4  31  ? 99.309  -44.750  24.733  1.00 0.00 ? 71   A   D N7    1 
ATOM 5069  C C5    . A   D 4  31  ? 98.750  -43.546  25.063  1.00 0.00 ? 71   A   D C5    1 
ATOM 5070  C C6    . A   D 4  31  ? 98.814  -42.813  26.261  1.00 0.00 ? 71   A   D C6    1 
ATOM 5071  N N6    . A   D 4  31  ? 99.539  -43.322  27.310  1.00 0.00 ? 71   A   D N6    1 
ATOM 5072  N N1    . A   D 4  31  ? 98.119  -41.629  26.251  1.00 0.00 ? 71   A   D N1    1 
ATOM 5073  C C2    . A   D 4  31  ? 97.475  -41.264  25.132  1.00 0.00 ? 71   A   D C2    1 
ATOM 5074  N N3    . A   D 4  31  ? 97.372  -41.879  23.947  1.00 0.00 ? 71   A   D N3    1 
ATOM 5075  C C4    . A   D 4  31  ? 98.034  -43.043  23.978  1.00 0.00 ? 71   A   D C4    1 
ATOM 5076  P P     . A   D 4  32  ? 96.814  -43.384  17.217  1.00 0.00 ? 72   A   D P     1 
ATOM 5077  O OP1   . A   D 4  32  ? 97.161  -44.658  16.555  1.00 0.00 ? 72   A   D OP1   1 
ATOM 5078  O OP2   . A   D 4  32  ? 97.254  -42.141  16.550  1.00 0.00 ? 72   A   D OP2   1 
ATOM 5079  O "O5'" . A   D 4  32  ? 95.251  -43.344  17.437  1.00 0.00 ? 72   A   D "O5'" 1 
ATOM 5080  C "C5'" . A   D 4  32  ? 94.578  -42.092  17.594  1.00 0.00 ? 72   A   D "C5'" 1 
ATOM 5081  C "C4'" . A   D 4  32  ? 94.258  -41.787  19.054  1.00 0.00 ? 72   A   D "C4'" 1 
ATOM 5082  O "O4'" . A   D 4  32  ? 95.441  -41.568  19.869  1.00 0.00 ? 72   A   D "O4'" 1 
ATOM 5083  C "C3'" . A   D 4  32  ? 93.527  -40.473  19.166  1.00 0.00 ? 72   A   D "C3'" 1 
ATOM 5084  O "O3'" . A   D 4  32  ? 92.172  -40.665  18.755  1.00 0.00 ? 72   A   D "O3'" 1 
ATOM 5085  C "C2'" . A   D 4  32  ? 93.746  -40.141  20.628  1.00 0.00 ? 72   A   D "C2'" 1 
ATOM 5086  O "O2'" . A   D 4  32  ? 92.967  -40.974  21.456  1.00 0.00 ? 72   A   D "O2'" 1 
ATOM 5087  C "C1'" . A   D 4  32  ? 95.207  -40.494  20.770  1.00 0.00 ? 72   A   D "C1'" 1 
ATOM 5088  N N9    . A   D 4  32  ? 96.083  -39.327  20.485  1.00 0.00 ? 72   A   D N9    1 
ATOM 5089  C C8    . A   D 4  32  ? 96.803  -39.062  19.343  1.00 0.00 ? 72   A   D C8    1 
ATOM 5090  N N7    . A   D 4  32  ? 97.457  -37.932  19.383  1.00 0.00 ? 72   A   D N7    1 
ATOM 5091  C C5    . A   D 4  32  ? 97.175  -37.395  20.604  1.00 0.00 ? 72   A   D C5    1 
ATOM 5092  C C6    . A   D 4  32  ? 97.579  -36.172  21.173  1.00 0.00 ? 72   A   D C6    1 
ATOM 5093  N N6    . A   D 4  32  ? 98.410  -35.331  20.478  1.00 0.00 ? 72   A   D N6    1 
ATOM 5094  N N1    . A   D 4  32  ? 97.075  -35.924  22.424  1.00 0.00 ? 72   A   D N1    1 
ATOM 5095  C C2    . A   D 4  32  ? 96.262  -36.827  22.988  1.00 0.00 ? 72   A   D C2    1 
ATOM 5096  N N3    . A   D 4  32  ? 95.835  -38.014  22.530  1.00 0.00 ? 72   A   D N3    1 
ATOM 5097  C C4    . A   D 4  32  ? 96.319  -38.245  21.304  1.00 0.00 ? 72   A   D C4    1 
ATOM 5098  P P     . U   D 4  33  ? 91.329  -39.354  18.509  1.00 0.00 ? 73   U   D P     1 
ATOM 5099  O OP1   . U   D 4  33  ? 90.335  -39.596  17.443  1.00 0.00 ? 73   U   D OP1   1 
ATOM 5100  O OP2   . U   D 4  33  ? 92.244  -38.206  18.323  1.00 0.00 ? 73   U   D OP2   1 
ATOM 5101  O "O5'" . U   D 4  33  ? 90.590  -39.221  19.901  1.00 0.00 ? 73   U   D "O5'" 1 
ATOM 5102  C "C5'" . U   D 4  33  ? 89.768  -38.062  20.082  1.00 0.00 ? 73   U   D "C5'" 1 
ATOM 5103  C "C4'" . U   D 4  33  ? 89.580  -37.766  21.572  1.00 0.00 ? 73   U   D "C4'" 1 
ATOM 5104  O "O4'" . U   D 4  33  ? 90.817  -37.911  22.325  1.00 0.00 ? 73   U   D "O4'" 1 
ATOM 5105  C "C3'" . U   D 4  33  ? 89.187  -36.309  21.737  1.00 0.00 ? 73   U   D "C3'" 1 
ATOM 5106  O "O3'" . U   D 4  33  ? 87.759  -36.246  21.754  1.00 0.00 ? 73   U   D "O3'" 1 
ATOM 5107  C "C2'" . U   D 4  33  ? 89.883  -35.883  23.015  1.00 0.00 ? 73   U   D "C2'" 1 
ATOM 5108  O "O2'" . U   D 4  33  ? 89.150  -36.258  24.155  1.00 0.00 ? 73   U   D "O2'" 1 
ATOM 5109  C "C1'" . U   D 4  33  ? 91.170  -36.679  22.933  1.00 0.00 ? 73   U   D "C1'" 1 
ATOM 5110  N N1    . U   D 4  33  ? 92.274  -35.949  22.201  1.00 0.00 ? 73   U   D N1    1 
ATOM 5111  C C2    . U   D 4  33  ? 92.877  -34.872  22.830  1.00 0.00 ? 73   U   D C2    1 
ATOM 5112  O O2    . U   D 4  33  ? 92.558  -34.516  23.963  1.00 0.00 ? 73   U   D O2    1 
ATOM 5113  N N3    . U   D 4  33  ? 93.884  -34.245  22.086  1.00 0.00 ? 73   U   D N3    1 
ATOM 5114  C C4    . U   D 4  33  ? 94.395  -34.645  20.839  1.00 0.00 ? 73   U   D C4    1 
ATOM 5115  O O4    . U   D 4  33  ? 95.275  -33.994  20.265  1.00 0.00 ? 73   U   D O4    1 
ATOM 5116  C C5    . U   D 4  33  ? 93.807  -35.857  20.339  1.00 0.00 ? 73   U   D C5    1 
ATOM 5117  C C6    . U   D 4  33  ? 92.787  -36.429  21.005  1.00 0.00 ? 73   U   D C6    1 
ATOM 5118  P P     . U   D 4  34  ? 87.006  -35.328  20.712  1.00 0.00 ? 74   U   D P     1 
ATOM 5119  O OP1   . U   D 4  34  ? 85.575  -35.702  20.686  1.00 0.00 ? 74   U   D OP1   1 
ATOM 5120  O OP2   . U   D 4  34  ? 87.728  -35.311  19.420  1.00 0.00 ? 74   U   D OP2   1 
ATOM 5121  O "O5'" . U   D 4  34  ? 87.159  -33.933  21.429  1.00 0.00 ? 74   U   D "O5'" 1 
ATOM 5122  C "C5'" . U   D 4  34  ? 86.513  -33.805  22.710  1.00 0.00 ? 74   U   D "C5'" 1 
ATOM 5123  C "C4'" . U   D 4  34  ? 86.834  -32.436  23.285  1.00 0.00 ? 74   U   D "C4'" 1 
ATOM 5124  O "O4'" . U   D 4  34  ? 88.211  -32.345  23.701  1.00 0.00 ? 74   U   D "O4'" 1 
ATOM 5125  C "C3'" . U   D 4  34  ? 86.682  -31.272  22.314  1.00 0.00 ? 74   U   D "C3'" 1 
ATOM 5126  O "O3'" . U   D 4  34  ? 85.292  -31.039  22.123  1.00 0.00 ? 74   U   D "O3'" 1 
ATOM 5127  C "C2'" . U   D 4  34  ? 87.462  -30.196  23.054  1.00 0.00 ? 74   U   D "C2'" 1 
ATOM 5128  O "O2'" . U   D 4  34  ? 86.711  -29.679  24.128  1.00 0.00 ? 74   U   D "O2'" 1 
ATOM 5129  C "C1'" . U   D 4  34  ? 88.642  -30.994  23.595  1.00 0.00 ? 74   U   D "C1'" 1 
ATOM 5130  N N1    . U   D 4  34  ? 89.879  -30.845  22.762  1.00 0.00 ? 74   U   D N1    1 
ATOM 5131  C C2    . U   D 4  34  ? 90.788  -29.844  23.096  1.00 0.00 ? 74   U   D C2    1 
ATOM 5132  O O2    . U   D 4  34  ? 90.597  -29.061  24.027  1.00 0.00 ? 74   U   D O2    1 
ATOM 5133  N N3    . U   D 4  34  ? 91.935  -29.808  22.295  1.00 0.00 ? 74   U   D N3    1 
ATOM 5134  C C4    . U   D 4  34  ? 92.259  -30.668  21.230  1.00 0.00 ? 74   U   D C4    1 
ATOM 5135  O O4    . U   D 4  34  ? 93.337  -30.581  20.636  1.00 0.00 ? 74   U   D O4    1 
ATOM 5136  C C5    . U   D 4  34  ? 91.221  -31.619  20.919  1.00 0.00 ? 74   U   D C5    1 
ATOM 5137  C C6    . U   D 4  34  ? 90.102  -31.658  21.664  1.00 0.00 ? 74   U   D C6    1 
ATOM 5138  P P     . G   D 4  35  ? 84.736  -29.998  21.075  1.00 0.00 ? 75   G   D P     1 
ATOM 5139  O OP1   . G   D 4  35  ? 85.423  -28.703  21.268  1.00 0.00 ? 75   G   D OP1   1 
ATOM 5140  O OP2   . G   D 4  35  ? 83.260  -29.999  21.187  1.00 0.00 ? 75   G   D OP2   1 
ATOM 5141  O "O5'" . G   D 4  35  ? 85.137  -30.560  19.655  1.00 0.00 ? 75   G   D "O5'" 1 
ATOM 5142  C "C5'" . G   D 4  35  ? 85.234  -31.941  19.301  1.00 0.00 ? 75   G   D "C5'" 1 
ATOM 5143  C "C4'" . G   D 4  35  ? 84.844  -32.148  17.826  1.00 0.00 ? 75   G   D "C4'" 1 
ATOM 5144  O "O4'" . G   D 4  35  ? 83.413  -31.970  17.698  1.00 0.00 ? 75   G   D "O4'" 1 
ATOM 5145  C "C3'" . G   D 4  35  ? 85.449  -31.135  16.836  1.00 0.00 ? 75   G   D "C3'" 1 
ATOM 5146  O "O3'" . G   D 4  35  ? 86.587  -31.714  16.190  1.00 0.00 ? 75   G   D "O3'" 1 
ATOM 5147  C "C2'" . G   D 4  35  ? 84.306  -30.777  15.888  1.00 0.00 ? 75   G   D "C2'" 1 
ATOM 5148  O "O2'" . G   D 4  35  ? 84.231  -31.685  14.811  1.00 0.00 ? 75   G   D "O2'" 1 
ATOM 5149  C "C1'" . G   D 4  35  ? 83.086  -30.965  16.759  1.00 0.00 ? 75   G   D "C1'" 1 
ATOM 5150  N N9    . G   D 4  35  ? 82.534  -29.734  17.428  1.00 0.00 ? 75   G   D N9    1 
ATOM 5151  C C8    . G   D 4  35  ? 81.765  -29.836  18.571  1.00 0.00 ? 75   G   D C8    1 
ATOM 5152  N N7    . G   D 4  35  ? 81.316  -28.701  19.019  1.00 0.00 ? 75   G   D N7    1 
ATOM 5153  C C5    . G   D 4  35  ? 81.759  -27.780  18.121  1.00 0.00 ? 75   G   D C5    1 
ATOM 5154  C C6    . G   D 4  35  ? 81.472  -26.407  18.093  1.00 0.00 ? 75   G   D C6    1 
ATOM 5155  O O6    . G   D 4  35  ? 80.801  -25.807  18.934  1.00 0.00 ? 75   G   D O6    1 
ATOM 5156  N N1    . G   D 4  35  ? 82.056  -25.806  16.964  1.00 0.00 ? 75   G   D N1    1 
ATOM 5157  C C2    . G   D 4  35  ? 82.828  -26.448  15.992  1.00 0.00 ? 75   G   D C2    1 
ATOM 5158  N N2    . G   D 4  35  ? 83.259  -25.649  14.974  1.00 0.00 ? 75   G   D N2    1 
ATOM 5159  N N3    . G   D 4  35  ? 83.077  -27.785  16.042  1.00 0.00 ? 75   G   D N3    1 
ATOM 5160  C C4    . G   D 4  35  ? 82.521  -28.380  17.115  1.00 0.00 ? 75   G   D C4    1 
ATOM 5161  P P     . C   D 4  36  ? 88.055  -31.150  16.342  1.00 0.00 ? 76   C   D P     1 
ATOM 5162  O OP1   . C   D 4  36  ? 88.983  -32.088  15.677  1.00 0.00 ? 76   C   D OP1   1 
ATOM 5163  O OP2   . C   D 4  36  ? 88.307  -30.817  17.764  1.00 0.00 ? 76   C   D OP2   1 
ATOM 5164  O "O5'" . C   D 4  36  ? 88.029  -29.820  15.487  1.00 0.00 ? 76   C   D "O5'" 1 
ATOM 5165  C "C5'" . C   D 4  36  ? 87.891  -29.907  14.059  1.00 0.00 ? 76   C   D "C5'" 1 
ATOM 5166  C "C4'" . C   D 4  36  ? 87.662  -28.514  13.464  1.00 0.00 ? 76   C   D "C4'" 1 
ATOM 5167  O "O4'" . C   D 4  36  ? 86.343  -28.022  13.824  1.00 0.00 ? 76   C   D "O4'" 1 
ATOM 5168  C "C3'" . C   D 4  36  ? 88.623  -27.427  13.968  1.00 0.00 ? 76   C   D "C3'" 1 
ATOM 5169  O "O3'" . C   D 4  36  ? 89.812  -27.461  13.195  1.00 0.00 ? 76   C   D "O3'" 1 
ATOM 5170  C "C2'" . C   D 4  36  ? 87.799  -26.169  13.814  1.00 0.00 ? 76   C   D "C2'" 1 
ATOM 5171  O "O2'" . C   D 4  36  ? 87.741  -25.737  12.476  1.00 0.00 ? 76   C   D "O2'" 1 
ATOM 5172  C "C1'" . C   D 4  36  ? 86.448  -26.667  14.267  1.00 0.00 ? 76   C   D "C1'" 1 
ATOM 5173  N N1    . C   D 4  36  ? 86.276  -26.511  15.753  1.00 0.00 ? 76   C   D N1    1 
ATOM 5174  C C2    . C   D 4  36  ? 86.138  -25.242  16.334  1.00 0.00 ? 76   C   D C2    1 
ATOM 5175  O O2    . C   D 4  36  ? 86.116  -24.239  15.597  1.00 0.00 ? 76   C   D O2    1 
ATOM 5176  N N3    . C   D 4  36  ? 86.031  -25.161  17.694  1.00 0.00 ? 76   C   D N3    1 
ATOM 5177  C C4    . C   D 4  36  ? 86.066  -26.275  18.474  1.00 0.00 ? 76   C   D C4    1 
ATOM 5178  N N4    . C   D 4  36  ? 86.133  -26.215  19.825  1.00 0.00 ? 76   C   D N4    1 
ATOM 5179  C C5    . C   D 4  36  ? 86.087  -27.568  17.882  1.00 0.00 ? 76   C   D C5    1 
ATOM 5180  C C6    . C   D 4  36  ? 86.198  -27.634  16.555  1.00 0.00 ? 76   C   D C6    1 
ATOM 5181  P P     . A   D 4  37  ? 91.183  -26.978  13.813  1.00 0.00 ? 77   A   D P     1 
ATOM 5182  O OP1   . A   D 4  37  ? 92.274  -27.323  12.880  1.00 0.00 ? 77   A   D OP1   1 
ATOM 5183  O OP2   . A   D 4  37  ? 91.311  -27.485  15.199  1.00 0.00 ? 77   A   D OP2   1 
ATOM 5184  O "O5'" . A   D 4  37  ? 91.023  -25.407  13.867  1.00 0.00 ? 77   A   D "O5'" 1 
ATOM 5185  C "C5'" . A   D 4  37  ? 91.359  -24.662  12.686  1.00 0.00 ? 77   A   D "C5'" 1 
ATOM 5186  C "C4'" . A   D 4  37  ? 91.149  -23.164  12.925  1.00 0.00 ? 77   A   D "C4'" 1 
ATOM 5187  O "O4'" . A   D 4  37  ? 89.770  -22.941  13.295  1.00 0.00 ? 77   A   D "O4'" 1 
ATOM 5188  C "C3'" . A   D 4  37  ? 91.938  -22.482  14.059  1.00 0.00 ? 77   A   D "C3'" 1 
ATOM 5189  O "O3'" . A   D 4  37  ? 93.242  -22.120  13.605  1.00 0.00 ? 77   A   D "O3'" 1 
ATOM 5190  C "C2'" . A   D 4  37  ? 91.064  -21.278  14.347  1.00 0.00 ? 77   A   D "C2'" 1 
ATOM 5191  O "O2'" . A   D 4  37  ? 91.237  -20.249  13.399  1.00 0.00 ? 77   A   D "O2'" 1 
ATOM 5192  C "C1'" . A   D 4  37  ? 89.699  -21.880  14.217  1.00 0.00 ? 77   A   D "C1'" 1 
ATOM 5193  N N9    . A   D 4  37  ? 89.184  -22.312  15.521  1.00 0.00 ? 77   A   D N9    1 
ATOM 5194  C C8    . A   D 4  37  ? 89.364  -23.473  16.243  1.00 0.00 ? 77   A   D C8    1 
ATOM 5195  N N7    . A   D 4  37  ? 88.697  -23.494  17.366  1.00 0.00 ? 77   A   D N7    1 
ATOM 5196  C C5    . A   D 4  37  ? 88.029  -22.301  17.400  1.00 0.00 ? 77   A   D C5    1 
ATOM 5197  C C6    . A   D 4  37  ? 87.081  -21.795  18.310  1.00 0.00 ? 77   A   D C6    1 
ATOM 5198  N N6    . A   D 4  37  ? 86.563  -22.567  19.310  1.00 0.00 ? 77   A   D N6    1 
ATOM 5199  N N1    . A   D 4  37  ? 86.716  -20.496  18.094  1.00 0.00 ? 77   A   D N1    1 
ATOM 5200  C C2    . A   D 4  37  ? 87.213  -19.844  17.033  1.00 0.00 ? 77   A   D C2    1 
ATOM 5201  N N3    . A   D 4  37  ? 87.981  -20.285  16.037  1.00 0.00 ? 77   A   D N3    1 
ATOM 5202  C C4    . A   D 4  37  ? 88.367  -21.540  16.284  1.00 0.00 ? 77   A   D C4    1 
ATOM 5203  P P     . G   D 4  38  ? 94.538  -22.741  14.244  1.00 0.00 ? 78   G   D P     1 
ATOM 5204  O OP1   . G   D 4  38  ? 95.698  -22.289  13.448  1.00 0.00 ? 78   G   D OP1   1 
ATOM 5205  O OP2   . G   D 4  38  ? 94.338  -24.199  14.396  1.00 0.00 ? 78   G   D OP2   1 
ATOM 5206  O "O5'" . G   D 4  38  ? 94.611  -22.079  15.679  1.00 0.00 ? 78   G   D "O5'" 1 
ATOM 5207  C "C5'" . G   D 4  38  ? 94.569  -20.652  15.832  1.00 0.00 ? 78   G   D "C5'" 1 
ATOM 5208  C "C4'" . G   D 4  38  ? 93.917  -20.263  17.167  1.00 0.00 ? 78   G   D "C4'" 1 
ATOM 5209  O "O4'" . G   D 4  38  ? 92.697  -21.011  17.364  1.00 0.00 ? 78   G   D "O4'" 1 
ATOM 5210  C "C3'" . G   D 4  38  ? 94.778  -20.561  18.391  1.00 0.00 ? 78   G   D "C3'" 1 
ATOM 5211  O "O3'" . G   D 4  38  ? 95.636  -19.445  18.634  1.00 0.00 ? 78   G   D "O3'" 1 
ATOM 5212  C "C2'" . G   D 4  38  ? 93.733  -20.844  19.470  1.00 0.00 ? 78   G   D "C2'" 1 
ATOM 5213  O "O2'" . G   D 4  38  ? 93.276  -19.661  20.071  1.00 0.00 ? 78   G   D "O2'" 1 
ATOM 5214  C "C1'" . G   D 4  38  ? 92.596  -21.448  18.692  1.00 0.00 ? 78   G   D "C1'" 1 
ATOM 5215  N N9    . G   D 4  38  ? 92.502  -22.925  18.810  1.00 0.00 ? 78   G   D N9    1 
ATOM 5216  C C8    . G   D 4  38  ? 92.649  -23.859  17.806  1.00 0.00 ? 78   G   D C8    1 
ATOM 5217  N N7    . G   D 4  38  ? 92.442  -25.081  18.204  1.00 0.00 ? 78   G   D N7    1 
ATOM 5218  C C5    . G   D 4  38  ? 92.114  -24.960  19.530  1.00 0.00 ? 78   G   D C5    1 
ATOM 5219  C C6    . G   D 4  38  ? 91.653  -25.964  20.407  1.00 0.00 ? 78   G   D C6    1 
ATOM 5220  O O6    . G   D 4  38  ? 91.546  -27.159  20.112  1.00 0.00 ? 78   G   D O6    1 
ATOM 5221  N N1    . G   D 4  38  ? 91.348  -25.410  21.672  1.00 0.00 ? 78   G   D N1    1 
ATOM 5222  C C2    . G   D 4  38  ? 91.462  -24.058  22.036  1.00 0.00 ? 78   G   D C2    1 
ATOM 5223  N N2    . G   D 4  38  ? 91.083  -23.749  23.315  1.00 0.00 ? 78   G   D N2    1 
ATOM 5224  N N3    . G   D 4  38  ? 91.904  -23.126  21.153  1.00 0.00 ? 78   G   D N3    1 
ATOM 5225  C C4    . G   D 4  38  ? 92.175  -23.637  19.938  1.00 0.00 ? 78   G   D C4    1 
ATOM 5226  P P     . A   D 4  39  ? 96.780  -19.456  19.727  1.00 0.00 ? 79   A   D P     1 
ATOM 5227  O OP1   . A   D 4  39  ? 97.492  -18.159  19.672  1.00 0.00 ? 79   A   D OP1   1 
ATOM 5228  O OP2   . A   D 4  39  ? 97.586  -20.681  19.550  1.00 0.00 ? 79   A   D OP2   1 
ATOM 5229  O "O5'" . A   D 4  39  ? 95.990  -19.535  21.094  1.00 0.00 ? 79   A   D "O5'" 1 
ATOM 5230  C "C5'" . A   D 4  39  ? 96.668  -19.854  22.317  1.00 0.00 ? 79   A   D "C5'" 1 
ATOM 5231  C "C4'" . A   D 4  39  ? 95.740  -20.520  23.355  1.00 0.00 ? 79   A   D "C4'" 1 
ATOM 5232  O "O4'" . A   D 4  39  ? 94.623  -21.204  22.729  1.00 0.00 ? 79   A   D "O4'" 1 
ATOM 5233  C "C3'" . A   D 4  39  ? 96.406  -21.621  24.189  1.00 0.00 ? 79   A   D "C3'" 1 
ATOM 5234  O "O3'" . A   D 4  39  ? 97.122  -21.043  25.293  1.00 0.00 ? 79   A   D "O3'" 1 
ATOM 5235  C "C2'" . A   D 4  39  ? 95.221  -22.467  24.602  1.00 0.00 ? 79   A   D "C2'" 1 
ATOM 5236  O "O2'" . A   D 4  39  ? 94.471  -21.852  25.621  1.00 0.00 ? 79   A   D "O2'" 1 
ATOM 5237  C "C1'" . A   D 4  39  ? 94.431  -22.464  23.340  1.00 0.00 ? 79   A   D "C1'" 1 
ATOM 5238  N N9    . A   D 4  39  ? 94.804  -23.586  22.454  1.00 0.00 ? 79   A   D N9    1 
ATOM 5239  C C8    . A   D 4  39  ? 95.426  -23.538  21.228  1.00 0.00 ? 79   A   D C8    1 
ATOM 5240  N N7    . A   D 4  39  ? 95.541  -24.705  20.661  1.00 0.00 ? 79   A   D N7    1 
ATOM 5241  C C5    . A   D 4  39  ? 94.970  -25.591  21.526  1.00 0.00 ? 79   A   D C5    1 
ATOM 5242  C C6    . A   D 4  39  ? 94.737  -26.969  21.385  1.00 0.00 ? 79   A   D C6    1 
ATOM 5243  N N6    . A   D 4  39  ? 95.163  -27.602  20.248  1.00 0.00 ? 79   A   D N6    1 
ATOM 5244  N N1    . A   D 4  39  ? 94.086  -27.560  22.440  1.00 0.00 ? 79   A   D N1    1 
ATOM 5245  C C2    . A   D 4  39  ? 93.724  -26.800  23.487  1.00 0.00 ? 79   A   D C2    1 
ATOM 5246  N N3    . A   D 4  39  ? 93.905  -25.490  23.707  1.00 0.00 ? 79   A   D N3    1 
ATOM 5247  C C4    . A   D 4  39  ? 94.519  -24.920  22.659  1.00 0.00 ? 79   A   D C4    1 
ATOM 5248  P P     . A   D 4  40  ? 98.365  -21.875  25.827  1.00 0.00 ? 80   A   D P     1 
ATOM 5249  O OP1   . A   D 4  40  ? 98.884  -21.249  27.062  1.00 0.00 ? 80   A   D OP1   1 
ATOM 5250  O OP2   . A   D 4  40  ? 99.300  -22.033  24.699  1.00 0.00 ? 80   A   D OP2   1 
ATOM 5251  O "O5'" . A   D 4  40  ? 97.735  -23.279  26.204  1.00 0.00 ? 80   A   D "O5'" 1 
ATOM 5252  C "C5'" . A   D 4  40  ? 98.535  -24.462  26.101  1.00 0.00 ? 80   A   D "C5'" 1 
ATOM 5253  C "C4'" . A   D 4  40  ? 97.651  -25.657  26.445  1.00 0.00 ? 80   A   D "C4'" 1 
ATOM 5254  O "O4'" . A   D 4  40  ? 96.760  -25.995  25.356  1.00 0.00 ? 80   A   D "O4'" 1 
ATOM 5255  C "C3'" . A   D 4  40  ? 98.338  -26.985  26.747  1.00 0.00 ? 80   A   D "C3'" 1 
ATOM 5256  O "O3'" . A   D 4  40  ? 98.976  -26.933  28.027  1.00 0.00 ? 80   A   D "O3'" 1 
ATOM 5257  C "C2'" . A   D 4  40  ? 97.131  -27.905  26.683  1.00 0.00 ? 80   A   D "C2'" 1 
ATOM 5258  O "O2'" . A   D 4  40  ? 96.319  -27.796  27.826  1.00 0.00 ? 80   A   D "O2'" 1 
ATOM 5259  C "C1'" . A   D 4  40  ? 96.399  -27.361  25.490  1.00 0.00 ? 80   A   D "C1'" 1 
ATOM 5260  N N9    . A   D 4  40  ? 96.696  -28.172  24.313  1.00 0.00 ? 80   A   D N9    1 
ATOM 5261  C C8    . A   D 4  40  ? 97.589  -27.984  23.288  1.00 0.00 ? 80   A   D C8    1 
ATOM 5262  N N7    . A   D 4  40  ? 97.598  -28.972  22.435  1.00 0.00 ? 80   A   D N7    1 
ATOM 5263  C C5    . A   D 4  40  ? 96.675  -29.869  22.901  1.00 0.00 ? 80   A   D C5    1 
ATOM 5264  C C6    . A   D 4  40  ? 96.284  -31.125  22.406  1.00 0.00 ? 80   A   D C6    1 
ATOM 5265  N N6    . A   D 4  40  ? 96.887  -31.631  21.289  1.00 0.00 ? 80   A   D N6    1 
ATOM 5266  N N1    . A   D 4  40  ? 95.313  -31.767  23.136  1.00 0.00 ? 80   A   D N1    1 
ATOM 5267  C C2    . A   D 4  40  ? 94.831  -31.176  24.238  1.00 0.00 ? 80   A   D C2    1 
ATOM 5268  N N3    . A   D 4  40  ? 95.165  -30.006  24.797  1.00 0.00 ? 80   A   D N3    1 
ATOM 5269  C C4    . A   D 4  40  ? 96.114  -29.393  24.075  1.00 0.00 ? 80   A   D C4    1 
ATOM 5270  P P     . U   D 4  41  ? 100.051 -28.046  28.389  1.00 0.00 ? 81   U   D P     1 
ATOM 5271  O OP1   . U   D 4  41  ? 100.603 -27.737  29.729  1.00 0.00 ? 81   U   D OP1   1 
ATOM 5272  O OP2   . U   D 4  41  ? 101.018 -28.164  27.274  1.00 0.00 ? 81   U   D OP2   1 
ATOM 5273  O "O5'" . U   D 4  41  ? 99.217  -29.392  28.469  1.00 0.00 ? 81   U   D "O5'" 1 
ATOM 5274  C "C5'" . U   D 4  41  ? 98.393  -29.644  29.612  1.00 0.00 ? 81   U   D "C5'" 1 
ATOM 5275  C "C4'" . U   D 4  41  ? 97.527  -30.898  29.396  1.00 0.00 ? 81   U   D "C4'" 1 
ATOM 5276  O "O4'" . U   D 4  41  ? 96.818  -30.863  28.122  1.00 0.00 ? 81   U   D "O4'" 1 
ATOM 5277  C "C3'" . U   D 4  41  ? 98.285  -32.219  29.320  1.00 0.00 ? 81   U   D "C3'" 1 
ATOM 5278  O "O3'" . U   D 4  41  ? 98.662  -32.644  30.635  1.00 0.00 ? 81   U   D "O3'" 1 
ATOM 5279  C "C2'" . U   D 4  41  ? 97.258  -33.106  28.652  1.00 0.00 ? 81   U   D "C2'" 1 
ATOM 5280  O "O2'" . U   D 4  41  ? 96.215  -33.457  29.528  1.00 0.00 ? 81   U   D "O2'" 1 
ATOM 5281  C "C1'" . U   D 4  41  ? 96.734  -32.182  27.579  1.00 0.00 ? 81   U   D "C1'" 1 
ATOM 5282  N N1    . U   D 4  41  ? 97.489  -32.355  26.284  1.00 0.00 ? 81   U   D N1    1 
ATOM 5283  C C2    . U   D 4  41  ? 97.204  -33.482  25.515  1.00 0.00 ? 81   U   D C2    1 
ATOM 5284  O O2    . U   D 4  41  ? 96.358  -34.313  25.847  1.00 0.00 ? 81   U   D O2    1 
ATOM 5285  N N3    . U   D 4  41  ? 97.965  -33.601  24.345  1.00 0.00 ? 81   U   D N3    1 
ATOM 5286  C C4    . U   D 4  41  ? 98.946  -32.713  23.875  1.00 0.00 ? 81   U   D C4    1 
ATOM 5287  O O4    . U   D 4  41  ? 99.513  -32.896  22.798  1.00 0.00 ? 81   U   D O4    1 
ATOM 5288  C C5    . U   D 4  41  ? 99.152  -31.575  24.734  1.00 0.00 ? 81   U   D C5    1 
ATOM 5289  C C6    . U   D 4  41  ? 98.455  -31.456  25.876  1.00 0.00 ? 81   U   D C6    1 
ATOM 5290  P P     . U   D 4  42  ? 100.108 -33.242  30.884  1.00 0.00 ? 82   U   D P     1 
ATOM 5291  O OP1   . U   D 4  42  ? 100.340 -33.314  32.344  1.00 0.00 ? 82   U   D OP1   1 
ATOM 5292  O OP2   . U   D 4  42  ? 101.103 -32.493  30.085  1.00 0.00 ? 82   U   D OP2   1 
ATOM 5293  O "O5'" . U   D 4  42  ? 99.972  -34.718  30.328  1.00 0.00 ? 82   U   D "O5'" 1 
ATOM 5294  C "C5'" . U   D 4  42  ? 100.376 -35.045  28.997  1.00 0.00 ? 82   U   D "C5'" 1 
ATOM 5295  C "C4'" . U   D 4  42  ? 99.596  -36.281  28.544  1.00 0.00 ? 82   U   D "C4'" 1 
ATOM 5296  O "O4'" . U   D 4  42  ? 98.819  -35.985  27.356  1.00 0.00 ? 82   U   D "O4'" 1 
ATOM 5297  C "C3'" . U   D 4  42  ? 100.448 -37.485  28.151  1.00 0.00 ? 82   U   D "C3'" 1 
ATOM 5298  O "O3'" . U   D 4  42  ? 100.780 -38.235  29.318  1.00 0.00 ? 82   U   D "O3'" 1 
ATOM 5299  C "C2'" . U   D 4  42  ? 99.525  -38.217  27.191  1.00 0.00 ? 82   U   D "C2'" 1 
ATOM 5300  O "O2'" . U   D 4  42  ? 98.529  -38.933  27.879  1.00 0.00 ? 82   U   D "O2'" 1 
ATOM 5301  C "C1'" . U   D 4  42  ? 98.906  -37.063  26.439  1.00 0.00 ? 82   U   D "C1'" 1 
ATOM 5302  N N1    . U   D 4  42  ? 99.689  -36.715  25.208  1.00 0.00 ? 82   U   D N1    1 
ATOM 5303  C C2    . U   D 4  42  ? 99.523  -37.506  24.072  1.00 0.00 ? 82   U   D C2    1 
ATOM 5304  O O2    . U   D 4  42  ? 98.788  -38.492  24.061  1.00 0.00 ? 82   U   D O2    1 
ATOM 5305  N N3    . U   D 4  42  ? 100.257 -37.087  22.954  1.00 0.00 ? 82   U   D N3    1 
ATOM 5306  C C4    . U   D 4  42  ? 101.105 -35.966  22.867  1.00 0.00 ? 82   U   D C4    1 
ATOM 5307  O O4    . U   D 4  42  ? 101.619 -35.627  21.801  1.00 0.00 ? 82   U   D O4    1 
ATOM 5308  C C5    . U   D 4  42  ? 101.278 -35.272  24.118  1.00 0.00 ? 82   U   D C5    1 
ATOM 5309  C C6    . U   D 4  42  ? 100.600 -35.668  25.206  1.00 0.00 ? 82   U   D C6    1 
ATOM 5310  P P     . C   D 4  43  ? 102.278 -38.485  29.752  1.00 0.00 ? 83   C   D P     1 
ATOM 5311  O OP1   . C   D 4  43  ? 102.285 -38.935  31.163  1.00 0.00 ? 83   C   D OP1   1 
ATOM 5312  O OP2   . C   D 4  43  ? 103.110 -37.306  29.416  1.00 0.00 ? 83   C   D OP2   1 
ATOM 5313  O "O5'" . C   D 4  43  ? 102.675 -39.709  28.836  1.00 0.00 ? 83   C   D "O5'" 1 
ATOM 5314  C "C5'" . C   D 4  43  ? 103.333 -39.527  27.579  1.00 0.00 ? 83   C   D "C5'" 1 
ATOM 5315  C "C4'" . C   D 4  43  ? 102.777 -40.547  26.586  1.00 0.00 ? 83   C   D "C4'" 1 
ATOM 5316  O "O4'" . C   D 4  43  ? 101.964 -39.910  25.586  1.00 0.00 ? 83   C   D "O4'" 1 
ATOM 5317  C "C3'" . C   D 4  43  ? 103.793 -41.329  25.770  1.00 0.00 ? 83   C   D "C3'" 1 
ATOM 5318  O "O3'" . C   D 4  43  ? 104.399 -42.320  26.598  1.00 0.00 ? 83   C   D "O3'" 1 
ATOM 5319  C "C2'" . C   D 4  43  ? 102.906 -41.859  24.640  1.00 0.00 ? 83   C   D "C2'" 1 
ATOM 5320  O "O2'" . C   D 4  43  ? 102.198 -43.013  25.026  1.00 0.00 ? 83   C   D "O2'" 1 
ATOM 5321  C "C1'" . C   D 4  43  ? 101.923 -40.719  24.427  1.00 0.00 ? 83   C   D "C1'" 1 
ATOM 5322  N N1    . C   D 4  43  ? 102.192 -39.952  23.180  1.00 0.00 ? 83   C   D N1    1 
ATOM 5323  C C2    . C   D 4  43  ? 103.215 -39.002  23.006  1.00 0.00 ? 83   C   D C2    1 
ATOM 5324  O O2    . C   D 4  43  ? 103.978 -38.729  23.954  1.00 0.00 ? 83   C   D O2    1 
ATOM 5325  N N3    . C   D 4  43  ? 103.336 -38.387  21.797  1.00 0.00 ? 83   C   D N3    1 
ATOM 5326  C C4    . C   D 4  43  ? 102.494 -38.669  20.767  1.00 0.00 ? 83   C   D C4    1 
ATOM 5327  N N4    . C   D 4  43  ? 102.572 -37.990  19.587  1.00 0.00 ? 83   C   D N4    1 
ATOM 5328  C C5    . C   D 4  43  ? 101.487 -39.684  20.928  1.00 0.00 ? 83   C   D C5    1 
ATOM 5329  C C6    . C   D 4  43  ? 101.372 -40.285  22.122  1.00 0.00 ? 83   C   D C6    1 
ATOM 5330  P P     . C   D 4  44  ? 105.674 -43.096  26.076  1.00 0.00 ? 84   C   D P     1 
ATOM 5331  O OP1   . C   D 4  44  ? 106.790 -42.860  27.018  1.00 0.00 ? 84   C   D OP1   1 
ATOM 5332  O OP2   . C   D 4  44  ? 105.918 -42.789  24.648  1.00 0.00 ? 84   C   D OP2   1 
ATOM 5333  O "O5'" . C   D 4  44  ? 105.191 -44.598  26.215  1.00 0.00 ? 84   C   D "O5'" 1 
ATOM 5334  C "C5'" . C   D 4  44  ? 106.144 -45.598  25.838  1.00 0.00 ? 84   C   D "C5'" 1 
ATOM 5335  C "C4'" . C   D 4  44  ? 105.581 -46.965  26.210  1.00 0.00 ? 84   C   D "C4'" 1 
ATOM 5336  O "O4'" . C   D 4  44  ? 106.531 -47.974  25.786  1.00 0.00 ? 84   C   D "O4'" 1 
ATOM 5337  C "C3'" . C   D 4  44  ? 105.437 -47.235  27.710  1.00 0.00 ? 84   C   D "C3'" 1 
ATOM 5338  O "O3'" . C   D 4  44  ? 104.520 -48.315  27.941  1.00 0.00 ? 84   C   D "O3'" 1 
ATOM 5339  C "C2'" . C   D 4  44  ? 106.866 -47.594  28.075  1.00 0.00 ? 84   C   D "C2'" 1 
ATOM 5340  O "O2'" . C   D 4  44  ? 106.944 -48.285  29.293  1.00 0.00 ? 84   C   D "O2'" 1 
ATOM 5341  C "C1'" . C   D 4  44  ? 107.240 -48.475  26.903  1.00 0.00 ? 84   C   D "C1'" 1 
ATOM 5342  N N1    . C   D 4  44  ? 108.699 -48.575  26.627  1.00 0.00 ? 84   C   D N1    1 
ATOM 5343  C C2    . C   D 4  44  ? 109.220 -49.740  26.038  1.00 0.00 ? 84   C   D C2    1 
ATOM 5344  O O2    . C   D 4  44  ? 108.454 -50.679  25.764  1.00 0.00 ? 84   C   D O2    1 
ATOM 5345  N N3    . C   D 4  44  ? 110.565 -49.794  25.786  1.00 0.00 ? 84   C   D N3    1 
ATOM 5346  C C4    . C   D 4  44  ? 111.378 -48.729  26.043  1.00 0.00 ? 84   C   D C4    1 
ATOM 5347  N N4    . C   D 4  44  ? 112.714 -48.757  25.772  1.00 0.00 ? 84   C   D N4    1 
ATOM 5348  C C5    . C   D 4  44  ? 110.827 -47.529  26.599  1.00 0.00 ? 84   C   D C5    1 
ATOM 5349  C C6    . C   D 4  44  ? 109.510 -47.489  26.848  1.00 0.00 ? 84   C   D C6    1 
ATOM 5350  P P     . G   D 4  45  ? 103.150 -48.104  28.686  1.00 0.00 ? 85   G   D P     1 
ATOM 5351  O OP1   . G   D 4  45  ? 102.403 -49.382  28.664  1.00 0.00 ? 85   G   D OP1   1 
ATOM 5352  O OP2   . G   D 4  45  ? 102.472 -46.910  28.131  1.00 0.00 ? 85   G   D OP2   1 
ATOM 5353  O "O5'" . G   D 4  45  ? 103.654 -47.816  30.162  1.00 0.00 ? 85   G   D "O5'" 1 
ATOM 5354  C "C5'" . G   D 4  45  ? 103.060 -46.770  30.931  1.00 0.00 ? 85   G   D "C5'" 1 
ATOM 5355  C "C4'" . G   D 4  45  ? 101.704 -47.178  31.524  1.00 0.00 ? 85   G   D "C4'" 1 
ATOM 5356  O "O4'" . G   D 4  45  ? 101.716 -48.538  32.060  1.00 0.00 ? 85   G   D "O4'" 1 
ATOM 5357  C "C3'" . G   D 4  45  ? 101.296 -46.305  32.720  1.00 0.00 ? 85   G   D "C3'" 1 
ATOM 5358  O "O3'" . G   D 4  45  ? 99.869  -46.202  32.772  1.00 0.00 ? 85   G   D "O3'" 1 
ATOM 5359  C "C2'" . G   D 4  45  ? 101.960 -47.085  33.857  1.00 0.00 ? 85   G   D "C2'" 1 
ATOM 5360  O "O2'" . G   D 4  45  ? 101.488 -46.754  35.140  1.00 0.00 ? 85   G   D "O2'" 1 
ATOM 5361  C "C1'" . G   D 4  45  ? 101.591 -48.483  33.468  1.00 0.00 ? 85   G   D "C1'" 1 
ATOM 5362  N N9    . G   D 4  45  ? 102.394 -49.518  34.153  1.00 0.00 ? 85   G   D N9    1 
ATOM 5363  C C8    . G   D 4  45  ? 103.640 -49.389  34.731  1.00 0.00 ? 85   G   D C8    1 
ATOM 5364  N N7    . G   D 4  45  ? 104.074 -50.496  35.271  1.00 0.00 ? 85   G   D N7    1 
ATOM 5365  C C5    . G   D 4  45  ? 103.073 -51.405  35.058  1.00 0.00 ? 85   G   D C5    1 
ATOM 5366  C C6    . G   D 4  45  ? 103.006 -52.749  35.482  1.00 0.00 ? 85   G   D C6    1 
ATOM 5367  O O6    . G   D 4  45  ? 103.892 -53.332  36.114  1.00 0.00 ? 85   G   D O6    1 
ATOM 5368  N N1    . G   D 4  45  ? 101.780 -53.323  35.074  1.00 0.00 ? 85   G   D N1    1 
ATOM 5369  C C2    . G   D 4  45  ? 100.753 -52.684  34.357  1.00 0.00 ? 85   G   D C2    1 
ATOM 5370  N N2    . G   D 4  45  ? 99.653  -53.456  34.094  1.00 0.00 ? 85   G   D N2    1 
ATOM 5371  N N3    . G   D 4  45  ? 100.863 -51.389  33.966  1.00 0.00 ? 85   G   D N3    1 
ATOM 5372  C C4    . G   D 4  45  ? 102.022 -50.825  34.356  1.00 0.00 ? 85   G   D C4    1 
ATOM 5373  P P     . U   D 4  46  ? 99.103  -45.187  33.703  1.00 0.00 ? 86   U   D P     1 
ATOM 5374  O OP1   . U   D 4  46  ? 99.983  -44.036  34.001  1.00 0.00 ? 86   U   D OP1   1 
ATOM 5375  O OP2   . U   D 4  46  ? 98.561  -45.943  34.854  1.00 0.00 ? 86   U   D OP2   1 
ATOM 5376  O "O5'" . U   D 4  46  ? 97.893  -44.717  32.789  1.00 0.00 ? 86   U   D "O5'" 1 
ATOM 5377  C "C5'" . U   D 4  46  ? 97.415  -43.359  32.795  1.00 0.00 ? 86   U   D "C5'" 1 
ATOM 5378  C "C4'" . U   D 4  46  ? 96.254  -43.076  33.792  1.00 0.00 ? 86   U   D "C4'" 1 
ATOM 5379  O "O4'" . U   D 4  46  ? 96.321  -43.905  34.996  1.00 0.00 ? 86   U   D "O4'" 1 
ATOM 5380  C "C3'" . U   D 4  46  ? 96.310  -41.645  34.356  1.00 0.00 ? 86   U   D "C3'" 1 
ATOM 5381  O "O3'" . U   D 4  46  ? 95.009  -41.205  34.764  1.00 0.00 ? 86   U   D "O3'" 1 
ATOM 5382  C "C2'" . U   D 4  46  ? 97.277  -41.836  35.510  1.00 0.00 ? 86   U   D "C2'" 1 
ATOM 5383  O "O2'" . U   D 4  46  ? 97.255  -40.771  36.429  1.00 0.00 ? 86   U   D "O2'" 1 
ATOM 5384  C "C1'" . U   D 4  46  ? 96.752  -43.124  36.103  1.00 0.00 ? 86   U   D "C1'" 1 
ATOM 5385  N N1    . U   D 4  46  ? 97.703  -43.863  37.008  1.00 0.00 ? 86   U   D N1    1 
ATOM 5386  C C2    . U   D 4  46  ? 97.185  -44.918  37.760  1.00 0.00 ? 86   U   D C2    1 
ATOM 5387  O O2    . U   D 4  46  ? 96.001  -45.246  37.699  1.00 0.00 ? 86   U   D O2    1 
ATOM 5388  N N3    . U   D 4  46  ? 98.113  -45.580  38.572  1.00 0.00 ? 86   U   D N3    1 
ATOM 5389  C C4    . U   D 4  46  ? 99.487  -45.307  38.688  1.00 0.00 ? 86   U   D C4    1 
ATOM 5390  O O4    . U   D 4  46  ? 100.218 -45.981  39.416  1.00 0.00 ? 86   U   D O4    1 
ATOM 5391  C C5    . U   D 4  46  ? 99.921  -44.194  37.884  1.00 0.00 ? 86   U   D C5    1 
ATOM 5392  C C6    . U   D 4  46  ? 99.043  -43.535  37.100  1.00 0.00 ? 86   U   D C6    1 
ATOM 5393  P P     . G   D 4  47  ? 94.468  -39.742  34.509  1.00 0.00 ? 87   G   D P     1 
ATOM 5394  O OP1   . G   D 4  47  ? 95.312  -38.769  35.237  1.00 0.00 ? 87   G   D OP1   1 
ATOM 5395  O OP2   . G   D 4  47  ? 93.018  -39.733  34.808  1.00 0.00 ? 87   G   D OP2   1 
ATOM 5396  O "O5'" . G   D 4  47  ? 94.690  -39.535  32.953  1.00 0.00 ? 87   G   D "O5'" 1 
ATOM 5397  C "C5'" . G   D 4  47  ? 93.674  -38.844  32.208  1.00 0.00 ? 87   G   D "C5'" 1 
ATOM 5398  C "C4'" . G   D 4  47  ? 94.261  -38.122  30.984  1.00 0.00 ? 87   G   D "C4'" 1 
ATOM 5399  O "O4'" . G   D 4  47  ? 95.341  -38.872  30.365  1.00 0.00 ? 87   G   D "O4'" 1 
ATOM 5400  C "C3'" . G   D 4  47  ? 93.272  -37.925  29.840  1.00 0.00 ? 87   G   D "C3'" 1 
ATOM 5401  O "O3'" . G   D 4  47  ? 92.387  -36.852  30.137  1.00 0.00 ? 87   G   D "O3'" 1 
ATOM 5402  C "C2'" . G   D 4  47  ? 94.222  -37.688  28.682  1.00 0.00 ? 87   G   D "C2'" 1 
ATOM 5403  O "O2'" . G   D 4  47  ? 94.810  -36.409  28.744  1.00 0.00 ? 87   G   D "O2'" 1 
ATOM 5404  C "C1'" . G   D 4  47  ? 95.289  -38.726  28.955  1.00 0.00 ? 87   G   D "C1'" 1 
ATOM 5405  N N9    . G   D 4  47  ? 95.058  -40.037  28.268  1.00 0.00 ? 87   G   D N9    1 
ATOM 5406  C C8    . G   D 4  47  ? 95.292  -41.282  28.824  1.00 0.00 ? 87   G   D C8    1 
ATOM 5407  N N7    . G   D 4  47  ? 95.011  -42.275  28.027  1.00 0.00 ? 87   G   D N7    1 
ATOM 5408  C C5    . G   D 4  47  ? 94.582  -41.681  26.870  1.00 0.00 ? 87   G   D C5    1 
ATOM 5409  C C6    . G   D 4  47  ? 94.070  -42.297  25.707  1.00 0.00 ? 87   G   D C6    1 
ATOM 5410  O O6    . G   D 4  47  ? 93.976  -43.517  25.539  1.00 0.00 ? 87   G   D O6    1 
ATOM 5411  N N1    . G   D 4  47  ? 93.671  -41.315  24.770  1.00 0.00 ? 87   G   D N1    1 
ATOM 5412  C C2    . G   D 4  47  ? 93.776  -39.923  24.937  1.00 0.00 ? 87   G   D C2    1 
ATOM 5413  N N2    . G   D 4  47  ? 93.282  -39.160  23.925  1.00 0.00 ? 87   G   D N2    1 
ATOM 5414  N N3    . G   D 4  47  ? 94.333  -39.380  26.038  1.00 0.00 ? 87   G   D N3    1 
ATOM 5415  C C4    . G   D 4  47  ? 94.637  -40.295  26.975  1.00 0.00 ? 87   G   D C4    1 
ATOM 5416  P P     . A   D 4  48  ? 91.262  -36.345  29.139  1.00 0.00 ? 88   A   D P     1 
ATOM 5417  O OP1   . A   D 4  48  ? 91.879  -35.407  28.173  1.00 0.00 ? 88   A   D OP1   1 
ATOM 5418  O OP2   . A   D 4  48  ? 90.133  -35.827  29.947  1.00 0.00 ? 88   A   D OP2   1 
ATOM 5419  O "O5'" . A   D 4  48  ? 90.767  -37.646  28.358  1.00 0.00 ? 88   A   D "O5'" 1 
ATOM 5420  C "C5'" . A   D 4  48  ? 89.928  -37.396  27.207  1.00 0.00 ? 88   A   D "C5'" 1 
ATOM 5421  C "C4'" . A   D 4  48  ? 89.394  -38.701  26.595  1.00 0.00 ? 88   A   D "C4'" 1 
ATOM 5422  O "O4'" . A   D 4  48  ? 90.468  -39.619  26.261  1.00 0.00 ? 88   A   D "O4'" 1 
ATOM 5423  C "C3'" . A   D 4  48  ? 88.461  -39.540  27.476  1.00 0.00 ? 88   A   D "C3'" 1 
ATOM 5424  O "O3'" . A   D 4  48  ? 87.164  -38.944  27.519  1.00 0.00 ? 88   A   D "O3'" 1 
ATOM 5425  C "C2'" . A   D 4  48  ? 88.548  -40.869  26.747  1.00 0.00 ? 88   A   D "C2'" 1 
ATOM 5426  O "O2'" . A   D 4  48  ? 87.896  -40.825  25.501  1.00 0.00 ? 88   A   D "O2'" 1 
ATOM 5427  C "C1'" . A   D 4  48  ? 90.039  -40.952  26.527  1.00 0.00 ? 88   A   D "C1'" 1 
ATOM 5428  N N9    . A   D 4  48  ? 90.711  -41.524  27.713  1.00 0.00 ? 88   A   D N9    1 
ATOM 5429  C C8    . A   D 4  48  ? 91.664  -40.941  28.511  1.00 0.00 ? 88   A   D C8    1 
ATOM 5430  N N7    . A   D 4  48  ? 92.020  -41.683  29.520  1.00 0.00 ? 88   A   D N7    1 
ATOM 5431  C C5    . A   D 4  48  ? 91.294  -42.834  29.402  1.00 0.00 ? 88   A   D C5    1 
ATOM 5432  C C6    . A   D 4  48  ? 91.248  -43.974  30.227  1.00 0.00 ? 88   A   D C6    1 
ATOM 5433  N N6    . A   D 4  48  ? 92.060  -44.030  31.330  1.00 0.00 ? 88   A   D N6    1 
ATOM 5434  N N1    . A   D 4  48  ? 90.372  -44.954  29.819  1.00 0.00 ? 88   A   D N1    1 
ATOM 5435  C C2    . A   D 4  48  ? 89.656  -44.756  28.699  1.00 0.00 ? 88   A   D C2    1 
ATOM 5436  N N3    . A   D 4  48  ? 89.640  -43.716  27.858  1.00 0.00 ? 88   A   D N3    1 
ATOM 5437  C C4    . A   D 4  48  ? 90.474  -42.758  28.281  1.00 0.00 ? 88   A   D C4    1 
ATOM 5438  P P     . A   D 4  49  ? 86.073  -39.528  28.514  1.00 0.00 ? 89   A   D P     1 
ATOM 5439  O OP1   . A   D 4  49  ? 85.086  -38.465  28.806  1.00 0.00 ? 89   A   D OP1   1 
ATOM 5440  O OP2   . A   D 4  49  ? 86.743  -40.154  29.677  1.00 0.00 ? 89   A   D OP2   1 
ATOM 5441  O "O5'" . A   D 4  49  ? 85.356  -40.662  27.667  1.00 0.00 ? 89   A   D "O5'" 1 
ATOM 5442  C "C5'" . A   D 4  49  ? 84.641  -40.283  26.481  1.00 0.00 ? 89   A   D "C5'" 1 
ATOM 5443  C "C4'" . A   D 4  49  ? 84.173  -41.519  25.690  1.00 0.00 ? 89   A   D "C4'" 1 
ATOM 5444  O "O4'" . A   D 4  49  ? 85.229  -42.518  25.610  1.00 0.00 ? 89   A   D "O4'" 1 
ATOM 5445  C "C3'" . A   D 4  49  ? 82.998  -42.306  26.300  1.00 0.00 ? 89   A   D "C3'" 1 
ATOM 5446  O "O3'" . A   D 4  49  ? 81.722  -41.705  26.092  1.00 0.00 ? 89   A   D "O3'" 1 
ATOM 5447  C "C2'" . A   D 4  49  ? 83.182  -43.692  25.697  1.00 0.00 ? 89   A   D "C2'" 1 
ATOM 5448  O "O2'" . A   D 4  49  ? 82.755  -43.763  24.360  1.00 0.00 ? 89   A   D "O2'" 1 
ATOM 5449  C "C1'" . A   D 4  49  ? 84.684  -43.824  25.713  1.00 0.00 ? 89   A   D "C1'" 1 
ATOM 5450  N N9    . A   D 4  49  ? 85.179  -44.562  26.902  1.00 0.00 ? 89   A   D N9    1 
ATOM 5451  C C8    . A   D 4  49  ? 85.991  -44.114  27.923  1.00 0.00 ? 89   A   D C8    1 
ATOM 5452  N N7    . A   D 4  49  ? 86.271  -45.034  28.807  1.00 0.00 ? 89   A   D N7    1 
ATOM 5453  C C5    . A   D 4  49  ? 85.621  -46.156  28.384  1.00 0.00 ? 89   A   D C5    1 
ATOM 5454  C C6    . A   D 4  49  ? 85.605  -47.457  28.926  1.00 0.00 ? 89   A   D C6    1 
ATOM 5455  N N6    . A   D 4  49  ? 86.290  -47.711  30.082  1.00 0.00 ? 89   A   D N6    1 
ATOM 5456  N N1    . A   D 4  49  ? 84.856  -48.375  28.228  1.00 0.00 ? 89   A   D N1    1 
ATOM 5457  C C2    . A   D 4  49  ? 84.238  -47.981  27.106  1.00 0.00 ? 89   A   D C2    1 
ATOM 5458  N N3    . A   D 4  49  ? 84.204  -46.777  26.516  1.00 0.00 ? 89   A   D N3    1 
ATOM 5459  C C4    . A   D 4  49  ? 84.939  -45.889  27.200  1.00 0.00 ? 89   A   D C4    1 
ATOM 5460  P P     . U   D 4  50  ? 81.150  -40.813  24.922  1.00 0.00 ? 90   U   D P     1 
ATOM 5461  O OP1   . U   D 4  50  ? 81.607  -41.304  23.603  1.00 0.00 ? 90   U   D OP1   1 
ATOM 5462  O OP2   . U   D 4  50  ? 81.428  -39.394  25.238  1.00 0.00 ? 90   U   D OP2   1 
ATOM 5463  O "O5'" . U   D 4  50  ? 79.586  -41.055  25.065  1.00 0.00 ? 90   U   D "O5'" 1 
ATOM 5464  C "C5'" . U   D 4  50  ? 78.922  -42.073  24.292  1.00 0.00 ? 90   U   D "C5'" 1 
ATOM 5465  C "C4'" . U   D 4  50  ? 79.224  -43.491  24.805  1.00 0.00 ? 90   U   D "C4'" 1 
ATOM 5466  O "O4'" . U   D 4  50  ? 79.024  -43.625  26.247  1.00 0.00 ? 90   U   D "O4'" 1 
ATOM 5467  C "C3'" . U   D 4  50  ? 78.405  -44.668  24.273  1.00 0.00 ? 90   U   D "C3'" 1 
ATOM 5468  O "O3'" . U   D 4  50  ? 78.584  -44.857  22.885  1.00 0.00 ? 90   U   D "O3'" 1 
ATOM 5469  C "C2'" . U   D 4  50  ? 78.891  -45.736  25.246  1.00 0.00 ? 90   U   D "C2'" 1 
ATOM 5470  O "O2'" . U   D 4  50  ? 80.263  -46.043  25.128  1.00 0.00 ? 90   U   D "O2'" 1 
ATOM 5471  C "C1'" . U   D 4  50  ? 78.711  -44.994  26.542  1.00 0.00 ? 90   U   D "C1'" 1 
ATOM 5472  N N1    . U   D 4  50  ? 77.340  -45.227  27.094  1.00 0.00 ? 90   U   D N1    1 
ATOM 5473  C C2    . U   D 4  50  ? 77.067  -46.480  27.640  1.00 0.00 ? 90   U   D C2    1 
ATOM 5474  O O2    . U   D 4  50  ? 77.918  -47.368  27.698  1.00 0.00 ? 90   U   D O2    1 
ATOM 5475  N N3    . U   D 4  50  ? 75.753  -46.646  28.101  1.00 0.00 ? 90   U   D N3    1 
ATOM 5476  C C4    . U   D 4  50  ? 74.695  -45.730  27.990  1.00 0.00 ? 90   U   D C4    1 
ATOM 5477  O O4    . U   D 4  50  ? 73.564  -46.010  28.395  1.00 0.00 ? 90   U   D O4    1 
ATOM 5478  C C5    . U   D 4  50  ? 75.069  -44.490  27.350  1.00 0.00 ? 90   U   D C5    1 
ATOM 5479  C C6    . U   D 4  50  ? 76.336  -44.293  26.945  1.00 0.00 ? 90   U   D C6    1 
ATOM 5480  P P     . C   D 4  51  ? 79.232  -45.960  21.980  1.00 0.00 ? 91   C   D P     1 
ATOM 5481  O OP1   . C   D 4  51  ? 80.673  -46.015  22.285  1.00 0.00 ? 91   C   D OP1   1 
ATOM 5482  O OP2   . C   D 4  51  ? 78.866  -45.644  20.580  1.00 0.00 ? 91   C   D OP2   1 
ATOM 5483  O "O5'" . C   D 4  51  ? 78.524  -47.326  22.374  1.00 0.00 ? 91   C   D "O5'" 1 
ATOM 5484  C "C5'" . C   D 4  51  ? 79.131  -48.355  23.163  1.00 0.00 ? 91   C   D "C5'" 1 
ATOM 5485  C "C4'" . C   D 4  51  ? 79.640  -49.516  22.306  1.00 0.00 ? 91   C   D "C4'" 1 
ATOM 5486  O "O4'" . C   D 4  51  ? 80.898  -49.210  21.656  1.00 0.00 ? 91   C   D "O4'" 1 
ATOM 5487  C "C3'" . C   D 4  51  ? 79.949  -50.729  23.185  1.00 0.00 ? 91   C   D "C3'" 1 
ATOM 5488  O "O3'" . C   D 4  51  ? 79.658  -51.947  22.497  1.00 0.00 ? 91   C   D "O3'" 1 
ATOM 5489  C "C2'" . C   D 4  51  ? 81.420  -50.560  23.532  1.00 0.00 ? 91   C   D "C2'" 1 
ATOM 5490  O "O2'" . C   D 4  51  ? 82.056  -51.789  23.796  1.00 0.00 ? 91   C   D "O2'" 1 
ATOM 5491  C "C1'" . C   D 4  51  ? 81.969  -49.901  22.298  1.00 0.00 ? 91   C   D "C1'" 1 
ATOM 5492  N N1    . C   D 4  51  ? 83.126  -49.026  22.621  1.00 0.00 ? 91   C   D N1    1 
ATOM 5493  C C2    . C   D 4  51  ? 84.438  -49.507  22.656  1.00 0.00 ? 91   C   D C2    1 
ATOM 5494  O O2    . C   D 4  51  ? 84.652  -50.712  22.431  1.00 0.00 ? 91   C   D O2    1 
ATOM 5495  N N3    . C   D 4  51  ? 85.440  -48.629  22.950  1.00 0.00 ? 91   C   D N3    1 
ATOM 5496  C C4    . C   D 4  51  ? 85.179  -47.346  23.324  1.00 0.00 ? 91   C   D C4    1 
ATOM 5497  N N4    . C   D 4  51  ? 86.170  -46.460  23.624  1.00 0.00 ? 91   C   D N4    1 
ATOM 5498  C C5    . C   D 4  51  ? 83.825  -46.912  23.439  1.00 0.00 ? 91   C   D C5    1 
ATOM 5499  C C6    . C   D 4  51  ? 82.859  -47.783  23.129  1.00 0.00 ? 91   C   D C6    1 
ATOM 5500  P P     . A   D 4  52  ? 78.314  -52.744  22.759  1.00 0.00 ? 92   A   D P     1 
ATOM 5501  O OP1   . A   D 4  52  ? 78.653  -54.001  23.466  1.00 0.00 ? 92   A   D OP1   1 
ATOM 5502  O OP2   . A   D 4  52  ? 77.586  -52.860  21.475  1.00 0.00 ? 92   A   D OP2   1 
ATOM 5503  O "O5'" . A   D 4  52  ? 77.473  -51.801  23.724  1.00 0.00 ? 92   A   D "O5'" 1 
ATOM 5504  C "C5'" . A   D 4  52  ? 76.561  -52.374  24.664  1.00 0.00 ? 92   A   D "C5'" 1 
ATOM 5505  C "C4'" . A   D 4  52  ? 77.096  -52.464  26.113  1.00 0.00 ? 92   A   D "C4'" 1 
ATOM 5506  O "O4'" . A   D 4  52  ? 78.519  -52.209  26.284  1.00 0.00 ? 92   A   D "O4'" 1 
ATOM 5507  C "C3'" . A   D 4  52  ? 76.491  -51.498  27.123  1.00 0.00 ? 92   A   D "C3'" 1 
ATOM 5508  O "O3'" . A   D 4  52  ? 75.109  -51.812  27.327  1.00 0.00 ? 92   A   D "O3'" 1 
ATOM 5509  C "C2'" . A   D 4  52  ? 77.390  -51.774  28.320  1.00 0.00 ? 92   A   D "C2'" 1 
ATOM 5510  O "O2'" . A   D 4  52  ? 77.044  -52.983  28.958  1.00 0.00 ? 92   A   D "O2'" 1 
ATOM 5511  C "C1'" . A   D 4  52  ? 78.748  -51.935  27.665  1.00 0.00 ? 92   A   D "C1'" 1 
ATOM 5512  N N9    . A   D 4  52  ? 79.607  -50.766  27.942  1.00 0.00 ? 92   A   D N9    1 
ATOM 5513  C C8    . A   D 4  52  ? 80.030  -49.740  27.128  1.00 0.00 ? 92   A   D C8    1 
ATOM 5514  N N7    . A   D 4  52  ? 80.768  -48.858  27.750  1.00 0.00 ? 92   A   D N7    1 
ATOM 5515  C C5    . A   D 4  52  ? 80.851  -49.296  29.045  1.00 0.00 ? 92   A   D C5    1 
ATOM 5516  C C6    . A   D 4  52  ? 81.508  -48.740  30.160  1.00 0.00 ? 92   A   D C6    1 
ATOM 5517  N N6    . A   D 4  52  ? 82.187  -47.559  30.014  1.00 0.00 ? 92   A   D N6    1 
ATOM 5518  N N1    . A   D 4  52  ? 81.412  -49.472  31.320  1.00 0.00 ? 92   A   D N1    1 
ATOM 5519  C C2    . A   D 4  52  ? 80.700  -50.610  31.308  1.00 0.00 ? 92   A   D C2    1 
ATOM 5520  N N3    . A   D 4  52  ? 80.019  -51.194  30.313  1.00 0.00 ? 92   A   D N3    1 
ATOM 5521  C C4    . A   D 4  52  ? 80.132  -50.478  29.184  1.00 0.00 ? 92   A   D C4    1 
ATOM 5522  P P     . U   D 4  53  ? 74.164  -50.749  28.035  1.00 0.00 ? 93   U   D P     1 
ATOM 5523  O OP1   . U   D 4  53  ? 72.760  -51.194  27.877  1.00 0.00 ? 93   U   D OP1   1 
ATOM 5524  O OP2   . U   D 4  53  ? 74.495  -49.395  27.540  1.00 0.00 ? 93   U   D OP2   1 
ATOM 5525  O "O5'" . U   D 4  53  ? 74.572  -50.845  29.565  1.00 0.00 ? 93   U   D "O5'" 1 
ATOM 5526  C "C5'" . U   D 4  53  ? 74.123  -51.982  30.319  1.00 0.00 ? 93   U   D "C5'" 1 
ATOM 5527  C "C4'" . U   D 4  53  ? 74.757  -52.024  31.727  1.00 0.00 ? 93   U   D "C4'" 1 
ATOM 5528  O "O4'" . U   D 4  53  ? 76.176  -51.738  31.621  1.00 0.00 ? 93   U   D "O4'" 1 
ATOM 5529  C "C3'" . U   D 4  53  ? 74.252  -50.991  32.749  1.00 0.00 ? 93   U   D "C3'" 1 
ATOM 5530  O "O3'" . U   D 4  53  ? 73.124  -51.420  33.494  1.00 0.00 ? 93   U   D "O3'" 1 
ATOM 5531  C "C2'" . U   D 4  53  ? 75.463  -50.796  33.664  1.00 0.00 ? 93   U   D "C2'" 1 
ATOM 5532  O "O2'" . U   D 4  53  ? 75.514  -51.746  34.705  1.00 0.00 ? 93   U   D "O2'" 1 
ATOM 5533  C "C1'" . U   D 4  53  ? 76.640  -51.030  32.752  1.00 0.00 ? 93   U   D "C1'" 1 
ATOM 5534  N N1    . U   D 4  53  ? 77.341  -49.757  32.419  1.00 0.00 ? 93   U   D N1    1 
ATOM 5535  C C2    . U   D 4  53  ? 78.260  -49.264  33.340  1.00 0.00 ? 93   U   D C2    1 
ATOM 5536  O O2    . U   D 4  53  ? 78.504  -49.838  34.400  1.00 0.00 ? 93   U   D O2    1 
ATOM 5537  N N3    . U   D 4  53  ? 78.870  -48.062  32.968  1.00 0.00 ? 93   U   D N3    1 
ATOM 5538  C C4    . U   D 4  53  ? 78.630  -47.317  31.802  1.00 0.00 ? 93   U   D C4    1 
ATOM 5539  O O4    . U   D 4  53  ? 79.244  -46.271  31.574  1.00 0.00 ? 93   U   D O4    1 
ATOM 5540  C C5    . U   D 4  53  ? 77.626  -47.891  30.946  1.00 0.00 ? 93   U   D C5    1 
ATOM 5541  C C6    . U   D 4  53  ? 77.024  -49.042  31.286  1.00 0.00 ? 93   U   D C6    1 
ATOM 5542  P P     . C   D 4  54  ? 71.789  -52.180  33.189  1.00 0.00 ? 94   C   D P     1 
ATOM 5543  O OP1   . C   D 4  54  ? 71.258  -52.679  34.476  1.00 0.00 ? 94   C   D OP1   1 
ATOM 5544  O OP2   . C   D 4  54  ? 71.976  -53.203  32.135  1.00 0.00 ? 94   C   D OP2   1 
ATOM 5545  O "O5'" . C   D 4  54  ? 70.834  -51.029  32.647  1.00 0.00 ? 94   C   D "O5'" 1 
ATOM 5546  C "C5'" . C   D 4  54  ? 70.750  -49.750  33.303  1.00 0.00 ? 94   C   D "C5'" 1 
ATOM 5547  C "C4'" . C   D 4  54  ? 69.346  -49.457  33.856  1.00 0.00 ? 94   C   D "C4'" 1 
ATOM 5548  O "O4'" . C   D 4  54  ? 68.365  -49.362  32.794  1.00 0.00 ? 94   C   D "O4'" 1 
ATOM 5549  C "C3'" . C   D 4  54  ? 68.771  -50.498  34.829  1.00 0.00 ? 94   C   D "C3'" 1 
ATOM 5550  O "O3'" . C   D 4  54  ? 68.101  -49.861  35.922  1.00 0.00 ? 94   C   D "O3'" 1 
ATOM 5551  C "C2'" . C   D 4  54  ? 67.853  -51.348  33.952  1.00 0.00 ? 94   C   D "C2'" 1 
ATOM 5552  O "O2'" . C   D 4  54  ? 66.808  -51.945  34.685  1.00 0.00 ? 94   C   D "O2'" 1 
ATOM 5553  C "C1'" . C   D 4  54  ? 67.334  -50.324  32.983  1.00 0.00 ? 94   C   D "C1'" 1 
ATOM 5554  N N1    . C   D 4  54  ? 66.870  -50.942  31.706  1.00 0.00 ? 94   C   D N1    1 
ATOM 5555  C C2    . C   D 4  54  ? 65.533  -51.314  31.512  1.00 0.00 ? 94   C   D C2    1 
ATOM 5556  O O2    . C   D 4  54  ? 64.709  -51.124  32.433  1.00 0.00 ? 94   C   D O2    1 
ATOM 5557  N N3    . C   D 4  54  ? 65.169  -51.865  30.316  1.00 0.00 ? 94   C   D N3    1 
ATOM 5558  C C4    . C   D 4  54  ? 66.095  -52.103  29.336  1.00 0.00 ? 94   C   D C4    1 
ATOM 5559  N N4    . C   D 4  54  ? 65.743  -52.631  28.127  1.00 0.00 ? 94   C   D N4    1 
ATOM 5560  C C5    . C   D 4  54  ? 67.473  -51.783  29.569  1.00 0.00 ? 94   C   D C5    1 
ATOM 5561  C C6    . C   D 4  54  ? 67.812  -51.238  30.744  1.00 0.00 ? 94   C   D C6    1 
ATOM 5562  P P     . G   D 4  55  ? 68.738  -49.917  37.377  1.00 0.00 ? 95   G   D P     1 
ATOM 5563  O OP1   . G   D 4  55  ? 68.723  -51.324  37.838  1.00 0.00 ? 95   G   D OP1   1 
ATOM 5564  O OP2   . G   D 4  55  ? 68.044  -48.924  38.228  1.00 0.00 ? 95   G   D OP2   1 
ATOM 5565  O "O5'" . G   D 4  55  ? 70.234  -49.425  37.160  1.00 0.00 ? 95   G   D "O5'" 1 
ATOM 5566  C "C5'" . G   D 4  55  ? 71.337  -50.333  37.273  1.00 0.00 ? 95   G   D "C5'" 1 
ATOM 5567  C "C4'" . G   D 4  55  ? 72.602  -49.591  37.746  1.00 0.00 ? 95   G   D "C4'" 1 
ATOM 5568  O "O4'" . G   D 4  55  ? 73.566  -49.528  36.669  1.00 0.00 ? 95   G   D "O4'" 1 
ATOM 5569  C "C3'" . G   D 4  55  ? 72.509  -48.119  38.203  1.00 0.00 ? 95   G   D "C3'" 1 
ATOM 5570  O "O3'" . G   D 4  55  ? 71.943  -48.045  39.517  1.00 0.00 ? 95   G   D "O3'" 1 
ATOM 5571  C "C2'" . G   D 4  55  ? 73.975  -47.711  38.124  1.00 0.00 ? 95   G   D "C2'" 1 
ATOM 5572  O "O2'" . G   D 4  55  ? 74.716  -48.223  39.207  1.00 0.00 ? 95   G   D "O2'" 1 
ATOM 5573  C "C1'" . G   D 4  55  ? 74.407  -48.395  36.850  1.00 0.00 ? 95   G   D "C1'" 1 
ATOM 5574  N N9    . G   D 4  55  ? 74.355  -47.473  35.697  1.00 0.00 ? 95   G   D N9    1 
ATOM 5575  C C8    . G   D 4  55  ? 73.253  -47.167  34.924  1.00 0.00 ? 95   G   D C8    1 
ATOM 5576  N N7    . G   D 4  55  ? 73.502  -46.303  33.982  1.00 0.00 ? 95   G   D N7    1 
ATOM 5577  C C5    . G   D 4  55  ? 74.838  -46.013  34.129  1.00 0.00 ? 95   G   D C5    1 
ATOM 5578  C C6    . G   D 4  55  ? 75.630  -45.122  33.375  1.00 0.00 ? 95   G   D C6    1 
ATOM 5579  O O6    . G   D 4  55  ? 75.225  -44.455  32.417  1.00 0.00 ? 95   G   D O6    1 
ATOM 5580  N N1    . G   D 4  55  ? 76.959  -45.110  33.863  1.00 0.00 ? 95   G   D N1    1 
ATOM 5581  C C2    . G   D 4  55  ? 77.449  -45.862  34.947  1.00 0.00 ? 95   G   D C2    1 
ATOM 5582  N N2    . G   D 4  55  ? 78.767  -45.701  35.233  1.00 0.00 ? 95   G   D N2    1 
ATOM 5583  N N3    . G   D 4  55  ? 76.653  -46.701  35.653  1.00 0.00 ? 95   G   D N3    1 
ATOM 5584  C C4    . G   D 4  55  ? 75.389  -46.724  35.189  1.00 0.00 ? 95   G   D C4    1 
ATOM 5585  P P     . A   D 4  56  ? 71.276  -46.682  40.000  1.00 0.00 ? 96   A   D P     1 
ATOM 5586  O OP1   . A   D 4  56  ? 70.646  -46.917  41.320  1.00 0.00 ? 96   A   D OP1   1 
ATOM 5587  O OP2   . A   D 4  56  ? 70.400  -46.174  38.922  1.00 0.00 ? 96   A   D OP2   1 
ATOM 5588  O "O5'" . A   D 4  56  ? 72.487  -45.667  40.173  1.00 0.00 ? 96   A   D "O5'" 1 
ATOM 5589  C "C5'" . A   D 4  56  ? 73.294  -45.756  41.363  1.00 0.00 ? 96   A   D "C5'" 1 
ATOM 5590  C "C4'" . A   D 4  56  ? 74.422  -44.709  41.344  1.00 0.00 ? 96   A   D "C4'" 1 
ATOM 5591  O "O4'" . A   D 4  56  ? 75.144  -44.752  40.085  1.00 0.00 ? 96   A   D "O4'" 1 
ATOM 5592  C "C3'" . A   D 4  56  ? 74.013  -43.238  41.459  1.00 0.00 ? 96   A   D "C3'" 1 
ATOM 5593  O "O3'" . A   D 4  56  ? 73.572  -42.905  42.771  1.00 0.00 ? 96   A   D "O3'" 1 
ATOM 5594  C "C2'" . A   D 4  56  ? 75.246  -42.525  40.888  1.00 0.00 ? 96   A   D "C2'" 1 
ATOM 5595  O "O2'" . A   D 4  56  ? 76.338  -42.432  41.768  1.00 0.00 ? 96   A   D "O2'" 1 
ATOM 5596  C "C1'" . A   D 4  56  ? 75.646  -43.463  39.773  1.00 0.00 ? 96   A   D "C1'" 1 
ATOM 5597  N N9    . A   D 4  56  ? 75.229  -42.964  38.450  1.00 0.00 ? 96   A   D N9    1 
ATOM 5598  C C8    . A   D 4  56  ? 74.344  -43.508  37.553  1.00 0.00 ? 96   A   D C8    1 
ATOM 5599  N N7    . A   D 4  56  ? 74.234  -42.815  36.454  1.00 0.00 ? 96   A   D N7    1 
ATOM 5600  C C5    . A   D 4  56  ? 75.091  -41.755  36.600  1.00 0.00 ? 96   A   D C5    1 
ATOM 5601  C C6    . A   D 4  56  ? 75.413  -40.711  35.711  1.00 0.00 ? 96   A   D C6    1 
ATOM 5602  N N6    . A   D 4  56  ? 74.794  -40.651  34.491  1.00 0.00 ? 96   A   D N6    1 
ATOM 5603  N N1    . A   D 4  56  ? 76.360  -39.824  36.169  1.00 0.00 ? 96   A   D N1    1 
ATOM 5604  C C2    . A   D 4  56  ? 76.889  -40.019  37.389  1.00 0.00 ? 96   A   D C2    1 
ATOM 5605  N N3    . A   D 4  56  ? 76.630  -40.963  38.305  1.00 0.00 ? 96   A   D N3    1 
ATOM 5606  C C4    . A   D 4  56  ? 75.716  -41.827  37.839  1.00 0.00 ? 96   A   D C4    1 
ATOM 5607  P P     . A   D 4  57  ? 74.297  -42.681  44.150  1.00 0.00 ? 97   A   D P     1 
ATOM 5608  O OP1   . A   D 4  57  ? 75.465  -43.583  44.266  1.00 0.00 ? 97   A   D OP1   1 
ATOM 5609  O OP2   . A   D 4  57  ? 73.292  -42.749  45.234  1.00 0.00 ? 97   A   D OP2   1 
ATOM 5610  O "O5'" . A   D 4  57  ? 74.799  -41.179  44.019  1.00 0.00 ? 97   A   D "O5'" 1 
ATOM 5611  C "C5'" . A   D 4  57  ? 75.457  -40.606  45.167  1.00 0.00 ? 97   A   D "C5'" 1 
ATOM 5612  C "C4'" . A   D 4  57  ? 76.270  -39.354  44.796  1.00 0.00 ? 97   A   D "C4'" 1 
ATOM 5613  O "O4'" . A   D 4  57  ? 76.969  -39.525  43.537  1.00 0.00 ? 97   A   D "O4'" 1 
ATOM 5614  C "C3'" . A   D 4  57  ? 75.513  -38.034  44.634  1.00 0.00 ? 97   A   D "C3'" 1 
ATOM 5615  O "O3'" . A   D 4  57  ? 75.226  -37.485  45.924  1.00 0.00 ? 97   A   D "O3'" 1 
ATOM 5616  C "C2'" . A   D 4  57  ? 76.514  -37.232  43.806  1.00 0.00 ? 97   A   D "C2'" 1 
ATOM 5617  O "O2'" . A   D 4  57  ? 77.570  -36.742  44.598  1.00 0.00 ? 97   A   D "O2'" 1 
ATOM 5618  C "C1'" . A   D 4  57  ? 77.036  -38.288  42.866  1.00 0.00 ? 97   A   D "C1'" 1 
ATOM 5619  N N9    . A   D 4  57  ? 76.271  -38.295  41.607  1.00 0.00 ? 97   A   D N9    1 
ATOM 5620  C C8    . A   D 4  57  ? 75.109  -38.960  41.297  1.00 0.00 ? 97   A   D C8    1 
ATOM 5621  N N7    . A   D 4  57  ? 74.672  -38.707  40.093  1.00 0.00 ? 97   A   D N7    1 
ATOM 5622  C C5    . A   D 4  57  ? 75.556  -37.810  39.572  1.00 0.00 ? 97   A   D C5    1 
ATOM 5623  C C6    . A   D 4  57  ? 75.569  -37.170  38.323  1.00 0.00 ? 97   A   D C6    1 
ATOM 5624  N N6    . A   D 4  57  ? 74.543  -37.407  37.446  1.00 0.00 ? 97   A   D N6    1 
ATOM 5625  N N1    . A   D 4  57  ? 76.645  -36.340  38.107  1.00 0.00 ? 97   A   D N1    1 
ATOM 5626  C C2    . A   D 4  57  ? 77.557  -36.189  39.079  1.00 0.00 ? 97   A   D C2    1 
ATOM 5627  N N3    . A   D 4  57  ? 77.609  -36.734  40.303  1.00 0.00 ? 97   A   D N3    1 
ATOM 5628  C C4    . A   D 4  57  ? 76.565  -37.551  40.496  1.00 0.00 ? 97   A   D C4    1 
ATOM 5629  P P     . U   D 4  58  ? 74.249  -36.245  46.083  1.00 0.00 ? 98   U   D P     1 
ATOM 5630  O OP1   . U   D 4  58  ? 74.097  -35.943  47.524  1.00 0.00 ? 98   U   D OP1   1 
ATOM 5631  O OP2   . U   D 4  58  ? 73.012  -36.510  45.313  1.00 0.00 ? 98   U   D OP2   1 
ATOM 5632  O "O5'" . U   D 4  58  ? 75.042  -35.047  45.409  1.00 0.00 ? 98   U   D "O5'" 1 
ATOM 5633  C "C5'" . U   D 4  58  ? 74.384  -33.774  45.265  1.00 0.00 ? 98   U   D "C5'" 1 
ATOM 5634  C "C4'" . U   D 4  58  ? 74.938  -32.933  44.087  1.00 0.00 ? 98   U   D "C4'" 1 
ATOM 5635  O "O4'" . U   D 4  58  ? 75.560  -33.774  43.066  1.00 0.00 ? 98   U   D "O4'" 1 
ATOM 5636  C "C3'" . U   D 4  58  ? 73.838  -32.166  43.324  1.00 0.00 ? 98   U   D "C3'" 1 
ATOM 5637  O "O3'" . U   D 4  58  ? 73.694  -30.857  43.884  1.00 0.00 ? 98   U   D "O3'" 1 
ATOM 5638  C "C2'" . U   D 4  58  ? 74.358  -32.154  41.890  1.00 0.00 ? 98   U   D "C2'" 1 
ATOM 5639  O "O2'" . U   D 4  58  ? 75.334  -31.158  41.695  1.00 0.00 ? 98   U   D "O2'" 1 
ATOM 5640  C "C1'" . U   D 4  58  ? 75.010  -33.505  41.788  1.00 0.00 ? 98   U   D "C1'" 1 
ATOM 5641  N N1    . U   D 4  58  ? 74.050  -34.556  41.308  1.00 0.00 ? 98   U   D N1    1 
ATOM 5642  C C2    . U   D 4  58  ? 73.715  -34.570  39.963  1.00 0.00 ? 98   U   D C2    1 
ATOM 5643  O O2    . U   D 4  58  ? 74.196  -33.761  39.166  1.00 0.00 ? 98   U   D O2    1 
ATOM 5644  N N3    . U   D 4  58  ? 72.819  -35.577  39.588  1.00 0.00 ? 98   U   D N3    1 
ATOM 5645  C C4    . U   D 4  58  ? 72.257  -36.568  40.412  1.00 0.00 ? 98   U   D C4    1 
ATOM 5646  O O4    . U   D 4  58  ? 71.490  -37.421  39.955  1.00 0.00 ? 98   U   D O4    1 
ATOM 5647  C C5    . U   D 4  58  ? 72.667  -36.467  41.791  1.00 0.00 ? 98   U   D C5    1 
ATOM 5648  C C6    . U   D 4  58  ? 73.516  -35.498  42.170  1.00 0.00 ? 98   U   D C6    1 
ATOM 5649  P P     . C   D 4  59  ? 72.501  -30.451  44.841  1.00 0.00 ? 99   C   D P     1 
ATOM 5650  O OP1   . C   D 4  59  ? 72.856  -29.193  45.535  1.00 0.00 ? 99   C   D OP1   1 
ATOM 5651  O OP2   . C   D 4  59  ? 72.127  -31.609  45.684  1.00 0.00 ? 99   C   D OP2   1 
ATOM 5652  O "O5'" . C   D 4  59  ? 71.313  -30.152  43.849  1.00 0.00 ? 99   C   D "O5'" 1 
ATOM 5653  C "C5'" . C   D 4  59  ? 71.452  -29.229  42.763  1.00 0.00 ? 99   C   D "C5'" 1 
ATOM 5654  C "C4'" . C   D 4  59  ? 70.627  -29.716  41.574  1.00 0.00 ? 99   C   D "C4'" 1 
ATOM 5655  O "O4'" . C   D 4  59  ? 71.043  -31.045  41.189  1.00 0.00 ? 99   C   D "O4'" 1 
ATOM 5656  C "C3'" . C   D 4  59  ? 69.132  -29.831  41.832  1.00 0.00 ? 99   C   D "C3'" 1 
ATOM 5657  O "O3'" . C   D 4  59  ? 68.560  -28.536  41.629  1.00 0.00 ? 99   C   D "O3'" 1 
ATOM 5658  C "C2'" . C   D 4  59  ? 68.696  -30.911  40.838  1.00 0.00 ? 99   C   D "C2'" 1 
ATOM 5659  O "O2'" . C   D 4  59  ? 68.438  -30.368  39.563  1.00 0.00 ? 99   C   D "O2'" 1 
ATOM 5660  C "C1'" . C   D 4  59  ? 69.929  -31.798  40.761  1.00 0.00 ? 99   C   D "C1'" 1 
ATOM 5661  N N1    . C   D 4  59  ? 69.786  -33.093  41.495  1.00 0.00 ? 99   C   D N1    1 
ATOM 5662  C C2    . C   D 4  59  ? 69.396  -34.263  40.830  1.00 0.00 ? 99   C   D C2    1 
ATOM 5663  O O2    . C   D 4  59  ? 69.165  -34.215  39.605  1.00 0.00 ? 99   C   D O2    1 
ATOM 5664  N N3    . C   D 4  59  ? 69.295  -35.422  41.548  1.00 0.00 ? 99   C   D N3    1 
ATOM 5665  C C4    . C   D 4  59  ? 69.559  -35.453  42.886  1.00 0.00 ? 99   C   D C4    1 
ATOM 5666  N N4    . C   D 4  59  ? 69.514  -36.607  43.615  1.00 0.00 ? 99   C   D N4    1 
ATOM 5667  C C5    . C   D 4  59  ? 69.904  -34.245  43.573  1.00 0.00 ? 99   C   D C5    1 
ATOM 5668  C C6    . C   D 4  59  ? 70.001  -33.118  42.857  1.00 0.00 ? 99   C   D C6    1 
ATOM 5669  P P     . U   D 4  60  ? 67.175  -28.148  42.276  1.00 0.00 ? 100  U   D P     1 
ATOM 5670  O OP1   . U   D 4  60  ? 67.312  -28.139  43.751  1.00 0.00 ? 100  U   D OP1   1 
ATOM 5671  O OP2   . U   D 4  60  ? 66.107  -28.990  41.692  1.00 0.00 ? 100  U   D OP2   1 
ATOM 5672  O "O5'" . U   D 4  60  ? 66.987  -26.660  41.757  1.00 0.00 ? 100  U   D "O5'" 1 
ATOM 5673  C "C5'" . U   D 4  60  ? 67.784  -25.614  42.339  1.00 0.00 ? 100  U   D "C5'" 1 
ATOM 5674  C "C4'" . U   D 4  60  ? 67.737  -24.357  41.464  1.00 0.00 ? 100  U   D "C4'" 1 
ATOM 5675  O "O4'" . U   D 4  60  ? 68.428  -24.626  40.220  1.00 0.00 ? 100  U   D "O4'" 1 
ATOM 5676  C "C3'" . U   D 4  60  ? 66.350  -23.868  41.020  1.00 0.00 ? 100  U   D "C3'" 1 
ATOM 5677  O "O3'" . U   D 4  60  ? 65.800  -23.008  42.022  1.00 0.00 ? 100  U   D "O3'" 1 
ATOM 5678  C "C2'" . U   D 4  60  ? 66.643  -23.166  39.707  1.00 0.00 ? 100  U   D "C2'" 1 
ATOM 5679  O "O2'" . U   D 4  60  ? 67.143  -21.862  39.903  1.00 0.00 ? 100  U   D "O2'" 1 
ATOM 5680  C "C1'" . U   D 4  60  ? 67.731  -24.044  39.124  1.00 0.00 ? 100  U   D "C1'" 1 
ATOM 5681  N N1    . U   D 4  60  ? 67.205  -25.053  38.132  1.00 0.00 ? 100  U   D N1    1 
ATOM 5682  C C2    . U   D 4  60  ? 66.676  -24.592  36.926  1.00 0.00 ? 100  U   D C2    1 
ATOM 5683  O O2    . U   D 4  60  ? 66.636  -23.396  36.637  1.00 0.00 ? 100  U   D O2    1 
ATOM 5684  N N3    . U   D 4  60  ? 66.214  -25.594  36.059  1.00 0.00 ? 100  U   D N3    1 
ATOM 5685  C C4    . U   D 4  60  ? 66.319  -26.983  36.247  1.00 0.00 ? 100  U   D C4    1 
ATOM 5686  O O4    . U   D 4  60  ? 65.907  -27.781  35.397  1.00 0.00 ? 100  U   D O4    1 
ATOM 5687  C C5    . U   D 4  60  ? 66.928  -27.358  37.494  1.00 0.00 ? 100  U   D C5    1 
ATOM 5688  C C6    . U   D 4  60  ? 67.337  -26.411  38.358  1.00 0.00 ? 100  U   D C6    1 
ATOM 5689  P P     . U   D 4  61  ? 64.328  -23.218  42.551  1.00 0.00 ? 101  U   D P     1 
ATOM 5690  O OP1   . U   D 4  61  ? 64.031  -22.194  43.576  1.00 0.00 ? 101  U   D OP1   1 
ATOM 5691  O OP2   . U   D 4  61  ? 64.155  -24.638  42.938  1.00 0.00 ? 101  U   D OP2   1 
ATOM 5692  O "O5'" . U   D 4  61  ? 63.460  -22.927  41.262  1.00 0.00 ? 101  U   D "O5'" 1 
ATOM 5693  C "C5'" . U   D 4  61  ? 63.321  -21.571  40.809  1.00 0.00 ? 101  U   D "C5'" 1 
ATOM 5694  C "C4'" . U   D 4  61  ? 62.598  -21.551  39.460  1.00 0.00 ? 101  U   D "C4'" 1 
ATOM 5695  O "O4'" . U   D 4  61  ? 63.397  -22.215  38.453  1.00 0.00 ? 101  U   D "O4'" 1 
ATOM 5696  C "C3'" . U   D 4  61  ? 61.262  -22.295  39.417  1.00 0.00 ? 101  U   D "C3'" 1 
ATOM 5697  O "O3'" . U   D 4  61  ? 60.236  -21.452  39.951  1.00 0.00 ? 101  U   D "O3'" 1 
ATOM 5698  C "C2'" . U   D 4  61  ? 61.126  -22.598  37.938  1.00 0.00 ? 101  U   D "C2'" 1 
ATOM 5699  O "O2'" . U   D 4  61  ? 60.687  -21.473  37.209  1.00 0.00 ? 101  U   D "O2'" 1 
ATOM 5700  C "C1'" . U   D 4  61  ? 62.553  -22.932  37.560  1.00 0.00 ? 101  U   D "C1'" 1 
ATOM 5701  N N1    . U   D 4  61  ? 62.798  -24.414  37.548  1.00 0.00 ? 101  U   D N1    1 
ATOM 5702  C C2    . U   D 4  61  ? 62.249  -25.147  36.500  1.00 0.00 ? 101  U   D C2    1 
ATOM 5703  O O2    . U   D 4  61  ? 61.583  -24.622  35.609  1.00 0.00 ? 101  U   D O2    1 
ATOM 5704  N N3    . U   D 4  61  ? 62.515  -26.520  36.541  1.00 0.00 ? 101  U   D N3    1 
ATOM 5705  C C4    . U   D 4  61  ? 63.245  -27.214  37.519  1.00 0.00 ? 101  U   D C4    1 
ATOM 5706  O O4    . U   D 4  61  ? 63.441  -28.429  37.425  1.00 0.00 ? 101  U   D O4    1 
ATOM 5707  C C5    . U   D 4  61  ? 63.716  -26.377  38.594  1.00 0.00 ? 101  U   D C5    1 
ATOM 5708  C C6    . U   D 4  61  ? 63.497  -25.051  38.559  1.00 0.00 ? 101  U   D C6    1 
ATOM 5709  P P     . U   D 4  62  ? 58.956  -22.104  40.624  1.00 0.00 ? 102  U   D P     1 
ATOM 5710  O OP1   . U   D 4  62  ? 58.057  -21.019  41.078  1.00 0.00 ? 102  U   D OP1   1 
ATOM 5711  O OP2   . U   D 4  62  ? 59.403  -23.079  41.646  1.00 0.00 ? 102  U   D OP2   1 
ATOM 5712  O "O5'" . U   D 4  62  ? 58.261  -22.895  39.437  1.00 0.00 ? 102  U   D "O5'" 1 
ATOM 5713  C "C5'" . U   D 4  62  ? 57.419  -22.169  38.528  1.00 0.00 ? 102  U   D "C5'" 1 
ATOM 5714  C "C4'" . U   D 4  62  ? 57.014  -23.056  37.339  1.00 0.00 ? 102  U   D "C4'" 1 
ATOM 5715  O "O4'" . U   D 4  62  ? 58.180  -23.657  36.712  1.00 0.00 ? 102  U   D "O4'" 1 
ATOM 5716  C "C3'" . U   D 4  62  ? 56.127  -24.261  37.662  1.00 0.00 ? 102  U   D "C3'" 1 
ATOM 5717  O "O3'" . U   D 4  62  ? 54.774  -23.830  37.843  1.00 0.00 ? 102  U   D "O3'" 1 
ATOM 5718  C "C2'" . U   D 4  62  ? 56.358  -25.113  36.426  1.00 0.00 ? 102  U   D "C2'" 1 
ATOM 5719  O "O2'" . U   D 4  62  ? 55.667  -24.606  35.308  1.00 0.00 ? 102  U   D "O2'" 1 
ATOM 5720  C "C1'" . U   D 4  62  ? 57.842  -24.942  36.210  1.00 0.00 ? 102  U   D "C1'" 1 
ATOM 5721  N N1    . U   D 4  62  ? 58.614  -26.069  36.831  1.00 0.00 ? 102  U   D N1    1 
ATOM 5722  C C2    . U   D 4  62  ? 58.614  -27.273  36.140  1.00 0.00 ? 102  U   D C2    1 
ATOM 5723  O O2    . U   D 4  62  ? 58.024  -27.402  35.075  1.00 0.00 ? 102  U   D O2    1 
ATOM 5724  N N3    . U   D 4  62  ? 59.331  -28.310  36.751  1.00 0.00 ? 102  U   D N3    1 
ATOM 5725  C C4    . U   D 4  62  ? 59.968  -28.271  38.003  1.00 0.00 ? 102  U   D C4    1 
ATOM 5726  O O4    . U   D 4  62  ? 60.556  -29.254  38.454  1.00 0.00 ? 102  U   D O4    1 
ATOM 5727  C C5    . U   D 4  62  ? 59.855  -26.992  38.670  1.00 0.00 ? 102  U   D C5    1 
ATOM 5728  C C6    . U   D 4  62  ? 59.208  -25.974  38.073  1.00 0.00 ? 102  U   D C6    1 
ATOM 5729  P P     . G   D 4  63  ? 53.789  -24.744  38.689  1.00 0.00 ? 103  G   D P     1 
ATOM 5730  O OP1   . G   D 4  63  ? 52.430  -24.163  38.618  1.00 0.00 ? 103  G   D OP1   1 
ATOM 5731  O OP2   . G   D 4  63  ? 54.363  -24.935  40.040  1.00 0.00 ? 103  G   D OP2   1 
ATOM 5732  O "O5'" . G   D 4  63  ? 53.800  -26.144  37.944  1.00 0.00 ? 103  G   D "O5'" 1 
ATOM 5733  C "C5'" . G   D 4  63  ? 52.974  -26.326  36.787  1.00 0.00 ? 103  G   D "C5'" 1 
ATOM 5734  C "C4'" . G   D 4  63  ? 53.029  -27.784  36.320  1.00 0.00 ? 103  G   D "C4'" 1 
ATOM 5735  O "O4'" . G   D 4  63  ? 54.380  -28.190  35.995  1.00 0.00 ? 103  G   D "O4'" 1 
ATOM 5736  C "C3'" . G   D 4  63  ? 52.586  -28.835  37.338  1.00 0.00 ? 103  G   D "C3'" 1 
ATOM 5737  O "O3'" . G   D 4  63  ? 51.147  -28.868  37.417  1.00 0.00 ? 103  G   D "O3'" 1 
ATOM 5738  C "C2'" . G   D 4  63  ? 53.200  -30.092  36.748  1.00 0.00 ? 103  G   D "C2'" 1 
ATOM 5739  O "O2'" . G   D 4  63  ? 52.464  -30.545  35.636  1.00 0.00 ? 103  G   D "O2'" 1 
ATOM 5740  C "C1'" . G   D 4  63  ? 54.536  -29.572  36.266  1.00 0.00 ? 103  G   D "C1'" 1 
ATOM 5741  N N9    . G   D 4  63  ? 55.608  -29.838  37.248  1.00 0.00 ? 103  G   D N9    1 
ATOM 5742  C C8    . G   D 4  63  ? 55.987  -29.036  38.306  1.00 0.00 ? 103  G   D C8    1 
ATOM 5743  N N7    . G   D 4  63  ? 56.960  -29.546  39.008  1.00 0.00 ? 103  G   D N7    1 
ATOM 5744  C C5    . G   D 4  63  ? 57.244  -30.744  38.399  1.00 0.00 ? 103  G   D C5    1 
ATOM 5745  C C6    . G   D 4  63  ? 58.208  -31.707  38.766  1.00 0.00 ? 103  G   D C6    1 
ATOM 5746  O O6    . G   D 4  63  ? 58.978  -31.601  39.726  1.00 0.00 ? 103  G   D O6    1 
ATOM 5747  N N1    . G   D 4  63  ? 58.161  -32.813  37.883  1.00 0.00 ? 103  G   D N1    1 
ATOM 5748  C C2    . G   D 4  63  ? 57.295  -32.966  36.790  1.00 0.00 ? 103  G   D C2    1 
ATOM 5749  N N2    . G   D 4  63  ? 57.448  -34.124  36.079  1.00 0.00 ? 103  G   D N2    1 
ATOM 5750  N N3    . G   D 4  63  ? 56.382  -32.007  36.469  1.00 0.00 ? 103  G   D N3    1 
ATOM 5751  C C4    . G   D 4  63  ? 56.416  -30.953  37.307  1.00 0.00 ? 103  G   D C4    1 
ATOM 5752  P P     . U   E 5  1   ? 76.164  -35.000  -3.083  1.00 0.00 ? 528  U   E P     1 
ATOM 5753  O OP1   . U   E 5  1   ? 75.262  -36.107  -3.473  1.00 0.00 ? 528  U   E OP1   1 
ATOM 5754  O OP2   . U   E 5  1   ? 76.436  -34.736  -1.653  1.00 0.00 ? 528  U   E OP2   1 
ATOM 5755  O "O5'" . U   E 5  1   ? 77.501  -35.008  -3.925  1.00 0.00 ? 528  U   E "O5'" 1 
ATOM 5756  C "C5'" . U   E 5  1   ? 77.408  -34.812  -5.343  1.00 0.00 ? 528  U   E "C5'" 1 
ATOM 5757  C "C4'" . U   E 5  1   ? 78.796  -34.507  -5.910  1.00 0.00 ? 528  U   E "C4'" 1 
ATOM 5758  O "O4'" . U   E 5  1   ? 79.358  -33.335  -5.275  1.00 0.00 ? 528  U   E "O4'" 1 
ATOM 5759  C "C3'" . U   E 5  1   ? 79.875  -35.569  -5.689  1.00 0.00 ? 528  U   E "C3'" 1 
ATOM 5760  O "O3'" . U   E 5  1   ? 79.696  -36.638  -6.620  1.00 0.00 ? 528  U   E "O3'" 1 
ATOM 5761  C "C2'" . U   E 5  1   ? 81.133  -34.750  -5.917  1.00 0.00 ? 528  U   E "C2'" 1 
ATOM 5762  O "O2'" . U   E 5  1   ? 81.375  -34.524  -7.287  1.00 0.00 ? 528  U   E "O2'" 1 
ATOM 5763  C "C1'" . U   E 5  1   ? 80.773  -33.452  -5.239  1.00 0.00 ? 528  U   E "C1'" 1 
ATOM 5764  N N1    . U   E 5  1   ? 81.346  -33.383  -3.860  1.00 0.00 ? 528  U   E N1    1 
ATOM 5765  C C2    . U   E 5  1   ? 82.676  -33.009  -3.753  1.00 0.00 ? 528  U   E C2    1 
ATOM 5766  O O2    . U   E 5  1   ? 83.354  -32.739  -4.742  1.00 0.00 ? 528  U   E O2    1 
ATOM 5767  N N3    . U   E 5  1   ? 83.175  -32.974  -2.448  1.00 0.00 ? 528  U   E N3    1 
ATOM 5768  C C4    . U   E 5  1   ? 82.484  -33.299  -1.269  1.00 0.00 ? 528  U   E C4    1 
ATOM 5769  O O4    . U   E 5  1   ? 83.026  -33.206  -0.165  1.00 0.00 ? 528  U   E O4    1 
ATOM 5770  C C5    . U   E 5  1   ? 81.124  -33.727  -1.494  1.00 0.00 ? 528  U   E C5    1 
ATOM 5771  C C6    . U   E 5  1   ? 80.625  -33.757  -2.742  1.00 0.00 ? 528  U   E C6    1 
ATOM 5772  P P     . G   E 5  2   ? 80.175  -38.096  -6.221  1.00 0.00 ? 529  G   E P     1 
ATOM 5773  O OP1   . G   E 5  2   ? 80.112  -38.951  -7.429  1.00 0.00 ? 529  G   E OP1   1 
ATOM 5774  O OP2   . G   E 5  2   ? 79.403  -38.540  -5.039  1.00 0.00 ? 529  G   E OP2   1 
ATOM 5775  O "O5'" . G   E 5  2   ? 81.691  -37.899  -5.790  1.00 0.00 ? 529  G   E "O5'" 1 
ATOM 5776  C "C5'" . G   E 5  2   ? 82.692  -37.896  -6.819  1.00 0.00 ? 529  G   E "C5'" 1 
ATOM 5777  C "C4'" . G   E 5  2   ? 84.086  -37.738  -6.204  1.00 0.00 ? 529  G   E "C4'" 1 
ATOM 5778  O "O4'" . G   E 5  2   ? 84.193  -36.526  -5.421  1.00 0.00 ? 529  G   E "O4'" 1 
ATOM 5779  C "C3'" . G   E 5  2   ? 84.517  -38.828  -5.225  1.00 0.00 ? 529  G   E "C3'" 1 
ATOM 5780  O "O3'" . G   E 5  2   ? 84.887  -39.998  -5.955  1.00 0.00 ? 529  G   E "O3'" 1 
ATOM 5781  C "C2'" . G   E 5  2   ? 85.667  -38.138  -4.516  1.00 0.00 ? 529  G   E "C2'" 1 
ATOM 5782  O "O2'" . G   E 5  2   ? 86.833  -38.108  -5.305  1.00 0.00 ? 529  G   E "O2'" 1 
ATOM 5783  C "C1'" . G   E 5  2   ? 85.114  -36.740  -4.366  1.00 0.00 ? 529  G   E "C1'" 1 
ATOM 5784  N N9    . G   E 5  2   ? 84.506  -36.571  -3.035  1.00 0.00 ? 529  G   E N9    1 
ATOM 5785  C C8    . G   E 5  2   ? 83.211  -36.834  -2.644  1.00 0.00 ? 529  G   E C8    1 
ATOM 5786  N N7    . G   E 5  2   ? 83.015  -36.633  -1.368  1.00 0.00 ? 529  G   E N7    1 
ATOM 5787  C C5    . G   E 5  2   ? 84.239  -36.233  -0.886  1.00 0.00 ? 529  G   E C5    1 
ATOM 5788  C C6    . G   E 5  2   ? 84.612  -35.947  0.445   1.00 0.00 ? 529  G   E C6    1 
ATOM 5789  O O6    . G   E 5  2   ? 83.845  -35.993  1.412   1.00 0.00 ? 529  G   E O6    1 
ATOM 5790  N N1    . G   E 5  2   ? 85.981  -35.586  0.505   1.00 0.00 ? 529  G   E N1    1 
ATOM 5791  C C2    . G   E 5  2   ? 86.866  -35.539  -0.585  1.00 0.00 ? 529  G   E C2    1 
ATOM 5792  N N2    . G   E 5  2   ? 88.140  -35.178  -0.299  1.00 0.00 ? 529  G   E N2    1 
ATOM 5793  N N3    . G   E 5  2   ? 86.473  -35.846  -1.840  1.00 0.00 ? 529  G   E N3    1 
ATOM 5794  C C4    . G   E 5  2   ? 85.172  -36.174  -1.907  1.00 0.00 ? 529  G   E C4    1 
ATOM 5795  P P     . A   E 5  3   ? 84.728  -41.426  -5.292  1.00 0.00 ? 530  A   E P     1 
ATOM 5796  O OP1   . A   E 5  3   ? 85.149  -42.444  -6.281  1.00 0.00 ? 530  A   E OP1   1 
ATOM 5797  O OP2   . A   E 5  3   ? 83.364  -41.551  -4.730  1.00 0.00 ? 530  A   E OP2   1 
ATOM 5798  O "O5'" . A   E 5  3   ? 85.782  -41.412  -4.106  1.00 0.00 ? 530  A   E "O5'" 1 
ATOM 5799  C "C5'" . A   E 5  3   ? 85.664  -42.454  -3.117  1.00 0.00 ? 530  A   E "C5'" 1 
ATOM 5800  C "C4'" . A   E 5  3   ? 86.992  -42.650  -2.376  1.00 0.00 ? 530  A   E "C4'" 1 
ATOM 5801  O "O4'" . A   E 5  3   ? 88.049  -42.987  -3.305  1.00 0.00 ? 530  A   E "O4'" 1 
ATOM 5802  C "C3'" . A   E 5  3   ? 87.535  -41.433  -1.625  1.00 0.00 ? 530  A   E "C3'" 1 
ATOM 5803  O "O3'" . A   E 5  3   ? 86.881  -41.330  -0.355  1.00 0.00 ? 530  A   E "O3'" 1 
ATOM 5804  C "C2'" . A   E 5  3   ? 89.021  -41.749  -1.539  1.00 0.00 ? 530  A   E "C2'" 1 
ATOM 5805  O "O2'" . A   E 5  3   ? 89.309  -42.649  -0.494  1.00 0.00 ? 530  A   E "O2'" 1 
ATOM 5806  C "C1'" . A   E 5  3   ? 89.272  -42.421  -2.867  1.00 0.00 ? 530  A   E "C1'" 1 
ATOM 5807  N N9    . A   E 5  3   ? 89.840  -41.493  -3.861  1.00 0.00 ? 530  A   E N9    1 
ATOM 5808  C C8    . A   E 5  3   ? 89.211  -40.872  -4.916  1.00 0.00 ? 530  A   E C8    1 
ATOM 5809  N N7    . A   E 5  3   ? 90.012  -40.137  -5.635  1.00 0.00 ? 530  A   E N7    1 
ATOM 5810  C C5    . A   E 5  3   ? 91.242  -40.261  -5.051  1.00 0.00 ? 530  A   E C5    1 
ATOM 5811  C C6    . A   E 5  3   ? 92.484  -39.722  -5.427  1.00 0.00 ? 530  A   E C6    1 
ATOM 5812  N N6    . A   E 5  3   ? 92.563  -38.985  -6.574  1.00 0.00 ? 530  A   E N6    1 
ATOM 5813  N N1    . A   E 5  3   ? 93.533  -40.026  -4.594  1.00 0.00 ? 530  A   E N1    1 
ATOM 5814  C C2    . A   E 5  3   ? 93.301  -40.810  -3.528  1.00 0.00 ? 530  A   E C2    1 
ATOM 5815  N N3    . A   E 5  3   ? 92.168  -41.399  -3.116  1.00 0.00 ? 530  A   E N3    1 
ATOM 5816  C C4    . A   E 5  3   ? 91.153  -41.083  -3.933  1.00 0.00 ? 530  A   E C4    1 
ATOM 5817  P P     . A   E 5  4   ? 86.458  -39.921  0.224   1.00 0.00 ? 531  A   E P     1 
ATOM 5818  O OP1   . A   E 5  4   ? 85.702  -40.128  1.479   1.00 0.00 ? 531  A   E OP1   1 
ATOM 5819  O OP2   . A   E 5  4   ? 85.795  -39.138  -0.844  1.00 0.00 ? 531  A   E OP2   1 
ATOM 5820  O "O5'" . A   E 5  4   ? 87.840  -39.245  0.566   1.00 0.00 ? 531  A   E "O5'" 1 
ATOM 5821  C "C5'" . A   E 5  4   ? 88.653  -39.720  1.647   1.00 0.00 ? 531  A   E "C5'" 1 
ATOM 5822  C "C4'" . A   E 5  4   ? 90.013  -39.011  1.612   1.00 0.00 ? 531  A   E "C4'" 1 
ATOM 5823  O "O4'" . A   E 5  4   ? 90.690  -39.297  0.368   1.00 0.00 ? 531  A   E "O4'" 1 
ATOM 5824  C "C3'" . A   E 5  4   ? 89.920  -37.484  1.654   1.00 0.00 ? 531  A   E "C3'" 1 
ATOM 5825  O "O3'" . A   E 5  4   ? 89.927  -37.040  3.014   1.00 0.00 ? 531  A   E "O3'" 1 
ATOM 5826  C "C2'" . A   E 5  4   ? 91.105  -37.004  0.829   1.00 0.00 ? 531  A   E "C2'" 1 
ATOM 5827  O "O2'" . A   E 5  4   ? 92.271  -36.867  1.601   1.00 0.00 ? 531  A   E "O2'" 1 
ATOM 5828  C "C1'" . A   E 5  4   ? 91.285  -38.128  -0.159  1.00 0.00 ? 531  A   E "C1'" 1 
ATOM 5829  N N9    . A   E 5  4   ? 90.765  -37.798  -1.496  1.00 0.00 ? 531  A   E N9    1 
ATOM 5830  C C8    . A   E 5  4   ? 89.537  -38.079  -2.047  1.00 0.00 ? 531  A   E C8    1 
ATOM 5831  N N7    . A   E 5  4   ? 89.415  -37.680  -3.280  1.00 0.00 ? 531  A   E N7    1 
ATOM 5832  C C5    . A   E 5  4   ? 90.609  -37.098  -3.588  1.00 0.00 ? 531  A   E C5    1 
ATOM 5833  C C6    . A   E 5  4   ? 91.051  -36.529  -4.791  1.00 0.00 ? 531  A   E C6    1 
ATOM 5834  N N6    . A   E 5  4   ? 90.246  -36.597  -5.899  1.00 0.00 ? 531  A   E N6    1 
ATOM 5835  N N1    . A   E 5  4   ? 92.302  -35.965  -4.736  1.00 0.00 ? 531  A   E N1    1 
ATOM 5836  C C2    . A   E 5  4   ? 93.002  -36.038  -3.593  1.00 0.00 ? 531  A   E C2    1 
ATOM 5837  N N3    . A   E 5  4   ? 92.688  -36.619  -2.425  1.00 0.00 ? 531  A   E N3    1 
ATOM 5838  C C4    . A   E 5  4   ? 91.456  -37.139  -2.484  1.00 0.00 ? 531  A   E C4    1 
ATOM 5839  P P     . A   E 5  5   ? 88.788  -36.100  3.575   1.00 0.00 ? 532  A   E P     1 
ATOM 5840  O OP1   . A   E 5  5   ? 89.146  -35.705  4.957   1.00 0.00 ? 532  A   E OP1   1 
ATOM 5841  O OP2   . A   E 5  5   ? 87.470  -36.742  3.369   1.00 0.00 ? 532  A   E OP2   1 
ATOM 5842  O "O5'" . A   E 5  5   ? 88.915  -34.852  2.616   1.00 0.00 ? 532  A   E "O5'" 1 
ATOM 5843  C "C5'" . A   E 5  5   ? 88.600  -33.529  3.051   1.00 0.00 ? 532  A   E "C5'" 1 
ATOM 5844  C "C4'" . A   E 5  5   ? 89.554  -32.551  2.366   1.00 0.00 ? 532  A   E "C4'" 1 
ATOM 5845  O "O4'" . A   E 5  5   ? 89.364  -32.553  0.925   1.00 0.00 ? 532  A   E "O4'" 1 
ATOM 5846  C "C3'" . A   E 5  5   ? 89.315  -31.099  2.800   1.00 0.00 ? 532  A   E "C3'" 1 
ATOM 5847  O "O3'" . A   E 5  5   ? 90.537  -30.430  3.074   1.00 0.00 ? 532  A   E "O3'" 1 
ATOM 5848  C "C2'" . A   E 5  5   ? 88.368  -30.590  1.705   1.00 0.00 ? 532  A   E "C2'" 1 
ATOM 5849  O "O2'" . A   E 5  5   ? 88.355  -29.194  1.557   1.00 0.00 ? 532  A   E "O2'" 1 
ATOM 5850  C "C1'" . A   E 5  5   ? 88.909  -31.291  0.494   1.00 0.00 ? 532  A   E "C1'" 1 
ATOM 5851  N N9    . A   E 5  5   ? 87.939  -31.400  -0.605  1.00 0.00 ? 532  A   E N9    1 
ATOM 5852  C C8    . A   E 5  5   ? 86.661  -31.906  -0.606  1.00 0.00 ? 532  A   E C8    1 
ATOM 5853  N N7    . A   E 5  5   ? 86.086  -31.846  -1.780  1.00 0.00 ? 532  A   E N7    1 
ATOM 5854  C C5    . A   E 5  5   ? 87.014  -31.280  -2.612  1.00 0.00 ? 532  A   E C5    1 
ATOM 5855  C C6    . A   E 5  5   ? 86.954  -30.963  -3.982  1.00 0.00 ? 532  A   E C6    1 
ATOM 5856  N N6    . A   E 5  5   ? 85.818  -31.223  -4.689  1.00 0.00 ? 532  A   E N6    1 
ATOM 5857  N N1    . A   E 5  5   ? 88.090  -30.398  -4.508  1.00 0.00 ? 532  A   E N1    1 
ATOM 5858  C C2    . A   E 5  5   ? 89.142  -30.199  -3.703  1.00 0.00 ? 532  A   E C2    1 
ATOM 5859  N N3    . A   E 5  5   ? 89.286  -30.468  -2.401  1.00 0.00 ? 532  A   E N3    1 
ATOM 5860  C C4    . A   E 5  5   ? 88.171  -31.004  -1.898  1.00 0.00 ? 532  A   E C4    1 
ATOM 5861  P P     . A   E 5  6   ? 91.473  -29.307  2.508   1.00 0.00 ? 533  A   E P     1 
ATOM 5862  O OP1   . A   E 5  6   ? 92.737  -29.321  3.281   1.00 0.00 ? 533  A   E OP1   1 
ATOM 5863  O OP2   . A   E 5  6   ? 90.733  -28.026  2.498   1.00 0.00 ? 533  A   E OP2   1 
ATOM 5864  O "O5'" . A   E 5  6   ? 91.800  -29.743  1.018   1.00 0.00 ? 533  A   E "O5'" 1 
ATOM 5865  C "C5'" . A   E 5  6   ? 92.555  -30.945  0.800   1.00 0.00 ? 533  A   E "C5'" 1 
ATOM 5866  C "C4'" . A   E 5  6   ? 93.366  -30.855  -0.496  1.00 0.00 ? 533  A   E "C4'" 1 
ATOM 5867  O "O4'" . A   E 5  6   ? 93.555  -32.169  -1.064  1.00 0.00 ? 533  A   E "O4'" 1 
ATOM 5868  C "C3'" . A   E 5  6   ? 92.786  -29.999  -1.610  1.00 0.00 ? 533  A   E "C3'" 1 
ATOM 5869  O "O3'" . A   E 5  6   ? 93.227  -28.662  -1.396  1.00 0.00 ? 533  A   E "O3'" 1 
ATOM 5870  C "C2'" . A   E 5  6   ? 93.323  -30.685  -2.860  1.00 0.00 ? 533  A   E "C2'" 1 
ATOM 5871  O "O2'" . A   E 5  6   ? 94.656  -30.323  -3.139  1.00 0.00 ? 533  A   E "O2'" 1 
ATOM 5872  C "C1'" . A   E 5  6   ? 93.272  -32.138  -2.447  1.00 0.00 ? 533  A   E "C1'" 1 
ATOM 5873  N N9    . A   E 5  6   ? 91.962  -32.751  -2.712  1.00 0.00 ? 533  A   E N9    1 
ATOM 5874  C C8    . A   E 5  6   ? 91.128  -33.352  -1.796  1.00 0.00 ? 533  A   E C8    1 
ATOM 5875  N N7    . A   E 5  6   ? 90.030  -33.803  -2.318  1.00 0.00 ? 533  A   E N7    1 
ATOM 5876  C C5    . A   E 5  6   ? 90.115  -33.514  -3.646  1.00 0.00 ? 533  A   E C5    1 
ATOM 5877  C C6    . A   E 5  6   ? 89.211  -33.778  -4.680  1.00 0.00 ? 533  A   E C6    1 
ATOM 5878  N N6    . A   E 5  6   ? 88.017  -34.374  -4.373  1.00 0.00 ? 533  A   E N6    1 
ATOM 5879  N N1    . A   E 5  6   ? 89.640  -33.407  -5.930  1.00 0.00 ? 533  A   E N1    1 
ATOM 5880  C C2    . A   E 5  6   ? 90.844  -32.831  -6.063  1.00 0.00 ? 533  A   E C2    1 
ATOM 5881  N N3    . A   E 5  6   ? 91.745  -32.499  -5.130  1.00 0.00 ? 533  A   E N3    1 
ATOM 5882  C C4    . A   E 5  6   ? 91.319  -32.875  -3.918  1.00 0.00 ? 533  A   E C4    1 
ATOM 5883  P P     . G   E 5  7   ? 92.665  -27.420  -2.174  1.00 0.00 ? 534  G   E P     1 
ATOM 5884  O OP1   . G   E 5  7   ? 91.930  -27.849  -3.386  1.00 0.00 ? 534  G   E OP1   1 
ATOM 5885  O OP2   . G   E 5  7   ? 93.774  -26.458  -2.357  1.00 0.00 ? 534  G   E OP2   1 
ATOM 5886  O "O5'" . G   E 5  7   ? 91.660  -26.817  -1.106  1.00 0.00 ? 534  G   E "O5'" 1 
ATOM 5887  C "C5'" . G   E 5  7   ? 90.362  -27.387  -0.916  1.00 0.00 ? 534  G   E "C5'" 1 
ATOM 5888  C "C4'" . G   E 5  7   ? 89.359  -26.640  -1.785  1.00 0.00 ? 534  G   E "C4'" 1 
ATOM 5889  O "O4'" . G   E 5  7   ? 88.185  -27.462  -2.018  1.00 0.00 ? 534  G   E "O4'" 1 
ATOM 5890  C "C3'" . G   E 5  7   ? 88.817  -25.372  -1.109  1.00 0.00 ? 534  G   E "C3'" 1 
ATOM 5891  O "O3'" . G   E 5  7   ? 88.551  -24.347  -2.072  1.00 0.00 ? 534  G   E "O3'" 1 
ATOM 5892  C "C2'" . G   E 5  7   ? 87.561  -25.889  -0.433  1.00 0.00 ? 534  G   E "C2'" 1 
ATOM 5893  O "O2'" . G   E 5  7   ? 86.647  -24.861  -0.130  1.00 0.00 ? 534  G   E "O2'" 1 
ATOM 5894  C "C1'" . G   E 5  7   ? 87.053  -26.794  -1.510  1.00 0.00 ? 534  G   E "C1'" 1 
ATOM 5895  N N9    . G   E 5  7   ? 85.997  -27.713  -1.068  1.00 0.00 ? 534  G   E N9    1 
ATOM 5896  C C8    . G   E 5  7   ? 85.705  -28.131  0.211   1.00 0.00 ? 534  G   E C8    1 
ATOM 5897  N N7    . G   E 5  7   ? 84.669  -28.920  0.264   1.00 0.00 ? 534  G   E N7    1 
ATOM 5898  C C5    . G   E 5  7   ? 84.239  -29.018  -1.036  1.00 0.00 ? 534  G   E C5    1 
ATOM 5899  C C6    . G   E 5  7   ? 83.066  -29.624  -1.520  1.00 0.00 ? 534  G   E C6    1 
ATOM 5900  O O6    . G   E 5  7   ? 82.273  -30.256  -0.817  1.00 0.00 ? 534  G   E O6    1 
ATOM 5901  N N1    . G   E 5  7   ? 82.933  -29.401  -2.912  1.00 0.00 ? 534  G   E N1    1 
ATOM 5902  C C2    . G   E 5  7   ? 83.827  -28.680  -3.722  1.00 0.00 ? 534  G   E C2    1 
ATOM 5903  N N2    . G   E 5  7   ? 83.479  -28.568  -5.035  1.00 0.00 ? 534  G   E N2    1 
ATOM 5904  N N3    . G   E 5  7   ? 84.960  -28.131  -3.217  1.00 0.00 ? 534  G   E N3    1 
ATOM 5905  C C4    . G   E 5  7   ? 85.066  -28.303  -1.885  1.00 0.00 ? 534  G   E C4    1 
ATOM 5906  P P     . A   E 5  8   ? 89.072  -22.866  -1.891  1.00 0.00 ? 535  A   E P     1 
ATOM 5907  O OP1   . A   E 5  8   ? 89.668  -22.688  -0.547  1.00 0.00 ? 535  A   E OP1   1 
ATOM 5908  O OP2   . A   E 5  8   ? 87.984  -21.939  -2.275  1.00 0.00 ? 535  A   E OP2   1 
ATOM 5909  O "O5'" . A   E 5  8   ? 90.202  -22.774  -2.983  1.00 0.00 ? 535  A   E "O5'" 1 
ATOM 5910  C "C5'" . A   E 5  8   ? 91.486  -23.372  -2.778  1.00 0.00 ? 535  A   E "C5'" 1 
ATOM 5911  C "C4'" . A   E 5  8   ? 92.212  -23.470  -4.122  1.00 0.00 ? 535  A   E "C4'" 1 
ATOM 5912  O "O4'" . A   E 5  8   ? 91.482  -24.341  -5.021  1.00 0.00 ? 535  A   E "O4'" 1 
ATOM 5913  C "C3'" . A   E 5  8   ? 92.332  -22.151  -4.894  1.00 0.00 ? 535  A   E "C3'" 1 
ATOM 5914  O "O3'" . A   E 5  8   ? 93.452  -21.415  -4.385  1.00 0.00 ? 535  A   E "O3'" 1 
ATOM 5915  C "C2'" . A   E 5  8   ? 92.473  -22.635  -6.333  1.00 0.00 ? 535  A   E "C2'" 1 
ATOM 5916  O "O2'" . A   E 5  8   ? 93.791  -23.047  -6.618  1.00 0.00 ? 535  A   E "O2'" 1 
ATOM 5917  C "C1'" . A   E 5  8   ? 91.561  -23.841  -6.343  1.00 0.00 ? 535  A   E "C1'" 1 
ATOM 5918  N N9    . A   E 5  8   ? 90.228  -23.557  -6.910  1.00 0.00 ? 535  A   E N9    1 
ATOM 5919  C C8    . A   E 5  8   ? 89.080  -23.151  -6.269  1.00 0.00 ? 535  A   E C8    1 
ATOM 5920  N N7    . A   E 5  8   ? 88.056  -23.023  -7.067  1.00 0.00 ? 535  A   E N7    1 
ATOM 5921  C C5    . A   E 5  8   ? 88.522  -23.354  -8.310  1.00 0.00 ? 535  A   E C5    1 
ATOM 5922  C C6    . A   E 5  8   ? 87.854  -23.417  -9.547  1.00 0.00 ? 535  A   E C6    1 
ATOM 5923  N N6    . A   E 5  8   ? 86.521  -23.101  -9.601  1.00 0.00 ? 535  A   E N6    1 
ATOM 5924  N N1    . A   E 5  8   ? 88.635  -23.797  -10.614 1.00 0.00 ? 535  A   E N1    1 
ATOM 5925  C C2    . A   E 5  8   ? 89.933  -24.065  -10.399 1.00 0.00 ? 535  A   E C2    1 
ATOM 5926  N N3    . A   E 5  8   ? 90.647  -24.033  -9.264  1.00 0.00 ? 535  A   E N3    1 
ATOM 5927  C C4    . A   E 5  8   ? 89.872  -23.679  -8.234  1.00 0.00 ? 535  A   E C4    1 
ATOM 5928  P P     . A   E 5  9   ? 93.538  -19.862  -4.691  1.00 0.00 ? 536  A   E P     1 
ATOM 5929  O OP1   . A   E 5  9   ? 92.551  -19.150  -3.847  1.00 0.00 ? 536  A   E OP1   1 
ATOM 5930  O OP2   . A   E 5  9   ? 93.470  -19.644  -6.154  1.00 0.00 ? 536  A   E OP2   1 
ATOM 5931  O "O5'" . A   E 5  9   ? 94.997  -19.496  -4.204  1.00 0.00 ? 536  A   E "O5'" 1 
ATOM 5932  C "C5'" . A   E 5  9   ? 95.424  -19.725  -2.854  1.00 0.00 ? 536  A   E "C5'" 1 
ATOM 5933  C "C4'" . A   E 5  9   ? 96.906  -20.122  -2.829  1.00 0.00 ? 536  A   E "C4'" 1 
ATOM 5934  O "O4'" . A   E 5  9   ? 97.071  -21.376  -3.544  1.00 0.00 ? 536  A   E "O4'" 1 
ATOM 5935  C "C3'" . A   E 5  9   ? 97.879  -19.156  -3.527  1.00 0.00 ? 536  A   E "C3'" 1 
ATOM 5936  O "O3'" . A   E 5  9   ? 98.338  -18.163  -2.605  1.00 0.00 ? 536  A   E "O3'" 1 
ATOM 5937  C "C2'" . A   E 5  9   ? 98.979  -20.079  -4.017  1.00 0.00 ? 536  A   E "C2'" 1 
ATOM 5938  O "O2'" . A   E 5  9   ? 99.905  -20.384  -3.009  1.00 0.00 ? 536  A   E "O2'" 1 
ATOM 5939  C "C1'" . A   E 5  9   ? 98.222  -21.329  -4.368  1.00 0.00 ? 536  A   E "C1'" 1 
ATOM 5940  N N9    . A   E 5  9   ? 97.893  -21.394  -5.796  1.00 0.00 ? 536  A   E N9    1 
ATOM 5941  C C8    . A   E 5  9   ? 96.656  -21.442  -6.391  1.00 0.00 ? 536  A   E C8    1 
ATOM 5942  N N7    . A   E 5  9   ? 96.707  -21.474  -7.690  1.00 0.00 ? 536  A   E N7    1 
ATOM 5943  C C5    . A   E 5  9   ? 98.040  -21.448  -7.996  1.00 0.00 ? 536  A   E C5    1 
ATOM 5944  C C6    . A   E 5  9   ? 98.687  -21.397  -9.237  1.00 0.00 ? 536  A   E C6    1 
ATOM 5945  N N6    . A   E 5  9   ? 97.924  -21.243  -10.352 1.00 0.00 ? 536  A   E N6    1 
ATOM 5946  N N1    . A   E 5  9   ? 100.058 -21.445  -9.200  1.00 0.00 ? 536  A   E N1    1 
ATOM 5947  C C2    . A   E 5  9   ? 100.660 -21.504  -8.003  1.00 0.00 ? 536  A   E C2    1 
ATOM 5948  N N3    . A   E 5  9   ? 100.129 -21.484  -6.772  1.00 0.00 ? 536  A   E N3    1 
ATOM 5949  C C4    . A   E 5  9   ? 98.792  -21.438  -6.833  1.00 0.00 ? 536  A   E C4    1 
ATOM 5950  P P     . C   E 5  10  ? 98.438  -16.634  -2.997  1.00 0.00 ? 537  C   E P     1 
ATOM 5951  O OP1   . C   E 5  10  ? 99.125  -15.914  -1.901  1.00 0.00 ? 537  C   E OP1   1 
ATOM 5952  O OP2   . C   E 5  10  ? 97.092  -16.153  -3.383  1.00 0.00 ? 537  C   E OP2   1 
ATOM 5953  O "O5'" . C   E 5  10  ? 99.362  -16.622  -4.278  1.00 0.00 ? 537  C   E "O5'" 1 
ATOM 5954  C "C5'" . C   E 5  10  ? 100.782 -16.787  -4.190  1.00 0.00 ? 537  C   E "C5'" 1 
ATOM 5955  C "C4'" . C   E 5  10  ? 101.380 -16.888  -5.603  1.00 0.00 ? 537  C   E "C4'" 1 
ATOM 5956  O "O4'" . C   E 5  10  ? 100.867 -18.068  -6.270  1.00 0.00 ? 537  C   E "O4'" 1 
ATOM 5957  C "C3'" . C   E 5  10  ? 101.024 -15.734  -6.554  1.00 0.00 ? 537  C   E "C3'" 1 
ATOM 5958  O "O3'" . C   E 5  10  ? 101.962 -14.665  -6.374  1.00 0.00 ? 537  C   E "O3'" 1 
ATOM 5959  C "C2'" . C   E 5  10  ? 101.074 -16.394  -7.924  1.00 0.00 ? 537  C   E "C2'" 1 
ATOM 5960  O "O2'" . C   E 5  10  ? 102.393 -16.494  -8.411  1.00 0.00 ? 537  C   E "O2'" 1 
ATOM 5961  C "C1'" . C   E 5  10  ? 100.544 -17.777  -7.621  1.00 0.00 ? 537  C   E "C1'" 1 
ATOM 5962  N N1    . C   E 5  10  ? 99.086  -17.927  -7.948  1.00 0.00 ? 537  C   E N1    1 
ATOM 5963  C C2    . C   E 5  10  ? 98.666  -18.009  -9.278  1.00 0.00 ? 537  C   E C2    1 
ATOM 5964  O O2    . C   E 5  10  ? 99.518  -17.959  -10.185 1.00 0.00 ? 537  C   E O2    1 
ATOM 5965  N N3    . C   E 5  10  ? 97.332  -18.163  -9.533  1.00 0.00 ? 537  C   E N3    1 
ATOM 5966  C C4    . C   E 5  10  ? 96.413  -18.264  -8.534  1.00 0.00 ? 537  C   E C4    1 
ATOM 5967  N N4    . C   E 5  10  ? 95.093  -18.505  -8.788  1.00 0.00 ? 537  C   E N4    1 
ATOM 5968  C C5    . C   E 5  10  ? 96.842  -18.159  -7.175  1.00 0.00 ? 537  C   E C5    1 
ATOM 5969  C C6    . C   E 5  10  ? 98.151  -18.001  -6.939  1.00 0.00 ? 537  C   E C6    1 
ATOM 5970  P P     . U   E 5  11  ? 101.498 -13.158  -6.524  1.00 0.00 ? 538  U   E P     1 
ATOM 5971  O OP1   . U   E 5  11  ? 102.621 -12.282  -6.122  1.00 0.00 ? 538  U   E OP1   1 
ATOM 5972  O OP2   . U   E 5  11  ? 100.211 -12.974  -5.815  1.00 0.00 ? 538  U   E OP2   1 
ATOM 5973  O "O5'" . U   E 5  11  ? 101.249 -13.000  -8.078  1.00 0.00 ? 538  U   E "O5'" 1 
ATOM 5974  C "C5'" . U   E 5  11  ? 102.366 -12.862  -8.969  1.00 0.00 ? 538  U   E "C5'" 1 
ATOM 5975  C "C4'" . U   E 5  11  ? 101.869 -12.763  -10.415 1.00 0.00 ? 538  U   E "C4'" 1 
ATOM 5976  O "O4'" . U   E 5  11  ? 101.147 -13.965  -10.779 1.00 0.00 ? 538  U   E "O4'" 1 
ATOM 5977  C "C3'" . U   E 5  11  ? 100.875 -11.633  -10.709 1.00 0.00 ? 538  U   E "C3'" 1 
ATOM 5978  O "O3'" . U   E 5  11  ? 101.599 -10.410  -10.895 1.00 0.00 ? 538  U   E "O3'" 1 
ATOM 5979  C "C2'" . U   E 5  11  ? 100.181 -12.159  -11.957 1.00 0.00 ? 538  U   E "C2'" 1 
ATOM 5980  O "O2'" . U   E 5  11  ? 100.973 -11.973  -13.109 1.00 0.00 ? 538  U   E "O2'" 1 
ATOM 5981  C "C1'" . U   E 5  11  ? 100.071 -13.639  -11.650 1.00 0.00 ? 538  U   E "C1'" 1 
ATOM 5982  N N1    . U   E 5  11  ? 98.726  -14.005  -11.100 1.00 0.00 ? 538  U   E N1    1 
ATOM 5983  C C2    . U   E 5  11  ? 97.675  -14.132  -11.998 1.00 0.00 ? 538  U   E C2    1 
ATOM 5984  O O2    . U   E 5  11  ? 97.816  -13.939  -13.205 1.00 0.00 ? 538  U   E O2    1 
ATOM 5985  N N3    . U   E 5  11  ? 96.457  -14.503  -11.421 1.00 0.00 ? 538  U   E N3    1 
ATOM 5986  C C4    . U   E 5  11  ? 96.197  -14.757  -10.065 1.00 0.00 ? 538  U   E C4    1 
ATOM 5987  O O4    . U   E 5  11  ? 95.083  -15.126  -9.686  1.00 0.00 ? 538  U   E O4    1 
ATOM 5988  C C5    . U   E 5  11  ? 97.339  -14.549  -9.211  1.00 0.00 ? 538  U   E C5    1 
ATOM 5989  C C6    . U   E 5  11  ? 98.518  -14.186  -9.744  1.00 0.00 ? 538  U   E C6    1 
ATOM 5990  P P     . U   E 5  12  ? 100.909 -9.011   -10.622 1.00 0.00 ? 539  U   E P     1 
ATOM 5991  O OP1   . U   E 5  12  ? 101.946 -7.958   -10.685 1.00 0.00 ? 539  U   E OP1   1 
ATOM 5992  O OP2   . U   E 5  12  ? 100.109 -9.098   -9.378  1.00 0.00 ? 539  U   E OP2   1 
ATOM 5993  O "O5'" . U   E 5  12  ? 99.923  -8.832   -11.840 1.00 0.00 ? 539  U   E "O5'" 1 
ATOM 5994  C "C5'" . U   E 5  12  ? 100.421 -8.447   -13.128 1.00 0.00 ? 539  U   E "C5'" 1 
ATOM 5995  C "C4'" . U   E 5  12  ? 99.304  -8.567   -14.171 1.00 0.00 ? 539  U   E "C4'" 1 
ATOM 5996  O "O4'" . U   E 5  12  ? 98.752  -9.908   -14.170 1.00 0.00 ? 539  U   E "O4'" 1 
ATOM 5997  C "C3'" . U   E 5  12  ? 98.078  -7.680   -13.942 1.00 0.00 ? 539  U   E "C3'" 1 
ATOM 5998  O "O3'" . U   E 5  12  ? 98.357  -6.352   -14.397 1.00 0.00 ? 539  U   E "O3'" 1 
ATOM 5999  C "C2'" . U   E 5  12  ? 97.023  -8.417   -14.753 1.00 0.00 ? 539  U   E "C2'" 1 
ATOM 6000  O "O2'" . U   E 5  12  ? 97.158  -8.170   -16.134 1.00 0.00 ? 539  U   E "O2'" 1 
ATOM 6001  C "C1'" . U   E 5  12  ? 97.361  -9.859   -14.457 1.00 0.00 ? 539  U   E "C1'" 1 
ATOM 6002  N N1    . U   E 5  12  ? 96.506  -10.416  -13.361 1.00 0.00 ? 539  U   E N1    1 
ATOM 6003  C C2    . U   E 5  12  ? 95.264  -10.928  -13.705 1.00 0.00 ? 539  U   E C2    1 
ATOM 6004  O O2    . U   E 5  12  ? 94.860  -10.932  -14.867 1.00 0.00 ? 539  U   E O2    1 
ATOM 6005  N N3    . U   E 5  12  ? 94.521  -11.430  -12.633 1.00 0.00 ? 539  U   E N3    1 
ATOM 6006  C C4    . U   E 5  12  ? 94.904  -11.478  -11.282 1.00 0.00 ? 539  U   E C4    1 
ATOM 6007  O O4    . U   E 5  12  ? 94.176  -11.987  -10.428 1.00 0.00 ? 539  U   E O4    1 
ATOM 6008  C C5    . U   E 5  12  ? 96.197  -10.896  -11.027 1.00 0.00 ? 539  U   E C5    1 
ATOM 6009  C C6    . U   E 5  12  ? 96.909  -10.376  -12.041 1.00 0.00 ? 539  U   E C6    1 
ATOM 6010  P P     . U   E 5  13  ? 97.583  -5.122   -13.766 1.00 0.00 ? 540  U   E P     1 
ATOM 6011  O OP1   . U   E 5  13  ? 98.024  -3.892   -14.461 1.00 0.00 ? 540  U   E OP1   1 
ATOM 6012  O OP2   . U   E 5  13  ? 97.745  -5.160   -12.294 1.00 0.00 ? 540  U   E OP2   1 
ATOM 6013  O "O5'" . U   E 5  13  ? 96.063  -5.399   -14.112 1.00 0.00 ? 540  U   E "O5'" 1 
ATOM 6014  C "C5'" . U   E 5  13  ? 95.570  -5.090   -15.423 1.00 0.00 ? 540  U   E "C5'" 1 
ATOM 6015  C "C4'" . U   E 5  13  ? 94.101  -5.515   -15.548 1.00 0.00 ? 540  U   E "C4'" 1 
ATOM 6016  O "O4'" . U   E 5  13  ? 93.941  -6.916   -15.221 1.00 0.00 ? 540  U   E "O4'" 1 
ATOM 6017  C "C3'" . U   E 5  13  ? 93.133  -4.807   -14.601 1.00 0.00 ? 540  U   E "C3'" 1 
ATOM 6018  O "O3'" . U   E 5  13  ? 92.784  -3.530   -15.146 1.00 0.00 ? 540  U   E "O3'" 1 
ATOM 6019  C "C2'" . U   E 5  13  ? 91.983  -5.794   -14.520 1.00 0.00 ? 540  U   E "C2'" 1 
ATOM 6020  O "O2'" . U   E 5  13  ? 91.103  -5.682   -15.611 1.00 0.00 ? 540  U   E "O2'" 1 
ATOM 6021  C "C1'" . U   E 5  13  ? 92.697  -7.124   -14.570 1.00 0.00 ? 540  U   E "C1'" 1 
ATOM 6022  N N1    . U   E 5  13  ? 92.823  -7.717   -13.206 1.00 0.00 ? 540  U   E N1    1 
ATOM 6023  C C2    . U   E 5  13  ? 91.681  -8.297   -12.680 1.00 0.00 ? 540  U   E C2    1 
ATOM 6024  O O2    . U   E 5  13  ? 90.624  -8.335   -13.309 1.00 0.00 ? 540  U   E O2    1 
ATOM 6025  N N3    . U   E 5  13  ? 91.827  -8.818   -11.392 1.00 0.00 ? 540  U   E N3    1 
ATOM 6026  C C4    . U   E 5  13  ? 92.967  -8.749   -10.575 1.00 0.00 ? 540  U   E C4    1 
ATOM 6027  O O4    . U   E 5  13  ? 92.964  -9.225   -9.437  1.00 0.00 ? 540  U   E O4    1 
ATOM 6028  C C5    . U   E 5  13  ? 94.090  -8.093   -11.201 1.00 0.00 ? 540  U   E C5    1 
ATOM 6029  C C6    . U   E 5  13  ? 93.976  -7.611   -12.452 1.00 0.00 ? 540  U   E C6    1 
ATOM 6030  P P     . G   E 5  14  ? 92.459  -2.327   -14.170 1.00 0.00 ? 541  G   E P     1 
ATOM 6031  O OP1   . G   E 5  14  ? 92.202  -1.123   -14.991 1.00 0.00 ? 541  G   E OP1   1 
ATOM 6032  O OP2   . G   E 5  14  ? 93.529  -2.234   -13.150 1.00 0.00 ? 541  G   E OP2   1 
ATOM 6033  O "O5'" . G   E 5  14  ? 91.116  -2.771   -13.455 1.00 0.00 ? 541  G   E "O5'" 1 
ATOM 6034  C "C5'" . G   E 5  14  ? 89.871  -2.629   -14.156 1.00 0.00 ? 541  G   E "C5'" 1 
ATOM 6035  C "C4'" . G   E 5  14  ? 88.737  -3.285   -13.358 1.00 0.00 ? 541  G   E "C4'" 1 
ATOM 6036  O "O4'" . G   E 5  14  ? 89.028  -4.683   -13.100 1.00 0.00 ? 541  G   E "O4'" 1 
ATOM 6037  C "C3'" . G   E 5  14  ? 88.468  -2.716   -11.960 1.00 0.00 ? 541  G   E "C3'" 1 
ATOM 6038  O "O3'" . G   E 5  14  ? 87.691  -1.521   -12.077 1.00 0.00 ? 541  G   E "O3'" 1 
ATOM 6039  C "C2'" . G   E 5  14  ? 87.732  -3.869   -11.302 1.00 0.00 ? 541  G   E "C2'" 1 
ATOM 6040  O "O2'" . G   E 5  14  ? 86.395  -3.952   -11.744 1.00 0.00 ? 541  G   E "O2'" 1 
ATOM 6041  C "C1'" . G   E 5  14  ? 88.524  -5.047   -11.824 1.00 0.00 ? 541  G   E "C1'" 1 
ATOM 6042  N N9    . G   E 5  14  ? 89.592  -5.440   -10.875 1.00 0.00 ? 541  G   E N9    1 
ATOM 6043  C C8    . G   E 5  14  ? 90.949  -5.194   -10.948 1.00 0.00 ? 541  G   E C8    1 
ATOM 6044  N N7    . G   E 5  14  ? 91.611  -5.655   -9.925  1.00 0.00 ? 541  G   E N7    1 
ATOM 6045  C C5    . G   E 5  14  ? 90.655  -6.220   -9.118  1.00 0.00 ? 541  G   E C5    1 
ATOM 6046  C C6    . G   E 5  14  ? 90.817  -6.802   -7.845  1.00 0.00 ? 541  G   E C6    1 
ATOM 6047  O O6    . G   E 5  14  ? 91.902  -6.949   -7.273  1.00 0.00 ? 541  G   E O6    1 
ATOM 6048  N N1    . G   E 5  14  ? 89.560  -7.182   -7.316  1.00 0.00 ? 541  G   E N1    1 
ATOM 6049  C C2    . G   E 5  14  ? 88.317  -7.029   -7.952  1.00 0.00 ? 541  G   E C2    1 
ATOM 6050  N N2    . G   E 5  14  ? 87.240  -7.418   -7.224  1.00 0.00 ? 541  G   E N2    1 
ATOM 6051  N N3    . G   E 5  14  ? 88.209  -6.508   -9.198  1.00 0.00 ? 541  G   E N3    1 
ATOM 6052  C C4    . G   E 5  14  ? 89.396  -6.107   -9.691  1.00 0.00 ? 541  G   E C4    1 
ATOM 6053  P P     . A   E 5  15  ? 87.985  -0.306   -11.107 1.00 0.00 ? 542  A   E P     1 
ATOM 6054  O OP1   . A   E 5  15  ? 86.902  0.693    -11.255 1.00 0.00 ? 542  A   E OP1   1 
ATOM 6055  O OP2   . A   E 5  15  ? 89.373  0.155    -11.339 1.00 0.00 ? 542  A   E OP2   1 
ATOM 6056  O "O5'" . A   E 5  15  ? 87.882  -0.967   -9.670  1.00 0.00 ? 542  A   E "O5'" 1 
ATOM 6057  C "C5'" . A   E 5  15  ? 88.585  -0.389   -8.558  1.00 0.00 ? 542  A   E "C5'" 1 
ATOM 6058  C "C4'" . A   E 5  15  ? 87.647  -0.192   -7.361  1.00 0.00 ? 542  A   E "C4'" 1 
ATOM 6059  O "O4'" . A   E 5  15  ? 86.528  0.638    -7.734  1.00 0.00 ? 542  A   E "O4'" 1 
ATOM 6060  C "C3'" . A   E 5  15  ? 86.995  -1.445   -6.769  1.00 0.00 ? 542  A   E "C3'" 1 
ATOM 6061  O "O3'" . A   E 5  15  ? 87.901  -2.095   -5.872  1.00 0.00 ? 542  A   E "O3'" 1 
ATOM 6062  C "C2'" . A   E 5  15  ? 85.778  -0.859   -6.062  1.00 0.00 ? 542  A   E "C2'" 1 
ATOM 6063  O "O2'" . A   E 5  15  ? 86.091  -0.367   -4.778  1.00 0.00 ? 542  A   E "O2'" 1 
ATOM 6064  C "C1'" . A   E 5  15  ? 85.399  0.296    -6.955  1.00 0.00 ? 542  A   E "C1'" 1 
ATOM 6065  N N9    . A   E 5  15  ? 84.217  0.008    -7.780  1.00 0.00 ? 542  A   E N9    1 
ATOM 6066  C C8    . A   E 5  15  ? 84.147  -0.186   -9.140  1.00 0.00 ? 542  A   E C8    1 
ATOM 6067  N N7    . A   E 5  15  ? 82.929  -0.358   -9.574  1.00 0.00 ? 542  A   E N7    1 
ATOM 6068  C C5    . A   E 5  15  ? 82.132  -0.275   -8.466  1.00 0.00 ? 542  A   E C5    1 
ATOM 6069  C C6    . A   E 5  15  ? 80.732  -0.327   -8.349  1.00 0.00 ? 542  A   E C6    1 
ATOM 6070  N N6    . A   E 5  15  ? 79.973  -0.487   -9.480  1.00 0.00 ? 542  A   E N6    1 
ATOM 6071  N N1    . A   E 5  15  ? 80.247  -0.200   -7.067  1.00 0.00 ? 542  A   E N1    1 
ATOM 6072  C C2    . A   E 5  15  ? 81.121  -0.038   -6.060  1.00 0.00 ? 542  A   E C2    1 
ATOM 6073  N N3    . A   E 5  15  ? 82.460  0.052    -6.081  1.00 0.00 ? 542  A   E N3    1 
ATOM 6074  C C4    . A   E 5  15  ? 82.917  -0.068   -7.336  1.00 0.00 ? 542  A   E C4    1 
ATOM 6075  P P     . A   E 5  16  ? 88.621  -3.460   -6.210  1.00 0.00 ? 543  A   E P     1 
ATOM 6076  O OP1   . A   E 5  16  ? 89.932  -3.476   -5.524  1.00 0.00 ? 543  A   E OP1   1 
ATOM 6077  O OP2   . A   E 5  16  ? 88.626  -3.676   -7.675  1.00 0.00 ? 543  A   E OP2   1 
ATOM 6078  O "O5'" . A   E 5  16  ? 87.681  -4.541   -5.537  1.00 0.00 ? 543  A   E "O5'" 1 
ATOM 6079  C "C5'" . A   E 5  16  ? 87.396  -4.541   -4.130  1.00 0.00 ? 543  A   E "C5'" 1 
ATOM 6080  C "C4'" . A   E 5  16  ? 85.900  -4.796   -3.878  1.00 0.00 ? 543  A   E "C4'" 1 
ATOM 6081  O "O4'" . A   E 5  16  ? 85.120  -3.797   -4.582  1.00 0.00 ? 543  A   E "O4'" 1 
ATOM 6082  C "C3'" . A   E 5  16  ? 85.328  -6.137   -4.371  1.00 0.00 ? 543  A   E "C3'" 1 
ATOM 6083  O "O3'" . A   E 5  16  ? 85.487  -7.133   -3.356  1.00 0.00 ? 543  A   E "O3'" 1 
ATOM 6084  C "C2'" . A   E 5  16  ? 83.875  -5.800   -4.676  1.00 0.00 ? 543  A   E "C2'" 1 
ATOM 6085  O "O2'" . A   E 5  16  ? 83.072  -5.853   -3.519  1.00 0.00 ? 543  A   E "O2'" 1 
ATOM 6086  C "C1'" . A   E 5  16  ? 83.964  -4.376   -5.153  1.00 0.00 ? 543  A   E "C1'" 1 
ATOM 6087  N N9    . A   E 5  16  ? 83.957  -4.269   -6.627  1.00 0.00 ? 543  A   E N9    1 
ATOM 6088  C C8    . A   E 5  16  ? 85.006  -4.410   -7.507  1.00 0.00 ? 543  A   E C8    1 
ATOM 6089  N N7    . A   E 5  16  ? 84.677  -4.204   -8.749  1.00 0.00 ? 543  A   E N7    1 
ATOM 6090  C C5    . A   E 5  16  ? 83.340  -3.931   -8.727  1.00 0.00 ? 543  A   E C5    1 
ATOM 6091  C C6    . A   E 5  16  ? 82.456  -3.653   -9.784  1.00 0.00 ? 543  A   E C6    1 
ATOM 6092  N N6    . A   E 5  16  ? 82.956  -3.456   -11.047 1.00 0.00 ? 543  A   E N6    1 
ATOM 6093  N N1    . A   E 5  16  ? 81.133  -3.563   -9.424  1.00 0.00 ? 543  A   E N1    1 
ATOM 6094  C C2    . A   E 5  16  ? 80.805  -3.689   -8.127  1.00 0.00 ? 543  A   E C2    1 
ATOM 6095  N N3    . A   E 5  16  ? 81.586  -3.857   -7.049  1.00 0.00 ? 543  A   E N3    1 
ATOM 6096  C C4    . A   E 5  16  ? 82.866  -3.993   -7.419  1.00 0.00 ? 543  A   E C4    1 
ATOM 6097  P P     . A   E 5  17  ? 85.980  -8.603   -3.674  1.00 0.00 ? 544  A   E P     1 
ATOM 6098  O OP1   . A   E 5  17  ? 86.024  -9.357   -2.401  1.00 0.00 ? 544  A   E OP1   1 
ATOM 6099  O OP2   . A   E 5  17  ? 87.238  -8.525   -4.448  1.00 0.00 ? 544  A   E OP2   1 
ATOM 6100  O "O5'" . A   E 5  17  ? 84.828  -9.202   -4.600  1.00 0.00 ? 544  A   E "O5'" 1 
ATOM 6101  C "C5'" . A   E 5  17  ? 83.691  -9.823   -3.965  1.00 0.00 ? 544  A   E "C5'" 1 
ATOM 6102  C "C4'" . A   E 5  17  ? 82.450  -9.874   -4.880  1.00 0.00 ? 544  A   E "C4'" 1 
ATOM 6103  O "O4'" . A   E 5  17  ? 82.240  -8.598   -5.540  1.00 0.00 ? 544  A   E "O4'" 1 
ATOM 6104  C "C3'" . A   E 5  17  ? 82.424  -10.885  -6.042  1.00 0.00 ? 544  A   E "C3'" 1 
ATOM 6105  O "O3'" . A   E 5  17  ? 82.037  -12.183  -5.589  1.00 0.00 ? 544  A   E "O3'" 1 
ATOM 6106  C "C2'" . A   E 5  17  ? 81.393  -10.254  -6.966  1.00 0.00 ? 544  A   E "C2'" 1 
ATOM 6107  O "O2'" . A   E 5  17  ? 80.076  -10.433  -6.498  1.00 0.00 ? 544  A   E "O2'" 1 
ATOM 6108  C "C1'" . A   E 5  17  ? 81.768  -8.804   -6.860  1.00 0.00 ? 544  A   E "C1'" 1 
ATOM 6109  N N9    . A   E 5  17  ? 82.789  -8.441   -7.862  1.00 0.00 ? 544  A   E N9    1 
ATOM 6110  C C8    . A   E 5  17  ? 84.131  -8.747   -7.844  1.00 0.00 ? 544  A   E C8    1 
ATOM 6111  N N7    . A   E 5  17  ? 84.781  -8.292   -8.873  1.00 0.00 ? 544  A   E N7    1 
ATOM 6112  C C5    . A   E 5  17  ? 83.851  -7.668   -9.645  1.00 0.00 ? 544  A   E C5    1 
ATOM 6113  C C6    . A   E 5  17  ? 83.995  -7.057   -10.898 1.00 0.00 ? 544  A   E C6    1 
ATOM 6114  N N6    . A   E 5  17  ? 85.252  -6.938   -11.431 1.00 0.00 ? 544  A   E N6    1 
ATOM 6115  N N1    . A   E 5  17  ? 82.820  -6.634   -11.473 1.00 0.00 ? 544  A   E N1    1 
ATOM 6116  C C2    . A   E 5  17  ? 81.674  -6.779   -10.783 1.00 0.00 ? 544  A   E C2    1 
ATOM 6117  N N3    . A   E 5  17  ? 81.455  -7.292   -9.561  1.00 0.00 ? 544  A   E N3    1 
ATOM 6118  C C4    . A   E 5  17  ? 82.600  -7.751   -9.040  1.00 0.00 ? 544  A   E C4    1 
ATOM 6119  P P     . A   E 5  18  ? 82.934  -13.457  -5.904  1.00 0.00 ? 545  A   E P     1 
ATOM 6120  O OP1   . A   E 5  18  ? 82.142  -14.680  -5.635  1.00 0.00 ? 545  A   E OP1   1 
ATOM 6121  O OP2   . A   E 5  18  ? 84.221  -13.319  -5.185  1.00 0.00 ? 545  A   E OP2   1 
ATOM 6122  O "O5'" . A   E 5  18  ? 83.209  -13.355  -7.468  1.00 0.00 ? 545  A   E "O5'" 1 
ATOM 6123  C "C5'" . A   E 5  18  ? 82.137  -13.585  -8.406  1.00 0.00 ? 545  A   E "C5'" 1 
ATOM 6124  C "C4'" . A   E 5  18  ? 82.367  -12.871  -9.755  1.00 0.00 ? 545  A   E "C4'" 1 
ATOM 6125  O "O4'" . A   E 5  18  ? 82.987  -11.579  -9.565  1.00 0.00 ? 545  A   E "O4'" 1 
ATOM 6126  C "C3'" . A   E 5  18  ? 83.283  -13.571  -10.781 1.00 0.00 ? 545  A   E "C3'" 1 
ATOM 6127  O "O3'" . A   E 5  18  ? 82.537  -14.561  -11.491 1.00 0.00 ? 545  A   E "O3'" 1 
ATOM 6128  C "C2'" . A   E 5  18  ? 83.718  -12.382  -11.631 1.00 0.00 ? 545  A   E "C2'" 1 
ATOM 6129  O "O2'" . A   E 5  18  ? 82.709  -11.981  -12.531 1.00 0.00 ? 545  A   E "O2'" 1 
ATOM 6130  C "C1'" . A   E 5  18  ? 83.901  -11.317  -10.592 1.00 0.00 ? 545  A   E "C1'" 1 
ATOM 6131  N N9    . A   E 5  18  ? 85.277  -11.250  -10.083 1.00 0.00 ? 545  A   E N9    1 
ATOM 6132  C C8    . A   E 5  18  ? 85.809  -11.736  -8.908  1.00 0.00 ? 545  A   E C8    1 
ATOM 6133  N N7    . A   E 5  18  ? 87.063  -11.427  -8.739  1.00 0.00 ? 545  A   E N7    1 
ATOM 6134  C C5    . A   E 5  18  ? 87.400  -10.687  -9.834  1.00 0.00 ? 545  A   E C5    1 
ATOM 6135  C C6    . A   E 5  18  ? 88.606  -10.044  -10.157 1.00 0.00 ? 545  A   E C6    1 
ATOM 6136  N N6    . A   E 5  18  ? 89.667  -10.117  -9.291  1.00 0.00 ? 545  A   E N6    1 
ATOM 6137  N N1    . A   E 5  18  ? 88.600  -9.371   -11.355 1.00 0.00 ? 545  A   E N1    1 
ATOM 6138  C C2    . A   E 5  18  ? 87.483  -9.379   -12.102 1.00 0.00 ? 545  A   E C2    1 
ATOM 6139  N N3    . A   E 5  18  ? 86.292  -9.947   -11.865 1.00 0.00 ? 545  A   E N3    1 
ATOM 6140  C C4    . A   E 5  18  ? 86.307  -10.584  -10.690 1.00 0.00 ? 545  A   E C4    1 
ATOM 6141  P P     . G   E 5  19  ? 83.243  -15.653  -12.406 1.00 0.00 ? 546  G   E P     1 
ATOM 6142  O OP1   . G   E 5  19  ? 82.203  -16.297  -13.242 1.00 0.00 ? 546  G   E OP1   1 
ATOM 6143  O OP2   . G   E 5  19  ? 84.047  -16.538  -11.535 1.00 0.00 ? 546  G   E OP2   1 
ATOM 6144  O "O5'" . G   E 5  19  ? 84.242  -14.851  -13.348 1.00 0.00 ? 546  G   E "O5'" 1 
ATOM 6145  C "C5'" . G   E 5  19  ? 83.747  -14.383  -14.612 1.00 0.00 ? 546  G   E "C5'" 1 
ATOM 6146  C "C4'" . G   E 5  19  ? 84.804  -13.558  -15.356 1.00 0.00 ? 546  G   E "C4'" 1 
ATOM 6147  O "O4'" . G   E 5  19  ? 85.383  -12.527  -14.531 1.00 0.00 ? 546  G   E "O4'" 1 
ATOM 6148  C "C3'" . G   E 5  19  ? 86.008  -14.342  -15.856 1.00 0.00 ? 546  G   E "C3'" 1 
ATOM 6149  O "O3'" . G   E 5  19  ? 85.630  -15.051  -17.035 1.00 0.00 ? 546  G   E "O3'" 1 
ATOM 6150  C "C2'" . G   E 5  19  ? 87.023  -13.230  -16.075 1.00 0.00 ? 546  G   E "C2'" 1 
ATOM 6151  O "O2'" . G   E 5  19  ? 86.813  -12.552  -17.285 1.00 0.00 ? 546  G   E "O2'" 1 
ATOM 6152  C "C1'" . G   E 5  19  ? 86.724  -12.303  -14.924 1.00 0.00 ? 546  G   E "C1'" 1 
ATOM 6153  N N9    . G   E 5  19  ? 87.684  -12.494  -13.823 1.00 0.00 ? 546  G   E N9    1 
ATOM 6154  C C8    . G   E 5  19  ? 87.482  -13.144  -12.626 1.00 0.00 ? 546  G   E C8    1 
ATOM 6155  N N7    . G   E 5  19  ? 88.535  -13.135  -11.856 1.00 0.00 ? 546  G   E N7    1 
ATOM 6156  C C5    . G   E 5  19  ? 89.490  -12.466  -12.582 1.00 0.00 ? 546  G   E C5    1 
ATOM 6157  C C6    . G   E 5  19  ? 90.819  -12.178  -12.223 1.00 0.00 ? 546  G   E C6    1 
ATOM 6158  O O6    . G   E 5  19  ? 91.321  -12.457  -11.131 1.00 0.00 ? 546  G   E O6    1 
ATOM 6159  N N1    . G   E 5  19  ? 91.494  -11.561  -13.302 1.00 0.00 ? 546  G   E N1    1 
ATOM 6160  C C2    . G   E 5  19  ? 90.939  -11.224  -14.545 1.00 0.00 ? 546  G   E C2    1 
ATOM 6161  N N2    . G   E 5  19  ? 91.798  -10.666  -15.443 1.00 0.00 ? 546  G   E N2    1 
ATOM 6162  N N3    . G   E 5  19  ? 89.628  -11.439  -14.818 1.00 0.00 ? 546  G   E N3    1 
ATOM 6163  C C4    . G   E 5  19  ? 88.992  -12.078  -13.816 1.00 0.00 ? 546  G   E C4    1 
ATOM 6164  P P     . A   E 5  20  ? 86.363  -16.391  -17.441 1.00 0.00 ? 547  A   E P     1 
ATOM 6165  O OP1   . A   E 5  20  ? 85.758  -16.886  -18.696 1.00 0.00 ? 547  A   E OP1   1 
ATOM 6166  O OP2   . A   E 5  20  ? 86.373  -17.314  -16.283 1.00 0.00 ? 547  A   E OP2   1 
ATOM 6167  O "O5'" . A   E 5  20  ? 87.846  -15.920  -17.724 1.00 0.00 ? 547  A   E "O5'" 1 
ATOM 6168  C "C5'" . A   E 5  20  ? 88.115  -15.398  -19.035 1.00 0.00 ? 547  A   E "C5'" 1 
ATOM 6169  C "C4'" . A   E 5  20  ? 89.550  -14.890  -19.113 1.00 0.00 ? 547  A   E "C4'" 1 
ATOM 6170  O "O4'" . A   E 5  20  ? 89.808  -13.908  -18.079 1.00 0.00 ? 547  A   E "O4'" 1 
ATOM 6171  C "C3'" . A   E 5  20  ? 90.641  -15.938  -18.887 1.00 0.00 ? 547  A   E "C3'" 1 
ATOM 6172  O "O3'" . A   E 5  20  ? 90.849  -16.707  -20.076 1.00 0.00 ? 547  A   E "O3'" 1 
ATOM 6173  C "C2'" . A   E 5  20  ? 91.816  -15.061  -18.511 1.00 0.00 ? 547  A   E "C2'" 1 
ATOM 6174  O "O2'" . A   E 5  20  ? 92.394  -14.438  -19.634 1.00 0.00 ? 547  A   E "O2'" 1 
ATOM 6175  C "C1'" . A   E 5  20  ? 91.148  -14.036  -17.634 1.00 0.00 ? 547  A   E "C1'" 1 
ATOM 6176  N N9    . A   E 5  20  ? 91.237  -14.428  -16.218 1.00 0.00 ? 547  A   E N9    1 
ATOM 6177  C C8    . A   E 5  20  ? 90.280  -14.981  -15.398 1.00 0.00 ? 547  A   E C8    1 
ATOM 6178  N N7    . A   E 5  20  ? 90.702  -15.212  -14.187 1.00 0.00 ? 547  A   E N7    1 
ATOM 6179  C C5    . A   E 5  20  ? 92.008  -14.818  -14.182 1.00 0.00 ? 547  A   E C5    1 
ATOM 6180  C C6    . A   E 5  20  ? 92.963  -14.858  -13.153 1.00 0.00 ? 547  A   E C6    1 
ATOM 6181  N N6    . A   E 5  20  ? 92.582  -15.251  -11.896 1.00 0.00 ? 547  A   E N6    1 
ATOM 6182  N N1    . A   E 5  20  ? 94.227  -14.475  -13.523 1.00 0.00 ? 547  A   E N1    1 
ATOM 6183  C C2    . A   E 5  20  ? 94.445  -14.073  -14.785 1.00 0.00 ? 547  A   E C2    1 
ATOM 6184  N N3    . A   E 5  20  ? 93.586  -13.935  -15.805 1.00 0.00 ? 547  A   E N3    1 
ATOM 6185  C C4    . A   E 5  20  ? 92.366  -14.350  -15.443 1.00 0.00 ? 547  A   E C4    1 
ATOM 6186  P P     . G   E 5  21  ? 90.919  -18.290  -20.010 1.00 0.00 ? 548  G   E P     1 
ATOM 6187  O OP1   . G   E 5  21  ? 90.800  -18.822  -21.385 1.00 0.00 ? 548  G   E OP1   1 
ATOM 6188  O OP2   . G   E 5  21  ? 89.953  -18.790  -19.005 1.00 0.00 ? 548  G   E OP2   1 
ATOM 6189  O "O5'" . G   E 5  21  ? 92.381  -18.561  -19.474 1.00 0.00 ? 548  G   E "O5'" 1 
ATOM 6190  C "C5'" . G   E 5  21  ? 93.527  -18.316  -20.302 1.00 0.00 ? 548  G   E "C5'" 1 
ATOM 6191  C "C4'" . G   E 5  21  ? 94.764  -18.095  -19.426 1.00 0.00 ? 548  G   E "C4'" 1 
ATOM 6192  O "O4'" . G   E 5  21  ? 94.498  -17.053  -18.455 1.00 0.00 ? 548  G   E "O4'" 1 
ATOM 6193  C "C3'" . G   E 5  21  ? 95.229  -19.280  -18.565 1.00 0.00 ? 548  G   E "C3'" 1 
ATOM 6194  O "O3'" . G   E 5  21  ? 96.009  -20.182  -19.354 1.00 0.00 ? 548  G   E "O3'" 1 
ATOM 6195  C "C2'" . G   E 5  21  ? 96.024  -18.550  -17.498 1.00 0.00 ? 548  G   E "C2'" 1 
ATOM 6196  O "O2'" . G   E 5  21  ? 97.285  -18.129  -17.970 1.00 0.00 ? 548  G   E "O2'" 1 
ATOM 6197  C "C1'" . G   E 5  21  ? 95.146  -17.354  -17.240 1.00 0.00 ? 548  G   E "C1'" 1 
ATOM 6198  N N9    . G   E 5  21  ? 94.203  -17.625  -16.127 1.00 0.00 ? 548  G   E N9    1 
ATOM 6199  C C8    . G   E 5  21  ? 92.856  -17.926  -16.133 1.00 0.00 ? 548  G   E C8    1 
ATOM 6200  N N7    . G   E 5  21  ? 92.376  -18.147  -14.935 1.00 0.00 ? 548  G   E N7    1 
ATOM 6201  C C5    . G   E 5  21  ? 93.456  -18.001  -14.097 1.00 0.00 ? 548  G   E C5    1 
ATOM 6202  C C6    . G   E 5  21  ? 93.537  -18.223  -12.704 1.00 0.00 ? 548  G   E C6    1 
ATOM 6203  O O6    . G   E 5  21  ? 92.583  -18.543  -11.989 1.00 0.00 ? 548  G   E O6    1 
ATOM 6204  N N1    . G   E 5  21  ? 94.865  -18.012  -12.250 1.00 0.00 ? 548  G   E N1    1 
ATOM 6205  C C2    . G   E 5  21  ? 95.959  -17.640  -13.053 1.00 0.00 ? 548  G   E C2    1 
ATOM 6206  N N2    . G   E 5  21  ? 97.160  -17.504  -12.437 1.00 0.00 ? 548  G   E N2    1 
ATOM 6207  N N3    . G   E 5  21  ? 95.830  -17.430  -14.373 1.00 0.00 ? 548  G   E N3    1 
ATOM 6208  C C4    . G   E 5  21  ? 94.587  -17.657  -14.817 1.00 0.00 ? 548  G   E C4    1 
ATOM 6209  P P     . A   E 5  22  ? 96.141  -21.714  -18.961 1.00 0.00 ? 549  A   E P     1 
ATOM 6210  O OP1   . A   E 5  22  ? 97.139  -22.330  -19.864 1.00 0.00 ? 549  A   E OP1   1 
ATOM 6211  O OP2   . A   E 5  22  ? 94.788  -22.316  -18.944 1.00 0.00 ? 549  A   E OP2   1 
ATOM 6212  O "O5'" . A   E 5  22  ? 96.702  -21.720  -17.479 1.00 0.00 ? 549  A   E "O5'" 1 
ATOM 6213  C "C5'" . A   E 5  22  ? 98.110  -21.605  -17.231 1.00 0.00 ? 549  A   E "C5'" 1 
ATOM 6214  C "C4'" . A   E 5  22  ? 98.391  -21.543  -15.719 1.00 0.00 ? 549  A   E "C4'" 1 
ATOM 6215  O "O4'" . A   E 5  22  ? 97.559  -20.533  -15.083 1.00 0.00 ? 549  A   E "O4'" 1 
ATOM 6216  C "C3'" . A   E 5  22  ? 98.117  -22.825  -14.906 1.00 0.00 ? 549  A   E "C3'" 1 
ATOM 6217  O "O3'" . A   E 5  22  ? 99.239  -23.707  -15.003 1.00 0.00 ? 549  A   E "O3'" 1 
ATOM 6218  C "C2'" . A   E 5  22  ? 97.915  -22.236  -13.524 1.00 0.00 ? 549  A   E "C2'" 1 
ATOM 6219  O "O2'" . A   E 5  22  ? 99.150  -21.840  -12.964 1.00 0.00 ? 549  A   E "O2'" 1 
ATOM 6220  C "C1'" . A   E 5  22  ? 97.097  -21.011  -13.834 1.00 0.00 ? 549  A   E "C1'" 1 
ATOM 6221  N N9    . A   E 5  22  ? 95.632  -21.270  -13.841 1.00 0.00 ? 549  A   E N9    1 
ATOM 6222  C C8    . A   E 5  22  ? 94.763  -21.211  -14.909 1.00 0.00 ? 549  A   E C8    1 
ATOM 6223  N N7    . A   E 5  22  ? 93.523  -21.455  -14.594 1.00 0.00 ? 549  A   E N7    1 
ATOM 6224  C C5    . A   E 5  22  ? 93.528  -21.674  -13.247 1.00 0.00 ? 549  A   E C5    1 
ATOM 6225  C C6    . A   E 5  22  ? 92.462  -21.934  -12.366 1.00 0.00 ? 549  A   E C6    1 
ATOM 6226  N N6    . A   E 5  22  ? 91.187  -22.023  -12.862 1.00 0.00 ? 549  A   E N6    1 
ATOM 6227  N N1    . A   E 5  22  ? 92.815  -22.065  -11.044 1.00 0.00 ? 549  A   E N1    1 
ATOM 6228  C C2    . A   E 5  22  ? 94.106  -21.933  -10.705 1.00 0.00 ? 549  A   E C2    1 
ATOM 6229  N N3    . A   E 5  22  ? 95.177  -21.681  -11.472 1.00 0.00 ? 549  A   E N3    1 
ATOM 6230  C C4    . A   E 5  22  ? 94.827  -21.561  -12.756 1.00 0.00 ? 549  A   E C4    1 
ATOM 6231  P P     . G   E 5  23  ? 99.170  -25.225  -14.545 1.00 0.00 ? 550  G   E P     1 
ATOM 6232  O OP1   . G   E 5  23  ? 100.519 -25.811  -14.722 1.00 0.00 ? 550  G   E OP1   1 
ATOM 6233  O OP2   . G   E 5  23  ? 98.054  -25.884  -15.260 1.00 0.00 ? 550  G   E OP2   1 
ATOM 6234  O "O5'" . G   E 5  23  ? 98.816  -25.193  -13.002 1.00 0.00 ? 550  G   E "O5'" 1 
ATOM 6235  C "C5'" . G   E 5  23  ? 99.844  -25.177  -12.000 1.00 0.00 ? 550  G   E "C5'" 1 
ATOM 6236  C "C4'" . G   E 5  23  ? 99.233  -25.217  -10.586 1.00 0.00 ? 550  G   E "C4'" 1 
ATOM 6237  O "O4'" . G   E 5  23  ? 98.110  -24.307  -10.478 1.00 0.00 ? 550  G   E "O4'" 1 
ATOM 6238  C "C3'" . G   E 5  23  ? 98.660  -26.570  -10.139 1.00 0.00 ? 550  G   E "C3'" 1 
ATOM 6239  O "O3'" . G   E 5  23  ? 99.718  -27.396  -9.648  1.00 0.00 ? 550  G   E "O3'" 1 
ATOM 6240  C "C2'" . G   E 5  23  ? 97.662  -26.137  -9.078  1.00 0.00 ? 550  G   E "C2'" 1 
ATOM 6241  O "O2'" . G   E 5  23  ? 98.302  -25.794  -7.868  1.00 0.00 ? 550  G   E "O2'" 1 
ATOM 6242  C "C1'" . G   E 5  23  ? 97.080  -24.895  -9.703  1.00 0.00 ? 550  G   E "C1'" 1 
ATOM 6243  N N9    . G   E 5  23  ? 95.867  -25.178  -10.510 1.00 0.00 ? 550  G   E N9    1 
ATOM 6244  C C8    . G   E 5  23  ? 95.694  -24.987  -11.868 1.00 0.00 ? 550  G   E C8    1 
ATOM 6245  N N7    . G   E 5  23  ? 94.506  -25.313  -12.290 1.00 0.00 ? 550  G   E N7    1 
ATOM 6246  C C5    . G   E 5  23  ? 93.850  -25.752  -11.169 1.00 0.00 ? 550  G   E C5    1 
ATOM 6247  C C6    . G   E 5  23  ? 92.549  -26.276  -11.071 1.00 0.00 ? 550  G   E C6    1 
ATOM 6248  O O6    . G   E 5  23  ? 91.757  -26.371  -12.014 1.00 0.00 ? 550  G   E O6    1 
ATOM 6249  N N1    . G   E 5  23  ? 92.290  -26.697  -9.747  1.00 0.00 ? 550  G   E N1    1 
ATOM 6250  C C2    . G   E 5  23  ? 93.163  -26.587  -8.652  1.00 0.00 ? 550  G   E C2    1 
ATOM 6251  N N2    . G   E 5  23  ? 92.702  -27.088  -7.469  1.00 0.00 ? 550  G   E N2    1 
ATOM 6252  N N3    . G   E 5  23  ? 94.385  -26.015  -8.777  1.00 0.00 ? 550  G   E N3    1 
ATOM 6253  C C4    . G   E 5  23  ? 94.669  -25.674  -10.050 1.00 0.00 ? 550  G   E C4    1 
ATOM 6254  P P     . U   E 5  24  ? 99.559  -28.968  -9.544  1.00 0.00 ? 551  U   E P     1 
ATOM 6255  O OP1   . U   E 5  24  ? 100.700 -29.491  -8.758  1.00 0.00 ? 551  U   E OP1   1 
ATOM 6256  O OP2   . U   E 5  24  ? 99.379  -29.513  -10.907 1.00 0.00 ? 551  U   E OP2   1 
ATOM 6257  O "O5'" . U   E 5  24  ? 98.216  -29.198  -8.737  1.00 0.00 ? 551  U   E "O5'" 1 
ATOM 6258  C "C5'" . U   E 5  24  ? 98.229  -29.392  -7.317  1.00 0.00 ? 551  U   E "C5'" 1 
ATOM 6259  C "C4'" . U   E 5  24  ? 96.891  -29.982  -6.854  1.00 0.00 ? 551  U   E "C4'" 1 
ATOM 6260  O "O4'" . U   E 5  24  ? 95.774  -29.186  -7.313  1.00 0.00 ? 551  U   E "O4'" 1 
ATOM 6261  C "C3'" . U   E 5  24  ? 96.581  -31.376  -7.395  1.00 0.00 ? 551  U   E "C3'" 1 
ATOM 6262  O "O3'" . U   E 5  24  ? 97.291  -32.347  -6.625  1.00 0.00 ? 551  U   E "O3'" 1 
ATOM 6263  C "C2'" . U   E 5  24  ? 95.069  -31.446  -7.251  1.00 0.00 ? 551  U   E "C2'" 1 
ATOM 6264  O "O2'" . U   E 5  24  ? 94.685  -31.791  -5.942  1.00 0.00 ? 551  U   E "O2'" 1 
ATOM 6265  C "C1'" . U   E 5  24  ? 94.648  -30.023  -7.542  1.00 0.00 ? 551  U   E "C1'" 1 
ATOM 6266  N N1    . U   E 5  24  ? 94.066  -29.885  -8.912  1.00 0.00 ? 551  U   E N1    1 
ATOM 6267  C C2    . U   E 5  24  ? 92.720  -30.189  -9.081  1.00 0.00 ? 551  U   E C2    1 
ATOM 6268  O O2    . U   E 5  24  ? 92.013  -30.566  -8.148  1.00 0.00 ? 551  U   E O2    1 
ATOM 6269  N N3    . U   E 5  24  ? 92.239  -30.022  -10.384 1.00 0.00 ? 551  U   E N3    1 
ATOM 6270  C C4    . U   E 5  24  ? 92.959  -29.552  -11.494 1.00 0.00 ? 551  U   E C4    1 
ATOM 6271  O O4    . U   E 5  24  ? 92.404  -29.364  -12.580 1.00 0.00 ? 551  U   E O4    1 
ATOM 6272  C C5    . U   E 5  24  ? 94.356  -29.310  -11.223 1.00 0.00 ? 551  U   E C5    1 
ATOM 6273  C C6    . U   E 5  24  ? 94.842  -29.491  -9.984  1.00 0.00 ? 551  U   E C6    1 
ATOM 6274  P P     . G   E 5  25  ? 97.714  -33.730  -7.265  1.00 0.00 ? 552  G   E P     1 
ATOM 6275  O OP1   . G   E 5  25  ? 98.298  -34.585  -6.206  1.00 0.00 ? 552  G   E OP1   1 
ATOM 6276  O OP2   . G   E 5  25  ? 98.552  -33.460  -8.454  1.00 0.00 ? 552  G   E OP2   1 
ATOM 6277  O "O5'" . G   E 5  25  ? 96.345  -34.358  -7.739  1.00 0.00 ? 552  G   E "O5'" 1 
ATOM 6278  C "C5'" . G   E 5  25  ? 95.551  -35.085  -6.793  1.00 0.00 ? 552  G   E "C5'" 1 
ATOM 6279  C "C4'" . G   E 5  25  ? 94.277  -35.569  -7.478  1.00 0.00 ? 552  G   E "C4'" 1 
ATOM 6280  O "O4'" . G   E 5  25  ? 93.476  -34.451  -7.921  1.00 0.00 ? 552  G   E "O4'" 1 
ATOM 6281  C "C3'" . G   E 5  25  ? 94.479  -36.407  -8.735  1.00 0.00 ? 552  G   E "C3'" 1 
ATOM 6282  O "O3'" . G   E 5  25  ? 94.818  -37.737  -8.340  1.00 0.00 ? 552  G   E "O3'" 1 
ATOM 6283  C "C2'" . G   E 5  25  ? 93.127  -36.240  -9.418  1.00 0.00 ? 552  G   E "C2'" 1 
ATOM 6284  O "O2'" . G   E 5  25  ? 92.127  -37.044  -8.843  1.00 0.00 ? 552  G   E "O2'" 1 
ATOM 6285  C "C1'" . G   E 5  25  ? 92.829  -34.791  -9.128  1.00 0.00 ? 552  G   E "C1'" 1 
ATOM 6286  N N9    . G   E 5  25  ? 93.259  -33.941  -10.249 1.00 0.00 ? 552  G   E N9    1 
ATOM 6287  C C8    . G   E 5  25  ? 94.524  -33.485  -10.551 1.00 0.00 ? 552  G   E C8    1 
ATOM 6288  N N7    . G   E 5  25  ? 94.565  -32.805  -11.665 1.00 0.00 ? 552  G   E N7    1 
ATOM 6289  C C5    . G   E 5  25  ? 93.272  -32.825  -12.133 1.00 0.00 ? 552  G   E C5    1 
ATOM 6290  C C6    . G   E 5  25  ? 92.769  -32.343  -13.359 1.00 0.00 ? 552  G   E C6    1 
ATOM 6291  O O6    . G   E 5  25  ? 93.445  -31.755  -14.208 1.00 0.00 ? 552  G   E O6    1 
ATOM 6292  N N1    . G   E 5  25  ? 91.380  -32.603  -13.459 1.00 0.00 ? 552  G   E N1    1 
ATOM 6293  C C2    . G   E 5  25  ? 90.601  -33.282  -12.505 1.00 0.00 ? 552  G   E C2    1 
ATOM 6294  N N2    . G   E 5  25  ? 89.289  -33.441  -12.803 1.00 0.00 ? 552  G   E N2    1 
ATOM 6295  N N3    . G   E 5  25  ? 91.131  -33.755  -11.359 1.00 0.00 ? 552  G   E N3    1 
ATOM 6296  C C4    . G   E 5  25  ? 92.443  -33.500  -11.252 1.00 0.00 ? 552  G   E C4    1 
ATOM 6297  P P     . A   E 5  26  ? 95.497  -38.718  -9.375  1.00 0.00 ? 553  A   E P     1 
ATOM 6298  O OP1   . A   E 5  26  ? 95.686  -40.036  -8.728  1.00 0.00 ? 553  A   E OP1   1 
ATOM 6299  O OP2   . A   E 5  26  ? 96.700  -38.057  -9.933  1.00 0.00 ? 553  A   E OP2   1 
ATOM 6300  O "O5'" . A   E 5  26  ? 94.397  -38.854  -10.503 1.00 0.00 ? 553  A   E "O5'" 1 
ATOM 6301  C "C5'" . A   E 5  26  ? 94.821  -39.096  -11.853 1.00 0.00 ? 553  A   E "C5'" 1 
ATOM 6302  C "C4'" . A   E 5  26  ? 93.692  -39.743  -12.669 1.00 0.00 ? 553  A   E "C4'" 1 
ATOM 6303  O "O4'" . A   E 5  26  ? 93.015  -40.784  -11.916 1.00 0.00 ? 553  A   E "O4'" 1 
ATOM 6304  C "C3'" . A   E 5  26  ? 92.561  -38.809  -13.097 1.00 0.00 ? 553  A   E "C3'" 1 
ATOM 6305  O "O3'" . A   E 5  26  ? 92.956  -38.081  -14.264 1.00 0.00 ? 553  A   E "O3'" 1 
ATOM 6306  C "C2'" . A   E 5  26  ? 91.419  -39.782  -13.342 1.00 0.00 ? 553  A   E "C2'" 1 
ATOM 6307  O "O2'" . A   E 5  26  ? 91.529  -40.418  -14.595 1.00 0.00 ? 553  A   E "O2'" 1 
ATOM 6308  C "C1'" . A   E 5  26  ? 91.634  -40.796  -12.246 1.00 0.00 ? 553  A   E "C1'" 1 
ATOM 6309  N N9    . A   E 5  26  ? 90.774  -40.535  -11.074 1.00 0.00 ? 553  A   E N9    1 
ATOM 6310  C C8    . A   E 5  26  ? 91.127  -40.034  -9.842  1.00 0.00 ? 553  A   E C8    1 
ATOM 6311  N N7    . A   E 5  26  ? 90.129  -39.958  -9.007  1.00 0.00 ? 553  A   E N7    1 
ATOM 6312  C C5    . A   E 5  26  ? 89.045  -40.431  -9.692  1.00 0.00 ? 553  A   E C5    1 
ATOM 6313  C C6    . A   E 5  26  ? 87.717  -40.618  -9.271  1.00 0.00 ? 553  A   E C6    1 
ATOM 6314  N N6    . A   E 5  26  ? 87.388  -40.337  -7.971  1.00 0.00 ? 553  A   E N6    1 
ATOM 6315  N N1    . A   E 5  26  ? 86.862  -41.101  -10.233 1.00 0.00 ? 553  A   E N1    1 
ATOM 6316  C C2    . A   E 5  26  ? 87.351  -41.366  -11.457 1.00 0.00 ? 553  A   E C2    1 
ATOM 6317  N N3    . A   E 5  26  ? 88.601  -41.257  -11.932 1.00 0.00 ? 553  A   E N3    1 
ATOM 6318  C C4    . A   E 5  26  ? 89.421  -40.779  -10.986 1.00 0.00 ? 553  A   E C4    1 
ATOM 6319  P P     . A   E 5  27  ? 92.842  -36.506  -14.331 1.00 0.00 ? 554  A   E P     1 
ATOM 6320  O OP1   . A   E 5  27  ? 93.684  -36.016  -15.446 1.00 0.00 ? 554  A   E OP1   1 
ATOM 6321  O OP2   . A   E 5  27  ? 93.100  -35.937  -12.990 1.00 0.00 ? 554  A   E OP2   1 
ATOM 6322  O "O5'" . A   E 5  27  ? 91.319  -36.288  -14.701 1.00 0.00 ? 554  A   E "O5'" 1 
ATOM 6323  C "C5'" . A   E 5  27  ? 90.826  -36.720  -15.982 1.00 0.00 ? 554  A   E "C5'" 1 
ATOM 6324  C "C4'" . A   E 5  27  ? 89.300  -36.860  -15.938 1.00 0.00 ? 554  A   E "C4'" 1 
ATOM 6325  O "O4'" . A   E 5  27  ? 88.936  -37.820  -14.916 1.00 0.00 ? 554  A   E "O4'" 1 
ATOM 6326  C "C3'" . A   E 5  27  ? 88.540  -35.587  -15.554 1.00 0.00 ? 554  A   E "C3'" 1 
ATOM 6327  O "O3'" . A   E 5  27  ? 88.249  -34.821  -16.727 1.00 0.00 ? 554  A   E "O3'" 1 
ATOM 6328  C "C2'" . A   E 5  27  ? 87.295  -36.113  -14.847 1.00 0.00 ? 554  A   E "C2'" 1 
ATOM 6329  O "O2'" . A   E 5  27  ? 86.266  -36.432  -15.754 1.00 0.00 ? 554  A   E "O2'" 1 
ATOM 6330  C "C1'" . A   E 5  27  ? 87.798  -37.383  -14.203 1.00 0.00 ? 554  A   E "C1'" 1 
ATOM 6331  N N9    . A   E 5  27  ? 88.068  -37.227  -12.762 1.00 0.00 ? 554  A   E N9    1 
ATOM 6332  C C8    . A   E 5  27  ? 89.265  -37.021  -12.114 1.00 0.00 ? 554  A   E C8    1 
ATOM 6333  N N7    . A   E 5  27  ? 89.152  -36.967  -10.818 1.00 0.00 ? 554  A   E N7    1 
ATOM 6334  C C5    . A   E 5  27  ? 87.821  -37.140  -10.565 1.00 0.00 ? 554  A   E C5    1 
ATOM 6335  C C6    . A   E 5  27  ? 87.129  -37.189  -9.343  1.00 0.00 ? 554  A   E C6    1 
ATOM 6336  N N6    . A   E 5  27  ? 87.846  -37.108  -8.179  1.00 0.00 ? 554  A   E N6    1 
ATOM 6337  N N1    . A   E 5  27  ? 85.766  -37.336  -9.450  1.00 0.00 ? 554  A   E N1    1 
ATOM 6338  C C2    . A   E 5  27  ? 85.220  -37.443  -10.673 1.00 0.00 ? 554  A   E C2    1 
ATOM 6339  N N3    . A   E 5  27  ? 85.804  -37.453  -11.881 1.00 0.00 ? 554  A   E N3    1 
ATOM 6340  C C4    . A   E 5  27  ? 87.128  -37.292  -11.761 1.00 0.00 ? 554  A   E C4    1 
ATOM 6341  P P     . A   E 5  28  ? 88.882  -33.407  -17.042 1.00 0.00 ? 555  A   E P     1 
ATOM 6342  O OP1   . A   E 5  28  ? 89.056  -33.295  -18.509 1.00 0.00 ? 555  A   E OP1   1 
ATOM 6343  O OP2   . A   E 5  28  ? 90.082  -33.187  -16.205 1.00 0.00 ? 555  A   E OP2   1 
ATOM 6344  O "O5'" . A   E 5  28  ? 87.729  -32.400  -16.602 1.00 0.00 ? 555  A   E "O5'" 1 
ATOM 6345  C "C5'" . A   E 5  28  ? 87.540  -32.194  -15.198 1.00 0.00 ? 555  A   E "C5'" 1 
ATOM 6346  C "C4'" . A   E 5  28  ? 86.297  -31.341  -14.959 1.00 0.00 ? 555  A   E "C4'" 1 
ATOM 6347  O "O4'" . A   E 5  28  ? 86.009  -31.330  -13.543 1.00 0.00 ? 555  A   E "O4'" 1 
ATOM 6348  C "C3'" . A   E 5  28  ? 86.487  -29.857  -15.286 1.00 0.00 ? 555  A   E "C3'" 1 
ATOM 6349  O "O3'" . A   E 5  28  ? 85.224  -29.225  -15.564 1.00 0.00 ? 555  A   E "O3'" 1 
ATOM 6350  C "C2'" . A   E 5  28  ? 87.156  -29.329  -14.033 1.00 0.00 ? 555  A   E "C2'" 1 
ATOM 6351  O "O2'" . A   E 5  28  ? 86.985  -27.941  -13.861 1.00 0.00 ? 555  A   E "O2'" 1 
ATOM 6352  C "C1'" . A   E 5  28  ? 86.430  -30.108  -12.972 1.00 0.00 ? 555  A   E "C1'" 1 
ATOM 6353  N N9    . A   E 5  28  ? 87.251  -30.320  -11.779 1.00 0.00 ? 555  A   E N9    1 
ATOM 6354  C C8    . A   E 5  28  ? 88.615  -30.462  -11.694 1.00 0.00 ? 555  A   E C8    1 
ATOM 6355  N N7    . A   E 5  28  ? 89.042  -30.612  -10.473 1.00 0.00 ? 555  A   E N7    1 
ATOM 6356  C C5    . A   E 5  28  ? 87.922  -30.560  -9.690  1.00 0.00 ? 555  A   E C5    1 
ATOM 6357  C C6    . A   E 5  28  ? 87.791  -30.587  -8.294  1.00 0.00 ? 555  A   E C6    1 
ATOM 6358  N N6    . A   E 5  28  ? 88.924  -30.697  -7.538  1.00 0.00 ? 555  A   E N6    1 
ATOM 6359  N N1    . A   E 5  28  ? 86.504  -30.469  -7.822  1.00 0.00 ? 555  A   E N1    1 
ATOM 6360  C C2    . A   E 5  28  ? 85.502  -30.342  -8.707  1.00 0.00 ? 555  A   E C2    1 
ATOM 6361  N N3    . A   E 5  28  ? 85.534  -30.298  -10.047 1.00 0.00 ? 555  A   E N3    1 
ATOM 6362  C C4    . A   E 5  28  ? 86.795  -30.400  -10.486 1.00 0.00 ? 555  A   E C4    1 
ATOM 6363  P P     . A   E 5  29  ? 85.036  -28.530  -16.973 1.00 0.00 ? 556  A   E P     1 
ATOM 6364  O OP1   . A   E 5  29  ? 85.477  -29.467  -18.029 1.00 0.00 ? 556  A   E OP1   1 
ATOM 6365  O OP2   . A   E 5  29  ? 85.697  -27.205  -16.927 1.00 0.00 ? 556  A   E OP2   1 
ATOM 6366  O "O5'" . A   E 5  29  ? 83.489  -28.293  -17.127 1.00 0.00 ? 556  A   E "O5'" 1 
ATOM 6367  C "C5'" . A   E 5  29  ? 82.443  -28.731  -16.263 1.00 0.00 ? 556  A   E "C5'" 1 
ATOM 6368  C "C4'" . A   E 5  29  ? 81.282  -29.323  -17.079 1.00 0.00 ? 556  A   E "C4'" 1 
ATOM 6369  O "O4'" . A   E 5  29  ? 80.985  -28.533  -18.261 1.00 0.00 ? 556  A   E "O4'" 1 
ATOM 6370  C "C3'" . A   E 5  29  ? 81.571  -30.718  -17.627 1.00 0.00 ? 556  A   E "C3'" 1 
ATOM 6371  O "O3'" . A   E 5  29  ? 81.294  -31.676  -16.610 1.00 0.00 ? 556  A   E "O3'" 1 
ATOM 6372  C "C2'" . A   E 5  29  ? 80.655  -30.811  -18.837 1.00 0.00 ? 556  A   E "C2'" 1 
ATOM 6373  O "O2'" . A   E 5  29  ? 79.339  -31.163  -18.476 1.00 0.00 ? 556  A   E "O2'" 1 
ATOM 6374  C "C1'" . A   E 5  29  ? 80.669  -29.389  -19.348 1.00 0.00 ? 556  A   E "C1'" 1 
ATOM 6375  N N9    . A   E 5  29  ? 81.607  -29.216  -20.470 1.00 0.00 ? 556  A   E N9    1 
ATOM 6376  C C8    . A   E 5  29  ? 82.980  -29.226  -20.428 1.00 0.00 ? 556  A   E C8    1 
ATOM 6377  N N7    . A   E 5  29  ? 83.538  -29.031  -21.590 1.00 0.00 ? 556  A   E N7    1 
ATOM 6378  C C5    . A   E 5  29  ? 82.502  -28.891  -22.471 1.00 0.00 ? 556  A   E C5    1 
ATOM 6379  C C6    . A   E 5  29  ? 82.515  -28.645  -23.856 1.00 0.00 ? 556  A   E C6    1 
ATOM 6380  N N6    . A   E 5  29  ? 83.718  -28.511  -24.501 1.00 0.00 ? 556  A   E N6    1 
ATOM 6381  N N1    . A   E 5  29  ? 81.275  -28.557  -24.444 1.00 0.00 ? 556  A   E N1    1 
ATOM 6382  C C2    . A   E 5  29  ? 80.183  -28.706  -23.675 1.00 0.00 ? 556  A   E C2    1 
ATOM 6383  N N3    . A   E 5  29  ? 80.075  -28.933  -22.356 1.00 0.00 ? 556  A   E N3    1 
ATOM 6384  C C4    . A   E 5  29  ? 81.290  -29.012  -21.796 1.00 0.00 ? 556  A   E C4    1 
ATOM 6385  P P     . A   E 5  30  ? 82.105  -33.027  -16.517 1.00 0.00 ? 557  A   E P     1 
ATOM 6386  O OP1   . A   E 5  30  ? 83.521  -32.793  -16.880 1.00 0.00 ? 557  A   E OP1   1 
ATOM 6387  O OP2   . A   E 5  30  ? 81.372  -34.077  -17.262 1.00 0.00 ? 557  A   E OP2   1 
ATOM 6388  O "O5'" . A   E 5  30  ? 82.013  -33.338  -14.960 1.00 0.00 ? 557  A   E "O5'" 1 
ATOM 6389  C "C5'" . A   E 5  30  ? 82.443  -32.302  -14.060 1.00 0.00 ? 557  A   E "C5'" 1 
ATOM 6390  C "C4'" . A   E 5  30  ? 82.068  -32.655  -12.622 1.00 0.00 ? 557  A   E "C4'" 1 
ATOM 6391  O "O4'" . A   E 5  30  ? 82.743  -33.861  -12.199 1.00 0.00 ? 557  A   E "O4'" 1 
ATOM 6392  C "C3'" . A   E 5  30  ? 82.482  -31.613  -11.585 1.00 0.00 ? 557  A   E "C3'" 1 
ATOM 6393  O "O3'" . A   E 5  30  ? 81.503  -30.579  -11.522 1.00 0.00 ? 557  A   E "O3'" 1 
ATOM 6394  C "C2'" . A   E 5  30  ? 82.542  -32.447  -10.317 1.00 0.00 ? 557  A   E "C2'" 1 
ATOM 6395  O "O2'" . A   E 5  30  ? 81.270  -32.687  -9.770  1.00 0.00 ? 557  A   E "O2'" 1 
ATOM 6396  C "C1'" . A   E 5  30  ? 83.105  -33.748  -10.831 1.00 0.00 ? 557  A   E "C1'" 1 
ATOM 6397  N N9    . A   E 5  30  ? 84.556  -33.805  -10.633 1.00 0.00 ? 557  A   E N9    1 
ATOM 6398  C C8    . A   E 5  30  ? 85.554  -33.784  -11.576 1.00 0.00 ? 557  A   E C8    1 
ATOM 6399  N N7    . A   E 5  30  ? 86.747  -33.830  -11.061 1.00 0.00 ? 557  A   E N7    1 
ATOM 6400  C C5    . A   E 5  30  ? 86.558  -33.878  -9.710  1.00 0.00 ? 557  A   E C5    1 
ATOM 6401  C C6    . A   E 5  30  ? 87.495  -33.925  -8.670  1.00 0.00 ? 557  A   E C6    1 
ATOM 6402  N N6    . A   E 5  30  ? 88.828  -33.949  -8.993  1.00 0.00 ? 557  A   E N6    1 
ATOM 6403  N N1    . A   E 5  30  ? 86.955  -33.952  -7.405  1.00 0.00 ? 557  A   E N1    1 
ATOM 6404  C C2    . A   E 5  30  ? 85.620  -33.931  -7.263  1.00 0.00 ? 557  A   E C2    1 
ATOM 6405  N N3    . A   E 5  30  ? 84.658  -33.893  -8.195  1.00 0.00 ? 557  A   E N3    1 
ATOM 6406  C C4    . A   E 5  30  ? 85.199  -33.863  -9.422  1.00 0.00 ? 557  A   E C4    1 
ATOM 6407  P P     . G   E 5  31  ? 81.739  -29.124  -12.089 1.00 0.00 ? 558  G   E P     1 
ATOM 6408  O OP1   . G   E 5  31  ? 80.711  -28.849  -13.118 1.00 0.00 ? 558  G   E OP1   1 
ATOM 6409  O OP2   . G   E 5  31  ? 83.153  -28.942  -12.485 1.00 0.00 ? 558  G   E OP2   1 
ATOM 6410  O "O5'" . G   E 5  31  ? 81.450  -28.216  -10.823 1.00 0.00 ? 558  G   E "O5'" 1 
ATOM 6411  C "C5'" . G   E 5  31  ? 82.115  -28.498  -9.584  1.00 0.00 ? 558  G   E "C5'" 1 
ATOM 6412  C "C4'" . G   E 5  31  ? 82.123  -27.265  -8.653  1.00 0.00 ? 558  G   E "C4'" 1 
ATOM 6413  O "O4'" . G   E 5  31  ? 83.430  -27.137  -8.028  1.00 0.00 ? 558  G   E "O4'" 1 
ATOM 6414  C "C3'" . G   E 5  31  ? 81.953  -25.896  -9.345  1.00 0.00 ? 558  G   E "C3'" 1 
ATOM 6415  O "O3'" . G   E 5  31  ? 81.548  -24.892  -8.411  1.00 0.00 ? 558  G   E "O3'" 1 
ATOM 6416  C "C2'" . G   E 5  31  ? 83.363  -25.669  -9.858  1.00 0.00 ? 558  G   E "C2'" 1 
ATOM 6417  O "O2'" . G   E 5  31  ? 83.591  -24.322  -10.195 1.00 0.00 ? 558  G   E "O2'" 1 
ATOM 6418  C "C1'" . G   E 5  31  ? 84.161  -26.095  -8.652  1.00 0.00 ? 558  G   E "C1'" 1 
ATOM 6419  N N9    . G   E 5  31  ? 85.539  -26.516  -8.966  1.00 0.00 ? 558  G   E N9    1 
ATOM 6420  C C8    . G   E 5  31  ? 86.047  -26.934  -10.175 1.00 0.00 ? 558  G   E C8    1 
ATOM 6421  N N7    . G   E 5  31  ? 87.309  -27.256  -10.114 1.00 0.00 ? 558  G   E N7    1 
ATOM 6422  C C5    . G   E 5  31  ? 87.658  -27.063  -8.803  1.00 0.00 ? 558  G   E C5    1 
ATOM 6423  C C6    . G   E 5  31  ? 88.888  -27.331  -8.177  1.00 0.00 ? 558  G   E C6    1 
ATOM 6424  O O6    . G   E 5  31  ? 89.864  -27.819  -8.754  1.00 0.00 ? 558  G   E O6    1 
ATOM 6425  N N1    . G   E 5  31  ? 88.850  -26.945  -6.817  1.00 0.00 ? 558  G   E N1    1 
ATOM 6426  C C2    . G   E 5  31  ? 87.738  -26.403  -6.151  1.00 0.00 ? 558  G   E C2    1 
ATOM 6427  N N2    . G   E 5  31  ? 87.949  -26.042  -4.857  1.00 0.00 ? 558  G   E N2    1 
ATOM 6428  N N3    . G   E 5  31  ? 86.540  -26.242  -6.771  1.00 0.00 ? 558  G   E N3    1 
ATOM 6429  C C4    . G   E 5  31  ? 86.586  -26.573  -8.075  1.00 0.00 ? 558  G   E C4    1 
ATOM 6430  P P     . U   E 5  32  ? 80.136  -24.192  -8.425  1.00 0.00 ? 559  U   E P     1 
ATOM 6431  O OP1   . U   E 5  32  ? 79.307  -24.708  -9.539  1.00 0.00 ? 559  U   E OP1   1 
ATOM 6432  O OP2   . U   E 5  32  ? 80.347  -22.729  -8.357  1.00 0.00 ? 559  U   E OP2   1 
ATOM 6433  O "O5'" . U   E 5  32  ? 79.534  -24.676  -7.044  1.00 0.00 ? 559  U   E "O5'" 1 
ATOM 6434  C "C5'" . U   E 5  32  ? 78.790  -25.900  -6.998  1.00 0.00 ? 559  U   E "C5'" 1 
ATOM 6435  C "C4'" . U   E 5  32  ? 78.707  -26.439  -5.567  1.00 0.00 ? 559  U   E "C4'" 1 
ATOM 6436  O "O4'" . U   E 5  32  ? 80.024  -26.782  -5.057  1.00 0.00 ? 559  U   E "O4'" 1 
ATOM 6437  C "C3'" . U   E 5  32  ? 78.126  -25.465  -4.537  1.00 0.00 ? 559  U   E "C3'" 1 
ATOM 6438  O "O3'" . U   E 5  32  ? 77.265  -26.159  -3.625  1.00 0.00 ? 559  U   E "O3'" 1 
ATOM 6439  C "C2'" . U   E 5  32  ? 79.366  -24.866  -3.882  1.00 0.00 ? 559  U   E "C2'" 1 
ATOM 6440  O "O2'" . U   E 5  32  ? 79.121  -24.390  -2.580  1.00 0.00 ? 559  U   E "O2'" 1 
ATOM 6441  C "C1'" . U   E 5  32  ? 80.302  -26.047  -3.876  1.00 0.00 ? 559  U   E "C1'" 1 
ATOM 6442  N N1    . U   E 5  32  ? 81.727  -25.614  -3.789  1.00 0.00 ? 559  U   E N1    1 
ATOM 6443  C C2    . U   E 5  32  ? 82.372  -25.655  -2.558  1.00 0.00 ? 559  U   E C2    1 
ATOM 6444  O O2    . U   E 5  32  ? 81.818  -26.075  -1.543  1.00 0.00 ? 559  U   E O2    1 
ATOM 6445  N N3    . U   E 5  32  ? 83.685  -25.167  -2.568  1.00 0.00 ? 559  U   E N3    1 
ATOM 6446  C C4    . U   E 5  32  ? 84.379  -24.629  -3.668  1.00 0.00 ? 559  U   E C4    1 
ATOM 6447  O O4    . U   E 5  32  ? 85.524  -24.185  -3.550  1.00 0.00 ? 559  U   E O4    1 
ATOM 6448  C C5    . U   E 5  32  ? 83.624  -24.648  -4.898  1.00 0.00 ? 559  U   E C5    1 
ATOM 6449  C C6    . U   E 5  32  ? 82.362  -25.109  -4.905  1.00 0.00 ? 559  U   E C6    1 
ATOM 6450  P P     . A   E 5  33  ? 75.906  -25.510  -3.131  1.00 0.00 ? 560  A   E P     1 
ATOM 6451  O OP1   . A   E 5  33  ? 75.482  -24.427  -4.047  1.00 0.00 ? 560  A   E OP1   1 
ATOM 6452  O OP2   . A   E 5  33  ? 76.048  -25.167  -1.697  1.00 0.00 ? 560  A   E OP2   1 
ATOM 6453  O "O5'" . A   E 5  33  ? 74.883  -26.703  -3.255  1.00 0.00 ? 560  A   E "O5'" 1 
ATOM 6454  C "C5'" . A   E 5  33  ? 74.767  -27.518  -4.428  1.00 0.00 ? 560  A   E "C5'" 1 
ATOM 6455  C "C4'" . A   E 5  33  ? 73.289  -27.794  -4.774  1.00 0.00 ? 560  A   E "C4'" 1 
ATOM 6456  O "O4'" . A   E 5  33  ? 72.464  -27.891  -3.582  1.00 0.00 ? 560  A   E "O4'" 1 
ATOM 6457  C "C3'" . A   E 5  33  ? 72.624  -26.675  -5.584  1.00 0.00 ? 560  A   E "C3'" 1 
ATOM 6458  O "O3'" . A   E 5  33  ? 72.923  -26.719  -6.976  1.00 0.00 ? 560  A   E "O3'" 1 
ATOM 6459  C "C2'" . A   E 5  33  ? 71.143  -26.769  -5.214  1.00 0.00 ? 560  A   E "C2'" 1 
ATOM 6460  O "O2'" . A   E 5  33  ? 70.417  -27.657  -6.022  1.00 0.00 ? 560  A   E "O2'" 1 
ATOM 6461  C "C1'" . A   E 5  33  ? 71.191  -27.316  -3.808  1.00 0.00 ? 560  A   E "C1'" 1 
ATOM 6462  N N9    . A   E 5  33  ? 70.853  -26.277  -2.829  1.00 0.00 ? 560  A   E N9    1 
ATOM 6463  C C8    . A   E 5  33  ? 71.664  -25.314  -2.274  1.00 0.00 ? 560  A   E C8    1 
ATOM 6464  N N7    . A   E 5  33  ? 71.028  -24.509  -1.466  1.00 0.00 ? 560  A   E N7    1 
ATOM 6465  C C5    . A   E 5  33  ? 69.723  -24.924  -1.489  1.00 0.00 ? 560  A   E C5    1 
ATOM 6466  C C6    . A   E 5  33  ? 68.589  -24.398  -0.847  1.00 0.00 ? 560  A   E C6    1 
ATOM 6467  N N6    . A   E 5  33  ? 68.729  -23.300  -0.039  1.00 0.00 ? 560  A   E N6    1 
ATOM 6468  N N1    . A   E 5  33  ? 67.409  -25.054  -1.112  1.00 0.00 ? 560  A   E N1    1 
ATOM 6469  C C2    . A   E 5  33  ? 67.430  -26.112  -1.940  1.00 0.00 ? 560  A   E C2    1 
ATOM 6470  N N3    . A   E 5  33  ? 68.455  -26.674  -2.599  1.00 0.00 ? 560  A   E N3    1 
ATOM 6471  C C4    . A   E 5  33  ? 69.595  -26.022  -2.334  1.00 0.00 ? 560  A   E C4    1 
ATOM 6472  P P     . C   E 5  34  ? 73.061  -27.915  -7.997  1.00 0.00 ? 561  C   E P     1 
ATOM 6473  O OP1   . C   E 5  34  ? 72.897  -27.377  -9.365  1.00 0.00 ? 561  C   E OP1   1 
ATOM 6474  O OP2   . C   E 5  34  ? 72.181  -29.042  -7.613  1.00 0.00 ? 561  C   E OP2   1 
ATOM 6475  O "O5'" . C   E 5  34  ? 74.567  -28.365  -7.818  1.00 0.00 ? 561  C   E "O5'" 1 
ATOM 6476  C "C5'" . C   E 5  34  ? 74.873  -29.762  -7.990  1.00 0.00 ? 561  C   E "C5'" 1 
ATOM 6477  C "C4'" . C   E 5  34  ? 76.304  -29.955  -8.502  1.00 0.00 ? 561  C   E "C4'" 1 
ATOM 6478  O "O4'" . C   E 5  34  ? 77.236  -29.068  -7.825  1.00 0.00 ? 561  C   E "O4'" 1 
ATOM 6479  C "C3'" . C   E 5  34  ? 76.875  -31.350  -8.234  1.00 0.00 ? 561  C   E "C3'" 1 
ATOM 6480  O "O3'" . C   E 5  34  ? 76.408  -32.277  -9.234  1.00 0.00 ? 561  C   E "O3'" 1 
ATOM 6481  C "C2'" . C   E 5  34  ? 78.365  -31.086  -8.284  1.00 0.00 ? 561  C   E "C2'" 1 
ATOM 6482  O "O2'" . C   E 5  34  ? 78.814  -30.926  -9.610  1.00 0.00 ? 561  C   E "O2'" 1 
ATOM 6483  C "C1'" . C   E 5  34  ? 78.446  -29.762  -7.569  1.00 0.00 ? 561  C   E "C1'" 1 
ATOM 6484  N N1    . C   E 5  34  ? 78.729  -29.935  -6.115  1.00 0.00 ? 561  C   E N1    1 
ATOM 6485  C C2    . C   E 5  34  ? 80.047  -30.007  -5.656  1.00 0.00 ? 561  C   E C2    1 
ATOM 6486  O O2    . C   E 5  34  ? 80.981  -29.923  -6.475  1.00 0.00 ? 561  C   E O2    1 
ATOM 6487  N N3    . C   E 5  34  ? 80.262  -30.161  -4.316  1.00 0.00 ? 561  C   E N3    1 
ATOM 6488  C C4    . C   E 5  34  ? 79.230  -30.316  -3.439  1.00 0.00 ? 561  C   E C4    1 
ATOM 6489  N N4    . C   E 5  34  ? 79.446  -30.472  -2.099  1.00 0.00 ? 561  C   E N4    1 
ATOM 6490  C C5    . C   E 5  34  ? 77.881  -30.320  -3.926  1.00 0.00 ? 561  C   E C5    1 
ATOM 6491  C C6    . C   E 5  34  ? 77.682  -30.134  -5.238  1.00 0.00 ? 561  C   E C6    1 
ATOM 6492  P P     . C   F 6  1   ? 68.262  2.137    16.146  1.00 0.00 ? 1654 C   F P     1 
ATOM 6493  O OP1   . C   F 6  1   ? 68.941  3.246    15.441  1.00 0.00 ? 1654 C   F OP1   1 
ATOM 6494  O OP2   . C   F 6  1   ? 68.958  0.842    16.318  1.00 0.00 ? 1654 C   F OP2   1 
ATOM 6495  O "O5'" . C   F 6  1   ? 67.610  2.618    17.500  1.00 0.00 ? 1654 C   F "O5'" 1 
ATOM 6496  C "C5'" . C   F 6  1   ? 66.679  3.709    17.493  1.00 0.00 ? 1654 C   F "C5'" 1 
ATOM 6497  C "C4'" . C   F 6  1   ? 66.589  4.364    18.880  1.00 0.00 ? 1654 C   F "C4'" 1 
ATOM 6498  O "O4'" . C   F 6  1   ? 66.199  3.397    19.894  1.00 0.00 ? 1654 C   F "O4'" 1 
ATOM 6499  C "C3'" . C   F 6  1   ? 67.949  4.891    19.353  1.00 0.00 ? 1654 C   F "C3'" 1 
ATOM 6500  O "O3'" . C   F 6  1   ? 68.072  6.275    19.004  1.00 0.00 ? 1654 C   F "O3'" 1 
ATOM 6501  C "C2'" . C   F 6  1   ? 67.960  4.613    20.844  1.00 0.00 ? 1654 C   F "C2'" 1 
ATOM 6502  O "O2'" . C   F 6  1   ? 67.284  5.609    21.576  1.00 0.00 ? 1654 C   F "O2'" 1 
ATOM 6503  C "C1'" . C   F 6  1   ? 67.185  3.313    20.925  1.00 0.00 ? 1654 C   F "C1'" 1 
ATOM 6504  N N1    . C   F 6  1   ? 68.050  2.074    20.833  1.00 0.00 ? 1654 C   F N1    1 
ATOM 6505  C C2    . C   F 6  1   ? 69.141  1.841    21.691  1.00 0.00 ? 1654 C   F C2    1 
ATOM 6506  O O2    . C   F 6  1   ? 69.419  2.671    22.575  1.00 0.00 ? 1654 C   F O2    1 
ATOM 6507  N N3    . C   F 6  1   ? 69.866  0.691    21.530  1.00 0.00 ? 1654 C   F N3    1 
ATOM 6508  C C4    . C   F 6  1   ? 69.477  -0.283   20.659  1.00 0.00 ? 1654 C   F C4    1 
ATOM 6509  N N4    . C   F 6  1   ? 70.189  -1.434   20.475  1.00 0.00 ? 1654 C   F N4    1 
ATOM 6510  C C5    . C   F 6  1   ? 68.283  -0.111   19.897  1.00 0.00 ? 1654 C   F C5    1 
ATOM 6511  C C6    . C   F 6  1   ? 67.610  1.036    20.030  1.00 0.00 ? 1654 C   F C6    1 
ATOM 6512  P P     . C   F 6  2   ? 69.256  6.757    18.069  1.00 0.00 ? 1655 C   F P     1 
ATOM 6513  O OP1   . C   F 6  2   ? 69.105  8.207    17.820  1.00 0.00 ? 1655 C   F OP1   1 
ATOM 6514  O OP2   . C   F 6  2   ? 69.360  5.869    16.887  1.00 0.00 ? 1655 C   F OP2   1 
ATOM 6515  O "O5'" . C   F 6  2   ? 70.513  6.516    18.996  1.00 0.00 ? 1655 C   F "O5'" 1 
ATOM 6516  C "C5'" . C   F 6  2   ? 70.637  7.330    20.171  1.00 0.00 ? 1655 C   F "C5'" 1 
ATOM 6517  C "C4'" . C   F 6  2   ? 71.869  6.919    20.972  1.00 0.00 ? 1655 C   F "C4'" 1 
ATOM 6518  O "O4'" . C   F 6  2   ? 71.643  5.630    21.586  1.00 0.00 ? 1655 C   F "O4'" 1 
ATOM 6519  C "C3'" . C   F 6  2   ? 73.160  6.736    20.163  1.00 0.00 ? 1655 C   F "C3'" 1 
ATOM 6520  O "O3'" . C   F 6  2   ? 73.797  8.009    20.000  1.00 0.00 ? 1655 C   F "O3'" 1 
ATOM 6521  C "C2'" . C   F 6  2   ? 73.930  5.739    21.010  1.00 0.00 ? 1655 C   F "C2'" 1 
ATOM 6522  O "O2'" . C   F 6  2   ? 74.549  6.361    22.112  1.00 0.00 ? 1655 C   F "O2'" 1 
ATOM 6523  C "C1'" . C   F 6  2   ? 72.814  4.836    21.491  1.00 0.00 ? 1655 C   F "C1'" 1 
ATOM 6524  N N1    . C   F 6  2   ? 72.645  3.619    20.630  1.00 0.00 ? 1655 C   F N1    1 
ATOM 6525  C C2    . C   F 6  2   ? 73.593  2.595    20.688  1.00 0.00 ? 1655 C   F C2    1 
ATOM 6526  O O2    . C   F 6  2   ? 74.561  2.718    21.459  1.00 0.00 ? 1655 C   F O2    1 
ATOM 6527  N N3    . C   F 6  2   ? 73.414  1.487    19.906  1.00 0.00 ? 1655 C   F N3    1 
ATOM 6528  C C4    . C   F 6  2   ? 72.342  1.369    19.073  1.00 0.00 ? 1655 C   F C4    1 
ATOM 6529  N N4    . C   F 6  2   ? 72.147  0.259    18.304  1.00 0.00 ? 1655 C   F N4    1 
ATOM 6530  C C5    . C   F 6  2   ? 71.382  2.429    18.997  1.00 0.00 ? 1655 C   F C5    1 
ATOM 6531  C C6    . C   F 6  2   ? 71.567  3.503    19.775  1.00 0.00 ? 1655 C   F C6    1 
ATOM 6532  P P     . A   F 6  3   ? 74.555  8.340    18.650  1.00 0.00 ? 1656 A   F P     1 
ATOM 6533  O OP1   . A   F 6  3   ? 75.013  9.746    18.698  1.00 0.00 ? 1656 A   F OP1   1 
ATOM 6534  O OP2   . A   F 6  3   ? 73.705  7.944    17.502  1.00 0.00 ? 1656 A   F OP2   1 
ATOM 6535  O "O5'" . A   F 6  3   ? 75.812  7.380    18.713  1.00 0.00 ? 1656 A   F "O5'" 1 
ATOM 6536  C "C5'" . A   F 6  3   ? 76.887  7.741    19.597  1.00 0.00 ? 1656 A   F "C5'" 1 
ATOM 6537  C "C4'" . A   F 6  3   ? 77.934  6.625    19.620  1.00 0.00 ? 1656 A   F "C4'" 1 
ATOM 6538  O "O4'" . A   F 6  3   ? 77.359  5.387    20.104  1.00 0.00 ? 1656 A   F "O4'" 1 
ATOM 6539  C "C3'" . A   F 6  3   ? 78.509  6.232    18.259  1.00 0.00 ? 1656 A   F "C3'" 1 
ATOM 6540  O "O3'" . A   F 6  3   ? 79.488  7.194    17.855  1.00 0.00 ? 1656 A   F "O3'" 1 
ATOM 6541  C "C2'" . A   F 6  3   ? 79.066  4.858    18.566  1.00 0.00 ? 1656 A   F "C2'" 1 
ATOM 6542  O "O2'" . A   F 6  3   ? 80.279  4.930    19.279  1.00 0.00 ? 1656 A   F "O2'" 1 
ATOM 6543  C "C1'" . A   F 6  3   ? 77.991  4.297    19.454  1.00 0.00 ? 1656 A   F "C1'" 1 
ATOM 6544  N N9    . A   F 6  3   ? 77.048  3.485    18.679  1.00 0.00 ? 1656 A   F N9    1 
ATOM 6545  C C8    . A   F 6  3   ? 75.823  3.822    18.153  1.00 0.00 ? 1656 A   F C8    1 
ATOM 6546  N N7    . A   F 6  3   ? 75.253  2.842    17.511  1.00 0.00 ? 1656 A   F N7    1 
ATOM 6547  C C5    . A   F 6  3   ? 76.128  1.795    17.599  1.00 0.00 ? 1656 A   F C5    1 
ATOM 6548  C C6    . A   F 6  3   ? 76.018  0.476    17.130  1.00 0.00 ? 1656 A   F C6    1 
ATOM 6549  N N6    . A   F 6  3   ? 74.883  0.103    16.461  1.00 0.00 ? 1656 A   F N6    1 
ATOM 6550  N N1    . A   F 6  3   ? 77.097  -0.329   17.402  1.00 0.00 ? 1656 A   F N1    1 
ATOM 6551  C C2    . A   F 6  3   ? 78.145  0.187    18.063  1.00 0.00 ? 1656 A   F C2    1 
ATOM 6552  N N3    . A   F 6  3   ? 78.332  1.421    18.550  1.00 0.00 ? 1656 A   F N3    1 
ATOM 6553  C C4    . A   F 6  3   ? 77.262  2.186    18.300  1.00 0.00 ? 1656 A   F C4    1 
ATOM 6554  P P     . C   F 6  4   ? 79.760  7.413    16.309  1.00 0.00 ? 1657 C   F P     1 
ATOM 6555  O OP1   . C   F 6  4   ? 80.585  8.630    16.151  1.00 0.00 ? 1657 C   F OP1   1 
ATOM 6556  O OP2   . C   F 6  4   ? 78.476  7.365    15.574  1.00 0.00 ? 1657 C   F OP2   1 
ATOM 6557  O "O5'" . C   F 6  4   ? 80.605  6.154    15.886  1.00 0.00 ? 1657 C   F "O5'" 1 
ATOM 6558  C "C5'" . C   F 6  4   ? 81.957  5.965    16.307  1.00 0.00 ? 1657 C   F "C5'" 1 
ATOM 6559  C "C4'" . C   F 6  4   ? 82.368  4.509    16.050  1.00 0.00 ? 1657 C   F "C4'" 1 
ATOM 6560  O "O4'" . C   F 6  4   ? 81.433  3.588    16.676  1.00 0.00 ? 1657 C   F "O4'" 1 
ATOM 6561  C "C3'" . C   F 6  4   ? 82.365  4.056    14.586  1.00 0.00 ? 1657 C   F "C3'" 1 
ATOM 6562  O "O3'" . C   F 6  4   ? 83.536  4.540    13.923  1.00 0.00 ? 1657 C   F "O3'" 1 
ATOM 6563  C "C2'" . C   F 6  4   ? 82.309  2.545    14.759  1.00 0.00 ? 1657 C   F "C2'" 1 
ATOM 6564  O "O2'" . C   F 6  4   ? 83.551  2.020    15.169  1.00 0.00 ? 1657 C   F "O2'" 1 
ATOM 6565  C "C1'" . C   F 6  4   ? 81.311  2.420    15.881  1.00 0.00 ? 1657 C   F "C1'" 1 
ATOM 6566  N N1    . C   F 6  4   ? 79.935  2.166    15.352  1.00 0.00 ? 1657 C   F N1    1 
ATOM 6567  C C2    . C   F 6  4   ? 79.531  0.856    15.081  1.00 0.00 ? 1657 C   F C2    1 
ATOM 6568  O O2    . C   F 6  4   ? 80.310  -0.080   15.338  1.00 0.00 ? 1657 C   F O2    1 
ATOM 6569  N N3    . C   F 6  4   ? 78.293  0.648    14.543  1.00 0.00 ? 1657 C   F N3    1 
ATOM 6570  C C4    . C   F 6  4   ? 77.466  1.686    14.234  1.00 0.00 ? 1657 C   F C4    1 
ATOM 6571  N N4    . C   F 6  4   ? 76.242  1.481    13.659  1.00 0.00 ? 1657 C   F N4    1 
ATOM 6572  C C5    . C   F 6  4   ? 77.889  3.030    14.498  1.00 0.00 ? 1657 C   F C5    1 
ATOM 6573  C C6    . C   F 6  4   ? 79.107  3.218    15.024  1.00 0.00 ? 1657 C   F C6    1 
ATOM 6574  P P     . G   F 6  5   ? 83.522  4.660    12.338  1.00 0.00 ? 1658 G   F P     1 
ATOM 6575  O OP1   . G   F 6  5   ? 84.843  5.166    11.901  1.00 0.00 ? 1658 G   F OP1   1 
ATOM 6576  O OP2   . G   F 6  5   ? 82.334  5.441    11.925  1.00 0.00 ? 1658 G   F OP2   1 
ATOM 6577  O "O5'" . G   F 6  5   ? 83.343  3.165    11.834  1.00 0.00 ? 1658 G   F "O5'" 1 
ATOM 6578  C "C5'" . G   F 6  5   ? 84.488  2.300    11.855  1.00 0.00 ? 1658 G   F "C5'" 1 
ATOM 6579  C "C4'" . G   F 6  5   ? 84.114  0.906    11.340  1.00 0.00 ? 1658 G   F "C4'" 1 
ATOM 6580  O "O4'" . G   F 6  5   ? 83.039  0.318    12.116  1.00 0.00 ? 1658 G   F "O4'" 1 
ATOM 6581  C "C3'" . G   F 6  5   ? 83.591  0.836    9.906   1.00 0.00 ? 1658 G   F "C3'" 1 
ATOM 6582  O "O3'" . G   F 6  5   ? 84.682  0.975    8.990   1.00 0.00 ? 1658 G   F "O3'" 1 
ATOM 6583  C "C2'" . G   F 6  5   ? 82.926  -0.534   9.922   1.00 0.00 ? 1658 G   F "C2'" 1 
ATOM 6584  O "O2'" . G   F 6  5   ? 83.869  -1.579   9.850   1.00 0.00 ? 1658 G   F "O2'" 1 
ATOM 6585  C "C1'" . G   F 6  5   ? 82.268  -0.531   11.279  1.00 0.00 ? 1658 G   F "C1'" 1 
ATOM 6586  N N9    . G   F 6  5   ? 80.855  -0.109   11.175  1.00 0.00 ? 1658 G   F N9    1 
ATOM 6587  C C8    . G   F 6  5   ? 80.308  1.129    11.441  1.00 0.00 ? 1658 G   F C8    1 
ATOM 6588  N N7    . G   F 6  5   ? 79.021  1.176    11.226  1.00 0.00 ? 1658 G   F N7    1 
ATOM 6589  C C5    . G   F 6  5   ? 78.694  -0.084   10.785  1.00 0.00 ? 1658 G   F C5    1 
ATOM 6590  C C6    . G   F 6  5   ? 77.433  -0.579   10.397  1.00 0.00 ? 1658 G   F C6    1 
ATOM 6591  O O6    . G   F 6  5   ? 76.389  0.079    10.411  1.00 0.00 ? 1658 G   F O6    1 
ATOM 6592  N N1    . G   F 6  5   ? 77.539  -1.930   9.990   1.00 0.00 ? 1658 G   F N1    1 
ATOM 6593  C C2    . G   F 6  5   ? 78.714  -2.698   9.960   1.00 0.00 ? 1658 G   F C2    1 
ATOM 6594  N N2    . G   F 6  5   ? 78.574  -3.983   9.527   1.00 0.00 ? 1658 G   F N2    1 
ATOM 6595  N N3    . G   F 6  5   ? 79.908  -2.182   10.345  1.00 0.00 ? 1658 G   F N3    1 
ATOM 6596  C C4    . G   F 6  5   ? 79.816  -0.896   10.739  1.00 0.00 ? 1658 G   F C4    1 
ATOM 6597  P P     . U   F 6  6   ? 84.367  1.206    7.452   1.00 0.00 ? 1659 U   F P     1 
ATOM 6598  O OP1   . U   F 6  6   ? 85.643  1.455    6.745   1.00 0.00 ? 1659 U   F OP1   1 
ATOM 6599  O OP2   . U   F 6  6   ? 83.313  2.240    7.330   1.00 0.00 ? 1659 U   F OP2   1 
ATOM 6600  O "O5'" . U   F 6  6   ? 83.791  -0.197   6.986   1.00 0.00 ? 1659 U   F "O5'" 1 
ATOM 6601  C "C5'" . U   F 6  6   ? 82.986  -0.243   5.802   1.00 0.00 ? 1659 U   F "C5'" 1 
ATOM 6602  C "C4'" . U   F 6  6   ? 82.207  -1.558   5.752   1.00 0.00 ? 1659 U   F "C4'" 1 
ATOM 6603  O "O4'" . U   F 6  6   ? 81.355  -1.695   6.920   1.00 0.00 ? 1659 U   F "O4'" 1 
ATOM 6604  C "C3'" . U   F 6  6   ? 81.240  -1.618   4.572   1.00 0.00 ? 1659 U   F "C3'" 1 
ATOM 6605  O "O3'" . U   F 6  6   ? 81.942  -2.100   3.422   1.00 0.00 ? 1659 U   F "O3'" 1 
ATOM 6606  C "C2'" . U   F 6  6   ? 80.152  -2.541   5.086   1.00 0.00 ? 1659 U   F "C2'" 1 
ATOM 6607  O "O2'" . U   F 6  6   ? 80.558  -3.891   5.044   1.00 0.00 ? 1659 U   F "O2'" 1 
ATOM 6608  C "C1'" . U   F 6  6   ? 80.045  -2.093   6.528   1.00 0.00 ? 1659 U   F "C1'" 1 
ATOM 6609  N N1    . U   F 6  6   ? 79.008  -1.021   6.720   1.00 0.00 ? 1659 U   F N1    1 
ATOM 6610  C C2    . U   F 6  6   ? 77.666  -1.380   6.622   1.00 0.00 ? 1659 U   F C2    1 
ATOM 6611  O O2    . U   F 6  6   ? 77.312  -2.535   6.393   1.00 0.00 ? 1659 U   F O2    1 
ATOM 6612  N N3    . U   F 6  6   ? 76.760  -0.329   6.813   1.00 0.00 ? 1659 U   F N3    1 
ATOM 6613  C C4    . U   F 6  6   ? 77.066  1.011    7.108   1.00 0.00 ? 1659 U   F C4    1 
ATOM 6614  O O4    . U   F 6  6   ? 76.179  1.855    7.251   1.00 0.00 ? 1659 U   F O4    1 
ATOM 6615  C C5    . U   F 6  6   ? 78.478  1.273    7.218   1.00 0.00 ? 1659 U   F C5    1 
ATOM 6616  C C6    . U   F 6  6   ? 79.365  0.282    7.026   1.00 0.00 ? 1659 U   F C6    1 
ATOM 6617  P P     . C   F 6  7   ? 81.587  -1.548   1.982   1.00 0.00 ? 1660 C   F P     1 
ATOM 6618  O OP1   . C   F 6  7   ? 82.608  -2.036   1.028   1.00 0.00 ? 1660 C   F OP1   1 
ATOM 6619  O OP2   . C   F 6  7   ? 81.378  -0.083   2.055   1.00 0.00 ? 1660 C   F OP2   1 
ATOM 6620  O "O5'" . C   F 6  7   ? 80.202  -2.244   1.664   1.00 0.00 ? 1660 C   F "O5'" 1 
ATOM 6621  C "C5'" . C   F 6  7   ? 80.159  -3.664   1.465   1.00 0.00 ? 1660 C   F "C5'" 1 
ATOM 6622  C "C4'" . C   F 6  7   ? 78.737  -4.130   1.116   1.00 0.00 ? 1660 C   F "C4'" 1 
ATOM 6623  O "O4'" . C   F 6  7   ? 77.747  -3.619   2.054   1.00 0.00 ? 1660 C   F "O4'" 1 
ATOM 6624  C "C3'" . C   F 6  7   ? 78.261  -3.651   -0.270  1.00 0.00 ? 1660 C   F "C3'" 1 
ATOM 6625  O "O3'" . C   F 6  7   ? 77.494  -4.665   -0.934  1.00 0.00 ? 1660 C   F "O3'" 1 
ATOM 6626  C "C2'" . C   F 6  7   ? 77.430  -2.419   0.067   1.00 0.00 ? 1660 C   F "C2'" 1 
ATOM 6627  O "O2'" . C   F 6  7   ? 76.474  -2.116   -0.922  1.00 0.00 ? 1660 C   F "O2'" 1 
ATOM 6628  C "C1'" . C   F 6  7   ? 76.783  -2.848   1.358   1.00 0.00 ? 1660 C   F "C1'" 1 
ATOM 6629  N N1    . C   F 6  7   ? 76.278  -1.692   2.150   1.00 0.00 ? 1660 C   F N1    1 
ATOM 6630  C C2    . C   F 6  7   ? 74.909  -1.431   2.271   1.00 0.00 ? 1660 C   F C2    1 
ATOM 6631  O O2    . C   F 6  7   ? 74.095  -2.181   1.699   1.00 0.00 ? 1660 C   F O2    1 
ATOM 6632  N N3    . C   F 6  7   ? 74.512  -0.354   3.010   1.00 0.00 ? 1660 C   F N3    1 
ATOM 6633  C C4    . C   F 6  7   ? 75.417  0.518    3.538   1.00 0.00 ? 1660 C   F C4    1 
ATOM 6634  N N4    . C   F 6  7   ? 75.019  1.619    4.243   1.00 0.00 ? 1660 C   F N4    1 
ATOM 6635  C C5    . C   F 6  7   ? 76.822  0.287    3.344   1.00 0.00 ? 1660 C   F C5    1 
ATOM 6636  C C6    . C   F 6  7   ? 77.197  -0.801   2.655   1.00 0.00 ? 1660 C   F C6    1 
ATOM 6637  P P     . A   F 6  8   ? 78.141  -5.509   -2.108  1.00 0.00 ? 1661 A   F P     1 
ATOM 6638  O OP1   . A   F 6  8   ? 79.278  -6.290   -1.568  1.00 0.00 ? 1661 A   F OP1   1 
ATOM 6639  O OP2   . A   F 6  8   ? 78.403  -4.623   -3.265  1.00 0.00 ? 1661 A   F OP2   1 
ATOM 6640  O "O5'" . A   F 6  8   ? 76.947  -6.488   -2.454  1.00 0.00 ? 1661 A   F "O5'" 1 
ATOM 6641  C "C5'" . A   F 6  8   ? 77.159  -7.692   -3.205  1.00 0.00 ? 1661 A   F "C5'" 1 
ATOM 6642  C "C4'" . A   F 6  8   ? 76.454  -8.880   -2.532  1.00 0.00 ? 1661 A   F "C4'" 1 
ATOM 6643  O "O4'" . A   F 6  8   ? 77.030  -9.138   -1.229  1.00 0.00 ? 1661 A   F "O4'" 1 
ATOM 6644  C "C3'" . A   F 6  8   ? 74.955  -8.712   -2.245  1.00 0.00 ? 1661 A   F "C3'" 1 
ATOM 6645  O "O3'" . A   F 6  8   ? 74.206  -9.034   -3.419  1.00 0.00 ? 1661 A   F "O3'" 1 
ATOM 6646  C "C2'" . A   F 6  8   ? 74.735  -9.673   -1.091  1.00 0.00 ? 1661 A   F "C2'" 1 
ATOM 6647  O "O2'" . A   F 6  8   ? 74.632  -11.010  -1.521  1.00 0.00 ? 1661 A   F "O2'" 1 
ATOM 6648  C "C1'" . A   F 6  8   ? 76.006  -9.490   -0.303  1.00 0.00 ? 1661 A   F "C1'" 1 
ATOM 6649  N N9    . A   F 6  8   ? 75.850  -8.474   0.756   1.00 0.00 ? 1661 A   F N9    1 
ATOM 6650  C C8    . A   F 6  8   ? 76.520  -7.280   0.863   1.00 0.00 ? 1661 A   F C8    1 
ATOM 6651  N N7    . A   F 6  8   ? 76.194  -6.588   1.912   1.00 0.00 ? 1661 A   F N7    1 
ATOM 6652  C C5    . A   F 6  8   ? 75.271  -7.344   2.570   1.00 0.00 ? 1661 A   F C5    1 
ATOM 6653  C C6    . A   F 6  8   ? 74.628  -7.108   3.793   1.00 0.00 ? 1661 A   F C6    1 
ATOM 6654  N N6    . A   F 6  8   ? 74.886  -5.924   4.436   1.00 0.00 ? 1661 A   F N6    1 
ATOM 6655  N N1    . A   F 6  8   ? 73.779  -8.108   4.207   1.00 0.00 ? 1661 A   F N1    1 
ATOM 6656  C C2    . A   F 6  8   ? 73.628  -9.191   3.425   1.00 0.00 ? 1661 A   F C2    1 
ATOM 6657  N N3    . A   F 6  8   ? 74.196  -9.498   2.247   1.00 0.00 ? 1661 A   F N3    1 
ATOM 6658  C C4    . A   F 6  8   ? 75.033  -8.523   1.867   1.00 0.00 ? 1661 A   F C4    1 
ATOM 6659  P P     . A   F 6  9   ? 72.965  -8.158   -3.864  1.00 0.00 ? 1662 A   F P     1 
ATOM 6660  O OP1   . A   F 6  9   ? 72.506  -8.631   -5.188  1.00 0.00 ? 1662 A   F OP1   1 
ATOM 6661  O OP2   . A   F 6  9   ? 73.304  -6.723   -3.742  1.00 0.00 ? 1662 A   F OP2   1 
ATOM 6662  O "O5'" . A   F 6  9   ? 71.867  -8.513   -2.780  1.00 0.00 ? 1662 A   F "O5'" 1 
ATOM 6663  C "C5'" . A   F 6  9   ? 71.221  -9.793   -2.846  1.00 0.00 ? 1662 A   F "C5'" 1 
ATOM 6664  C "C4'" . A   F 6  9   ? 70.400  -10.050  -1.571  1.00 0.00 ? 1662 A   F "C4'" 1 
ATOM 6665  O "O4'" . A   F 6  9   ? 71.255  -9.933   -0.407  1.00 0.00 ? 1662 A   F "O4'" 1 
ATOM 6666  C "C3'" . A   F 6  9   ? 69.246  -9.079   -1.282  1.00 0.00 ? 1662 A   F "C3'" 1 
ATOM 6667  O "O3'" . A   F 6  9   ? 68.076  -9.477   -2.007  1.00 0.00 ? 1662 A   F "O3'" 1 
ATOM 6668  C "C2'" . A   F 6  9   ? 69.105  -9.185   0.228   1.00 0.00 ? 1662 A   F "C2'" 1 
ATOM 6669  O "O2'" . A   F 6  9   ? 68.384  -10.333  0.613   1.00 0.00 ? 1662 A   F "O2'" 1 
ATOM 6670  C "C1'" . A   F 6  9   ? 70.545  -9.326   0.662   1.00 0.00 ? 1662 A   F "C1'" 1 
ATOM 6671  N N9    . A   F 6  9   ? 71.121  -8.030   1.058   1.00 0.00 ? 1662 A   F N9    1 
ATOM 6672  C C8    . A   F 6  9   ? 71.820  -7.125   0.290   1.00 0.00 ? 1662 A   F C8    1 
ATOM 6673  N N7    . A   F 6  9   ? 72.182  -6.057   0.942   1.00 0.00 ? 1662 A   F N7    1 
ATOM 6674  C C5    . A   F 6  9   ? 71.693  -6.228   2.202   1.00 0.00 ? 1662 A   F C5    1 
ATOM 6675  C C6    . A   F 6  9   ? 71.753  -5.372   3.325   1.00 0.00 ? 1662 A   F C6    1 
ATOM 6676  N N6    . A   F 6  9   ? 72.361  -4.149   3.199   1.00 0.00 ? 1662 A   F N6    1 
ATOM 6677  N N1    . A   F 6  9   ? 71.181  -5.885   4.467   1.00 0.00 ? 1662 A   F N1    1 
ATOM 6678  C C2    . A   F 6  9   ? 70.604  -7.092   4.420   1.00 0.00 ? 1662 A   F C2    1 
ATOM 6679  N N3    . A   F 6  9   ? 70.449  -7.941   3.401   1.00 0.00 ? 1662 A   F N3    1 
ATOM 6680  C C4    . A   F 6  9   ? 71.028  -7.451   2.298   1.00 0.00 ? 1662 A   F C4    1 
ATOM 6681  P P     . C   F 6  10  ? 67.156  -8.376   -2.685  1.00 0.00 ? 1663 C   F P     1 
ATOM 6682  O OP1   . C   F 6  10  ? 66.069  -9.050   -3.432  1.00 0.00 ? 1663 C   F OP1   1 
ATOM 6683  O OP2   . C   F 6  10  ? 68.015  -7.442   -3.445  1.00 0.00 ? 1663 C   F OP2   1 
ATOM 6684  O "O5'" . C   F 6  10  ? 66.539  -7.605   -1.449  1.00 0.00 ? 1663 C   F "O5'" 1 
ATOM 6685  C "C5'" . C   F 6  10  ? 65.518  -8.217   -0.650  1.00 0.00 ? 1663 C   F "C5'" 1 
ATOM 6686  C "C4'" . C   F 6  10  ? 65.235  -7.367   0.599   1.00 0.00 ? 1663 C   F "C4'" 1 
ATOM 6687  O "O4'" . C   F 6  10  ? 66.421  -7.233   1.424   1.00 0.00 ? 1663 C   F "O4'" 1 
ATOM 6688  C "C3'" . C   F 6  10  ? 64.821  -5.915   0.338   1.00 0.00 ? 1663 C   F "C3'" 1 
ATOM 6689  O "O3'" . C   F 6  10  ? 63.432  -5.865   -0.013  1.00 0.00 ? 1663 C   F "O3'" 1 
ATOM 6690  C "C2'" . C   F 6  10  ? 65.159  -5.239   1.655   1.00 0.00 ? 1663 C   F "C2'" 1 
ATOM 6691  O "O2'" . C   F 6  10  ? 64.189  -5.494   2.644   1.00 0.00 ? 1663 C   F "O2'" 1 
ATOM 6692  C "C1'" . C   F 6  10  ? 66.452  -5.935   2.015   1.00 0.00 ? 1663 C   F "C1'" 1 
ATOM 6693  N N1    . C   F 6  10  ? 67.646  -5.122   1.630   1.00 0.00 ? 1663 C   F N1    1 
ATOM 6694  C C2    . C   F 6  10  ? 68.104  -4.090   2.460   1.00 0.00 ? 1663 C   F C2    1 
ATOM 6695  O O2    . C   F 6  10  ? 67.513  -3.865   3.532   1.00 0.00 ? 1663 C   F O2    1 
ATOM 6696  N N3    . C   F 6  10  ? 69.200  -3.374   2.066   1.00 0.00 ? 1663 C   F N3    1 
ATOM 6697  C C4    . C   F 6  10  ? 69.828  -3.626   0.882   1.00 0.00 ? 1663 C   F C4    1 
ATOM 6698  N N4    . C   F 6  10  ? 70.951  -2.949   0.500   1.00 0.00 ? 1663 C   F N4    1 
ATOM 6699  C C5    . C   F 6  10  ? 69.316  -4.639   0.009   1.00 0.00 ? 1663 C   F C5    1 
ATOM 6700  C C6    . C   F 6  10  ? 68.248  -5.339   0.412   1.00 0.00 ? 1663 C   F C6    1 
ATOM 6701  P P     . A   F 6  11  ? 62.974  -4.929   -1.208  1.00 0.00 ? 1664 A   F P     1 
ATOM 6702  O OP1   . A   F 6  11  ? 61.547  -5.189   -1.504  1.00 0.00 ? 1664 A   F OP1   1 
ATOM 6703  O OP2   . A   F 6  11  ? 63.931  -5.065   -2.330  1.00 0.00 ? 1664 A   F OP2   1 
ATOM 6704  O "O5'" . A   F 6  11  ? 63.121  -3.477   -0.584  1.00 0.00 ? 1664 A   F "O5'" 1 
ATOM 6705  C "C5'" . A   F 6  11  ? 62.219  -3.113   0.476   1.00 0.00 ? 1664 A   F "C5'" 1 
ATOM 6706  C "C4'" . A   F 6  11  ? 62.489  -1.685   0.966   1.00 0.00 ? 1664 A   F "C4'" 1 
ATOM 6707  O "O4'" . A   F 6  11  ? 63.871  -1.514   1.377   1.00 0.00 ? 1664 A   F "O4'" 1 
ATOM 6708  C "C3'" . A   F 6  11  ? 62.253  -0.603   -0.109  1.00 0.00 ? 1664 A   F "C3'" 1 
ATOM 6709  O "O3'" . A   F 6  11  ? 61.615  0.556    0.439   1.00 0.00 ? 1664 A   F "O3'" 1 
ATOM 6710  C "C2'" . A   F 6  11  ? 63.664  -0.301   -0.592  1.00 0.00 ? 1664 A   F "C2'" 1 
ATOM 6711  O "O2'" . A   F 6  11  ? 63.798  0.983    -1.156  1.00 0.00 ? 1664 A   F "O2'" 1 
ATOM 6712  C "C1'" . A   F 6  11  ? 64.417  -0.411   0.695   1.00 0.00 ? 1664 A   F "C1'" 1 
ATOM 6713  N N9    . A   F 6  11  ? 65.857  -0.551   0.480   1.00 0.00 ? 1664 A   F N9    1 
ATOM 6714  C C8    . A   F 6  11  ? 66.524  -1.408   -0.362  1.00 0.00 ? 1664 A   F C8    1 
ATOM 6715  N N7    . A   F 6  11  ? 67.819  -1.241   -0.341  1.00 0.00 ? 1664 A   F N7    1 
ATOM 6716  C C5    . A   F 6  11  ? 68.038  -0.219   0.545   1.00 0.00 ? 1664 A   F C5    1 
ATOM 6717  C C6    . A   F 6  11  ? 69.227  0.444    0.903   1.00 0.00 ? 1664 A   F C6    1 
ATOM 6718  N N6    . A   F 6  11  ? 70.403  0.070    0.314   1.00 0.00 ? 1664 A   F N6    1 
ATOM 6719  N N1    . A   F 6  11  ? 69.073  1.484    1.788   1.00 0.00 ? 1664 A   F N1    1 
ATOM 6720  C C2    . A   F 6  11  ? 67.841  1.788    2.222   1.00 0.00 ? 1664 A   F C2    1 
ATOM 6721  N N3    . A   F 6  11  ? 66.662  1.225    1.934   1.00 0.00 ? 1664 A   F N3    1 
ATOM 6722  C C4    . A   F 6  11  ? 66.827  0.218    1.068   1.00 0.00 ? 1664 A   F C4    1 
ATOM 6723  P P     . G   F 6  12  ? 60.067  0.818    0.243   1.00 0.00 ? 1665 G   F P     1 
ATOM 6724  O OP1   . G   F 6  12  ? 59.781  2.233    0.570   1.00 0.00 ? 1665 G   F OP1   1 
ATOM 6725  O OP2   . G   F 6  12  ? 59.314  -0.215   0.989   1.00 0.00 ? 1665 G   F OP2   1 
ATOM 6726  O "O5'" . G   F 6  12  ? 59.811  0.599    -1.299  1.00 0.00 ? 1665 G   F "O5'" 1 
ATOM 6727  C "C5'" . G   F 6  12  ? 60.475  1.371    -2.307  1.00 0.00 ? 1665 G   F "C5'" 1 
ATOM 6728  C "C4'" . G   F 6  12  ? 61.031  0.445    -3.407  1.00 0.00 ? 1665 G   F "C4'" 1 
ATOM 6729  O "O4'" . G   F 6  12  ? 60.093  -0.610   -3.742  1.00 0.00 ? 1665 G   F "O4'" 1 
ATOM 6730  C "C3'" . G   F 6  12  ? 61.214  1.184    -4.747  1.00 0.00 ? 1665 G   F "C3'" 1 
ATOM 6731  O "O3'" . G   F 6  12  ? 62.204  0.604    -5.612  1.00 0.00 ? 1665 G   F "O3'" 1 
ATOM 6732  C "C2'" . G   F 6  12  ? 59.804  1.107    -5.318  1.00 0.00 ? 1665 G   F "C2'" 1 
ATOM 6733  O "O2'" . G   F 6  12  ? 59.783  1.281    -6.714  1.00 0.00 ? 1665 G   F "O2'" 1 
ATOM 6734  C "C1'" . G   F 6  12  ? 59.407  -0.294   -4.935  1.00 0.00 ? 1665 G   F "C1'" 1 
ATOM 6735  N N9    . G   F 6  12  ? 57.948  -0.442   -4.783  1.00 0.00 ? 1665 G   F N9    1 
ATOM 6736  C C8    . G   F 6  12  ? 57.181  -0.078   -3.696  1.00 0.00 ? 1665 G   F C8    1 
ATOM 6737  N N7    . G   F 6  12  ? 55.911  -0.333   -3.858  1.00 0.00 ? 1665 G   F N7    1 
ATOM 6738  C C5    . G   F 6  12  ? 55.823  -0.884   -5.113  1.00 0.00 ? 1665 G   F C5    1 
ATOM 6739  C C6    . G   F 6  12  ? 54.673  -1.320   -5.802  1.00 0.00 ? 1665 G   F C6    1 
ATOM 6740  O O6    . G   F 6  12  ? 53.525  -1.284   -5.348  1.00 0.00 ? 1665 G   F O6    1 
ATOM 6741  N N1    . G   F 6  12  ? 55.022  -1.790   -7.090  1.00 0.00 ? 1665 G   F N1    1 
ATOM 6742  C C2    . G   F 6  12  ? 56.317  -1.850   -7.630  1.00 0.00 ? 1665 G   F C2    1 
ATOM 6743  N N2    . G   F 6  12  ? 56.409  -2.353   -8.895  1.00 0.00 ? 1665 G   F N2    1 
ATOM 6744  N N3    . G   F 6  12  ? 57.398  -1.426   -6.929  1.00 0.00 ? 1665 G   F N3    1 
ATOM 6745  C C4    . G   F 6  12  ? 57.075  -0.961   -5.707  1.00 0.00 ? 1665 G   F C4    1 
ATOM 6746  P P     . C   F 6  13  ? 63.689  0.351    -5.130  1.00 0.00 ? 1666 C   F P     1 
ATOM 6747  O OP1   . C   F 6  13  ? 63.817  -1.038   -4.638  1.00 0.00 ? 1666 C   F OP1   1 
ATOM 6748  O OP2   . C   F 6  13  ? 64.089  1.437    -4.208  1.00 0.00 ? 1666 C   F OP2   1 
ATOM 6749  O "O5'" . C   F 6  13  ? 64.534  0.499    -6.450  1.00 0.00 ? 1666 C   F "O5'" 1 
ATOM 6750  C "C5'" . C   F 6  13  ? 64.199  -0.112   -7.696  1.00 0.00 ? 1666 C   F "C5'" 1 
ATOM 6751  C "C4'" . C   F 6  13  ? 64.626  0.815    -8.840  1.00 0.00 ? 1666 C   F "C4'" 1 
ATOM 6752  O "O4'" . C   F 6  13  ? 63.863  2.047    -8.800  1.00 0.00 ? 1666 C   F "O4'" 1 
ATOM 6753  C "C3'" . C   F 6  13  ? 66.084  1.296    -8.798  1.00 0.00 ? 1666 C   F "C3'" 1 
ATOM 6754  O "O3'" . C   F 6  13  ? 66.942  0.288    -9.350  1.00 0.00 ? 1666 C   F "O3'" 1 
ATOM 6755  C "C2'" . C   F 6  13  ? 66.023  2.573    -9.617  1.00 0.00 ? 1666 C   F "C2'" 1 
ATOM 6756  O "O2'" . C   F 6  13  ? 65.999  2.307    -11.001 1.00 0.00 ? 1666 C   F "O2'" 1 
ATOM 6757  C "C1'" . C   F 6  13  ? 64.691  3.143    -9.179  1.00 0.00 ? 1666 C   F "C1'" 1 
ATOM 6758  N N1    . C   F 6  13  ? 64.839  4.196    -8.121  1.00 0.00 ? 1666 C   F N1    1 
ATOM 6759  C C2    . C   F 6  13  ? 65.267  5.485    -8.460  1.00 0.00 ? 1666 C   F C2    1 
ATOM 6760  O O2    . C   F 6  13  ? 65.527  5.741    -9.651  1.00 0.00 ? 1666 C   F O2    1 
ATOM 6761  N N3    . C   F 6  13  ? 65.371  6.426    -7.471  1.00 0.00 ? 1666 C   F N3    1 
ATOM 6762  C C4    . C   F 6  13  ? 65.082  6.126    -6.172  1.00 0.00 ? 1666 C   F C4    1 
ATOM 6763  N N4    . C   F 6  13  ? 65.132  7.073    -5.188  1.00 0.00 ? 1666 C   F N4    1 
ATOM 6764  C C5    . C   F 6  13  ? 64.693  4.790    -5.822  1.00 0.00 ? 1666 C   F C5    1 
ATOM 6765  C C6    . C   F 6  13  ? 64.594  3.884    -6.802  1.00 0.00 ? 1666 C   F C6    1 
ATOM 6766  P P     . A   F 6  14  ? 68.060  -0.379   -8.444  1.00 0.00 ? 1667 A   F P     1 
ATOM 6767  O OP1   . A   F 6  14  ? 68.698  -1.481   -9.196  1.00 0.00 ? 1667 A   F OP1   1 
ATOM 6768  O OP2   . A   F 6  14  ? 67.481  -0.712   -7.121  1.00 0.00 ? 1667 A   F OP2   1 
ATOM 6769  O "O5'" . A   F 6  14  ? 69.111  0.779    -8.244  1.00 0.00 ? 1667 A   F "O5'" 1 
ATOM 6770  C "C5'" . A   F 6  14  ? 69.711  1.484    -9.334  1.00 0.00 ? 1667 A   F "C5'" 1 
ATOM 6771  C "C4'" . A   F 6  14  ? 70.236  2.837    -8.842  1.00 0.00 ? 1667 A   F "C4'" 1 
ATOM 6772  O "O4'" . A   F 6  14  ? 69.158  3.611    -8.276  1.00 0.00 ? 1667 A   F "O4'" 1 
ATOM 6773  C "C3'" . A   F 6  14  ? 71.298  2.739    -7.736  1.00 0.00 ? 1667 A   F "C3'" 1 
ATOM 6774  O "O3'" . A   F 6  14  ? 72.558  2.617    -8.378  1.00 0.00 ? 1667 A   F "O3'" 1 
ATOM 6775  C "C2'" . A   F 6  14  ? 71.058  4.011    -6.918  1.00 0.00 ? 1667 A   F "C2'" 1 
ATOM 6776  O "O2'" . A   F 6  14  ? 71.763  5.111    -7.443  1.00 0.00 ? 1667 A   F "O2'" 1 
ATOM 6777  C "C1'" . A   F 6  14  ? 69.573  4.249    -7.092  1.00 0.00 ? 1667 A   F "C1'" 1 
ATOM 6778  N N9    . A   F 6  14  ? 68.743  3.835    -5.941  1.00 0.00 ? 1667 A   F N9    1 
ATOM 6779  C C8    . A   F 6  14  ? 68.172  2.609    -5.684  1.00 0.00 ? 1667 A   F C8    1 
ATOM 6780  N N7    . A   F 6  14  ? 67.392  2.602    -4.642  1.00 0.00 ? 1667 A   F N7    1 
ATOM 6781  C C5    . A   F 6  14  ? 67.423  3.878    -4.161  1.00 0.00 ? 1667 A   F C5    1 
ATOM 6782  C C6    . A   F 6  14  ? 66.728  4.456    -3.084  1.00 0.00 ? 1667 A   F C6    1 
ATOM 6783  N N6    . A   F 6  14  ? 65.814  3.700    -2.394  1.00 0.00 ? 1667 A   F N6    1 
ATOM 6784  N N1    . A   F 6  14  ? 67.046  5.769    -2.828  1.00 0.00 ? 1667 A   F N1    1 
ATOM 6785  C C2    . A   F 6  14  ? 67.946  6.382    -3.616  1.00 0.00 ? 1667 A   F C2    1 
ATOM 6786  N N3    . A   F 6  14  ? 68.588  5.936    -4.707  1.00 0.00 ? 1667 A   F N3    1 
ATOM 6787  C C4    . A   F 6  14  ? 68.279  4.655    -4.937  1.00 0.00 ? 1667 A   F C4    1 
ATOM 6788  P P     . G   F 6  15  ? 74.013  2.415    -7.817  1.00 0.00 ? 1668 G   F P     1 
ATOM 6789  O OP1   . G   F 6  15  ? 74.908  3.279    -8.617  1.00 0.00 ? 1668 G   F OP1   1 
ATOM 6790  O OP2   . G   F 6  15  ? 74.320  0.967    -7.807  1.00 0.00 ? 1668 G   F OP2   1 
ATOM 6791  O "O5'" . G   F 6  15  ? 73.980  2.938    -6.321  1.00 0.00 ? 1668 G   F "O5'" 1 
ATOM 6792  C "C5'" . G   F 6  15  ? 75.192  3.483    -5.752  1.00 0.00 ? 1668 G   F "C5'" 1 
ATOM 6793  C "C4'" . G   F 6  15  ? 74.921  4.436    -4.566  1.00 0.00 ? 1668 G   F "C4'" 1 
ATOM 6794  O "O4'" . G   F 6  15  ? 73.548  4.917    -4.550  1.00 0.00 ? 1668 G   F "O4'" 1 
ATOM 6795  C "C3'" . G   F 6  15  ? 75.126  3.837    -3.168  1.00 0.00 ? 1668 G   F "C3'" 1 
ATOM 6796  O "O3'" . G   F 6  15  ? 76.523  3.841    -2.855  1.00 0.00 ? 1668 G   F "O3'" 1 
ATOM 6797  C "C2'" . G   F 6  15  ? 74.252  4.753    -2.317  1.00 0.00 ? 1668 G   F "C2'" 1 
ATOM 6798  O "O2'" . G   F 6  15  ? 74.862  6.005    -2.099  1.00 0.00 ? 1668 G   F "O2'" 1 
ATOM 6799  C "C1'" . G   F 6  15  ? 73.070  4.958    -3.222  1.00 0.00 ? 1668 G   F "C1'" 1 
ATOM 6800  N N9    . G   F 6  15  ? 72.002  3.962    -2.977  1.00 0.00 ? 1668 G   F N9    1 
ATOM 6801  C C8    . G   F 6  15  ? 71.853  2.710    -3.538  1.00 0.00 ? 1668 G   F C8    1 
ATOM 6802  N N7    . G   F 6  15  ? 70.788  2.084    -3.119  1.00 0.00 ? 1668 G   F N7    1 
ATOM 6803  C C5    . G   F 6  15  ? 70.206  2.951    -2.228  1.00 0.00 ? 1668 G   F C5    1 
ATOM 6804  C C6    . G   F 6  15  ? 69.016  2.787    -1.496  1.00 0.00 ? 1668 G   F C6    1 
ATOM 6805  O O6    . G   F 6  15  ? 68.286  1.797    -1.584  1.00 0.00 ? 1668 G   F O6    1 
ATOM 6806  N N1    . G   F 6  15  ? 68.794  3.904    -0.653  1.00 0.00 ? 1668 G   F N1    1 
ATOM 6807  C C2    . G   F 6  15  ? 69.595  5.057    -0.587  1.00 0.00 ? 1668 G   F C2    1 
ATOM 6808  N N2    . G   F 6  15  ? 69.164  6.042    0.252   1.00 0.00 ? 1668 G   F N2    1 
ATOM 6809  N N3    . G   F 6  15  ? 70.717  5.187    -1.335  1.00 0.00 ? 1668 G   F N3    1 
ATOM 6810  C C4    . G   F 6  15  ? 70.950  4.113    -2.110  1.00 0.00 ? 1668 G   F C4    1 
ATOM 6811  P P     . U   F 6  16  ? 77.047  3.333    -1.447  1.00 0.00 ? 1669 U   F P     1 
ATOM 6812  O OP1   . U   F 6  16  ? 78.447  2.881    -1.608  1.00 0.00 ? 1669 U   F OP1   1 
ATOM 6813  O OP2   . U   F 6  16  ? 76.083  2.366    -0.874  1.00 0.00 ? 1669 U   F OP2   1 
ATOM 6814  O "O5'" . U   F 6  16  ? 77.043  4.667    -0.590  1.00 0.00 ? 1669 U   F "O5'" 1 
ATOM 6815  C "C5'" . U   F 6  16  ? 77.616  4.705    0.723   1.00 0.00 ? 1669 U   F "C5'" 1 
ATOM 6816  C "C4'" . U   F 6  16  ? 78.315  6.046    1.014   1.00 0.00 ? 1669 U   F "C4'" 1 
ATOM 6817  O "O4'" . U   F 6  16  ? 79.294  6.382    -0.001  1.00 0.00 ? 1669 U   F "O4'" 1 
ATOM 6818  C "C3'" . U   F 6  16  ? 77.378  7.268    1.072   1.00 0.00 ? 1669 U   F "C3'" 1 
ATOM 6819  O "O3'" . U   F 6  16  ? 77.807  8.217    2.054   1.00 0.00 ? 1669 U   F "O3'" 1 
ATOM 6820  C "C2'" . U   F 6  16  ? 77.482  7.823    -0.343  1.00 0.00 ? 1669 U   F "C2'" 1 
ATOM 6821  O "O2'" . U   F 6  16  ? 77.129  9.185    -0.415  1.00 0.00 ? 1669 U   F "O2'" 1 
ATOM 6822  C "C1'" . U   F 6  16  ? 78.943  7.603    -0.636  1.00 0.00 ? 1669 U   F "C1'" 1 
ATOM 6823  N N1    . U   F 6  16  ? 79.232  7.596    -2.101  1.00 0.00 ? 1669 U   F N1    1 
ATOM 6824  C C2    . U   F 6  16  ? 79.648  8.773    -2.711  1.00 0.00 ? 1669 U   F C2    1 
ATOM 6825  O O2    . U   F 6  16  ? 79.789  9.822    -2.082  1.00 0.00 ? 1669 U   F O2    1 
ATOM 6826  N N3    . U   F 6  16  ? 79.888  8.666    -4.087  1.00 0.00 ? 1669 U   F N3    1 
ATOM 6827  C C4    . U   F 6  16  ? 79.732  7.518    -4.887  1.00 0.00 ? 1669 U   F C4    1 
ATOM 6828  O O4    . U   F 6  16  ? 79.985  7.538    -6.093  1.00 0.00 ? 1669 U   F O4    1 
ATOM 6829  C C5    . U   F 6  16  ? 79.264  6.363    -4.160  1.00 0.00 ? 1669 U   F C5    1 
ATOM 6830  C C6    . U   F 6  16  ? 79.031  6.448    -2.840  1.00 0.00 ? 1669 U   F C6    1 
ATOM 6831  P P     . U   F 6  17  ? 77.389  8.089    3.575   1.00 0.00 ? 1670 U   F P     1 
ATOM 6832  O OP1   . U   F 6  17  ? 77.539  9.419    4.208   1.00 0.00 ? 1670 U   F OP1   1 
ATOM 6833  O OP2   . U   F 6  17  ? 78.137  6.970    4.190   1.00 0.00 ? 1670 U   F OP2   1 
ATOM 6834  O "O5'" . U   F 6  17  ? 75.854  7.689    3.517   1.00 0.00 ? 1670 U   F "O5'" 1 
ATOM 6835  C "C5'" . U   F 6  17  ? 74.873  8.728    3.615   1.00 0.00 ? 1670 U   F "C5'" 1 
ATOM 6836  C "C4'" . U   F 6  17  ? 73.468  8.121    3.683   1.00 0.00 ? 1670 U   F "C4'" 1 
ATOM 6837  O "O4'" . U   F 6  17  ? 73.119  7.443    2.452   1.00 0.00 ? 1670 U   F "O4'" 1 
ATOM 6838  C "C3'" . U   F 6  17  ? 73.237  7.040    4.740   1.00 0.00 ? 1670 U   F "C3'" 1 
ATOM 6839  O "O3'" . U   F 6  17  ? 73.162  7.645    6.033   1.00 0.00 ? 1670 U   F "O3'" 1 
ATOM 6840  C "C2'" . U   F 6  17  ? 71.936  6.436    4.238   1.00 0.00 ? 1670 U   F "C2'" 1 
ATOM 6841  O "O2'" . U   F 6  17  ? 70.831  7.255    4.543   1.00 0.00 ? 1670 U   F "O2'" 1 
ATOM 6842  C "C1'" . U   F 6  17  ? 72.158  6.428    2.739   1.00 0.00 ? 1670 U   F "C1'" 1 
ATOM 6843  N N1    . U   F 6  17  ? 72.529  5.067    2.239   1.00 0.00 ? 1670 U   F N1    1 
ATOM 6844  C C2    . U   F 6  17  ? 71.521  4.109    2.174   1.00 0.00 ? 1670 U   F C2    1 
ATOM 6845  O O2    . U   F 6  17  ? 70.369  4.343    2.537   1.00 0.00 ? 1670 U   F O2    1 
ATOM 6846  N N3    . U   F 6  17  ? 71.920  2.871    1.661   1.00 0.00 ? 1670 U   F N3    1 
ATOM 6847  C C4    . U   F 6  17  ? 73.203  2.512    1.224   1.00 0.00 ? 1670 U   F C4    1 
ATOM 6848  O O4    . U   F 6  17  ? 73.416  1.419    0.694   1.00 0.00 ? 1670 U   F O4    1 
ATOM 6849  C C5    . U   F 6  17  ? 74.195  3.532    1.448   1.00 0.00 ? 1670 U   F C5    1 
ATOM 6850  C C6    . U   F 6  17  ? 73.834  4.735    1.929   1.00 0.00 ? 1670 U   F C6    1 
ATOM 6851  P P     . G   F 6  18  ? 73.390  6.755    7.327   1.00 0.00 ? 1671 G   F P     1 
ATOM 6852  O OP1   . G   F 6  18  ? 73.436  7.653    8.502   1.00 0.00 ? 1671 G   F OP1   1 
ATOM 6853  O OP2   . G   F 6  18  ? 74.556  5.869    7.114   1.00 0.00 ? 1671 G   F OP2   1 
ATOM 6854  O "O5'" . G   F 6  18  ? 72.092  5.855    7.409   1.00 0.00 ? 1671 G   F "O5'" 1 
ATOM 6855  C "C5'" . G   F 6  18  ? 70.855  6.439    7.836   1.00 0.00 ? 1671 G   F "C5'" 1 
ATOM 6856  C "C4'" . G   F 6  18  ? 69.732  5.404    7.718   1.00 0.00 ? 1671 G   F "C4'" 1 
ATOM 6857  O "O4'" . G   F 6  18  ? 69.620  4.912    6.358   1.00 0.00 ? 1671 G   F "O4'" 1 
ATOM 6858  C "C3'" . G   F 6  18  ? 69.866  4.113    8.531   1.00 0.00 ? 1671 G   F "C3'" 1 
ATOM 6859  O "O3'" . G   F 6  18  ? 69.595  4.371    9.915   1.00 0.00 ? 1671 G   F "O3'" 1 
ATOM 6860  C "C2'" . G   F 6  18  ? 68.838  3.241    7.822   1.00 0.00 ? 1671 G   F "C2'" 1 
ATOM 6861  O "O2'" . G   F 6  18  ? 67.519  3.608    8.154   1.00 0.00 ? 1671 G   F "O2'" 1 
ATOM 6862  C "C1'" . G   F 6  18  ? 69.092  3.597    6.378   1.00 0.00 ? 1671 G   F "C1'" 1 
ATOM 6863  N N9    . G   F 6  18  ? 69.969  2.599    5.725   1.00 0.00 ? 1671 G   F N9    1 
ATOM 6864  C C8    . G   F 6  18  ? 71.323  2.664    5.472   1.00 0.00 ? 1671 G   F C8    1 
ATOM 6865  N N7    . G   F 6  18  ? 71.782  1.594    4.876   1.00 0.00 ? 1671 G   F N7    1 
ATOM 6866  C C5    . G   F 6  18  ? 70.689  0.774    4.737   1.00 0.00 ? 1671 G   F C5    1 
ATOM 6867  C C6    . G   F 6  18  ? 70.613  -0.497   4.132   1.00 0.00 ? 1671 G   F C6    1 
ATOM 6868  O O6    . G   F 6  18  ? 71.566  -1.090   3.621   1.00 0.00 ? 1671 G   F O6    1 
ATOM 6869  N N1    . G   F 6  18  ? 69.292  -0.998   4.195   1.00 0.00 ? 1671 G   F N1    1 
ATOM 6870  C C2    . G   F 6  18  ? 68.187  -0.344   4.768   1.00 0.00 ? 1671 G   F C2    1 
ATOM 6871  N N2    . G   F 6  18  ? 66.999  -1.010   4.700   1.00 0.00 ? 1671 G   F N2    1 
ATOM 6872  N N3    . G   F 6  18  ? 68.304  0.880    5.340   1.00 0.00 ? 1671 G   F N3    1 
ATOM 6873  C C4    . G   F 6  18  ? 69.557  1.368    5.271   1.00 0.00 ? 1671 G   F C4    1 
ATOM 6874  P P     . G   F 6  19  ? 69.754  3.176    10.952  1.00 0.00 ? 1672 G   F P     1 
ATOM 6875  O OP1   . G   F 6  19  ? 70.079  3.747    12.278  1.00 0.00 ? 1672 G   F OP1   1 
ATOM 6876  O OP2   . G   F 6  19  ? 70.687  2.160    10.412  1.00 0.00 ? 1672 G   F OP2   1 
ATOM 6877  O "O5'" . G   F 6  19  ? 68.284  2.564    11.007  1.00 0.00 ? 1672 G   F "O5'" 1 
ATOM 6878  C "C5'" . G   F 6  19  ? 68.003  1.731    12.143  1.00 0.00 ? 1672 G   F "C5'" 1 
ATOM 6879  C "C4'" . G   F 6  19  ? 66.625  1.067    12.040  1.00 0.00 ? 1672 G   F "C4'" 1 
ATOM 6880  O "O4'" . G   F 6  19  ? 65.550  2.029    11.870  1.00 0.00 ? 1672 G   F "O4'" 1 
ATOM 6881  C "C3'" . G   F 6  19  ? 66.465  0.074    10.877  1.00 0.00 ? 1672 G   F "C3'" 1 
ATOM 6882  O "O3'" . G   F 6  19  ? 65.843  -1.138   11.335  1.00 0.00 ? 1672 G   F "O3'" 1 
ATOM 6883  C "C2'" . G   F 6  19  ? 65.594  0.843    9.886   1.00 0.00 ? 1672 G   F "C2'" 1 
ATOM 6884  O "O2'" . G   F 6  19  ? 64.864  -0.012   9.038   1.00 0.00 ? 1672 G   F "O2'" 1 
ATOM 6885  C "C1'" . G   F 6  19  ? 64.701  1.592    10.830  1.00 0.00 ? 1672 G   F "C1'" 1 
ATOM 6886  N N9    . G   F 6  19  ? 63.987  2.714    10.188  1.00 0.00 ? 1672 G   F N9    1 
ATOM 6887  C C8    . G   F 6  19  ? 64.550  3.829    9.612   1.00 0.00 ? 1672 G   F C8    1 
ATOM 6888  N N7    . G   F 6  19  ? 63.668  4.660    9.127   1.00 0.00 ? 1672 G   F N7    1 
ATOM 6889  C C5    . G   F 6  19  ? 62.455  4.074    9.392   1.00 0.00 ? 1672 G   F C5    1 
ATOM 6890  C C6    . G   F 6  19  ? 61.162  4.550    9.081   1.00 0.00 ? 1672 G   F C6    1 
ATOM 6891  O O6    . G   F 6  19  ? 60.928  5.610    8.492   1.00 0.00 ? 1672 G   F O6    1 
ATOM 6892  N N1    . G   F 6  19  ? 60.178  3.640    9.543   1.00 0.00 ? 1672 G   F N1    1 
ATOM 6893  C C2    . G   F 6  19  ? 60.424  2.429    10.215  1.00 0.00 ? 1672 G   F C2    1 
ATOM 6894  N N2    . G   F 6  19  ? 59.320  1.711    10.574  1.00 0.00 ? 1672 G   F N2    1 
ATOM 6895  N N3    . G   F 6  19  ? 61.686  2.008    10.488  1.00 0.00 ? 1672 G   F N3    1 
ATOM 6896  C C4    . G   F 6  19  ? 62.626  2.867    10.054  1.00 0.00 ? 1672 G   F C4    1 
ATOM 6897  P P     . A   F 6  20  ? 66.771  -2.365   11.699  1.00 0.00 ? 1673 A   F P     1 
ATOM 6898  O OP1   . A   F 6  20  ? 65.947  -3.420   12.331  1.00 0.00 ? 1673 A   F OP1   1 
ATOM 6899  O OP2   . A   F 6  20  ? 67.954  -1.890   12.454  1.00 0.00 ? 1673 A   F OP2   1 
ATOM 6900  O "O5'" . A   F 6  20  ? 67.249  -2.850   10.272  1.00 0.00 ? 1673 A   F "O5'" 1 
ATOM 6901  C "C5'" . A   F 6  20  ? 66.334  -3.574   9.447   1.00 0.00 ? 1673 A   F "C5'" 1 
ATOM 6902  C "C4'" . A   F 6  20  ? 67.076  -4.126   8.239   1.00 0.00 ? 1673 A   F "C4'" 1 
ATOM 6903  O "O4'" . A   F 6  20  ? 67.547  -3.042   7.399   1.00 0.00 ? 1673 A   F "O4'" 1 
ATOM 6904  C "C3'" . A   F 6  20  ? 68.354  -4.923   8.564   1.00 0.00 ? 1673 A   F "C3'" 1 
ATOM 6905  O "O3'" . A   F 6  20  ? 67.978  -6.257   8.892   1.00 0.00 ? 1673 A   F "O3'" 1 
ATOM 6906  C "C2'" . A   F 6  20  ? 69.123  -4.786   7.263   1.00 0.00 ? 1673 A   F "C2'" 1 
ATOM 6907  O "O2'" . A   F 6  20  ? 68.569  -5.635   6.283   1.00 0.00 ? 1673 A   F "O2'" 1 
ATOM 6908  C "C1'" . A   F 6  20  ? 68.837  -3.341   6.898   1.00 0.00 ? 1673 A   F "C1'" 1 
ATOM 6909  N N9    . A   F 6  20  ? 69.854  -2.373   7.395   1.00 0.00 ? 1673 A   F N9    1 
ATOM 6910  C C8    . A   F 6  20  ? 69.649  -1.282   8.218   1.00 0.00 ? 1673 A   F C8    1 
ATOM 6911  N N7    . A   F 6  20  ? 70.712  -0.550   8.400   1.00 0.00 ? 1673 A   F N7    1 
ATOM 6912  C C5    . A   F 6  20  ? 71.688  -1.140   7.653   1.00 0.00 ? 1673 A   F C5    1 
ATOM 6913  C C6    . A   F 6  20  ? 73.015  -0.736   7.409   1.00 0.00 ? 1673 A   F C6    1 
ATOM 6914  N N6    . A   F 6  20  ? 73.515  0.402    7.986   1.00 0.00 ? 1673 A   F N6    1 
ATOM 6915  N N1    . A   F 6  20  ? 73.724  -1.550   6.558   1.00 0.00 ? 1673 A   F N1    1 
ATOM 6916  C C2    . A   F 6  20  ? 73.116  -2.628   6.041   1.00 0.00 ? 1673 A   F C2    1 
ATOM 6917  N N3    . A   F 6  20  ? 71.867  -3.084   6.208   1.00 0.00 ? 1673 A   F N3    1 
ATOM 6918  C C4    . A   F 6  20  ? 71.181  -2.283   7.029   1.00 0.00 ? 1673 A   F C4    1 
ATOM 6919  P P     . C   F 6  21  ? 68.766  -7.098   9.973   1.00 0.00 ? 1674 C   F P     1 
ATOM 6920  O OP1   . C   F 6  21  ? 68.174  -8.454   10.057  1.00 0.00 ? 1674 C   F OP1   1 
ATOM 6921  O OP2   . C   F 6  21  ? 68.841  -6.318   11.229  1.00 0.00 ? 1674 C   F OP2   1 
ATOM 6922  O "O5'" . C   F 6  21  ? 70.211  -7.198   9.357   1.00 0.00 ? 1674 C   F "O5'" 1 
ATOM 6923  C "C5'" . C   F 6  21  ? 70.515  -8.195   8.380   1.00 0.00 ? 1674 C   F "C5'" 1 
ATOM 6924  C "C4'" . C   F 6  21  ? 71.998  -8.106   8.006   1.00 0.00 ? 1674 C   F "C4'" 1 
ATOM 6925  O "O4'" . C   F 6  21  ? 72.300  -6.816   7.416   1.00 0.00 ? 1674 C   F "O4'" 1 
ATOM 6926  C "C3'" . C   F 6  21  ? 72.978  -8.198   9.179   1.00 0.00 ? 1674 C   F "C3'" 1 
ATOM 6927  O "O3'" . C   F 6  21  ? 73.148  -9.569   9.553   1.00 0.00 ? 1674 C   F "O3'" 1 
ATOM 6928  C "C2'" . C   F 6  21  ? 74.218  -7.540   8.602   1.00 0.00 ? 1674 C   F "C2'" 1 
ATOM 6929  O "O2'" . C   F 6  21  ? 74.904  -8.403   7.723   1.00 0.00 ? 1674 C   F "O2'" 1 
ATOM 6930  C "C1'" . C   F 6  21  ? 73.600  -6.404   7.821   1.00 0.00 ? 1674 C   F "C1'" 1 
ATOM 6931  N N1    . C   F 6  21  ? 73.621  -5.114   8.579   1.00 0.00 ? 1674 C   F N1    1 
ATOM 6932  C C2    . C   F 6  21  ? 74.777  -4.325   8.593   1.00 0.00 ? 1674 C   F C2    1 
ATOM 6933  O O2    . C   F 6  21  ? 75.777  -4.702   7.953   1.00 0.00 ? 1674 C   F O2    1 
ATOM 6934  N N3    . C   F 6  21  ? 74.764  -3.158   9.304   1.00 0.00 ? 1674 C   F N3    1 
ATOM 6935  C C4    . C   F 6  21  ? 73.666  -2.763   10.010  1.00 0.00 ? 1674 C   F C4    1 
ATOM 6936  N N4    . C   F 6  21  ? 73.652  -1.607   10.742  1.00 0.00 ? 1674 C   F N4    1 
ATOM 6937  C C5    . C   F 6  21  ? 72.489  -3.580   10.002  1.00 0.00 ? 1674 C   F C5    1 
ATOM 6938  C C6    . C   F 6  21  ? 72.516  -4.722   9.303   1.00 0.00 ? 1674 C   F C6    1 
ATOM 6939  P P     . G   F 6  22  ? 73.212  -9.938   11.093  1.00 0.00 ? 1675 G   F P     1 
ATOM 6940  O OP1   . G   F 6  22  ? 73.227  -11.411  11.226  1.00 0.00 ? 1675 G   F OP1   1 
ATOM 6941  O OP2   . G   F 6  22  ? 72.150  -9.207   11.823  1.00 0.00 ? 1675 G   F OP2   1 
ATOM 6942  O "O5'" . G   F 6  22  ? 74.623  -9.356   11.521  1.00 0.00 ? 1675 G   F "O5'" 1 
ATOM 6943  C "C5'" . G   F 6  22  ? 75.801  -10.001  11.006  1.00 0.00 ? 1675 G   F "C5'" 1 
ATOM 6944  C "C4'" . G   F 6  22  ? 77.047  -9.238   11.458  1.00 0.00 ? 1675 G   F "C4'" 1 
ATOM 6945  O "O4'" . G   F 6  22  ? 77.087  -7.916   10.871  1.00 0.00 ? 1675 G   F "O4'" 1 
ATOM 6946  C "C3'" . G   F 6  22  ? 77.164  -8.959   12.955  1.00 0.00 ? 1675 G   F "C3'" 1 
ATOM 6947  O "O3'" . G   F 6  22  ? 77.572  -10.155  13.626  1.00 0.00 ? 1675 G   F "O3'" 1 
ATOM 6948  C "C2'" . G   F 6  22  ? 78.184  -7.830   12.963  1.00 0.00 ? 1675 G   F "C2'" 1 
ATOM 6949  O "O2'" . G   F 6  22  ? 79.496  -8.304   12.763  1.00 0.00 ? 1675 G   F "O2'" 1 
ATOM 6950  C "C1'" . G   F 6  22  ? 77.748  -7.028   11.759  1.00 0.00 ? 1675 G   F "C1'" 1 
ATOM 6951  N N9    . G   F 6  22  ? 76.907  -5.872   12.144  1.00 0.00 ? 1675 G   F N9    1 
ATOM 6952  C C8    . G   F 6  22  ? 75.536  -5.743   12.057  1.00 0.00 ? 1675 G   F C8    1 
ATOM 6953  N N7    . G   F 6  22  ? 75.105  -4.582   12.470  1.00 0.00 ? 1675 G   F N7    1 
ATOM 6954  C C5    . G   F 6  22  ? 76.237  -3.906   12.855  1.00 0.00 ? 1675 G   F C5    1 
ATOM 6955  C C6    . G   F 6  22  ? 76.352  -2.581   13.327  1.00 0.00 ? 1675 G   F C6    1 
ATOM 6956  O O6    . G   F 6  22  ? 75.405  -1.806   13.490  1.00 0.00 ? 1675 G   F O6    1 
ATOM 6957  N N1    . G   F 6  22  ? 77.706  -2.274   13.598  1.00 0.00 ? 1675 G   F N1    1 
ATOM 6958  C C2    . G   F 6  22  ? 78.800  -3.138   13.434  1.00 0.00 ? 1675 G   F C2    1 
ATOM 6959  N N2    . G   F 6  22  ? 80.016  -2.628   13.776  1.00 0.00 ? 1675 G   F N2    1 
ATOM 6960  N N3    . G   F 6  22  ? 78.647  -4.398   12.960  1.00 0.00 ? 1675 G   F N3    1 
ATOM 6961  C C4    . G   F 6  22  ? 77.364  -4.696   12.687  1.00 0.00 ? 1675 G   F C4    1 
ATOM 6962  P P     . U   F 6  23  ? 77.054  -10.427  15.100  1.00 0.00 ? 1676 U   F P     1 
ATOM 6963  O OP1   . U   F 6  23  ? 77.496  -11.779  15.510  1.00 0.00 ? 1676 U   F OP1   1 
ATOM 6964  O OP2   . U   F 6  23  ? 75.602  -10.140  15.168  1.00 0.00 ? 1676 U   F OP2   1 
ATOM 6965  O "O5'" . U   F 6  23  ? 77.834  -9.345   15.960  1.00 0.00 ? 1676 U   F "O5'" 1 
ATOM 6966  C "C5'" . U   F 6  23  ? 79.254  -9.522   16.073  1.00 0.00 ? 1676 U   F "C5'" 1 
ATOM 6967  C "C4'" . U   F 6  23  ? 79.917  -8.310   16.716  1.00 0.00 ? 1676 U   F "C4'" 1 
ATOM 6968  O "O4'" . U   F 6  23  ? 79.738  -7.128   15.905  1.00 0.00 ? 1676 U   F "O4'" 1 
ATOM 6969  C "C3'" . U   F 6  23  ? 79.345  -7.915   18.067  1.00 0.00 ? 1676 U   F "C3'" 1 
ATOM 6970  O "O3'" . U   F 6  23  ? 79.850  -8.817   19.052  1.00 0.00 ? 1676 U   F "O3'" 1 
ATOM 6971  C "C2'" . U   F 6  23  ? 79.813  -6.469   18.166  1.00 0.00 ? 1676 U   F "C2'" 1 
ATOM 6972  O "O2'" . U   F 6  23  ? 81.172  -6.371   18.512  1.00 0.00 ? 1676 U   F "O2'" 1 
ATOM 6973  C "C1'" . U   F 6  23  ? 79.627  -5.989   16.745  1.00 0.00 ? 1676 U   F "C1'" 1 
ATOM 6974  N N1    . U   F 6  23  ? 78.335  -5.261   16.585  1.00 0.00 ? 1676 U   F N1    1 
ATOM 6975  C C2    . U   F 6  23  ? 78.318  -3.903   16.872  1.00 0.00 ? 1676 U   F C2    1 
ATOM 6976  O O2    . U   F 6  23  ? 79.326  -3.295   17.229  1.00 0.00 ? 1676 U   F O2    1 
ATOM 6977  N N3    . U   F 6  23  ? 77.067  -3.297   16.733  1.00 0.00 ? 1676 U   F N3    1 
ATOM 6978  C C4    . U   F 6  23  ? 75.850  -3.919   16.414  1.00 0.00 ? 1676 U   F C4    1 
ATOM 6979  O O4    . U   F 6  23  ? 74.803  -3.273   16.338  1.00 0.00 ? 1676 U   F O4    1 
ATOM 6980  C C5    . U   F 6  23  ? 75.968  -5.339   16.191  1.00 0.00 ? 1676 U   F C5    1 
ATOM 6981  C C6    . U   F 6  23  ? 77.168  -5.935   16.282  1.00 0.00 ? 1676 U   F C6    1 
ATOM 6982  P P     . G   F 6  24  ? 79.235  -8.811   20.508  1.00 0.00 ? 1677 G   F P     1 
ATOM 6983  O OP1   . G   F 6  24  ? 79.514  -10.118  21.144  1.00 0.00 ? 1677 G   F OP1   1 
ATOM 6984  O OP2   . G   F 6  24  ? 77.822  -8.367   20.451  1.00 0.00 ? 1677 G   F OP2   1 
ATOM 6985  O "O5'" . G   F 6  24  ? 80.119  -7.710   21.204  1.00 0.00 ? 1677 G   F "O5'" 1 
ATOM 6986  C "C5'" . G   F 6  24  ? 79.636  -7.003   22.350  1.00 0.00 ? 1677 G   F "C5'" 1 
ATOM 6987  C "C4'" . G   F 6  24  ? 80.271  -5.612   22.401  1.00 0.00 ? 1677 G   F "C4'" 1 
ATOM 6988  O "O4'" . G   F 6  24  ? 80.160  -4.948   21.111  1.00 0.00 ? 1677 G   F "O4'" 1 
ATOM 6989  C "C3'" . G   F 6  24  ? 79.543  -4.669   23.356  1.00 0.00 ? 1677 G   F "C3'" 1 
ATOM 6990  O "O3'" . G   F 6  24  ? 80.095  -4.801   24.672  1.00 0.00 ? 1677 G   F "O3'" 1 
ATOM 6991  C "C2'" . G   F 6  24  ? 79.746  -3.309   22.728  1.00 0.00 ? 1677 G   F "C2'" 1 
ATOM 6992  O "O2'" . G   F 6  24  ? 81.035  -2.802   22.983  1.00 0.00 ? 1677 G   F "O2'" 1 
ATOM 6993  C "C1'" . G   F 6  24  ? 79.613  -3.651   21.269  1.00 0.00 ? 1677 G   F "C1'" 1 
ATOM 6994  N N9    . G   F 6  24  ? 78.203  -3.572   20.804  1.00 0.00 ? 1677 G   F N9    1 
ATOM 6995  C C8    . G   F 6  24  ? 77.392  -4.603   20.369  1.00 0.00 ? 1677 G   F C8    1 
ATOM 6996  N N7    . G   F 6  24  ? 76.196  -4.211   20.026  1.00 0.00 ? 1677 G   F N7    1 
ATOM 6997  C C5    . G   F 6  24  ? 76.195  -2.858   20.253  1.00 0.00 ? 1677 G   F C5    1 
ATOM 6998  C C6    . G   F 6  24  ? 75.129  -1.947   20.107  1.00 0.00 ? 1677 G   F C6    1 
ATOM 6999  O O6    . G   F 6  24  ? 74.009  -2.236   19.675  1.00 0.00 ? 1677 G   F O6    1 
ATOM 7000  N N1    . G   F 6  24  ? 75.525  -0.662   20.544  1.00 0.00 ? 1677 G   F N1    1 
ATOM 7001  C C2    . G   F 6  24  ? 76.791  -0.306   21.035  1.00 0.00 ? 1677 G   F C2    1 
ATOM 7002  N N2    . G   F 6  24  ? 76.929  0.984    21.444  1.00 0.00 ? 1677 G   F N2    1 
ATOM 7003  N N3    . G   F 6  24  ? 77.806  -1.199   21.098  1.00 0.00 ? 1677 G   F N3    1 
ATOM 7004  C C4    . G   F 6  24  ? 77.428  -2.438   20.736  1.00 0.00 ? 1677 G   F C4    1 
ATOM 7005  P P     . G   F 6  25  ? 79.114  -5.045   25.889  1.00 0.00 ? 1678 G   F P     1 
ATOM 7006  O OP1   . G   F 6  25  ? 79.906  -5.376   27.097  1.00 0.00 ? 1678 G   F OP1   1 
ATOM 7007  O OP2   . G   F 6  25  ? 78.060  -6.004   25.484  1.00 0.00 ? 1678 G   F OP2   1 
ATOM 7008  O "O5'" . G   F 6  25  ? 78.460  -3.612   26.071  1.00 0.00 ? 1678 G   F "O5'" 1 
ATOM 7009  C "C5'" . G   F 6  25  ? 79.312  -2.560   26.552  1.00 0.00 ? 1678 G   F "C5'" 1 
ATOM 7010  C "C4'" . G   F 6  25  ? 78.642  -1.197   26.371  1.00 0.00 ? 1678 G   F "C4'" 1 
ATOM 7011  O "O4'" . G   F 6  25  ? 78.294  -0.966   24.984  1.00 0.00 ? 1678 G   F "O4'" 1 
ATOM 7012  C "C3'" . G   F 6  25  ? 77.324  -0.990   27.119  1.00 0.00 ? 1678 G   F "C3'" 1 
ATOM 7013  O "O3'" . G   F 6  25  ? 77.582  -0.660   28.499  1.00 0.00 ? 1678 G   F "O3'" 1 
ATOM 7014  C "C2'" . G   F 6  25  ? 76.698  0.137    26.323  1.00 0.00 ? 1678 G   F "C2'" 1 
ATOM 7015  O "O2'" . G   F 6  25  ? 77.287  1.382    26.618  1.00 0.00 ? 1678 G   F "O2'" 1 
ATOM 7016  C "C1'" . G   F 6  25  ? 77.061  -0.270   24.913  1.00 0.00 ? 1678 G   F "C1'" 1 
ATOM 7017  N N9    . G   F 6  25  ? 75.995  -1.092   24.303  1.00 0.00 ? 1678 G   F N9    1 
ATOM 7018  C C8    . G   F 6  25  ? 76.030  -2.438   24.002  1.00 0.00 ? 1678 G   F C8    1 
ATOM 7019  N N7    . G   F 6  25  ? 74.917  -2.879   23.489  1.00 0.00 ? 1678 G   F N7    1 
ATOM 7020  C C5    . G   F 6  25  ? 74.095  -1.781   23.448  1.00 0.00 ? 1678 G   F C5    1 
ATOM 7021  C C6    . G   F 6  25  ? 72.756  -1.709   23.018  1.00 0.00 ? 1678 G   F C6    1 
ATOM 7022  O O6    . G   F 6  25  ? 72.113  -2.666   22.576  1.00 0.00 ? 1678 G   F O6    1 
ATOM 7023  N N1    . G   F 6  25  ? 72.262  -0.393   23.177  1.00 0.00 ? 1678 G   F N1    1 
ATOM 7024  C C2    . G   F 6  25  ? 72.979  0.709    23.674  1.00 0.00 ? 1678 G   F C2    1 
ATOM 7025  N N2    . G   F 6  25  ? 72.288  1.881    23.749  1.00 0.00 ? 1678 G   F N2    1 
ATOM 7026  N N3    . G   F 6  25  ? 74.273  0.598    24.061  1.00 0.00 ? 1678 G   F N3    1 
ATOM 7027  C C4    . G   F 6  25  ? 74.745  -0.657   23.937  1.00 0.00 ? 1678 G   F C4    1 
ATOM 7028  P P     . G   G 7  1   ? 77.465  24.520   37.148  1.00 0.00 ? 912  G   G P     1 
ATOM 7029  O OP1   . G   G 7  1   ? 77.995  23.314   36.472  1.00 0.00 ? 912  G   G OP1   1 
ATOM 7030  O OP2   . G   G 7  1   ? 78.382  25.613   37.543  1.00 0.00 ? 912  G   G OP2   1 
ATOM 7031  O "O5'" . G   G 7  1   ? 76.170  25.084   36.435  1.00 0.00 ? 912  G   G "O5'" 1 
ATOM 7032  C "C5'" . G   G 7  1   ? 75.184  24.135   36.002  1.00 0.00 ? 912  G   G "C5'" 1 
ATOM 7033  C "C4'" . G   G 7  1   ? 73.913  24.869   35.567  1.00 0.00 ? 912  G   G "C4'" 1 
ATOM 7034  O "O4'" . G   G 7  1   ? 73.351  25.618   36.674  1.00 0.00 ? 912  G   G "O4'" 1 
ATOM 7035  C "C3'" . G   G 7  1   ? 74.085  25.922   34.470  1.00 0.00 ? 912  G   G "C3'" 1 
ATOM 7036  O "O3'" . G   G 7  1   ? 74.164  25.268   33.199  1.00 0.00 ? 912  G   G "O3'" 1 
ATOM 7037  C "C2'" . G   G 7  1   ? 72.833  26.758   34.676  1.00 0.00 ? 912  G   G "C2'" 1 
ATOM 7038  O "O2'" . G   G 7  1   ? 71.684  26.117   34.169  1.00 0.00 ? 912  G   G "O2'" 1 
ATOM 7039  C "C1'" . G   G 7  1   ? 72.762  26.813   36.183  1.00 0.00 ? 912  G   G "C1'" 1 
ATOM 7040  N N9    . G   G 7  1   ? 73.421  28.026   36.717  1.00 0.00 ? 912  G   G N9    1 
ATOM 7041  C C8    . G   G 7  1   ? 74.623  28.111   37.388  1.00 0.00 ? 912  G   G C8    1 
ATOM 7042  N N7    . G   G 7  1   ? 74.929  29.330   37.739  1.00 0.00 ? 912  G   G N7    1 
ATOM 7043  C C5    . G   G 7  1   ? 73.887  30.097   37.279  1.00 0.00 ? 912  G   G C5    1 
ATOM 7044  C C6    . G   G 7  1   ? 73.708  31.490   37.394  1.00 0.00 ? 912  G   G C6    1 
ATOM 7045  O O6    . G   G 7  1   ? 74.494  32.249   37.968  1.00 0.00 ? 912  G   G O6    1 
ATOM 7046  N N1    . G   G 7  1   ? 72.514  31.886   36.746  1.00 0.00 ? 912  G   G N1    1 
ATOM 7047  C C2    . G   G 7  1   ? 71.608  31.037   36.088  1.00 0.00 ? 912  G   G C2    1 
ATOM 7048  N N2    . G   G 7  1   ? 70.535  31.645   35.508  1.00 0.00 ? 912  G   G N2    1 
ATOM 7049  N N3    . G   G 7  1   ? 71.797  29.695   36.040  1.00 0.00 ? 912  G   G N3    1 
ATOM 7050  C C4    . G   G 7  1   ? 72.945  29.313   36.632  1.00 0.00 ? 912  G   G C4    1 
ATOM 7051  P P     . C   G 7  2   ? 74.913  25.976   31.996  1.00 0.00 ? 913  C   G P     1 
ATOM 7052  O OP1   . C   G 7  2   ? 74.890  25.067   30.829  1.00 0.00 ? 913  C   G OP1   1 
ATOM 7053  O OP2   . C   G 7  2   ? 76.240  26.444   32.459  1.00 0.00 ? 913  C   G OP2   1 
ATOM 7054  O "O5'" . C   G 7  2   ? 74.017  27.239   31.688  1.00 0.00 ? 913  C   G "O5'" 1 
ATOM 7055  C "C5'" . C   G 7  2   ? 72.800  27.091   30.948  1.00 0.00 ? 913  C   G "C5'" 1 
ATOM 7056  C "C4'" . C   G 7  2   ? 72.107  28.452   30.810  1.00 0.00 ? 913  C   G "C4'" 1 
ATOM 7057  O "O4'" . C   G 7  2   ? 71.829  29.042   32.110  1.00 0.00 ? 913  C   G "O4'" 1 
ATOM 7058  C "C3'" . C   G 7  2   ? 72.924  29.537   30.101  1.00 0.00 ? 913  C   G "C3'" 1 
ATOM 7059  O "O3'" . C   G 7  2   ? 72.879  29.327   28.687  1.00 0.00 ? 913  C   G "O3'" 1 
ATOM 7060  C "C2'" . C   G 7  2   ? 72.212  30.790   30.576  1.00 0.00 ? 913  C   G "C2'" 1 
ATOM 7061  O "O2'" . C   G 7  2   ? 70.966  30.960   29.938  1.00 0.00 ? 913  C   G "O2'" 1 
ATOM 7062  C "C1'" . C   G 7  2   ? 71.996  30.457   32.031  1.00 0.00 ? 913  C   G "C1'" 1 
ATOM 7063  N N1    . C   G 7  2   ? 73.104  30.996   32.886  1.00 0.00 ? 913  C   G N1    1 
ATOM 7064  C C2    . C   G 7  2   ? 73.167  32.362   33.189  1.00 0.00 ? 913  C   G C2    1 
ATOM 7065  O O2    . C   G 7  2   ? 72.278  33.121   32.759  1.00 0.00 ? 913  C   G O2    1 
ATOM 7066  N N3    . C   G 7  2   ? 74.204  32.816   33.957  1.00 0.00 ? 913  C   G N3    1 
ATOM 7067  C C4    . C   G 7  2   ? 75.174  31.972   34.414  1.00 0.00 ? 913  C   G C4    1 
ATOM 7068  N N4    . C   G 7  2   ? 76.211  32.402   35.189  1.00 0.00 ? 913  C   G N4    1 
ATOM 7069  C C5    . C   G 7  2   ? 75.119  30.583   34.082  1.00 0.00 ? 913  C   G C5    1 
ATOM 7070  C C6    . C   G 7  2   ? 74.100  30.154   33.329  1.00 0.00 ? 913  C   G C6    1 
ATOM 7071  P P     . C   G 7  3   ? 74.065  29.881   27.791  1.00 0.00 ? 914  C   G P     1 
ATOM 7072  O OP1   . C   G 7  3   ? 73.791  29.528   26.383  1.00 0.00 ? 914  C   G OP1   1 
ATOM 7073  O OP2   . C   G 7  3   ? 75.356  29.430   28.360  1.00 0.00 ? 914  C   G OP2   1 
ATOM 7074  O "O5'" . C   G 7  3   ? 73.963  31.448   27.961  1.00 0.00 ? 914  C   G "O5'" 1 
ATOM 7075  C "C5'" . C   G 7  3   ? 72.996  32.176   27.195  1.00 0.00 ? 914  C   G "C5'" 1 
ATOM 7076  C "C4'" . C   G 7  3   ? 73.137  33.675   27.474  1.00 0.00 ? 914  C   G "C4'" 1 
ATOM 7077  O "O4'" . C   G 7  3   ? 72.986  33.962   28.890  1.00 0.00 ? 914  C   G "O4'" 1 
ATOM 7078  C "C3'" . C   G 7  3   ? 74.502  34.287   27.137  1.00 0.00 ? 914  C   G "C3'" 1 
ATOM 7079  O "O3'" . C   G 7  3   ? 74.607  34.489   25.724  1.00 0.00 ? 914  C   G "O3'" 1 
ATOM 7080  C "C2'" . C   G 7  3   ? 74.447  35.564   27.957  1.00 0.00 ? 914  C   G "C2'" 1 
ATOM 7081  O "O2'" . C   G 7  3   ? 73.598  36.527   27.373  1.00 0.00 ? 914  C   G "O2'" 1 
ATOM 7082  C "C1'" . C   G 7  3   ? 73.834  35.050   29.241  1.00 0.00 ? 914  C   G "C1'" 1 
ATOM 7083  N N1    . C   G 7  3   ? 74.893  34.707   30.241  1.00 0.00 ? 914  C   G N1    1 
ATOM 7084  C C2    . C   G 7  3   ? 75.539  35.732   30.939  1.00 0.00 ? 914  C   G C2    1 
ATOM 7085  O O2    . C   G 7  3   ? 75.190  36.910   30.742  1.00 0.00 ? 914  C   G O2    1 
ATOM 7086  N N3    . C   G 7  3   ? 76.536  35.403   31.811  1.00 0.00 ? 914  C   G N3    1 
ATOM 7087  C C4    . C   G 7  3   ? 76.936  34.112   31.984  1.00 0.00 ? 914  C   G C4    1 
ATOM 7088  N N4    . C   G 7  3   ? 77.976  33.784   32.806  1.00 0.00 ? 914  C   G N4    1 
ATOM 7089  C C5    . C   G 7  3   ? 76.270  33.063   31.270  1.00 0.00 ? 914  C   G C5    1 
ATOM 7090  C C6    . C   G 7  3   ? 75.292  33.400   30.419  1.00 0.00 ? 914  C   G C6    1 
ATOM 7091  P P     . A   G 7  4   ? 76.049  34.532   25.061  1.00 0.00 ? 915  A   G P     1 
ATOM 7092  O OP1   . A   G 7  4   ? 75.884  34.672   23.596  1.00 0.00 ? 915  A   G OP1   1 
ATOM 7093  O OP2   . A   G 7  4   ? 76.834  33.372   25.540  1.00 0.00 ? 915  A   G OP2   1 
ATOM 7094  O "O5'" . A   G 7  4   ? 76.699  35.853   25.650  1.00 0.00 ? 915  A   G "O5'" 1 
ATOM 7095  C "C5'" . A   G 7  4   ? 76.344  37.114   25.063  1.00 0.00 ? 915  A   G "C5'" 1 
ATOM 7096  C "C4'" . A   G 7  4   ? 77.057  38.259   25.796  1.00 0.00 ? 915  A   G "C4'" 1 
ATOM 7097  O "O4'" . A   G 7  4   ? 76.777  38.226   27.219  1.00 0.00 ? 915  A   G "O4'" 1 
ATOM 7098  C "C3'" . A   G 7  4   ? 78.588  38.263   25.737  1.00 0.00 ? 915  A   G "C3'" 1 
ATOM 7099  O "O3'" . A   G 7  4   ? 79.025  38.742   24.462  1.00 0.00 ? 915  A   G "O3'" 1 
ATOM 7100  C "C2'" . A   G 7  4   ? 78.906  39.188   26.902  1.00 0.00 ? 915  A   G "C2'" 1 
ATOM 7101  O "O2'" . A   G 7  4   ? 78.664  40.539   26.583  1.00 0.00 ? 915  A   G "O2'" 1 
ATOM 7102  C "C1'" . A   G 7  4   ? 77.902  38.726   27.926  1.00 0.00 ? 915  A   G "C1'" 1 
ATOM 7103  N N9    . A   G 7  4   ? 78.500  37.723   28.818  1.00 0.00 ? 915  A   G N9    1 
ATOM 7104  C C8    . A   G 7  4   ? 78.384  36.353   28.790  1.00 0.00 ? 915  A   G C8    1 
ATOM 7105  N N7    . A   G 7  4   ? 79.082  35.757   29.715  1.00 0.00 ? 915  A   G N7    1 
ATOM 7106  C C5    . A   G 7  4   ? 79.707  36.760   30.400  1.00 0.00 ? 915  A   G C5    1 
ATOM 7107  C C6    . A   G 7  4   ? 80.591  36.699   31.488  1.00 0.00 ? 915  A   G C6    1 
ATOM 7108  N N6    . A   G 7  4   ? 80.915  35.472   32.007  1.00 0.00 ? 915  A   G N6    1 
ATOM 7109  N N1    . A   G 7  4   ? 81.053  37.916   31.931  1.00 0.00 ? 915  A   G N1    1 
ATOM 7110  C C2    . A   G 7  4   ? 80.642  39.033   31.310  1.00 0.00 ? 915  A   G C2    1 
ATOM 7111  N N3    . A   G 7  4   ? 79.808  39.185   30.272  1.00 0.00 ? 915  A   G N3    1 
ATOM 7112  C C4    . A   G 7  4   ? 79.365  37.991   29.851  1.00 0.00 ? 915  A   G C4    1 
ATOM 7113  P P     . G   G 7  5   ? 80.499  38.416   23.966  1.00 0.00 ? 916  G   G P     1 
ATOM 7114  O OP1   . G   G 7  5   ? 80.630  38.879   22.566  1.00 0.00 ? 916  G   G OP1   1 
ATOM 7115  O OP2   . G   G 7  5   ? 80.794  36.989   24.230  1.00 0.00 ? 916  G   G OP2   1 
ATOM 7116  O "O5'" . G   G 7  5   ? 81.432  39.297   24.894  1.00 0.00 ? 916  G   G "O5'" 1 
ATOM 7117  C "C5'" . G   G 7  5   ? 81.609  40.689   24.598  1.00 0.00 ? 916  G   G "C5'" 1 
ATOM 7118  C "C4'" . G   G 7  5   ? 82.548  41.336   25.626  1.00 0.00 ? 916  G   G "C4'" 1 
ATOM 7119  O "O4'" . G   G 7  5   ? 82.081  41.079   26.974  1.00 0.00 ? 916  G   G "O4'" 1 
ATOM 7120  C "C3'" . G   G 7  5   ? 83.999  40.836   25.633  1.00 0.00 ? 916  G   G "C3'" 1 
ATOM 7121  O "O3'" . G   G 7  5   ? 84.729  41.490   24.588  1.00 0.00 ? 916  G   G "O3'" 1 
ATOM 7122  C "C2'" . G   G 7  5   ? 84.437  41.211   27.043  1.00 0.00 ? 916  G   G "C2'" 1 
ATOM 7123  O "O2'" . G   G 7  5   ? 84.736  42.585   27.148  1.00 0.00 ? 916  G   G "O2'" 1 
ATOM 7124  C "C1'" . G   G 7  5   ? 83.189  40.907   27.841  1.00 0.00 ? 916  G   G "C1'" 1 
ATOM 7125  N N9    . G   G 7  5   ? 83.226  39.556   28.452  1.00 0.00 ? 916  G   G N9    1 
ATOM 7126  C C8    . G   G 7  5   ? 82.586  38.411   28.022  1.00 0.00 ? 916  G   G C8    1 
ATOM 7127  N N7    . G   G 7  5   ? 82.804  37.379   28.789  1.00 0.00 ? 916  G   G N7    1 
ATOM 7128  C C5    . G   G 7  5   ? 83.634  37.850   29.775  1.00 0.00 ? 916  G   G C5    1 
ATOM 7129  C C6    . G   G 7  5   ? 84.175  37.149   30.871  1.00 0.00 ? 916  G   G C6    1 
ATOM 7130  O O6    . G   G 7  5   ? 83.949  35.962   31.122  1.00 0.00 ? 916  G   G O6    1 
ATOM 7131  N N1    . G   G 7  5   ? 85.028  37.991   31.619  1.00 0.00 ? 916  G   G N1    1 
ATOM 7132  C C2    . G   G 7  5   ? 85.292  39.345   31.358  1.00 0.00 ? 916  G   G C2    1 
ATOM 7133  N N2    . G   G 7  5   ? 86.158  39.952   32.216  1.00 0.00 ? 916  G   G N2    1 
ATOM 7134  N N3    . G   G 7  5   ? 84.710  39.997   30.320  1.00 0.00 ? 916  G   G N3    1 
ATOM 7135  C C4    . G   G 7  5   ? 83.923  39.193   29.580  1.00 0.00 ? 916  G   G C4    1 
ATOM 7136  P P     . C   G 7  6   ? 85.960  40.778   23.891  1.00 0.00 ? 917  C   G P     1 
ATOM 7137  O OP1   . C   G 7  6   ? 86.383  41.599   22.734  1.00 0.00 ? 917  C   G OP1   1 
ATOM 7138  O OP2   . C   G 7  6   ? 85.614  39.363   23.622  1.00 0.00 ? 917  C   G OP2   1 
ATOM 7139  O "O5'" . C   G 7  6   ? 87.094  40.817   24.989  1.00 0.00 ? 917  C   G "O5'" 1 
ATOM 7140  C "C5'" . C   G 7  6   ? 87.851  42.007   25.232  1.00 0.00 ? 917  C   G "C5'" 1 
ATOM 7141  C "C4'" . C   G 7  6   ? 88.810  41.783   26.413  1.00 0.00 ? 917  C   G "C4'" 1 
ATOM 7142  O "O4'" . C   G 7  6   ? 88.068  41.409   27.604  1.00 0.00 ? 917  C   G "O4'" 1 
ATOM 7143  C "C3'" . C   G 7  6   ? 89.827  40.644   26.242  1.00 0.00 ? 917  C   G "C3'" 1 
ATOM 7144  O "O3'" . C   G 7  6   ? 90.947  41.110   25.480  1.00 0.00 ? 917  C   G "O3'" 1 
ATOM 7145  C "C2'" . C   G 7  6   ? 90.151  40.293   27.687  1.00 0.00 ? 917  C   G "C2'" 1 
ATOM 7146  O "O2'" . C   G 7  6   ? 91.065  41.203   28.255  1.00 0.00 ? 917  C   G "O2'" 1 
ATOM 7147  C "C1'" . C   G 7  6   ? 88.804  40.446   28.350  1.00 0.00 ? 917  C   G "C1'" 1 
ATOM 7148  N N1    . C   G 7  6   ? 88.104  39.133   28.509  1.00 0.00 ? 917  C   G N1    1 
ATOM 7149  C C2    . C   G 7  6   ? 88.436  38.271   29.560  1.00 0.00 ? 917  C   G C2    1 
ATOM 7150  O O2    . C   G 7  6   ? 89.317  38.616   30.369  1.00 0.00 ? 917  C   G O2    1 
ATOM 7151  N N3    . C   G 7  6   ? 87.770  37.082   29.666  1.00 0.00 ? 917  C   G N3    1 
ATOM 7152  C C4    . C   G 7  6   ? 86.818  36.716   28.760  1.00 0.00 ? 917  C   G C4    1 
ATOM 7153  N N4    . C   G 7  6   ? 86.143  35.534   28.845  1.00 0.00 ? 917  C   G N4    1 
ATOM 7154  C C5    . C   G 7  6   ? 86.503  37.588   27.672  1.00 0.00 ? 917  C   G C5    1 
ATOM 7155  C C6    . C   G 7  6   ? 87.165  38.745   27.581  1.00 0.00 ? 917  C   G C6    1 
ATOM 7156  P P     . A   G 7  7   ? 91.831  40.079   24.659  1.00 0.00 ? 918  A   G P     1 
ATOM 7157  O OP1   . A   G 7  7   ? 92.916  40.826   23.982  1.00 0.00 ? 918  A   G OP1   1 
ATOM 7158  O OP2   . A   G 7  7   ? 90.943  39.263   23.801  1.00 0.00 ? 918  A   G OP2   1 
ATOM 7159  O "O5'" . A   G 7  7   ? 92.453  39.137   25.769  1.00 0.00 ? 918  A   G "O5'" 1 
ATOM 7160  C "C5'" . A   G 7  7   ? 93.678  39.519   26.416  1.00 0.00 ? 918  A   G "C5'" 1 
ATOM 7161  C "C4'" . A   G 7  7   ? 94.105  38.431   27.406  1.00 0.00 ? 918  A   G "C4'" 1 
ATOM 7162  O "O4'" . A   G 7  7   ? 93.052  38.152   28.358  1.00 0.00 ? 918  A   G "O4'" 1 
ATOM 7163  C "C3'" . A   G 7  7   ? 94.401  37.062   26.789  1.00 0.00 ? 918  A   G "C3'" 1 
ATOM 7164  O "O3'" . A   G 7  7   ? 95.720  37.066   26.230  1.00 0.00 ? 918  A   G "O3'" 1 
ATOM 7165  C "C2'" . A   G 7  7   ? 94.233  36.137   27.982  1.00 0.00 ? 918  A   G "C2'" 1 
ATOM 7166  O "O2'" . A   G 7  7   ? 95.362  36.157   28.824  1.00 0.00 ? 918  A   G "O2'" 1 
ATOM 7167  C "C1'" . A   G 7  7   ? 93.062  36.776   28.688  1.00 0.00 ? 918  A   G "C1'" 1 
ATOM 7168  N N9    . A   G 7  7   ? 91.798  36.112   28.346  1.00 0.00 ? 918  A   G N9    1 
ATOM 7169  C C8    . A   G 7  7   ? 90.832  36.472   27.434  1.00 0.00 ? 918  A   G C8    1 
ATOM 7170  N N7    . A   G 7  7   ? 89.829  35.640   27.388  1.00 0.00 ? 918  A   G N7    1 
ATOM 7171  C C5    . A   G 7  7   ? 90.129  34.665   28.299  1.00 0.00 ? 918  A   G C5    1 
ATOM 7172  C C6    . A   G 7  7   ? 89.426  33.501   28.651  1.00 0.00 ? 918  A   G C6    1 
ATOM 7173  N N6    . A   G 7  7   ? 88.205  33.258   28.082  1.00 0.00 ? 918  A   G N6    1 
ATOM 7174  N N1    . A   G 7  7   ? 90.054  32.699   29.572  1.00 0.00 ? 918  A   G N1    1 
ATOM 7175  C C2    . A   G 7  7   ? 91.244  33.076   30.064  1.00 0.00 ? 918  A   G C2    1 
ATOM 7176  N N3    . A   G 7  7   ? 91.969  34.174   29.810  1.00 0.00 ? 918  A   G N3    1 
ATOM 7177  C C4    . A   G 7  7   ? 91.355  34.937   28.896  1.00 0.00 ? 918  A   G C4    1 
ATOM 7178  P P     . C   G 7  8   ? 96.003  36.216   24.924  1.00 0.00 ? 919  C   G P     1 
ATOM 7179  O OP1   . C   G 7  8   ? 97.430  36.366   24.558  1.00 0.00 ? 919  C   G OP1   1 
ATOM 7180  O OP2   . C   G 7  8   ? 94.995  36.570   23.899  1.00 0.00 ? 919  C   G OP2   1 
ATOM 7181  O "O5'" . C   G 7  8   ? 95.725  34.735   25.390  1.00 0.00 ? 919  C   G "O5'" 1 
ATOM 7182  C "C5'" . C   G 7  8   ? 96.765  33.921   25.928  1.00 0.00 ? 919  C   G "C5'" 1 
ATOM 7183  C "C4'" . C   G 7  8   ? 96.236  32.496   26.103  1.00 0.00 ? 919  C   G "C4'" 1 
ATOM 7184  O "O4'" . C   G 7  8   ? 95.126  32.454   27.046  1.00 0.00 ? 919  C   G "O4'" 1 
ATOM 7185  C "C3'" . C   G 7  8   ? 95.628  31.846   24.852  1.00 0.00 ? 919  C   G "C3'" 1 
ATOM 7186  O "O3'" . C   G 7  8   ? 96.657  31.444   23.942  1.00 0.00 ? 919  C   G "O3'" 1 
ATOM 7187  C "C2'" . C   G 7  8   ? 94.867  30.699   25.485  1.00 0.00 ? 919  C   G "C2'" 1 
ATOM 7188  O "O2'" . C   G 7  8   ? 95.749  29.696   25.934  1.00 0.00 ? 919  C   G "O2'" 1 
ATOM 7189  C "C1'" . C   G 7  8   ? 94.233  31.407   26.664  1.00 0.00 ? 919  C   G "C1'" 1 
ATOM 7190  N N1    . C   G 7  8   ? 92.852  31.877   26.322  1.00 0.00 ? 919  C   G N1    1 
ATOM 7191  C C2    . C   G 7  8   ? 91.753  31.024   26.483  1.00 0.00 ? 919  C   G C2    1 
ATOM 7192  O O2    . C   G 7  8   ? 91.928  29.890   26.964  1.00 0.00 ? 919  C   G O2    1 
ATOM 7193  N N3    . C   G 7  8   ? 90.521  31.465   26.088  1.00 0.00 ? 919  C   G N3    1 
ATOM 7194  C C4    . C   G 7  8   ? 90.352  32.678   25.489  1.00 0.00 ? 919  C   G C4    1 
ATOM 7195  N N4    . C   G 7  8   ? 89.133  33.082   25.016  1.00 0.00 ? 919  C   G N4    1 
ATOM 7196  C C5    . C   G 7  8   ? 91.479  33.549   25.329  1.00 0.00 ? 919  C   G C5    1 
ATOM 7197  C C6    . C   G 7  8   ? 92.680  33.112   25.733  1.00 0.00 ? 919  C   G C6    1 
ATOM 7198  P P     . C   G 7  9   ? 96.328  31.473   22.386  1.00 0.00 ? 920  C   G P     1 
ATOM 7199  O OP1   . C   G 7  9   ? 97.434  30.811   21.658  1.00 0.00 ? 920  C   G OP1   1 
ATOM 7200  O OP2   . C   G 7  9   ? 95.993  32.861   21.992  1.00 0.00 ? 920  C   G OP2   1 
ATOM 7201  O "O5'" . C   G 7  9   ? 95.026  30.575   22.276  1.00 0.00 ? 920  C   G "O5'" 1 
ATOM 7202  C "C5'" . C   G 7  9   ? 94.461  30.257   20.995  1.00 0.00 ? 920  C   G "C5'" 1 
ATOM 7203  C "C4'" . C   G 7  9   ? 94.403  28.737   20.782  1.00 0.00 ? 920  C   G "C4'" 1 
ATOM 7204  O "O4'" . C   G 7  9   ? 95.732  28.159   20.803  1.00 0.00 ? 920  C   G "O4'" 1 
ATOM 7205  C "C3'" . C   G 7  9   ? 93.637  27.913   21.823  1.00 0.00 ? 920  C   G "C3'" 1 
ATOM 7206  O "O3'" . C   G 7  9   ? 92.232  27.983   21.561  1.00 0.00 ? 920  C   G "O3'" 1 
ATOM 7207  C "C2'" . C   G 7  9   ? 94.224  26.524   21.615  1.00 0.00 ? 920  C   G "C2'" 1 
ATOM 7208  O "O2'" . C   G 7  9   ? 93.655  25.881   20.497  1.00 0.00 ? 920  C   G "O2'" 1 
ATOM 7209  C "C1'" . C   G 7  9   ? 95.676  26.838   21.333  1.00 0.00 ? 920  C   G "C1'" 1 
ATOM 7210  N N1    . C   G 7  9   ? 96.542  26.617   22.534  1.00 0.00 ? 920  C   G N1    1 
ATOM 7211  C C2    . C   G 7  9   ? 96.923  25.322   22.910  1.00 0.00 ? 920  C   G C2    1 
ATOM 7212  O O2    . C   G 7  9   ? 96.529  24.352   22.234  1.00 0.00 ? 920  C   G O2    1 
ATOM 7213  N N3    . C   G 7  9   ? 97.730  25.169   24.007  1.00 0.00 ? 920  C   G N3    1 
ATOM 7214  C C4    . C   G 7  9   ? 98.127  26.242   24.753  1.00 0.00 ? 920  C   G C4    1 
ATOM 7215  N N4    . C   G 7  9   ? 98.937  26.112   25.847  1.00 0.00 ? 920  C   G N4    1 
ATOM 7216  C C5    . C   G 7  9   ? 97.685  27.556   24.393  1.00 0.00 ? 920  C   G C5    1 
ATOM 7217  C C6    . C   G 7  9   ? 96.906  27.691   23.313  1.00 0.00 ? 920  C   G C6    1 
ATOM 7218  P P     . U   G 7  10  ? 91.219  28.614   22.600  1.00 0.00 ? 921  U   G P     1 
ATOM 7219  O OP1   . U   G 7  10  ? 90.022  29.085   21.867  1.00 0.00 ? 921  U   G OP1   1 
ATOM 7220  O OP2   . U   G 7  10  ? 91.921  29.602   23.450  1.00 0.00 ? 921  U   G OP2   1 
ATOM 7221  O "O5'" . U   G 7  10  ? 90.815  27.371   23.492  1.00 0.00 ? 921  U   G "O5'" 1 
ATOM 7222  C "C5'" . U   G 7  10  ? 90.083  26.269   22.930  1.00 0.00 ? 921  U   G "C5'" 1 
ATOM 7223  C "C4'" . U   G 7  10  ? 90.558  24.936   23.525  1.00 0.00 ? 921  U   G "C4'" 1 
ATOM 7224  O "O4'" . U   G 7  10  ? 91.991  24.823   23.434  1.00 0.00 ? 921  U   G "O4'" 1 
ATOM 7225  C "C3'" . U   G 7  10  ? 90.231  24.635   24.991  1.00 0.00 ? 921  U   G "C3'" 1 
ATOM 7226  O "O3'" . U   G 7  10  ? 88.873  24.194   25.064  1.00 0.00 ? 921  U   G "O3'" 1 
ATOM 7227  C "C2'" . U   G 7  10  ? 91.305  23.595   25.327  1.00 0.00 ? 921  U   G "C2'" 1 
ATOM 7228  O "O2'" . U   G 7  10  ? 90.950  22.307   24.879  1.00 0.00 ? 921  U   G "O2'" 1 
ATOM 7229  C "C1'" . U   G 7  10  ? 92.492  24.077   24.523  1.00 0.00 ? 921  U   G "C1'" 1 
ATOM 7230  N N1    . U   G 7  10  ? 93.468  24.851   25.346  1.00 0.00 ? 921  U   G N1    1 
ATOM 7231  C C2    . U   G 7  10  ? 94.598  24.206   25.837  1.00 0.00 ? 921  U   G C2    1 
ATOM 7232  O O2    . U   G 7  10  ? 94.818  23.015   25.623  1.00 0.00 ? 921  U   G O2    1 
ATOM 7233  N N3    . U   G 7  10  ? 95.460  25.023   26.580  1.00 0.00 ? 921  U   G N3    1 
ATOM 7234  C C4    . U   G 7  10  ? 95.316  26.399   26.828  1.00 0.00 ? 921  U   G C4    1 
ATOM 7235  O O4    . U   G 7  10  ? 96.148  27.019   27.494  1.00 0.00 ? 921  U   G O4    1 
ATOM 7236  C C5    . U   G 7  10  ? 94.118  26.968   26.263  1.00 0.00 ? 921  U   G C5    1 
ATOM 7237  C C6    . U   G 7  10  ? 93.253  26.189   25.597  1.00 0.00 ? 921  U   G C6    1 
ATOM 7238  P P     . U   G 7  11  ? 88.111  23.826   26.397  1.00 0.00 ? 922  U   G P     1 
ATOM 7239  O OP1   . U   G 7  11  ? 86.717  23.471   26.049  1.00 0.00 ? 922  U   G OP1   1 
ATOM 7240  O OP2   . U   G 7  11  ? 88.305  24.898   27.399  1.00 0.00 ? 922  U   G OP2   1 
ATOM 7241  O "O5'" . U   G 7  11  ? 88.862  22.527   26.864  1.00 0.00 ? 922  U   G "O5'" 1 
ATOM 7242  C "C5'" . U   G 7  11  ? 88.432  21.696   27.939  1.00 0.00 ? 922  U   G "C5'" 1 
ATOM 7243  C "C4'" . U   G 7  11  ? 89.533  21.488   29.003  1.00 0.00 ? 922  U   G "C4'" 1 
ATOM 7244  O "O4'" . U   G 7  11  ? 90.873  21.822   28.531  1.00 0.00 ? 922  U   G "O4'" 1 
ATOM 7245  C "C3'" . U   G 7  11  ? 89.380  22.348   30.254  1.00 0.00 ? 922  U   G "C3'" 1 
ATOM 7246  O "O3'" . U   G 7  11  ? 88.332  21.814   31.070  1.00 0.00 ? 922  U   G "O3'" 1 
ATOM 7247  C "C2'" . U   G 7  11  ? 90.779  22.247   30.849  1.00 0.00 ? 922  U   G "C2'" 1 
ATOM 7248  O "O2'" . U   G 7  11  ? 90.988  21.003   31.477  1.00 0.00 ? 922  U   G "O2'" 1 
ATOM 7249  C "C1'" . U   G 7  11  ? 91.637  22.356   29.609  1.00 0.00 ? 922  U   G "C1'" 1 
ATOM 7250  N N1    . U   G 7  11  ? 92.075  23.774   29.380  1.00 0.00 ? 922  U   G N1    1 
ATOM 7251  C C2    . U   G 7  11  ? 93.321  24.175   29.846  1.00 0.00 ? 922  U   G C2    1 
ATOM 7252  O O2    . U   G 7  11  ? 94.088  23.398   30.412  1.00 0.00 ? 922  U   G O2    1 
ATOM 7253  N N3    . U   G 7  11  ? 93.618  25.528   29.637  1.00 0.00 ? 922  U   G N3    1 
ATOM 7254  C C4    . U   G 7  11  ? 92.769  26.506   29.087  1.00 0.00 ? 922  U   G C4    1 
ATOM 7255  O O4    . U   G 7  11  ? 93.120  27.685   29.002  1.00 0.00 ? 922  U   G O4    1 
ATOM 7256  C C5    . U   G 7  11  ? 91.496  25.990   28.650  1.00 0.00 ? 922  U   G C5    1 
ATOM 7257  C C6    . U   G 7  11  ? 91.211  24.688   28.813  1.00 0.00 ? 922  U   G C6    1 
ATOM 7258  P P     . U   G 7  12  ? 87.594  22.803   32.066  1.00 0.00 ? 923  U   G P     1 
ATOM 7259  O OP1   . U   G 7  12  ? 86.703  22.015   32.945  1.00 0.00 ? 923  U   G OP1   1 
ATOM 7260  O OP2   . U   G 7  12  ? 86.979  23.893   31.275  1.00 0.00 ? 923  U   G OP2   1 
ATOM 7261  O "O5'" . U   G 7  12  ? 88.785  23.379   32.928  1.00 0.00 ? 923  U   G "O5'" 1 
ATOM 7262  C "C5'" . U   G 7  12  ? 88.663  24.639   33.590  1.00 0.00 ? 923  U   G "C5'" 1 
ATOM 7263  C "C4'" . U   G 7  12  ? 90.025  25.324   33.625  1.00 0.00 ? 923  U   G "C4'" 1 
ATOM 7264  O "O4'" . U   G 7  12  ? 90.505  25.545   32.273  1.00 0.00 ? 923  U   G "O4'" 1 
ATOM 7265  C "C3'" . U   G 7  12  ? 89.991  26.717   34.247  1.00 0.00 ? 923  U   G "C3'" 1 
ATOM 7266  O "O3'" . U   G 7  12  ? 90.168  26.610   35.662  1.00 0.00 ? 923  U   G "O3'" 1 
ATOM 7267  C "C2'" . U   G 7  12  ? 91.117  27.439   33.535  1.00 0.00 ? 923  U   G "C2'" 1 
ATOM 7268  O "O2'" . U   G 7  12  ? 92.379  27.107   34.073  1.00 0.00 ? 923  U   G "O2'" 1 
ATOM 7269  C "C1'" . U   G 7  12  ? 90.999  26.870   32.138  1.00 0.00 ? 923  U   G "C1'" 1 
ATOM 7270  N N1    . U   G 7  12  ? 90.166  27.730   31.231  1.00 0.00 ? 923  U   G N1    1 
ATOM 7271  C C2    . U   G 7  12  ? 90.716  28.935   30.808  1.00 0.00 ? 923  U   G C2    1 
ATOM 7272  O O2    . U   G 7  12  ? 91.833  29.311   31.162  1.00 0.00 ? 923  U   G O2    1 
ATOM 7273  N N3    . U   G 7  12  ? 89.907  29.670   29.940  1.00 0.00 ? 923  U   G N3    1 
ATOM 7274  C C4    . U   G 7  12  ? 88.639  29.321   29.451  1.00 0.00 ? 923  U   G C4    1 
ATOM 7275  O O4    . U   G 7  12  ? 88.021  30.065   28.686  1.00 0.00 ? 923  U   G O4    1 
ATOM 7276  C C5    . U   G 7  12  ? 88.171  28.043   29.921  1.00 0.00 ? 923  U   G C5    1 
ATOM 7277  C C6    . U   G 7  12  ? 88.923  27.322   30.772  1.00 0.00 ? 923  U   G C6    1 
ATOM 7278  P P     . G   G 7  13  ? 89.113  27.247   36.650  1.00 0.00 ? 924  G   G P     1 
ATOM 7279  O OP1   . G   G 7  13  ? 89.323  26.683   38.002  1.00 0.00 ? 924  G   G OP1   1 
ATOM 7280  O OP2   . G   G 7  13  ? 87.751  27.145   36.075  1.00 0.00 ? 924  G   G OP2   1 
ATOM 7281  O "O5'" . G   G 7  13  ? 89.572  28.761   36.637  1.00 0.00 ? 924  G   G "O5'" 1 
ATOM 7282  C "C5'" . G   G 7  13  ? 90.846  29.062   37.234  1.00 0.00 ? 924  G   G "C5'" 1 
ATOM 7283  C "C4'" . G   G 7  13  ? 91.275  30.475   36.849  1.00 0.00 ? 924  G   G "C4'" 1 
ATOM 7284  O "O4'" . G   G 7  13  ? 91.394  30.608   35.411  1.00 0.00 ? 924  G   G "O4'" 1 
ATOM 7285  C "C3'" . G   G 7  13  ? 90.312  31.595   37.226  1.00 0.00 ? 924  G   G "C3'" 1 
ATOM 7286  O "O3'" . G   G 7  13  ? 90.418  31.861   38.628  1.00 0.00 ? 924  G   G "O3'" 1 
ATOM 7287  C "C2'" . G   G 7  13  ? 90.815  32.705   36.321  1.00 0.00 ? 924  G   G "C2'" 1 
ATOM 7288  O "O2'" . G   G 7  13  ? 92.002  33.283   36.812  1.00 0.00 ? 924  G   G "O2'" 1 
ATOM 7289  C "C1'" . G   G 7  13  ? 91.106  31.946   35.046  1.00 0.00 ? 924  G   G "C1'" 1 
ATOM 7290  N N9    . G   G 7  13  ? 89.980  32.053   34.094  1.00 0.00 ? 924  G   G N9    1 
ATOM 7291  C C8    . G   G 7  13  ? 89.015  31.116   33.788  1.00 0.00 ? 924  G   G C8    1 
ATOM 7292  N N7    . G   G 7  13  ? 88.149  31.544   32.909  1.00 0.00 ? 924  G   G N7    1 
ATOM 7293  C C5    . G   G 7  13  ? 88.549  32.826   32.622  1.00 0.00 ? 924  G   G C5    1 
ATOM 7294  C C6    . G   G 7  13  ? 87.947  33.759   31.756  1.00 0.00 ? 924  G   G C6    1 
ATOM 7295  O O6    . G   G 7  13  ? 86.930  33.540   31.093  1.00 0.00 ? 924  G   G O6    1 
ATOM 7296  N N1    . G   G 7  13  ? 88.679  34.970   31.751  1.00 0.00 ? 924  G   G N1    1 
ATOM 7297  C C2    . G   G 7  13  ? 89.837  35.241   32.498  1.00 0.00 ? 924  G   G C2    1 
ATOM 7298  N N2    . G   G 7  13  ? 90.371  36.482   32.330  1.00 0.00 ? 924  G   G N2    1 
ATOM 7299  N N3    . G   G 7  13  ? 90.378  34.317   33.328  1.00 0.00 ? 924  G   G N3    1 
ATOM 7300  C C4    . G   G 7  13  ? 89.687  33.161   33.338  1.00 0.00 ? 924  G   G C4    1 
ATOM 7301  P P     . C   G 7  14  ? 89.199  32.525   39.394  1.00 0.00 ? 925  C   G P     1 
ATOM 7302  O OP1   . C   G 7  14  ? 89.544  32.608   40.831  1.00 0.00 ? 925  C   G OP1   1 
ATOM 7303  O OP2   . C   G 7  14  ? 87.951  31.809   39.042  1.00 0.00 ? 925  C   G OP2   1 
ATOM 7304  O "O5'" . C   G 7  14  ? 89.130  33.985   38.793  1.00 0.00 ? 925  C   G "O5'" 1 
ATOM 7305  C "C5'" . C   G 7  14  ? 90.068  34.974   39.238  1.00 0.00 ? 925  C   G "C5'" 1 
ATOM 7306  C "C4'" . C   G 7  14  ? 89.877  36.272   38.445  1.00 0.00 ? 925  C   G "C4'" 1 
ATOM 7307  O "O4'" . C   G 7  14  ? 90.018  36.037   37.016  1.00 0.00 ? 925  C   G "O4'" 1 
ATOM 7308  C "C3'" . C   G 7  14  ? 88.504  36.946   38.552  1.00 0.00 ? 925  C   G "C3'" 1 
ATOM 7309  O "O3'" . C   G 7  14  ? 88.395  37.645   39.797  1.00 0.00 ? 925  C   G "O3'" 1 
ATOM 7310  C "C2'" . C   G 7  14  ? 88.538  37.842   37.325  1.00 0.00 ? 925  C   G "C2'" 1 
ATOM 7311  O "O2'" . C   G 7  14  ? 89.383  38.955   37.510  1.00 0.00 ? 925  C   G "O2'" 1 
ATOM 7312  C "C1'" . C   G 7  14  ? 89.141  36.907   36.307  1.00 0.00 ? 925  C   G "C1'" 1 
ATOM 7313  N N1    . C   G 7  14  ? 88.075  36.206   35.522  1.00 0.00 ? 925  C   G N1    1 
ATOM 7314  C C2    . C   G 7  14  ? 87.417  36.878   34.485  1.00 0.00 ? 925  C   G C2    1 
ATOM 7315  O O2    . C   G 7  14  ? 87.759  38.042   34.203  1.00 0.00 ? 925  C   G O2    1 
ATOM 7316  N N3    . C   G 7  14  ? 86.418  36.231   33.814  1.00 0.00 ? 925  C   G N3    1 
ATOM 7317  C C4    . C   G 7  14  ? 86.042  34.964   34.147  1.00 0.00 ? 925  C   G C4    1 
ATOM 7318  N N4    . C   G 7  14  ? 85.029  34.316   33.498  1.00 0.00 ? 925  C   G N4    1 
ATOM 7319  C C5    . C   G 7  14  ? 86.713  34.280   35.211  1.00 0.00 ? 925  C   G C5    1 
ATOM 7320  C C6    . C   G 7  14  ? 87.685  34.929   35.865  1.00 0.00 ? 925  C   G C6    1 
ATOM 7321  P P     . U   G 7  15  ? 86.950  37.915   40.399  1.00 0.00 ? 926  U   G P     1 
ATOM 7322  O OP1   . U   G 7  15  ? 87.104  38.615   41.694  1.00 0.00 ? 926  U   G OP1   1 
ATOM 7323  O OP2   . U   G 7  15  ? 86.186  36.647   40.408  1.00 0.00 ? 926  U   G OP2   1 
ATOM 7324  O "O5'" . U   G 7  15  ? 86.279  38.897   39.354  1.00 0.00 ? 926  U   G "O5'" 1 
ATOM 7325  C "C5'" . U   G 7  15  ? 86.641  40.284   39.368  1.00 0.00 ? 926  U   G "C5'" 1 
ATOM 7326  C "C4'" . U   G 7  15  ? 85.882  41.039   38.272  1.00 0.00 ? 926  U   G "C4'" 1 
ATOM 7327  O "O4'" . U   G 7  15  ? 86.158  40.478   36.959  1.00 0.00 ? 926  U   G "O4'" 1 
ATOM 7328  C "C3'" . U   G 7  15  ? 84.353  40.988   38.353  1.00 0.00 ? 926  U   G "C3'" 1 
ATOM 7329  O "O3'" . U   G 7  15  ? 83.891  41.883   39.371  1.00 0.00 ? 926  U   G "O3'" 1 
ATOM 7330  C "C2'" . U   G 7  15  ? 83.986  41.391   36.935  1.00 0.00 ? 926  U   G "C2'" 1 
ATOM 7331  O "O2'" . U   G 7  15  ? 84.178  42.771   36.715  1.00 0.00 ? 926  U   G "O2'" 1 
ATOM 7332  C "C1'" . U   G 7  15  ? 84.999  40.598   36.137  1.00 0.00 ? 926  U   G "C1'" 1 
ATOM 7333  N N1    . U   G 7  15  ? 84.426  39.282   35.705  1.00 0.00 ? 926  U   G N1    1 
ATOM 7334  C C2    . U   G 7  15  ? 83.575  39.281   34.607  1.00 0.00 ? 926  U   G C2    1 
ATOM 7335  O O2    . U   G 7  15  ? 83.322  40.304   33.973  1.00 0.00 ? 926  U   G O2    1 
ATOM 7336  N N3    . U   G 7  15  ? 83.018  38.036   34.301  1.00 0.00 ? 926  U   G N3    1 
ATOM 7337  C C4    . U   G 7  15  ? 83.156  36.843   35.028  1.00 0.00 ? 926  U   G C4    1 
ATOM 7338  O O4    . U   G 7  15  ? 82.541  35.824   34.708  1.00 0.00 ? 926  U   G O4    1 
ATOM 7339  C C5    . U   G 7  15  ? 84.067  36.946   36.141  1.00 0.00 ? 926  U   G C5    1 
ATOM 7340  C C6    . U   G 7  15  ? 84.651  38.122   36.424  1.00 0.00 ? 926  U   G C6    1 
ATOM 7341  P P     . G   G 7  16  ? 82.477  41.609   40.040  1.00 0.00 ? 927  G   G P     1 
ATOM 7342  O OP1   . G   G 7  16  ? 82.273  42.594   41.126  1.00 0.00 ? 927  G   G OP1   1 
ATOM 7343  O OP2   . G   G 7  16  ? 82.381  40.177   40.405  1.00 0.00 ? 927  G   G OP2   1 
ATOM 7344  O "O5'" . G   G 7  16  ? 81.447  41.898   38.872  1.00 0.00 ? 927  G   G "O5'" 1 
ATOM 7345  C "C5'" . G   G 7  16  ? 81.132  43.262   38.556  1.00 0.00 ? 927  G   G "C5'" 1 
ATOM 7346  C "C4'" . G   G 7  16  ? 80.147  43.315   37.384  1.00 0.00 ? 927  G   G "C4'" 1 
ATOM 7347  O "O4'" . G   G 7  16  ? 80.679  42.620   36.225  1.00 0.00 ? 927  G   G "O4'" 1 
ATOM 7348  C "C3'" . G   G 7  16  ? 78.790  42.639   37.606  1.00 0.00 ? 927  G   G "C3'" 1 
ATOM 7349  O "O3'" . G   G 7  16  ? 77.953  43.481   38.406  1.00 0.00 ? 927  G   G "O3'" 1 
ATOM 7350  C "C2'" . G   G 7  16  ? 78.330  42.468   36.169  1.00 0.00 ? 927  G   G "C2'" 1 
ATOM 7351  O "O2'" . G   G 7  16  ? 77.902  43.686   35.605  1.00 0.00 ? 927  G   G "O2'" 1 
ATOM 7352  C "C1'" . G   G 7  16  ? 79.610  42.019   35.508  1.00 0.00 ? 927  G   G "C1'" 1 
ATOM 7353  N N9    . G   G 7  16  ? 79.692  40.542   35.484  1.00 0.00 ? 927  G   G N9    1 
ATOM 7354  C C8    . G   G 7  16  ? 80.404  39.713   36.325  1.00 0.00 ? 927  G   G C8    1 
ATOM 7355  N N7    . G   G 7  16  ? 80.234  38.447   36.059  1.00 0.00 ? 927  G   G N7    1 
ATOM 7356  C C5    . G   G 7  16  ? 79.358  38.427   35.003  1.00 0.00 ? 927  G   G C5    1 
ATOM 7357  C C6    . G   G 7  16  ? 78.792  37.311   34.355  1.00 0.00 ? 927  G   G C6    1 
ATOM 7358  O O6    . G   G 7  16  ? 79.048  36.137   34.635  1.00 0.00 ? 927  G   G O6    1 
ATOM 7359  N N1    . G   G 7  16  ? 77.897  37.733   33.342  1.00 0.00 ? 927  G   G N1    1 
ATOM 7360  C C2    . G   G 7  16  ? 77.591  39.063   33.010  1.00 0.00 ? 927  G   G C2    1 
ATOM 7361  N N2    . G   G 7  16  ? 76.683  39.232   32.009  1.00 0.00 ? 927  G   G N2    1 
ATOM 7362  N N3    . G   G 7  16  ? 78.166  40.107   33.653  1.00 0.00 ? 927  G   G N3    1 
ATOM 7363  C C4    . G   G 7  16  ? 79.011  39.715   34.625  1.00 0.00 ? 927  G   G C4    1 
ATOM 7364  P P     . G   G 7  17  ? 76.729  42.835   39.187  1.00 0.00 ? 928  G   G P     1 
ATOM 7365  O OP1   . G   G 7  17  ? 76.120  43.877   40.044  1.00 0.00 ? 928  G   G OP1   1 
ATOM 7366  O OP2   . G   G 7  17  ? 77.181  41.595   39.858  1.00 0.00 ? 928  G   G OP2   1 
ATOM 7367  O "O5'" . G   G 7  17  ? 75.707  42.441   38.045  1.00 0.00 ? 928  G   G "O5'" 1 
ATOM 7368  C "C5'" . G   G 7  17  ? 74.899  43.465   37.447  1.00 0.00 ? 928  G   G "C5'" 1 
ATOM 7369  C "C4'" . G   G 7  17  ? 74.009  42.861   36.355  1.00 0.00 ? 928  G   G "C4'" 1 
ATOM 7370  O "O4'" . G   G 7  17  ? 74.803  42.119   35.393  1.00 0.00 ? 928  G   G "O4'" 1 
ATOM 7371  C "C3'" . G   G 7  17  ? 72.968  41.843   36.831  1.00 0.00 ? 928  G   G "C3'" 1 
ATOM 7372  O "O3'" . G   G 7  17  ? 71.834  42.538   37.364  1.00 0.00 ? 928  G   G "O3'" 1 
ATOM 7373  C "C2'" . G   G 7  17  ? 72.692  41.079   35.547  1.00 0.00 ? 928  G   G "C2'" 1 
ATOM 7374  O "O2'" . G   G 7  17  ? 71.854  41.805   34.678  1.00 0.00 ? 928  G   G "O2'" 1 
ATOM 7375  C "C1'" . G   G 7  17  ? 74.078  40.981   34.955  1.00 0.00 ? 928  G   G "C1'" 1 
ATOM 7376  N N9    . G   G 7  17  ? 74.742  39.708   35.321  1.00 0.00 ? 928  G   G N9    1 
ATOM 7377  C C8    . G   G 7  17  ? 75.747  39.509   36.247  1.00 0.00 ? 928  G   G C8    1 
ATOM 7378  N N7    . G   G 7  17  ? 76.124  38.264   36.336  1.00 0.00 ? 928  G   G N7    1 
ATOM 7379  C C5    . G   G 7  17  ? 75.334  37.596   35.437  1.00 0.00 ? 928  G   G C5    1 
ATOM 7380  C C6    . G   G 7  17  ? 75.330  36.222   35.131  1.00 0.00 ? 928  G   G C6    1 
ATOM 7381  O O6    . G   G 7  17  ? 76.096  35.395   35.633  1.00 0.00 ? 928  G   G O6    1 
ATOM 7382  N N1    . G   G 7  17  ? 74.311  35.930   34.195  1.00 0.00 ? 928  G   G N1    1 
ATOM 7383  C C2    . G   G 7  17  ? 73.439  36.859   33.603  1.00 0.00 ? 928  G   G C2    1 
ATOM 7384  N N2    . G   G 7  17  ? 72.524  36.340   32.737  1.00 0.00 ? 928  G   G N2    1 
ATOM 7385  N N3    . G   G 7  17  ? 73.518  38.185   33.881  1.00 0.00 ? 928  G   G N3    1 
ATOM 7386  C C4    . G   G 7  17  ? 74.457  38.465   34.805  1.00 0.00 ? 928  G   G C4    1 
ATOM 7387  P P     . C   G 7  18  ? 70.940  41.854   38.478  1.00 0.00 ? 929  C   G P     1 
ATOM 7388  O OP1   . C   G 7  18  ? 69.901  42.818   38.905  1.00 0.00 ? 929  C   G OP1   1 
ATOM 7389  O OP2   . C   G 7  18  ? 71.821  41.305   39.535  1.00 0.00 ? 929  C   G OP2   1 
ATOM 7390  O "O5'" . C   G 7  18  ? 70.248  40.649   37.724  1.00 0.00 ? 929  C   G "O5'" 1 
ATOM 7391  C "C5'" . C   G 7  18  ? 69.137  40.878   36.849  1.00 0.00 ? 929  C   G "C5'" 1 
ATOM 7392  C "C4'" . C   G 7  18  ? 68.653  39.546   36.261  1.00 0.00 ? 929  C   G "C4'" 1 
ATOM 7393  O "O4'" . C   G 7  18  ? 69.707  38.905   35.492  1.00 0.00 ? 929  C   G "O4'" 1 
ATOM 7394  C "C3'" . C   G 7  18  ? 68.254  38.478   37.286  1.00 0.00 ? 929  C   G "C3'" 1 
ATOM 7395  O "O3'" . C   G 7  18  ? 66.918  38.728   37.771  1.00 0.00 ? 929  C   G "O3'" 1 
ATOM 7396  C "C2'" . C   G 7  18  ? 68.391  37.202   36.479  1.00 0.00 ? 929  C   G "C2'" 1 
ATOM 7397  O "O2'" . C   G 7  18  ? 67.296  37.018   35.612  1.00 0.00 ? 929  C   G "O2'" 1 
ATOM 7398  C "C1'" . C   G 7  18  ? 69.642  37.493   35.674  1.00 0.00 ? 929  C   G "C1'" 1 
ATOM 7399  N N1    . C   G 7  18  ? 70.865  36.902   36.311  1.00 0.00 ? 929  C   G N1    1 
ATOM 7400  C C2    . C   G 7  18  ? 71.135  35.534   36.188  1.00 0.00 ? 929  C   G C2    1 
ATOM 7401  O O2    . C   G 7  18  ? 70.364  34.822   35.518  1.00 0.00 ? 929  C   G O2    1 
ATOM 7402  N N3    . C   G 7  18  ? 72.241  35.025   36.813  1.00 0.00 ? 929  C   G N3    1 
ATOM 7403  C C4    . C   G 7  18  ? 73.066  35.817   37.558  1.00 0.00 ? 929  C   G C4    1 
ATOM 7404  N N4    . C   G 7  18  ? 74.155  35.318   38.214  1.00 0.00 ? 929  C   G N4    1 
ATOM 7405  C C5    . C   G 7  18  ? 72.793  37.216   37.671  1.00 0.00 ? 929  C   G C5    1 
ATOM 7406  C C6    . C   G 7  18  ? 71.702  37.698   37.062  1.00 0.00 ? 929  C   G C6    1 
ATOM 7407  N N     . MET H 8  1   ? 66.542  -109.686 -13.770 1.00 0.00 ? 1    MET H N     1 
ATOM 7408  C CA    . MET H 8  1   ? 67.419  -109.205 -12.671 1.00 0.00 ? 1    MET H CA    1 
ATOM 7409  C C     . MET H 8  1   ? 67.741  -107.741 -12.818 1.00 0.00 ? 1    MET H C     1 
ATOM 7410  O O     . MET H 8  1   ? 68.805  -107.289 -12.402 1.00 0.00 ? 1    MET H O     1 
ATOM 7411  C CB    . MET H 8  1   ? 68.720  -110.050 -12.632 1.00 0.00 ? 1    MET H CB    1 
ATOM 7412  C CG    . MET H 8  1   ? 68.460  -111.552 -12.366 1.00 0.00 ? 1    MET H CG    1 
ATOM 7413  S SD    . MET H 8  1   ? 69.965  -112.573 -12.187 1.00 0.00 ? 1    MET H SD    1 
ATOM 7414  C CE    . MET H 8  1   ? 70.465  -111.975 -10.544 1.00 0.00 ? 1    MET H CE    1 
ATOM 7415  N N     . SER H 8  2   ? 66.801  -106.953 -13.397 1.00 0.00 ? 2    SER H N     1 
ATOM 7416  C CA    . SER H 8  2   ? 66.932  -105.526 -13.487 1.00 0.00 ? 2    SER H CA    1 
ATOM 7417  C C     . SER H 8  2   ? 65.563  -104.982 -13.771 1.00 0.00 ? 2    SER H C     1 
ATOM 7418  O O     . SER H 8  2   ? 64.713  -105.660 -14.347 1.00 0.00 ? 2    SER H O     1 
ATOM 7419  C CB    . SER H 8  2   ? 67.899  -105.049 -14.605 1.00 0.00 ? 2    SER H CB    1 
ATOM 7420  O OG    . SER H 8  2   ? 68.307  -103.698 -14.405 1.00 0.00 ? 2    SER H OG    1 
ATOM 7421  N N     . ARG H 8  3   ? 65.362  -103.707 -13.379 1.00 0.00 ? 3    ARG H N     1 
ATOM 7422  C CA    . ARG H 8  3   ? 64.125  -102.993 -13.475 1.00 0.00 ? 3    ARG H CA    1 
ATOM 7423  C C     . ARG H 8  3   ? 64.616  -101.571 -13.266 1.00 0.00 ? 3    ARG H C     1 
ATOM 7424  O O     . ARG H 8  3   ? 65.604  -101.254 -13.927 1.00 0.00 ? 3    ARG H O     1 
ATOM 7425  C CB    . ARG H 8  3   ? 63.069  -103.571 -12.487 1.00 0.00 ? 3    ARG H CB    1 
ATOM 7426  C CG    . ARG H 8  3   ? 63.543  -103.749 -11.032 1.00 0.00 ? 3    ARG H CG    1 
ATOM 7427  C CD    . ARG H 8  3   ? 62.440  -104.273 -10.097 1.00 0.00 ? 3    ARG H CD    1 
ATOM 7428  N NE    . ARG H 8  3   ? 61.497  -103.156 -9.732  1.00 0.00 ? 3    ARG H NE    1 
ATOM 7429  C CZ    . ARG H 8  3   ? 60.195  -103.071 -10.146 1.00 0.00 ? 3    ARG H CZ    1 
ATOM 7430  N NH1   . ARG H 8  3   ? 59.672  -103.945 -11.053 1.00 0.00 ? 3    ARG H NH1   1 
ATOM 7431  N NH2   . ARG H 8  3   ? 59.396  -102.091 -9.626  1.00 0.00 ? 3    ARG H NH2   1 
ATOM 7432  N N     . PRO H 8  4   ? 64.099  -100.648 -12.448 1.00 0.00 ? 4    PRO H N     1 
ATOM 7433  C CA    . PRO H 8  4   ? 64.807  -99.418  -12.125 1.00 0.00 ? 4    PRO H CA    1 
ATOM 7434  C C     . PRO H 8  4   ? 66.131  -99.526  -11.396 1.00 0.00 ? 4    PRO H C     1 
ATOM 7435  O O     . PRO H 8  4   ? 66.674  -98.459  -11.123 1.00 0.00 ? 4    PRO H O     1 
ATOM 7436  C CB    . PRO H 8  4   ? 63.810  -98.651  -11.259 1.00 0.00 ? 4    PRO H CB    1 
ATOM 7437  C CG    . PRO H 8  4   ? 62.487  -98.949  -11.951 1.00 0.00 ? 4    PRO H CG    1 
ATOM 7438  C CD    . PRO H 8  4   ? 62.652  -100.432 -12.303 1.00 0.00 ? 4    PRO H CD    1 
ATOM 7439  N N     . GLN H 8  5   ? 66.659  -100.737 -11.056 1.00 0.00 ? 5    GLN H N     1 
ATOM 7440  C CA    . GLN H 8  5   ? 67.950  -100.962 -10.415 1.00 0.00 ? 5    GLN H CA    1 
ATOM 7441  C C     . GLN H 8  5   ? 69.091  -100.148 -11.002 1.00 0.00 ? 5    GLN H C     1 
ATOM 7442  O O     . GLN H 8  5   ? 69.165  -99.934  -12.212 1.00 0.00 ? 5    GLN H O     1 
ATOM 7443  C CB    . GLN H 8  5   ? 68.362  -102.456 -10.406 1.00 0.00 ? 5    GLN H CB    1 
ATOM 7444  C CG    . GLN H 8  5   ? 67.439  -103.335 -9.535  1.00 0.00 ? 5    GLN H CG    1 
ATOM 7445  C CD    . GLN H 8  5   ? 67.732  -104.831 -9.728  1.00 0.00 ? 5    GLN H CD    1 
ATOM 7446  O OE1   . GLN H 8  5   ? 66.799  -105.619 -9.927  1.00 0.00 ? 5    GLN H OE1   1 
ATOM 7447  N NE2   . GLN H 8  5   ? 69.041  -105.221 -9.662  1.00 0.00 ? 5    GLN H NE2   1 
ATOM 7448  N N     . VAL H 8  6   ? 69.992  -99.662  -10.112 1.00 0.00 ? 6    VAL H N     1 
ATOM 7449  C CA    . VAL H 8  6   ? 70.987  -98.646  -10.394 1.00 0.00 ? 6    VAL H CA    1 
ATOM 7450  C C     . VAL H 8  6   ? 72.299  -99.213  -9.901  1.00 0.00 ? 6    VAL H C     1 
ATOM 7451  O O     . VAL H 8  6   ? 72.311  -100.133 -9.086  1.00 0.00 ? 6    VAL H O     1 
ATOM 7452  C CB    . VAL H 8  6   ? 70.633  -97.329  -9.670  1.00 0.00 ? 6    VAL H CB    1 
ATOM 7453  C CG1   . VAL H 8  6   ? 71.713  -96.230  -9.755  1.00 0.00 ? 6    VAL H CG1   1 
ATOM 7454  C CG2   . VAL H 8  6   ? 69.312  -96.792  -10.251 1.00 0.00 ? 6    VAL H CG2   1 
ATOM 7455  N N     . THR H 8  7   ? 73.434  -98.671  -10.417 1.00 0.00 ? 7    THR H N     1 
ATOM 7456  C CA    . THR H 8  7   ? 74.778  -98.941  -9.956  1.00 0.00 ? 7    THR H CA    1 
ATOM 7457  C C     . THR H 8  7   ? 75.122  -97.880  -8.929  1.00 0.00 ? 7    THR H C     1 
ATOM 7458  O O     . THR H 8  7   ? 74.974  -96.689  -9.196  1.00 0.00 ? 7    THR H O     1 
ATOM 7459  C CB    . THR H 8  7   ? 75.811  -98.893  -11.083 1.00 0.00 ? 7    THR H CB    1 
ATOM 7460  O OG1   . THR H 8  7   ? 75.613  -97.773  -11.943 1.00 0.00 ? 7    THR H OG1   1 
ATOM 7461  C CG2   . THR H 8  7   ? 75.701  -100.182 -11.921 1.00 0.00 ? 7    THR H CG2   1 
ATOM 7462  N N     . VAL H 8  8   ? 75.594  -98.287  -7.717  1.00 0.00 ? 8    VAL H N     1 
ATOM 7463  C CA    . VAL H 8  8   ? 75.999  -97.372  -6.660  1.00 0.00 ? 8    VAL H CA    1 
ATOM 7464  C C     . VAL H 8  8   ? 77.208  -96.597  -7.089  1.00 0.00 ? 8    VAL H C     1 
ATOM 7465  O O     . VAL H 8  8   ? 78.016  -97.095  -7.871  1.00 0.00 ? 8    VAL H O     1 
ATOM 7466  C CB    . VAL H 8  8   ? 76.219  -98.035  -5.293  1.00 0.00 ? 8    VAL H CB    1 
ATOM 7467  C CG1   . VAL H 8  8   ? 77.539  -98.834  -5.244  1.00 0.00 ? 8    VAL H CG1   1 
ATOM 7468  C CG2   . VAL H 8  8   ? 76.120  -97.009  -4.140  1.00 0.00 ? 8    VAL H CG2   1 
ATOM 7469  N N     . HIS H 8  9   ? 77.334  -95.346  -6.603  1.00 0.00 ? 9    HIS H N     1 
ATOM 7470  C CA    . HIS H 8  9   ? 78.519  -94.572  -6.811  1.00 0.00 ? 9    HIS H CA    1 
ATOM 7471  C C     . HIS H 8  9   ? 78.843  -93.964  -5.497  1.00 0.00 ? 9    HIS H C     1 
ATOM 7472  O O     . HIS H 8  9   ? 78.023  -93.306  -4.861  1.00 0.00 ? 9    HIS H O     1 
ATOM 7473  C CB    . HIS H 8  9   ? 78.371  -93.500  -7.896  1.00 0.00 ? 9    HIS H CB    1 
ATOM 7474  C CG    . HIS H 8  9   ? 78.143  -94.179  -9.212  1.00 0.00 ? 9    HIS H CG    1 
ATOM 7475  N ND1   . HIS H 8  9   ? 79.122  -94.815  -9.945  1.00 0.00 ? 9    HIS H ND1   1 
ATOM 7476  C CD2   . HIS H 8  9   ? 76.973  -94.439  -9.851  1.00 0.00 ? 9    HIS H CD2   1 
ATOM 7477  C CE1   . HIS H 8  9   ? 78.498  -95.413  -10.990 1.00 0.00 ? 9    HIS H CE1   1 
ATOM 7478  N NE2   . HIS H 8  9   ? 77.195  -95.216  -10.972 1.00 0.00 ? 9    HIS H NE2   1 
ATOM 7479  N N     . SER H 8  10  ? 80.087  -94.230  -5.062  1.00 0.00 ? 10   SER H N     1 
ATOM 7480  C CA    . SER H 8  10  ? 80.633  -93.791  -3.812  1.00 0.00 ? 10   SER H CA    1 
ATOM 7481  C C     . SER H 8  10  ? 81.363  -92.493  -4.044  1.00 0.00 ? 10   SER H C     1 
ATOM 7482  O O     . SER H 8  10  ? 81.471  -92.031  -5.180  1.00 0.00 ? 10   SER H O     1 
ATOM 7483  C CB    . SER H 8  10  ? 81.536  -94.881  -3.172  1.00 0.00 ? 10   SER H CB    1 
ATOM 7484  O OG    . SER H 8  10  ? 82.442  -95.453  -4.105  1.00 0.00 ? 10   SER H OG    1 
ATOM 7485  N N     . LEU H 8  11  ? 81.871  -91.865  -2.953  1.00 0.00 ? 11   LEU H N     1 
ATOM 7486  C CA    . LEU H 8  11  ? 82.719  -90.692  -3.039  1.00 0.00 ? 11   LEU H CA    1 
ATOM 7487  C C     . LEU H 8  11  ? 84.156  -91.118  -2.900  1.00 0.00 ? 11   LEU H C     1 
ATOM 7488  O O     . LEU H 8  11  ? 85.060  -90.285  -2.925  1.00 0.00 ? 11   LEU H O     1 
ATOM 7489  C CB    . LEU H 8  11  ? 82.366  -89.584  -2.006  1.00 0.00 ? 11   LEU H CB    1 
ATOM 7490  C CG    . LEU H 8  11  ? 82.373  -89.940  -0.494  1.00 0.00 ? 11   LEU H CG    1 
ATOM 7491  C CD1   . LEU H 8  11  ? 83.774  -89.935  0.152   1.00 0.00 ? 11   LEU H CD1   1 
ATOM 7492  C CD2   . LEU H 8  11  ? 81.453  -88.972  0.279   1.00 0.00 ? 11   LEU H CD2   1 
ATOM 7493  N N     . THR H 8  12  ? 84.393  -92.449  -2.788  1.00 0.00 ? 12   THR H N     1 
ATOM 7494  C CA    . THR H 8  12  ? 85.703  -93.029  -2.684  1.00 0.00 ? 12   THR H CA    1 
ATOM 7495  C C     . THR H 8  12  ? 86.431  -93.363  -3.998  1.00 0.00 ? 12   THR H C     1 
ATOM 7496  O O     . THR H 8  12  ? 87.643  -93.554  -3.915  1.00 0.00 ? 12   THR H O     1 
ATOM 7497  C CB    . THR H 8  12  ? 85.701  -94.248  -1.759  1.00 0.00 ? 12   THR H CB    1 
ATOM 7498  O OG1   . THR H 8  12  ? 84.948  -95.333  -2.291  1.00 0.00 ? 12   THR H OG1   1 
ATOM 7499  C CG2   . THR H 8  12  ? 85.103  -93.841  -0.391  1.00 0.00 ? 12   THR H CG2   1 
ATOM 7500  N N     . GLY H 8  13  ? 85.862  -93.444  -5.246  1.00 0.00 ? 13   GLY H N     1 
ATOM 7501  C CA    . GLY H 8  13  ? 84.506  -93.355  -5.728  1.00 0.00 ? 13   GLY H CA    1 
ATOM 7502  C C     . GLY H 8  13  ? 84.468  -92.824  -7.136  1.00 0.00 ? 13   GLY H C     1 
ATOM 7503  O O     . GLY H 8  13  ? 84.044  -91.683  -7.317  1.00 0.00 ? 13   GLY H O     1 
ATOM 7504  N N     . GLU H 8  14  ? 84.877  -93.564  -8.211  1.00 0.00 ? 14   GLU H N     1 
ATOM 7505  C CA    . GLU H 8  14  ? 85.505  -94.867  -8.322  1.00 0.00 ? 14   GLU H CA    1 
ATOM 7506  C C     . GLU H 8  14  ? 84.750  -95.991  -7.663  1.00 0.00 ? 14   GLU H C     1 
ATOM 7507  O O     . GLU H 8  14  ? 85.212  -96.602  -6.701  1.00 0.00 ? 14   GLU H O     1 
ATOM 7508  C CB    . GLU H 8  14  ? 87.034  -94.924  -8.064  1.00 0.00 ? 14   GLU H CB    1 
ATOM 7509  C CG    . GLU H 8  14  ? 87.873  -93.992  -8.970  1.00 0.00 ? 14   GLU H CG    1 
ATOM 7510  C CD    . GLU H 8  14  ? 87.784  -92.527  -8.536  1.00 0.00 ? 14   GLU H CD    1 
ATOM 7511  O OE1   . GLU H 8  14  ? 88.171  -92.224  -7.375  1.00 0.00 ? 14   GLU H OE1   1 
ATOM 7512  O OE2   . GLU H 8  14  ? 87.330  -91.691  -9.362  1.00 0.00 ? 14   GLU H OE2   1 
ATOM 7513  N N     . ALA H 8  15  ? 83.528  -96.248  -8.184  1.00 0.00 ? 15   ALA H N     1 
ATOM 7514  C CA    . ALA H 8  15  ? 82.566  -97.189  -7.661  1.00 0.00 ? 15   ALA H CA    1 
ATOM 7515  C C     . ALA H 8  15  ? 82.931  -98.630  -7.917  1.00 0.00 ? 15   ALA H C     1 
ATOM 7516  O O     . ALA H 8  15  ? 83.813  -98.917  -8.728  1.00 0.00 ? 15   ALA H O     1 
ATOM 7517  C CB    . ALA H 8  15  ? 81.190  -96.952  -8.293  1.00 0.00 ? 15   ALA H CB    1 
ATOM 7518  N N     . THR H 8  16  ? 82.249  -99.566  -7.198  1.00 0.00 ? 16   THR H N     1 
ATOM 7519  C CA    . THR H 8  16  ? 82.538  -100.983 -7.288  1.00 0.00 ? 16   THR H CA    1 
ATOM 7520  C C     . THR H 8  16  ? 81.289  -101.843 -7.380  1.00 0.00 ? 16   THR H C     1 
ATOM 7521  O O     . THR H 8  16  ? 81.350  -102.894 -8.015  1.00 0.00 ? 16   THR H O     1 
ATOM 7522  C CB    . THR H 8  16  ? 83.309  -101.479 -6.059  1.00 0.00 ? 16   THR H CB    1 
ATOM 7523  O OG1   . THR H 8  16  ? 82.684  -101.076 -4.841  1.00 0.00 ? 16   THR H OG1   1 
ATOM 7524  C CG2   . THR H 8  16  ? 84.751  -100.929 -6.088  1.00 0.00 ? 16   THR H CG2   1 
ATOM 7525  N N     . ALA H 8  17  ? 80.141  -101.451 -6.765  1.00 0.00 ? 17   ALA H N     1 
ATOM 7526  C CA    . ALA H 8  17  ? 79.052  -102.389 -6.536  1.00 0.00 ? 17   ALA H CA    1 
ATOM 7527  C C     . ALA H 8  17  ? 77.785  -101.890 -7.185  1.00 0.00 ? 17   ALA H C     1 
ATOM 7528  O O     . ALA H 8  17  ? 77.835  -101.281 -8.254  1.00 0.00 ? 17   ALA H O     1 
ATOM 7529  C CB    . ALA H 8  17  ? 78.830  -102.643 -5.029  1.00 0.00 ? 17   ALA H CB    1 
ATOM 7530  N N     . ASN H 8  18  ? 76.609  -102.169 -6.559  1.00 0.00 ? 18   ASN H N     1 
ATOM 7531  C CA    . ASN H 8  18  ? 75.312  -101.818 -7.091  1.00 0.00 ? 18   ASN H CA    1 
ATOM 7532  C C     . ASN H 8  18  ? 74.502  -101.195 -5.984  1.00 0.00 ? 18   ASN H C     1 
ATOM 7533  O O     . ASN H 8  18  ? 74.760  -101.399 -4.798  1.00 0.00 ? 18   ASN H O     1 
ATOM 7534  C CB    . ASN H 8  18  ? 74.510  -103.032 -7.631  1.00 0.00 ? 18   ASN H CB    1 
ATOM 7535  C CG    . ASN H 8  18  ? 75.068  -103.477 -8.989  1.00 0.00 ? 18   ASN H CG    1 
ATOM 7536  O OD1   . ASN H 8  18  ? 74.734  -102.875 -10.016 1.00 0.00 ? 18   ASN H OD1   1 
ATOM 7537  N ND2   . ASN H 8  18  ? 75.922  -104.544 -8.988  1.00 0.00 ? 18   ASN H ND2   1 
ATOM 7538  N N     . ALA H 8  19  ? 73.505  -100.379 -6.403  1.00 0.00 ? 19   ALA H N     1 
ATOM 7539  C CA    . ALA H 8  19  ? 72.618  -99.610  -5.568  1.00 0.00 ? 19   ALA H CA    1 
ATOM 7540  C C     . ALA H 8  19  ? 71.285  -100.285 -5.523  1.00 0.00 ? 19   ALA H C     1 
ATOM 7541  O O     . ALA H 8  19  ? 71.035  -101.277 -6.207  1.00 0.00 ? 19   ALA H O     1 
ATOM 7542  C CB    . ALA H 8  19  ? 72.377  -98.174  -6.088  1.00 0.00 ? 19   ALA H CB    1 
ATOM 7543  N N     . LEU H 8  20  ? 70.383  -99.709  -4.696  1.00 0.00 ? 20   LEU H N     1 
ATOM 7544  C CA    . LEU H 8  20  ? 68.992  -100.067 -4.601  1.00 0.00 ? 20   LEU H CA    1 
ATOM 7545  C C     . LEU H 8  20  ? 68.265  -99.410  -5.762  1.00 0.00 ? 20   LEU H C     1 
ATOM 7546  O O     . LEU H 8  20  ? 68.808  -98.457  -6.323  1.00 0.00 ? 20   LEU H O     1 
ATOM 7547  C CB    . LEU H 8  20  ? 68.391  -99.572  -3.261  1.00 0.00 ? 20   LEU H CB    1 
ATOM 7548  C CG    . LEU H 8  20  ? 69.045  -100.195 -2.003  1.00 0.00 ? 20   LEU H CG    1 
ATOM 7549  C CD1   . LEU H 8  20  ? 68.485  -99.540  -0.725  1.00 0.00 ? 20   LEU H CD1   1 
ATOM 7550  C CD2   . LEU H 8  20  ? 68.897  -101.729 -1.950  1.00 0.00 ? 20   LEU H CD2   1 
ATOM 7551  N N     . PRO H 8  21  ? 67.077  -99.873  -6.177  1.00 0.00 ? 21   PRO H N     1 
ATOM 7552  C CA    . PRO H 8  21  ? 66.243  -99.278  -7.219  1.00 0.00 ? 21   PRO H CA    1 
ATOM 7553  C C     . PRO H 8  21  ? 66.065  -97.784  -7.176  1.00 0.00 ? 21   PRO H C     1 
ATOM 7554  O O     . PRO H 8  21  ? 66.135  -97.195  -6.100  1.00 0.00 ? 21   PRO H O     1 
ATOM 7555  C CB    . PRO H 8  21  ? 64.893  -99.984  -7.079  1.00 0.00 ? 21   PRO H CB    1 
ATOM 7556  C CG    . PRO H 8  21  ? 65.267  -101.379 -6.575  1.00 0.00 ? 21   PRO H CG    1 
ATOM 7557  C CD    . PRO H 8  21  ? 66.460  -101.096 -5.656  1.00 0.00 ? 21   PRO H CD    1 
ATOM 7558  N N     . LEU H 8  22  ? 65.824  -97.162  -8.354  1.00 0.00 ? 22   LEU H N     1 
ATOM 7559  C CA    . LEU H 8  22  ? 65.494  -95.763  -8.464  1.00 0.00 ? 22   LEU H CA    1 
ATOM 7560  C C     . LEU H 8  22  ? 64.006  -95.708  -8.180  1.00 0.00 ? 22   LEU H C     1 
ATOM 7561  O O     . LEU H 8  22  ? 63.320  -96.606  -8.668  1.00 0.00 ? 22   LEU H O     1 
ATOM 7562  C CB    . LEU H 8  22  ? 65.792  -95.218  -9.887  1.00 0.00 ? 22   LEU H CB    1 
ATOM 7563  C CG    . LEU H 8  22  ? 65.758  -93.678  -10.052 1.00 0.00 ? 22   LEU H CG    1 
ATOM 7564  C CD1   . LEU H 8  22  ? 66.834  -92.965  -9.207  1.00 0.00 ? 22   LEU H CD1   1 
ATOM 7565  C CD2   . LEU H 8  22  ? 65.899  -93.285  -11.536 1.00 0.00 ? 22   LEU H CD2   1 
ATOM 7566  N N     . PRO H 8  23  ? 63.443  -94.778  -7.402  1.00 0.00 ? 23   PRO H N     1 
ATOM 7567  C CA    . PRO H 8  23  ? 62.068  -94.861  -6.926  1.00 0.00 ? 23   PRO H CA    1 
ATOM 7568  C C     . PRO H 8  23  ? 61.018  -94.923  -8.008  1.00 0.00 ? 23   PRO H C     1 
ATOM 7569  O O     . PRO H 8  23  ? 61.286  -94.522  -9.141  1.00 0.00 ? 23   PRO H O     1 
ATOM 7570  C CB    . PRO H 8  23  ? 61.876  -93.590  -6.089  1.00 0.00 ? 23   PRO H CB    1 
ATOM 7571  C CG    . PRO H 8  23  ? 63.276  -93.265  -5.566  1.00 0.00 ? 23   PRO H CG    1 
ATOM 7572  C CD    . PRO H 8  23  ? 64.186  -93.723  -6.706  1.00 0.00 ? 23   PRO H CD    1 
ATOM 7573  N N     . ALA H 8  24  ? 59.801  -95.386  -7.634  1.00 0.00 ? 24   ALA H N     1 
ATOM 7574  C CA    . ALA H 8  24  ? 58.631  -95.349  -8.477  1.00 0.00 ? 24   ALA H CA    1 
ATOM 7575  C C     . ALA H 8  24  ? 57.986  -93.984  -8.366  1.00 0.00 ? 24   ALA H C     1 
ATOM 7576  O O     . ALA H 8  24  ? 57.105  -93.642  -9.151  1.00 0.00 ? 24   ALA H O     1 
ATOM 7577  C CB    . ALA H 8  24  ? 57.595  -96.399  -8.032  1.00 0.00 ? 24   ALA H CB    1 
ATOM 7578  N N     . VAL H 8  25  ? 58.459  -93.169  -7.388  1.00 0.00 ? 25   VAL H N     1 
ATOM 7579  C CA    . VAL H 8  25  ? 58.006  -91.838  -7.061  1.00 0.00 ? 25   VAL H CA    1 
ATOM 7580  C C     . VAL H 8  25  ? 58.689  -90.855  -7.994  1.00 0.00 ? 25   VAL H C     1 
ATOM 7581  O O     . VAL H 8  25  ? 58.313  -89.687  -8.077  1.00 0.00 ? 25   VAL H O     1 
ATOM 7582  C CB    . VAL H 8  25  ? 58.363  -91.493  -5.609  1.00 0.00 ? 25   VAL H CB    1 
ATOM 7583  C CG1   . VAL H 8  25  ? 57.785  -90.127  -5.168  1.00 0.00 ? 25   VAL H CG1   1 
ATOM 7584  C CG2   . VAL H 8  25  ? 57.858  -92.609  -4.666  1.00 0.00 ? 25   VAL H CG2   1 
ATOM 7585  N N     . PHE H 8  26  ? 59.695  -91.323  -8.776  1.00 0.00 ? 26   PHE H N     1 
ATOM 7586  C CA    . PHE H 8  26  ? 60.500  -90.482  -9.631  1.00 0.00 ? 26   PHE H CA    1 
ATOM 7587  C C     . PHE H 8  26  ? 59.865  -90.449  -11.005 1.00 0.00 ? 26   PHE H C     1 
ATOM 7588  O O     . PHE H 8  26  ? 60.404  -89.829  -11.921 1.00 0.00 ? 26   PHE H O     1 
ATOM 7589  C CB    . PHE H 8  26  ? 61.963  -91.014  -9.778  1.00 0.00 ? 26   PHE H CB    1 
ATOM 7590  C CG    . PHE H 8  26  ? 62.944  -90.411  -8.790  1.00 0.00 ? 26   PHE H CG    1 
ATOM 7591  C CD1   . PHE H 8  26  ? 62.645  -90.227  -7.427  1.00 0.00 ? 26   PHE H CD1   1 
ATOM 7592  C CD2   . PHE H 8  26  ? 64.232  -90.058  -9.242  1.00 0.00 ? 26   PHE H CD2   1 
ATOM 7593  C CE1   . PHE H 8  26  ? 63.605  -89.707  -6.546  1.00 0.00 ? 26   PHE H CE1   1 
ATOM 7594  C CE2   . PHE H 8  26  ? 65.186  -89.528  -8.368  1.00 0.00 ? 26   PHE H CE2   1 
ATOM 7595  C CZ    . PHE H 8  26  ? 64.873  -89.354  -7.017  1.00 0.00 ? 26   PHE H CZ    1 
ATOM 7596  N N     . SER H 8  27  ? 58.674  -91.076  -11.165 1.00 0.00 ? 27   SER H N     1 
ATOM 7597  C CA    . SER H 8  27  ? 57.912  -91.043  -12.384 1.00 0.00 ? 27   SER H CA    1 
ATOM 7598  C C     . SER H 8  27  ? 56.632  -90.325  -12.072 1.00 0.00 ? 27   SER H C     1 
ATOM 7599  O O     . SER H 8  27  ? 56.153  -90.356  -10.939 1.00 0.00 ? 27   SER H O     1 
ATOM 7600  C CB    . SER H 8  27  ? 57.588  -92.448  -12.938 1.00 0.00 ? 27   SER H CB    1 
ATOM 7601  O OG    . SER H 8  27  ? 58.788  -93.123  -13.292 1.00 0.00 ? 27   SER H OG    1 
ATOM 7602  N N     . ALA H 8  28  ? 56.098  -89.647  -13.114 1.00 0.00 ? 28   ALA H N     1 
ATOM 7603  C CA    . ALA H 8  28  ? 54.960  -88.760  -13.123 1.00 0.00 ? 28   ALA H CA    1 
ATOM 7604  C C     . ALA H 8  28  ? 55.319  -87.795  -14.220 1.00 0.00 ? 28   ALA H C     1 
ATOM 7605  O O     . ALA H 8  28  ? 56.513  -87.585  -14.441 1.00 0.00 ? 28   ALA H O     1 
ATOM 7606  C CB    . ALA H 8  28  ? 54.684  -87.928  -11.846 1.00 0.00 ? 28   ALA H CB    1 
ATOM 7607  N N     . PRO H 8  29  ? 54.393  -87.184  -14.955 1.00 0.00 ? 29   PRO H N     1 
ATOM 7608  C CA    . PRO H 8  29  ? 54.734  -86.237  -16.001 1.00 0.00 ? 29   PRO H CA    1 
ATOM 7609  C C     . PRO H 8  29  ? 55.177  -84.948  -15.354 1.00 0.00 ? 29   PRO H C     1 
ATOM 7610  O O     . PRO H 8  29  ? 54.579  -84.533  -14.360 1.00 0.00 ? 29   PRO H O     1 
ATOM 7611  C CB    . PRO H 8  29  ? 53.425  -86.064  -16.784 1.00 0.00 ? 29   PRO H CB    1 
ATOM 7612  C CG    . PRO H 8  29  ? 52.314  -86.341  -15.763 1.00 0.00 ? 29   PRO H CG    1 
ATOM 7613  C CD    . PRO H 8  29  ? 52.947  -87.372  -14.822 1.00 0.00 ? 29   PRO H CD    1 
ATOM 7614  N N     . ILE H 8  30  ? 56.250  -84.322  -15.894 1.00 0.00 ? 30   ILE H N     1 
ATOM 7615  C CA    . ILE H 8  30  ? 56.823  -83.125  -15.335 1.00 0.00 ? 30   ILE H CA    1 
ATOM 7616  C C     . ILE H 8  30  ? 55.944  -81.973  -15.755 1.00 0.00 ? 30   ILE H C     1 
ATOM 7617  O O     . ILE H 8  30  ? 55.717  -81.731  -16.941 1.00 0.00 ? 30   ILE H O     1 
ATOM 7618  C CB    . ILE H 8  30  ? 58.301  -82.951  -15.674 1.00 0.00 ? 30   ILE H CB    1 
ATOM 7619  C CG1   . ILE H 8  30  ? 58.918  -81.777  -14.877 1.00 0.00 ? 30   ILE H CG1   1 
ATOM 7620  C CG2   . ILE H 8  30  ? 58.539  -82.858  -17.200 1.00 0.00 ? 30   ILE H CG2   1 
ATOM 7621  C CD1   . ILE H 8  30  ? 60.446  -81.724  -14.963 1.00 0.00 ? 30   ILE H CD1   1 
ATOM 7622  N N     . ARG H 8  31  ? 55.362  -81.289  -14.746 1.00 0.00 ? 31   ARG H N     1 
ATOM 7623  C CA    . ARG H 8  31  ? 54.272  -80.376  -14.946 1.00 0.00 ? 31   ARG H CA    1 
ATOM 7624  C C     . ARG H 8  31  ? 54.743  -79.052  -14.400 1.00 0.00 ? 31   ARG H C     1 
ATOM 7625  O O     . ARG H 8  31  ? 55.011  -78.977  -13.201 1.00 0.00 ? 31   ARG H O     1 
ATOM 7626  C CB    . ARG H 8  31  ? 53.000  -80.852  -14.207 1.00 0.00 ? 31   ARG H CB    1 
ATOM 7627  C CG    . ARG H 8  31  ? 51.800  -79.902  -14.343 1.00 0.00 ? 31   ARG H CG    1 
ATOM 7628  C CD    . ARG H 8  31  ? 50.435  -80.605  -14.298 1.00 0.00 ? 31   ARG H CD    1 
ATOM 7629  N NE    . ARG H 8  31  ? 50.219  -81.340  -15.593 1.00 0.00 ? 31   ARG H NE    1 
ATOM 7630  C CZ    . ARG H 8  31  ? 49.658  -80.763  -16.702 1.00 0.00 ? 31   ARG H CZ    1 
ATOM 7631  N NH1   . ARG H 8  31  ? 49.152  -79.496  -16.671 1.00 0.00 ? 31   ARG H NH1   1 
ATOM 7632  N NH2   . ARG H 8  31  ? 49.608  -81.469  -17.870 1.00 0.00 ? 31   ARG H NH2   1 
ATOM 7633  N N     . PRO H 8  32  ? 54.879  -77.991  -15.201 1.00 0.00 ? 32   PRO H N     1 
ATOM 7634  C CA    . PRO H 8  32  ? 55.590  -76.800  -14.774 1.00 0.00 ? 32   PRO H CA    1 
ATOM 7635  C C     . PRO H 8  32  ? 54.616  -75.814  -14.193 1.00 0.00 ? 32   PRO H C     1 
ATOM 7636  O O     . PRO H 8  32  ? 55.063  -74.903  -13.500 1.00 0.00 ? 32   PRO H O     1 
ATOM 7637  C CB    . PRO H 8  32  ? 56.194  -76.234  -16.068 1.00 0.00 ? 32   PRO H CB    1 
ATOM 7638  C CG    . PRO H 8  32  ? 55.243  -76.696  -17.173 1.00 0.00 ? 32   PRO H CG    1 
ATOM 7639  C CD    . PRO H 8  32  ? 54.804  -78.068  -16.666 1.00 0.00 ? 32   PRO H CD    1 
ATOM 7640  N N     . ASP H 8  33  ? 53.300  -75.939  -14.490 1.00 0.00 ? 33   ASP H N     1 
ATOM 7641  C CA    . ASP H 8  33  ? 52.283  -75.053  -13.975 1.00 0.00 ? 33   ASP H CA    1 
ATOM 7642  C C     . ASP H 8  33  ? 52.065  -75.289  -12.504 1.00 0.00 ? 33   ASP H C     1 
ATOM 7643  O O     . ASP H 8  33  ? 51.966  -74.325  -11.752 1.00 0.00 ? 33   ASP H O     1 
ATOM 7644  C CB    . ASP H 8  33  ? 50.944  -75.088  -14.762 1.00 0.00 ? 33   ASP H CB    1 
ATOM 7645  C CG    . ASP H 8  33  ? 50.481  -76.510  -15.081 1.00 0.00 ? 33   ASP H CG    1 
ATOM 7646  O OD1   . ASP H 8  33  ? 50.970  -77.067  -16.100 1.00 0.00 ? 33   ASP H OD1   1 
ATOM 7647  O OD2   . ASP H 8  33  ? 49.631  -77.050  -14.324 1.00 0.00 ? 33   ASP H OD2   1 
ATOM 7648  N N     . ILE H 8  34  ? 52.027  -76.573  -12.054 1.00 0.00 ? 34   ILE H N     1 
ATOM 7649  C CA    . ILE H 8  34  ? 51.909  -76.932  -10.653 1.00 0.00 ? 34   ILE H CA    1 
ATOM 7650  C C     . ILE H 8  34  ? 53.162  -76.527  -9.922  1.00 0.00 ? 34   ILE H C     1 
ATOM 7651  O O     . ILE H 8  34  ? 53.083  -76.025  -8.805  1.00 0.00 ? 34   ILE H O     1 
ATOM 7652  C CB    . ILE H 8  34  ? 51.583  -78.412  -10.414 1.00 0.00 ? 34   ILE H CB    1 
ATOM 7653  C CG1   . ILE H 8  34  ? 50.164  -78.703  -10.966 1.00 0.00 ? 34   ILE H CG1   1 
ATOM 7654  C CG2   . ILE H 8  34  ? 51.678  -78.765  -8.906  1.00 0.00 ? 34   ILE H CG2   1 
ATOM 7655  C CD1   . ILE H 8  34  ? 49.697  -80.152  -10.789 1.00 0.00 ? 34   ILE H CD1   1 
ATOM 7656  N N     . VAL H 8  35  ? 54.352  -76.716  -10.546 1.00 0.00 ? 35   VAL H N     1 
ATOM 7657  C CA    . VAL H 8  35  ? 55.634  -76.430  -9.938  1.00 0.00 ? 35   VAL H CA    1 
ATOM 7658  C C     . VAL H 8  35  ? 55.775  -74.955  -9.617  1.00 0.00 ? 35   VAL H C     1 
ATOM 7659  O O     . VAL H 8  35  ? 56.314  -74.595  -8.572  1.00 0.00 ? 35   VAL H O     1 
ATOM 7660  C CB    . VAL H 8  35  ? 56.799  -77.009  -10.757 1.00 0.00 ? 35   VAL H CB    1 
ATOM 7661  C CG1   . VAL H 8  35  ? 57.712  -75.959  -11.432 1.00 0.00 ? 35   VAL H CG1   1 
ATOM 7662  C CG2   . VAL H 8  35  ? 57.608  -77.949  -9.844  1.00 0.00 ? 35   VAL H CG2   1 
ATOM 7663  N N     . HIS H 8  36  ? 55.259  -74.075  -10.514 1.00 0.00 ? 36   HIS H N     1 
ATOM 7664  C CA    . HIS H 8  36  ? 55.292  -72.641  -10.370 1.00 0.00 ? 36   HIS H CA    1 
ATOM 7665  C C     . HIS H 8  36  ? 54.295  -72.160  -9.349  1.00 0.00 ? 36   HIS H C     1 
ATOM 7666  O O     . HIS H 8  36  ? 54.597  -71.252  -8.577  1.00 0.00 ? 36   HIS H O     1 
ATOM 7667  C CB    . HIS H 8  36  ? 55.056  -71.926  -11.723 1.00 0.00 ? 36   HIS H CB    1 
ATOM 7668  C CG    . HIS H 8  36  ? 55.652  -70.545  -11.792 1.00 0.00 ? 36   HIS H CG    1 
ATOM 7669  N ND1   . HIS H 8  36  ? 55.195  -69.441  -11.104 1.00 0.00 ? 36   HIS H ND1   1 
ATOM 7670  C CD2   . HIS H 8  36  ? 56.747  -70.123  -12.481 1.00 0.00 ? 36   HIS H CD2   1 
ATOM 7671  C CE1   . HIS H 8  36  ? 56.031  -68.417  -11.410 1.00 0.00 ? 36   HIS H CE1   1 
ATOM 7672  N NE2   . HIS H 8  36  ? 56.988  -68.782  -12.241 1.00 0.00 ? 36   HIS H NE2   1 
ATOM 7673  N N     . THR H 8  37  ? 53.080  -72.767  -9.326  1.00 0.00 ? 37   THR H N     1 
ATOM 7674  C CA    . THR H 8  37  ? 51.989  -72.409  -8.441  1.00 0.00 ? 37   THR H CA    1 
ATOM 7675  C C     . THR H 8  37  ? 52.346  -72.685  -7.004  1.00 0.00 ? 37   THR H C     1 
ATOM 7676  O O     . THR H 8  37  ? 52.075  -71.859  -6.138  1.00 0.00 ? 37   THR H O     1 
ATOM 7677  C CB    . THR H 8  37  ? 50.684  -73.116  -8.797  1.00 0.00 ? 37   THR H CB    1 
ATOM 7678  O OG1   . THR H 8  37  ? 50.264  -72.705  -10.091 1.00 0.00 ? 37   THR H OG1   1 
ATOM 7679  C CG2   . THR H 8  37  ? 49.558  -72.772  -7.795  1.00 0.00 ? 37   THR H CG2   1 
ATOM 7680  N N     . VAL H 8  38  ? 52.981  -73.845  -6.715  1.00 0.00 ? 38   VAL H N     1 
ATOM 7681  C CA    . VAL H 8  38  ? 53.393  -74.232  -5.384  1.00 0.00 ? 38   VAL H CA    1 
ATOM 7682  C C     . VAL H 8  38  ? 54.500  -73.329  -4.898  1.00 0.00 ? 38   VAL H C     1 
ATOM 7683  O O     . VAL H 8  38  ? 54.506  -72.951  -3.730  1.00 0.00 ? 38   VAL H O     1 
ATOM 7684  C CB    . VAL H 8  38  ? 53.807  -75.697  -5.305  1.00 0.00 ? 38   VAL H CB    1 
ATOM 7685  C CG1   . VAL H 8  38  ? 54.376  -76.044  -3.910  1.00 0.00 ? 38   VAL H CG1   1 
ATOM 7686  C CG2   . VAL H 8  38  ? 52.568  -76.566  -5.609  1.00 0.00 ? 38   VAL H CG2   1 
ATOM 7687  N N     . PHE H 8  39  ? 55.451  -72.946  -5.790  1.00 0.00 ? 39   PHE H N     1 
ATOM 7688  C CA    . PHE H 8  39  ? 56.570  -72.088  -5.463  1.00 0.00 ? 39   PHE H CA    1 
ATOM 7689  C C     . PHE H 8  39  ? 56.101  -70.713  -5.031  1.00 0.00 ? 39   PHE H C     1 
ATOM 7690  O O     . PHE H 8  39  ? 56.642  -70.155  -4.077  1.00 0.00 ? 39   PHE H O     1 
ATOM 7691  C CB    . PHE H 8  39  ? 57.576  -71.967  -6.644  1.00 0.00 ? 39   PHE H CB    1 
ATOM 7692  C CG    . PHE H 8  39  ? 58.798  -71.151  -6.284  1.00 0.00 ? 39   PHE H CG    1 
ATOM 7693  C CD1   . PHE H 8  39  ? 59.880  -71.723  -5.591  1.00 0.00 ? 39   PHE H CD1   1 
ATOM 7694  C CD2   . PHE H 8  39  ? 58.844  -69.781  -6.604  1.00 0.00 ? 39   PHE H CD2   1 
ATOM 7695  C CE1   . PHE H 8  39  ? 60.976  -70.935  -5.214  1.00 0.00 ? 39   PHE H CE1   1 
ATOM 7696  C CE2   . PHE H 8  39  ? 59.935  -68.994  -6.222  1.00 0.00 ? 39   PHE H CE2   1 
ATOM 7697  C CZ    . PHE H 8  39  ? 61.000  -69.570  -5.521  1.00 0.00 ? 39   PHE H CZ    1 
ATOM 7698  N N     . THR H 8  40  ? 55.080  -70.134  -5.713  1.00 0.00 ? 40   THR H N     1 
ATOM 7699  C CA    . THR H 8  40  ? 54.569  -68.830  -5.355  1.00 0.00 ? 40   THR H CA    1 
ATOM 7700  C C     . THR H 8  40  ? 53.703  -68.918  -4.112  1.00 0.00 ? 40   THR H C     1 
ATOM 7701  O O     . THR H 8  40  ? 53.649  -67.966  -3.342  1.00 0.00 ? 40   THR H O     1 
ATOM 7702  C CB    . THR H 8  40  ? 53.883  -68.088  -6.506  1.00 0.00 ? 40   THR H CB    1 
ATOM 7703  O OG1   . THR H 8  40  ? 53.612  -66.731  -6.165  1.00 0.00 ? 40   THR H OG1   1 
ATOM 7704  C CG2   . THR H 8  40  ? 52.582  -68.778  -6.962  1.00 0.00 ? 40   THR H CG2   1 
ATOM 7705  N N     . SER H 8  41  ? 53.033  -70.072  -3.856  1.00 0.00 ? 41   SER H N     1 
ATOM 7706  C CA    . SER H 8  41  ? 52.189  -70.263  -2.692  1.00 0.00 ? 41   SER H CA    1 
ATOM 7707  C C     . SER H 8  41  ? 52.987  -70.218  -1.417  1.00 0.00 ? 41   SER H C     1 
ATOM 7708  O O     . SER H 8  41  ? 52.574  -69.582  -0.449  1.00 0.00 ? 41   SER H O     1 
ATOM 7709  C CB    . SER H 8  41  ? 51.435  -71.615  -2.693  1.00 0.00 ? 41   SER H CB    1 
ATOM 7710  O OG    . SER H 8  41  ? 50.493  -71.671  -3.754  1.00 0.00 ? 41   SER H OG    1 
ATOM 7711  N N     . VAL H 8  42  ? 54.161  -70.895  -1.407  1.00 0.00 ? 42   VAL H N     1 
ATOM 7712  C CA    . VAL H 8  42  ? 55.021  -70.982  -0.253  1.00 0.00 ? 42   VAL H CA    1 
ATOM 7713  C C     . VAL H 8  42  ? 55.718  -69.672  0.033   1.00 0.00 ? 42   VAL H C     1 
ATOM 7714  O O     . VAL H 8  42  ? 55.892  -69.333  1.203   1.00 0.00 ? 42   VAL H O     1 
ATOM 7715  C CB    . VAL H 8  42  ? 56.011  -72.146  -0.283  1.00 0.00 ? 42   VAL H CB    1 
ATOM 7716  C CG1   . VAL H 8  42  ? 55.215  -73.470  -0.263  1.00 0.00 ? 42   VAL H CG1   1 
ATOM 7717  C CG2   . VAL H 8  42  ? 56.959  -72.077  -1.496  1.00 0.00 ? 42   VAL H CG2   1 
ATOM 7718  N N     . ASN H 8  43  ? 56.130  -68.894  -1.010  1.00 0.00 ? 43   ASN H N     1 
ATOM 7719  C CA    . ASN H 8  43  ? 56.900  -67.687  -0.781  1.00 0.00 ? 43   ASN H CA    1 
ATOM 7720  C C     . ASN H 8  43  ? 56.036  -66.524  -0.341  1.00 0.00 ? 43   ASN H C     1 
ATOM 7721  O O     . ASN H 8  43  ? 56.537  -65.611  0.309   1.00 0.00 ? 43   ASN H O     1 
ATOM 7722  C CB    . ASN H 8  43  ? 57.898  -67.306  -1.930  1.00 0.00 ? 43   ASN H CB    1 
ATOM 7723  C CG    . ASN H 8  43  ? 57.361  -66.890  -3.321  1.00 0.00 ? 43   ASN H CG    1 
ATOM 7724  O OD1   . ASN H 8  43  ? 58.055  -67.125  -4.320  1.00 0.00 ? 43   ASN H OD1   1 
ATOM 7725  N ND2   . ASN H 8  43  ? 56.167  -66.237  -3.394  1.00 0.00 ? 43   ASN H ND2   1 
ATOM 7726  N N     . LYS H 8  44  ? 54.711  -66.558  -0.652  1.00 0.00 ? 44   LYS H N     1 
ATOM 7727  C CA    . LYS H 8  44  ? 53.752  -65.524  -0.319  1.00 0.00 ? 44   LYS H CA    1 
ATOM 7728  C C     . LYS H 8  44  ? 53.508  -65.437  1.155   1.00 0.00 ? 44   LYS H C     1 
ATOM 7729  O O     . LYS H 8  44  ? 53.254  -64.351  1.674   1.00 0.00 ? 44   LYS H O     1 
ATOM 7730  C CB    . LYS H 8  44  ? 52.362  -65.753  -0.955  1.00 0.00 ? 44   LYS H CB    1 
ATOM 7731  C CG    . LYS H 8  44  ? 52.225  -65.190  -2.378  1.00 0.00 ? 44   LYS H CG    1 
ATOM 7732  C CD    . LYS H 8  44  ? 50.771  -65.229  -2.868  1.00 0.00 ? 44   LYS H CD    1 
ATOM 7733  C CE    . LYS H 8  44  ? 50.211  -66.641  -3.080  1.00 0.00 ? 44   LYS H CE    1 
ATOM 7734  N NZ    . LYS H 8  44  ? 48.751  -66.593  -3.327  1.00 0.00 ? 44   LYS H NZ    1 
ATOM 7735  N N     . ASN H 8  45  ? 53.538  -66.599  1.847   1.00 0.00 ? 45   ASN H N     1 
ATOM 7736  C CA    . ASN H 8  45  ? 53.161  -66.734  3.234   1.00 0.00 ? 45   ASN H CA    1 
ATOM 7737  C C     . ASN H 8  45  ? 54.086  -65.931  4.119   1.00 0.00 ? 45   ASN H C     1 
ATOM 7738  O O     . ASN H 8  45  ? 53.633  -65.277  5.058   1.00 0.00 ? 45   ASN H O     1 
ATOM 7739  C CB    . ASN H 8  45  ? 53.147  -68.219  3.685   1.00 0.00 ? 45   ASN H CB    1 
ATOM 7740  C CG    . ASN H 8  45  ? 52.044  -69.002  2.945   1.00 0.00 ? 45   ASN H CG    1 
ATOM 7741  O OD1   . ASN H 8  45  ? 51.178  -68.431  2.272   1.00 0.00 ? 45   ASN H OD1   1 
ATOM 7742  N ND2   . ASN H 8  45  ? 52.084  -70.361  3.098   1.00 0.00 ? 45   ASN H ND2   1 
ATOM 7743  N N     . LYS H 8  46  ? 55.406  -65.934  3.800   1.00 0.00 ? 46   LYS H N     1 
ATOM 7744  C CA    . LYS H 8  46  ? 56.405  -65.124  4.462   1.00 0.00 ? 46   LYS H CA    1 
ATOM 7745  C C     . LYS H 8  46  ? 56.266  -63.659  4.104   1.00 0.00 ? 46   LYS H C     1 
ATOM 7746  O O     . LYS H 8  46  ? 56.369  -62.796  4.974   1.00 0.00 ? 46   LYS H O     1 
ATOM 7747  C CB    . LYS H 8  46  ? 57.846  -65.617  4.140   1.00 0.00 ? 46   LYS H CB    1 
ATOM 7748  C CG    . LYS H 8  46  ? 58.693  -65.947  5.388   1.00 0.00 ? 46   LYS H CG    1 
ATOM 7749  C CD    . LYS H 8  46  ? 59.822  -64.957  5.738   1.00 0.00 ? 46   LYS H CD    1 
ATOM 7750  C CE    . LYS H 8  46  ? 59.400  -63.531  6.119   1.00 0.00 ? 46   LYS H CE    1 
ATOM 7751  N NZ    . LYS H 8  46  ? 58.446  -63.529  7.252   1.00 0.00 ? 46   LYS H NZ    1 
ATOM 7752  N N     . ARG H 8  47  ? 56.032  -63.358  2.800   1.00 0.00 ? 47   ARG H N     1 
ATOM 7753  C CA    . ARG H 8  47  ? 56.091  -62.023  2.237   1.00 0.00 ? 47   ARG H CA    1 
ATOM 7754  C C     . ARG H 8  47  ? 55.150  -61.012  2.842   1.00 0.00 ? 47   ARG H C     1 
ATOM 7755  O O     . ARG H 8  47  ? 53.970  -61.276  3.072   1.00 0.00 ? 47   ARG H O     1 
ATOM 7756  C CB    . ARG H 8  47  ? 55.862  -61.995  0.706   1.00 0.00 ? 47   ARG H CB    1 
ATOM 7757  C CG    . ARG H 8  47  ? 57.101  -62.418  -0.098  1.00 0.00 ? 47   ARG H CG    1 
ATOM 7758  C CD    . ARG H 8  47  ? 57.530  -61.324  -1.085  1.00 0.00 ? 47   ARG H CD    1 
ATOM 7759  N NE    . ARG H 8  47  ? 58.875  -61.669  -1.659  1.00 0.00 ? 47   ARG H NE    1 
ATOM 7760  C CZ    . ARG H 8  47  ? 60.053  -61.205  -1.137  1.00 0.00 ? 47   ARG H CZ    1 
ATOM 7761  N NH1   . ARG H 8  47  ? 60.075  -60.400  -0.036  1.00 0.00 ? 47   ARG H NH1   1 
ATOM 7762  N NH2   . ARG H 8  47  ? 61.232  -61.555  -1.731  1.00 0.00 ? 47   ARG H NH2   1 
ATOM 7763  N N     . GLN H 8  48  ? 55.721  -59.805  3.072   1.00 0.00 ? 48   GLN H N     1 
ATOM 7764  C CA    . GLN H 8  48  ? 55.057  -58.582  3.453   1.00 0.00 ? 48   GLN H CA    1 
ATOM 7765  C C     . GLN H 8  48  ? 56.088  -57.492  3.249   1.00 0.00 ? 48   GLN H C     1 
ATOM 7766  O O     . GLN H 8  48  ? 57.192  -57.770  2.780   1.00 0.00 ? 48   GLN H O     1 
ATOM 7767  C CB    . GLN H 8  48  ? 54.389  -58.562  4.856   1.00 0.00 ? 48   GLN H CB    1 
ATOM 7768  C CG    . GLN H 8  48  ? 55.150  -59.271  5.992   1.00 0.00 ? 48   GLN H CG    1 
ATOM 7769  C CD    . GLN H 8  48  ? 56.463  -58.554  6.315   1.00 0.00 ? 48   GLN H CD    1 
ATOM 7770  O OE1   . GLN H 8  48  ? 57.553  -59.068  6.038   1.00 0.00 ? 48   GLN H OE1   1 
ATOM 7771  N NE2   . GLN H 8  48  ? 56.333  -57.333  6.918   1.00 0.00 ? 48   GLN H NE2   1 
ATOM 7772  N N     . ALA H 8  49  ? 55.731  -56.213  3.535   1.00 0.00 ? 49   ALA H N     1 
ATOM 7773  C CA    . ALA H 8  49  ? 56.517  -55.082  3.097   1.00 0.00 ? 49   ALA H CA    1 
ATOM 7774  C C     . ALA H 8  49  ? 56.366  -53.929  4.051   1.00 0.00 ? 49   ALA H C     1 
ATOM 7775  O O     . ALA H 8  49  ? 55.539  -53.953  4.961   1.00 0.00 ? 49   ALA H O     1 
ATOM 7776  C CB    . ALA H 8  49  ? 56.069  -54.581  1.703   1.00 0.00 ? 49   ALA H CB    1 
ATOM 7777  N N     . TYR H 8  50  ? 57.180  -52.870  3.809   1.00 0.00 ? 50   TYR H N     1 
ATOM 7778  C CA    . TYR H 8  50  ? 57.031  -51.560  4.397   1.00 0.00 ? 50   TYR H CA    1 
ATOM 7779  C C     . TYR H 8  50  ? 57.060  -50.608  3.226   1.00 0.00 ? 50   TYR H C     1 
ATOM 7780  O O     . TYR H 8  50  ? 57.400  -50.994  2.108   1.00 0.00 ? 50   TYR H O     1 
ATOM 7781  C CB    . TYR H 8  50  ? 58.084  -51.166  5.483   1.00 0.00 ? 50   TYR H CB    1 
ATOM 7782  C CG    . TYR H 8  50  ? 59.532  -51.182  5.033   1.00 0.00 ? 50   TYR H CG    1 
ATOM 7783  C CD1   . TYR H 8  50  ? 60.116  -50.035  4.460   1.00 0.00 ? 50   TYR H CD1   1 
ATOM 7784  C CD2   . TYR H 8  50  ? 60.342  -52.313  5.249   1.00 0.00 ? 50   TYR H CD2   1 
ATOM 7785  C CE1   . TYR H 8  50  ? 61.469  -50.020  4.106   1.00 0.00 ? 50   TYR H CE1   1 
ATOM 7786  C CE2   . TYR H 8  50  ? 61.700  -52.300  4.903   1.00 0.00 ? 50   TYR H CE2   1 
ATOM 7787  C CZ    . TYR H 8  50  ? 62.266  -51.152  4.327   1.00 0.00 ? 50   TYR H CZ    1 
ATOM 7788  O OH    . TYR H 8  50  ? 63.635  -51.122  3.972   1.00 0.00 ? 50   TYR H OH    1 
ATOM 7789  N N     . ALA H 8  51  ? 56.650  -49.342  3.451   1.00 0.00 ? 51   ALA H N     1 
ATOM 7790  C CA    . ALA H 8  51  ? 56.497  -48.390  2.386   1.00 0.00 ? 51   ALA H CA    1 
ATOM 7791  C C     . ALA H 8  51  ? 56.790  -47.041  2.974   1.00 0.00 ? 51   ALA H C     1 
ATOM 7792  O O     . ALA H 8  51  ? 57.835  -46.831  3.587   1.00 0.00 ? 51   ALA H O     1 
ATOM 7793  C CB    . ALA H 8  51  ? 55.077  -48.420  1.782   1.00 0.00 ? 51   ALA H CB    1 
ATOM 7794  N N     . VAL H 8  52  ? 55.844  -46.094  2.770   1.00 0.00 ? 52   VAL H N     1 
ATOM 7795  C CA    . VAL H 8  52  ? 55.841  -44.747  3.283   1.00 0.00 ? 52   VAL H CA    1 
ATOM 7796  C C     . VAL H 8  52  ? 55.050  -44.771  4.569   1.00 0.00 ? 52   VAL H C     1 
ATOM 7797  O O     . VAL H 8  52  ? 54.437  -45.780  4.922   1.00 0.00 ? 52   VAL H O     1 
ATOM 7798  C CB    . VAL H 8  52  ? 55.287  -43.760  2.252   1.00 0.00 ? 52   VAL H CB    1 
ATOM 7799  C CG1   . VAL H 8  52  ? 53.755  -43.906  2.093   1.00 0.00 ? 52   VAL H CG1   1 
ATOM 7800  C CG2   . VAL H 8  52  ? 55.752  -42.315  2.544   1.00 0.00 ? 52   VAL H CG2   1 
ATOM 7801  N N     . SER H 8  53  ? 55.090  -43.650  5.318   1.00 0.00 ? 53   SER H N     1 
ATOM 7802  C CA    . SER H 8  53  ? 54.571  -43.568  6.653   1.00 0.00 ? 53   SER H CA    1 
ATOM 7803  C C     . SER H 8  53  ? 54.187  -42.139  6.904   1.00 0.00 ? 53   SER H C     1 
ATOM 7804  O O     . SER H 8  53  ? 54.476  -41.251  6.101   1.00 0.00 ? 53   SER H O     1 
ATOM 7805  C CB    . SER H 8  53  ? 55.615  -44.003  7.724   1.00 0.00 ? 53   SER H CB    1 
ATOM 7806  O OG    . SER H 8  53  ? 56.839  -43.280  7.620   1.00 0.00 ? 53   SER H OG    1 
ATOM 7807  N N     . GLU H 8  54  ? 53.522  -41.923  8.061   1.00 0.00 ? 54   GLU H N     1 
ATOM 7808  C CA    . GLU H 8  54  ? 53.347  -40.633  8.662   1.00 0.00 ? 54   GLU H CA    1 
ATOM 7809  C C     . GLU H 8  54  ? 52.799  -40.880  10.044  1.00 0.00 ? 54   GLU H C     1 
ATOM 7810  O O     . GLU H 8  54  ? 53.570  -40.698  10.986  1.00 0.00 ? 54   GLU H O     1 
ATOM 7811  C CB    . GLU H 8  54  ? 52.549  -39.558  7.870   1.00 0.00 ? 54   GLU H CB    1 
ATOM 7812  C CG    . GLU H 8  54  ? 52.284  -38.226  8.586   1.00 0.00 ? 54   GLU H CG    1 
ATOM 7813  C CD    . GLU H 8  54  ? 51.383  -37.417  7.658   1.00 0.00 ? 54   GLU H CD    1 
ATOM 7814  O OE1   . GLU H 8  54  ? 50.180  -37.772  7.555   1.00 0.00 ? 54   GLU H OE1   1 
ATOM 7815  O OE2   . GLU H 8  54  ? 51.885  -36.452  7.022   1.00 0.00 ? 54   GLU H OE2   1 
ATOM 7816  N N     . LYS H 8  55  ? 51.515  -41.269  10.323  1.00 0.00 ? 55   LYS H N     1 
ATOM 7817  C CA    . LYS H 8  55  ? 50.334  -41.768  9.627   1.00 0.00 ? 55   LYS H CA    1 
ATOM 7818  C C     . LYS H 8  55  ? 50.259  -42.394  8.239   1.00 0.00 ? 55   LYS H C     1 
ATOM 7819  O O     . LYS H 8  55  ? 50.812  -41.966  7.233   1.00 0.00 ? 55   LYS H O     1 
ATOM 7820  C CB    . LYS H 8  55  ? 49.040  -40.944  9.899   1.00 0.00 ? 55   LYS H CB    1 
ATOM 7821  C CG    . LYS H 8  55  ? 48.341  -41.315  11.228  1.00 0.00 ? 55   LYS H CG    1 
ATOM 7822  C CD    . LYS H 8  55  ? 48.804  -40.565  12.492  1.00 0.00 ? 55   LYS H CD    1 
ATOM 7823  C CE    . LYS H 8  55  ? 48.151  -39.182  12.627  1.00 0.00 ? 55   LYS H CE    1 
ATOM 7824  N NZ    . LYS H 8  55  ? 48.439  -38.538  13.928  1.00 0.00 ? 55   LYS H NZ    1 
ATOM 7825  N N     . ALA H 8  56  ? 49.456  -43.484  8.160   1.00 0.00 ? 56   ALA H N     1 
ATOM 7826  C CA    . ALA H 8  56  ? 49.012  -44.075  6.915   1.00 0.00 ? 56   ALA H CA    1 
ATOM 7827  C C     . ALA H 8  56  ? 47.876  -43.276  6.273   1.00 0.00 ? 56   ALA H C     1 
ATOM 7828  O O     . ALA H 8  56  ? 46.893  -43.834  5.788   1.00 0.00 ? 56   ALA H O     1 
ATOM 7829  C CB    . ALA H 8  56  ? 48.499  -45.511  7.144   1.00 0.00 ? 56   ALA H CB    1 
ATOM 7830  N N     . GLY H 8  57  ? 47.998  -41.931  6.262   1.00 0.00 ? 57   GLY H N     1 
ATOM 7831  C CA    . GLY H 8  57  ? 47.019  -41.003  5.776   1.00 0.00 ? 57   GLY H CA    1 
ATOM 7832  C C     . GLY H 8  57  ? 47.733  -39.697  5.980   1.00 0.00 ? 57   GLY H C     1 
ATOM 7833  O O     . GLY H 8  57  ? 48.740  -39.497  5.302   1.00 0.00 ? 57   GLY H O     1 
ATOM 7834  N N     . HIS H 8  58  ? 47.350  -38.740  6.878   1.00 0.00 ? 58   HIS H N     1 
ATOM 7835  C CA    . HIS H 8  58  ? 46.217  -38.507  7.758   1.00 0.00 ? 58   HIS H CA    1 
ATOM 7836  C C     . HIS H 8  58  ? 46.817  -37.848  8.980   1.00 0.00 ? 58   HIS H C     1 
ATOM 7837  O O     . HIS H 8  58  ? 46.644  -38.342  10.091  1.00 0.00 ? 58   HIS H O     1 
ATOM 7838  C CB    . HIS H 8  58  ? 45.289  -39.668  8.240   1.00 0.00 ? 58   HIS H CB    1 
ATOM 7839  C CG    . HIS H 8  58  ? 44.161  -39.231  9.146   1.00 0.00 ? 58   HIS H CG    1 
ATOM 7840  N ND1   . HIS H 8  58  ? 43.153  -38.370  8.767   1.00 0.00 ? 58   HIS H ND1   1 
ATOM 7841  C CD2   . HIS H 8  58  ? 43.923  -39.523  10.455  1.00 0.00 ? 58   HIS H CD2   1 
ATOM 7842  C CE1   . HIS H 8  58  ? 42.367  -38.183  9.857   1.00 0.00 ? 58   HIS H CE1   1 
ATOM 7843  N NE2   . HIS H 8  58  ? 42.794  -38.861  10.905  1.00 0.00 ? 58   HIS H NE2   1 
ATOM 7844  N N     . GLN H 8  59  ? 47.538  -36.705  8.822   1.00 0.00 ? 59   GLN H N     1 
ATOM 7845  C CA    . GLN H 8  59  ? 48.095  -35.967  9.941   1.00 0.00 ? 59   GLN H CA    1 
ATOM 7846  C C     . GLN H 8  59  ? 47.016  -35.209  10.690  1.00 0.00 ? 59   GLN H C     1 
ATOM 7847  O O     . GLN H 8  59  ? 47.181  -35.005  11.891  1.00 0.00 ? 59   GLN H O     1 
ATOM 7848  C CB    . GLN H 8  59  ? 49.293  -35.035  9.592   1.00 0.00 ? 59   GLN H CB    1 
ATOM 7849  C CG    . GLN H 8  59  ? 50.172  -34.535  10.767  1.00 0.00 ? 59   GLN H CG    1 
ATOM 7850  C CD    . GLN H 8  59  ? 50.864  -35.683  11.522  1.00 0.00 ? 59   GLN H CD    1 
ATOM 7851  O OE1   . GLN H 8  59  ? 50.299  -36.250  12.464  1.00 0.00 ? 59   GLN H OE1   1 
ATOM 7852  N NE2   . GLN H 8  59  ? 52.136  -35.992  11.122  1.00 0.00 ? 59   GLN H NE2   1 
ATOM 7853  N N     . THR H 8  60  ? 45.816  -34.883  10.119  1.00 0.00 ? 60   THR H N     1 
ATOM 7854  C CA    . THR H 8  60  ? 45.442  -34.057  8.976   1.00 0.00 ? 60   THR H CA    1 
ATOM 7855  C C     . THR H 8  60  ? 43.963  -34.262  9.089   1.00 0.00 ? 60   THR H C     1 
ATOM 7856  O O     . THR H 8  60  ? 43.421  -35.277  8.650   1.00 0.00 ? 60   THR H O     1 
ATOM 7857  C CB    . THR H 8  60  ? 45.896  -34.369  7.538   1.00 0.00 ? 60   THR H CB    1 
ATOM 7858  O OG1   . THR H 8  60  ? 47.218  -33.896  7.330   1.00 0.00 ? 60   THR H OG1   1 
ATOM 7859  C CG2   . THR H 8  60  ? 44.992  -33.729  6.454   1.00 0.00 ? 60   THR H CG2   1 
ATOM 7860  N N     . SER H 8  61  ? 43.292  -33.296  9.760   1.00 0.00 ? 61   SER H N     1 
ATOM 7861  C CA    . SER H 8  61  ? 41.899  -33.385  10.120  1.00 0.00 ? 61   SER H CA    1 
ATOM 7862  C C     . SER H 8  61  ? 41.107  -32.812  8.980   1.00 0.00 ? 61   SER H C     1 
ATOM 7863  O O     . SER H 8  61  ? 41.549  -31.868  8.325   1.00 0.00 ? 61   SER H O     1 
ATOM 7864  C CB    . SER H 8  61  ? 41.571  -32.669  11.459  1.00 0.00 ? 61   SER H CB    1 
ATOM 7865  O OG    . SER H 8  61  ? 42.040  -31.324  11.490  1.00 0.00 ? 61   SER H OG    1 
ATOM 7866  N N     . ALA H 8  62  ? 39.937  -33.420  8.688   1.00 0.00 ? 62   ALA H N     1 
ATOM 7867  C CA    . ALA H 8  62  ? 39.234  -33.117  7.474   1.00 0.00 ? 62   ALA H CA    1 
ATOM 7868  C C     . ALA H 8  62  ? 37.843  -33.659  7.605   1.00 0.00 ? 62   ALA H C     1 
ATOM 7869  O O     . ALA H 8  62  ? 37.376  -33.992  8.692   1.00 0.00 ? 62   ALA H O     1 
ATOM 7870  C CB    . ALA H 8  62  ? 39.901  -33.740  6.225   1.00 0.00 ? 62   ALA H CB    1 
ATOM 7871  N N     . GLU H 8  63  ? 37.161  -33.730  6.446   1.00 0.00 ? 63   GLU H N     1 
ATOM 7872  C CA    . GLU H 8  63  ? 35.971  -34.494  6.196   1.00 0.00 ? 63   GLU H CA    1 
ATOM 7873  C C     . GLU H 8  63  ? 35.961  -34.356  4.701   1.00 0.00 ? 63   GLU H C     1 
ATOM 7874  O O     . GLU H 8  63  ? 36.380  -35.248  3.964   1.00 0.00 ? 63   GLU H O     1 
ATOM 7875  C CB    . GLU H 8  63  ? 34.668  -34.023  6.934   1.00 0.00 ? 63   GLU H CB    1 
ATOM 7876  C CG    . GLU H 8  63  ? 34.290  -32.514  6.969   1.00 0.00 ? 63   GLU H CG    1 
ATOM 7877  C CD    . GLU H 8  63  ? 33.177  -32.115  5.987   1.00 0.00 ? 63   GLU H CD    1 
ATOM 7878  O OE1   . GLU H 8  63  ? 32.584  -33.010  5.327   1.00 0.00 ? 63   GLU H OE1   1 
ATOM 7879  O OE2   . GLU H 8  63  ? 32.910  -30.887  5.891   1.00 0.00 ? 63   GLU H OE2   1 
ATOM 7880  N N     . SER H 8  64  ? 35.626  -33.129  4.274   1.00 0.00 ? 64   SER H N     1 
ATOM 7881  C CA    . SER H 8  64  ? 35.998  -32.502  3.048   1.00 0.00 ? 64   SER H CA    1 
ATOM 7882  C C     . SER H 8  64  ? 35.505  -31.118  3.347   1.00 0.00 ? 64   SER H C     1 
ATOM 7883  O O     . SER H 8  64  ? 34.437  -30.721  2.883   1.00 0.00 ? 64   SER H O     1 
ATOM 7884  C CB    . SER H 8  64  ? 35.335  -33.043  1.753   1.00 0.00 ? 64   SER H CB    1 
ATOM 7885  O OG    . SER H 8  64  ? 35.691  -32.262  0.617   1.00 0.00 ? 64   SER H OG    1 
ATOM 7886  N N     . TRP H 8  65  ? 36.281  -30.347  4.159   1.00 0.00 ? 65   TRP H N     1 
ATOM 7887  C CA    . TRP H 8  65  ? 36.033  -28.929  4.334   1.00 0.00 ? 65   TRP H CA    1 
ATOM 7888  C C     . TRP H 8  65  ? 36.838  -28.182  3.307   1.00 0.00 ? 65   TRP H C     1 
ATOM 7889  O O     . TRP H 8  65  ? 37.609  -27.278  3.618   1.00 0.00 ? 65   TRP H O     1 
ATOM 7890  C CB    . TRP H 8  65  ? 36.248  -28.358  5.772   1.00 0.00 ? 65   TRP H CB    1 
ATOM 7891  C CG    . TRP H 8  65  ? 37.593  -28.537  6.469   1.00 0.00 ? 65   TRP H CG    1 
ATOM 7892  C CD1   . TRP H 8  65  ? 38.010  -29.619  7.191   1.00 0.00 ? 65   TRP H CD1   1 
ATOM 7893  C CD2   . TRP H 8  65  ? 38.604  -27.518  6.654   1.00 0.00 ? 65   TRP H CD2   1 
ATOM 7894  N NE1   . TRP H 8  65  ? 39.210  -29.353  7.811   1.00 0.00 ? 65   TRP H NE1   1 
ATOM 7895  C CE2   . TRP H 8  65  ? 39.589  -28.067  7.505   1.00 0.00 ? 65   TRP H CE2   1 
ATOM 7896  C CE3   . TRP H 8  65  ? 38.716  -26.205  6.189   1.00 0.00 ? 65   TRP H CE3   1 
ATOM 7897  C CZ2   . TRP H 8  65  ? 40.692  -27.317  7.900   1.00 0.00 ? 65   TRP H CZ2   1 
ATOM 7898  C CZ3   . TRP H 8  65  ? 39.858  -25.471  6.544   1.00 0.00 ? 65   TRP H CZ3   1 
ATOM 7899  C CH2   . TRP H 8  65  ? 40.834  -26.021  7.386   1.00 0.00 ? 65   TRP H CH2   1 
ATOM 7900  N N     . GLY H 8  66  ? 36.665  -28.555  2.015   1.00 0.00 ? 66   GLY H N     1 
ATOM 7901  C CA    . GLY H 8  66  ? 37.161  -27.791  0.898   1.00 0.00 ? 66   GLY H CA    1 
ATOM 7902  C C     . GLY H 8  66  ? 36.497  -26.440  0.865   1.00 0.00 ? 66   GLY H C     1 
ATOM 7903  O O     . GLY H 8  66  ? 35.356  -26.290  1.302   1.00 0.00 ? 66   GLY H O     1 
ATOM 7904  N N     . THR H 8  67  ? 37.219  -25.422  0.352   1.00 0.00 ? 67   THR H N     1 
ATOM 7905  C CA    . THR H 8  67  ? 36.768  -24.049  0.346   1.00 0.00 ? 67   THR H CA    1 
ATOM 7906  C C     . THR H 8  67  ? 36.911  -23.612  -1.085  1.00 0.00 ? 67   THR H C     1 
ATOM 7907  O O     . THR H 8  67  ? 37.997  -23.683  -1.659  1.00 0.00 ? 67   THR H O     1 
ATOM 7908  C CB    . THR H 8  67  ? 37.600  -23.178  1.281   1.00 0.00 ? 67   THR H CB    1 
ATOM 7909  O OG1   . THR H 8  67  ? 37.462  -23.649  2.616   1.00 0.00 ? 67   THR H OG1   1 
ATOM 7910  C CG2   . THR H 8  67  ? 37.183  -21.692  1.235   1.00 0.00 ? 67   THR H CG2   1 
ATOM 7911  N N     . GLY H 8  68  ? 35.776  -23.199  -1.705  1.00 0.00 ? 68   GLY H N     1 
ATOM 7912  C CA    . GLY H 8  68  ? 35.697  -22.791  -3.088  1.00 0.00 ? 68   GLY H CA    1 
ATOM 7913  C C     . GLY H 8  68  ? 36.431  -21.508  -3.371  1.00 0.00 ? 68   GLY H C     1 
ATOM 7914  O O     . GLY H 8  68  ? 36.664  -20.695  -2.477  1.00 0.00 ? 68   GLY H O     1 
ATOM 7915  N N     . ARG H 8  69  ? 36.754  -21.309  -4.667  1.00 0.00 ? 69   ARG H N     1 
ATOM 7916  C CA    . ARG H 8  69  ? 37.396  -20.145  -5.226  1.00 0.00 ? 69   ARG H CA    1 
ATOM 7917  C C     . ARG H 8  69  ? 37.244  -20.403  -6.696  1.00 0.00 ? 69   ARG H C     1 
ATOM 7918  O O     . ARG H 8  69  ? 36.740  -19.565  -7.445  1.00 0.00 ? 69   ARG H O     1 
ATOM 7919  C CB    . ARG H 8  69  ? 38.940  -20.065  -4.996  1.00 0.00 ? 69   ARG H CB    1 
ATOM 7920  C CG    . ARG H 8  69  ? 39.394  -19.494  -3.642  1.00 0.00 ? 69   ARG H CG    1 
ATOM 7921  C CD    . ARG H 8  69  ? 40.103  -20.534  -2.762  1.00 0.00 ? 69   ARG H CD    1 
ATOM 7922  N NE    . ARG H 8  69  ? 40.379  -19.911  -1.425  1.00 0.00 ? 69   ARG H NE    1 
ATOM 7923  C CZ    . ARG H 8  69  ? 40.597  -20.643  -0.289  1.00 0.00 ? 69   ARG H CZ    1 
ATOM 7924  N NH1   . ARG H 8  69  ? 40.655  -22.005  -0.318  1.00 0.00 ? 69   ARG H NH1   1 
ATOM 7925  N NH2   . ARG H 8  69  ? 40.736  -19.999  0.908   1.00 0.00 ? 69   ARG H NH2   1 
ATOM 7926  N N     . ALA H 8  70  ? 37.695  -21.619  -7.077  1.00 0.00 ? 70   ALA H N     1 
ATOM 7927  C CA    . ALA H 8  70  ? 37.971  -22.121  -8.391  1.00 0.00 ? 70   ALA H CA    1 
ATOM 7928  C C     . ALA H 8  70  ? 39.213  -22.925  -8.102  1.00 0.00 ? 70   ALA H C     1 
ATOM 7929  O O     . ALA H 8  70  ? 40.027  -22.517  -7.274  1.00 0.00 ? 70   ALA H O     1 
ATOM 7930  C CB    . ALA H 8  70  ? 38.303  -21.080  -9.483  1.00 0.00 ? 70   ALA H CB    1 
ATOM 7931  N N     . VAL H 8  71  ? 39.427  -24.105  -8.730  1.00 0.00 ? 71   VAL H N     1 
ATOM 7932  C CA    . VAL H 8  71  ? 38.713  -24.670  -9.845  1.00 0.00 ? 71   VAL H CA    1 
ATOM 7933  C C     . VAL H 8  71  ? 37.553  -25.514  -9.347  1.00 0.00 ? 71   VAL H C     1 
ATOM 7934  O O     . VAL H 8  71  ? 36.649  -25.850  -10.113 1.00 0.00 ? 71   VAL H O     1 
ATOM 7935  C CB    . VAL H 8  71  ? 39.711  -25.456  -10.697 1.00 0.00 ? 71   VAL H CB    1 
ATOM 7936  C CG1   . VAL H 8  71  ? 40.348  -26.630  -9.915  1.00 0.00 ? 71   VAL H CG1   1 
ATOM 7937  C CG2   . VAL H 8  71  ? 39.090  -25.882  -12.042 1.00 0.00 ? 71   VAL H CG2   1 
ATOM 7938  N N     . ALA H 8  72  ? 37.532  -25.794  -8.022  1.00 0.00 ? 72   ALA H N     1 
ATOM 7939  C CA    . ALA H 8  72  ? 36.456  -26.451  -7.330  1.00 0.00 ? 72   ALA H CA    1 
ATOM 7940  C C     . ALA H 8  72  ? 36.933  -26.468  -5.907  1.00 0.00 ? 72   ALA H C     1 
ATOM 7941  O O     . ALA H 8  72  ? 37.440  -25.469  -5.396  1.00 0.00 ? 72   ALA H O     1 
ATOM 7942  C CB    . ALA H 8  72  ? 36.116  -27.881  -7.839  1.00 0.00 ? 72   ALA H CB    1 
ATOM 7943  N N     . ARG H 8  73  ? 36.794  -27.630  -5.244  1.00 0.00 ? 73   ARG H N     1 
ATOM 7944  C CA    . ARG H 8  73  ? 37.330  -27.927  -3.954  1.00 0.00 ? 73   ARG H CA    1 
ATOM 7945  C C     . ARG H 8  73  ? 38.616  -28.659  -4.233  1.00 0.00 ? 73   ARG H C     1 
ATOM 7946  O O     . ARG H 8  73  ? 39.463  -28.780  -3.362  1.00 0.00 ? 73   ARG H O     1 
ATOM 7947  C CB    . ARG H 8  73  ? 36.406  -28.958  -3.256  1.00 0.00 ? 73   ARG H CB    1 
ATOM 7948  C CG    . ARG H 8  73  ? 35.220  -28.330  -2.508  1.00 0.00 ? 73   ARG H CG    1 
ATOM 7949  C CD    . ARG H 8  73  ? 34.447  -29.302  -1.586  1.00 0.00 ? 73   ARG H CD    1 
ATOM 7950  N NE    . ARG H 8  73  ? 33.822  -28.486  -0.489  1.00 0.00 ? 73   ARG H NE    1 
ATOM 7951  C CZ    . ARG H 8  73  ? 33.042  -28.995  0.514   1.00 0.00 ? 73   ARG H CZ    1 
ATOM 7952  N NH1   . ARG H 8  73  ? 32.581  -30.278  0.487   1.00 0.00 ? 73   ARG H NH1   1 
ATOM 7953  N NH2   . ARG H 8  73  ? 32.741  -28.198  1.583   1.00 0.00 ? 73   ARG H NH2   1 
ATOM 7954  N N     . ILE H 8  74  ? 38.790  -29.151  -5.472  1.00 0.00 ? 74   ILE H N     1 
ATOM 7955  C CA    . ILE H 8  74  ? 39.640  -30.263  -5.813  1.00 0.00 ? 74   ILE H CA    1 
ATOM 7956  C C     . ILE H 8  74  ? 40.070  -31.248  -4.696  1.00 0.00 ? 74   ILE H C     1 
ATOM 7957  O O     . ILE H 8  74  ? 41.060  -31.007  -4.004  1.00 0.00 ? 74   ILE H O     1 
ATOM 7958  C CB    . ILE H 8  74  ? 40.709  -30.002  -6.879  1.00 0.00 ? 74   ILE H CB    1 
ATOM 7959  C CG1   . ILE H 8  74  ? 41.044  -31.298  -7.664  1.00 0.00 ? 74   ILE H CG1   1 
ATOM 7960  C CG2   . ILE H 8  74  ? 41.961  -29.301  -6.304  1.00 0.00 ? 74   ILE H CG2   1 
ATOM 7961  C CD1   . ILE H 8  74  ? 41.773  -31.017  -8.980  1.00 0.00 ? 74   ILE H CD1   1 
ATOM 7962  N N     . PRO H 8  75  ? 39.401  -32.376  -4.463  1.00 0.00 ? 75   PRO H N     1 
ATOM 7963  C CA    . PRO H 8  75  ? 37.955  -32.512  -4.513  1.00 0.00 ? 75   PRO H CA    1 
ATOM 7964  C C     . PRO H 8  75  ? 37.119  -32.382  -3.222  1.00 0.00 ? 75   PRO H C     1 
ATOM 7965  O O     . PRO H 8  75  ? 35.917  -32.283  -3.462  1.00 0.00 ? 75   PRO H O     1 
ATOM 7966  C CB    . PRO H 8  75  ? 37.695  -33.895  -5.164  1.00 0.00 ? 75   PRO H CB    1 
ATOM 7967  C CG    . PRO H 8  75  ? 38.992  -34.686  -5.008  1.00 0.00 ? 75   PRO H CG    1 
ATOM 7968  C CD    . PRO H 8  75  ? 40.042  -33.580  -4.995  1.00 0.00 ? 75   PRO H CD    1 
ATOM 7969  N N     . ARG H 8  76  ? 37.478  -32.387  -1.883  1.00 0.00 ? 76   ARG H N     1 
ATOM 7970  C CA    . ARG H 8  76  ? 38.647  -32.522  -1.020  1.00 0.00 ? 76   ARG H CA    1 
ATOM 7971  C C     . ARG H 8  76  ? 39.265  -31.166  -0.688  1.00 0.00 ? 76   ARG H C     1 
ATOM 7972  O O     . ARG H 8  76  ? 38.773  -30.162  -1.182  1.00 0.00 ? 76   ARG H O     1 
ATOM 7973  C CB    . ARG H 8  76  ? 39.589  -33.702  -1.324  1.00 0.00 ? 76   ARG H CB    1 
ATOM 7974  C CG    . ARG H 8  76  ? 38.868  -35.066  -1.270  1.00 0.00 ? 76   ARG H CG    1 
ATOM 7975  C CD    . ARG H 8  76  ? 38.971  -35.754  0.099   1.00 0.00 ? 76   ARG H CD    1 
ATOM 7976  N NE    . ARG H 8  76  ? 40.308  -36.433  0.186   1.00 0.00 ? 76   ARG H NE    1 
ATOM 7977  C CZ    . ARG H 8  76  ? 40.785  -36.997  1.336   1.00 0.00 ? 76   ARG H CZ    1 
ATOM 7978  N NH1   . ARG H 8  76  ? 40.157  -36.809  2.531   1.00 0.00 ? 76   ARG H NH1   1 
ATOM 7979  N NH2   . ARG H 8  76  ? 41.903  -37.777  1.282   1.00 0.00 ? 76   ARG H NH2   1 
ATOM 7980  N N     . VAL H 8  77  ? 40.297  -31.013  0.207   1.00 0.00 ? 77   VAL H N     1 
ATOM 7981  C CA    . VAL H 8  77  ? 40.455  -31.739  1.444   1.00 0.00 ? 77   VAL H CA    1 
ATOM 7982  C C     . VAL H 8  77  ? 40.199  -30.762  2.585   1.00 0.00 ? 77   VAL H C     1 
ATOM 7983  O O     . VAL H 8  77  ? 39.071  -30.702  3.066   1.00 0.00 ? 77   VAL H O     1 
ATOM 7984  C CB    . VAL H 8  77  ? 41.715  -32.606  1.579   1.00 0.00 ? 77   VAL H CB    1 
ATOM 7985  C CG1   . VAL H 8  77  ? 43.055  -31.904  1.892   1.00 0.00 ? 77   VAL H CG1   1 
ATOM 7986  C CG2   . VAL H 8  77  ? 41.400  -33.698  2.609   1.00 0.00 ? 77   VAL H CG2   1 
ATOM 7987  N N     . GLY H 8  78  ? 41.197  -29.965  3.054   1.00 0.00 ? 78   GLY H N     1 
ATOM 7988  C CA    . GLY H 8  78  ? 41.055  -29.131  4.221   1.00 0.00 ? 78   GLY H CA    1 
ATOM 7989  C C     . GLY H 8  78  ? 42.402  -28.878  4.843   1.00 0.00 ? 78   GLY H C     1 
ATOM 7990  O O     . GLY H 8  78  ? 43.246  -28.194  4.266   1.00 0.00 ? 78   GLY H O     1 
ATOM 7991  N N     . GLY H 8  79  ? 42.578  -29.397  6.085   1.00 0.00 ? 79   GLY H N     1 
ATOM 7992  C CA    . GLY H 8  79  ? 43.553  -28.976  7.071   1.00 0.00 ? 79   GLY H CA    1 
ATOM 7993  C C     . GLY H 8  79  ? 44.998  -29.241  6.729   1.00 0.00 ? 79   GLY H C     1 
ATOM 7994  O O     . GLY H 8  79  ? 45.392  -30.401  6.691   1.00 0.00 ? 79   GLY H O     1 
ATOM 7995  N N     . GLY H 8  80  ? 45.864  -28.211  6.518   1.00 0.00 ? 80   GLY H N     1 
ATOM 7996  C CA    . GLY H 8  80  ? 45.512  -26.820  6.547   1.00 0.00 ? 80   GLY H CA    1 
ATOM 7997  C C     . GLY H 8  80  ? 46.744  -25.981  6.564   1.00 0.00 ? 80   GLY H C     1 
ATOM 7998  O O     . GLY H 8  80  ? 47.561  -26.074  7.480   1.00 0.00 ? 80   GLY H O     1 
ATOM 7999  N N     . GLY H 8  81  ? 46.837  -25.064  5.569   1.00 0.00 ? 81   GLY H N     1 
ATOM 8000  C CA    . GLY H 8  81  ? 47.621  -23.860  5.668   1.00 0.00 ? 81   GLY H CA    1 
ATOM 8001  C C     . GLY H 8  81  ? 49.048  -24.023  5.251   1.00 0.00 ? 81   GLY H C     1 
ATOM 8002  O O     . GLY H 8  81  ? 49.801  -24.768  5.879   1.00 0.00 ? 81   GLY H O     1 
ATOM 8003  N N     . THR H 8  82  ? 49.441  -23.239  4.206   1.00 0.00 ? 82   THR H N     1 
ATOM 8004  C CA    . THR H 8  82  ? 50.790  -22.842  3.831   1.00 0.00 ? 82   THR H CA    1 
ATOM 8005  C C     . THR H 8  82  ? 51.797  -23.969  3.866   1.00 0.00 ? 82   THR H C     1 
ATOM 8006  O O     . THR H 8  82  ? 52.838  -23.867  4.516   1.00 0.00 ? 82   THR H O     1 
ATOM 8007  C CB    . THR H 8  82  ? 51.284  -21.608  4.591   1.00 0.00 ? 82   THR H CB    1 
ATOM 8008  O OG1   . THR H 8  82  ? 51.314  -21.822  6.001   1.00 0.00 ? 82   THR H OG1   1 
ATOM 8009  C CG2   . THR H 8  82  ? 50.342  -20.420  4.291   1.00 0.00 ? 82   THR H CG2   1 
ATOM 8010  N N     . GLY H 8  83  ? 51.466  -25.095  3.196   1.00 0.00 ? 83   GLY H N     1 
ATOM 8011  C CA    . GLY H 8  83  ? 52.048  -26.361  3.546   1.00 0.00 ? 83   GLY H CA    1 
ATOM 8012  C C     . GLY H 8  83  ? 52.328  -27.150  2.308   1.00 0.00 ? 83   GLY H C     1 
ATOM 8013  O O     . GLY H 8  83  ? 52.974  -26.621  1.404   1.00 0.00 ? 83   GLY H O     1 
ATOM 8014  N N     . ARG H 8  84  ? 51.909  -28.445  2.193   1.00 0.00 ? 84   ARG H N     1 
ATOM 8015  C CA    . ARG H 8  84  ? 50.931  -29.218  2.941   1.00 0.00 ? 84   ARG H CA    1 
ATOM 8016  C C     . ARG H 8  84  ? 49.529  -28.746  2.699   1.00 0.00 ? 84   ARG H C     1 
ATOM 8017  O O     . ARG H 8  84  ? 49.164  -27.607  2.987   1.00 0.00 ? 84   ARG H O     1 
ATOM 8018  C CB    . ARG H 8  84  ? 51.113  -29.498  4.456   1.00 0.00 ? 84   ARG H CB    1 
ATOM 8019  C CG    . ARG H 8  84  ? 52.251  -30.465  4.784   1.00 0.00 ? 84   ARG H CG    1 
ATOM 8020  C CD    . ARG H 8  84  ? 52.400  -30.631  6.301   1.00 0.00 ? 84   ARG H CD    1 
ATOM 8021  N NE    . ARG H 8  84  ? 53.299  -31.803  6.574   1.00 0.00 ? 84   ARG H NE    1 
ATOM 8022  C CZ    . ARG H 8  84  ? 52.828  -33.053  6.875   1.00 0.00 ? 84   ARG H CZ    1 
ATOM 8023  N NH1   . ARG H 8  84  ? 51.494  -33.296  7.037   1.00 0.00 ? 84   ARG H NH1   1 
ATOM 8024  N NH2   . ARG H 8  84  ? 53.708  -34.088  7.019   1.00 0.00 ? 84   ARG H NH2   1 
ATOM 8025  N N     . SER H 8  85  ? 48.710  -29.679  2.174   1.00 0.00 ? 85   SER H N     1 
ATOM 8026  C CA    . SER H 8  85  ? 47.294  -29.540  1.995   1.00 0.00 ? 85   SER H CA    1 
ATOM 8027  C C     . SER H 8  85  ? 46.898  -28.653  0.852   1.00 0.00 ? 85   SER H C     1 
ATOM 8028  O O     . SER H 8  85  ? 47.656  -27.796  0.404   1.00 0.00 ? 85   SER H O     1 
ATOM 8029  C CB    . SER H 8  85  ? 46.461  -29.308  3.262   1.00 0.00 ? 85   SER H CB    1 
ATOM 8030  O OG    . SER H 8  85  ? 46.754  -30.341  4.192   1.00 0.00 ? 85   SER H OG    1 
ATOM 8031  N N     . GLY H 8  86  ? 45.694  -28.923  0.305   1.00 0.00 ? 86   GLY H N     1 
ATOM 8032  C CA    . GLY H 8  86  ? 45.344  -28.473  -1.010  1.00 0.00 ? 86   GLY H CA    1 
ATOM 8033  C C     . GLY H 8  86  ? 43.998  -29.017  -1.392  1.00 0.00 ? 86   GLY H C     1 
ATOM 8034  O O     . GLY H 8  86  ? 43.114  -28.210  -1.676  1.00 0.00 ? 86   GLY H O     1 
ATOM 8035  N N     . GLN H 8  87  ? 43.706  -30.354  -1.417  1.00 0.00 ? 87   GLN H N     1 
ATOM 8036  C CA    . GLN H 8  87  ? 44.455  -31.601  -1.316  1.00 0.00 ? 87   GLN H CA    1 
ATOM 8037  C C     . GLN H 8  87  ? 45.799  -31.715  -0.678  1.00 0.00 ? 87   GLN H C     1 
ATOM 8038  O O     . GLN H 8  87  ? 45.865  -32.019  0.509   1.00 0.00 ? 87   GLN H O     1 
ATOM 8039  C CB    . GLN H 8  87  ? 44.249  -32.624  -2.457  1.00 0.00 ? 87   GLN H CB    1 
ATOM 8040  C CG    . GLN H 8  87  ? 43.324  -33.751  -1.955  1.00 0.00 ? 87   GLN H CG    1 
ATOM 8041  C CD    . GLN H 8  87  ? 42.892  -34.690  -3.075  1.00 0.00 ? 87   GLN H CD    1 
ATOM 8042  O OE1   . GLN H 8  87  ? 43.379  -34.612  -4.204  1.00 0.00 ? 87   GLN H OE1   1 
ATOM 8043  N NE2   . GLN H 8  87  ? 41.911  -35.584  -2.748  1.00 0.00 ? 87   GLN H NE2   1 
ATOM 8044  N N     . GLY H 8  88  ? 46.904  -31.543  -1.438  1.00 0.00 ? 88   GLY H N     1 
ATOM 8045  C CA    . GLY H 8  88  ? 48.224  -31.759  -0.908  1.00 0.00 ? 88   GLY H CA    1 
ATOM 8046  C C     . GLY H 8  88  ? 48.620  -33.073  -1.501  1.00 0.00 ? 88   GLY H C     1 
ATOM 8047  O O     . GLY H 8  88  ? 48.410  -33.229  -2.702  1.00 0.00 ? 88   GLY H O     1 
ATOM 8048  N N     . ALA H 8  89  ? 49.208  -34.076  -0.790  1.00 0.00 ? 89   ALA H N     1 
ATOM 8049  C CA    . ALA H 8  89  ? 49.449  -34.343  0.616   1.00 0.00 ? 89   ALA H CA    1 
ATOM 8050  C C     . ALA H 8  89  ? 48.468  -35.378  1.081   1.00 0.00 ? 89   ALA H C     1 
ATOM 8051  O O     . ALA H 8  89  ? 48.877  -36.495  1.399   1.00 0.00 ? 89   ALA H O     1 
ATOM 8052  C CB    . ALA H 8  89  ? 49.537  -33.216  1.668   1.00 0.00 ? 89   ALA H CB    1 
ATOM 8053  N N     . PHE H 8  90  ? 47.143  -35.065  1.110   1.00 0.00 ? 90   PHE H N     1 
ATOM 8054  C CA    . PHE H 8  90  ? 46.149  -36.030  1.548   1.00 0.00 ? 90   PHE H CA    1 
ATOM 8055  C C     . PHE H 8  90  ? 45.556  -36.678  0.313   1.00 0.00 ? 90   PHE H C     1 
ATOM 8056  O O     . PHE H 8  90  ? 44.814  -37.651  0.414   1.00 0.00 ? 90   PHE H O     1 
ATOM 8057  C CB    . PHE H 8  90  ? 45.055  -35.400  2.460   1.00 0.00 ? 90   PHE H CB    1 
ATOM 8058  C CG    . PHE H 8  90  ? 44.361  -36.352  3.436   1.00 0.00 ? 90   PHE H CG    1 
ATOM 8059  C CD1   . PHE H 8  90  ? 43.421  -35.791  4.318   1.00 0.00 ? 90   PHE H CD1   1 
ATOM 8060  C CD2   . PHE H 8  90  ? 44.613  -37.736  3.554   1.00 0.00 ? 90   PHE H CD2   1 
ATOM 8061  C CE1   . PHE H 8  90  ? 42.710  -36.569  5.236   1.00 0.00 ? 90   PHE H CE1   1 
ATOM 8062  C CE2   . PHE H 8  90  ? 43.909  -38.526  4.474   1.00 0.00 ? 90   PHE H CE2   1 
ATOM 8063  C CZ    . PHE H 8  90  ? 42.947  -37.944  5.306   1.00 0.00 ? 90   PHE H CZ    1 
ATOM 8064  N N     . GLY H 8  91  ? 45.972  -36.180  -0.879  1.00 0.00 ? 91   GLY H N     1 
ATOM 8065  C CA    . GLY H 8  91  ? 46.049  -36.878  -2.138  1.00 0.00 ? 91   GLY H CA    1 
ATOM 8066  C C     . GLY H 8  91  ? 44.834  -37.534  -2.727  1.00 0.00 ? 91   GLY H C     1 
ATOM 8067  O O     . GLY H 8  91  ? 43.765  -37.567  -2.127  1.00 0.00 ? 91   GLY H O     1 
ATOM 8068  N N     . ASN H 8  92  ? 44.965  -38.145  -3.935  1.00 0.00 ? 92   ASN H N     1 
ATOM 8069  C CA    . ASN H 8  92  ? 46.215  -38.514  -4.559  1.00 0.00 ? 92   ASN H CA    1 
ATOM 8070  C C     . ASN H 8  92  ? 46.139  -38.188  -6.026  1.00 0.00 ? 92   ASN H C     1 
ATOM 8071  O O     . ASN H 8  92  ? 45.315  -38.770  -6.729  1.00 0.00 ? 92   ASN H O     1 
ATOM 8072  C CB    . ASN H 8  92  ? 46.439  -40.053  -4.453  1.00 0.00 ? 92   ASN H CB    1 
ATOM 8073  C CG    . ASN H 8  92  ? 46.423  -40.469  -2.972  1.00 0.00 ? 92   ASN H CG    1 
ATOM 8074  O OD1   . ASN H 8  92  ? 47.446  -40.355  -2.290  1.00 0.00 ? 92   ASN H OD1   1 
ATOM 8075  N ND2   . ASN H 8  92  ? 45.228  -40.925  -2.480  1.00 0.00 ? 92   ASN H ND2   1 
ATOM 8076  N N     . MET H 8  93  ? 47.031  -37.320  -6.586  1.00 0.00 ? 93   MET H N     1 
ATOM 8077  C CA    . MET H 8  93  ? 47.187  -35.905  -6.301  1.00 0.00 ? 93   MET H CA    1 
ATOM 8078  C C     . MET H 8  93  ? 48.392  -35.530  -5.474  1.00 0.00 ? 93   MET H C     1 
ATOM 8079  O O     . MET H 8  93  ? 48.633  -34.337  -5.288  1.00 0.00 ? 93   MET H O     1 
ATOM 8080  C CB    . MET H 8  93  ? 45.933  -35.168  -5.748  1.00 0.00 ? 93   MET H CB    1 
ATOM 8081  C CG    . MET H 8  93  ? 45.375  -34.071  -6.683  1.00 0.00 ? 93   MET H CG    1 
ATOM 8082  S SD    . MET H 8  93  ? 44.600  -34.675  -8.221  1.00 0.00 ? 93   MET H SD    1 
ATOM 8083  C CE    . MET H 8  93  ? 43.232  -35.626  -7.487  1.00 0.00 ? 93   MET H CE    1 
ATOM 8084  N N     . CYS H 8  94  ? 49.216  -36.494  -4.992  1.00 0.00 ? 94   CYS H N     1 
ATOM 8085  C CA    . CYS H 8  94  ? 50.291  -36.155  -4.082  1.00 0.00 ? 94   CYS H CA    1 
ATOM 8086  C C     . CYS H 8  94  ? 51.502  -35.670  -4.829  1.00 0.00 ? 94   CYS H C     1 
ATOM 8087  O O     . CYS H 8  94  ? 52.029  -36.346  -5.713  1.00 0.00 ? 94   CYS H O     1 
ATOM 8088  C CB    . CYS H 8  94  ? 50.708  -37.310  -3.146  1.00 0.00 ? 94   CYS H CB    1 
ATOM 8089  S SG    . CYS H 8  94  ? 49.447  -37.587  -1.868  1.00 0.00 ? 94   CYS H SG    1 
ATOM 8090  N N     . ARG H 8  95  ? 51.942  -34.456  -4.482  1.00 0.00 ? 95   ARG H N     1 
ATOM 8091  C CA    . ARG H 8  95  ? 53.280  -34.005  -4.771  1.00 0.00 ? 95   ARG H CA    1 
ATOM 8092  C C     . ARG H 8  95  ? 54.069  -33.961  -3.476  1.00 0.00 ? 95   ARG H C     1 
ATOM 8093  O O     . ARG H 8  95  ? 55.194  -33.475  -3.449  1.00 0.00 ? 95   ARG H O     1 
ATOM 8094  C CB    . ARG H 8  95  ? 53.256  -32.613  -5.446  1.00 0.00 ? 95   ARG H CB    1 
ATOM 8095  C CG    . ARG H 8  95  ? 52.547  -32.649  -6.818  1.00 0.00 ? 95   ARG H CG    1 
ATOM 8096  C CD    . ARG H 8  95  ? 52.637  -31.351  -7.625  1.00 0.00 ? 95   ARG H CD    1 
ATOM 8097  N NE    . ARG H 8  95  ? 54.090  -31.161  -7.943  1.00 0.00 ? 95   ARG H NE    1 
ATOM 8098  C CZ    . ARG H 8  95  ? 54.610  -30.082  -8.536  1.00 0.00 ? 95   ARG H CZ    1 
ATOM 8099  N NH1   . ARG H 8  95  ? 53.845  -29.087  -8.963  1.00 0.00 ? 95   ARG H NH1   1 
ATOM 8100  N NH2   . ARG H 8  95  ? 55.926  -30.001  -8.703  1.00 0.00 ? 95   ARG H NH2   1 
ATOM 8101  N N     . GLY H 8  96  ? 53.475  -34.461  -2.365  1.00 0.00 ? 96   GLY H N     1 
ATOM 8102  C CA    . GLY H 8  96  ? 54.145  -34.568  -1.099  1.00 0.00 ? 96   GLY H CA    1 
ATOM 8103  C C     . GLY H 8  96  ? 53.915  -35.931  -0.522  1.00 0.00 ? 96   GLY H C     1 
ATOM 8104  O O     . GLY H 8  96  ? 54.853  -36.712  -0.374  1.00 0.00 ? 96   GLY H O     1 
ATOM 8105  N N     . GLY H 8  97  ? 52.650  -36.213  -0.122  1.00 0.00 ? 97   GLY H N     1 
ATOM 8106  C CA    . GLY H 8  97  ? 52.318  -37.302  0.766   1.00 0.00 ? 97   GLY H CA    1 
ATOM 8107  C C     . GLY H 8  97  ? 52.180  -38.652  0.121   1.00 0.00 ? 97   GLY H C     1 
ATOM 8108  O O     . GLY H 8  97  ? 52.813  -38.962  -0.887  1.00 0.00 ? 97   GLY H O     1 
ATOM 8109  N N     . ARG H 8  98  ? 51.333  -39.483  0.781   1.00 0.00 ? 98   ARG H N     1 
ATOM 8110  C CA    . ARG H 8  98  ? 51.006  -40.875  0.538   1.00 0.00 ? 98   ARG H CA    1 
ATOM 8111  C C     . ARG H 8  98  ? 50.533  -41.252  -0.864  1.00 0.00 ? 98   ARG H C     1 
ATOM 8112  O O     . ARG H 8  98  ? 50.584  -40.471  -1.808  1.00 0.00 ? 98   ARG H O     1 
ATOM 8113  C CB    . ARG H 8  98  ? 50.075  -41.430  1.661   1.00 0.00 ? 98   ARG H CB    1 
ATOM 8114  C CG    . ARG H 8  98  ? 48.819  -40.606  2.040   1.00 0.00 ? 98   ARG H CG    1 
ATOM 8115  C CD    . ARG H 8  98  ? 47.868  -40.275  0.881   1.00 0.00 ? 98   ARG H CD    1 
ATOM 8116  N NE    . ARG H 8  98  ? 46.483  -39.983  1.378   1.00 0.00 ? 98   ARG H NE    1 
ATOM 8117  C CZ    . ARG H 8  98  ? 45.480  -40.916  1.423   1.00 0.00 ? 98   ARG H CZ    1 
ATOM 8118  N NH1   . ARG H 8  98  ? 45.732  -42.244  1.246   1.00 0.00 ? 98   ARG H NH1   1 
ATOM 8119  N NH2   . ARG H 8  98  ? 44.194  -40.507  1.631   1.00 0.00 ? 98   ARG H NH2   1 
ATOM 8120  N N     . MET H 8  99  ? 50.071  -42.516  -1.016  1.00 0.00 ? 99   MET H N     1 
ATOM 8121  C CA    . MET H 8  99  ? 49.501  -43.078  -2.222  1.00 0.00 ? 99   MET H CA    1 
ATOM 8122  C C     . MET H 8  99  ? 48.111  -43.493  -1.820  1.00 0.00 ? 99   MET H C     1 
ATOM 8123  O O     . MET H 8  99  ? 47.691  -43.217  -0.702  1.00 0.00 ? 99   MET H O     1 
ATOM 8124  C CB    . MET H 8  99  ? 50.292  -44.295  -2.762  1.00 0.00 ? 99   MET H CB    1 
ATOM 8125  C CG    . MET H 8  99  ? 50.530  -45.394  -1.708  1.00 0.00 ? 99   MET H CG    1 
ATOM 8126  S SD    . MET H 8  99  ? 51.395  -46.877  -2.310  1.00 0.00 ? 99   MET H SD    1 
ATOM 8127  C CE    . MET H 8  99  ? 50.006  -47.562  -3.262  1.00 0.00 ? 99   MET H CE    1 
ATOM 8128  N N     . PHE H 8  100 ? 47.320  -44.148  -2.705  1.00 0.00 ? 100  PHE H N     1 
ATOM 8129  C CA    . PHE H 8  100 ? 45.897  -44.318  -2.469  1.00 0.00 ? 100  PHE H CA    1 
ATOM 8130  C C     . PHE H 8  100 ? 45.634  -45.567  -1.647  1.00 0.00 ? 100  PHE H C     1 
ATOM 8131  O O     . PHE H 8  100 ? 44.480  -45.923  -1.411  1.00 0.00 ? 100  PHE H O     1 
ATOM 8132  C CB    . PHE H 8  100 ? 45.120  -44.357  -3.822  1.00 0.00 ? 100  PHE H CB    1 
ATOM 8133  C CG    . PHE H 8  100 ? 43.609  -44.185  -3.765  1.00 0.00 ? 100  PHE H CG    1 
ATOM 8134  C CD1   . PHE H 8  100 ? 42.907  -43.617  -2.679  1.00 0.00 ? 100  PHE H CD1   1 
ATOM 8135  C CD2   . PHE H 8  100 ? 42.870  -44.592  -4.891  1.00 0.00 ? 100  PHE H CD2   1 
ATOM 8136  C CE1   . PHE H 8  100 ? 41.510  -43.496  -2.711  1.00 0.00 ? 100  PHE H CE1   1 
ATOM 8137  C CE2   . PHE H 8  100 ? 41.476  -44.466  -4.930  1.00 0.00 ? 100  PHE H CE2   1 
ATOM 8138  C CZ    . PHE H 8  100 ? 40.795  -43.921  -3.836  1.00 0.00 ? 100  PHE H CZ    1 
ATOM 8139  N N     . ALA H 8  101 ? 46.708  -46.207  -1.124  1.00 0.00 ? 101  ALA H N     1 
ATOM 8140  C CA    . ALA H 8  101 ? 46.602  -47.250  -0.137  1.00 0.00 ? 101  ALA H CA    1 
ATOM 8141  C C     . ALA H 8  101 ? 48.008  -47.615  0.310   1.00 0.00 ? 101  ALA H C     1 
ATOM 8142  O O     . ALA H 8  101 ? 48.432  -48.667  -0.151  1.00 0.00 ? 101  ALA H O     1 
ATOM 8143  C CB    . ALA H 8  101 ? 45.920  -48.528  -0.683  1.00 0.00 ? 101  ALA H CB    1 
ATOM 8144  N N     . PRO H 8  102 ? 48.739  -46.820  1.144   1.00 0.00 ? 102  PRO H N     1 
ATOM 8145  C CA    . PRO H 8  102 ? 50.087  -46.987  1.732   1.00 0.00 ? 102  PRO H CA    1 
ATOM 8146  C C     . PRO H 8  102 ? 50.890  -48.282  1.856   1.00 0.00 ? 102  PRO H C     1 
ATOM 8147  O O     . PRO H 8  102 ? 51.677  -48.342  2.800   1.00 0.00 ? 102  PRO H O     1 
ATOM 8148  C CB    . PRO H 8  102 ? 49.878  -46.426  3.151   1.00 0.00 ? 102  PRO H CB    1 
ATOM 8149  C CG    . PRO H 8  102 ? 48.836  -45.309  3.011   1.00 0.00 ? 102  PRO H CG    1 
ATOM 8150  C CD    . PRO H 8  102 ? 48.215  -45.536  1.629   1.00 0.00 ? 102  PRO H CD    1 
ATOM 8151  N N     . THR H 8  103 ? 50.729  -49.306  0.986   1.00 0.00 ? 103  THR H N     1 
ATOM 8152  C CA    . THR H 8  103 ? 50.978  -50.722  1.193   1.00 0.00 ? 103  THR H CA    1 
ATOM 8153  C C     . THR H 8  103 ? 50.170  -51.224  2.369   1.00 0.00 ? 103  THR H C     1 
ATOM 8154  O O     . THR H 8  103 ? 50.236  -50.695  3.478   1.00 0.00 ? 103  THR H O     1 
ATOM 8155  C CB    . THR H 8  103 ? 52.415  -51.254  1.109   1.00 0.00 ? 103  THR H CB    1 
ATOM 8156  O OG1   . THR H 8  103 ? 52.425  -52.554  0.525   1.00 0.00 ? 103  THR H OG1   1 
ATOM 8157  C CG2   . THR H 8  103 ? 53.116  -51.333  2.483   1.00 0.00 ? 103  THR H CG2   1 
ATOM 8158  N N     . LYS H 8  104 ? 49.342  -52.254  2.125   1.00 0.00 ? 104  LYS H N     1 
ATOM 8159  C CA    . LYS H 8  104 ? 48.256  -52.590  3.003   1.00 0.00 ? 104  LYS H CA    1 
ATOM 8160  C C     . LYS H 8  104 ? 48.576  -53.909  3.630   1.00 0.00 ? 104  LYS H C     1 
ATOM 8161  O O     . LYS H 8  104 ? 49.148  -54.791  2.994   1.00 0.00 ? 104  LYS H O     1 
ATOM 8162  C CB    . LYS H 8  104 ? 46.935  -52.618  2.208   1.00 0.00 ? 104  LYS H CB    1 
ATOM 8163  C CG    . LYS H 8  104 ? 46.356  -51.208  1.994   1.00 0.00 ? 104  LYS H CG    1 
ATOM 8164  C CD    . LYS H 8  104 ? 45.671  -50.601  3.234   1.00 0.00 ? 104  LYS H CD    1 
ATOM 8165  C CE    . LYS H 8  104 ? 46.180  -49.208  3.642   1.00 0.00 ? 104  LYS H CE    1 
ATOM 8166  N NZ    . LYS H 8  104 ? 47.521  -49.283  4.268   1.00 0.00 ? 104  LYS H NZ    1 
ATOM 8167  N N     . THR H 8  105 ? 48.263  -54.026  4.943   1.00 0.00 ? 105  THR H N     1 
ATOM 8168  C CA    . THR H 8  105 ? 48.666  -55.144  5.753   1.00 0.00 ? 105  THR H CA    1 
ATOM 8169  C C     . THR H 8  105 ? 47.810  -55.133  7.025   1.00 0.00 ? 105  THR H C     1 
ATOM 8170  O O     . THR H 8  105 ? 48.343  -55.056  8.131   1.00 0.00 ? 105  THR H O     1 
ATOM 8171  C CB    . THR H 8  105 ? 50.183  -55.125  6.021   1.00 0.00 ? 105  THR H CB    1 
ATOM 8172  O OG1   . THR H 8  105 ? 50.617  -56.215  6.832   1.00 0.00 ? 105  THR H OG1   1 
ATOM 8173  C CG2   . THR H 8  105 ? 50.653  -53.769  6.610   1.00 0.00 ? 105  THR H CG2   1 
ATOM 8174  N N     . TRP H 8  106 ? 46.442  -55.198  6.986   1.00 0.00 ? 106  TRP H N     1 
ATOM 8175  C CA    . TRP H 8  106 ? 45.460  -55.408  5.932   1.00 0.00 ? 106  TRP H CA    1 
ATOM 8176  C C     . TRP H 8  106 ? 45.831  -56.504  4.956   1.00 0.00 ? 106  TRP H C     1 
ATOM 8177  O O     . TRP H 8  106 ? 46.505  -57.450  5.360   1.00 0.00 ? 106  TRP H O     1 
ATOM 8178  C CB    . TRP H 8  106 ? 44.963  -54.116  5.226   1.00 0.00 ? 106  TRP H CB    1 
ATOM 8179  C CG    . TRP H 8  106 ? 44.709  -52.896  6.104   1.00 0.00 ? 106  TRP H CG    1 
ATOM 8180  C CD1   . TRP H 8  106 ? 45.606  -52.154  6.827   1.00 0.00 ? 106  TRP H CD1   1 
ATOM 8181  C CD2   . TRP H 8  106 ? 43.450  -52.203  6.195   1.00 0.00 ? 106  TRP H CD2   1 
ATOM 8182  N NE1   . TRP H 8  106 ? 44.988  -51.061  7.384   1.00 0.00 ? 106  TRP H NE1   1 
ATOM 8183  C CE2   . TRP H 8  106 ? 43.663  -51.067  7.007   1.00 0.00 ? 106  TRP H CE2   1 
ATOM 8184  C CE3   . TRP H 8  106 ? 42.201  -52.465  5.636   1.00 0.00 ? 106  TRP H CE3   1 
ATOM 8185  C CZ2   . TRP H 8  106 ? 42.626  -50.182  7.284   1.00 0.00 ? 106  TRP H CZ2   1 
ATOM 8186  C CZ3   . TRP H 8  106 ? 41.166  -51.552  5.887   1.00 0.00 ? 106  TRP H CZ3   1 
ATOM 8187  C CH2   . TRP H 8  106 ? 41.375  -50.429  6.702   1.00 0.00 ? 106  TRP H CH2   1 
ATOM 8188  N N     . ARG H 8  107 ? 45.357  -56.400  3.675   1.00 0.00 ? 107  ARG H N     1 
ATOM 8189  C CA    . ARG H 8  107 ? 45.601  -57.258  2.516   1.00 0.00 ? 107  ARG H CA    1 
ATOM 8190  C C     . ARG H 8  107 ? 46.110  -58.644  2.830   1.00 0.00 ? 107  ARG H C     1 
ATOM 8191  O O     . ARG H 8  107 ? 47.301  -58.932  2.712   1.00 0.00 ? 107  ARG H O     1 
ATOM 8192  C CB    . ARG H 8  107 ? 46.500  -56.601  1.435   1.00 0.00 ? 107  ARG H CB    1 
ATOM 8193  C CG    . ARG H 8  107 ? 45.774  -55.636  0.478   1.00 0.00 ? 107  ARG H CG    1 
ATOM 8194  C CD    . ARG H 8  107 ? 45.106  -56.353  -0.710  1.00 0.00 ? 107  ARG H CD    1 
ATOM 8195  N NE    . ARG H 8  107 ? 44.708  -55.326  -1.735  1.00 0.00 ? 107  ARG H NE    1 
ATOM 8196  C CZ    . ARG H 8  107 ? 44.629  -55.597  -3.075  1.00 0.00 ? 107  ARG H CZ    1 
ATOM 8197  N NH1   . ARG H 8  107 ? 44.822  -56.858  -3.559  1.00 0.00 ? 107  ARG H NH1   1 
ATOM 8198  N NH2   . ARG H 8  107 ? 44.361  -54.581  -3.949  1.00 0.00 ? 107  ARG H NH2   1 
ATOM 8199  N N     . LYS H 8  108 ? 45.173  -59.524  3.249   1.00 0.00 ? 108  LYS H N     1 
ATOM 8200  C CA    . LYS H 8  108 ? 45.408  -60.921  3.506   1.00 0.00 ? 108  LYS H CA    1 
ATOM 8201  C C     . LYS H 8  108 ? 45.526  -61.580  2.159   1.00 0.00 ? 108  LYS H C     1 
ATOM 8202  O O     . LYS H 8  108 ? 44.638  -61.425  1.321   1.00 0.00 ? 108  LYS H O     1 
ATOM 8203  C CB    . LYS H 8  108 ? 44.212  -61.531  4.282   1.00 0.00 ? 108  LYS H CB    1 
ATOM 8204  C CG    . LYS H 8  108 ? 44.225  -63.060  4.478   1.00 0.00 ? 108  LYS H CG    1 
ATOM 8205  C CD    . LYS H 8  108 ? 42.832  -63.697  4.310   1.00 0.00 ? 108  LYS H CD    1 
ATOM 8206  C CE    . LYS H 8  108 ? 42.343  -63.702  2.852   1.00 0.00 ? 108  LYS H CE    1 
ATOM 8207  N NZ    . LYS H 8  108 ? 40.972  -64.246  2.741   1.00 0.00 ? 108  LYS H NZ    1 
ATOM 8208  N N     . TRP H 8  109 ? 46.643  -62.314  1.928   1.00 0.00 ? 109  TRP H N     1 
ATOM 8209  C CA    . TRP H 8  109 ? 46.865  -63.004  0.682   1.00 0.00 ? 109  TRP H CA    1 
ATOM 8210  C C     . TRP H 8  109 ? 46.772  -64.475  0.993   1.00 0.00 ? 109  TRP H C     1 
ATOM 8211  O O     . TRP H 8  109 ? 45.673  -65.027  0.980   1.00 0.00 ? 109  TRP H O     1 
ATOM 8212  C CB    . TRP H 8  109 ? 48.197  -62.589  -0.011  1.00 0.00 ? 109  TRP H CB    1 
ATOM 8213  C CG    . TRP H 8  109 ? 48.218  -62.769  -1.524  1.00 0.00 ? 109  TRP H CG    1 
ATOM 8214  C CD1   . TRP H 8  109 ? 47.482  -63.621  -2.303  1.00 0.00 ? 109  TRP H CD1   1 
ATOM 8215  C CD2   . TRP H 8  109 ? 49.001  -61.968  -2.434  1.00 0.00 ? 109  TRP H CD2   1 
ATOM 8216  N NE1   . TRP H 8  109 ? 47.747  -63.404  -3.635  1.00 0.00 ? 109  TRP H NE1   1 
ATOM 8217  C CE2   . TRP H 8  109 ? 48.670  -62.387  -3.742  1.00 0.00 ? 109  TRP H CE2   1 
ATOM 8218  C CE3   . TRP H 8  109 ? 49.922  -60.945  -2.220  1.00 0.00 ? 109  TRP H CE3   1 
ATOM 8219  C CZ2   . TRP H 8  109 ? 49.247  -61.784  -4.855  1.00 0.00 ? 109  TRP H CZ2   1 
ATOM 8220  C CZ3   . TRP H 8  109 ? 50.506  -60.341  -3.344  1.00 0.00 ? 109  TRP H CZ3   1 
ATOM 8221  C CH2   . TRP H 8  109 ? 50.170  -60.750  -4.643  1.00 0.00 ? 109  TRP H CH2   1 
ATOM 8222  N N     . ASN H 8  110 ? 47.926  -65.118  1.314   1.00 0.00 ? 110  ASN H N     1 
ATOM 8223  C CA    . ASN H 8  110 ? 48.128  -66.521  1.637   1.00 0.00 ? 110  ASN H CA    1 
ATOM 8224  C C     . ASN H 8  110 ? 47.708  -67.513  0.571   1.00 0.00 ? 110  ASN H C     1 
ATOM 8225  O O     . ASN H 8  110 ? 46.907  -67.215  -0.315  1.00 0.00 ? 110  ASN H O     1 
ATOM 8226  C CB    . ASN H 8  110 ? 47.601  -66.952  3.050   1.00 0.00 ? 110  ASN H CB    1 
ATOM 8227  C CG    . ASN H 8  110 ? 46.072  -67.176  3.157   1.00 0.00 ? 110  ASN H CG    1 
ATOM 8228  O OD1   . ASN H 8  110 ? 45.532  -68.137  2.595   1.00 0.00 ? 110  ASN H OD1   1 
ATOM 8229  N ND2   . ASN H 8  110 ? 45.373  -66.284  3.919   1.00 0.00 ? 110  ASN H ND2   1 
ATOM 8230  N N     . VAL H 8  111 ? 48.235  -68.758  0.689   1.00 0.00 ? 111  VAL H N     1 
ATOM 8231  C CA    . VAL H 8  111 ? 47.501  -69.934  0.287   1.00 0.00 ? 111  VAL H CA    1 
ATOM 8232  C C     . VAL H 8  111 ? 47.724  -70.878  1.431   1.00 0.00 ? 111  VAL H C     1 
ATOM 8233  O O     . VAL H 8  111 ? 48.864  -71.204  1.762   1.00 0.00 ? 111  VAL H O     1 
ATOM 8234  C CB    . VAL H 8  111 ? 47.929  -70.643  -0.996  1.00 0.00 ? 111  VAL H CB    1 
ATOM 8235  C CG1   . VAL H 8  111 ? 46.791  -71.591  -1.432  1.00 0.00 ? 111  VAL H CG1   1 
ATOM 8236  C CG2   . VAL H 8  111 ? 48.244  -69.616  -2.097  1.00 0.00 ? 111  VAL H CG2   1 
ATOM 8237  N N     . LYS H 8  112 ? 46.621  -71.344  2.058   1.00 0.00 ? 112  LYS H N     1 
ATOM 8238  C CA    . LYS H 8  112 ? 46.648  -72.371  3.072   1.00 0.00 ? 112  LYS H CA    1 
ATOM 8239  C C     . LYS H 8  112 ? 46.897  -73.710  2.429   1.00 0.00 ? 112  LYS H C     1 
ATOM 8240  O O     . LYS H 8  112 ? 46.522  -73.940  1.279   1.00 0.00 ? 112  LYS H O     1 
ATOM 8241  C CB    . LYS H 8  112 ? 45.366  -72.384  3.935   1.00 0.00 ? 112  LYS H CB    1 
ATOM 8242  C CG    . LYS H 8  112 ? 44.051  -72.565  3.156   1.00 0.00 ? 112  LYS H CG    1 
ATOM 8243  C CD    . LYS H 8  112 ? 43.495  -73.997  3.178   1.00 0.00 ? 112  LYS H CD    1 
ATOM 8244  C CE    . LYS H 8  112 ? 42.192  -74.100  2.378   1.00 0.00 ? 112  LYS H CE    1 
ATOM 8245  N NZ    . LYS H 8  112 ? 41.523  -75.395  2.612   1.00 0.00 ? 112  LYS H NZ    1 
ATOM 8246  N N     . VAL H 8  113 ? 47.580  -74.614  3.163   1.00 0.00 ? 113  VAL H N     1 
ATOM 8247  C CA    . VAL H 8  113 ? 48.105  -75.832  2.598   1.00 0.00 ? 113  VAL H CA    1 
ATOM 8248  C C     . VAL H 8  113 ? 47.168  -76.952  2.955   1.00 0.00 ? 113  VAL H C     1 
ATOM 8249  O O     . VAL H 8  113 ? 46.984  -77.303  4.121   1.00 0.00 ? 113  VAL H O     1 
ATOM 8250  C CB    . VAL H 8  113 ? 49.549  -76.122  3.012   1.00 0.00 ? 113  VAL H CB    1 
ATOM 8251  C CG1   . VAL H 8  113 ? 50.464  -75.187  2.190   1.00 0.00 ? 113  VAL H CG1   1 
ATOM 8252  C CG2   . VAL H 8  113 ? 49.777  -75.923  4.529   1.00 0.00 ? 113  VAL H CG2   1 
ATOM 8253  N N     . ASN H 8  114 ? 46.539  -77.537  1.906   1.00 0.00 ? 114  ASN H N     1 
ATOM 8254  C CA    . ASN H 8  114 ? 45.722  -78.719  2.022   1.00 0.00 ? 114  ASN H CA    1 
ATOM 8255  C C     . ASN H 8  114 ? 46.645  -79.895  2.050   1.00 0.00 ? 114  ASN H C     1 
ATOM 8256  O O     . ASN H 8  114 ? 47.763  -79.842  1.542   1.00 0.00 ? 114  ASN H O     1 
ATOM 8257  C CB    . ASN H 8  114 ? 44.720  -78.928  0.860   1.00 0.00 ? 114  ASN H CB    1 
ATOM 8258  C CG    . ASN H 8  114 ? 43.538  -77.971  1.042   1.00 0.00 ? 114  ASN H CG    1 
ATOM 8259  O OD1   . ASN H 8  114 ? 42.788  -78.100  2.016   1.00 0.00 ? 114  ASN H OD1   1 
ATOM 8260  N ND2   . ASN H 8  114 ? 43.372  -77.009  0.085   1.00 0.00 ? 114  ASN H ND2   1 
ATOM 8261  N N     . HIS H 8  115 ? 46.177  -80.979  2.703   1.00 0.00 ? 115  HIS H N     1 
ATOM 8262  C CA    . HIS H 8  115 ? 46.935  -82.172  2.966   1.00 0.00 ? 115  HIS H CA    1 
ATOM 8263  C C     . HIS H 8  115 ? 47.231  -82.917  1.697   1.00 0.00 ? 115  HIS H C     1 
ATOM 8264  O O     . HIS H 8  115 ? 48.364  -83.337  1.472   1.00 0.00 ? 115  HIS H O     1 
ATOM 8265  C CB    . HIS H 8  115 ? 46.163  -83.091  3.937   1.00 0.00 ? 115  HIS H CB    1 
ATOM 8266  C CG    . HIS H 8  115 ? 45.558  -82.291  5.061   1.00 0.00 ? 115  HIS H CG    1 
ATOM 8267  N ND1   . HIS H 8  115 ? 46.283  -81.555  5.976   1.00 0.00 ? 115  HIS H ND1   1 
ATOM 8268  C CD2   . HIS H 8  115 ? 44.251  -81.998  5.305   1.00 0.00 ? 115  HIS H CD2   1 
ATOM 8269  C CE1   . HIS H 8  115 ? 45.383  -80.862  6.719   1.00 0.00 ? 115  HIS H CE1   1 
ATOM 8270  N NE2   . HIS H 8  115 ? 44.139  -81.098  6.349   1.00 0.00 ? 115  HIS H NE2   1 
ATOM 8271  N N     . ASN H 8  116 ? 46.197  -83.053  0.829   1.00 0.00 ? 116  ASN H N     1 
ATOM 8272  C CA    . ASN H 8  116 ? 46.260  -83.715  -0.453  1.00 0.00 ? 116  ASN H CA    1 
ATOM 8273  C C     . ASN H 8  116 ? 47.134  -82.986  -1.436  1.00 0.00 ? 116  ASN H C     1 
ATOM 8274  O O     . ASN H 8  116 ? 47.943  -83.607  -2.118  1.00 0.00 ? 116  ASN H O     1 
ATOM 8275  C CB    . ASN H 8  116 ? 44.862  -84.002  -1.076  1.00 0.00 ? 116  ASN H CB    1 
ATOM 8276  C CG    . ASN H 8  116 ? 43.928  -82.777  -1.087  1.00 0.00 ? 116  ASN H CG    1 
ATOM 8277  O OD1   . ASN H 8  116 ? 43.412  -82.369  -0.040  1.00 0.00 ? 116  ASN H OD1   1 
ATOM 8278  N ND2   . ASN H 8  116 ? 43.697  -82.204  -2.305  1.00 0.00 ? 116  ASN H ND2   1 
ATOM 8279  N N     . GLU H 8  117 ? 47.006  -81.642  -1.506  1.00 0.00 ? 117  GLU H N     1 
ATOM 8280  C CA    . GLU H 8  117 ? 47.718  -80.804  -2.443  1.00 0.00 ? 117  GLU H CA    1 
ATOM 8281  C C     . GLU H 8  117 ? 49.185  -80.718  -2.126  1.00 0.00 ? 117  GLU H C     1 
ATOM 8282  O O     . GLU H 8  117 ? 49.996  -80.612  -3.042  1.00 0.00 ? 117  GLU H O     1 
ATOM 8283  C CB    . GLU H 8  117 ? 47.104  -79.389  -2.509  1.00 0.00 ? 117  GLU H CB    1 
ATOM 8284  C CG    . GLU H 8  117 ? 45.822  -79.381  -3.366  1.00 0.00 ? 117  GLU H CG    1 
ATOM 8285  C CD    . GLU H 8  117 ? 44.878  -78.257  -2.945  1.00 0.00 ? 117  GLU H CD    1 
ATOM 8286  O OE1   . GLU H 8  117 ? 45.317  -77.077  -2.933  1.00 0.00 ? 117  GLU H OE1   1 
ATOM 8287  O OE2   . GLU H 8  117 ? 43.699  -78.572  -2.627  1.00 0.00 ? 117  GLU H OE2   1 
ATOM 8288  N N     . LYS H 8  118 ? 49.559  -80.773  -0.823  1.00 0.00 ? 118  LYS H N     1 
ATOM 8289  C CA    . LYS H 8  118 ? 50.933  -80.719  -0.381  1.00 0.00 ? 118  LYS H CA    1 
ATOM 8290  C C     . LYS H 8  118 ? 51.687  -81.977  -0.746  1.00 0.00 ? 118  LYS H C     1 
ATOM 8291  O O     . LYS H 8  118 ? 52.850  -81.905  -1.135  1.00 0.00 ? 118  LYS H O     1 
ATOM 8292  C CB    . LYS H 8  118 ? 51.069  -80.460  1.138   1.00 0.00 ? 118  LYS H CB    1 
ATOM 8293  C CG    . LYS H 8  118 ? 52.499  -80.089  1.579   1.00 0.00 ? 118  LYS H CG    1 
ATOM 8294  C CD    . LYS H 8  118 ? 53.136  -81.094  2.553   1.00 0.00 ? 118  LYS H CD    1 
ATOM 8295  C CE    . LYS H 8  118 ? 54.629  -80.822  2.791   1.00 0.00 ? 118  LYS H CE    1 
ATOM 8296  N NZ    . LYS H 8  118 ? 55.197  -81.752  3.794   1.00 0.00 ? 118  LYS H NZ    1 
ATOM 8297  N N     . ARG H 8  119 ? 51.037  -83.165  -0.637  1.00 0.00 ? 119  ARG H N     1 
ATOM 8298  C CA    . ARG H 8  119 ? 51.679  -84.430  -0.932  1.00 0.00 ? 119  ARG H CA    1 
ATOM 8299  C C     . ARG H 8  119 ? 51.686  -84.724  -2.410  1.00 0.00 ? 119  ARG H C     1 
ATOM 8300  O O     . ARG H 8  119 ? 52.484  -85.541  -2.864  1.00 0.00 ? 119  ARG H O     1 
ATOM 8301  C CB    . ARG H 8  119 ? 51.083  -85.637  -0.158  1.00 0.00 ? 119  ARG H CB    1 
ATOM 8302  C CG    . ARG H 8  119 ? 49.592  -85.928  -0.393  1.00 0.00 ? 119  ARG H CG    1 
ATOM 8303  C CD    . ARG H 8  119 ? 49.033  -87.017  0.548   1.00 0.00 ? 119  ARG H CD    1 
ATOM 8304  N NE    . ARG H 8  119 ? 47.799  -86.498  1.240   1.00 0.00 ? 119  ARG H NE    1 
ATOM 8305  C CZ    . ARG H 8  119 ? 46.582  -87.126  1.265   1.00 0.00 ? 119  ARG H CZ    1 
ATOM 8306  N NH1   . ARG H 8  119 ? 46.383  -88.352  0.707   1.00 0.00 ? 119  ARG H NH1   1 
ATOM 8307  N NH2   . ARG H 8  119 ? 45.525  -86.490  1.857   1.00 0.00 ? 119  ARG H NH2   1 
ATOM 8308  N N     . TYR H 8  120 ? 50.830  -84.034  -3.207  1.00 0.00 ? 120  TYR H N     1 
ATOM 8309  C CA    . TYR H 8  120 ? 50.911  -84.053  -4.652  1.00 0.00 ? 120  TYR H CA    1 
ATOM 8310  C C     . TYR H 8  120 ? 52.064  -83.198  -5.096  1.00 0.00 ? 120  TYR H C     1 
ATOM 8311  O O     . TYR H 8  120 ? 52.750  -83.541  -6.055  1.00 0.00 ? 120  TYR H O     1 
ATOM 8312  C CB    . TYR H 8  120 ? 49.649  -83.498  -5.370  1.00 0.00 ? 120  TYR H CB    1 
ATOM 8313  C CG    . TYR H 8  120 ? 48.533  -84.509  -5.424  1.00 0.00 ? 120  TYR H CG    1 
ATOM 8314  C CD1   . TYR H 8  120 ? 48.733  -85.786  -5.983  1.00 0.00 ? 120  TYR H CD1   1 
ATOM 8315  C CD2   . TYR H 8  120 ? 47.243  -84.161  -4.986  1.00 0.00 ? 120  TYR H CD2   1 
ATOM 8316  C CE1   . TYR H 8  120 ? 47.679  -86.702  -6.062  1.00 0.00 ? 120  TYR H CE1   1 
ATOM 8317  C CE2   . TYR H 8  120 ? 46.193  -85.083  -5.039  1.00 0.00 ? 120  TYR H CE2   1 
ATOM 8318  C CZ    . TYR H 8  120 ? 46.413  -86.361  -5.569  1.00 0.00 ? 120  TYR H CZ    1 
ATOM 8319  O OH    . TYR H 8  120 ? 45.372  -87.314  -5.604  1.00 0.00 ? 120  TYR H OH    1 
ATOM 8320  N N     . ALA H 8  121 ? 52.284  -82.050  -4.407  1.00 0.00 ? 121  ALA H N     1 
ATOM 8321  C CA    . ALA H 8  121 ? 53.297  -81.075  -4.728  1.00 0.00 ? 121  ALA H CA    1 
ATOM 8322  C C     . ALA H 8  121 ? 54.682  -81.625  -4.549  1.00 0.00 ? 121  ALA H C     1 
ATOM 8323  O O     . ALA H 8  121 ? 55.553  -81.390  -5.385  1.00 0.00 ? 121  ALA H O     1 
ATOM 8324  C CB    . ALA H 8  121 ? 53.195  -79.816  -3.850  1.00 0.00 ? 121  ALA H CB    1 
ATOM 8325  N N     . THR H 8  122 ? 54.905  -82.381  -3.446  1.00 0.00 ? 122  THR H N     1 
ATOM 8326  C CA    . THR H 8  122 ? 56.163  -83.026  -3.156  1.00 0.00 ? 122  THR H CA    1 
ATOM 8327  C C     . THR H 8  122 ? 56.423  -84.156  -4.123  1.00 0.00 ? 122  THR H C     1 
ATOM 8328  O O     . THR H 8  122 ? 57.550  -84.316  -4.575  1.00 0.00 ? 122  THR H O     1 
ATOM 8329  C CB    . THR H 8  122 ? 56.300  -83.520  -1.717  1.00 0.00 ? 122  THR H CB    1 
ATOM 8330  O OG1   . THR H 8  122 ? 55.197  -84.329  -1.322  1.00 0.00 ? 122  THR H OG1   1 
ATOM 8331  C CG2   . THR H 8  122 ? 56.408  -82.305  -0.769  1.00 0.00 ? 122  THR H CG2   1 
ATOM 8332  N N     . ALA H 8  123 ? 55.385  -84.957  -4.473  1.00 0.00 ? 123  ALA H N     1 
ATOM 8333  C CA    . ALA H 8  123 ? 55.504  -86.105  -5.348  1.00 0.00 ? 123  ALA H CA    1 
ATOM 8334  C C     . ALA H 8  123 ? 55.888  -85.723  -6.753  1.00 0.00 ? 123  ALA H C     1 
ATOM 8335  O O     . ALA H 8  123 ? 56.720  -86.385  -7.371  1.00 0.00 ? 123  ALA H O     1 
ATOM 8336  C CB    . ALA H 8  123 ? 54.194  -86.912  -5.424  1.00 0.00 ? 123  ALA H CB    1 
ATOM 8337  N N     . SER H 8  124 ? 55.283  -84.629  -7.278  1.00 0.00 ? 124  SER H N     1 
ATOM 8338  C CA    . SER H 8  124 ? 55.554  -84.088  -8.591  1.00 0.00 ? 124  SER H CA    1 
ATOM 8339  C C     . SER H 8  124 ? 56.933  -83.482  -8.660  1.00 0.00 ? 124  SER H C     1 
ATOM 8340  O O     . SER H 8  124 ? 57.597  -83.574  -9.690  1.00 0.00 ? 124  SER H O     1 
ATOM 8341  C CB    . SER H 8  124 ? 54.487  -83.064  -9.072  1.00 0.00 ? 124  SER H CB    1 
ATOM 8342  O OG    . SER H 8  124 ? 54.353  -81.944  -8.202  1.00 0.00 ? 124  SER H OG    1 
ATOM 8343  N N     . ALA H 8  125 ? 57.384  -82.846  -7.549  1.00 0.00 ? 125  ALA H N     1 
ATOM 8344  C CA    . ALA H 8  125 ? 58.680  -82.221  -7.420  1.00 0.00 ? 125  ALA H CA    1 
ATOM 8345  C C     . ALA H 8  125 ? 59.799  -83.226  -7.461  1.00 0.00 ? 125  ALA H C     1 
ATOM 8346  O O     . ALA H 8  125 ? 60.827  -82.983  -8.086  1.00 0.00 ? 125  ALA H O     1 
ATOM 8347  C CB    . ALA H 8  125 ? 58.812  -81.436  -6.103  1.00 0.00 ? 125  ALA H CB    1 
ATOM 8348  N N     . ILE H 8  126 ? 59.600  -84.389  -6.795  1.00 0.00 ? 126  ILE H N     1 
ATOM 8349  C CA    . ILE H 8  126 ? 60.517  -85.506  -6.722  1.00 0.00 ? 126  ILE H CA    1 
ATOM 8350  C C     . ILE H 8  126 ? 60.627  -86.159  -8.082  1.00 0.00 ? 126  ILE H C     1 
ATOM 8351  O O     . ILE H 8  126 ? 61.687  -86.661  -8.453  1.00 0.00 ? 126  ILE H O     1 
ATOM 8352  C CB    . ILE H 8  126 ? 60.077  -86.492  -5.639  1.00 0.00 ? 126  ILE H CB    1 
ATOM 8353  C CG1   . ILE H 8  126 ? 60.312  -85.866  -4.241  1.00 0.00 ? 126  ILE H CG1   1 
ATOM 8354  C CG2   . ILE H 8  126 ? 60.810  -87.844  -5.755  1.00 0.00 ? 126  ILE H CG2   1 
ATOM 8355  C CD1   . ILE H 8  126 ? 59.607  -86.625  -3.112  1.00 0.00 ? 126  ILE H CD1   1 
ATOM 8356  N N     . ALA H 8  127 ? 59.534  -86.132  -8.879  1.00 0.00 ? 127  ALA H N     1 
ATOM 8357  C CA    . ALA H 8  127 ? 59.521  -86.685  -10.210 1.00 0.00 ? 127  ALA H CA    1 
ATOM 8358  C C     . ALA H 8  127 ? 60.130  -85.729  -11.206 1.00 0.00 ? 127  ALA H C     1 
ATOM 8359  O O     . ALA H 8  127 ? 60.382  -86.110  -12.348 1.00 0.00 ? 127  ALA H O     1 
ATOM 8360  C CB    . ALA H 8  127 ? 58.093  -87.016  -10.676 1.00 0.00 ? 127  ALA H CB    1 
ATOM 8361  N N     . ALA H 8  128 ? 60.396  -84.466  -10.786 1.00 0.00 ? 128  ALA H N     1 
ATOM 8362  C CA    . ALA H 8  128 ? 60.918  -83.425  -11.636 1.00 0.00 ? 128  ALA H CA    1 
ATOM 8363  C C     . ALA H 8  128 ? 62.407  -83.288  -11.461 1.00 0.00 ? 128  ALA H C     1 
ATOM 8364  O O     . ALA H 8  128 ? 63.020  -82.428  -12.094 1.00 0.00 ? 128  ALA H O     1 
ATOM 8365  C CB    . ALA H 8  128 ? 60.306  -82.048  -11.304 1.00 0.00 ? 128  ALA H CB    1 
ATOM 8366  N N     . THR H 8  129 ? 63.030  -84.149  -10.618 1.00 0.00 ? 129  THR H N     1 
ATOM 8367  C CA    . THR H 8  129 ? 64.464  -84.158  -10.422 1.00 0.00 ? 129  THR H CA    1 
ATOM 8368  C C     . THR H 8  129 ? 65.056  -85.281  -11.245 1.00 0.00 ? 129  THR H C     1 
ATOM 8369  O O     . THR H 8  129 ? 66.274  -85.445  -11.291 1.00 0.00 ? 129  THR H O     1 
ATOM 8370  C CB    . THR H 8  129 ? 64.869  -84.372  -8.961  1.00 0.00 ? 129  THR H CB    1 
ATOM 8371  O OG1   . THR H 8  129 ? 64.400  -85.615  -8.443  1.00 0.00 ? 129  THR H OG1   1 
ATOM 8372  C CG2   . THR H 8  129 ? 64.339  -83.230  -8.072  1.00 0.00 ? 129  THR H CG2   1 
ATOM 8373  N N     . ALA H 8  130 ? 64.190  -86.079  -11.915 1.00 0.00 ? 130  ALA H N     1 
ATOM 8374  C CA    . ALA H 8  130 ? 64.559  -87.348  -12.488 1.00 0.00 ? 130  ALA H CA    1 
ATOM 8375  C C     . ALA H 8  130 ? 64.911  -87.208  -13.946 1.00 0.00 ? 130  ALA H C     1 
ATOM 8376  O O     . ALA H 8  130 ? 65.123  -88.212  -14.626 1.00 0.00 ? 130  ALA H O     1 
ATOM 8377  C CB    . ALA H 8  130 ? 63.379  -88.334  -12.396 1.00 0.00 ? 130  ALA H CB    1 
ATOM 8378  N N     . VAL H 8  131 ? 64.999  -85.951  -14.458 1.00 0.00 ? 131  VAL H N     1 
ATOM 8379  C CA    . VAL H 8  131 ? 65.250  -85.660  -15.855 1.00 0.00 ? 131  VAL H CA    1 
ATOM 8380  C C     . VAL H 8  131 ? 66.759  -85.573  -16.036 1.00 0.00 ? 131  VAL H C     1 
ATOM 8381  O O     . VAL H 8  131 ? 67.500  -86.243  -15.316 1.00 0.00 ? 131  VAL H O     1 
ATOM 8382  C CB    . VAL H 8  131 ? 64.473  -84.432  -16.347 1.00 0.00 ? 131  VAL H CB    1 
ATOM 8383  C CG1   . VAL H 8  131 ? 64.250  -84.510  -17.876 1.00 0.00 ? 131  VAL H CG1   1 
ATOM 8384  C CG2   . VAL H 8  131 ? 63.098  -84.391  -15.634 1.00 0.00 ? 131  VAL H CG2   1 
ATOM 8385  N N     . ALA H 8  132 ? 67.271  -84.767  -16.998 1.00 0.00 ? 132  ALA H N     1 
ATOM 8386  C CA    . ALA H 8  132 ? 68.661  -84.847  -17.368 1.00 0.00 ? 132  ALA H CA    1 
ATOM 8387  C C     . ALA H 8  132 ? 69.043  -83.647  -18.177 1.00 0.00 ? 132  ALA H C     1 
ATOM 8388  O O     . ALA H 8  132 ? 70.037  -82.990  -17.870 1.00 0.00 ? 132  ALA H O     1 
ATOM 8389  C CB    . ALA H 8  132 ? 68.961  -86.064  -18.278 1.00 0.00 ? 132  ALA H CB    1 
ATOM 8390  N N     . SER H 8  133 ? 68.277  -83.339  -19.254 1.00 0.00 ? 133  SER H N     1 
ATOM 8391  C CA    . SER H 8  133 ? 68.703  -82.368  -20.239 1.00 0.00 ? 133  SER H CA    1 
ATOM 8392  C C     . SER H 8  133 ? 68.355  -80.957  -19.831 1.00 0.00 ? 133  SER H C     1 
ATOM 8393  O O     . SER H 8  133 ? 68.907  -79.998  -20.369 1.00 0.00 ? 133  SER H O     1 
ATOM 8394  C CB    . SER H 8  133 ? 68.094  -82.639  -21.640 1.00 0.00 ? 133  SER H CB    1 
ATOM 8395  O OG    . SER H 8  133 ? 66.674  -82.736  -21.603 1.00 0.00 ? 133  SER H OG    1 
ATOM 8396  N N     . LEU H 8  134 ? 67.437  -80.813  -18.845 1.00 0.00 ? 134  LEU H N     1 
ATOM 8397  C CA    . LEU H 8  134 ? 66.903  -79.548  -18.400 1.00 0.00 ? 134  LEU H CA    1 
ATOM 8398  C C     . LEU H 8  134 ? 67.860  -78.850  -17.466 1.00 0.00 ? 134  LEU H C     1 
ATOM 8399  O O     . LEU H 8  134 ? 67.687  -77.669  -17.168 1.00 0.00 ? 134  LEU H O     1 
ATOM 8400  C CB    . LEU H 8  134 ? 65.571  -79.742  -17.641 1.00 0.00 ? 134  LEU H CB    1 
ATOM 8401  C CG    . LEU H 8  134 ? 64.447  -80.394  -18.481 1.00 0.00 ? 134  LEU H CG    1 
ATOM 8402  C CD1   . LEU H 8  134 ? 63.255  -80.765  -17.580 1.00 0.00 ? 134  LEU H CD1   1 
ATOM 8403  C CD2   . LEU H 8  134 ? 63.993  -79.511  -19.661 1.00 0.00 ? 134  LEU H CD2   1 
ATOM 8404  N N     . VAL H 8  135 ? 68.901  -79.579  -16.994 1.00 0.00 ? 135  VAL H N     1 
ATOM 8405  C CA    . VAL H 8  135 ? 69.957  -79.098  -16.137 1.00 0.00 ? 135  VAL H CA    1 
ATOM 8406  C C     . VAL H 8  135 ? 70.775  -78.034  -16.835 1.00 0.00 ? 135  VAL H C     1 
ATOM 8407  O O     . VAL H 8  135 ? 71.059  -76.991  -16.249 1.00 0.00 ? 135  VAL H O     1 
ATOM 8408  C CB    . VAL H 8  135 ? 70.815  -80.267  -15.663 1.00 0.00 ? 135  VAL H CB    1 
ATOM 8409  C CG1   . VAL H 8  135 ? 72.051  -79.794  -14.874 1.00 0.00 ? 135  VAL H CG1   1 
ATOM 8410  C CG2   . VAL H 8  135 ? 69.934  -81.182  -14.782 1.00 0.00 ? 135  VAL H CG2   1 
ATOM 8411  N N     . LEU H 8  136 ? 71.135  -78.251  -18.124 1.00 0.00 ? 136  LEU H N     1 
ATOM 8412  C CA    . LEU H 8  136 ? 71.901  -77.307  -18.911 1.00 0.00 ? 136  LEU H CA    1 
ATOM 8413  C C     . LEU H 8  136 ? 71.129  -76.039  -19.191 1.00 0.00 ? 136  LEU H C     1 
ATOM 8414  O O     . LEU H 8  136 ? 71.695  -74.948  -19.160 1.00 0.00 ? 136  LEU H O     1 
ATOM 8415  C CB    . LEU H 8  136 ? 72.424  -77.918  -20.239 1.00 0.00 ? 136  LEU H CB    1 
ATOM 8416  C CG    . LEU H 8  136 ? 73.972  -77.973  -20.353 1.00 0.00 ? 136  LEU H CG    1 
ATOM 8417  C CD1   . LEU H 8  136 ? 74.626  -76.576  -20.299 1.00 0.00 ? 136  LEU H CD1   1 
ATOM 8418  C CD2   . LEU H 8  136 ? 74.609  -78.940  -19.332 1.00 0.00 ? 136  LEU H CD2   1 
ATOM 8419  N N     . ALA H 8  137 ? 69.807  -76.174  -19.465 1.00 0.00 ? 137  ALA H N     1 
ATOM 8420  C CA    . ALA H 8  137 ? 68.909  -75.086  -19.779 1.00 0.00 ? 137  ALA H CA    1 
ATOM 8421  C C     . ALA H 8  137 ? 68.725  -74.125  -18.632 1.00 0.00 ? 137  ALA H C     1 
ATOM 8422  O O     . ALA H 8  137 ? 68.666  -72.916  -18.850 1.00 0.00 ? 137  ALA H O     1 
ATOM 8423  C CB    . ALA H 8  137 ? 67.521  -75.596  -20.208 1.00 0.00 ? 137  ALA H CB    1 
ATOM 8424  N N     . ARG H 8  138 ? 68.646  -74.650  -17.380 1.00 0.00 ? 138  ARG H N     1 
ATOM 8425  C CA    . ARG H 8  138 ? 68.507  -73.874  -16.166 1.00 0.00 ? 138  ARG H CA    1 
ATOM 8426  C C     . ARG H 8  138 ? 69.695  -72.969  -15.968 1.00 0.00 ? 138  ARG H C     1 
ATOM 8427  O O     . ARG H 8  138 ? 69.528  -71.796  -15.638 1.00 0.00 ? 138  ARG H O     1 
ATOM 8428  C CB    . ARG H 8  138 ? 68.334  -74.793  -14.932 1.00 0.00 ? 138  ARG H CB    1 
ATOM 8429  C CG    . ARG H 8  138 ? 68.575  -74.120  -13.570 1.00 0.00 ? 138  ARG H CG    1 
ATOM 8430  C CD    . ARG H 8  138 ? 68.144  -74.999  -12.394 1.00 0.00 ? 138  ARG H CD    1 
ATOM 8431  N NE    . ARG H 8  138 ? 66.715  -74.721  -12.045 1.00 0.00 ? 138  ARG H NE    1 
ATOM 8432  C CZ    . ARG H 8  138 ? 66.350  -73.886  -11.024 1.00 0.00 ? 138  ARG H CZ    1 
ATOM 8433  N NH1   . ARG H 8  138 ? 65.033  -73.576  -10.849 1.00 0.00 ? 138  ARG H NH1   1 
ATOM 8434  N NH2   . ARG H 8  138 ? 67.279  -73.360  -10.175 1.00 0.00 ? 138  ARG H NH2   1 
ATOM 8435  N N     . GLY H 8  139 ? 70.914  -73.496  -16.215 1.00 0.00 ? 139  GLY H N     1 
ATOM 8436  C CA    . GLY H 8  139 ? 72.122  -72.718  -16.228 1.00 0.00 ? 139  GLY H CA    1 
ATOM 8437  C C     . GLY H 8  139 ? 73.037  -73.278  -15.199 1.00 0.00 ? 139  GLY H C     1 
ATOM 8438  O O     . GLY H 8  139 ? 73.455  -72.581  -14.278 1.00 0.00 ? 139  GLY H O     1 
ATOM 8439  N N     . HIS H 8  140 ? 73.407  -74.559  -15.373 1.00 0.00 ? 140  HIS H N     1 
ATOM 8440  C CA    . HIS H 8  140 ? 74.509  -75.137  -14.662 1.00 0.00 ? 140  HIS H CA    1 
ATOM 8441  C C     . HIS H 8  140 ? 74.974  -76.283  -15.506 1.00 0.00 ? 140  HIS H C     1 
ATOM 8442  O O     . HIS H 8  140 ? 74.216  -76.847  -16.292 1.00 0.00 ? 140  HIS H O     1 
ATOM 8443  C CB    . HIS H 8  140 ? 74.261  -75.545  -13.183 1.00 0.00 ? 140  HIS H CB    1 
ATOM 8444  C CG    . HIS H 8  140 ? 72.874  -75.897  -12.747 1.00 0.00 ? 140  HIS H CG    1 
ATOM 8445  N ND1   . HIS H 8  140 ? 71.988  -76.677  -13.448 1.00 0.00 ? 140  HIS H ND1   1 
ATOM 8446  C CD2   . HIS H 8  140 ? 72.281  -75.648  -11.549 1.00 0.00 ? 140  HIS H CD2   1 
ATOM 8447  C CE1   . HIS H 8  140 ? 70.909  -76.858  -12.650 1.00 0.00 ? 140  HIS H CE1   1 
ATOM 8448  N NE2   . HIS H 8  140 ? 71.045  -76.257  -11.483 1.00 0.00 ? 140  HIS H NE2   1 
ATOM 8449  N N     . ARG H 8  141 ? 76.284  -76.601  -15.390 1.00 0.00 ? 141  ARG H N     1 
ATOM 8450  C CA    . ARG H 8  141 ? 77.017  -77.339  -16.390 1.00 0.00 ? 141  ARG H CA    1 
ATOM 8451  C C     . ARG H 8  141 ? 77.517  -78.601  -15.743 1.00 0.00 ? 141  ARG H C     1 
ATOM 8452  O O     . ARG H 8  141 ? 78.029  -78.571  -14.624 1.00 0.00 ? 141  ARG H O     1 
ATOM 8453  C CB    . ARG H 8  141 ? 78.218  -76.498  -16.895 1.00 0.00 ? 141  ARG H CB    1 
ATOM 8454  C CG    . ARG H 8  141 ? 78.563  -76.636  -18.388 1.00 0.00 ? 141  ARG H CG    1 
ATOM 8455  C CD    . ARG H 8  141 ? 78.958  -78.048  -18.837 1.00 0.00 ? 141  ARG H CD    1 
ATOM 8456  N NE    . ARG H 8  141 ? 79.673  -77.947  -20.149 1.00 0.00 ? 141  ARG H NE    1 
ATOM 8457  C CZ    . ARG H 8  141 ? 80.052  -79.046  -20.866 1.00 0.00 ? 141  ARG H CZ    1 
ATOM 8458  N NH1   . ARG H 8  141 ? 79.623  -80.294  -20.523 1.00 0.00 ? 141  ARG H NH1   1 
ATOM 8459  N NH2   . ARG H 8  141 ? 80.915  -78.899  -21.916 1.00 0.00 ? 141  ARG H NH2   1 
ATOM 8460  N N     . VAL H 8  142 ? 77.341  -79.753  -16.435 1.00 0.00 ? 142  VAL H N     1 
ATOM 8461  C CA    . VAL H 8  142 ? 77.760  -81.047  -15.946 1.00 0.00 ? 142  VAL H CA    1 
ATOM 8462  C C     . VAL H 8  142 ? 78.545  -81.669  -17.074 1.00 0.00 ? 142  VAL H C     1 
ATOM 8463  O O     . VAL H 8  142 ? 78.035  -81.811  -18.184 1.00 0.00 ? 142  VAL H O     1 
ATOM 8464  C CB    . VAL H 8  142 ? 76.595  -81.965  -15.574 1.00 0.00 ? 142  VAL H CB    1 
ATOM 8465  C CG1   . VAL H 8  142 ? 77.145  -83.235  -14.885 1.00 0.00 ? 142  VAL H CG1   1 
ATOM 8466  C CG2   . VAL H 8  142 ? 75.599  -81.196  -14.677 1.00 0.00 ? 142  VAL H CG2   1 
ATOM 8467  N N     . GLU H 8  143 ? 79.820  -82.048  -16.800 1.00 0.00 ? 143  GLU H N     1 
ATOM 8468  C CA    . GLU H 8  143 ? 80.702  -82.663  -17.769 1.00 0.00 ? 143  GLU H CA    1 
ATOM 8469  C C     . GLU H 8  143 ? 80.468  -84.154  -17.808 1.00 0.00 ? 143  GLU H C     1 
ATOM 8470  O O     . GLU H 8  143 ? 80.307  -84.745  -18.875 1.00 0.00 ? 143  GLU H O     1 
ATOM 8471  C CB    . GLU H 8  143 ? 82.194  -82.453  -17.397 1.00 0.00 ? 143  GLU H CB    1 
ATOM 8472  C CG    . GLU H 8  143 ? 82.640  -80.978  -17.293 1.00 0.00 ? 143  GLU H CG    1 
ATOM 8473  C CD    . GLU H 8  143 ? 82.666  -80.268  -18.647 1.00 0.00 ? 143  GLU H CD    1 
ATOM 8474  O OE1   . GLU H 8  143 ? 82.800  -80.954  -19.695 1.00 0.00 ? 143  GLU H OE1   1 
ATOM 8475  O OE2   . GLU H 8  143 ? 82.579  -79.011  -18.646 1.00 0.00 ? 143  GLU H OE2   1 
ATOM 8476  N N     . LYS H 8  144 ? 80.456  -84.772  -16.606 1.00 0.00 ? 144  LYS H N     1 
ATOM 8477  C CA    . LYS H 8  144 ? 80.393  -86.187  -16.336 1.00 0.00 ? 144  LYS H CA    1 
ATOM 8478  C C     . LYS H 8  144 ? 79.104  -86.823  -16.798 1.00 0.00 ? 144  LYS H C     1 
ATOM 8479  O O     . LYS H 8  144 ? 78.040  -86.208  -16.767 1.00 0.00 ? 144  LYS H O     1 
ATOM 8480  C CB    . LYS H 8  144 ? 80.584  -86.376  -14.817 1.00 0.00 ? 144  LYS H CB    1 
ATOM 8481  C CG    . LYS H 8  144 ? 80.526  -87.794  -14.240 1.00 0.00 ? 144  LYS H CG    1 
ATOM 8482  C CD    . LYS H 8  144 ? 80.809  -87.755  -12.733 1.00 0.00 ? 144  LYS H CD    1 
ATOM 8483  C CE    . LYS H 8  144 ? 80.384  -89.019  -11.989 1.00 0.00 ? 144  LYS H CE    1 
ATOM 8484  N NZ    . LYS H 8  144 ? 81.200  -90.181  -12.401 1.00 0.00 ? 144  LYS H NZ    1 
ATOM 8485  N N     . ILE H 8  145 ? 79.207  -88.095  -17.254 1.00 0.00 ? 145  ILE H N     1 
ATOM 8486  C CA    . ILE H 8  145 ? 78.104  -88.907  -17.710 1.00 0.00 ? 145  ILE H CA    1 
ATOM 8487  C C     . ILE H 8  145 ? 78.433  -90.254  -17.096 1.00 0.00 ? 145  ILE H C     1 
ATOM 8488  O O     . ILE H 8  145 ? 79.618  -90.594  -17.086 1.00 0.00 ? 145  ILE H O     1 
ATOM 8489  C CB    . ILE H 8  145 ? 77.934  -88.962  -19.252 1.00 0.00 ? 145  ILE H CB    1 
ATOM 8490  C CG1   . ILE H 8  145 ? 77.994  -90.382  -19.884 1.00 0.00 ? 145  ILE H CG1   1 
ATOM 8491  C CG2   . ILE H 8  145 ? 78.929  -87.997  -19.944 1.00 0.00 ? 145  ILE H CG2   1 
ATOM 8492  C CD1   . ILE H 8  145 ? 77.614  -90.433  -21.368 1.00 0.00 ? 145  ILE H CD1   1 
ATOM 8493  N N     . PRO H 8  146 ? 77.512  -91.056  -16.541 1.00 0.00 ? 146  PRO H N     1 
ATOM 8494  C CA    . PRO H 8  146 ? 76.069  -90.887  -16.639 1.00 0.00 ? 146  PRO H CA    1 
ATOM 8495  C C     . PRO H 8  146 ? 75.563  -90.719  -15.221 1.00 0.00 ? 146  PRO H C     1 
ATOM 8496  O O     . PRO H 8  146 ? 75.719  -89.619  -14.691 1.00 0.00 ? 146  PRO H O     1 
ATOM 8497  C CB    . PRO H 8  146 ? 75.614  -92.209  -17.284 1.00 0.00 ? 146  PRO H CB    1 
ATOM 8498  C CG    . PRO H 8  146 ? 76.648  -93.273  -16.860 1.00 0.00 ? 146  PRO H CG    1 
ATOM 8499  C CD    . PRO H 8  146 ? 77.849  -92.470  -16.334 1.00 0.00 ? 146  PRO H CD    1 
ATOM 8500  N N     . GLU H 8  147 ? 74.999  -91.794  -14.598 1.00 0.00 ? 147  GLU H N     1 
ATOM 8501  C CA    . GLU H 8  147 ? 74.736  -91.980  -13.184 1.00 0.00 ? 147  GLU H CA    1 
ATOM 8502  C C     . GLU H 8  147 ? 73.907  -90.894  -12.551 1.00 0.00 ? 147  GLU H C     1 
ATOM 8503  O O     . GLU H 8  147 ? 74.291  -90.317  -11.537 1.00 0.00 ? 147  GLU H O     1 
ATOM 8504  C CB    . GLU H 8  147 ? 76.009  -92.345  -12.367 1.00 0.00 ? 147  GLU H CB    1 
ATOM 8505  C CG    . GLU H 8  147 ? 77.138  -91.294  -12.286 1.00 0.00 ? 147  GLU H CG    1 
ATOM 8506  C CD    . GLU H 8  147 ? 78.416  -91.948  -11.761 1.00 0.00 ? 147  GLU H CD    1 
ATOM 8507  O OE1   . GLU H 8  147 ? 78.976  -92.809  -12.492 1.00 0.00 ? 147  GLU H OE1   1 
ATOM 8508  O OE2   . GLU H 8  147 ? 78.858  -91.580  -10.640 1.00 0.00 ? 147  GLU H OE2   1 
ATOM 8509  N N     . ILE H 8  148 ? 72.747  -90.579  -13.176 1.00 0.00 ? 148  ILE H N     1 
ATOM 8510  C CA    . ILE H 8  148 ? 72.133  -89.281  -13.034 1.00 0.00 ? 148  ILE H CA    1 
ATOM 8511  C C     . ILE H 8  148 ? 70.696  -89.435  -12.554 1.00 0.00 ? 148  ILE H C     1 
ATOM 8512  O O     . ILE H 8  148 ? 70.064  -90.437  -12.891 1.00 0.00 ? 148  ILE H O     1 
ATOM 8513  C CB    . ILE H 8  148 ? 72.257  -88.525  -14.357 1.00 0.00 ? 148  ILE H CB    1 
ATOM 8514  C CG1   . ILE H 8  148 ? 72.445  -87.009  -14.125 1.00 0.00 ? 148  ILE H CG1   1 
ATOM 8515  C CG2   . ILE H 8  148 ? 71.144  -88.891  -15.367 1.00 0.00 ? 148  ILE H CG2   1 
ATOM 8516  C CD1   . ILE H 8  148 ? 73.051  -86.296  -15.336 1.00 0.00 ? 148  ILE H CD1   1 
ATOM 8517  N N     . PRO H 8  149 ? 70.122  -88.499  -11.773 1.00 0.00 ? 149  PRO H N     1 
ATOM 8518  C CA    . PRO H 8  149 ? 70.791  -87.606  -10.823 1.00 0.00 ? 149  PRO H CA    1 
ATOM 8519  C C     . PRO H 8  149 ? 71.718  -88.347  -9.878  1.00 0.00 ? 149  PRO H C     1 
ATOM 8520  O O     . PRO H 8  149 ? 71.447  -89.501  -9.546  1.00 0.00 ? 149  PRO H O     1 
ATOM 8521  C CB    . PRO H 8  149 ? 69.649  -86.889  -10.091 1.00 0.00 ? 149  PRO H CB    1 
ATOM 8522  C CG    . PRO H 8  149 ? 68.485  -87.877  -10.158 1.00 0.00 ? 149  PRO H CG    1 
ATOM 8523  C CD    . PRO H 8  149 ? 68.672  -88.523  -11.531 1.00 0.00 ? 149  PRO H CD    1 
ATOM 8524  N N     . LEU H 8  150 ? 72.840  -87.687  -9.494  1.00 0.00 ? 150  LEU H N     1 
ATOM 8525  C CA    . LEU H 8  150 ? 74.005  -88.250  -8.840  1.00 0.00 ? 150  LEU H CA    1 
ATOM 8526  C C     . LEU H 8  150 ? 73.695  -88.924  -7.526  1.00 0.00 ? 150  LEU H C     1 
ATOM 8527  O O     . LEU H 8  150 ? 72.724  -88.578  -6.862  1.00 0.00 ? 150  LEU H O     1 
ATOM 8528  C CB    . LEU H 8  150 ? 75.118  -87.195  -8.647  1.00 0.00 ? 150  LEU H CB    1 
ATOM 8529  C CG    . LEU H 8  150 ? 75.474  -86.408  -9.938  1.00 0.00 ? 150  LEU H CG    1 
ATOM 8530  C CD1   . LEU H 8  150 ? 76.557  -85.360  -9.651  1.00 0.00 ? 150  LEU H CD1   1 
ATOM 8531  C CD2   . LEU H 8  150 ? 75.949  -87.297  -11.104 1.00 0.00 ? 150  LEU H CD2   1 
ATOM 8532  N N     . VAL H 8  151 ? 74.498  -89.954  -7.159  1.00 0.00 ? 151  VAL H N     1 
ATOM 8533  C CA    . VAL H 8  151 ? 74.285  -90.772  -5.984  1.00 0.00 ? 151  VAL H CA    1 
ATOM 8534  C C     . VAL H 8  151 ? 75.654  -90.866  -5.354  1.00 0.00 ? 151  VAL H C     1 
ATOM 8535  O O     . VAL H 8  151 ? 76.655  -90.982  -6.059  1.00 0.00 ? 151  VAL H O     1 
ATOM 8536  C CB    . VAL H 8  151 ? 73.695  -92.153  -6.280  1.00 0.00 ? 151  VAL H CB    1 
ATOM 8537  C CG1   . VAL H 8  151 ? 73.452  -92.917  -4.960  1.00 0.00 ? 151  VAL H CG1   1 
ATOM 8538  C CG2   . VAL H 8  151 ? 72.363  -91.989  -7.049  1.00 0.00 ? 151  VAL H CG2   1 
ATOM 8539  N N     . VAL H 8  152 ? 75.723  -90.743  -4.000  1.00 0.00 ? 152  VAL H N     1 
ATOM 8540  C CA    . VAL H 8  152 ? 76.946  -90.522  -3.248  1.00 0.00 ? 152  VAL H CA    1 
ATOM 8541  C C     . VAL H 8  152 ? 76.844  -91.418  -2.020  1.00 0.00 ? 152  VAL H C     1 
ATOM 8542  O O     . VAL H 8  152 ? 75.812  -92.050  -1.800  1.00 0.00 ? 152  VAL H O     1 
ATOM 8543  C CB    . VAL H 8  152 ? 77.141  -89.039  -2.883  1.00 0.00 ? 152  VAL H CB    1 
ATOM 8544  C CG1   . VAL H 8  152 ? 78.544  -88.751  -2.314  1.00 0.00 ? 152  VAL H CG1   1 
ATOM 8545  C CG2   . VAL H 8  152 ? 76.960  -88.166  -4.145  1.00 0.00 ? 152  VAL H CG2   1 
ATOM 8546  N N     . SER H 8  153 ? 77.941  -91.545  -1.224  1.00 0.00 ? 153  SER H N     1 
ATOM 8547  C CA    . SER H 8  153 ? 78.054  -92.379  -0.043  1.00 0.00 ? 153  SER H CA    1 
ATOM 8548  C C     . SER H 8  153 ? 77.500  -91.736  1.202   1.00 0.00 ? 153  SER H C     1 
ATOM 8549  O O     . SER H 8  153 ? 77.199  -90.545  1.248   1.00 0.00 ? 153  SER H O     1 
ATOM 8550  C CB    . SER H 8  153 ? 79.518  -92.719  0.331   1.00 0.00 ? 153  SER H CB    1 
ATOM 8551  O OG    . SER H 8  153 ? 80.145  -93.472  -0.684  1.00 0.00 ? 153  SER H OG    1 
ATOM 8552  N N     . THR H 8  154 ? 77.420  -92.579  2.262   1.00 0.00 ? 154  THR H N     1 
ATOM 8553  C CA    . THR H 8  154 ? 77.050  -92.288  3.628   1.00 0.00 ? 154  THR H CA    1 
ATOM 8554  C C     . THR H 8  154 ? 78.177  -91.556  4.336   1.00 0.00 ? 154  THR H C     1 
ATOM 8555  O O     . THR H 8  154 ? 77.968  -90.972  5.400   1.00 0.00 ? 154  THR H O     1 
ATOM 8556  C CB    . THR H 8  154 ? 76.702  -93.596  4.360   1.00 0.00 ? 154  THR H CB    1 
ATOM 8557  O OG1   . THR H 8  154 ? 76.342  -93.401  5.725   1.00 0.00 ? 154  THR H OG1   1 
ATOM 8558  C CG2   . THR H 8  154 ? 77.868  -94.610  4.286   1.00 0.00 ? 154  THR H CG2   1 
ATOM 8559  N N     . ASP H 8  155 ? 79.400  -91.552  3.741   1.00 0.00 ? 155  ASP H N     1 
ATOM 8560  C CA    . ASP H 8  155 ? 80.605  -90.978  4.307   1.00 0.00 ? 155  ASP H CA    1 
ATOM 8561  C C     . ASP H 8  155 ? 80.563  -89.461  4.266   1.00 0.00 ? 155  ASP H C     1 
ATOM 8562  O O     . ASP H 8  155 ? 81.384  -88.792  4.894   1.00 0.00 ? 155  ASP H O     1 
ATOM 8563  C CB    . ASP H 8  155 ? 81.897  -91.418  3.559   1.00 0.00 ? 155  ASP H CB    1 
ATOM 8564  C CG    . ASP H 8  155 ? 81.976  -92.937  3.367   1.00 0.00 ? 155  ASP H CG    1 
ATOM 8565  O OD1   . ASP H 8  155 ? 81.761  -93.677  4.361   1.00 0.00 ? 155  ASP H OD1   1 
ATOM 8566  O OD2   . ASP H 8  155 ? 82.262  -93.374  2.219   1.00 0.00 ? 155  ASP H OD2   1 
ATOM 8567  N N     . LEU H 8  156 ? 79.576  -88.906  3.516   1.00 0.00 ? 156  LEU H N     1 
ATOM 8568  C CA    . LEU H 8  156 ? 79.293  -87.510  3.284   1.00 0.00 ? 156  LEU H CA    1 
ATOM 8569  C C     . LEU H 8  156 ? 78.957  -86.775  4.566   1.00 0.00 ? 156  LEU H C     1 
ATOM 8570  O O     . LEU H 8  156 ? 79.239  -85.587  4.691   1.00 0.00 ? 156  LEU H O     1 
ATOM 8571  C CB    . LEU H 8  156 ? 78.126  -87.421  2.260   1.00 0.00 ? 156  LEU H CB    1 
ATOM 8572  C CG    . LEU H 8  156 ? 77.801  -86.056  1.593   1.00 0.00 ? 156  LEU H CG    1 
ATOM 8573  C CD1   . LEU H 8  156 ? 76.859  -85.158  2.422   1.00 0.00 ? 156  LEU H CD1   1 
ATOM 8574  C CD2   . LEU H 8  156 ? 79.048  -85.300  1.091   1.00 0.00 ? 156  LEU H CD2   1 
ATOM 8575  N N     . GLU H 8  157 ? 78.340  -87.470  5.550   1.00 0.00 ? 157  GLU H N     1 
ATOM 8576  C CA    . GLU H 8  157 ? 77.949  -86.928  6.830   1.00 0.00 ? 157  GLU H CA    1 
ATOM 8577  C C     . GLU H 8  157 ? 79.113  -86.503  7.705   1.00 0.00 ? 157  GLU H C     1 
ATOM 8578  O O     . GLU H 8  157 ? 79.064  -85.428  8.303   1.00 0.00 ? 157  GLU H O     1 
ATOM 8579  C CB    . GLU H 8  157 ? 77.098  -87.983  7.586   1.00 0.00 ? 157  GLU H CB    1 
ATOM 8580  C CG    . GLU H 8  157 ? 76.507  -87.571  8.956   1.00 0.00 ? 157  GLU H CG    1 
ATOM 8581  C CD    . GLU H 8  157 ? 77.495  -87.782  10.103  1.00 0.00 ? 157  GLU H CD    1 
ATOM 8582  O OE1   . GLU H 8  157 ? 77.953  -88.942  10.287  1.00 0.00 ? 157  GLU H OE1   1 
ATOM 8583  O OE2   . GLU H 8  157 ? 77.797  -86.791  10.816  1.00 0.00 ? 157  GLU H OE2   1 
ATOM 8584  N N     . SER H 8  158 ? 80.174  -87.351  7.814   1.00 0.00 ? 158  SER H N     1 
ATOM 8585  C CA    . SER H 8  158 ? 81.179  -87.284  8.867   1.00 0.00 ? 158  SER H CA    1 
ATOM 8586  C C     . SER H 8  158 ? 81.998  -86.011  8.881   1.00 0.00 ? 158  SER H C     1 
ATOM 8587  O O     . SER H 8  158 ? 82.169  -85.404  9.934   1.00 0.00 ? 158  SER H O     1 
ATOM 8588  C CB    . SER H 8  158 ? 82.142  -88.493  8.803   1.00 0.00 ? 158  SER H CB    1 
ATOM 8589  O OG    . SER H 8  158 ? 81.411  -89.713  8.854   1.00 0.00 ? 158  SER H OG    1 
ATOM 8590  N N     . ILE H 8  159 ? 82.452  -85.554  7.686   1.00 0.00 ? 159  ILE H N     1 
ATOM 8591  C CA    . ILE H 8  159 ? 83.116  -84.292  7.389   1.00 0.00 ? 159  ILE H CA    1 
ATOM 8592  C C     . ILE H 8  159 ? 82.244  -83.145  7.872   1.00 0.00 ? 159  ILE H C     1 
ATOM 8593  O O     . ILE H 8  159 ? 81.044  -83.177  7.609   1.00 0.00 ? 159  ILE H O     1 
ATOM 8594  C CB    . ILE H 8  159 ? 83.304  -84.171  5.856   1.00 0.00 ? 159  ILE H CB    1 
ATOM 8595  C CG1   . ILE H 8  159 ? 83.510  -82.718  5.378   1.00 0.00 ? 159  ILE H CG1   1 
ATOM 8596  C CG2   . ILE H 8  159 ? 82.127  -84.818  5.099   1.00 0.00 ? 159  ILE H CG2   1 
ATOM 8597  C CD1   . ILE H 8  159 ? 83.665  -82.554  3.866   1.00 0.00 ? 159  ILE H CD1   1 
ATOM 8598  N N     . GLN H 8  160 ? 82.732  -82.051  8.530   1.00 0.00 ? 160  GLN H N     1 
ATOM 8599  C CA    . GLN H 8  160 ? 83.991  -81.655  9.127   1.00 0.00 ? 160  GLN H CA    1 
ATOM 8600  C C     . GLN H 8  160 ? 85.090  -81.066  8.251   1.00 0.00 ? 160  GLN H C     1 
ATOM 8601  O O     . GLN H 8  160 ? 85.039  -79.861  7.993   1.00 0.00 ? 160  GLN H O     1 
ATOM 8602  C CB    . GLN H 8  160 ? 84.458  -82.407  10.400  1.00 0.00 ? 160  GLN H CB    1 
ATOM 8603  C CG    . GLN H 8  160 ? 83.388  -82.465  11.513  1.00 0.00 ? 160  GLN H CG    1 
ATOM 8604  C CD    . GLN H 8  160 ? 82.794  -81.067  11.865  1.00 0.00 ? 160  GLN H CD    1 
ATOM 8605  O OE1   . GLN H 8  160 ? 81.593  -80.844  11.652  1.00 0.00 ? 160  GLN H OE1   1 
ATOM 8606  N NE2   . GLN H 8  160 ? 83.667  -80.148  12.368  1.00 0.00 ? 160  GLN H NE2   1 
ATOM 8607  N N     . LYS H 8  161 ? 86.129  -81.820  7.796   1.00 0.00 ? 161  LYS H N     1 
ATOM 8608  C CA    . LYS H 8  161 ? 87.266  -81.197  7.130   1.00 0.00 ? 161  LYS H CA    1 
ATOM 8609  C C     . LYS H 8  161 ? 86.935  -80.521  5.812   1.00 0.00 ? 161  LYS H C     1 
ATOM 8610  O O     . LYS H 8  161 ? 86.138  -81.011  5.022   1.00 0.00 ? 161  LYS H O     1 
ATOM 8611  C CB    . LYS H 8  161 ? 88.464  -82.126  6.839   1.00 0.00 ? 161  LYS H CB    1 
ATOM 8612  C CG    . LYS H 8  161 ? 89.183  -82.722  8.066   1.00 0.00 ? 161  LYS H CG    1 
ATOM 8613  C CD    . LYS H 8  161 ? 88.471  -83.928  8.686   1.00 0.00 ? 161  LYS H CD    1 
ATOM 8614  C CE    . LYS H 8  161 ? 89.395  -84.855  9.495   1.00 0.00 ? 161  LYS H CE    1 
ATOM 8615  N NZ    . LYS H 8  161 ? 90.454  -85.452  8.646   1.00 0.00 ? 161  LYS H NZ    1 
ATOM 8616  N N     . THR H 8  162 ? 87.571  -79.355  5.543   1.00 0.00 ? 162  THR H N     1 
ATOM 8617  C CA    . THR H 8  162 ? 87.342  -78.549  4.359   1.00 0.00 ? 162  THR H CA    1 
ATOM 8618  C C     . THR H 8  162 ? 87.819  -79.240  3.103   1.00 0.00 ? 162  THR H C     1 
ATOM 8619  O O     . THR H 8  162 ? 87.193  -79.126  2.051   1.00 0.00 ? 162  THR H O     1 
ATOM 8620  C CB    . THR H 8  162 ? 87.982  -77.168  4.444   1.00 0.00 ? 162  THR H CB    1 
ATOM 8621  O OG1   . THR H 8  162 ? 87.815  -76.616  5.745   1.00 0.00 ? 162  THR H OG1   1 
ATOM 8622  C CG2   . THR H 8  162 ? 87.337  -76.212  3.416   1.00 0.00 ? 162  THR H CG2   1 
ATOM 8623  N N     . LYS H 8  163 ? 88.953  -79.975  3.186   1.00 0.00 ? 163  LYS H N     1 
ATOM 8624  C CA    . LYS H 8  163 ? 89.622  -80.564  2.046   1.00 0.00 ? 163  LYS H CA    1 
ATOM 8625  C C     . LYS H 8  163 ? 88.928  -81.810  1.559   1.00 0.00 ? 163  LYS H C     1 
ATOM 8626  O O     . LYS H 8  163 ? 89.156  -82.228  0.424   1.00 0.00 ? 163  LYS H O     1 
ATOM 8627  C CB    . LYS H 8  163 ? 91.091  -80.949  2.364   1.00 0.00 ? 163  LYS H CB    1 
ATOM 8628  C CG    . LYS H 8  163 ? 92.096  -79.791  2.228   1.00 0.00 ? 163  LYS H CG    1 
ATOM 8629  C CD    . LYS H 8  163 ? 91.908  -78.617  3.200   1.00 0.00 ? 163  LYS H CD    1 
ATOM 8630  C CE    . LYS H 8  163 ? 93.025  -77.576  3.063   1.00 0.00 ? 163  LYS H CE    1 
ATOM 8631  N NZ    . LYS H 8  163 ? 92.797  -76.423  3.965   1.00 0.00 ? 163  LYS H NZ    1 
ATOM 8632  N N     . GLU H 8  164 ? 88.050  -82.425  2.389   1.00 0.00 ? 164  GLU H N     1 
ATOM 8633  C CA    . GLU H 8  164 ? 87.337  -83.621  2.002   1.00 0.00 ? 164  GLU H CA    1 
ATOM 8634  C C     . GLU H 8  164 ? 86.073  -83.233  1.277   1.00 0.00 ? 164  GLU H C     1 
ATOM 8635  O O     . GLU H 8  164 ? 85.466  -84.076  0.620   1.00 0.00 ? 164  GLU H O     1 
ATOM 8636  C CB    . GLU H 8  164 ? 86.975  -84.542  3.200   1.00 0.00 ? 164  GLU H CB    1 
ATOM 8637  C CG    . GLU H 8  164 ? 88.069  -85.563  3.587   1.00 0.00 ? 164  GLU H CG    1 
ATOM 8638  C CD    . GLU H 8  164 ? 89.173  -84.969  4.466   1.00 0.00 ? 164  GLU H CD    1 
ATOM 8639  O OE1   . GLU H 8  164 ? 89.930  -84.092  3.980   1.00 0.00 ? 164  GLU H OE1   1 
ATOM 8640  O OE2   . GLU H 8  164 ? 89.283  -85.410  5.644   1.00 0.00 ? 164  GLU H OE2   1 
ATOM 8641  N N     . ALA H 8  165 ? 85.665  -81.937  1.343   1.00 0.00 ? 165  ALA H N     1 
ATOM 8642  C CA    . ALA H 8  165 ? 84.584  -81.401  0.549   1.00 0.00 ? 165  ALA H CA    1 
ATOM 8643  C C     . ALA H 8  165 ? 85.017  -81.288  -0.883  1.00 0.00 ? 165  ALA H C     1 
ATOM 8644  O O     . ALA H 8  165 ? 84.249  -81.594  -1.788  1.00 0.00 ? 165  ALA H O     1 
ATOM 8645  C CB    . ALA H 8  165 ? 84.113  -80.006  1.008   1.00 0.00 ? 165  ALA H CB    1 
ATOM 8646  N N     . VAL H 8  166 ? 86.282  -80.854  -1.106  1.00 0.00 ? 166  VAL H N     1 
ATOM 8647  C CA    . VAL H 8  166 ? 86.900  -80.693  -2.405  1.00 0.00 ? 166  VAL H CA    1 
ATOM 8648  C C     . VAL H 8  166 ? 87.079  -82.042  -3.062  1.00 0.00 ? 166  VAL H C     1 
ATOM 8649  O O     . VAL H 8  166 ? 86.876  -82.187  -4.267  1.00 0.00 ? 166  VAL H O     1 
ATOM 8650  C CB    . VAL H 8  166 ? 88.241  -79.970  -2.321  1.00 0.00 ? 166  VAL H CB    1 
ATOM 8651  C CG1   . VAL H 8  166 ? 88.784  -79.677  -3.738  1.00 0.00 ? 166  VAL H CG1   1 
ATOM 8652  C CG2   . VAL H 8  166 ? 88.056  -78.663  -1.519  1.00 0.00 ? 166  VAL H CG2   1 
ATOM 8653  N N     . ALA H 8  167 ? 87.443  -83.067  -2.251  1.00 0.00 ? 167  ALA H N     1 
ATOM 8654  C CA    . ALA H 8  167 ? 87.610  -84.441  -2.666  1.00 0.00 ? 167  ALA H CA    1 
ATOM 8655  C C     . ALA H 8  167 ? 86.305  -85.063  -3.092  1.00 0.00 ? 167  ALA H C     1 
ATOM 8656  O O     . ALA H 8  167 ? 86.279  -85.908  -3.984  1.00 0.00 ? 167  ALA H O     1 
ATOM 8657  C CB    . ALA H 8  167 ? 88.205  -85.315  -1.547  1.00 0.00 ? 167  ALA H CB    1 
ATOM 8658  N N     . ALA H 8  168 ? 85.183  -84.660  -2.450  1.00 0.00 ? 168  ALA H N     1 
ATOM 8659  C CA    . ALA H 8  168 ? 83.854  -85.077  -2.827  1.00 0.00 ? 168  ALA H CA    1 
ATOM 8660  C C     . ALA H 8  168 ? 83.440  -84.452  -4.137  1.00 0.00 ? 168  ALA H C     1 
ATOM 8661  O O     . ALA H 8  168 ? 82.821  -85.117  -4.965  1.00 0.00 ? 168  ALA H O     1 
ATOM 8662  C CB    . ALA H 8  168 ? 82.797  -84.720  -1.763  1.00 0.00 ? 168  ALA H CB    1 
ATOM 8663  N N     . LEU H 8  169 ? 83.780  -83.151  -4.343  1.00 0.00 ? 169  LEU H N     1 
ATOM 8664  C CA    . LEU H 8  169 ? 83.320  -82.359  -5.462  1.00 0.00 ? 169  LEU H CA    1 
ATOM 8665  C C     . LEU H 8  169 ? 84.018  -82.692  -6.754  1.00 0.00 ? 169  LEU H C     1 
ATOM 8666  O O     . LEU H 8  169 ? 83.451  -82.447  -7.818  1.00 0.00 ? 169  LEU H O     1 
ATOM 8667  C CB    . LEU H 8  169 ? 83.482  -80.831  -5.246  1.00 0.00 ? 169  LEU H CB    1 
ATOM 8668  C CG    . LEU H 8  169 ? 82.490  -80.211  -4.231  1.00 0.00 ? 169  LEU H CG    1 
ATOM 8669  C CD1   . LEU H 8  169 ? 82.832  -78.733  -3.954  1.00 0.00 ? 169  LEU H CD1   1 
ATOM 8670  C CD2   . LEU H 8  169 ? 81.018  -80.350  -4.669  1.00 0.00 ? 169  LEU H CD2   1 
ATOM 8671  N N     . LYS H 8  170 ? 85.247  -83.270  -6.719  1.00 0.00 ? 170  LYS H N     1 
ATOM 8672  C CA    . LYS H 8  170 ? 85.952  -83.653  -7.927  1.00 0.00 ? 170  LYS H CA    1 
ATOM 8673  C C     . LYS H 8  170 ? 85.268  -84.825  -8.596  1.00 0.00 ? 170  LYS H C     1 
ATOM 8674  O O     . LYS H 8  170 ? 85.239  -84.912  -9.823  1.00 0.00 ? 170  LYS H O     1 
ATOM 8675  C CB    . LYS H 8  170 ? 87.470  -83.924  -7.716  1.00 0.00 ? 170  LYS H CB    1 
ATOM 8676  C CG    . LYS H 8  170 ? 87.835  -85.165  -6.881  1.00 0.00 ? 170  LYS H CG    1 
ATOM 8677  C CD    . LYS H 8  170 ? 88.073  -86.443  -7.705  1.00 0.00 ? 170  LYS H CD    1 
ATOM 8678  C CE    . LYS H 8  170 ? 88.051  -87.713  -6.845  1.00 0.00 ? 170  LYS H CE    1 
ATOM 8679  N NZ    . LYS H 8  170 ? 88.138  -88.923  -7.691  1.00 0.00 ? 170  LYS H NZ    1 
ATOM 8680  N N     . ALA H 8  171 ? 84.709  -85.752  -7.773  1.00 0.00 ? 171  ALA H N     1 
ATOM 8681  C CA    . ALA H 8  171 ? 84.087  -86.984  -8.189  1.00 0.00 ? 171  ALA H CA    1 
ATOM 8682  C C     . ALA H 8  171 ? 82.820  -86.753  -8.962  1.00 0.00 ? 171  ALA H C     1 
ATOM 8683  O O     . ALA H 8  171 ? 82.570  -87.431  -9.957  1.00 0.00 ? 171  ALA H O     1 
ATOM 8684  C CB    . ALA H 8  171 ? 83.727  -87.871  -6.981  1.00 0.00 ? 171  ALA H CB    1 
ATOM 8685  N N     . VAL H 8  172 ? 81.989  -85.787  -8.499  1.00 0.00 ? 172  VAL H N     1 
ATOM 8686  C CA    . VAL H 8  172 ? 80.659  -85.550  -9.016  1.00 0.00 ? 172  VAL H CA    1 
ATOM 8687  C C     . VAL H 8  172 ? 80.670  -84.726  -10.282 1.00 0.00 ? 172  VAL H C     1 
ATOM 8688  O O     . VAL H 8  172 ? 79.684  -84.754  -11.018 1.00 0.00 ? 172  VAL H O     1 
ATOM 8689  C CB    . VAL H 8  172 ? 79.736  -84.896  -7.992  1.00 0.00 ? 172  VAL H CB    1 
ATOM 8690  C CG1   . VAL H 8  172 ? 79.241  -85.987  -7.021  1.00 0.00 ? 172  VAL H CG1   1 
ATOM 8691  C CG2   . VAL H 8  172 ? 80.443  -83.749  -7.250  1.00 0.00 ? 172  VAL H CG2   1 
ATOM 8692  N N     . GLY H 8  173 ? 81.798  -84.023  -10.567 1.00 0.00 ? 173  GLY H N     1 
ATOM 8693  C CA    . GLY H 8  173 ? 82.136  -83.312  -11.785 1.00 0.00 ? 173  GLY H CA    1 
ATOM 8694  C C     . GLY H 8  173 ? 81.018  -82.802  -12.686 1.00 0.00 ? 173  GLY H C     1 
ATOM 8695  O O     . GLY H 8  173 ? 80.798  -83.404  -13.734 1.00 0.00 ? 173  GLY H O     1 
ATOM 8696  N N     . ALA H 8  174 ? 80.254  -81.714  -12.369 1.00 0.00 ? 174  ALA H N     1 
ATOM 8697  C CA    . ALA H 8  174 ? 80.363  -80.719  -11.324 1.00 0.00 ? 174  ALA H CA    1 
ATOM 8698  C C     . ALA H 8  174 ? 81.734  -80.116  -11.179 1.00 0.00 ? 174  ALA H C     1 
ATOM 8699  O O     . ALA H 8  174 ? 82.530  -80.140  -12.118 1.00 0.00 ? 174  ALA H O     1 
ATOM 8700  C CB    . ALA H 8  174 ? 79.829  -81.190  -9.959  1.00 0.00 ? 174  ALA H CB    1 
ATOM 8701  N N     . HIS H 8  175 ? 81.995  -79.542  -9.975  1.00 0.00 ? 175  HIS H N     1 
ATOM 8702  C CA    . HIS H 8  175 ? 83.229  -78.943  -9.529  1.00 0.00 ? 175  HIS H CA    1 
ATOM 8703  C C     . HIS H 8  175 ? 83.346  -77.549  -10.064 1.00 0.00 ? 175  HIS H C     1 
ATOM 8704  O O     . HIS H 8  175 ? 83.321  -76.587  -9.299  1.00 0.00 ? 175  HIS H O     1 
ATOM 8705  C CB    . HIS H 8  175 ? 84.523  -79.741  -9.823  1.00 0.00 ? 175  HIS H CB    1 
ATOM 8706  C CG    . HIS H 8  175 ? 85.709  -79.162  -9.106  1.00 0.00 ? 175  HIS H CG    1 
ATOM 8707  N ND1   . HIS H 8  175 ? 85.900  -79.252  -7.744  1.00 0.00 ? 175  HIS H ND1   1 
ATOM 8708  C CD2   . HIS H 8  175 ? 86.705  -78.359  -9.572  1.00 0.00 ? 175  HIS H CD2   1 
ATOM 8709  C CE1   . HIS H 8  175 ? 87.002  -78.514  -7.460  1.00 0.00 ? 175  HIS H CE1   1 
ATOM 8710  N NE2   . HIS H 8  175 ? 87.524  -77.952  -8.535  1.00 0.00 ? 175  HIS H NE2   1 
ATOM 8711  N N     . SER H 8  176 ? 83.443  -77.449  -11.414 1.00 0.00 ? 176  SER H N     1 
ATOM 8712  C CA    . SER H 8  176 ? 83.533  -76.261  -12.224 1.00 0.00 ? 176  SER H CA    1 
ATOM 8713  C C     . SER H 8  176 ? 82.286  -75.435  -12.096 1.00 0.00 ? 176  SER H C     1 
ATOM 8714  O O     . SER H 8  176 ? 82.332  -74.211  -12.212 1.00 0.00 ? 176  SER H O     1 
ATOM 8715  C CB    . SER H 8  176 ? 83.689  -76.626  -13.717 1.00 0.00 ? 176  SER H CB    1 
ATOM 8716  O OG    . SER H 8  176 ? 84.850  -77.420  -13.920 1.00 0.00 ? 176  SER H OG    1 
ATOM 8717  N N     . ASP H 8  177 ? 81.141  -76.114  -11.844 1.00 0.00 ? 177  ASP H N     1 
ATOM 8718  C CA    . ASP H 8  177 ? 79.858  -75.512  -11.608 1.00 0.00 ? 177  ASP H CA    1 
ATOM 8719  C C     . ASP H 8  177 ? 79.857  -74.676  -10.351 1.00 0.00 ? 177  ASP H C     1 
ATOM 8720  O O     . ASP H 8  177 ? 79.234  -73.621  -10.314 1.00 0.00 ? 177  ASP H O     1 
ATOM 8721  C CB    . ASP H 8  177 ? 78.740  -76.581  -11.519 1.00 0.00 ? 177  ASP H CB    1 
ATOM 8722  C CG    . ASP H 8  177 ? 77.377  -75.912  -11.657 1.00 0.00 ? 177  ASP H CG    1 
ATOM 8723  O OD1   . ASP H 8  177 ? 77.218  -75.153  -12.651 1.00 0.00 ? 177  ASP H OD1   1 
ATOM 8724  O OD2   . ASP H 8  177 ? 76.503  -76.124  -10.777 1.00 0.00 ? 177  ASP H OD2   1 
ATOM 8725  N N     . LEU H 8  178 ? 80.554  -75.122  -9.281  1.00 0.00 ? 178  LEU H N     1 
ATOM 8726  C CA    . LEU H 8  178 ? 80.616  -74.383  -8.043  1.00 0.00 ? 178  LEU H CA    1 
ATOM 8727  C C     . LEU H 8  178 ? 81.680  -73.313  -8.115  1.00 0.00 ? 178  LEU H C     1 
ATOM 8728  O O     . LEU H 8  178 ? 81.672  -72.391  -7.301  1.00 0.00 ? 178  LEU H O     1 
ATOM 8729  C CB    . LEU H 8  178 ? 80.882  -75.267  -6.799  1.00 0.00 ? 178  LEU H CB    1 
ATOM 8730  C CG    . LEU H 8  178 ? 79.826  -76.383  -6.590  1.00 0.00 ? 178  LEU H CG    1 
ATOM 8731  C CD1   . LEU H 8  178 ? 80.214  -77.699  -7.296  1.00 0.00 ? 178  LEU H CD1   1 
ATOM 8732  C CD2   . LEU H 8  178 ? 79.543  -76.619  -5.092  1.00 0.00 ? 178  LEU H CD2   1 
ATOM 8733  N N     . LEU H 8  179 ? 82.602  -73.388  -9.114  1.00 0.00 ? 179  LEU H N     1 
ATOM 8734  C CA    . LEU H 8  179 ? 83.584  -72.353  -9.368  1.00 0.00 ? 179  LEU H CA    1 
ATOM 8735  C C     . LEU H 8  179 ? 82.942  -71.195  -10.092 1.00 0.00 ? 179  LEU H C     1 
ATOM 8736  O O     . LEU H 8  179 ? 83.374  -70.055  -9.947  1.00 0.00 ? 179  LEU H O     1 
ATOM 8737  C CB    . LEU H 8  179 ? 84.797  -72.822  -10.213 1.00 0.00 ? 179  LEU H CB    1 
ATOM 8738  C CG    . LEU H 8  179 ? 85.576  -74.022  -9.618  1.00 0.00 ? 179  LEU H CG    1 
ATOM 8739  C CD1   . LEU H 8  179 ? 86.742  -74.447  -10.532 1.00 0.00 ? 179  LEU H CD1   1 
ATOM 8740  C CD2   . LEU H 8  179 ? 86.062  -73.794  -8.173  1.00 0.00 ? 179  LEU H CD2   1 
ATOM 8741  N N     . LYS H 8  180 ? 81.855  -71.462  -10.860 1.00 0.00 ? 180  LYS H N     1 
ATOM 8742  C CA    . LYS H 8  180 ? 81.052  -70.473  -11.546 1.00 0.00 ? 180  LYS H CA    1 
ATOM 8743  C C     . LYS H 8  180 ? 80.367  -69.579  -10.548 1.00 0.00 ? 180  LYS H C     1 
ATOM 8744  O O     . LYS H 8  180 ? 80.256  -68.371  -10.758 1.00 0.00 ? 180  LYS H O     1 
ATOM 8745  C CB    . LYS H 8  180 ? 79.968  -71.155  -12.417 1.00 0.00 ? 180  LYS H CB    1 
ATOM 8746  C CG    . LYS H 8  180 ? 79.016  -70.217  -13.181 1.00 0.00 ? 180  LYS H CG    1 
ATOM 8747  C CD    . LYS H 8  180 ? 77.810  -70.929  -13.823 1.00 0.00 ? 180  LYS H CD    1 
ATOM 8748  C CE    . LYS H 8  180 ? 76.614  -71.140  -12.875 1.00 0.00 ? 180  LYS H CE    1 
ATOM 8749  N NZ    . LYS H 8  180 ? 76.858  -72.184  -11.856 1.00 0.00 ? 180  LYS H NZ    1 
ATOM 8750  N N     . VAL H 8  181 ? 79.897  -70.174  -9.425  1.00 0.00 ? 181  VAL H N     1 
ATOM 8751  C CA    . VAL H 8  181 ? 79.150  -69.497  -8.396  1.00 0.00 ? 181  VAL H CA    1 
ATOM 8752  C C     . VAL H 8  181 ? 80.041  -68.541  -7.621  1.00 0.00 ? 181  VAL H C     1 
ATOM 8753  O O     . VAL H 8  181 ? 79.555  -67.506  -7.167  1.00 0.00 ? 181  VAL H O     1 
ATOM 8754  C CB    . VAL H 8  181 ? 78.413  -70.488  -7.497  1.00 0.00 ? 181  VAL H CB    1 
ATOM 8755  C CG1   . VAL H 8  181 ? 77.633  -69.754  -6.389  1.00 0.00 ? 181  VAL H CG1   1 
ATOM 8756  C CG2   . VAL H 8  181 ? 77.434  -71.309  -8.368  1.00 0.00 ? 181  VAL H CG2   1 
ATOM 8757  N N     . LEU H 8  182 ? 81.371  -68.823  -7.500  1.00 0.00 ? 182  LEU H N     1 
ATOM 8758  C CA    . LEU H 8  182 ? 82.331  -67.907  -6.898  1.00 0.00 ? 182  LEU H CA    1 
ATOM 8759  C C     . LEU H 8  182 ? 82.998  -67.030  -7.935  1.00 0.00 ? 182  LEU H C     1 
ATOM 8760  O O     . LEU H 8  182 ? 84.201  -66.777  -7.866  1.00 0.00 ? 182  LEU H O     1 
ATOM 8761  C CB    . LEU H 8  182 ? 83.363  -68.553  -5.920  1.00 0.00 ? 182  LEU H CB    1 
ATOM 8762  C CG    . LEU H 8  182 ? 84.133  -69.832  -6.347  1.00 0.00 ? 182  LEU H CG    1 
ATOM 8763  C CD1   . LEU H 8  182 ? 85.291  -69.621  -7.343  1.00 0.00 ? 182  LEU H CD1   1 
ATOM 8764  C CD2   . LEU H 8  182 ? 84.703  -70.533  -5.098  1.00 0.00 ? 182  LEU H CD2   1 
ATOM 8765  N N     . LYS H 8  183 ? 82.222  -66.510  -8.917  1.00 0.00 ? 183  LYS H N     1 
ATOM 8766  C CA    . LYS H 8  183 ? 82.778  -65.679  -9.955  1.00 0.00 ? 183  LYS H CA    1 
ATOM 8767  C C     . LYS H 8  183 ? 81.795  -64.597  -10.280 1.00 0.00 ? 183  LYS H C     1 
ATOM 8768  O O     . LYS H 8  183 ? 80.597  -64.848  -10.389 1.00 0.00 ? 183  LYS H O     1 
ATOM 8769  C CB    . LYS H 8  183 ? 83.114  -66.479  -11.239 1.00 0.00 ? 183  LYS H CB    1 
ATOM 8770  C CG    . LYS H 8  183 ? 84.475  -66.083  -11.836 1.00 0.00 ? 183  LYS H CG    1 
ATOM 8771  C CD    . LYS H 8  183 ? 85.047  -67.077  -12.865 1.00 0.00 ? 183  LYS H CD    1 
ATOM 8772  C CE    . LYS H 8  183 ? 85.245  -68.516  -12.348 1.00 0.00 ? 183  LYS H CE    1 
ATOM 8773  N NZ    . LYS H 8  183 ? 85.999  -68.543  -11.069 1.00 0.00 ? 183  LYS H NZ    1 
ATOM 8774  N N     . SER H 8  184 ? 82.327  -63.358  -10.441 1.00 0.00 ? 184  SER H N     1 
ATOM 8775  C CA    . SER H 8  184 ? 81.633  -62.153  -10.848 1.00 0.00 ? 184  SER H CA    1 
ATOM 8776  C C     . SER H 8  184 ? 81.086  -62.334  -12.243 1.00 0.00 ? 184  SER H C     1 
ATOM 8777  O O     . SER H 8  184 ? 81.908  -62.543  -13.134 1.00 0.00 ? 184  SER H O     1 
ATOM 8778  C CB    . SER H 8  184 ? 82.592  -60.944  -10.869 1.00 0.00 ? 184  SER H CB    1 
ATOM 8779  O OG    . SER H 8  184 ? 83.037  -60.652  -9.550  1.00 0.00 ? 184  SER H OG    1 
ATOM 8780  N N     . LYS H 8  185 ? 79.764  -62.284  -12.596 1.00 0.00 ? 185  LYS H N     1 
ATOM 8781  C CA    . LYS H 8  185 ? 78.411  -62.176  -12.055 1.00 0.00 ? 185  LYS H CA    1 
ATOM 8782  C C     . LYS H 8  185 ? 77.982  -62.157  -10.596 1.00 0.00 ? 185  LYS H C     1 
ATOM 8783  O O     . LYS H 8  185 ? 76.876  -61.693  -10.326 1.00 0.00 ? 185  LYS H O     1 
ATOM 8784  C CB    . LYS H 8  185 ? 77.536  -63.259  -12.746 1.00 0.00 ? 185  LYS H CB    1 
ATOM 8785  C CG    . LYS H 8  185 ? 77.400  -63.086  -14.274 1.00 0.00 ? 185  LYS H CG    1 
ATOM 8786  C CD    . LYS H 8  185 ? 76.487  -61.911  -14.667 1.00 0.00 ? 185  LYS H CD    1 
ATOM 8787  C CE    . LYS H 8  185 ? 76.331  -61.690  -16.176 1.00 0.00 ? 185  LYS H CE    1 
ATOM 8788  N NZ    . LYS H 8  185 ? 75.416  -60.550  -16.435 1.00 0.00 ? 185  LYS H NZ    1 
ATOM 8789  N N     . LYS H 8  186 ? 78.777  -62.625  -9.612  1.00 0.00 ? 186  LYS H N     1 
ATOM 8790  C CA    . LYS H 8  186 ? 78.448  -62.624  -8.204  1.00 0.00 ? 186  LYS H CA    1 
ATOM 8791  C C     . LYS H 8  186 ? 78.169  -61.232  -7.697  1.00 0.00 ? 186  LYS H C     1 
ATOM 8792  O O     . LYS H 8  186 ? 77.124  -61.014  -7.084  1.00 0.00 ? 186  LYS H O     1 
ATOM 8793  C CB    . LYS H 8  186 ? 79.573  -63.297  -7.383  1.00 0.00 ? 186  LYS H CB    1 
ATOM 8794  C CG    . LYS H 8  186 ? 79.181  -63.648  -5.939  1.00 0.00 ? 186  LYS H CG    1 
ATOM 8795  C CD    . LYS H 8  186 ? 80.092  -64.724  -5.322  1.00 0.00 ? 186  LYS H CD    1 
ATOM 8796  C CE    . LYS H 8  186 ? 79.444  -65.461  -4.139  1.00 0.00 ? 186  LYS H CE    1 
ATOM 8797  N NZ    . LYS H 8  186 ? 80.164  -66.720  -3.830  1.00 0.00 ? 186  LYS H NZ    1 
ATOM 8798  N N     . LEU H 8  187 ? 79.065  -60.272  -8.051  1.00 0.00 ? 187  LEU H N     1 
ATOM 8799  C CA    . LEU H 8  187 ? 78.928  -58.826  -7.992  1.00 0.00 ? 187  LEU H CA    1 
ATOM 8800  C C     . LEU H 8  187 ? 78.119  -58.249  -6.847  1.00 0.00 ? 187  LEU H C     1 
ATOM 8801  O O     . LEU H 8  187 ? 78.141  -58.763  -5.728  1.00 0.00 ? 187  LEU H O     1 
ATOM 8802  C CB    . LEU H 8  187 ? 78.531  -58.200  -9.364  1.00 0.00 ? 187  LEU H CB    1 
ATOM 8803  C CG    . LEU H 8  187 ? 79.570  -58.393  -10.495 1.00 0.00 ? 187  LEU H CG    1 
ATOM 8804  C CD1   . LEU H 8  187 ? 79.014  -57.843  -11.825 1.00 0.00 ? 187  LEU H CD1   1 
ATOM 8805  C CD2   . LEU H 8  187 ? 80.914  -57.714  -10.153 1.00 0.00 ? 187  LEU H CD2   1 
ATOM 8806  N N     . ARG H 8  188 ? 77.459  -57.098  -7.107  1.00 0.00 ? 188  ARG H N     1 
ATOM 8807  C CA    . ARG H 8  188 ? 76.963  -56.202  -6.105  1.00 0.00 ? 188  ARG H CA    1 
ATOM 8808  C C     . ARG H 8  188 ? 75.531  -55.921  -6.460  1.00 0.00 ? 188  ARG H C     1 
ATOM 8809  O O     . ARG H 8  188 ? 75.250  -55.272  -7.466  1.00 0.00 ? 188  ARG H O     1 
ATOM 8810  C CB    . ARG H 8  188 ? 77.747  -54.861  -6.152  1.00 0.00 ? 188  ARG H CB    1 
ATOM 8811  C CG    . ARG H 8  188 ? 79.280  -54.968  -5.974  1.00 0.00 ? 188  ARG H CG    1 
ATOM 8812  C CD    . ARG H 8  188 ? 79.789  -55.158  -4.534  1.00 0.00 ? 188  ARG H CD    1 
ATOM 8813  N NE    . ARG H 8  188 ? 79.598  -56.578  -4.089  1.00 0.00 ? 188  ARG H NE    1 
ATOM 8814  C CZ    . ARG H 8  188 ? 80.250  -57.103  -3.007  1.00 0.00 ? 188  ARG H CZ    1 
ATOM 8815  N NH1   . ARG H 8  188 ? 81.088  -56.337  -2.248  1.00 0.00 ? 188  ARG H NH1   1 
ATOM 8816  N NH2   . ARG H 8  188 ? 80.061  -58.416  -2.683  1.00 0.00 ? 188  ARG H NH2   1 
ATOM 8817  N N     . ALA H 8  189 ? 74.584  -56.392  -5.613  1.00 0.00 ? 189  ALA H N     1 
ATOM 8818  C CA    . ALA H 8  189 ? 73.189  -56.039  -5.726  1.00 0.00 ? 189  ALA H CA    1 
ATOM 8819  C C     . ALA H 8  189 ? 72.983  -54.669  -5.129  1.00 0.00 ? 189  ALA H C     1 
ATOM 8820  O O     . ALA H 8  189 ? 73.716  -54.259  -4.229  1.00 0.00 ? 189  ALA H O     1 
ATOM 8821  C CB    . ALA H 8  189 ? 72.261  -57.051  -5.034  1.00 0.00 ? 189  ALA H CB    1 
ATOM 8822  N N     . GLY H 8  190 ? 71.980  -53.925  -5.657  1.00 0.00 ? 190  GLY H N     1 
ATOM 8823  C CA    . GLY H 8  190 ? 71.729  -52.541  -5.319  1.00 0.00 ? 190  GLY H CA    1 
ATOM 8824  C C     . GLY H 8  190 ? 70.808  -52.420  -4.139  1.00 0.00 ? 190  GLY H C     1 
ATOM 8825  O O     . GLY H 8  190 ? 71.088  -52.929  -3.053  1.00 0.00 ? 190  GLY H O     1 
ATOM 8826  N N     . LYS H 8  191 ? 69.673  -51.702  -4.349  1.00 0.00 ? 191  LYS H N     1 
ATOM 8827  C CA    . LYS H 8  191 ? 68.654  -51.476  -3.348  1.00 0.00 ? 191  LYS H CA    1 
ATOM 8828  C C     . LYS H 8  191 ? 67.775  -52.691  -3.219  1.00 0.00 ? 191  LYS H C     1 
ATOM 8829  O O     . LYS H 8  191 ? 67.084  -52.858  -2.214  1.00 0.00 ? 191  LYS H O     1 
ATOM 8830  C CB    . LYS H 8  191 ? 67.715  -50.305  -3.721  1.00 0.00 ? 191  LYS H CB    1 
ATOM 8831  C CG    . LYS H 8  191 ? 68.329  -48.912  -3.519  1.00 0.00 ? 191  LYS H CG    1 
ATOM 8832  C CD    . LYS H 8  191 ? 67.278  -47.800  -3.684  1.00 0.00 ? 191  LYS H CD    1 
ATOM 8833  C CE    . LYS H 8  191 ? 67.770  -46.410  -3.260  1.00 0.00 ? 191  LYS H CE    1 
ATOM 8834  N NZ    . LYS H 8  191 ? 66.687  -45.404  -3.381  1.00 0.00 ? 191  LYS H NZ    1 
ATOM 8835  N N     . GLY H 8  192 ? 67.806  -53.584  -4.238  1.00 0.00 ? 192  GLY H N     1 
ATOM 8836  C CA    . GLY H 8  192 ? 67.009  -54.781  -4.281  1.00 0.00 ? 192  GLY H CA    1 
ATOM 8837  C C     . GLY H 8  192 ? 67.578  -55.871  -3.420  1.00 0.00 ? 192  GLY H C     1 
ATOM 8838  O O     . GLY H 8  192 ? 66.961  -56.922  -3.296  1.00 0.00 ? 192  GLY H O     1 
ATOM 8839  N N     . LYS H 8  193 ? 68.772  -55.647  -2.811  1.00 0.00 ? 193  LYS H N     1 
ATOM 8840  C CA    . LYS H 8  193 ? 69.492  -56.595  -1.993  1.00 0.00 ? 193  LYS H CA    1 
ATOM 8841  C C     . LYS H 8  193 ? 68.740  -56.944  -0.735  1.00 0.00 ? 193  LYS H C     1 
ATOM 8842  O O     . LYS H 8  193 ? 68.729  -58.103  -0.322  1.00 0.00 ? 193  LYS H O     1 
ATOM 8843  C CB    . LYS H 8  193 ? 70.901  -56.061  -1.631  1.00 0.00 ? 193  LYS H CB    1 
ATOM 8844  C CG    . LYS H 8  193 ? 71.959  -57.141  -1.322  1.00 0.00 ? 193  LYS H CG    1 
ATOM 8845  C CD    . LYS H 8  193 ? 72.006  -57.711  0.104   1.00 0.00 ? 193  LYS H CD    1 
ATOM 8846  C CE    . LYS H 8  193 ? 72.408  -56.681  1.164   1.00 0.00 ? 193  LYS H CE    1 
ATOM 8847  N NZ    . LYS H 8  193 ? 72.591  -57.337  2.476   1.00 0.00 ? 193  LYS H NZ    1 
ATOM 8848  N N     . TYR H 8  194 ? 68.080  -55.932  -0.110  1.00 0.00 ? 194  TYR H N     1 
ATOM 8849  C CA    . TYR H 8  194 ? 67.436  -56.027  1.182   1.00 0.00 ? 194  TYR H CA    1 
ATOM 8850  C C     . TYR H 8  194 ? 66.370  -57.093  1.195   1.00 0.00 ? 194  TYR H C     1 
ATOM 8851  O O     . TYR H 8  194 ? 66.328  -57.921  2.103   1.00 0.00 ? 194  TYR H O     1 
ATOM 8852  C CB    . TYR H 8  194 ? 66.770  -54.669  1.553   1.00 0.00 ? 194  TYR H CB    1 
ATOM 8853  C CG    . TYR H 8  194 ? 66.588  -54.489  3.042   1.00 0.00 ? 194  TYR H CG    1 
ATOM 8854  C CD1   . TYR H 8  194 ? 67.360  -53.525  3.708   1.00 0.00 ? 194  TYR H CD1   1 
ATOM 8855  C CD2   . TYR H 8  194 ? 65.650  -55.231  3.787   1.00 0.00 ? 194  TYR H CD2   1 
ATOM 8856  C CE1   . TYR H 8  194 ? 67.213  -53.319  5.080   1.00 0.00 ? 194  TYR H CE1   1 
ATOM 8857  C CE2   . TYR H 8  194 ? 65.534  -55.056  5.172   1.00 0.00 ? 194  TYR H CE2   1 
ATOM 8858  C CZ    . TYR H 8  194 ? 66.322  -54.099  5.825   1.00 0.00 ? 194  TYR H CZ    1 
ATOM 8859  O OH    . TYR H 8  194 ? 66.218  -53.919  7.223   1.00 0.00 ? 194  TYR H OH    1 
ATOM 8860  N N     . ARG H 8  195 ? 65.511  -57.101  0.150   1.00 0.00 ? 195  ARG H N     1 
ATOM 8861  C CA    . ARG H 8  195 ? 64.383  -57.992  0.073   1.00 0.00 ? 195  ARG H CA    1 
ATOM 8862  C C     . ARG H 8  195 ? 64.658  -59.058  -0.954  1.00 0.00 ? 195  ARG H C     1 
ATOM 8863  O O     . ARG H 8  195 ? 63.786  -59.887  -1.204  1.00 0.00 ? 195  ARG H O     1 
ATOM 8864  C CB    . ARG H 8  195 ? 63.083  -57.246  -0.309  1.00 0.00 ? 195  ARG H CB    1 
ATOM 8865  C CG    . ARG H 8  195 ? 62.728  -56.104  0.661   1.00 0.00 ? 195  ARG H CG    1 
ATOM 8866  C CD    . ARG H 8  195 ? 61.409  -55.410  0.290   1.00 0.00 ? 195  ARG H CD    1 
ATOM 8867  N NE    . ARG H 8  195 ? 61.215  -54.222  1.186   1.00 0.00 ? 195  ARG H NE    1 
ATOM 8868  C CZ    . ARG H 8  195 ? 60.183  -53.341  1.018   1.00 0.00 ? 195  ARG H CZ    1 
ATOM 8869  N NH1   . ARG H 8  195 ? 59.214  -53.553  0.081   1.00 0.00 ? 195  ARG H NH1   1 
ATOM 8870  N NH2   . ARG H 8  195 ? 60.126  -52.221  1.795   1.00 0.00 ? 195  ARG H NH2   1 
ATOM 8871  N N     . ASN H 8  196 ? 65.884  -59.057  -1.551  1.00 0.00 ? 196  ASN H N     1 
ATOM 8872  C CA    . ASN H 8  196 ? 66.399  -60.026  -2.504  1.00 0.00 ? 196  ASN H CA    1 
ATOM 8873  C C     . ASN H 8  196 ? 65.766  -59.850  -3.867  1.00 0.00 ? 196  ASN H C     1 
ATOM 8874  O O     . ASN H 8  196 ? 64.541  -59.884  -3.984  1.00 0.00 ? 196  ASN H O     1 
ATOM 8875  C CB    . ASN H 8  196 ? 66.307  -61.506  -2.045  1.00 0.00 ? 196  ASN H CB    1 
ATOM 8876  C CG    . ASN H 8  196 ? 67.167  -61.729  -0.790  1.00 0.00 ? 196  ASN H CG    1 
ATOM 8877  O OD1   . ASN H 8  196 ? 68.376  -61.968  -0.896  1.00 0.00 ? 196  ASN H OD1   1 
ATOM 8878  N ND2   . ASN H 8  196 ? 66.521  -61.652  0.415   1.00 0.00 ? 196  ASN H ND2   1 
ATOM 8879  N N     . ARG H 8  197 ? 66.585  -59.613  -4.935  1.00 0.00 ? 197  ARG H N     1 
ATOM 8880  C CA    . ARG H 8  197 ? 66.025  -59.302  -6.236  1.00 0.00 ? 197  ARG H CA    1 
ATOM 8881  C C     . ARG H 8  197 ? 66.787  -59.779  -7.464  1.00 0.00 ? 197  ARG H C     1 
ATOM 8882  O O     . ARG H 8  197 ? 66.195  -60.522  -8.246  1.00 0.00 ? 197  ARG H O     1 
ATOM 8883  C CB    . ARG H 8  197 ? 65.643  -57.811  -6.425  1.00 0.00 ? 197  ARG H CB    1 
ATOM 8884  C CG    . ARG H 8  197 ? 64.614  -57.648  -7.558  1.00 0.00 ? 197  ARG H CG    1 
ATOM 8885  C CD    . ARG H 8  197 ? 63.978  -56.263  -7.668  1.00 0.00 ? 197  ARG H CD    1 
ATOM 8886  N NE    . ARG H 8  197 ? 62.889  -56.369  -8.695  1.00 0.00 ? 197  ARG H NE    1 
ATOM 8887  C CZ    . ARG H 8  197 ? 62.038  -55.338  -8.981  1.00 0.00 ? 197  ARG H CZ    1 
ATOM 8888  N NH1   . ARG H 8  197 ? 62.193  -54.121  -8.386  1.00 0.00 ? 197  ARG H NH1   1 
ATOM 8889  N NH2   . ARG H 8  197 ? 61.018  -55.531  -9.872  1.00 0.00 ? 197  ARG H NH2   1 
ATOM 8890  N N     . ARG H 8  198 ? 68.055  -59.379  -7.779  1.00 0.00 ? 198  ARG H N     1 
ATOM 8891  C CA    . ARG H 8  198 ? 69.133  -58.992  -6.912  1.00 0.00 ? 198  ARG H CA    1 
ATOM 8892  C C     . ARG H 8  198 ? 70.152  -58.269  -7.775  1.00 0.00 ? 198  ARG H C     1 
ATOM 8893  O O     . ARG H 8  198 ? 70.248  -57.044  -7.702  1.00 0.00 ? 198  ARG H O     1 
ATOM 8894  C CB    . ARG H 8  198 ? 69.764  -60.250  -6.239  1.00 0.00 ? 198  ARG H CB    1 
ATOM 8895  C CG    . ARG H 8  198 ? 69.964  -61.499  -7.141  1.00 0.00 ? 198  ARG H CG    1 
ATOM 8896  C CD    . ARG H 8  198 ? 69.549  -62.812  -6.476  1.00 0.00 ? 198  ARG H CD    1 
ATOM 8897  N NE    . ARG H 8  198 ? 70.443  -63.003  -5.291  1.00 0.00 ? 198  ARG H NE    1 
ATOM 8898  C CZ    . ARG H 8  198 ? 70.000  -63.269  -4.027  1.00 0.00 ? 198  ARG H CZ    1 
ATOM 8899  N NH1   . ARG H 8  198 ? 68.677  -63.461  -3.769  1.00 0.00 ? 198  ARG H NH1   1 
ATOM 8900  N NH2   . ARG H 8  198 ? 70.906  -63.344  -3.008  1.00 0.00 ? 198  ARG H NH2   1 
ATOM 8901  N N     . TRP H 8  199 ? 70.899  -59.041  -8.610  1.00 0.00 ? 199  TRP H N     1 
ATOM 8902  C CA    . TRP H 8  199 ? 71.988  -58.725  -9.507  1.00 0.00 ? 199  TRP H CA    1 
ATOM 8903  C C     . TRP H 8  199 ? 73.158  -59.542  -8.982  1.00 0.00 ? 199  TRP H C     1 
ATOM 8904  O O     . TRP H 8  199 ? 73.790  -59.115  -8.016  1.00 0.00 ? 199  TRP H O     1 
ATOM 8905  C CB    . TRP H 8  199 ? 72.410  -57.232  -9.725  1.00 0.00 ? 199  TRP H CB    1 
ATOM 8906  C CG    . TRP H 8  199 ? 73.489  -56.974  -10.781 1.00 0.00 ? 199  TRP H CG    1 
ATOM 8907  C CD1   . TRP H 8  199 ? 74.818  -56.690  -10.602 1.00 0.00 ? 199  TRP H CD1   1 
ATOM 8908  C CD2   . TRP H 8  199 ? 73.279  -57.024  -12.206 1.00 0.00 ? 199  TRP H CD2   1 
ATOM 8909  N NE1   . TRP H 8  199 ? 75.454  -56.579  -11.817 1.00 0.00 ? 199  TRP H NE1   1 
ATOM 8910  C CE2   . TRP H 8  199 ? 74.531  -56.789  -12.818 1.00 0.00 ? 199  TRP H CE2   1 
ATOM 8911  C CE3   . TRP H 8  199 ? 72.141  -57.265  -12.972 1.00 0.00 ? 199  TRP H CE3   1 
ATOM 8912  C CZ2   . TRP H 8  199 ? 74.665  -56.805  -14.204 1.00 0.00 ? 199  TRP H CZ2   1 
ATOM 8913  C CZ3   . TRP H 8  199 ? 72.285  -57.317  -14.367 1.00 0.00 ? 199  TRP H CZ3   1 
ATOM 8914  C CH2   . TRP H 8  199 ? 73.529  -57.091  -14.973 1.00 0.00 ? 199  TRP H CH2   1 
ATOM 8915  N N     . THR H 8  200 ? 73.498  -60.748  -9.533  1.00 0.00 ? 200  THR H N     1 
ATOM 8916  C CA    . THR H 8  200 ? 72.971  -61.383  -10.723 1.00 0.00 ? 200  THR H CA    1 
ATOM 8917  C C     . THR H 8  200 ? 73.552  -62.800  -10.783 1.00 0.00 ? 200  THR H C     1 
ATOM 8918  O O     . THR H 8  200 ? 73.657  -63.393  -11.857 1.00 0.00 ? 200  THR H O     1 
ATOM 8919  C CB    . THR H 8  200 ? 73.271  -60.590  -12.012 1.00 0.00 ? 200  THR H CB    1 
ATOM 8920  O OG1   . THR H 8  200 ? 72.722  -61.171  -13.193 1.00 0.00 ? 200  THR H OG1   1 
ATOM 8921  C CG2   . THR H 8  200 ? 74.770  -60.280  -12.184 1.00 0.00 ? 200  THR H CG2   1 
ATOM 8922  N N     . GLN H 8  201 ? 73.931  -63.408  -9.625  1.00 0.00 ? 201  GLN H N     1 
ATOM 8923  C CA    . GLN H 8  201 ? 74.472  -64.760  -9.599  1.00 0.00 ? 201  GLN H CA    1 
ATOM 8924  C C     . GLN H 8  201 ? 73.418  -65.840  -9.700  1.00 0.00 ? 201  GLN H C     1 
ATOM 8925  O O     . GLN H 8  201 ? 72.234  -65.632  -9.435  1.00 0.00 ? 201  GLN H O     1 
ATOM 8926  C CB    . GLN H 8  201 ? 75.448  -65.092  -8.432  1.00 0.00 ? 201  GLN H CB    1 
ATOM 8927  C CG    . GLN H 8  201 ? 75.205  -64.387  -7.084  1.00 0.00 ? 201  GLN H CG    1 
ATOM 8928  C CD    . GLN H 8  201 ? 73.800  -64.637  -6.535  1.00 0.00 ? 201  GLN H CD    1 
ATOM 8929  O OE1   . GLN H 8  201 ? 73.068  -63.671  -6.297  1.00 0.00 ? 201  GLN H OE1   1 
ATOM 8930  N NE2   . GLN H 8  201 ? 73.434  -65.939  -6.331  1.00 0.00 ? 201  GLN H NE2   1 
ATOM 8931  N N     . ARG H 8  202 ? 73.899  -67.034  -10.124 1.00 0.00 ? 202  ARG H N     1 
ATOM 8932  C CA    . ARG H 8  202 ? 73.164  -68.244  -10.383 1.00 0.00 ? 202  ARG H CA    1 
ATOM 8933  C C     . ARG H 8  202 ? 73.328  -69.155  -9.184  1.00 0.00 ? 202  ARG H C     1 
ATOM 8934  O O     . ARG H 8  202 ? 74.115  -68.870  -8.280  1.00 0.00 ? 202  ARG H O     1 
ATOM 8935  C CB    . ARG H 8  202 ? 73.731  -68.915  -11.663 1.00 0.00 ? 202  ARG H CB    1 
ATOM 8936  C CG    . ARG H 8  202 ? 72.850  -69.964  -12.374 1.00 0.00 ? 202  ARG H CG    1 
ATOM 8937  C CD    . ARG H 8  202 ? 71.489  -69.469  -12.887 1.00 0.00 ? 202  ARG H CD    1 
ATOM 8938  N NE    . ARG H 8  202 ? 71.712  -68.258  -13.750 1.00 0.00 ? 202  ARG H NE    1 
ATOM 8939  C CZ    . ARG H 8  202 ? 70.961  -67.959  -14.854 1.00 0.00 ? 202  ARG H CZ    1 
ATOM 8940  N NH1   . ARG H 8  202 ? 69.958  -68.781  -15.276 1.00 0.00 ? 202  ARG H NH1   1 
ATOM 8941  N NH2   . ARG H 8  202 ? 71.229  -66.815  -15.552 1.00 0.00 ? 202  ARG H NH2   1 
ATOM 8942  N N     . ARG H 8  203 ? 72.572  -70.282  -9.155  1.00 0.00 ? 203  ARG H N     1 
ATOM 8943  C CA    . ARG H 8  203 ? 72.602  -71.270  -8.101  1.00 0.00 ? 203  ARG H CA    1 
ATOM 8944  C C     . ARG H 8  203 ? 73.559  -72.371  -8.502  1.00 0.00 ? 203  ARG H C     1 
ATOM 8945  O O     . ARG H 8  203 ? 74.309  -72.233  -9.469  1.00 0.00 ? 203  ARG H O     1 
ATOM 8946  C CB    . ARG H 8  203 ? 71.215  -71.881  -7.762  1.00 0.00 ? 203  ARG H CB    1 
ATOM 8947  C CG    . ARG H 8  203 ? 70.133  -70.844  -7.390  1.00 0.00 ? 203  ARG H CG    1 
ATOM 8948  C CD    . ARG H 8  203 ? 69.376  -70.280  -8.601  1.00 0.00 ? 203  ARG H CD    1 
ATOM 8949  N NE    . ARG H 8  203 ? 68.238  -69.435  -8.120  1.00 0.00 ? 203  ARG H NE    1 
ATOM 8950  C CZ    . ARG H 8  203 ? 67.357  -68.862  -8.993  1.00 0.00 ? 203  ARG H CZ    1 
ATOM 8951  N NH1   . ARG H 8  203 ? 67.525  -68.999  -10.340 1.00 0.00 ? 203  ARG H NH1   1 
ATOM 8952  N NH2   . ARG H 8  203 ? 66.293  -68.158  -8.513  1.00 0.00 ? 203  ARG H NH2   1 
ATOM 8953  N N     . GLY H 8  204 ? 73.567  -73.486  -7.731  1.00 0.00 ? 204  GLY H N     1 
ATOM 8954  C CA    . GLY H 8  204 ? 74.496  -74.578  -7.898  1.00 0.00 ? 204  GLY H CA    1 
ATOM 8955  C C     . GLY H 8  204 ? 73.746  -75.862  -7.651  1.00 0.00 ? 204  GLY H C     1 
ATOM 8956  O O     . GLY H 8  204 ? 72.593  -75.955  -8.070  1.00 0.00 ? 204  GLY H O     1 
ATOM 8957  N N     . PRO H 8  205 ? 74.334  -76.879  -7.010  1.00 0.00 ? 205  PRO H N     1 
ATOM 8958  C CA    . PRO H 8  205 ? 73.708  -78.190  -6.878  1.00 0.00 ? 205  PRO H CA    1 
ATOM 8959  C C     . PRO H 8  205 ? 73.144  -78.349  -5.482  1.00 0.00 ? 205  PRO H C     1 
ATOM 8960  O O     . PRO H 8  205 ? 73.475  -77.558  -4.601  1.00 0.00 ? 205  PRO H O     1 
ATOM 8961  C CB    . PRO H 8  205 ? 74.872  -79.169  -7.086  1.00 0.00 ? 205  PRO H CB    1 
ATOM 8962  C CG    . PRO H 8  205 ? 76.104  -78.430  -6.556  1.00 0.00 ? 205  PRO H CG    1 
ATOM 8963  C CD    . PRO H 8  205 ? 75.792  -76.962  -6.861  1.00 0.00 ? 205  PRO H CD    1 
ATOM 8964  N N     . LEU H 8  206 ? 72.273  -79.367  -5.289  1.00 0.00 ? 206  LEU H N     1 
ATOM 8965  C CA    . LEU H 8  206 ? 71.607  -79.680  -4.047  1.00 0.00 ? 206  LEU H CA    1 
ATOM 8966  C C     . LEU H 8  206 ? 72.090  -81.057  -3.695  1.00 0.00 ? 206  LEU H C     1 
ATOM 8967  O O     . LEU H 8  206 ? 72.189  -81.892  -4.582  1.00 0.00 ? 206  LEU H O     1 
ATOM 8968  C CB    . LEU H 8  206 ? 70.069  -79.743  -4.256  1.00 0.00 ? 206  LEU H CB    1 
ATOM 8969  C CG    . LEU H 8  206 ? 69.219  -80.163  -3.033  1.00 0.00 ? 206  LEU H CG    1 
ATOM 8970  C CD1   . LEU H 8  206 ? 69.249  -79.106  -1.917  1.00 0.00 ? 206  LEU H CD1   1 
ATOM 8971  C CD2   . LEU H 8  206 ? 67.776  -80.489  -3.458  1.00 0.00 ? 206  LEU H CD2   1 
ATOM 8972  N N     . VAL H 8  207 ? 72.404  -81.335  -2.405  1.00 0.00 ? 207  VAL H N     1 
ATOM 8973  C CA    . VAL H 8  207 ? 72.851  -82.635  -1.939  1.00 0.00 ? 207  VAL H CA    1 
ATOM 8974  C C     . VAL H 8  207 ? 71.806  -83.063  -0.948  1.00 0.00 ? 207  VAL H C     1 
ATOM 8975  O O     . VAL H 8  207 ? 71.355  -82.261  -0.138  1.00 0.00 ? 207  VAL H O     1 
ATOM 8976  C CB    . VAL H 8  207 ? 74.232  -82.612  -1.279  1.00 0.00 ? 207  VAL H CB    1 
ATOM 8977  C CG1   . VAL H 8  207 ? 74.649  -84.029  -0.824  1.00 0.00 ? 207  VAL H CG1   1 
ATOM 8978  C CG2   . VAL H 8  207 ? 75.257  -82.041  -2.282  1.00 0.00 ? 207  VAL H CG2   1 
ATOM 8979  N N     . VAL H 8  208 ? 71.354  -84.336  -1.025  1.00 0.00 ? 208  VAL H N     1 
ATOM 8980  C CA    . VAL H 8  208 ? 70.269  -84.831  -0.212  1.00 0.00 ? 208  VAL H CA    1 
ATOM 8981  C C     . VAL H 8  208 ? 70.745  -86.139  0.372   1.00 0.00 ? 208  VAL H C     1 
ATOM 8982  O O     . VAL H 8  208 ? 71.320  -86.952  -0.345  1.00 0.00 ? 208  VAL H O     1 
ATOM 8983  C CB    . VAL H 8  208 ? 68.985  -85.063  -1.010  1.00 0.00 ? 208  VAL H CB    1 
ATOM 8984  C CG1   . VAL H 8  208 ? 67.820  -85.347  -0.042  1.00 0.00 ? 208  VAL H CG1   1 
ATOM 8985  C CG2   . VAL H 8  208 ? 68.662  -83.837  -1.892  1.00 0.00 ? 208  VAL H CG2   1 
ATOM 8986  N N     . TYR H 8  209 ? 70.508  -86.376  1.689   1.00 0.00 ? 209  TYR H N     1 
ATOM 8987  C CA    . TYR H 8  209 ? 70.748  -87.658  2.323   1.00 0.00 ? 209  TYR H CA    1 
ATOM 8988  C C     . TYR H 8  209 ? 69.470  -87.936  3.091   1.00 0.00 ? 209  TYR H C     1 
ATOM 8989  O O     . TYR H 8  209 ? 68.403  -87.579  2.599   1.00 0.00 ? 209  TYR H O     1 
ATOM 8990  C CB    . TYR H 8  209 ? 72.085  -87.696  3.135   1.00 0.00 ? 209  TYR H CB    1 
ATOM 8991  C CG    . TYR H 8  209 ? 72.551  -89.052  3.654   1.00 0.00 ? 209  TYR H CG    1 
ATOM 8992  C CD1   . TYR H 8  209 ? 71.905  -90.273  3.362   1.00 0.00 ? 209  TYR H CD1   1 
ATOM 8993  C CD2   . TYR H 8  209 ? 73.649  -89.081  4.540   1.00 0.00 ? 209  TYR H CD2   1 
ATOM 8994  C CE1   . TYR H 8  209 ? 72.240  -91.442  4.050   1.00 0.00 ? 209  TYR H CE1   1 
ATOM 8995  C CE2   . TYR H 8  209 ? 74.005  -90.261  5.209   1.00 0.00 ? 209  TYR H CE2   1 
ATOM 8996  C CZ    . TYR H 8  209 ? 73.268  -91.431  4.993   1.00 0.00 ? 209  TYR H CZ    1 
ATOM 8997  O OH    . TYR H 8  209 ? 73.510  -92.600  5.744   1.00 0.00 ? 209  TYR H OH    1 
ATOM 8998  N N     . ALA H 8  210 ? 69.498  -88.640  4.252   1.00 0.00 ? 210  ALA H N     1 
ATOM 8999  C CA    . ALA H 8  210 ? 68.346  -89.424  4.630   1.00 0.00 ? 210  ALA H CA    1 
ATOM 9000  C C     . ALA H 8  210 ? 68.147  -89.504  6.109   1.00 0.00 ? 210  ALA H C     1 
ATOM 9001  O O     . ALA H 8  210 ? 67.115  -89.067  6.612   1.00 0.00 ? 210  ALA H O     1 
ATOM 9002  C CB    . ALA H 8  210 ? 68.461  -90.865  4.086   1.00 0.00 ? 210  ALA H CB    1 
ATOM 9003  N N     . GLU H 8  211 ? 69.093  -90.113  6.853   1.00 0.00 ? 211  GLU H N     1 
ATOM 9004  C CA    . GLU H 8  211 ? 68.865  -90.464  8.235   1.00 0.00 ? 211  GLU H CA    1 
ATOM 9005  C C     . GLU H 8  211 ? 69.053  -89.247  9.108   1.00 0.00 ? 211  GLU H C     1 
ATOM 9006  O O     . GLU H 8  211 ? 68.065  -88.772  9.664   1.00 0.00 ? 211  GLU H O     1 
ATOM 9007  C CB    . GLU H 8  211 ? 69.795  -91.631  8.636   1.00 0.00 ? 211  GLU H CB    1 
ATOM 9008  C CG    . GLU H 8  211 ? 69.391  -92.928  7.901   1.00 0.00 ? 211  GLU H CG    1 
ATOM 9009  C CD    . GLU H 8  211 ? 70.527  -93.949  7.919   1.00 0.00 ? 211  GLU H CD    1 
ATOM 9010  O OE1   . GLU H 8  211 ? 70.980  -94.344  6.808   1.00 0.00 ? 211  GLU H OE1   1 
ATOM 9011  O OE2   . GLU H 8  211 ? 70.954  -94.349  9.032   1.00 0.00 ? 211  GLU H OE2   1 
ATOM 9012  N N     . ASP H 8  212 ? 70.310  -88.726  9.166   1.00 0.00 ? 212  ASP H N     1 
ATOM 9013  C CA    . ASP H 8  212 ? 70.838  -87.386  9.430   1.00 0.00 ? 212  ASP H CA    1 
ATOM 9014  C C     . ASP H 8  212 ? 69.844  -86.249  9.790   1.00 0.00 ? 212  ASP H C     1 
ATOM 9015  O O     . ASP H 8  212 ? 68.991  -86.493  10.641  1.00 0.00 ? 212  ASP H O     1 
ATOM 9016  C CB    . ASP H 8  212 ? 72.018  -87.128  8.461   1.00 0.00 ? 212  ASP H CB    1 
ATOM 9017  C CG    . ASP H 8  212 ? 71.633  -87.367  6.999   1.00 0.00 ? 212  ASP H CG    1 
ATOM 9018  O OD1   . ASP H 8  212 ? 71.350  -86.383  6.269   1.00 0.00 ? 212  ASP H OD1   1 
ATOM 9019  O OD2   . ASP H 8  212 ? 71.627  -88.558  6.592   1.00 0.00 ? 212  ASP H OD2   1 
ATOM 9020  N N     . ASN H 8  213 ? 69.831  -84.970  9.267   1.00 0.00 ? 213  ASN H N     1 
ATOM 9021  C CA    . ASN H 8  213 ? 70.820  -84.092  8.663   1.00 0.00 ? 213  ASN H CA    1 
ATOM 9022  C C     . ASN H 8  213 ? 71.839  -83.720  9.714   1.00 0.00 ? 213  ASN H C     1 
ATOM 9023  O O     . ASN H 8  213 ? 71.458  -83.527  10.868  1.00 0.00 ? 213  ASN H O     1 
ATOM 9024  C CB    . ASN H 8  213 ? 70.212  -82.732  8.187   1.00 0.00 ? 213  ASN H CB    1 
ATOM 9025  C CG    . ASN H 8  213 ? 69.545  -82.745  6.800   1.00 0.00 ? 213  ASN H CG    1 
ATOM 9026  O OD1   . ASN H 8  213 ? 68.621  -81.957  6.563   1.00 0.00 ? 213  ASN H OD1   1 
ATOM 9027  N ND2   . ASN H 8  213 ? 70.058  -83.592  5.861   1.00 0.00 ? 213  ASN H ND2   1 
ATOM 9028  N N     . GLY H 8  214 ? 73.158  -83.577  9.399   1.00 0.00 ? 214  GLY H N     1 
ATOM 9029  C CA    . GLY H 8  214 ? 73.885  -83.811  8.169   1.00 0.00 ? 214  GLY H CA    1 
ATOM 9030  C C     . GLY H 8  214 ? 73.465  -83.100  6.908   1.00 0.00 ? 214  GLY H C     1 
ATOM 9031  O O     . GLY H 8  214 ? 73.145  -83.796  5.947   1.00 0.00 ? 214  GLY H O     1 
ATOM 9032  N N     . ILE H 8  215 ? 73.463  -81.741  6.763   1.00 0.00 ? 215  ILE H N     1 
ATOM 9033  C CA    . ILE H 8  215 ? 73.706  -80.573  7.593   1.00 0.00 ? 215  ILE H CA    1 
ATOM 9034  C C     . ILE H 8  215 ? 74.375  -80.768  8.932   1.00 0.00 ? 215  ILE H C     1 
ATOM 9035  O O     . ILE H 8  215 ? 73.740  -80.621  9.978   1.00 0.00 ? 215  ILE H O     1 
ATOM 9036  C CB    . ILE H 8  215 ? 72.517  -79.608  7.709   1.00 0.00 ? 215  ILE H CB    1 
ATOM 9037  C CG1   . ILE H 8  215 ? 71.650  -79.599  6.421   1.00 0.00 ? 215  ILE H CG1   1 
ATOM 9038  C CG2   . ILE H 8  215 ? 73.057  -78.190  8.021   1.00 0.00 ? 215  ILE H CG2   1 
ATOM 9039  C CD1   . ILE H 8  215 ? 70.394  -78.725  6.519   1.00 0.00 ? 215  ILE H CD1   1 
ATOM 9040  N N     . VAL H 8  216 ? 75.702  -81.052  8.925   1.00 0.00 ? 216  VAL H N     1 
ATOM 9041  C CA    . VAL H 8  216 ? 76.536  -80.893  10.093  1.00 0.00 ? 216  VAL H CA    1 
ATOM 9042  C C     . VAL H 8  216 ? 77.132  -79.521  9.941   1.00 0.00 ? 216  VAL H C     1 
ATOM 9043  O O     . VAL H 8  216 ? 76.780  -78.777  9.025   1.00 0.00 ? 216  VAL H O     1 
ATOM 9044  C CB    . VAL H 8  216 ? 77.589  -81.972  10.348  1.00 0.00 ? 216  VAL H CB    1 
ATOM 9045  C CG1   . VAL H 8  216 ? 76.874  -83.299  10.681  1.00 0.00 ? 216  VAL H CG1   1 
ATOM 9046  C CG2   . VAL H 8  216 ? 78.559  -82.123  9.164   1.00 0.00 ? 216  VAL H CG2   1 
ATOM 9047  N N     . LYS H 8  217 ? 78.016  -79.138  10.888  1.00 0.00 ? 217  LYS H N     1 
ATOM 9048  C CA    . LYS H 8  217 ? 78.540  -77.805  11.038  1.00 0.00 ? 217  LYS H CA    1 
ATOM 9049  C C     . LYS H 8  217 ? 79.321  -77.343  9.825   1.00 0.00 ? 217  LYS H C     1 
ATOM 9050  O O     . LYS H 8  217 ? 79.228  -76.179  9.437   1.00 0.00 ? 217  LYS H O     1 
ATOM 9051  C CB    . LYS H 8  217 ? 79.391  -77.718  12.327  1.00 0.00 ? 217  LYS H CB    1 
ATOM 9052  C CG    . LYS H 8  217 ? 79.540  -76.296  12.895  1.00 0.00 ? 217  LYS H CG    1 
ATOM 9053  C CD    . LYS H 8  217 ? 79.999  -76.253  14.367  1.00 0.00 ? 217  LYS H CD    1 
ATOM 9054  C CE    . LYS H 8  217 ? 78.916  -76.696  15.369  1.00 0.00 ? 217  LYS H CE    1 
ATOM 9055  N NZ    . LYS H 8  217 ? 79.399  -76.628  16.770  1.00 0.00 ? 217  LYS H NZ    1 
ATOM 9056  N N     . ALA H 8  218 ? 80.086  -78.262  9.183   1.00 0.00 ? 218  ALA H N     1 
ATOM 9057  C CA    . ALA H 8  218 ? 80.894  -77.935  8.034   1.00 0.00 ? 218  ALA H CA    1 
ATOM 9058  C C     . ALA H 8  218 ? 80.163  -78.048  6.722   1.00 0.00 ? 218  ALA H C     1 
ATOM 9059  O O     . ALA H 8  218 ? 80.613  -77.473  5.732   1.00 0.00 ? 218  ALA H O     1 
ATOM 9060  C CB    . ALA H 8  218 ? 82.063  -78.912  7.892   1.00 0.00 ? 218  ALA H CB    1 
ATOM 9061  N N     . LEU H 8  219 ? 79.030  -78.795  6.665   1.00 0.00 ? 219  LEU H N     1 
ATOM 9062  C CA    . LEU H 8  219 ? 78.300  -78.996  5.428   1.00 0.00 ? 219  LEU H CA    1 
ATOM 9063  C C     . LEU H 8  219 ? 77.511  -77.763  5.068   1.00 0.00 ? 219  LEU H C     1 
ATOM 9064  O O     . LEU H 8  219 ? 77.324  -77.478  3.885   1.00 0.00 ? 219  LEU H O     1 
ATOM 9065  C CB    . LEU H 8  219 ? 77.353  -80.221  5.447   1.00 0.00 ? 219  LEU H CB    1 
ATOM 9066  C CG    . LEU H 8  219 ? 78.084  -81.587  5.472   1.00 0.00 ? 219  LEU H CG    1 
ATOM 9067  C CD1   . LEU H 8  219 ? 77.076  -82.740  5.635   1.00 0.00 ? 219  LEU H CD1   1 
ATOM 9068  C CD2   . LEU H 8  219 ? 78.978  -81.820  4.237   1.00 0.00 ? 219  LEU H CD2   1 
ATOM 9069  N N     . ARG H 8  220 ? 77.082  -76.967  6.084   1.00 0.00 ? 220  ARG H N     1 
ATOM 9070  C CA    . ARG H 8  220 ? 76.688  -75.587  5.896   1.00 0.00 ? 220  ARG H CA    1 
ATOM 9071  C C     . ARG H 8  220 ? 77.931  -74.803  5.518   1.00 0.00 ? 220  ARG H C     1 
ATOM 9072  O O     . ARG H 8  220 ? 78.985  -75.025  6.112   1.00 0.00 ? 220  ARG H O     1 
ATOM 9073  C CB    . ARG H 8  220 ? 76.023  -74.998  7.168   1.00 0.00 ? 220  ARG H CB    1 
ATOM 9074  C CG    . ARG H 8  220 ? 75.665  -73.505  7.079   1.00 0.00 ? 220  ARG H CG    1 
ATOM 9075  C CD    . ARG H 8  220 ? 74.883  -72.996  8.298   1.00 0.00 ? 220  ARG H CD    1 
ATOM 9076  N NE    . ARG H 8  220 ? 74.836  -71.495  8.246   1.00 0.00 ? 220  ARG H NE    1 
ATOM 9077  C CZ    . ARG H 8  220 ? 74.142  -70.744  9.156   1.00 0.00 ? 220  ARG H CZ    1 
ATOM 9078  N NH1   . ARG H 8  220 ? 73.345  -71.333  10.094  1.00 0.00 ? 220  ARG H NH1   1 
ATOM 9079  N NH2   . ARG H 8  220 ? 74.251  -69.381  9.129   1.00 0.00 ? 220  ARG H NH2   1 
ATOM 9080  N N     . ASN H 8  221 ? 77.810  -73.903  4.504   1.00 0.00 ? 221  ASN H N     1 
ATOM 9081  C CA    . ASN H 8  221 ? 78.878  -73.195  3.813   1.00 0.00 ? 221  ASN H CA    1 
ATOM 9082  C C     . ASN H 8  221 ? 79.354  -74.053  2.666   1.00 0.00 ? 221  ASN H C     1 
ATOM 9083  O O     . ASN H 8  221 ? 79.219  -75.274  2.737   1.00 0.00 ? 221  ASN H O     1 
ATOM 9084  C CB    . ASN H 8  221 ? 80.116  -72.713  4.629   1.00 0.00 ? 221  ASN H CB    1 
ATOM 9085  C CG    . ASN H 8  221 ? 79.688  -71.818  5.801   1.00 0.00 ? 221  ASN H CG    1 
ATOM 9086  O OD1   . ASN H 8  221 ? 79.027  -70.792  5.605   1.00 0.00 ? 221  ASN H OD1   1 
ATOM 9087  N ND2   . ASN H 8  221 ? 80.094  -72.228  7.043   1.00 0.00 ? 221  ASN H ND2   1 
ATOM 9088  N N     . VAL H 8  222 ? 79.877  -73.380  1.596   1.00 0.00 ? 222  VAL H N     1 
ATOM 9089  C CA    . VAL H 8  222 ? 80.384  -73.865  0.316   1.00 0.00 ? 222  VAL H CA    1 
ATOM 9090  C C     . VAL H 8  222 ? 79.732  -72.931  -0.690  1.00 0.00 ? 222  VAL H C     1 
ATOM 9091  O O     . VAL H 8  222 ? 78.595  -72.530  -0.444  1.00 0.00 ? 222  VAL H O     1 
ATOM 9092  C CB    . VAL H 8  222 ? 80.184  -75.358  -0.034  1.00 0.00 ? 222  VAL H CB    1 
ATOM 9093  C CG1   . VAL H 8  222 ? 80.122  -75.690  -1.547  1.00 0.00 ? 222  VAL H CG1   1 
ATOM 9094  C CG2   . VAL H 8  222 ? 81.316  -76.172  0.630   1.00 0.00 ? 222  VAL H CG2   1 
ATOM 9095  N N     . PRO H 8  223 ? 80.363  -72.546  -1.813  1.00 0.00 ? 223  PRO H N     1 
ATOM 9096  C CA    . PRO H 8  223 ? 79.776  -71.706  -2.852  1.00 0.00 ? 223  PRO H CA    1 
ATOM 9097  C C     . PRO H 8  223 ? 78.635  -72.383  -3.588  1.00 0.00 ? 223  PRO H C     1 
ATOM 9098  O O     . PRO H 8  223 ? 78.869  -73.113  -4.550  1.00 0.00 ? 223  PRO H O     1 
ATOM 9099  C CB    . PRO H 8  223 ? 80.939  -71.431  -3.829  1.00 0.00 ? 223  PRO H CB    1 
ATOM 9100  C CG    . PRO H 8  223 ? 81.910  -72.587  -3.571  1.00 0.00 ? 223  PRO H CG    1 
ATOM 9101  C CD    . PRO H 8  223 ? 81.795  -72.744  -2.061  1.00 0.00 ? 223  PRO H CD    1 
ATOM 9102  N N     . GLY H 8  224 ? 77.387  -72.107  -3.146  1.00 0.00 ? 224  GLY H N     1 
ATOM 9103  C CA    . GLY H 8  224 ? 76.178  -72.429  -3.856  1.00 0.00 ? 224  GLY H CA    1 
ATOM 9104  C C     . GLY H 8  224 ? 75.651  -73.819  -3.662  1.00 0.00 ? 224  GLY H C     1 
ATOM 9105  O O     . GLY H 8  224 ? 74.620  -74.148  -4.249  1.00 0.00 ? 224  GLY H O     1 
ATOM 9106  N N     . VAL H 8  225 ? 76.293  -74.668  -2.816  1.00 0.00 ? 225  VAL H N     1 
ATOM 9107  C CA    . VAL H 8  225 ? 75.711  -75.943  -2.449  1.00 0.00 ? 225  VAL H CA    1 
ATOM 9108  C C     . VAL H 8  225 ? 74.599  -75.695  -1.453  1.00 0.00 ? 225  VAL H C     1 
ATOM 9109  O O     . VAL H 8  225 ? 74.630  -74.733  -0.684  1.00 0.00 ? 225  VAL H O     1 
ATOM 9110  C CB    . VAL H 8  225 ? 76.714  -76.989  -1.952  1.00 0.00 ? 225  VAL H CB    1 
ATOM 9111  C CG1   . VAL H 8  225 ? 76.984  -76.876  -0.437  1.00 0.00 ? 225  VAL H CG1   1 
ATOM 9112  C CG2   . VAL H 8  225 ? 76.246  -78.409  -2.334  1.00 0.00 ? 225  VAL H CG2   1 
ATOM 9113  N N     . GLU H 8  226 ? 73.584  -76.577  -1.470  1.00 0.00 ? 226  GLU H N     1 
ATOM 9114  C CA    . GLU H 8  226 ? 72.507  -76.577  -0.519  1.00 0.00 ? 226  GLU H CA    1 
ATOM 9115  C C     . GLU H 8  226 ? 72.450  -78.010  -0.073  1.00 0.00 ? 226  GLU H C     1 
ATOM 9116  O O     . GLU H 8  226 ? 72.975  -78.893  -0.747  1.00 0.00 ? 226  GLU H O     1 
ATOM 9117  C CB    . GLU H 8  226 ? 71.171  -76.099  -1.140  1.00 0.00 ? 226  GLU H CB    1 
ATOM 9118  C CG    . GLU H 8  226 ? 71.170  -74.575  -1.394  1.00 0.00 ? 226  GLU H CG    1 
ATOM 9119  C CD    . GLU H 8  226 ? 69.880  -74.100  -2.069  1.00 0.00 ? 226  GLU H CD    1 
ATOM 9120  O OE1   . GLU H 8  226 ? 68.780  -74.504  -1.608  1.00 0.00 ? 226  GLU H OE1   1 
ATOM 9121  O OE2   . GLU H 8  226 ? 69.980  -73.319  -3.054  1.00 0.00 ? 226  GLU H OE2   1 
ATOM 9122  N N     . THR H 8  227 ? 71.867  -78.270  1.119   1.00 0.00 ? 227  THR H N     1 
ATOM 9123  C CA    . THR H 8  227 ? 71.943  -79.567  1.754   1.00 0.00 ? 227  THR H CA    1 
ATOM 9124  C C     . THR H 8  227 ? 70.581  -79.780  2.374   1.00 0.00 ? 227  THR H C     1 
ATOM 9125  O O     . THR H 8  227 ? 69.976  -78.841  2.892   1.00 0.00 ? 227  THR H O     1 
ATOM 9126  C CB    . THR H 8  227 ? 73.067  -79.682  2.782   1.00 0.00 ? 227  THR H CB    1 
ATOM 9127  O OG1   . THR H 8  227 ? 74.308  -79.294  2.204   1.00 0.00 ? 227  THR H OG1   1 
ATOM 9128  C CG2   . THR H 8  227 ? 73.204  -81.136  3.289   1.00 0.00 ? 227  THR H CG2   1 
ATOM 9129  N N     . ALA H 8  228 ? 70.048  -81.025  2.274   1.00 0.00 ? 228  ALA H N     1 
ATOM 9130  C CA    . ALA H 8  228 ? 68.658  -81.325  2.529   1.00 0.00 ? 228  ALA H CA    1 
ATOM 9131  C C     . ALA H 8  228 ? 68.541  -82.778  2.905   1.00 0.00 ? 228  ALA H C     1 
ATOM 9132  O O     . ALA H 8  228 ? 69.531  -83.507  2.922   1.00 0.00 ? 228  ALA H O     1 
ATOM 9133  C CB    . ALA H 8  228 ? 67.779  -81.104  1.284   1.00 0.00 ? 228  ALA H CB    1 
ATOM 9134  N N     . ASN H 8  229 ? 67.299  -83.212  3.242   1.00 0.00 ? 229  ASN H N     1 
ATOM 9135  C CA    . ASN H 8  229 ? 66.987  -84.544  3.711   1.00 0.00 ? 229  ASN H CA    1 
ATOM 9136  C C     . ASN H 8  229 ? 65.813  -85.010  2.880   1.00 0.00 ? 229  ASN H C     1 
ATOM 9137  O O     . ASN H 8  229 ? 65.131  -84.186  2.279   1.00 0.00 ? 229  ASN H O     1 
ATOM 9138  C CB    . ASN H 8  229 ? 66.567  -84.501  5.206   1.00 0.00 ? 229  ASN H CB    1 
ATOM 9139  C CG    . ASN H 8  229 ? 66.775  -85.849  5.905   1.00 0.00 ? 229  ASN H CG    1 
ATOM 9140  O OD1   . ASN H 8  229 ? 65.828  -86.630  6.041   1.00 0.00 ? 229  ASN H OD1   1 
ATOM 9141  N ND2   . ASN H 8  229 ? 68.037  -86.106  6.368   1.00 0.00 ? 229  ASN H ND2   1 
ATOM 9142  N N     . VAL H 8  230 ? 65.537  -86.343  2.811   1.00 0.00 ? 230  VAL H N     1 
ATOM 9143  C CA    . VAL H 8  230 ? 64.382  -86.856  2.090   1.00 0.00 ? 230  VAL H CA    1 
ATOM 9144  C C     . VAL H 8  230 ? 63.131  -86.720  2.924   1.00 0.00 ? 230  VAL H C     1 
ATOM 9145  O O     . VAL H 8  230 ? 62.028  -86.711  2.379   1.00 0.00 ? 230  VAL H O     1 
ATOM 9146  C CB    . VAL H 8  230 ? 64.491  -88.316  1.647   1.00 0.00 ? 230  VAL H CB    1 
ATOM 9147  C CG1   . VAL H 8  230 ? 65.567  -88.428  0.551   1.00 0.00 ? 230  VAL H CG1   1 
ATOM 9148  C CG2   . VAL H 8  230 ? 64.778  -89.257  2.834   1.00 0.00 ? 230  VAL H CG2   1 
ATOM 9149  N N     . ALA H 8  231 ? 63.278  -86.594  4.268   1.00 0.00 ? 231  ALA H N     1 
ATOM 9150  C CA    . ALA H 8  231 ? 62.180  -86.414  5.185   1.00 0.00 ? 231  ALA H CA    1 
ATOM 9151  C C     . ALA H 8  231 ? 61.591  -85.036  5.062   1.00 0.00 ? 231  ALA H C     1 
ATOM 9152  O O     . ALA H 8  231 ? 60.371  -84.883  5.033   1.00 0.00 ? 231  ALA H O     1 
ATOM 9153  C CB    . ALA H 8  231 ? 62.609  -86.605  6.651   1.00 0.00 ? 231  ALA H CB    1 
ATOM 9154  N N     . SER H 8  232 ? 62.465  -84.003  4.978   1.00 0.00 ? 232  SER H N     1 
ATOM 9155  C CA    . SER H 8  232 ? 62.039  -82.630  4.887   1.00 0.00 ? 232  SER H CA    1 
ATOM 9156  C C     . SER H 8  232 ? 62.834  -81.981  3.790   1.00 0.00 ? 232  SER H C     1 
ATOM 9157  O O     . SER H 8  232 ? 64.056  -81.854  3.870   1.00 0.00 ? 232  SER H O     1 
ATOM 9158  C CB    . SER H 8  232 ? 62.191  -81.846  6.218   1.00 0.00 ? 232  SER H CB    1 
ATOM 9159  O OG    . SER H 8  232 ? 63.483  -81.995  6.798   1.00 0.00 ? 232  SER H OG    1 
ATOM 9160  N N     . LEU H 8  233 ? 62.114  -81.553  2.731   1.00 0.00 ? 233  LEU H N     1 
ATOM 9161  C CA    . LEU H 8  233 ? 62.667  -80.847  1.606   1.00 0.00 ? 233  LEU H CA    1 
ATOM 9162  C C     . LEU H 8  233 ? 61.504  -80.185  0.926   1.00 0.00 ? 233  LEU H C     1 
ATOM 9163  O O     . LEU H 8  233 ? 60.349  -80.451  1.261   1.00 0.00 ? 233  LEU H O     1 
ATOM 9164  C CB    . LEU H 8  233 ? 63.545  -81.684  0.629   1.00 0.00 ? 233  LEU H CB    1 
ATOM 9165  C CG    . LEU H 8  233 ? 62.885  -82.803  -0.228  1.00 0.00 ? 233  LEU H CG    1 
ATOM 9166  C CD1   . LEU H 8  233 ? 63.973  -83.642  -0.934  1.00 0.00 ? 233  LEU H CD1   1 
ATOM 9167  C CD2   . LEU H 8  233 ? 61.926  -83.744  0.530   1.00 0.00 ? 233  LEU H CD2   1 
ATOM 9168  N N     . ASN H 8  234 ? 61.785  -79.259  -0.016  1.00 0.00 ? 234  ASN H N     1 
ATOM 9169  C CA    . ASN H 8  234 ? 60.773  -78.369  -0.533  1.00 0.00 ? 234  ASN H CA    1 
ATOM 9170  C C     . ASN H 8  234 ? 61.188  -77.947  -1.912  1.00 0.00 ? 234  ASN H C     1 
ATOM 9171  O O     . ASN H 8  234 ? 62.284  -78.266  -2.365  1.00 0.00 ? 234  ASN H O     1 
ATOM 9172  C CB    . ASN H 8  234 ? 60.511  -77.132  0.381   1.00 0.00 ? 234  ASN H CB    1 
ATOM 9173  C CG    . ASN H 8  234 ? 61.812  -76.415  0.791   1.00 0.00 ? 234  ASN H CG    1 
ATOM 9174  O OD1   . ASN H 8  234 ? 62.499  -75.828  -0.051  1.00 0.00 ? 234  ASN H OD1   1 
ATOM 9175  N ND2   . ASN H 8  234 ? 62.146  -76.468  2.117   1.00 0.00 ? 234  ASN H ND2   1 
ATOM 9176  N N     . LEU H 8  235 ? 60.282  -77.233  -2.627  1.00 0.00 ? 235  LEU H N     1 
ATOM 9177  C CA    . LEU H 8  235 ? 60.456  -76.861  -4.012  1.00 0.00 ? 235  LEU H CA    1 
ATOM 9178  C C     . LEU H 8  235 ? 61.381  -75.689  -4.189  1.00 0.00 ? 235  LEU H C     1 
ATOM 9179  O O     . LEU H 8  235 ? 61.860  -75.457  -5.298  1.00 0.00 ? 235  LEU H O     1 
ATOM 9180  C CB    . LEU H 8  235 ? 59.109  -76.545  -4.714  1.00 0.00 ? 235  LEU H CB    1 
ATOM 9181  C CG    . LEU H 8  235 ? 58.598  -77.712  -5.589  1.00 0.00 ? 235  LEU H CG    1 
ATOM 9182  C CD1   . LEU H 8  235 ? 57.163  -77.456  -6.086  1.00 0.00 ? 235  LEU H CD1   1 
ATOM 9183  C CD2   . LEU H 8  235 ? 59.537  -77.995  -6.780  1.00 0.00 ? 235  LEU H CD2   1 
ATOM 9184  N N     . LEU H 8  236 ? 61.685  -74.934  -3.104  1.00 0.00 ? 236  LEU H N     1 
ATOM 9185  C CA    . LEU H 8  236 ? 62.686  -73.891  -3.124  1.00 0.00 ? 236  LEU H CA    1 
ATOM 9186  C C     . LEU H 8  236 ? 64.057  -74.499  -3.274  1.00 0.00 ? 236  LEU H C     1 
ATOM 9187  O O     . LEU H 8  236 ? 64.932  -73.920  -3.907  1.00 0.00 ? 236  LEU H O     1 
ATOM 9188  C CB    . LEU H 8  236 ? 62.694  -72.966  -1.880  1.00 0.00 ? 236  LEU H CB    1 
ATOM 9189  C CG    . LEU H 8  236 ? 61.335  -72.295  -1.563  1.00 0.00 ? 236  LEU H CG    1 
ATOM 9190  C CD1   . LEU H 8  236 ? 60.432  -73.168  -0.667  1.00 0.00 ? 236  LEU H CD1   1 
ATOM 9191  C CD2   . LEU H 8  236 ? 61.539  -70.904  -0.931  1.00 0.00 ? 236  LEU H CD2   1 
ATOM 9192  N N     . GLN H 8  237 ? 64.265  -75.698  -2.687  1.00 0.00 ? 237  GLN H N     1 
ATOM 9193  C CA    . GLN H 8  237 ? 65.493  -76.441  -2.796  1.00 0.00 ? 237  GLN H CA    1 
ATOM 9194  C C     . GLN H 8  237 ? 65.551  -77.231  -4.081  1.00 0.00 ? 237  GLN H C     1 
ATOM 9195  O O     . GLN H 8  237 ? 66.622  -77.370  -4.664  1.00 0.00 ? 237  GLN H O     1 
ATOM 9196  C CB    . GLN H 8  237 ? 65.675  -77.405  -1.603  1.00 0.00 ? 237  GLN H CB    1 
ATOM 9197  C CG    . GLN H 8  237 ? 65.906  -76.642  -0.287  1.00 0.00 ? 237  GLN H CG    1 
ATOM 9198  C CD    . GLN H 8  237 ? 65.902  -77.624  0.888   1.00 0.00 ? 237  GLN H CD    1 
ATOM 9199  O OE1   . GLN H 8  237 ? 64.923  -78.352  1.087   1.00 0.00 ? 237  GLN H OE1   1 
ATOM 9200  N NE2   . GLN H 8  237 ? 67.014  -77.628  1.683   1.00 0.00 ? 237  GLN H NE2   1 
ATOM 9201  N N     . LEU H 8  238 ? 64.408  -77.773  -4.569  1.00 0.00 ? 238  LEU H N     1 
ATOM 9202  C CA    . LEU H 8  238 ? 64.404  -78.716  -5.672  1.00 0.00 ? 238  LEU H CA    1 
ATOM 9203  C C     . LEU H 8  238 ? 64.375  -78.009  -7.004  1.00 0.00 ? 238  LEU H C     1 
ATOM 9204  O O     . LEU H 8  238 ? 64.600  -78.646  -8.033  1.00 0.00 ? 238  LEU H O     1 
ATOM 9205  C CB    . LEU H 8  238 ? 63.206  -79.701  -5.604  1.00 0.00 ? 238  LEU H CB    1 
ATOM 9206  C CG    . LEU H 8  238 ? 63.541  -81.048  -4.916  1.00 0.00 ? 238  LEU H CG    1 
ATOM 9207  C CD1   . LEU H 8  238 ? 64.032  -80.920  -3.464  1.00 0.00 ? 238  LEU H CD1   1 
ATOM 9208  C CD2   . LEU H 8  238 ? 62.348  -82.018  -5.002  1.00 0.00 ? 238  LEU H CD2   1 
ATOM 9209  N N     . ALA H 8  239 ? 64.151  -76.675  -7.011  1.00 0.00 ? 239  ALA H N     1 
ATOM 9210  C CA    . ALA H 8  239 ? 64.149  -75.882  -8.215  1.00 0.00 ? 239  ALA H CA    1 
ATOM 9211  C C     . ALA H 8  239 ? 63.903  -74.457  -7.788  1.00 0.00 ? 239  ALA H C     1 
ATOM 9212  O O     . ALA H 8  239 ? 62.779  -73.982  -7.948  1.00 0.00 ? 239  ALA H O     1 
ATOM 9213  C CB    . ALA H 8  239 ? 63.047  -76.273  -9.227  1.00 0.00 ? 239  ALA H CB    1 
ATOM 9214  N N     . PRO H 8  240 ? 64.878  -73.736  -7.219  1.00 0.00 ? 240  PRO H N     1 
ATOM 9215  C CA    . PRO H 8  240 ? 64.734  -72.339  -6.822  1.00 0.00 ? 240  PRO H CA    1 
ATOM 9216  C C     . PRO H 8  240 ? 64.367  -71.418  -7.962  1.00 0.00 ? 240  PRO H C     1 
ATOM 9217  O O     . PRO H 8  240 ? 65.113  -71.337  -8.936  1.00 0.00 ? 240  PRO H O     1 
ATOM 9218  C CB    . PRO H 8  240 ? 66.082  -71.941  -6.192  1.00 0.00 ? 240  PRO H CB    1 
ATOM 9219  C CG    . PRO H 8  240 ? 67.078  -73.027  -6.618  1.00 0.00 ? 240  PRO H CG    1 
ATOM 9220  C CD    . PRO H 8  240 ? 66.212  -74.252  -6.915  1.00 0.00 ? 240  PRO H CD    1 
ATOM 9221  N N     . GLY H 8  241 ? 63.237  -70.689  -7.826  1.00 0.00 ? 241  GLY H N     1 
ATOM 9222  C CA    . GLY H 8  241 ? 62.783  -69.714  -8.788  1.00 0.00 ? 241  GLY H CA    1 
ATOM 9223  C C     . GLY H 8  241 ? 61.747  -70.291  -9.712  1.00 0.00 ? 241  GLY H C     1 
ATOM 9224  O O     . GLY H 8  241 ? 61.088  -69.538  -10.427 1.00 0.00 ? 241  GLY H O     1 
ATOM 9225  N N     . ALA H 8  242 ? 61.569  -71.636  -9.684  1.00 0.00 ? 242  ALA H N     1 
ATOM 9226  C CA    . ALA H 8  242 ? 60.494  -72.374  -10.306 1.00 0.00 ? 242  ALA H CA    1 
ATOM 9227  C C     . ALA H 8  242 ? 60.733  -72.668  -11.764 1.00 0.00 ? 242  ALA H C     1 
ATOM 9228  O O     . ALA H 8  242 ? 59.780  -72.923  -12.500 1.00 0.00 ? 242  ALA H O     1 
ATOM 9229  C CB    . ALA H 8  242 ? 59.088  -71.765  -10.130 1.00 0.00 ? 242  ALA H CB    1 
ATOM 9230  N N     . HIS H 8  243 ? 62.012  -72.660  -12.216 1.00 0.00 ? 243  HIS H N     1 
ATOM 9231  C CA    . HIS H 8  243 ? 62.375  -72.966  -13.586 1.00 0.00 ? 243  HIS H CA    1 
ATOM 9232  C C     . HIS H 8  243 ? 63.080  -74.288  -13.546 1.00 0.00 ? 243  HIS H C     1 
ATOM 9233  O O     . HIS H 8  243 ? 64.294  -74.375  -13.711 1.00 0.00 ? 243  HIS H O     1 
ATOM 9234  C CB    . HIS H 8  243 ? 63.214  -71.882  -14.314 1.00 0.00 ? 243  HIS H CB    1 
ATOM 9235  C CG    . HIS H 8  243 ? 63.724  -70.782  -13.429 1.00 0.00 ? 243  HIS H CG    1 
ATOM 9236  N ND1   . HIS H 8  243 ? 62.975  -69.690  -13.042 1.00 0.00 ? 243  HIS H ND1   1 
ATOM 9237  C CD2   . HIS H 8  243 ? 64.944  -70.618  -12.852 1.00 0.00 ? 243  HIS H CD2   1 
ATOM 9238  C CE1   . HIS H 8  243 ? 63.775  -68.929  -12.253 1.00 0.00 ? 243  HIS H CE1   1 
ATOM 9239  N NE2   . HIS H 8  243 ? 64.976  -69.453  -12.109 1.00 0.00 ? 243  HIS H NE2   1 
ATOM 9240  N N     . LEU H 8  244 ? 62.265  -75.338  -13.307 1.00 0.00 ? 244  LEU H N     1 
ATOM 9241  C CA    . LEU H 8  244 ? 62.518  -76.756  -13.203 1.00 0.00 ? 244  LEU H CA    1 
ATOM 9242  C C     . LEU H 8  244 ? 63.737  -77.324  -13.896 1.00 0.00 ? 244  LEU H C     1 
ATOM 9243  O O     . LEU H 8  244 ? 64.148  -76.888  -14.973 1.00 0.00 ? 244  LEU H O     1 
ATOM 9244  C CB    . LEU H 8  244 ? 61.288  -77.560  -13.701 1.00 0.00 ? 244  LEU H CB    1 
ATOM 9245  C CG    . LEU H 8  244 ? 60.802  -77.164  -15.125 1.00 0.00 ? 244  LEU H CG    1 
ATOM 9246  C CD1   . LEU H 8  244 ? 60.295  -78.384  -15.911 1.00 0.00 ? 244  LEU H CD1   1 
ATOM 9247  C CD2   . LEU H 8  244 ? 59.723  -76.062  -15.110 1.00 0.00 ? 244  LEU H CD2   1 
ATOM 9248  N N     . GLY H 8  245 ? 64.319  -78.363  -13.251 1.00 0.00 ? 245  GLY H N     1 
ATOM 9249  C CA    . GLY H 8  245 ? 65.430  -79.101  -13.785 1.00 0.00 ? 245  GLY H CA    1 
ATOM 9250  C C     . GLY H 8  245 ? 66.699  -78.712  -13.102 1.00 0.00 ? 245  GLY H C     1 
ATOM 9251  O O     . GLY H 8  245 ? 67.695  -78.442  -13.767 1.00 0.00 ? 245  GLY H O     1 
ATOM 9252  N N     . ARG H 8  246 ? 66.700  -78.666  -11.745 1.00 0.00 ? 246  ARG H N     1 
ATOM 9253  C CA    . ARG H 8  246 ? 67.907  -78.488  -10.968 1.00 0.00 ? 246  ARG H CA    1 
ATOM 9254  C C     . ARG H 8  246 ? 68.837  -79.678  -11.107 1.00 0.00 ? 246  ARG H C     1 
ATOM 9255  O O     . ARG H 8  246 ? 68.400  -80.810  -11.310 1.00 0.00 ? 246  ARG H O     1 
ATOM 9256  C CB    . ARG H 8  246 ? 67.648  -78.180  -9.471  1.00 0.00 ? 246  ARG H CB    1 
ATOM 9257  C CG    . ARG H 8  246 ? 68.829  -77.464  -8.788  1.00 0.00 ? 246  ARG H CG    1 
ATOM 9258  C CD    . ARG H 8  246 ? 68.701  -77.329  -7.271  1.00 0.00 ? 246  ARG H CD    1 
ATOM 9259  N NE    . ARG H 8  246 ? 69.986  -76.734  -6.766  1.00 0.00 ? 246  ARG H NE    1 
ATOM 9260  C CZ    . ARG H 8  246 ? 70.078  -75.949  -5.650  1.00 0.00 ? 246  ARG H CZ    1 
ATOM 9261  N NH1   . ARG H 8  246 ? 71.286  -75.424  -5.289  1.00 0.00 ? 246  ARG H NH1   1 
ATOM 9262  N NH2   . ARG H 8  246 ? 68.985  -75.687  -4.882  1.00 0.00 ? 246  ARG H NH2   1 
ATOM 9263  N N     . PHE H 8  247 ? 70.162  -79.414  -10.999 1.00 0.00 ? 247  PHE H N     1 
ATOM 9264  C CA    . PHE H 8  247 ? 71.219  -80.376  -10.812 1.00 0.00 ? 247  PHE H CA    1 
ATOM 9265  C C     . PHE H 8  247 ? 71.102  -80.877  -9.387  1.00 0.00 ? 247  PHE H C     1 
ATOM 9266  O O     . PHE H 8  247 ? 71.310  -80.114  -8.445  1.00 0.00 ? 247  PHE H O     1 
ATOM 9267  C CB    . PHE H 8  247 ? 72.588  -79.657  -11.018 1.00 0.00 ? 247  PHE H CB    1 
ATOM 9268  C CG    . PHE H 8  247 ? 73.828  -80.517  -11.063 1.00 0.00 ? 247  PHE H CG    1 
ATOM 9269  C CD1   . PHE H 8  247 ? 73.813  -81.898  -11.339 1.00 0.00 ? 247  PHE H CD1   1 
ATOM 9270  C CD2   . PHE H 8  247 ? 75.071  -79.878  -10.890 1.00 0.00 ? 247  PHE H CD2   1 
ATOM 9271  C CE1   . PHE H 8  247 ? 75.011  -82.619  -11.424 1.00 0.00 ? 247  PHE H CE1   1 
ATOM 9272  C CE2   . PHE H 8  247 ? 76.267  -80.598  -10.970 1.00 0.00 ? 247  PHE H CE2   1 
ATOM 9273  C CZ    . PHE H 8  247 ? 76.238  -81.971  -11.237 1.00 0.00 ? 247  PHE H CZ    1 
ATOM 9274  N N     . VAL H 8  248 ? 70.724  -82.165  -9.204  1.00 0.00 ? 248  VAL H N     1 
ATOM 9275  C CA    . VAL H 8  248 ? 70.422  -82.714  -7.901  1.00 0.00 ? 248  VAL H CA    1 
ATOM 9276  C C     . VAL H 8  248 ? 71.345  -83.885  -7.702  1.00 0.00 ? 248  VAL H C     1 
ATOM 9277  O O     . VAL H 8  248 ? 71.644  -84.644  -8.622  1.00 0.00 ? 248  VAL H O     1 
ATOM 9278  C CB    . VAL H 8  248 ? 68.956  -83.113  -7.712  1.00 0.00 ? 248  VAL H CB    1 
ATOM 9279  C CG1   . VAL H 8  248 ? 68.697  -83.637  -6.284  1.00 0.00 ? 248  VAL H CG1   1 
ATOM 9280  C CG2   . VAL H 8  248 ? 68.072  -81.874  -7.960  1.00 0.00 ? 248  VAL H CG2   1 
ATOM 9281  N N     . ILE H 8  249 ? 71.841  -83.997  -6.454  1.00 0.00 ? 249  ILE H N     1 
ATOM 9282  C CA    . ILE H 8  249 ? 72.748  -84.987  -5.953  1.00 0.00 ? 249  ILE H CA    1 
ATOM 9283  C C     . ILE H 8  249 ? 71.961  -85.604  -4.820  1.00 0.00 ? 249  ILE H C     1 
ATOM 9284  O O     . ILE H 8  249 ? 71.207  -84.918  -4.133  1.00 0.00 ? 249  ILE H O     1 
ATOM 9285  C CB    . ILE H 8  249 ? 74.060  -84.369  -5.455  1.00 0.00 ? 249  ILE H CB    1 
ATOM 9286  C CG1   . ILE H 8  249 ? 74.678  -83.478  -6.568  1.00 0.00 ? 249  ILE H CG1   1 
ATOM 9287  C CG2   . ILE H 8  249 ? 75.018  -85.469  -4.956  1.00 0.00 ? 249  ILE H CG2   1 
ATOM 9288  C CD1   . ILE H 8  249 ? 76.044  -82.870  -6.233  1.00 0.00 ? 249  ILE H CD1   1 
ATOM 9289  N N     . TRP H 8  250 ? 72.093  -86.934  -4.638  1.00 0.00 ? 250  TRP H N     1 
ATOM 9290  C CA    . TRP H 8  250 ? 71.365  -87.725  -3.680  1.00 0.00 ? 250  TRP H CA    1 
ATOM 9291  C C     . TRP H 8  250 ? 72.395  -88.600  -3.028  1.00 0.00 ? 250  TRP H C     1 
ATOM 9292  O O     . TRP H 8  250 ? 73.576  -88.545  -3.366  1.00 0.00 ? 250  TRP H O     1 
ATOM 9293  C CB    . TRP H 8  250 ? 70.283  -88.652  -4.300  1.00 0.00 ? 250  TRP H CB    1 
ATOM 9294  C CG    . TRP H 8  250 ? 69.212  -87.928  -5.090  1.00 0.00 ? 250  TRP H CG    1 
ATOM 9295  C CD1   . TRP H 8  250 ? 69.193  -87.641  -6.426  1.00 0.00 ? 250  TRP H CD1   1 
ATOM 9296  C CD2   . TRP H 8  250 ? 67.988  -87.401  -4.544  1.00 0.00 ? 250  TRP H CD2   1 
ATOM 9297  N NE1   . TRP H 8  250 ? 68.045  -86.961  -6.753  1.00 0.00 ? 250  TRP H NE1   1 
ATOM 9298  C CE2   . TRP H 8  250 ? 67.294  -86.790  -5.610  1.00 0.00 ? 250  TRP H CE2   1 
ATOM 9299  C CE3   . TRP H 8  250 ? 67.461  -87.411  -3.255  1.00 0.00 ? 250  TRP H CE3   1 
ATOM 9300  C CZ2   . TRP H 8  250 ? 66.072  -86.160  -5.398  1.00 0.00 ? 250  TRP H CZ2   1 
ATOM 9301  C CZ3   . TRP H 8  250 ? 66.228  -86.774  -3.047  1.00 0.00 ? 250  TRP H CZ3   1 
ATOM 9302  C CH2   . TRP H 8  250 ? 65.545  -86.154  -4.101  1.00 0.00 ? 250  TRP H CH2   1 
ATOM 9303  N N     . THR H 8  251 ? 71.956  -89.417  -2.045  1.00 0.00 ? 251  THR H N     1 
ATOM 9304  C CA    . THR H 8  251 ? 72.804  -90.334  -1.326  1.00 0.00 ? 251  THR H CA    1 
ATOM 9305  C C     . THR H 8  251 ? 71.967  -91.580  -1.182  1.00 0.00 ? 251  THR H C     1 
ATOM 9306  O O     . THR H 8  251 ? 70.741  -91.506  -1.200  1.00 0.00 ? 251  THR H O     1 
ATOM 9307  C CB    . THR H 8  251 ? 73.196  -89.780  0.042   1.00 0.00 ? 251  THR H CB    1 
ATOM 9308  O OG1   . THR H 8  251 ? 73.884  -88.542  -0.110  1.00 0.00 ? 251  THR H OG1   1 
ATOM 9309  C CG2   . THR H 8  251 ? 74.106  -90.740  0.829   1.00 0.00 ? 251  THR H CG2   1 
ATOM 9310  N N     . GLU H 8  252 ? 72.618  -92.769  -1.055  1.00 0.00 ? 252  GLU H N     1 
ATOM 9311  C CA    . GLU H 8  252 ? 71.975  -94.039  -0.777  1.00 0.00 ? 252  GLU H CA    1 
ATOM 9312  C C     . GLU H 8  252 ? 71.279  -94.035  0.565   1.00 0.00 ? 252  GLU H C     1 
ATOM 9313  O O     . GLU H 8  252 ? 71.716  -93.355  1.490   1.00 0.00 ? 252  GLU H O     1 
ATOM 9314  C CB    . GLU H 8  252 ? 72.950  -95.249  -0.839  1.00 0.00 ? 252  GLU H CB    1 
ATOM 9315  C CG    . GLU H 8  252 ? 72.903  -96.000  -2.184  1.00 0.00 ? 252  GLU H CG    1 
ATOM 9316  C CD    . GLU H 8  252 ? 71.517  -96.618  -2.374  1.00 0.00 ? 252  GLU H CD    1 
ATOM 9317  O OE1   . GLU H 8  252 ? 70.759  -96.134  -3.256  1.00 0.00 ? 252  GLU H OE1   1 
ATOM 9318  O OE2   . GLU H 8  252 ? 71.199  -97.580  -1.620  1.00 0.00 ? 252  GLU H OE2   1 
ATOM 9319  N N     . ALA H 8  253 ? 70.155  -94.793  0.638   1.00 0.00 ? 253  ALA H N     1 
ATOM 9320  C CA    . ALA H 8  253 ? 69.231  -94.968  1.742   1.00 0.00 ? 253  ALA H CA    1 
ATOM 9321  C C     . ALA H 8  253 ? 68.014  -94.127  1.471   1.00 0.00 ? 253  ALA H C     1 
ATOM 9322  O O     . ALA H 8  253 ? 67.011  -94.231  2.177   1.00 0.00 ? 253  ALA H O     1 
ATOM 9323  C CB    . ALA H 8  253 ? 69.730  -94.649  3.171   1.00 0.00 ? 253  ALA H CB    1 
ATOM 9324  N N     . ALA H 8  254 ? 68.084  -93.277  0.417   1.00 0.00 ? 254  ALA H N     1 
ATOM 9325  C CA    . ALA H 8  254 ? 67.049  -92.371  -0.001  1.00 0.00 ? 254  ALA H CA    1 
ATOM 9326  C C     . ALA H 8  254 ? 65.865  -93.100  -0.565  1.00 0.00 ? 254  ALA H C     1 
ATOM 9327  O O     . ALA H 8  254 ? 64.732  -92.701  -0.304  1.00 0.00 ? 254  ALA H O     1 
ATOM 9328  C CB    . ALA H 8  254 ? 67.551  -91.377  -1.063  1.00 0.00 ? 254  ALA H CB    1 
ATOM 9329  N N     . PHE H 8  255 ? 66.107  -94.186  -1.352  1.00 0.00 ? 255  PHE H N     1 
ATOM 9330  C CA    . PHE H 8  255 ? 65.076  -94.945  -2.028  1.00 0.00 ? 255  PHE H CA    1 
ATOM 9331  C C     . PHE H 8  255 ? 64.125  -95.560  -1.034  1.00 0.00 ? 255  PHE H C     1 
ATOM 9332  O O     . PHE H 8  255 ? 62.921  -95.359  -1.146  1.00 0.00 ? 255  PHE H O     1 
ATOM 9333  C CB    . PHE H 8  255 ? 65.698  -96.082  -2.920  1.00 0.00 ? 255  PHE H CB    1 
ATOM 9334  C CG    . PHE H 8  255 ? 64.736  -97.201  -3.308  1.00 0.00 ? 255  PHE H CG    1 
ATOM 9335  C CD1   . PHE H 8  255 ? 63.610  -96.954  -4.110  1.00 0.00 ? 255  PHE H CD1   1 
ATOM 9336  C CD2   . PHE H 8  255 ? 64.897  -98.484  -2.755  1.00 0.00 ? 255  PHE H CD2   1 
ATOM 9337  C CE1   . PHE H 8  255 ? 62.664  -97.958  -4.351  1.00 0.00 ? 255  PHE H CE1   1 
ATOM 9338  C CE2   . PHE H 8  255 ? 63.960  -99.495  -2.998  1.00 0.00 ? 255  PHE H CE2   1 
ATOM 9339  C CZ    . PHE H 8  255 ? 62.840  -99.231  -3.795  1.00 0.00 ? 255  PHE H CZ    1 
ATOM 9340  N N     . THR H 8  256 ? 64.665  -96.320  -0.054  1.00 0.00 ? 256  THR H N     1 
ATOM 9341  C CA    . THR H 8  256 ? 63.887  -97.162  0.824   1.00 0.00 ? 256  THR H CA    1 
ATOM 9342  C C     . THR H 8  256 ? 63.106  -96.330  1.819   1.00 0.00 ? 256  THR H C     1 
ATOM 9343  O O     . THR H 8  256 ? 61.983  -96.684  2.175   1.00 0.00 ? 256  THR H O     1 
ATOM 9344  C CB    . THR H 8  256 ? 64.735  -98.262  1.468   1.00 0.00 ? 256  THR H CB    1 
ATOM 9345  O OG1   . THR H 8  256 ? 63.964  -99.127  2.299   1.00 0.00 ? 256  THR H OG1   1 
ATOM 9346  C CG2   . THR H 8  256 ? 65.926  -97.686  2.265   1.00 0.00 ? 256  THR H CG2   1 
ATOM 9347  N N     . LYS H 8  257 ? 63.694  -95.196  2.271   1.00 0.00 ? 257  LYS H N     1 
ATOM 9348  C CA    . LYS H 8  257 ? 63.101  -94.279  3.215   1.00 0.00 ? 257  LYS H CA    1 
ATOM 9349  C C     . LYS H 8  257 ? 61.927  -93.544  2.611   1.00 0.00 ? 257  LYS H C     1 
ATOM 9350  O O     . LYS H 8  257 ? 60.898  -93.363  3.261   1.00 0.00 ? 257  LYS H O     1 
ATOM 9351  C CB    . LYS H 8  257 ? 64.169  -93.292  3.735   1.00 0.00 ? 257  LYS H CB    1 
ATOM 9352  C CG    . LYS H 8  257 ? 63.764  -92.501  4.989   1.00 0.00 ? 257  LYS H CG    1 
ATOM 9353  C CD    . LYS H 8  257 ? 64.972  -92.148  5.875   1.00 0.00 ? 257  LYS H CD    1 
ATOM 9354  C CE    . LYS H 8  257 ? 64.598  -91.444  7.185   1.00 0.00 ? 257  LYS H CE    1 
ATOM 9355  N NZ    . LYS H 8  257 ? 64.146  -90.062  6.924   1.00 0.00 ? 257  LYS H NZ    1 
ATOM 9356  N N     . LEU H 8  258 ? 62.064  -93.138  1.322   1.00 0.00 ? 258  LEU H N     1 
ATOM 9357  C CA    . LEU H 8  258 ? 61.038  -92.503  0.523   1.00 0.00 ? 258  LEU H CA    1 
ATOM 9358  C C     . LEU H 8  258 ? 59.894  -93.448  0.228   1.00 0.00 ? 258  LEU H C     1 
ATOM 9359  O O     . LEU H 8  258 ? 58.735  -93.036  0.230   1.00 0.00 ? 258  LEU H O     1 
ATOM 9360  C CB    . LEU H 8  258 ? 61.630  -91.986  -0.816  1.00 0.00 ? 258  LEU H CB    1 
ATOM 9361  C CG    . LEU H 8  258 ? 60.658  -91.260  -1.781  1.00 0.00 ? 258  LEU H CG    1 
ATOM 9362  C CD1   . LEU H 8  258 ? 59.950  -90.046  -1.146  1.00 0.00 ? 258  LEU H CD1   1 
ATOM 9363  C CD2   . LEU H 8  258 ? 61.376  -90.841  -3.080  1.00 0.00 ? 258  LEU H CD2   1 
ATOM 9364  N N     . ASP H 8  259 ? 60.217  -94.739  -0.042  1.00 0.00 ? 259  ASP H N     1 
ATOM 9365  C CA    . ASP H 8  259 ? 59.311  -95.747  -0.550  1.00 0.00 ? 259  ASP H CA    1 
ATOM 9366  C C     . ASP H 8  259 ? 58.173  -96.040  0.397   1.00 0.00 ? 259  ASP H C     1 
ATOM 9367  O O     . ASP H 8  259 ? 57.030  -96.186  -0.035  1.00 0.00 ? 259  ASP H O     1 
ATOM 9368  C CB    . ASP H 8  259 ? 60.054  -97.080  -0.849  1.00 0.00 ? 259  ASP H CB    1 
ATOM 9369  C CG    . ASP H 8  259 ? 59.277  -97.933  -1.854  1.00 0.00 ? 259  ASP H CG    1 
ATOM 9370  O OD1   . ASP H 8  259 ? 59.131  -97.474  -3.019  1.00 0.00 ? 259  ASP H OD1   1 
ATOM 9371  O OD2   . ASP H 8  259 ? 58.824  -99.045  -1.475  1.00 0.00 ? 259  ASP H OD2   1 
ATOM 9372  N N     . GLN H 8  260 ? 58.474  -96.125  1.717   1.00 0.00 ? 260  GLN H N     1 
ATOM 9373  C CA    . GLN H 8  260 ? 57.507  -96.504  2.716   1.00 0.00 ? 260  GLN H CA    1 
ATOM 9374  C C     . GLN H 8  260 ? 56.808  -95.256  3.187   1.00 0.00 ? 260  GLN H C     1 
ATOM 9375  O O     . GLN H 8  260 ? 57.452  -94.296  3.613   1.00 0.00 ? 260  GLN H O     1 
ATOM 9376  C CB    . GLN H 8  260 ? 58.163  -97.238  3.911   1.00 0.00 ? 260  GLN H CB    1 
ATOM 9377  C CG    . GLN H 8  260 ? 57.363  -98.451  4.424   1.00 0.00 ? 260  GLN H CG    1 
ATOM 9378  C CD    . GLN H 8  260 ? 56.024  -98.014  5.033   1.00 0.00 ? 260  GLN H CD    1 
ATOM 9379  O OE1   . GLN H 8  260 ? 56.001  -97.342  6.071   1.00 0.00 ? 260  GLN H OE1   1 
ATOM 9380  N NE2   . GLN H 8  260 ? 54.895  -98.412  4.370   1.00 0.00 ? 260  GLN H NE2   1 
ATOM 9381  N N     . VAL H 8  261 ? 55.460  -95.255  3.073   1.00 0.00 ? 261  VAL H N     1 
ATOM 9382  C CA    . VAL H 8  261 ? 54.610  -94.125  3.364   1.00 0.00 ? 261  VAL H CA    1 
ATOM 9383  C C     . VAL H 8  261 ? 53.284  -94.702  3.792   1.00 0.00 ? 261  VAL H C     1 
ATOM 9384  O O     . VAL H 8  261 ? 52.987  -95.854  3.475   1.00 0.00 ? 261  VAL H O     1 
ATOM 9385  C CB    . VAL H 8  261 ? 54.346  -93.210  2.159   1.00 0.00 ? 261  VAL H CB    1 
ATOM 9386  C CG1   . VAL H 8  261 ? 55.580  -92.324  1.879   1.00 0.00 ? 261  VAL H CG1   1 
ATOM 9387  C CG2   . VAL H 8  261 ? 53.935  -94.039  0.918   1.00 0.00 ? 261  VAL H CG2   1 
ATOM 9388  N N     . TRP H 8  262 ? 52.471  -93.876  4.505   1.00 0.00 ? 262  TRP H N     1 
ATOM 9389  C CA    . TRP H 8  262 ? 51.087  -94.130  4.846   1.00 0.00 ? 262  TRP H CA    1 
ATOM 9390  C C     . TRP H 8  262 ? 50.700  -93.062  5.853   1.00 0.00 ? 262  TRP H C     1 
ATOM 9391  O O     . TRP H 8  262 ? 51.022  -93.220  7.029   1.00 0.00 ? 262  TRP H O     1 
ATOM 9392  C CB    . TRP H 8  262 ? 50.774  -95.517  5.510   1.00 0.00 ? 262  TRP H CB    1 
ATOM 9393  C CG    . TRP H 8  262 ? 49.310  -95.789  5.864   1.00 0.00 ? 262  TRP H CG    1 
ATOM 9394  C CD1   . TRP H 8  262 ? 48.256  -96.030  5.027   1.00 0.00 ? 262  TRP H CD1   1 
ATOM 9395  C CD2   . TRP H 8  262 ? 48.779  -95.832  7.204   1.00 0.00 ? 262  TRP H CD2   1 
ATOM 9396  N NE1   . TRP H 8  262 ? 47.099  -96.209  5.751   1.00 0.00 ? 262  TRP H NE1   1 
ATOM 9397  C CE2   . TRP H 8  262 ? 47.396  -96.095  7.092   1.00 0.00 ? 262  TRP H CE2   1 
ATOM 9398  C CE3   . TRP H 8  262 ? 49.378  -95.666  8.451   1.00 0.00 ? 262  TRP H CE3   1 
ATOM 9399  C CZ2   . TRP H 8  262 ? 46.593  -96.197  8.225   1.00 0.00 ? 262  TRP H CZ2   1 
ATOM 9400  C CZ3   . TRP H 8  262 ? 48.568  -95.764  9.591   1.00 0.00 ? 262  TRP H CZ3   1 
ATOM 9401  C CH2   . TRP H 8  262 ? 47.194  -96.026  9.481   1.00 0.00 ? 262  TRP H CH2   1 
ATOM 9402  N N     . GLY H 8  263 ? 50.005  -91.935  5.510   1.00 0.00 ? 263  GLY H N     1 
ATOM 9403  C CA    . GLY H 8  263 ? 49.647  -91.352  4.235   1.00 0.00 ? 263  GLY H CA    1 
ATOM 9404  C C     . GLY H 8  263 ? 48.916  -92.216  3.250   1.00 0.00 ? 263  GLY H C     1 
ATOM 9405  O O     . GLY H 8  263 ? 48.203  -93.147  3.623   1.00 0.00 ? 263  GLY H O     1 
ATOM 9406  N N     . SER H 8  264 ? 49.102  -91.862  1.954   1.00 0.00 ? 264  SER H N     1 
ATOM 9407  C CA    . SER H 8  264 ? 48.662  -92.573  0.779   1.00 0.00 ? 264  SER H CA    1 
ATOM 9408  C C     . SER H 8  264 ? 48.811  -91.589  -0.347  1.00 0.00 ? 264  SER H C     1 
ATOM 9409  O O     . SER H 8  264 ? 48.220  -90.512  -0.312  1.00 0.00 ? 264  SER H O     1 
ATOM 9410  C CB    . SER H 8  264 ? 47.205  -93.127  0.754   1.00 0.00 ? 264  SER H CB    1 
ATOM 9411  O OG    . SER H 8  264 ? 46.235  -92.166  1.157   1.00 0.00 ? 264  SER H OG    1 
ATOM 9412  N N     . GLU H 8  265 ? 49.607  -91.963  -1.375  1.00 0.00 ? 265  GLU H N     1 
ATOM 9413  C CA    . GLU H 8  265 ? 49.811  -91.191  -2.577  1.00 0.00 ? 265  GLU H CA    1 
ATOM 9414  C C     . GLU H 8  265 ? 50.878  -91.938  -3.310  1.00 0.00 ? 265  GLU H C     1 
ATOM 9415  O O     . GLU H 8  265 ? 51.891  -92.310  -2.719  1.00 0.00 ? 265  GLU H O     1 
ATOM 9416  C CB    . GLU H 8  265 ? 50.281  -89.709  -2.421  1.00 0.00 ? 265  GLU H CB    1 
ATOM 9417  C CG    . GLU H 8  265 ? 49.740  -88.786  -3.530  1.00 0.00 ? 265  GLU H CG    1 
ATOM 9418  C CD    . GLU H 8  265 ? 48.215  -88.707  -3.436  1.00 0.00 ? 265  GLU H CD    1 
ATOM 9419  O OE1   . GLU H 8  265 ? 47.534  -89.382  -4.253  1.00 0.00 ? 265  GLU H OE1   1 
ATOM 9420  O OE2   . GLU H 8  265 ? 47.707  -87.975  -2.545  1.00 0.00 ? 265  GLU H OE2   1 
ATOM 9421  N N     . THR H 8  266 ? 50.651  -92.212  -4.615  1.00 0.00 ? 266  THR H N     1 
ATOM 9422  C CA    . THR H 8  266 ? 51.514  -93.100  -5.346  1.00 0.00 ? 266  THR H CA    1 
ATOM 9423  C C     . THR H 8  266 ? 51.372  -92.753  -6.804  1.00 0.00 ? 266  THR H C     1 
ATOM 9424  O O     . THR H 8  266 ? 50.440  -92.059  -7.212  1.00 0.00 ? 266  THR H O     1 
ATOM 9425  C CB    . THR H 8  266 ? 51.206  -94.573  -5.051  1.00 0.00 ? 266  THR H CB    1 
ATOM 9426  O OG1   . THR H 8  266 ? 52.240  -95.440  -5.503  1.00 0.00 ? 266  THR H OG1   1 
ATOM 9427  C CG2   . THR H 8  266 ? 49.849  -95.008  -5.646  1.00 0.00 ? 266  THR H CG2   1 
ATOM 9428  N N     . VAL H 8  267 ? 52.356  -93.218  -7.607  1.00 0.00 ? 267  VAL H N     1 
ATOM 9429  C CA    . VAL H 8  267 ? 52.529  -92.933  -9.009  1.00 0.00 ? 267  VAL H CA    1 
ATOM 9430  C C     . VAL H 8  267 ? 51.364  -93.377  -9.870  1.00 0.00 ? 267  VAL H C     1 
ATOM 9431  O O     . VAL H 8  267 ? 50.775  -94.438  -9.663  1.00 0.00 ? 267  VAL H O     1 
ATOM 9432  C CB    . VAL H 8  267 ? 53.857  -93.504  -9.508  1.00 0.00 ? 267  VAL H CB    1 
ATOM 9433  C CG1   . VAL H 8  267 ? 53.928  -95.041  -9.345  1.00 0.00 ? 267  VAL H CG1   1 
ATOM 9434  C CG2   . VAL H 8  267 ? 54.164  -93.046  -10.948 1.00 0.00 ? 267  VAL H CG2   1 
ATOM 9435  N N     . ALA H 8  268 ? 51.027  -92.530  -10.868 1.00 0.00 ? 268  ALA H N     1 
ATOM 9436  C CA    . ALA H 8  268 ? 50.195  -92.886  -11.984 1.00 0.00 ? 268  ALA H CA    1 
ATOM 9437  C C     . ALA H 8  268 ? 50.474  -91.834  -13.019 1.00 0.00 ? 268  ALA H C     1 
ATOM 9438  O O     . ALA H 8  268 ? 50.944  -90.742  -12.696 1.00 0.00 ? 268  ALA H O     1 
ATOM 9439  C CB    . ALA H 8  268 ? 48.681  -92.902  -11.690 1.00 0.00 ? 268  ALA H CB    1 
ATOM 9440  N N     . SER H 8  269 ? 50.197  -92.153  -14.302 1.00 0.00 ? 269  SER H N     1 
ATOM 9441  C CA    . SER H 8  269 ? 50.378  -91.222  -15.391 1.00 0.00 ? 269  SER H CA    1 
ATOM 9442  C C     . SER H 8  269 ? 49.394  -91.611  -16.511 1.00 0.00 ? 269  SER H C     1 
ATOM 9443  O O     . SER H 8  269 ? 48.895  -92.768  -16.515 1.00 0.00 ? 269  SER H O     1 
ATOM 9444  C CB    . SER H 8  269 ? 51.830  -91.231  -15.942 1.00 0.00 ? 269  SER H CB    1 
ATOM 9445  O OG    . SER H 8  269 ? 52.051  -90.198  -16.895 1.00 0.00 ? 269  SER H OG    1 
ATOM 9446  N N     . MET I 9  1   ? 84.068  -24.226  -16.748 1.00 0.00 ? 1    MET I N     1 
ATOM 9447  C CA    . MET I 9  1   ? 82.746  -24.782  -17.131 1.00 0.00 ? 1    MET I CA    1 
ATOM 9448  C C     . MET I 9  1   ? 82.219  -24.125  -18.366 1.00 0.00 ? 1    MET I C     1 
ATOM 9449  O O     . MET I 9  1   ? 82.165  -24.756  -19.422 1.00 0.00 ? 1    MET I O     1 
ATOM 9450  C CB    . MET I 9  1   ? 81.710  -24.637  -15.981 1.00 0.00 ? 1    MET I CB    1 
ATOM 9451  C CG    . MET I 9  1   ? 80.321  -25.251  -16.285 1.00 0.00 ? 1    MET I CG    1 
ATOM 9452  S SD    . MET I 9  1   ? 78.977  -24.664  -15.200 1.00 0.00 ? 1    MET I SD    1 
ATOM 9453  C CE    . MET I 9  1   ? 79.560  -25.398  -13.645 1.00 0.00 ? 1    MET I CE    1 
ATOM 9454  N N     . ALA I 9  2   ? 81.767  -22.849  -18.249 1.00 0.00 ? 2    ALA I N     1 
ATOM 9455  C CA    . ALA I 9  2   ? 80.833  -22.275  -19.185 1.00 0.00 ? 2    ALA I CA    1 
ATOM 9456  C C     . ALA I 9  2   ? 81.523  -21.707  -20.400 1.00 0.00 ? 2    ALA I C     1 
ATOM 9457  O O     . ALA I 9  2   ? 82.593  -22.172  -20.789 1.00 0.00 ? 2    ALA I O     1 
ATOM 9458  C CB    . ALA I 9  2   ? 79.947  -21.207  -18.507 1.00 0.00 ? 2    ALA I CB    1 
ATOM 9459  N N     . ARG I 9  3   ? 80.862  -20.716  -21.055 1.00 0.00 ? 3    ARG I N     1 
ATOM 9460  C CA    . ARG I 9  3   ? 81.092  -20.174  -22.385 1.00 0.00 ? 3    ARG I CA    1 
ATOM 9461  C C     . ARG I 9  3   ? 81.110  -21.287  -23.440 1.00 0.00 ? 3    ARG I C     1 
ATOM 9462  O O     . ARG I 9  3   ? 80.943  -22.455  -23.094 1.00 0.00 ? 3    ARG I O     1 
ATOM 9463  C CB    . ARG I 9  3   ? 82.175  -19.046  -22.406 1.00 0.00 ? 3    ARG I CB    1 
ATOM 9464  C CG    . ARG I 9  3   ? 83.647  -19.426  -22.169 1.00 0.00 ? 3    ARG I CG    1 
ATOM 9465  C CD    . ARG I 9  3   ? 84.094  -19.185  -20.717 1.00 0.00 ? 3    ARG I CD    1 
ATOM 9466  N NE    . ARG I 9  3   ? 85.584  -19.319  -20.603 1.00 0.00 ? 3    ARG I NE    1 
ATOM 9467  C CZ    . ARG I 9  3   ? 86.222  -20.504  -20.362 1.00 0.00 ? 3    ARG I CZ    1 
ATOM 9468  N NH1   . ARG I 9  3   ? 85.562  -21.697  -20.411 1.00 0.00 ? 3    ARG I NH1   1 
ATOM 9469  N NH2   . ARG I 9  3   ? 87.553  -20.488  -20.056 1.00 0.00 ? 3    ARG I NH2   1 
ATOM 9470  N N     . TYR I 9  4   ? 81.240  -21.068  -24.771 1.00 0.00 ? 4    TYR I N     1 
ATOM 9471  C CA    . TYR I 9  4   ? 81.353  -19.890  -25.581 1.00 0.00 ? 4    TYR I CA    1 
ATOM 9472  C C     . TYR I 9  4   ? 80.030  -19.222  -25.935 1.00 0.00 ? 4    TYR I C     1 
ATOM 9473  O O     . TYR I 9  4   ? 79.930  -18.012  -25.738 1.00 0.00 ? 4    TYR I O     1 
ATOM 9474  C CB    . TYR I 9  4   ? 82.141  -20.307  -26.831 1.00 0.00 ? 4    TYR I CB    1 
ATOM 9475  C CG    . TYR I 9  4   ? 82.760  -19.181  -27.598 1.00 0.00 ? 4    TYR I CG    1 
ATOM 9476  C CD1   . TYR I 9  4   ? 84.103  -18.848  -27.361 1.00 0.00 ? 4    TYR I CD1   1 
ATOM 9477  C CD2   . TYR I 9  4   ? 82.058  -18.512  -28.614 1.00 0.00 ? 4    TYR I CD2   1 
ATOM 9478  C CE1   . TYR I 9  4   ? 84.742  -17.892  -28.155 1.00 0.00 ? 4    TYR I CE1   1 
ATOM 9479  C CE2   . TYR I 9  4   ? 82.709  -17.593  -29.443 1.00 0.00 ? 4    TYR I CE2   1 
ATOM 9480  C CZ    . TYR I 9  4   ? 84.051  -17.293  -29.211 1.00 0.00 ? 4    TYR I CZ    1 
ATOM 9481  O OH    . TYR I 9  4   ? 84.698  -16.372  -30.036 1.00 0.00 ? 4    TYR I OH    1 
ATOM 9482  N N     . GLY I 9  5   ? 78.949  -19.898  -26.439 1.00 0.00 ? 5    GLY I N     1 
ATOM 9483  C CA    . GLY I 9  5   ? 78.720  -21.304  -26.709 1.00 0.00 ? 5    GLY I CA    1 
ATOM 9484  C C     . GLY I 9  5   ? 78.966  -21.714  -28.139 1.00 0.00 ? 5    GLY I C     1 
ATOM 9485  O O     . GLY I 9  5   ? 78.760  -22.878  -28.480 1.00 0.00 ? 5    GLY I O     1 
ATOM 9486  N N     . ALA I 9  6   ? 79.410  -20.777  -29.012 1.00 0.00 ? 6    ALA I N     1 
ATOM 9487  C CA    . ALA I 9  6   ? 79.719  -21.035  -30.405 1.00 0.00 ? 6    ALA I CA    1 
ATOM 9488  C C     . ALA I 9  6   ? 81.223  -21.107  -30.536 1.00 0.00 ? 6    ALA I C     1 
ATOM 9489  O O     . ALA I 9  6   ? 81.859  -20.180  -31.035 1.00 0.00 ? 6    ALA I O     1 
ATOM 9490  C CB    . ALA I 9  6   ? 79.181  -19.924  -31.326 1.00 0.00 ? 6    ALA I CB    1 
ATOM 9491  N N     . THR I 9  7   ? 81.797  -22.229  -30.038 1.00 0.00 ? 7    THR I N     1 
ATOM 9492  C CA    . THR I 9  7   ? 83.145  -22.437  -29.536 1.00 0.00 ? 7    THR I CA    1 
ATOM 9493  C C     . THR I 9  7   ? 84.345  -21.979  -30.334 1.00 0.00 ? 7    THR I C     1 
ATOM 9494  O O     . THR I 9  7   ? 85.394  -21.764  -29.727 1.00 0.00 ? 7    THR I O     1 
ATOM 9495  C CB    . THR I 9  7   ? 83.357  -23.886  -29.122 1.00 0.00 ? 7    THR I CB    1 
ATOM 9496  O OG1   . THR I 9  7   ? 83.047  -24.775  -30.192 1.00 0.00 ? 7    THR I OG1   1 
ATOM 9497  C CG2   . THR I 9  7   ? 82.444  -24.186  -27.910 1.00 0.00 ? 7    THR I CG2   1 
ATOM 9498  N N     . SER I 9  8   ? 84.254  -21.831  -31.681 1.00 0.00 ? 8    SER I N     1 
ATOM 9499  C CA    . SER I 9  8   ? 85.370  -21.466  -32.535 1.00 0.00 ? 8    SER I CA    1 
ATOM 9500  C C     . SER I 9  8   ? 85.988  -20.145  -32.118 1.00 0.00 ? 8    SER I C     1 
ATOM 9501  O O     . SER I 9  8   ? 85.278  -19.142  -32.030 1.00 0.00 ? 8    SER I O     1 
ATOM 9502  C CB    . SER I 9  8   ? 84.916  -21.353  -34.017 1.00 0.00 ? 8    SER I CB    1 
ATOM 9503  O OG    . SER I 9  8   ? 86.012  -21.200  -34.914 1.00 0.00 ? 8    SER I OG    1 
ATOM 9504  N N     . THR I 9  9   ? 87.328  -20.127  -31.861 1.00 0.00 ? 9    THR I N     1 
ATOM 9505  C CA    . THR I 9  9   ? 88.016  -18.894  -31.556 1.00 0.00 ? 9    THR I CA    1 
ATOM 9506  C C     . THR I 9  9   ? 89.419  -18.862  -32.162 1.00 0.00 ? 9    THR I C     1 
ATOM 9507  O O     . THR I 9  9   ? 89.531  -18.322  -33.261 1.00 0.00 ? 9    THR I O     1 
ATOM 9508  C CB    . THR I 9  9   ? 87.744  -18.294  -30.166 1.00 0.00 ? 9    THR I CB    1 
ATOM 9509  O OG1   . THR I 9  9   ? 88.296  -16.995  -30.047 1.00 0.00 ? 9    THR I OG1   1 
ATOM 9510  C CG2   . THR I 9  9   ? 88.102  -19.151  -28.934 1.00 0.00 ? 9    THR I CG2   1 
ATOM 9511  N N     . ASN I 9  10  ? 90.556  -19.370  -31.602 1.00 0.00 ? 10   ASN I N     1 
ATOM 9512  C CA    . ASN I 9  10  ? 90.829  -20.243  -30.488 1.00 0.00 ? 10   ASN I CA    1 
ATOM 9513  C C     . ASN I 9  10  ? 91.646  -19.360  -29.536 1.00 0.00 ? 10   ASN I C     1 
ATOM 9514  O O     . ASN I 9  10  ? 91.833  -18.200  -29.899 1.00 0.00 ? 10   ASN I O     1 
ATOM 9515  C CB    . ASN I 9  10  ? 91.612  -21.492  -31.000 1.00 0.00 ? 10   ASN I CB    1 
ATOM 9516  C CG    . ASN I 9  10  ? 90.952  -22.815  -30.567 1.00 0.00 ? 10   ASN I CG    1 
ATOM 9517  O OD1   . ASN I 9  10  ? 89.935  -22.846  -29.865 1.00 0.00 ? 10   ASN I OD1   1 
ATOM 9518  N ND2   . ASN I 9  10  ? 91.574  -23.947  -31.016 1.00 0.00 ? 10   ASN I ND2   1 
ATOM 9519  N N     . PRO I 9  11  ? 92.104  -19.734  -28.324 1.00 0.00 ? 11   PRO I N     1 
ATOM 9520  C CA    . PRO I 9  11  ? 92.464  -18.774  -27.278 1.00 0.00 ? 11   PRO I CA    1 
ATOM 9521  C C     . PRO I 9  11  ? 93.743  -17.993  -27.497 1.00 0.00 ? 11   PRO I C     1 
ATOM 9522  O O     . PRO I 9  11  ? 94.010  -17.109  -26.685 1.00 0.00 ? 11   PRO I O     1 
ATOM 9523  C CB    . PRO I 9  11  ? 92.540  -19.586  -25.974 1.00 0.00 ? 11   PRO I CB    1 
ATOM 9524  C CG    . PRO I 9  11  ? 92.669  -21.039  -26.425 1.00 0.00 ? 11   PRO I CG    1 
ATOM 9525  C CD    . PRO I 9  11  ? 91.900  -21.060  -27.745 1.00 0.00 ? 11   PRO I CD    1 
ATOM 9526  N N     . ALA I 9  12  ? 94.534  -18.270  -28.562 1.00 0.00 ? 12   ALA I N     1 
ATOM 9527  C CA    . ALA I 9  12  ? 95.729  -17.515  -28.879 1.00 0.00 ? 12   ALA I CA    1 
ATOM 9528  C C     . ALA I 9  12  ? 95.381  -16.405  -29.845 1.00 0.00 ? 12   ALA I C     1 
ATOM 9529  O O     . ALA I 9  12  ? 96.261  -15.718  -30.363 1.00 0.00 ? 12   ALA I O     1 
ATOM 9530  C CB    . ALA I 9  12  ? 96.799  -18.403  -29.546 1.00 0.00 ? 12   ALA I CB    1 
ATOM 9531  N N     . LYS I 9  13  ? 94.065  -16.206  -30.082 1.00 0.00 ? 13   LYS I N     1 
ATOM 9532  C CA    . LYS I 9  13  ? 93.501  -15.232  -30.975 1.00 0.00 ? 13   LYS I CA    1 
ATOM 9533  C C     . LYS I 9  13  ? 92.195  -14.803  -30.346 1.00 0.00 ? 13   LYS I C     1 
ATOM 9534  O O     . LYS I 9  13  ? 91.261  -14.431  -31.051 1.00 0.00 ? 13   LYS I O     1 
ATOM 9535  C CB    . LYS I 9  13  ? 93.233  -15.768  -32.408 1.00 0.00 ? 13   LYS I CB    1 
ATOM 9536  C CG    . LYS I 9  13  ? 94.524  -16.026  -33.207 1.00 0.00 ? 13   LYS I CG    1 
ATOM 9537  C CD    . LYS I 9  13  ? 94.292  -16.200  -34.717 1.00 0.00 ? 13   LYS I CD    1 
ATOM 9538  C CE    . LYS I 9  13  ? 95.587  -16.264  -35.546 1.00 0.00 ? 13   LYS I CE    1 
ATOM 9539  N NZ    . LYS I 9  13  ? 96.354  -14.997  -35.458 1.00 0.00 ? 13   LYS I NZ    1 
ATOM 9540  N N     . SER I 9  14  ? 92.099  -14.847  -28.990 1.00 0.00 ? 14   SER I N     1 
ATOM 9541  C CA    . SER I 9  14  ? 90.874  -14.556  -28.277 1.00 0.00 ? 14   SER I CA    1 
ATOM 9542  C C     . SER I 9  14  ? 91.166  -13.688  -27.084 1.00 0.00 ? 14   SER I C     1 
ATOM 9543  O O     . SER I 9  14  ? 92.301  -13.584  -26.621 1.00 0.00 ? 14   SER I O     1 
ATOM 9544  C CB    . SER I 9  14  ? 90.209  -15.851  -27.738 1.00 0.00 ? 14   SER I CB    1 
ATOM 9545  O OG    . SER I 9  14  ? 88.846  -15.674  -27.365 1.00 0.00 ? 14   SER I OG    1 
ATOM 9546  N N     . ALA I 9  15  ? 90.081  -13.081  -26.552 1.00 0.00 ? 15   ALA I N     1 
ATOM 9547  C CA    . ALA I 9  15  ? 90.006  -12.556  -25.215 1.00 0.00 ? 15   ALA I CA    1 
ATOM 9548  C C     . ALA I 9  15  ? 88.598  -12.860  -24.776 1.00 0.00 ? 15   ALA I C     1 
ATOM 9549  O O     . ALA I 9  15  ? 87.742  -13.183  -25.599 1.00 0.00 ? 15   ALA I O     1 
ATOM 9550  C CB    . ALA I 9  15  ? 90.258  -11.043  -25.113 1.00 0.00 ? 15   ALA I CB    1 
ATOM 9551  N N     . SER I 9  16  ? 88.337  -12.804  -23.450 1.00 0.00 ? 16   SER I N     1 
ATOM 9552  C CA    . SER I 9  16  ? 87.098  -13.284  -22.885 1.00 0.00 ? 16   SER I CA    1 
ATOM 9553  C C     . SER I 9  16  ? 86.803  -12.449  -21.673 1.00 0.00 ? 16   SER I C     1 
ATOM 9554  O O     . SER I 9  16  ? 87.711  -11.896  -21.060 1.00 0.00 ? 16   SER I O     1 
ATOM 9555  C CB    . SER I 9  16  ? 87.182  -14.757  -22.409 1.00 0.00 ? 16   SER I CB    1 
ATOM 9556  O OG    . SER I 9  16  ? 87.496  -15.638  -23.478 1.00 0.00 ? 16   SER I OG    1 
ATOM 9557  N N     . ALA I 9  17  ? 85.503  -12.345  -21.310 1.00 0.00 ? 17   ALA I N     1 
ATOM 9558  C CA    . ALA I 9  17  ? 85.058  -11.661  -20.122 1.00 0.00 ? 17   ALA I CA    1 
ATOM 9559  C C     . ALA I 9  17  ? 83.689  -12.183  -19.814 1.00 0.00 ? 17   ALA I C     1 
ATOM 9560  O O     . ALA I 9  17  ? 83.013  -12.702  -20.693 1.00 0.00 ? 17   ALA I O     1 
ATOM 9561  C CB    . ALA I 9  17  ? 84.958  -10.134  -20.279 1.00 0.00 ? 17   ALA I CB    1 
ATOM 9562  N N     . ARG I 9  18  ? 83.229  -12.072  -18.545 1.00 0.00 ? 18   ARG I N     1 
ATOM 9563  C CA    . ARG I 9  18  ? 81.891  -12.492  -18.189 1.00 0.00 ? 18   ARG I CA    1 
ATOM 9564  C C     . ARG I 9  18  ? 81.463  -11.619  -17.042 1.00 0.00 ? 18   ARG I C     1 
ATOM 9565  O O     . ARG I 9  18  ? 82.284  -11.209  -16.223 1.00 0.00 ? 18   ARG I O     1 
ATOM 9566  C CB    . ARG I 9  18  ? 81.764  -13.972  -17.712 1.00 0.00 ? 18   ARG I CB    1 
ATOM 9567  C CG    . ARG I 9  18  ? 82.388  -15.034  -18.639 1.00 0.00 ? 18   ARG I CG    1 
ATOM 9568  C CD    . ARG I 9  18  ? 82.416  -16.455  -18.050 1.00 0.00 ? 18   ARG I CD    1 
ATOM 9569  N NE    . ARG I 9  18  ? 81.062  -17.098  -18.143 1.00 0.00 ? 18   ARG I NE    1 
ATOM 9570  C CZ    . ARG I 9  18  ? 80.252  -17.317  -17.063 1.00 0.00 ? 18   ARG I CZ    1 
ATOM 9571  N NH1   . ARG I 9  18  ? 80.599  -16.868  -15.824 1.00 0.00 ? 18   ARG I NH1   1 
ATOM 9572  N NH2   . ARG I 9  18  ? 79.077  -17.998  -17.218 1.00 0.00 ? 18   ARG I NH2   1 
ATOM 9573  N N     . GLY I 9  19  ? 80.139  -11.339  -16.953 1.00 0.00 ? 19   GLY I N     1 
ATOM 9574  C CA    . GLY I 9  19  ? 79.516  -10.793  -15.769 1.00 0.00 ? 19   GLY I CA    1 
ATOM 9575  C C     . GLY I 9  19  ? 78.906  -11.958  -15.046 1.00 0.00 ? 19   GLY I C     1 
ATOM 9576  O O     . GLY I 9  19  ? 78.735  -13.031  -15.624 1.00 0.00 ? 19   GLY I O     1 
ATOM 9577  N N     . SER I 9  20  ? 78.554  -11.782  -13.752 1.00 0.00 ? 20   SER I N     1 
ATOM 9578  C CA    . SER I 9  20  ? 78.055  -12.891  -12.980 1.00 0.00 ? 20   SER I CA    1 
ATOM 9579  C C     . SER I 9  20  ? 77.169  -12.337  -11.898 1.00 0.00 ? 20   SER I C     1 
ATOM 9580  O O     . SER I 9  20  ? 77.632  -11.593  -11.033 1.00 0.00 ? 20   SER I O     1 
ATOM 9581  C CB    . SER I 9  20  ? 79.218  -13.712  -12.360 1.00 0.00 ? 20   SER I CB    1 
ATOM 9582  O OG    . SER I 9  20  ? 78.778  -14.914  -11.743 1.00 0.00 ? 20   SER I OG    1 
ATOM 9583  N N     . TYR I 9  21  ? 75.862  -12.713  -11.946 1.00 0.00 ? 21   TYR I N     1 
ATOM 9584  C CA    . TYR I 9  21  ? 74.828  -12.429  -10.966 1.00 0.00 ? 21   TYR I CA    1 
ATOM 9585  C C     . TYR I 9  21  ? 74.687  -10.960  -10.652 1.00 0.00 ? 21   TYR I C     1 
ATOM 9586  O O     . TYR I 9  21  ? 74.597  -10.571  -9.488  1.00 0.00 ? 21   TYR I O     1 
ATOM 9587  C CB    . TYR I 9  21  ? 74.964  -13.222  -9.639  1.00 0.00 ? 21   TYR I CB    1 
ATOM 9588  C CG    . TYR I 9  21  ? 74.899  -14.705  -9.888  1.00 0.00 ? 21   TYR I CG    1 
ATOM 9589  C CD1   . TYR I 9  21  ? 76.071  -15.479  -9.908  1.00 0.00 ? 21   TYR I CD1   1 
ATOM 9590  C CD2   . TYR I 9  21  ? 73.660  -15.344  -10.070 1.00 0.00 ? 21   TYR I CD2   1 
ATOM 9591  C CE1   . TYR I 9  21  ? 76.011  -16.862  -10.122 1.00 0.00 ? 21   TYR I CE1   1 
ATOM 9592  C CE2   . TYR I 9  21  ? 73.594  -16.727  -10.279 1.00 0.00 ? 21   TYR I CE2   1 
ATOM 9593  C CZ    . TYR I 9  21  ? 74.770  -17.489  -10.306 1.00 0.00 ? 21   TYR I CZ    1 
ATOM 9594  O OH    . TYR I 9  21  ? 74.700  -18.886  -10.507 1.00 0.00 ? 21   TYR I OH    1 
ATOM 9595  N N     . LEU I 9  22  ? 74.652  -10.111  -11.705 1.00 0.00 ? 22   LEU I N     1 
ATOM 9596  C CA    . LEU I 9  22  ? 74.495  -8.684   -11.558 1.00 0.00 ? 22   LEU I CA    1 
ATOM 9597  C C     . LEU I 9  22  ? 73.037  -8.390   -11.762 1.00 0.00 ? 22   LEU I C     1 
ATOM 9598  O O     . LEU I 9  22  ? 72.316  -9.180   -12.369 1.00 0.00 ? 22   LEU I O     1 
ATOM 9599  C CB    . LEU I 9  22  ? 75.399  -7.885   -12.529 1.00 0.00 ? 22   LEU I CB    1 
ATOM 9600  C CG    . LEU I 9  22  ? 76.917  -8.115   -12.273 1.00 0.00 ? 22   LEU I CG    1 
ATOM 9601  C CD1   . LEU I 9  22  ? 77.798  -7.371   -13.293 1.00 0.00 ? 22   LEU I CD1   1 
ATOM 9602  C CD2   . LEU I 9  22  ? 77.350  -7.739   -10.840 1.00 0.00 ? 22   LEU I CD2   1 
ATOM 9603  N N     . ARG I 9  23  ? 72.549  -7.263   -11.193 1.00 0.00 ? 23   ARG I N     1 
ATOM 9604  C CA    . ARG I 9  23  ? 71.132  -7.016   -11.060 1.00 0.00 ? 23   ARG I CA    1 
ATOM 9605  C C     . ARG I 9  23  ? 70.674  -6.054   -12.119 1.00 0.00 ? 23   ARG I C     1 
ATOM 9606  O O     . ARG I 9  23  ? 70.129  -4.997   -11.811 1.00 0.00 ? 23   ARG I O     1 
ATOM 9607  C CB    . ARG I 9  23  ? 70.761  -6.465   -9.661  1.00 0.00 ? 23   ARG I CB    1 
ATOM 9608  C CG    . ARG I 9  23  ? 71.033  -7.476   -8.533  1.00 0.00 ? 23   ARG I CG    1 
ATOM 9609  C CD    . ARG I 9  23  ? 70.256  -7.176   -7.241  1.00 0.00 ? 23   ARG I CD    1 
ATOM 9610  N NE    . ARG I 9  23  ? 70.928  -6.097   -6.441  1.00 0.00 ? 23   ARG I NE    1 
ATOM 9611  C CZ    . ARG I 9  23  ? 70.239  -5.339   -5.533  1.00 0.00 ? 23   ARG I CZ    1 
ATOM 9612  N NH1   . ARG I 9  23  ? 68.873  -5.311   -5.525  1.00 0.00 ? 23   ARG I NH1   1 
ATOM 9613  N NH2   . ARG I 9  23  ? 70.924  -4.624   -4.594  1.00 0.00 ? 23   ARG I NH2   1 
ATOM 9614  N N     . VAL I 9  24  ? 70.886  -6.416   -13.407 1.00 0.00 ? 24   VAL I N     1 
ATOM 9615  C CA    . VAL I 9  24  ? 70.523  -5.595   -14.533 1.00 0.00 ? 24   VAL I CA    1 
ATOM 9616  C C     . VAL I 9  24  ? 69.888  -6.517   -15.540 1.00 0.00 ? 24   VAL I C     1 
ATOM 9617  O O     . VAL I 9  24  ? 70.423  -7.584   -15.833 1.00 0.00 ? 24   VAL I O     1 
ATOM 9618  C CB    . VAL I 9  24  ? 71.715  -4.886   -15.152 1.00 0.00 ? 24   VAL I CB    1 
ATOM 9619  C CG1   . VAL I 9  24  ? 71.275  -4.114   -16.406 1.00 0.00 ? 24   VAL I CG1   1 
ATOM 9620  C CG2   . VAL I 9  24  ? 72.353  -3.935   -14.115 1.00 0.00 ? 24   VAL I CG2   1 
ATOM 9621  N N     . SER I 9  25  ? 68.706  -6.085   -16.052 1.00 0.00 ? 25   SER I N     1 
ATOM 9622  C CA    . SER I 9  25  ? 67.719  -6.757   -16.873 1.00 0.00 ? 25   SER I CA    1 
ATOM 9623  C C     . SER I 9  25  ? 68.166  -7.869   -17.795 1.00 0.00 ? 25   SER I C     1 
ATOM 9624  O O     . SER I 9  25  ? 69.195  -7.787   -18.455 1.00 0.00 ? 25   SER I O     1 
ATOM 9625  C CB    . SER I 9  25  ? 66.875  -5.716   -17.661 1.00 0.00 ? 25   SER I CB    1 
ATOM 9626  O OG    . SER I 9  25  ? 65.652  -6.248   -18.156 1.00 0.00 ? 25   SER I OG    1 
ATOM 9627  N N     . PHE I 9  26  ? 67.346  -8.944   -17.849 1.00 0.00 ? 26   PHE I N     1 
ATOM 9628  C CA    . PHE I 9  26  ? 67.446  -10.041  -18.783 1.00 0.00 ? 26   PHE I CA    1 
ATOM 9629  C C     . PHE I 9  26  ? 66.956  -9.611   -20.142 1.00 0.00 ? 26   PHE I C     1 
ATOM 9630  O O     . PHE I 9  26  ? 67.570  -9.922   -21.160 1.00 0.00 ? 26   PHE I O     1 
ATOM 9631  C CB    . PHE I 9  26  ? 66.563  -11.207  -18.248 1.00 0.00 ? 26   PHE I CB    1 
ATOM 9632  C CG    . PHE I 9  26  ? 66.622  -12.520  -18.999 1.00 0.00 ? 26   PHE I CG    1 
ATOM 9633  C CD1   . PHE I 9  26  ? 67.821  -13.060  -19.504 1.00 0.00 ? 26   PHE I CD1   1 
ATOM 9634  C CD2   . PHE I 9  26  ? 65.442  -13.278  -19.115 1.00 0.00 ? 26   PHE I CD2   1 
ATOM 9635  C CE1   . PHE I 9  26  ? 67.843  -14.339  -20.072 1.00 0.00 ? 26   PHE I CE1   1 
ATOM 9636  C CE2   . PHE I 9  26  ? 65.457  -14.544  -19.709 1.00 0.00 ? 26   PHE I CE2   1 
ATOM 9637  C CZ    . PHE I 9  26  ? 66.661  -15.080  -20.178 1.00 0.00 ? 26   PHE I CZ    1 
ATOM 9638  N N     . LYS I 9  27  ? 65.812  -8.890   -20.149 1.00 0.00 ? 27   LYS I N     1 
ATOM 9639  C CA    . LYS I 9  27  ? 65.037  -8.513   -21.303 1.00 0.00 ? 27   LYS I CA    1 
ATOM 9640  C C     . LYS I 9  27  ? 65.698  -7.462   -22.151 1.00 0.00 ? 27   LYS I C     1 
ATOM 9641  O O     . LYS I 9  27  ? 65.582  -7.495   -23.375 1.00 0.00 ? 27   LYS I O     1 
ATOM 9642  C CB    . LYS I 9  27  ? 63.651  -7.979   -20.877 1.00 0.00 ? 27   LYS I CB    1 
ATOM 9643  C CG    . LYS I 9  27  ? 62.838  -9.034   -20.106 1.00 0.00 ? 27   LYS I CG    1 
ATOM 9644  C CD    . LYS I 9  27  ? 61.563  -8.499   -19.436 1.00 0.00 ? 27   LYS I CD    1 
ATOM 9645  C CE    . LYS I 9  27  ? 61.858  -7.470   -18.336 1.00 0.00 ? 27   LYS I CE    1 
ATOM 9646  N NZ    . LYS I 9  27  ? 60.670  -7.232   -17.485 1.00 0.00 ? 27   LYS I NZ    1 
ATOM 9647  N N     . ASN I 9  28  ? 66.394  -6.487   -21.520 1.00 0.00 ? 28   ASN I N     1 
ATOM 9648  C CA    . ASN I 9  28  ? 66.920  -5.347   -22.235 1.00 0.00 ? 28   ASN I CA    1 
ATOM 9649  C C     . ASN I 9  28  ? 68.370  -5.564   -22.566 1.00 0.00 ? 28   ASN I C     1 
ATOM 9650  O O     . ASN I 9  28  ? 68.879  -4.919   -23.480 1.00 0.00 ? 28   ASN I O     1 
ATOM 9651  C CB    . ASN I 9  28  ? 66.859  -4.046   -21.393 1.00 0.00 ? 28   ASN I CB    1 
ATOM 9652  C CG    . ASN I 9  28  ? 65.406  -3.611   -21.156 1.00 0.00 ? 28   ASN I CG    1 
ATOM 9653  O OD1   . ASN I 9  28  ? 64.893  -3.727   -20.037 1.00 0.00 ? 28   ASN I OD1   1 
ATOM 9654  N ND2   . ASN I 9  28  ? 64.749  -3.084   -22.234 1.00 0.00 ? 28   ASN I ND2   1 
ATOM 9655  N N     . THR I 9  29  ? 69.065  -6.496   -21.865 1.00 0.00 ? 29   THR I N     1 
ATOM 9656  C CA    . THR I 9  29  ? 70.477  -6.720   -22.086 1.00 0.00 ? 29   THR I CA    1 
ATOM 9657  C C     . THR I 9  29  ? 70.653  -7.772   -23.150 1.00 0.00 ? 29   THR I C     1 
ATOM 9658  O O     . THR I 9  29  ? 71.710  -7.831   -23.771 1.00 0.00 ? 29   THR I O     1 
ATOM 9659  C CB    . THR I 9  29  ? 71.208  -7.134   -20.815 1.00 0.00 ? 29   THR I CB    1 
ATOM 9660  O OG1   . THR I 9  29  ? 71.048  -6.122   -19.829 1.00 0.00 ? 29   THR I OG1   1 
ATOM 9661  C CG2   . THR I 9  29  ? 72.723  -7.322   -21.046 1.00 0.00 ? 29   THR I CG2   1 
ATOM 9662  N N     . ARG I 9  30  ? 69.615  -8.596   -23.455 1.00 0.00 ? 30   ARG I N     1 
ATOM 9663  C CA    . ARG I 9  30  ? 69.683  -9.508   -24.582 1.00 0.00 ? 30   ARG I CA    1 
ATOM 9664  C C     . ARG I 9  30  ? 69.670  -8.752   -25.879 1.00 0.00 ? 30   ARG I C     1 
ATOM 9665  O O     . ARG I 9  30  ? 70.344  -9.140   -26.829 1.00 0.00 ? 30   ARG I O     1 
ATOM 9666  C CB    . ARG I 9  30  ? 68.595  -10.608  -24.627 1.00 0.00 ? 30   ARG I CB    1 
ATOM 9667  C CG    . ARG I 9  30  ? 67.128  -10.152  -24.557 1.00 0.00 ? 30   ARG I CG    1 
ATOM 9668  C CD    . ARG I 9  30  ? 66.114  -11.300  -24.715 1.00 0.00 ? 30   ARG I CD    1 
ATOM 9669  N NE    . ARG I 9  30  ? 66.482  -12.409  -23.763 1.00 0.00 ? 30   ARG I NE    1 
ATOM 9670  C CZ    . ARG I 9  30  ? 66.819  -13.672  -24.173 1.00 0.00 ? 30   ARG I CZ    1 
ATOM 9671  N NH1   . ARG I 9  30  ? 66.577  -14.099  -25.446 1.00 0.00 ? 30   ARG I NH1   1 
ATOM 9672  N NH2   . ARG I 9  30  ? 67.427  -14.520  -23.294 1.00 0.00 ? 30   ARG I NH2   1 
ATOM 9673  N N     . GLU I 9  31  ? 68.894  -7.647   -25.930 1.00 0.00 ? 31   GLU I N     1 
ATOM 9674  C CA    . GLU I 9  31  ? 68.787  -6.777   -27.069 1.00 0.00 ? 31   GLU I CA    1 
ATOM 9675  C C     . GLU I 9  31  ? 70.045  -5.986   -27.277 1.00 0.00 ? 31   GLU I C     1 
ATOM 9676  O O     . GLU I 9  31  ? 70.458  -5.801   -28.417 1.00 0.00 ? 31   GLU I O     1 
ATOM 9677  C CB    . GLU I 9  31  ? 67.583  -5.822   -26.936 1.00 0.00 ? 31   GLU I CB    1 
ATOM 9678  C CG    . GLU I 9  31  ? 66.243  -6.582   -27.003 1.00 0.00 ? 31   GLU I CG    1 
ATOM 9679  C CD    . GLU I 9  31  ? 65.922  -7.070   -28.421 1.00 0.00 ? 31   GLU I CD    1 
ATOM 9680  O OE1   . GLU I 9  31  ? 66.629  -6.681   -29.388 1.00 0.00 ? 31   GLU I OE1   1 
ATOM 9681  O OE2   . GLU I 9  31  ? 64.938  -7.848   -28.549 1.00 0.00 ? 31   GLU I OE2   1 
ATOM 9682  N N     . THR I 9  32  ? 70.690  -5.518   -26.178 1.00 0.00 ? 32   THR I N     1 
ATOM 9683  C CA    . THR I 9  32  ? 71.949  -4.800   -26.210 1.00 0.00 ? 32   THR I CA    1 
ATOM 9684  C C     . THR I 9  32  ? 73.055  -5.709   -26.687 1.00 0.00 ? 32   THR I C     1 
ATOM 9685  O O     . THR I 9  32  ? 73.910  -5.296   -27.466 1.00 0.00 ? 32   THR I O     1 
ATOM 9686  C CB    . THR I 9  32  ? 72.325  -4.216   -24.854 1.00 0.00 ? 32   THR I CB    1 
ATOM 9687  O OG1   . THR I 9  32  ? 71.276  -3.379   -24.385 1.00 0.00 ? 32   THR I OG1   1 
ATOM 9688  C CG2   . THR I 9  32  ? 73.616  -3.373   -24.956 1.00 0.00 ? 32   THR I CG2   1 
ATOM 9689  N N     . ALA I 9  33  ? 73.034  -6.985   -26.229 1.00 0.00 ? 33   ALA I N     1 
ATOM 9690  C CA    . ALA I 9  33  ? 73.991  -8.017   -26.549 1.00 0.00 ? 33   ALA I CA    1 
ATOM 9691  C C     . ALA I 9  33  ? 73.959  -8.376   -28.009 1.00 0.00 ? 33   ALA I C     1 
ATOM 9692  O O     . ALA I 9  33  ? 74.996  -8.595   -28.627 1.00 0.00 ? 33   ALA I O     1 
ATOM 9693  C CB    . ALA I 9  33  ? 73.751  -9.302   -25.733 1.00 0.00 ? 33   ALA I CB    1 
ATOM 9694  N N     . GLN I 9  34  ? 72.750  -8.415   -28.604 1.00 0.00 ? 34   GLN I N     1 
ATOM 9695  C CA    . GLN I 9  34  ? 72.521  -8.733   -29.991 1.00 0.00 ? 34   GLN I CA    1 
ATOM 9696  C C     . GLN I 9  34  ? 72.864  -7.541   -30.860 1.00 0.00 ? 34   GLN I C     1 
ATOM 9697  O O     . GLN I 9  34  ? 73.064  -7.680   -32.066 1.00 0.00 ? 34   GLN I O     1 
ATOM 9698  C CB    . GLN I 9  34  ? 71.034  -9.167   -30.134 1.00 0.00 ? 34   GLN I CB    1 
ATOM 9699  C CG    . GLN I 9  34  ? 70.339  -9.095   -31.511 1.00 0.00 ? 34   GLN I CG    1 
ATOM 9700  C CD    . GLN I 9  34  ? 71.042  -9.859   -32.643 1.00 0.00 ? 34   GLN I CD    1 
ATOM 9701  O OE1   . GLN I 9  34  ? 71.096  -9.353   -33.772 1.00 0.00 ? 34   GLN I OE1   1 
ATOM 9702  N NE2   . GLN I 9  34  ? 71.570  -11.082  -32.344 1.00 0.00 ? 34   GLN I NE2   1 
ATOM 9703  N N     . ALA I 9  35  ? 72.981  -6.337   -30.256 1.00 0.00 ? 35   ALA I N     1 
ATOM 9704  C CA    . ALA I 9  35  ? 73.094  -5.107   -30.989 1.00 0.00 ? 35   ALA I CA    1 
ATOM 9705  C C     . ALA I 9  35  ? 74.446  -4.456   -30.863 1.00 0.00 ? 35   ALA I C     1 
ATOM 9706  O O     . ALA I 9  35  ? 74.612  -3.363   -31.402 1.00 0.00 ? 35   ALA I O     1 
ATOM 9707  C CB    . ALA I 9  35  ? 72.051  -4.097   -30.468 1.00 0.00 ? 35   ALA I CB    1 
ATOM 9708  N N     . ILE I 9  36  ? 75.449  -5.073   -30.167 1.00 0.00 ? 36   ILE I N     1 
ATOM 9709  C CA    . ILE I 9  36  ? 76.650  -4.344   -29.788 1.00 0.00 ? 36   ILE I CA    1 
ATOM 9710  C C     . ILE I 9  36  ? 77.517  -3.711   -30.865 1.00 0.00 ? 36   ILE I C     1 
ATOM 9711  O O     . ILE I 9  36  ? 77.866  -2.561   -30.620 1.00 0.00 ? 36   ILE I O     1 
ATOM 9712  C CB    . ILE I 9  36  ? 77.530  -4.858   -28.640 1.00 0.00 ? 36   ILE I CB    1 
ATOM 9713  C CG1   . ILE I 9  36  ? 77.359  -6.352   -28.321 1.00 0.00 ? 36   ILE I CG1   1 
ATOM 9714  C CG2   . ILE I 9  36  ? 77.240  -3.983   -27.395 1.00 0.00 ? 36   ILE I CG2   1 
ATOM 9715  C CD1   . ILE I 9  36  ? 78.420  -6.857   -27.338 1.00 0.00 ? 36   ILE I CD1   1 
ATOM 9716  N N     . ASN I 9  37  ? 77.912  -4.252   -32.059 1.00 0.00 ? 37   ASN I N     1 
ATOM 9717  C CA    . ASN I 9  37  ? 78.042  -5.552   -32.690 1.00 0.00 ? 37   ASN I CA    1 
ATOM 9718  C C     . ASN I 9  37  ? 78.141  -5.067   -34.116 1.00 0.00 ? 37   ASN I C     1 
ATOM 9719  O O     . ASN I 9  37  ? 77.211  -4.415   -34.591 1.00 0.00 ? 37   ASN I O     1 
ATOM 9720  C CB    . ASN I 9  37  ? 76.876  -6.591   -32.721 1.00 0.00 ? 37   ASN I CB    1 
ATOM 9721  C CG    . ASN I 9  37  ? 77.126  -7.752   -31.750 1.00 0.00 ? 37   ASN I CG    1 
ATOM 9722  O OD1   . ASN I 9  37  ? 78.250  -7.978   -31.292 1.00 0.00 ? 37   ASN I OD1   1 
ATOM 9723  N ND2   . ASN I 9  37  ? 76.043  -8.536   -31.473 1.00 0.00 ? 37   ASN I ND2   1 
ATOM 9724  N N     . GLY I 9  38  ? 79.234  -5.334   -34.872 1.00 0.00 ? 38   GLY I N     1 
ATOM 9725  C CA    . GLY I 9  38  ? 80.460  -5.969   -34.478 1.00 0.00 ? 38   GLY I CA    1 
ATOM 9726  C C     . GLY I 9  38  ? 81.359  -5.613   -35.619 1.00 0.00 ? 38   GLY I C     1 
ATOM 9727  O O     . GLY I 9  38  ? 81.252  -6.245   -36.667 1.00 0.00 ? 38   GLY I O     1 
ATOM 9728  N N     . TRP I 9  39  ? 82.268  -4.605   -35.536 1.00 0.00 ? 39   TRP I N     1 
ATOM 9729  C CA    . TRP I 9  39  ? 82.561  -3.628   -34.513 1.00 0.00 ? 39   TRP I CA    1 
ATOM 9730  C C     . TRP I 9  39  ? 83.581  -4.143   -33.551 1.00 0.00 ? 39   TRP I C     1 
ATOM 9731  O O     . TRP I 9  39  ? 83.447  -5.208   -32.947 1.00 0.00 ? 39   TRP I O     1 
ATOM 9732  C CB    . TRP I 9  39  ? 81.433  -2.875   -33.747 1.00 0.00 ? 39   TRP I CB    1 
ATOM 9733  C CG    . TRP I 9  39  ? 80.426  -2.088   -34.571 1.00 0.00 ? 39   TRP I CG    1 
ATOM 9734  C CD1   . TRP I 9  39  ? 80.201  -2.032   -35.920 1.00 0.00 ? 39   TRP I CD1   1 
ATOM 9735  C CD2   . TRP I 9  39  ? 79.442  -1.236   -33.962 1.00 0.00 ? 39   TRP I CD2   1 
ATOM 9736  N NE1   . TRP I 9  39  ? 79.126  -1.214   -36.191 1.00 0.00 ? 39   TRP I NE1   1 
ATOM 9737  C CE2   . TRP I 9  39  ? 78.633  -0.727   -34.998 1.00 0.00 ? 39   TRP I CE2   1 
ATOM 9738  C CE3   . TRP I 9  39  ? 79.206  -0.902   -32.636 1.00 0.00 ? 39   TRP I CE3   1 
ATOM 9739  C CZ2   . TRP I 9  39  ? 77.553  0.107    -34.717 1.00 0.00 ? 39   TRP I CZ2   1 
ATOM 9740  C CZ3   . TRP I 9  39  ? 78.115  -0.070   -32.349 1.00 0.00 ? 39   TRP I CZ3   1 
ATOM 9741  C CH2   . TRP I 9  39  ? 77.295  0.423    -33.375 1.00 0.00 ? 39   TRP I CH2   1 
ATOM 9742  N N     . GLU I 9  40  ? 84.638  -3.318   -33.392 1.00 0.00 ? 40   GLU I N     1 
ATOM 9743  C CA    . GLU I 9  40  ? 85.695  -3.450   -32.430 1.00 0.00 ? 40   GLU I CA    1 
ATOM 9744  C C     . GLU I 9  40  ? 85.199  -2.875   -31.131 1.00 0.00 ? 40   GLU I C     1 
ATOM 9745  O O     . GLU I 9  40  ? 84.103  -2.319   -31.060 1.00 0.00 ? 40   GLU I O     1 
ATOM 9746  C CB    . GLU I 9  40  ? 87.037  -2.776   -32.856 1.00 0.00 ? 40   GLU I CB    1 
ATOM 9747  C CG    . GLU I 9  40  ? 87.100  -2.187   -34.287 1.00 0.00 ? 40   GLU I CG    1 
ATOM 9748  C CD    . GLU I 9  40  ? 86.207  -0.954   -34.452 1.00 0.00 ? 40   GLU I CD    1 
ATOM 9749  O OE1   . GLU I 9  40  ? 85.422  -0.917   -35.437 1.00 0.00 ? 40   GLU I OE1   1 
ATOM 9750  O OE2   . GLU I 9  40  ? 86.293  -0.039   -33.593 1.00 0.00 ? 40   GLU I OE2   1 
ATOM 9751  N N     . LEU I 9  41  ? 86.001  -3.038   -30.053 1.00 0.00 ? 41   LEU I N     1 
ATOM 9752  C CA    . LEU I 9  41  ? 85.662  -2.628   -28.710 1.00 0.00 ? 41   LEU I CA    1 
ATOM 9753  C C     . LEU I 9  41  ? 85.488  -1.137   -28.583 1.00 0.00 ? 41   LEU I C     1 
ATOM 9754  O O     . LEU I 9  41  ? 84.621  -0.701   -27.835 1.00 0.00 ? 41   LEU I O     1 
ATOM 9755  C CB    . LEU I 9  41  ? 86.698  -3.085   -27.654 1.00 0.00 ? 41   LEU I CB    1 
ATOM 9756  C CG    . LEU I 9  41  ? 86.934  -4.614   -27.622 1.00 0.00 ? 41   LEU I CG    1 
ATOM 9757  C CD1   . LEU I 9  41  ? 88.014  -4.984   -26.589 1.00 0.00 ? 41   LEU I CD1   1 
ATOM 9758  C CD2   . LEU I 9  41  ? 85.643  -5.419   -27.363 1.00 0.00 ? 41   LEU I CD2   1 
ATOM 9759  N N     . THR I 9  42  ? 86.303  -0.323   -29.302 1.00 0.00 ? 42   THR I N     1 
ATOM 9760  C CA    . THR I 9  42  ? 86.231  1.126    -29.274 1.00 0.00 ? 42   THR I CA    1 
ATOM 9761  C C     . THR I 9  42  ? 84.961  1.653    -29.924 1.00 0.00 ? 42   THR I C     1 
ATOM 9762  O O     . THR I 9  42  ? 84.416  2.650    -29.455 1.00 0.00 ? 42   THR I O     1 
ATOM 9763  C CB    . THR I 9  42  ? 87.502  1.798    -29.803 1.00 0.00 ? 42   THR I CB    1 
ATOM 9764  O OG1   . THR I 9  42  ? 87.448  3.218    -29.726 1.00 0.00 ? 42   THR I OG1   1 
ATOM 9765  C CG2   . THR I 9  42  ? 87.837  1.375    -31.244 1.00 0.00 ? 42   THR I CG2   1 
ATOM 9766  N N     . LYS I 9  43  ? 84.445  1.005    -31.002 1.00 0.00 ? 43   LYS I N     1 
ATOM 9767  C CA    . LYS I 9  43  ? 83.169  1.361    -31.597 1.00 0.00 ? 43   LYS I CA    1 
ATOM 9768  C C     . LYS I 9  43  ? 82.022  1.032    -30.676 1.00 0.00 ? 43   LYS I C     1 
ATOM 9769  O O     . LYS I 9  43  ? 81.088  1.821    -30.556 1.00 0.00 ? 43   LYS I O     1 
ATOM 9770  C CB    . LYS I 9  43  ? 82.903  0.668    -32.957 1.00 0.00 ? 43   LYS I CB    1 
ATOM 9771  C CG    . LYS I 9  43  ? 83.247  1.533    -34.184 1.00 0.00 ? 43   LYS I CG    1 
ATOM 9772  C CD    . LYS I 9  43  ? 82.362  2.778    -34.423 1.00 0.00 ? 43   LYS I CD    1 
ATOM 9773  C CE    . LYS I 9  43  ? 80.885  2.489    -34.752 1.00 0.00 ? 43   LYS I CE    1 
ATOM 9774  N NZ    . LYS I 9  43  ? 80.062  2.351    -33.529 1.00 0.00 ? 43   LYS I NZ    1 
ATOM 9775  N N     . ALA I 9  44  ? 82.075  -0.143   -30.001 1.00 0.00 ? 44   ALA I N     1 
ATOM 9776  C CA    . ALA I 9  44  ? 81.066  -0.583   -29.063 1.00 0.00 ? 44   ALA I CA    1 
ATOM 9777  C C     . ALA I 9  44  ? 80.997  0.323    -27.864 1.00 0.00 ? 44   ALA I C     1 
ATOM 9778  O O     . ALA I 9  44  ? 79.913  0.634    -27.377 1.00 0.00 ? 44   ALA I O     1 
ATOM 9779  C CB    . ALA I 9  44  ? 81.320  -2.017   -28.561 1.00 0.00 ? 44   ALA I CB    1 
ATOM 9780  N N     . GLN I 9  45  ? 82.179  0.773    -27.382 1.00 0.00 ? 45   GLN I N     1 
ATOM 9781  C CA    . GLN I 9  45  ? 82.354  1.640    -26.249 1.00 0.00 ? 45   GLN I CA    1 
ATOM 9782  C C     . GLN I 9  45  ? 81.761  2.995    -26.495 1.00 0.00 ? 45   GLN I C     1 
ATOM 9783  O O     . GLN I 9  45  ? 81.059  3.512    -25.634 1.00 0.00 ? 45   GLN I O     1 
ATOM 9784  C CB    . GLN I 9  45  ? 83.859  1.832    -25.944 1.00 0.00 ? 45   GLN I CB    1 
ATOM 9785  C CG    . GLN I 9  45  ? 84.182  2.750    -24.751 1.00 0.00 ? 45   GLN I CG    1 
ATOM 9786  C CD    . GLN I 9  45  ? 85.702  2.926    -24.653 1.00 0.00 ? 45   GLN I CD    1 
ATOM 9787  O OE1   . GLN I 9  45  ? 86.474  2.248    -25.340 1.00 0.00 ? 45   GLN I OE1   1 
ATOM 9788  N NE2   . GLN I 9  45  ? 86.127  3.893    -23.786 1.00 0.00 ? 45   GLN I NE2   1 
ATOM 9789  N N     . LYS I 9  46  ? 82.011  3.592    -27.687 1.00 0.00 ? 46   LYS I N     1 
ATOM 9790  C CA    . LYS I 9  46  ? 81.655  4.967    -27.960 1.00 0.00 ? 46   LYS I CA    1 
ATOM 9791  C C     . LYS I 9  46  ? 80.352  5.029    -28.702 1.00 0.00 ? 46   LYS I C     1 
ATOM 9792  O O     . LYS I 9  46  ? 79.946  6.103    -29.141 1.00 0.00 ? 46   LYS I O     1 
ATOM 9793  C CB    . LYS I 9  46  ? 82.730  5.773    -28.740 1.00 0.00 ? 46   LYS I CB    1 
ATOM 9794  C CG    . LYS I 9  46  ? 83.764  6.457    -27.827 1.00 0.00 ? 46   LYS I CG    1 
ATOM 9795  C CD    . LYS I 9  46  ? 84.898  5.555    -27.324 1.00 0.00 ? 46   LYS I CD    1 
ATOM 9796  C CE    . LYS I 9  46  ? 86.266  6.022    -27.837 1.00 0.00 ? 46   LYS I CE    1 
ATOM 9797  N NZ    . LYS I 9  46  ? 87.355  5.182    -27.295 1.00 0.00 ? 46   LYS I NZ    1 
ATOM 9798  N N     . TYR I 9  47  ? 79.617  3.898    -28.817 1.00 0.00 ? 47   TYR I N     1 
ATOM 9799  C CA    . TYR I 9  47  ? 78.211  3.970    -29.123 1.00 0.00 ? 47   TYR I CA    1 
ATOM 9800  C C     . TYR I 9  47  ? 77.509  4.108    -27.796 1.00 0.00 ? 47   TYR I C     1 
ATOM 9801  O O     . TYR I 9  47  ? 76.633  4.954    -27.649 1.00 0.00 ? 47   TYR I O     1 
ATOM 9802  C CB    . TYR I 9  47  ? 77.679  2.740    -29.903 1.00 0.00 ? 47   TYR I CB    1 
ATOM 9803  C CG    . TYR I 9  47  ? 76.310  3.062    -30.447 1.00 0.00 ? 47   TYR I CG    1 
ATOM 9804  C CD1   . TYR I 9  47  ? 76.169  3.893    -31.574 1.00 0.00 ? 47   TYR I CD1   1 
ATOM 9805  C CD2   . TYR I 9  47  ? 75.158  2.642    -29.762 1.00 0.00 ? 47   TYR I CD2   1 
ATOM 9806  C CE1   . TYR I 9  47  ? 74.900  4.321    -31.989 1.00 0.00 ? 47   TYR I CE1   1 
ATOM 9807  C CE2   . TYR I 9  47  ? 73.893  3.078    -30.169 1.00 0.00 ? 47   TYR I CE2   1 
ATOM 9808  C CZ    . TYR I 9  47  ? 73.761  3.924    -31.275 1.00 0.00 ? 47   TYR I CZ    1 
ATOM 9809  O OH    . TYR I 9  47  ? 72.484  4.396    -31.646 1.00 0.00 ? 47   TYR I OH    1 
ATOM 9810  N N     . LEU I 9  48  ? 77.916  3.283    -26.798 1.00 0.00 ? 48   LEU I N     1 
ATOM 9811  C CA    . LEU I 9  48  ? 77.319  3.206    -25.483 1.00 0.00 ? 48   LEU I CA    1 
ATOM 9812  C C     . LEU I 9  48  ? 77.575  4.428    -24.630 1.00 0.00 ? 48   LEU I C     1 
ATOM 9813  O O     . LEU I 9  48  ? 76.738  4.788    -23.803 1.00 0.00 ? 48   LEU I O     1 
ATOM 9814  C CB    . LEU I 9  48  ? 77.778  1.952    -24.704 1.00 0.00 ? 48   LEU I CB    1 
ATOM 9815  C CG    . LEU I 9  48  ? 77.268  0.606    -25.286 1.00 0.00 ? 48   LEU I CG    1 
ATOM 9816  C CD1   . LEU I 9  48  ? 77.796  -0.579   -24.458 1.00 0.00 ? 48   LEU I CD1   1 
ATOM 9817  C CD2   . LEU I 9  48  ? 75.733  0.517    -25.417 1.00 0.00 ? 48   LEU I CD2   1 
ATOM 9818  N N     . GLU I 9  49  ? 78.736  5.102    -24.801 1.00 0.00 ? 49   GLU I N     1 
ATOM 9819  C CA    . GLU I 9  49  ? 79.062  6.322    -24.094 1.00 0.00 ? 49   GLU I CA    1 
ATOM 9820  C C     . GLU I 9  49  ? 78.258  7.483    -24.603 1.00 0.00 ? 49   GLU I C     1 
ATOM 9821  O O     . GLU I 9  49  ? 77.842  8.331    -23.817 1.00 0.00 ? 49   GLU I O     1 
ATOM 9822  C CB    . GLU I 9  49  ? 80.558  6.685    -24.175 1.00 0.00 ? 49   GLU I CB    1 
ATOM 9823  C CG    . GLU I 9  49  ? 81.405  5.793    -23.250 1.00 0.00 ? 49   GLU I CG    1 
ATOM 9824  C CD    . GLU I 9  49  ? 82.892  6.136    -23.340 1.00 0.00 ? 49   GLU I CD    1 
ATOM 9825  O OE1   . GLU I 9  49  ? 83.277  6.983    -24.189 1.00 0.00 ? 49   GLU I OE1   1 
ATOM 9826  O OE2   . GLU I 9  49  ? 83.669  5.538    -22.546 1.00 0.00 ? 49   GLU I OE2   1 
ATOM 9827  N N     . GLN I 9  50  ? 78.002  7.542    -25.934 1.00 0.00 ? 50   GLN I N     1 
ATOM 9828  C CA    . GLN I 9  50  ? 77.195  8.592    -26.512 1.00 0.00 ? 50   GLN I CA    1 
ATOM 9829  C C     . GLN I 9  50  ? 75.735  8.373    -26.218 1.00 0.00 ? 50   GLN I C     1 
ATOM 9830  O O     . GLN I 9  50  ? 74.972  9.332    -26.201 1.00 0.00 ? 50   GLN I O     1 
ATOM 9831  C CB    . GLN I 9  50  ? 77.334  8.689    -28.046 1.00 0.00 ? 50   GLN I CB    1 
ATOM 9832  C CG    . GLN I 9  50  ? 78.741  9.126    -28.478 1.00 0.00 ? 50   GLN I CG    1 
ATOM 9833  C CD    . GLN I 9  50  ? 78.754  9.352    -29.995 1.00 0.00 ? 50   GLN I CD    1 
ATOM 9834  O OE1   . GLN I 9  50  ? 78.147  8.595    -30.761 1.00 0.00 ? 50   GLN I OE1   1 
ATOM 9835  N NE2   . GLN I 9  50  ? 79.466  10.439   -30.423 1.00 0.00 ? 50   GLN I NE2   1 
ATOM 9836  N N     . VAL I 9  51  ? 75.335  7.106    -25.949 1.00 0.00 ? 51   VAL I N     1 
ATOM 9837  C CA    . VAL I 9  51  ? 73.998  6.669    -25.610 1.00 0.00 ? 51   VAL I CA    1 
ATOM 9838  C C     . VAL I 9  51  ? 73.542  7.269    -24.312 1.00 0.00 ? 51   VAL I C     1 
ATOM 9839  O O     . VAL I 9  51  ? 72.374  7.634    -24.175 1.00 0.00 ? 51   VAL I O     1 
ATOM 9840  C CB    . VAL I 9  51  ? 73.931  5.143    -25.590 1.00 0.00 ? 51   VAL I CB    1 
ATOM 9841  C CG1   . VAL I 9  51  ? 73.053  4.547    -24.469 1.00 0.00 ? 51   VAL I CG1   1 
ATOM 9842  C CG2   . VAL I 9  51  ? 73.483  4.687    -26.986 1.00 0.00 ? 51   VAL I CG2   1 
ATOM 9843  N N     . LEU I 9  52  ? 74.475  7.391    -23.337 1.00 0.00 ? 52   LEU I N     1 
ATOM 9844  C CA    . LEU I 9  52  ? 74.245  7.952    -22.028 1.00 0.00 ? 52   LEU I CA    1 
ATOM 9845  C C     . LEU I 9  52  ? 73.837  9.396    -22.172 1.00 0.00 ? 52   LEU I C     1 
ATOM 9846  O O     . LEU I 9  52  ? 72.886  9.851    -21.536 1.00 0.00 ? 52   LEU I O     1 
ATOM 9847  C CB    . LEU I 9  52  ? 75.545  7.825    -21.187 1.00 0.00 ? 52   LEU I CB    1 
ATOM 9848  C CG    . LEU I 9  52  ? 75.448  8.009    -19.649 1.00 0.00 ? 52   LEU I CG    1 
ATOM 9849  C CD1   . LEU I 9  52  ? 75.266  9.470    -19.191 1.00 0.00 ? 52   LEU I CD1   1 
ATOM 9850  C CD2   . LEU I 9  52  ? 74.419  7.063    -18.998 1.00 0.00 ? 52   LEU I CD2   1 
ATOM 9851  N N     . ASP I 9  53  ? 74.543  10.131   -23.064 1.00 0.00 ? 53   ASP I N     1 
ATOM 9852  C CA    . ASP I 9  53  ? 74.281  11.518   -23.349 1.00 0.00 ? 53   ASP I CA    1 
ATOM 9853  C C     . ASP I 9  53  ? 72.996  11.734   -24.110 1.00 0.00 ? 53   ASP I C     1 
ATOM 9854  O O     . ASP I 9  53  ? 72.235  12.636   -23.760 1.00 0.00 ? 53   ASP I O     1 
ATOM 9855  C CB    . ASP I 9  53  ? 75.407  12.162   -24.204 1.00 0.00 ? 53   ASP I CB    1 
ATOM 9856  C CG    . ASP I 9  53  ? 76.737  12.117   -23.452 1.00 0.00 ? 53   ASP I CG    1 
ATOM 9857  O OD1   . ASP I 9  53  ? 76.829  12.756   -22.371 1.00 0.00 ? 53   ASP I OD1   1 
ATOM 9858  O OD2   . ASP I 9  53  ? 77.680  11.449   -23.954 1.00 0.00 ? 53   ASP I OD2   1 
ATOM 9859  N N     . HIS I 9  54  ? 72.734  10.941   -25.183 1.00 0.00 ? 54   HIS I N     1 
ATOM 9860  C CA    . HIS I 9  54  ? 71.826  11.415   -26.199 1.00 0.00 ? 54   HIS I CA    1 
ATOM 9861  C C     . HIS I 9  54  ? 71.414  10.342   -27.169 1.00 0.00 ? 54   HIS I C     1 
ATOM 9862  O O     . HIS I 9  54  ? 70.263  10.349   -27.599 1.00 0.00 ? 54   HIS I O     1 
ATOM 9863  C CB    . HIS I 9  54  ? 72.436  12.587   -27.023 1.00 0.00 ? 54   HIS I CB    1 
ATOM 9864  C CG    . HIS I 9  54  ? 71.457  13.705   -27.253 1.00 0.00 ? 54   HIS I CG    1 
ATOM 9865  N ND1   . HIS I 9  54  ? 70.916  14.469   -26.240 1.00 0.00 ? 54   HIS I ND1   1 
ATOM 9866  C CD2   . HIS I 9  54  ? 70.918  14.185   -28.406 1.00 0.00 ? 54   HIS I CD2   1 
ATOM 9867  C CE1   . HIS I 9  54  ? 70.081  15.362   -26.827 1.00 0.00 ? 54   HIS I CE1   1 
ATOM 9868  N NE2   . HIS I 9  54  ? 70.049  15.229   -28.140 1.00 0.00 ? 54   HIS I NE2   1 
ATOM 9869  N N     . GLN I 9  55  ? 72.354  9.445    -27.580 1.00 0.00 ? 55   GLN I N     1 
ATOM 9870  C CA    . GLN I 9  55  ? 72.282  8.615    -28.775 1.00 0.00 ? 55   GLN I CA    1 
ATOM 9871  C C     . GLN I 9  55  ? 71.405  7.376    -28.633 1.00 0.00 ? 55   GLN I C     1 
ATOM 9872  O O     . GLN I 9  55  ? 71.661  6.343    -29.247 1.00 0.00 ? 55   GLN I O     1 
ATOM 9873  C CB    . GLN I 9  55  ? 73.708  8.226    -29.263 1.00 0.00 ? 55   GLN I CB    1 
ATOM 9874  C CG    . GLN I 9  55  ? 73.859  7.962    -30.778 1.00 0.00 ? 55   GLN I CG    1 
ATOM 9875  C CD    . GLN I 9  55  ? 73.703  9.258    -31.587 1.00 0.00 ? 55   GLN I CD    1 
ATOM 9876  O OE1   . GLN I 9  55  ? 72.639  9.517    -32.163 1.00 0.00 ? 55   GLN I OE1   1 
ATOM 9877  N NE2   . GLN I 9  55  ? 74.803  10.072   -31.638 1.00 0.00 ? 55   GLN I NE2   1 
ATOM 9878  N N     . ARG I 9  56  ? 70.328  7.495    -27.827 1.00 0.00 ? 56   ARG I N     1 
ATOM 9879  C CA    . ARG I 9  56  ? 69.217  6.598    -27.607 1.00 0.00 ? 56   ARG I CA    1 
ATOM 9880  C C     . ARG I 9  56  ? 69.351  6.002    -26.221 1.00 0.00 ? 56   ARG I C     1 
ATOM 9881  O O     . ARG I 9  56  ? 69.052  6.765    -25.304 1.00 0.00 ? 56   ARG I O     1 
ATOM 9882  C CB    . ARG I 9  56  ? 68.543  5.878    -28.810 1.00 0.00 ? 56   ARG I CB    1 
ATOM 9883  C CG    . ARG I 9  56  ? 68.343  6.799    -30.049 1.00 0.00 ? 56   ARG I CG    1 
ATOM 9884  C CD    . ARG I 9  56  ? 67.575  8.113    -29.789 1.00 0.00 ? 56   ARG I CD    1 
ATOM 9885  N NE    . ARG I 9  56  ? 67.553  8.954    -31.037 1.00 0.00 ? 56   ARG I NE    1 
ATOM 9886  C CZ    . ARG I 9  56  ? 68.516  9.877    -31.348 1.00 0.00 ? 56   ARG I CZ    1 
ATOM 9887  N NH1   . ARG I 9  56  ? 69.607  10.059   -30.553 1.00 0.00 ? 56   ARG I NH1   1 
ATOM 9888  N NH2   . ARG I 9  56  ? 68.387  10.638   -32.474 1.00 0.00 ? 56   ARG I NH2   1 
ATOM 9889  N N     . ALA I 9  57  ? 69.810  4.773    -25.839 1.00 0.00 ? 57   ALA I N     1 
ATOM 9890  C CA    . ALA I 9  57  ? 70.033  3.417    -26.285 1.00 0.00 ? 57   ALA I CA    1 
ATOM 9891  C C     . ALA I 9  57  ? 70.384  2.996    -27.683 1.00 0.00 ? 57   ALA I C     1 
ATOM 9892  O O     . ALA I 9  57  ? 70.931  3.737    -28.493 1.00 0.00 ? 57   ALA I O     1 
ATOM 9893  C CB    . ALA I 9  57  ? 69.062  2.426    -25.613 1.00 0.00 ? 57   ALA I CB    1 
ATOM 9894  N N     . ILE I 9  58  ? 70.147  1.690    -27.933 1.00 0.00 ? 58   ILE I N     1 
ATOM 9895  C CA    . ILE I 9  58  ? 70.714  0.930    -29.007 1.00 0.00 ? 58   ILE I CA    1 
ATOM 9896  C C     . ILE I 9  58  ? 69.509  0.227    -29.595 1.00 0.00 ? 58   ILE I C     1 
ATOM 9897  O O     . ILE I 9  58  ? 68.607  -0.096   -28.822 1.00 0.00 ? 58   ILE I O     1 
ATOM 9898  C CB    . ILE I 9  58  ? 71.805  -0.008   -28.467 1.00 0.00 ? 58   ILE I CB    1 
ATOM 9899  C CG1   . ILE I 9  58  ? 72.794  -0.473   -29.560 1.00 0.00 ? 58   ILE I CG1   1 
ATOM 9900  C CG2   . ILE I 9  58  ? 71.213  -1.173   -27.641 1.00 0.00 ? 58   ILE I CG2   1 
ATOM 9901  C CD1   . ILE I 9  58  ? 74.044  -1.145   -28.986 1.00 0.00 ? 58   ILE I CD1   1 
ATOM 9902  N N     . PRO I 9  59  ? 69.387  0.015    -30.910 1.00 0.00 ? 59   PRO I N     1 
ATOM 9903  C CA    . PRO I 9  59  ? 68.228  -0.591   -31.561 1.00 0.00 ? 59   PRO I CA    1 
ATOM 9904  C C     . PRO I 9  59  ? 67.629  -1.831   -30.922 1.00 0.00 ? 59   PRO I C     1 
ATOM 9905  O O     . PRO I 9  59  ? 68.375  -2.668   -30.413 1.00 0.00 ? 59   PRO I O     1 
ATOM 9906  C CB    . PRO I 9  59  ? 68.740  -0.846   -32.979 1.00 0.00 ? 59   PRO I CB    1 
ATOM 9907  C CG    . PRO I 9  59  ? 69.602  0.385    -33.255 1.00 0.00 ? 59   PRO I CG    1 
ATOM 9908  C CD    . PRO I 9  59  ? 70.287  0.607    -31.906 1.00 0.00 ? 59   PRO I CD    1 
ATOM 9909  N N     . PHE I 9  60  ? 66.275  -1.934   -30.940 1.00 0.00 ? 60   PHE I N     1 
ATOM 9910  C CA    . PHE I 9  60  ? 65.520  -2.990   -30.303 1.00 0.00 ? 60   PHE I CA    1 
ATOM 9911  C C     . PHE I 9  60  ? 64.769  -3.688   -31.397 1.00 0.00 ? 60   PHE I C     1 
ATOM 9912  O O     . PHE I 9  60  ? 63.930  -3.087   -32.066 1.00 0.00 ? 60   PHE I O     1 
ATOM 9913  C CB    . PHE I 9  60  ? 64.469  -2.460   -29.290 1.00 0.00 ? 60   PHE I CB    1 
ATOM 9914  C CG    . PHE I 9  60  ? 65.147  -1.982   -28.034 1.00 0.00 ? 60   PHE I CG    1 
ATOM 9915  C CD1   . PHE I 9  60  ? 65.561  -0.646   -27.880 1.00 0.00 ? 60   PHE I CD1   1 
ATOM 9916  C CD2   . PHE I 9  60  ? 65.376  -2.886   -26.984 1.00 0.00 ? 60   PHE I CD2   1 
ATOM 9917  C CE1   . PHE I 9  60  ? 66.225  -0.237   -26.717 1.00 0.00 ? 60   PHE I CE1   1 
ATOM 9918  C CE2   . PHE I 9  60  ? 66.050  -2.485   -25.825 1.00 0.00 ? 60   PHE I CE2   1 
ATOM 9919  C CZ    . PHE I 9  60  ? 66.484  -1.161   -25.697 1.00 0.00 ? 60   PHE I CZ    1 
ATOM 9920  N N     . ARG I 9  61  ? 65.088  -4.987   -31.612 1.00 0.00 ? 61   ARG I N     1 
ATOM 9921  C CA    . ARG I 9  61  ? 64.593  -5.759   -32.727 1.00 0.00 ? 61   ARG I CA    1 
ATOM 9922  C C     . ARG I 9  61  ? 63.249  -6.388   -32.457 1.00 0.00 ? 61   ARG I C     1 
ATOM 9923  O O     . ARG I 9  61  ? 62.372  -6.326   -33.317 1.00 0.00 ? 61   ARG I O     1 
ATOM 9924  C CB    . ARG I 9  61  ? 65.524  -6.944   -33.095 1.00 0.00 ? 61   ARG I CB    1 
ATOM 9925  C CG    . ARG I 9  61  ? 66.864  -6.575   -33.758 1.00 0.00 ? 61   ARG I CG    1 
ATOM 9926  C CD    . ARG I 9  61  ? 67.978  -6.133   -32.799 1.00 0.00 ? 61   ARG I CD    1 
ATOM 9927  N NE    . ARG I 9  61  ? 69.280  -6.324   -33.523 1.00 0.00 ? 61   ARG I NE    1 
ATOM 9928  C CZ    . ARG I 9  61  ? 70.262  -5.381   -33.630 1.00 0.00 ? 61   ARG I CZ    1 
ATOM 9929  N NH1   . ARG I 9  61  ? 70.114  -4.142   -33.088 1.00 0.00 ? 61   ARG I NH1   1 
ATOM 9930  N NH2   . ARG I 9  61  ? 71.413  -5.699   -34.294 1.00 0.00 ? 61   ARG I NH2   1 
ATOM 9931  N N     . ARG I 9  62  ? 63.078  -7.045   -31.282 1.00 0.00 ? 62   ARG I N     1 
ATOM 9932  C CA    . ARG I 9  62  ? 62.046  -8.044   -31.094 1.00 0.00 ? 62   ARG I CA    1 
ATOM 9933  C C     . ARG I 9  62  ? 61.253  -7.708   -29.864 1.00 0.00 ? 62   ARG I C     1 
ATOM 9934  O O     . ARG I 9  62  ? 60.082  -8.070   -29.755 1.00 0.00 ? 62   ARG I O     1 
ATOM 9935  C CB    . ARG I 9  62  ? 62.680  -9.448   -30.894 1.00 0.00 ? 62   ARG I CB    1 
ATOM 9936  C CG    . ARG I 9  62  ? 61.696  -10.635  -30.853 1.00 0.00 ? 62   ARG I CG    1 
ATOM 9937  C CD    . ARG I 9  62  ? 60.939  -10.861  -32.170 1.00 0.00 ? 62   ARG I CD    1 
ATOM 9938  N NE    . ARG I 9  62  ? 59.987  -12.005  -31.984 1.00 0.00 ? 62   ARG I NE    1 
ATOM 9939  C CZ    . ARG I 9  62  ? 59.356  -12.618  -33.032 1.00 0.00 ? 62   ARG I CZ    1 
ATOM 9940  N NH1   . ARG I 9  62  ? 59.605  -12.245  -34.320 1.00 0.00 ? 62   ARG I NH1   1 
ATOM 9941  N NH2   . ARG I 9  62  ? 58.458  -13.617  -32.783 1.00 0.00 ? 62   ARG I NH2   1 
ATOM 9942  N N     . PHE I 9  63  ? 61.873  -6.958   -28.924 1.00 0.00 ? 63   PHE I N     1 
ATOM 9943  C CA    . PHE I 9  63  ? 61.244  -6.468   -27.723 1.00 0.00 ? 63   PHE I CA    1 
ATOM 9944  C C     . PHE I 9  63  ? 60.963  -5.035   -28.068 1.00 0.00 ? 63   PHE I C     1 
ATOM 9945  O O     . PHE I 9  63  ? 61.688  -4.126   -27.669 1.00 0.00 ? 63   PHE I O     1 
ATOM 9946  C CB    . PHE I 9  63  ? 62.178  -6.594   -26.483 1.00 0.00 ? 63   PHE I CB    1 
ATOM 9947  C CG    . PHE I 9  63  ? 61.519  -6.226   -25.171 1.00 0.00 ? 63   PHE I CG    1 
ATOM 9948  C CD1   . PHE I 9  63  ? 60.320  -6.840   -24.761 1.00 0.00 ? 63   PHE I CD1   1 
ATOM 9949  C CD2   . PHE I 9  63  ? 62.137  -5.304   -24.306 1.00 0.00 ? 63   PHE I CD2   1 
ATOM 9950  C CE1   . PHE I 9  63  ? 59.750  -6.534   -23.518 1.00 0.00 ? 63   PHE I CE1   1 
ATOM 9951  C CE2   . PHE I 9  63  ? 61.568  -4.997   -23.064 1.00 0.00 ? 63   PHE I CE2   1 
ATOM 9952  C CZ    . PHE I 9  63  ? 60.373  -5.611   -22.670 1.00 0.00 ? 63   PHE I CZ    1 
ATOM 9953  N N     . ASN I 9  64  ? 59.915  -4.839   -28.901 1.00 0.00 ? 64   ASN I N     1 
ATOM 9954  C CA    . ASN I 9  64  ? 59.622  -3.594   -29.559 1.00 0.00 ? 64   ASN I CA    1 
ATOM 9955  C C     . ASN I 9  64  ? 58.216  -3.168   -29.212 1.00 0.00 ? 64   ASN I C     1 
ATOM 9956  O O     . ASN I 9  64  ? 57.639  -2.317   -29.884 1.00 0.00 ? 64   ASN I O     1 
ATOM 9957  C CB    . ASN I 9  64  ? 59.839  -3.702   -31.101 1.00 0.00 ? 64   ASN I CB    1 
ATOM 9958  C CG    . ASN I 9  64  ? 58.931  -4.729   -31.812 1.00 0.00 ? 64   ASN I CG    1 
ATOM 9959  O OD1   . ASN I 9  64  ? 57.727  -4.502   -31.976 1.00 0.00 ? 64   ASN I OD1   1 
ATOM 9960  N ND2   . ASN I 9  64  ? 59.537  -5.862   -32.275 1.00 0.00 ? 64   ASN I ND2   1 
ATOM 9961  N N     . SER I 9  65  ? 57.629  -3.762   -28.144 1.00 0.00 ? 65   SER I N     1 
ATOM 9962  C CA    . SER I 9  65  ? 56.267  -3.537   -27.706 1.00 0.00 ? 65   SER I CA    1 
ATOM 9963  C C     . SER I 9  65  ? 55.939  -2.095   -27.378 1.00 0.00 ? 65   SER I C     1 
ATOM 9964  O O     . SER I 9  65  ? 56.776  -1.338   -26.887 1.00 0.00 ? 65   SER I O     1 
ATOM 9965  C CB    . SER I 9  65  ? 55.875  -4.435   -26.504 1.00 0.00 ? 65   SER I CB    1 
ATOM 9966  O OG    . SER I 9  65  ? 56.737  -4.244   -25.386 1.00 0.00 ? 65   SER I OG    1 
ATOM 9967  N N     . SER I 9  66  ? 54.673  -1.711   -27.676 1.00 0.00 ? 66   SER I N     1 
ATOM 9968  C CA    . SER I 9  66  ? 54.079  -0.415   -27.430 1.00 0.00 ? 66   SER I CA    1 
ATOM 9969  C C     . SER I 9  66  ? 54.039  -0.128   -25.938 1.00 0.00 ? 66   SER I C     1 
ATOM 9970  O O     . SER I 9  66  ? 53.647  -1.026   -25.194 1.00 0.00 ? 66   SER I O     1 
ATOM 9971  C CB    . SER I 9  66  ? 52.633  -0.414   -28.003 1.00 0.00 ? 66   SER I CB    1 
ATOM 9972  O OG    . SER I 9  66  ? 52.288  0.830    -28.585 1.00 0.00 ? 66   SER I OG    1 
ATOM 9973  N N     . ILE I 9  67  ? 54.417  1.066    -25.390 1.00 0.00 ? 67   ILE I N     1 
ATOM 9974  C CA    . ILE I 9  67  ? 54.949  2.312    -25.914 1.00 0.00 ? 67   ILE I CA    1 
ATOM 9975  C C     . ILE I 9  67  ? 53.902  3.189    -26.562 1.00 0.00 ? 67   ILE I C     1 
ATOM 9976  O O     . ILE I 9  67  ? 52.740  2.807    -26.680 1.00 0.00 ? 67   ILE I O     1 
ATOM 9977  C CB    . ILE I 9  67  ? 56.360  2.273    -26.543 1.00 0.00 ? 67   ILE I CB    1 
ATOM 9978  C CG1   . ILE I 9  67  ? 57.288  3.289    -25.819 1.00 0.00 ? 67   ILE I CG1   1 
ATOM 9979  C CG2   . ILE I 9  67  ? 56.395  2.455    -28.082 1.00 0.00 ? 67   ILE I CG2   1 
ATOM 9980  C CD1   . ILE I 9  67  ? 58.710  3.363    -26.381 1.00 0.00 ? 67   ILE I CD1   1 
ATOM 9981  N N     . GLY I 9  68  ? 54.284  4.434    -26.946 1.00 0.00 ? 68   GLY I N     1 
ATOM 9982  C CA    . GLY I 9  68  ? 53.480  5.328    -27.742 1.00 0.00 ? 68   GLY I CA    1 
ATOM 9983  C C     . GLY I 9  68  ? 53.792  5.042    -29.184 1.00 0.00 ? 68   GLY I C     1 
ATOM 9984  O O     . GLY I 9  68  ? 53.925  3.885    -29.582 1.00 0.00 ? 68   GLY I O     1 
ATOM 9985  N N     . ARG I 9  69  ? 53.919  6.108    -30.007 1.00 0.00 ? 69   ARG I N     1 
ATOM 9986  C CA    . ARG I 9  69  ? 54.319  5.990    -31.388 1.00 0.00 ? 69   ARG I CA    1 
ATOM 9987  C C     . ARG I 9  69  ? 55.562  6.829    -31.503 1.00 0.00 ? 69   ARG I C     1 
ATOM 9988  O O     . ARG I 9  69  ? 55.724  7.824    -30.797 1.00 0.00 ? 69   ARG I O     1 
ATOM 9989  C CB    . ARG I 9  69  ? 53.250  6.421    -32.425 1.00 0.00 ? 69   ARG I CB    1 
ATOM 9990  C CG    . ARG I 9  69  ? 52.036  5.469    -32.531 1.00 0.00 ? 69   ARG I CG    1 
ATOM 9991  C CD    . ARG I 9  69  ? 50.925  5.724    -31.496 1.00 0.00 ? 69   ARG I CD    1 
ATOM 9992  N NE    . ARG I 9  69  ? 49.839  4.692    -31.652 1.00 0.00 ? 69   ARG I NE    1 
ATOM 9993  C CZ    . ARG I 9  69  ? 49.851  3.490    -30.995 1.00 0.00 ? 69   ARG I CZ    1 
ATOM 9994  N NH1   . ARG I 9  69  ? 50.889  3.144    -30.180 1.00 0.00 ? 69   ARG I NH1   1 
ATOM 9995  N NH2   . ARG I 9  69  ? 48.806  2.625    -31.150 1.00 0.00 ? 69   ARG I NH2   1 
ATOM 9996  N N     . THR I 9  70  ? 56.509  6.368    -32.353 1.00 0.00 ? 70   THR I N     1 
ATOM 9997  C CA    . THR I 9  70  ? 57.919  6.666    -32.221 1.00 0.00 ? 70   THR I CA    1 
ATOM 9998  C C     . THR I 9  70  ? 58.490  6.741    -33.621 1.00 0.00 ? 70   THR I C     1 
ATOM 9999  O O     . THR I 9  70  ? 57.976  6.055    -34.504 1.00 0.00 ? 70   THR I O     1 
ATOM 10000 C CB    . THR I 9  70  ? 58.646  5.544    -31.467 1.00 0.00 ? 70   THR I CB    1 
ATOM 10001 O OG1   . THR I 9  70  ? 58.177  4.257    -31.865 1.00 0.00 ? 70   THR I OG1   1 
ATOM 10002 C CG2   . THR I 9  70  ? 58.420  5.710    -29.950 1.00 0.00 ? 70   THR I CG2   1 
ATOM 10003 N N     . ALA I 9  71  ? 59.552  7.547    -33.932 1.00 0.00 ? 71   ALA I N     1 
ATOM 10004 C CA    . ALA I 9  71  ? 60.292  8.532    -33.163 1.00 0.00 ? 71   ALA I CA    1 
ATOM 10005 C C     . ALA I 9  71  ? 61.465  8.887    -34.054 1.00 0.00 ? 71   ALA I C     1 
ATOM 10006 O O     . ALA I 9  71  ? 61.385  8.761    -35.276 1.00 0.00 ? 71   ALA I O     1 
ATOM 10007 C CB    . ALA I 9  71  ? 60.849  8.118    -31.777 1.00 0.00 ? 71   ALA I CB    1 
ATOM 10008 N N     . GLN I 9  72  ? 62.583  9.358    -33.448 1.00 0.00 ? 72   GLN I N     1 
ATOM 10009 C CA    . GLN I 9  72  ? 63.766  9.819    -34.131 1.00 0.00 ? 72   GLN I CA    1 
ATOM 10010 C C     . GLN I 9  72  ? 64.896  8.904    -33.739 1.00 0.00 ? 72   GLN I C     1 
ATOM 10011 O O     . GLN I 9  72  ? 64.886  8.313    -32.660 1.00 0.00 ? 72   GLN I O     1 
ATOM 10012 C CB    . GLN I 9  72  ? 64.120  11.307   -33.838 1.00 0.00 ? 72   GLN I CB    1 
ATOM 10013 C CG    . GLN I 9  72  ? 64.450  11.714   -32.379 1.00 0.00 ? 72   GLN I CG    1 
ATOM 10014 C CD    . GLN I 9  72  ? 63.229  11.677   -31.445 1.00 0.00 ? 72   GLN I CD    1 
ATOM 10015 O OE1   . GLN I 9  72  ? 63.181  10.863   -30.516 1.00 0.00 ? 72   GLN I OE1   1 
ATOM 10016 N NE2   . GLN I 9  72  ? 62.241  12.590   -31.693 1.00 0.00 ? 72   GLN I NE2   1 
ATOM 10017 N N     . GLY I 9  73  ? 65.883  8.735    -34.650 1.00 0.00 ? 73   GLY I N     1 
ATOM 10018 C CA    . GLY I 9  73  ? 67.036  7.904    -34.420 1.00 0.00 ? 73   GLY I CA    1 
ATOM 10019 C C     . GLY I 9  73  ? 68.125  8.422    -35.313 1.00 0.00 ? 73   GLY I C     1 
ATOM 10020 O O     . GLY I 9  73  ? 68.234  9.637    -35.463 1.00 0.00 ? 73   GLY I O     1 
ATOM 10021 N N     . LYS I 9  74  ? 68.998  7.576    -35.937 1.00 0.00 ? 74   LYS I N     1 
ATOM 10022 C CA    . LYS I 9  74  ? 68.986  6.135    -36.119 1.00 0.00 ? 74   LYS I CA    1 
ATOM 10023 C C     . LYS I 9  74  ? 67.658  5.583    -36.577 1.00 0.00 ? 74   LYS I C     1 
ATOM 10024 O O     . LYS I 9  74  ? 67.043  6.141    -37.485 1.00 0.00 ? 74   LYS I O     1 
ATOM 10025 C CB    . LYS I 9  74  ? 69.644  5.322    -34.968 1.00 0.00 ? 74   LYS I CB    1 
ATOM 10026 C CG    . LYS I 9  74  ? 71.145  5.626    -34.770 1.00 0.00 ? 74   LYS I CG    1 
ATOM 10027 C CD    . LYS I 9  74  ? 72.054  5.245    -35.959 1.00 0.00 ? 74   LYS I CD    1 
ATOM 10028 C CE    . LYS I 9  74  ? 72.167  3.733    -36.214 1.00 0.00 ? 74   LYS I CE    1 
ATOM 10029 N NZ    . LYS I 9  74  ? 72.906  3.461    -37.470 1.00 0.00 ? 74   LYS I NZ    1 
ATOM 10030 N N     . GLU I 9  75  ? 67.219  4.449    -35.973 1.00 0.00 ? 75   GLU I N     1 
ATOM 10031 C CA    . GLU I 9  75  ? 66.046  3.691    -36.342 1.00 0.00 ? 75   GLU I CA    1 
ATOM 10032 C C     . GLU I 9  75  ? 66.317  3.014    -37.650 1.00 0.00 ? 75   GLU I C     1 
ATOM 10033 O O     . GLU I 9  75  ? 65.601  3.192    -38.635 1.00 0.00 ? 75   GLU I O     1 
ATOM 10034 C CB    . GLU I 9  75  ? 64.675  4.424    -36.312 1.00 0.00 ? 75   GLU I CB    1 
ATOM 10035 C CG    . GLU I 9  75  ? 64.352  5.187    -35.010 1.00 0.00 ? 75   GLU I CG    1 
ATOM 10036 C CD    . GLU I 9  75  ? 64.789  4.416    -33.767 1.00 0.00 ? 75   GLU I CD    1 
ATOM 10037 O OE1   . GLU I 9  75  ? 65.805  4.829    -33.146 1.00 0.00 ? 75   GLU I OE1   1 
ATOM 10038 O OE2   . GLU I 9  75  ? 64.126  3.403    -33.426 1.00 0.00 ? 75   GLU I OE2   1 
ATOM 10039 N N     . PHE I 9  76  ? 67.435  2.252    -37.659 1.00 0.00 ? 76   PHE I N     1 
ATOM 10040 C CA    . PHE I 9  76  ? 68.068  1.707    -38.827 1.00 0.00 ? 76   PHE I CA    1 
ATOM 10041 C C     . PHE I 9  76  ? 67.601  0.276    -38.923 1.00 0.00 ? 76   PHE I C     1 
ATOM 10042 O O     . PHE I 9  76  ? 68.313  -0.662   -38.566 1.00 0.00 ? 76   PHE I O     1 
ATOM 10043 C CB    . PHE I 9  76  ? 69.618  1.810    -38.673 1.00 0.00 ? 76   PHE I CB    1 
ATOM 10044 C CG    . PHE I 9  76  ? 70.292  2.375    -39.895 1.00 0.00 ? 76   PHE I CG    1 
ATOM 10045 C CD1   . PHE I 9  76  ? 70.065  3.714    -40.264 1.00 0.00 ? 76   PHE I CD1   1 
ATOM 10046 C CD2   . PHE I 9  76  ? 71.216  1.614    -40.633 1.00 0.00 ? 76   PHE I CD2   1 
ATOM 10047 C CE1   . PHE I 9  76  ? 70.746  4.280    -41.349 1.00 0.00 ? 76   PHE I CE1   1 
ATOM 10048 C CE2   . PHE I 9  76  ? 71.900  2.179    -41.718 1.00 0.00 ? 76   PHE I CE2   1 
ATOM 10049 C CZ    . PHE I 9  76  ? 71.666  3.513    -42.076 1.00 0.00 ? 76   PHE I CZ    1 
ATOM 10050 N N     . GLY I 9  77  ? 66.344  0.092    -39.392 1.00 0.00 ? 77   GLY I N     1 
ATOM 10051 C CA    . GLY I 9  77  ? 65.711  -1.201   -39.509 1.00 0.00 ? 77   GLY I CA    1 
ATOM 10052 C C     . GLY I 9  77  ? 64.901  -1.534   -38.284 1.00 0.00 ? 77   GLY I C     1 
ATOM 10053 O O     . GLY I 9  77  ? 64.304  -2.607   -38.216 1.00 0.00 ? 77   GLY I O     1 
ATOM 10054 N N     . VAL I 9  78  ? 64.846  -0.604   -37.301 1.00 0.00 ? 78   VAL I N     1 
ATOM 10055 C CA    . VAL I 9  78  ? 63.984  -0.681   -36.143 1.00 0.00 ? 78   VAL I CA    1 
ATOM 10056 C C     . VAL I 9  78  ? 63.200  0.601    -36.192 1.00 0.00 ? 78   VAL I C     1 
ATOM 10057 O O     . VAL I 9  78  ? 63.374  1.383    -37.125 1.00 0.00 ? 78   VAL I O     1 
ATOM 10058 C CB    . VAL I 9  78  ? 64.713  -0.848   -34.813 1.00 0.00 ? 78   VAL I CB    1 
ATOM 10059 C CG1   . VAL I 9  78  ? 65.516  -2.167   -34.849 1.00 0.00 ? 78   VAL I CG1   1 
ATOM 10060 C CG2   . VAL I 9  78  ? 65.617  0.363    -34.499 1.00 0.00 ? 78   VAL I CG2   1 
ATOM 10061 N N     . THR I 9  79  ? 62.289  0.845    -35.215 1.00 0.00 ? 79   THR I N     1 
ATOM 10062 C CA    . THR I 9  79  ? 61.517  2.071    -35.205 1.00 0.00 ? 79   THR I CA    1 
ATOM 10063 C C     . THR I 9  79  ? 61.098  2.366    -33.782 1.00 0.00 ? 79   THR I C     1 
ATOM 10064 O O     . THR I 9  79  ? 60.381  3.334    -33.540 1.00 0.00 ? 79   THR I O     1 
ATOM 10065 C CB    . THR I 9  79  ? 60.249  2.050    -36.081 1.00 0.00 ? 79   THR I CB    1 
ATOM 10066 O OG1   . THR I 9  79  ? 60.366  1.164    -37.187 1.00 0.00 ? 79   THR I OG1   1 
ATOM 10067 C CG2   . THR I 9  79  ? 59.970  3.468    -36.627 1.00 0.00 ? 79   THR I CG2   1 
ATOM 10068 N N     . LYS I 9  80  ? 61.545  1.547    -32.795 1.00 0.00 ? 80   LYS I N     1 
ATOM 10069 C CA    . LYS I 9  80  ? 61.046  1.616    -31.439 1.00 0.00 ? 80   LYS I CA    1 
ATOM 10070 C C     . LYS I 9  80  ? 62.212  1.740    -30.500 1.00 0.00 ? 80   LYS I C     1 
ATOM 10071 O O     . LYS I 9  80  ? 62.513  0.826    -29.732 1.00 0.00 ? 80   LYS I O     1 
ATOM 10072 C CB    . LYS I 9  80  ? 60.182  0.401    -31.014 1.00 0.00 ? 80   LYS I CB    1 
ATOM 10073 C CG    . LYS I 9  80  ? 58.810  0.322    -31.711 1.00 0.00 ? 80   LYS I CG    1 
ATOM 10074 C CD    . LYS I 9  80  ? 58.814  -0.335   -33.102 1.00 0.00 ? 80   LYS I CD    1 
ATOM 10075 C CE    . LYS I 9  80  ? 57.414  -0.527   -33.704 1.00 0.00 ? 80   LYS I CE    1 
ATOM 10076 N NZ    . LYS I 9  80  ? 56.615  -1.493   -32.915 1.00 0.00 ? 80   LYS I NZ    1 
ATOM 10077 N N     . ALA I 9  81  ? 62.885  2.917    -30.528 1.00 0.00 ? 81   ALA I N     1 
ATOM 10078 C CA    . ALA I 9  81  ? 63.892  3.299    -29.564 1.00 0.00 ? 81   ALA I CA    1 
ATOM 10079 C C     . ALA I 9  81  ? 63.322  3.453    -28.179 1.00 0.00 ? 81   ALA I C     1 
ATOM 10080 O O     . ALA I 9  81  ? 62.174  3.860    -28.002 1.00 0.00 ? 81   ALA I O     1 
ATOM 10081 C CB    . ALA I 9  81  ? 64.584  4.634    -29.901 1.00 0.00 ? 81   ALA I CB    1 
ATOM 10082 N N     . ARG I 9  82  ? 64.162  3.139    -27.171 1.00 0.00 ? 82   ARG I N     1 
ATOM 10083 C CA    . ARG I 9  82  ? 63.888  3.359    -25.777 1.00 0.00 ? 82   ARG I CA    1 
ATOM 10084 C C     . ARG I 9  82  ? 65.219  3.764    -25.216 1.00 0.00 ? 82   ARG I C     1 
ATOM 10085 O O     . ARG I 9  82  ? 66.183  3.944    -25.960 1.00 0.00 ? 82   ARG I O     1 
ATOM 10086 C CB    . ARG I 9  82  ? 63.335  2.147    -24.989 1.00 0.00 ? 82   ARG I CB    1 
ATOM 10087 C CG    . ARG I 9  82  ? 62.002  1.608    -25.527 1.00 0.00 ? 82   ARG I CG    1 
ATOM 10088 C CD    . ARG I 9  82  ? 61.278  0.748    -24.481 1.00 0.00 ? 82   ARG I CD    1 
ATOM 10089 N NE    . ARG I 9  82  ? 60.240  -0.120   -25.135 1.00 0.00 ? 82   ARG I NE    1 
ATOM 10090 C CZ    . ARG I 9  82  ? 60.554  -1.331   -25.691 1.00 0.00 ? 82   ARG I CZ    1 
ATOM 10091 N NH1   . ARG I 9  82  ? 61.854  -1.715   -25.852 1.00 0.00 ? 82   ARG I NH1   1 
ATOM 10092 N NH2   . ARG I 9  82  ? 59.560  -2.177   -26.088 1.00 0.00 ? 82   ARG I NH2   1 
ATOM 10093 N N     . TRP I 9  83  ? 65.288  3.977    -23.883 1.00 0.00 ? 83   TRP I N     1 
ATOM 10094 C CA    . TRP I 9  83  ? 66.471  4.507    -23.256 1.00 0.00 ? 83   TRP I CA    1 
ATOM 10095 C C     . TRP I 9  83  ? 66.747  3.824    -21.931 1.00 0.00 ? 83   TRP I C     1 
ATOM 10096 O O     . TRP I 9  83  ? 66.759  4.515    -20.913 1.00 0.00 ? 83   TRP I O     1 
ATOM 10097 C CB    . TRP I 9  83  ? 66.374  6.058    -23.086 1.00 0.00 ? 83   TRP I CB    1 
ATOM 10098 C CG    . TRP I 9  83  ? 65.082  6.580    -22.460 1.00 0.00 ? 83   TRP I CG    1 
ATOM 10099 C CD1   . TRP I 9  83  ? 64.789  6.818    -21.144 1.00 0.00 ? 83   TRP I CD1   1 
ATOM 10100 C CD2   . TRP I 9  83  ? 63.881  6.874    -23.199 1.00 0.00 ? 83   TRP I CD2   1 
ATOM 10101 N NE1   . TRP I 9  83  ? 63.477  7.204    -21.006 1.00 0.00 ? 83   TRP I NE1   1 
ATOM 10102 C CE2   . TRP I 9  83  ? 62.897  7.243    -22.256 1.00 0.00 ? 83   TRP I CE2   1 
ATOM 10103 C CE3   . TRP I 9  83  ? 63.592  6.834    -24.561 1.00 0.00 ? 83   TRP I CE3   1 
ATOM 10104 C CZ2   . TRP I 9  83  ? 61.606  7.567    -22.661 1.00 0.00 ? 83   TRP I CZ2   1 
ATOM 10105 C CZ3   . TRP I 9  83  ? 62.288  7.150    -24.968 1.00 0.00 ? 83   TRP I CZ3   1 
ATOM 10106 C CH2   . TRP I 9  83  ? 61.309  7.510    -24.030 1.00 0.00 ? 83   TRP I CH2   1 
ATOM 10107 N N     . PRO I 9  84  ? 67.050  2.522    -21.830 1.00 0.00 ? 84   PRO I N     1 
ATOM 10108 C CA    . PRO I 9  84  ? 67.468  1.962    -20.558 1.00 0.00 ? 84   PRO I CA    1 
ATOM 10109 C C     . PRO I 9  84  ? 68.965  2.146    -20.480 1.00 0.00 ? 84   PRO I C     1 
ATOM 10110 O O     . PRO I 9  84  ? 69.699  1.538    -21.255 1.00 0.00 ? 84   PRO I O     1 
ATOM 10111 C CB    . PRO I 9  84  ? 67.131  0.465    -20.652 1.00 0.00 ? 84   PRO I CB    1 
ATOM 10112 C CG    . PRO I 9  84  ? 67.118  0.150    -22.151 1.00 0.00 ? 84   PRO I CG    1 
ATOM 10113 C CD    . PRO I 9  84  ? 66.674  1.470    -22.786 1.00 0.00 ? 84   PRO I CD    1 
ATOM 10114 N N     . ALA I 9  85  ? 69.425  2.996    -19.531 1.00 0.00 ? 85   ALA I N     1 
ATOM 10115 C CA    . ALA I 9  85  ? 70.824  3.296    -19.322 1.00 0.00 ? 85   ALA I CA    1 
ATOM 10116 C C     . ALA I 9  85  ? 71.331  2.414    -18.216 1.00 0.00 ? 85   ALA I C     1 
ATOM 10117 O O     . ALA I 9  85  ? 72.507  2.451    -17.854 1.00 0.00 ? 85   ALA I O     1 
ATOM 10118 C CB    . ALA I 9  85  ? 71.032  4.766    -18.912 1.00 0.00 ? 85   ALA I CB    1 
ATOM 10119 N N     . LYS I 9  86  ? 70.421  1.567    -17.684 1.00 0.00 ? 86   LYS I N     1 
ATOM 10120 C CA    . LYS I 9  86  ? 70.657  0.553    -16.703 1.00 0.00 ? 86   LYS I CA    1 
ATOM 10121 C C     . LYS I 9  86  ? 71.494  -0.546   -17.308 1.00 0.00 ? 86   LYS I C     1 
ATOM 10122 O O     . LYS I 9  86  ? 72.466  -1.000   -16.708 1.00 0.00 ? 86   LYS I O     1 
ATOM 10123 C CB    . LYS I 9  86  ? 69.284  -0.004   -16.261 1.00 0.00 ? 86   LYS I CB    1 
ATOM 10124 C CG    . LYS I 9  86  ? 69.285  -0.830   -14.971 1.00 0.00 ? 86   LYS I CG    1 
ATOM 10125 C CD    . LYS I 9  86  ? 69.721  -0.039   -13.729 1.00 0.00 ? 86   LYS I CD    1 
ATOM 10126 C CE    . LYS I 9  86  ? 69.133  -0.608   -12.435 1.00 0.00 ? 86   LYS I CE    1 
ATOM 10127 N NZ    . LYS I 9  86  ? 69.499  -2.029   -12.261 1.00 0.00 ? 86   LYS I NZ    1 
ATOM 10128 N N     . SER I 9  87  ? 71.133  -0.948   -18.555 1.00 0.00 ? 87   SER I N     1 
ATOM 10129 C CA    . SER I 9  87  ? 71.755  -2.024   -19.293 1.00 0.00 ? 87   SER I CA    1 
ATOM 10130 C C     . SER I 9  87  ? 72.982  -1.554   -20.011 1.00 0.00 ? 87   SER I C     1 
ATOM 10131 O O     . SER I 9  87  ? 73.809  -2.365   -20.421 1.00 0.00 ? 87   SER I O     1 
ATOM 10132 C CB    . SER I 9  87  ? 70.796  -2.635   -20.336 1.00 0.00 ? 87   SER I CB    1 
ATOM 10133 O OG    . SER I 9  87  ? 69.672  -3.204   -19.683 1.00 0.00 ? 87   SER I OG    1 
ATOM 10134 N N     . VAL I 9  88  ? 73.145  -0.222   -20.154 1.00 0.00 ? 88   VAL I N     1 
ATOM 10135 C CA    . VAL I 9  88  ? 74.305  0.394    -20.744 1.00 0.00 ? 88   VAL I CA    1 
ATOM 10136 C C     . VAL I 9  88  ? 75.452  0.325    -19.773 1.00 0.00 ? 88   VAL I C     1 
ATOM 10137 O O     . VAL I 9  88  ? 76.580  0.067    -20.183 1.00 0.00 ? 88   VAL I O     1 
ATOM 10138 C CB    . VAL I 9  88  ? 74.012  1.822    -21.175 1.00 0.00 ? 88   VAL I CB    1 
ATOM 10139 C CG1   . VAL I 9  88  ? 75.271  2.504    -21.744 1.00 0.00 ? 88   VAL I CG1   1 
ATOM 10140 C CG2   . VAL I 9  88  ? 72.899  1.754    -22.242 1.00 0.00 ? 88   VAL I CG2   1 
ATOM 10141 N N     . LYS I 9  89  ? 75.187  0.528    -18.456 1.00 0.00 ? 89   LYS I N     1 
ATOM 10142 C CA    . LYS I 9  89  ? 76.195  0.468    -17.420 1.00 0.00 ? 89   LYS I CA    1 
ATOM 10143 C C     . LYS I 9  89  ? 76.756  -0.927   -17.261 1.00 0.00 ? 89   LYS I C     1 
ATOM 10144 O O     . LYS I 9  89  ? 77.950  -1.095   -17.025 1.00 0.00 ? 89   LYS I O     1 
ATOM 10145 C CB    . LYS I 9  89  ? 75.684  0.979    -16.050 1.00 0.00 ? 89   LYS I CB    1 
ATOM 10146 C CG    . LYS I 9  89  ? 76.833  1.270    -15.069 1.00 0.00 ? 89   LYS I CG    1 
ATOM 10147 C CD    . LYS I 9  89  ? 76.424  2.024    -13.795 1.00 0.00 ? 89   LYS I CD    1 
ATOM 10148 C CE    . LYS I 9  89  ? 75.767  1.154    -12.715 1.00 0.00 ? 89   LYS I CE    1 
ATOM 10149 N NZ    . LYS I 9  89  ? 75.601  1.940    -11.471 1.00 0.00 ? 89   LYS I NZ    1 
ATOM 10150 N N     . PHE I 9  90  ? 75.884  -1.957   -17.403 1.00 0.00 ? 90   PHE I N     1 
ATOM 10151 C CA    . PHE I 9  90  ? 76.218  -3.362   -17.313 1.00 0.00 ? 90   PHE I CA    1 
ATOM 10152 C C     . PHE I 9  90  ? 77.156  -3.781   -18.420 1.00 0.00 ? 90   PHE I C     1 
ATOM 10153 O O     . PHE I 9  90  ? 78.135  -4.480   -18.165 1.00 0.00 ? 90   PHE I O     1 
ATOM 10154 C CB    . PHE I 9  90  ? 74.904  -4.196   -17.392 1.00 0.00 ? 90   PHE I CB    1 
ATOM 10155 C CG    . PHE I 9  90  ? 74.974  -5.704   -17.213 1.00 0.00 ? 90   PHE I CG    1 
ATOM 10156 C CD1   . PHE I 9  90  ? 76.062  -6.408   -16.658 1.00 0.00 ? 90   PHE I CD1   1 
ATOM 10157 C CD2   . PHE I 9  90  ? 73.838  -6.437   -17.602 1.00 0.00 ? 90   PHE I CD2   1 
ATOM 10158 C CE1   . PHE I 9  90  ? 76.013  -7.805   -16.529 1.00 0.00 ? 90   PHE I CE1   1 
ATOM 10159 C CE2   . PHE I 9  90  ? 73.773  -7.824   -17.439 1.00 0.00 ? 90   PHE I CE2   1 
ATOM 10160 C CZ    . PHE I 9  90  ? 74.866  -8.510   -16.906 1.00 0.00 ? 90   PHE I CZ    1 
ATOM 10161 N N     . VAL I 9  91  ? 76.883  -3.349   -19.676 1.00 0.00 ? 91   VAL I N     1 
ATOM 10162 C CA    . VAL I 9  91  ? 77.640  -3.776   -20.830 1.00 0.00 ? 91   VAL I CA    1 
ATOM 10163 C C     . VAL I 9  91  ? 78.917  -2.971   -20.938 1.00 0.00 ? 91   VAL I C     1 
ATOM 10164 O O     . VAL I 9  91  ? 79.905  -3.466   -21.470 1.00 0.00 ? 91   VAL I O     1 
ATOM 10165 C CB    . VAL I 9  91  ? 76.801  -3.718   -22.105 1.00 0.00 ? 91   VAL I CB    1 
ATOM 10166 C CG1   . VAL I 9  91  ? 77.622  -4.085   -23.360 1.00 0.00 ? 91   VAL I CG1   1 
ATOM 10167 C CG2   . VAL I 9  91  ? 75.629  -4.712   -21.948 1.00 0.00 ? 91   VAL I CG2   1 
ATOM 10168 N N     . GLN I 9  92  ? 78.966  -1.736   -20.375 1.00 0.00 ? 92   GLN I N     1 
ATOM 10169 C CA    . GLN I 9  92  ? 80.178  -0.944   -20.268 1.00 0.00 ? 92   GLN I CA    1 
ATOM 10170 C C     . GLN I 9  92  ? 81.130  -1.561   -19.278 1.00 0.00 ? 92   GLN I C     1 
ATOM 10171 O O     . GLN I 9  92  ? 82.343  -1.520   -19.478 1.00 0.00 ? 92   GLN I O     1 
ATOM 10172 C CB    . GLN I 9  92  ? 79.917  0.524    -19.846 1.00 0.00 ? 92   GLN I CB    1 
ATOM 10173 C CG    . GLN I 9  92  ? 79.438  1.422    -21.003 1.00 0.00 ? 92   GLN I CG    1 
ATOM 10174 C CD    . GLN I 9  92  ? 80.588  1.662    -21.991 1.00 0.00 ? 92   GLN I CD    1 
ATOM 10175 O OE1   . GLN I 9  92  ? 80.665  1.022    -23.046 1.00 0.00 ? 92   GLN I OE1   1 
ATOM 10176 N NE2   . GLN I 9  92  ? 81.503  2.610    -21.625 1.00 0.00 ? 92   GLN I NE2   1 
ATOM 10177 N N     . GLY I 9  93  ? 80.587  -2.165   -18.192 1.00 0.00 ? 93   GLY I N     1 
ATOM 10178 C CA    . GLY I 9  93  ? 81.351  -2.867   -17.191 1.00 0.00 ? 93   GLY I CA    1 
ATOM 10179 C C     . GLY I 9  93  ? 81.894  -4.170   -17.713 1.00 0.00 ? 93   GLY I C     1 
ATOM 10180 O O     . GLY I 9  93  ? 82.925  -4.648   -17.242 1.00 0.00 ? 93   GLY I O     1 
ATOM 10181 N N     . LEU I 9  94  ? 81.200  -4.772   -18.713 1.00 0.00 ? 94   LEU I N     1 
ATOM 10182 C CA    . LEU I 9  94  ? 81.593  -6.004   -19.353 1.00 0.00 ? 94   LEU I CA    1 
ATOM 10183 C C     . LEU I 9  94  ? 82.736  -5.735   -20.303 1.00 0.00 ? 94   LEU I C     1 
ATOM 10184 O O     . LEU I 9  94  ? 83.701  -6.493   -20.353 1.00 0.00 ? 94   LEU I O     1 
ATOM 10185 C CB    . LEU I 9  94  ? 80.414  -6.626   -20.151 1.00 0.00 ? 94   LEU I CB    1 
ATOM 10186 C CG    . LEU I 9  94  ? 80.234  -8.162   -20.038 1.00 0.00 ? 94   LEU I CG    1 
ATOM 10187 C CD1   . LEU I 9  94  ? 79.212  -8.641   -21.087 1.00 0.00 ? 94   LEU I CD1   1 
ATOM 10188 C CD2   . LEU I 9  94  ? 81.534  -8.982   -20.132 1.00 0.00 ? 94   LEU I CD2   1 
ATOM 10189 N N     . LEU I 9  95  ? 82.603  -4.659   -21.114 1.00 0.00 ? 95   LEU I N     1 
ATOM 10190 C CA    . LEU I 9  95  ? 83.557  -4.229   -22.118 1.00 0.00 ? 95   LEU I CA    1 
ATOM 10191 C C     . LEU I 9  95  ? 84.874  -3.772   -21.536 1.00 0.00 ? 95   LEU I C     1 
ATOM 10192 O O     . LEU I 9  95  ? 85.929  -4.046   -22.093 1.00 0.00 ? 95   LEU I O     1 
ATOM 10193 C CB    . LEU I 9  95  ? 82.988  -3.091   -23.005 1.00 0.00 ? 95   LEU I CB    1 
ATOM 10194 C CG    . LEU I 9  95  ? 81.916  -3.532   -24.025 1.00 0.00 ? 95   LEU I CG    1 
ATOM 10195 C CD1   . LEU I 9  95  ? 81.245  -2.296   -24.641 1.00 0.00 ? 95   LEU I CD1   1 
ATOM 10196 C CD2   . LEU I 9  95  ? 82.497  -4.415   -25.140 1.00 0.00 ? 95   LEU I CD2   1 
ATOM 10197 N N     . GLN I 9  96  ? 84.879  -3.065   -20.388 1.00 0.00 ? 96   GLN I N     1 
ATOM 10198 C CA    . GLN I 9  96  ? 86.106  -2.585   -19.789 1.00 0.00 ? 96   GLN I CA    1 
ATOM 10199 C C     . GLN I 9  96  ? 86.947  -3.719   -19.261 1.00 0.00 ? 96   GLN I C     1 
ATOM 10200 O O     . GLN I 9  96  ? 88.171  -3.673   -19.364 1.00 0.00 ? 96   GLN I O     1 
ATOM 10201 C CB    . GLN I 9  96  ? 85.906  -1.497   -18.703 1.00 0.00 ? 96   GLN I CB    1 
ATOM 10202 C CG    . GLN I 9  96  ? 85.194  -1.955   -17.419 1.00 0.00 ? 96   GLN I CG    1 
ATOM 10203 C CD    . GLN I 9  96  ? 84.928  -0.741   -16.522 1.00 0.00 ? 96   GLN I CD    1 
ATOM 10204 O OE1   . GLN I 9  96  ? 83.951  -0.013   -16.734 1.00 0.00 ? 96   GLN I OE1   1 
ATOM 10205 N NE2   . GLN I 9  96  ? 85.820  -0.528   -15.507 1.00 0.00 ? 96   GLN I NE2   1 
ATOM 10206 N N     . ASN I 9  97  ? 86.299  -4.777   -18.707 1.00 0.00 ? 97   ASN I N     1 
ATOM 10207 C CA    . ASN I 9  97  ? 86.944  -5.987   -18.252 1.00 0.00 ? 97   ASN I CA    1 
ATOM 10208 C C     . ASN I 9  97  ? 87.496  -6.748   -19.433 1.00 0.00 ? 97   ASN I C     1 
ATOM 10209 O O     . ASN I 9  97  ? 88.600  -7.278   -19.364 1.00 0.00 ? 97   ASN I O     1 
ATOM 10210 C CB    . ASN I 9  97  ? 85.963  -6.887   -17.445 1.00 0.00 ? 97   ASN I CB    1 
ATOM 10211 C CG    . ASN I 9  97  ? 86.624  -8.153   -16.862 1.00 0.00 ? 97   ASN I CG    1 
ATOM 10212 O OD1   . ASN I 9  97  ? 86.180  -9.269   -17.154 1.00 0.00 ? 97   ASN I OD1   1 
ATOM 10213 N ND2   . ASN I 9  97  ? 87.696  -7.965   -16.033 1.00 0.00 ? 97   ASN I ND2   1 
ATOM 10214 N N     . ALA I 9  98  ? 86.727  -6.795   -20.549 1.00 0.00 ? 98   ALA I N     1 
ATOM 10215 C CA    . ALA I 9  98  ? 87.070  -7.473   -21.776 1.00 0.00 ? 98   ALA I CA    1 
ATOM 10216 C C     . ALA I 9  98  ? 88.236  -6.837   -22.465 1.00 0.00 ? 98   ALA I C     1 
ATOM 10217 O O     . ALA I 9  98  ? 89.020  -7.528   -23.108 1.00 0.00 ? 98   ALA I O     1 
ATOM 10218 C CB    . ALA I 9  98  ? 85.906  -7.488   -22.784 1.00 0.00 ? 98   ALA I CB    1 
ATOM 10219 N N     . ALA I 9  99  ? 88.358  -5.495   -22.347 1.00 0.00 ? 99   ALA I N     1 
ATOM 10220 C CA    . ALA I 9  99  ? 89.358  -4.713   -23.023 1.00 0.00 ? 99   ALA I CA    1 
ATOM 10221 C C     . ALA I 9  99  ? 90.609  -4.633   -22.199 1.00 0.00 ? 99   ALA I C     1 
ATOM 10222 O O     . ALA I 9  99  ? 91.638  -4.191   -22.703 1.00 0.00 ? 99   ALA I O     1 
ATOM 10223 C CB    . ALA I 9  99  ? 88.894  -3.261   -23.253 1.00 0.00 ? 99   ALA I CB    1 
ATOM 10224 N N     . ALA I 9  100 ? 90.563  -5.080   -20.921 1.00 0.00 ? 100  ALA I N     1 
ATOM 10225 C CA    . ALA I 9  100 ? 91.701  -5.034   -20.036 1.00 0.00 ? 100  ALA I CA    1 
ATOM 10226 C C     . ALA I 9  100 ? 92.303  -6.405   -19.960 1.00 0.00 ? 100  ALA I C     1 
ATOM 10227 O O     . ALA I 9  100 ? 93.494  -6.553   -19.689 1.00 0.00 ? 100  ALA I O     1 
ATOM 10228 C CB    . ALA I 9  100 ? 91.279  -4.647   -18.612 1.00 0.00 ? 100  ALA I CB    1 
ATOM 10229 N N     . ASN I 9  101 ? 91.485  -7.440   -20.272 1.00 0.00 ? 101  ASN I N     1 
ATOM 10230 C CA    . ASN I 9  101 ? 91.922  -8.800   -20.476 1.00 0.00 ? 101  ASN I CA    1 
ATOM 10231 C C     . ASN I 9  101 ? 92.513  -8.866   -21.858 1.00 0.00 ? 101  ASN I C     1 
ATOM 10232 O O     . ASN I 9  101 ? 93.470  -9.601   -22.098 1.00 0.00 ? 101  ASN I O     1 
ATOM 10233 C CB    . ASN I 9  101 ? 90.756  -9.816   -20.371 1.00 0.00 ? 101  ASN I CB    1 
ATOM 10234 C CG    . ASN I 9  101 ? 90.218  -9.861   -18.929 1.00 0.00 ? 101  ASN I CG    1 
ATOM 10235 O OD1   . ASN I 9  101 ? 90.833  -9.343   -17.990 1.00 0.00 ? 101  ASN I OD1   1 
ATOM 10236 N ND2   . ASN I 9  101 ? 89.018  -10.500  -18.768 1.00 0.00 ? 101  ASN I ND2   1 
ATOM 10237 N N     . ALA I 9  102 ? 91.973  -8.027   -22.778 1.00 0.00 ? 102  ALA I N     1 
ATOM 10238 C CA    . ALA I 9  102 ? 92.508  -7.779   -24.090 1.00 0.00 ? 102  ALA I CA    1 
ATOM 10239 C C     . ALA I 9  102 ? 93.407  -6.566   -24.032 1.00 0.00 ? 102  ALA I C     1 
ATOM 10240 O O     . ALA I 9  102 ? 93.296  -5.664   -24.862 1.00 0.00 ? 102  ALA I O     1 
ATOM 10241 C CB    . ALA I 9  102 ? 91.419  -7.526   -25.154 1.00 0.00 ? 102  ALA I CB    1 
ATOM 10242 N N     . GLU I 9  103 ? 94.363  -6.548   -23.069 1.00 0.00 ? 103  GLU I N     1 
ATOM 10243 C CA    . GLU I 9  103 ? 95.445  -5.588   -23.068 1.00 0.00 ? 103  GLU I CA    1 
ATOM 10244 C C     . GLU I 9  103 ? 96.649  -6.251   -22.436 1.00 0.00 ? 103  GLU I C     1 
ATOM 10245 O O     . GLU I 9  103 ? 97.751  -5.706   -22.453 1.00 0.00 ? 103  GLU I O     1 
ATOM 10246 C CB    . GLU I 9  103 ? 95.079  -4.276   -22.325 1.00 0.00 ? 103  GLU I CB    1 
ATOM 10247 C CG    . GLU I 9  103 ? 96.085  -3.109   -22.457 1.00 0.00 ? 103  GLU I CG    1 
ATOM 10248 C CD    . GLU I 9  103 ? 96.427  -2.827   -23.923 1.00 0.00 ? 103  GLU I CD    1 
ATOM 10249 O OE1   . GLU I 9  103 ? 95.495  -2.468   -24.693 1.00 0.00 ? 103  GLU I OE1   1 
ATOM 10250 O OE2   . GLU I 9  103 ? 97.622  -2.972   -24.292 1.00 0.00 ? 103  GLU I OE2   1 
ATOM 10251 N N     . ALA I 9  104 ? 96.482  -7.502   -21.940 1.00 0.00 ? 104  ALA I N     1 
ATOM 10252 C CA    . ALA I 9  104 ? 97.555  -8.312   -21.402 1.00 0.00 ? 104  ALA I CA    1 
ATOM 10253 C C     . ALA I 9  104 ? 97.817  -9.462   -22.349 1.00 0.00 ? 104  ALA I C     1 
ATOM 10254 O O     . ALA I 9  104 ? 98.490  -10.431  -22.000 1.00 0.00 ? 104  ALA I O     1 
ATOM 10255 C CB    . ALA I 9  104 ? 97.152  -8.905   -20.033 1.00 0.00 ? 104  ALA I CB    1 
ATOM 10256 N N     . LYS I 9  105 ? 97.228  -9.380   -23.563 1.00 0.00 ? 105  LYS I N     1 
ATOM 10257 C CA    . LYS I 9  105 ? 96.919  -10.495  -24.420 1.00 0.00 ? 105  LYS I CA    1 
ATOM 10258 C C     . LYS I 9  105 ? 98.023  -11.247  -25.168 1.00 0.00 ? 105  LYS I C     1 
ATOM 10259 O O     . LYS I 9  105 ? 98.005  -12.472  -25.063 1.00 0.00 ? 105  LYS I O     1 
ATOM 10260 C CB    . LYS I 9  105 ? 95.656  -10.231  -25.290 1.00 0.00 ? 105  LYS I CB    1 
ATOM 10261 C CG    . LYS I 9  105 ? 95.717  -9.139   -26.376 1.00 0.00 ? 105  LYS I CG    1 
ATOM 10262 C CD    . LYS I 9  105 ? 96.160  -7.740   -25.926 1.00 0.00 ? 105  LYS I CD    1 
ATOM 10263 C CE    . LYS I 9  105 ? 96.138  -6.673   -27.017 1.00 0.00 ? 105  LYS I CE    1 
ATOM 10264 N NZ    . LYS I 9  105 ? 96.850  -5.448   -26.576 1.00 0.00 ? 105  LYS I NZ    1 
ATOM 10265 N N     . GLY I 9  106 ? 99.035  -10.696  -25.913 1.00 0.00 ? 106  GLY I N     1 
ATOM 10266 C CA    . GLY I 9  106 ? 99.395  -9.344   -26.262 1.00 0.00 ? 106  GLY I CA    1 
ATOM 10267 C C     . GLY I 9  106 ? 98.986  -8.962   -27.674 1.00 0.00 ? 106  GLY I C     1 
ATOM 10268 O O     . GLY I 9  106 ? 99.116  -7.793   -28.028 1.00 0.00 ? 106  GLY I O     1 
ATOM 10269 N N     . LEU I 9  107 ? 98.484  -9.943   -28.487 1.00 0.00 ? 107  LEU I N     1 
ATOM 10270 C CA    . LEU I 9  107 ? 97.762  -9.887   -29.768 1.00 0.00 ? 107  LEU I CA    1 
ATOM 10271 C C     . LEU I 9  107 ? 97.723  -8.539   -30.488 1.00 0.00 ? 107  LEU I C     1 
ATOM 10272 O O     . LEU I 9  107 ? 98.749  -8.112   -31.014 1.00 0.00 ? 107  LEU I O     1 
ATOM 10273 C CB    . LEU I 9  107 ? 96.335  -10.519  -29.741 1.00 0.00 ? 107  LEU I CB    1 
ATOM 10274 C CG    . LEU I 9  107 ? 96.203  -12.048  -29.475 1.00 0.00 ? 107  LEU I CG    1 
ATOM 10275 C CD1   . LEU I 9  107 ? 97.048  -12.652  -28.339 1.00 0.00 ? 107  LEU I CD1   1 
ATOM 10276 C CD2   . LEU I 9  107 ? 94.721  -12.376  -29.218 1.00 0.00 ? 107  LEU I CD2   1 
ATOM 10277 N N     . ASP I 9  108 ? 96.522  -7.877   -30.540 1.00 0.00 ? 108  ASP I N     1 
ATOM 10278 C CA    . ASP I 9  108 ? 96.191  -6.594   -31.164 1.00 0.00 ? 108  ASP I CA    1 
ATOM 10279 C C     . ASP I 9  108 ? 96.334  -6.572   -32.695 1.00 0.00 ? 108  ASP I C     1 
ATOM 10280 O O     . ASP I 9  108 ? 96.970  -7.464   -33.253 1.00 0.00 ? 108  ASP I O     1 
ATOM 10281 C CB    . ASP I 9  108 ? 96.787  -5.360   -30.405 1.00 0.00 ? 108  ASP I CB    1 
ATOM 10282 C CG    . ASP I 9  108 ? 98.307  -5.204   -30.516 1.00 0.00 ? 108  ASP I CG    1 
ATOM 10283 O OD1   . ASP I 9  108 ? 98.819  -5.073   -31.656 1.00 0.00 ? 108  ASP I OD1   1 
ATOM 10284 O OD2   . ASP I 9  108 ? 98.970  -5.196   -29.443 1.00 0.00 ? 108  ASP I OD2   1 
ATOM 10285 N N     . ALA I 9  109 ? 95.730  -5.606   -33.467 1.00 0.00 ? 109  ALA I N     1 
ATOM 10286 C CA    . ALA I 9  109 ? 95.069  -4.394   -33.035 1.00 0.00 ? 109  ALA I CA    1 
ATOM 10287 C C     . ALA I 9  109 ? 93.900  -3.999   -33.891 1.00 0.00 ? 109  ALA I C     1 
ATOM 10288 O O     . ALA I 9  109 ? 93.018  -3.300   -33.392 1.00 0.00 ? 109  ALA I O     1 
ATOM 10289 C CB    . ALA I 9  109 ? 96.021  -3.182   -33.155 1.00 0.00 ? 109  ALA I CB    1 
ATOM 10290 N N     . THR I 9  110 ? 93.828  -4.420   -35.182 1.00 0.00 ? 110  THR I N     1 
ATOM 10291 C CA    . THR I 9  110 ? 92.729  -3.999   -36.035 1.00 0.00 ? 110  THR I CA    1 
ATOM 10292 C C     . THR I 9  110 ? 91.607  -4.972   -35.814 1.00 0.00 ? 110  THR I C     1 
ATOM 10293 O O     . THR I 9  110 ? 90.598  -4.602   -35.216 1.00 0.00 ? 110  THR I O     1 
ATOM 10294 C CB    . THR I 9  110 ? 93.067  -3.882   -37.522 1.00 0.00 ? 110  THR I CB    1 
ATOM 10295 O OG1   . THR I 9  110 ? 93.899  -4.940   -37.991 1.00 0.00 ? 110  THR I OG1   1 
ATOM 10296 C CG2   . THR I 9  110 ? 93.785  -2.534   -37.744 1.00 0.00 ? 110  THR I CG2   1 
ATOM 10297 N N     . LYS I 9  111 ? 91.845  -6.241   -36.232 1.00 0.00 ? 111  LYS I N     1 
ATOM 10298 C CA    . LYS I 9  111 ? 91.225  -7.492   -35.850 1.00 0.00 ? 111  LYS I CA    1 
ATOM 10299 C C     . LYS I 9  111 ? 89.809  -7.387   -35.326 1.00 0.00 ? 111  LYS I C     1 
ATOM 10300 O O     . LYS I 9  111 ? 88.957  -6.803   -35.996 1.00 0.00 ? 111  LYS I O     1 
ATOM 10301 C CB    . LYS I 9  111 ? 92.226  -8.294   -34.978 1.00 0.00 ? 111  LYS I CB    1 
ATOM 10302 C CG    . LYS I 9  111 ? 93.083  -9.284   -35.793 1.00 0.00 ? 111  LYS I CG    1 
ATOM 10303 C CD    . LYS I 9  111 ? 93.840  -8.739   -37.017 1.00 0.00 ? 111  LYS I CD    1 
ATOM 10304 C CE    . LYS I 9  111 ? 94.615  -9.827   -37.780 1.00 0.00 ? 111  LYS I CE    1 
ATOM 10305 N NZ    . LYS I 9  111 ? 93.727  -10.946  -38.176 1.00 0.00 ? 111  LYS I NZ    1 
ATOM 10306 N N     . LEU I 9  112 ? 89.531  -7.957   -34.125 1.00 0.00 ? 112  LEU I N     1 
ATOM 10307 C CA    . LEU I 9  112 ? 88.279  -7.872   -33.407 1.00 0.00 ? 112  LEU I CA    1 
ATOM 10308 C C     . LEU I 9  112 ? 87.089  -8.387   -34.192 1.00 0.00 ? 112  LEU I C     1 
ATOM 10309 O O     . LEU I 9  112 ? 87.272  -9.079   -35.193 1.00 0.00 ? 112  LEU I O     1 
ATOM 10310 C CB    . LEU I 9  112 ? 88.058  -6.454   -32.806 1.00 0.00 ? 112  LEU I CB    1 
ATOM 10311 C CG    . LEU I 9  112 ? 88.098  -6.376   -31.258 1.00 0.00 ? 112  LEU I CG    1 
ATOM 10312 C CD1   . LEU I 9  112 ? 86.934  -7.142   -30.597 1.00 0.00 ? 112  LEU I CD1   1 
ATOM 10313 C CD2   . LEU I 9  112 ? 89.472  -6.784   -30.687 1.00 0.00 ? 112  LEU I CD2   1 
ATOM 10314 N N     . TYR I 9  113 ? 85.869  -8.088   -33.670 1.00 0.00 ? 113  TYR I N     1 
ATOM 10315 C CA    . TYR I 9  113 ? 84.557  -8.582   -34.022 1.00 0.00 ? 113  TYR I CA    1 
ATOM 10316 C C     . TYR I 9  113 ? 84.136  -9.287   -32.768 1.00 0.00 ? 113  TYR I C     1 
ATOM 10317 O O     . TYR I 9  113 ? 84.817  -10.206  -32.312 1.00 0.00 ? 113  TYR I O     1 
ATOM 10318 C CB    . TYR I 9  113 ? 84.426  -9.526   -35.258 1.00 0.00 ? 113  TYR I CB    1 
ATOM 10319 C CG    . TYR I 9  113 ? 83.003  -9.894   -35.605 1.00 0.00 ? 113  TYR I CG    1 
ATOM 10320 C CD1   . TYR I 9  113 ? 82.287  -9.173   -36.573 1.00 0.00 ? 113  TYR I CD1   1 
ATOM 10321 C CD2   . TYR I 9  113 ? 82.384  -10.998  -34.995 1.00 0.00 ? 113  TYR I CD2   1 
ATOM 10322 C CE1   . TYR I 9  113 ? 80.967  -9.518   -36.892 1.00 0.00 ? 113  TYR I CE1   1 
ATOM 10323 C CE2   . TYR I 9  113 ? 81.067  -11.352  -35.310 1.00 0.00 ? 113  TYR I CE2   1 
ATOM 10324 C CZ    . TYR I 9  113 ? 80.349  -10.601  -36.250 1.00 0.00 ? 113  TYR I CZ    1 
ATOM 10325 O OH    . TYR I 9  113 ? 79.009  -10.936  -36.546 1.00 0.00 ? 113  TYR I OH    1 
ATOM 10326 N N     . VAL I 9  114 ? 82.993  -8.856   -32.177 1.00 0.00 ? 114  VAL I N     1 
ATOM 10327 C CA    . VAL I 9  114 ? 82.402  -9.497   -31.024 1.00 0.00 ? 114  VAL I CA    1 
ATOM 10328 C C     . VAL I 9  114 ? 81.733  -10.749  -31.523 1.00 0.00 ? 114  VAL I C     1 
ATOM 10329 O O     . VAL I 9  114 ? 80.747  -10.697  -32.257 1.00 0.00 ? 114  VAL I O     1 
ATOM 10330 C CB    . VAL I 9  114 ? 81.420  -8.603   -30.283 1.00 0.00 ? 114  VAL I CB    1 
ATOM 10331 C CG1   . VAL I 9  114 ? 80.682  -9.406   -29.190 1.00 0.00 ? 114  VAL I CG1   1 
ATOM 10332 C CG2   . VAL I 9  114 ? 82.195  -7.404   -29.693 1.00 0.00 ? 114  VAL I CG2   1 
ATOM 10333 N N     . SER I 9  115 ? 82.332  -11.906  -31.163 1.00 0.00 ? 115  SER I N     1 
ATOM 10334 C CA    . SER I 9  115 ? 82.117  -13.159  -31.834 1.00 0.00 ? 115  SER I CA    1 
ATOM 10335 C C     . SER I 9  115 ? 80.920  -13.876  -31.279 1.00 0.00 ? 115  SER I C     1 
ATOM 10336 O O     . SER I 9  115 ? 80.142  -14.450  -32.040 1.00 0.00 ? 115  SER I O     1 
ATOM 10337 C CB    . SER I 9  115 ? 83.396  -14.013  -31.734 1.00 0.00 ? 115  SER I CB    1 
ATOM 10338 O OG    . SER I 9  115 ? 83.337  -15.191  -32.532 1.00 0.00 ? 115  SER I OG    1 
ATOM 10339 N N     . HIS I 9  116 ? 80.731  -13.835  -29.943 1.00 0.00 ? 116  HIS I N     1 
ATOM 10340 C CA    . HIS I 9  116 ? 79.525  -14.347  -29.357 1.00 0.00 ? 116  HIS I CA    1 
ATOM 10341 C C     . HIS I 9  116 ? 79.349  -13.616  -28.069 1.00 0.00 ? 116  HIS I C     1 
ATOM 10342 O O     . HIS I 9  116 ? 80.311  -13.226  -27.411 1.00 0.00 ? 116  HIS I O     1 
ATOM 10343 C CB    . HIS I 9  116 ? 79.533  -15.876  -29.102 1.00 0.00 ? 116  HIS I CB    1 
ATOM 10344 C CG    . HIS I 9  116 ? 78.156  -16.460  -28.965 1.00 0.00 ? 116  HIS I CG    1 
ATOM 10345 N ND1   . HIS I 9  116 ? 77.504  -16.721  -27.778 1.00 0.00 ? 116  HIS I ND1   1 
ATOM 10346 C CD2   . HIS I 9  116 ? 77.278  -16.791  -29.951 1.00 0.00 ? 116  HIS I CD2   1 
ATOM 10347 C CE1   . HIS I 9  116 ? 76.275  -17.194  -28.108 1.00 0.00 ? 116  HIS I CE1   1 
ATOM 10348 N NE2   . HIS I 9  116 ? 76.092  -17.254  -29.413 1.00 0.00 ? 116  HIS I NE2   1 
ATOM 10349 N N     . ILE I 9  117 ? 78.080  -13.401  -27.695 1.00 0.00 ? 117  ILE I N     1 
ATOM 10350 C CA    . ILE I 9  117 ? 77.722  -12.836  -26.431 1.00 0.00 ? 117  ILE I CA    1 
ATOM 10351 C C     . ILE I 9  117 ? 76.385  -13.467  -26.179 1.00 0.00 ? 117  ILE I C     1 
ATOM 10352 O O     . ILE I 9  117 ? 75.560  -13.581  -27.085 1.00 0.00 ? 117  ILE I O     1 
ATOM 10353 C CB    . ILE I 9  117 ? 77.722  -11.302  -26.415 1.00 0.00 ? 117  ILE I CB    1 
ATOM 10354 C CG1   . ILE I 9  117 ? 77.250  -10.719  -25.055 1.00 0.00 ? 117  ILE I CG1   1 
ATOM 10355 C CG2   . ILE I 9  117 ? 76.950  -10.752  -27.632 1.00 0.00 ? 117  ILE I CG2   1 
ATOM 10356 C CD1   . ILE I 9  117 ? 77.405  -9.202   -24.913 1.00 0.00 ? 117  ILE I CD1   1 
ATOM 10357 N N     . GLN I 9  118 ? 76.162  -13.941  -24.937 1.00 0.00 ? 118  GLN I N     1 
ATOM 10358 C CA    . GLN I 9  118 ? 74.960  -14.644  -24.587 1.00 0.00 ? 118  GLN I CA    1 
ATOM 10359 C C     . GLN I 9  118 ? 74.701  -14.311  -23.158 1.00 0.00 ? 118  GLN I C     1 
ATOM 10360 O O     . GLN I 9  118 ? 75.626  -14.150  -22.366 1.00 0.00 ? 118  GLN I O     1 
ATOM 10361 C CB    . GLN I 9  118 ? 75.039  -16.183  -24.781 1.00 0.00 ? 118  GLN I CB    1 
ATOM 10362 C CG    . GLN I 9  118 ? 76.229  -16.886  -24.092 1.00 0.00 ? 118  GLN I CG    1 
ATOM 10363 C CD    . GLN I 9  118 ? 76.231  -18.385  -24.442 1.00 0.00 ? 118  GLN I CD    1 
ATOM 10364 O OE1   . GLN I 9  118 ? 75.728  -18.793  -25.496 1.00 0.00 ? 118  GLN I OE1   1 
ATOM 10365 N NE2   . GLN I 9  118 ? 76.826  -19.219  -23.535 1.00 0.00 ? 118  GLN I NE2   1 
ATOM 10366 N N     . VAL I 9  119 ? 73.403  -14.173  -22.817 1.00 0.00 ? 119  VAL I N     1 
ATOM 10367 C CA    . VAL I 9  119 ? 72.958  -13.716  -21.529 1.00 0.00 ? 119  VAL I CA    1 
ATOM 10368 C C     . VAL I 9  119 ? 72.241  -14.889  -20.916 1.00 0.00 ? 119  VAL I C     1 
ATOM 10369 O O     . VAL I 9  119 ? 71.520  -15.619  -21.596 1.00 0.00 ? 119  VAL I O     1 
ATOM 10370 C CB    . VAL I 9  119 ? 72.101  -12.455  -21.638 1.00 0.00 ? 119  VAL I CB    1 
ATOM 10371 C CG1   . VAL I 9  119 ? 70.774  -12.705  -22.379 1.00 0.00 ? 119  VAL I CG1   1 
ATOM 10372 C CG2   . VAL I 9  119 ? 71.872  -11.818  -20.258 1.00 0.00 ? 119  VAL I CG2   1 
ATOM 10373 N N     . ASN I 9  120 ? 72.481  -15.122  -19.606 1.00 0.00 ? 120  ASN I N     1 
ATOM 10374 C CA    . ASN I 9  120 ? 71.973  -16.264  -18.887 1.00 0.00 ? 120  ASN I CA    1 
ATOM 10375 C C     . ASN I 9  120 ? 71.055  -15.689  -17.851 1.00 0.00 ? 120  ASN I C     1 
ATOM 10376 O O     . ASN I 9  120 ? 71.276  -14.588  -17.348 1.00 0.00 ? 120  ASN I O     1 
ATOM 10377 C CB    . ASN I 9  120 ? 73.047  -17.128  -18.161 1.00 0.00 ? 120  ASN I CB    1 
ATOM 10378 C CG    . ASN I 9  120 ? 74.351  -17.192  -18.968 1.00 0.00 ? 120  ASN I CG    1 
ATOM 10379 O OD1   . ASN I 9  120 ? 75.254  -16.377  -18.739 1.00 0.00 ? 120  ASN I OD1   1 
ATOM 10380 N ND2   . ASN I 9  120 ? 74.442  -18.167  -19.919 1.00 0.00 ? 120  ASN I ND2   1 
ATOM 10381 N N     . GLN I 9  121 ? 69.976  -16.