data_2WY2
# 
_entry.id   2WY2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WY2         
PDBE  EBI-41701    
WWPDB D_1290041701 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2WWV unspecified 
;NMR STRUCTURE OF THE IIACHITOBIOSE- IIBCHITOBIOSE COMPLEX OF THE N,N'- DIACETYLCHITOBOISE BRANCE OF THE E. COLI PHOSPHOTRANSFERASE SYSTEM.
;
PDB 1WCR unspecified 
;TRIMERIC STRUCTURE OF THE ENZYME IIA FROM ESCHERICHIA COLI PHOSPHOTRANSFERASE SYSTEM SPECIFIC FOR N,N'-DIACETYLCHITOBIOSE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WY2 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-11-11 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sang, Y.S.'  1 
'Cai, M.'     2 
'Clore, G.M.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
;
J.Biol.Chem. 285 4173  ? 2010 JBCHA3 US 0021-9258 0071 ? 19959833 10.1074/JBC.M109.080937         
1       
;Solution Structure of Enzyme Iia(Chitobiose) from the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransferase System.
;
J.Biol.Chem. 280 11770 ? 2005 JBCHA3 US 0021-9258 0071 ? 15654077 10.1074/JBC.M414300200          
2       
;The Structure of an Energy-Coupling Protein from Bacteria, Iibcellobiose, Reveals Similarity to Eukaryotic Protein Tyrosine Phosphatases.
;
Structure    5   217   ? 1997 STRUE6 UK 0969-2126 2005 ? 9032081  '10.1016/S0969-2126(97)00180-9' 
3       
;NMR Structure of Cysteinyl-Phosphorylated Enzyme Iib of the N,N'-Diacetylchitobiose-Specific Phosphoenolpyruvate-Dependent Phosphotransferase System of Escherichia Coli.
;
J.Mol.Biol.  308 993   ? 2001 JMOBAK UK 0022-2836 0070 ? 11352587 10.1006/JMBI.2001.4623          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jung, Y.S.'              1  ? 
primary 'Cai, M.'                 2  ? 
primary 'Clore, G.M.'             3  ? 
1       'Tang, C.'                4  ? 
1       'Williams, D.C.J.'        5  ? 
1       'Ghirlando, R.'           6  ? 
1       'Clore, G.M.'             7  ? 
2       'Van Montfort, R.L.'      8  ? 
2       'Pijning, T.'             9  ? 
2       'Kalk, K.H.'              10 ? 
2       'Reizer, J.'              11 ? 
2       'Saier, M.H.J.'           12 ? 
2       'Thunnissen, M.M.'        13 ? 
2       'Robillard, G.T.'         14 ? 
2       'Dijkstra, B.W.'          15 ? 
3       'Ab, E.'                  16 ? 
3       'Schuurman-Wolters, G.K.' 17 ? 
3       'Nijlant, D.'             18 ? 
3       'Dijkstra, K.'            19 ? 
3       'Saier, M.H.'             20 ? 
3       'Robillard, G.T.'         21 ? 
3       'Scheek, R.M.'            22 ? 
# 
_cell.entry_id           2WY2 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WY2 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT
;
11256.186 3 2.7.1.-  YES 'RESIDUES 14-116' ? 
2 polymer     man 
;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT
;
11065.101 1 2.7.1.69 ?   ?                 ? 
3 non-polymer syn 'PHOSPHITE ION'                                                             78.972    1 ?        ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;IIACHB, PTS SYSTEM N\,N'-DIACETYLCHITOBIOSE-SPECIFIC EIIA COMPONENT, EIIA-CHB, EIII-CHB
;
2 
;IIBCHB, PTS SYSTEM N\,N'-DIACETYLCHITOBIOSE-SPECIFIC EIIB COMPONENT
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLH
LMTSMLARELITELIELHEKLKA
;
;AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLH
LMTSMLARELITELIELHEKLKA
;
A,B,C ? 
2 'polypeptide(L)' no no 
;KKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSL
LYGKVDGLGVLKAAVAAIKKAAA
;
;KKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSL
LYGKVDGLGVLKAAVAAIKKAAA
;
D     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLU n 
1 3   GLU n 
1 4   LEU n 
1 5   GLU n 
1 6   GLU n 
1 7   VAL n 
1 8   VAL n 
1 9   MET n 
1 10  GLY n 
1 11  LEU n 
1 12  ILE n 
1 13  ILE n 
1 14  ASN n 
1 15  SER n 
1 16  GLY n 
1 17  GLN n 
1 18  ALA n 
1 19  ARG n 
1 20  SER n 
1 21  LEU n 
1 22  ALA n 
1 23  TYR n 
1 24  ALA n 
1 25  ALA n 
1 26  LEU n 
1 27  LYS n 
1 28  GLN n 
1 29  ALA n 
1 30  LYS n 
1 31  GLN n 
1 32  GLY n 
1 33  ASP n 
1 34  PHE n 
1 35  ALA n 
1 36  ALA n 
1 37  ALA n 
1 38  LYS n 
1 39  ALA n 
1 40  MET n 
1 41  MET n 
1 42  ASP n 
1 43  GLN n 
1 44  SER n 
1 45  ARG n 
1 46  MET n 
1 47  ALA n 
1 48  LEU n 
1 49  ASN n 
1 50  GLU n 
1 51  ALA n 
1 52  HIS n 
1 53  LEU n 
1 54  VAL n 
1 55  GLN n 
1 56  THR n 
1 57  LYS n 
1 58  LEU n 
1 59  ILE n 
1 60  GLU n 
1 61  GLY n 
1 62  ASP n 
1 63  ALA n 
1 64  GLY n 
1 65  GLU n 
1 66  GLY n 
1 67  LYS n 
1 68  MET n 
1 69  LYS n 
1 70  VAL n 
1 71  SER n 
1 72  LEU n 
1 73  VAL n 
1 74  LEU n 
1 75  VAL n 
1 76  HIS n 
1 77  ALA n 
1 78  GLN n 
1 79  LEU n 
1 80  HIS n 
1 81  LEU n 
1 82  MET n 
1 83  THR n 
1 84  SER n 
1 85  MET n 
1 86  LEU n 
1 87  ALA n 
1 88  ARG n 
1 89  GLU n 
1 90  LEU n 
1 91  ILE n 
1 92  THR n 
1 93  GLU n 
1 94  LEU n 
1 95  ILE n 
1 96  GLU n 
1 97  LEU n 
1 98  HIS n 
1 99  GLU n 
1 100 LYS n 
1 101 LEU n 
1 102 LYS n 
1 103 ALA n 
2 1   LYS n 
2 2   LYS n 
2 3   HIS n 
2 4   ILE n 
2 5   TYR n 
2 6   LEU n 
2 7   PHE n 
2 8   CYS n 
2 9   SER n 
2 10  ALA n 
2 11  GLY n 
2 12  MET n 
2 13  SER n 
2 14  THR n 
2 15  SER n 
2 16  LEU n 
2 17  LEU n 
2 18  VAL n 
2 19  SER n 
2 20  LYS n 
2 21  MET n 
2 22  ARG n 
2 23  ALA n 
2 24  GLN n 
2 25  ALA n 
2 26  GLU n 
2 27  LYS n 
2 28  TYR n 
2 29  GLU n 
2 30  VAL n 
2 31  PRO n 
2 32  VAL n 
2 33  ILE n 
2 34  ILE n 
2 35  GLU n 
2 36  ALA n 
2 37  PHE n 
2 38  PRO n 
2 39  GLU n 
2 40  THR n 
2 41  LEU n 
2 42  ALA n 
2 43  GLY n 
2 44  GLU n 
2 45  LYS n 
2 46  GLY n 
2 47  GLN n 
2 48  ASN n 
2 49  ALA n 
2 50  ASP n 
2 51  VAL n 
2 52  VAL n 
2 53  LEU n 
2 54  LEU n 
2 55  GLY n 
2 56  PRO n 
2 57  GLN n 
2 58  ILE n 
2 59  ALA n 
2 60  TYR n 
2 61  MET n 
2 62  LEU n 
2 63  PRO n 
2 64  GLU n 
2 65  ILE n 
2 66  GLN n 
2 67  ARG n 
2 68  LEU n 
2 69  LEU n 
2 70  PRO n 
2 71  ASN n 
2 72  LYS n 
2 73  PRO n 
2 74  VAL n 
2 75  GLU n 
2 76  VAL n 
2 77  ILE n 
2 78  ASP n 
2 79  SER n 
2 80  LEU n 
2 81  LEU n 
2 82  TYR n 
2 83  GLY n 
2 84  LYS n 
2 85  VAL n 
2 86  ASP n 
2 87  GLY n 
2 88  LEU n 
2 89  GLY n 
2 90  VAL n 
2 91  LEU n 
2 92  LYS n 
2 93  ALA n 
2 94  ALA n 
2 95  VAL n 
2 96  ALA n 
2 97  ALA n 
2 98  ILE n 
2 99  LYS n 
2 100 LYS n 
2 101 ALA n 
2 102 ALA n 
2 103 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI BL21(DE3)' 496008 ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PTQA_ECOLI   1 ? ? P69791 ? 
2 UNP C3T7F7_ECOLX 2 ? ? C3T7F7 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WY2 A 1 ? 103 ? P69791 14 ? 116 ? 1 103 
2 1 2WY2 B 1 ? 103 ? P69791 14 ? 116 ? 1 103 
3 1 2WY2 C 1 ? 103 ? P69791 14 ? 116 ? 1 103 
4 2 2WY2 D 1 ? 103 ? C3T7F7 3  ? 105 ? 3 105 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2WY2 LEU A 79 ? UNP P69791 ASP 92 'engineered mutation' 79 1 
2 2WY2 LEU B 79 ? UNP P69791 ASP 92 'engineered mutation' 79 2 
3 2WY2 LEU C 79 ? UNP P69791 ASP 92 'engineered mutation' 79 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO3 non-polymer         . 'PHOSPHITE ION' ? 'O3 P -3'        78.972  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            308.0 
_pdbx_nmr_exptl_sample_conditions.pressure_units         ? 
_pdbx_nmr_exptl_sample_conditions.pressure               ? 
_pdbx_nmr_exptl_sample_conditions.pH                     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX Bruker 500 ? 
2 DMX Bruker 600 ? 
3 DRX Bruker 600 ? 
4 DRX Bruker 800 ? 
5 DRX Bruker 900 ? 
# 
_pdbx_nmr_refine.entry_id           2WY2 
_pdbx_nmr_refine.method             ? 
_pdbx_nmr_refine.details            
;THE STRUCTURE WAS SOLVED ON THE BASIS OF THE COORDINATES OF THE UNPHOSPHORYLATED COMPLEX 2WWV. TO SOLVE THE TRANSITION STATE COMPLEX, THE COORDINATES OF THE UNPHOSPHORYLATED COMPLEX 2WWV ARE HELD FIXED WITH THE EXCEPTION OF THE ACTIVE SITE LOOP OF IIBCHB, THE ACTIVE SITE OF IIACHB, THE PHOSPHORYL GROUP, AND INTERFACIAL SIDE CHAINS IN THE IMMEDIATE VICINITY OF THE ACTIVE SITE AND THE PHOSPHORYL GROUP WHICH ARE GIVEN TORSION DEGREES OF FREEDOM. THE ACTIVE SITE LOOP OF IIBCHB COMPRISES RESIDUES 9-16 OF CHAIN D. THE ACTIVE SITE REGION OF IIACHB COMPRISES RESIDUES 74 TO 79 OF CHAINS A, B AND C. THE EXPERIMENTAL NMR RESTRAINTS ARE IDENTICAL TO THOSE USED TO CALCULATE 2WWV EXCEPT FOR THE DIPOLAR COUPLINGS WHICH WERE OBTAINED FROM FREE PHOSPHORYLATED IIBCHB. FOR FURTHER DETAILS SEE THE JNRL CITATION ABOVE.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2WY2 
_pdbx_nmr_details.text       NONE 
# 
_pdbx_nmr_ensemble.entry_id                             2WY2 
_pdbx_nmr_ensemble.conformers_calculated_total_number   64 
_pdbx_nmr_ensemble.conformers_submitted_total_number    64 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_representative.entry_id             2WY2 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             Xplor-NIH 
_pdbx_nmr_software.version          2.23 
_pdbx_nmr_software.authors          SCHWIETERS,KUSZEWSKI,CLORE 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          2WY2 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2WY2 
_struct.title                     
;NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system.
;
_struct.pdbx_descriptor           
;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT (E.C.2.7.1.-), N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT (E.C.2.7.1.69)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'RESTRAINED MINIMIZED AVERAGE, MODEL 1' 
# 
_struct_keywords.entry_id        2WY2 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'KINASE, PHOSPHOTRANSFERASE SYSTEM, CHITOBIOSE, TRANSFERASE, SUGAR TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 1  ? GLN A 31  ? ALA A 1  GLN A 31  1 ? 31 
HELX_P HELX_P2  2  ASP A 33 ? GLY A 61  ? ASP A 33 GLY A 61  1 ? 29 
HELX_P HELX_P3  3  LEU A 72 ? LEU A 101 ? LEU A 72 LEU A 101 1 ? 30 
HELX_P HELX_P4  4  ALA B 1  ? GLN B 31  ? ALA B 1  GLN B 31  1 ? 31 
HELX_P HELX_P5  5  ASP B 33 ? GLY B 61  ? ASP B 33 GLY B 61  1 ? 29 
HELX_P HELX_P6  6  LEU B 72 ? LEU B 101 ? LEU B 72 LEU B 101 1 ? 30 
HELX_P HELX_P7  7  ALA C 1  ? GLN C 31  ? ALA C 1  GLN C 31  1 ? 31 
HELX_P HELX_P8  8  ASP C 33 ? GLY C 61  ? ASP C 33 GLY C 61  1 ? 29 
HELX_P HELX_P9  9  LEU C 72 ? LEU C 101 ? LEU C 72 LEU C 101 1 ? 30 
HELX_P HELX_P10 10 MET D 12 ? TYR D 28  ? MET D 14 TYR D 30  1 ? 17 
HELX_P HELX_P11 11 LEU D 41 ? GLN D 47  ? LEU D 43 GLN D 49  1 ? 7  
HELX_P HELX_P12 12 PRO D 56 ? TYR D 60  ? PRO D 58 TYR D 62  5 ? 5  
HELX_P HELX_P13 13 MET D 61 ? LEU D 69  ? MET D 63 LEU D 71  1 ? 9  
HELX_P HELX_P14 14 ASP D 78 ? LYS D 84  ? ASP D 80 LYS D 86  1 ? 7  
HELX_P HELX_P15 15 ASP D 86 ? ALA D 103 ? ASP D 88 ALA D 105 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               DA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
DA 1 2 ? parallel 
DA 2 3 ? parallel 
DA 3 4 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
DA 1 VAL D 32 ? PRO D 38 ? VAL D 34 PRO D 40 
DA 2 LYS D 2  ? CYS D 8  ? LYS D 4  CYS D 10 
DA 3 VAL D 51 ? LEU D 54 ? VAL D 53 LEU D 56 
DA 4 VAL D 74 ? VAL D 76 ? VAL D 76 VAL D 78 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
DA 1 2 N ILE D 33 ? N ILE D 35 O LYS D 2  ? O LYS D 4  
DA 2 3 N TYR D 5  ? N TYR D 7  O VAL D 51 ? O VAL D 53 
DA 3 4 N LEU D 54 ? N LEU D 56 O GLU D 75 ? O GLU D 77 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE PO3 D 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 ILE A 12 ? ILE A 12 . ? 1_555 ? 
2 AC1 8 HIS A 76 ? HIS A 76 . ? 1_555 ? 
3 AC1 8 CYS D 8  ? CYS D 10 . ? 1_555 ? 
4 AC1 8 SER D 9  ? SER D 11 . ? 1_555 ? 
5 AC1 8 ALA D 10 ? ALA D 12 . ? 1_555 ? 
6 AC1 8 GLY D 11 ? GLY D 13 . ? 1_555 ? 
7 AC1 8 MET D 12 ? MET D 14 . ? 1_555 ? 
8 AC1 8 SER D 13 ? SER D 15 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2WY2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WY2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . ALA A 1 1   ? -12.226 -16.475 -3.134  1.00 0.00 ? 1   ALA A N    1  
ATOM   2      C CA   . ALA A 1 1   ? -13.262 -17.518 -2.881  1.00 0.00 ? 1   ALA A CA   1  
ATOM   3      C C    . ALA A 1 1   ? -14.204 -17.019 -1.788  1.00 0.00 ? 1   ALA A C    1  
ATOM   4      O O    . ALA A 1 1   ? -13.926 -16.005 -1.159  1.00 0.00 ? 1   ALA A O    1  
ATOM   5      C CB   . ALA A 1 1   ? -12.572 -18.824 -2.457  1.00 0.00 ? 1   ALA A CB   1  
ATOM   6      H H1   . ALA A 1 1   ? -12.230 -15.784 -2.353  1.00 0.00 ? 1   ALA A H1   1  
ATOM   7      H H2   . ALA A 1 1   ? -11.289 -16.925 -3.195  1.00 0.00 ? 1   ALA A H2   1  
ATOM   8      H H3   . ALA A 1 1   ? -12.435 -15.983 -4.027  1.00 0.00 ? 1   ALA A H3   1  
ATOM   9      H HA   . ALA A 1 1   ? -13.831 -17.685 -3.784  1.00 0.00 ? 1   ALA A HA   1  
ATOM   10     H HB1  . ALA A 1 1   ? -13.185 -19.343 -1.734  1.00 0.00 ? 1   ALA A HB1  1  
ATOM   11     H HB2  . ALA A 1 1   ? -11.611 -18.600 -2.018  1.00 0.00 ? 1   ALA A HB2  1  
ATOM   12     H HB3  . ALA A 1 1   ? -12.432 -19.455 -3.324  1.00 0.00 ? 1   ALA A HB3  1  
ATOM   13     N N    . GLU A 1 2   ? -15.304 -17.740 -1.585  1.00 0.00 ? 2   GLU A N    1  
ATOM   14     C CA   . GLU A 1 2   ? -16.316 -17.385 -0.581  1.00 0.00 ? 2   GLU A CA   1  
ATOM   15     C C    . GLU A 1 2   ? -15.750 -16.533 0.562   1.00 0.00 ? 2   GLU A C    1  
ATOM   16     O O    . GLU A 1 2   ? -15.822 -15.305 0.530   1.00 0.00 ? 2   GLU A O    1  
ATOM   17     C CB   . GLU A 1 2   ? -16.929 -18.664 0.001   1.00 0.00 ? 2   GLU A CB   1  
ATOM   18     C CG   . GLU A 1 2   ? -17.587 -19.503 -1.121  1.00 0.00 ? 2   GLU A CG   1  
ATOM   19     C CD   . GLU A 1 2   ? -17.108 -20.953 -1.070  1.00 0.00 ? 2   GLU A CD   1  
ATOM   20     O OE1  . GLU A 1 2   ? -16.943 -21.467 0.020   1.00 0.00 ? 2   GLU A OE1  1  
ATOM   21     O OE2  . GLU A 1 2   ? -16.918 -21.528 -2.126  1.00 0.00 ? 2   GLU A OE2  1  
ATOM   22     H H    . GLU A 1 2   ? -15.450 -18.541 -2.127  1.00 0.00 ? 2   GLU A H    1  
ATOM   23     H HA   . GLU A 1 2   ? -17.099 -16.823 -1.066  1.00 0.00 ? 2   GLU A HA   1  
ATOM   24     H HB2  . GLU A 1 2   ? -16.153 -19.247 0.478   1.00 0.00 ? 2   GLU A HB2  1  
ATOM   25     H HB3  . GLU A 1 2   ? -17.678 -18.399 0.735   1.00 0.00 ? 2   GLU A HB3  1  
ATOM   26     H HG2  . GLU A 1 2   ? -18.659 -19.487 -0.998  1.00 0.00 ? 2   GLU A HG2  1  
ATOM   27     H HG3  . GLU A 1 2   ? -17.339 -19.085 -2.085  1.00 0.00 ? 2   GLU A HG3  1  
ATOM   28     N N    . GLU A 1 3   ? -15.202 -17.194 1.573   1.00 0.00 ? 3   GLU A N    1  
ATOM   29     C CA   . GLU A 1 3   ? -14.648 -16.487 2.725   1.00 0.00 ? 3   GLU A CA   1  
ATOM   30     C C    . GLU A 1 3   ? -13.425 -15.663 2.332   1.00 0.00 ? 3   GLU A C    1  
ATOM   31     O O    . GLU A 1 3   ? -13.413 -14.446 2.492   1.00 0.00 ? 3   GLU A O    1  
ATOM   32     C CB   . GLU A 1 3   ? -14.274 -17.497 3.813   1.00 0.00 ? 3   GLU A CB   1  
ATOM   33     C CG   . GLU A 1 3   ? -15.541 -17.929 4.570   1.00 0.00 ? 3   GLU A CG   1  
ATOM   34     C CD   . GLU A 1 3   ? -15.331 -19.286 5.236   1.00 0.00 ? 3   GLU A CD   1  
ATOM   35     O OE1  . GLU A 1 3   ? -14.402 -19.401 6.016   1.00 0.00 ? 3   GLU A OE1  1  
ATOM   36     O OE2  . GLU A 1 3   ? -16.105 -20.183 4.959   1.00 0.00 ? 3   GLU A OE2  1  
ATOM   37     H H    . GLU A 1 3   ? -15.180 -18.173 1.554   1.00 0.00 ? 3   GLU A H    1  
ATOM   38     H HA   . GLU A 1 3   ? -15.402 -15.819 3.111   1.00 0.00 ? 3   GLU A HA   1  
ATOM   39     H HB2  . GLU A 1 3   ? -13.813 -18.363 3.360   1.00 0.00 ? 3   GLU A HB2  1  
ATOM   40     H HB3  . GLU A 1 3   ? -13.581 -17.043 4.506   1.00 0.00 ? 3   GLU A HB3  1  
ATOM   41     H HG2  . GLU A 1 3   ? -15.773 -17.197 5.328   1.00 0.00 ? 3   GLU A HG2  1  
ATOM   42     H HG3  . GLU A 1 3   ? -16.369 -17.998 3.881   1.00 0.00 ? 3   GLU A HG3  1  
ATOM   43     N N    . LEU A 1 4   ? -12.393 -16.324 1.822   1.00 0.00 ? 4   LEU A N    1  
ATOM   44     C CA   . LEU A 1 4   ? -11.176 -15.618 1.421   1.00 0.00 ? 4   LEU A CA   1  
ATOM   45     C C    . LEU A 1 4   ? -11.493 -14.307 0.694   1.00 0.00 ? 4   LEU A C    1  
ATOM   46     O O    . LEU A 1 4   ? -10.860 -13.286 0.940   1.00 0.00 ? 4   LEU A O    1  
ATOM   47     C CB   . LEU A 1 4   ? -10.311 -16.493 0.501   1.00 0.00 ? 4   LEU A CB   1  
ATOM   48     C CG   . LEU A 1 4   ? -9.971  -17.821 1.185   1.00 0.00 ? 4   LEU A CG   1  
ATOM   49     C CD1  . LEU A 1 4   ? -9.086  -18.666 0.253   1.00 0.00 ? 4   LEU A CD1  1  
ATOM   50     C CD2  . LEU A 1 4   ? -9.232  -17.561 2.508   1.00 0.00 ? 4   LEU A CD2  1  
ATOM   51     H H    . LEU A 1 4   ? -12.448 -17.294 1.716   1.00 0.00 ? 4   LEU A H    1  
ATOM   52     H HA   . LEU A 1 4   ? -10.615 -15.388 2.310   1.00 0.00 ? 4   LEU A HA   1  
ATOM   53     H HB2  . LEU A 1 4   ? -10.848 -16.687 -0.414  1.00 0.00 ? 4   LEU A HB2  1  
ATOM   54     H HB3  . LEU A 1 4   ? -9.396  -15.964 0.269   1.00 0.00 ? 4   LEU A HB3  1  
ATOM   55     H HG   . LEU A 1 4   ? -10.885 -18.363 1.385   1.00 0.00 ? 4   LEU A HG   1  
ATOM   56     H HD11 . LEU A 1 4   ? -9.335  -18.456 -0.777  1.00 0.00 ? 4   LEU A HD11 1  
ATOM   57     H HD12 . LEU A 1 4   ? -8.044  -18.432 0.424   1.00 0.00 ? 4   LEU A HD12 1  
ATOM   58     H HD13 . LEU A 1 4   ? -9.252  -19.717 0.453   1.00 0.00 ? 4   LEU A HD13 1  
ATOM   59     H HD21 . LEU A 1 4   ? -8.593  -16.695 2.409   1.00 0.00 ? 4   LEU A HD21 1  
ATOM   60     H HD22 . LEU A 1 4   ? -9.953  -17.385 3.293   1.00 0.00 ? 4   LEU A HD22 1  
ATOM   61     H HD23 . LEU A 1 4   ? -8.632  -18.423 2.763   1.00 0.00 ? 4   LEU A HD23 1  
ATOM   62     N N    . GLU A 1 5   ? -12.470 -14.344 -0.203  1.00 0.00 ? 5   GLU A N    1  
ATOM   63     C CA   . GLU A 1 5   ? -12.846 -13.152 -0.957  1.00 0.00 ? 5   GLU A CA   1  
ATOM   64     C C    . GLU A 1 5   ? -13.543 -12.139 -0.056  1.00 0.00 ? 5   GLU A C    1  
ATOM   65     O O    . GLU A 1 5   ? -13.223 -10.944 -0.077  1.00 0.00 ? 5   GLU A O    1  
ATOM   66     C CB   . GLU A 1 5   ? -13.771 -13.536 -2.114  1.00 0.00 ? 5   GLU A CB   1  
ATOM   67     C CG   . GLU A 1 5   ? -14.057 -12.302 -2.971  1.00 0.00 ? 5   GLU A CG   1  
ATOM   68     C CD   . GLU A 1 5   ? -14.883 -12.694 -4.191  1.00 0.00 ? 5   GLU A CD   1  
ATOM   69     O OE1  . GLU A 1 5   ? -14.954 -13.878 -4.478  1.00 0.00 ? 5   GLU A OE1  1  
ATOM   70     O OE2  . GLU A 1 5   ? -15.430 -11.806 -4.823  1.00 0.00 ? 5   GLU A OE2  1  
ATOM   71     H H    . GLU A 1 5   ? -12.954 -15.185 -0.360  1.00 0.00 ? 5   GLU A H    1  
ATOM   72     H HA   . GLU A 1 5   ? -11.956 -12.701 -1.363  1.00 0.00 ? 5   GLU A HA   1  
ATOM   73     H HB2  . GLU A 1 5   ? -13.296 -14.294 -2.719  1.00 0.00 ? 5   GLU A HB2  1  
ATOM   74     H HB3  . GLU A 1 5   ? -14.701 -13.920 -1.720  1.00 0.00 ? 5   GLU A HB3  1  
ATOM   75     H HG2  . GLU A 1 5   ? -14.605 -11.578 -2.385  1.00 0.00 ? 5   GLU A HG2  1  
ATOM   76     H HG3  . GLU A 1 5   ? -13.124 -11.867 -3.296  1.00 0.00 ? 5   GLU A HG3  1  
ATOM   77     N N    . GLU A 1 6   ? -14.478 -12.622 0.748   1.00 0.00 ? 6   GLU A N    1  
ATOM   78     C CA   . GLU A 1 6   ? -15.196 -11.757 1.672   1.00 0.00 ? 6   GLU A CA   1  
ATOM   79     C C    . GLU A 1 6   ? -14.240 -11.264 2.757   1.00 0.00 ? 6   GLU A C    1  
ATOM   80     O O    . GLU A 1 6   ? -14.333 -10.125 3.224   1.00 0.00 ? 6   GLU A O    1  
ATOM   81     C CB   . GLU A 1 6   ? -16.367 -12.529 2.292   1.00 0.00 ? 6   GLU A CB   1  
ATOM   82     C CG   . GLU A 1 6   ? -17.464 -11.557 2.740   1.00 0.00 ? 6   GLU A CG   1  
ATOM   83     C CD   . GLU A 1 6   ? -18.755 -12.324 3.007   1.00 0.00 ? 6   GLU A CD   1  
ATOM   84     O OE1  . GLU A 1 6   ? -18.679 -13.527 3.196   1.00 0.00 ? 6   GLU A OE1  1  
ATOM   85     O OE2  . GLU A 1 6   ? -19.801 -11.696 3.026   1.00 0.00 ? 6   GLU A OE2  1  
ATOM   86     H H    . GLU A 1 6   ? -14.676 -13.582 0.734   1.00 0.00 ? 6   GLU A H    1  
ATOM   87     H HA   . GLU A 1 6   ? -15.584 -10.906 1.133   1.00 0.00 ? 6   GLU A HA   1  
ATOM   88     H HB2  . GLU A 1 6   ? -16.772 -13.211 1.558   1.00 0.00 ? 6   GLU A HB2  1  
ATOM   89     H HB3  . GLU A 1 6   ? -16.015 -13.089 3.145   1.00 0.00 ? 6   GLU A HB3  1  
ATOM   90     H HG2  . GLU A 1 6   ? -17.152 -11.058 3.647   1.00 0.00 ? 6   GLU A HG2  1  
ATOM   91     H HG3  . GLU A 1 6   ? -17.641 -10.822 1.969   1.00 0.00 ? 6   GLU A HG3  1  
ATOM   92     N N    . VAL A 1 7   ? -13.301 -12.127 3.130   1.00 0.00 ? 7   VAL A N    1  
ATOM   93     C CA   . VAL A 1 7   ? -12.302 -11.786 4.139   1.00 0.00 ? 7   VAL A CA   1  
ATOM   94     C C    . VAL A 1 7   ? -11.392 -10.672 3.616   1.00 0.00 ? 7   VAL A C    1  
ATOM   95     O O    . VAL A 1 7   ? -11.074 -9.725  4.337   1.00 0.00 ? 7   VAL A O    1  
ATOM   96     C CB   . VAL A 1 7   ? -11.473 -13.029 4.488   1.00 0.00 ? 7   VAL A CB   1  
ATOM   97     C CG1  . VAL A 1 7   ? -10.292 -12.633 5.379   1.00 0.00 ? 7   VAL A CG1  1  
ATOM   98     C CG2  . VAL A 1 7   ? -12.355 -14.043 5.231   1.00 0.00 ? 7   VAL A CG2  1  
ATOM   99     H H    . VAL A 1 7   ? -13.271 -13.013 2.702   1.00 0.00 ? 7   VAL A H    1  
ATOM   100    H HA   . VAL A 1 7   ? -12.803 -11.437 5.028   1.00 0.00 ? 7   VAL A HA   1  
ATOM   101    H HB   . VAL A 1 7   ? -11.100 -13.479 3.577   1.00 0.00 ? 7   VAL A HB   1  
ATOM   102    H HG11 . VAL A 1 7   ? -10.629 -11.944 6.139   1.00 0.00 ? 7   VAL A HG11 1  
ATOM   103    H HG12 . VAL A 1 7   ? -9.881  -13.515 5.848   1.00 0.00 ? 7   VAL A HG12 1  
ATOM   104    H HG13 . VAL A 1 7   ? -9.531  -12.158 4.777   1.00 0.00 ? 7   VAL A HG13 1  
ATOM   105    H HG21 . VAL A 1 7   ? -13.348 -14.045 4.800   1.00 0.00 ? 7   VAL A HG21 1  
ATOM   106    H HG22 . VAL A 1 7   ? -11.926 -15.029 5.144   1.00 0.00 ? 7   VAL A HG22 1  
ATOM   107    H HG23 . VAL A 1 7   ? -12.419 -13.770 6.274   1.00 0.00 ? 7   VAL A HG23 1  
ATOM   108    N N    . VAL A 1 8   ? -10.997 -10.783 2.349   1.00 0.00 ? 8   VAL A N    1  
ATOM   109    C CA   . VAL A 1 8   ? -10.144 -9.768  1.732   1.00 0.00 ? 8   VAL A CA   1  
ATOM   110    C C    . VAL A 1 8   ? -10.871 -8.425  1.748   1.00 0.00 ? 8   VAL A C    1  
ATOM   111    O O    . VAL A 1 8   ? -10.296 -7.401  2.108   1.00 0.00 ? 8   VAL A O    1  
ATOM   112    C CB   . VAL A 1 8   ? -9.799  -10.172 0.292   1.00 0.00 ? 8   VAL A CB   1  
ATOM   113    C CG1  . VAL A 1 8   ? -9.133  -8.988  -0.440  1.00 0.00 ? 8   VAL A CG1  1  
ATOM   114    C CG2  . VAL A 1 8   ? -8.849  -11.392 0.312   1.00 0.00 ? 8   VAL A CG2  1  
ATOM   115    H H    . VAL A 1 8   ? -11.297 -11.551 1.816   1.00 0.00 ? 8   VAL A H    1  
ATOM   116    H HA   . VAL A 1 8   ? -9.235  -9.675  2.305   1.00 0.00 ? 8   VAL A HA   1  
ATOM   117    H HB   . VAL A 1 8   ? -10.711 -10.438 -0.224  1.00 0.00 ? 8   VAL A HB   1  
ATOM   118    H HG11 . VAL A 1 8   ? -8.772  -8.267  0.279   1.00 0.00 ? 8   VAL A HG11 1  
ATOM   119    H HG12 . VAL A 1 8   ? -8.304  -9.346  -1.033  1.00 0.00 ? 8   VAL A HG12 1  
ATOM   120    H HG13 . VAL A 1 8   ? -9.857  -8.514  -1.088  1.00 0.00 ? 8   VAL A HG13 1  
ATOM   121    H HG21 . VAL A 1 8   ? -8.794  -11.801 1.311   1.00 0.00 ? 8   VAL A HG21 1  
ATOM   122    H HG22 . VAL A 1 8   ? -9.224  -12.149 -0.361  1.00 0.00 ? 8   VAL A HG22 1  
ATOM   123    H HG23 . VAL A 1 8   ? -7.860  -11.092 -0.006  1.00 0.00 ? 8   VAL A HG23 1  
ATOM   124    N N    . MET A 1 9   ? -12.158 -8.441  1.397   1.00 0.00 ? 9   MET A N    1  
ATOM   125    C CA   . MET A 1 9   ? -12.946 -7.214  1.416   1.00 0.00 ? 9   MET A CA   1  
ATOM   126    C C    . MET A 1 9   ? -12.890 -6.602  2.812   1.00 0.00 ? 9   MET A C    1  
ATOM   127    O O    . MET A 1 9   ? -12.690 -5.397  2.968   1.00 0.00 ? 9   MET A O    1  
ATOM   128    C CB   . MET A 1 9   ? -14.407 -7.502  1.085   1.00 0.00 ? 9   MET A CB   1  
ATOM   129    C CG   . MET A 1 9   ? -14.569 -7.687  -0.406  1.00 0.00 ? 9   MET A CG   1  
ATOM   130    S SD   . MET A 1 9   ? -16.265 -8.220  -0.763  1.00 0.00 ? 9   MET A SD   1  
ATOM   131    C CE   . MET A 1 9   ? -17.057 -6.606  -0.596  1.00 0.00 ? 9   MET A CE   1  
ATOM   132    H H    . MET A 1 9   ? -12.583 -9.290  1.149   1.00 0.00 ? 9   MET A H    1  
ATOM   133    H HA   . MET A 1 9   ? -12.524 -6.513  0.714   1.00 0.00 ? 9   MET A HA   1  
ATOM   134    H HB2  . MET A 1 9   ? -14.720 -8.399  1.596   1.00 0.00 ? 9   MET A HB2  1  
ATOM   135    H HB3  . MET A 1 9   ? -15.017 -6.672  1.410   1.00 0.00 ? 9   MET A HB3  1  
ATOM   136    H HG2  . MET A 1 9   ? -14.375 -6.746  -0.881  1.00 0.00 ? 9   MET A HG2  1  
ATOM   137    H HG3  . MET A 1 9   ? -13.866 -8.427  -0.758  1.00 0.00 ? 9   MET A HG3  1  
ATOM   138    H HE1  . MET A 1 9   ? -16.514 -5.880  -1.180  1.00 0.00 ? 9   MET A HE1  1  
ATOM   139    H HE2  . MET A 1 9   ? -18.075 -6.673  -0.950  1.00 0.00 ? 9   MET A HE2  1  
ATOM   140    H HE3  . MET A 1 9   ? -17.055 -6.305  0.434   1.00 0.00 ? 9   MET A HE3  1  
ATOM   141    N N    . GLY A 1 10  ? -13.043 -7.448  3.826   1.00 0.00 ? 10  GLY A N    1  
ATOM   142    C CA   . GLY A 1 10  ? -12.977 -6.980  5.206   1.00 0.00 ? 10  GLY A CA   1  
ATOM   143    C C    . GLY A 1 10  ? -11.600 -6.395  5.497   1.00 0.00 ? 10  GLY A C    1  
ATOM   144    O O    . GLY A 1 10  ? -11.480 -5.329  6.104   1.00 0.00 ? 10  GLY A O    1  
ATOM   145    H H    . GLY A 1 10  ? -13.180 -8.404  3.643   1.00 0.00 ? 10  GLY A H    1  
ATOM   146    H HA2  . GLY A 1 10  ? -13.729 -6.220  5.361   1.00 0.00 ? 10  GLY A HA2  1  
ATOM   147    H HA3  . GLY A 1 10  ? -13.161 -7.807  5.875   1.00 0.00 ? 10  GLY A HA3  1  
ATOM   148    N N    . LEU A 1 11  ? -10.561 -7.090  5.045   1.00 0.00 ? 11  LEU A N    1  
ATOM   149    C CA   . LEU A 1 11  ? -9.189  -6.622  5.253   1.00 0.00 ? 11  LEU A CA   1  
ATOM   150    C C    . LEU A 1 11  ? -8.961  -5.290  4.551   1.00 0.00 ? 11  LEU A C    1  
ATOM   151    O O    . LEU A 1 11  ? -8.358  -4.375  5.117   1.00 0.00 ? 11  LEU A O    1  
ATOM   152    C CB   . LEU A 1 11  ? -8.189  -7.645  4.712   1.00 0.00 ? 11  LEU A CB   1  
ATOM   153    C CG   . LEU A 1 11  ? -8.183  -8.898  5.592   1.00 0.00 ? 11  LEU A CG   1  
ATOM   154    C CD1  . LEU A 1 11  ? -7.365  -9.990  4.898   1.00 0.00 ? 11  LEU A CD1  1  
ATOM   155    C CD2  . LEU A 1 11  ? -7.571  -8.584  6.969   1.00 0.00 ? 11  LEU A CD2  1  
ATOM   156    H H    . LEU A 1 11  ? -10.717 -7.928  4.557   1.00 0.00 ? 11  LEU A H    1  
ATOM   157    H HA   . LEU A 1 11  ? -9.017  -6.491  6.311   1.00 0.00 ? 11  LEU A HA   1  
ATOM   158    H HB2  . LEU A 1 11  ? -8.471  -7.915  3.703   1.00 0.00 ? 11  LEU A HB2  1  
ATOM   159    H HB3  . LEU A 1 11  ? -7.201  -7.208  4.700   1.00 0.00 ? 11  LEU A HB3  1  
ATOM   160    H HG   . LEU A 1 11  ? -9.198  -9.244  5.720   1.00 0.00 ? 11  LEU A HG   1  
ATOM   161    H HD11 . LEU A 1 11  ? -6.502  -9.551  4.419   1.00 0.00 ? 11  LEU A HD11 1  
ATOM   162    H HD12 . LEU A 1 11  ? -7.039  -10.716 5.628   1.00 0.00 ? 11  LEU A HD12 1  
ATOM   163    H HD13 . LEU A 1 11  ? -7.977  -10.480 4.154   1.00 0.00 ? 11  LEU A HD13 1  
ATOM   164    H HD21 . LEU A 1 11  ? -6.808  -7.825  6.870   1.00 0.00 ? 11  LEU A HD21 1  
ATOM   165    H HD22 . LEU A 1 11  ? -8.344  -8.229  7.635   1.00 0.00 ? 11  LEU A HD22 1  
ATOM   166    H HD23 . LEU A 1 11  ? -7.130  -9.482  7.380   1.00 0.00 ? 11  LEU A HD23 1  
ATOM   167    N N    . ILE A 1 12  ? -9.448  -5.184  3.321   1.00 0.00 ? 12  ILE A N    1  
ATOM   168    C CA   . ILE A 1 12  ? -9.289  -3.949  2.558   1.00 0.00 ? 12  ILE A CA   1  
ATOM   169    C C    . ILE A 1 12  ? -10.000 -2.816  3.278   1.00 0.00 ? 12  ILE A C    1  
ATOM   170    O O    . ILE A 1 12  ? -9.452  -1.725  3.447   1.00 0.00 ? 12  ILE A O    1  
ATOM   171    C CB   . ILE A 1 12  ? -9.860  -4.095  1.152   1.00 0.00 ? 12  ILE A CB   1  
ATOM   172    C CG1  . ILE A 1 12  ? -9.118  -5.198  0.397   1.00 0.00 ? 12  ILE A CG1  1  
ATOM   173    C CG2  . ILE A 1 12  ? -9.697  -2.771  0.415   1.00 0.00 ? 12  ILE A CG2  1  
ATOM   174    C CD1  . ILE A 1 12  ? -7.622  -4.905  0.380   1.00 0.00 ? 12  ILE A CD1  1  
ATOM   175    H H    . ILE A 1 12  ? -9.924  -5.947  2.922   1.00 0.00 ? 12  ILE A H    1  
ATOM   176    H HA   . ILE A 1 12  ? -8.237  -3.715  2.492   1.00 0.00 ? 12  ILE A HA   1  
ATOM   177    H HB   . ILE A 1 12  ? -10.908 -4.344  1.216   1.00 0.00 ? 12  ILE A HB   1  
ATOM   178    H HG12 . ILE A 1 12  ? -9.281  -6.139  0.875   1.00 0.00 ? 12  ILE A HG12 1  
ATOM   179    H HG13 . ILE A 1 12  ? -9.482  -5.244  -0.614  1.00 0.00 ? 12  ILE A HG13 1  
ATOM   180    H HG21 . ILE A 1 12  ? -10.215 -2.004  0.945   1.00 0.00 ? 12  ILE A HG21 1  
ATOM   181    H HG22 . ILE A 1 12  ? -8.655  -2.515  0.360   1.00 0.00 ? 12  ILE A HG22 1  
ATOM   182    H HG23 . ILE A 1 12  ? -10.092 -2.859  -0.580  1.00 0.00 ? 12  ILE A HG23 1  
ATOM   183    H HD11 . ILE A 1 12  ? -7.462  -3.852  0.371   1.00 0.00 ? 12  ILE A HD11 1  
ATOM   184    H HD12 . ILE A 1 12  ? -7.166  -5.328  1.254   1.00 0.00 ? 12  ILE A HD12 1  
ATOM   185    H HD13 . ILE A 1 12  ? -7.183  -5.338  -0.489  1.00 0.00 ? 12  ILE A HD13 1  
ATOM   186    N N    . ILE A 1 13  ? -11.215 -3.093  3.731   1.00 0.00 ? 13  ILE A N    1  
ATOM   187    C CA   . ILE A 1 13  ? -11.978 -2.093  4.464   1.00 0.00 ? 13  ILE A CA   1  
ATOM   188    C C    . ILE A 1 13  ? -11.259 -1.744  5.765   1.00 0.00 ? 13  ILE A C    1  
ATOM   189    O O    . ILE A 1 13  ? -11.114 -0.572  6.117   1.00 0.00 ? 13  ILE A O    1  
ATOM   190    C CB   . ILE A 1 13  ? -13.377 -2.639  4.765   1.00 0.00 ? 13  ILE A CB   1  
ATOM   191    C CG1  . ILE A 1 13  ? -14.165 -2.796  3.447   1.00 0.00 ? 13  ILE A CG1  1  
ATOM   192    C CG2  . ILE A 1 13  ? -14.117 -1.700  5.726   1.00 0.00 ? 13  ILE A CG2  1  
ATOM   193    C CD1  . ILE A 1 13  ? -14.698 -1.448  2.932   1.00 0.00 ? 13  ILE A CD1  1  
ATOM   194    H H    . ILE A 1 13  ? -11.596 -3.988  3.590   1.00 0.00 ? 13  ILE A H    1  
ATOM   195    H HA   . ILE A 1 13  ? -12.062 -1.202  3.859   1.00 0.00 ? 13  ILE A HA   1  
ATOM   196    H HB   . ILE A 1 13  ? -13.278 -3.608  5.234   1.00 0.00 ? 13  ILE A HB   1  
ATOM   197    H HG12 . ILE A 1 13  ? -13.515 -3.222  2.700   1.00 0.00 ? 13  ILE A HG12 1  
ATOM   198    H HG13 . ILE A 1 13  ? -14.987 -3.461  3.607   1.00 0.00 ? 13  ILE A HG13 1  
ATOM   199    H HG21 . ILE A 1 13  ? -14.157 -0.706  5.302   1.00 0.00 ? 13  ILE A HG21 1  
ATOM   200    H HG22 . ILE A 1 13  ? -15.121 -2.063  5.881   1.00 0.00 ? 13  ILE A HG22 1  
ATOM   201    H HG23 . ILE A 1 13  ? -13.603 -1.668  6.672   1.00 0.00 ? 13  ILE A HG23 1  
ATOM   202    H HD11 . ILE A 1 13  ? -15.297 -0.971  3.686   1.00 0.00 ? 13  ILE A HD11 1  
ATOM   203    H HD12 . ILE A 1 13  ? -13.884 -0.814  2.673   1.00 0.00 ? 13  ILE A HD12 1  
ATOM   204    H HD13 . ILE A 1 13  ? -15.304 -1.615  2.057   1.00 0.00 ? 13  ILE A HD13 1  
ATOM   205    N N    . ASN A 1 14  ? -10.803 -2.775  6.471   1.00 0.00 ? 14  ASN A N    1  
ATOM   206    C CA   . ASN A 1 14  ? -10.094 -2.575  7.734   1.00 0.00 ? 14  ASN A CA   1  
ATOM   207    C C    . ASN A 1 14  ? -8.842  -1.734  7.501   1.00 0.00 ? 14  ASN A C    1  
ATOM   208    O O    . ASN A 1 14  ? -8.580  -0.766  8.217   1.00 0.00 ? 14  ASN A O    1  
ATOM   209    C CB   . ASN A 1 14  ? -9.719  -3.934  8.343   1.00 0.00 ? 14  ASN A CB   1  
ATOM   210    C CG   . ASN A 1 14  ? -9.605  -3.836  9.862   1.00 0.00 ? 14  ASN A CG   1  
ATOM   211    O OD1  . ASN A 1 14  ? -9.659  -2.748  10.423  1.00 0.00 ? 14  ASN A OD1  1  
ATOM   212    N ND2  . ASN A 1 14  ? -9.449  -4.922  10.563  1.00 0.00 ? 14  ASN A ND2  1  
ATOM   213    H H    . ASN A 1 14  ? -10.942 -3.689  6.133   1.00 0.00 ? 14  ASN A H    1  
ATOM   214    H HA   . ASN A 1 14  ? -10.742 -2.049  8.418   1.00 0.00 ? 14  ASN A HA   1  
ATOM   215    H HB2  . ASN A 1 14  ? -10.483 -4.656  8.097   1.00 0.00 ? 14  ASN A HB2  1  
ATOM   216    H HB3  . ASN A 1 14  ? -8.775  -4.264  7.937   1.00 0.00 ? 14  ASN A HB3  1  
ATOM   217    H HD21 . ASN A 1 14  ? -9.405  -5.789  10.115  1.00 0.00 ? 14  ASN A HD21 1  
ATOM   218    H HD22 . ASN A 1 14  ? -9.378  -4.868  11.539  1.00 0.00 ? 14  ASN A HD22 1  
ATOM   219    N N    . SER A 1 15  ? -8.077  -2.097  6.476   1.00 0.00 ? 15  SER A N    1  
ATOM   220    C CA   . SER A 1 15  ? -6.867  -1.350  6.145   1.00 0.00 ? 15  SER A CA   1  
ATOM   221    C C    . SER A 1 15  ? -7.224  0.097   5.824   1.00 0.00 ? 15  SER A C    1  
ATOM   222    O O    . SER A 1 15  ? -6.556  1.030   6.268   1.00 0.00 ? 15  SER A O    1  
ATOM   223    C CB   . SER A 1 15  ? -6.171  -1.981  4.939   1.00 0.00 ? 15  SER A CB   1  
ATOM   224    O OG   . SER A 1 15  ? -6.882  -1.640  3.757   1.00 0.00 ? 15  SER A OG   1  
ATOM   225    H H    . SER A 1 15  ? -8.341  -2.867  5.924   1.00 0.00 ? 15  SER A H    1  
ATOM   226    H HA   . SER A 1 15  ? -6.201  -1.367  6.992   1.00 0.00 ? 15  SER A HA   1  
ATOM   227    H HB2  . SER A 1 15  ? -5.162  -1.611  4.867   1.00 0.00 ? 15  SER A HB2  1  
ATOM   228    H HB3  . SER A 1 15  ? -6.151  -3.054  5.059   1.00 0.00 ? 15  SER A HB3  1  
ATOM   229    H HG   . SER A 1 15  ? -6.812  -2.377  3.146   1.00 0.00 ? 15  SER A HG   1  
ATOM   230    N N    . GLY A 1 16  ? -8.303  0.273   5.060   1.00 0.00 ? 16  GLY A N    1  
ATOM   231    C CA   . GLY A 1 16  ? -8.760  1.611   4.697   1.00 0.00 ? 16  GLY A CA   1  
ATOM   232    C C    . GLY A 1 16  ? -9.165  2.396   5.939   1.00 0.00 ? 16  GLY A C    1  
ATOM   233    O O    . GLY A 1 16  ? -8.809  3.567   6.086   1.00 0.00 ? 16  GLY A O    1  
ATOM   234    H H    . GLY A 1 16  ? -8.808  -0.510  4.748   1.00 0.00 ? 16  GLY A H    1  
ATOM   235    H HA2  . GLY A 1 16  ? -7.959  2.133   4.193   1.00 0.00 ? 16  GLY A HA2  1  
ATOM   236    H HA3  . GLY A 1 16  ? -9.608  1.533   4.034   1.00 0.00 ? 16  GLY A HA3  1  
ATOM   237    N N    . GLN A 1 17  ? -9.899  1.747   6.844   1.00 0.00 ? 17  GLN A N    1  
ATOM   238    C CA   . GLN A 1 17  ? -10.317 2.413   8.078   1.00 0.00 ? 17  GLN A CA   1  
ATOM   239    C C    . GLN A 1 17  ? -9.088  2.793   8.891   1.00 0.00 ? 17  GLN A C    1  
ATOM   240    O O    . GLN A 1 17  ? -9.024  3.880   9.466   1.00 0.00 ? 17  GLN A O    1  
ATOM   241    C CB   . GLN A 1 17  ? -11.231 1.489   8.890   1.00 0.00 ? 17  GLN A CB   1  
ATOM   242    C CG   . GLN A 1 17  ? -12.046 2.302   9.912   1.00 0.00 ? 17  GLN A CG   1  
ATOM   243    C CD   . GLN A 1 17  ? -13.410 1.651   10.126  1.00 0.00 ? 17  GLN A CD   1  
ATOM   244    O OE1  . GLN A 1 17  ? -13.596 0.477   9.805   1.00 0.00 ? 17  GLN A OE1  1  
ATOM   245    N NE2  . GLN A 1 17  ? -14.382 2.351   10.644  1.00 0.00 ? 17  GLN A NE2  1  
ATOM   246    H H    . GLN A 1 17  ? -10.145 0.807   6.685   1.00 0.00 ? 17  GLN A H    1  
ATOM   247    H HA   . GLN A 1 17  ? -10.860 3.310   7.825   1.00 0.00 ? 17  GLN A HA   1  
ATOM   248    H HB2  . GLN A 1 17  ? -11.904 0.976   8.218   1.00 0.00 ? 17  GLN A HB2  1  
ATOM   249    H HB3  . GLN A 1 17  ? -10.628 0.763   9.414   1.00 0.00 ? 17  GLN A HB3  1  
ATOM   250    H HG2  . GLN A 1 17  ? -11.515 2.329   10.852  1.00 0.00 ? 17  GLN A HG2  1  
ATOM   251    H HG3  . GLN A 1 17  ? -12.189 3.310   9.555   1.00 0.00 ? 17  GLN A HG3  1  
ATOM   252    H HE21 . GLN A 1 17  ? -14.233 3.287   10.893  1.00 0.00 ? 17  GLN A HE21 1  
ATOM   253    H HE22 . GLN A 1 17  ? -15.261 1.941   10.781  1.00 0.00 ? 17  GLN A HE22 1  
ATOM   254    N N    . ALA A 1 18  ? -8.113  1.888   8.928   1.00 0.00 ? 18  ALA A N    1  
ATOM   255    C CA   . ALA A 1 18  ? -6.883  2.136   9.666   1.00 0.00 ? 18  ALA A CA   1  
ATOM   256    C C    . ALA A 1 18  ? -6.222  3.414   9.161   1.00 0.00 ? 18  ALA A C    1  
ATOM   257    O O    . ALA A 1 18  ? -5.883  4.308   9.943   1.00 0.00 ? 18  ALA A O    1  
ATOM   258    C CB   . ALA A 1 18  ? -5.934  0.945   9.511   1.00 0.00 ? 18  ALA A CB   1  
ATOM   259    H H    . ALA A 1 18  ? -8.222  1.039   8.442   1.00 0.00 ? 18  ALA A H    1  
ATOM   260    H HA   . ALA A 1 18  ? -7.127  2.261   10.711  1.00 0.00 ? 18  ALA A HA   1  
ATOM   261    H HB1  . ALA A 1 18  ? -5.274  1.113   8.672   1.00 0.00 ? 18  ALA A HB1  1  
ATOM   262    H HB2  . ALA A 1 18  ? -6.510  0.047   9.344   1.00 0.00 ? 18  ALA A HB2  1  
ATOM   263    H HB3  . ALA A 1 18  ? -5.349  0.835   10.413  1.00 0.00 ? 18  ALA A HB3  1  
ATOM   264    N N    . ARG A 1 19  ? -6.058  3.515   7.846   1.00 0.00 ? 19  ARG A N    1  
ATOM   265    C CA   . ARG A 1 19  ? -5.458  4.711   7.269   1.00 0.00 ? 19  ARG A CA   1  
ATOM   266    C C    . ARG A 1 19  ? -6.308  5.927   7.616   1.00 0.00 ? 19  ARG A C    1  
ATOM   267    O O    . ARG A 1 19  ? -5.791  6.963   8.041   1.00 0.00 ? 19  ARG A O    1  
ATOM   268    C CB   . ARG A 1 19  ? -5.349  4.588   5.744   1.00 0.00 ? 19  ARG A CB   1  
ATOM   269    C CG   . ARG A 1 19  ? -4.626  5.826   5.191   1.00 0.00 ? 19  ARG A CG   1  
ATOM   270    C CD   . ARG A 1 19  ? -4.400  5.683   3.685   1.00 0.00 ? 19  ARG A CD   1  
ATOM   271    N NE   . ARG A 1 19  ? -5.677  5.687   2.970   1.00 0.00 ? 19  ARG A NE   1  
ATOM   272    C CZ   . ARG A 1 19  ? -5.721  5.765   1.650   1.00 0.00 ? 19  ARG A CZ   1  
ATOM   273    N NH1  . ARG A 1 19  ? -4.621  5.778   0.970   1.00 0.00 ? 19  ARG A NH1  1  
ATOM   274    N NH2  . ARG A 1 19  ? -6.860  5.821   1.041   1.00 0.00 ? 19  ARG A NH2  1  
ATOM   275    H H    . ARG A 1 19  ? -6.361  2.786   7.261   1.00 0.00 ? 19  ARG A H    1  
ATOM   276    H HA   . ARG A 1 19  ? -4.471  4.841   7.686   1.00 0.00 ? 19  ARG A HA   1  
ATOM   277    H HB2  . ARG A 1 19  ? -4.795  3.697   5.492   1.00 0.00 ? 19  ARG A HB2  1  
ATOM   278    H HB3  . ARG A 1 19  ? -6.341  4.531   5.316   1.00 0.00 ? 19  ARG A HB3  1  
ATOM   279    H HG2  . ARG A 1 19  ? -5.222  6.708   5.382   1.00 0.00 ? 19  ARG A HG2  1  
ATOM   280    H HG3  . ARG A 1 19  ? -3.670  5.929   5.685   1.00 0.00 ? 19  ARG A HG3  1  
ATOM   281    H HD2  . ARG A 1 19  ? -3.800  6.517   3.341   1.00 0.00 ? 19  ARG A HD2  1  
ATOM   282    H HD3  . ARG A 1 19  ? -3.877  4.757   3.488   1.00 0.00 ? 19  ARG A HD3  1  
ATOM   283    H HE   . ARG A 1 19  ? -6.514  5.654   3.483   1.00 0.00 ? 19  ARG A HE   1  
ATOM   284    H HH11 . ARG A 1 19  ? -3.742  5.729   1.446   1.00 0.00 ? 19  ARG A HH11 1  
ATOM   285    H HH12 . ARG A 1 19  ? -4.643  5.839   -0.022  1.00 0.00 ? 19  ARG A HH12 1  
ATOM   286    H HH21 . ARG A 1 19  ? -7.712  5.804   1.566   1.00 0.00 ? 19  ARG A HH21 1  
ATOM   287    H HH22 . ARG A 1 19  ? -6.892  5.884   0.045   1.00 0.00 ? 19  ARG A HH22 1  
ATOM   288    N N    . SER A 1 20  ? -7.616  5.793   7.429   1.00 0.00 ? 20  SER A N    1  
ATOM   289    C CA   . SER A 1 20  ? -8.535  6.885   7.725   1.00 0.00 ? 20  SER A CA   1  
ATOM   290    C C    . SER A 1 20  ? -8.317  7.389   9.148   1.00 0.00 ? 20  SER A C    1  
ATOM   291    O O    . SER A 1 20  ? -8.193  8.595   9.385   1.00 0.00 ? 20  SER A O    1  
ATOM   292    C CB   . SER A 1 20  ? -9.979  6.421   7.555   1.00 0.00 ? 20  SER A CB   1  
ATOM   293    O OG   . SER A 1 20  ? -10.849 7.367   8.161   1.00 0.00 ? 20  SER A OG   1  
ATOM   294    H H    . SER A 1 20  ? -7.970  4.940   7.090   1.00 0.00 ? 20  SER A H    1  
ATOM   295    H HA   . SER A 1 20  ? -8.341  7.694   7.039   1.00 0.00 ? 20  SER A HA   1  
ATOM   296    H HB2  . SER A 1 20  ? -10.213 6.344   6.507   1.00 0.00 ? 20  SER A HB2  1  
ATOM   297    H HB3  . SER A 1 20  ? -10.100 5.453   8.022   1.00 0.00 ? 20  SER A HB3  1  
ATOM   298    H HG   . SER A 1 20  ? -10.606 8.239   7.842   1.00 0.00 ? 20  SER A HG   1  
ATOM   299    N N    . LEU A 1 21  ? -8.243  6.460   10.092  1.00 0.00 ? 21  LEU A N    1  
ATOM   300    C CA   . LEU A 1 21  ? -8.009  6.821   11.486  1.00 0.00 ? 21  LEU A CA   1  
ATOM   301    C C    . LEU A 1 21  ? -6.645  7.498   11.630  1.00 0.00 ? 21  LEU A C    1  
ATOM   302    O O    . LEU A 1 21  ? -6.506  8.501   12.333  1.00 0.00 ? 21  LEU A O    1  
ATOM   303    C CB   . LEU A 1 21  ? -8.047  5.568   12.368  1.00 0.00 ? 21  LEU A CB   1  
ATOM   304    C CG   . LEU A 1 21  ? -9.482  5.025   12.441  1.00 0.00 ? 21  LEU A CG   1  
ATOM   305    C CD1  . LEU A 1 21  ? -9.477  3.618   13.065  1.00 0.00 ? 21  LEU A CD1  1  
ATOM   306    C CD2  . LEU A 1 21  ? -10.363 5.971   13.289  1.00 0.00 ? 21  LEU A CD2  1  
ATOM   307    H H    . LEU A 1 21  ? -8.327  5.513   9.846   1.00 0.00 ? 21  LEU A H    1  
ATOM   308    H HA   . LEU A 1 21  ? -8.776  7.508   11.809  1.00 0.00 ? 21  LEU A HA   1  
ATOM   309    H HB2  . LEU A 1 21  ? -7.395  4.819   11.944  1.00 0.00 ? 21  LEU A HB2  1  
ATOM   310    H HB3  . LEU A 1 21  ? -7.707  5.818   13.362  1.00 0.00 ? 21  LEU A HB3  1  
ATOM   311    H HG   . LEU A 1 21  ? -9.886  4.964   11.441  1.00 0.00 ? 21  LEU A HG   1  
ATOM   312    H HD11 . LEU A 1 21  ? -8.540  3.125   12.854  1.00 0.00 ? 21  LEU A HD11 1  
ATOM   313    H HD12 . LEU A 1 21  ? -9.607  3.698   14.134  1.00 0.00 ? 21  LEU A HD12 1  
ATOM   314    H HD13 . LEU A 1 21  ? -10.288 3.039   12.649  1.00 0.00 ? 21  LEU A HD13 1  
ATOM   315    H HD21 . LEU A 1 21  ? -9.757  6.754   13.722  1.00 0.00 ? 21  LEU A HD21 1  
ATOM   316    H HD22 . LEU A 1 21  ? -11.119 6.414   12.657  1.00 0.00 ? 21  LEU A HD22 1  
ATOM   317    H HD23 . LEU A 1 21  ? -10.844 5.416   14.083  1.00 0.00 ? 21  LEU A HD23 1  
ATOM   318    N N    . ALA A 1 22  ? -5.643  6.944   10.949  1.00 0.00 ? 22  ALA A N    1  
ATOM   319    C CA   . ALA A 1 22  ? -4.295  7.505   11.000  1.00 0.00 ? 22  ALA A CA   1  
ATOM   320    C C    . ALA A 1 22  ? -4.301  8.964   10.532  1.00 0.00 ? 22  ALA A C    1  
ATOM   321    O O    . ALA A 1 22  ? -3.807  9.848   11.233  1.00 0.00 ? 22  ALA A O    1  
ATOM   322    C CB   . ALA A 1 22  ? -3.355  6.669   10.129  1.00 0.00 ? 22  ALA A CB   1  
ATOM   323    H H    . ALA A 1 22  ? -5.818  6.149   10.400  1.00 0.00 ? 22  ALA A H    1  
ATOM   324    H HA   . ALA A 1 22  ? -3.944  7.474   12.019  1.00 0.00 ? 22  ALA A HA   1  
ATOM   325    H HB1  . ALA A 1 22  ? -2.330  6.923   10.362  1.00 0.00 ? 22  ALA A HB1  1  
ATOM   326    H HB2  . ALA A 1 22  ? -3.519  5.621   10.329  1.00 0.00 ? 22  ALA A HB2  1  
ATOM   327    H HB3  . ALA A 1 22  ? -3.549  6.872   9.087   1.00 0.00 ? 22  ALA A HB3  1  
ATOM   328    N N    . TYR A 1 23  ? -4.876  9.218   9.357   1.00 0.00 ? 23  TYR A N    1  
ATOM   329    C CA   . TYR A 1 23  ? -4.948  10.593  8.850   1.00 0.00 ? 23  TYR A CA   1  
ATOM   330    C C    . TYR A 1 23  ? -5.722  11.458  9.838   1.00 0.00 ? 23  TYR A C    1  
ATOM   331    O O    . TYR A 1 23  ? -5.339  12.594  10.122  1.00 0.00 ? 23  TYR A O    1  
ATOM   332    C CB   . TYR A 1 23  ? -5.624  10.619  7.481   1.00 0.00 ? 23  TYR A CB   1  
ATOM   333    C CG   . TYR A 1 23  ? -5.772  12.047  7.022   1.00 0.00 ? 23  TYR A CG   1  
ATOM   334    C CD1  . TYR A 1 23  ? -4.672  12.732  6.494   1.00 0.00 ? 23  TYR A CD1  1  
ATOM   335    C CD2  . TYR A 1 23  ? -7.012  12.687  7.125   1.00 0.00 ? 23  TYR A CD2  1  
ATOM   336    C CE1  . TYR A 1 23  ? -4.812  14.058  6.067   1.00 0.00 ? 23  TYR A CE1  1  
ATOM   337    C CE2  . TYR A 1 23  ? -7.153  14.012  6.699   1.00 0.00 ? 23  TYR A CE2  1  
ATOM   338    C CZ   . TYR A 1 23  ? -6.054  14.698  6.170   1.00 0.00 ? 23  TYR A CZ   1  
ATOM   339    O OH   . TYR A 1 23  ? -6.193  16.005  5.749   1.00 0.00 ? 23  TYR A OH   1  
ATOM   340    H H    . TYR A 1 23  ? -5.269  8.481   8.837   1.00 0.00 ? 23  TYR A H    1  
ATOM   341    H HA   . TYR A 1 23  ? -3.946  10.984  8.764   1.00 0.00 ? 23  TYR A HA   1  
ATOM   342    H HB2  . TYR A 1 23  ? -5.021  10.072  6.772   1.00 0.00 ? 23  TYR A HB2  1  
ATOM   343    H HB3  . TYR A 1 23  ? -6.600  10.161  7.553   1.00 0.00 ? 23  TYR A HB3  1  
ATOM   344    H HD1  . TYR A 1 23  ? -3.715  12.238  6.415   1.00 0.00 ? 23  TYR A HD1  1  
ATOM   345    H HD2  . TYR A 1 23  ? -7.861  12.158  7.533   1.00 0.00 ? 23  TYR A HD2  1  
ATOM   346    H HE1  . TYR A 1 23  ? -3.964  14.587  5.660   1.00 0.00 ? 23  TYR A HE1  1  
ATOM   347    H HE2  . TYR A 1 23  ? -8.111  14.506  6.778   1.00 0.00 ? 23  TYR A HE2  1  
ATOM   348    H HH   . TYR A 1 23  ? -5.382  16.261  5.305   1.00 0.00 ? 23  TYR A HH   1  
ATOM   349    N N    . ALA A 1 24  ? -6.803  10.907  10.387  1.00 0.00 ? 24  ALA A N    1  
ATOM   350    C CA   . ALA A 1 24  ? -7.591  11.645  11.361  1.00 0.00 ? 24  ALA A CA   1  
ATOM   351    C C    . ALA A 1 24  ? -6.715  11.960  12.576  1.00 0.00 ? 24  ALA A C    1  
ATOM   352    O O    . ALA A 1 24  ? -6.749  13.068  13.114  1.00 0.00 ? 24  ALA A O    1  
ATOM   353    C CB   . ALA A 1 24  ? -8.831  10.828  11.759  1.00 0.00 ? 24  ALA A CB   1  
ATOM   354    H H    . ALA A 1 24  ? -7.059  9.991   10.146  1.00 0.00 ? 24  ALA A H    1  
ATOM   355    H HA   . ALA A 1 24  ? -7.909  12.577  10.916  1.00 0.00 ? 24  ALA A HA   1  
ATOM   356    H HB1  . ALA A 1 24  ? -9.721  11.317  11.386  1.00 0.00 ? 24  ALA A HB1  1  
ATOM   357    H HB2  . ALA A 1 24  ? -8.890  10.751  12.833  1.00 0.00 ? 24  ALA A HB2  1  
ATOM   358    H HB3  . ALA A 1 24  ? -8.762  9.838   11.331  1.00 0.00 ? 24  ALA A HB3  1  
ATOM   359    N N    . ALA A 1 25  ? -5.898  10.984  12.976  1.00 0.00 ? 25  ALA A N    1  
ATOM   360    C CA   . ALA A 1 25  ? -4.987  11.177  14.102  1.00 0.00 ? 25  ALA A CA   1  
ATOM   361    C C    . ALA A 1 25  ? -4.063  12.356  13.815  1.00 0.00 ? 25  ALA A C    1  
ATOM   362    O O    . ALA A 1 25  ? -3.837  13.216  14.671  1.00 0.00 ? 25  ALA A O    1  
ATOM   363    C CB   . ALA A 1 25  ? -4.158  9.909   14.323  1.00 0.00 ? 25  ALA A CB   1  
ATOM   364    H H    . ALA A 1 25  ? -5.893  10.131  12.490  1.00 0.00 ? 25  ALA A H    1  
ATOM   365    H HA   . ALA A 1 25  ? -5.560  11.388  14.991  1.00 0.00 ? 25  ALA A HA   1  
ATOM   366    H HB1  . ALA A 1 25  ? -3.335  9.888   13.621  1.00 0.00 ? 25  ALA A HB1  1  
ATOM   367    H HB2  . ALA A 1 25  ? -4.781  9.039   14.172  1.00 0.00 ? 25  ALA A HB2  1  
ATOM   368    H HB3  . ALA A 1 25  ? -3.769  9.904   15.331  1.00 0.00 ? 25  ALA A HB3  1  
ATOM   369    N N    . LEU A 1 26  ? -3.546  12.400  12.594  1.00 0.00 ? 26  LEU A N    1  
ATOM   370    C CA   . LEU A 1 26  ? -2.662  13.490  12.187  1.00 0.00 ? 26  LEU A CA   1  
ATOM   371    C C    . LEU A 1 26  ? -3.408  14.819  12.255  1.00 0.00 ? 26  LEU A C    1  
ATOM   372    O O    . LEU A 1 26  ? -2.883  15.821  12.747  1.00 0.00 ? 26  LEU A O    1  
ATOM   373    C CB   . LEU A 1 26  ? -2.152  13.243  10.762  1.00 0.00 ? 26  LEU A CB   1  
ATOM   374    C CG   . LEU A 1 26  ? -1.356  14.454  10.254  1.00 0.00 ? 26  LEU A CG   1  
ATOM   375    C CD1  . LEU A 1 26  ? -0.152  14.717  11.159  1.00 0.00 ? 26  LEU A CD1  1  
ATOM   376    C CD2  . LEU A 1 26  ? -0.863  14.163  8.835   1.00 0.00 ? 26  LEU A CD2  1  
ATOM   377    H H    . LEU A 1 26  ? -3.773  11.694  11.949  1.00 0.00 ? 26  LEU A H    1  
ATOM   378    H HA   . LEU A 1 26  ? -1.823  13.525  12.862  1.00 0.00 ? 26  LEU A HA   1  
ATOM   379    H HB2  . LEU A 1 26  ? -1.517  12.373  10.759  1.00 0.00 ? 26  LEU A HB2  1  
ATOM   380    H HB3  . LEU A 1 26  ? -2.995  13.073  10.105  1.00 0.00 ? 26  LEU A HB3  1  
ATOM   381    H HG   . LEU A 1 26  ? -1.992  15.328  10.238  1.00 0.00 ? 26  LEU A HG   1  
ATOM   382    H HD11 . LEU A 1 26  ? 0.332   13.781  11.396  1.00 0.00 ? 26  LEU A HD11 1  
ATOM   383    H HD12 . LEU A 1 26  ? 0.546   15.362  10.650  1.00 0.00 ? 26  LEU A HD12 1  
ATOM   384    H HD13 . LEU A 1 26  ? -0.483  15.192  12.072  1.00 0.00 ? 26  LEU A HD13 1  
ATOM   385    H HD21 . LEU A 1 26  ? -0.239  13.282  8.843   1.00 0.00 ? 26  LEU A HD21 1  
ATOM   386    H HD22 . LEU A 1 26  ? -1.710  13.997  8.185   1.00 0.00 ? 26  LEU A HD22 1  
ATOM   387    H HD23 . LEU A 1 26  ? -0.292  15.003  8.472   1.00 0.00 ? 26  LEU A HD23 1  
ATOM   388    N N    . LYS A 1 27  ? -4.640  14.819  11.762  1.00 0.00 ? 27  LYS A N    1  
ATOM   389    C CA   . LYS A 1 27  ? -5.456  16.026  11.783  1.00 0.00 ? 27  LYS A CA   1  
ATOM   390    C C    . LYS A 1 27  ? -5.593  16.550  13.215  1.00 0.00 ? 27  LYS A C    1  
ATOM   391    O O    . LYS A 1 27  ? -5.490  17.755  13.455  1.00 0.00 ? 27  LYS A O    1  
ATOM   392    C CB   . LYS A 1 27  ? -6.831  15.727  11.183  1.00 0.00 ? 27  LYS A CB   1  
ATOM   393    C CG   . LYS A 1 27  ? -7.639  17.022  11.066  1.00 0.00 ? 27  LYS A CG   1  
ATOM   394    C CD   . LYS A 1 27  ? -8.988  16.718  10.409  1.00 0.00 ? 27  LYS A CD   1  
ATOM   395    C CE   . LYS A 1 27  ? -9.801  18.005  10.276  1.00 0.00 ? 27  LYS A CE   1  
ATOM   396    N NZ   . LYS A 1 27  ? -11.099 17.700  9.607   1.00 0.00 ? 27  LYS A NZ   1  
ATOM   397    H H    . LYS A 1 27  ? -5.009  13.990  11.387  1.00 0.00 ? 27  LYS A H    1  
ATOM   398    H HA   . LYS A 1 27  ? -4.968  16.778  11.186  1.00 0.00 ? 27  LYS A HA   1  
ATOM   399    H HB2  . LYS A 1 27  ? -6.704  15.290  10.203  1.00 0.00 ? 27  LYS A HB2  1  
ATOM   400    H HB3  . LYS A 1 27  ? -7.359  15.032  11.820  1.00 0.00 ? 27  LYS A HB3  1  
ATOM   401    H HG2  . LYS A 1 27  ? -7.800  17.436  12.054  1.00 0.00 ? 27  LYS A HG2  1  
ATOM   402    H HG3  . LYS A 1 27  ? -7.095  17.735  10.462  1.00 0.00 ? 27  LYS A HG3  1  
ATOM   403    H HD2  . LYS A 1 27  ? -8.820  16.291  9.429   1.00 0.00 ? 27  LYS A HD2  1  
ATOM   404    H HD3  . LYS A 1 27  ? -9.532  16.009  11.019  1.00 0.00 ? 27  LYS A HD3  1  
ATOM   405    H HE2  . LYS A 1 27  ? -9.986  18.418  11.261  1.00 0.00 ? 27  LYS A HE2  1  
ATOM   406    H HE3  . LYS A 1 27  ? -9.247  18.722  9.685   1.00 0.00 ? 27  LYS A HE3  1  
ATOM   407    H HZ1  . LYS A 1 27  ? -10.921 17.235  8.694   1.00 0.00 ? 27  LYS A HZ1  1  
ATOM   408    H HZ2  . LYS A 1 27  ? -11.664 17.069  10.216  1.00 0.00 ? 27  LYS A HZ2  1  
ATOM   409    H HZ3  . LYS A 1 27  ? -11.623 18.585  9.445   1.00 0.00 ? 27  LYS A HZ3  1  
ATOM   410    N N    . GLN A 1 28  ? -5.793  15.639  14.163  1.00 0.00 ? 28  GLN A N    1  
ATOM   411    C CA   . GLN A 1 28  ? -5.905  16.027  15.567  1.00 0.00 ? 28  GLN A CA   1  
ATOM   412    C C    . GLN A 1 28  ? -4.631  16.743  16.001  1.00 0.00 ? 28  GLN A C    1  
ATOM   413    O O    . GLN A 1 28  ? -4.672  17.753  16.701  1.00 0.00 ? 28  GLN A O    1  
ATOM   414    C CB   . GLN A 1 28  ? -6.115  14.786  16.438  1.00 0.00 ? 28  GLN A CB   1  
ATOM   415    C CG   . GLN A 1 28  ? -7.484  14.175  16.139  1.00 0.00 ? 28  GLN A CG   1  
ATOM   416    C CD   . GLN A 1 28  ? -8.588  15.141  16.557  1.00 0.00 ? 28  GLN A CD   1  
ATOM   417    O OE1  . GLN A 1 28  ? -8.609  15.603  17.698  1.00 0.00 ? 28  GLN A OE1  1  
ATOM   418    N NE2  . GLN A 1 28  ? -9.511  15.476  15.698  1.00 0.00 ? 28  GLN A NE2  1  
ATOM   419    H H    . GLN A 1 28  ? -5.845  14.690  13.916  1.00 0.00 ? 28  GLN A H    1  
ATOM   420    H HA   . GLN A 1 28  ? -6.748  16.691  15.691  1.00 0.00 ? 28  GLN A HA   1  
ATOM   421    H HB2  . GLN A 1 28  ? -5.342  14.062  16.225  1.00 0.00 ? 28  GLN A HB2  1  
ATOM   422    H HB3  . GLN A 1 28  ? -6.069  15.066  17.480  1.00 0.00 ? 28  GLN A HB3  1  
ATOM   423    H HG2  . GLN A 1 28  ? -7.564  13.977  15.080  1.00 0.00 ? 28  GLN A HG2  1  
ATOM   424    H HG3  . GLN A 1 28  ? -7.592  13.251  16.686  1.00 0.00 ? 28  GLN A HG3  1  
ATOM   425    H HE21 . GLN A 1 28  ? -9.492  15.107  14.790  1.00 0.00 ? 28  GLN A HE21 1  
ATOM   426    H HE22 . GLN A 1 28  ? -10.223 16.096  15.961  1.00 0.00 ? 28  GLN A HE22 1  
ATOM   427    N N    . ALA A 1 29  ? -3.494  16.210  15.564  1.00 0.00 ? 29  ALA A N    1  
ATOM   428    C CA   . ALA A 1 29  ? -2.200  16.799  15.901  1.00 0.00 ? 29  ALA A CA   1  
ATOM   429    C C    . ALA A 1 29  ? -2.119  18.233  15.383  1.00 0.00 ? 29  ALA A C    1  
ATOM   430    O O    . ALA A 1 29  ? -1.657  19.134  16.078  1.00 0.00 ? 29  ALA A O    1  
ATOM   431    C CB   . ALA A 1 29  ? -1.067  15.961  15.298  1.00 0.00 ? 29  ALA A CB   1  
ATOM   432    H H    . ALA A 1 29  ? -3.524  15.408  15.000  1.00 0.00 ? 29  ALA A H    1  
ATOM   433    H HA   . ALA A 1 29  ? -2.090  16.814  16.976  1.00 0.00 ? 29  ALA A HA   1  
ATOM   434    H HB1  . ALA A 1 29  ? -0.158  16.129  15.856  1.00 0.00 ? 29  ALA A HB1  1  
ATOM   435    H HB2  . ALA A 1 29  ? -1.330  14.916  15.343  1.00 0.00 ? 29  ALA A HB2  1  
ATOM   436    H HB3  . ALA A 1 29  ? -0.914  16.249  14.267  1.00 0.00 ? 29  ALA A HB3  1  
ATOM   437    N N    . LYS A 1 30  ? -2.585  18.440  14.156  1.00 0.00 ? 30  LYS A N    1  
ATOM   438    C CA   . LYS A 1 30  ? -2.568  19.778  13.570  1.00 0.00 ? 30  LYS A CA   1  
ATOM   439    C C    . LYS A 1 30  ? -3.395  20.743  14.414  1.00 0.00 ? 30  LYS A C    1  
ATOM   440    O O    . LYS A 1 30  ? -3.080  21.928  14.486  1.00 0.00 ? 30  LYS A O    1  
ATOM   441    C CB   . LYS A 1 30  ? -3.123  19.752  12.141  1.00 0.00 ? 30  LYS A CB   1  
ATOM   442    C CG   . LYS A 1 30  ? -2.153  19.014  11.218  1.00 0.00 ? 30  LYS A CG   1  
ATOM   443    C CD   . LYS A 1 30  ? -2.677  19.090  9.781   1.00 0.00 ? 30  LYS A CD   1  
ATOM   444    C CE   . LYS A 1 30  ? -1.709  18.374  8.838   1.00 0.00 ? 30  LYS A CE   1  
ATOM   445    N NZ   . LYS A 1 30  ? -2.216  18.480  7.444   1.00 0.00 ? 30  LYS A NZ   1  
ATOM   446    H H    . LYS A 1 30  ? -2.954  17.687  13.647  1.00 0.00 ? 30  LYS A H    1  
ATOM   447    H HA   . LYS A 1 30  ? -1.551  20.131  13.543  1.00 0.00 ? 30  LYS A HA   1  
ATOM   448    H HB2  . LYS A 1 30  ? -4.081  19.249  12.137  1.00 0.00 ? 30  LYS A HB2  1  
ATOM   449    H HB3  . LYS A 1 30  ? -3.251  20.766  11.791  1.00 0.00 ? 30  LYS A HB3  1  
ATOM   450    H HG2  . LYS A 1 30  ? -1.179  19.477  11.277  1.00 0.00 ? 30  LYS A HG2  1  
ATOM   451    H HG3  . LYS A 1 30  ? -2.081  17.980  11.524  1.00 0.00 ? 30  LYS A HG3  1  
ATOM   452    H HD2  . LYS A 1 30  ? -3.649  18.615  9.730   1.00 0.00 ? 30  LYS A HD2  1  
ATOM   453    H HD3  . LYS A 1 30  ? -2.769  20.125  9.485   1.00 0.00 ? 30  LYS A HD3  1  
ATOM   454    H HE2  . LYS A 1 30  ? -0.734  18.836  8.905   1.00 0.00 ? 30  LYS A HE2  1  
ATOM   455    H HE3  . LYS A 1 30  ? -1.633  17.331  9.119   1.00 0.00 ? 30  LYS A HE3  1  
ATOM   456    H HZ1  . LYS A 1 30  ? -2.507  19.462  7.244   1.00 0.00 ? 30  LYS A HZ1  1  
ATOM   457    H HZ2  . LYS A 1 30  ? -1.461  18.201  6.776   1.00 0.00 ? 30  LYS A HZ2  1  
ATOM   458    H HZ3  . LYS A 1 30  ? -3.028  17.844  7.317   1.00 0.00 ? 30  LYS A HZ3  1  
ATOM   459    N N    . GLN A 1 31  ? -4.445  20.230  15.050  1.00 0.00 ? 31  GLN A N    1  
ATOM   460    C CA   . GLN A 1 31  ? -5.295  21.069  15.887  1.00 0.00 ? 31  GLN A CA   1  
ATOM   461    C C    . GLN A 1 31  ? -4.637  21.284  17.250  1.00 0.00 ? 31  GLN A C    1  
ATOM   462    O O    . GLN A 1 31  ? -5.159  22.005  18.096  1.00 0.00 ? 31  GLN A O    1  
ATOM   463    C CB   . GLN A 1 31  ? -6.677  20.427  16.063  1.00 0.00 ? 31  GLN A CB   1  
ATOM   464    C CG   . GLN A 1 31  ? -7.229  19.948  14.699  1.00 0.00 ? 31  GLN A CG   1  
ATOM   465    C CD   . GLN A 1 31  ? -8.688  20.367  14.523  1.00 0.00 ? 31  GLN A CD   1  
ATOM   466    O OE1  . GLN A 1 31  ? -9.419  20.518  15.494  1.00 0.00 ? 31  GLN A OE1  1  
ATOM   467    N NE2  . GLN A 1 31  ? -9.159  20.562  13.325  1.00 0.00 ? 31  GLN A NE2  1  
ATOM   468    H H    . GLN A 1 31  ? -4.648  19.275  14.959  1.00 0.00 ? 31  GLN A H    1  
ATOM   469    H HA   . GLN A 1 31  ? -5.415  22.030  15.410  1.00 0.00 ? 31  GLN A HA   1  
ATOM   470    H HB2  . GLN A 1 31  ? -6.590  19.584  16.736  1.00 0.00 ? 31  GLN A HB2  1  
ATOM   471    H HB3  . GLN A 1 31  ? -7.352  21.154  16.490  1.00 0.00 ? 31  GLN A HB3  1  
ATOM   472    H HG2  . GLN A 1 31  ? -6.643  20.376  13.900  1.00 0.00 ? 31  GLN A HG2  1  
ATOM   473    H HG3  . GLN A 1 31  ? -7.165  18.872  14.648  1.00 0.00 ? 31  GLN A HG3  1  
ATOM   474    H HE21 . GLN A 1 31  ? -8.580  20.443  12.547  1.00 0.00 ? 31  GLN A HE21 1  
ATOM   475    H HE22 . GLN A 1 31  ? -10.093 20.833  13.207  1.00 0.00 ? 31  GLN A HE22 1  
ATOM   476    N N    . GLY A 1 32  ? -3.476  20.661  17.446  1.00 0.00 ? 32  GLY A N    1  
ATOM   477    C CA   . GLY A 1 32  ? -2.741  20.797  18.703  1.00 0.00 ? 32  GLY A CA   1  
ATOM   478    C C    . GLY A 1 32  ? -3.281  19.852  19.775  1.00 0.00 ? 32  GLY A C    1  
ATOM   479    O O    . GLY A 1 32  ? -2.991  20.018  20.961  1.00 0.00 ? 32  GLY A O    1  
ATOM   480    H H    . GLY A 1 32  ? -3.099  20.106  16.729  1.00 0.00 ? 32  GLY A H    1  
ATOM   481    H HA2  . GLY A 1 32  ? -1.697  20.570  18.529  1.00 0.00 ? 32  GLY A HA2  1  
ATOM   482    H HA3  . GLY A 1 32  ? -2.826  21.813  19.053  1.00 0.00 ? 32  GLY A HA3  1  
ATOM   483    N N    . ASP A 1 33  ? -4.056  18.855  19.353  1.00 0.00 ? 33  ASP A N    1  
ATOM   484    C CA   . ASP A 1 33  ? -4.626  17.883  20.282  1.00 0.00 ? 33  ASP A CA   1  
ATOM   485    C C    . ASP A 1 33  ? -3.778  16.614  20.313  1.00 0.00 ? 33  ASP A C    1  
ATOM   486    O O    . ASP A 1 33  ? -4.093  15.621  19.648  1.00 0.00 ? 33  ASP A O    1  
ATOM   487    C CB   . ASP A 1 33  ? -6.054  17.541  19.853  1.00 0.00 ? 33  ASP A CB   1  
ATOM   488    C CG   . ASP A 1 33  ? -6.978  18.726  20.105  1.00 0.00 ? 33  ASP A CG   1  
ATOM   489    O OD1  . ASP A 1 33  ? -6.549  19.659  20.760  1.00 0.00 ? 33  ASP A OD1  1  
ATOM   490    O OD2  . ASP A 1 33  ? -8.104  18.673  19.650  1.00 0.00 ? 33  ASP A OD2  1  
ATOM   491    H H    . ASP A 1 33  ? -4.247  18.772  18.395  1.00 0.00 ? 33  ASP A H    1  
ATOM   492    H HA   . ASP A 1 33  ? -4.654  18.315  21.275  1.00 0.00 ? 33  ASP A HA   1  
ATOM   493    H HB2  . ASP A 1 33  ? -6.063  17.302  18.800  1.00 0.00 ? 33  ASP A HB2  1  
ATOM   494    H HB3  . ASP A 1 33  ? -6.406  16.692  20.417  1.00 0.00 ? 33  ASP A HB3  1  
ATOM   495    N N    . PHE A 1 34  ? -2.694  16.647  21.078  1.00 0.00 ? 34  PHE A N    1  
ATOM   496    C CA   . PHE A 1 34  ? -1.800  15.494  21.172  1.00 0.00 ? 34  PHE A CA   1  
ATOM   497    C C    . PHE A 1 34  ? -2.483  14.295  21.823  1.00 0.00 ? 34  PHE A C    1  
ATOM   498    O O    . PHE A 1 34  ? -2.212  13.149  21.465  1.00 0.00 ? 34  PHE A O    1  
ATOM   499    C CB   . PHE A 1 34  ? -0.562  15.854  21.992  1.00 0.00 ? 34  PHE A CB   1  
ATOM   500    C CG   . PHE A 1 34  ? 0.221   16.936  21.294  1.00 0.00 ? 34  PHE A CG   1  
ATOM   501    C CD1  . PHE A 1 34  ? 0.348   18.200  21.880  1.00 0.00 ? 34  PHE A CD1  1  
ATOM   502    C CD2  . PHE A 1 34  ? 0.815   16.676  20.053  1.00 0.00 ? 34  PHE A CD2  1  
ATOM   503    C CE1  . PHE A 1 34  ? 1.082   19.199  21.232  1.00 0.00 ? 34  PHE A CE1  1  
ATOM   504    C CE2  . PHE A 1 34  ? 1.547   17.676  19.406  1.00 0.00 ? 34  PHE A CE2  1  
ATOM   505    C CZ   . PHE A 1 34  ? 1.673   18.937  19.993  1.00 0.00 ? 34  PHE A CZ   1  
ATOM   506    H H    . PHE A 1 34  ? -2.485  17.466  21.578  1.00 0.00 ? 34  PHE A H    1  
ATOM   507    H HA   . PHE A 1 34  ? -1.485  15.217  20.177  1.00 0.00 ? 34  PHE A HA   1  
ATOM   508    H HB2  . PHE A 1 34  ? -0.865  16.203  22.970  1.00 0.00 ? 34  PHE A HB2  1  
ATOM   509    H HB3  . PHE A 1 34  ? 0.063   14.980  22.102  1.00 0.00 ? 34  PHE A HB3  1  
ATOM   510    H HD1  . PHE A 1 34  ? -0.110  18.406  22.836  1.00 0.00 ? 34  PHE A HD1  1  
ATOM   511    H HD2  . PHE A 1 34  ? 0.718   15.702  19.601  1.00 0.00 ? 34  PHE A HD2  1  
ATOM   512    H HE1  . PHE A 1 34  ? 1.183   20.177  21.680  1.00 0.00 ? 34  PHE A HE1  1  
ATOM   513    H HE2  . PHE A 1 34  ? 2.006   17.476  18.450  1.00 0.00 ? 34  PHE A HE2  1  
ATOM   514    H HZ   . PHE A 1 34  ? 2.240   19.711  19.494  1.00 0.00 ? 34  PHE A HZ   1  
ATOM   515    N N    . ALA A 1 35  ? -3.354  14.563  22.792  1.00 0.00 ? 35  ALA A N    1  
ATOM   516    C CA   . ALA A 1 35  ? -4.044  13.490  23.503  1.00 0.00 ? 35  ALA A CA   1  
ATOM   517    C C    . ALA A 1 35  ? -4.917  12.678  22.549  1.00 0.00 ? 35  ALA A C    1  
ATOM   518    O O    . ALA A 1 35  ? -4.839  11.449  22.515  1.00 0.00 ? 35  ALA A O    1  
ATOM   519    C CB   . ALA A 1 35  ? -4.902  14.087  24.626  1.00 0.00 ? 35  ALA A CB   1  
ATOM   520    H H    . ALA A 1 35  ? -3.521  15.494  23.042  1.00 0.00 ? 35  ALA A H    1  
ATOM   521    H HA   . ALA A 1 35  ? -3.306  12.832  23.939  1.00 0.00 ? 35  ALA A HA   1  
ATOM   522    H HB1  . ALA A 1 35  ? -5.231  15.075  24.343  1.00 0.00 ? 35  ALA A HB1  1  
ATOM   523    H HB2  . ALA A 1 35  ? -4.315  14.152  25.533  1.00 0.00 ? 35  ALA A HB2  1  
ATOM   524    H HB3  . ALA A 1 35  ? -5.763  13.457  24.800  1.00 0.00 ? 35  ALA A HB3  1  
ATOM   525    N N    . ALA A 1 36  ? -5.744  13.370  21.777  1.00 0.00 ? 36  ALA A N    1  
ATOM   526    C CA   . ALA A 1 36  ? -6.624  12.693  20.835  1.00 0.00 ? 36  ALA A CA   1  
ATOM   527    C C    . ALA A 1 36  ? -5.805  12.006  19.744  1.00 0.00 ? 36  ALA A C    1  
ATOM   528    O O    . ALA A 1 36  ? -6.127  10.897  19.319  1.00 0.00 ? 36  ALA A O    1  
ATOM   529    C CB   . ALA A 1 36  ? -7.622  13.697  20.228  1.00 0.00 ? 36  ALA A CB   1  
ATOM   530    H H    . ALA A 1 36  ? -5.760  14.347  21.842  1.00 0.00 ? 36  ALA A H    1  
ATOM   531    H HA   . ALA A 1 36  ? -7.175  11.934  21.367  1.00 0.00 ? 36  ALA A HA   1  
ATOM   532    H HB1  . ALA A 1 36  ? -8.632  13.356  20.413  1.00 0.00 ? 36  ALA A HB1  1  
ATOM   533    H HB2  . ALA A 1 36  ? -7.485  14.665  20.686  1.00 0.00 ? 36  ALA A HB2  1  
ATOM   534    H HB3  . ALA A 1 36  ? -7.462  13.777  19.162  1.00 0.00 ? 36  ALA A HB3  1  
ATOM   535    N N    . ALA A 1 37  ? -4.730  12.650  19.313  1.00 0.00 ? 37  ALA A N    1  
ATOM   536    C CA   . ALA A 1 37  ? -3.879  12.056  18.290  1.00 0.00 ? 37  ALA A CA   1  
ATOM   537    C C    . ALA A 1 37  ? -3.343  10.715  18.790  1.00 0.00 ? 37  ALA A C    1  
ATOM   538    O O    . ALA A 1 37  ? -3.468  9.692   18.114  1.00 0.00 ? 37  ALA A O    1  
ATOM   539    C CB   . ALA A 1 37  ? -2.716  13.003  17.951  1.00 0.00 ? 37  ALA A CB   1  
ATOM   540    H H    . ALA A 1 37  ? -4.497  13.523  19.695  1.00 0.00 ? 37  ALA A H    1  
ATOM   541    H HA   . ALA A 1 37  ? -4.465  11.887  17.398  1.00 0.00 ? 37  ALA A HA   1  
ATOM   542    H HB1  . ALA A 1 37  ? -1.849  12.426  17.658  1.00 0.00 ? 37  ALA A HB1  1  
ATOM   543    H HB2  . ALA A 1 37  ? -3.004  13.655  17.138  1.00 0.00 ? 37  ALA A HB2  1  
ATOM   544    H HB3  . ALA A 1 37  ? -2.471  13.600  18.817  1.00 0.00 ? 37  ALA A HB3  1  
ATOM   545    N N    . LYS A 1 38  ? -2.758  10.733  19.983  1.00 0.00 ? 38  LYS A N    1  
ATOM   546    C CA   . LYS A 1 38  ? -2.200  9.525   20.591  1.00 0.00 ? 38  LYS A CA   1  
ATOM   547    C C    . LYS A 1 38  ? -3.246  8.406   20.668  1.00 0.00 ? 38  LYS A C    1  
ATOM   548    O O    . LYS A 1 38  ? -2.967  7.258   20.320  1.00 0.00 ? 38  LYS A O    1  
ATOM   549    C CB   . LYS A 1 38  ? -1.676  9.873   22.001  1.00 0.00 ? 38  LYS A CB   1  
ATOM   550    C CG   . LYS A 1 38  ? -0.235  9.378   22.198  1.00 0.00 ? 38  LYS A CG   1  
ATOM   551    C CD   . LYS A 1 38  ? 0.302   9.914   23.534  1.00 0.00 ? 38  LYS A CD   1  
ATOM   552    C CE   . LYS A 1 38  ? 1.544   9.127   23.957  1.00 0.00 ? 38  LYS A CE   1  
ATOM   553    N NZ   . LYS A 1 38  ? 2.615   9.295   22.932  1.00 0.00 ? 38  LYS A NZ   1  
ATOM   554    H H    . LYS A 1 38  ? -2.703  11.582  20.474  1.00 0.00 ? 38  LYS A H    1  
ATOM   555    H HA   . LYS A 1 38  ? -1.377  9.183   19.983  1.00 0.00 ? 38  LYS A HA   1  
ATOM   556    H HB2  . LYS A 1 38  ? -1.698  10.946  22.129  1.00 0.00 ? 38  LYS A HB2  1  
ATOM   557    H HB3  . LYS A 1 38  ? -2.316  9.416   22.746  1.00 0.00 ? 38  LYS A HB3  1  
ATOM   558    H HG2  . LYS A 1 38  ? -0.222  8.296   22.207  1.00 0.00 ? 38  LYS A HG2  1  
ATOM   559    H HG3  . LYS A 1 38  ? 0.385   9.742   21.392  1.00 0.00 ? 38  LYS A HG3  1  
ATOM   560    H HD2  . LYS A 1 38  ? 0.556   10.961  23.427  1.00 0.00 ? 38  LYS A HD2  1  
ATOM   561    H HD3  . LYS A 1 38  ? -0.461  9.810   24.296  1.00 0.00 ? 38  LYS A HD3  1  
ATOM   562    H HE2  . LYS A 1 38  ? 1.895   9.496   24.912  1.00 0.00 ? 38  LYS A HE2  1  
ATOM   563    H HE3  . LYS A 1 38  ? 1.291   8.079   24.049  1.00 0.00 ? 38  LYS A HE3  1  
ATOM   564    H HZ1  . LYS A 1 38  ? 2.464   10.186  22.411  1.00 0.00 ? 38  LYS A HZ1  1  
ATOM   565    H HZ2  . LYS A 1 38  ? 3.545   9.327   23.401  1.00 0.00 ? 38  LYS A HZ2  1  
ATOM   566    H HZ3  . LYS A 1 38  ? 2.589   8.498   22.266  1.00 0.00 ? 38  LYS A HZ3  1  
ATOM   567    N N    . ALA A 1 39  ? -4.446  8.745   21.129  1.00 0.00 ? 39  ALA A N    1  
ATOM   568    C CA   . ALA A 1 39  ? -5.514  7.755   21.254  1.00 0.00 ? 39  ALA A CA   1  
ATOM   569    C C    . ALA A 1 39  ? -5.888  7.164   19.896  1.00 0.00 ? 39  ALA A C    1  
ATOM   570    O O    . ALA A 1 39  ? -6.119  5.960   19.768  1.00 0.00 ? 39  ALA A O    1  
ATOM   571    C CB   . ALA A 1 39  ? -6.748  8.405   21.894  1.00 0.00 ? 39  ALA A CB   1  
ATOM   572    H H    . ALA A 1 39  ? -4.614  9.676   21.390  1.00 0.00 ? 39  ALA A H    1  
ATOM   573    H HA   . ALA A 1 39  ? -5.172  6.957   21.896  1.00 0.00 ? 39  ALA A HA   1  
ATOM   574    H HB1  . ALA A 1 39  ? -7.349  7.643   22.369  1.00 0.00 ? 39  ALA A HB1  1  
ATOM   575    H HB2  . ALA A 1 39  ? -6.433  9.128   22.631  1.00 0.00 ? 39  ALA A HB2  1  
ATOM   576    H HB3  . ALA A 1 39  ? -7.333  8.900   21.131  1.00 0.00 ? 39  ALA A HB3  1  
ATOM   577    N N    . MET A 1 40  ? -5.951  8.022   18.887  1.00 0.00 ? 40  MET A N    1  
ATOM   578    C CA   . MET A 1 40  ? -6.307  7.581   17.540  1.00 0.00 ? 40  MET A CA   1  
ATOM   579    C C    . MET A 1 40  ? -5.237  6.652   16.963  1.00 0.00 ? 40  MET A C    1  
ATOM   580    O O    . MET A 1 40  ? -5.559  5.644   16.327  1.00 0.00 ? 40  MET A O    1  
ATOM   581    C CB   . MET A 1 40  ? -6.508  8.800   16.634  1.00 0.00 ? 40  MET A CB   1  
ATOM   582    C CG   . MET A 1 40  ? -7.737  9.589   17.104  1.00 0.00 ? 40  MET A CG   1  
ATOM   583    S SD   . MET A 1 40  ? -9.246  8.686   16.682  1.00 0.00 ? 40  MET A SD   1  
ATOM   584    C CE   . MET A 1 40  ? -9.436  9.338   15.007  1.00 0.00 ? 40  MET A CE   1  
ATOM   585    H H    . MET A 1 40  ? -5.762  8.969   19.050  1.00 0.00 ? 40  MET A H    1  
ATOM   586    H HA   . MET A 1 40  ? -7.239  7.036   17.591  1.00 0.00 ? 40  MET A HA   1  
ATOM   587    H HB2  . MET A 1 40  ? -5.632  9.432   16.684  1.00 0.00 ? 40  MET A HB2  1  
ATOM   588    H HB3  . MET A 1 40  ? -6.659  8.472   15.616  1.00 0.00 ? 40  MET A HB3  1  
ATOM   589    H HG2  . MET A 1 40  ? -7.691  9.721   18.175  1.00 0.00 ? 40  MET A HG2  1  
ATOM   590    H HG3  . MET A 1 40  ? -7.751  10.555  16.624  1.00 0.00 ? 40  MET A HG3  1  
ATOM   591    H HE1  . MET A 1 40  ? -9.501  10.417  15.048  1.00 0.00 ? 40  MET A HE1  1  
ATOM   592    H HE2  . MET A 1 40  ? -8.584  9.052   14.413  1.00 0.00 ? 40  MET A HE2  1  
ATOM   593    H HE3  . MET A 1 40  ? -10.336 8.934   14.564  1.00 0.00 ? 40  MET A HE3  1  
ATOM   594    N N    . MET A 1 41  ? -3.965  6.972   17.189  1.00 0.00 ? 41  MET A N    1  
ATOM   595    C CA   . MET A 1 41  ? -2.889  6.117   16.679  1.00 0.00 ? 41  MET A CA   1  
ATOM   596    C C    . MET A 1 41  ? -2.960  4.735   17.311  1.00 0.00 ? 41  MET A C    1  
ATOM   597    O O    . MET A 1 41  ? -2.743  3.721   16.639  1.00 0.00 ? 41  MET A O    1  
ATOM   598    C CB   . MET A 1 41  ? -1.503  6.684   17.005  1.00 0.00 ? 41  MET A CB   1  
ATOM   599    C CG   . MET A 1 41  ? -1.337  8.107   16.464  1.00 0.00 ? 41  MET A CG   1  
ATOM   600    S SD   . MET A 1 41  ? 0.414   8.421   16.097  1.00 0.00 ? 41  MET A SD   1  
ATOM   601    C CE   . MET A 1 41  ? 1.117   7.788   17.642  1.00 0.00 ? 41  MET A CE   1  
ATOM   602    H H    . MET A 1 41  ? -3.748  7.776   17.709  1.00 0.00 ? 41  MET A H    1  
ATOM   603    H HA   . MET A 1 41  ? -2.991  6.022   15.608  1.00 0.00 ? 41  MET A HA   1  
ATOM   604    H HB2  . MET A 1 41  ? -1.372  6.691   18.079  1.00 0.00 ? 41  MET A HB2  1  
ATOM   605    H HB3  . MET A 1 41  ? -0.756  6.043   16.563  1.00 0.00 ? 41  MET A HB3  1  
ATOM   606    H HG2  . MET A 1 41  ? -1.916  8.224   15.560  1.00 0.00 ? 41  MET A HG2  1  
ATOM   607    H HG3  . MET A 1 41  ? -1.678  8.813   17.204  1.00 0.00 ? 41  MET A HG3  1  
ATOM   608    H HE1  . MET A 1 41  ? 0.454   8.010   18.461  1.00 0.00 ? 41  MET A HE1  1  
ATOM   609    H HE2  . MET A 1 41  ? 1.243   6.717   17.562  1.00 0.00 ? 41  MET A HE2  1  
ATOM   610    H HE3  . MET A 1 41  ? 2.076   8.256   17.816  1.00 0.00 ? 41  MET A HE3  1  
ATOM   611    N N    . ASP A 1 42  ? -3.230  4.707   18.610  1.00 0.00 ? 42  ASP A N    1  
ATOM   612    C CA   . ASP A 1 42  ? -3.288  3.449   19.342  1.00 0.00 ? 42  ASP A CA   1  
ATOM   613    C C    . ASP A 1 42  ? -4.363  2.543   18.752  1.00 0.00 ? 42  ASP A C    1  
ATOM   614    O O    . ASP A 1 42  ? -4.122  1.362   18.475  1.00 0.00 ? 42  ASP A O    1  
ATOM   615    C CB   . ASP A 1 42  ? -3.570  3.731   20.826  1.00 0.00 ? 42  ASP A CB   1  
ATOM   616    C CG   . ASP A 1 42  ? -2.868  2.705   21.714  1.00 0.00 ? 42  ASP A CG   1  
ATOM   617    O OD1  . ASP A 1 42  ? -1.718  2.399   21.441  1.00 0.00 ? 42  ASP A OD1  1  
ATOM   618    O OD2  . ASP A 1 42  ? -3.490  2.248   22.656  1.00 0.00 ? 42  ASP A OD2  1  
ATOM   619    H H    . ASP A 1 42  ? -3.371  5.549   19.095  1.00 0.00 ? 42  ASP A H    1  
ATOM   620    H HA   . ASP A 1 42  ? -2.332  2.956   19.254  1.00 0.00 ? 42  ASP A HA   1  
ATOM   621    H HB2  . ASP A 1 42  ? -3.206  4.715   21.077  1.00 0.00 ? 42  ASP A HB2  1  
ATOM   622    H HB3  . ASP A 1 42  ? -4.632  3.688   21.007  1.00 0.00 ? 42  ASP A HB3  1  
ATOM   623    N N    . GLN A 1 43  ? -5.541  3.108   18.537  1.00 0.00 ? 43  GLN A N    1  
ATOM   624    C CA   . GLN A 1 43  ? -6.641  2.344   17.959  1.00 0.00 ? 43  GLN A CA   1  
ATOM   625    C C    . GLN A 1 43  ? -6.296  1.902   16.545  1.00 0.00 ? 43  GLN A C    1  
ATOM   626    O O    . GLN A 1 43  ? -6.574  0.765   16.152  1.00 0.00 ? 43  GLN A O    1  
ATOM   627    C CB   . GLN A 1 43  ? -7.921  3.180   17.940  1.00 0.00 ? 43  GLN A CB   1  
ATOM   628    C CG   . GLN A 1 43  ? -8.376  3.448   19.376  1.00 0.00 ? 43  GLN A CG   1  
ATOM   629    C CD   . GLN A 1 43  ? -9.765  4.069   19.382  1.00 0.00 ? 43  GLN A CD   1  
ATOM   630    O OE1  . GLN A 1 43  ? -10.358 4.284   18.330  1.00 0.00 ? 43  GLN A OE1  1  
ATOM   631    N NE2  . GLN A 1 43  ? -10.326 4.372   20.514  1.00 0.00 ? 43  GLN A NE2  1  
ATOM   632    H H    . GLN A 1 43  ? -5.668  4.056   18.758  1.00 0.00 ? 43  GLN A H    1  
ATOM   633    H HA   . GLN A 1 43  ? -6.808  1.467   18.564  1.00 0.00 ? 43  GLN A HA   1  
ATOM   634    H HB2  . GLN A 1 43  ? -7.736  4.118   17.436  1.00 0.00 ? 43  GLN A HB2  1  
ATOM   635    H HB3  . GLN A 1 43  ? -8.697  2.637   17.415  1.00 0.00 ? 43  GLN A HB3  1  
ATOM   636    H HG2  . GLN A 1 43  ? -8.400  2.517   19.923  1.00 0.00 ? 43  GLN A HG2  1  
ATOM   637    H HG3  . GLN A 1 43  ? -7.678  4.123   19.850  1.00 0.00 ? 43  GLN A HG3  1  
ATOM   638    H HE21 . GLN A 1 43  ? -9.856  4.200   21.353  1.00 0.00 ? 43  GLN A HE21 1  
ATOM   639    H HE22 . GLN A 1 43  ? -11.218 4.773   20.523  1.00 0.00 ? 43  GLN A HE22 1  
ATOM   640    N N    . SER A 1 44  ? -5.679  2.795   15.784  1.00 0.00 ? 44  SER A N    1  
ATOM   641    C CA   . SER A 1 44  ? -5.289  2.470   14.419  1.00 0.00 ? 44  SER A CA   1  
ATOM   642    C C    . SER A 1 44  ? -4.325  1.277   14.426  1.00 0.00 ? 44  SER A C    1  
ATOM   643    O O    . SER A 1 44  ? -4.475  0.334   13.649  1.00 0.00 ? 44  SER A O    1  
ATOM   644    C CB   . SER A 1 44  ? -4.644  3.692   13.762  1.00 0.00 ? 44  SER A CB   1  
ATOM   645    O OG   . SER A 1 44  ? -5.110  3.801   12.424  1.00 0.00 ? 44  SER A OG   1  
ATOM   646    H H    . SER A 1 44  ? -5.473  3.682   16.151  1.00 0.00 ? 44  SER A H    1  
ATOM   647    H HA   . SER A 1 44  ? -6.175  2.197   13.863  1.00 0.00 ? 44  SER A HA   1  
ATOM   648    H HB2  . SER A 1 44  ? -4.921  4.582   14.305  1.00 0.00 ? 44  SER A HB2  1  
ATOM   649    H HB3  . SER A 1 44  ? -3.567  3.588   13.773  1.00 0.00 ? 44  SER A HB3  1  
ATOM   650    H HG   . SER A 1 44  ? -4.682  4.558   12.011  1.00 0.00 ? 44  SER A HG   1  
ATOM   651    N N    . ARG A 1 45  ? -3.347  1.319   15.333  1.00 0.00 ? 45  ARG A N    1  
ATOM   652    C CA   . ARG A 1 45  ? -2.369  0.237   15.476  1.00 0.00 ? 45  ARG A CA   1  
ATOM   653    C C    . ARG A 1 45  ? -3.063  -1.093  15.790  1.00 0.00 ? 45  ARG A C    1  
ATOM   654    O O    . ARG A 1 45  ? -2.745  -2.132  15.206  1.00 0.00 ? 45  ARG A O    1  
ATOM   655    C CB   . ARG A 1 45  ? -1.405  0.593   16.616  1.00 0.00 ? 45  ARG A CB   1  
ATOM   656    C CG   . ARG A 1 45  ? -0.287  -0.457  16.738  1.00 0.00 ? 45  ARG A CG   1  
ATOM   657    C CD   . ARG A 1 45  ? 0.648   -0.105  17.915  1.00 0.00 ? 45  ARG A CD   1  
ATOM   658    N NE   . ARG A 1 45  ? 1.778   -1.047  17.936  1.00 0.00 ? 45  ARG A NE   1  
ATOM   659    C CZ   . ARG A 1 45  ? 2.769   -0.965  18.815  1.00 0.00 ? 45  ARG A CZ   1  
ATOM   660    N NH1  . ARG A 1 45  ? 2.822   0.012   19.656  1.00 0.00 ? 45  ARG A NH1  1  
ATOM   661    N NH2  . ARG A 1 45  ? 3.727   -1.843  18.779  1.00 0.00 ? 45  ARG A NH2  1  
ATOM   662    H H    . ARG A 1 45  ? -3.295  2.088   15.940  1.00 0.00 ? 45  ARG A H    1  
ATOM   663    H HA   . ARG A 1 45  ? -1.814  0.136   14.556  1.00 0.00 ? 45  ARG A HA   1  
ATOM   664    H HB2  . ARG A 1 45  ? -0.972  1.558   16.424  1.00 0.00 ? 45  ARG A HB2  1  
ATOM   665    H HB3  . ARG A 1 45  ? -1.960  0.627   17.545  1.00 0.00 ? 45  ARG A HB3  1  
ATOM   666    H HG2  . ARG A 1 45  ? -0.727  -1.430  16.901  1.00 0.00 ? 45  ARG A HG2  1  
ATOM   667    H HG3  . ARG A 1 45  ? 0.286   -0.474  15.822  1.00 0.00 ? 45  ARG A HG3  1  
ATOM   668    H HD2  . ARG A 1 45  ? 1.021   0.908   17.777  1.00 0.00 ? 45  ARG A HD2  1  
ATOM   669    H HD3  . ARG A 1 45  ? 0.101   -0.168  18.851  1.00 0.00 ? 45  ARG A HD3  1  
ATOM   670    H HE   . ARG A 1 45  ? 1.801   -1.762  17.269  1.00 0.00 ? 45  ARG A HE   1  
ATOM   671    H HH11 . ARG A 1 45  ? 2.103   0.705   19.658  1.00 0.00 ? 45  ARG A HH11 1  
ATOM   672    H HH12 . ARG A 1 45  ? 3.570   0.069   20.312  1.00 0.00 ? 45  ARG A HH12 1  
ATOM   673    H HH21 . ARG A 1 45  ? 3.703   -2.582  18.104  1.00 0.00 ? 45  ARG A HH21 1  
ATOM   674    H HH22 . ARG A 1 45  ? 4.476   -1.795  19.434  1.00 0.00 ? 45  ARG A HH22 1  
ATOM   675    N N    . MET A 1 46  ? -4.005  -1.046  16.727  1.00 0.00 ? 46  MET A N    1  
ATOM   676    C CA   . MET A 1 46  ? -4.741  -2.242  17.132  1.00 0.00 ? 46  MET A CA   1  
ATOM   677    C C    . MET A 1 46  ? -5.520  -2.812  15.944  1.00 0.00 ? 46  MET A C    1  
ATOM   678    O O    . MET A 1 46  ? -5.550  -4.027  15.730  1.00 0.00 ? 46  MET A O    1  
ATOM   679    C CB   . MET A 1 46  ? -5.688  -1.906  18.289  1.00 0.00 ? 46  MET A CB   1  
ATOM   680    C CG   . MET A 1 46  ? -4.856  -1.521  19.517  1.00 0.00 ? 46  MET A CG   1  
ATOM   681    S SD   . MET A 1 46  ? -5.934  -0.872  20.826  1.00 0.00 ? 46  MET A SD   1  
ATOM   682    C CE   . MET A 1 46  ? -6.599  -2.440  21.446  1.00 0.00 ? 46  MET A CE   1  
ATOM   683    H H    . MET A 1 46  ? -4.208  -0.188  17.159  1.00 0.00 ? 46  MET A H    1  
ATOM   684    H HA   . MET A 1 46  ? -4.037  -2.987  17.465  1.00 0.00 ? 46  MET A HA   1  
ATOM   685    H HB2  . MET A 1 46  ? -6.322  -1.077  18.007  1.00 0.00 ? 46  MET A HB2  1  
ATOM   686    H HB3  . MET A 1 46  ? -6.297  -2.766  18.523  1.00 0.00 ? 46  MET A HB3  1  
ATOM   687    H HG2  . MET A 1 46  ? -4.331  -2.392  19.880  1.00 0.00 ? 46  MET A HG2  1  
ATOM   688    H HG3  . MET A 1 46  ? -4.136  -0.767  19.239  1.00 0.00 ? 46  MET A HG3  1  
ATOM   689    H HE1  . MET A 1 46  ? -5.911  -3.242  21.228  1.00 0.00 ? 46  MET A HE1  1  
ATOM   690    H HE2  . MET A 1 46  ? -6.744  -2.366  22.515  1.00 0.00 ? 46  MET A HE2  1  
ATOM   691    H HE3  . MET A 1 46  ? -7.544  -2.644  20.974  1.00 0.00 ? 46  MET A HE3  1  
ATOM   692    N N    . ALA A 1 47  ? -6.133  -1.928  15.164  1.00 0.00 ? 47  ALA A N    1  
ATOM   693    C CA   . ALA A 1 47  ? -6.893  -2.354  13.990  1.00 0.00 ? 47  ALA A CA   1  
ATOM   694    C C    . ALA A 1 47  ? -5.987  -3.093  13.007  1.00 0.00 ? 47  ALA A C    1  
ATOM   695    O O    . ALA A 1 47  ? -6.349  -4.141  12.467  1.00 0.00 ? 47  ALA A O    1  
ATOM   696    C CB   . ALA A 1 47  ? -7.526  -1.139  13.305  1.00 0.00 ? 47  ALA A CB   1  
ATOM   697    H H    . ALA A 1 47  ? -6.061  -0.972  15.373  1.00 0.00 ? 47  ALA A H    1  
ATOM   698    H HA   . ALA A 1 47  ? -7.678  -3.024  14.308  1.00 0.00 ? 47  ALA A HA   1  
ATOM   699    H HB1  . ALA A 1 47  ? -7.872  -1.420  12.321  1.00 0.00 ? 47  ALA A HB1  1  
ATOM   700    H HB2  . ALA A 1 47  ? -6.792  -0.351  13.217  1.00 0.00 ? 47  ALA A HB2  1  
ATOM   701    H HB3  . ALA A 1 47  ? -8.360  -0.787  13.893  1.00 0.00 ? 47  ALA A HB3  1  
ATOM   702    N N    . LEU A 1 48  ? -4.797  -2.545  12.790  1.00 0.00 ? 48  LEU A N    1  
ATOM   703    C CA   . LEU A 1 48  ? -3.828  -3.154  11.880  1.00 0.00 ? 48  LEU A CA   1  
ATOM   704    C C    . LEU A 1 48  ? -3.338  -4.486  12.425  1.00 0.00 ? 48  LEU A C    1  
ATOM   705    O O    . LEU A 1 48  ? -3.164  -5.452  11.680  1.00 0.00 ? 48  LEU A O    1  
ATOM   706    C CB   . LEU A 1 48  ? -2.616  -2.244  11.735  1.00 0.00 ? 48  LEU A CB   1  
ATOM   707    C CG   . LEU A 1 48  ? -3.010  -0.940  11.051  1.00 0.00 ? 48  LEU A CG   1  
ATOM   708    C CD1  . LEU A 1 48  ? -1.848  0.042   11.178  1.00 0.00 ? 48  LEU A CD1  1  
ATOM   709    C CD2  . LEU A 1 48  ? -3.326  -1.186  9.566   1.00 0.00 ? 48  LEU A CD2  1  
ATOM   710    H H    . LEU A 1 48  ? -4.561  -1.713  13.255  1.00 0.00 ? 48  LEU A H    1  
ATOM   711    H HA   . LEU A 1 48  ? -4.281  -3.303  10.913  1.00 0.00 ? 48  LEU A HA   1  
ATOM   712    H HB2  . LEU A 1 48  ? -2.223  -2.024  12.720  1.00 0.00 ? 48  LEU A HB2  1  
ATOM   713    H HB3  . LEU A 1 48  ? -1.855  -2.744  11.152  1.00 0.00 ? 48  LEU A HB3  1  
ATOM   714    H HG   . LEU A 1 48  ? -3.879  -0.527  11.544  1.00 0.00 ? 48  LEU A HG   1  
ATOM   715    H HD11 . LEU A 1 48  ? -0.935  -0.443  10.864  1.00 0.00 ? 48  LEU A HD11 1  
ATOM   716    H HD12 . LEU A 1 48  ? -2.033  0.903   10.556  1.00 0.00 ? 48  LEU A HD12 1  
ATOM   717    H HD13 . LEU A 1 48  ? -1.757  0.349   12.208  1.00 0.00 ? 48  LEU A HD13 1  
ATOM   718    H HD21 . LEU A 1 48  ? -2.669  -1.947  9.172   1.00 0.00 ? 48  LEU A HD21 1  
ATOM   719    H HD22 . LEU A 1 48  ? -4.352  -1.512  9.468   1.00 0.00 ? 48  LEU A HD22 1  
ATOM   720    H HD23 . LEU A 1 48  ? -3.188  -0.267  9.013   1.00 0.00 ? 48  LEU A HD23 1  
ATOM   721    N N    . ASN A 1 49  ? -3.086  -4.511  13.724  1.00 0.00 ? 49  ASN A N    1  
ATOM   722    C CA   . ASN A 1 49  ? -2.582  -5.710  14.371  1.00 0.00 ? 49  ASN A CA   1  
ATOM   723    C C    . ASN A 1 49  ? -3.550  -6.868  14.149  1.00 0.00 ? 49  ASN A C    1  
ATOM   724    O O    . ASN A 1 49  ? -3.146  -7.973  13.783  1.00 0.00 ? 49  ASN A O    1  
ATOM   725    C CB   . ASN A 1 49  ? -2.383  -5.466  15.868  1.00 0.00 ? 49  ASN A CB   1  
ATOM   726    C CG   . ASN A 1 49  ? -1.869  -6.737  16.536  1.00 0.00 ? 49  ASN A CG   1  
ATOM   727    O OD1  . ASN A 1 49  ? -2.091  -7.837  16.030  1.00 0.00 ? 49  ASN A OD1  1  
ATOM   728    N ND2  . ASN A 1 49  ? -1.188  -6.652  17.645  1.00 0.00 ? 49  ASN A ND2  1  
ATOM   729    H H    . ASN A 1 49  ? -3.233  -3.701  14.258  1.00 0.00 ? 49  ASN A H    1  
ATOM   730    H HA   . ASN A 1 49  ? -1.631  -5.964  13.926  1.00 0.00 ? 49  ASN A HA   1  
ATOM   731    H HB2  . ASN A 1 49  ? -1.665  -4.671  16.010  1.00 0.00 ? 49  ASN A HB2  1  
ATOM   732    H HB3  . ASN A 1 49  ? -3.324  -5.183  16.315  1.00 0.00 ? 49  ASN A HB3  1  
ATOM   733    H HD21 . ASN A 1 49  ? -1.008  -5.775  18.045  1.00 0.00 ? 49  ASN A HD21 1  
ATOM   734    H HD22 . ASN A 1 49  ? -0.855  -7.466  18.079  1.00 0.00 ? 49  ASN A HD22 1  
ATOM   735    N N    . GLU A 1 50  ? -4.831  -6.595  14.337  1.00 0.00 ? 50  GLU A N    1  
ATOM   736    C CA   . GLU A 1 50  ? -5.851  -7.615  14.122  1.00 0.00 ? 50  GLU A CA   1  
ATOM   737    C C    . GLU A 1 50  ? -5.884  -8.007  12.650  1.00 0.00 ? 50  GLU A C    1  
ATOM   738    O O    . GLU A 1 50  ? -5.989  -9.184  12.303  1.00 0.00 ? 50  GLU A O    1  
ATOM   739    C CB   . GLU A 1 50  ? -7.227  -7.089  14.546  1.00 0.00 ? 50  GLU A CB   1  
ATOM   740    C CG   . GLU A 1 50  ? -8.277  -8.189  14.352  1.00 0.00 ? 50  GLU A CG   1  
ATOM   741    C CD   . GLU A 1 50  ? -9.632  -7.723  14.864  1.00 0.00 ? 50  GLU A CD   1  
ATOM   742    O OE1  . GLU A 1 50  ? -10.282 -6.974  14.155  1.00 0.00 ? 50  GLU A OE1  1  
ATOM   743    O OE2  . GLU A 1 50  ? -9.998  -8.120  15.955  1.00 0.00 ? 50  GLU A OE2  1  
ATOM   744    H H    . GLU A 1 50  ? -5.099  -5.687  14.600  1.00 0.00 ? 50  GLU A H    1  
ATOM   745    H HA   . GLU A 1 50  ? -5.613  -8.486  14.709  1.00 0.00 ? 50  GLU A HA   1  
ATOM   746    H HB2  . GLU A 1 50  ? -7.197  -6.798  15.586  1.00 0.00 ? 50  GLU A HB2  1  
ATOM   747    H HB3  . GLU A 1 50  ? -7.491  -6.233  13.940  1.00 0.00 ? 50  GLU A HB3  1  
ATOM   748    H HG2  . GLU A 1 50  ? -8.358  -8.429  13.302  1.00 0.00 ? 50  GLU A HG2  1  
ATOM   749    H HG3  . GLU A 1 50  ? -7.976  -9.073  14.895  1.00 0.00 ? 50  GLU A HG3  1  
ATOM   750    N N    . ALA A 1 51  ? -5.776  -7.005  11.781  1.00 0.00 ? 51  ALA A N    1  
ATOM   751    C CA   . ALA A 1 51  ? -5.782  -7.253  10.343  1.00 0.00 ? 51  ALA A CA   1  
ATOM   752    C C    . ALA A 1 51  ? -4.554  -8.078  9.948   1.00 0.00 ? 51  ALA A C    1  
ATOM   753    O O    . ALA A 1 51  ? -4.659  -9.054  9.202   1.00 0.00 ? 51  ALA A O    1  
ATOM   754    C CB   . ALA A 1 51  ? -5.808  -5.915  9.588   1.00 0.00 ? 51  ALA A CB   1  
ATOM   755    H H    . ALA A 1 51  ? -5.681  -6.087  12.113  1.00 0.00 ? 51  ALA A H    1  
ATOM   756    H HA   . ALA A 1 51  ? -6.669  -7.814  10.091  1.00 0.00 ? 51  ALA A HA   1  
ATOM   757    H HB1  . ALA A 1 51  ? -4.808  -5.654  9.270   1.00 0.00 ? 51  ALA A HB1  1  
ATOM   758    H HB2  . ALA A 1 51  ? -6.448  -6.001  8.723   1.00 0.00 ? 51  ALA A HB2  1  
ATOM   759    H HB3  . ALA A 1 51  ? -6.191  -5.141  10.240  1.00 0.00 ? 51  ALA A HB3  1  
ATOM   760    N N    . HIS A 1 52  ? -3.395  -7.690  10.473  1.00 0.00 ? 52  HIS A N    1  
ATOM   761    C CA   . HIS A 1 52  ? -2.153  -8.404  10.189  1.00 0.00 ? 52  HIS A CA   1  
ATOM   762    C C    . HIS A 1 52  ? -2.238  -9.853  10.669  1.00 0.00 ? 52  HIS A C    1  
ATOM   763    O O    . HIS A 1 52  ? -1.774  -10.770 9.988   1.00 0.00 ? 52  HIS A O    1  
ATOM   764    C CB   . HIS A 1 52  ? -0.979  -7.704  10.878  1.00 0.00 ? 52  HIS A CB   1  
ATOM   765    C CG   . HIS A 1 52  ? 0.304   -8.391  10.500  1.00 0.00 ? 52  HIS A CG   1  
ATOM   766    N ND1  . HIS A 1 52  ? 0.704   -9.582  11.085  1.00 0.00 ? 52  HIS A ND1  1  
ATOM   767    C CD2  . HIS A 1 52  ? 1.288   -8.067  9.599   1.00 0.00 ? 52  HIS A CD2  1  
ATOM   768    C CE1  . HIS A 1 52  ? 1.881   -9.929  10.534  1.00 0.00 ? 52  HIS A CE1  1  
ATOM   769    N NE2  . HIS A 1 52  ? 2.283   -9.040  9.622   1.00 0.00 ? 52  HIS A NE2  1  
ATOM   770    H H    . HIS A 1 52  ? -3.377  -6.911  11.073  1.00 0.00 ? 52  HIS A H    1  
ATOM   771    H HA   . HIS A 1 52  ? -1.981  -8.402  9.123   1.00 0.00 ? 52  HIS A HA   1  
ATOM   772    H HB2  . HIS A 1 52  ? -0.941  -6.671  10.563  1.00 0.00 ? 52  HIS A HB2  1  
ATOM   773    H HB3  . HIS A 1 52  ? -1.110  -7.750  11.948  1.00 0.00 ? 52  HIS A HB3  1  
ATOM   774    H HD1  . HIS A 1 52  ? 0.217   -10.081 11.774  1.00 0.00 ? 52  HIS A HD1  1  
ATOM   775    H HD2  . HIS A 1 52  ? 1.290   -7.190  8.968   1.00 0.00 ? 52  HIS A HD2  1  
ATOM   776    H HE1  . HIS A 1 52  ? 2.434   -10.819 10.796  1.00 0.00 ? 52  HIS A HE1  1  
ATOM   777    H HE2  . HIS A 1 52  ? 3.102   -9.067  9.084   1.00 0.00 ? 52  HIS A HE2  1  
ATOM   778    N N    . LEU A 1 53  ? -2.837  -10.049 11.841  1.00 0.00 ? 53  LEU A N    1  
ATOM   779    C CA   . LEU A 1 53  ? -2.978  -11.388 12.402  1.00 0.00 ? 53  LEU A CA   1  
ATOM   780    C C    . LEU A 1 53  ? -3.792  -12.270 11.458  1.00 0.00 ? 53  LEU A C    1  
ATOM   781    O O    . LEU A 1 53  ? -3.438  -13.424 11.203  1.00 0.00 ? 53  LEU A O    1  
ATOM   782    C CB   . LEU A 1 53  ? -3.674  -11.313 13.764  1.00 0.00 ? 53  LEU A CB   1  
ATOM   783    C CG   . LEU A 1 53  ? -2.681  -10.854 14.840  1.00 0.00 ? 53  LEU A CG   1  
ATOM   784    C CD1  . LEU A 1 53  ? -3.454  -10.403 16.080  1.00 0.00 ? 53  LEU A CD1  1  
ATOM   785    C CD2  . LEU A 1 53  ? -1.746  -12.008 15.229  1.00 0.00 ? 53  LEU A CD2  1  
ATOM   786    H H    . LEU A 1 53  ? -3.192  -9.278  12.335  1.00 0.00 ? 53  LEU A H    1  
ATOM   787    H HA   . LEU A 1 53  ? -1.999  -11.824 12.528  1.00 0.00 ? 53  LEU A HA   1  
ATOM   788    H HB2  . LEU A 1 53  ? -4.490  -10.607 13.707  1.00 0.00 ? 53  LEU A HB2  1  
ATOM   789    H HB3  . LEU A 1 53  ? -4.063  -12.286 14.023  1.00 0.00 ? 53  LEU A HB3  1  
ATOM   790    H HG   . LEU A 1 53  ? -2.097  -10.027 14.461  1.00 0.00 ? 53  LEU A HG   1  
ATOM   791    H HD11 . LEU A 1 53  ? -4.306  -11.051 16.228  1.00 0.00 ? 53  LEU A HD11 1  
ATOM   792    H HD12 . LEU A 1 53  ? -2.809  -10.453 16.945  1.00 0.00 ? 53  LEU A HD12 1  
ATOM   793    H HD13 . LEU A 1 53  ? -3.794  -9.387  15.943  1.00 0.00 ? 53  LEU A HD13 1  
ATOM   794    H HD21 . LEU A 1 53  ? -2.302  -12.933 15.262  1.00 0.00 ? 53  LEU A HD21 1  
ATOM   795    H HD22 . LEU A 1 53  ? -0.950  -12.091 14.504  1.00 0.00 ? 53  LEU A HD22 1  
ATOM   796    H HD23 . LEU A 1 53  ? -1.322  -11.811 16.202  1.00 0.00 ? 53  LEU A HD23 1  
ATOM   797    N N    . VAL A 1 54  ? -4.879  -11.714 10.936  1.00 0.00 ? 54  VAL A N    1  
ATOM   798    C CA   . VAL A 1 54  ? -5.725  -12.456 10.012  1.00 0.00 ? 54  VAL A CA   1  
ATOM   799    C C    . VAL A 1 54  ? -4.930  -12.786 8.752   1.00 0.00 ? 54  VAL A C    1  
ATOM   800    O O    . VAL A 1 54  ? -4.980  -13.911 8.255   1.00 0.00 ? 54  VAL A O    1  
ATOM   801    C CB   . VAL A 1 54  ? -6.976  -11.636 9.659   1.00 0.00 ? 54  VAL A CB   1  
ATOM   802    C CG1  . VAL A 1 54  ? -7.736  -12.313 8.508   1.00 0.00 ? 54  VAL A CG1  1  
ATOM   803    C CG2  . VAL A 1 54  ? -7.892  -11.522 10.893  1.00 0.00 ? 54  VAL A CG2  1  
ATOM   804    H H    . VAL A 1 54  ? -5.109  -10.788 11.168  1.00 0.00 ? 54  VAL A H    1  
ATOM   805    H HA   . VAL A 1 54  ? -6.029  -13.380 10.480  1.00 0.00 ? 54  VAL A HA   1  
ATOM   806    H HB   . VAL A 1 54  ? -6.670  -10.646 9.347   1.00 0.00 ? 54  VAL A HB   1  
ATOM   807    H HG11 . VAL A 1 54  ? -7.667  -13.387 8.607   1.00 0.00 ? 54  VAL A HG11 1  
ATOM   808    H HG12 . VAL A 1 54  ? -8.776  -12.019 8.536   1.00 0.00 ? 54  VAL A HG12 1  
ATOM   809    H HG13 . VAL A 1 54  ? -7.305  -12.013 7.565   1.00 0.00 ? 54  VAL A HG13 1  
ATOM   810    H HG21 . VAL A 1 54  ? -7.834  -12.425 11.479  1.00 0.00 ? 54  VAL A HG21 1  
ATOM   811    H HG22 . VAL A 1 54  ? -7.576  -10.682 11.499  1.00 0.00 ? 54  VAL A HG22 1  
ATOM   812    H HG23 . VAL A 1 54  ? -8.913  -11.365 10.574  1.00 0.00 ? 54  VAL A HG23 1  
ATOM   813    N N    . GLN A 1 55  ? -4.176  -11.811 8.248   1.00 0.00 ? 55  GLN A N    1  
ATOM   814    C CA   . GLN A 1 55  ? -3.370  -12.051 7.056   1.00 0.00 ? 55  GLN A CA   1  
ATOM   815    C C    . GLN A 1 55  ? -2.329  -13.143 7.336   1.00 0.00 ? 55  GLN A C    1  
ATOM   816    O O    . GLN A 1 55  ? -2.112  -14.022 6.503   1.00 0.00 ? 55  GLN A O    1  
ATOM   817    C CB   . GLN A 1 55  ? -2.687  -10.748 6.588   1.00 0.00 ? 55  GLN A CB   1  
ATOM   818    C CG   . GLN A 1 55  ? -1.520  -11.063 5.620   1.00 0.00 ? 55  GLN A CG   1  
ATOM   819    C CD   . GLN A 1 55  ? -1.431  -10.020 4.505   1.00 0.00 ? 55  GLN A CD   1  
ATOM   820    O OE1  . GLN A 1 55  ? -1.236  -8.838  4.768   1.00 0.00 ? 55  GLN A OE1  1  
ATOM   821    N NE2  . GLN A 1 55  ? -1.543  -10.400 3.266   1.00 0.00 ? 55  GLN A NE2  1  
ATOM   822    H H    . GLN A 1 55  ? -4.152  -10.933 8.691   1.00 0.00 ? 55  GLN A H    1  
ATOM   823    H HA   . GLN A 1 55  ? -4.027  -12.397 6.273   1.00 0.00 ? 55  GLN A HA   1  
ATOM   824    H HB2  . GLN A 1 55  ? -3.418  -10.134 6.083   1.00 0.00 ? 55  GLN A HB2  1  
ATOM   825    H HB3  . GLN A 1 55  ? -2.307  -10.213 7.448   1.00 0.00 ? 55  GLN A HB3  1  
ATOM   826    H HG2  . GLN A 1 55  ? -0.592  -11.063 6.170   1.00 0.00 ? 55  GLN A HG2  1  
ATOM   827    H HG3  . GLN A 1 55  ? -1.669  -12.035 5.176   1.00 0.00 ? 55  GLN A HG3  1  
ATOM   828    H HE21 . GLN A 1 55  ? -1.685  -11.345 3.055   1.00 0.00 ? 55  GLN A HE21 1  
ATOM   829    H HE22 . GLN A 1 55  ? -1.483  -9.740  2.545   1.00 0.00 ? 55  GLN A HE22 1  
ATOM   830    N N    . THR A 1 56  ? -1.703  -13.097 8.512   1.00 0.00 ? 56  THR A N    1  
ATOM   831    C CA   . THR A 1 56  ? -0.705  -14.110 8.873   1.00 0.00 ? 56  THR A CA   1  
ATOM   832    C C    . THR A 1 56  ? -1.275  -15.510 8.650   1.00 0.00 ? 56  THR A C    1  
ATOM   833    O O    . THR A 1 56  ? -0.641  -16.360 8.020   1.00 0.00 ? 56  THR A O    1  
ATOM   834    C CB   . THR A 1 56  ? -0.277  -13.944 10.334  1.00 0.00 ? 56  THR A CB   1  
ATOM   835    O OG1  . THR A 1 56  ? 0.067   -12.587 10.572  1.00 0.00 ? 56  THR A OG1  1  
ATOM   836    C CG2  . THR A 1 56  ? 0.931   -14.838 10.623  1.00 0.00 ? 56  THR A CG2  1  
ATOM   837    H H    . THR A 1 56  ? -1.920  -12.382 9.152   1.00 0.00 ? 56  THR A H    1  
ATOM   838    H HA   . THR A 1 56  ? 0.154   -13.986 8.233   1.00 0.00 ? 56  THR A HA   1  
ATOM   839    H HB   . THR A 1 56  ? -1.092  -14.228 10.982  1.00 0.00 ? 56  THR A HB   1  
ATOM   840    H HG1  . THR A 1 56  ? 0.424   -12.223 9.759   1.00 0.00 ? 56  THR A HG1  1  
ATOM   841    H HG21 . THR A 1 56  ? 0.878   -15.728 10.013  1.00 0.00 ? 56  THR A HG21 1  
ATOM   842    H HG22 . THR A 1 56  ? 1.839   -14.300 10.397  1.00 0.00 ? 56  THR A HG22 1  
ATOM   843    H HG23 . THR A 1 56  ? 0.929   -15.118 11.666  1.00 0.00 ? 56  THR A HG23 1  
ATOM   844    N N    . LYS A 1 57  ? -2.495  -15.733 9.131   1.00 0.00 ? 57  LYS A N    1  
ATOM   845    C CA   . LYS A 1 57  ? -3.152  -17.027 8.943   1.00 0.00 ? 57  LYS A CA   1  
ATOM   846    C C    . LYS A 1 57  ? -3.362  -17.284 7.456   1.00 0.00 ? 57  LYS A C    1  
ATOM   847    O O    . LYS A 1 57  ? -3.204  -18.406 6.973   1.00 0.00 ? 57  LYS A O    1  
ATOM   848    C CB   . LYS A 1 57  ? -4.500  -17.045 9.666   1.00 0.00 ? 57  LYS A CB   1  
ATOM   849    C CG   . LYS A 1 57  ? -5.089  -18.455 9.593   1.00 0.00 ? 57  LYS A CG   1  
ATOM   850    C CD   . LYS A 1 57  ? -6.405  -18.504 10.372  1.00 0.00 ? 57  LYS A CD   1  
ATOM   851    C CE   . LYS A 1 57  ? -6.972  -19.924 10.319  1.00 0.00 ? 57  LYS A CE   1  
ATOM   852    N NZ   . LYS A 1 57  ? -8.404  -19.904 10.728  1.00 0.00 ? 57  LYS A NZ   1  
ATOM   853    H H    . LYS A 1 57  ? -2.968  -15.014 9.598   1.00 0.00 ? 57  LYS A H    1  
ATOM   854    H HA   . LYS A 1 57  ? -2.531  -17.811 9.351   1.00 0.00 ? 57  LYS A HA   1  
ATOM   855    H HB2  . LYS A 1 57  ? -4.359  -16.763 10.699  1.00 0.00 ? 57  LYS A HB2  1  
ATOM   856    H HB3  . LYS A 1 57  ? -5.174  -16.349 9.190   1.00 0.00 ? 57  LYS A HB3  1  
ATOM   857    H HG2  . LYS A 1 57  ? -5.271  -18.716 8.561   1.00 0.00 ? 57  LYS A HG2  1  
ATOM   858    H HG3  . LYS A 1 57  ? -4.392  -19.157 10.025  1.00 0.00 ? 57  LYS A HG3  1  
ATOM   859    H HD2  . LYS A 1 57  ? -6.226  -18.224 11.400  1.00 0.00 ? 57  LYS A HD2  1  
ATOM   860    H HD3  . LYS A 1 57  ? -7.112  -17.819 9.929   1.00 0.00 ? 57  LYS A HD3  1  
ATOM   861    H HE2  . LYS A 1 57  ? -6.890  -20.307 9.312   1.00 0.00 ? 57  LYS A HE2  1  
ATOM   862    H HE3  . LYS A 1 57  ? -6.414  -20.559 10.992  1.00 0.00 ? 57  LYS A HE3  1  
ATOM   863    H HZ1  . LYS A 1 57  ? -8.632  -18.979 11.148  1.00 0.00 ? 57  LYS A HZ1  1  
ATOM   864    H HZ2  . LYS A 1 57  ? -9.005  -20.065 9.895   1.00 0.00 ? 57  LYS A HZ2  1  
ATOM   865    H HZ3  . LYS A 1 57  ? -8.576  -20.655 11.426  1.00 0.00 ? 57  LYS A HZ3  1  
ATOM   866    N N    . LEU A 1 58  ? -3.736  -16.233 6.738   1.00 0.00 ? 58  LEU A N    1  
ATOM   867    C CA   . LEU A 1 58  ? -3.983  -16.358 5.313   1.00 0.00 ? 58  LEU A CA   1  
ATOM   868    C C    . LEU A 1 58  ? -2.691  -16.660 4.536   1.00 0.00 ? 58  LEU A C    1  
ATOM   869    O O    . LEU A 1 58  ? -2.754  -17.152 3.415   1.00 0.00 ? 58  LEU A O    1  
ATOM   870    C CB   . LEU A 1 58  ? -4.648  -15.099 4.769   1.00 0.00 ? 58  LEU A CB   1  
ATOM   871    C CG   . LEU A 1 58  ? -6.055  -14.951 5.363   1.00 0.00 ? 58  LEU A CG   1  
ATOM   872    C CD1  . LEU A 1 58  ? -6.626  -13.590 4.950   1.00 0.00 ? 58  LEU A CD1  1  
ATOM   873    C CD2  . LEU A 1 58  ? -6.973  -16.084 4.859   1.00 0.00 ? 58  LEU A CD2  1  
ATOM   874    H H    . LEU A 1 58  ? -3.856  -15.364 7.177   1.00 0.00 ? 58  LEU A H    1  
ATOM   875    H HA   . LEU A 1 58  ? -4.665  -17.186 5.170   1.00 0.00 ? 58  LEU A HA   1  
ATOM   876    H HB2  . LEU A 1 58  ? -4.049  -14.240 5.035   1.00 0.00 ? 58  LEU A HB2  1  
ATOM   877    H HB3  . LEU A 1 58  ? -4.716  -15.174 3.695   1.00 0.00 ? 58  LEU A HB3  1  
ATOM   878    H HG   . LEU A 1 58  ? -5.994  -14.991 6.444   1.00 0.00 ? 58  LEU A HG   1  
ATOM   879    H HD11 . LEU A 1 58  ? -6.290  -13.343 3.953   1.00 0.00 ? 58  LEU A HD11 1  
ATOM   880    H HD12 . LEU A 1 58  ? -7.703  -13.624 4.970   1.00 0.00 ? 58  LEU A HD12 1  
ATOM   881    H HD13 . LEU A 1 58  ? -6.278  -12.836 5.642   1.00 0.00 ? 58  LEU A HD13 1  
ATOM   882    H HD21 . LEU A 1 58  ? -6.623  -16.446 3.903   1.00 0.00 ? 58  LEU A HD21 1  
ATOM   883    H HD22 . LEU A 1 58  ? -6.963  -16.897 5.574   1.00 0.00 ? 58  LEU A HD22 1  
ATOM   884    H HD23 . LEU A 1 58  ? -7.984  -15.716 4.755   1.00 0.00 ? 58  LEU A HD23 1  
ATOM   885    N N    . ILE A 1 59  ? -1.526  -16.379 5.129   1.00 0.00 ? 59  ILE A N    1  
ATOM   886    C CA   . ILE A 1 59  ? -0.256  -16.681 4.461   1.00 0.00 ? 59  ILE A CA   1  
ATOM   887    C C    . ILE A 1 59  ? 0.283   -18.056 4.902   1.00 0.00 ? 59  ILE A C    1  
ATOM   888    O O    . ILE A 1 59  ? 0.894   -18.772 4.116   1.00 0.00 ? 59  ILE A O    1  
ATOM   889    C CB   . ILE A 1 59  ? 0.780   -15.558 4.734   1.00 0.00 ? 59  ILE A CB   1  
ATOM   890    C CG1  . ILE A 1 59  ? 1.703   -15.387 3.522   1.00 0.00 ? 59  ILE A CG1  1  
ATOM   891    C CG2  . ILE A 1 59  ? 1.663   -15.891 5.941   1.00 0.00 ? 59  ILE A CG2  1  
ATOM   892    C CD1  . ILE A 1 59  ? 2.538   -14.117 3.702   1.00 0.00 ? 59  ILE A CD1  1  
ATOM   893    H H    . ILE A 1 59  ? -1.525  -15.985 6.030   1.00 0.00 ? 59  ILE A H    1  
ATOM   894    H HA   . ILE A 1 59  ? -0.431  -16.716 3.393   1.00 0.00 ? 59  ILE A HA   1  
ATOM   895    H HB   . ILE A 1 59  ? 0.259   -14.630 4.919   1.00 0.00 ? 59  ILE A HB   1  
ATOM   896    H HG12 . ILE A 1 59  ? 2.357   -16.243 3.443   1.00 0.00 ? 59  ILE A HG12 1  
ATOM   897    H HG13 . ILE A 1 59  ? 1.115   -15.297 2.622   1.00 0.00 ? 59  ILE A HG13 1  
ATOM   898    H HG21 . ILE A 1 59  ? 1.055   -16.098 6.789   1.00 0.00 ? 59  ILE A HG21 1  
ATOM   899    H HG22 . ILE A 1 59  ? 2.272   -16.750 5.719   1.00 0.00 ? 59  ILE A HG22 1  
ATOM   900    H HG23 . ILE A 1 59  ? 2.302   -15.053 6.158   1.00 0.00 ? 59  ILE A HG23 1  
ATOM   901    H HD11 . ILE A 1 59  ? 1.888   -13.289 3.940   1.00 0.00 ? 59  ILE A HD11 1  
ATOM   902    H HD12 . ILE A 1 59  ? 3.244   -14.262 4.504   1.00 0.00 ? 59  ILE A HD12 1  
ATOM   903    H HD13 . ILE A 1 59  ? 3.070   -13.904 2.788   1.00 0.00 ? 59  ILE A HD13 1  
ATOM   904    N N    . GLU A 1 60  ? 0.048   -18.426 6.164   1.00 0.00 ? 60  GLU A N    1  
ATOM   905    C CA   . GLU A 1 60  ? 0.519   -19.725 6.677   1.00 0.00 ? 60  GLU A CA   1  
ATOM   906    C C    . GLU A 1 60  ? -0.188  -20.883 5.974   1.00 0.00 ? 60  GLU A C    1  
ATOM   907    O O    . GLU A 1 60  ? 0.426   -21.904 5.666   1.00 0.00 ? 60  GLU A O    1  
ATOM   908    C CB   . GLU A 1 60  ? 0.244   -19.814 8.185   1.00 0.00 ? 60  GLU A CB   1  
ATOM   909    C CG   . GLU A 1 60  ? 0.690   -21.175 8.741   1.00 0.00 ? 60  GLU A CG   1  
ATOM   910    C CD   . GLU A 1 60  ? 0.159   -21.351 10.158  1.00 0.00 ? 60  GLU A CD   1  
ATOM   911    O OE1  . GLU A 1 60  ? -0.467  -20.429 10.655  1.00 0.00 ? 60  GLU A OE1  1  
ATOM   912    O OE2  . GLU A 1 60  ? 0.355   -22.419 10.714  1.00 0.00 ? 60  GLU A OE2  1  
ATOM   913    H H    . GLU A 1 60  ? -0.444  -17.822 6.760   1.00 0.00 ? 60  GLU A H    1  
ATOM   914    H HA   . GLU A 1 60  ? 1.581   -19.807 6.495   1.00 0.00 ? 60  GLU A HA   1  
ATOM   915    H HB2  . GLU A 1 60  ? 0.790   -19.031 8.691   1.00 0.00 ? 60  GLU A HB2  1  
ATOM   916    H HB3  . GLU A 1 60  ? -0.813  -19.683 8.364   1.00 0.00 ? 60  GLU A HB3  1  
ATOM   917    H HG2  . GLU A 1 60  ? 0.306   -21.970 8.121   1.00 0.00 ? 60  GLU A HG2  1  
ATOM   918    H HG3  . GLU A 1 60  ? 1.767   -21.221 8.757   1.00 0.00 ? 60  GLU A HG3  1  
ATOM   919    N N    . GLY A 1 61  ? -1.489  -20.725 5.734   1.00 0.00 ? 61  GLY A N    1  
ATOM   920    C CA   . GLY A 1 61  ? -2.272  -21.774 5.078   1.00 0.00 ? 61  GLY A CA   1  
ATOM   921    C C    . GLY A 1 61  ? -2.655  -21.379 3.656   1.00 0.00 ? 61  GLY A C    1  
ATOM   922    O O    . GLY A 1 61  ? -3.723  -21.744 3.170   1.00 0.00 ? 61  GLY A O    1  
ATOM   923    H H    . GLY A 1 61  ? -1.930  -19.893 6.010   1.00 0.00 ? 61  GLY A H    1  
ATOM   924    H HA2  . GLY A 1 61  ? -1.692  -22.687 5.051   1.00 0.00 ? 61  GLY A HA2  1  
ATOM   925    H HA3  . GLY A 1 61  ? -3.174  -21.946 5.645   1.00 0.00 ? 61  GLY A HA3  1  
ATOM   926    N N    . ASP A 1 62  ? -1.779  -20.624 2.999   1.00 0.00 ? 62  ASP A N    1  
ATOM   927    C CA   . ASP A 1 62  ? -2.040  -20.165 1.638   1.00 0.00 ? 62  ASP A CA   1  
ATOM   928    C C    . ASP A 1 62  ? -2.089  -21.330 0.650   1.00 0.00 ? 62  ASP A C    1  
ATOM   929    O O    . ASP A 1 62  ? -2.423  -21.144 -0.520  1.00 0.00 ? 62  ASP A O    1  
ATOM   930    C CB   . ASP A 1 62  ? -0.952  -19.179 1.211   1.00 0.00 ? 62  ASP A CB   1  
ATOM   931    C CG   . ASP A 1 62  ? 0.423   -19.817 1.373   1.00 0.00 ? 62  ASP A CG   1  
ATOM   932    O OD1  . ASP A 1 62  ? 0.486   -20.921 1.889   1.00 0.00 ? 62  ASP A OD1  1  
ATOM   933    O OD2  . ASP A 1 62  ? 1.394   -19.192 0.979   1.00 0.00 ? 62  ASP A OD2  1  
ATOM   934    H H    . ASP A 1 62  ? -0.946  -20.361 3.443   1.00 0.00 ? 62  ASP A H    1  
ATOM   935    H HA   . ASP A 1 62  ? -2.991  -19.655 1.620   1.00 0.00 ? 62  ASP A HA   1  
ATOM   936    H HB2  . ASP A 1 62  ? -1.103  -18.907 0.178   1.00 0.00 ? 62  ASP A HB2  1  
ATOM   937    H HB3  . ASP A 1 62  ? -1.010  -18.293 1.826   1.00 0.00 ? 62  ASP A HB3  1  
ATOM   938    N N    . ALA A 1 63  ? -1.759  -22.526 1.122   1.00 0.00 ? 63  ALA A N    1  
ATOM   939    C CA   . ALA A 1 63  ? -1.777  -23.705 0.260   1.00 0.00 ? 63  ALA A CA   1  
ATOM   940    C C    . ALA A 1 63  ? -3.191  -24.271 0.151   1.00 0.00 ? 63  ALA A C    1  
ATOM   941    O O    . ALA A 1 63  ? -4.102  -23.825 0.850   1.00 0.00 ? 63  ALA A O    1  
ATOM   942    C CB   . ALA A 1 63  ? -0.840  -24.776 0.820   1.00 0.00 ? 63  ALA A CB   1  
ATOM   943    H H    . ALA A 1 63  ? -1.502  -22.620 2.063   1.00 0.00 ? 63  ALA A H    1  
ATOM   944    H HA   . ALA A 1 63  ? -1.435  -23.424 -0.725  1.00 0.00 ? 63  ALA A HA   1  
ATOM   945    H HB1  . ALA A 1 63  ? -1.353  -25.339 1.586   1.00 0.00 ? 63  ALA A HB1  1  
ATOM   946    H HB2  . ALA A 1 63  ? 0.034   -24.304 1.245   1.00 0.00 ? 63  ALA A HB2  1  
ATOM   947    H HB3  . ALA A 1 63  ? -0.538  -25.442 0.025   1.00 0.00 ? 63  ALA A HB3  1  
ATOM   948    N N    . GLY A 1 64  ? -3.368  -25.258 -0.727  1.00 0.00 ? 64  GLY A N    1  
ATOM   949    C CA   . GLY A 1 64  ? -4.678  -25.882 -0.914  1.00 0.00 ? 64  GLY A CA   1  
ATOM   950    C C    . GLY A 1 64  ? -5.054  -25.972 -2.393  1.00 0.00 ? 64  GLY A C    1  
ATOM   951    O O    . GLY A 1 64  ? -5.296  -27.062 -2.911  1.00 0.00 ? 64  GLY A O    1  
ATOM   952    H H    . GLY A 1 64  ? -2.606  -25.575 -1.254  1.00 0.00 ? 64  GLY A H    1  
ATOM   953    H HA2  . GLY A 1 64  ? -4.656  -26.877 -0.495  1.00 0.00 ? 64  GLY A HA2  1  
ATOM   954    H HA3  . GLY A 1 64  ? -5.428  -25.299 -0.398  1.00 0.00 ? 64  GLY A HA3  1  
ATOM   955    N N    . GLU A 1 65  ? -5.111  -24.827 -3.067  1.00 0.00 ? 65  GLU A N    1  
ATOM   956    C CA   . GLU A 1 65  ? -5.470  -24.806 -4.483  1.00 0.00 ? 65  GLU A CA   1  
ATOM   957    C C    . GLU A 1 65  ? -4.410  -25.502 -5.329  1.00 0.00 ? 65  GLU A C    1  
ATOM   958    O O    . GLU A 1 65  ? -4.732  -26.210 -6.284  1.00 0.00 ? 65  GLU A O    1  
ATOM   959    C CB   . GLU A 1 65  ? -5.633  -23.364 -4.965  1.00 0.00 ? 65  GLU A CB   1  
ATOM   960    C CG   . GLU A 1 65  ? -6.866  -22.739 -4.312  1.00 0.00 ? 65  GLU A CG   1  
ATOM   961    C CD   . GLU A 1 65  ? -6.993  -21.280 -4.734  1.00 0.00 ? 65  GLU A CD   1  
ATOM   962    O OE1  . GLU A 1 65  ? -6.163  -20.833 -5.508  1.00 0.00 ? 65  GLU A OE1  1  
ATOM   963    O OE2  . GLU A 1 65  ? -7.920  -20.631 -4.278  1.00 0.00 ? 65  GLU A OE2  1  
ATOM   964    H H    . GLU A 1 65  ? -4.915  -23.985 -2.605  1.00 0.00 ? 65  GLU A H    1  
ATOM   965    H HA   . GLU A 1 65  ? -6.410  -25.321 -4.611  1.00 0.00 ? 65  GLU A HA   1  
ATOM   966    H HB2  . GLU A 1 65  ? -4.755  -22.794 -4.698  1.00 0.00 ? 65  GLU A HB2  1  
ATOM   967    H HB3  . GLU A 1 65  ? -5.754  -23.356 -6.038  1.00 0.00 ? 65  GLU A HB3  1  
ATOM   968    H HG2  . GLU A 1 65  ? -7.748  -23.281 -4.620  1.00 0.00 ? 65  GLU A HG2  1  
ATOM   969    H HG3  . GLU A 1 65  ? -6.769  -22.794 -3.238  1.00 0.00 ? 65  GLU A HG3  1  
ATOM   970    N N    . GLY A 1 66  ? -3.146  -25.294 -4.981  1.00 0.00 ? 66  GLY A N    1  
ATOM   971    C CA   . GLY A 1 66  ? -2.053  -25.905 -5.727  1.00 0.00 ? 66  GLY A CA   1  
ATOM   972    C C    . GLY A 1 66  ? -0.771  -25.921 -4.903  1.00 0.00 ? 66  GLY A C    1  
ATOM   973    O O    . GLY A 1 66  ? -0.713  -25.352 -3.814  1.00 0.00 ? 66  GLY A O    1  
ATOM   974    H H    . GLY A 1 66  ? -2.945  -24.717 -4.215  1.00 0.00 ? 66  GLY A H    1  
ATOM   975    H HA2  . GLY A 1 66  ? -2.323  -26.919 -5.984  1.00 0.00 ? 66  GLY A HA2  1  
ATOM   976    H HA3  . GLY A 1 66  ? -1.882  -25.342 -6.632  1.00 0.00 ? 66  GLY A HA3  1  
ATOM   977    N N    . LYS A 1 67  ? 0.249   -26.588 -5.429  1.00 0.00 ? 67  LYS A N    1  
ATOM   978    C CA   . LYS A 1 67  ? 1.526   -26.687 -4.733  1.00 0.00 ? 67  LYS A CA   1  
ATOM   979    C C    . LYS A 1 67  ? 2.220   -25.325 -4.654  1.00 0.00 ? 67  LYS A C    1  
ATOM   980    O O    . LYS A 1 67  ? 2.164   -24.644 -3.631  1.00 0.00 ? 67  LYS A O    1  
ATOM   981    C CB   . LYS A 1 67  ? 2.441   -27.673 -5.469  1.00 0.00 ? 67  LYS A CB   1  
ATOM   982    C CG   . LYS A 1 67  ? 1.747   -29.033 -5.628  1.00 0.00 ? 67  LYS A CG   1  
ATOM   983    C CD   . LYS A 1 67  ? 1.571   -29.703 -4.263  1.00 0.00 ? 67  LYS A CD   1  
ATOM   984    C CE   . LYS A 1 67  ? 1.218   -31.178 -4.467  1.00 0.00 ? 67  LYS A CE   1  
ATOM   985    N NZ   . LYS A 1 67  ? 1.187   -31.870 -3.148  1.00 0.00 ? 67  LYS A NZ   1  
ATOM   986    H H    . LYS A 1 67  ? 0.140   -27.028 -6.298  1.00 0.00 ? 67  LYS A H    1  
ATOM   987    H HA   . LYS A 1 67  ? 1.355   -27.048 -3.732  1.00 0.00 ? 67  LYS A HA   1  
ATOM   988    H HB2  . LYS A 1 67  ? 2.678   -27.279 -6.446  1.00 0.00 ? 67  LYS A HB2  1  
ATOM   989    H HB3  . LYS A 1 67  ? 3.352   -27.803 -4.905  1.00 0.00 ? 67  LYS A HB3  1  
ATOM   990    H HG2  . LYS A 1 67  ? 0.778   -28.888 -6.084  1.00 0.00 ? 67  LYS A HG2  1  
ATOM   991    H HG3  . LYS A 1 67  ? 2.348   -29.668 -6.262  1.00 0.00 ? 67  LYS A HG3  1  
ATOM   992    H HD2  . LYS A 1 67  ? 2.490   -29.625 -3.700  1.00 0.00 ? 67  LYS A HD2  1  
ATOM   993    H HD3  . LYS A 1 67  ? 0.773   -29.220 -3.722  1.00 0.00 ? 67  LYS A HD3  1  
ATOM   994    H HE2  . LYS A 1 67  ? 0.249   -31.255 -4.936  1.00 0.00 ? 67  LYS A HE2  1  
ATOM   995    H HE3  . LYS A 1 67  ? 1.961   -31.642 -5.099  1.00 0.00 ? 67  LYS A HE3  1  
ATOM   996    H HZ1  . LYS A 1 67  ? 0.909   -31.195 -2.408  1.00 0.00 ? 67  LYS A HZ1  1  
ATOM   997    H HZ2  . LYS A 1 67  ? 0.500   -32.651 -3.182  1.00 0.00 ? 67  LYS A HZ2  1  
ATOM   998    H HZ3  . LYS A 1 67  ? 2.132   -32.248 -2.932  1.00 0.00 ? 67  LYS A HZ3  1  
ATOM   999    N N    . MET A 1 68  ? 2.895   -24.955 -5.738  1.00 0.00 ? 68  MET A N    1  
ATOM   1000   C CA   . MET A 1 68  ? 3.633   -23.694 -5.799  1.00 0.00 ? 68  MET A CA   1  
ATOM   1001   C C    . MET A 1 68  ? 2.719   -22.465 -5.760  1.00 0.00 ? 68  MET A C    1  
ATOM   1002   O O    . MET A 1 68  ? 3.063   -21.452 -5.153  1.00 0.00 ? 68  MET A O    1  
ATOM   1003   C CB   . MET A 1 68  ? 4.465   -23.656 -7.082  1.00 0.00 ? 68  MET A CB   1  
ATOM   1004   C CG   . MET A 1 68  ? 5.733   -24.493 -6.898  1.00 0.00 ? 68  MET A CG   1  
ATOM   1005   S SD   . MET A 1 68  ? 6.820   -23.686 -5.696  1.00 0.00 ? 68  MET A SD   1  
ATOM   1006   C CE   . MET A 1 68  ? 7.233   -25.163 -4.735  1.00 0.00 ? 68  MET A CE   1  
ATOM   1007   H H    . MET A 1 68  ? 2.915   -25.554 -6.513  1.00 0.00 ? 68  MET A H    1  
ATOM   1008   H HA   . MET A 1 68  ? 4.305   -23.648 -4.957  1.00 0.00 ? 68  MET A HA   1  
ATOM   1009   H HB2  . MET A 1 68  ? 3.884   -24.059 -7.899  1.00 0.00 ? 68  MET A HB2  1  
ATOM   1010   H HB3  . MET A 1 68  ? 4.739   -22.636 -7.304  1.00 0.00 ? 68  MET A HB3  1  
ATOM   1011   H HG2  . MET A 1 68  ? 5.466   -25.476 -6.540  1.00 0.00 ? 68  MET A HG2  1  
ATOM   1012   H HG3  . MET A 1 68  ? 6.246   -24.582 -7.844  1.00 0.00 ? 68  MET A HG3  1  
ATOM   1013   H HE1  . MET A 1 68  ? 7.558   -25.948 -5.404  1.00 0.00 ? 68  MET A HE1  1  
ATOM   1014   H HE2  . MET A 1 68  ? 8.026   -24.933 -4.042  1.00 0.00 ? 68  MET A HE2  1  
ATOM   1015   H HE3  . MET A 1 68  ? 6.360   -25.489 -4.185  1.00 0.00 ? 68  MET A HE3  1  
ATOM   1016   N N    . LYS A 1 69  ? 1.582   -22.539 -6.445  1.00 0.00 ? 69  LYS A N    1  
ATOM   1017   C CA   . LYS A 1 69  ? 0.666   -21.399 -6.511  1.00 0.00 ? 69  LYS A CA   1  
ATOM   1018   C C    . LYS A 1 69  ? -0.078  -21.161 -5.197  1.00 0.00 ? 69  LYS A C    1  
ATOM   1019   O O    . LYS A 1 69  ? -0.304  -22.082 -4.412  1.00 0.00 ? 69  LYS A O    1  
ATOM   1020   C CB   . LYS A 1 69  ? -0.333  -21.604 -7.649  1.00 0.00 ? 69  LYS A CB   1  
ATOM   1021   C CG   . LYS A 1 69  ? 0.417   -21.541 -8.981  1.00 0.00 ? 69  LYS A CG   1  
ATOM   1022   C CD   . LYS A 1 69  ? -0.560  -21.743 -10.139 1.00 0.00 ? 69  LYS A CD   1  
ATOM   1023   C CE   . LYS A 1 69  ? 0.214   -21.744 -11.459 1.00 0.00 ? 69  LYS A CE   1  
ATOM   1024   N NZ   . LYS A 1 69  ? 0.801   -20.394 -11.691 1.00 0.00 ? 69  LYS A NZ   1  
ATOM   1025   H H    . LYS A 1 69  ? 1.369   -23.358 -6.940  1.00 0.00 ? 69  LYS A H    1  
ATOM   1026   H HA   . LYS A 1 69  ? 1.246   -20.516 -6.732  1.00 0.00 ? 69  LYS A HA   1  
ATOM   1027   H HB2  . LYS A 1 69  ? -0.808  -22.568 -7.544  1.00 0.00 ? 69  LYS A HB2  1  
ATOM   1028   H HB3  . LYS A 1 69  ? -1.080  -20.825 -7.621  1.00 0.00 ? 69  LYS A HB3  1  
ATOM   1029   H HG2  . LYS A 1 69  ? 0.895   -20.577 -9.078  1.00 0.00 ? 69  LYS A HG2  1  
ATOM   1030   H HG3  . LYS A 1 69  ? 1.167   -22.317 -9.008  1.00 0.00 ? 69  LYS A HG3  1  
ATOM   1031   H HD2  . LYS A 1 69  ? -1.072  -22.687 -10.018 1.00 0.00 ? 69  LYS A HD2  1  
ATOM   1032   H HD3  . LYS A 1 69  ? -1.281  -20.939 -10.147 1.00 0.00 ? 69  LYS A HD3  1  
ATOM   1033   H HE2  . LYS A 1 69  ? 1.005   -22.477 -11.411 1.00 0.00 ? 69  LYS A HE2  1  
ATOM   1034   H HE3  . LYS A 1 69  ? -0.456  -21.990 -12.269 1.00 0.00 ? 69  LYS A HE3  1  
ATOM   1035   H HZ1  . LYS A 1 69  ? 0.850   -19.877 -10.791 1.00 0.00 ? 69  LYS A HZ1  1  
ATOM   1036   H HZ2  . LYS A 1 69  ? 1.759   -20.494 -12.082 1.00 0.00 ? 69  LYS A HZ2  1  
ATOM   1037   H HZ3  . LYS A 1 69  ? 0.205   -19.868 -12.362 1.00 0.00 ? 69  LYS A HZ3  1  
ATOM   1038   N N    . VAL A 1 70  ? -0.443  -19.896 -4.978  1.00 0.00 ? 70  VAL A N    1  
ATOM   1039   C CA   . VAL A 1 70  ? -1.155  -19.484 -3.768  1.00 0.00 ? 70  VAL A CA   1  
ATOM   1040   C C    . VAL A 1 70  ? -2.353  -18.605 -4.129  1.00 0.00 ? 70  VAL A C    1  
ATOM   1041   O O    . VAL A 1 70  ? -2.517  -18.216 -5.285  1.00 0.00 ? 70  VAL A O    1  
ATOM   1042   C CB   . VAL A 1 70  ? -0.211  -18.696 -2.859  1.00 0.00 ? 70  VAL A CB   1  
ATOM   1043   C CG1  . VAL A 1 70  ? 0.953   -19.590 -2.428  1.00 0.00 ? 70  VAL A CG1  1  
ATOM   1044   C CG2  . VAL A 1 70  ? 0.332   -17.484 -3.620  1.00 0.00 ? 70  VAL A CG2  1  
ATOM   1045   H H    . VAL A 1 70  ? -0.221  -19.218 -5.649  1.00 0.00 ? 70  VAL A H    1  
ATOM   1046   H HA   . VAL A 1 70  ? -1.501  -20.360 -3.242  1.00 0.00 ? 70  VAL A HA   1  
ATOM   1047   H HB   . VAL A 1 70  ? -0.751  -18.361 -1.987  1.00 0.00 ? 70  VAL A HB   1  
ATOM   1048   H HG11 . VAL A 1 70  ? 1.460   -19.967 -3.304  1.00 0.00 ? 70  VAL A HG11 1  
ATOM   1049   H HG12 . VAL A 1 70  ? 1.645   -19.015 -1.830  1.00 0.00 ? 70  VAL A HG12 1  
ATOM   1050   H HG13 . VAL A 1 70  ? 0.575   -20.417 -1.846  1.00 0.00 ? 70  VAL A HG13 1  
ATOM   1051   H HG21 . VAL A 1 70  ? -0.491  -16.861 -3.939  1.00 0.00 ? 70  VAL A HG21 1  
ATOM   1052   H HG22 . VAL A 1 70  ? 0.985   -16.916 -2.974  1.00 0.00 ? 70  VAL A HG22 1  
ATOM   1053   H HG23 . VAL A 1 70  ? 0.885   -17.820 -4.485  1.00 0.00 ? 70  VAL A HG23 1  
ATOM   1054   N N    . SER A 1 71  ? -3.187  -18.289 -3.137  1.00 0.00 ? 71  SER A N    1  
ATOM   1055   C CA   . SER A 1 71  ? -4.355  -17.447 -3.387  1.00 0.00 ? 71  SER A CA   1  
ATOM   1056   C C    . SER A 1 71  ? -3.903  -16.098 -3.943  1.00 0.00 ? 71  SER A C    1  
ATOM   1057   O O    . SER A 1 71  ? -2.999  -15.464 -3.400  1.00 0.00 ? 71  SER A O    1  
ATOM   1058   C CB   . SER A 1 71  ? -5.140  -17.240 -2.090  1.00 0.00 ? 71  SER A CB   1  
ATOM   1059   O OG   . SER A 1 71  ? -6.351  -16.555 -2.378  1.00 0.00 ? 71  SER A OG   1  
ATOM   1060   H H    . SER A 1 71  ? -3.012  -18.620 -2.231  1.00 0.00 ? 71  SER A H    1  
ATOM   1061   H HA   . SER A 1 71  ? -4.993  -17.933 -4.111  1.00 0.00 ? 71  SER A HA   1  
ATOM   1062   H HB2  . SER A 1 71  ? -5.370  -18.195 -1.649  1.00 0.00 ? 71  SER A HB2  1  
ATOM   1063   H HB3  . SER A 1 71  ? -4.543  -16.661 -1.398  1.00 0.00 ? 71  SER A HB3  1  
ATOM   1064   H HG   . SER A 1 71  ? -6.156  -15.860 -3.011  1.00 0.00 ? 71  SER A HG   1  
ATOM   1065   N N    . LEU A 1 72  ? -4.512  -15.688 -5.049  1.00 0.00 ? 72  LEU A N    1  
ATOM   1066   C CA   . LEU A 1 72  ? -4.148  -14.433 -5.714  1.00 0.00 ? 72  LEU A CA   1  
ATOM   1067   C C    . LEU A 1 72  ? -4.477  -13.215 -4.847  1.00 0.00 ? 72  LEU A C    1  
ATOM   1068   O O    . LEU A 1 72  ? -3.722  -12.243 -4.789  1.00 0.00 ? 72  LEU A O    1  
ATOM   1069   C CB   . LEU A 1 72  ? -4.912  -14.317 -7.036  1.00 0.00 ? 72  LEU A CB   1  
ATOM   1070   C CG   . LEU A 1 72  ? -4.387  -15.359 -8.029  1.00 0.00 ? 72  LEU A CG   1  
ATOM   1071   C CD1  . LEU A 1 72  ? -5.303  -15.397 -9.255  1.00 0.00 ? 72  LEU A CD1  1  
ATOM   1072   C CD2  . LEU A 1 72  ? -2.960  -14.994 -8.465  1.00 0.00 ? 72  LEU A CD2  1  
ATOM   1073   H H    . LEU A 1 72  ? -5.203  -16.244 -5.452  1.00 0.00 ? 72  LEU A H    1  
ATOM   1074   H HA   . LEU A 1 72  ? -3.091  -14.437 -5.935  1.00 0.00 ? 72  LEU A HA   1  
ATOM   1075   H HB2  . LEU A 1 72  ? -5.964  -14.490 -6.857  1.00 0.00 ? 72  LEU A HB2  1  
ATOM   1076   H HB3  . LEU A 1 72  ? -4.776  -13.328 -7.445  1.00 0.00 ? 72  LEU A HB3  1  
ATOM   1077   H HG   . LEU A 1 72  ? -4.383  -16.331 -7.557  1.00 0.00 ? 72  LEU A HG   1  
ATOM   1078   H HD11 . LEU A 1 72  ? -6.330  -15.490 -8.934  1.00 0.00 ? 72  LEU A HD11 1  
ATOM   1079   H HD12 . LEU A 1 72  ? -5.184  -14.485 -9.822  1.00 0.00 ? 72  LEU A HD12 1  
ATOM   1080   H HD13 . LEU A 1 72  ? -5.041  -16.243 -9.874  1.00 0.00 ? 72  LEU A HD13 1  
ATOM   1081   H HD21 . LEU A 1 72  ? -2.837  -13.922 -8.449  1.00 0.00 ? 72  LEU A HD21 1  
ATOM   1082   H HD22 . LEU A 1 72  ? -2.251  -15.448 -7.789  1.00 0.00 ? 72  LEU A HD22 1  
ATOM   1083   H HD23 . LEU A 1 72  ? -2.783  -15.360 -9.467  1.00 0.00 ? 72  LEU A HD23 1  
ATOM   1084   N N    . VAL A 1 73  ? -5.628  -13.278 -4.197  1.00 0.00 ? 73  VAL A N    1  
ATOM   1085   C CA   . VAL A 1 73  ? -6.106  -12.190 -3.344  1.00 0.00 ? 73  VAL A CA   1  
ATOM   1086   C C    . VAL A 1 73  ? -5.142  -11.884 -2.186  1.00 0.00 ? 73  VAL A C    1  
ATOM   1087   O O    . VAL A 1 73  ? -5.195  -10.808 -1.587  1.00 0.00 ? 73  VAL A O    1  
ATOM   1088   C CB   . VAL A 1 73  ? -7.474  -12.548 -2.762  1.00 0.00 ? 73  VAL A CB   1  
ATOM   1089   C CG1  . VAL A 1 73  ? -8.388  -13.069 -3.873  1.00 0.00 ? 73  VAL A CG1  1  
ATOM   1090   C CG2  . VAL A 1 73  ? -7.304  -13.626 -1.690  1.00 0.00 ? 73  VAL A CG2  1  
ATOM   1091   H H    . VAL A 1 73  ? -6.182  -14.074 -4.301  1.00 0.00 ? 73  VAL A H    1  
ATOM   1092   H HA   . VAL A 1 73  ? -6.220  -11.303 -3.947  1.00 0.00 ? 73  VAL A HA   1  
ATOM   1093   H HB   . VAL A 1 73  ? -7.916  -11.667 -2.320  1.00 0.00 ? 73  VAL A HB   1  
ATOM   1094   H HG11 . VAL A 1 73  ? -7.928  -13.923 -4.348  1.00 0.00 ? 73  VAL A HG11 1  
ATOM   1095   H HG12 . VAL A 1 73  ? -9.338  -13.360 -3.450  1.00 0.00 ? 73  VAL A HG12 1  
ATOM   1096   H HG13 . VAL A 1 73  ? -8.544  -12.290 -4.605  1.00 0.00 ? 73  VAL A HG13 1  
ATOM   1097   H HG21 . VAL A 1 73  ? -6.521  -14.307 -1.986  1.00 0.00 ? 73  VAL A HG21 1  
ATOM   1098   H HG22 . VAL A 1 73  ? -7.040  -13.160 -0.752  1.00 0.00 ? 73  VAL A HG22 1  
ATOM   1099   H HG23 . VAL A 1 73  ? -8.230  -14.169 -1.574  1.00 0.00 ? 73  VAL A HG23 1  
ATOM   1100   N N    . LEU A 1 74  ? -4.293  -12.847 -1.863  1.00 0.00 ? 74  LEU A N    1  
ATOM   1101   C CA   . LEU A 1 74  ? -3.352  -12.659 -0.777  1.00 0.00 ? 74  LEU A CA   1  
ATOM   1102   C C    . LEU A 1 74  ? -2.648  -11.326 -0.988  1.00 0.00 ? 74  LEU A C    1  
ATOM   1103   O O    . LEU A 1 74  ? -2.366  -10.594 -0.038  1.00 0.00 ? 74  LEU A O    1  
ATOM   1104   C CB   . LEU A 1 74  ? -2.348  -13.825 -0.762  1.00 0.00 ? 74  LEU A CB   1  
ATOM   1105   C CG   . LEU A 1 74  ? -1.216  -13.579 0.251   1.00 0.00 ? 74  LEU A CG   1  
ATOM   1106   C CD1  . LEU A 1 74  ? -1.776  -13.561 1.678   1.00 0.00 ? 74  LEU A CD1  1  
ATOM   1107   C CD2  . LEU A 1 74  ? -0.168  -14.704 0.131   1.00 0.00 ? 74  LEU A CD2  1  
ATOM   1108   H H    . LEU A 1 74  ? -4.306  -13.693 -2.357  1.00 0.00 ? 74  LEU A H    1  
ATOM   1109   H HA   . LEU A 1 74  ? -3.890  -12.635 0.156   1.00 0.00 ? 74  LEU A HA   1  
ATOM   1110   H HB2  . LEU A 1 74  ? -2.869  -14.732 -0.493  1.00 0.00 ? 74  LEU A HB2  1  
ATOM   1111   H HB3  . LEU A 1 74  ? -1.925  -13.938 -1.749  1.00 0.00 ? 74  LEU A HB3  1  
ATOM   1112   H HG   . LEU A 1 74  ? -0.745  -12.631 0.041   1.00 0.00 ? 74  LEU A HG   1  
ATOM   1113   H HD11 . LEU A 1 74  ? -2.375  -14.445 1.840   1.00 0.00 ? 74  LEU A HD11 1  
ATOM   1114   H HD12 . LEU A 1 74  ? -0.956  -13.551 2.384   1.00 0.00 ? 74  LEU A HD12 1  
ATOM   1115   H HD13 . LEU A 1 74  ? -2.382  -12.681 1.820   1.00 0.00 ? 74  LEU A HD13 1  
ATOM   1116   H HD21 . LEU A 1 74  ? -0.205  -15.136 -0.860  1.00 0.00 ? 74  LEU A HD21 1  
ATOM   1117   H HD22 . LEU A 1 74  ? 0.817   -14.294 0.303   1.00 0.00 ? 74  LEU A HD22 1  
ATOM   1118   H HD23 . LEU A 1 74  ? -0.371  -15.474 0.865   1.00 0.00 ? 74  LEU A HD23 1  
ATOM   1119   N N    . VAL A 1 75  ? -2.383  -11.019 -2.252  1.00 0.00 ? 75  VAL A N    1  
ATOM   1120   C CA   . VAL A 1 75  ? -1.730  -9.770  -2.615  1.00 0.00 ? 75  VAL A CA   1  
ATOM   1121   C C    . VAL A 1 75  ? -2.650  -8.537  -2.377  1.00 0.00 ? 75  VAL A C    1  
ATOM   1122   O O    . VAL A 1 75  ? -2.177  -7.529  -1.861  1.00 0.00 ? 75  VAL A O    1  
ATOM   1123   C CB   . VAL A 1 75  ? -1.269  -9.832  -4.075  1.00 0.00 ? 75  VAL A CB   1  
ATOM   1124   C CG1  . VAL A 1 75  ? -0.615  -8.499  -4.470  1.00 0.00 ? 75  VAL A CG1  1  
ATOM   1125   C CG2  . VAL A 1 75  ? -0.253  -10.975 -4.243  1.00 0.00 ? 75  VAL A CG2  1  
ATOM   1126   H H    . VAL A 1 75  ? -2.642  -11.645 -2.960  1.00 0.00 ? 75  VAL A H    1  
ATOM   1127   H HA   . VAL A 1 75  ? -0.852  -9.662  -1.994  1.00 0.00 ? 75  VAL A HA   1  
ATOM   1128   H HB   . VAL A 1 75  ? -2.124  -10.017 -4.711  1.00 0.00 ? 75  VAL A HB   1  
ATOM   1129   H HG11 . VAL A 1 75  ? -0.328  -7.954  -3.583  1.00 0.00 ? 75  VAL A HG11 1  
ATOM   1130   H HG12 . VAL A 1 75  ? 0.260   -8.692  -5.065  1.00 0.00 ? 75  VAL A HG12 1  
ATOM   1131   H HG13 . VAL A 1 75  ? -1.314  -7.910  -5.041  1.00 0.00 ? 75  VAL A HG13 1  
ATOM   1132   H HG21 . VAL A 1 75  ? -0.669  -11.892 -3.850  1.00 0.00 ? 75  VAL A HG21 1  
ATOM   1133   H HG22 . VAL A 1 75  ? -0.029  -11.104 -5.293  1.00 0.00 ? 75  VAL A HG22 1  
ATOM   1134   H HG23 . VAL A 1 75  ? 0.653   -10.733 -3.710  1.00 0.00 ? 75  VAL A HG23 1  
ATOM   1135   N N    . HIS A 1 76  ? -3.970  -8.613  -2.746  1.00 0.00 ? 76  HIS A N    1  
ATOM   1136   C CA   . HIS A 1 76  ? -4.909  -7.464  -2.539  1.00 0.00 ? 76  HIS A CA   1  
ATOM   1137   C C    . HIS A 1 76  ? -4.888  -7.078  -1.070  1.00 0.00 ? 76  HIS A C    1  
ATOM   1138   O O    . HIS A 1 76  ? -4.935  -5.895  -0.723  1.00 0.00 ? 76  HIS A O    1  
ATOM   1139   C CB   . HIS A 1 76  ? -6.369  -7.828  -2.973  1.00 0.00 ? 76  HIS A CB   1  
ATOM   1140   C CG   . HIS A 1 76  ? -7.359  -6.633  -2.868  1.00 0.00 ? 76  HIS A CG   1  
ATOM   1141   N ND1  . HIS A 1 76  ? -6.934  -5.314  -2.696  1.00 0.00 ? 76  HIS A ND1  1  
ATOM   1142   C CD2  . HIS A 1 76  ? -8.764  -6.549  -2.971  1.00 0.00 ? 76  HIS A CD2  1  
ATOM   1143   C CE1  . HIS A 1 76  ? -8.033  -4.509  -2.698  1.00 0.00 ? 76  HIS A CE1  1  
ATOM   1144   N NE2  . HIS A 1 76  ? -9.163  -5.197  -2.875  1.00 0.00 ? 76  HIS A NE2  1  
ATOM   1145   H H    . HIS A 1 76  ? -4.311  -9.438  -3.154  1.00 0.00 ? 76  HIS A H    1  
ATOM   1146   H HA   . HIS A 1 76  ? -4.567  -6.623  -3.124  1.00 0.00 ? 76  HIS A HA   1  
ATOM   1147   H HB2  . HIS A 1 76  ? -6.352  -8.174  -3.991  1.00 0.00 ? 76  HIS A HB2  1  
ATOM   1148   H HB3  . HIS A 1 76  ? -6.716  -8.627  -2.353  1.00 0.00 ? 76  HIS A HB3  1  
ATOM   1149   H HD1  . HIS A 1 76  ? -6.005  -5.017  -2.591  1.00 0.00 ? 76  HIS A HD1  1  
ATOM   1150   H HD2  . HIS A 1 76  ? -9.428  -7.391  -3.106  1.00 0.00 ? 76  HIS A HD2  1  
ATOM   1151   H HE1  . HIS A 1 76  ? -7.995  -3.439  -2.572  1.00 0.00 ? 76  HIS A HE1  1  
ATOM   1152   N N    . ALA A 1 77  ? -4.814  -8.088  -0.205  1.00 0.00 ? 77  ALA A N    1  
ATOM   1153   C CA   . ALA A 1 77  ? -4.778  -7.850  1.234   1.00 0.00 ? 77  ALA A CA   1  
ATOM   1154   C C    . ALA A 1 77  ? -3.389  -7.384  1.689   1.00 0.00 ? 77  ALA A C    1  
ATOM   1155   O O    . ALA A 1 77  ? -3.272  -6.468  2.502   1.00 0.00 ? 77  ALA A O    1  
ATOM   1156   C CB   . ALA A 1 77  ? -5.167  -9.129  1.979   1.00 0.00 ? 77  ALA A CB   1  
ATOM   1157   H H    . ALA A 1 77  ? -4.778  -9.007  -0.538  1.00 0.00 ? 77  ALA A H    1  
ATOM   1158   H HA   . ALA A 1 77  ? -5.496  -7.079  1.474   1.00 0.00 ? 77  ALA A HA   1  
ATOM   1159   H HB1  . ALA A 1 77  ? -4.831  -9.987  1.417   1.00 0.00 ? 77  ALA A HB1  1  
ATOM   1160   H HB2  . ALA A 1 77  ? -4.708  -9.135  2.957   1.00 0.00 ? 77  ALA A HB2  1  
ATOM   1161   H HB3  . ALA A 1 77  ? -6.241  -9.168  2.086   1.00 0.00 ? 77  ALA A HB3  1  
ATOM   1162   N N    . GLN A 1 78  ? -2.343  -8.023  1.166   1.00 0.00 ? 78  GLN A N    1  
ATOM   1163   C CA   . GLN A 1 78  ? -0.974  -7.663  1.540   1.00 0.00 ? 78  GLN A CA   1  
ATOM   1164   C C    . GLN A 1 78  ? -0.661  -6.233  1.104   1.00 0.00 ? 78  GLN A C    1  
ATOM   1165   O O    . GLN A 1 78  ? -0.145  -5.433  1.884   1.00 0.00 ? 78  GLN A O    1  
ATOM   1166   C CB   . GLN A 1 78  ? 0.015   -8.628  0.883   1.00 0.00 ? 78  GLN A CB   1  
ATOM   1167   C CG   . GLN A 1 78  ? 1.366   -8.536  1.596   1.00 0.00 ? 78  GLN A CG   1  
ATOM   1168   C CD   . GLN A 1 78  ? 2.374   -9.460  0.918   1.00 0.00 ? 78  GLN A CD   1  
ATOM   1169   O OE1  . GLN A 1 78  ? 2.045   -10.123 -0.064  1.00 0.00 ? 78  GLN A OE1  1  
ATOM   1170   N NE2  . GLN A 1 78  ? 3.590   -9.543  1.386   1.00 0.00 ? 78  GLN A NE2  1  
ATOM   1171   H H    . GLN A 1 78  ? -2.493  -8.750  0.525   1.00 0.00 ? 78  GLN A H    1  
ATOM   1172   H HA   . GLN A 1 78  ? -0.873  -7.736  2.613   1.00 0.00 ? 78  GLN A HA   1  
ATOM   1173   H HB2  . GLN A 1 78  ? -0.362  -9.639  0.956   1.00 0.00 ? 78  GLN A HB2  1  
ATOM   1174   H HB3  . GLN A 1 78  ? 0.141   -8.364  -0.156  1.00 0.00 ? 78  GLN A HB3  1  
ATOM   1175   H HG2  . GLN A 1 78  ? 1.723   -7.519  1.558   1.00 0.00 ? 78  GLN A HG2  1  
ATOM   1176   H HG3  . GLN A 1 78  ? 1.248   -8.835  2.627   1.00 0.00 ? 78  GLN A HG3  1  
ATOM   1177   H HE21 . GLN A 1 78  ? 3.851   -9.014  2.169   1.00 0.00 ? 78  GLN A HE21 1  
ATOM   1178   H HE22 . GLN A 1 78  ? 4.241   -10.134 0.955   1.00 0.00 ? 78  GLN A HE22 1  
ATOM   1179   N N    . LEU A 1 79  ? -0.993  -5.926  -0.144  1.00 0.00 ? 79  LEU A N    1  
ATOM   1180   C CA   . LEU A 1 79  ? -0.767  -4.590  -0.693  1.00 0.00 ? 79  LEU A CA   1  
ATOM   1181   C C    . LEU A 1 79  ? -1.449  -3.526  0.157   1.00 0.00 ? 79  LEU A C    1  
ATOM   1182   O O    . LEU A 1 79  ? -0.835  -2.531  0.528   1.00 0.00 ? 79  LEU A O    1  
ATOM   1183   C CB   . LEU A 1 79  ? -1.300  -4.517  -2.134  1.00 0.00 ? 79  LEU A CB   1  
ATOM   1184   C CG   . LEU A 1 79  ? -1.163  -3.087  -2.690  1.00 0.00 ? 79  LEU A CG   1  
ATOM   1185   C CD1  . LEU A 1 79  ? 0.293   -2.624  -2.578  1.00 0.00 ? 79  LEU A CD1  1  
ATOM   1186   C CD2  . LEU A 1 79  ? -1.612  -3.057  -4.161  1.00 0.00 ? 79  LEU A CD2  1  
ATOM   1187   H H    . LEU A 1 79  ? -1.399  -6.618  -0.712  1.00 0.00 ? 79  LEU A H    1  
ATOM   1188   H HA   . LEU A 1 79  ? 0.294   -4.396  -0.699  1.00 0.00 ? 79  LEU A HA   1  
ATOM   1189   H HB2  . LEU A 1 79  ? -0.738  -5.198  -2.752  1.00 0.00 ? 79  LEU A HB2  1  
ATOM   1190   H HB3  . LEU A 1 79  ? -2.340  -4.802  -2.141  1.00 0.00 ? 79  LEU A HB3  1  
ATOM   1191   H HG   . LEU A 1 79  ? -1.789  -2.417  -2.113  1.00 0.00 ? 79  LEU A HG   1  
ATOM   1192   H HD11 . LEU A 1 79  ? 0.951   -3.471  -2.699  1.00 0.00 ? 79  LEU A HD11 1  
ATOM   1193   H HD12 . LEU A 1 79  ? 0.500   -1.892  -3.343  1.00 0.00 ? 79  LEU A HD12 1  
ATOM   1194   H HD13 . LEU A 1 79  ? 0.453   -2.180  -1.604  1.00 0.00 ? 79  LEU A HD13 1  
ATOM   1195   H HD21 . LEU A 1 79  ? -1.317  -3.974  -4.653  1.00 0.00 ? 79  LEU A HD21 1  
ATOM   1196   H HD22 . LEU A 1 79  ? -2.686  -2.961  -4.206  1.00 0.00 ? 79  LEU A HD22 1  
ATOM   1197   H HD23 . LEU A 1 79  ? -1.158  -2.217  -4.666  1.00 0.00 ? 79  LEU A HD23 1  
ATOM   1198   N N    . HIS A 1 80  ? -2.723  -3.734  0.456   1.00 0.00 ? 80  HIS A N    1  
ATOM   1199   C CA   . HIS A 1 80  ? -3.463  -2.764  1.253   1.00 0.00 ? 80  HIS A CA   1  
ATOM   1200   C C    . HIS A 1 80  ? -2.924  -2.695  2.676   1.00 0.00 ? 80  HIS A C    1  
ATOM   1201   O O    . HIS A 1 80  ? -2.730  -1.608  3.226   1.00 0.00 ? 80  HIS A O    1  
ATOM   1202   C CB   . HIS A 1 80  ? -4.950  -3.114  1.252   1.00 0.00 ? 80  HIS A CB   1  
ATOM   1203   C CG   . HIS A 1 80  ? -5.616  -2.397  0.102   1.00 0.00 ? 80  HIS A CG   1  
ATOM   1204   N ND1  . HIS A 1 80  ? -6.424  -1.287  0.291   1.00 0.00 ? 80  HIS A ND1  1  
ATOM   1205   C CD2  . HIS A 1 80  ? -5.605  -2.629  -1.250  1.00 0.00 ? 80  HIS A CD2  1  
ATOM   1206   C CE1  . HIS A 1 80  ? -6.864  -0.896  -0.919  1.00 0.00 ? 80  HIS A CE1  1  
ATOM   1207   N NE2  . HIS A 1 80  ? -6.394  -1.680  -1.894  1.00 0.00 ? 80  HIS A NE2  1  
ATOM   1208   H H    . HIS A 1 80  ? -3.172  -4.549  0.133   1.00 0.00 ? 80  HIS A H    1  
ATOM   1209   H HA   . HIS A 1 80  ? -3.353  -1.792  0.799   1.00 0.00 ? 80  HIS A HA   1  
ATOM   1210   H HB2  . HIS A 1 80  ? -5.070  -4.181  1.134   1.00 0.00 ? 80  HIS A HB2  1  
ATOM   1211   H HB3  . HIS A 1 80  ? -5.401  -2.799  2.181   1.00 0.00 ? 80  HIS A HB3  1  
ATOM   1212   H HD1  . HIS A 1 80  ? -6.636  -0.864  1.150   1.00 0.00 ? 80  HIS A HD1  1  
ATOM   1213   H HD2  . HIS A 1 80  ? -5.064  -3.425  -1.741  1.00 0.00 ? 80  HIS A HD2  1  
ATOM   1214   H HE1  . HIS A 1 80  ? -7.519  -0.054  -1.082  1.00 0.00 ? 80  HIS A HE1  1  
ATOM   1215   H HE2  . HIS A 1 80  ? -6.569  -1.605  -2.855  1.00 0.00 ? 80  HIS A HE2  1  
ATOM   1216   N N    . LEU A 1 81  ? -2.691  -3.854  3.272   1.00 0.00 ? 81  LEU A N    1  
ATOM   1217   C CA   . LEU A 1 81  ? -2.184  -3.906  4.640   1.00 0.00 ? 81  LEU A CA   1  
ATOM   1218   C C    . LEU A 1 81  ? -0.785  -3.296  4.751   1.00 0.00 ? 81  LEU A C    1  
ATOM   1219   O O    . LEU A 1 81  ? -0.508  -2.527  5.678   1.00 0.00 ? 81  LEU A O    1  
ATOM   1220   C CB   . LEU A 1 81  ? -2.149  -5.356  5.128   1.00 0.00 ? 81  LEU A CB   1  
ATOM   1221   C CG   . LEU A 1 81  ? -3.580  -5.874  5.325   1.00 0.00 ? 81  LEU A CG   1  
ATOM   1222   C CD1  . LEU A 1 81  ? -3.547  -7.391  5.529   1.00 0.00 ? 81  LEU A CD1  1  
ATOM   1223   C CD2  . LEU A 1 81  ? -4.231  -5.206  6.548   1.00 0.00 ? 81  LEU A CD2  1  
ATOM   1224   H H    . LEU A 1 81  ? -2.871  -4.691  2.789   1.00 0.00 ? 81  LEU A H    1  
ATOM   1225   H HA   . LEU A 1 81  ? -2.850  -3.346  5.274   1.00 0.00 ? 81  LEU A HA   1  
ATOM   1226   H HB2  . LEU A 1 81  ? -1.642  -5.966  4.390   1.00 0.00 ? 81  LEU A HB2  1  
ATOM   1227   H HB3  . LEU A 1 81  ? -1.612  -5.409  6.064   1.00 0.00 ? 81  LEU A HB3  1  
ATOM   1228   H HG   . LEU A 1 81  ? -4.161  -5.650  4.440   1.00 0.00 ? 81  LEU A HG   1  
ATOM   1229   H HD11 . LEU A 1 81  ? -2.716  -7.652  6.169   1.00 0.00 ? 81  LEU A HD11 1  
ATOM   1230   H HD12 . LEU A 1 81  ? -4.469  -7.716  5.986   1.00 0.00 ? 81  LEU A HD12 1  
ATOM   1231   H HD13 . LEU A 1 81  ? -3.428  -7.878  4.571   1.00 0.00 ? 81  LEU A HD13 1  
ATOM   1232   H HD21 . LEU A 1 81  ? -3.486  -5.030  7.311   1.00 0.00 ? 81  LEU A HD21 1  
ATOM   1233   H HD22 . LEU A 1 81  ? -4.671  -4.264  6.253   1.00 0.00 ? 81  LEU A HD22 1  
ATOM   1234   H HD23 . LEU A 1 81  ? -5.001  -5.853  6.942   1.00 0.00 ? 81  LEU A HD23 1  
ATOM   1235   N N    . MET A 1 82  ? 0.094   -3.643  3.815   1.00 0.00 ? 82  MET A N    1  
ATOM   1236   C CA   . MET A 1 82  ? 1.457   -3.115  3.837   1.00 0.00 ? 82  MET A CA   1  
ATOM   1237   C C    . MET A 1 82  ? 1.447   -1.597  3.696   1.00 0.00 ? 82  MET A C    1  
ATOM   1238   O O    . MET A 1 82  ? 2.154   -0.885  4.413   1.00 0.00 ? 82  MET A O    1  
ATOM   1239   C CB   . MET A 1 82  ? 2.279   -3.727  2.695   1.00 0.00 ? 82  MET A CB   1  
ATOM   1240   C CG   . MET A 1 82  ? 2.655   -5.177  3.029   1.00 0.00 ? 82  MET A CG   1  
ATOM   1241   S SD   . MET A 1 82  ? 3.792   -5.218  4.443   1.00 0.00 ? 82  MET A SD   1  
ATOM   1242   C CE   . MET A 1 82  ? 5.273   -4.609  3.596   1.00 0.00 ? 82  MET A CE   1  
ATOM   1243   H H    . MET A 1 82  ? -0.176  -4.258  3.098   1.00 0.00 ? 82  MET A H    1  
ATOM   1244   H HA   . MET A 1 82  ? 1.913   -3.373  4.779   1.00 0.00 ? 82  MET A HA   1  
ATOM   1245   H HB2  . MET A 1 82  ? 1.692   -3.711  1.787   1.00 0.00 ? 82  MET A HB2  1  
ATOM   1246   H HB3  . MET A 1 82  ? 3.178   -3.147  2.549   1.00 0.00 ? 82  MET A HB3  1  
ATOM   1247   H HG2  . MET A 1 82  ? 1.761   -5.731  3.273   1.00 0.00 ? 82  MET A HG2  1  
ATOM   1248   H HG3  . MET A 1 82  ? 3.132   -5.626  2.171   1.00 0.00 ? 82  MET A HG3  1  
ATOM   1249   H HE1  . MET A 1 82  ? 5.316   -5.022  2.598   1.00 0.00 ? 82  MET A HE1  1  
ATOM   1250   H HE2  . MET A 1 82  ? 5.235   -3.533  3.535   1.00 0.00 ? 82  MET A HE2  1  
ATOM   1251   H HE3  . MET A 1 82  ? 6.153   -4.904  4.150   1.00 0.00 ? 82  MET A HE3  1  
ATOM   1252   N N    . THR A 1 83  ? 0.639   -1.107  2.765   1.00 0.00 ? 83  THR A N    1  
ATOM   1253   C CA   . THR A 1 83  ? 0.538   0.329   2.532   1.00 0.00 ? 83  THR A CA   1  
ATOM   1254   C C    . THR A 1 83  ? -0.010  1.039   3.766   1.00 0.00 ? 83  THR A C    1  
ATOM   1255   O O    . THR A 1 83  ? 0.534   2.053   4.210   1.00 0.00 ? 83  THR A O    1  
ATOM   1256   C CB   . THR A 1 83  ? -0.386  0.610   1.336   1.00 0.00 ? 83  THR A CB   1  
ATOM   1257   O OG1  . THR A 1 83  ? -1.558  -0.176  1.461   1.00 0.00 ? 83  THR A OG1  1  
ATOM   1258   C CG2  . THR A 1 83  ? 0.318   0.261   0.020   1.00 0.00 ? 83  THR A CG2  1  
ATOM   1259   H H    . THR A 1 83  ? 0.094   -1.721  2.227   1.00 0.00 ? 83  THR A H    1  
ATOM   1260   H HA   . THR A 1 83  ? 1.516   0.721   2.313   1.00 0.00 ? 83  THR A HA   1  
ATOM   1261   H HB   . THR A 1 83  ? -0.658  1.656   1.332   1.00 0.00 ? 83  THR A HB   1  
ATOM   1262   H HG1  . THR A 1 83  ? -2.314  0.366   1.226   1.00 0.00 ? 83  THR A HG1  1  
ATOM   1263   H HG21 . THR A 1 83  ? 1.102   -0.461  0.203   1.00 0.00 ? 83  THR A HG21 1  
ATOM   1264   H HG22 . THR A 1 83  ? -0.398  -0.161  -0.671  1.00 0.00 ? 83  THR A HG22 1  
ATOM   1265   H HG23 . THR A 1 83  ? 0.747   1.154   -0.410  1.00 0.00 ? 83  THR A HG23 1  
ATOM   1266   N N    . SER A 1 84  ? -1.094  0.507   4.317   1.00 0.00 ? 84  SER A N    1  
ATOM   1267   C CA   . SER A 1 84  ? -1.716  1.110   5.499   1.00 0.00 ? 84  SER A CA   1  
ATOM   1268   C C    . SER A 1 84  ? -0.768  1.114   6.696   1.00 0.00 ? 84  SER A C    1  
ATOM   1269   O O    . SER A 1 84  ? -0.623  2.132   7.376   1.00 0.00 ? 84  SER A O    1  
ATOM   1270   C CB   . SER A 1 84  ? -2.997  0.359   5.863   1.00 0.00 ? 84  SER A CB   1  
ATOM   1271   O OG   . SER A 1 84  ? -4.015  0.697   4.931   1.00 0.00 ? 84  SER A OG   1  
ATOM   1272   H H    . SER A 1 84  ? -1.492  -0.300  3.919   1.00 0.00 ? 84  SER A H    1  
ATOM   1273   H HA   . SER A 1 84  ? -1.975  2.131   5.266   1.00 0.00 ? 84  SER A HA   1  
ATOM   1274   H HB2  . SER A 1 84  ? -2.819  -0.703  5.830   1.00 0.00 ? 84  SER A HB2  1  
ATOM   1275   H HB3  . SER A 1 84  ? -3.305  0.639   6.865   1.00 0.00 ? 84  SER A HB3  1  
ATOM   1276   H HG   . SER A 1 84  ? -3.770  0.329   4.073   1.00 0.00 ? 84  SER A HG   1  
ATOM   1277   N N    . MET A 1 85  ? -0.129  -0.022  6.961   1.00 0.00 ? 85  MET A N    1  
ATOM   1278   C CA   . MET A 1 85  ? 0.796   -0.113  8.092   1.00 0.00 ? 85  MET A CA   1  
ATOM   1279   C C    . MET A 1 85  ? 1.933   0.890   7.950   1.00 0.00 ? 85  MET A C    1  
ATOM   1280   O O    . MET A 1 85  ? 2.280   1.596   8.900   1.00 0.00 ? 85  MET A O    1  
ATOM   1281   C CB   . MET A 1 85  ? 1.353   -1.534  8.206   1.00 0.00 ? 85  MET A CB   1  
ATOM   1282   C CG   . MET A 1 85  ? 2.155   -1.666  9.505   1.00 0.00 ? 85  MET A CG   1  
ATOM   1283   S SD   . MET A 1 85  ? 2.516   -3.413  9.828   1.00 0.00 ? 85  MET A SD   1  
ATOM   1284   C CE   . MET A 1 85  ? 3.856   -3.621  8.630   1.00 0.00 ? 85  MET A CE   1  
ATOM   1285   H H    . MET A 1 85  ? -0.276  -0.809  6.390   1.00 0.00 ? 85  MET A H    1  
ATOM   1286   H HA   . MET A 1 85  ? 0.252   0.113   8.994   1.00 0.00 ? 85  MET A HA   1  
ATOM   1287   H HB2  . MET A 1 85  ? 0.536   -2.241  8.212   1.00 0.00 ? 85  MET A HB2  1  
ATOM   1288   H HB3  . MET A 1 85  ? 1.997   -1.734  7.365   1.00 0.00 ? 85  MET A HB3  1  
ATOM   1289   H HG2  . MET A 1 85  ? 3.081   -1.119  9.413   1.00 0.00 ? 85  MET A HG2  1  
ATOM   1290   H HG3  . MET A 1 85  ? 1.580   -1.261  10.325  1.00 0.00 ? 85  MET A HG3  1  
ATOM   1291   H HE1  . MET A 1 85  ? 3.495   -3.404  7.639   1.00 0.00 ? 85  MET A HE1  1  
ATOM   1292   H HE2  . MET A 1 85  ? 4.664   -2.945  8.874   1.00 0.00 ? 85  MET A HE2  1  
ATOM   1293   H HE3  . MET A 1 85  ? 4.211   -4.642  8.664   1.00 0.00 ? 85  MET A HE3  1  
ATOM   1294   N N    . LEU A 1 86  ? 2.508   0.945   6.760   1.00 0.00 ? 86  LEU A N    1  
ATOM   1295   C CA   . LEU A 1 86  ? 3.607   1.861   6.497   1.00 0.00 ? 86  LEU A CA   1  
ATOM   1296   C C    . LEU A 1 86  ? 3.149   3.307   6.669   1.00 0.00 ? 86  LEU A C    1  
ATOM   1297   O O    . LEU A 1 86  ? 3.824   4.122   7.302   1.00 0.00 ? 86  LEU A O    1  
ATOM   1298   C CB   . LEU A 1 86  ? 4.113   1.641   5.071   1.00 0.00 ? 86  LEU A CB   1  
ATOM   1299   C CG   . LEU A 1 86  ? 5.476   2.323   4.894   1.00 0.00 ? 86  LEU A CG   1  
ATOM   1300   C CD1  . LEU A 1 86  ? 6.580   1.490   5.577   1.00 0.00 ? 86  LEU A CD1  1  
ATOM   1301   C CD2  . LEU A 1 86  ? 5.786   2.476   3.393   1.00 0.00 ? 86  LEU A CD2  1  
ATOM   1302   H H    . LEU A 1 86  ? 2.183   0.362   6.040   1.00 0.00 ? 86  LEU A H    1  
ATOM   1303   H HA   . LEU A 1 86  ? 4.406   1.661   7.193   1.00 0.00 ? 86  LEU A HA   1  
ATOM   1304   H HB2  . LEU A 1 86  ? 4.205   0.581   4.884   1.00 0.00 ? 86  LEU A HB2  1  
ATOM   1305   H HB3  . LEU A 1 86  ? 3.403   2.067   4.374   1.00 0.00 ? 86  LEU A HB3  1  
ATOM   1306   H HG   . LEU A 1 86  ? 5.439   3.302   5.351   1.00 0.00 ? 86  LEU A HG   1  
ATOM   1307   H HD11 . LEU A 1 86  ? 6.133   0.687   6.148   1.00 0.00 ? 86  LEU A HD11 1  
ATOM   1308   H HD12 . LEU A 1 86  ? 7.245   1.079   4.832   1.00 0.00 ? 86  LEU A HD12 1  
ATOM   1309   H HD13 . LEU A 1 86  ? 7.144   2.127   6.244   1.00 0.00 ? 86  LEU A HD13 1  
ATOM   1310   H HD21 . LEU A 1 86  ? 4.889   2.773   2.865   1.00 0.00 ? 86  LEU A HD21 1  
ATOM   1311   H HD22 . LEU A 1 86  ? 6.545   3.233   3.261   1.00 0.00 ? 86  LEU A HD22 1  
ATOM   1312   H HD23 . LEU A 1 86  ? 6.143   1.537   2.998   1.00 0.00 ? 86  LEU A HD23 1  
ATOM   1313   N N    . ALA A 1 87  ? 1.991   3.613   6.102   1.00 0.00 ? 87  ALA A N    1  
ATOM   1314   C CA   . ALA A 1 87  ? 1.438   4.963   6.193   1.00 0.00 ? 87  ALA A CA   1  
ATOM   1315   C C    . ALA A 1 87  ? 1.299   5.385   7.650   1.00 0.00 ? 87  ALA A C    1  
ATOM   1316   O O    . ALA A 1 87  ? 1.708   6.482   8.044   1.00 0.00 ? 87  ALA A O    1  
ATOM   1317   C CB   . ALA A 1 87  ? 0.060   5.017   5.506   1.00 0.00 ? 87  ALA A CB   1  
ATOM   1318   H H    . ALA A 1 87  ? 1.496   2.920   5.614   1.00 0.00 ? 87  ALA A H    1  
ATOM   1319   H HA   . ALA A 1 87  ? 2.104   5.646   5.699   1.00 0.00 ? 87  ALA A HA   1  
ATOM   1320   H HB1  . ALA A 1 87  ? -0.214  4.030   5.161   1.00 0.00 ? 87  ALA A HB1  1  
ATOM   1321   H HB2  . ALA A 1 87  ? -0.688  5.371   6.206   1.00 0.00 ? 87  ALA A HB2  1  
ATOM   1322   H HB3  . ALA A 1 87  ? 0.104   5.690   4.661   1.00 0.00 ? 87  ALA A HB3  1  
ATOM   1323   N N    . ARG A 1 88  ? 0.716   4.512   8.453   1.00 0.00 ? 88  ARG A N    1  
ATOM   1324   C CA   . ARG A 1 88  ? 0.524   4.819   9.862   1.00 0.00 ? 88  ARG A CA   1  
ATOM   1325   C C    . ARG A 1 88  ? 1.849   5.081   10.566  1.00 0.00 ? 88  ARG A C    1  
ATOM   1326   O O    . ARG A 1 88  ? 1.968   6.028   11.345  1.00 0.00 ? 88  ARG A O    1  
ATOM   1327   C CB   . ARG A 1 88  ? -0.185  3.673   10.585  1.00 0.00 ? 88  ARG A CB   1  
ATOM   1328   C CG   . ARG A 1 88  ? -0.646  4.172   11.966  1.00 0.00 ? 88  ARG A CG   1  
ATOM   1329   C CD   . ARG A 1 88  ? -0.701  3.026   12.968  1.00 0.00 ? 88  ARG A CD   1  
ATOM   1330   N NE   . ARG A 1 88  ? -0.124  3.464   14.245  1.00 0.00 ? 88  ARG A NE   1  
ATOM   1331   C CZ   . ARG A 1 88  ? 1.099   3.969   14.351  1.00 0.00 ? 88  ARG A CZ   1  
ATOM   1332   N NH1  . ARG A 1 88  ? 1.896   3.980   13.335  1.00 0.00 ? 88  ARG A NH1  1  
ATOM   1333   N NH2  . ARG A 1 88  ? 1.493   4.450   15.490  1.00 0.00 ? 88  ARG A NH2  1  
ATOM   1334   H H    . ARG A 1 88  ? 0.409   3.652   8.091   1.00 0.00 ? 88  ARG A H    1  
ATOM   1335   H HA   . ARG A 1 88  ? -0.089  5.702   9.940   1.00 0.00 ? 88  ARG A HA   1  
ATOM   1336   H HB2  . ARG A 1 88  ? -1.039  3.355   10.006  1.00 0.00 ? 88  ARG A HB2  1  
ATOM   1337   H HB3  . ARG A 1 88  ? 0.501   2.847   10.709  1.00 0.00 ? 88  ARG A HB3  1  
ATOM   1338   H HG2  . ARG A 1 88  ? 0.037   4.922   12.331  1.00 0.00 ? 88  ARG A HG2  1  
ATOM   1339   H HG3  . ARG A 1 88  ? -1.632  4.606   11.878  1.00 0.00 ? 88  ARG A HG3  1  
ATOM   1340   H HD2  . ARG A 1 88  ? -1.746  2.756   13.123  1.00 0.00 ? 88  ARG A HD2  1  
ATOM   1341   H HD3  . ARG A 1 88  ? -0.160  2.167   12.589  1.00 0.00 ? 88  ARG A HD3  1  
ATOM   1342   H HE   . ARG A 1 88  ? -0.683  3.432   15.045  1.00 0.00 ? 88  ARG A HE   1  
ATOM   1343   H HH11 . ARG A 1 88  ? 1.593   3.603   12.464  1.00 0.00 ? 88  ARG A HH11 1  
ATOM   1344   H HH12 . ARG A 1 88  ? 2.813   4.368   13.424  1.00 0.00 ? 88  ARG A HH12 1  
ATOM   1345   H HH21 . ARG A 1 88  ? 0.882   4.435   16.281  1.00 0.00 ? 88  ARG A HH21 1  
ATOM   1346   H HH22 . ARG A 1 88  ? 2.402   4.855   15.574  1.00 0.00 ? 88  ARG A HH22 1  
ATOM   1347   N N    . GLU A 1 89  ? 2.836   4.228   10.326  1.00 0.00 ? 89  GLU A N    1  
ATOM   1348   C CA   . GLU A 1 89  ? 4.123   4.402   10.988  1.00 0.00 ? 89  GLU A CA   1  
ATOM   1349   C C    . GLU A 1 89  ? 4.717   5.760   10.658  1.00 0.00 ? 89  GLU A C    1  
ATOM   1350   O O    . GLU A 1 89  ? 5.175   6.478   11.542  1.00 0.00 ? 89  GLU A O    1  
ATOM   1351   C CB   . GLU A 1 89  ? 5.094   3.293   10.589  1.00 0.00 ? 89  GLU A CB   1  
ATOM   1352   C CG   . GLU A 1 89  ? 6.342   3.343   11.485  1.00 0.00 ? 89  GLU A CG   1  
ATOM   1353   C CD   . GLU A 1 89  ? 7.253   2.154   11.185  1.00 0.00 ? 89  GLU A CD   1  
ATOM   1354   O OE1  . GLU A 1 89  ? 6.825   1.267   10.459  1.00 0.00 ? 89  GLU A OE1  1  
ATOM   1355   O OE2  . GLU A 1 89  ? 8.361   2.147   11.681  1.00 0.00 ? 89  GLU A OE2  1  
ATOM   1356   H H    . GLU A 1 89  ? 2.696   3.470   9.710   1.00 0.00 ? 89  GLU A H    1  
ATOM   1357   H HA   . GLU A 1 89  ? 3.966   4.352   12.052  1.00 0.00 ? 89  GLU A HA   1  
ATOM   1358   H HB2  . GLU A 1 89  ? 4.613   2.331   10.706  1.00 0.00 ? 89  GLU A HB2  1  
ATOM   1359   H HB3  . GLU A 1 89  ? 5.392   3.422   9.559   1.00 0.00 ? 89  GLU A HB3  1  
ATOM   1360   H HG2  . GLU A 1 89  ? 6.884   4.261   11.300  1.00 0.00 ? 89  GLU A HG2  1  
ATOM   1361   H HG3  . GLU A 1 89  ? 6.047   3.308   12.522  1.00 0.00 ? 89  GLU A HG3  1  
ATOM   1362   N N    . LEU A 1 90  ? 4.681   6.118   9.388   1.00 0.00 ? 90  LEU A N    1  
ATOM   1363   C CA   . LEU A 1 90  ? 5.206   7.403   8.960   1.00 0.00 ? 90  LEU A CA   1  
ATOM   1364   C C    . LEU A 1 90  ? 4.372   8.536   9.550   1.00 0.00 ? 90  LEU A C    1  
ATOM   1365   O O    . LEU A 1 90  ? 4.909   9.540   10.026  1.00 0.00 ? 90  LEU A O    1  
ATOM   1366   C CB   . LEU A 1 90  ? 5.199   7.451   7.441   1.00 0.00 ? 90  LEU A CB   1  
ATOM   1367   C CG   . LEU A 1 90  ? 6.232   6.447   6.915   1.00 0.00 ? 90  LEU A CG   1  
ATOM   1368   C CD1  . LEU A 1 90  ? 5.997   6.229   5.426   1.00 0.00 ? 90  LEU A CD1  1  
ATOM   1369   C CD2  . LEU A 1 90  ? 7.661   6.975   7.144   1.00 0.00 ? 90  LEU A CD2  1  
ATOM   1370   H H    . LEU A 1 90  ? 4.282   5.510   8.725   1.00 0.00 ? 90  LEU A H    1  
ATOM   1371   H HA   . LEU A 1 90  ? 6.222   7.502   9.307   1.00 0.00 ? 90  LEU A HA   1  
ATOM   1372   H HB2  . LEU A 1 90  ? 4.211   7.180   7.083   1.00 0.00 ? 90  LEU A HB2  1  
ATOM   1373   H HB3  . LEU A 1 90  ? 5.447   8.445   7.103   1.00 0.00 ? 90  LEU A HB3  1  
ATOM   1374   H HG   . LEU A 1 90  ? 6.109   5.506   7.434   1.00 0.00 ? 90  LEU A HG   1  
ATOM   1375   H HD11 . LEU A 1 90  ? 5.845   7.182   4.947   1.00 0.00 ? 90  LEU A HD11 1  
ATOM   1376   H HD12 . LEU A 1 90  ? 6.854   5.737   4.993   1.00 0.00 ? 90  LEU A HD12 1  
ATOM   1377   H HD13 . LEU A 1 90  ? 5.119   5.612   5.291   1.00 0.00 ? 90  LEU A HD13 1  
ATOM   1378   H HD21 . LEU A 1 90  ? 7.666   8.054   7.108   1.00 0.00 ? 90  LEU A HD21 1  
ATOM   1379   H HD22 . LEU A 1 90  ? 8.012   6.647   8.114   1.00 0.00 ? 90  LEU A HD22 1  
ATOM   1380   H HD23 . LEU A 1 90  ? 8.319   6.587   6.379   1.00 0.00 ? 90  LEU A HD23 1  
ATOM   1381   N N    . ILE A 1 91  ? 3.057   8.357   9.542   1.00 0.00 ? 91  ILE A N    1  
ATOM   1382   C CA   . ILE A 1 91  ? 2.167   9.365   10.111  1.00 0.00 ? 91  ILE A CA   1  
ATOM   1383   C C    . ILE A 1 91  ? 2.485   9.539   11.593  1.00 0.00 ? 91  ILE A C    1  
ATOM   1384   O O    . ILE A 1 91  ? 2.528   10.660  12.102  1.00 0.00 ? 91  ILE A O    1  
ATOM   1385   C CB   . ILE A 1 91  ? 0.697   8.972   9.888   1.00 0.00 ? 91  ILE A CB   1  
ATOM   1386   C CG1  . ILE A 1 91  ? 0.375   9.164   8.399   1.00 0.00 ? 91  ILE A CG1  1  
ATOM   1387   C CG2  . ILE A 1 91  ? -0.229  9.863   10.740  1.00 0.00 ? 91  ILE A CG2  1  
ATOM   1388   C CD1  . ILE A 1 91  ? -0.953  8.490   8.051   1.00 0.00 ? 91  ILE A CD1  1  
ATOM   1389   H H    . ILE A 1 91  ? 2.683   7.532   9.165   1.00 0.00 ? 91  ILE A H    1  
ATOM   1390   H HA   . ILE A 1 91  ? 2.353   10.305  9.617   1.00 0.00 ? 91  ILE A HA   1  
ATOM   1391   H HB   . ILE A 1 91  ? 0.553   7.937   10.162  1.00 0.00 ? 91  ILE A HB   1  
ATOM   1392   H HG12 . ILE A 1 91  ? 0.311   10.220  8.178   1.00 0.00 ? 91  ILE A HG12 1  
ATOM   1393   H HG13 . ILE A 1 91  ? 1.164   8.722   7.804   1.00 0.00 ? 91  ILE A HG13 1  
ATOM   1394   H HG21 . ILE A 1 91  ? 0.235   10.826  10.900  1.00 0.00 ? 91  ILE A HG21 1  
ATOM   1395   H HG22 . ILE A 1 91  ? -1.171  10.001  10.229  1.00 0.00 ? 91  ILE A HG22 1  
ATOM   1396   H HG23 . ILE A 1 91  ? -0.406  9.391   11.697  1.00 0.00 ? 91  ILE A HG23 1  
ATOM   1397   H HD11 . ILE A 1 91  ? -1.639  8.596   8.876   1.00 0.00 ? 91  ILE A HD11 1  
ATOM   1398   H HD12 . ILE A 1 91  ? -1.370  8.960   7.171   1.00 0.00 ? 91  ILE A HD12 1  
ATOM   1399   H HD13 . ILE A 1 91  ? -0.785  7.442   7.851   1.00 0.00 ? 91  ILE A HD13 1  
ATOM   1400   N N    . THR A 1 92  ? 2.763   8.431   12.274  1.00 0.00 ? 92  THR A N    1  
ATOM   1401   C CA   . THR A 1 92  ? 3.130   8.500   13.688  1.00 0.00 ? 92  THR A CA   1  
ATOM   1402   C C    . THR A 1 92  ? 4.361   9.388   13.845  1.00 0.00 ? 92  THR A C    1  
ATOM   1403   O O    . THR A 1 92  ? 4.402   10.268  14.708  1.00 0.00 ? 92  THR A O    1  
ATOM   1404   C CB   . THR A 1 92  ? 3.420   7.096   14.231  1.00 0.00 ? 92  THR A CB   1  
ATOM   1405   O OG1  . THR A 1 92  ? 2.213   6.357   14.287  1.00 0.00 ? 92  THR A OG1  1  
ATOM   1406   C CG2  . THR A 1 92  ? 4.025   7.178   15.636  1.00 0.00 ? 92  THR A CG2  1  
ATOM   1407   H H    . THR A 1 92  ? 2.750   7.562   11.817  1.00 0.00 ? 92  THR A H    1  
ATOM   1408   H HA   . THR A 1 92  ? 2.315   8.936   14.242  1.00 0.00 ? 92  THR A HA   1  
ATOM   1409   H HB   . THR A 1 92  ? 4.114   6.595   13.573  1.00 0.00 ? 92  THR A HB   1  
ATOM   1410   H HG1  . THR A 1 92  ? 2.143   5.845   13.476  1.00 0.00 ? 92  THR A HG1  1  
ATOM   1411   H HG21 . THR A 1 92  ? 3.675   8.071   16.135  1.00 0.00 ? 92  THR A HG21 1  
ATOM   1412   H HG22 . THR A 1 92  ? 3.734   6.311   16.208  1.00 0.00 ? 92  THR A HG22 1  
ATOM   1413   H HG23 . THR A 1 92  ? 5.104   7.211   15.560  1.00 0.00 ? 92  THR A HG23 1  
ATOM   1414   N N    . GLU A 1 93  ? 5.353   9.176   12.987  1.00 0.00 ? 93  GLU A N    1  
ATOM   1415   C CA   . GLU A 1 93  ? 6.566   9.988   13.023  1.00 0.00 ? 93  GLU A CA   1  
ATOM   1416   C C    . GLU A 1 93  ? 6.218   11.453  12.767  1.00 0.00 ? 93  GLU A C    1  
ATOM   1417   O O    . GLU A 1 93  ? 6.719   12.358  13.443  1.00 0.00 ? 93  GLU A O    1  
ATOM   1418   C CB   . GLU A 1 93  ? 7.556   9.503   11.961  1.00 0.00 ? 93  GLU A CB   1  
ATOM   1419   C CG   . GLU A 1 93  ? 7.927   8.042   12.236  1.00 0.00 ? 93  GLU A CG   1  
ATOM   1420   C CD   . GLU A 1 93  ? 8.871   7.942   13.435  1.00 0.00 ? 93  GLU A CD   1  
ATOM   1421   O OE1  . GLU A 1 93  ? 9.221   8.972   13.997  1.00 0.00 ? 93  GLU A OE1  1  
ATOM   1422   O OE2  . GLU A 1 93  ? 9.232   6.839   13.783  1.00 0.00 ? 93  GLU A OE2  1  
ATOM   1423   H H    . GLU A 1 93  ? 5.261   8.478   12.303  1.00 0.00 ? 93  GLU A H    1  
ATOM   1424   H HA   . GLU A 1 93  ? 7.022   9.899   13.998  1.00 0.00 ? 93  GLU A HA   1  
ATOM   1425   H HB2  . GLU A 1 93  ? 7.105   9.585   10.983  1.00 0.00 ? 93  GLU A HB2  1  
ATOM   1426   H HB3  . GLU A 1 93  ? 8.449   10.110  11.995  1.00 0.00 ? 93  GLU A HB3  1  
ATOM   1427   H HG2  . GLU A 1 93  ? 7.032   7.478   12.444  1.00 0.00 ? 93  GLU A HG2  1  
ATOM   1428   H HG3  . GLU A 1 93  ? 8.414   7.626   11.366  1.00 0.00 ? 93  GLU A HG3  1  
ATOM   1429   N N    . LEU A 1 94  ? 5.345   11.681  11.786  1.00 0.00 ? 94  LEU A N    1  
ATOM   1430   C CA   . LEU A 1 94  ? 4.918   13.041  11.454  1.00 0.00 ? 94  LEU A CA   1  
ATOM   1431   C C    . LEU A 1 94  ? 4.254   13.693  12.669  1.00 0.00 ? 94  LEU A C    1  
ATOM   1432   O O    . LEU A 1 94  ? 4.505   14.861  12.981  1.00 0.00 ? 94  LEU A O    1  
ATOM   1433   C CB   . LEU A 1 94  ? 3.937   13.027  10.267  1.00 0.00 ? 94  LEU A CB   1  
ATOM   1434   C CG   . LEU A 1 94  ? 4.688   12.730  8.953   1.00 0.00 ? 94  LEU A CG   1  
ATOM   1435   C CD1  . LEU A 1 94  ? 3.714   12.174  7.901   1.00 0.00 ? 94  LEU A CD1  1  
ATOM   1436   C CD2  . LEU A 1 94  ? 5.327   14.017  8.412   1.00 0.00 ? 94  LEU A CD2  1  
ATOM   1437   H H    . LEU A 1 94  ? 4.973   10.921  11.289  1.00 0.00 ? 94  LEU A H    1  
ATOM   1438   H HA   . LEU A 1 94  ? 5.785   13.622  11.188  1.00 0.00 ? 94  LEU A HA   1  
ATOM   1439   H HB2  . LEU A 1 94  ? 3.190   12.264  10.437  1.00 0.00 ? 94  LEU A HB2  1  
ATOM   1440   H HB3  . LEU A 1 94  ? 3.453   13.991  10.196  1.00 0.00 ? 94  LEU A HB3  1  
ATOM   1441   H HG   . LEU A 1 94  ? 5.463   11.998  9.142   1.00 0.00 ? 94  LEU A HG   1  
ATOM   1442   H HD11 . LEU A 1 94  ? 2.721   12.556  8.084   1.00 0.00 ? 94  LEU A HD11 1  
ATOM   1443   H HD12 . LEU A 1 94  ? 4.038   12.477  6.912   1.00 0.00 ? 94  LEU A HD12 1  
ATOM   1444   H HD13 . LEU A 1 94  ? 3.700   11.097  7.957   1.00 0.00 ? 94  LEU A HD13 1  
ATOM   1445   H HD21 . LEU A 1 94  ? 4.583   14.797  8.365   1.00 0.00 ? 94  LEU A HD21 1  
ATOM   1446   H HD22 . LEU A 1 94  ? 6.134   14.325  9.061   1.00 0.00 ? 94  LEU A HD22 1  
ATOM   1447   H HD23 . LEU A 1 94  ? 5.716   13.834  7.420   1.00 0.00 ? 94  LEU A HD23 1  
ATOM   1448   N N    . ILE A 1 95  ? 3.412   12.938  13.364  1.00 0.00 ? 95  ILE A N    1  
ATOM   1449   C CA   . ILE A 1 95  ? 2.744   13.467  14.553  1.00 0.00 ? 95  ILE A CA   1  
ATOM   1450   C C    . ILE A 1 95  ? 3.776   13.828  15.618  1.00 0.00 ? 95  ILE A C    1  
ATOM   1451   O O    . ILE A 1 95  ? 3.690   14.887  16.241  1.00 0.00 ? 95  ILE A O    1  
ATOM   1452   C CB   . ILE A 1 95  ? 1.742   12.446  15.101  1.00 0.00 ? 95  ILE A CB   1  
ATOM   1453   C CG1  . ILE A 1 95  ? 0.573   12.345  14.122  1.00 0.00 ? 95  ILE A CG1  1  
ATOM   1454   C CG2  . ILE A 1 95  ? 1.221   12.913  16.464  1.00 0.00 ? 95  ILE A CG2  1  
ATOM   1455   C CD1  . ILE A 1 95  ? -0.332  11.166  14.492  1.00 0.00 ? 95  ILE A CD1  1  
ATOM   1456   H H    . ILE A 1 95  ? 3.246   12.011  13.082  1.00 0.00 ? 95  ILE A H    1  
ATOM   1457   H HA   . ILE A 1 95  ? 2.210   14.363  14.279  1.00 0.00 ? 95  ILE A HA   1  
ATOM   1458   H HB   . ILE A 1 95  ? 2.222   11.481  15.203  1.00 0.00 ? 95  ILE A HB   1  
ATOM   1459   H HG12 . ILE A 1 95  ? 0.004   13.260  14.157  1.00 0.00 ? 95  ILE A HG12 1  
ATOM   1460   H HG13 . ILE A 1 95  ? 0.957   12.199  13.124  1.00 0.00 ? 95  ILE A HG13 1  
ATOM   1461   H HG21 . ILE A 1 95  ? 0.947   13.957  16.407  1.00 0.00 ? 95  ILE A HG21 1  
ATOM   1462   H HG22 . ILE A 1 95  ? 0.357   12.328  16.737  1.00 0.00 ? 95  ILE A HG22 1  
ATOM   1463   H HG23 . ILE A 1 95  ? 1.993   12.785  17.210  1.00 0.00 ? 95  ILE A HG23 1  
ATOM   1464   H HD11 . ILE A 1 95  ? -0.363  11.054  15.566  1.00 0.00 ? 95  ILE A HD11 1  
ATOM   1465   H HD12 . ILE A 1 95  ? -1.329  11.354  14.122  1.00 0.00 ? 95  ILE A HD12 1  
ATOM   1466   H HD13 . ILE A 1 95  ? 0.051   10.262  14.044  1.00 0.00 ? 95  ILE A HD13 1  
ATOM   1467   N N    . GLU A 1 96  ? 4.767   12.961  15.806  1.00 0.00 ? 96  GLU A N    1  
ATOM   1468   C CA   . GLU A 1 96  ? 5.815   13.236  16.788  1.00 0.00 ? 96  GLU A CA   1  
ATOM   1469   C C    . GLU A 1 96  ? 6.518   14.545  16.433  1.00 0.00 ? 96  GLU A C    1  
ATOM   1470   O O    . GLU A 1 96  ? 6.847   15.348  17.305  1.00 0.00 ? 96  GLU A O    1  
ATOM   1471   C CB   . GLU A 1 96  ? 6.823   12.081  16.819  1.00 0.00 ? 96  GLU A CB   1  
ATOM   1472   C CG   . GLU A 1 96  ? 7.962   12.385  17.826  1.00 0.00 ? 96  GLU A CG   1  
ATOM   1473   C CD   . GLU A 1 96  ? 8.112   11.261  18.854  1.00 0.00 ? 96  GLU A CD   1  
ATOM   1474   O OE1  . GLU A 1 96  ? 7.793   10.131  18.531  1.00 0.00 ? 96  GLU A OE1  1  
ATOM   1475   O OE2  . GLU A 1 96  ? 8.591   11.545  19.938  1.00 0.00 ? 96  GLU A OE2  1  
ATOM   1476   H H    . GLU A 1 96  ? 4.802   12.139  15.271  1.00 0.00 ? 96  GLU A H    1  
ATOM   1477   H HA   . GLU A 1 96  ? 5.363   13.337  17.762  1.00 0.00 ? 96  GLU A HA   1  
ATOM   1478   H HB2  . GLU A 1 96  ? 6.306   11.176  17.113  1.00 0.00 ? 96  GLU A HB2  1  
ATOM   1479   H HB3  . GLU A 1 96  ? 7.239   11.948  15.832  1.00 0.00 ? 96  GLU A HB3  1  
ATOM   1480   H HG2  . GLU A 1 96  ? 8.890   12.493  17.293  1.00 0.00 ? 96  GLU A HG2  1  
ATOM   1481   H HG3  . GLU A 1 96  ? 7.746   13.308  18.349  1.00 0.00 ? 96  GLU A HG3  1  
ATOM   1482   N N    . LEU A 1 97  ? 6.729   14.771  15.135  1.00 0.00 ? 97  LEU A N    1  
ATOM   1483   C CA   . LEU A 1 97  ? 7.373   16.005  14.689  1.00 0.00 ? 97  LEU A CA   1  
ATOM   1484   C C    . LEU A 1 97  ? 6.508   17.207  15.066  1.00 0.00 ? 97  LEU A C    1  
ATOM   1485   O O    . LEU A 1 97  ? 7.020   18.227  15.533  1.00 0.00 ? 97  LEU A O    1  
ATOM   1486   C CB   . LEU A 1 97  ? 7.599   15.976  13.172  1.00 0.00 ? 97  LEU A CB   1  
ATOM   1487   C CG   . LEU A 1 97  ? 8.830   15.121  12.831  1.00 0.00 ? 97  LEU A CG   1  
ATOM   1488   C CD1  . LEU A 1 97  ? 8.836   14.840  11.329  1.00 0.00 ? 97  LEU A CD1  1  
ATOM   1489   C CD2  . LEU A 1 97  ? 10.124  15.862  13.205  1.00 0.00 ? 97  LEU A CD2  1  
ATOM   1490   H H    . LEU A 1 97  ? 6.434   14.107  14.475  1.00 0.00 ? 97  LEU A H    1  
ATOM   1491   H HA   . LEU A 1 97  ? 8.324   16.100  15.185  1.00 0.00 ? 97  LEU A HA   1  
ATOM   1492   H HB2  . LEU A 1 97  ? 6.729   15.554  12.691  1.00 0.00 ? 97  LEU A HB2  1  
ATOM   1493   H HB3  . LEU A 1 97  ? 7.751   16.984  12.812  1.00 0.00 ? 97  LEU A HB3  1  
ATOM   1494   H HG   . LEU A 1 97  ? 8.776   14.184  13.370  1.00 0.00 ? 97  LEU A HG   1  
ATOM   1495   H HD11 . LEU A 1 97  ? 8.721   15.769  10.790  1.00 0.00 ? 97  LEU A HD11 1  
ATOM   1496   H HD12 . LEU A 1 97  ? 9.770   14.377  11.052  1.00 0.00 ? 97  LEU A HD12 1  
ATOM   1497   H HD13 . LEU A 1 97  ? 8.020   14.178  11.085  1.00 0.00 ? 97  LEU A HD13 1  
ATOM   1498   H HD21 . LEU A 1 97  ? 10.016  16.914  12.987  1.00 0.00 ? 97  LEU A HD21 1  
ATOM   1499   H HD22 . LEU A 1 97  ? 10.330  15.731  14.255  1.00 0.00 ? 97  LEU A HD22 1  
ATOM   1500   H HD23 . LEU A 1 97  ? 10.946  15.460  12.625  1.00 0.00 ? 97  LEU A HD23 1  
ATOM   1501   N N    . HIS A 1 98  ? 5.195   17.079  14.889  1.00 0.00 ? 98  HIS A N    1  
ATOM   1502   C CA   . HIS A 1 98  ? 4.292   18.167  15.256  1.00 0.00 ? 98  HIS A CA   1  
ATOM   1503   C C    . HIS A 1 98  ? 4.477   18.498  16.732  1.00 0.00 ? 98  HIS A C    1  
ATOM   1504   O O    . HIS A 1 98  ? 4.481   19.662  17.121  1.00 0.00 ? 98  HIS A O    1  
ATOM   1505   C CB   . HIS A 1 98  ? 2.836   17.773  14.987  1.00 0.00 ? 98  HIS A CB   1  
ATOM   1506   C CG   . HIS A 1 98  ? 2.586   17.758  13.506  1.00 0.00 ? 98  HIS A CG   1  
ATOM   1507   N ND1  . HIS A 1 98  ? 2.839   16.642  12.730  1.00 0.00 ? 98  HIS A ND1  1  
ATOM   1508   C CD2  . HIS A 1 98  ? 2.119   18.714  12.644  1.00 0.00 ? 98  HIS A CD2  1  
ATOM   1509   C CE1  . HIS A 1 98  ? 2.527   16.949  11.458  1.00 0.00 ? 98  HIS A CE1  1  
ATOM   1510   N NE2  . HIS A 1 98  ? 2.084   18.202  11.348  1.00 0.00 ? 98  HIS A NE2  1  
ATOM   1511   H H    . HIS A 1 98  ? 4.832   16.240  14.535  1.00 0.00 ? 98  HIS A H    1  
ATOM   1512   H HA   . HIS A 1 98  ? 4.536   19.040  14.670  1.00 0.00 ? 98  HIS A HA   1  
ATOM   1513   H HB2  . HIS A 1 98  ? 2.645   16.792  15.398  1.00 0.00 ? 98  HIS A HB2  1  
ATOM   1514   H HB3  . HIS A 1 98  ? 2.180   18.493  15.455  1.00 0.00 ? 98  HIS A HB3  1  
ATOM   1515   H HD1  . HIS A 1 98  ? 3.195   15.777  13.049  1.00 0.00 ? 98  HIS A HD1  1  
ATOM   1516   H HD2  . HIS A 1 98  ? 1.823   19.712  12.928  1.00 0.00 ? 98  HIS A HD2  1  
ATOM   1517   H HE1  . HIS A 1 98  ? 2.634   16.266  10.625  1.00 0.00 ? 98  HIS A HE1  1  
ATOM   1518   H HE2  . HIS A 1 98  ? 1.802   18.657  10.531  1.00 0.00 ? 98  HIS A HE2  1  
ATOM   1519   N N    . GLU A 1 99  ? 4.662   17.460  17.542  1.00 0.00 ? 99  GLU A N    1  
ATOM   1520   C CA   . GLU A 1 99  ? 4.873   17.651  18.970  1.00 0.00 ? 99  GLU A CA   1  
ATOM   1521   C C    . GLU A 1 99  ? 6.186   18.395  19.210  1.00 0.00 ? 99  GLU A C    1  
ATOM   1522   O O    . GLU A 1 99  ? 6.258   19.301  20.041  1.00 0.00 ? 99  GLU A O    1  
ATOM   1523   C CB   . GLU A 1 99  ? 4.888   16.299  19.686  1.00 0.00 ? 99  GLU A CB   1  
ATOM   1524   C CG   . GLU A 1 99  ? 4.992   16.523  21.200  1.00 0.00 ? 99  GLU A CG   1  
ATOM   1525   C CD   . GLU A 1 99  ? 4.922   15.189  21.939  1.00 0.00 ? 99  GLU A CD   1  
ATOM   1526   O OE1  . GLU A 1 99  ? 5.021   14.163  21.289  1.00 0.00 ? 99  GLU A OE1  1  
ATOM   1527   O OE2  . GLU A 1 99  ? 4.764   15.214  23.146  1.00 0.00 ? 99  GLU A OE2  1  
ATOM   1528   H H    . GLU A 1 99  ? 4.670   16.551  17.169  1.00 0.00 ? 99  GLU A H    1  
ATOM   1529   H HA   . GLU A 1 99  ? 4.066   18.246  19.368  1.00 0.00 ? 99  GLU A HA   1  
ATOM   1530   H HB2  . GLU A 1 99  ? 3.975   15.764  19.465  1.00 0.00 ? 99  GLU A HB2  1  
ATOM   1531   H HB3  . GLU A 1 99  ? 5.735   15.717  19.354  1.00 0.00 ? 99  GLU A HB3  1  
ATOM   1532   H HG2  . GLU A 1 99  ? 5.927   17.009  21.428  1.00 0.00 ? 99  GLU A HG2  1  
ATOM   1533   H HG3  . GLU A 1 99  ? 4.175   17.152  21.526  1.00 0.00 ? 99  GLU A HG3  1  
ATOM   1534   N N    . LYS A 1 100 ? 7.223   18.030  18.461  1.00 0.00 ? 100 LYS A N    1  
ATOM   1535   C CA   . LYS A 1 100 ? 8.510   18.704  18.606  1.00 0.00 ? 100 LYS A CA   1  
ATOM   1536   C C    . LYS A 1 100 ? 8.389   20.155  18.136  1.00 0.00 ? 100 LYS A C    1  
ATOM   1537   O O    . LYS A 1 100 ? 8.997   21.052  18.717  1.00 0.00 ? 100 LYS A O    1  
ATOM   1538   C CB   . LYS A 1 100 ? 9.601   17.962  17.829  1.00 0.00 ? 100 LYS A CB   1  
ATOM   1539   C CG   . LYS A 1 100 ? 9.877   16.622  18.524  1.00 0.00 ? 100 LYS A CG   1  
ATOM   1540   C CD   . LYS A 1 100 ? 11.042  15.908  17.835  1.00 0.00 ? 100 LYS A CD   1  
ATOM   1541   C CE   . LYS A 1 100 ? 11.317  14.585  18.552  1.00 0.00 ? 100 LYS A CE   1  
ATOM   1542   N NZ   . LYS A 1 100 ? 12.495  13.920  17.920  1.00 0.00 ? 100 LYS A NZ   1  
ATOM   1543   H H    . LYS A 1 100 ? 7.117   17.312  17.799  1.00 0.00 ? 100 LYS A H    1  
ATOM   1544   H HA   . LYS A 1 100 ? 8.776   18.711  19.654  1.00 0.00 ? 100 LYS A HA   1  
ATOM   1545   H HB2  . LYS A 1 100 ? 9.270   17.786  16.815  1.00 0.00 ? 100 LYS A HB2  1  
ATOM   1546   H HB3  . LYS A 1 100 ? 10.502  18.554  17.821  1.00 0.00 ? 100 LYS A HB3  1  
ATOM   1547   H HG2  . LYS A 1 100 ? 10.126  16.804  19.563  1.00 0.00 ? 100 LYS A HG2  1  
ATOM   1548   H HG3  . LYS A 1 100 ? 8.992   16.002  18.473  1.00 0.00 ? 100 LYS A HG3  1  
ATOM   1549   H HD2  . LYS A 1 100 ? 10.784  15.717  16.803  1.00 0.00 ? 100 LYS A HD2  1  
ATOM   1550   H HD3  . LYS A 1 100 ? 11.923  16.532  17.878  1.00 0.00 ? 100 LYS A HD3  1  
ATOM   1551   H HE2  . LYS A 1 100 ? 11.527  14.776  19.597  1.00 0.00 ? 100 LYS A HE2  1  
ATOM   1552   H HE3  . LYS A 1 100 ? 10.449  13.942  18.473  1.00 0.00 ? 100 LYS A HE3  1  
ATOM   1553   H HZ1  . LYS A 1 100 ? 13.270  14.608  17.814  1.00 0.00 ? 100 LYS A HZ1  1  
ATOM   1554   H HZ2  . LYS A 1 100 ? 12.814  13.135  18.524  1.00 0.00 ? 100 LYS A HZ2  1  
ATOM   1555   H HZ3  . LYS A 1 100 ? 12.224  13.555  16.987  1.00 0.00 ? 100 LYS A HZ3  1  
ATOM   1556   N N    . LEU A 1 101 ? 7.564   20.387  17.112  1.00 0.00 ? 101 LEU A N    1  
ATOM   1557   C CA   . LEU A 1 101 ? 7.345   21.751  16.615  1.00 0.00 ? 101 LEU A CA   1  
ATOM   1558   C C    . LEU A 1 101 ? 6.683   22.597  17.703  1.00 0.00 ? 101 LEU A C    1  
ATOM   1559   O O    . LEU A 1 101 ? 6.355   23.764  17.484  1.00 0.00 ? 101 LEU A O    1  
ATOM   1560   C CB   . LEU A 1 101 ? 6.445   21.738  15.367  1.00 0.00 ? 101 LEU A CB   1  
ATOM   1561   C CG   . LEU A 1 101 ? 7.272   21.466  14.104  1.00 0.00 ? 101 LEU A CG   1  
ATOM   1562   C CD1  . LEU A 1 101 ? 6.338   21.031  12.971  1.00 0.00 ? 101 LEU A CD1  1  
ATOM   1563   C CD2  . LEU A 1 101 ? 8.017   22.737  13.669  1.00 0.00 ? 101 LEU A CD2  1  
ATOM   1564   H H    . LEU A 1 101 ? 7.080   19.640  16.701  1.00 0.00 ? 101 LEU A H    1  
ATOM   1565   H HA   . LEU A 1 101 ? 8.296   22.196  16.365  1.00 0.00 ? 101 LEU A HA   1  
ATOM   1566   H HB2  . LEU A 1 101 ? 5.698   20.965  15.481  1.00 0.00 ? 101 LEU A HB2  1  
ATOM   1567   H HB3  . LEU A 1 101 ? 5.951   22.696  15.273  1.00 0.00 ? 101 LEU A HB3  1  
ATOM   1568   H HG   . LEU A 1 101 ? 7.984   20.677  14.305  1.00 0.00 ? 101 LEU A HG   1  
ATOM   1569   H HD11 . LEU A 1 101 ? 5.430   21.617  13.004  1.00 0.00 ? 101 LEU A HD11 1  
ATOM   1570   H HD12 . LEU A 1 101 ? 6.828   21.185  12.021  1.00 0.00 ? 101 LEU A HD12 1  
ATOM   1571   H HD13 . LEU A 1 101 ? 6.093   19.985  13.084  1.00 0.00 ? 101 LEU A HD13 1  
ATOM   1572   H HD21 . LEU A 1 101 ? 7.359   23.591  13.750  1.00 0.00 ? 101 LEU A HD21 1  
ATOM   1573   H HD22 . LEU A 1 101 ? 8.881   22.886  14.300  1.00 0.00 ? 101 LEU A HD22 1  
ATOM   1574   H HD23 . LEU A 1 101 ? 8.337   22.630  12.642  1.00 0.00 ? 101 LEU A HD23 1  
ATOM   1575   N N    . LYS A 1 102 ? 6.485   21.993  18.876  1.00 0.00 ? 102 LYS A N    1  
ATOM   1576   C CA   . LYS A 1 102 ? 5.863   22.679  20.010  1.00 0.00 ? 102 LYS A CA   1  
ATOM   1577   C C    . LYS A 1 102 ? 4.349   22.678  19.870  1.00 0.00 ? 102 LYS A C    1  
ATOM   1578   O O    . LYS A 1 102 ? 3.662   22.170  20.739  1.00 0.00 ? 102 LYS A O    1  
ATOM   1579   C CB   . LYS A 1 102 ? 6.379   24.131  20.100  1.00 0.00 ? 102 LYS A CB   1  
ATOM   1580   C CG   . LYS A 1 102 ? 6.293   24.743  21.531  1.00 0.00 ? 102 LYS A CG   1  
ATOM   1581   C CD   . LYS A 1 102 ? 5.079   24.258  22.368  1.00 0.00 ? 102 LYS A CD   1  
ATOM   1582   C CE   . LYS A 1 102 ? 3.747   24.897  21.909  1.00 0.00 ? 102 LYS A CE   1  
ATOM   1583   N NZ   . LYS A 1 102 ? 3.872   25.459  20.537  1.00 0.00 ? 102 LYS A NZ   1  
ATOM   1584   H H    . LYS A 1 102 ? 6.761   21.059  18.982  1.00 0.00 ? 102 LYS A H    1  
ATOM   1585   H HA   . LYS A 1 102 ? 6.133   22.151  20.915  1.00 0.00 ? 102 LYS A HA   1  
ATOM   1586   H HB2  . LYS A 1 102 ? 7.416   24.140  19.790  1.00 0.00 ? 102 LYS A HB2  1  
ATOM   1587   H HB3  . LYS A 1 102 ? 5.818   24.747  19.416  1.00 0.00 ? 102 LYS A HB3  1  
ATOM   1588   H HG2  . LYS A 1 102 ? 7.198   24.489  22.066  1.00 0.00 ? 102 LYS A HG2  1  
ATOM   1589   H HG3  . LYS A 1 102 ? 6.246   25.819  21.439  1.00 0.00 ? 102 LYS A HG3  1  
ATOM   1590   H HD2  . LYS A 1 102 ? 5.000   23.184  22.319  1.00 0.00 ? 102 LYS A HD2  1  
ATOM   1591   H HD3  . LYS A 1 102 ? 5.252   24.544  23.402  1.00 0.00 ? 102 LYS A HD3  1  
ATOM   1592   H HE2  . LYS A 1 102 ? 2.970   24.145  21.916  1.00 0.00 ? 102 LYS A HE2  1  
ATOM   1593   H HE3  . LYS A 1 102 ? 3.476   25.690  22.598  1.00 0.00 ? 102 LYS A HE3  1  
ATOM   1594   H HZ1  . LYS A 1 102 ? 4.202   24.716  19.894  1.00 0.00 ? 102 LYS A HZ1  1  
ATOM   1595   H HZ2  . LYS A 1 102 ? 2.943   25.799  20.219  1.00 0.00 ? 102 LYS A HZ2  1  
ATOM   1596   H HZ3  . LYS A 1 102 ? 4.548   26.245  20.536  1.00 0.00 ? 102 LYS A HZ3  1  
ATOM   1597   N N    . ALA A 1 103 ? 3.860   23.296  18.784  1.00 0.00 ? 103 ALA A N    1  
ATOM   1598   C CA   . ALA A 1 103 ? 2.420   23.412  18.518  1.00 0.00 ? 103 ALA A CA   1  
ATOM   1599   C C    . ALA A 1 103 ? 1.643   22.185  18.997  1.00 0.00 ? 103 ALA A C    1  
ATOM   1600   O O    . ALA A 1 103 ? 1.316   21.354  18.167  1.00 0.00 ? 103 ALA A O    1  
ATOM   1601   C CB   . ALA A 1 103 ? 2.184   23.608  17.017  1.00 0.00 ? 103 ALA A CB   1  
ATOM   1602   O OXT  . ALA A 1 103 ? 1.358   22.112  20.182  1.00 0.00 ? 103 ALA A OXT  1  
ATOM   1603   H H    . ALA A 1 103 ? 4.493   23.697  18.150  1.00 0.00 ? 103 ALA A H    1  
ATOM   1604   H HA   . ALA A 1 103 ? 2.041   24.277  19.038  1.00 0.00 ? 103 ALA A HA   1  
ATOM   1605   H HB1  . ALA A 1 103 ? 1.138   23.437  16.797  1.00 0.00 ? 103 ALA A HB1  1  
ATOM   1606   H HB2  . ALA A 1 103 ? 2.785   22.898  16.465  1.00 0.00 ? 103 ALA A HB2  1  
ATOM   1607   H HB3  . ALA A 1 103 ? 2.453   24.610  16.732  1.00 0.00 ? 103 ALA A HB3  1  
ATOM   1608   N N    . ALA B 1 1   ? 9.933   -20.893 -6.784  1.00 0.00 ? 1   ALA B N    1  
ATOM   1609   C CA   . ALA B 1 1   ? 10.730  -22.096 -7.163  1.00 0.00 ? 1   ALA B CA   1  
ATOM   1610   C C    . ALA B 1 1   ? 12.028  -22.095 -6.363  1.00 0.00 ? 1   ALA B C    1  
ATOM   1611   O O    . ALA B 1 1   ? 12.337  -21.110 -5.704  1.00 0.00 ? 1   ALA B O    1  
ATOM   1612   C CB   . ALA B 1 1   ? 11.016  -22.057 -8.672  1.00 0.00 ? 1   ALA B CB   1  
ATOM   1613   H H1   . ALA B 1 1   ? 10.538  -20.229 -6.259  1.00 0.00 ? 1   ALA B H1   1  
ATOM   1614   H H2   . ALA B 1 1   ? 9.572   -20.433 -7.644  1.00 0.00 ? 1   ALA B H2   1  
ATOM   1615   H H3   . ALA B 1 1   ? 9.135   -21.179 -6.181  1.00 0.00 ? 1   ALA B H3   1  
ATOM   1616   H HA   . ALA B 1 1   ? 10.170  -22.990 -6.922  1.00 0.00 ? 1   ALA B HA   1  
ATOM   1617   H HB1  . ALA B 1 1   ? 10.263  -22.630 -9.198  1.00 0.00 ? 1   ALA B HB1  1  
ATOM   1618   H HB2  . ALA B 1 1   ? 11.991  -22.483 -8.871  1.00 0.00 ? 1   ALA B HB2  1  
ATOM   1619   H HB3  . ALA B 1 1   ? 10.995  -21.034 -9.020  1.00 0.00 ? 1   ALA B HB3  1  
ATOM   1620   N N    . GLU B 1 2   ? 12.765  -23.201 -6.430  1.00 0.00 ? 2   GLU B N    1  
ATOM   1621   C CA   . GLU B 1 2   ? 14.034  -23.360 -5.705  1.00 0.00 ? 2   GLU B CA   1  
ATOM   1622   C C    . GLU B 1 2   ? 14.712  -22.021 -5.389  1.00 0.00 ? 2   GLU B C    1  
ATOM   1623   O O    . GLU B 1 2   ? 14.539  -21.466 -4.305  1.00 0.00 ? 2   GLU B O    1  
ATOM   1624   C CB   . GLU B 1 2   ? 14.989  -24.229 -6.532  1.00 0.00 ? 2   GLU B CB   1  
ATOM   1625   C CG   . GLU B 1 2   ? 14.360  -25.618 -6.796  1.00 0.00 ? 2   GLU B CG   1  
ATOM   1626   C CD   . GLU B 1 2   ? 14.436  -25.977 -8.280  1.00 0.00 ? 2   GLU B CD   1  
ATOM   1627   O OE1  . GLU B 1 2   ? 15.433  -25.659 -8.899  1.00 0.00 ? 2   GLU B OE1  1  
ATOM   1628   O OE2  . GLU B 1 2   ? 13.489  -26.564 -8.772  1.00 0.00 ? 2   GLU B OE2  1  
ATOM   1629   H H    . GLU B 1 2   ? 12.451  -23.945 -6.984  1.00 0.00 ? 2   GLU B H    1  
ATOM   1630   H HA   . GLU B 1 2   ? 13.836  -23.867 -4.774  1.00 0.00 ? 2   GLU B HA   1  
ATOM   1631   H HB2  . GLU B 1 2   ? 15.189  -23.738 -7.475  1.00 0.00 ? 2   GLU B HB2  1  
ATOM   1632   H HB3  . GLU B 1 2   ? 15.918  -24.351 -5.992  1.00 0.00 ? 2   GLU B HB3  1  
ATOM   1633   H HG2  . GLU B 1 2   ? 14.896  -26.365 -6.231  1.00 0.00 ? 2   GLU B HG2  1  
ATOM   1634   H HG3  . GLU B 1 2   ? 13.326  -25.616 -6.488  1.00 0.00 ? 2   GLU B HG3  1  
ATOM   1635   N N    . GLU B 1 3   ? 15.493  -21.519 -6.335  1.00 0.00 ? 3   GLU B N    1  
ATOM   1636   C CA   . GLU B 1 3   ? 16.205  -20.259 -6.138  1.00 0.00 ? 3   GLU B CA   1  
ATOM   1637   C C    . GLU B 1 3   ? 15.236  -19.088 -6.033  1.00 0.00 ? 3   GLU B C    1  
ATOM   1638   O O    . GLU B 1 3   ? 15.220  -18.372 -5.035  1.00 0.00 ? 3   GLU B O    1  
ATOM   1639   C CB   . GLU B 1 3   ? 17.179  -20.036 -7.299  1.00 0.00 ? 3   GLU B CB   1  
ATOM   1640   C CG   . GLU B 1 3   ? 18.441  -20.888 -7.085  1.00 0.00 ? 3   GLU B CG   1  
ATOM   1641   C CD   . GLU B 1 3   ? 19.146  -21.144 -8.414  1.00 0.00 ? 3   GLU B CD   1  
ATOM   1642   O OE1  . GLU B 1 3   ? 19.488  -20.181 -9.075  1.00 0.00 ? 3   GLU B OE1  1  
ATOM   1643   O OE2  . GLU B 1 3   ? 19.335  -22.301 -8.746  1.00 0.00 ? 3   GLU B OE2  1  
ATOM   1644   H H    . GLU B 1 3   ? 15.608  -22.006 -7.178  1.00 0.00 ? 3   GLU B H    1  
ATOM   1645   H HA   . GLU B 1 3   ? 16.768  -20.322 -5.219  1.00 0.00 ? 3   GLU B HA   1  
ATOM   1646   H HB2  . GLU B 1 3   ? 16.708  -20.319 -8.229  1.00 0.00 ? 3   GLU B HB2  1  
ATOM   1647   H HB3  . GLU B 1 3   ? 17.458  -18.992 -7.343  1.00 0.00 ? 3   GLU B HB3  1  
ATOM   1648   H HG2  . GLU B 1 3   ? 19.119  -20.370 -6.423  1.00 0.00 ? 3   GLU B HG2  1  
ATOM   1649   H HG3  . GLU B 1 3   ? 18.169  -21.835 -6.643  1.00 0.00 ? 3   GLU B HG3  1  
ATOM   1650   N N    . LEU B 1 4   ? 14.434  -18.877 -7.068  1.00 0.00 ? 4   LEU B N    1  
ATOM   1651   C CA   . LEU B 1 4   ? 13.480  -17.770 -7.054  1.00 0.00 ? 4   LEU B CA   1  
ATOM   1652   C C    . LEU B 1 4   ? 12.768  -17.652 -5.701  1.00 0.00 ? 4   LEU B C    1  
ATOM   1653   O O    . LEU B 1 4   ? 12.591  -16.555 -5.183  1.00 0.00 ? 4   LEU B O    1  
ATOM   1654   C CB   . LEU B 1 4   ? 12.427  -17.939 -8.158  1.00 0.00 ? 4   LEU B CB   1  
ATOM   1655   C CG   . LEU B 1 4   ? 13.100  -18.069 -9.531  1.00 0.00 ? 4   LEU B CG   1  
ATOM   1656   C CD1  . LEU B 1 4   ? 12.025  -18.221 -10.618 1.00 0.00 ? 4   LEU B CD1  1  
ATOM   1657   C CD2  . LEU B 1 4   ? 13.956  -16.823 -9.817  1.00 0.00 ? 4   LEU B CD2  1  
ATOM   1658   H H    . LEU B 1 4   ? 14.484  -19.468 -7.846  1.00 0.00 ? 4   LEU B H    1  
ATOM   1659   H HA   . LEU B 1 4   ? 14.025  -16.858 -7.233  1.00 0.00 ? 4   LEU B HA   1  
ATOM   1660   H HB2  . LEU B 1 4   ? 11.844  -18.827 -7.960  1.00 0.00 ? 4   LEU B HB2  1  
ATOM   1661   H HB3  . LEU B 1 4   ? 11.773  -17.078 -8.158  1.00 0.00 ? 4   LEU B HB3  1  
ATOM   1662   H HG   . LEU B 1 4   ? 13.730  -18.946 -9.535  1.00 0.00 ? 4   LEU B HG   1  
ATOM   1663   H HD11 . LEU B 1 4   ? 11.167  -18.736 -10.212 1.00 0.00 ? 4   LEU B HD11 1  
ATOM   1664   H HD12 . LEU B 1 4   ? 11.723  -17.246 -10.974 1.00 0.00 ? 4   LEU B HD12 1  
ATOM   1665   H HD13 . LEU B 1 4   ? 12.426  -18.793 -11.443 1.00 0.00 ? 4   LEU B HD13 1  
ATOM   1666   H HD21 . LEU B 1 4   ? 13.482  -15.946 -9.405  1.00 0.00 ? 4   LEU B HD21 1  
ATOM   1667   H HD22 . LEU B 1 4   ? 14.932  -16.946 -9.368  1.00 0.00 ? 4   LEU B HD22 1  
ATOM   1668   H HD23 . LEU B 1 4   ? 14.070  -16.701 -10.886 1.00 0.00 ? 4   LEU B HD23 1  
ATOM   1669   N N    . GLU B 1 5   ? 12.362  -18.784 -5.137  1.00 0.00 ? 5   GLU B N    1  
ATOM   1670   C CA   . GLU B 1 5   ? 11.668  -18.783 -3.850  1.00 0.00 ? 5   GLU B CA   1  
ATOM   1671   C C    . GLU B 1 5   ? 12.624  -18.403 -2.725  1.00 0.00 ? 5   GLU B C    1  
ATOM   1672   O O    . GLU B 1 5   ? 12.305  -17.564 -1.876  1.00 0.00 ? 5   GLU B O    1  
ATOM   1673   C CB   . GLU B 1 5   ? 11.068  -20.159 -3.581  1.00 0.00 ? 5   GLU B CB   1  
ATOM   1674   C CG   . GLU B 1 5   ? 10.228  -20.101 -2.305  1.00 0.00 ? 5   GLU B CG   1  
ATOM   1675   C CD   . GLU B 1 5   ? 9.513   -21.429 -2.090  1.00 0.00 ? 5   GLU B CD   1  
ATOM   1676   O OE1  . GLU B 1 5   ? 9.450   -22.204 -3.031  1.00 0.00 ? 5   GLU B OE1  1  
ATOM   1677   O OE2  . GLU B 1 5   ? 9.035   -21.651 -0.990  1.00 0.00 ? 5   GLU B OE2  1  
ATOM   1678   H H    . GLU B 1 5   ? 12.536  -19.639 -5.589  1.00 0.00 ? 5   GLU B H    1  
ATOM   1679   H HA   . GLU B 1 5   ? 10.865  -18.064 -3.883  1.00 0.00 ? 5   GLU B HA   1  
ATOM   1680   H HB2  . GLU B 1 5   ? 10.442  -20.447 -4.414  1.00 0.00 ? 5   GLU B HB2  1  
ATOM   1681   H HB3  . GLU B 1 5   ? 11.860  -20.881 -3.458  1.00 0.00 ? 5   GLU B HB3  1  
ATOM   1682   H HG2  . GLU B 1 5   ? 10.873  -19.900 -1.462  1.00 0.00 ? 5   GLU B HG2  1  
ATOM   1683   H HG3  . GLU B 1 5   ? 9.496   -19.311 -2.393  1.00 0.00 ? 5   GLU B HG3  1  
ATOM   1684   N N    . GLU B 1 6   ? 13.805  -19.005 -2.735  1.00 0.00 ? 6   GLU B N    1  
ATOM   1685   C CA   . GLU B 1 6   ? 14.813  -18.712 -1.727  1.00 0.00 ? 6   GLU B CA   1  
ATOM   1686   C C    . GLU B 1 6   ? 15.334  -17.289 -1.916  1.00 0.00 ? 6   GLU B C    1  
ATOM   1687   O O    . GLU B 1 6   ? 15.639  -16.583 -0.950  1.00 0.00 ? 6   GLU B O    1  
ATOM   1688   C CB   . GLU B 1 6   ? 15.958  -19.727 -1.841  1.00 0.00 ? 6   GLU B CB   1  
ATOM   1689   C CG   . GLU B 1 6   ? 16.673  -19.872 -0.492  1.00 0.00 ? 6   GLU B CG   1  
ATOM   1690   C CD   . GLU B 1 6   ? 17.546  -21.122 -0.504  1.00 0.00 ? 6   GLU B CD   1  
ATOM   1691   O OE1  . GLU B 1 6   ? 17.855  -21.597 -1.584  1.00 0.00 ? 6   GLU B OE1  1  
ATOM   1692   O OE2  . GLU B 1 6   ? 17.901  -21.582 0.570   1.00 0.00 ? 6   GLU B OE2  1  
ATOM   1693   H H    . GLU B 1 6   ? 14.009  -19.651 -3.446  1.00 0.00 ? 6   GLU B H    1  
ATOM   1694   H HA   . GLU B 1 6   ? 14.368  -18.797 -0.748  1.00 0.00 ? 6   GLU B HA   1  
ATOM   1695   H HB2  . GLU B 1 6   ? 15.556  -20.686 -2.137  1.00 0.00 ? 6   GLU B HB2  1  
ATOM   1696   H HB3  . GLU B 1 6   ? 16.664  -19.390 -2.585  1.00 0.00 ? 6   GLU B HB3  1  
ATOM   1697   H HG2  . GLU B 1 6   ? 17.294  -19.005 -0.321  1.00 0.00 ? 6   GLU B HG2  1  
ATOM   1698   H HG3  . GLU B 1 6   ? 15.946  -19.955 0.302   1.00 0.00 ? 6   GLU B HG3  1  
ATOM   1699   N N    . VAL B 1 7   ? 15.407  -16.864 -3.175  1.00 0.00 ? 7   VAL B N    1  
ATOM   1700   C CA   . VAL B 1 7   ? 15.867  -15.518 -3.504  1.00 0.00 ? 7   VAL B CA   1  
ATOM   1701   C C    . VAL B 1 7   ? 14.870  -14.484 -2.975  1.00 0.00 ? 7   VAL B C    1  
ATOM   1702   O O    . VAL B 1 7   ? 15.259  -13.460 -2.408  1.00 0.00 ? 7   VAL B O    1  
ATOM   1703   C CB   . VAL B 1 7   ? 16.023  -15.378 -5.024  1.00 0.00 ? 7   VAL B CB   1  
ATOM   1704   C CG1  . VAL B 1 7   ? 16.288  -13.913 -5.387  1.00 0.00 ? 7   VAL B CG1  1  
ATOM   1705   C CG2  . VAL B 1 7   ? 17.199  -16.241 -5.502  1.00 0.00 ? 7   VAL B CG2  1  
ATOM   1706   H H    . VAL B 1 7   ? 15.131  -17.471 -3.899  1.00 0.00 ? 7   VAL B H    1  
ATOM   1707   H HA   . VAL B 1 7   ? 16.823  -15.348 -3.036  1.00 0.00 ? 7   VAL B HA   1  
ATOM   1708   H HB   . VAL B 1 7   ? 15.112  -15.707 -5.510  1.00 0.00 ? 7   VAL B HB   1  
ATOM   1709   H HG11 . VAL B 1 7   ? 17.012  -13.498 -4.701  1.00 0.00 ? 7   VAL B HG11 1  
ATOM   1710   H HG12 . VAL B 1 7   ? 16.675  -13.857 -6.394  1.00 0.00 ? 7   VAL B HG12 1  
ATOM   1711   H HG13 . VAL B 1 7   ? 15.369  -13.352 -5.321  1.00 0.00 ? 7   VAL B HG13 1  
ATOM   1712   H HG21 . VAL B 1 7   ? 17.217  -17.168 -4.946  1.00 0.00 ? 7   VAL B HG21 1  
ATOM   1713   H HG22 . VAL B 1 7   ? 17.085  -16.456 -6.555  1.00 0.00 ? 7   VAL B HG22 1  
ATOM   1714   H HG23 . VAL B 1 7   ? 18.125  -15.709 -5.345  1.00 0.00 ? 7   VAL B HG23 1  
ATOM   1715   N N    . VAL B 1 8   ? 13.581  -14.772 -3.145  1.00 0.00 ? 8   VAL B N    1  
ATOM   1716   C CA   . VAL B 1 8   ? 12.534  -13.873 -2.663  1.00 0.00 ? 8   VAL B CA   1  
ATOM   1717   C C    . VAL B 1 8   ? 12.657  -13.731 -1.147  1.00 0.00 ? 8   VAL B C    1  
ATOM   1718   O O    . VAL B 1 8   ? 12.603  -12.625 -0.611  1.00 0.00 ? 8   VAL B O    1  
ATOM   1719   C CB   . VAL B 1 8   ? 11.150  -14.423 -3.039  1.00 0.00 ? 8   VAL B CB   1  
ATOM   1720   C CG1  . VAL B 1 8   ? 10.050  -13.630 -2.305  1.00 0.00 ? 8   VAL B CG1  1  
ATOM   1721   C CG2  . VAL B 1 8   ? 10.952  -14.323 -4.569  1.00 0.00 ? 8   VAL B CG2  1  
ATOM   1722   H H    . VAL B 1 8   ? 13.329  -15.611 -3.587  1.00 0.00 ? 8   VAL B H    1  
ATOM   1723   H HA   . VAL B 1 8   ? 12.669  -12.901 -3.113  1.00 0.00 ? 8   VAL B HA   1  
ATOM   1724   H HB   . VAL B 1 8   ? 11.094  -15.461 -2.740  1.00 0.00 ? 8   VAL B HB   1  
ATOM   1725   H HG11 . VAL B 1 8   ? 10.449  -12.690 -1.950  1.00 0.00 ? 8   VAL B HG11 1  
ATOM   1726   H HG12 . VAL B 1 8   ? 9.228   -13.435 -2.979  1.00 0.00 ? 8   VAL B HG12 1  
ATOM   1727   H HG13 . VAL B 1 8   ? 9.692   -14.206 -1.463  1.00 0.00 ? 8   VAL B HG13 1  
ATOM   1728   H HG21 . VAL B 1 8   ? 11.889  -14.072 -5.048  1.00 0.00 ? 8   VAL B HG21 1  
ATOM   1729   H HG22 . VAL B 1 8   ? 10.604  -15.273 -4.949  1.00 0.00 ? 8   VAL B HG22 1  
ATOM   1730   H HG23 . VAL B 1 8   ? 10.220  -13.560 -4.795  1.00 0.00 ? 8   VAL B HG23 1  
ATOM   1731   N N    . MET B 1 9   ? 12.865  -14.852 -0.460  1.00 0.00 ? 9   MET B N    1  
ATOM   1732   C CA   . MET B 1 9   ? 13.031  -14.815 0.989   1.00 0.00 ? 9   MET B CA   1  
ATOM   1733   C C    . MET B 1 9   ? 14.181  -13.878 1.339   1.00 0.00 ? 9   MET B C    1  
ATOM   1734   O O    . MET B 1 9   ? 14.071  -13.047 2.243   1.00 0.00 ? 9   MET B O    1  
ATOM   1735   C CB   . MET B 1 9   ? 13.333  -16.214 1.535   1.00 0.00 ? 9   MET B CB   1  
ATOM   1736   C CG   . MET B 1 9   ? 12.049  -17.043 1.589   1.00 0.00 ? 9   MET B CG   1  
ATOM   1737   S SD   . MET B 1 9   ? 12.445  -18.749 2.057   1.00 0.00 ? 9   MET B SD   1  
ATOM   1738   C CE   . MET B 1 9   ? 12.766  -18.455 3.815   1.00 0.00 ? 9   MET B CE   1  
ATOM   1739   H H    . MET B 1 9   ? 12.935  -15.709 -0.935  1.00 0.00 ? 9   MET B H    1  
ATOM   1740   H HA   . MET B 1 9   ? 12.126  -14.436 1.437   1.00 0.00 ? 9   MET B HA   1  
ATOM   1741   H HB2  . MET B 1 9   ? 14.050  -16.702 0.890   1.00 0.00 ? 9   MET B HB2  1  
ATOM   1742   H HB3  . MET B 1 9   ? 13.746  -16.127 2.528   1.00 0.00 ? 9   MET B HB3  1  
ATOM   1743   H HG2  . MET B 1 9   ? 11.379  -16.616 2.319   1.00 0.00 ? 9   MET B HG2  1  
ATOM   1744   H HG3  . MET B 1 9   ? 11.575  -17.036 0.618   1.00 0.00 ? 9   MET B HG3  1  
ATOM   1745   H HE1  . MET B 1 9   ? 11.952  -17.884 4.238   1.00 0.00 ? 9   MET B HE1  1  
ATOM   1746   H HE2  . MET B 1 9   ? 12.849  -19.404 4.326   1.00 0.00 ? 9   MET B HE2  1  
ATOM   1747   H HE3  . MET B 1 9   ? 13.685  -17.907 3.930   1.00 0.00 ? 9   MET B HE3  1  
ATOM   1748   N N    . GLY B 1 10  ? 15.278  -13.998 0.598   1.00 0.00 ? 10  GLY B N    1  
ATOM   1749   C CA   . GLY B 1 10  ? 16.432  -13.134 0.824   1.00 0.00 ? 10  GLY B CA   1  
ATOM   1750   C C    . GLY B 1 10  ? 16.051  -11.678 0.579   1.00 0.00 ? 10  GLY B C    1  
ATOM   1751   O O    . GLY B 1 10  ? 16.401  -10.791 1.359   1.00 0.00 ? 10  GLY B O    1  
ATOM   1752   H H    . GLY B 1 10  ? 15.304  -14.665 -0.124  1.00 0.00 ? 10  GLY B H    1  
ATOM   1753   H HA2  . GLY B 1 10  ? 16.768  -13.247 1.844   1.00 0.00 ? 10  GLY B HA2  1  
ATOM   1754   H HA3  . GLY B 1 10  ? 17.228  -13.412 0.149   1.00 0.00 ? 10  GLY B HA3  1  
ATOM   1755   N N    . LEU B 1 11  ? 15.319  -11.439 -0.505  1.00 0.00 ? 11  LEU B N    1  
ATOM   1756   C CA   . LEU B 1 11  ? 14.882  -10.082 -0.839  1.00 0.00 ? 11  LEU B CA   1  
ATOM   1757   C C    . LEU B 1 11  ? 13.967  -9.527  0.244   1.00 0.00 ? 11  LEU B C    1  
ATOM   1758   O O    . LEU B 1 11  ? 14.101  -8.370  0.652   1.00 0.00 ? 11  LEU B O    1  
ATOM   1759   C CB   . LEU B 1 11  ? 14.133  -10.077 -2.173  1.00 0.00 ? 11  LEU B CB   1  
ATOM   1760   C CG   . LEU B 1 11  ? 15.103  -10.342 -3.328  1.00 0.00 ? 11  LEU B CG   1  
ATOM   1761   C CD1  . LEU B 1 11  ? 14.301  -10.575 -4.610  1.00 0.00 ? 11  LEU B CD1  1  
ATOM   1762   C CD2  . LEU B 1 11  ? 16.050  -9.144  -3.516  1.00 0.00 ? 11  LEU B CD2  1  
ATOM   1763   H H    . LEU B 1 11  ? 15.059  -12.188 -1.086  1.00 0.00 ? 11  LEU B H    1  
ATOM   1764   H HA   . LEU B 1 11  ? 15.747  -9.444  -0.923  1.00 0.00 ? 11  LEU B HA   1  
ATOM   1765   H HB2  . LEU B 1 11  ? 13.376  -10.851 -2.155  1.00 0.00 ? 11  LEU B HB2  1  
ATOM   1766   H HB3  . LEU B 1 11  ? 13.658  -9.116  -2.314  1.00 0.00 ? 11  LEU B HB3  1  
ATOM   1767   H HG   . LEU B 1 11  ? 15.682  -11.227 -3.106  1.00 0.00 ? 11  LEU B HG   1  
ATOM   1768   H HD11 . LEU B 1 11  ? 13.465  -9.891  -4.644  1.00 0.00 ? 11  LEU B HD11 1  
ATOM   1769   H HD12 . LEU B 1 11  ? 14.936  -10.410 -5.465  1.00 0.00 ? 11  LEU B HD12 1  
ATOM   1770   H HD13 . LEU B 1 11  ? 13.934  -11.591 -4.623  1.00 0.00 ? 11  LEU B HD13 1  
ATOM   1771   H HD21 . LEU B 1 11  ? 15.541  -8.226  -3.258  1.00 0.00 ? 11  LEU B HD21 1  
ATOM   1772   H HD22 . LEU B 1 11  ? 16.916  -9.264  -2.881  1.00 0.00 ? 11  LEU B HD22 1  
ATOM   1773   H HD23 . LEU B 1 11  ? 16.369  -9.095  -4.548  1.00 0.00 ? 11  LEU B HD23 1  
ATOM   1774   N N    . ILE B 1 12  ? 13.038  -10.354 0.709   1.00 0.00 ? 12  ILE B N    1  
ATOM   1775   C CA   . ILE B 1 12  ? 12.109  -9.926  1.752   1.00 0.00 ? 12  ILE B CA   1  
ATOM   1776   C C    . ILE B 1 12  ? 12.888  -9.584  3.010   1.00 0.00 ? 12  ILE B C    1  
ATOM   1777   O O    . ILE B 1 12  ? 12.663  -8.545  3.637   1.00 0.00 ? 12  ILE B O    1  
ATOM   1778   C CB   . ILE B 1 12  ? 11.105  -11.041 2.078   1.00 0.00 ? 12  ILE B CB   1  
ATOM   1779   C CG1  . ILE B 1 12  ? 10.228  -11.332 0.855   1.00 0.00 ? 12  ILE B CG1  1  
ATOM   1780   C CG2  . ILE B 1 12  ? 10.208  -10.606 3.245   1.00 0.00 ? 12  ILE B CG2  1  
ATOM   1781   C CD1  . ILE B 1 12  ? 9.491   -10.076 0.417   1.00 0.00 ? 12  ILE B CD1  1  
ATOM   1782   H H    . ILE B 1 12  ? 12.979  -11.268 0.348   1.00 0.00 ? 12  ILE B H    1  
ATOM   1783   H HA   . ILE B 1 12  ? 11.589  -9.044  1.411   1.00 0.00 ? 12  ILE B HA   1  
ATOM   1784   H HB   . ILE B 1 12  ? 11.642  -11.935 2.358   1.00 0.00 ? 12  ILE B HB   1  
ATOM   1785   H HG12 . ILE B 1 12  ? 10.842  -11.676 0.050   1.00 0.00 ? 12  ILE B HG12 1  
ATOM   1786   H HG13 . ILE B 1 12  ? 9.508   -12.093 1.104   1.00 0.00 ? 12  ILE B HG13 1  
ATOM   1787   H HG21 . ILE B 1 12  ? 9.690   -9.698  2.977   1.00 0.00 ? 12  ILE B HG21 1  
ATOM   1788   H HG22 . ILE B 1 12  ? 9.486   -11.381 3.451   1.00 0.00 ? 12  ILE B HG22 1  
ATOM   1789   H HG23 . ILE B 1 12  ? 10.806  -10.431 4.124   1.00 0.00 ? 12  ILE B HG23 1  
ATOM   1790   H HD11 . ILE B 1 12  ? 9.451   -9.379  1.225   1.00 0.00 ? 12  ILE B HD11 1  
ATOM   1791   H HD12 . ILE B 1 12  ? 10.001  -9.634  -0.418  1.00 0.00 ? 12  ILE B HD12 1  
ATOM   1792   H HD13 . ILE B 1 12  ? 8.497   -10.335 0.125   1.00 0.00 ? 12  ILE B HD13 1  
ATOM   1793   N N    . ILE B 1 13  ? 13.831  -10.448 3.361   1.00 0.00 ? 13  ILE B N    1  
ATOM   1794   C CA   . ILE B 1 13  ? 14.660  -10.208 4.532   1.00 0.00 ? 13  ILE B CA   1  
ATOM   1795   C C    . ILE B 1 13  ? 15.490  -8.945  4.324   1.00 0.00 ? 13  ILE B C    1  
ATOM   1796   O O    . ILE B 1 13  ? 15.580  -8.090  5.210   1.00 0.00 ? 13  ILE B O    1  
ATOM   1797   C CB   . ILE B 1 13  ? 15.580  -11.415 4.767   1.00 0.00 ? 13  ILE B CB   1  
ATOM   1798   C CG1  . ILE B 1 13  ? 14.741  -12.646 5.182   1.00 0.00 ? 13  ILE B CG1  1  
ATOM   1799   C CG2  . ILE B 1 13  ? 16.615  -11.093 5.851   1.00 0.00 ? 13  ILE B CG2  1  
ATOM   1800   C CD1  . ILE B 1 13  ? 14.207  -12.521 6.621   1.00 0.00 ? 13  ILE B CD1  1  
ATOM   1801   H H    . ILE B 1 13  ? 13.983  -11.250 2.812   1.00 0.00 ? 13  ILE B H    1  
ATOM   1802   H HA   . ILE B 1 13  ? 14.023  -10.071 5.393   1.00 0.00 ? 13  ILE B HA   1  
ATOM   1803   H HB   . ILE B 1 13  ? 16.100  -11.638 3.846   1.00 0.00 ? 13  ILE B HB   1  
ATOM   1804   H HG12 . ILE B 1 13  ? 13.905  -12.742 4.508   1.00 0.00 ? 13  ILE B HG12 1  
ATOM   1805   H HG13 . ILE B 1 13  ? 15.355  -13.530 5.109   1.00 0.00 ? 13  ILE B HG13 1  
ATOM   1806   H HG21 . ILE B 1 13  ? 16.108  -10.810 6.760   1.00 0.00 ? 13  ILE B HG21 1  
ATOM   1807   H HG22 . ILE B 1 13  ? 17.221  -11.967 6.036   1.00 0.00 ? 13  ILE B HG22 1  
ATOM   1808   H HG23 . ILE B 1 13  ? 17.247  -10.284 5.523   1.00 0.00 ? 13  ILE B HG23 1  
ATOM   1809   H HD11 . ILE B 1 13  ? 15.007  -12.267 7.296   1.00 0.00 ? 13  ILE B HD11 1  
ATOM   1810   H HD12 . ILE B 1 13  ? 13.442  -11.766 6.666   1.00 0.00 ? 13  ILE B HD12 1  
ATOM   1811   H HD13 . ILE B 1 13  ? 13.783  -13.465 6.922   1.00 0.00 ? 13  ILE B HD13 1  
ATOM   1812   N N    . ASN B 1 14  ? 16.090  -8.830  3.141   1.00 0.00 ? 14  ASN B N    1  
ATOM   1813   C CA   . ASN B 1 14  ? 16.910  -7.662  2.817   1.00 0.00 ? 14  ASN B CA   1  
ATOM   1814   C C    . ASN B 1 14  ? 16.071  -6.391  2.904   1.00 0.00 ? 14  ASN B C    1  
ATOM   1815   O O    . ASN B 1 14  ? 16.476  -5.402  3.517   1.00 0.00 ? 14  ASN B O    1  
ATOM   1816   C CB   . ASN B 1 14  ? 17.501  -7.817  1.407   1.00 0.00 ? 14  ASN B CB   1  
ATOM   1817   C CG   . ASN B 1 14  ? 18.810  -7.045  1.279   1.00 0.00 ? 14  ASN B CG   1  
ATOM   1818   O OD1  . ASN B 1 14  ? 19.186  -6.296  2.174   1.00 0.00 ? 14  ASN B OD1  1  
ATOM   1819   N ND2  . ASN B 1 14  ? 19.532  -7.186  0.206   1.00 0.00 ? 14  ASN B ND2  1  
ATOM   1820   H H    . ASN B 1 14  ? 15.972  -9.538  2.472   1.00 0.00 ? 14  ASN B H    1  
ATOM   1821   H HA   . ASN B 1 14  ? 17.716  -7.596  3.531   1.00 0.00 ? 14  ASN B HA   1  
ATOM   1822   H HB2  . ASN B 1 14  ? 17.691  -8.861  1.215   1.00 0.00 ? 14  ASN B HB2  1  
ATOM   1823   H HB3  . ASN B 1 14  ? 16.796  -7.445  0.680   1.00 0.00 ? 14  ASN B HB3  1  
ATOM   1824   H HD21 . ASN B 1 14  ? 19.235  -7.782  -0.509  1.00 0.00 ? 14  ASN B HD21 1  
ATOM   1825   H HD22 . ASN B 1 14  ? 20.378  -6.697  0.117   1.00 0.00 ? 14  ASN B HD22 1  
ATOM   1826   N N    . SER B 1 15  ? 14.886  -6.430  2.304   1.00 0.00 ? 15  SER B N    1  
ATOM   1827   C CA   . SER B 1 15  ? 13.990  -5.280  2.346   1.00 0.00 ? 15  SER B CA   1  
ATOM   1828   C C    . SER B 1 15  ? 13.642  -4.944  3.791   1.00 0.00 ? 15  SER B C    1  
ATOM   1829   O O    . SER B 1 15  ? 13.638  -3.781  4.192   1.00 0.00 ? 15  SER B O    1  
ATOM   1830   C CB   . SER B 1 15  ? 12.708  -5.583  1.571   1.00 0.00 ? 15  SER B CB   1  
ATOM   1831   O OG   . SER B 1 15  ? 11.882  -6.441  2.348   1.00 0.00 ? 15  SER B OG   1  
ATOM   1832   H H    . SER B 1 15  ? 14.603  -7.251  1.843   1.00 0.00 ? 15  SER B H    1  
ATOM   1833   H HA   . SER B 1 15  ? 14.487  -4.431  1.901   1.00 0.00 ? 15  SER B HA   1  
ATOM   1834   H HB2  . SER B 1 15  ? 12.179  -4.667  1.369   1.00 0.00 ? 15  SER B HB2  1  
ATOM   1835   H HB3  . SER B 1 15  ? 12.960  -6.065  0.637   1.00 0.00 ? 15  SER B HB3  1  
ATOM   1836   H HG   . SER B 1 15  ? 11.408  -7.020  1.748   1.00 0.00 ? 15  SER B HG   1  
ATOM   1837   N N    . GLY B 1 16  ? 13.367  -5.985  4.577   1.00 0.00 ? 16  GLY B N    1  
ATOM   1838   C CA   . GLY B 1 16  ? 13.034  -5.800  5.985   1.00 0.00 ? 16  GLY B CA   1  
ATOM   1839   C C    . GLY B 1 16  ? 14.206  -5.180  6.737   1.00 0.00 ? 16  GLY B C    1  
ATOM   1840   O O    . GLY B 1 16  ? 14.026  -4.255  7.528   1.00 0.00 ? 16  GLY B O    1  
ATOM   1841   H H    . GLY B 1 16  ? 13.400  -6.893  4.205   1.00 0.00 ? 16  GLY B H    1  
ATOM   1842   H HA2  . GLY B 1 16  ? 12.179  -5.147  6.065   1.00 0.00 ? 16  GLY B HA2  1  
ATOM   1843   H HA3  . GLY B 1 16  ? 12.796  -6.755  6.426   1.00 0.00 ? 16  GLY B HA3  1  
ATOM   1844   N N    . GLN B 1 17  ? 15.414  -5.685  6.481   1.00 0.00 ? 17  GLN B N    1  
ATOM   1845   C CA   . GLN B 1 17  ? 16.603  -5.139  7.140   1.00 0.00 ? 17  GLN B CA   1  
ATOM   1846   C C    . GLN B 1 17  ? 16.782  -3.682  6.739   1.00 0.00 ? 17  GLN B C    1  
ATOM   1847   O O    . GLN B 1 17  ? 17.121  -2.837  7.569   1.00 0.00 ? 17  GLN B O    1  
ATOM   1848   C CB   . GLN B 1 17  ? 17.839  -5.964  6.748   1.00 0.00 ? 17  GLN B CB   1  
ATOM   1849   C CG   . GLN B 1 17  ? 18.979  -5.741  7.756   1.00 0.00 ? 17  GLN B CG   1  
ATOM   1850   C CD   . GLN B 1 17  ? 19.819  -7.010  7.883   1.00 0.00 ? 17  GLN B CD   1  
ATOM   1851   O OE1  . GLN B 1 17  ? 19.769  -7.880  7.013   1.00 0.00 ? 17  GLN B OE1  1  
ATOM   1852   N NE2  . GLN B 1 17  ? 20.585  -7.170  8.928   1.00 0.00 ? 17  GLN B NE2  1  
ATOM   1853   H H    . GLN B 1 17  ? 15.506  -6.417  5.830   1.00 0.00 ? 17  GLN B H    1  
ATOM   1854   H HA   . GLN B 1 17  ? 16.464  -5.195  8.210   1.00 0.00 ? 17  GLN B HA   1  
ATOM   1855   H HB2  . GLN B 1 17  ? 17.574  -7.012  6.728   1.00 0.00 ? 17  GLN B HB2  1  
ATOM   1856   H HB3  . GLN B 1 17  ? 18.169  -5.662  5.765   1.00 0.00 ? 17  GLN B HB3  1  
ATOM   1857   H HG2  . GLN B 1 17  ? 19.608  -4.934  7.410   1.00 0.00 ? 17  GLN B HG2  1  
ATOM   1858   H HG3  . GLN B 1 17  ? 18.574  -5.488  8.722   1.00 0.00 ? 17  GLN B HG3  1  
ATOM   1859   H HE21 . GLN B 1 17  ? 20.619  -6.479  9.621   1.00 0.00 ? 17  GLN B HE21 1  
ATOM   1860   H HE22 . GLN B 1 17  ? 21.126  -7.983  9.019   1.00 0.00 ? 17  GLN B HE22 1  
ATOM   1861   N N    . ALA B 1 18  ? 16.545  -3.398  5.462   1.00 0.00 ? 18  ALA B N    1  
ATOM   1862   C CA   . ALA B 1 18  ? 16.675  -2.040  4.957   1.00 0.00 ? 18  ALA B CA   1  
ATOM   1863   C C    . ALA B 1 18  ? 15.773  -1.098  5.748   1.00 0.00 ? 18  ALA B C    1  
ATOM   1864   O O    . ALA B 1 18  ? 16.219  -0.061  6.248   1.00 0.00 ? 18  ALA B O    1  
ATOM   1865   C CB   . ALA B 1 18  ? 16.309  -2.000  3.472   1.00 0.00 ? 18  ALA B CB   1  
ATOM   1866   H H    . ALA B 1 18  ? 16.269  -4.116  4.850   1.00 0.00 ? 18  ALA B H    1  
ATOM   1867   H HA   . ALA B 1 18  ? 17.700  -1.721  5.076   1.00 0.00 ? 18  ALA B HA   1  
ATOM   1868   H HB1  . ALA B 1 18  ? 15.246  -1.843  3.366   1.00 0.00 ? 18  ALA B HB1  1  
ATOM   1869   H HB2  . ALA B 1 18  ? 16.582  -2.937  3.010   1.00 0.00 ? 18  ALA B HB2  1  
ATOM   1870   H HB3  . ALA B 1 18  ? 16.843  -1.193  2.994   1.00 0.00 ? 18  ALA B HB3  1  
ATOM   1871   N N    . ARG B 1 19  ? 14.506  -1.472  5.879   1.00 0.00 ? 19  ARG B N    1  
ATOM   1872   C CA   . ARG B 1 19  ? 13.571  -0.651  6.638   1.00 0.00 ? 19  ARG B CA   1  
ATOM   1873   C C    . ARG B 1 19  ? 14.057  -0.524  8.076   1.00 0.00 ? 19  ARG B C    1  
ATOM   1874   O O    . ARG B 1 19  ? 14.085  0.570   8.645   1.00 0.00 ? 19  ARG B O    1  
ATOM   1875   C CB   . ARG B 1 19  ? 12.170  -1.271  6.627   1.00 0.00 ? 19  ARG B CB   1  
ATOM   1876   C CG   . ARG B 1 19  ? 11.195  -0.327  7.346   1.00 0.00 ? 19  ARG B CG   1  
ATOM   1877   C CD   . ARG B 1 19  ? 9.770   -0.877  7.263   1.00 0.00 ? 19  ARG B CD   1  
ATOM   1878   N NE   . ARG B 1 19  ? 9.660   -2.141  7.992   1.00 0.00 ? 19  ARG B NE   1  
ATOM   1879   C CZ   . ARG B 1 19  ? 8.481   -2.692  8.227   1.00 0.00 ? 19  ARG B CZ   1  
ATOM   1880   N NH1  . ARG B 1 19  ? 7.407   -2.131  7.768   1.00 0.00 ? 19  ARG B NH1  1  
ATOM   1881   N NH2  . ARG B 1 19  ? 8.399   -3.783  8.916   1.00 0.00 ? 19  ARG B NH2  1  
ATOM   1882   H H    . ARG B 1 19  ? 14.202  -2.316  5.477   1.00 0.00 ? 19  ARG B H    1  
ATOM   1883   H HA   . ARG B 1 19  ? 13.529  0.332   6.194   1.00 0.00 ? 19  ARG B HA   1  
ATOM   1884   H HB2  . ARG B 1 19  ? 11.851  -1.422  5.608   1.00 0.00 ? 19  ARG B HB2  1  
ATOM   1885   H HB3  . ARG B 1 19  ? 12.196  -2.220  7.145   1.00 0.00 ? 19  ARG B HB3  1  
ATOM   1886   H HG2  . ARG B 1 19  ? 11.482  -0.231  8.385   1.00 0.00 ? 19  ARG B HG2  1  
ATOM   1887   H HG3  . ARG B 1 19  ? 11.229  0.645   6.877   1.00 0.00 ? 19  ARG B HG3  1  
ATOM   1888   H HD2  . ARG B 1 19  ? 9.090   -0.156  7.700   1.00 0.00 ? 19  ARG B HD2  1  
ATOM   1889   H HD3  . ARG B 1 19  ? 9.509   -1.034  6.223   1.00 0.00 ? 19  ARG B HD3  1  
ATOM   1890   H HE   . ARG B 1 19  ? 10.473  -2.575  8.326   1.00 0.00 ? 19  ARG B HE   1  
ATOM   1891   H HH11 . ARG B 1 19  ? 7.475   -1.288  7.235   1.00 0.00 ? 19  ARG B HH11 1  
ATOM   1892   H HH12 . ARG B 1 19  ? 6.517   -2.536  7.943   1.00 0.00 ? 19  ARG B HH12 1  
ATOM   1893   H HH21 . ARG B 1 19  ? 9.229   -4.218  9.266   1.00 0.00 ? 19  ARG B HH21 1  
ATOM   1894   H HH22 . ARG B 1 19  ? 7.509   -4.194  9.097   1.00 0.00 ? 19  ARG B HH22 1  
ATOM   1895   N N    . SER B 1 20  ? 14.437  -1.655  8.658   1.00 0.00 ? 20  SER B N    1  
ATOM   1896   C CA   . SER B 1 20  ? 14.926  -1.670  10.033  1.00 0.00 ? 20  SER B CA   1  
ATOM   1897   C C    . SER B 1 20  ? 16.052  -0.658  10.207  1.00 0.00 ? 20  SER B C    1  
ATOM   1898   O O    . SER B 1 20  ? 16.046  0.146   11.143  1.00 0.00 ? 20  SER B O    1  
ATOM   1899   C CB   . SER B 1 20  ? 15.425  -3.067  10.407  1.00 0.00 ? 20  SER B CB   1  
ATOM   1900   O OG   . SER B 1 20  ? 16.195  -2.988  11.600  1.00 0.00 ? 20  SER B OG   1  
ATOM   1901   H H    . SER B 1 20  ? 14.395  -2.497  8.151   1.00 0.00 ? 20  SER B H    1  
ATOM   1902   H HA   . SER B 1 20  ? 14.113  -1.399  10.689  1.00 0.00 ? 20  SER B HA   1  
ATOM   1903   H HB2  . SER B 1 20  ? 14.585  -3.721  10.570  1.00 0.00 ? 20  SER B HB2  1  
ATOM   1904   H HB3  . SER B 1 20  ? 16.031  -3.457  9.601   1.00 0.00 ? 20  SER B HB3  1  
ATOM   1905   H HG   . SER B 1 20  ? 15.682  -2.508  12.254  1.00 0.00 ? 20  SER B HG   1  
ATOM   1906   N N    . LEU B 1 21  ? 17.008  -0.683  9.287   1.00 0.00 ? 21  LEU B N    1  
ATOM   1907   C CA   . LEU B 1 21  ? 18.126  0.255   9.336   1.00 0.00 ? 21  LEU B CA   1  
ATOM   1908   C C    . LEU B 1 21  ? 17.611  1.689   9.193   1.00 0.00 ? 21  LEU B C    1  
ATOM   1909   O O    . LEU B 1 21  ? 18.049  2.595   9.907   1.00 0.00 ? 21  LEU B O    1  
ATOM   1910   C CB   . LEU B 1 21  ? 19.114  -0.045  8.205   1.00 0.00 ? 21  LEU B CB   1  
ATOM   1911   C CG   . LEU B 1 21  ? 19.838  -1.372  8.480   1.00 0.00 ? 21  LEU B CG   1  
ATOM   1912   C CD1  . LEU B 1 21  ? 20.597  -1.823  7.220   1.00 0.00 ? 21  LEU B CD1  1  
ATOM   1913   C CD2  . LEU B 1 21  ? 20.827  -1.200  9.655   1.00 0.00 ? 21  LEU B CD2  1  
ATOM   1914   H H    . LEU B 1 21  ? 16.953  -1.330  8.550   1.00 0.00 ? 21  LEU B H    1  
ATOM   1915   H HA   . LEU B 1 21  ? 18.626  0.159   10.287  1.00 0.00 ? 21  LEU B HA   1  
ATOM   1916   H HB2  . LEU B 1 21  ? 18.572  -0.113  7.273   1.00 0.00 ? 21  LEU B HB2  1  
ATOM   1917   H HB3  . LEU B 1 21  ? 19.839  0.753   8.141   1.00 0.00 ? 21  LEU B HB3  1  
ATOM   1918   H HG   . LEU B 1 21  ? 19.106  -2.124  8.738   1.00 0.00 ? 21  LEU B HG   1  
ATOM   1919   H HD11 . LEU B 1 21  ? 20.095  -1.458  6.337   1.00 0.00 ? 21  LEU B HD11 1  
ATOM   1920   H HD12 . LEU B 1 21  ? 21.604  -1.432  7.247   1.00 0.00 ? 21  LEU B HD12 1  
ATOM   1921   H HD13 . LEU B 1 21  ? 20.633  -2.902  7.190   1.00 0.00 ? 21  LEU B HD13 1  
ATOM   1922   H HD21 . LEU B 1 21  ? 20.860  -0.165  9.965   1.00 0.00 ? 21  LEU B HD21 1  
ATOM   1923   H HD22 . LEU B 1 21  ? 20.502  -1.810  10.485  1.00 0.00 ? 21  LEU B HD22 1  
ATOM   1924   H HD23 . LEU B 1 21  ? 21.818  -1.510  9.353   1.00 0.00 ? 21  LEU B HD23 1  
ATOM   1925   N N    . ALA B 1 22  ? 16.673  1.887   8.268   1.00 0.00 ? 22  ALA B N    1  
ATOM   1926   C CA   . ALA B 1 22  ? 16.100  3.211   8.044   1.00 0.00 ? 22  ALA B CA   1  
ATOM   1927   C C    . ALA B 1 22  ? 15.467  3.747   9.332   1.00 0.00 ? 22  ALA B C    1  
ATOM   1928   O O    . ALA B 1 22  ? 15.771  4.862   9.761   1.00 0.00 ? 22  ALA B O    1  
ATOM   1929   C CB   . ALA B 1 22  ? 15.063  3.148   6.923   1.00 0.00 ? 22  ALA B CB   1  
ATOM   1930   H H    . ALA B 1 22  ? 16.358  1.124   7.733   1.00 0.00 ? 22  ALA B H    1  
ATOM   1931   H HA   . ALA B 1 22  ? 16.891  3.883   7.748   1.00 0.00 ? 22  ALA B HA   1  
ATOM   1932   H HB1  . ALA B 1 22  ? 14.193  2.609   7.266   1.00 0.00 ? 22  ALA B HB1  1  
ATOM   1933   H HB2  . ALA B 1 22  ? 14.780  4.150   6.639   1.00 0.00 ? 22  ALA B HB2  1  
ATOM   1934   H HB3  . ALA B 1 22  ? 15.489  2.638   6.071   1.00 0.00 ? 22  ALA B HB3  1  
ATOM   1935   N N    . TYR B 1 23  ? 14.603  2.949   9.959   1.00 0.00 ? 23  TYR B N    1  
ATOM   1936   C CA   . TYR B 1 23  ? 13.973  3.380   11.212  1.00 0.00 ? 23  TYR B CA   1  
ATOM   1937   C C    . TYR B 1 23  ? 15.055  3.649   12.253  1.00 0.00 ? 23  TYR B C    1  
ATOM   1938   O O    . TYR B 1 23  ? 14.994  4.634   12.989  1.00 0.00 ? 23  TYR B O    1  
ATOM   1939   C CB   . TYR B 1 23  ? 13.007  2.306   11.724  1.00 0.00 ? 23  TYR B CB   1  
ATOM   1940   C CG   . TYR B 1 23  ? 12.449  2.724   13.063  1.00 0.00 ? 23  TYR B CG   1  
ATOM   1941   C CD1  . TYR B 1 23  ? 11.426  3.677   13.131  1.00 0.00 ? 23  TYR B CD1  1  
ATOM   1942   C CD2  . TYR B 1 23  ? 12.956  2.157   14.239  1.00 0.00 ? 23  TYR B CD2  1  
ATOM   1943   C CE1  . TYR B 1 23  ? 10.910  4.064   14.374  1.00 0.00 ? 23  TYR B CE1  1  
ATOM   1944   C CE2  . TYR B 1 23  ? 12.440  2.543   15.482  1.00 0.00 ? 23  TYR B CE2  1  
ATOM   1945   C CZ   . TYR B 1 23  ? 11.417  3.497   15.550  1.00 0.00 ? 23  TYR B CZ   1  
ATOM   1946   O OH   . TYR B 1 23  ? 10.909  3.878   16.775  1.00 0.00 ? 23  TYR B OH   1  
ATOM   1947   H H    . TYR B 1 23  ? 14.399  2.061   9.585   1.00 0.00 ? 23  TYR B H    1  
ATOM   1948   H HA   . TYR B 1 23  ? 13.434  4.296   11.036  1.00 0.00 ? 23  TYR B HA   1  
ATOM   1949   H HB2  . TYR B 1 23  ? 12.198  2.184   11.018  1.00 0.00 ? 23  TYR B HB2  1  
ATOM   1950   H HB3  . TYR B 1 23  ? 13.535  1.370   11.831  1.00 0.00 ? 23  TYR B HB3  1  
ATOM   1951   H HD1  . TYR B 1 23  ? 11.034  4.114   12.224  1.00 0.00 ? 23  TYR B HD1  1  
ATOM   1952   H HD2  . TYR B 1 23  ? 13.745  1.421   14.188  1.00 0.00 ? 23  TYR B HD2  1  
ATOM   1953   H HE1  . TYR B 1 23  ? 10.121  4.799   14.426  1.00 0.00 ? 23  TYR B HE1  1  
ATOM   1954   H HE2  . TYR B 1 23  ? 12.831  2.106   16.389  1.00 0.00 ? 23  TYR B HE2  1  
ATOM   1955   H HH   . TYR B 1 23  ? 10.143  4.435   16.618  1.00 0.00 ? 23  TYR B HH   1  
ATOM   1956   N N    . ALA B 1 24  ? 16.067  2.786   12.292  1.00 0.00 ? 24  ALA B N    1  
ATOM   1957   C CA   . ALA B 1 24  ? 17.159  2.973   13.232  1.00 0.00 ? 24  ALA B CA   1  
ATOM   1958   C C    . ALA B 1 24  ? 17.857  4.300   12.924  1.00 0.00 ? 24  ALA B C    1  
ATOM   1959   O O    . ALA B 1 24  ? 18.199  5.062   13.830  1.00 0.00 ? 24  ALA B O    1  
ATOM   1960   C CB   . ALA B 1 24  ? 18.139  1.789   13.140  1.00 0.00 ? 24  ALA B CB   1  
ATOM   1961   H H    . ALA B 1 24  ? 16.084  2.025   11.669  1.00 0.00 ? 24  ALA B H    1  
ATOM   1962   H HA   . ALA B 1 24  ? 16.754  3.020   14.233  1.00 0.00 ? 24  ALA B HA   1  
ATOM   1963   H HB1  . ALA B 1 24  ? 18.114  1.230   14.066  1.00 0.00 ? 24  ALA B HB1  1  
ATOM   1964   H HB2  . ALA B 1 24  ? 17.845  1.143   12.326  1.00 0.00 ? 24  ALA B HB2  1  
ATOM   1965   H HB3  . ALA B 1 24  ? 19.139  2.153   12.966  1.00 0.00 ? 24  ALA B HB3  1  
ATOM   1966   N N    . ALA B 1 25  ? 18.025  4.586   11.634  1.00 0.00 ? 25  ALA B N    1  
ATOM   1967   C CA   . ALA B 1 25  ? 18.643  5.841   11.212  1.00 0.00 ? 25  ALA B CA   1  
ATOM   1968   C C    . ALA B 1 25  ? 17.842  7.015   11.764  1.00 0.00 ? 25  ALA B C    1  
ATOM   1969   O O    . ALA B 1 25  ? 18.400  7.981   12.288  1.00 0.00 ? 25  ALA B O    1  
ATOM   1970   C CB   . ALA B 1 25  ? 18.684  5.913   9.683   1.00 0.00 ? 25  ALA B CB   1  
ATOM   1971   H H    . ALA B 1 25  ? 17.707  3.952   10.953  1.00 0.00 ? 25  ALA B H    1  
ATOM   1972   H HA   . ALA B 1 25  ? 19.650  5.890   11.598  1.00 0.00 ? 25  ALA B HA   1  
ATOM   1973   H HB1  . ALA B 1 25  ? 18.932  4.941   9.283   1.00 0.00 ? 25  ALA B HB1  1  
ATOM   1974   H HB2  . ALA B 1 25  ? 17.717  6.220   9.309   1.00 0.00 ? 25  ALA B HB2  1  
ATOM   1975   H HB3  . ALA B 1 25  ? 19.431  6.630   9.376   1.00 0.00 ? 25  ALA B HB3  1  
ATOM   1976   N N    . LEU B 1 26  ? 16.524  6.914   11.656  1.00 0.00 ? 26  LEU B N    1  
ATOM   1977   C CA   . LEU B 1 26  ? 15.643  7.962   12.164  1.00 0.00 ? 26  LEU B CA   1  
ATOM   1978   C C    . LEU B 1 26  ? 15.819  8.104   13.672  1.00 0.00 ? 26  LEU B C    1  
ATOM   1979   O O    . LEU B 1 26  ? 15.909  9.216   14.203  1.00 0.00 ? 26  LEU B O    1  
ATOM   1980   C CB   . LEU B 1 26  ? 14.185  7.623   11.833  1.00 0.00 ? 26  LEU B CB   1  
ATOM   1981   C CG   . LEU B 1 26  ? 13.229  8.626   12.501  1.00 0.00 ? 26  LEU B CG   1  
ATOM   1982   C CD1  . LEU B 1 26  ? 13.520  10.046  12.007  1.00 0.00 ? 26  LEU B CD1  1  
ATOM   1983   C CD2  . LEU B 1 26  ? 11.791  8.255   12.138  1.00 0.00 ? 26  LEU B CD2  1  
ATOM   1984   H H    . LEU B 1 26  ? 16.134  6.114   11.240  1.00 0.00 ? 26  LEU B H    1  
ATOM   1985   H HA   . LEU B 1 26  ? 15.907  8.895   11.693  1.00 0.00 ? 26  LEU B HA   1  
ATOM   1986   H HB2  . LEU B 1 26  ? 14.046  7.657   10.766  1.00 0.00 ? 26  LEU B HB2  1  
ATOM   1987   H HB3  . LEU B 1 26  ? 13.958  6.629   12.191  1.00 0.00 ? 26  LEU B HB3  1  
ATOM   1988   H HG   . LEU B 1 26  ? 13.351  8.585   13.572  1.00 0.00 ? 26  LEU B HG   1  
ATOM   1989   H HD11 . LEU B 1 26  ? 13.666  10.034  10.938  1.00 0.00 ? 26  LEU B HD11 1  
ATOM   1990   H HD12 . LEU B 1 26  ? 12.686  10.686  12.249  1.00 0.00 ? 26  LEU B HD12 1  
ATOM   1991   H HD13 . LEU B 1 26  ? 14.412  10.420  12.490  1.00 0.00 ? 26  LEU B HD13 1  
ATOM   1992   H HD21 . LEU B 1 26  ? 11.673  8.271   11.064  1.00 0.00 ? 26  LEU B HD21 1  
ATOM   1993   H HD22 . LEU B 1 26  ? 11.567  7.267   12.510  1.00 0.00 ? 26  LEU B HD22 1  
ATOM   1994   H HD23 . LEU B 1 26  ? 11.113  8.968   12.582  1.00 0.00 ? 26  LEU B HD23 1  
ATOM   1995   N N    . LYS B 1 27  ? 15.874  6.971   14.361  1.00 0.00 ? 27  LYS B N    1  
ATOM   1996   C CA   . LYS B 1 27  ? 16.055  6.979   15.806  1.00 0.00 ? 27  LYS B CA   1  
ATOM   1997   C C    . LYS B 1 27  ? 17.327  7.743   16.178  1.00 0.00 ? 27  LYS B C    1  
ATOM   1998   O O    . LYS B 1 27  ? 17.332  8.533   17.125  1.00 0.00 ? 27  LYS B O    1  
ATOM   1999   C CB   . LYS B 1 27  ? 16.115  5.541   16.325  1.00 0.00 ? 27  LYS B CB   1  
ATOM   2000   C CG   . LYS B 1 27  ? 16.155  5.541   17.856  1.00 0.00 ? 27  LYS B CG   1  
ATOM   2001   C CD   . LYS B 1 27  ? 16.151  4.094   18.361  1.00 0.00 ? 27  LYS B CD   1  
ATOM   2002   C CE   . LYS B 1 27  ? 16.166  4.081   19.890  1.00 0.00 ? 27  LYS B CE   1  
ATOM   2003   N NZ   . LYS B 1 27  ? 16.139  2.670   20.370  1.00 0.00 ? 27  LYS B NZ   1  
ATOM   2004   H H    . LYS B 1 27  ? 15.803  6.114   13.884  1.00 0.00 ? 27  LYS B H    1  
ATOM   2005   H HA   . LYS B 1 27  ? 15.212  7.479   16.254  1.00 0.00 ? 27  LYS B HA   1  
ATOM   2006   H HB2  . LYS B 1 27  ? 15.241  5.003   15.987  1.00 0.00 ? 27  LYS B HB2  1  
ATOM   2007   H HB3  . LYS B 1 27  ? 17.004  5.057   15.942  1.00 0.00 ? 27  LYS B HB3  1  
ATOM   2008   H HG2  . LYS B 1 27  ? 17.055  6.042   18.192  1.00 0.00 ? 27  LYS B HG2  1  
ATOM   2009   H HG3  . LYS B 1 27  ? 15.288  6.059   18.239  1.00 0.00 ? 27  LYS B HG3  1  
ATOM   2010   H HD2  . LYS B 1 27  ? 15.264  3.592   18.001  1.00 0.00 ? 27  LYS B HD2  1  
ATOM   2011   H HD3  . LYS B 1 27  ? 17.029  3.583   17.988  1.00 0.00 ? 27  LYS B HD3  1  
ATOM   2012   H HE2  . LYS B 1 27  ? 17.064  4.571   20.245  1.00 0.00 ? 27  LYS B HE2  1  
ATOM   2013   H HE3  . LYS B 1 27  ? 15.299  4.610   20.261  1.00 0.00 ? 27  LYS B HE3  1  
ATOM   2014   H HZ1  . LYS B 1 27  ? 15.306  2.184   19.980  1.00 0.00 ? 27  LYS B HZ1  1  
ATOM   2015   H HZ2  . LYS B 1 27  ? 17.004  2.180   20.058  1.00 0.00 ? 27  LYS B HZ2  1  
ATOM   2016   H HZ3  . LYS B 1 27  ? 16.089  2.658   21.410  1.00 0.00 ? 27  LYS B HZ3  1  
ATOM   2017   N N    . GLN B 1 28  ? 18.394  7.524   15.413  1.00 0.00 ? 28  GLN B N    1  
ATOM   2018   C CA   . GLN B 1 28  ? 19.652  8.226   15.660  1.00 0.00 ? 28  GLN B CA   1  
ATOM   2019   C C    . GLN B 1 28  ? 19.422  9.732   15.565  1.00 0.00 ? 28  GLN B C    1  
ATOM   2020   O O    . GLN B 1 28  ? 19.929  10.507  16.374  1.00 0.00 ? 28  GLN B O    1  
ATOM   2021   C CB   . GLN B 1 28  ? 20.698  7.801   14.626  1.00 0.00 ? 28  GLN B CB   1  
ATOM   2022   C CG   . GLN B 1 28  ? 21.069  6.333   14.845  1.00 0.00 ? 28  GLN B CG   1  
ATOM   2023   C CD   . GLN B 1 28  ? 21.760  6.168   16.195  1.00 0.00 ? 28  GLN B CD   1  
ATOM   2024   O OE1  . GLN B 1 28  ? 22.733  6.864   16.483  1.00 0.00 ? 28  GLN B OE1  1  
ATOM   2025   N NE2  . GLN B 1 28  ? 21.313  5.284   17.043  1.00 0.00 ? 28  GLN B NE2  1  
ATOM   2026   H H    . GLN B 1 28  ? 18.327  6.899   14.659  1.00 0.00 ? 28  GLN B H    1  
ATOM   2027   H HA   . GLN B 1 28  ? 20.013  7.982   16.648  1.00 0.00 ? 28  GLN B HA   1  
ATOM   2028   H HB2  . GLN B 1 28  ? 20.292  7.926   13.632  1.00 0.00 ? 28  GLN B HB2  1  
ATOM   2029   H HB3  . GLN B 1 28  ? 21.580  8.414   14.734  1.00 0.00 ? 28  GLN B HB3  1  
ATOM   2030   H HG2  . GLN B 1 28  ? 20.173  5.730   14.824  1.00 0.00 ? 28  GLN B HG2  1  
ATOM   2031   H HG3  . GLN B 1 28  ? 21.737  6.011   14.060  1.00 0.00 ? 28  GLN B HG3  1  
ATOM   2032   H HE21 . GLN B 1 28  ? 20.538  4.731   16.812  1.00 0.00 ? 28  GLN B HE21 1  
ATOM   2033   H HE22 . GLN B 1 28  ? 21.752  5.173   17.912  1.00 0.00 ? 28  GLN B HE22 1  
ATOM   2034   N N    . ALA B 1 29  ? 18.641  10.134  14.565  1.00 0.00 ? 29  ALA B N    1  
ATOM   2035   C CA   . ALA B 1 29  ? 18.334  11.548  14.364  1.00 0.00 ? 29  ALA B CA   1  
ATOM   2036   C C    . ALA B 1 29  ? 17.631  12.118  15.592  1.00 0.00 ? 29  ALA B C    1  
ATOM   2037   O O    . ALA B 1 29  ? 17.943  13.215  16.049  1.00 0.00 ? 29  ALA B O    1  
ATOM   2038   C CB   . ALA B 1 29  ? 17.447  11.720  13.126  1.00 0.00 ? 29  ALA B CB   1  
ATOM   2039   H H    . ALA B 1 29  ? 18.258  9.466   13.958  1.00 0.00 ? 29  ALA B H    1  
ATOM   2040   H HA   . ALA B 1 29  ? 19.258  12.086  14.212  1.00 0.00 ? 29  ALA B HA   1  
ATOM   2041   H HB1  . ALA B 1 29  ? 16.414  11.551  13.394  1.00 0.00 ? 29  ALA B HB1  1  
ATOM   2042   H HB2  . ALA B 1 29  ? 17.558  12.724  12.742  1.00 0.00 ? 29  ALA B HB2  1  
ATOM   2043   H HB3  . ALA B 1 29  ? 17.743  11.009  12.369  1.00 0.00 ? 29  ALA B HB3  1  
ATOM   2044   N N    . LYS B 1 30  ? 16.684  11.359  16.134  1.00 0.00 ? 30  LYS B N    1  
ATOM   2045   C CA   . LYS B 1 30  ? 15.959  11.806  17.319  1.00 0.00 ? 30  LYS B CA   1  
ATOM   2046   C C    . LYS B 1 30  ? 16.921  12.029  18.482  1.00 0.00 ? 30  LYS B C    1  
ATOM   2047   O O    . LYS B 1 30  ? 16.692  12.897  19.320  1.00 0.00 ? 30  LYS B O    1  
ATOM   2048   C CB   . LYS B 1 30  ? 14.901  10.776  17.727  1.00 0.00 ? 30  LYS B CB   1  
ATOM   2049   C CG   . LYS B 1 30  ? 13.775  10.746  16.692  1.00 0.00 ? 30  LYS B CG   1  
ATOM   2050   C CD   . LYS B 1 30  ? 12.682  9.787   17.171  1.00 0.00 ? 30  LYS B CD   1  
ATOM   2051   C CE   . LYS B 1 30  ? 11.539  9.756   16.156  1.00 0.00 ? 30  LYS B CE   1  
ATOM   2052   N NZ   . LYS B 1 30  ? 10.469  8.844   16.648  1.00 0.00 ? 30  LYS B NZ   1  
ATOM   2053   H H    . LYS B 1 30  ? 16.482  10.487  15.734  1.00 0.00 ? 30  LYS B H    1  
ATOM   2054   H HA   . LYS B 1 30  ? 15.470  12.740  17.094  1.00 0.00 ? 30  LYS B HA   1  
ATOM   2055   H HB2  . LYS B 1 30  ? 15.357  9.799   17.796  1.00 0.00 ? 30  LYS B HB2  1  
ATOM   2056   H HB3  . LYS B 1 30  ? 14.493  11.049  18.691  1.00 0.00 ? 30  LYS B HB3  1  
ATOM   2057   H HG2  . LYS B 1 30  ? 13.367  11.737  16.574  1.00 0.00 ? 30  LYS B HG2  1  
ATOM   2058   H HG3  . LYS B 1 30  ? 14.170  10.401  15.746  1.00 0.00 ? 30  LYS B HG3  1  
ATOM   2059   H HD2  . LYS B 1 30  ? 13.098  8.793   17.275  1.00 0.00 ? 30  LYS B HD2  1  
ATOM   2060   H HD3  . LYS B 1 30  ? 12.305  10.119  18.127  1.00 0.00 ? 30  LYS B HD3  1  
ATOM   2061   H HE2  . LYS B 1 30  ? 11.136  10.754  16.036  1.00 0.00 ? 30  LYS B HE2  1  
ATOM   2062   H HE3  . LYS B 1 30  ? 11.908  9.399   15.203  1.00 0.00 ? 30  LYS B HE3  1  
ATOM   2063   H HZ1  . LYS B 1 30  ? 10.270  9.043   17.652  1.00 0.00 ? 30  LYS B HZ1  1  
ATOM   2064   H HZ2  . LYS B 1 30  ? 9.600   8.991   16.085  1.00 0.00 ? 30  LYS B HZ2  1  
ATOM   2065   H HZ3  . LYS B 1 30  ? 10.776  7.858   16.540  1.00 0.00 ? 30  LYS B HZ3  1  
ATOM   2066   N N    . GLN B 1 31  ? 17.995  11.245  18.525  1.00 0.00 ? 31  GLN B N    1  
ATOM   2067   C CA   . GLN B 1 31  ? 18.977  11.384  19.592  1.00 0.00 ? 31  GLN B CA   1  
ATOM   2068   C C    . GLN B 1 31  ? 19.909  12.559  19.297  1.00 0.00 ? 31  GLN B C    1  
ATOM   2069   O O    . GLN B 1 31  ? 20.783  12.888  20.096  1.00 0.00 ? 31  GLN B O    1  
ATOM   2070   C CB   . GLN B 1 31  ? 19.790  10.090  19.744  1.00 0.00 ? 31  GLN B CB   1  
ATOM   2071   C CG   . GLN B 1 31  ? 18.853  8.860   19.761  1.00 0.00 ? 31  GLN B CG   1  
ATOM   2072   C CD   . GLN B 1 31  ? 19.229  7.901   20.891  1.00 0.00 ? 31  GLN B CD   1  
ATOM   2073   O OE1  . GLN B 1 31  ? 20.379  7.834   21.300  1.00 0.00 ? 31  GLN B OE1  1  
ATOM   2074   N NE2  . GLN B 1 31  ? 18.311  7.143   21.422  1.00 0.00 ? 31  GLN B NE2  1  
ATOM   2075   H H    . GLN B 1 31  ? 18.130  10.568  17.827  1.00 0.00 ? 31  GLN B H    1  
ATOM   2076   H HA   . GLN B 1 31  ? 18.461  11.580  20.521  1.00 0.00 ? 31  GLN B HA   1  
ATOM   2077   H HB2  . GLN B 1 31  ? 20.481  10.008  18.914  1.00 0.00 ? 31  GLN B HB2  1  
ATOM   2078   H HB3  . GLN B 1 31  ? 20.348  10.132  20.668  1.00 0.00 ? 31  GLN B HB3  1  
ATOM   2079   H HG2  . GLN B 1 31  ? 17.833  9.183   19.902  1.00 0.00 ? 31  GLN B HG2  1  
ATOM   2080   H HG3  . GLN B 1 31  ? 18.933  8.338   18.820  1.00 0.00 ? 31  GLN B HG3  1  
ATOM   2081   H HE21 . GLN B 1 31  ? 17.391  7.192   21.097  1.00 0.00 ? 31  GLN B HE21 1  
ATOM   2082   H HE22 . GLN B 1 31  ? 18.547  6.529   22.146  1.00 0.00 ? 31  GLN B HE22 1  
ATOM   2083   N N    . GLY B 1 32  ? 19.701  13.198  18.148  1.00 0.00 ? 32  GLY B N    1  
ATOM   2084   C CA   . GLY B 1 32  ? 20.516  14.348  17.756  1.00 0.00 ? 32  GLY B CA   1  
ATOM   2085   C C    . GLY B 1 32  ? 21.836  13.911  17.124  1.00 0.00 ? 32  GLY B C    1  
ATOM   2086   O O    . GLY B 1 32  ? 22.763  14.712  16.995  1.00 0.00 ? 32  GLY B O    1  
ATOM   2087   H H    . GLY B 1 32  ? 18.979  12.899  17.555  1.00 0.00 ? 32  GLY B H    1  
ATOM   2088   H HA2  . GLY B 1 32  ? 19.964  14.943  17.041  1.00 0.00 ? 32  GLY B HA2  1  
ATOM   2089   H HA3  . GLY B 1 32  ? 20.723  14.946  18.628  1.00 0.00 ? 32  GLY B HA3  1  
ATOM   2090   N N    . ASP B 1 33  ? 21.912  12.645  16.724  1.00 0.00 ? 33  ASP B N    1  
ATOM   2091   C CA   . ASP B 1 33  ? 23.122  12.112  16.100  1.00 0.00 ? 33  ASP B CA   1  
ATOM   2092   C C    . ASP B 1 33  ? 22.986  12.115  14.576  1.00 0.00 ? 33  ASP B C    1  
ATOM   2093   O O    . ASP B 1 33  ? 22.652  11.096  13.966  1.00 0.00 ? 33  ASP B O    1  
ATOM   2094   C CB   . ASP B 1 33  ? 23.366  10.684  16.594  1.00 0.00 ? 33  ASP B CB   1  
ATOM   2095   C CG   . ASP B 1 33  ? 23.796  10.699  18.055  1.00 0.00 ? 33  ASP B CG   1  
ATOM   2096   O OD1  . ASP B 1 33  ? 24.080  11.769  18.560  1.00 0.00 ? 33  ASP B OD1  1  
ATOM   2097   O OD2  . ASP B 1 33  ? 23.848  9.635   18.639  1.00 0.00 ? 33  ASP B OD2  1  
ATOM   2098   H H    . ASP B 1 33  ? 21.141  12.055  16.849  1.00 0.00 ? 33  ASP B H    1  
ATOM   2099   H HA   . ASP B 1 33  ? 23.966  12.727  16.381  1.00 0.00 ? 33  ASP B HA   1  
ATOM   2100   H HB2  . ASP B 1 33  ? 22.455  10.113  16.497  1.00 0.00 ? 33  ASP B HB2  1  
ATOM   2101   H HB3  . ASP B 1 33  ? 24.141  10.228  16.000  1.00 0.00 ? 33  ASP B HB3  1  
ATOM   2102   N N    . PHE B 1 34  ? 23.233  13.268  13.967  1.00 0.00 ? 34  PHE B N    1  
ATOM   2103   C CA   . PHE B 1 34  ? 23.119  13.391  12.514  1.00 0.00 ? 34  PHE B CA   1  
ATOM   2104   C C    . PHE B 1 34  ? 24.153  12.536  11.787  1.00 0.00 ? 34  PHE B C    1  
ATOM   2105   O O    . PHE B 1 34  ? 23.881  12.006  10.710  1.00 0.00 ? 34  PHE B O    1  
ATOM   2106   C CB   . PHE B 1 34  ? 23.309  14.849  12.091  1.00 0.00 ? 34  PHE B CB   1  
ATOM   2107   C CG   . PHE B 1 34  ? 22.210  15.699  12.674  1.00 0.00 ? 34  PHE B CG   1  
ATOM   2108   C CD1  . PHE B 1 34  ? 22.513  16.689  13.614  1.00 0.00 ? 34  PHE B CD1  1  
ATOM   2109   C CD2  . PHE B 1 34  ? 20.885  15.497  12.269  1.00 0.00 ? 34  PHE B CD2  1  
ATOM   2110   C CE1  . PHE B 1 34  ? 21.491  17.478  14.147  1.00 0.00 ? 34  PHE B CE1  1  
ATOM   2111   C CE2  . PHE B 1 34  ? 19.865  16.287  12.804  1.00 0.00 ? 34  PHE B CE2  1  
ATOM   2112   C CZ   . PHE B 1 34  ? 20.167  17.275  13.744  1.00 0.00 ? 34  PHE B CZ   1  
ATOM   2113   H H    . PHE B 1 34  ? 23.484  14.052  14.501  1.00 0.00 ? 34  PHE B H    1  
ATOM   2114   H HA   . PHE B 1 34  ? 22.132  13.071  12.214  1.00 0.00 ? 34  PHE B HA   1  
ATOM   2115   H HB2  . PHE B 1 34  ? 24.265  15.203  12.443  1.00 0.00 ? 34  PHE B HB2  1  
ATOM   2116   H HB3  . PHE B 1 34  ? 23.278  14.914  11.012  1.00 0.00 ? 34  PHE B HB3  1  
ATOM   2117   H HD1  . PHE B 1 34  ? 23.534  16.846  13.927  1.00 0.00 ? 34  PHE B HD1  1  
ATOM   2118   H HD2  . PHE B 1 34  ? 20.652  14.734  11.543  1.00 0.00 ? 34  PHE B HD2  1  
ATOM   2119   H HE1  . PHE B 1 34  ? 21.719  18.245  14.877  1.00 0.00 ? 34  PHE B HE1  1  
ATOM   2120   H HE2  . PHE B 1 34  ? 18.841  16.133  12.495  1.00 0.00 ? 34  PHE B HE2  1  
ATOM   2121   H HZ   . PHE B 1 34  ? 19.379  17.889  14.158  1.00 0.00 ? 34  PHE B HZ   1  
ATOM   2122   N N    . ALA B 1 35  ? 25.343  12.425  12.366  1.00 0.00 ? 35  ALA B N    1  
ATOM   2123   C CA   . ALA B 1 35  ? 26.417  11.657  11.743  1.00 0.00 ? 35  ALA B CA   1  
ATOM   2124   C C    . ALA B 1 35  ? 26.024  10.188  11.599  1.00 0.00 ? 35  ALA B C    1  
ATOM   2125   O O    . ALA B 1 35  ? 26.134  9.609   10.517  1.00 0.00 ? 35  ALA B O    1  
ATOM   2126   C CB   . ALA B 1 35  ? 27.694  11.781  12.585  1.00 0.00 ? 35  ALA B CB   1  
ATOM   2127   H H    . ALA B 1 35  ? 25.507  12.880  13.218  1.00 0.00 ? 35  ALA B H    1  
ATOM   2128   H HA   . ALA B 1 35  ? 26.610  12.060  10.760  1.00 0.00 ? 35  ALA B HA   1  
ATOM   2129   H HB1  . ALA B 1 35  ? 28.265  12.637  12.251  1.00 0.00 ? 35  ALA B HB1  1  
ATOM   2130   H HB2  . ALA B 1 35  ? 27.429  11.913  13.624  1.00 0.00 ? 35  ALA B HB2  1  
ATOM   2131   H HB3  . ALA B 1 35  ? 28.291  10.888  12.477  1.00 0.00 ? 35  ALA B HB3  1  
ATOM   2132   N N    . ALA B 1 36  ? 25.566  9.594   12.692  1.00 0.00 ? 36  ALA B N    1  
ATOM   2133   C CA   . ALA B 1 36  ? 25.167  8.193   12.664  1.00 0.00 ? 36  ALA B CA   1  
ATOM   2134   C C    . ALA B 1 36  ? 23.944  8.006   11.769  1.00 0.00 ? 36  ALA B C    1  
ATOM   2135   O O    . ALA B 1 36  ? 23.844  7.021   11.036  1.00 0.00 ? 36  ALA B O    1  
ATOM   2136   C CB   . ALA B 1 36  ? 24.887  7.694   14.094  1.00 0.00 ? 36  ALA B CB   1  
ATOM   2137   H H    . ALA B 1 36  ? 25.496  10.103  13.525  1.00 0.00 ? 36  ALA B H    1  
ATOM   2138   H HA   . ALA B 1 36  ? 25.978  7.616   12.247  1.00 0.00 ? 36  ALA B HA   1  
ATOM   2139   H HB1  . ALA B 1 36  ? 25.063  8.495   14.797  1.00 0.00 ? 36  ALA B HB1  1  
ATOM   2140   H HB2  . ALA B 1 36  ? 25.549  6.868   14.323  1.00 0.00 ? 36  ALA B HB2  1  
ATOM   2141   H HB3  . ALA B 1 36  ? 23.861  7.364   14.175  1.00 0.00 ? 36  ALA B HB3  1  
ATOM   2142   N N    . ALA B 1 37  ? 23.027  8.963   11.802  1.00 0.00 ? 37  ALA B N    1  
ATOM   2143   C CA   . ALA B 1 37  ? 21.842  8.874   10.962  1.00 0.00 ? 37  ALA B CA   1  
ATOM   2144   C C    . ALA B 1 37  ? 22.264  8.805   9.496   1.00 0.00 ? 37  ALA B C    1  
ATOM   2145   O O    . ALA B 1 37  ? 21.852  7.907   8.760   1.00 0.00 ? 37  ALA B O    1  
ATOM   2146   C CB   . ALA B 1 37  ? 20.930  10.088  11.200  1.00 0.00 ? 37  ALA B CB   1  
ATOM   2147   H H    . ALA B 1 37  ? 23.157  9.742   12.385  1.00 0.00 ? 37  ALA B H    1  
ATOM   2148   H HA   . ALA B 1 37  ? 21.299  7.974   11.210  1.00 0.00 ? 37  ALA B HA   1  
ATOM   2149   H HB1  . ALA B 1 37  ? 20.214  9.858   11.977  1.00 0.00 ? 37  ALA B HB1  1  
ATOM   2150   H HB2  . ALA B 1 37  ? 20.401  10.331  10.288  1.00 0.00 ? 37  ALA B HB2  1  
ATOM   2151   H HB3  . ALA B 1 37  ? 21.525  10.936  11.504  1.00 0.00 ? 37  ALA B HB3  1  
ATOM   2152   N N    . LYS B 1 38  ? 23.097  9.757   9.087   1.00 0.00 ? 38  LYS B N    1  
ATOM   2153   C CA   . LYS B 1 38  ? 23.589  9.817   7.710   1.00 0.00 ? 38  LYS B CA   1  
ATOM   2154   C C    . LYS B 1 38  ? 24.245  8.494   7.291   1.00 0.00 ? 38  LYS B C    1  
ATOM   2155   O O    . LYS B 1 38  ? 23.979  7.976   6.207   1.00 0.00 ? 38  LYS B O    1  
ATOM   2156   C CB   . LYS B 1 38  ? 24.601  10.979  7.594   1.00 0.00 ? 38  LYS B CB   1  
ATOM   2157   C CG   . LYS B 1 38  ? 24.268  11.887  6.399   1.00 0.00 ? 38  LYS B CG   1  
ATOM   2158   C CD   . LYS B 1 38  ? 25.181  13.124  6.443   1.00 0.00 ? 38  LYS B CD   1  
ATOM   2159   C CE   . LYS B 1 38  ? 25.166  13.838  5.088   1.00 0.00 ? 38  LYS B CE   1  
ATOM   2160   N NZ   . LYS B 1 38  ? 23.782  14.300  4.785   1.00 0.00 ? 38  LYS B NZ   1  
ATOM   2161   H H    . LYS B 1 38  ? 23.397  10.436  9.731   1.00 0.00 ? 38  LYS B H    1  
ATOM   2162   H HA   . LYS B 1 38  ? 22.754  10.010  7.054   1.00 0.00 ? 38  LYS B HA   1  
ATOM   2163   H HB2  . LYS B 1 38  ? 24.565  11.566  8.498   1.00 0.00 ? 38  LYS B HB2  1  
ATOM   2164   H HB3  . LYS B 1 38  ? 25.598  10.578  7.471   1.00 0.00 ? 38  LYS B HB3  1  
ATOM   2165   H HG2  . LYS B 1 38  ? 24.431  11.349  5.476   1.00 0.00 ? 38  LYS B HG2  1  
ATOM   2166   H HG3  . LYS B 1 38  ? 23.237  12.203  6.459   1.00 0.00 ? 38  LYS B HG3  1  
ATOM   2167   H HD2  . LYS B 1 38  ? 24.832  13.801  7.211   1.00 0.00 ? 38  LYS B HD2  1  
ATOM   2168   H HD3  . LYS B 1 38  ? 26.192  12.816  6.673   1.00 0.00 ? 38  LYS B HD3  1  
ATOM   2169   H HE2  . LYS B 1 38  ? 25.833  14.688  5.123   1.00 0.00 ? 38  LYS B HE2  1  
ATOM   2170   H HE3  . LYS B 1 38  ? 25.498  13.151  4.318   1.00 0.00 ? 38  LYS B HE3  1  
ATOM   2171   H HZ1  . LYS B 1 38  ? 23.250  14.425  5.671   1.00 0.00 ? 38  LYS B HZ1  1  
ATOM   2172   H HZ2  . LYS B 1 38  ? 23.822  15.210  4.279   1.00 0.00 ? 38  LYS B HZ2  1  
ATOM   2173   H HZ3  . LYS B 1 38  ? 23.301  13.595  4.191   1.00 0.00 ? 38  LYS B HZ3  1  
ATOM   2174   N N    . ALA B 1 39  ? 25.098  7.958   8.155   1.00 0.00 ? 39  ALA B N    1  
ATOM   2175   C CA   . ALA B 1 39  ? 25.788  6.703   7.855   1.00 0.00 ? 39  ALA B CA   1  
ATOM   2176   C C    . ALA B 1 39  ? 24.797  5.552   7.680   1.00 0.00 ? 39  ALA B C    1  
ATOM   2177   O O    . ALA B 1 39  ? 24.946  4.712   6.789   1.00 0.00 ? 39  ALA B O    1  
ATOM   2178   C CB   . ALA B 1 39  ? 26.774  6.373   8.980   1.00 0.00 ? 39  ALA B CB   1  
ATOM   2179   H H    . ALA B 1 39  ? 25.271  8.412   9.006   1.00 0.00 ? 39  ALA B H    1  
ATOM   2180   H HA   . ALA B 1 39  ? 26.340  6.825   6.935   1.00 0.00 ? 39  ALA B HA   1  
ATOM   2181   H HB1  . ALA B 1 39  ? 27.206  7.287   9.362   1.00 0.00 ? 39  ALA B HB1  1  
ATOM   2182   H HB2  . ALA B 1 39  ? 26.254  5.860   9.778   1.00 0.00 ? 39  ALA B HB2  1  
ATOM   2183   H HB3  . ALA B 1 39  ? 27.557  5.737   8.597   1.00 0.00 ? 39  ALA B HB3  1  
ATOM   2184   N N    . MET B 1 40  ? 23.792  5.515   8.543   1.00 0.00 ? 40  MET B N    1  
ATOM   2185   C CA   . MET B 1 40  ? 22.786  4.458   8.488   1.00 0.00 ? 40  MET B CA   1  
ATOM   2186   C C    . MET B 1 40  ? 21.959  4.550   7.204   1.00 0.00 ? 40  MET B C    1  
ATOM   2187   O O    . MET B 1 40  ? 21.658  3.530   6.579   1.00 0.00 ? 40  MET B O    1  
ATOM   2188   C CB   . MET B 1 40  ? 21.876  4.543   9.718   1.00 0.00 ? 40  MET B CB   1  
ATOM   2189   C CG   . MET B 1 40  ? 22.690  4.221   10.978  1.00 0.00 ? 40  MET B CG   1  
ATOM   2190   S SD   . MET B 1 40  ? 23.059  2.449   11.036  1.00 0.00 ? 40  MET B SD   1  
ATOM   2191   C CE   . MET B 1 40  ? 21.533  1.931   11.852  1.00 0.00 ? 40  MET B CE   1  
ATOM   2192   H H    . MET B 1 40  ? 23.729  6.206   9.235   1.00 0.00 ? 40  MET B H    1  
ATOM   2193   H HA   . MET B 1 40  ? 23.288  3.501   8.500   1.00 0.00 ? 40  MET B HA   1  
ATOM   2194   H HB2  . MET B 1 40  ? 21.471  5.543   9.795   1.00 0.00 ? 40  MET B HB2  1  
ATOM   2195   H HB3  . MET B 1 40  ? 21.066  3.833   9.620   1.00 0.00 ? 40  MET B HB3  1  
ATOM   2196   H HG2  . MET B 1 40  ? 23.616  4.776   10.959  1.00 0.00 ? 40  MET B HG2  1  
ATOM   2197   H HG3  . MET B 1 40  ? 22.123  4.498   11.853  1.00 0.00 ? 40  MET B HG3  1  
ATOM   2198   H HE1  . MET B 1 40  ? 21.434  2.453   12.794  1.00 0.00 ? 40  MET B HE1  1  
ATOM   2199   H HE2  . MET B 1 40  ? 20.692  2.166   11.222  1.00 0.00 ? 40  MET B HE2  1  
ATOM   2200   H HE3  . MET B 1 40  ? 21.563  0.864   12.027  1.00 0.00 ? 40  MET B HE3  1  
ATOM   2201   N N    . MET B 1 41  ? 21.601  5.766   6.796   1.00 0.00 ? 41  MET B N    1  
ATOM   2202   C CA   . MET B 1 41  ? 20.824  5.930   5.567   1.00 0.00 ? 41  MET B CA   1  
ATOM   2203   C C    . MET B 1 41  ? 21.618  5.437   4.363   1.00 0.00 ? 41  MET B C    1  
ATOM   2204   O O    . MET B 1 41  ? 21.066  4.804   3.456   1.00 0.00 ? 41  MET B O    1  
ATOM   2205   C CB   . MET B 1 41  ? 20.475  7.399   5.302   1.00 0.00 ? 41  MET B CB   1  
ATOM   2206   C CG   . MET B 1 41  ? 19.718  8.018   6.482   1.00 0.00 ? 41  MET B CG   1  
ATOM   2207   S SD   . MET B 1 41  ? 18.640  9.349   5.884   1.00 0.00 ? 41  MET B SD   1  
ATOM   2208   C CE   . MET B 1 41  ? 19.835  10.195  4.818   1.00 0.00 ? 41  MET B CE   1  
ATOM   2209   H H    . MET B 1 41  ? 21.870  6.554   7.316   1.00 0.00 ? 41  MET B H    1  
ATOM   2210   H HA   . MET B 1 41  ? 19.912  5.358   5.645   1.00 0.00 ? 41  MET B HA   1  
ATOM   2211   H HB2  . MET B 1 41  ? 21.390  7.950   5.132   1.00 0.00 ? 41  MET B HB2  1  
ATOM   2212   H HB3  . MET B 1 41  ? 19.861  7.455   4.415   1.00 0.00 ? 41  MET B HB3  1  
ATOM   2213   H HG2  . MET B 1 41  ? 19.119  7.264   6.967   1.00 0.00 ? 41  MET B HG2  1  
ATOM   2214   H HG3  . MET B 1 41  ? 20.426  8.423   7.188   1.00 0.00 ? 41  MET B HG3  1  
ATOM   2215   H HE1  . MET B 1 41  ? 20.816  10.152  5.264   1.00 0.00 ? 41  MET B HE1  1  
ATOM   2216   H HE2  . MET B 1 41  ? 19.858  9.712   3.853   1.00 0.00 ? 41  MET B HE2  1  
ATOM   2217   H HE3  . MET B 1 41  ? 19.541  11.230  4.702   1.00 0.00 ? 41  MET B HE3  1  
ATOM   2218   N N    . ASP B 1 42  ? 22.906  5.763   4.347   1.00 0.00 ? 42  ASP B N    1  
ATOM   2219   C CA   . ASP B 1 42  ? 23.767  5.382   3.237   1.00 0.00 ? 42  ASP B CA   1  
ATOM   2220   C C    . ASP B 1 42  ? 23.800  3.865   3.085   1.00 0.00 ? 42  ASP B C    1  
ATOM   2221   O O    . ASP B 1 42  ? 23.630  3.328   1.984   1.00 0.00 ? 42  ASP B O    1  
ATOM   2222   C CB   . ASP B 1 42  ? 25.184  5.935   3.474   1.00 0.00 ? 42  ASP B CB   1  
ATOM   2223   C CG   . ASP B 1 42  ? 25.846  6.312   2.151   1.00 0.00 ? 42  ASP B CG   1  
ATOM   2224   O OD1  . ASP B 1 42  ? 25.177  6.911   1.322   1.00 0.00 ? 42  ASP B OD1  1  
ATOM   2225   O OD2  . ASP B 1 42  ? 27.016  6.008   1.993   1.00 0.00 ? 42  ASP B OD2  1  
ATOM   2226   H H    . ASP B 1 42  ? 23.283  6.285   5.089   1.00 0.00 ? 42  ASP B H    1  
ATOM   2227   H HA   . ASP B 1 42  ? 23.372  5.813   2.331   1.00 0.00 ? 42  ASP B HA   1  
ATOM   2228   H HB2  . ASP B 1 42  ? 25.124  6.812   4.099   1.00 0.00 ? 42  ASP B HB2  1  
ATOM   2229   H HB3  . ASP B 1 42  ? 25.783  5.187   3.970   1.00 0.00 ? 42  ASP B HB3  1  
ATOM   2230   N N    . GLN B 1 43  ? 23.993  3.176   4.201   1.00 0.00 ? 43  GLN B N    1  
ATOM   2231   C CA   . GLN B 1 43  ? 24.027  1.718   4.181   1.00 0.00 ? 43  GLN B CA   1  
ATOM   2232   C C    . GLN B 1 43  ? 22.674  1.157   3.756   1.00 0.00 ? 43  GLN B C    1  
ATOM   2233   O O    . GLN B 1 43  ? 22.602  0.202   2.982   1.00 0.00 ? 43  GLN B O    1  
ATOM   2234   C CB   . GLN B 1 43  ? 24.411  1.173   5.558   1.00 0.00 ? 43  GLN B CB   1  
ATOM   2235   C CG   . GLN B 1 43  ? 25.857  1.569   5.874   1.00 0.00 ? 43  GLN B CG   1  
ATOM   2236   C CD   . GLN B 1 43  ? 26.344  0.840   7.119   1.00 0.00 ? 43  GLN B CD   1  
ATOM   2237   O OE1  . GLN B 1 43  ? 25.607  0.060   7.714   1.00 0.00 ? 43  GLN B OE1  1  
ATOM   2238   N NE2  . GLN B 1 43  ? 27.552  1.044   7.550   1.00 0.00 ? 43  GLN B NE2  1  
ATOM   2239   H H    . GLN B 1 43  ? 24.102  3.657   5.050   1.00 0.00 ? 43  GLN B H    1  
ATOM   2240   H HA   . GLN B 1 43  ? 24.768  1.402   3.465   1.00 0.00 ? 43  GLN B HA   1  
ATOM   2241   H HB2  . GLN B 1 43  ? 23.748  1.582   6.310   1.00 0.00 ? 43  GLN B HB2  1  
ATOM   2242   H HB3  . GLN B 1 43  ? 24.328  0.094   5.553   1.00 0.00 ? 43  GLN B HB3  1  
ATOM   2243   H HG2  . GLN B 1 43  ? 26.490  1.308   5.040   1.00 0.00 ? 43  GLN B HG2  1  
ATOM   2244   H HG3  . GLN B 1 43  ? 25.906  2.634   6.041   1.00 0.00 ? 43  GLN B HG3  1  
ATOM   2245   H HE21 . GLN B 1 43  ? 28.142  1.663   7.075   1.00 0.00 ? 43  GLN B HE21 1  
ATOM   2246   H HE22 . GLN B 1 43  ? 27.870  0.579   8.351   1.00 0.00 ? 43  GLN B HE22 1  
ATOM   2247   N N    . SER B 1 44  ? 21.602  1.764   4.250   1.00 0.00 ? 44  SER B N    1  
ATOM   2248   C CA   . SER B 1 44  ? 20.260  1.318   3.887   1.00 0.00 ? 44  SER B CA   1  
ATOM   2249   C C    . SER B 1 44  ? 20.076  1.421   2.370   1.00 0.00 ? 44  SER B C    1  
ATOM   2250   O O    . SER B 1 44  ? 19.596  0.491   1.723   1.00 0.00 ? 44  SER B O    1  
ATOM   2251   C CB   . SER B 1 44  ? 19.213  2.166   4.618   1.00 0.00 ? 44  SER B CB   1  
ATOM   2252   O OG   . SER B 1 44  ? 18.323  1.304   5.312   1.00 0.00 ? 44  SER B OG   1  
ATOM   2253   H H    . SER B 1 44  ? 21.712  2.530   4.854   1.00 0.00 ? 44  SER B H    1  
ATOM   2254   H HA   . SER B 1 44  ? 20.146  0.285   4.182   1.00 0.00 ? 44  SER B HA   1  
ATOM   2255   H HB2  . SER B 1 44  ? 19.702  2.813   5.329   1.00 0.00 ? 44  SER B HB2  1  
ATOM   2256   H HB3  . SER B 1 44  ? 18.666  2.769   3.905   1.00 0.00 ? 44  SER B HB3  1  
ATOM   2257   H HG   . SER B 1 44  ? 17.576  1.824   5.629   1.00 0.00 ? 44  SER B HG   1  
ATOM   2258   N N    . ARG B 1 45  ? 20.487  2.555   1.810   1.00 0.00 ? 45  ARG B N    1  
ATOM   2259   C CA   . ARG B 1 45  ? 20.393  2.785   0.369   1.00 0.00 ? 45  ARG B CA   1  
ATOM   2260   C C    . ARG B 1 45  ? 21.152  1.711   -0.412  1.00 0.00 ? 45  ARG B C    1  
ATOM   2261   O O    . ARG B 1 45  ? 20.647  1.164   -1.397  1.00 0.00 ? 45  ARG B O    1  
ATOM   2262   C CB   . ARG B 1 45  ? 20.981  4.162   0.050   1.00 0.00 ? 45  ARG B CB   1  
ATOM   2263   C CG   . ARG B 1 45  ? 20.780  4.501   -1.434  1.00 0.00 ? 45  ARG B CG   1  
ATOM   2264   C CD   . ARG B 1 45  ? 21.387  5.882   -1.756  1.00 0.00 ? 45  ARG B CD   1  
ATOM   2265   N NE   . ARG B 1 45  ? 21.045  6.246   -3.139  1.00 0.00 ? 45  ARG B NE   1  
ATOM   2266   C CZ   . ARG B 1 45  ? 21.389  7.406   -3.686  1.00 0.00 ? 45  ARG B CZ   1  
ATOM   2267   N NH1  . ARG B 1 45  ? 22.012  8.298   -2.994  1.00 0.00 ? 45  ARG B NH1  1  
ATOM   2268   N NH2  . ARG B 1 45  ? 21.030  7.662   -4.909  1.00 0.00 ? 45  ARG B NH2  1  
ATOM   2269   H H    . ARG B 1 45  ? 20.882  3.252   2.378   1.00 0.00 ? 45  ARG B H    1  
ATOM   2270   H HA   . ARG B 1 45  ? 19.355  2.766   0.074   1.00 0.00 ? 45  ARG B HA   1  
ATOM   2271   H HB2  . ARG B 1 45  ? 20.495  4.903   0.659   1.00 0.00 ? 45  ARG B HB2  1  
ATOM   2272   H HB3  . ARG B 1 45  ? 22.040  4.151   0.271   1.00 0.00 ? 45  ARG B HB3  1  
ATOM   2273   H HG2  . ARG B 1 45  ? 21.255  3.746   -2.043  1.00 0.00 ? 45  ARG B HG2  1  
ATOM   2274   H HG3  . ARG B 1 45  ? 19.722  4.521   -1.654  1.00 0.00 ? 45  ARG B HG3  1  
ATOM   2275   H HD2  . ARG B 1 45  ? 20.970  6.619   -1.070  1.00 0.00 ? 45  ARG B HD2  1  
ATOM   2276   H HD3  . ARG B 1 45  ? 22.467  5.847   -1.641  1.00 0.00 ? 45  ARG B HD3  1  
ATOM   2277   H HE   . ARG B 1 45  ? 20.534  5.608   -3.675  1.00 0.00 ? 45  ARG B HE   1  
ATOM   2278   H HH11 . ARG B 1 45  ? 22.264  8.108   -2.049  1.00 0.00 ? 45  ARG B HH11 1  
ATOM   2279   H HH12 . ARG B 1 45  ? 22.263  9.168   -3.411  1.00 0.00 ? 45  ARG B HH12 1  
ATOM   2280   H HH21 . ARG B 1 45  ? 20.524  6.978   -5.437  1.00 0.00 ? 45  ARG B HH21 1  
ATOM   2281   H HH22 . ARG B 1 45  ? 21.279  8.529   -5.333  1.00 0.00 ? 45  ARG B HH22 1  
ATOM   2282   N N    . MET B 1 46  ? 22.371  1.421   0.029   1.00 0.00 ? 46  MET B N    1  
ATOM   2283   C CA   . MET B 1 46  ? 23.201  0.421   -0.634  1.00 0.00 ? 46  MET B CA   1  
ATOM   2284   C C    . MET B 1 46  ? 22.512  -0.945  -0.587  1.00 0.00 ? 46  MET B C    1  
ATOM   2285   O O    . MET B 1 46  ? 22.494  -1.679  -1.577  1.00 0.00 ? 46  MET B O    1  
ATOM   2286   C CB   . MET B 1 46  ? 24.575  0.382   0.035   1.00 0.00 ? 46  MET B CB   1  
ATOM   2287   C CG   . MET B 1 46  ? 25.272  1.731   -0.187  1.00 0.00 ? 46  MET B CG   1  
ATOM   2288   S SD   . MET B 1 46  ? 26.801  1.813   0.786   1.00 0.00 ? 46  MET B SD   1  
ATOM   2289   C CE   . MET B 1 46  ? 27.851  0.772   -0.262  1.00 0.00 ? 46  MET B CE   1  
ATOM   2290   H H    . MET B 1 46  ? 22.721  1.894   0.817   1.00 0.00 ? 46  MET B H    1  
ATOM   2291   H HA   . MET B 1 46  ? 23.325  0.703   -1.669  1.00 0.00 ? 46  MET B HA   1  
ATOM   2292   H HB2  . MET B 1 46  ? 24.454  0.208   1.095   1.00 0.00 ? 46  MET B HB2  1  
ATOM   2293   H HB3  . MET B 1 46  ? 25.169  -0.406  -0.399  1.00 0.00 ? 46  MET B HB3  1  
ATOM   2294   H HG2  . MET B 1 46  ? 25.505  1.845   -1.235  1.00 0.00 ? 46  MET B HG2  1  
ATOM   2295   H HG3  . MET B 1 46  ? 24.612  2.528   0.115   1.00 0.00 ? 46  MET B HG3  1  
ATOM   2296   H HE1  . MET B 1 46  ? 27.489  0.792   -1.278  1.00 0.00 ? 46  MET B HE1  1  
ATOM   2297   H HE2  . MET B 1 46  ? 28.865  1.146   -0.231  1.00 0.00 ? 46  MET B HE2  1  
ATOM   2298   H HE3  . MET B 1 46  ? 27.836  -0.240  0.101   1.00 0.00 ? 46  MET B HE3  1  
ATOM   2299   N N    . ALA B 1 47  ? 21.920  -1.265  0.560   1.00 0.00 ? 47  ALA B N    1  
ATOM   2300   C CA   . ALA B 1 47  ? 21.211  -2.534  0.714   1.00 0.00 ? 47  ALA B CA   1  
ATOM   2301   C C    . ALA B 1 47  ? 20.045  -2.608  -0.272  1.00 0.00 ? 47  ALA B C    1  
ATOM   2302   O O    . ALA B 1 47  ? 19.824  -3.630  -0.922  1.00 0.00 ? 47  ALA B O    1  
ATOM   2303   C CB   . ALA B 1 47  ? 20.692  -2.676  2.148   1.00 0.00 ? 47  ALA B CB   1  
ATOM   2304   H H    . ALA B 1 47  ? 21.947  -0.632  1.309   1.00 0.00 ? 47  ALA B H    1  
ATOM   2305   H HA   . ALA B 1 47  ? 21.893  -3.345  0.505   1.00 0.00 ? 47  ALA B HA   1  
ATOM   2306   H HB1  . ALA B 1 47  ? 20.210  -1.758  2.452   1.00 0.00 ? 47  ALA B HB1  1  
ATOM   2307   H HB2  . ALA B 1 47  ? 21.518  -2.886  2.810   1.00 0.00 ? 47  ALA B HB2  1  
ATOM   2308   H HB3  . ALA B 1 47  ? 19.981  -3.489  2.193   1.00 0.00 ? 47  ALA B HB3  1  
ATOM   2309   N N    . LEU B 1 48  ? 19.309  -1.505  -0.386  1.00 0.00 ? 48  LEU B N    1  
ATOM   2310   C CA   . LEU B 1 48  ? 18.171  -1.438  -1.301  1.00 0.00 ? 48  LEU B CA   1  
ATOM   2311   C C    . LEU B 1 48  ? 18.637  -1.524  -2.749  1.00 0.00 ? 48  LEU B C    1  
ATOM   2312   O O    . LEU B 1 48  ? 18.008  -2.181  -3.581  1.00 0.00 ? 48  LEU B O    1  
ATOM   2313   C CB   . LEU B 1 48  ? 17.435  -0.110  -1.114  1.00 0.00 ? 48  LEU B CB   1  
ATOM   2314   C CG   . LEU B 1 48  ? 16.790  -0.055  0.272   1.00 0.00 ? 48  LEU B CG   1  
ATOM   2315   C CD1  . LEU B 1 48  ? 16.283  1.364   0.541   1.00 0.00 ? 48  LEU B CD1  1  
ATOM   2316   C CD2  . LEU B 1 48  ? 15.624  -1.052  0.356   1.00 0.00 ? 48  LEU B CD2  1  
ATOM   2317   H H    . LEU B 1 48  ? 19.539  -0.719  0.153   1.00 0.00 ? 48  LEU B H    1  
ATOM   2318   H HA   . LEU B 1 48  ? 17.492  -2.252  -1.095  1.00 0.00 ? 48  LEU B HA   1  
ATOM   2319   H HB2  . LEU B 1 48  ? 18.146  0.703   -1.209  1.00 0.00 ? 48  LEU B HB2  1  
ATOM   2320   H HB3  . LEU B 1 48  ? 16.674  -0.008  -1.874  1.00 0.00 ? 48  LEU B HB3  1  
ATOM   2321   H HG   . LEU B 1 48  ? 17.533  -0.311  1.013   1.00 0.00 ? 48  LEU B HG   1  
ATOM   2322   H HD11 . LEU B 1 48  ? 15.825  1.765   -0.351  1.00 0.00 ? 48  LEU B HD11 1  
ATOM   2323   H HD12 . LEU B 1 48  ? 15.557  1.342   1.340   1.00 0.00 ? 48  LEU B HD12 1  
ATOM   2324   H HD13 . LEU B 1 48  ? 17.115  1.990   0.828   1.00 0.00 ? 48  LEU B HD13 1  
ATOM   2325   H HD21 . LEU B 1 48  ? 15.127  -1.122  -0.601  1.00 0.00 ? 48  LEU B HD21 1  
ATOM   2326   H HD22 . LEU B 1 48  ? 16.004  -2.025  0.635   1.00 0.00 ? 48  LEU B HD22 1  
ATOM   2327   H HD23 . LEU B 1 48  ? 14.918  -0.718  1.103   1.00 0.00 ? 48  LEU B HD23 1  
ATOM   2328   N N    . ASN B 1 49  ? 19.731  -0.834  -3.041  1.00 0.00 ? 49  ASN B N    1  
ATOM   2329   C CA   . ASN B 1 49  ? 20.274  -0.808  -4.389  1.00 0.00 ? 49  ASN B CA   1  
ATOM   2330   C C    . ASN B 1 49  ? 20.627  -2.220  -4.849  1.00 0.00 ? 49  ASN B C    1  
ATOM   2331   O O    . ASN B 1 49  ? 20.288  -2.630  -5.962  1.00 0.00 ? 49  ASN B O    1  
ATOM   2332   C CB   . ASN B 1 49  ? 21.517  0.082   -4.447  1.00 0.00 ? 49  ASN B CB   1  
ATOM   2333   C CG   . ASN B 1 49  ? 22.087  0.092   -5.862  1.00 0.00 ? 49  ASN B CG   1  
ATOM   2334   O OD1  . ASN B 1 49  ? 21.873  -0.849  -6.626  1.00 0.00 ? 49  ASN B OD1  1  
ATOM   2335   N ND2  . ASN B 1 49  ? 22.802  1.109   -6.260  1.00 0.00 ? 49  ASN B ND2  1  
ATOM   2336   H H    . ASN B 1 49  ? 20.178  -0.323  -2.330  1.00 0.00 ? 49  ASN B H    1  
ATOM   2337   H HA   . ASN B 1 49  ? 19.521  -0.406  -5.053  1.00 0.00 ? 49  ASN B HA   1  
ATOM   2338   H HB2  . ASN B 1 49  ? 21.249  1.089   -4.161  1.00 0.00 ? 49  ASN B HB2  1  
ATOM   2339   H HB3  . ASN B 1 49  ? 22.262  -0.298  -3.765  1.00 0.00 ? 49  ASN B HB3  1  
ATOM   2340   H HD21 . ASN B 1 49  ? 22.969  1.859   -5.651  1.00 0.00 ? 49  ASN B HD21 1  
ATOM   2341   H HD22 . ASN B 1 49  ? 23.172  1.123   -7.167  1.00 0.00 ? 49  ASN B HD22 1  
ATOM   2342   N N    . GLU B 1 50  ? 21.286  -2.970  -3.976  1.00 0.00 ? 50  GLU B N    1  
ATOM   2343   C CA   . GLU B 1 50  ? 21.652  -4.346  -4.298  1.00 0.00 ? 50  GLU B CA   1  
ATOM   2344   C C    . GLU B 1 50  ? 20.396  -5.192  -4.467  1.00 0.00 ? 50  GLU B C    1  
ATOM   2345   O O    . GLU B 1 50  ? 20.295  -6.016  -5.378  1.00 0.00 ? 50  GLU B O    1  
ATOM   2346   C CB   . GLU B 1 50  ? 22.523  -4.939  -3.186  1.00 0.00 ? 50  GLU B CB   1  
ATOM   2347   C CG   . GLU B 1 50  ? 22.933  -6.369  -3.565  1.00 0.00 ? 50  GLU B CG   1  
ATOM   2348   C CD   . GLU B 1 50  ? 23.883  -6.939  -2.518  1.00 0.00 ? 50  GLU B CD   1  
ATOM   2349   O OE1  . GLU B 1 50  ? 23.403  -7.349  -1.475  1.00 0.00 ? 50  GLU B OE1  1  
ATOM   2350   O OE2  . GLU B 1 50  ? 25.074  -6.957  -2.778  1.00 0.00 ? 50  GLU B OE2  1  
ATOM   2351   H H    . GLU B 1 50  ? 21.509  -2.602  -3.095  1.00 0.00 ? 50  GLU B H    1  
ATOM   2352   H HA   . GLU B 1 50  ? 22.206  -4.357  -5.223  1.00 0.00 ? 50  GLU B HA   1  
ATOM   2353   H HB2  . GLU B 1 50  ? 23.408  -4.333  -3.059  1.00 0.00 ? 50  GLU B HB2  1  
ATOM   2354   H HB3  . GLU B 1 50  ? 21.968  -4.960  -2.260  1.00 0.00 ? 50  GLU B HB3  1  
ATOM   2355   H HG2  . GLU B 1 50  ? 22.053  -6.993  -3.619  1.00 0.00 ? 50  GLU B HG2  1  
ATOM   2356   H HG3  . GLU B 1 50  ? 23.427  -6.361  -4.523  1.00 0.00 ? 50  GLU B HG3  1  
ATOM   2357   N N    . ALA B 1 51  ? 19.425  -4.969  -3.587  1.00 0.00 ? 51  ALA B N    1  
ATOM   2358   C CA   . ALA B 1 51  ? 18.170  -5.706  -3.652  1.00 0.00 ? 51  ALA B CA   1  
ATOM   2359   C C    . ALA B 1 51  ? 17.429  -5.367  -4.949  1.00 0.00 ? 51  ALA B C    1  
ATOM   2360   O O    . ALA B 1 51  ? 16.938  -6.255  -5.648  1.00 0.00 ? 51  ALA B O    1  
ATOM   2361   C CB   . ALA B 1 51  ? 17.308  -5.368  -2.424  1.00 0.00 ? 51  ALA B CB   1  
ATOM   2362   H H    . ALA B 1 51  ? 19.555  -4.291  -2.890  1.00 0.00 ? 51  ALA B H    1  
ATOM   2363   H HA   . ALA B 1 51  ? 18.386  -6.764  -3.645  1.00 0.00 ? 51  ALA B HA   1  
ATOM   2364   H HB1  . ALA B 1 51  ? 16.584  -4.611  -2.684  1.00 0.00 ? 51  ALA B HB1  1  
ATOM   2365   H HB2  . ALA B 1 51  ? 17.945  -4.998  -1.631  1.00 0.00 ? 51  ALA B HB2  1  
ATOM   2366   H HB3  . ALA B 1 51  ? 16.798  -6.258  -2.086  1.00 0.00 ? 51  ALA B HB3  1  
ATOM   2367   N N    . HIS B 1 52  ? 17.375  -4.078  -5.270  1.00 0.00 ? 52  HIS B N    1  
ATOM   2368   C CA   . HIS B 1 52  ? 16.713  -3.624  -6.492  1.00 0.00 ? 52  HIS B CA   1  
ATOM   2369   C C    . HIS B 1 52  ? 17.388  -4.224  -7.728  1.00 0.00 ? 52  HIS B C    1  
ATOM   2370   O O    . HIS B 1 52  ? 16.713  -4.630  -8.677  1.00 0.00 ? 52  HIS B O    1  
ATOM   2371   C CB   . HIS B 1 52  ? 16.758  -2.098  -6.577  1.00 0.00 ? 52  HIS B CB   1  
ATOM   2372   C CG   . HIS B 1 52  ? 15.993  -1.642  -7.789  1.00 0.00 ? 52  HIS B CG   1  
ATOM   2373   N ND1  . HIS B 1 52  ? 16.528  -1.704  -9.066  1.00 0.00 ? 52  HIS B ND1  1  
ATOM   2374   C CD2  . HIS B 1 52  ? 14.734  -1.115  -7.935  1.00 0.00 ? 52  HIS B CD2  1  
ATOM   2375   C CE1  . HIS B 1 52  ? 15.602  -1.227  -9.917  1.00 0.00 ? 52  HIS B CE1  1  
ATOM   2376   N NE2  . HIS B 1 52  ? 14.489  -0.853  -9.279  1.00 0.00 ? 52  HIS B NE2  1  
ATOM   2377   H H    . HIS B 1 52  ? 17.799  -3.416  -4.679  1.00 0.00 ? 52  HIS B H    1  
ATOM   2378   H HA   . HIS B 1 52  ? 15.681  -3.942  -6.473  1.00 0.00 ? 52  HIS B HA   1  
ATOM   2379   H HB2  . HIS B 1 52  ? 16.312  -1.675  -5.688  1.00 0.00 ? 52  HIS B HB2  1  
ATOM   2380   H HB3  . HIS B 1 52  ? 17.784  -1.772  -6.655  1.00 0.00 ? 52  HIS B HB3  1  
ATOM   2381   H HD1  . HIS B 1 52  ? 17.419  -2.035  -9.306  1.00 0.00 ? 52  HIS B HD1  1  
ATOM   2382   H HD2  . HIS B 1 52  ? 14.039  -0.931  -7.128  1.00 0.00 ? 52  HIS B HD2  1  
ATOM   2383   H HE1  . HIS B 1 52  ? 15.740  -1.155  -10.986 1.00 0.00 ? 52  HIS B HE1  1  
ATOM   2384   H HE2  . HIS B 1 52  ? 13.675  -0.477  -9.674  1.00 0.00 ? 52  HIS B HE2  1  
ATOM   2385   N N    . LEU B 1 53  ? 18.717  -4.280  -7.703  1.00 0.00 ? 53  LEU B N    1  
ATOM   2386   C CA   . LEU B 1 53  ? 19.470  -4.832  -8.826  1.00 0.00 ? 53  LEU B CA   1  
ATOM   2387   C C    . LEU B 1 53  ? 19.074  -6.288  -9.058  1.00 0.00 ? 53  LEU B C    1  
ATOM   2388   O O    . LEU B 1 53  ? 18.861  -6.715  -10.196 1.00 0.00 ? 53  LEU B O    1  
ATOM   2389   C CB   . LEU B 1 53  ? 20.972  -4.752  -8.539  1.00 0.00 ? 53  LEU B CB   1  
ATOM   2390   C CG   . LEU B 1 53  ? 21.475  -3.322  -8.773  1.00 0.00 ? 53  LEU B CG   1  
ATOM   2391   C CD1  . LEU B 1 53  ? 22.845  -3.157  -8.114  1.00 0.00 ? 53  LEU B CD1  1  
ATOM   2392   C CD2  . LEU B 1 53  ? 21.608  -3.044  -10.277 1.00 0.00 ? 53  LEU B CD2  1  
ATOM   2393   H H    . LEU B 1 53  ? 19.199  -3.948  -6.915  1.00 0.00 ? 53  LEU B H    1  
ATOM   2394   H HA   . LEU B 1 53  ? 19.249  -4.264  -9.715  1.00 0.00 ? 53  LEU B HA   1  
ATOM   2395   H HB2  . LEU B 1 53  ? 21.153  -5.031  -7.511  1.00 0.00 ? 53  LEU B HB2  1  
ATOM   2396   H HB3  . LEU B 1 53  ? 21.499  -5.432  -9.191  1.00 0.00 ? 53  LEU B HB3  1  
ATOM   2397   H HG   . LEU B 1 53  ? 20.780  -2.621  -8.334  1.00 0.00 ? 53  LEU B HG   1  
ATOM   2398   H HD11 . LEU B 1 53  ? 23.416  -4.066  -8.238  1.00 0.00 ? 53  LEU B HD11 1  
ATOM   2399   H HD12 . LEU B 1 53  ? 23.371  -2.336  -8.578  1.00 0.00 ? 53  LEU B HD12 1  
ATOM   2400   H HD13 . LEU B 1 53  ? 22.717  -2.954  -7.061  1.00 0.00 ? 53  LEU B HD13 1  
ATOM   2401   H HD21 . LEU B 1 53  ? 21.994  -3.919  -10.777 1.00 0.00 ? 53  LEU B HD21 1  
ATOM   2402   H HD22 . LEU B 1 53  ? 20.642  -2.791  -10.686 1.00 0.00 ? 53  LEU B HD22 1  
ATOM   2403   H HD23 . LEU B 1 53  ? 22.286  -2.218  -10.428 1.00 0.00 ? 53  LEU B HD23 1  
ATOM   2404   N N    . VAL B 1 54  ? 18.969  -7.045  -7.971  1.00 0.00 ? 54  VAL B N    1  
ATOM   2405   C CA   . VAL B 1 54  ? 18.585  -8.445  -8.072  1.00 0.00 ? 54  VAL B CA   1  
ATOM   2406   C C    . VAL B 1 54  ? 17.172  -8.544  -8.636  1.00 0.00 ? 54  VAL B C    1  
ATOM   2407   O O    . VAL B 1 54  ? 16.902  -9.361  -9.516  1.00 0.00 ? 54  VAL B O    1  
ATOM   2408   C CB   . VAL B 1 54  ? 18.662  -9.119  -6.693  1.00 0.00 ? 54  VAL B CB   1  
ATOM   2409   C CG1  . VAL B 1 54  ? 18.035  -10.520 -6.761  1.00 0.00 ? 54  VAL B CG1  1  
ATOM   2410   C CG2  . VAL B 1 54  ? 20.132  -9.229  -6.245  1.00 0.00 ? 54  VAL B CG2  1  
ATOM   2411   H H    . VAL B 1 54  ? 19.143  -6.650  -7.089  1.00 0.00 ? 54  VAL B H    1  
ATOM   2412   H HA   . VAL B 1 54  ? 19.262  -8.945  -8.748  1.00 0.00 ? 54  VAL B HA   1  
ATOM   2413   H HB   . VAL B 1 54  ? 18.114  -8.521  -5.978  1.00 0.00 ? 54  VAL B HB   1  
ATOM   2414   H HG11 . VAL B 1 54  ? 18.250  -10.971 -7.719  1.00 0.00 ? 54  VAL B HG11 1  
ATOM   2415   H HG12 . VAL B 1 54  ? 18.439  -11.139 -5.974  1.00 0.00 ? 54  VAL B HG12 1  
ATOM   2416   H HG13 . VAL B 1 54  ? 16.964  -10.440 -6.637  1.00 0.00 ? 54  VAL B HG13 1  
ATOM   2417   H HG21 . VAL B 1 54  ? 20.765  -9.402  -7.103  1.00 0.00 ? 54  VAL B HG21 1  
ATOM   2418   H HG22 . VAL B 1 54  ? 20.431  -8.310  -5.761  1.00 0.00 ? 54  VAL B HG22 1  
ATOM   2419   H HG23 . VAL B 1 54  ? 20.239  -10.049 -5.549  1.00 0.00 ? 54  VAL B HG23 1  
ATOM   2420   N N    . GLN B 1 55  ? 16.273  -7.693  -8.149  1.00 0.00 ? 55  GLN B N    1  
ATOM   2421   C CA   . GLN B 1 55  ? 14.901  -7.708  -8.651  1.00 0.00 ? 55  GLN B CA   1  
ATOM   2422   C C    . GLN B 1 55  ? 14.886  -7.365  -10.144 1.00 0.00 ? 55  GLN B C    1  
ATOM   2423   O O    . GLN B 1 55  ? 14.172  -7.999  -10.922 1.00 0.00 ? 55  GLN B O    1  
ATOM   2424   C CB   . GLN B 1 55  ? 14.015  -6.732  -7.850  1.00 0.00 ? 55  GLN B CB   1  
ATOM   2425   C CG   . GLN B 1 55  ? 12.712  -6.419  -8.627  1.00 0.00 ? 55  GLN B CG   1  
ATOM   2426   C CD   . GLN B 1 55  ? 11.522  -6.290  -7.675  1.00 0.00 ? 55  GLN B CD   1  
ATOM   2427   O OE1  . GLN B 1 55  ? 11.513  -5.432  -6.800  1.00 0.00 ? 55  GLN B OE1  1  
ATOM   2428   N NE2  . GLN B 1 55  ? 10.503  -7.086  -7.814  1.00 0.00 ? 55  GLN B NE2  1  
ATOM   2429   H H    . GLN B 1 55  ? 16.536  -7.043  -7.459  1.00 0.00 ? 55  GLN B H    1  
ATOM   2430   H HA   . GLN B 1 55  ? 14.513  -8.708  -8.527  1.00 0.00 ? 55  GLN B HA   1  
ATOM   2431   H HB2  . GLN B 1 55  ? 13.768  -7.182  -6.899  1.00 0.00 ? 55  GLN B HB2  1  
ATOM   2432   H HB3  . GLN B 1 55  ? 14.559  -5.814  -7.678  1.00 0.00 ? 55  GLN B HB3  1  
ATOM   2433   H HG2  . GLN B 1 55  ? 12.831  -5.491  -9.163  1.00 0.00 ? 55  GLN B HG2  1  
ATOM   2434   H HG3  . GLN B 1 55  ? 12.509  -7.211  -9.332  1.00 0.00 ? 55  GLN B HG3  1  
ATOM   2435   H HE21 . GLN B 1 55  ? 10.505  -7.761  -8.522  1.00 0.00 ? 55  GLN B HE21 1  
ATOM   2436   H HE22 . GLN B 1 55  ? 9.734   -7.007  -7.212  1.00 0.00 ? 55  GLN B HE22 1  
ATOM   2437   N N    . THR B 1 56  ? 15.685  -6.374  -10.547 1.00 0.00 ? 56  THR B N    1  
ATOM   2438   C CA   . THR B 1 56  ? 15.748  -5.988  -11.961 1.00 0.00 ? 56  THR B CA   1  
ATOM   2439   C C    . THR B 1 56  ? 15.979  -7.221  -12.833 1.00 0.00 ? 56  THR B C    1  
ATOM   2440   O O    . THR B 1 56  ? 15.271  -7.443  -13.819 1.00 0.00 ? 56  THR B O    1  
ATOM   2441   C CB   . THR B 1 56  ? 16.868  -4.971  -12.189 1.00 0.00 ? 56  THR B CB   1  
ATOM   2442   O OG1  . THR B 1 56  ? 16.750  -3.921  -11.240 1.00 0.00 ? 56  THR B OG1  1  
ATOM   2443   C CG2  . THR B 1 56  ? 16.764  -4.397  -13.605 1.00 0.00 ? 56  THR B CG2  1  
ATOM   2444   H H    . THR B 1 56  ? 16.248  -5.908  -9.892  1.00 0.00 ? 56  THR B H    1  
ATOM   2445   H HA   . THR B 1 56  ? 14.804  -5.547  -12.237 1.00 0.00 ? 56  THR B HA   1  
ATOM   2446   H HB   . THR B 1 56  ? 17.824  -5.456  -12.072 1.00 0.00 ? 56  THR B HB   1  
ATOM   2447   H HG1  . THR B 1 56  ? 15.819  -3.811  -11.032 1.00 0.00 ? 56  THR B HG1  1  
ATOM   2448   H HG21 . THR B 1 56  ? 16.360  -5.146  -14.271 1.00 0.00 ? 56  THR B HG21 1  
ATOM   2449   H HG22 . THR B 1 56  ? 16.113  -3.535  -13.597 1.00 0.00 ? 56  THR B HG22 1  
ATOM   2450   H HG23 . THR B 1 56  ? 17.745  -4.104  -13.946 1.00 0.00 ? 56  THR B HG23 1  
ATOM   2451   N N    . LYS B 1 57  ? 16.945  -8.050  -12.442 1.00 0.00 ? 57  LYS B N    1  
ATOM   2452   C CA   . LYS B 1 57  ? 17.224  -9.278  -13.181 1.00 0.00 ? 57  LYS B CA   1  
ATOM   2453   C C    . LYS B 1 57  ? 16.007  -10.191 -13.143 1.00 0.00 ? 57  LYS B C    1  
ATOM   2454   O O    . LYS B 1 57  ? 15.666  -10.844 -14.130 1.00 0.00 ? 57  LYS B O    1  
ATOM   2455   C CB   . LYS B 1 57  ? 18.424  -10.003 -12.570 1.00 0.00 ? 57  LYS B CB   1  
ATOM   2456   C CG   . LYS B 1 57  ? 18.795  -11.196 -13.454 1.00 0.00 ? 57  LYS B CG   1  
ATOM   2457   C CD   . LYS B 1 57  ? 20.038  -11.887 -12.893 1.00 0.00 ? 57  LYS B CD   1  
ATOM   2458   C CE   . LYS B 1 57  ? 20.420  -13.059 -13.799 1.00 0.00 ? 57  LYS B CE   1  
ATOM   2459   N NZ   . LYS B 1 57  ? 21.369  -13.955 -13.081 1.00 0.00 ? 57  LYS B NZ   1  
ATOM   2460   H H    . LYS B 1 57  ? 17.457  -7.842  -11.631 1.00 0.00 ? 57  LYS B H    1  
ATOM   2461   H HA   . LYS B 1 57  ? 17.452  -9.038  -14.209 1.00 0.00 ? 57  LYS B HA   1  
ATOM   2462   H HB2  . LYS B 1 57  ? 19.262  -9.324  -12.505 1.00 0.00 ? 57  LYS B HB2  1  
ATOM   2463   H HB3  . LYS B 1 57  ? 18.168  -10.356 -11.582 1.00 0.00 ? 57  LYS B HB3  1  
ATOM   2464   H HG2  . LYS B 1 57  ? 17.972  -11.896 -13.476 1.00 0.00 ? 57  LYS B HG2  1  
ATOM   2465   H HG3  . LYS B 1 57  ? 19.000  -10.850 -14.456 1.00 0.00 ? 57  LYS B HG3  1  
ATOM   2466   H HD2  . LYS B 1 57  ? 20.855  -11.180 -12.851 1.00 0.00 ? 57  LYS B HD2  1  
ATOM   2467   H HD3  . LYS B 1 57  ? 19.829  -12.256 -11.900 1.00 0.00 ? 57  LYS B HD3  1  
ATOM   2468   H HE2  . LYS B 1 57  ? 19.532  -13.613 -14.065 1.00 0.00 ? 57  LYS B HE2  1  
ATOM   2469   H HE3  . LYS B 1 57  ? 20.890  -12.681 -14.696 1.00 0.00 ? 57  LYS B HE3  1  
ATOM   2470   H HZ1  . LYS B 1 57  ? 21.710  -13.481 -12.220 1.00 0.00 ? 57  LYS B HZ1  1  
ATOM   2471   H HZ2  . LYS B 1 57  ? 20.885  -14.838 -12.823 1.00 0.00 ? 57  LYS B HZ2  1  
ATOM   2472   H HZ3  . LYS B 1 57  ? 22.176  -14.174 -13.700 1.00 0.00 ? 57  LYS B HZ3  1  
ATOM   2473   N N    . LEU B 1 58  ? 15.360  -10.240 -11.986 1.00 0.00 ? 58  LEU B N    1  
ATOM   2474   C CA   . LEU B 1 58  ? 14.191  -11.088 -11.824 1.00 0.00 ? 58  LEU B CA   1  
ATOM   2475   C C    . LEU B 1 58  ? 13.009  -10.595 -12.673 1.00 0.00 ? 58  LEU B C    1  
ATOM   2476   O O    . LEU B 1 58  ? 12.098  -11.364 -12.954 1.00 0.00 ? 58  LEU B O    1  
ATOM   2477   C CB   . LEU B 1 58  ? 13.792  -11.174 -10.355 1.00 0.00 ? 58  LEU B CB   1  
ATOM   2478   C CG   . LEU B 1 58  ? 14.879  -11.910 -9.556  1.00 0.00 ? 58  LEU B CG   1  
ATOM   2479   C CD1  . LEU B 1 58  ? 14.543  -11.818 -8.064  1.00 0.00 ? 58  LEU B CD1  1  
ATOM   2480   C CD2  . LEU B 1 58  ? 14.958  -13.387 -9.992  1.00 0.00 ? 58  LEU B CD2  1  
ATOM   2481   H H    . LEU B 1 58  ? 15.680  -9.706  -11.229 1.00 0.00 ? 58  LEU B H    1  
ATOM   2482   H HA   . LEU B 1 58  ? 14.458  -12.081 -12.159 1.00 0.00 ? 58  LEU B HA   1  
ATOM   2483   H HB2  . LEU B 1 58  ? 13.667  -10.175 -9.962  1.00 0.00 ? 58  LEU B HB2  1  
ATOM   2484   H HB3  . LEU B 1 58  ? 12.861  -11.714 -10.276 1.00 0.00 ? 58  LEU B HB3  1  
ATOM   2485   H HG   . LEU B 1 58  ? 15.835  -11.432 -9.729  1.00 0.00 ? 58  LEU B HG   1  
ATOM   2486   H HD11 . LEU B 1 58  ? 13.469  -11.852 -7.930  1.00 0.00 ? 58  LEU B HD11 1  
ATOM   2487   H HD12 . LEU B 1 58  ? 14.997  -12.642 -7.536  1.00 0.00 ? 58  LEU B HD12 1  
ATOM   2488   H HD13 . LEU B 1 58  ? 14.922  -10.886 -7.672  1.00 0.00 ? 58  LEU B HD13 1  
ATOM   2489   H HD21 . LEU B 1 58  ? 14.005  -13.706 -10.390 1.00 0.00 ? 58  LEU B HD21 1  
ATOM   2490   H HD22 . LEU B 1 58  ? 15.717  -13.495 -10.755 1.00 0.00 ? 58  LEU B HD22 1  
ATOM   2491   H HD23 . LEU B 1 58  ? 15.217  -14.005 -9.144  1.00 0.00 ? 58  LEU B HD23 1  
ATOM   2492   N N    . ILE B 1 59  ? 13.028  -9.325  -13.091 1.00 0.00 ? 59  ILE B N    1  
ATOM   2493   C CA   . ILE B 1 59  ? 11.951  -8.801  -13.939 1.00 0.00 ? 59  ILE B CA   1  
ATOM   2494   C C    . ILE B 1 59  ? 12.325  -8.906  -15.430 1.00 0.00 ? 59  ILE B C    1  
ATOM   2495   O O    . ILE B 1 59  ? 11.471  -9.147  -16.276 1.00 0.00 ? 59  ILE B O    1  
ATOM   2496   C CB   . ILE B 1 59  ? 11.614  -7.338  -13.546 1.00 0.00 ? 59  ILE B CB   1  
ATOM   2497   C CG1  . ILE B 1 59  ? 10.119  -7.067  -13.758 1.00 0.00 ? 59  ILE B CG1  1  
ATOM   2498   C CG2  . ILE B 1 59  ? 12.389  -6.332  -14.402 1.00 0.00 ? 59  ILE B CG2  1  
ATOM   2499   C CD1  . ILE B 1 59  ? 9.759   -5.719  -13.130 1.00 0.00 ? 59  ILE B CD1  1  
ATOM   2500   H H    . ILE B 1 59  ? 13.781  -8.745  -12.842 1.00 0.00 ? 59  ILE B H    1  
ATOM   2501   H HA   . ILE B 1 59  ? 11.064  -9.398  -13.774 1.00 0.00 ? 59  ILE B HA   1  
ATOM   2502   H HB   . ILE B 1 59  ? 11.858  -7.184  -12.506 1.00 0.00 ? 59  ILE B HB   1  
ATOM   2503   H HG12 . ILE B 1 59  ? 9.905   -7.043  -14.816 1.00 0.00 ? 59  ILE B HG12 1  
ATOM   2504   H HG13 . ILE B 1 59  ? 9.535   -7.842  -13.288 1.00 0.00 ? 59  ILE B HG13 1  
ATOM   2505   H HG21 . ILE B 1 59  ? 13.433  -6.531  -14.340 1.00 0.00 ? 59  ILE B HG21 1  
ATOM   2506   H HG22 . ILE B 1 59  ? 12.070  -6.406  -15.428 1.00 0.00 ? 59  ILE B HG22 1  
ATOM   2507   H HG23 . ILE B 1 59  ? 12.195  -5.334  -14.044 1.00 0.00 ? 59  ILE B HG23 1  
ATOM   2508   H HD11 . ILE B 1 59  ? 10.121  -5.687  -12.113 1.00 0.00 ? 59  ILE B HD11 1  
ATOM   2509   H HD12 . ILE B 1 59  ? 10.215  -4.924  -13.698 1.00 0.00 ? 59  ILE B HD12 1  
ATOM   2510   H HD13 . ILE B 1 59  ? 8.688   -5.595  -13.133 1.00 0.00 ? 59  ILE B HD13 1  
ATOM   2511   N N    . GLU B 1 60  ? 13.611  -8.733  -15.747 1.00 0.00 ? 60  GLU B N    1  
ATOM   2512   C CA   . GLU B 1 60  ? 14.061  -8.824  -17.145 1.00 0.00 ? 60  GLU B CA   1  
ATOM   2513   C C    . GLU B 1 60  ? 13.884  -10.241 -17.687 1.00 0.00 ? 60  GLU B C    1  
ATOM   2514   O O    . GLU B 1 60  ? 13.514  -10.433 -18.846 1.00 0.00 ? 60  GLU B O    1  
ATOM   2515   C CB   . GLU B 1 60  ? 15.546  -8.452  -17.230 1.00 0.00 ? 60  GLU B CB   1  
ATOM   2516   C CG   . GLU B 1 60  ? 16.058  -8.589  -18.672 1.00 0.00 ? 60  GLU B CG   1  
ATOM   2517   C CD   . GLU B 1 60  ? 17.578  -8.489  -18.689 1.00 0.00 ? 60  GLU B CD   1  
ATOM   2518   O OE1  . GLU B 1 60  ? 18.150  -8.286  -17.632 1.00 0.00 ? 60  GLU B OE1  1  
ATOM   2519   O OE2  . GLU B 1 60  ? 18.149  -8.634  -19.757 1.00 0.00 ? 60  GLU B OE2  1  
ATOM   2520   H H    . GLU B 1 60  ? 14.263  -8.542  -15.041 1.00 0.00 ? 60  GLU B H    1  
ATOM   2521   H HA   . GLU B 1 60  ? 13.476  -8.145  -17.748 1.00 0.00 ? 60  GLU B HA   1  
ATOM   2522   H HB2  . GLU B 1 60  ? 15.675  -7.431  -16.903 1.00 0.00 ? 60  GLU B HB2  1  
ATOM   2523   H HB3  . GLU B 1 60  ? 16.115  -9.107  -16.587 1.00 0.00 ? 60  GLU B HB3  1  
ATOM   2524   H HG2  . GLU B 1 60  ? 15.763  -9.542  -19.083 1.00 0.00 ? 60  GLU B HG2  1  
ATOM   2525   H HG3  . GLU B 1 60  ? 15.644  -7.796  -19.275 1.00 0.00 ? 60  GLU B HG3  1  
ATOM   2526   N N    . GLY B 1 61  ? 14.164  -11.234 -16.846 1.00 0.00 ? 61  GLY B N    1  
ATOM   2527   C CA   . GLY B 1 61  ? 14.048  -12.632 -17.260 1.00 0.00 ? 61  GLY B CA   1  
ATOM   2528   C C    . GLY B 1 61  ? 12.869  -13.316 -16.582 1.00 0.00 ? 61  GLY B C    1  
ATOM   2529   O O    . GLY B 1 61  ? 12.927  -14.506 -16.280 1.00 0.00 ? 61  GLY B O    1  
ATOM   2530   H H    . GLY B 1 61  ? 14.462  -11.024 -15.934 1.00 0.00 ? 61  GLY B H    1  
ATOM   2531   H HA2  . GLY B 1 61  ? 13.916  -12.674 -18.333 1.00 0.00 ? 61  GLY B HA2  1  
ATOM   2532   H HA3  . GLY B 1 61  ? 14.953  -13.153 -16.993 1.00 0.00 ? 61  GLY B HA3  1  
ATOM   2533   N N    . ASP B 1 62  ? 11.803  -12.561 -16.343 1.00 0.00 ? 62  ASP B N    1  
ATOM   2534   C CA   . ASP B 1 62  ? 10.616  -13.103 -15.682 1.00 0.00 ? 62  ASP B CA   1  
ATOM   2535   C C    . ASP B 1 62  ? 9.910   -14.148 -16.548 1.00 0.00 ? 62  ASP B C    1  
ATOM   2536   O O    . ASP B 1 62  ? 8.965   -14.795 -16.098 1.00 0.00 ? 62  ASP B O    1  
ATOM   2537   C CB   . ASP B 1 62  ? 9.646   -11.966 -15.364 1.00 0.00 ? 62  ASP B CB   1  
ATOM   2538   C CG   . ASP B 1 62  ? 9.321   -11.188 -16.635 1.00 0.00 ? 62  ASP B CG   1  
ATOM   2539   O OD1  . ASP B 1 62  ? 9.918   -11.485 -17.657 1.00 0.00 ? 62  ASP B OD1  1  
ATOM   2540   O OD2  . ASP B 1 62  ? 8.481   -10.306 -16.568 1.00 0.00 ? 62  ASP B OD2  1  
ATOM   2541   H H    . ASP B 1 62  ? 11.815  -11.617 -16.605 1.00 0.00 ? 62  ASP B H    1  
ATOM   2542   H HA   . ASP B 1 62  ? 10.917  -13.566 -14.755 1.00 0.00 ? 62  ASP B HA   1  
ATOM   2543   H HB2  . ASP B 1 62  ? 8.738   -12.376 -14.953 1.00 0.00 ? 62  ASP B HB2  1  
ATOM   2544   H HB3  . ASP B 1 62  ? 10.097  -11.300 -14.644 1.00 0.00 ? 62  ASP B HB3  1  
ATOM   2545   N N    . ALA B 1 63  ? 10.369  -14.311 -17.782 1.00 0.00 ? 63  ALA B N    1  
ATOM   2546   C CA   . ALA B 1 63  ? 9.764   -15.287 -18.687 1.00 0.00 ? 63  ALA B CA   1  
ATOM   2547   C C    . ALA B 1 63  ? 10.320  -16.684 -18.423 1.00 0.00 ? 63  ALA B C    1  
ATOM   2548   O O    . ALA B 1 63  ? 11.259  -16.851 -17.644 1.00 0.00 ? 63  ALA B O    1  
ATOM   2549   C CB   . ALA B 1 63  ? 10.038  -14.893 -20.139 1.00 0.00 ? 63  ALA B CB   1  
ATOM   2550   H H    . ALA B 1 63  ? 11.126  -13.771 -18.091 1.00 0.00 ? 63  ALA B H    1  
ATOM   2551   H HA   . ALA B 1 63  ? 8.696   -15.299 -18.525 1.00 0.00 ? 63  ALA B HA   1  
ATOM   2552   H HB1  . ALA B 1 63  ? 11.017  -15.244 -20.429 1.00 0.00 ? 63  ALA B HB1  1  
ATOM   2553   H HB2  . ALA B 1 63  ? 9.291   -15.338 -20.780 1.00 0.00 ? 63  ALA B HB2  1  
ATOM   2554   H HB3  . ALA B 1 63  ? 9.999   -13.818 -20.234 1.00 0.00 ? 63  ALA B HB3  1  
ATOM   2555   N N    . GLY B 1 64  ? 9.739   -17.688 -19.082 1.00 0.00 ? 64  GLY B N    1  
ATOM   2556   C CA   . GLY B 1 64  ? 10.191  -19.069 -18.915 1.00 0.00 ? 64  GLY B CA   1  
ATOM   2557   C C    . GLY B 1 64  ? 9.022   -20.017 -18.648 1.00 0.00 ? 64  GLY B C    1  
ATOM   2558   O O    . GLY B 1 64  ? 8.808   -20.970 -19.397 1.00 0.00 ? 64  GLY B O    1  
ATOM   2559   H H    . GLY B 1 64  ? 8.998   -17.495 -19.693 1.00 0.00 ? 64  GLY B H    1  
ATOM   2560   H HA2  . GLY B 1 64  ? 10.701  -19.383 -19.814 1.00 0.00 ? 64  GLY B HA2  1  
ATOM   2561   H HA3  . GLY B 1 64  ? 10.880  -19.121 -18.084 1.00 0.00 ? 64  GLY B HA3  1  
ATOM   2562   N N    . GLU B 1 65  ? 8.276   -19.760 -17.578 1.00 0.00 ? 65  GLU B N    1  
ATOM   2563   C CA   . GLU B 1 65  ? 7.141   -20.613 -17.231 1.00 0.00 ? 65  GLU B CA   1  
ATOM   2564   C C    . GLU B 1 65  ? 6.044   -20.524 -18.287 1.00 0.00 ? 65  GLU B C    1  
ATOM   2565   O O    . GLU B 1 65  ? 5.414   -21.526 -18.624 1.00 0.00 ? 65  GLU B O    1  
ATOM   2566   C CB   . GLU B 1 65  ? 6.568   -20.204 -15.873 1.00 0.00 ? 65  GLU B CB   1  
ATOM   2567   C CG   . GLU B 1 65  ? 7.572   -20.540 -14.770 1.00 0.00 ? 65  GLU B CG   1  
ATOM   2568   C CD   . GLU B 1 65  ? 7.037   -20.071 -13.422 1.00 0.00 ? 65  GLU B CD   1  
ATOM   2569   O OE1  . GLU B 1 65  ? 5.937   -19.544 -13.394 1.00 0.00 ? 65  GLU B OE1  1  
ATOM   2570   O OE2  . GLU B 1 65  ? 7.734   -20.248 -12.436 1.00 0.00 ? 65  GLU B OE2  1  
ATOM   2571   H H    . GLU B 1 65  ? 8.494   -18.991 -17.011 1.00 0.00 ? 65  GLU B H    1  
ATOM   2572   H HA   . GLU B 1 65  ? 7.481   -21.635 -17.169 1.00 0.00 ? 65  GLU B HA   1  
ATOM   2573   H HB2  . GLU B 1 65  ? 6.372   -19.142 -15.871 1.00 0.00 ? 65  GLU B HB2  1  
ATOM   2574   H HB3  . GLU B 1 65  ? 5.648   -20.740 -15.696 1.00 0.00 ? 65  GLU B HB3  1  
ATOM   2575   H HG2  . GLU B 1 65  ? 7.729   -21.609 -14.742 1.00 0.00 ? 65  GLU B HG2  1  
ATOM   2576   H HG3  . GLU B 1 65  ? 8.509   -20.045 -14.975 1.00 0.00 ? 65  GLU B HG3  1  
ATOM   2577   N N    . GLY B 1 66  ? 5.814   -19.321 -18.799 1.00 0.00 ? 66  GLY B N    1  
ATOM   2578   C CA   . GLY B 1 66  ? 4.782   -19.122 -19.809 1.00 0.00 ? 66  GLY B CA   1  
ATOM   2579   C C    . GLY B 1 66  ? 5.006   -17.821 -20.570 1.00 0.00 ? 66  GLY B C    1  
ATOM   2580   O O    . GLY B 1 66  ? 5.885   -17.031 -20.227 1.00 0.00 ? 66  GLY B O    1  
ATOM   2581   H H    . GLY B 1 66  ? 6.342   -18.555 -18.491 1.00 0.00 ? 66  GLY B H    1  
ATOM   2582   H HA2  . GLY B 1 66  ? 4.803   -19.949 -20.505 1.00 0.00 ? 66  GLY B HA2  1  
ATOM   2583   H HA3  . GLY B 1 66  ? 3.817   -19.087 -19.328 1.00 0.00 ? 66  GLY B HA3  1  
ATOM   2584   N N    . LYS B 1 67  ? 4.210   -17.613 -21.612 1.00 0.00 ? 67  LYS B N    1  
ATOM   2585   C CA   . LYS B 1 67  ? 4.333   -16.411 -22.427 1.00 0.00 ? 67  LYS B CA   1  
ATOM   2586   C C    . LYS B 1 67  ? 3.929   -15.163 -21.638 1.00 0.00 ? 67  LYS B C    1  
ATOM   2587   O O    . LYS B 1 67  ? 4.779   -14.430 -21.134 1.00 0.00 ? 67  LYS B O    1  
ATOM   2588   C CB   . LYS B 1 67  ? 3.435   -16.533 -23.665 1.00 0.00 ? 67  LYS B CB   1  
ATOM   2589   C CG   . LYS B 1 67  ? 3.765   -17.812 -24.445 1.00 0.00 ? 67  LYS B CG   1  
ATOM   2590   C CD   . LYS B 1 67  ? 5.164   -17.714 -25.060 1.00 0.00 ? 67  LYS B CD   1  
ATOM   2591   C CE   . LYS B 1 67  ? 5.332   -18.815 -26.110 1.00 0.00 ? 67  LYS B CE   1  
ATOM   2592   N NZ   . LYS B 1 67  ? 6.633   -18.637 -26.815 1.00 0.00 ? 67  LYS B NZ   1  
ATOM   2593   H H    . LYS B 1 67  ? 3.533   -18.282 -21.842 1.00 0.00 ? 67  LYS B H    1  
ATOM   2594   H HA   . LYS B 1 67  ? 5.356   -16.304 -22.747 1.00 0.00 ? 67  LYS B HA   1  
ATOM   2595   H HB2  . LYS B 1 67  ? 2.401   -16.563 -23.355 1.00 0.00 ? 67  LYS B HB2  1  
ATOM   2596   H HB3  . LYS B 1 67  ? 3.591   -15.677 -24.304 1.00 0.00 ? 67  LYS B HB3  1  
ATOM   2597   H HG2  . LYS B 1 67  ? 3.729   -18.658 -23.774 1.00 0.00 ? 67  LYS B HG2  1  
ATOM   2598   H HG3  . LYS B 1 67  ? 3.039   -17.949 -25.232 1.00 0.00 ? 67  LYS B HG3  1  
ATOM   2599   H HD2  . LYS B 1 67  ? 5.287   -16.747 -25.527 1.00 0.00 ? 67  LYS B HD2  1  
ATOM   2600   H HD3  . LYS B 1 67  ? 5.909   -17.842 -24.291 1.00 0.00 ? 67  LYS B HD3  1  
ATOM   2601   H HE2  . LYS B 1 67  ? 5.314   -19.780 -25.626 1.00 0.00 ? 67  LYS B HE2  1  
ATOM   2602   H HE3  . LYS B 1 67  ? 4.524   -18.757 -26.825 1.00 0.00 ? 67  LYS B HE3  1  
ATOM   2603   H HZ1  . LYS B 1 67  ? 7.318   -18.193 -26.172 1.00 0.00 ? 67  LYS B HZ1  1  
ATOM   2604   H HZ2  . LYS B 1 67  ? 6.991   -19.566 -27.119 1.00 0.00 ? 67  LYS B HZ2  1  
ATOM   2605   H HZ3  . LYS B 1 67  ? 6.497   -18.028 -27.646 1.00 0.00 ? 67  LYS B HZ3  1  
ATOM   2606   N N    . MET B 1 68  ? 2.624   -14.922 -21.564 1.00 0.00 ? 68  MET B N    1  
ATOM   2607   C CA   . MET B 1 68  ? 2.090   -13.751 -20.868 1.00 0.00 ? 68  MET B CA   1  
ATOM   2608   C C    . MET B 1 68  ? 2.324   -13.798 -19.355 1.00 0.00 ? 68  MET B C    1  
ATOM   2609   O O    . MET B 1 68  ? 2.589   -12.769 -18.734 1.00 0.00 ? 68  MET B O    1  
ATOM   2610   C CB   . MET B 1 68  ? 0.588   -13.643 -21.139 1.00 0.00 ? 68  MET B CB   1  
ATOM   2611   C CG   . MET B 1 68  ? 0.356   -13.037 -22.524 1.00 0.00 ? 68  MET B CG   1  
ATOM   2612   S SD   . MET B 1 68  ? 0.884   -11.306 -22.524 1.00 0.00 ? 68  MET B SD   1  
ATOM   2613   C CE   . MET B 1 68  ? 1.792   -11.343 -24.089 1.00 0.00 ? 68  MET B CE   1  
ATOM   2614   H H    . MET B 1 68  ? 2.001   -15.536 -22.004 1.00 0.00 ? 68  MET B H    1  
ATOM   2615   H HA   . MET B 1 68  ? 2.570   -12.869 -21.263 1.00 0.00 ? 68  MET B HA   1  
ATOM   2616   H HB2  . MET B 1 68  ? 0.144   -14.627 -21.097 1.00 0.00 ? 68  MET B HB2  1  
ATOM   2617   H HB3  . MET B 1 68  ? 0.133   -13.011 -20.391 1.00 0.00 ? 68  MET B HB3  1  
ATOM   2618   H HG2  . MET B 1 68  ? 0.927   -13.588 -23.258 1.00 0.00 ? 68  MET B HG2  1  
ATOM   2619   H HG3  . MET B 1 68  ? -0.694  -13.093 -22.770 1.00 0.00 ? 68  MET B HG3  1  
ATOM   2620   H HE1  . MET B 1 68  ? 1.167   -11.779 -24.856 1.00 0.00 ? 68  MET B HE1  1  
ATOM   2621   H HE2  . MET B 1 68  ? 2.062   -10.340 -24.374 1.00 0.00 ? 68  MET B HE2  1  
ATOM   2622   H HE3  . MET B 1 68  ? 2.689   -11.935 -23.969 1.00 0.00 ? 68  MET B HE3  1  
ATOM   2623   N N    . LYS B 1 69  ? 2.180   -14.977 -18.760 1.00 0.00 ? 69  LYS B N    1  
ATOM   2624   C CA   . LYS B 1 69  ? 2.332   -15.114 -17.310 1.00 0.00 ? 69  LYS B CA   1  
ATOM   2625   C C    . LYS B 1 69  ? 3.787   -15.003 -16.855 1.00 0.00 ? 69  LYS B C    1  
ATOM   2626   O O    . LYS B 1 69  ? 4.718   -15.310 -17.599 1.00 0.00 ? 69  LYS B O    1  
ATOM   2627   C CB   . LYS B 1 69  ? 1.740   -16.446 -16.852 1.00 0.00 ? 69  LYS B CB   1  
ATOM   2628   C CG   . LYS B 1 69  ? 0.224   -16.408 -17.053 1.00 0.00 ? 69  LYS B CG   1  
ATOM   2629   C CD   . LYS B 1 69  ? -0.394  -17.731 -16.602 1.00 0.00 ? 69  LYS B CD   1  
ATOM   2630   C CE   . LYS B 1 69  ? -1.900  -17.702 -16.871 1.00 0.00 ? 69  LYS B CE   1  
ATOM   2631   N NZ   . LYS B 1 69  ? -2.540  -16.672 -16.005 1.00 0.00 ? 69  LYS B NZ   1  
ATOM   2632   H H    . LYS B 1 69  ? 1.935   -15.761 -19.295 1.00 0.00 ? 69  LYS B H    1  
ATOM   2633   H HA   . LYS B 1 69  ? 1.772   -14.321 -16.838 1.00 0.00 ? 69  LYS B HA   1  
ATOM   2634   H HB2  . LYS B 1 69  ? 2.165   -17.251 -17.436 1.00 0.00 ? 69  LYS B HB2  1  
ATOM   2635   H HB3  . LYS B 1 69  ? 1.960   -16.600 -15.807 1.00 0.00 ? 69  LYS B HB3  1  
ATOM   2636   H HG2  . LYS B 1 69  ? -0.194  -15.599 -16.472 1.00 0.00 ? 69  LYS B HG2  1  
ATOM   2637   H HG3  . LYS B 1 69  ? 0.005   -16.250 -18.099 1.00 0.00 ? 69  LYS B HG3  1  
ATOM   2638   H HD2  . LYS B 1 69  ? 0.056   -18.545 -17.151 1.00 0.00 ? 69  LYS B HD2  1  
ATOM   2639   H HD3  . LYS B 1 69  ? -0.222  -17.868 -15.545 1.00 0.00 ? 69  LYS B HD3  1  
ATOM   2640   H HE2  . LYS B 1 69  ? -2.076  -17.460 -17.909 1.00 0.00 ? 69  LYS B HE2  1  
ATOM   2641   H HE3  . LYS B 1 69  ? -2.324  -18.671 -16.651 1.00 0.00 ? 69  LYS B HE3  1  
ATOM   2642   H HZ1  . LYS B 1 69  ? -1.820  -15.995 -15.681 1.00 0.00 ? 69  LYS B HZ1  1  
ATOM   2643   H HZ2  . LYS B 1 69  ? -3.269  -16.166 -16.547 1.00 0.00 ? 69  LYS B HZ2  1  
ATOM   2644   H HZ3  . LYS B 1 69  ? -2.977  -17.134 -15.181 1.00 0.00 ? 69  LYS B HZ3  1  
ATOM   2645   N N    . VAL B 1 70  ? 3.956   -14.543 -15.612 1.00 0.00 ? 70  VAL B N    1  
ATOM   2646   C CA   . VAL B 1 70  ? 5.279   -14.362 -15.015 1.00 0.00 ? 70  VAL B CA   1  
ATOM   2647   C C    . VAL B 1 70  ? 5.319   -14.970 -13.610 1.00 0.00 ? 70  VAL B C    1  
ATOM   2648   O O    . VAL B 1 70  ? 4.288   -15.383 -13.079 1.00 0.00 ? 70  VAL B O    1  
ATOM   2649   C CB   . VAL B 1 70  ? 5.603   -12.871 -14.926 1.00 0.00 ? 70  VAL B CB   1  
ATOM   2650   C CG1  . VAL B 1 70  ? 5.645   -12.269 -16.332 1.00 0.00 ? 70  VAL B CG1  1  
ATOM   2651   C CG2  . VAL B 1 70  ? 4.524   -12.165 -14.103 1.00 0.00 ? 70  VAL B CG2  1  
ATOM   2652   H H    . VAL B 1 70  ? 3.164   -14.313 -15.083 1.00 0.00 ? 70  VAL B H    1  
ATOM   2653   H HA   . VAL B 1 70  ? 6.018   -14.848 -15.633 1.00 0.00 ? 70  VAL B HA   1  
ATOM   2654   H HB   . VAL B 1 70  ? 6.563   -12.740 -14.450 1.00 0.00 ? 70  VAL B HB   1  
ATOM   2655   H HG11 . VAL B 1 70  ? 4.701   -12.446 -16.827 1.00 0.00 ? 70  VAL B HG11 1  
ATOM   2656   H HG12 . VAL B 1 70  ? 5.821   -11.206 -16.264 1.00 0.00 ? 70  VAL B HG12 1  
ATOM   2657   H HG13 . VAL B 1 70  ? 6.440   -12.731 -16.898 1.00 0.00 ? 70  VAL B HG13 1  
ATOM   2658   H HG21 . VAL B 1 70  ? 4.483   -12.600 -13.115 1.00 0.00 ? 70  VAL B HG21 1  
ATOM   2659   H HG22 . VAL B 1 70  ? 4.761   -11.114 -14.024 1.00 0.00 ? 70  VAL B HG22 1  
ATOM   2660   H HG23 . VAL B 1 70  ? 3.566   -12.282 -14.588 1.00 0.00 ? 70  VAL B HG23 1  
ATOM   2661   N N    . SER B 1 71  ? 6.510   -15.022 -13.009 1.00 0.00 ? 71  SER B N    1  
ATOM   2662   C CA   . SER B 1 71  ? 6.646   -15.584 -11.663 1.00 0.00 ? 71  SER B CA   1  
ATOM   2663   C C    . SER B 1 71  ? 5.769   -14.801 -10.691 1.00 0.00 ? 71  SER B C    1  
ATOM   2664   O O    . SER B 1 71  ? 5.773   -13.569 -10.692 1.00 0.00 ? 71  SER B O    1  
ATOM   2665   C CB   . SER B 1 71  ? 8.105   -15.520 -11.213 1.00 0.00 ? 71  SER B CB   1  
ATOM   2666   O OG   . SER B 1 71  ? 8.242   -16.200 -9.974  1.00 0.00 ? 71  SER B OG   1  
ATOM   2667   H H    . SER B 1 71  ? 7.302   -14.678 -13.472 1.00 0.00 ? 71  SER B H    1  
ATOM   2668   H HA   . SER B 1 71  ? 6.325   -16.615 -11.677 1.00 0.00 ? 71  SER B HA   1  
ATOM   2669   H HB2  . SER B 1 71  ? 8.732   -15.993 -11.950 1.00 0.00 ? 71  SER B HB2  1  
ATOM   2670   H HB3  . SER B 1 71  ? 8.401   -14.484 -11.103 1.00 0.00 ? 71  SER B HB3  1  
ATOM   2671   H HG   . SER B 1 71  ? 7.491   -15.968 -9.423  1.00 0.00 ? 71  SER B HG   1  
ATOM   2672   N N    . LEU B 1 72  ? 4.972   -15.521 -9.904  1.00 0.00 ? 72  LEU B N    1  
ATOM   2673   C CA   . LEU B 1 72  ? 4.035   -14.874 -8.977  1.00 0.00 ? 72  LEU B CA   1  
ATOM   2674   C C    . LEU B 1 72  ? 4.773   -14.125 -7.864  1.00 0.00 ? 72  LEU B C    1  
ATOM   2675   O O    . LEU B 1 72  ? 4.371   -13.039 -7.442  1.00 0.00 ? 72  LEU B O    1  
ATOM   2676   C CB   . LEU B 1 72  ? 3.127   -15.932 -8.350  1.00 0.00 ? 72  LEU B CB   1  
ATOM   2677   C CG   . LEU B 1 72  ? 2.166   -16.482 -9.408  1.00 0.00 ? 72  LEU B CG   1  
ATOM   2678   C CD1  . LEU B 1 72  ? 1.437   -17.703 -8.844  1.00 0.00 ? 72  LEU B CD1  1  
ATOM   2679   C CD2  . LEU B 1 72  ? 1.141   -15.405 -9.795  1.00 0.00 ? 72  LEU B CD2  1  
ATOM   2680   H H    . LEU B 1 72  ? 4.971   -16.491 -9.973  1.00 0.00 ? 72  LEU B H    1  
ATOM   2681   H HA   . LEU B 1 72  ? 3.420   -14.179 -9.525  1.00 0.00 ? 72  LEU B HA   1  
ATOM   2682   H HB2  . LEU B 1 72  ? 3.734   -16.739 -7.963  1.00 0.00 ? 72  LEU B HB2  1  
ATOM   2683   H HB3  . LEU B 1 72  ? 2.562   -15.492 -7.543  1.00 0.00 ? 72  LEU B HB3  1  
ATOM   2684   H HG   . LEU B 1 72  ? 2.729   -16.775 -10.283 1.00 0.00 ? 72  LEU B HG   1  
ATOM   2685   H HD11 . LEU B 1 72  ? 2.157   -18.389 -8.423  1.00 0.00 ? 72  LEU B HD11 1  
ATOM   2686   H HD12 . LEU B 1 72  ? 0.749   -17.387 -8.074  1.00 0.00 ? 72  LEU B HD12 1  
ATOM   2687   H HD13 . LEU B 1 72  ? 0.891   -18.194 -9.636  1.00 0.00 ? 72  LEU B HD13 1  
ATOM   2688   H HD21 . LEU B 1 72  ? 0.953   -14.760 -8.950  1.00 0.00 ? 72  LEU B HD21 1  
ATOM   2689   H HD22 . LEU B 1 72  ? 1.528   -14.819 -10.616 1.00 0.00 ? 72  LEU B HD22 1  
ATOM   2690   H HD23 . LEU B 1 72  ? 0.218   -15.877 -10.098 1.00 0.00 ? 72  LEU B HD23 1  
ATOM   2691   N N    . VAL B 1 73  ? 5.837   -14.746 -7.383  1.00 0.00 ? 73  VAL B N    1  
ATOM   2692   C CA   . VAL B 1 73  ? 6.646   -14.195 -6.299  1.00 0.00 ? 73  VAL B CA   1  
ATOM   2693   C C    . VAL B 1 73  ? 7.258   -12.833 -6.658  1.00 0.00 ? 73  VAL B C    1  
ATOM   2694   O O    . VAL B 1 73  ? 7.664   -12.070 -5.778  1.00 0.00 ? 73  VAL B O    1  
ATOM   2695   C CB   . VAL B 1 73  ? 7.778   -15.165 -5.953  1.00 0.00 ? 73  VAL B CB   1  
ATOM   2696   C CG1  . VAL B 1 73  ? 7.221   -16.582 -5.810  1.00 0.00 ? 73  VAL B CG1  1  
ATOM   2697   C CG2  . VAL B 1 73  ? 8.829   -15.136 -7.064  1.00 0.00 ? 73  VAL B CG2  1  
ATOM   2698   H H    . VAL B 1 73  ? 6.081   -15.613 -7.757  1.00 0.00 ? 73  VAL B H    1  
ATOM   2699   H HA   . VAL B 1 73  ? 6.023   -14.080 -5.425  1.00 0.00 ? 73  VAL B HA   1  
ATOM   2700   H HB   . VAL B 1 73  ? 8.233   -14.864 -5.020  1.00 0.00 ? 73  VAL B HB   1  
ATOM   2701   H HG11 . VAL B 1 73  ? 6.727   -16.870 -6.726  1.00 0.00 ? 73  VAL B HG11 1  
ATOM   2702   H HG12 . VAL B 1 73  ? 8.031   -17.268 -5.608  1.00 0.00 ? 73  VAL B HG12 1  
ATOM   2703   H HG13 . VAL B 1 73  ? 6.514   -16.611 -4.995  1.00 0.00 ? 73  VAL B HG13 1  
ATOM   2704   H HG21 . VAL B 1 73  ? 8.340   -15.017 -8.019  1.00 0.00 ? 73  VAL B HG21 1  
ATOM   2705   H HG22 . VAL B 1 73  ? 9.503   -14.308 -6.900  1.00 0.00 ? 73  VAL B HG22 1  
ATOM   2706   H HG23 . VAL B 1 73  ? 9.387   -16.061 -7.058  1.00 0.00 ? 73  VAL B HG23 1  
ATOM   2707   N N    . LEU B 1 74  ? 7.334   -12.544 -7.951  1.00 0.00 ? 74  LEU B N    1  
ATOM   2708   C CA   . LEU B 1 74  ? 7.904   -11.283 -8.397  1.00 0.00 ? 74  LEU B CA   1  
ATOM   2709   C C    . LEU B 1 74  ? 7.225   -10.144 -7.651  1.00 0.00 ? 74  LEU B C    1  
ATOM   2710   O O    . LEU B 1 74  ? 7.869   -9.178  -7.237  1.00 0.00 ? 74  LEU B O    1  
ATOM   2711   C CB   . LEU B 1 74  ? 7.692   -11.130 -9.912  1.00 0.00 ? 74  LEU B CB   1  
ATOM   2712   C CG   . LEU B 1 74  ? 8.104   -9.728  -10.396 1.00 0.00 ? 74  LEU B CG   1  
ATOM   2713   C CD1  . LEU B 1 74  ? 9.615   -9.535  -10.228 1.00 0.00 ? 74  LEU B CD1  1  
ATOM   2714   C CD2  . LEU B 1 74  ? 7.730   -9.568  -11.880 1.00 0.00 ? 74  LEU B CD2  1  
ATOM   2715   H H    . LEU B 1 74  ? 7.007   -13.189 -8.612  1.00 0.00 ? 74  LEU B H    1  
ATOM   2716   H HA   . LEU B 1 74  ? 8.960   -11.276 -8.178  1.00 0.00 ? 74  LEU B HA   1  
ATOM   2717   H HB2  . LEU B 1 74  ? 8.285   -11.872 -10.426 1.00 0.00 ? 74  LEU B HB2  1  
ATOM   2718   H HB3  . LEU B 1 74  ? 6.648   -11.292 -10.138 1.00 0.00 ? 74  LEU B HB3  1  
ATOM   2719   H HG   . LEU B 1 74  ? 7.584   -8.978  -9.819  1.00 0.00 ? 74  LEU B HG   1  
ATOM   2720   H HD11 . LEU B 1 74  ? 10.138  -10.366 -10.680 1.00 0.00 ? 74  LEU B HD11 1  
ATOM   2721   H HD12 . LEU B 1 74  ? 9.914   -8.617  -10.715 1.00 0.00 ? 74  LEU B HD12 1  
ATOM   2722   H HD13 . LEU B 1 74  ? 9.862   -9.480  -9.179  1.00 0.00 ? 74  LEU B HD13 1  
ATOM   2723   H HD21 . LEU B 1 74  ? 6.914   -10.231 -12.128 1.00 0.00 ? 74  LEU B HD21 1  
ATOM   2724   H HD22 . LEU B 1 74  ? 7.424   -8.547  -12.062 1.00 0.00 ? 74  LEU B HD22 1  
ATOM   2725   H HD23 . LEU B 1 74  ? 8.585   -9.804  -12.501 1.00 0.00 ? 74  LEU B HD23 1  
ATOM   2726   N N    . VAL B 1 75  ? 5.921   -10.273 -7.479  1.00 0.00 ? 75  VAL B N    1  
ATOM   2727   C CA   . VAL B 1 75  ? 5.139   -9.267  -6.778  1.00 0.00 ? 75  VAL B CA   1  
ATOM   2728   C C    . VAL B 1 75  ? 5.532   -9.193  -5.318  1.00 0.00 ? 75  VAL B C    1  
ATOM   2729   O O    . VAL B 1 75  ? 5.675   -8.116  -4.744  1.00 0.00 ? 75  VAL B O    1  
ATOM   2730   C CB   . VAL B 1 75  ? 3.661   -9.618  -6.858  1.00 0.00 ? 75  VAL B CB   1  
ATOM   2731   C CG1  . VAL B 1 75  ? 2.857   -8.648  -5.979  1.00 0.00 ? 75  VAL B CG1  1  
ATOM   2732   C CG2  . VAL B 1 75  ? 3.205   -9.522  -8.316  1.00 0.00 ? 75  VAL B CG2  1  
ATOM   2733   H H    . VAL B 1 75  ? 5.470   -11.071 -7.827  1.00 0.00 ? 75  VAL B H    1  
ATOM   2734   H HA   . VAL B 1 75  ? 5.298   -8.307  -7.237  1.00 0.00 ? 75  VAL B HA   1  
ATOM   2735   H HB   . VAL B 1 75  ? 3.516   -10.630 -6.501  1.00 0.00 ? 75  VAL B HB   1  
ATOM   2736   H HG11 . VAL B 1 75  ? 3.445   -7.768  -5.766  1.00 0.00 ? 75  VAL B HG11 1  
ATOM   2737   H HG12 . VAL B 1 75  ? 1.959   -8.359  -6.495  1.00 0.00 ? 75  VAL B HG12 1  
ATOM   2738   H HG13 . VAL B 1 75  ? 2.596   -9.136  -5.052  1.00 0.00 ? 75  VAL B HG13 1  
ATOM   2739   H HG21 . VAL B 1 75  ? 3.843   -10.139 -8.932  1.00 0.00 ? 75  VAL B HG21 1  
ATOM   2740   H HG22 . VAL B 1 75  ? 2.185   -9.865  -8.396  1.00 0.00 ? 75  VAL B HG22 1  
ATOM   2741   H HG23 . VAL B 1 75  ? 3.268   -8.496  -8.646  1.00 0.00 ? 75  VAL B HG23 1  
ATOM   2742   N N    . HIS B 1 76  ? 5.681   -10.354 -4.720  1.00 0.00 ? 76  HIS B N    1  
ATOM   2743   C CA   . HIS B 1 76  ? 6.028   -10.427 -3.322  1.00 0.00 ? 76  HIS B CA   1  
ATOM   2744   C C    . HIS B 1 76  ? 7.307   -9.629  -3.063  1.00 0.00 ? 76  HIS B C    1  
ATOM   2745   O O    . HIS B 1 76  ? 7.373   -8.829  -2.129  1.00 0.00 ? 76  HIS B O    1  
ATOM   2746   C CB   . HIS B 1 76  ? 6.205   -11.898 -2.931  1.00 0.00 ? 76  HIS B CB   1  
ATOM   2747   C CG   . HIS B 1 76  ? 5.894   -12.065 -1.477  1.00 0.00 ? 76  HIS B CG   1  
ATOM   2748   N ND1  . HIS B 1 76  ? 6.542   -11.323 -0.521  1.00 0.00 ? 76  HIS B ND1  1  
ATOM   2749   C CD2  . HIS B 1 76  ? 5.020   -12.878 -0.799  1.00 0.00 ? 76  HIS B CD2  1  
ATOM   2750   C CE1  . HIS B 1 76  ? 6.069   -11.694 0.679   1.00 0.00 ? 76  HIS B CE1  1  
ATOM   2751   N NE2  . HIS B 1 76  ? 5.135   -12.641 0.570   1.00 0.00 ? 76  HIS B NE2  1  
ATOM   2752   H H    . HIS B 1 76  ? 5.536   -11.182 -5.226  1.00 0.00 ? 76  HIS B H    1  
ATOM   2753   H HA   . HIS B 1 76  ? 5.223   -9.999  -2.739  1.00 0.00 ? 76  HIS B HA   1  
ATOM   2754   H HB2  . HIS B 1 76  ? 5.536   -12.510 -3.518  1.00 0.00 ? 76  HIS B HB2  1  
ATOM   2755   H HB3  . HIS B 1 76  ? 7.226   -12.200 -3.117  1.00 0.00 ? 76  HIS B HB3  1  
ATOM   2756   H HD1  . HIS B 1 76  ? 7.209   -10.634 -0.694  1.00 0.00 ? 76  HIS B HD1  1  
ATOM   2757   H HD2  . HIS B 1 76  ? 4.339   -13.583 -1.256  1.00 0.00 ? 76  HIS B HD2  1  
ATOM   2758   H HE1  . HIS B 1 76  ? 6.409   -11.283 1.616   1.00 0.00 ? 76  HIS B HE1  1  
ATOM   2759   N N    . ALA B 1 77  ? 8.308   -9.828  -3.914  1.00 0.00 ? 77  ALA B N    1  
ATOM   2760   C CA   . ALA B 1 77  ? 9.570   -9.100  -3.791  1.00 0.00 ? 77  ALA B CA   1  
ATOM   2761   C C    . ALA B 1 77  ? 9.375   -7.620  -4.142  1.00 0.00 ? 77  ALA B C    1  
ATOM   2762   O O    . ALA B 1 77  ? 9.944   -6.740  -3.495  1.00 0.00 ? 77  ALA B O    1  
ATOM   2763   C CB   . ALA B 1 77  ? 10.619  -9.717  -4.721  1.00 0.00 ? 77  ALA B CB   1  
ATOM   2764   H H    . ALA B 1 77  ? 8.192   -10.458 -4.649  1.00 0.00 ? 77  ALA B H    1  
ATOM   2765   H HA   . ALA B 1 77  ? 9.922   -9.174  -2.772  1.00 0.00 ? 77  ALA B HA   1  
ATOM   2766   H HB1  . ALA B 1 77  ? 11.153  -10.493 -4.195  1.00 0.00 ? 77  ALA B HB1  1  
ATOM   2767   H HB2  . ALA B 1 77  ? 10.125  -10.141 -5.583  1.00 0.00 ? 77  ALA B HB2  1  
ATOM   2768   H HB3  . ALA B 1 77  ? 11.314  -8.955  -5.044  1.00 0.00 ? 77  ALA B HB3  1  
ATOM   2769   N N    . GLN B 1 78  ? 8.576   -7.358  -5.174  1.00 0.00 ? 78  GLN B N    1  
ATOM   2770   C CA   . GLN B 1 78  ? 8.322   -5.984  -5.609  1.00 0.00 ? 78  GLN B CA   1  
ATOM   2771   C C    . GLN B 1 78  ? 7.603   -5.205  -4.511  1.00 0.00 ? 78  GLN B C    1  
ATOM   2772   O O    . GLN B 1 78  ? 7.979   -4.081  -4.180  1.00 0.00 ? 78  GLN B O    1  
ATOM   2773   C CB   . GLN B 1 78  ? 7.465   -5.999  -6.876  1.00 0.00 ? 78  GLN B CB   1  
ATOM   2774   C CG   . GLN B 1 78  ? 7.547   -4.638  -7.569  1.00 0.00 ? 78  GLN B CG   1  
ATOM   2775   C CD   . GLN B 1 78  ? 6.658   -4.636  -8.808  1.00 0.00 ? 78  GLN B CD   1  
ATOM   2776   O OE1  . GLN B 1 78  ? 6.000   -5.634  -9.103  1.00 0.00 ? 78  GLN B OE1  1  
ATOM   2777   N NE2  . GLN B 1 78  ? 6.598   -3.569  -9.556  1.00 0.00 ? 78  GLN B NE2  1  
ATOM   2778   H H    . GLN B 1 78  ? 8.154   -8.101  -5.657  1.00 0.00 ? 78  GLN B H    1  
ATOM   2779   H HA   . GLN B 1 78  ? 9.263   -5.503  -5.828  1.00 0.00 ? 78  GLN B HA   1  
ATOM   2780   H HB2  . GLN B 1 78  ? 7.826   -6.766  -7.546  1.00 0.00 ? 78  GLN B HB2  1  
ATOM   2781   H HB3  . GLN B 1 78  ? 6.438   -6.205  -6.613  1.00 0.00 ? 78  GLN B HB3  1  
ATOM   2782   H HG2  . GLN B 1 78  ? 7.221   -3.868  -6.887  1.00 0.00 ? 78  GLN B HG2  1  
ATOM   2783   H HG3  . GLN B 1 78  ? 8.568   -4.448  -7.863  1.00 0.00 ? 78  GLN B HG3  1  
ATOM   2784   H HE21 . GLN B 1 78  ? 7.122   -2.776  -9.321  1.00 0.00 ? 78  GLN B HE21 1  
ATOM   2785   H HE22 . GLN B 1 78  ? 6.028   -3.561  -10.354 1.00 0.00 ? 78  GLN B HE22 1  
ATOM   2786   N N    . LEU B 1 79  ? 6.573   -5.823  -3.950  1.00 0.00 ? 79  LEU B N    1  
ATOM   2787   C CA   . LEU B 1 79  ? 5.796   -5.202  -2.879  1.00 0.00 ? 79  LEU B CA   1  
ATOM   2788   C C    . LEU B 1 79  ? 6.690   -4.819  -1.704  1.00 0.00 ? 79  LEU B C    1  
ATOM   2789   O O    . LEU B 1 79  ? 6.633   -3.695  -1.216  1.00 0.00 ? 79  LEU B O    1  
ATOM   2790   C CB   . LEU B 1 79  ? 4.703   -6.170  -2.396  1.00 0.00 ? 79  LEU B CB   1  
ATOM   2791   C CG   . LEU B 1 79  ? 3.936   -5.570  -1.202  1.00 0.00 ? 79  LEU B CG   1  
ATOM   2792   C CD1  . LEU B 1 79  ? 3.382   -4.193  -1.582  1.00 0.00 ? 79  LEU B CD1  1  
ATOM   2793   C CD2  . LEU B 1 79  ? 2.783   -6.510  -0.803  1.00 0.00 ? 79  LEU B CD2  1  
ATOM   2794   H H    . LEU B 1 79  ? 6.325   -6.716  -4.272  1.00 0.00 ? 79  LEU B H    1  
ATOM   2795   H HA   . LEU B 1 79  ? 5.330   -4.309  -3.262  1.00 0.00 ? 79  LEU B HA   1  
ATOM   2796   H HB2  . LEU B 1 79  ? 4.017   -6.362  -3.205  1.00 0.00 ? 79  LEU B HB2  1  
ATOM   2797   H HB3  . LEU B 1 79  ? 5.163   -7.100  -2.091  1.00 0.00 ? 79  LEU B HB3  1  
ATOM   2798   H HG   . LEU B 1 79  ? 4.610   -5.459  -0.363  1.00 0.00 ? 79  LEU B HG   1  
ATOM   2799   H HD11 . LEU B 1 79  ? 3.098   -4.193  -2.623  1.00 0.00 ? 79  LEU B HD11 1  
ATOM   2800   H HD12 . LEU B 1 79  ? 2.518   -3.971  -0.974  1.00 0.00 ? 79  LEU B HD12 1  
ATOM   2801   H HD13 . LEU B 1 79  ? 4.143   -3.444  -1.414  1.00 0.00 ? 79  LEU B HD13 1  
ATOM   2802   H HD21 . LEU B 1 79  ? 2.350   -6.954  -1.689  1.00 0.00 ? 79  LEU B HD21 1  
ATOM   2803   H HD22 . LEU B 1 79  ? 3.164   -7.291  -0.164  1.00 0.00 ? 79  LEU B HD22 1  
ATOM   2804   H HD23 . LEU B 1 79  ? 2.024   -5.952  -0.272  1.00 0.00 ? 79  LEU B HD23 1  
ATOM   2805   N N    . HIS B 1 80  ? 7.509   -5.756  -1.253  1.00 0.00 ? 80  HIS B N    1  
ATOM   2806   C CA   . HIS B 1 80  ? 8.392   -5.489  -0.126  1.00 0.00 ? 80  HIS B CA   1  
ATOM   2807   C C    . HIS B 1 80  ? 9.447   -4.450  -0.491  1.00 0.00 ? 80  HIS B C    1  
ATOM   2808   O O    . HIS B 1 80  ? 9.711   -3.522  0.276   1.00 0.00 ? 80  HIS B O    1  
ATOM   2809   C CB   . HIS B 1 80  ? 9.043   -6.788  0.345   1.00 0.00 ? 80  HIS B CB   1  
ATOM   2810   C CG   . HIS B 1 80  ? 8.172   -7.406  1.413   1.00 0.00 ? 80  HIS B CG   1  
ATOM   2811   N ND1  . HIS B 1 80  ? 8.512   -7.370  2.756   1.00 0.00 ? 80  HIS B ND1  1  
ATOM   2812   C CD2  . HIS B 1 80  ? 6.978   -8.079  1.345   1.00 0.00 ? 80  HIS B CD2  1  
ATOM   2813   C CE1  . HIS B 1 80  ? 7.540   -8.005  3.436   1.00 0.00 ? 80  HIS B CE1  1  
ATOM   2814   N NE2  . HIS B 1 80  ? 6.580   -8.457  2.623   1.00 0.00 ? 80  HIS B NE2  1  
ATOM   2815   H H    . HIS B 1 80  ? 7.514   -6.644  -1.680  1.00 0.00 ? 80  HIS B H    1  
ATOM   2816   H HA   . HIS B 1 80  ? 7.802   -5.102  0.689   1.00 0.00 ? 80  HIS B HA   1  
ATOM   2817   H HB2  . HIS B 1 80  ? 9.135   -7.468  -0.488  1.00 0.00 ? 80  HIS B HB2  1  
ATOM   2818   H HB3  . HIS B 1 80  ? 10.020  -6.579  0.753   1.00 0.00 ? 80  HIS B HB3  1  
ATOM   2819   H HD1  . HIS B 1 80  ? 9.315   -6.959  3.139   1.00 0.00 ? 80  HIS B HD1  1  
ATOM   2820   H HD2  . HIS B 1 80  ? 6.430   -8.284  0.436   1.00 0.00 ? 80  HIS B HD2  1  
ATOM   2821   H HE1  . HIS B 1 80  ? 7.538   -8.138  4.507   1.00 0.00 ? 80  HIS B HE1  1  
ATOM   2822   H HE2  . HIS B 1 80  ? 5.772   -8.951  2.874   1.00 0.00 ? 80  HIS B HE2  1  
ATOM   2823   N N    . LEU B 1 81  ? 10.053  -4.615  -1.655  1.00 0.00 ? 81  LEU B N    1  
ATOM   2824   C CA   . LEU B 1 81  ? 11.088  -3.686  -2.103  1.00 0.00 ? 81  LEU B CA   1  
ATOM   2825   C C    . LEU B 1 81  ? 10.532  -2.278  -2.319  1.00 0.00 ? 81  LEU B C    1  
ATOM   2826   O O    . LEU B 1 81  ? 11.148  -1.289  -1.903  1.00 0.00 ? 81  LEU B O    1  
ATOM   2827   C CB   . LEU B 1 81  ? 11.718  -4.192  -3.401  1.00 0.00 ? 81  LEU B CB   1  
ATOM   2828   C CG   . LEU B 1 81  ? 12.551  -5.450  -3.122  1.00 0.00 ? 81  LEU B CG   1  
ATOM   2829   C CD1  . LEU B 1 81  ? 12.937  -6.107  -4.449  1.00 0.00 ? 81  LEU B CD1  1  
ATOM   2830   C CD2  . LEU B 1 81  ? 13.824  -5.088  -2.337  1.00 0.00 ? 81  LEU B CD2  1  
ATOM   2831   H H    . LEU B 1 81  ? 9.807   -5.378  -2.223  1.00 0.00 ? 81  LEU B H    1  
ATOM   2832   H HA   . LEU B 1 81  ? 11.852  -3.637  -1.345  1.00 0.00 ? 81  LEU B HA   1  
ATOM   2833   H HB2  . LEU B 1 81  ? 10.931  -4.429  -4.108  1.00 0.00 ? 81  LEU B HB2  1  
ATOM   2834   H HB3  . LEU B 1 81  ? 12.351  -3.423  -3.817  1.00 0.00 ? 81  LEU B HB3  1  
ATOM   2835   H HG   . LEU B 1 81  ? 11.958  -6.144  -2.544  1.00 0.00 ? 81  LEU B HG   1  
ATOM   2836   H HD11 . LEU B 1 81  ? 13.208  -5.347  -5.165  1.00 0.00 ? 81  LEU B HD11 1  
ATOM   2837   H HD12 . LEU B 1 81  ? 13.774  -6.771  -4.294  1.00 0.00 ? 81  LEU B HD12 1  
ATOM   2838   H HD13 . LEU B 1 81  ? 12.096  -6.671  -4.827  1.00 0.00 ? 81  LEU B HD13 1  
ATOM   2839   H HD21 . LEU B 1 81  ? 14.183  -4.117  -2.646  1.00 0.00 ? 81  LEU B HD21 1  
ATOM   2840   H HD22 . LEU B 1 81  ? 13.604  -5.069  -1.279  1.00 0.00 ? 81  LEU B HD22 1  
ATOM   2841   H HD23 . LEU B 1 81  ? 14.586  -5.830  -2.530  1.00 0.00 ? 81  LEU B HD23 1  
ATOM   2842   N N    . MET B 1 82  ? 9.378   -2.182  -2.972  1.00 0.00 ? 82  MET B N    1  
ATOM   2843   C CA   . MET B 1 82  ? 8.770   -0.879  -3.232  1.00 0.00 ? 82  MET B CA   1  
ATOM   2844   C C    . MET B 1 82  ? 8.430   -0.172  -1.923  1.00 0.00 ? 82  MET B C    1  
ATOM   2845   O O    . MET B 1 82  ? 8.687   1.024   -1.758  1.00 0.00 ? 82  MET B O    1  
ATOM   2846   C CB   . MET B 1 82  ? 7.493   -1.051  -4.064  1.00 0.00 ? 82  MET B CB   1  
ATOM   2847   C CG   . MET B 1 82  ? 7.848   -1.362  -5.525  1.00 0.00 ? 82  MET B CG   1  
ATOM   2848   S SD   . MET B 1 82  ? 8.668   0.066   -6.287  1.00 0.00 ? 82  MET B SD   1  
ATOM   2849   C CE   . MET B 1 82  ? 7.212   1.129   -6.466  1.00 0.00 ? 82  MET B CE   1  
ATOM   2850   H H    . MET B 1 82  ? 8.929   -2.999  -3.282  1.00 0.00 ? 82  MET B H    1  
ATOM   2851   H HA   . MET B 1 82  ? 9.470   -0.274  -3.782  1.00 0.00 ? 82  MET B HA   1  
ATOM   2852   H HB2  . MET B 1 82  ? 6.910   -1.866  -3.658  1.00 0.00 ? 82  MET B HB2  1  
ATOM   2853   H HB3  . MET B 1 82  ? 6.911   -0.142  -4.022  1.00 0.00 ? 82  MET B HB3  1  
ATOM   2854   H HG2  . MET B 1 82  ? 8.510   -2.216  -5.557  1.00 0.00 ? 82  MET B HG2  1  
ATOM   2855   H HG3  . MET B 1 82  ? 6.943   -1.593  -6.070  1.00 0.00 ? 82  MET B HG3  1  
ATOM   2856   H HE1  . MET B 1 82  ? 6.353   0.527   -6.729  1.00 0.00 ? 82  MET B HE1  1  
ATOM   2857   H HE2  . MET B 1 82  ? 7.019   1.636   -5.535  1.00 0.00 ? 82  MET B HE2  1  
ATOM   2858   H HE3  . MET B 1 82  ? 7.394   1.862   -7.241  1.00 0.00 ? 82  MET B HE3  1  
ATOM   2859   N N    . THR B 1 83  ? 7.852   -0.921  -0.993  1.00 0.00 ? 83  THR B N    1  
ATOM   2860   C CA   . THR B 1 83  ? 7.478   -0.365  0.304   1.00 0.00 ? 83  THR B CA   1  
ATOM   2861   C C    . THR B 1 83  ? 8.712   0.101   1.068   1.00 0.00 ? 83  THR B C    1  
ATOM   2862   O O    . THR B 1 83  ? 8.743   1.208   1.613   1.00 0.00 ? 83  THR B O    1  
ATOM   2863   C CB   . THR B 1 83  ? 6.737   -1.421  1.137   1.00 0.00 ? 83  THR B CB   1  
ATOM   2864   O OG1  . THR B 1 83  ? 7.440   -2.649  1.064   1.00 0.00 ? 83  THR B OG1  1  
ATOM   2865   C CG2  . THR B 1 83  ? 5.312   -1.621  0.605   1.00 0.00 ? 83  THR B CG2  1  
ATOM   2866   H H    . THR B 1 83  ? 7.677   -1.871  -1.177  1.00 0.00 ? 83  THR B H    1  
ATOM   2867   H HA   . THR B 1 83  ? 6.828   0.478   0.149   1.00 0.00 ? 83  THR B HA   1  
ATOM   2868   H HB   . THR B 1 83  ? 6.692   -1.097  2.167   1.00 0.00 ? 83  THR B HB   1  
ATOM   2869   H HG1  . THR B 1 83  ? 7.447   -3.047  1.937   1.00 0.00 ? 83  THR B HG1  1  
ATOM   2870   H HG21 . THR B 1 83  ? 5.265   -1.333  -0.433  1.00 0.00 ? 83  THR B HG21 1  
ATOM   2871   H HG22 . THR B 1 83  ? 5.038   -2.661  0.698   1.00 0.00 ? 83  THR B HG22 1  
ATOM   2872   H HG23 . THR B 1 83  ? 4.625   -1.017  1.180   1.00 0.00 ? 83  THR B HG23 1  
ATOM   2873   N N    . SER B 1 84  ? 9.729   -0.751  1.117   1.00 0.00 ? 84  SER B N    1  
ATOM   2874   C CA   . SER B 1 84  ? 10.962  -0.417  1.835   1.00 0.00 ? 84  SER B CA   1  
ATOM   2875   C C    . SER B 1 84  ? 11.659  0.800   1.230   1.00 0.00 ? 84  SER B C    1  
ATOM   2876   O O    . SER B 1 84  ? 12.064  1.714   1.954   1.00 0.00 ? 84  SER B O    1  
ATOM   2877   C CB   . SER B 1 84  ? 11.917  -1.612  1.824   1.00 0.00 ? 84  SER B CB   1  
ATOM   2878   O OG   . SER B 1 84  ? 11.442  -2.595  2.736   1.00 0.00 ? 84  SER B OG   1  
ATOM   2879   H H    . SER B 1 84  ? 9.649   -1.623  0.670   1.00 0.00 ? 84  SER B H    1  
ATOM   2880   H HA   . SER B 1 84  ? 10.710  -0.193  2.859   1.00 0.00 ? 84  SER B HA   1  
ATOM   2881   H HB2  . SER B 1 84  ? 11.962  -2.037  0.834   1.00 0.00 ? 84  SER B HB2  1  
ATOM   2882   H HB3  . SER B 1 84  ? 12.909  -1.285  2.116   1.00 0.00 ? 84  SER B HB3  1  
ATOM   2883   H HG   . SER B 1 84  ? 10.632  -2.972  2.375   1.00 0.00 ? 84  SER B HG   1  
ATOM   2884   N N    . MET B 1 85  ? 11.804  0.818   -0.092  1.00 0.00 ? 85  MET B N    1  
ATOM   2885   C CA   . MET B 1 85  ? 12.461  1.943   -0.761  1.00 0.00 ? 85  MET B CA   1  
ATOM   2886   C C    . MET B 1 85  ? 11.723  3.251   -0.492  1.00 0.00 ? 85  MET B C    1  
ATOM   2887   O O    . MET B 1 85  ? 12.338  4.270   -0.169  1.00 0.00 ? 85  MET B O    1  
ATOM   2888   C CB   . MET B 1 85  ? 12.537  1.679   -2.268  1.00 0.00 ? 85  MET B CB   1  
ATOM   2889   C CG   . MET B 1 85  ? 13.399  2.755   -2.934  1.00 0.00 ? 85  MET B CG   1  
ATOM   2890   S SD   . MET B 1 85  ? 13.785  2.267   -4.637  1.00 0.00 ? 85  MET B SD   1  
ATOM   2891   C CE   . MET B 1 85  ? 12.187  2.668   -5.386  1.00 0.00 ? 85  MET B CE   1  
ATOM   2892   H H    . MET B 1 85  ? 11.464  0.067   -0.629  1.00 0.00 ? 85  MET B H    1  
ATOM   2893   H HA   . MET B 1 85  ? 13.464  2.030   -0.378  1.00 0.00 ? 85  MET B HA   1  
ATOM   2894   H HB2  . MET B 1 85  ? 12.974  0.706   -2.442  1.00 0.00 ? 85  MET B HB2  1  
ATOM   2895   H HB3  . MET B 1 85  ? 11.543  1.706   -2.687  1.00 0.00 ? 85  MET B HB3  1  
ATOM   2896   H HG2  . MET B 1 85  ? 12.861  3.691   -2.942  1.00 0.00 ? 85  MET B HG2  1  
ATOM   2897   H HG3  . MET B 1 85  ? 14.317  2.874   -2.377  1.00 0.00 ? 85  MET B HG3  1  
ATOM   2898   H HE1  . MET B 1 85  ? 11.409  2.092   -4.914  1.00 0.00 ? 85  MET B HE1  1  
ATOM   2899   H HE2  . MET B 1 85  ? 11.984  3.722   -5.256  1.00 0.00 ? 85  MET B HE2  1  
ATOM   2900   H HE3  . MET B 1 85  ? 12.218  2.430   -6.441  1.00 0.00 ? 85  MET B HE3  1  
ATOM   2901   N N    . LEU B 1 86  ? 10.407  3.213   -0.631  1.00 0.00 ? 86  LEU B N    1  
ATOM   2902   C CA   . LEU B 1 86  ? 9.587   4.397   -0.407  1.00 0.00 ? 86  LEU B CA   1  
ATOM   2903   C C    . LEU B 1 86  ? 9.715   4.874   1.034   1.00 0.00 ? 86  LEU B C    1  
ATOM   2904   O O    . LEU B 1 86  ? 9.908   6.062   1.306   1.00 0.00 ? 86  LEU B O    1  
ATOM   2905   C CB   . LEU B 1 86  ? 8.126   4.060   -0.709  1.00 0.00 ? 86  LEU B CB   1  
ATOM   2906   C CG   . LEU B 1 86  ? 7.303   5.352   -0.791  1.00 0.00 ? 86  LEU B CG   1  
ATOM   2907   C CD1  . LEU B 1 86  ? 7.588   6.084   -2.120  1.00 0.00 ? 86  LEU B CD1  1  
ATOM   2908   C CD2  . LEU B 1 86  ? 5.806   5.016   -0.684  1.00 0.00 ? 86  LEU B CD2  1  
ATOM   2909   H H    . LEU B 1 86  ? 9.975   2.369   -0.887  1.00 0.00 ? 86  LEU B H    1  
ATOM   2910   H HA   . LEU B 1 86  ? 9.915   5.182   -1.069  1.00 0.00 ? 86  LEU B HA   1  
ATOM   2911   H HB2  . LEU B 1 86  ? 8.069   3.525   -1.645  1.00 0.00 ? 86  LEU B HB2  1  
ATOM   2912   H HB3  . LEU B 1 86  ? 7.738   3.436   0.085   1.00 0.00 ? 86  LEU B HB3  1  
ATOM   2913   H HG   . LEU B 1 86  ? 7.581   5.997   0.033   1.00 0.00 ? 86  LEU B HG   1  
ATOM   2914   H HD11 . LEU B 1 86  ? 8.357   5.560   -2.669  1.00 0.00 ? 86  LEU B HD11 1  
ATOM   2915   H HD12 . LEU B 1 86  ? 6.685   6.127   -2.714  1.00 0.00 ? 86  LEU B HD12 1  
ATOM   2916   H HD13 . LEU B 1 86  ? 7.923   7.088   -1.908  1.00 0.00 ? 86  LEU B HD13 1  
ATOM   2917   H HD21 . LEU B 1 86  ? 5.654   4.263   0.079   1.00 0.00 ? 86  LEU B HD21 1  
ATOM   2918   H HD22 . LEU B 1 86  ? 5.257   5.908   -0.414  1.00 0.00 ? 86  LEU B HD22 1  
ATOM   2919   H HD23 . LEU B 1 86  ? 5.446   4.648   -1.630  1.00 0.00 ? 86  LEU B HD23 1  
ATOM   2920   N N    . ALA B 1 87  ? 9.598   3.934   1.958   1.00 0.00 ? 87  ALA B N    1  
ATOM   2921   C CA   . ALA B 1 87  ? 9.695   4.245   3.379   1.00 0.00 ? 87  ALA B CA   1  
ATOM   2922   C C    . ALA B 1 87  ? 11.027  4.911   3.690   1.00 0.00 ? 87  ALA B C    1  
ATOM   2923   O O    . ALA B 1 87  ? 11.093  5.942   4.364   1.00 0.00 ? 87  ALA B O    1  
ATOM   2924   C CB   . ALA B 1 87  ? 9.560   2.955   4.204   1.00 0.00 ? 87  ALA B CB   1  
ATOM   2925   H H    . ALA B 1 87  ? 9.445   3.004   1.677   1.00 0.00 ? 87  ALA B H    1  
ATOM   2926   H HA   . ALA B 1 87  ? 8.899   4.919   3.647   1.00 0.00 ? 87  ALA B HA   1  
ATOM   2927   H HB1  . ALA B 1 87  ? 9.702   2.098   3.560   1.00 0.00 ? 87  ALA B HB1  1  
ATOM   2928   H HB2  . ALA B 1 87  ? 10.307  2.940   4.990   1.00 0.00 ? 87  ALA B HB2  1  
ATOM   2929   H HB3  . ALA B 1 87  ? 8.578   2.911   4.646   1.00 0.00 ? 87  ALA B HB3  1  
ATOM   2930   N N    . ARG B 1 88  ? 12.092  4.308   3.197   1.00 0.00 ? 88  ARG B N    1  
ATOM   2931   C CA   . ARG B 1 88  ? 13.427  4.836   3.434   1.00 0.00 ? 88  ARG B CA   1  
ATOM   2932   C C    . ARG B 1 88  ? 13.555  6.260   2.886   1.00 0.00 ? 88  ARG B C    1  
ATOM   2933   O O    . ARG B 1 88  ? 14.111  7.137   3.551   1.00 0.00 ? 88  ARG B O    1  
ATOM   2934   C CB   . ARG B 1 88  ? 14.470  3.909   2.798   1.00 0.00 ? 88  ARG B CB   1  
ATOM   2935   C CG   . ARG B 1 88  ? 15.890  4.289   3.273   1.00 0.00 ? 88  ARG B CG   1  
ATOM   2936   C CD   . ARG B 1 88  ? 16.878  4.209   2.104   1.00 0.00 ? 88  ARG B CD   1  
ATOM   2937   N NE   . ARG B 1 88  ? 17.764  5.373   2.123   1.00 0.00 ? 88  ARG B NE   1  
ATOM   2938   C CZ   . ARG B 1 88  ? 17.289  6.597   1.984   1.00 0.00 ? 88  ARG B CZ   1  
ATOM   2939   N NH1  . ARG B 1 88  ? 16.012  6.783   1.907   1.00 0.00 ? 88  ARG B NH1  1  
ATOM   2940   N NH2  . ARG B 1 88  ? 18.096  7.603   1.958   1.00 0.00 ? 88  ARG B NH2  1  
ATOM   2941   H H    . ARG B 1 88  ? 11.981  3.490   2.666   1.00 0.00 ? 88  ARG B H    1  
ATOM   2942   H HA   . ARG B 1 88  ? 13.592  4.865   4.499   1.00 0.00 ? 88  ARG B HA   1  
ATOM   2943   H HB2  . ARG B 1 88  ? 14.256  2.890   3.095   1.00 0.00 ? 88  ARG B HB2  1  
ATOM   2944   H HB3  . ARG B 1 88  ? 14.411  3.983   1.722   1.00 0.00 ? 88  ARG B HB3  1  
ATOM   2945   H HG2  . ARG B 1 88  ? 15.886  5.294   3.669   1.00 0.00 ? 88  ARG B HG2  1  
ATOM   2946   H HG3  . ARG B 1 88  ? 16.204  3.604   4.047   1.00 0.00 ? 88  ARG B HG3  1  
ATOM   2947   H HD2  . ARG B 1 88  ? 17.470  3.306   2.201   1.00 0.00 ? 88  ARG B HD2  1  
ATOM   2948   H HD3  . ARG B 1 88  ? 16.335  4.179   1.168   1.00 0.00 ? 88  ARG B HD3  1  
ATOM   2949   H HE   . ARG B 1 88  ? 18.731  5.239   2.215   1.00 0.00 ? 88  ARG B HE   1  
ATOM   2950   H HH11 . ARG B 1 88  ? 15.393  5.998   1.937   1.00 0.00 ? 88  ARG B HH11 1  
ATOM   2951   H HH12 . ARG B 1 88  ? 15.642  7.702   1.806   1.00 0.00 ? 88  ARG B HH12 1  
ATOM   2952   H HH21 . ARG B 1 88  ? 19.080  7.457   2.021   1.00 0.00 ? 88  ARG B HH21 1  
ATOM   2953   H HH22 . ARG B 1 88  ? 17.731  8.531   1.878   1.00 0.00 ? 88  ARG B HH22 1  
ATOM   2954   N N    . GLU B 1 89  ? 13.054  6.495   1.676   1.00 0.00 ? 89  GLU B N    1  
ATOM   2955   C CA   . GLU B 1 89  ? 13.137  7.834   1.083   1.00 0.00 ? 89  GLU B CA   1  
ATOM   2956   C C    . GLU B 1 89  ? 12.402  8.853   1.946   1.00 0.00 ? 89  GLU B C    1  
ATOM   2957   O O    . GLU B 1 89  ? 12.920  9.934   2.222   1.00 0.00 ? 89  GLU B O    1  
ATOM   2958   C CB   . GLU B 1 89  ? 12.540  7.837   -0.325  1.00 0.00 ? 89  GLU B CB   1  
ATOM   2959   C CG   . GLU B 1 89  ? 12.743  9.213   -0.981  1.00 0.00 ? 89  GLU B CG   1  
ATOM   2960   C CD   . GLU B 1 89  ? 12.249  9.178   -2.426  1.00 0.00 ? 89  GLU B CD   1  
ATOM   2961   O OE1  . GLU B 1 89  ? 11.674  8.172   -2.817  1.00 0.00 ? 89  GLU B OE1  1  
ATOM   2962   O OE2  . GLU B 1 89  ? 12.450  10.156  -3.120  1.00 0.00 ? 89  GLU B OE2  1  
ATOM   2963   H H    . GLU B 1 89  ? 12.620  5.765   1.176   1.00 0.00 ? 89  GLU B H    1  
ATOM   2964   H HA   . GLU B 1 89  ? 14.171  8.122   1.019   1.00 0.00 ? 89  GLU B HA   1  
ATOM   2965   H HB2  . GLU B 1 89  ? 13.025  7.083   -0.929  1.00 0.00 ? 89  GLU B HB2  1  
ATOM   2966   H HB3  . GLU B 1 89  ? 11.481  7.627   -0.270  1.00 0.00 ? 89  GLU B HB3  1  
ATOM   2967   H HG2  . GLU B 1 89  ? 12.187  9.963   -0.433  1.00 0.00 ? 89  GLU B HG2  1  
ATOM   2968   H HG3  . GLU B 1 89  ? 13.790  9.470   -0.970  1.00 0.00 ? 89  GLU B HG3  1  
ATOM   2969   N N    . LEU B 1 90  ? 11.206  8.499   2.386   1.00 0.00 ? 90  LEU B N    1  
ATOM   2970   C CA   . LEU B 1 90  ? 10.424  9.399   3.224   1.00 0.00 ? 90  LEU B CA   1  
ATOM   2971   C C    . LEU B 1 90  ? 11.125  9.612   4.559   1.00 0.00 ? 90  LEU B C    1  
ATOM   2972   O O    . LEU B 1 90  ? 11.201  10.733  5.072   1.00 0.00 ? 90  LEU B O    1  
ATOM   2973   C CB   . LEU B 1 90  ? 9.037   8.809   3.428   1.00 0.00 ? 90  LEU B CB   1  
ATOM   2974   C CG   . LEU B 1 90  ? 8.277   8.861   2.096   1.00 0.00 ? 90  LEU B CG   1  
ATOM   2975   C CD1  . LEU B 1 90  ? 7.049   7.966   2.194   1.00 0.00 ? 90  LEU B CD1  1  
ATOM   2976   C CD2  . LEU B 1 90  ? 7.841   10.303  1.779   1.00 0.00 ? 90  LEU B CD2  1  
ATOM   2977   H H    . LEU B 1 90  ? 10.841  7.618   2.149   1.00 0.00 ? 90  LEU B H    1  
ATOM   2978   H HA   . LEU B 1 90  ? 10.331  10.352  2.725   1.00 0.00 ? 90  LEU B HA   1  
ATOM   2979   H HB2  . LEU B 1 90  ? 9.132   7.781   3.752   1.00 0.00 ? 90  LEU B HB2  1  
ATOM   2980   H HB3  . LEU B 1 90  ? 8.504   9.377   4.175   1.00 0.00 ? 90  LEU B HB3  1  
ATOM   2981   H HG   . LEU B 1 90  ? 8.920   8.497   1.306   1.00 0.00 ? 90  LEU B HG   1  
ATOM   2982   H HD11 . LEU B 1 90  ? 6.541   8.161   3.126   1.00 0.00 ? 90  LEU B HD11 1  
ATOM   2983   H HD12 . LEU B 1 90  ? 6.386   8.172   1.369   1.00 0.00 ? 90  LEU B HD12 1  
ATOM   2984   H HD13 . LEU B 1 90  ? 7.357   6.930   2.161   1.00 0.00 ? 90  LEU B HD13 1  
ATOM   2985   H HD21 . LEU B 1 90  ? 7.644   10.839  2.693   1.00 0.00 ? 90  LEU B HD21 1  
ATOM   2986   H HD22 . LEU B 1 90  ? 8.630   10.805  1.233   1.00 0.00 ? 90  LEU B HD22 1  
ATOM   2987   H HD23 . LEU B 1 90  ? 6.945   10.285  1.172   1.00 0.00 ? 90  LEU B HD23 1  
ATOM   2988   N N    . ILE B 1 91  ? 11.665  8.530   5.106   1.00 0.00 ? 91  ILE B N    1  
ATOM   2989   C CA   . ILE B 1 91  ? 12.391  8.618   6.368   1.00 0.00 ? 91  ILE B CA   1  
ATOM   2990   C C    . ILE B 1 91  ? 13.574  9.566   6.203   1.00 0.00 ? 91  ILE B C    1  
ATOM   2991   O O    . ILE B 1 91  ? 13.858  10.379  7.084   1.00 0.00 ? 91  ILE B O    1  
ATOM   2992   C CB   . ILE B 1 91  ? 12.835  7.219   6.822   1.00 0.00 ? 91  ILE B CB   1  
ATOM   2993   C CG1  . ILE B 1 91  ? 11.589  6.460   7.302   1.00 0.00 ? 91  ILE B CG1  1  
ATOM   2994   C CG2  . ILE B 1 91  ? 13.855  7.328   7.973   1.00 0.00 ? 91  ILE B CG2  1  
ATOM   2995   C CD1  . ILE B 1 91  ? 11.898  4.972   7.459   1.00 0.00 ? 91  ILE B CD1  1  
ATOM   2996   H H    . ILE B 1 91  ? 11.590  7.669   4.647   1.00 0.00 ? 91  ILE B H    1  
ATOM   2997   H HA   . ILE B 1 91  ? 11.733  9.033   7.115   1.00 0.00 ? 91  ILE B HA   1  
ATOM   2998   H HB   . ILE B 1 91  ? 13.283  6.692   5.991   1.00 0.00 ? 91  ILE B HB   1  
ATOM   2999   H HG12 . ILE B 1 91  ? 11.267  6.862   8.251   1.00 0.00 ? 91  ILE B HG12 1  
ATOM   3000   H HG13 . ILE B 1 91  ? 10.796  6.582   6.575   1.00 0.00 ? 91  ILE B HG13 1  
ATOM   3001   H HG21 . ILE B 1 91  ? 13.680  8.236   8.530   1.00 0.00 ? 91  ILE B HG21 1  
ATOM   3002   H HG22 . ILE B 1 91  ? 13.753  6.477   8.631   1.00 0.00 ? 91  ILE B HG22 1  
ATOM   3003   H HG23 . ILE B 1 91  ? 14.857  7.346   7.565   1.00 0.00 ? 91  ILE B HG23 1  
ATOM   3004   H HD11 . ILE B 1 91  ? 12.904  4.848   7.826   1.00 0.00 ? 91  ILE B HD11 1  
ATOM   3005   H HD12 . ILE B 1 91  ? 11.202  4.538   8.164   1.00 0.00 ? 91  ILE B HD12 1  
ATOM   3006   H HD13 . ILE B 1 91  ? 11.795  4.479   6.504   1.00 0.00 ? 91  ILE B HD13 1  
ATOM   3007   N N    . THR B 1 92  ? 14.234  9.501   5.048   1.00 0.00 ? 92  THR B N    1  
ATOM   3008   C CA   . THR B 1 92  ? 15.350  10.406  4.780   1.00 0.00 ? 92  THR B CA   1  
ATOM   3009   C C    . THR B 1 92  ? 14.860  11.848  4.876   1.00 0.00 ? 92  THR B C    1  
ATOM   3010   O O    . THR B 1 92  ? 15.493  12.692  5.513   1.00 0.00 ? 92  THR B O    1  
ATOM   3011   C CB   . THR B 1 92  ? 15.933  10.138  3.384   1.00 0.00 ? 92  THR B CB   1  
ATOM   3012   O OG1  . THR B 1 92  ? 16.586  8.881   3.377   1.00 0.00 ? 92  THR B OG1  1  
ATOM   3013   C CG2  . THR B 1 92  ? 16.936  11.232  3.005   1.00 0.00 ? 92  THR B CG2  1  
ATOM   3014   H H    . THR B 1 92  ? 13.949  8.861   4.363   1.00 0.00 ? 92  THR B H    1  
ATOM   3015   H HA   . THR B 1 92  ? 16.117  10.250  5.522   1.00 0.00 ? 92  THR B HA   1  
ATOM   3016   H HB   . THR B 1 92  ? 15.130  10.127  2.661   1.00 0.00 ? 92  THR B HB   1  
ATOM   3017   H HG1  . THR B 1 92  ? 15.958  8.229   3.066   1.00 0.00 ? 92  THR B HG1  1  
ATOM   3018   H HG21 . THR B 1 92  ? 17.394  11.635  3.897   1.00 0.00 ? 92  THR B HG21 1  
ATOM   3019   H HG22 . THR B 1 92  ? 17.701  10.813  2.367   1.00 0.00 ? 92  THR B HG22 1  
ATOM   3020   H HG23 . THR B 1 92  ? 16.424  12.024  2.477   1.00 0.00 ? 92  THR B HG23 1  
ATOM   3021   N N    . GLU B 1 93  ? 13.709  12.120  4.268   1.00 0.00 ? 93  GLU B N    1  
ATOM   3022   C CA   . GLU B 1 93  ? 13.128  13.460  4.323   1.00 0.00 ? 93  GLU B CA   1  
ATOM   3023   C C    . GLU B 1 93  ? 12.835  13.841  5.772   1.00 0.00 ? 93  GLU B C    1  
ATOM   3024   O O    . GLU B 1 93  ? 13.112  14.961  6.209   1.00 0.00 ? 93  GLU B O    1  
ATOM   3025   C CB   . GLU B 1 93  ? 11.832  13.502  3.509   1.00 0.00 ? 93  GLU B CB   1  
ATOM   3026   C CG   . GLU B 1 93  ? 12.129  13.140  2.051   1.00 0.00 ? 93  GLU B CG   1  
ATOM   3027   C CD   . GLU B 1 93  ? 12.859  14.284  1.351   1.00 0.00 ? 93  GLU B CD   1  
ATOM   3028   O OE1  . GLU B 1 93  ? 13.080  15.315  1.977   1.00 0.00 ? 93  GLU B OE1  1  
ATOM   3029   O OE2  . GLU B 1 93  ? 13.190  14.124  0.197   1.00 0.00 ? 93  GLU B OE2  1  
ATOM   3030   H H    . GLU B 1 93  ? 13.231  11.408  3.794   1.00 0.00 ? 93  GLU B H    1  
ATOM   3031   H HA   . GLU B 1 93  ? 13.830  14.168  3.908   1.00 0.00 ? 93  GLU B HA   1  
ATOM   3032   H HB2  . GLU B 1 93  ? 11.124  12.800  3.923   1.00 0.00 ? 93  GLU B HB2  1  
ATOM   3033   H HB3  . GLU B 1 93  ? 11.414  14.499  3.552   1.00 0.00 ? 93  GLU B HB3  1  
ATOM   3034   H HG2  . GLU B 1 93  ? 12.748  12.255  2.023   1.00 0.00 ? 93  GLU B HG2  1  
ATOM   3035   H HG3  . GLU B 1 93  ? 11.202  12.940  1.536   1.00 0.00 ? 93  GLU B HG3  1  
ATOM   3036   N N    . LEU B 1 94  ? 12.274  12.891  6.520   1.00 0.00 ? 94  LEU B N    1  
ATOM   3037   C CA   . LEU B 1 94  ? 11.956  13.126  7.928   1.00 0.00 ? 94  LEU B CA   1  
ATOM   3038   C C    . LEU B 1 94  ? 13.229  13.470  8.704   1.00 0.00 ? 94  LEU B C    1  
ATOM   3039   O O    . LEU B 1 94  ? 13.243  14.383  9.532   1.00 0.00 ? 94  LEU B O    1  
ATOM   3040   C CB   . LEU B 1 94  ? 11.286  11.884  8.544   1.00 0.00 ? 94  LEU B CB   1  
ATOM   3041   C CG   . LEU B 1 94  ? 9.836   11.747  8.035   1.00 0.00 ? 94  LEU B CG   1  
ATOM   3042   C CD1  . LEU B 1 94  ? 9.362   10.292  8.175   1.00 0.00 ? 94  LEU B CD1  1  
ATOM   3043   C CD2  . LEU B 1 94  ? 8.905   12.654  8.851   1.00 0.00 ? 94  LEU B CD2  1  
ATOM   3044   H H    . LEU B 1 94  ? 12.085  12.014  6.120   1.00 0.00 ? 94  LEU B H    1  
ATOM   3045   H HA   . LEU B 1 94  ? 11.279  13.962  7.997   1.00 0.00 ? 94  LEU B HA   1  
ATOM   3046   H HB2  . LEU B 1 94  ? 11.850  11.006  8.270   1.00 0.00 ? 94  LEU B HB2  1  
ATOM   3047   H HB3  . LEU B 1 94  ? 11.281  11.982  9.621   1.00 0.00 ? 94  LEU B HB3  1  
ATOM   3048   H HG   . LEU B 1 94  ? 9.796   12.036  6.992   1.00 0.00 ? 94  LEU B HG   1  
ATOM   3049   H HD11 . LEU B 1 94  ? 9.876   9.815   8.996   1.00 0.00 ? 94  LEU B HD11 1  
ATOM   3050   H HD12 . LEU B 1 94  ? 8.296   10.273  8.360   1.00 0.00 ? 94  LEU B HD12 1  
ATOM   3051   H HD13 . LEU B 1 94  ? 9.573   9.754   7.262   1.00 0.00 ? 94  LEU B HD13 1  
ATOM   3052   H HD21 . LEU B 1 94  ? 9.054   12.474  9.904   1.00 0.00 ? 94  LEU B HD21 1  
ATOM   3053   H HD22 . LEU B 1 94  ? 9.118   13.691  8.630   1.00 0.00 ? 94  LEU B HD22 1  
ATOM   3054   H HD23 . LEU B 1 94  ? 7.877   12.439  8.593   1.00 0.00 ? 94  LEU B HD23 1  
ATOM   3055   N N    . ILE B 1 95  ? 14.306  12.744  8.430   1.00 0.00 ? 95  ILE B N    1  
ATOM   3056   C CA   . ILE B 1 95  ? 15.575  13.008  9.104   1.00 0.00 ? 95  ILE B CA   1  
ATOM   3057   C C    . ILE B 1 95  ? 16.066  14.413  8.768   1.00 0.00 ? 95  ILE B C    1  
ATOM   3058   O O    . ILE B 1 95  ? 16.513  15.149  9.649   1.00 0.00 ? 95  ILE B O    1  
ATOM   3059   C CB   . ILE B 1 95  ? 16.620  11.965  8.700   1.00 0.00 ? 95  ILE B CB   1  
ATOM   3060   C CG1  . ILE B 1 95  ? 16.228  10.623  9.319   1.00 0.00 ? 95  ILE B CG1  1  
ATOM   3061   C CG2  . ILE B 1 95  ? 17.999  12.381  9.229   1.00 0.00 ? 95  ILE B CG2  1  
ATOM   3062   C CD1  . ILE B 1 95  ? 17.098  9.497   8.755   1.00 0.00 ? 95  ILE B CD1  1  
ATOM   3063   H H    . ILE B 1 95  ? 14.250  12.028  7.758   1.00 0.00 ? 95  ILE B H    1  
ATOM   3064   H HA   . ILE B 1 95  ? 15.420  12.947  10.172  1.00 0.00 ? 95  ILE B HA   1  
ATOM   3065   H HB   . ILE B 1 95  ? 16.656  11.877  7.623   1.00 0.00 ? 95  ILE B HB   1  
ATOM   3066   H HG12 . ILE B 1 95  ? 16.360  10.676  10.390  1.00 0.00 ? 95  ILE B HG12 1  
ATOM   3067   H HG13 . ILE B 1 95  ? 15.192  10.420  9.096   1.00 0.00 ? 95  ILE B HG13 1  
ATOM   3068   H HG21 . ILE B 1 95  ? 17.914  12.681  10.265  1.00 0.00 ? 95  ILE B HG21 1  
ATOM   3069   H HG22 . ILE B 1 95  ? 18.680  11.548  9.153   1.00 0.00 ? 95  ILE B HG22 1  
ATOM   3070   H HG23 . ILE B 1 95  ? 18.376  13.209  8.645   1.00 0.00 ? 95  ILE B HG23 1  
ATOM   3071   H HD11 . ILE B 1 95  ? 18.097  9.867   8.568   1.00 0.00 ? 95  ILE B HD11 1  
ATOM   3072   H HD12 . ILE B 1 95  ? 17.142  8.689   9.467   1.00 0.00 ? 95  ILE B HD12 1  
ATOM   3073   H HD13 . ILE B 1 95  ? 16.669  9.139   7.832   1.00 0.00 ? 95  ILE B HD13 1  
ATOM   3074   N N    . GLU B 1 96  ? 15.955  14.798  7.501   1.00 0.00 ? 96  GLU B N    1  
ATOM   3075   C CA   . GLU B 1 96  ? 16.375  16.136  7.092   1.00 0.00 ? 96  GLU B CA   1  
ATOM   3076   C C    . GLU B 1 96  ? 15.583  17.183  7.876   1.00 0.00 ? 96  GLU B C    1  
ATOM   3077   O O    . GLU B 1 96  ? 16.122  18.206  8.299   1.00 0.00 ? 96  GLU B O    1  
ATOM   3078   C CB   . GLU B 1 96  ? 16.157  16.321  5.585   1.00 0.00 ? 96  GLU B CB   1  
ATOM   3079   C CG   . GLU B 1 96  ? 16.560  17.755  5.153   1.00 0.00 ? 96  GLU B CG   1  
ATOM   3080   C CD   . GLU B 1 96  ? 17.589  17.728  4.019   1.00 0.00 ? 96  GLU B CD   1  
ATOM   3081   O OE1  . GLU B 1 96  ? 17.592  16.774  3.260   1.00 0.00 ? 96  GLU B OE1  1  
ATOM   3082   O OE2  . GLU B 1 96  ? 18.331  18.687  3.904   1.00 0.00 ? 96  GLU B OE2  1  
ATOM   3083   H H    . GLU B 1 96  ? 15.575  14.181  6.837   1.00 0.00 ? 96  GLU B H    1  
ATOM   3084   H HA   . GLU B 1 96  ? 17.425  16.257  7.314   1.00 0.00 ? 96  GLU B HA   1  
ATOM   3085   H HB2  . GLU B 1 96  ? 16.758  15.596  5.055   1.00 0.00 ? 96  GLU B HB2  1  
ATOM   3086   H HB3  . GLU B 1 96  ? 15.116  16.155  5.356   1.00 0.00 ? 96  GLU B HB3  1  
ATOM   3087   H HG2  . GLU B 1 96  ? 15.685  18.284  4.814   1.00 0.00 ? 96  GLU B HG2  1  
ATOM   3088   H HG3  . GLU B 1 96  ? 16.985  18.282  5.995   1.00 0.00 ? 96  GLU B HG3  1  
ATOM   3089   N N    . LEU B 1 97  ? 14.297  16.912  8.090   1.00 0.00 ? 97  LEU B N    1  
ATOM   3090   C CA   . LEU B 1 97  ? 13.454  17.836  8.850   1.00 0.00 ? 97  LEU B CA   1  
ATOM   3091   C C    . LEU B 1 97  ? 13.978  17.958  10.281  1.00 0.00 ? 97  LEU B C    1  
ATOM   3092   O O    . LEU B 1 97  ? 14.047  19.055  10.834  1.00 0.00 ? 97  LEU B O    1  
ATOM   3093   C CB   . LEU B 1 97  ? 11.998  17.358  8.860   1.00 0.00 ? 97  LEU B CB   1  
ATOM   3094   C CG   . LEU B 1 97  ? 11.310  17.706  7.532   1.00 0.00 ? 97  LEU B CG   1  
ATOM   3095   C CD1  . LEU B 1 97  ? 9.993   16.938  7.439   1.00 0.00 ? 97  LEU B CD1  1  
ATOM   3096   C CD2  . LEU B 1 97  ? 11.013  19.212  7.454   1.00 0.00 ? 97  LEU B CD2  1  
ATOM   3097   H H    . LEU B 1 97  ? 13.913  16.075  7.745   1.00 0.00 ? 97  LEU B H    1  
ATOM   3098   H HA   . LEU B 1 97  ? 13.502  18.810  8.388   1.00 0.00 ? 97  LEU B HA   1  
ATOM   3099   H HB2  . LEU B 1 97  ? 11.980  16.286  9.002   1.00 0.00 ? 97  LEU B HB2  1  
ATOM   3100   H HB3  . LEU B 1 97  ? 11.470  17.834  9.674   1.00 0.00 ? 97  LEU B HB3  1  
ATOM   3101   H HG   . LEU B 1 97  ? 11.950  17.418  6.709   1.00 0.00 ? 97  LEU B HG   1  
ATOM   3102   H HD11 . LEU B 1 97  ? 9.421   17.094  8.342   1.00 0.00 ? 97  LEU B HD11 1  
ATOM   3103   H HD12 . LEU B 1 97  ? 9.427   17.294  6.592   1.00 0.00 ? 97  LEU B HD12 1  
ATOM   3104   H HD13 . LEU B 1 97  ? 10.199  15.885  7.320   1.00 0.00 ? 97  LEU B HD13 1  
ATOM   3105   H HD21 . LEU B 1 97  ? 10.710  19.573  8.425   1.00 0.00 ? 97  LEU B HD21 1  
ATOM   3106   H HD22 . LEU B 1 97  ? 11.898  19.741  7.134   1.00 0.00 ? 97  LEU B HD22 1  
ATOM   3107   H HD23 . LEU B 1 97  ? 10.216  19.385  6.743   1.00 0.00 ? 97  LEU B HD23 1  
ATOM   3108   N N    . HIS B 1 98  ? 14.373  16.831  10.871  1.00 0.00 ? 98  HIS B N    1  
ATOM   3109   C CA   . HIS B 1 98  ? 14.918  16.859  12.224  1.00 0.00 ? 98  HIS B CA   1  
ATOM   3110   C C    . HIS B 1 98  ? 16.128  17.786  12.260  1.00 0.00 ? 98  HIS B C    1  
ATOM   3111   O O    . HIS B 1 98  ? 16.314  18.543  13.206  1.00 0.00 ? 98  HIS B O    1  
ATOM   3112   C CB   . HIS B 1 98  ? 15.323  15.452  12.671  1.00 0.00 ? 98  HIS B CB   1  
ATOM   3113   C CG   . HIS B 1 98  ? 14.091  14.634  12.936  1.00 0.00 ? 98  HIS B CG   1  
ATOM   3114   N ND1  . HIS B 1 98  ? 13.444  13.931  11.937  1.00 0.00 ? 98  HIS B ND1  1  
ATOM   3115   C CD2  . HIS B 1 98  ? 13.368  14.409  14.080  1.00 0.00 ? 98  HIS B CD2  1  
ATOM   3116   C CE1  . HIS B 1 98  ? 12.380  13.321  12.488  1.00 0.00 ? 98  HIS B CE1  1  
ATOM   3117   N NE2  . HIS B 1 98  ? 12.287  13.578  13.792  1.00 0.00 ? 98  HIS B NE2  1  
ATOM   3118   H H    . HIS B 1 98  ? 14.320  15.982  10.382  1.00 0.00 ? 98  HIS B H    1  
ATOM   3119   H HA   . HIS B 1 98  ? 14.166  17.242  12.898  1.00 0.00 ? 98  HIS B HA   1  
ATOM   3120   H HB2  . HIS B 1 98  ? 15.911  14.982  11.895  1.00 0.00 ? 98  HIS B HB2  1  
ATOM   3121   H HB3  . HIS B 1 98  ? 15.912  15.520  13.576  1.00 0.00 ? 98  HIS B HB3  1  
ATOM   3122   H HD1  . HIS B 1 98  ? 13.708  13.895  10.985  1.00 0.00 ? 98  HIS B HD1  1  
ATOM   3123   H HD2  . HIS B 1 98  ? 13.605  14.814  15.050  1.00 0.00 ? 98  HIS B HD2  1  
ATOM   3124   H HE1  . HIS B 1 98  ? 11.682  12.704  11.939  1.00 0.00 ? 98  HIS B HE1  1  
ATOM   3125   H HE2  . HIS B 1 98  ? 11.599  13.255  14.410  1.00 0.00 ? 98  HIS B HE2  1  
ATOM   3126   N N    . GLU B 1 99  ? 16.929  17.734  11.199  1.00 0.00 ? 99  GLU B N    1  
ATOM   3127   C CA   . GLU B 1 99  ? 18.104  18.590  11.107  1.00 0.00 ? 99  GLU B CA   1  
ATOM   3128   C C    . GLU B 1 99  ? 17.682  20.055  11.036  1.00 0.00 ? 99  GLU B C    1  
ATOM   3129   O O    . GLU B 1 99  ? 18.275  20.918  11.686  1.00 0.00 ? 99  GLU B O    1  
ATOM   3130   C CB   . GLU B 1 99  ? 18.935  18.215  9.880   1.00 0.00 ? 99  GLU B CB   1  
ATOM   3131   C CG   . GLU B 1 99  ? 20.228  19.039  9.867   1.00 0.00 ? 99  GLU B CG   1  
ATOM   3132   C CD   . GLU B 1 99  ? 21.115  18.618  8.698   1.00 0.00 ? 99  GLU B CD   1  
ATOM   3133   O OE1  . GLU B 1 99  ? 20.635  17.898  7.839   1.00 0.00 ? 99  GLU B OE1  1  
ATOM   3134   O OE2  . GLU B 1 99  ? 22.265  19.017  8.682   1.00 0.00 ? 99  GLU B OE2  1  
ATOM   3135   H H    . GLU B 1 99  ? 16.718  17.123  10.462  1.00 0.00 ? 99  GLU B H    1  
ATOM   3136   H HA   . GLU B 1 99  ? 18.707  18.451  11.990  1.00 0.00 ? 99  GLU B HA   1  
ATOM   3137   H HB2  . GLU B 1 99  ? 19.182  17.163  9.920   1.00 0.00 ? 99  GLU B HB2  1  
ATOM   3138   H HB3  . GLU B 1 99  ? 18.374  18.420  8.980   1.00 0.00 ? 99  GLU B HB3  1  
ATOM   3139   H HG2  . GLU B 1 99  ? 19.986  20.087  9.770   1.00 0.00 ? 99  GLU B HG2  1  
ATOM   3140   H HG3  . GLU B 1 99  ? 20.763  18.883  10.792  1.00 0.00 ? 99  GLU B HG3  1  
ATOM   3141   N N    . LYS B 1 100 ? 16.636  20.339  10.263  1.00 0.00 ? 100 LYS B N    1  
ATOM   3142   C CA   . LYS B 1 100 ? 16.150  21.711  10.156  1.00 0.00 ? 100 LYS B CA   1  
ATOM   3143   C C    . LYS B 1 100 ? 15.572  22.160  11.499  1.00 0.00 ? 100 LYS B C    1  
ATOM   3144   O O    . LYS B 1 100 ? 15.720  23.318  11.887  1.00 0.00 ? 100 LYS B O    1  
ATOM   3145   C CB   . LYS B 1 100 ? 15.110  21.831  9.039   1.00 0.00 ? 100 LYS B CB   1  
ATOM   3146   C CG   . LYS B 1 100 ? 15.811  21.645  7.689   1.00 0.00 ? 100 LYS B CG   1  
ATOM   3147   C CD   . LYS B 1 100 ? 14.814  21.873  6.549   1.00 0.00 ? 100 LYS B CD   1  
ATOM   3148   C CE   . LYS B 1 100 ? 15.534  21.700  5.208   1.00 0.00 ? 100 LYS B CE   1  
ATOM   3149   N NZ   . LYS B 1 100 ? 14.578  21.987  4.098   1.00 0.00 ? 100 LYS B NZ   1  
ATOM   3150   H H    . LYS B 1 100 ? 16.183  19.619  9.776   1.00 0.00 ? 100 LYS B H    1  
ATOM   3151   H HA   . LYS B 1 100 ? 16.986  22.354  9.920   1.00 0.00 ? 100 LYS B HA   1  
ATOM   3152   H HB2  . LYS B 1 100 ? 14.350  21.071  9.167   1.00 0.00 ? 100 LYS B HB2  1  
ATOM   3153   H HB3  . LYS B 1 100 ? 14.653  22.809  9.076   1.00 0.00 ? 100 LYS B HB3  1  
ATOM   3154   H HG2  . LYS B 1 100 ? 16.624  22.356  7.608   1.00 0.00 ? 100 LYS B HG2  1  
ATOM   3155   H HG3  . LYS B 1 100 ? 16.207  20.640  7.626   1.00 0.00 ? 100 LYS B HG3  1  
ATOM   3156   H HD2  . LYS B 1 100 ? 14.012  21.154  6.627   1.00 0.00 ? 100 LYS B HD2  1  
ATOM   3157   H HD3  . LYS B 1 100 ? 14.412  22.873  6.617   1.00 0.00 ? 100 LYS B HD3  1  
ATOM   3158   H HE2  . LYS B 1 100 ? 16.369  22.388  5.156   1.00 0.00 ? 100 LYS B HE2  1  
ATOM   3159   H HE3  . LYS B 1 100 ? 15.900  20.685  5.122   1.00 0.00 ? 100 LYS B HE3  1  
ATOM   3160   H HZ1  . LYS B 1 100 ? 14.079  22.882  4.289   1.00 0.00 ? 100 LYS B HZ1  1  
ATOM   3161   H HZ2  . LYS B 1 100 ? 15.103  22.072  3.205   1.00 0.00 ? 100 LYS B HZ2  1  
ATOM   3162   H HZ3  . LYS B 1 100 ? 13.891  21.213  4.027   1.00 0.00 ? 100 LYS B HZ3  1  
ATOM   3163   N N    . LEU B 1 101 ? 14.952  21.229  12.229  1.00 0.00 ? 101 LEU B N    1  
ATOM   3164   C CA   . LEU B 1 101 ? 14.401  21.546  13.552  1.00 0.00 ? 101 LEU B CA   1  
ATOM   3165   C C    . LEU B 1 101 ? 15.534  21.929  14.505  1.00 0.00 ? 101 LEU B C    1  
ATOM   3166   O O    . LEU B 1 101 ? 15.305  22.166  15.694  1.00 0.00 ? 101 LEU B O    1  
ATOM   3167   C CB   . LEU B 1 101 ? 13.646  20.339  14.132  1.00 0.00 ? 101 LEU B CB   1  
ATOM   3168   C CG   . LEU B 1 101 ? 12.206  20.291  13.602  1.00 0.00 ? 101 LEU B CG   1  
ATOM   3169   C CD1  . LEU B 1 101 ? 11.625  18.893  13.838  1.00 0.00 ? 101 LEU B CD1  1  
ATOM   3170   C CD2  . LEU B 1 101 ? 11.335  21.320  14.336  1.00 0.00 ? 101 LEU B CD2  1  
ATOM   3171   H H    . LEU B 1 101 ? 14.886  20.312  11.886  1.00 0.00 ? 101 LEU B H    1  
ATOM   3172   H HA   . LEU B 1 101 ? 13.726  22.382  13.466  1.00 0.00 ? 101 LEU B HA   1  
ATOM   3173   H HB2  . LEU B 1 101 ? 14.161  19.431  13.848  1.00 0.00 ? 101 LEU B HB2  1  
ATOM   3174   H HB3  . LEU B 1 101 ? 13.629  20.412  15.210  1.00 0.00 ? 101 LEU B HB3  1  
ATOM   3175   H HG   . LEU B 1 101 ? 12.209  20.505  12.542  1.00 0.00 ? 101 LEU B HG   1  
ATOM   3176   H HD11 . LEU B 1 101 ? 11.941  18.528  14.805  1.00 0.00 ? 101 LEU B HD11 1  
ATOM   3177   H HD12 . LEU B 1 101 ? 10.547  18.944  13.812  1.00 0.00 ? 101 LEU B HD12 1  
ATOM   3178   H HD13 . LEU B 1 101 ? 11.973  18.222  13.068  1.00 0.00 ? 101 LEU B HD13 1  
ATOM   3179   H HD21 . LEU B 1 101 ? 11.556  21.298  15.395  1.00 0.00 ? 101 LEU B HD21 1  
ATOM   3180   H HD22 . LEU B 1 101 ? 11.531  22.308  13.947  1.00 0.00 ? 101 LEU B HD22 1  
ATOM   3181   H HD23 . LEU B 1 101 ? 10.293  21.076  14.186  1.00 0.00 ? 101 LEU B HD23 1  
ATOM   3182   N N    . LYS B 1 102 ? 16.755  21.978  13.977  1.00 0.00 ? 102 LYS B N    1  
ATOM   3183   C CA   . LYS B 1 102 ? 17.935  22.325  14.773  1.00 0.00 ? 102 LYS B CA   1  
ATOM   3184   C C    . LYS B 1 102 ? 18.408  21.115  15.565  1.00 0.00 ? 102 LYS B C    1  
ATOM   3185   O O    . LYS B 1 102 ? 19.538  20.690  15.402  1.00 0.00 ? 102 LYS B O    1  
ATOM   3186   C CB   . LYS B 1 102 ? 17.604  23.486  15.734  1.00 0.00 ? 102 LYS B CB   1  
ATOM   3187   C CG   . LYS B 1 102 ? 18.849  24.316  16.170  1.00 0.00 ? 102 LYS B CG   1  
ATOM   3188   C CD   . LYS B 1 102 ? 20.156  23.489  16.304  1.00 0.00 ? 102 LYS B CD   1  
ATOM   3189   C CE   . LYS B 1 102 ? 20.175  22.610  17.576  1.00 0.00 ? 102 LYS B CE   1  
ATOM   3190   N NZ   . LYS B 1 102 ? 18.801  22.442  18.125  1.00 0.00 ? 102 LYS B NZ   1  
ATOM   3191   H H    . LYS B 1 102 ? 16.871  21.767  13.027  1.00 0.00 ? 102 LYS B H    1  
ATOM   3192   H HA   . LYS B 1 102 ? 18.721  22.633  14.098  1.00 0.00 ? 102 LYS B HA   1  
ATOM   3193   H HB2  . LYS B 1 102 ? 16.911  24.152  15.233  1.00 0.00 ? 102 LYS B HB2  1  
ATOM   3194   H HB3  . LYS B 1 102 ? 17.117  23.089  16.610  1.00 0.00 ? 102 LYS B HB3  1  
ATOM   3195   H HG2  . LYS B 1 102 ? 19.014  25.095  15.440  1.00 0.00 ? 102 LYS B HG2  1  
ATOM   3196   H HG3  . LYS B 1 102 ? 18.632  24.781  17.119  1.00 0.00 ? 102 LYS B HG3  1  
ATOM   3197   H HD2  . LYS B 1 102 ? 20.293  22.866  15.431  1.00 0.00 ? 102 LYS B HD2  1  
ATOM   3198   H HD3  . LYS B 1 102 ? 20.987  24.186  16.364  1.00 0.00 ? 102 LYS B HD3  1  
ATOM   3199   H HE2  . LYS B 1 102 ? 20.583  21.637  17.332  1.00 0.00 ? 102 LYS B HE2  1  
ATOM   3200   H HE3  . LYS B 1 102 ? 20.806  23.078  18.323  1.00 0.00 ? 102 LYS B HE3  1  
ATOM   3201   H HZ1  . LYS B 1 102 ? 18.190  22.031  17.394  1.00 0.00 ? 102 LYS B HZ1  1  
ATOM   3202   H HZ2  . LYS B 1 102 ? 18.835  21.799  18.942  1.00 0.00 ? 102 LYS B HZ2  1  
ATOM   3203   H HZ3  . LYS B 1 102 ? 18.424  23.360  18.420  1.00 0.00 ? 102 LYS B HZ3  1  
ATOM   3204   N N    . ALA B 1 103 ? 17.530  20.609  16.443  1.00 0.00 ? 103 ALA B N    1  
ATOM   3205   C CA   . ALA B 1 103 ? 17.847  19.462  17.302  1.00 0.00 ? 103 ALA B CA   1  
ATOM   3206   C C    . ALA B 1 103 ? 18.728  18.439  16.587  1.00 0.00 ? 103 ALA B C    1  
ATOM   3207   O O    . ALA B 1 103 ? 18.191  17.457  16.103  1.00 0.00 ? 103 ALA B O    1  
ATOM   3208   C CB   . ALA B 1 103 ? 16.550  18.786  17.759  1.00 0.00 ? 103 ALA B CB   1  
ATOM   3209   O OXT  . ALA B 1 103 ? 19.931  18.638  16.560  1.00 0.00 ? 103 ALA B OXT  1  
ATOM   3210   H H    . ALA B 1 103 ? 16.647  21.032  16.521  1.00 0.00 ? 103 ALA B H    1  
ATOM   3211   H HA   . ALA B 1 103 ? 18.372  19.816  18.174  1.00 0.00 ? 103 ALA B HA   1  
ATOM   3212   H HB1  . ALA B 1 103 ? 15.889  18.669  16.912  1.00 0.00 ? 103 ALA B HB1  1  
ATOM   3213   H HB2  . ALA B 1 103 ? 16.783  17.813  18.169  1.00 0.00 ? 103 ALA B HB2  1  
ATOM   3214   H HB3  . ALA B 1 103 ? 16.070  19.389  18.511  1.00 0.00 ? 103 ALA B HB3  1  
ATOM   3215   N N    . ALA C 1 1   ? -1.769  -7.984  -21.649 1.00 0.00 ? 1   ALA C N    1  
ATOM   3216   C CA   . ALA C 1 1   ? -2.260  -8.153  -23.047 1.00 0.00 ? 1   ALA C CA   1  
ATOM   3217   C C    . ALA C 1 1   ? -2.069  -6.838  -23.798 1.00 0.00 ? 1   ALA C C    1  
ATOM   3218   O O    . ALA C 1 1   ? -1.758  -5.824  -23.185 1.00 0.00 ? 1   ALA C O    1  
ATOM   3219   C CB   . ALA C 1 1   ? -3.744  -8.558  -23.017 1.00 0.00 ? 1   ALA C CB   1  
ATOM   3220   H H1   . ALA C 1 1   ? -1.657  -6.970  -21.441 1.00 0.00 ? 1   ALA C H1   1  
ATOM   3221   H H2   . ALA C 1 1   ? -2.455  -8.403  -20.988 1.00 0.00 ? 1   ALA C H2   1  
ATOM   3222   H H3   . ALA C 1 1   ? -0.848  -8.458  -21.544 1.00 0.00 ? 1   ALA C H3   1  
ATOM   3223   H HA   . ALA C 1 1   ? -1.685  -8.924  -23.540 1.00 0.00 ? 1   ALA C HA   1  
ATOM   3224   H HB1  . ALA C 1 1   ? -3.824  -9.636  -23.066 1.00 0.00 ? 1   ALA C HB1  1  
ATOM   3225   H HB2  . ALA C 1 1   ? -4.259  -8.123  -23.862 1.00 0.00 ? 1   ALA C HB2  1  
ATOM   3226   H HB3  . ALA C 1 1   ? -4.197  -8.205  -22.103 1.00 0.00 ? 1   ALA C HB3  1  
ATOM   3227   N N    . GLU C 1 2   ? -2.260  -6.879  -25.115 1.00 0.00 ? 2   GLU C N    1  
ATOM   3228   C CA   . GLU C 1 2   ? -2.102  -5.704  -25.984 1.00 0.00 ? 2   GLU C CA   1  
ATOM   3229   C C    . GLU C 1 2   ? -2.285  -4.378  -25.234 1.00 0.00 ? 2   GLU C C    1  
ATOM   3230   O O    . GLU C 1 2   ? -1.315  -3.770  -24.782 1.00 0.00 ? 2   GLU C O    1  
ATOM   3231   C CB   . GLU C 1 2   ? -3.116  -5.779  -27.131 1.00 0.00 ? 2   GLU C CB   1  
ATOM   3232   C CG   . GLU C 1 2   ? -2.898  -7.067  -27.959 1.00 0.00 ? 2   GLU C CG   1  
ATOM   3233   C CD   . GLU C 1 2   ? -4.215  -7.815  -28.159 1.00 0.00 ? 2   GLU C CD   1  
ATOM   3234   O OE1  . GLU C 1 2   ? -5.224  -7.164  -28.355 1.00 0.00 ? 2   GLU C OE1  1  
ATOM   3235   O OE2  . GLU C 1 2   ? -4.191  -9.031  -28.113 1.00 0.00 ? 2   GLU C OE2  1  
ATOM   3236   H H    . GLU C 1 2   ? -2.513  -7.730  -25.528 1.00 0.00 ? 2   GLU C H    1  
ATOM   3237   H HA   . GLU C 1 2   ? -1.108  -5.720  -26.406 1.00 0.00 ? 2   GLU C HA   1  
ATOM   3238   H HB2  . GLU C 1 2   ? -4.116  -5.777  -26.722 1.00 0.00 ? 2   GLU C HB2  1  
ATOM   3239   H HB3  . GLU C 1 2   ? -2.993  -4.917  -27.771 1.00 0.00 ? 2   GLU C HB3  1  
ATOM   3240   H HG2  . GLU C 1 2   ? -2.497  -6.808  -28.928 1.00 0.00 ? 2   GLU C HG2  1  
ATOM   3241   H HG3  . GLU C 1 2   ? -2.201  -7.715  -27.451 1.00 0.00 ? 2   GLU C HG3  1  
ATOM   3242   N N    . GLU C 1 3   ? -3.528  -3.936  -25.116 1.00 0.00 ? 3   GLU C N    1  
ATOM   3243   C CA   . GLU C 1 3   ? -3.821  -2.677  -24.437 1.00 0.00 ? 3   GLU C CA   1  
ATOM   3244   C C    . GLU C 1 3   ? -3.499  -2.763  -22.948 1.00 0.00 ? 3   GLU C C    1  
ATOM   3245   O O    . GLU C 1 3   ? -2.679  -2.005  -22.439 1.00 0.00 ? 3   GLU C O    1  
ATOM   3246   C CB   . GLU C 1 3   ? -5.296  -2.316  -24.639 1.00 0.00 ? 3   GLU C CB   1  
ATOM   3247   C CG   . GLU C 1 3   ? -5.494  -1.717  -26.040 1.00 0.00 ? 3   GLU C CG   1  
ATOM   3248   C CD   . GLU C 1 3   ? -6.945  -1.869  -26.487 1.00 0.00 ? 3   GLU C CD   1  
ATOM   3249   O OE1  . GLU C 1 3   ? -7.815  -1.398  -25.778 1.00 0.00 ? 3   GLU C OE1  1  
ATOM   3250   O OE2  . GLU C 1 3   ? -7.160  -2.449  -27.536 1.00 0.00 ? 3   GLU C OE2  1  
ATOM   3251   H H    . GLU C 1 3   ? -4.264  -4.454  -25.503 1.00 0.00 ? 3   GLU C H    1  
ATOM   3252   H HA   . GLU C 1 3   ? -3.210  -1.901  -24.874 1.00 0.00 ? 3   GLU C HA   1  
ATOM   3253   H HB2  . GLU C 1 3   ? -5.901  -3.208  -24.541 1.00 0.00 ? 3   GLU C HB2  1  
ATOM   3254   H HB3  . GLU C 1 3   ? -5.598  -1.594  -23.894 1.00 0.00 ? 3   GLU C HB3  1  
ATOM   3255   H HG2  . GLU C 1 3   ? -5.240  -0.667  -26.020 1.00 0.00 ? 3   GLU C HG2  1  
ATOM   3256   H HG3  . GLU C 1 3   ? -4.851  -2.223  -26.745 1.00 0.00 ? 3   GLU C HG3  1  
ATOM   3257   N N    . LEU C 1 4   ? -4.156  -3.677  -22.246 1.00 0.00 ? 4   LEU C N    1  
ATOM   3258   C CA   . LEU C 1 4   ? -3.917  -3.826  -20.812 1.00 0.00 ? 4   LEU C CA   1  
ATOM   3259   C C    . LEU C 1 4   ? -2.427  -3.726  -20.472 1.00 0.00 ? 4   LEU C C    1  
ATOM   3260   O O    . LEU C 1 4   ? -2.047  -3.074  -19.505 1.00 0.00 ? 4   LEU C O    1  
ATOM   3261   C CB   . LEU C 1 4   ? -4.451  -5.173  -20.302 1.00 0.00 ? 4   LEU C CB   1  
ATOM   3262   C CG   . LEU C 1 4   ? -5.943  -5.320  -20.622 1.00 0.00 ? 4   LEU C CG   1  
ATOM   3263   C CD1  . LEU C 1 4   ? -6.453  -6.666  -20.084 1.00 0.00 ? 4   LEU C CD1  1  
ATOM   3264   C CD2  . LEU C 1 4   ? -6.736  -4.169  -19.978 1.00 0.00 ? 4   LEU C CD2  1  
ATOM   3265   H H    . LEU C 1 4   ? -4.806  -4.256  -22.695 1.00 0.00 ? 4   LEU C H    1  
ATOM   3266   H HA   . LEU C 1 4   ? -4.437  -3.031  -20.303 1.00 0.00 ? 4   LEU C HA   1  
ATOM   3267   H HB2  . LEU C 1 4   ? -3.903  -5.974  -20.775 1.00 0.00 ? 4   LEU C HB2  1  
ATOM   3268   H HB3  . LEU C 1 4   ? -4.305  -5.227  -19.230 1.00 0.00 ? 4   LEU C HB3  1  
ATOM   3269   H HG   . LEU C 1 4   ? -6.080  -5.294  -21.693 1.00 0.00 ? 4   LEU C HG   1  
ATOM   3270   H HD11 . LEU C 1 4   ? -5.658  -7.397  -20.117 1.00 0.00 ? 4   LEU C HD11 1  
ATOM   3271   H HD12 . LEU C 1 4   ? -6.790  -6.551  -19.064 1.00 0.00 ? 4   LEU C HD12 1  
ATOM   3272   H HD13 . LEU C 1 4   ? -7.278  -7.008  -20.696 1.00 0.00 ? 4   LEU C HD13 1  
ATOM   3273   H HD21 . LEU C 1 4   ? -6.294  -3.902  -19.029 1.00 0.00 ? 4   LEU C HD21 1  
ATOM   3274   H HD22 . LEU C 1 4   ? -6.719  -3.310  -20.634 1.00 0.00 ? 4   LEU C HD22 1  
ATOM   3275   H HD23 . LEU C 1 4   ? -7.761  -4.478  -19.824 1.00 0.00 ? 4   LEU C HD23 1  
ATOM   3276   N N    . GLU C 1 5   ? -1.591  -4.378  -21.271 1.00 0.00 ? 5   GLU C N    1  
ATOM   3277   C CA   . GLU C 1 5   ? -0.150  -4.361  -21.034 1.00 0.00 ? 5   GLU C CA   1  
ATOM   3278   C C    . GLU C 1 5   ? 0.433   -2.981  -21.328 1.00 0.00 ? 5   GLU C C    1  
ATOM   3279   O O    . GLU C 1 5   ? 1.205   -2.435  -20.533 1.00 0.00 ? 5   GLU C O    1  
ATOM   3280   C CB   . GLU C 1 5   ? 0.538   -5.411  -21.914 1.00 0.00 ? 5   GLU C CB   1  
ATOM   3281   C CG   . GLU C 1 5   ? 2.028   -5.473  -21.569 1.00 0.00 ? 5   GLU C CG   1  
ATOM   3282   C CD   . GLU C 1 5   ? 2.700   -6.596  -22.353 1.00 0.00 ? 5   GLU C CD   1  
ATOM   3283   O OE1  . GLU C 1 5   ? 1.987   -7.432  -22.883 1.00 0.00 ? 5   GLU C OE1  1  
ATOM   3284   O OE2  . GLU C 1 5   ? 3.919   -6.606  -22.409 1.00 0.00 ? 5   GLU C OE2  1  
ATOM   3285   H H    . GLU C 1 5   ? -1.945  -4.880  -22.036 1.00 0.00 ? 5   GLU C H    1  
ATOM   3286   H HA   . GLU C 1 5   ? 0.041   -4.604  -20.001 1.00 0.00 ? 5   GLU C HA   1  
ATOM   3287   H HB2  . GLU C 1 5   ? 0.087   -6.377  -21.744 1.00 0.00 ? 5   GLU C HB2  1  
ATOM   3288   H HB3  . GLU C 1 5   ? 0.426   -5.138  -22.955 1.00 0.00 ? 5   GLU C HB3  1  
ATOM   3289   H HG2  . GLU C 1 5   ? 2.495   -4.534  -21.818 1.00 0.00 ? 5   GLU C HG2  1  
ATOM   3290   H HG3  . GLU C 1 5   ? 2.142   -5.660  -20.510 1.00 0.00 ? 5   GLU C HG3  1  
ATOM   3291   N N    . GLU C 1 6   ? 0.039   -2.413  -22.460 1.00 0.00 ? 6   GLU C N    1  
ATOM   3292   C CA   . GLU C 1 6   ? 0.509   -1.088  -22.839 1.00 0.00 ? 6   GLU C CA   1  
ATOM   3293   C C    . GLU C 1 6   ? -0.072  -0.047  -21.883 1.00 0.00 ? 6   GLU C C    1  
ATOM   3294   O O    . GLU C 1 6   ? 0.579   0.945   -21.541 1.00 0.00 ? 6   GLU C O    1  
ATOM   3295   C CB   . GLU C 1 6   ? 0.088   -0.792  -24.285 1.00 0.00 ? 6   GLU C CB   1  
ATOM   3296   C CG   . GLU C 1 6   ? 1.036   0.236   -24.913 1.00 0.00 ? 6   GLU C CG   1  
ATOM   3297   C CD   . GLU C 1 6   ? 0.846   0.254   -26.427 1.00 0.00 ? 6   GLU C CD   1  
ATOM   3298   O OE1  . GLU C 1 6   ? -0.188  -0.208  -26.881 1.00 0.00 ? 6   GLU C OE1  1  
ATOM   3299   O OE2  . GLU C 1 6   ? 1.735   0.736   -27.109 1.00 0.00 ? 6   GLU C OE2  1  
ATOM   3300   H H    . GLU C 1 6   ? -0.591  -2.887  -23.044 1.00 0.00 ? 6   GLU C H    1  
ATOM   3301   H HA   . GLU C 1 6   ? 1.585   -1.062  -22.776 1.00 0.00 ? 6   GLU C HA   1  
ATOM   3302   H HB2  . GLU C 1 6   ? 0.121   -1.707  -24.860 1.00 0.00 ? 6   GLU C HB2  1  
ATOM   3303   H HB3  . GLU C 1 6   ? -0.919  -0.402  -24.292 1.00 0.00 ? 6   GLU C HB3  1  
ATOM   3304   H HG2  . GLU C 1 6   ? 0.815   1.216   -24.515 1.00 0.00 ? 6   GLU C HG2  1  
ATOM   3305   H HG3  . GLU C 1 6   ? 2.059   -0.021  -24.687 1.00 0.00 ? 6   GLU C HG3  1  
ATOM   3306   N N    . VAL C 1 7   ? -1.296  -0.304  -21.431 1.00 0.00 ? 7   VAL C N    1  
ATOM   3307   C CA   . VAL C 1 7   ? -1.969  0.587   -20.492 1.00 0.00 ? 7   VAL C CA   1  
ATOM   3308   C C    . VAL C 1 7   ? -1.226  0.587   -19.153 1.00 0.00 ? 7   VAL C C    1  
ATOM   3309   O O    . VAL C 1 7   ? -1.018  1.639   -18.543 1.00 0.00 ? 7   VAL C O    1  
ATOM   3310   C CB   . VAL C 1 7   ? -3.422  0.130   -20.294 1.00 0.00 ? 7   VAL C CB   1  
ATOM   3311   C CG1  . VAL C 1 7   ? -4.063  0.921   -19.149 1.00 0.00 ? 7   VAL C CG1  1  
ATOM   3312   C CG2  . VAL C 1 7   ? -4.215  0.373   -21.586 1.00 0.00 ? 7   VAL C CG2  1  
ATOM   3313   H H    . VAL C 1 7   ? -1.753  -1.124  -21.729 1.00 0.00 ? 7   VAL C H    1  
ATOM   3314   H HA   . VAL C 1 7   ? -1.966  1.589   -20.891 1.00 0.00 ? 7   VAL C HA   1  
ATOM   3315   H HB   . VAL C 1 7   ? -3.435  -0.924  -20.056 1.00 0.00 ? 7   VAL C HB   1  
ATOM   3316   H HG11 . VAL C 1 7   ? -3.801  1.965   -19.239 1.00 0.00 ? 7   VAL C HG11 1  
ATOM   3317   H HG12 . VAL C 1 7   ? -5.137  0.814   -19.197 1.00 0.00 ? 7   VAL C HG12 1  
ATOM   3318   H HG13 . VAL C 1 7   ? -3.705  0.539   -18.205 1.00 0.00 ? 7   VAL C HG13 1  
ATOM   3319   H HG21 . VAL C 1 7   ? -3.590  0.154   -22.443 1.00 0.00 ? 7   VAL C HG21 1  
ATOM   3320   H HG22 . VAL C 1 7   ? -5.082  -0.271  -21.604 1.00 0.00 ? 7   VAL C HG22 1  
ATOM   3321   H HG23 . VAL C 1 7   ? -4.531  1.405   -21.630 1.00 0.00 ? 7   VAL C HG23 1  
ATOM   3322   N N    . VAL C 1 8   ? -0.807  -0.600  -18.714 1.00 0.00 ? 8   VAL C N    1  
ATOM   3323   C CA   . VAL C 1 8   ? -0.066  -0.727  -17.459 1.00 0.00 ? 8   VAL C CA   1  
ATOM   3324   C C    . VAL C 1 8   ? 1.229   0.075   -17.557 1.00 0.00 ? 8   VAL C C    1  
ATOM   3325   O O    . VAL C 1 8   ? 1.581   0.818   -16.642 1.00 0.00 ? 8   VAL C O    1  
ATOM   3326   C CB   . VAL C 1 8   ? 0.228   -2.209  -17.172 1.00 0.00 ? 8   VAL C CB   1  
ATOM   3327   C CG1  . VAL C 1 8   ? 1.221   -2.331  -15.999 1.00 0.00 ? 8   VAL C CG1  1  
ATOM   3328   C CG2  . VAL C 1 8   ? -1.090  -2.947  -16.832 1.00 0.00 ? 8   VAL C CG2  1  
ATOM   3329   H H    . VAL C 1 8   ? -0.987  -1.400  -19.250 1.00 0.00 ? 8   VAL C H    1  
ATOM   3330   H HA   . VAL C 1 8   ? -0.663  -0.323  -16.654 1.00 0.00 ? 8   VAL C HA   1  
ATOM   3331   H HB   . VAL C 1 8   ? 0.667   -2.656  -18.054 1.00 0.00 ? 8   VAL C HB   1  
ATOM   3332   H HG11 . VAL C 1 8   ? 1.246   -1.406  -15.442 1.00 0.00 ? 8   VAL C HG11 1  
ATOM   3333   H HG12 . VAL C 1 8   ? 0.915   -3.133  -15.343 1.00 0.00 ? 8   VAL C HG12 1  
ATOM   3334   H HG13 . VAL C 1 8   ? 2.208   -2.543  -16.385 1.00 0.00 ? 8   VAL C HG13 1  
ATOM   3335   H HG21 . VAL C 1 8   ? -1.937  -2.312  -17.055 1.00 0.00 ? 8   VAL C HG21 1  
ATOM   3336   H HG22 . VAL C 1 8   ? -1.160  -3.850  -17.420 1.00 0.00 ? 8   VAL C HG22 1  
ATOM   3337   H HG23 . VAL C 1 8   ? -1.106  -3.206  -15.782 1.00 0.00 ? 8   VAL C HG23 1  
ATOM   3338   N N    . MET C 1 9   ? 1.918   -0.048  -18.688 1.00 0.00 ? 9   MET C N    1  
ATOM   3339   C CA   . MET C 1 9   ? 3.153   0.704   -18.889 1.00 0.00 ? 9   MET C CA   1  
ATOM   3340   C C    . MET C 1 9   ? 2.866   2.192   -18.723 1.00 0.00 ? 9   MET C C    1  
ATOM   3341   O O    . MET C 1 9   ? 3.609   2.912   -18.054 1.00 0.00 ? 9   MET C O    1  
ATOM   3342   C CB   . MET C 1 9   ? 3.716   0.444   -20.287 1.00 0.00 ? 9   MET C CB   1  
ATOM   3343   C CG   . MET C 1 9   ? 4.399   -0.924  -20.328 1.00 0.00 ? 9   MET C CG   1  
ATOM   3344   S SD   . MET C 1 9   ? 4.901   -1.304  -22.028 1.00 0.00 ? 9   MET C SD   1  
ATOM   3345   C CE   . MET C 1 9   ? 6.317   -0.180  -22.124 1.00 0.00 ? 9   MET C CE   1  
ATOM   3346   H H    . MET C 1 9   ? 1.583   -0.630  -19.403 1.00 0.00 ? 9   MET C H    1  
ATOM   3347   H HA   . MET C 1 9   ? 3.873   0.405   -18.143 1.00 0.00 ? 9   MET C HA   1  
ATOM   3348   H HB2  . MET C 1 9   ? 2.910   0.466   -21.008 1.00 0.00 ? 9   MET C HB2  1  
ATOM   3349   H HB3  . MET C 1 9   ? 4.435   1.211   -20.530 1.00 0.00 ? 9   MET C HB3  1  
ATOM   3350   H HG2  . MET C 1 9   ? 5.271   -0.908  -19.692 1.00 0.00 ? 9   MET C HG2  1  
ATOM   3351   H HG3  . MET C 1 9   ? 3.712   -1.681  -19.978 1.00 0.00 ? 9   MET C HG3  1  
ATOM   3352   H HE1  . MET C 1 9   ? 6.948   -0.322  -21.259 1.00 0.00 ? 9   MET C HE1  1  
ATOM   3353   H HE2  . MET C 1 9   ? 6.879   -0.388  -23.024 1.00 0.00 ? 9   MET C HE2  1  
ATOM   3354   H HE3  . MET C 1 9   ? 5.971   0.839   -22.150 1.00 0.00 ? 9   MET C HE3  1  
ATOM   3355   N N    . GLY C 1 10  ? 1.762   2.641   -19.313 1.00 0.00 ? 10  GLY C N    1  
ATOM   3356   C CA   . GLY C 1 10  ? 1.370   4.041   -19.197 1.00 0.00 ? 10  GLY C CA   1  
ATOM   3357   C C    . GLY C 1 10  ? 1.098   4.390   -17.737 1.00 0.00 ? 10  GLY C C    1  
ATOM   3358   O O    . GLY C 1 10  ? 1.536   5.430   -17.243 1.00 0.00 ? 10  GLY C O    1  
ATOM   3359   H H    . GLY C 1 10  ? 1.194   2.018   -19.817 1.00 0.00 ? 10  GLY C H    1  
ATOM   3360   H HA2  . GLY C 1 10  ? 2.167   4.668   -19.572 1.00 0.00 ? 10  GLY C HA2  1  
ATOM   3361   H HA3  . GLY C 1 10  ? 0.476   4.214   -19.775 1.00 0.00 ? 10  GLY C HA3  1  
ATOM   3362   N N    . LEU C 1 11  ? 0.385   3.506   -17.047 1.00 0.00 ? 11  LEU C N    1  
ATOM   3363   C CA   . LEU C 1 11  ? 0.070   3.725   -15.632 1.00 0.00 ? 11  LEU C CA   1  
ATOM   3364   C C    . LEU C 1 11  ? 1.343   3.772   -14.798 1.00 0.00 ? 11  LEU C C    1  
ATOM   3365   O O    . LEU C 1 11  ? 1.495   4.632   -13.927 1.00 0.00 ? 11  LEU C O    1  
ATOM   3366   C CB   . LEU C 1 11  ? -0.827  2.603   -15.108 1.00 0.00 ? 11  LEU C CB   1  
ATOM   3367   C CG   . LEU C 1 11  ? -2.226  2.713   -15.719 1.00 0.00 ? 11  LEU C CG   1  
ATOM   3368   C CD1  . LEU C 1 11  ? -3.021  1.452   -15.375 1.00 0.00 ? 11  LEU C CD1  1  
ATOM   3369   C CD2  . LEU C 1 11  ? -2.956  3.953   -15.170 1.00 0.00 ? 11  LEU C CD2  1  
ATOM   3370   H H    . LEU C 1 11  ? 0.073   2.687   -17.490 1.00 0.00 ? 11  LEU C H    1  
ATOM   3371   H HA   . LEU C 1 11  ? -0.448  4.664   -15.528 1.00 0.00 ? 11  LEU C HA   1  
ATOM   3372   H HB2  . LEU C 1 11  ? -0.393  1.648   -15.375 1.00 0.00 ? 11  LEU C HB2  1  
ATOM   3373   H HB3  . LEU C 1 11  ? -0.896  2.672   -14.031 1.00 0.00 ? 11  LEU C HB3  1  
ATOM   3374   H HG   . LEU C 1 11  ? -2.137  2.793   -16.793 1.00 0.00 ? 11  LEU C HG   1  
ATOM   3375   H HD11 . LEU C 1 11  ? -2.820  1.163   -14.353 1.00 0.00 ? 11  LEU C HD11 1  
ATOM   3376   H HD12 . LEU C 1 11  ? -4.075  1.649   -15.491 1.00 0.00 ? 11  LEU C HD12 1  
ATOM   3377   H HD13 . LEU C 1 11  ? -2.729  0.652   -16.039 1.00 0.00 ? 11  LEU C HD13 1  
ATOM   3378   H HD21 . LEU C 1 11  ? -2.645  4.143   -14.154 1.00 0.00 ? 11  LEU C HD21 1  
ATOM   3379   H HD22 . LEU C 1 11  ? -2.719  4.811   -15.784 1.00 0.00 ? 11  LEU C HD22 1  
ATOM   3380   H HD23 . LEU C 1 11  ? -4.023  3.784   -15.195 1.00 0.00 ? 11  LEU C HD23 1  
ATOM   3381   N N    . ILE C 1 12  ? 2.256   2.847   -15.066 1.00 0.00 ? 12  ILE C N    1  
ATOM   3382   C CA   . ILE C 1 12  ? 3.514   2.803   -14.327 1.00 0.00 ? 12  ILE C CA   1  
ATOM   3383   C C    . ILE C 1 12  ? 4.286   4.089   -14.564 1.00 0.00 ? 12  ILE C C    1  
ATOM   3384   O O    . ILE C 1 12  ? 4.796   4.711   -13.630 1.00 0.00 ? 12  ILE C O    1  
ATOM   3385   C CB   . ILE C 1 12  ? 4.372   1.609   -14.782 1.00 0.00 ? 12  ILE C CB   1  
ATOM   3386   C CG1  . ILE C 1 12  ? 3.666   0.282   -14.458 1.00 0.00 ? 12  ILE C CG1  1  
ATOM   3387   C CG2  . ILE C 1 12  ? 5.726   1.640   -14.060 1.00 0.00 ? 12  ILE C CG2  1  
ATOM   3388   C CD1  . ILE C 1 12  ? 3.376   0.171   -12.968 1.00 0.00 ? 12  ILE C CD1  1  
ATOM   3389   H H    . ILE C 1 12  ? 2.084   2.187   -15.776 1.00 0.00 ? 12  ILE C H    1  
ATOM   3390   H HA   . ILE C 1 12  ? 3.295   2.718   -13.273 1.00 0.00 ? 12  ILE C HA   1  
ATOM   3391   H HB   . ILE C 1 12  ? 4.539   1.676   -15.847 1.00 0.00 ? 12  ILE C HB   1  
ATOM   3392   H HG12 . ILE C 1 12  ? 2.743   0.230   -14.992 1.00 0.00 ? 12  ILE C HG12 1  
ATOM   3393   H HG13 . ILE C 1 12  ? 4.297   -0.539  -14.758 1.00 0.00 ? 12  ILE C HG13 1  
ATOM   3394   H HG21 . ILE C 1 12  ? 5.562   1.600   -12.994 1.00 0.00 ? 12  ILE C HG21 1  
ATOM   3395   H HG22 . ILE C 1 12  ? 6.314   0.788   -14.362 1.00 0.00 ? 12  ILE C HG22 1  
ATOM   3396   H HG23 . ILE C 1 12  ? 6.255   2.545   -14.307 1.00 0.00 ? 12  ILE C HG23 1  
ATOM   3397   H HD11 . ILE C 1 12  ? 4.054   0.789   -12.426 1.00 0.00 ? 12  ILE C HD11 1  
ATOM   3398   H HD12 . ILE C 1 12  ? 2.364   0.488   -12.775 1.00 0.00 ? 12  ILE C HD12 1  
ATOM   3399   H HD13 . ILE C 1 12  ? 3.492   -0.851  -12.653 1.00 0.00 ? 12  ILE C HD13 1  
ATOM   3400   N N    . ILE C 1 13  ? 4.342   4.504   -15.824 1.00 0.00 ? 13  ILE C N    1  
ATOM   3401   C CA   . ILE C 1 13  ? 5.027   5.740   -16.166 1.00 0.00 ? 13  ILE C CA   1  
ATOM   3402   C C    . ILE C 1 13  ? 4.323   6.920   -15.502 1.00 0.00 ? 13  ILE C C    1  
ATOM   3403   O O    . ILE C 1 13  ? 4.963   7.794   -14.913 1.00 0.00 ? 13  ILE C O    1  
ATOM   3404   C CB   . ILE C 1 13  ? 5.036   5.914   -17.691 1.00 0.00 ? 13  ILE C CB   1  
ATOM   3405   C CG1  . ILE C 1 13  ? 5.927   4.832   -18.344 1.00 0.00 ? 13  ILE C CG1  1  
ATOM   3406   C CG2  . ILE C 1 13  ? 5.543   7.312   -18.062 1.00 0.00 ? 13  ILE C CG2  1  
ATOM   3407   C CD1  . ILE C 1 13  ? 7.425   5.095   -18.102 1.00 0.00 ? 13  ILE C CD1  1  
ATOM   3408   H H    . ILE C 1 13  ? 3.898   3.981   -16.529 1.00 0.00 ? 13  ILE C H    1  
ATOM   3409   H HA   . ILE C 1 13  ? 6.044   5.691   -15.806 1.00 0.00 ? 13  ILE C HA   1  
ATOM   3410   H HB   . ILE C 1 13  ? 4.026   5.805   -18.058 1.00 0.00 ? 13  ILE C HB   1  
ATOM   3411   H HG12 . ILE C 1 13  ? 5.672   3.872   -17.928 1.00 0.00 ? 13  ILE C HG12 1  
ATOM   3412   H HG13 . ILE C 1 13  ? 5.740   4.817   -19.406 1.00 0.00 ? 13  ILE C HG13 1  
ATOM   3413   H HG21 . ILE C 1 13  ? 6.520   7.466   -17.628 1.00 0.00 ? 13  ILE C HG21 1  
ATOM   3414   H HG22 . ILE C 1 13  ? 5.610   7.395   -19.134 1.00 0.00 ? 13  ILE C HG22 1  
ATOM   3415   H HG23 . ILE C 1 13  ? 4.861   8.057   -17.689 1.00 0.00 ? 13  ILE C HG23 1  
ATOM   3416   H HD11 . ILE C 1 13  ? 7.672   6.111   -18.353 1.00 0.00 ? 13  ILE C HD11 1  
ATOM   3417   H HD12 . ILE C 1 13  ? 7.670   4.906   -17.072 1.00 0.00 ? 13  ILE C HD12 1  
ATOM   3418   H HD13 . ILE C 1 13  ? 8.004   4.432   -18.723 1.00 0.00 ? 13  ILE C HD13 1  
ATOM   3419   N N    . ASN C 1 14  ? 2.995   6.933   -15.596 1.00 0.00 ? 14  ASN C N    1  
ATOM   3420   C CA   . ASN C 1 14  ? 2.202   8.006   -14.996 1.00 0.00 ? 14  ASN C CA   1  
ATOM   3421   C C    . ASN C 1 14  ? 2.443   8.057   -13.491 1.00 0.00 ? 14  ASN C C    1  
ATOM   3422   O O    . ASN C 1 14  ? 2.693   9.122   -12.922 1.00 0.00 ? 14  ASN C O    1  
ATOM   3423   C CB   . ASN C 1 14  ? 0.712   7.781   -15.292 1.00 0.00 ? 14  ASN C CB   1  
ATOM   3424   C CG   . ASN C 1 14  ? -0.047  9.107   -15.300 1.00 0.00 ? 14  ASN C CG   1  
ATOM   3425   O OD1  . ASN C 1 14  ? 0.502   10.143  -14.945 1.00 0.00 ? 14  ASN C OD1  1  
ATOM   3426   N ND2  . ASN C 1 14  ? -1.288  9.128   -15.686 1.00 0.00 ? 14  ASN C ND2  1  
ATOM   3427   H H    . ASN C 1 14  ? 2.539   6.202   -16.069 1.00 0.00 ? 14  ASN C H    1  
ATOM   3428   H HA   . ASN C 1 14  ? 2.509   8.947   -15.430 1.00 0.00 ? 14  ASN C HA   1  
ATOM   3429   H HB2  . ASN C 1 14  ? 0.608   7.314   -16.259 1.00 0.00 ? 14  ASN C HB2  1  
ATOM   3430   H HB3  . ASN C 1 14  ? 0.288   7.136   -14.538 1.00 0.00 ? 14  ASN C HB3  1  
ATOM   3431   H HD21 . ASN C 1 14  ? -1.729  8.302   -15.967 1.00 0.00 ? 14  ASN C HD21 1  
ATOM   3432   H HD22 . ASN C 1 14  ? -1.783  9.975   -15.698 1.00 0.00 ? 14  ASN C HD22 1  
ATOM   3433   N N    . SER C 1 15  ? 2.389   6.894   -12.851 1.00 0.00 ? 15  SER C N    1  
ATOM   3434   C CA   . SER C 1 15  ? 2.629   6.821   -11.412 1.00 0.00 ? 15  SER C CA   1  
ATOM   3435   C C    . SER C 1 15  ? 4.029   7.334   -11.096 1.00 0.00 ? 15  SER C C    1  
ATOM   3436   O O    . SER C 1 15  ? 4.231   8.091   -10.145 1.00 0.00 ? 15  SER C O    1  
ATOM   3437   C CB   . SER C 1 15  ? 2.494   5.378   -10.928 1.00 0.00 ? 15  SER C CB   1  
ATOM   3438   O OG   . SER C 1 15  ? 3.652   4.647   -11.309 1.00 0.00 ? 15  SER C OG   1  
ATOM   3439   H H    . SER C 1 15  ? 2.204   6.070   -13.355 1.00 0.00 ? 15  SER C H    1  
ATOM   3440   H HA   . SER C 1 15  ? 1.907   7.440   -10.905 1.00 0.00 ? 15  SER C HA   1  
ATOM   3441   H HB2  . SER C 1 15  ? 2.398   5.361   -9.856  1.00 0.00 ? 15  SER C HB2  1  
ATOM   3442   H HB3  . SER C 1 15  ? 1.616   4.932   -11.374 1.00 0.00 ? 15  SER C HB3  1  
ATOM   3443   H HG   . SER C 1 15  ? 3.385   3.744   -11.496 1.00 0.00 ? 15  SER C HG   1  
ATOM   3444   N N    . GLY C 1 16  ? 4.997   6.925   -11.917 1.00 0.00 ? 16  GLY C N    1  
ATOM   3445   C CA   . GLY C 1 16  ? 6.378   7.358   -11.732 1.00 0.00 ? 16  GLY C CA   1  
ATOM   3446   C C    . GLY C 1 16  ? 6.493   8.869   -11.888 1.00 0.00 ? 16  GLY C C    1  
ATOM   3447   O O    . GLY C 1 16  ? 7.147   9.537   -11.085 1.00 0.00 ? 16  GLY C O    1  
ATOM   3448   H H    . GLY C 1 16  ? 4.775   6.332   -12.669 1.00 0.00 ? 16  GLY C H    1  
ATOM   3449   H HA2  . GLY C 1 16  ? 6.706   7.080   -10.740 1.00 0.00 ? 16  GLY C HA2  1  
ATOM   3450   H HA3  . GLY C 1 16  ? 7.006   6.877   -12.464 1.00 0.00 ? 16  GLY C HA3  1  
ATOM   3451   N N    . GLN C 1 17  ? 5.843   9.416   -12.916 1.00 0.00 ? 17  GLN C N    1  
ATOM   3452   C CA   . GLN C 1 17  ? 5.880   10.864  -13.134 1.00 0.00 ? 17  GLN C CA   1  
ATOM   3453   C C    . GLN C 1 17  ? 5.240   11.571  -11.949 1.00 0.00 ? 17  GLN C C    1  
ATOM   3454   O O    . GLN C 1 17  ? 5.729   12.603  -11.491 1.00 0.00 ? 17  GLN C O    1  
ATOM   3455   C CB   . GLN C 1 17  ? 5.137   11.213  -14.433 1.00 0.00 ? 17  GLN C CB   1  
ATOM   3456   C CG   . GLN C 1 17  ? 5.549   12.608  -14.935 1.00 0.00 ? 17  GLN C CG   1  
ATOM   3457   C CD   . GLN C 1 17  ? 5.500   12.650  -16.461 1.00 0.00 ? 17  GLN C CD   1  
ATOM   3458   O OE1  . GLN C 1 17  ? 4.857   11.807  -17.086 1.00 0.00 ? 17  GLN C OE1  1  
ATOM   3459   N NE2  . GLN C 1 17  ? 6.152   13.583  -17.099 1.00 0.00 ? 17  GLN C NE2  1  
ATOM   3460   H H    . GLN C 1 17  ? 5.323   8.842   -13.523 1.00 0.00 ? 17  GLN C H    1  
ATOM   3461   H HA   . GLN C 1 17  ? 6.909   11.178  -13.216 1.00 0.00 ? 17  GLN C HA   1  
ATOM   3462   H HB2  . GLN C 1 17  ? 5.374   10.475  -15.187 1.00 0.00 ? 17  GLN C HB2  1  
ATOM   3463   H HB3  . GLN C 1 17  ? 4.073   11.202  -14.248 1.00 0.00 ? 17  GLN C HB3  1  
ATOM   3464   H HG2  . GLN C 1 17  ? 4.866   13.345  -14.538 1.00 0.00 ? 17  GLN C HG2  1  
ATOM   3465   H HG3  . GLN C 1 17  ? 6.550   12.838  -14.608 1.00 0.00 ? 17  GLN C HG3  1  
ATOM   3466   H HE21 . GLN C 1 17  ? 6.667   14.250  -16.599 1.00 0.00 ? 17  GLN C HE21 1  
ATOM   3467   H HE22 . GLN C 1 17  ? 6.129   13.615  -18.078 1.00 0.00 ? 17  GLN C HE22 1  
ATOM   3468   N N    . ALA C 1 18  ? 4.145   10.999  -11.455 1.00 0.00 ? 18  ALA C N    1  
ATOM   3469   C CA   . ALA C 1 18  ? 3.441   11.575  -10.321 1.00 0.00 ? 18  ALA C CA   1  
ATOM   3470   C C    . ALA C 1 18  ? 4.389   11.706  -9.131  1.00 0.00 ? 18  ALA C C    1  
ATOM   3471   O O    . ALA C 1 18  ? 4.514   12.778  -8.531  1.00 0.00 ? 18  ALA C O    1  
ATOM   3472   C CB   . ALA C 1 18  ? 2.238   10.698  -9.958  1.00 0.00 ? 18  ALA C CB   1  
ATOM   3473   H H    . ALA C 1 18  ? 3.807   10.170  -11.863 1.00 0.00 ? 18  ALA C H    1  
ATOM   3474   H HA   . ALA C 1 18  ? 3.092   12.560  -10.595 1.00 0.00 ? 18  ALA C HA   1  
ATOM   3475   H HB1  . ALA C 1 18  ? 1.954   10.107  -10.817 1.00 0.00 ? 18  ALA C HB1  1  
ATOM   3476   H HB2  . ALA C 1 18  ? 1.411   11.328  -9.669  1.00 0.00 ? 18  ALA C HB2  1  
ATOM   3477   H HB3  . ALA C 1 18  ? 2.498   10.042  -9.141  1.00 0.00 ? 18  ALA C HB3  1  
ATOM   3478   N N    . ARG C 1 19  ? 5.075   10.618  -8.802  1.00 0.00 ? 19  ARG C N    1  
ATOM   3479   C CA   . ARG C 1 19  ? 6.023   10.657  -7.697  1.00 0.00 ? 19  ARG C CA   1  
ATOM   3480   C C    . ARG C 1 19  ? 7.106   11.687  -7.987  1.00 0.00 ? 19  ARG C C    1  
ATOM   3481   O O    . ARG C 1 19  ? 7.455   12.504  -7.133  1.00 0.00 ? 19  ARG C O    1  
ATOM   3482   C CB   . ARG C 1 19  ? 6.672   9.283   -7.482  1.00 0.00 ? 19  ARG C CB   1  
ATOM   3483   C CG   . ARG C 1 19  ? 7.587   9.348   -6.249  1.00 0.00 ? 19  ARG C CG   1  
ATOM   3484   C CD   . ARG C 1 19  ? 8.189   7.973   -5.954  1.00 0.00 ? 19  ARG C CD   1  
ATOM   3485   N NE   . ARG C 1 19  ? 9.065   7.542   -7.044  1.00 0.00 ? 19  ARG C NE   1  
ATOM   3486   C CZ   . ARG C 1 19  ? 9.825   6.467   -6.926  1.00 0.00 ? 19  ARG C CZ   1  
ATOM   3487   N NH1  . ARG C 1 19  ? 9.778   5.765   -5.838  1.00 0.00 ? 19  ARG C NH1  1  
ATOM   3488   N NH2  . ARG C 1 19  ? 10.616  6.120   -7.889  1.00 0.00 ? 19  ARG C NH2  1  
ATOM   3489   H H    . ARG C 1 19  ? 4.959   9.790   -9.320  1.00 0.00 ? 19  ARG C H    1  
ATOM   3490   H HA   . ARG C 1 19  ? 5.498   10.944  -6.798  1.00 0.00 ? 19  ARG C HA   1  
ATOM   3491   H HB2  . ARG C 1 19  ? 5.904   8.540   -7.327  1.00 0.00 ? 19  ARG C HB2  1  
ATOM   3492   H HB3  . ARG C 1 19  ? 7.260   9.023   -8.350  1.00 0.00 ? 19  ARG C HB3  1  
ATOM   3493   H HG2  . ARG C 1 19  ? 8.385   10.058  -6.428  1.00 0.00 ? 19  ARG C HG2  1  
ATOM   3494   H HG3  . ARG C 1 19  ? 7.010   9.673   -5.395  1.00 0.00 ? 19  ARG C HG3  1  
ATOM   3495   H HD2  . ARG C 1 19  ? 8.767   8.033   -5.041  1.00 0.00 ? 19  ARG C HD2  1  
ATOM   3496   H HD3  . ARG C 1 19  ? 7.390   7.255   -5.825  1.00 0.00 ? 19  ARG C HD3  1  
ATOM   3497   H HE   . ARG C 1 19  ? 9.094   8.071   -7.874  1.00 0.00 ? 19  ARG C HE   1  
ATOM   3498   H HH11 . ARG C 1 19  ? 9.164   6.038   -5.097  1.00 0.00 ? 19  ARG C HH11 1  
ATOM   3499   H HH12 . ARG C 1 19  ? 10.348  4.958   -5.737  1.00 0.00 ? 19  ARG C HH12 1  
ATOM   3500   H HH21 . ARG C 1 19  ? 10.649  6.662   -8.727  1.00 0.00 ? 19  ARG C HH21 1  
ATOM   3501   H HH22 . ARG C 1 19  ? 11.192  5.312   -7.793  1.00 0.00 ? 19  ARG C HH22 1  
ATOM   3502   N N    . SER C 1 20  ? 7.633   11.642  -9.207  1.00 0.00 ? 20  SER C N    1  
ATOM   3503   C CA   . SER C 1 20  ? 8.677   12.579  -9.611  1.00 0.00 ? 20  SER C CA   1  
ATOM   3504   C C    . SER C 1 20  ? 8.232   14.015  -9.351  1.00 0.00 ? 20  SER C C    1  
ATOM   3505   O O    . SER C 1 20  ? 8.967   14.811  -8.760  1.00 0.00 ? 20  SER C O    1  
ATOM   3506   C CB   . SER C 1 20  ? 9.008   12.403  -11.093 1.00 0.00 ? 20  SER C CB   1  
ATOM   3507   O OG   . SER C 1 20  ? 9.760   13.523  -11.544 1.00 0.00 ? 20  SER C OG   1  
ATOM   3508   H H    . SER C 1 20  ? 7.311   10.971  -9.849  1.00 0.00 ? 20  SER C H    1  
ATOM   3509   H HA   . SER C 1 20  ? 9.561   12.380  -9.027  1.00 0.00 ? 20  SER C HA   1  
ATOM   3510   H HB2  . SER C 1 20  ? 9.590   11.507  -11.231 1.00 0.00 ? 20  SER C HB2  1  
ATOM   3511   H HB3  . SER C 1 20  ? 8.090   12.324  -11.657 1.00 0.00 ? 20  SER C HB3  1  
ATOM   3512   H HG   . SER C 1 20  ? 10.490  13.656  -10.934 1.00 0.00 ? 20  SER C HG   1  
ATOM   3513   N N    . LEU C 1 21  ? 7.015   14.336  -9.773  1.00 0.00 ? 21  LEU C N    1  
ATOM   3514   C CA   . LEU C 1 21  ? 6.473   15.674  -9.558  1.00 0.00 ? 21  LEU C CA   1  
ATOM   3515   C C    . LEU C 1 21  ? 6.349   15.956  -8.060  1.00 0.00 ? 21  LEU C C    1  
ATOM   3516   O O    . LEU C 1 21  ? 6.687   17.044  -7.588  1.00 0.00 ? 21  LEU C O    1  
ATOM   3517   C CB   . LEU C 1 21  ? 5.093   15.793  -10.211 1.00 0.00 ? 21  LEU C CB   1  
ATOM   3518   C CG   . LEU C 1 21  ? 5.234   15.780  -11.741 1.00 0.00 ? 21  LEU C CG   1  
ATOM   3519   C CD1  . LEU C 1 21  ? 3.852   15.595  -12.391 1.00 0.00 ? 21  LEU C CD1  1  
ATOM   3520   C CD2  . LEU C 1 21  ? 5.867   17.104  -12.225 1.00 0.00 ? 21  LEU C CD2  1  
ATOM   3521   H H    . LEU C 1 21  ? 6.463   13.658  -10.219 1.00 0.00 ? 21  LEU C H    1  
ATOM   3522   H HA   . LEU C 1 21  ? 7.141   16.402  -9.994  1.00 0.00 ? 21  LEU C HA   1  
ATOM   3523   H HB2  . LEU C 1 21  ? 4.481   14.961  -9.895  1.00 0.00 ? 21  LEU C HB2  1  
ATOM   3524   H HB3  . LEU C 1 21  ? 4.628   16.718  -9.902  1.00 0.00 ? 21  LEU C HB3  1  
ATOM   3525   H HG   . LEU C 1 21  ? 5.871   14.955  -12.028 1.00 0.00 ? 21  LEU C HG   1  
ATOM   3526   H HD11 . LEU C 1 21  ? 3.207   15.032  -11.732 1.00 0.00 ? 21  LEU C HD11 1  
ATOM   3527   H HD12 . LEU C 1 21  ? 3.411   16.562  -12.583 1.00 0.00 ? 21  LEU C HD12 1  
ATOM   3528   H HD13 . LEU C 1 21  ? 3.962   15.060  -13.323 1.00 0.00 ? 21  LEU C HD13 1  
ATOM   3529   H HD21 . LEU C 1 21  ? 5.987   17.784  -11.393 1.00 0.00 ? 21  LEU C HD21 1  
ATOM   3530   H HD22 . LEU C 1 21  ? 6.835   16.898  -12.659 1.00 0.00 ? 21  LEU C HD22 1  
ATOM   3531   H HD23 . LEU C 1 21  ? 5.235   17.565  -12.971 1.00 0.00 ? 21  LEU C HD23 1  
ATOM   3532   N N    . ALA C 1 22  ? 5.871   14.962  -7.314  1.00 0.00 ? 22  ALA C N    1  
ATOM   3533   C CA   . ALA C 1 22  ? 5.714   15.110  -5.868  1.00 0.00 ? 22  ALA C CA   1  
ATOM   3534   C C    . ALA C 1 22  ? 7.058   15.445  -5.215  1.00 0.00 ? 22  ALA C C    1  
ATOM   3535   O O    . ALA C 1 22  ? 7.165   16.420  -4.469  1.00 0.00 ? 22  ALA C O    1  
ATOM   3536   C CB   . ALA C 1 22  ? 5.136   13.825  -5.275  1.00 0.00 ? 22  ALA C CB   1  
ATOM   3537   H H    . ALA C 1 22  ? 5.627   14.114  -7.745  1.00 0.00 ? 22  ALA C H    1  
ATOM   3538   H HA   . ALA C 1 22  ? 5.029   15.921  -5.676  1.00 0.00 ? 22  ALA C HA   1  
ATOM   3539   H HB1  . ALA C 1 22  ? 5.875   13.041  -5.319  1.00 0.00 ? 22  ALA C HB1  1  
ATOM   3540   H HB2  . ALA C 1 22  ? 4.855   14.000  -4.246  1.00 0.00 ? 22  ALA C HB2  1  
ATOM   3541   H HB3  . ALA C 1 22  ? 4.264   13.530  -5.840  1.00 0.00 ? 22  ALA C HB3  1  
ATOM   3542   N N    . TYR C 1 23  ? 8.089   14.652  -5.509  1.00 0.00 ? 23  TYR C N    1  
ATOM   3543   C CA   . TYR C 1 23  ? 9.416   14.923  -4.945  1.00 0.00 ? 23  TYR C CA   1  
ATOM   3544   C C    . TYR C 1 23  ? 9.877   16.310  -5.380  1.00 0.00 ? 23  TYR C C    1  
ATOM   3545   O O    . TYR C 1 23  ? 10.427  17.072  -4.584  1.00 0.00 ? 23  TYR C O    1  
ATOM   3546   C CB   . TYR C 1 23  ? 10.423  13.867  -5.409  1.00 0.00 ? 23  TYR C CB   1  
ATOM   3547   C CG   . TYR C 1 23  ? 11.800  14.221  -4.899  1.00 0.00 ? 23  TYR C CG   1  
ATOM   3548   C CD1  . TYR C 1 23  ? 12.142  13.965  -3.565  1.00 0.00 ? 23  TYR C CD1  1  
ATOM   3549   C CD2  . TYR C 1 23  ? 12.735  14.808  -5.761  1.00 0.00 ? 23  TYR C CD2  1  
ATOM   3550   C CE1  . TYR C 1 23  ? 13.419  14.295  -3.095  1.00 0.00 ? 23  TYR C CE1  1  
ATOM   3551   C CE2  . TYR C 1 23  ? 14.012  15.137  -5.290  1.00 0.00 ? 23  TYR C CE2  1  
ATOM   3552   C CZ   . TYR C 1 23  ? 14.354  14.881  -3.957  1.00 0.00 ? 23  TYR C CZ   1  
ATOM   3553   O OH   . TYR C 1 23  ? 15.612  15.206  -3.493  1.00 0.00 ? 23  TYR C OH   1  
ATOM   3554   H H    . TYR C 1 23  ? 7.960   13.891  -6.120  1.00 0.00 ? 23  TYR C H    1  
ATOM   3555   H HA   . TYR C 1 23  ? 9.347   14.907  -3.868  1.00 0.00 ? 23  TYR C HA   1  
ATOM   3556   H HB2  . TYR C 1 23  ? 10.134  12.900  -5.022  1.00 0.00 ? 23  TYR C HB2  1  
ATOM   3557   H HB3  . TYR C 1 23  ? 10.438  13.833  -6.488  1.00 0.00 ? 23  TYR C HB3  1  
ATOM   3558   H HD1  . TYR C 1 23  ? 11.422  13.513  -2.900  1.00 0.00 ? 23  TYR C HD1  1  
ATOM   3559   H HD2  . TYR C 1 23  ? 12.471  15.005  -6.789  1.00 0.00 ? 23  TYR C HD2  1  
ATOM   3560   H HE1  . TYR C 1 23  ? 13.684  14.097  -2.066  1.00 0.00 ? 23  TYR C HE1  1  
ATOM   3561   H HE2  . TYR C 1 23  ? 14.732  15.589  -5.955  1.00 0.00 ? 23  TYR C HE2  1  
ATOM   3562   H HH   . TYR C 1 23  ? 15.705  14.846  -2.608  1.00 0.00 ? 23  TYR C HH   1  
ATOM   3563   N N    . ALA C 1 24  ? 9.622   16.649  -6.641  1.00 0.00 ? 24  ALA C N    1  
ATOM   3564   C CA   . ALA C 1 24  ? 10.000  17.961  -7.141  1.00 0.00 ? 24  ALA C CA   1  
ATOM   3565   C C    . ALA C 1 24  ? 9.250   19.032  -6.345  1.00 0.00 ? 24  ALA C C    1  
ATOM   3566   O O    . ALA C 1 24  ? 9.820   20.057  -5.966  1.00 0.00 ? 24  ALA C O    1  
ATOM   3567   C CB   . ALA C 1 24  ? 9.690   18.059  -8.644  1.00 0.00 ? 24  ALA C CB   1  
ATOM   3568   H H    . ALA C 1 24  ? 9.161   16.016  -7.234  1.00 0.00 ? 24  ALA C H    1  
ATOM   3569   H HA   . ALA C 1 24  ? 11.059  18.099  -6.989  1.00 0.00 ? 24  ALA C HA   1  
ATOM   3570   H HB1  . ALA C 1 24  ? 9.183   17.161  -8.966  1.00 0.00 ? 24  ALA C HB1  1  
ATOM   3571   H HB2  . ALA C 1 24  ? 10.614  18.163  -9.197  1.00 0.00 ? 24  ALA C HB2  1  
ATOM   3572   H HB3  . ALA C 1 24  ? 9.060   18.914  -8.835  1.00 0.00 ? 24  ALA C HB3  1  
ATOM   3573   N N    . ALA C 1 25  ? 7.976   18.766  -6.059  1.00 0.00 ? 25  ALA C N    1  
ATOM   3574   C CA   . ALA C 1 25  ? 7.168   19.692  -5.272  1.00 0.00 ? 25  ALA C CA   1  
ATOM   3575   C C    . ALA C 1 25  ? 7.824   19.917  -3.914  1.00 0.00 ? 25  ALA C C    1  
ATOM   3576   O O    . ALA C 1 25  ? 7.936   21.047  -3.436  1.00 0.00 ? 25  ALA C O    1  
ATOM   3577   C CB   . ALA C 1 25  ? 5.758   19.122  -5.081  1.00 0.00 ? 25  ALA C CB   1  
ATOM   3578   H H    . ALA C 1 25  ? 7.581   17.917  -6.363  1.00 0.00 ? 25  ALA C H    1  
ATOM   3579   H HA   . ALA C 1 25  ? 7.103   20.635  -5.792  1.00 0.00 ? 25  ALA C HA   1  
ATOM   3580   H HB1  . ALA C 1 25  ? 5.441   18.638  -5.992  1.00 0.00 ? 25  ALA C HB1  1  
ATOM   3581   H HB2  . ALA C 1 25  ? 5.075   19.926  -4.842  1.00 0.00 ? 25  ALA C HB2  1  
ATOM   3582   H HB3  . ALA C 1 25  ? 5.765   18.404  -4.273  1.00 0.00 ? 25  ALA C HB3  1  
ATOM   3583   N N    . LEU C 1 26  ? 8.278   18.827  -3.307  1.00 0.00 ? 26  LEU C N    1  
ATOM   3584   C CA   . LEU C 1 26  ? 8.947   18.909  -2.012  1.00 0.00 ? 26  LEU C CA   1  
ATOM   3585   C C    . LEU C 1 26  ? 10.217  19.747  -2.132  1.00 0.00 ? 26  LEU C C    1  
ATOM   3586   O O    . LEU C 1 26  ? 10.500  20.602  -1.289  1.00 0.00 ? 26  LEU C O    1  
ATOM   3587   C CB   . LEU C 1 26  ? 9.289   17.500  -1.511  1.00 0.00 ? 26  LEU C CB   1  
ATOM   3588   C CG   . LEU C 1 26  ? 10.139  17.570  -0.232  1.00 0.00 ? 26  LEU C CG   1  
ATOM   3589   C CD1  . LEU C 1 26  ? 9.373   18.303  0.873   1.00 0.00 ? 26  LEU C CD1  1  
ATOM   3590   C CD2  . LEU C 1 26  ? 10.451  16.149  0.233   1.00 0.00 ? 26  LEU C CD2  1  
ATOM   3591   H H    . LEU C 1 26  ? 8.173   17.954  -3.745  1.00 0.00 ? 26  LEU C H    1  
ATOM   3592   H HA   . LEU C 1 26  ? 8.282   19.383  -1.307  1.00 0.00 ? 26  LEU C HA   1  
ATOM   3593   H HB2  . LEU C 1 26  ? 8.377   16.967  -1.303  1.00 0.00 ? 26  LEU C HB2  1  
ATOM   3594   H HB3  . LEU C 1 26  ? 9.846   16.975  -2.276  1.00 0.00 ? 26  LEU C HB3  1  
ATOM   3595   H HG   . LEU C 1 26  ? 11.063  18.092  -0.437  1.00 0.00 ? 26  LEU C HG   1  
ATOM   3596   H HD11 . LEU C 1 26  ? 8.351   17.961  0.892   1.00 0.00 ? 26  LEU C HD11 1  
ATOM   3597   H HD12 . LEU C 1 26  ? 9.840   18.098  1.825   1.00 0.00 ? 26  LEU C HD12 1  
ATOM   3598   H HD13 . LEU C 1 26  ? 9.395   19.367  0.683   1.00 0.00 ? 26  LEU C HD13 1  
ATOM   3599   H HD21 . LEU C 1 26  ? 9.530   15.623  0.437   1.00 0.00 ? 26  LEU C HD21 1  
ATOM   3600   H HD22 . LEU C 1 26  ? 10.999  15.627  -0.537  1.00 0.00 ? 26  LEU C HD22 1  
ATOM   3601   H HD23 . LEU C 1 26  ? 11.047  16.185  1.133   1.00 0.00 ? 26  LEU C HD23 1  
ATOM   3602   N N    . LYS C 1 27  ? 10.974  19.500  -3.193  1.00 0.00 ? 27  LYS C N    1  
ATOM   3603   C CA   . LYS C 1 27  ? 12.204  20.248  -3.424  1.00 0.00 ? 27  LYS C CA   1  
ATOM   3604   C C    . LYS C 1 27  ? 11.913  21.747  -3.473  1.00 0.00 ? 27  LYS C C    1  
ATOM   3605   O O    . LYS C 1 27  ? 12.653  22.550  -2.899  1.00 0.00 ? 27  LYS C O    1  
ATOM   3606   C CB   . LYS C 1 27  ? 12.851  19.778  -4.732  1.00 0.00 ? 27  LYS C CB   1  
ATOM   3607   C CG   . LYS C 1 27  ? 14.215  20.452  -4.908  1.00 0.00 ? 27  LYS C CG   1  
ATOM   3608   C CD   . LYS C 1 27  ? 14.879  19.918  -6.182  1.00 0.00 ? 27  LYS C CD   1  
ATOM   3609   C CE   . LYS C 1 27  ? 16.259  20.556  -6.347  1.00 0.00 ? 27  LYS C CE   1  
ATOM   3610   N NZ   . LYS C 1 27  ? 16.899  20.025  -7.585  1.00 0.00 ? 27  LYS C NZ   1  
ATOM   3611   H H    . LYS C 1 27  ? 10.695  18.812  -3.835  1.00 0.00 ? 27  LYS C H    1  
ATOM   3612   H HA   . LYS C 1 27  ? 12.880  20.053  -2.610  1.00 0.00 ? 27  LYS C HA   1  
ATOM   3613   H HB2  . LYS C 1 27  ? 12.979  18.706  -4.700  1.00 0.00 ? 27  LYS C HB2  1  
ATOM   3614   H HB3  . LYS C 1 27  ? 12.212  20.038  -5.564  1.00 0.00 ? 27  LYS C HB3  1  
ATOM   3615   H HG2  . LYS C 1 27  ? 14.078  21.524  -4.988  1.00 0.00 ? 27  LYS C HG2  1  
ATOM   3616   H HG3  . LYS C 1 27  ? 14.840  20.231  -4.054  1.00 0.00 ? 27  LYS C HG3  1  
ATOM   3617   H HD2  . LYS C 1 27  ? 14.981  18.845  -6.108  1.00 0.00 ? 27  LYS C HD2  1  
ATOM   3618   H HD3  . LYS C 1 27  ? 14.264  20.163  -7.035  1.00 0.00 ? 27  LYS C HD3  1  
ATOM   3619   H HE2  . LYS C 1 27  ? 16.151  21.630  -6.424  1.00 0.00 ? 27  LYS C HE2  1  
ATOM   3620   H HE3  . LYS C 1 27  ? 16.872  20.316  -5.489  1.00 0.00 ? 27  LYS C HE3  1  
ATOM   3621   H HZ1  . LYS C 1 27  ? 16.957  18.988  -7.532  1.00 0.00 ? 27  LYS C HZ1  1  
ATOM   3622   H HZ2  . LYS C 1 27  ? 16.332  20.298  -8.415  1.00 0.00 ? 27  LYS C HZ2  1  
ATOM   3623   H HZ3  . LYS C 1 27  ? 17.859  20.417  -7.676  1.00 0.00 ? 27  LYS C HZ3  1  
ATOM   3624   N N    . GLN C 1 28  ? 10.818  22.119  -4.133  1.00 0.00 ? 28  GLN C N    1  
ATOM   3625   C CA   . GLN C 1 28  ? 10.430  23.524  -4.214  1.00 0.00 ? 28  GLN C CA   1  
ATOM   3626   C C    . GLN C 1 28  ? 10.226  24.078  -2.806  1.00 0.00 ? 28  GLN C C    1  
ATOM   3627   O O    . GLN C 1 28  ? 10.639  25.192  -2.491  1.00 0.00 ? 28  GLN C O    1  
ATOM   3628   C CB   . GLN C 1 28  ? 9.133   23.664  -5.014  1.00 0.00 ? 28  GLN C CB   1  
ATOM   3629   C CG   . GLN C 1 28  ? 9.389   23.290  -6.475  1.00 0.00 ? 28  GLN C CG   1  
ATOM   3630   C CD   . GLN C 1 28  ? 10.349  24.291  -7.108  1.00 0.00 ? 28  GLN C CD   1  
ATOM   3631   O OE1  . GLN C 1 28  ? 10.116  25.498  -7.050  1.00 0.00 ? 28  GLN C OE1  1  
ATOM   3632   N NE2  . GLN C 1 28  ? 11.422  23.860  -7.713  1.00 0.00 ? 28  GLN C NE2  1  
ATOM   3633   H H    . GLN C 1 28  ? 10.255  21.434  -4.554  1.00 0.00 ? 28  GLN C H    1  
ATOM   3634   H HA   . GLN C 1 28  ? 11.212  24.087  -4.707  1.00 0.00 ? 28  GLN C HA   1  
ATOM   3635   H HB2  . GLN C 1 28  ? 8.383   23.006  -4.599  1.00 0.00 ? 28  GLN C HB2  1  
ATOM   3636   H HB3  . GLN C 1 28  ? 8.786   24.684  -4.961  1.00 0.00 ? 28  GLN C HB3  1  
ATOM   3637   H HG2  . GLN C 1 28  ? 9.820   22.300  -6.521  1.00 0.00 ? 28  GLN C HG2  1  
ATOM   3638   H HG3  . GLN C 1 28  ? 8.455   23.299  -7.016  1.00 0.00 ? 28  GLN C HG3  1  
ATOM   3639   H HE21 . GLN C 1 28  ? 11.607  22.899  -7.759  1.00 0.00 ? 28  GLN C HE21 1  
ATOM   3640   H HE22 . GLN C 1 28  ? 12.043  24.499  -8.123  1.00 0.00 ? 28  GLN C HE22 1  
ATOM   3641   N N    . ALA C 1 29  ? 9.584   23.275  -1.960  1.00 0.00 ? 29  ALA C N    1  
ATOM   3642   C CA   . ALA C 1 29  ? 9.327   23.679  -0.581  1.00 0.00 ? 29  ALA C CA   1  
ATOM   3643   C C    . ALA C 1 29  ? 10.641  23.954  0.146   1.00 0.00 ? 29  ALA C C    1  
ATOM   3644   O O    . ALA C 1 29  ? 10.770  24.939  0.870   1.00 0.00 ? 29  ALA C O    1  
ATOM   3645   C CB   . ALA C 1 29  ? 8.547   22.580  0.150   1.00 0.00 ? 29  ALA C CB   1  
ATOM   3646   H H    . ALA C 1 29  ? 9.285   22.393  -2.269  1.00 0.00 ? 29  ALA C H    1  
ATOM   3647   H HA   . ALA C 1 29  ? 8.736   24.583  -0.585  1.00 0.00 ? 29  ALA C HA   1  
ATOM   3648   H HB1  . ALA C 1 29  ? 9.232   21.831  0.516   1.00 0.00 ? 29  ALA C HB1  1  
ATOM   3649   H HB2  . ALA C 1 29  ? 8.011   23.013  0.983   1.00 0.00 ? 29  ALA C HB2  1  
ATOM   3650   H HB3  . ALA C 1 29  ? 7.845   22.123  -0.530  1.00 0.00 ? 29  ALA C HB3  1  
ATOM   3651   N N    . LYS C 1 30  ? 11.622  23.084  -0.064  1.00 0.00 ? 30  LYS C N    1  
ATOM   3652   C CA   . LYS C 1 30  ? 12.923  23.261  0.571   1.00 0.00 ? 30  LYS C CA   1  
ATOM   3653   C C    . LYS C 1 30  ? 13.550  24.585  0.146   1.00 0.00 ? 30  LYS C C    1  
ATOM   3654   O O    . LYS C 1 30  ? 14.277  25.205  0.920   1.00 0.00 ? 30  LYS C O    1  
ATOM   3655   C CB   . LYS C 1 30  ? 13.869  22.113  0.204   1.00 0.00 ? 30  LYS C CB   1  
ATOM   3656   C CG   . LYS C 1 30  ? 13.396  20.818  0.864   1.00 0.00 ? 30  LYS C CG   1  
ATOM   3657   C CD   . LYS C 1 30  ? 14.410  19.707  0.568   1.00 0.00 ? 30  LYS C CD   1  
ATOM   3658   C CE   . LYS C 1 30  ? 13.964  18.406  1.237   1.00 0.00 ? 30  LYS C CE   1  
ATOM   3659   N NZ   . LYS C 1 30  ? 14.974  17.346  0.966   1.00 0.00 ? 30  LYS C NZ   1  
ATOM   3660   H H    . LYS C 1 30  ? 11.468  22.319  -0.660  1.00 0.00 ? 30  LYS C H    1  
ATOM   3661   H HA   . LYS C 1 30  ? 12.789  23.273  1.641   1.00 0.00 ? 30  LYS C HA   1  
ATOM   3662   H HB2  . LYS C 1 30  ? 13.883  21.989  -0.871  1.00 0.00 ? 30  LYS C HB2  1  
ATOM   3663   H HB3  . LYS C 1 30  ? 14.867  22.349  0.549   1.00 0.00 ? 30  LYS C HB3  1  
ATOM   3664   H HG2  . LYS C 1 30  ? 13.317  20.964  1.930   1.00 0.00 ? 30  LYS C HG2  1  
ATOM   3665   H HG3  . LYS C 1 30  ? 12.430  20.542  0.462   1.00 0.00 ? 30  LYS C HG3  1  
ATOM   3666   H HD2  . LYS C 1 30  ? 14.475  19.558  -0.503  1.00 0.00 ? 30  LYS C HD2  1  
ATOM   3667   H HD3  . LYS C 1 30  ? 15.381  19.994  0.948   1.00 0.00 ? 30  LYS C HD3  1  
ATOM   3668   H HE2  . LYS C 1 30  ? 13.879  18.561  2.304   1.00 0.00 ? 30  LYS C HE2  1  
ATOM   3669   H HE3  . LYS C 1 30  ? 13.004  18.105  0.837   1.00 0.00 ? 30  LYS C HE3  1  
ATOM   3670   H HZ1  . LYS C 1 30  ? 15.933  17.717  1.142   1.00 0.00 ? 30  LYS C HZ1  1  
ATOM   3671   H HZ2  . LYS C 1 30  ? 14.798  16.528  1.595   1.00 0.00 ? 30  LYS C HZ2  1  
ATOM   3672   H HZ3  . LYS C 1 30  ? 14.897  17.032  -0.021  1.00 0.00 ? 30  LYS C HZ3  1  
ATOM   3673   N N    . GLN C 1 31  ? 13.261  25.014  -1.080  1.00 0.00 ? 31  GLN C N    1  
ATOM   3674   C CA   . GLN C 1 31  ? 13.806  26.272  -1.579  1.00 0.00 ? 31  GLN C CA   1  
ATOM   3675   C C    . GLN C 1 31  ? 12.992  27.447  -1.034  1.00 0.00 ? 31  GLN C C    1  
ATOM   3676   O O    . GLN C 1 31  ? 13.310  28.605  -1.290  1.00 0.00 ? 31  GLN C O    1  
ATOM   3677   C CB   . GLN C 1 31  ? 13.795  26.290  -3.114  1.00 0.00 ? 31  GLN C CB   1  
ATOM   3678   C CG   . GLN C 1 31  ? 14.367  24.967  -3.674  1.00 0.00 ? 31  GLN C CG   1  
ATOM   3679   C CD   . GLN C 1 31  ? 15.368  25.235  -4.797  1.00 0.00 ? 31  GLN C CD   1  
ATOM   3680   O OE1  . GLN C 1 31  ? 15.278  26.239  -5.491  1.00 0.00 ? 31  GLN C OE1  1  
ATOM   3681   N NE2  . GLN C 1 31  ? 16.325  24.381  -5.021  1.00 0.00 ? 31  GLN C NE2  1  
ATOM   3682   H H    . GLN C 1 31  ? 12.673  24.479  -1.655  1.00 0.00 ? 31  GLN C H    1  
ATOM   3683   H HA   . GLN C 1 31  ? 14.825  26.375  -1.235  1.00 0.00 ? 31  GLN C HA   1  
ATOM   3684   H HB2  . GLN C 1 31  ? 12.778  26.420  -3.457  1.00 0.00 ? 31  GLN C HB2  1  
ATOM   3685   H HB3  . GLN C 1 31  ? 14.397  27.118  -3.460  1.00 0.00 ? 31  GLN C HB3  1  
ATOM   3686   H HG2  . GLN C 1 31  ? 14.864  24.422  -2.886  1.00 0.00 ? 31  GLN C HG2  1  
ATOM   3687   H HG3  . GLN C 1 31  ? 13.558  24.367  -4.063  1.00 0.00 ? 31  GLN C HG3  1  
ATOM   3688   H HE21 . GLN C 1 31  ? 16.402  23.577  -4.472  1.00 0.00 ? 31  GLN C HE21 1  
ATOM   3689   H HE22 . GLN C 1 31  ? 16.971  24.552  -5.738  1.00 0.00 ? 31  GLN C HE22 1  
ATOM   3690   N N    . GLY C 1 32  ? 11.950  27.132  -0.266  1.00 0.00 ? 32  GLY C N    1  
ATOM   3691   C CA   . GLY C 1 32  ? 11.100  28.166  0.325   1.00 0.00 ? 32  GLY C CA   1  
ATOM   3692   C C    . GLY C 1 32  ? 10.056  28.673  -0.667  1.00 0.00 ? 32  GLY C C    1  
ATOM   3693   O O    . GLY C 1 32  ? 9.448   29.723  -0.456  1.00 0.00 ? 32  GLY C O    1  
ATOM   3694   H H    . GLY C 1 32  ? 11.752  26.188  -0.085  1.00 0.00 ? 32  GLY C H    1  
ATOM   3695   H HA2  . GLY C 1 32  ? 10.596  27.755  1.190   1.00 0.00 ? 32  GLY C HA2  1  
ATOM   3696   H HA3  . GLY C 1 32  ? 11.719  28.992  0.639   1.00 0.00 ? 32  GLY C HA3  1  
ATOM   3697   N N    . ASP C 1 33  ? 9.842   27.916  -1.741  1.00 0.00 ? 33  ASP C N    1  
ATOM   3698   C CA   . ASP C 1 33  ? 8.862   28.292  -2.759  1.00 0.00 ? 33  ASP C CA   1  
ATOM   3699   C C    . ASP C 1 33  ? 7.545   27.554  -2.532  1.00 0.00 ? 33  ASP C C    1  
ATOM   3700   O O    . ASP C 1 33  ? 7.273   26.528  -3.165  1.00 0.00 ? 33  ASP C O    1  
ATOM   3701   C CB   . ASP C 1 33  ? 9.412   27.957  -4.146  1.00 0.00 ? 33  ASP C CB   1  
ATOM   3702   C CG   . ASP C 1 33  ? 10.550  28.902  -4.504  1.00 0.00 ? 33  ASP C CG   1  
ATOM   3703   O OD1  . ASP C 1 33  ? 10.739  29.872  -3.793  1.00 0.00 ? 33  ASP C OD1  1  
ATOM   3704   O OD2  . ASP C 1 33  ? 11.208  28.646  -5.494  1.00 0.00 ? 33  ASP C OD2  1  
ATOM   3705   H H    . ASP C 1 33  ? 10.353  27.087  -1.852  1.00 0.00 ? 33  ASP C H    1  
ATOM   3706   H HA   . ASP C 1 33  ? 8.685   29.358  -2.704  1.00 0.00 ? 33  ASP C HA   1  
ATOM   3707   H HB2  . ASP C 1 33  ? 9.779   26.941  -4.149  1.00 0.00 ? 33  ASP C HB2  1  
ATOM   3708   H HB3  . ASP C 1 33  ? 8.625   28.055  -4.877  1.00 0.00 ? 33  ASP C HB3  1  
ATOM   3709   N N    . PHE C 1 34  ? 6.730   28.068  -1.619  1.00 0.00 ? 34  PHE C N    1  
ATOM   3710   C CA   . PHE C 1 34  ? 5.448   27.436  -1.310  1.00 0.00 ? 34  PHE C CA   1  
ATOM   3711   C C    . PHE C 1 34  ? 4.491   27.477  -2.498  1.00 0.00 ? 34  PHE C C    1  
ATOM   3712   O O    . PHE C 1 34  ? 3.704   26.552  -2.701  1.00 0.00 ? 34  PHE C O    1  
ATOM   3713   C CB   . PHE C 1 34  ? 4.782   28.143  -0.128  1.00 0.00 ? 34  PHE C CB   1  
ATOM   3714   C CG   . PHE C 1 34  ? 5.631   27.996  1.107   1.00 0.00 ? 34  PHE C CG   1  
ATOM   3715   C CD1  . PHE C 1 34  ? 6.221   29.123  1.692   1.00 0.00 ? 34  PHE C CD1  1  
ATOM   3716   C CD2  . PHE C 1 34  ? 5.841   26.729  1.662   1.00 0.00 ? 34  PHE C CD2  1  
ATOM   3717   C CE1  . PHE C 1 34  ? 7.000   28.983  2.845   1.00 0.00 ? 34  PHE C CE1  1  
ATOM   3718   C CE2  . PHE C 1 34  ? 6.620   26.590  2.813   1.00 0.00 ? 34  PHE C CE2  1  
ATOM   3719   C CZ   . PHE C 1 34  ? 7.207   27.715  3.396   1.00 0.00 ? 34  PHE C CZ   1  
ATOM   3720   H H    . PHE C 1 34  ? 6.999   28.880  -1.138  1.00 0.00 ? 34  PHE C H    1  
ATOM   3721   H HA   . PHE C 1 34  ? 5.623   26.406  -1.041  1.00 0.00 ? 34  PHE C HA   1  
ATOM   3722   H HB2  . PHE C 1 34  ? 4.660   29.192  -0.359  1.00 0.00 ? 34  PHE C HB2  1  
ATOM   3723   H HB3  . PHE C 1 34  ? 3.813   27.700  0.053   1.00 0.00 ? 34  PHE C HB3  1  
ATOM   3724   H HD1  . PHE C 1 34  ? 6.062   30.100  1.265   1.00 0.00 ? 34  PHE C HD1  1  
ATOM   3725   H HD2  . PHE C 1 34  ? 5.387   25.859  1.211   1.00 0.00 ? 34  PHE C HD2  1  
ATOM   3726   H HE1  . PHE C 1 34  ? 7.456   29.851  3.300   1.00 0.00 ? 34  PHE C HE1  1  
ATOM   3727   H HE2  . PHE C 1 34  ? 6.783   25.613  3.243   1.00 0.00 ? 34  PHE C HE2  1  
ATOM   3728   H HZ   . PHE C 1 34  ? 7.812   27.610  4.287   1.00 0.00 ? 34  PHE C HZ   1  
ATOM   3729   N N    . ALA C 1 35  ? 4.547   28.560  -3.267  1.00 0.00 ? 35  ALA C N    1  
ATOM   3730   C CA   . ALA C 1 35  ? 3.658   28.719  -4.414  1.00 0.00 ? 35  ALA C CA   1  
ATOM   3731   C C    . ALA C 1 35  ? 3.897   27.618  -5.445  1.00 0.00 ? 35  ALA C C    1  
ATOM   3732   O O    . ALA C 1 35  ? 2.959   26.954  -5.890  1.00 0.00 ? 35  ALA C O    1  
ATOM   3733   C CB   . ALA C 1 35  ? 3.879   30.099  -5.048  1.00 0.00 ? 35  ALA C CB   1  
ATOM   3734   H H    . ALA C 1 35  ? 5.186   29.270  -3.050  1.00 0.00 ? 35  ALA C H    1  
ATOM   3735   H HA   . ALA C 1 35  ? 2.634   28.653  -4.072  1.00 0.00 ? 35  ALA C HA   1  
ATOM   3736   H HB1  . ALA C 1 35  ? 3.209   30.816  -4.595  1.00 0.00 ? 35  ALA C HB1  1  
ATOM   3737   H HB2  . ALA C 1 35  ? 4.900   30.410  -4.888  1.00 0.00 ? 35  ALA C HB2  1  
ATOM   3738   H HB3  . ALA C 1 35  ? 3.681   30.047  -6.110  1.00 0.00 ? 35  ALA C HB3  1  
ATOM   3739   N N    . ALA C 1 36  ? 5.155   27.430  -5.821  1.00 0.00 ? 36  ALA C N    1  
ATOM   3740   C CA   . ALA C 1 36  ? 5.493   26.410  -6.803  1.00 0.00 ? 36  ALA C CA   1  
ATOM   3741   C C    . ALA C 1 36  ? 5.206   25.018  -6.245  1.00 0.00 ? 36  ALA C C    1  
ATOM   3742   O O    . ALA C 1 36  ? 4.724   24.138  -6.959  1.00 0.00 ? 36  ALA C O    1  
ATOM   3743   C CB   . ALA C 1 36  ? 6.969   26.546  -7.221  1.00 0.00 ? 36  ALA C CB   1  
ATOM   3744   H H    . ALA C 1 36  ? 5.861   27.984  -5.431  1.00 0.00 ? 36  ALA C H    1  
ATOM   3745   H HA   . ALA C 1 36  ? 4.871   26.555  -7.674  1.00 0.00 ? 36  ALA C HA   1  
ATOM   3746   H HB1  . ALA C 1 36  ? 7.406   27.401  -6.727  1.00 0.00 ? 36  ALA C HB1  1  
ATOM   3747   H HB2  . ALA C 1 36  ? 7.513   25.654  -6.944  1.00 0.00 ? 36  ALA C HB2  1  
ATOM   3748   H HB3  . ALA C 1 36  ? 7.028   26.683  -8.293  1.00 0.00 ? 36  ALA C HB3  1  
ATOM   3749   N N    . ALA C 1 37  ? 5.472   24.825  -4.960  1.00 0.00 ? 37  ALA C N    1  
ATOM   3750   C CA   . ALA C 1 37  ? 5.207   23.534  -4.340  1.00 0.00 ? 37  ALA C CA   1  
ATOM   3751   C C    . ALA C 1 37  ? 3.721   23.204  -4.471  1.00 0.00 ? 37  ALA C C    1  
ATOM   3752   O O    . ALA C 1 37  ? 3.349   22.135  -4.958  1.00 0.00 ? 37  ALA C O    1  
ATOM   3753   C CB   . ALA C 1 37  ? 5.621   23.561  -2.859  1.00 0.00 ? 37  ALA C CB   1  
ATOM   3754   H H    . ALA C 1 37  ? 5.833   25.560  -4.421  1.00 0.00 ? 37  ALA C H    1  
ATOM   3755   H HA   . ALA C 1 37  ? 5.777   22.772  -4.851  1.00 0.00 ? 37  ALA C HA   1  
ATOM   3756   H HB1  . ALA C 1 37  ? 6.652   23.246  -2.766  1.00 0.00 ? 37  ALA C HB1  1  
ATOM   3757   H HB2  . ALA C 1 37  ? 5.518   24.562  -2.472  1.00 0.00 ? 37  ALA C HB2  1  
ATOM   3758   H HB3  . ALA C 1 37  ? 4.992   22.890  -2.293  1.00 0.00 ? 37  ALA C HB3  1  
ATOM   3759   N N    . LYS C 1 38  ? 2.880   24.141  -4.043  1.00 0.00 ? 38  LYS C N    1  
ATOM   3760   C CA   . LYS C 1 38  ? 1.429   23.967  -4.110  1.00 0.00 ? 38  LYS C CA   1  
ATOM   3761   C C    . LYS C 1 38  ? 0.975   23.616  -5.533  1.00 0.00 ? 38  LYS C C    1  
ATOM   3762   O O    . LYS C 1 38  ? 0.175   22.700  -5.732  1.00 0.00 ? 38  LYS C O    1  
ATOM   3763   C CB   . LYS C 1 38  ? 0.747   25.269  -3.635  1.00 0.00 ? 38  LYS C CB   1  
ATOM   3764   C CG   . LYS C 1 38  ? -0.330  24.978  -2.577  1.00 0.00 ? 38  LYS C CG   1  
ATOM   3765   C CD   . LYS C 1 38  ? -0.836  26.310  -2.003  1.00 0.00 ? 38  LYS C CD   1  
ATOM   3766   C CE   . LYS C 1 38  ? -2.148  26.090  -1.243  1.00 0.00 ? 38  LYS C CE   1  
ATOM   3767   N NZ   . LYS C 1 38  ? -1.912  25.163  -0.098  1.00 0.00 ? 38  LYS C NZ   1  
ATOM   3768   H H    . LYS C 1 38  ? 3.243   24.976  -3.678  1.00 0.00 ? 38  LYS C H    1  
ATOM   3769   H HA   . LYS C 1 38  ? 1.147   23.160  -3.453  1.00 0.00 ? 38  LYS C HA   1  
ATOM   3770   H HB2  . LYS C 1 38  ? 1.495   25.917  -3.201  1.00 0.00 ? 38  LYS C HB2  1  
ATOM   3771   H HB3  . LYS C 1 38  ? 0.294   25.769  -4.479  1.00 0.00 ? 38  LYS C HB3  1  
ATOM   3772   H HG2  . LYS C 1 38  ? -1.152  24.442  -3.034  1.00 0.00 ? 38  LYS C HG2  1  
ATOM   3773   H HG3  . LYS C 1 38  ? 0.095   24.383  -1.780  1.00 0.00 ? 38  LYS C HG3  1  
ATOM   3774   H HD2  . LYS C 1 38  ? -0.094  26.720  -1.331  1.00 0.00 ? 38  LYS C HD2  1  
ATOM   3775   H HD3  . LYS C 1 38  ? -1.009  27.008  -2.812  1.00 0.00 ? 38  LYS C HD3  1  
ATOM   3776   H HE2  . LYS C 1 38  ? -2.509  27.039  -0.870  1.00 0.00 ? 38  LYS C HE2  1  
ATOM   3777   H HE3  . LYS C 1 38  ? -2.883  25.663  -1.912  1.00 0.00 ? 38  LYS C HE3  1  
ATOM   3778   H HZ1  . LYS C 1 38  ? -0.909  25.200  0.182   1.00 0.00 ? 38  LYS C HZ1  1  
ATOM   3779   H HZ2  . LYS C 1 38  ? -2.504  25.449  0.709   1.00 0.00 ? 38  LYS C HZ2  1  
ATOM   3780   H HZ3  . LYS C 1 38  ? -2.153  24.192  -0.381  1.00 0.00 ? 38  LYS C HZ3  1  
ATOM   3781   N N    . ALA C 1 39  ? 1.486   24.349  -6.517  1.00 0.00 ? 39  ALA C N    1  
ATOM   3782   C CA   . ALA C 1 39  ? 1.113   24.109  -7.911  1.00 0.00 ? 39  ALA C CA   1  
ATOM   3783   C C    . ALA C 1 39  ? 1.529   22.708  -8.366  1.00 0.00 ? 39  ALA C C    1  
ATOM   3784   O O    . ALA C 1 39  ? 0.779   22.016  -9.056  1.00 0.00 ? 39  ALA C O    1  
ATOM   3785   C CB   . ALA C 1 39  ? 1.772   25.160  -8.812  1.00 0.00 ? 39  ALA C CB   1  
ATOM   3786   H H    . ALA C 1 39  ? 2.119   25.065  -6.303  1.00 0.00 ? 39  ALA C H    1  
ATOM   3787   H HA   . ALA C 1 39  ? 0.042   24.196  -8.003  1.00 0.00 ? 39  ALA C HA   1  
ATOM   3788   H HB1  . ALA C 1 39  ? 1.809   26.108  -8.293  1.00 0.00 ? 39  ALA C HB1  1  
ATOM   3789   H HB2  . ALA C 1 39  ? 2.776   24.848  -9.060  1.00 0.00 ? 39  ALA C HB2  1  
ATOM   3790   H HB3  . ALA C 1 39  ? 1.195   25.271  -9.719  1.00 0.00 ? 39  ALA C HB3  1  
ATOM   3791   N N    . MET C 1 40  ? 2.730   22.304  -7.976  1.00 0.00 ? 40  MET C N    1  
ATOM   3792   C CA   . MET C 1 40  ? 3.245   20.988  -8.349  1.00 0.00 ? 40  MET C CA   1  
ATOM   3793   C C    . MET C 1 40  ? 2.417   19.881  -7.702  1.00 0.00 ? 40  MET C C    1  
ATOM   3794   O O    . MET C 1 40  ? 2.129   18.859  -8.332  1.00 0.00 ? 40  MET C O    1  
ATOM   3795   C CB   . MET C 1 40  ? 4.711   20.865  -7.924  1.00 0.00 ? 40  MET C CB   1  
ATOM   3796   C CG   . MET C 1 40  ? 5.567   21.833  -8.749  1.00 0.00 ? 40  MET C CG   1  
ATOM   3797   S SD   . MET C 1 40  ? 5.713   21.233  -10.450 1.00 0.00 ? 40  MET C SD   1  
ATOM   3798   C CE   . MET C 1 40  ? 7.132   20.147  -10.181 1.00 0.00 ? 40  MET C CE   1  
ATOM   3799   H H    . MET C 1 40  ? 3.283   22.901  -7.429  1.00 0.00 ? 40  MET C H    1  
ATOM   3800   H HA   . MET C 1 40  ? 3.185   20.882  -9.421  1.00 0.00 ? 40  MET C HA   1  
ATOM   3801   H HB2  . MET C 1 40  ? 4.800   21.107  -6.875  1.00 0.00 ? 40  MET C HB2  1  
ATOM   3802   H HB3  . MET C 1 40  ? 5.051   19.852  -8.090  1.00 0.00 ? 40  MET C HB3  1  
ATOM   3803   H HG2  . MET C 1 40  ? 5.103   22.808  -8.754  1.00 0.00 ? 40  MET C HG2  1  
ATOM   3804   H HG3  . MET C 1 40  ? 6.551   21.908  -8.308  1.00 0.00 ? 40  MET C HG3  1  
ATOM   3805   H HE1  . MET C 1 40  ? 7.955   20.723  -9.781  1.00 0.00 ? 40  MET C HE1  1  
ATOM   3806   H HE2  . MET C 1 40  ? 6.862   19.374  -9.480  1.00 0.00 ? 40  MET C HE2  1  
ATOM   3807   H HE3  . MET C 1 40  ? 7.423   19.695  -11.119 1.00 0.00 ? 40  MET C HE3  1  
ATOM   3808   N N    . MET C 1 41  ? 2.026   20.086  -6.451  1.00 0.00 ? 41  MET C N    1  
ATOM   3809   C CA   . MET C 1 41  ? 1.218   19.095  -5.747  1.00 0.00 ? 41  MET C CA   1  
ATOM   3810   C C    . MET C 1 41  ? -0.122  18.897  -6.447  1.00 0.00 ? 41  MET C C    1  
ATOM   3811   O O    . MET C 1 41  ? -0.608  17.769  -6.585  1.00 0.00 ? 41  MET C O    1  
ATOM   3812   C CB   . MET C 1 41  ? 0.915   19.554  -4.320  1.00 0.00 ? 41  MET C CB   1  
ATOM   3813   C CG   . MET C 1 41  ? 2.199   19.690  -3.487  1.00 0.00 ? 41  MET C CG   1  
ATOM   3814   S SD   . MET C 1 41  ? 1.873   19.191  -1.769  1.00 0.00 ? 41  MET C SD   1  
ATOM   3815   C CE   . MET C 1 41  ? 0.325   20.098  -1.519  1.00 0.00 ? 41  MET C CE   1  
ATOM   3816   H H    . MET C 1 41  ? 2.275   20.921  -5.996  1.00 0.00 ? 41  MET C H    1  
ATOM   3817   H HA   . MET C 1 41  ? 1.748   18.156  -5.718  1.00 0.00 ? 41  MET C HA   1  
ATOM   3818   H HB2  . MET C 1 41  ? 0.413   20.510  -4.364  1.00 0.00 ? 41  MET C HB2  1  
ATOM   3819   H HB3  . MET C 1 41  ? 0.261   18.832  -3.857  1.00 0.00 ? 41  MET C HB3  1  
ATOM   3820   H HG2  . MET C 1 41  ? 2.971   19.060  -3.898  1.00 0.00 ? 41  MET C HG2  1  
ATOM   3821   H HG3  . MET C 1 41  ? 2.528   20.717  -3.501  1.00 0.00 ? 41  MET C HG3  1  
ATOM   3822   H HE1  . MET C 1 41  ? 0.307   20.973  -2.149  1.00 0.00 ? 41  MET C HE1  1  
ATOM   3823   H HE2  . MET C 1 41  ? -0.506  19.458  -1.771  1.00 0.00 ? 41  MET C HE2  1  
ATOM   3824   H HE3  . MET C 1 41  ? 0.252   20.401  -0.481  1.00 0.00 ? 41  MET C HE3  1  
ATOM   3825   N N    . ASP C 1 42  ? -0.727  20.010  -6.847  1.00 0.00 ? 42  ASP C N    1  
ATOM   3826   C CA   . ASP C 1 42  ? -2.030  19.973  -7.494  1.00 0.00 ? 42  ASP C CA   1  
ATOM   3827   C C    . ASP C 1 42  ? -1.968  19.156  -8.781  1.00 0.00 ? 42  ASP C C    1  
ATOM   3828   O O    . ASP C 1 42  ? -2.815  18.290  -9.029  1.00 0.00 ? 42  ASP C O    1  
ATOM   3829   C CB   . ASP C 1 42  ? -2.490  21.412  -7.789  1.00 0.00 ? 42  ASP C CB   1  
ATOM   3830   C CG   . ASP C 1 42  ? -4.008  21.529  -7.676  1.00 0.00 ? 42  ASP C CG   1  
ATOM   3831   O OD1  . ASP C 1 42  ? -4.559  20.975  -6.736  1.00 0.00 ? 42  ASP C OD1  1  
ATOM   3832   O OD2  . ASP C 1 42  ? -4.593  22.182  -8.521  1.00 0.00 ? 42  ASP C OD2  1  
ATOM   3833   H H    . ASP C 1 42  ? -0.297  20.877  -6.688  1.00 0.00 ? 42  ASP C H    1  
ATOM   3834   H HA   . ASP C 1 42  ? -2.735  19.512  -6.821  1.00 0.00 ? 42  ASP C HA   1  
ATOM   3835   H HB2  . ASP C 1 42  ? -2.034  22.084  -7.078  1.00 0.00 ? 42  ASP C HB2  1  
ATOM   3836   H HB3  . ASP C 1 42  ? -2.186  21.689  -8.786  1.00 0.00 ? 42  ASP C HB3  1  
ATOM   3837   N N    . GLN C 1 43  ? -0.950  19.420  -9.586  1.00 0.00 ? 43  GLN C N    1  
ATOM   3838   C CA   . GLN C 1 43  ? -0.779  18.693  -10.838 1.00 0.00 ? 43  GLN C CA   1  
ATOM   3839   C C    . GLN C 1 43  ? -0.531  17.213  -10.571 1.00 0.00 ? 43  GLN C C    1  
ATOM   3840   O O    . GLN C 1 43  ? -1.071  16.347  -11.262 1.00 0.00 ? 43  GLN C O    1  
ATOM   3841   C CB   . GLN C 1 43  ? 0.377   19.281  -11.646 1.00 0.00 ? 43  GLN C CB   1  
ATOM   3842   C CG   . GLN C 1 43  ? 0.015   20.702  -12.092 1.00 0.00 ? 43  GLN C CG   1  
ATOM   3843   C CD   . GLN C 1 43  ? 1.040   21.221  -13.091 1.00 0.00 ? 43  GLN C CD   1  
ATOM   3844   O OE1  . GLN C 1 43  ? 1.989   20.522  -13.434 1.00 0.00 ? 43  GLN C OE1  1  
ATOM   3845   N NE2  . GLN C 1 43  ? 0.905   22.414  -13.585 1.00 0.00 ? 43  GLN C NE2  1  
ATOM   3846   H H    . GLN C 1 43  ? -0.299  20.109  -9.327  1.00 0.00 ? 43  GLN C H    1  
ATOM   3847   H HA   . GLN C 1 43  ? -1.687  18.788  -11.415 1.00 0.00 ? 43  GLN C HA   1  
ATOM   3848   H HB2  . GLN C 1 43  ? 1.271   19.309  -11.037 1.00 0.00 ? 43  GLN C HB2  1  
ATOM   3849   H HB3  . GLN C 1 43  ? 0.556   18.669  -12.519 1.00 0.00 ? 43  GLN C HB3  1  
ATOM   3850   H HG2  . GLN C 1 43  ? -0.960  20.693  -12.557 1.00 0.00 ? 43  GLN C HG2  1  
ATOM   3851   H HG3  . GLN C 1 43  ? -0.006  21.350  -11.230 1.00 0.00 ? 43  GLN C HG3  1  
ATOM   3852   H HE21 . GLN C 1 43  ? 0.149   22.972  -13.316 1.00 0.00 ? 43  GLN C HE21 1  
ATOM   3853   H HE22 . GLN C 1 43  ? 1.563   22.754  -14.225 1.00 0.00 ? 43  GLN C HE22 1  
ATOM   3854   N N    . SER C 1 44  ? 0.273   16.923  -9.556  1.00 0.00 ? 44  SER C N    1  
ATOM   3855   C CA   . SER C 1 44  ? 0.559   15.535  -9.204  1.00 0.00 ? 44  SER C CA   1  
ATOM   3856   C C    . SER C 1 44  ? -0.742  14.812  -8.847  1.00 0.00 ? 44  SER C C    1  
ATOM   3857   O O    . SER C 1 44  ? -1.002  13.702  -9.312  1.00 0.00 ? 44  SER C O    1  
ATOM   3858   C CB   . SER C 1 44  ? 1.543   15.491  -8.027  1.00 0.00 ? 44  SER C CB   1  
ATOM   3859   O OG   . SER C 1 44  ? 2.642   14.664  -8.374  1.00 0.00 ? 44  SER C OG   1  
ATOM   3860   H H    . SER C 1 44  ? 0.669   17.651  -9.028  1.00 0.00 ? 44  SER C H    1  
ATOM   3861   H HA   . SER C 1 44  ? 1.008   15.046  -10.055 1.00 0.00 ? 44  SER C HA   1  
ATOM   3862   H HB2  . SER C 1 44  ? 1.903   16.485  -7.819  1.00 0.00 ? 44  SER C HB2  1  
ATOM   3863   H HB3  . SER C 1 44  ? 1.045   15.100  -7.148  1.00 0.00 ? 44  SER C HB3  1  
ATOM   3864   H HG   . SER C 1 44  ? 3.156   14.484  -7.578  1.00 0.00 ? 44  SER C HG   1  
ATOM   3865   N N    . ARG C 1 45  ? -1.567  15.466  -8.032  1.00 0.00 ? 45  ARG C N    1  
ATOM   3866   C CA   . ARG C 1 45  ? -2.857  14.911  -7.622  1.00 0.00 ? 45  ARG C CA   1  
ATOM   3867   C C    . ARG C 1 45  ? -3.739  14.614  -8.838  1.00 0.00 ? 45  ARG C C    1  
ATOM   3868   O O    . ARG C 1 45  ? -4.352  13.548  -8.935  1.00 0.00 ? 45  ARG C O    1  
ATOM   3869   C CB   . ARG C 1 45  ? -3.549  15.926  -6.704  1.00 0.00 ? 45  ARG C CB   1  
ATOM   3870   C CG   . ARG C 1 45  ? -4.870  15.363  -6.158  1.00 0.00 ? 45  ARG C CG   1  
ATOM   3871   C CD   . ARG C 1 45  ? -5.569  16.422  -5.277  1.00 0.00 ? 45  ARG C CD   1  
ATOM   3872   N NE   . ARG C 1 45  ? -6.756  15.823  -4.648  1.00 0.00 ? 45  ARG C NE   1  
ATOM   3873   C CZ   . ARG C 1 45  ? -7.547  16.495  -3.819  1.00 0.00 ? 45  ARG C CZ   1  
ATOM   3874   N NH1  . ARG C 1 45  ? -7.253  17.698  -3.463  1.00 0.00 ? 45  ARG C NH1  1  
ATOM   3875   N NH2  . ARG C 1 45  ? -8.592  15.906  -3.321  1.00 0.00 ? 45  ARG C NH2  1  
ATOM   3876   H H    . ARG C 1 45  ? -1.311  16.358  -7.713  1.00 0.00 ? 45  ARG C H    1  
ATOM   3877   H HA   . ARG C 1 45  ? -2.691  13.994  -7.077  1.00 0.00 ? 45  ARG C HA   1  
ATOM   3878   H HB2  . ARG C 1 45  ? -2.892  16.160  -5.884  1.00 0.00 ? 45  ARG C HB2  1  
ATOM   3879   H HB3  . ARG C 1 45  ? -3.751  16.825  -7.269  1.00 0.00 ? 45  ARG C HB3  1  
ATOM   3880   H HG2  . ARG C 1 45  ? -5.513  15.095  -6.984  1.00 0.00 ? 45  ARG C HG2  1  
ATOM   3881   H HG3  . ARG C 1 45  ? -4.665  14.485  -5.562  1.00 0.00 ? 45  ARG C HG3  1  
ATOM   3882   H HD2  . ARG C 1 45  ? -4.875  16.750  -4.505  1.00 0.00 ? 45  ARG C HD2  1  
ATOM   3883   H HD3  . ARG C 1 45  ? -5.865  17.269  -5.886  1.00 0.00 ? 45  ARG C HD3  1  
ATOM   3884   H HE   . ARG C 1 45  ? -6.968  14.890  -4.845  1.00 0.00 ? 45  ARG C HE   1  
ATOM   3885   H HH11 . ARG C 1 45  ? -6.429  18.137  -3.820  1.00 0.00 ? 45  ARG C HH11 1  
ATOM   3886   H HH12 . ARG C 1 45  ? -7.850  18.197  -2.841  1.00 0.00 ? 45  ARG C HH12 1  
ATOM   3887   H HH21 . ARG C 1 45  ? -8.802  14.960  -3.571  1.00 0.00 ? 45  ARG C HH21 1  
ATOM   3888   H HH22 . ARG C 1 45  ? -9.199  16.398  -2.701  1.00 0.00 ? 45  ARG C HH22 1  
ATOM   3889   N N    . MET C 1 46  ? -3.796  15.570  -9.761  1.00 0.00 ? 46  MET C N    1  
ATOM   3890   C CA   . MET C 1 46  ? -4.601  15.415  -10.971 1.00 0.00 ? 46  MET C CA   1  
ATOM   3891   C C    . MET C 1 46  ? -4.096  14.228  -11.793 1.00 0.00 ? 46  MET C C    1  
ATOM   3892   O O    . MET C 1 46  ? -4.885  13.430  -12.308 1.00 0.00 ? 46  MET C O    1  
ATOM   3893   C CB   . MET C 1 46  ? -4.551  16.696  -11.807 1.00 0.00 ? 46  MET C CB   1  
ATOM   3894   C CG   . MET C 1 46  ? -5.238  17.820  -11.032 1.00 0.00 ? 46  MET C CG   1  
ATOM   3895   S SD   . MET C 1 46  ? -4.983  19.408  -11.874 1.00 0.00 ? 46  MET C SD   1  
ATOM   3896   C CE   . MET C 1 46  ? -6.229  19.244  -13.181 1.00 0.00 ? 46  MET C CE   1  
ATOM   3897   H H    . MET C 1 46  ? -3.285  16.398  -9.625  1.00 0.00 ? 46  MET C H    1  
ATOM   3898   H HA   . MET C 1 46  ? -5.623  15.220  -10.684 1.00 0.00 ? 46  MET C HA   1  
ATOM   3899   H HB2  . MET C 1 46  ? -3.520  16.961  -11.994 1.00 0.00 ? 46  MET C HB2  1  
ATOM   3900   H HB3  . MET C 1 46  ? -5.061  16.538  -12.745 1.00 0.00 ? 46  MET C HB3  1  
ATOM   3901   H HG2  . MET C 1 46  ? -6.295  17.612  -10.965 1.00 0.00 ? 46  MET C HG2  1  
ATOM   3902   H HG3  . MET C 1 46  ? -4.825  17.871  -10.037 1.00 0.00 ? 46  MET C HG3  1  
ATOM   3903   H HE1  . MET C 1 46  ? -7.025  18.600  -12.847 1.00 0.00 ? 46  MET C HE1  1  
ATOM   3904   H HE2  . MET C 1 46  ? -6.626  20.223  -13.409 1.00 0.00 ? 46  MET C HE2  1  
ATOM   3905   H HE3  . MET C 1 46  ? -5.781  18.826  -14.069 1.00 0.00 ? 46  MET C HE3  1  
ATOM   3906   N N    . ALA C 1 47  ? -2.777  14.099  -11.892 1.00 0.00 ? 47  ALA C N    1  
ATOM   3907   C CA   . ALA C 1 47  ? -2.182  12.991  -12.640 1.00 0.00 ? 47  ALA C CA   1  
ATOM   3908   C C    . ALA C 1 47  ? -2.589  11.654  -12.018 1.00 0.00 ? 47  ALA C C    1  
ATOM   3909   O O    . ALA C 1 47  ? -2.943  10.706  -12.720 1.00 0.00 ? 47  ALA C O    1  
ATOM   3910   C CB   . ALA C 1 47  ? -0.655  13.121  -12.641 1.00 0.00 ? 47  ALA C CB   1  
ATOM   3911   H H    . ALA C 1 47  ? -2.194  14.750  -11.447 1.00 0.00 ? 47  ALA C H    1  
ATOM   3912   H HA   . ALA C 1 47  ? -2.538  13.023  -13.658 1.00 0.00 ? 47  ALA C HA   1  
ATOM   3913   H HB1  . ALA C 1 47  ? -0.310  13.341  -11.642 1.00 0.00 ? 47  ALA C HB1  1  
ATOM   3914   H HB2  . ALA C 1 47  ? -0.216  12.190  -12.976 1.00 0.00 ? 47  ALA C HB2  1  
ATOM   3915   H HB3  . ALA C 1 47  ? -0.362  13.918  -13.309 1.00 0.00 ? 47  ALA C HB3  1  
ATOM   3916   N N    . LEU C 1 48  ? -2.546  11.594  -10.691 1.00 0.00 ? 48  LEU C N    1  
ATOM   3917   C CA   . LEU C 1 48  ? -2.920  10.379  -9.967  1.00 0.00 ? 48  LEU C CA   1  
ATOM   3918   C C    . LEU C 1 48  ? -4.404  10.086  -10.132 1.00 0.00 ? 48  LEU C C    1  
ATOM   3919   O O    . LEU C 1 48  ? -4.812  8.934   -10.289 1.00 0.00 ? 48  LEU C O    1  
ATOM   3920   C CB   . LEU C 1 48  ? -2.628  10.558  -8.477  1.00 0.00 ? 48  LEU C CB   1  
ATOM   3921   C CG   . LEU C 1 48  ? -1.121  10.674  -8.251  1.00 0.00 ? 48  LEU C CG   1  
ATOM   3922   C CD1  . LEU C 1 48  ? -0.855  11.120  -6.812  1.00 0.00 ? 48  LEU C CD1  1  
ATOM   3923   C CD2  . LEU C 1 48  ? -0.436  9.323   -8.516  1.00 0.00 ? 48  LEU C CD2  1  
ATOM   3924   H H    . LEU C 1 48  ? -2.262  12.386  -10.185 1.00 0.00 ? 48  LEU C H    1  
ATOM   3925   H HA   . LEU C 1 48  ? -2.348  9.546   -10.344 1.00 0.00 ? 48  LEU C HA   1  
ATOM   3926   H HB2  . LEU C 1 48  ? -3.114  11.461  -8.129  1.00 0.00 ? 48  LEU C HB2  1  
ATOM   3927   H HB3  . LEU C 1 48  ? -3.015  9.711   -7.929  1.00 0.00 ? 48  LEU C HB3  1  
ATOM   3928   H HG   . LEU C 1 48  ? -0.723  11.417  -8.929  1.00 0.00 ? 48  LEU C HG   1  
ATOM   3929   H HD11 . LEU C 1 48  ? -1.534  10.613  -6.141  1.00 0.00 ? 48  LEU C HD11 1  
ATOM   3930   H HD12 . LEU C 1 48  ? 0.163   10.881  -6.541  1.00 0.00 ? 48  LEU C HD12 1  
ATOM   3931   H HD13 . LEU C 1 48  ? -1.004  12.185  -6.737  1.00 0.00 ? 48  LEU C HD13 1  
ATOM   3932   H HD21 . LEU C 1 48  ? -1.084  8.515   -8.214  1.00 0.00 ? 48  LEU C HD21 1  
ATOM   3933   H HD22 . LEU C 1 48  ? -0.218  9.233   -9.571  1.00 0.00 ? 48  LEU C HD22 1  
ATOM   3934   H HD23 . LEU C 1 48  ? 0.487   9.272   -7.956  1.00 0.00 ? 48  LEU C HD23 1  
ATOM   3935   N N    . ASN C 1 49  ? -5.206  11.140  -10.074 1.00 0.00 ? 49  ASN C N    1  
ATOM   3936   C CA   . ASN C 1 49  ? -6.650  11.000  -10.193 1.00 0.00 ? 49  ASN C CA   1  
ATOM   3937   C C    . ASN C 1 49  ? -7.007  10.356  -11.532 1.00 0.00 ? 49  ASN C C    1  
ATOM   3938   O O    . ASN C 1 49  ? -7.815  9.426   -11.593 1.00 0.00 ? 49  ASN C O    1  
ATOM   3939   C CB   . ASN C 1 49  ? -7.327  12.365  -10.074 1.00 0.00 ? 49  ASN C CB   1  
ATOM   3940   C CG   . ASN C 1 49  ? -8.837  12.210  -10.218 1.00 0.00 ? 49  ASN C CG   1  
ATOM   3941   O OD1  . ASN C 1 49  ? -9.308  11.252  -10.830 1.00 0.00 ? 49  ASN C OD1  1  
ATOM   3942   N ND2  . ASN C 1 49  ? -9.628  13.100  -9.684  1.00 0.00 ? 49  ASN C ND2  1  
ATOM   3943   H H    . ASN C 1 49  ? -4.818  12.031  -9.938  1.00 0.00 ? 49  ASN C H    1  
ATOM   3944   H HA   . ASN C 1 49  ? -6.998  10.360  -9.397  1.00 0.00 ? 49  ASN C HA   1  
ATOM   3945   H HB2  . ASN C 1 49  ? -7.100  12.795  -9.110  1.00 0.00 ? 49  ASN C HB2  1  
ATOM   3946   H HB3  . ASN C 1 49  ? -6.959  13.017  -10.853 1.00 0.00 ? 49  ASN C HB3  1  
ATOM   3947   H HD21 . ASN C 1 49  ? -9.251  13.860  -9.194  1.00 0.00 ? 49  ASN C HD21 1  
ATOM   3948   H HD22 . ASN C 1 49  ? -10.599 13.007  -9.772  1.00 0.00 ? 49  ASN C HD22 1  
ATOM   3949   N N    . GLU C 1 50  ? -6.380  10.836  -12.596 1.00 0.00 ? 50  GLU C N    1  
ATOM   3950   C CA   . GLU C 1 50  ? -6.621  10.278  -13.921 1.00 0.00 ? 50  GLU C CA   1  
ATOM   3951   C C    . GLU C 1 50  ? -6.142  8.832   -13.971 1.00 0.00 ? 50  GLU C C    1  
ATOM   3952   O O    . GLU C 1 50  ? -6.807  7.955   -14.528 1.00 0.00 ? 50  GLU C O    1  
ATOM   3953   C CB   . GLU C 1 50  ? -5.888  11.100  -14.987 1.00 0.00 ? 50  GLU C CB   1  
ATOM   3954   C CG   . GLU C 1 50  ? -6.190  10.521  -16.377 1.00 0.00 ? 50  GLU C CG   1  
ATOM   3955   C CD   . GLU C 1 50  ? -5.551  11.385  -17.456 1.00 0.00 ? 50  GLU C CD   1  
ATOM   3956   O OE1  . GLU C 1 50  ? -4.356  11.254  -17.659 1.00 0.00 ? 50  GLU C OE1  1  
ATOM   3957   O OE2  . GLU C 1 50  ? -6.266  12.163  -18.062 1.00 0.00 ? 50  GLU C OE2  1  
ATOM   3958   H H    . GLU C 1 50  ? -5.726  11.562  -12.485 1.00 0.00 ? 50  GLU C H    1  
ATOM   3959   H HA   . GLU C 1 50  ? -7.679  10.301  -14.129 1.00 0.00 ? 50  GLU C HA   1  
ATOM   3960   H HB2  . GLU C 1 50  ? -6.220  12.125  -14.944 1.00 0.00 ? 50  GLU C HB2  1  
ATOM   3961   H HB3  . GLU C 1 50  ? -4.822  11.057  -14.808 1.00 0.00 ? 50  GLU C HB3  1  
ATOM   3962   H HG2  . GLU C 1 50  ? -5.793  9.519   -16.444 1.00 0.00 ? 50  GLU C HG2  1  
ATOM   3963   H HG3  . GLU C 1 50  ? -7.257  10.493  -16.530 1.00 0.00 ? 50  GLU C HG3  1  
ATOM   3964   N N    . ALA C 1 51  ? -4.986  8.585   -13.366 1.00 0.00 ? 51  ALA C N    1  
ATOM   3965   C CA   . ALA C 1 51  ? -4.426  7.238   -13.335 1.00 0.00 ? 51  ALA C CA   1  
ATOM   3966   C C    . ALA C 1 51  ? -5.343  6.308   -12.533 1.00 0.00 ? 51  ALA C C    1  
ATOM   3967   O O    . ALA C 1 51  ? -5.645  5.192   -12.961 1.00 0.00 ? 51  ALA C O    1  
ATOM   3968   C CB   . ALA C 1 51  ? -3.017  7.276   -12.724 1.00 0.00 ? 51  ALA C CB   1  
ATOM   3969   H H    . ALA C 1 51  ? -4.504  9.318   -12.928 1.00 0.00 ? 51  ALA C H    1  
ATOM   3970   H HA   . ALA C 1 51  ? -4.359  6.866   -14.347 1.00 0.00 ? 51  ALA C HA   1  
ATOM   3971   H HB1  . ALA C 1 51  ? -3.063  7.003   -11.681 1.00 0.00 ? 51  ALA C HB1  1  
ATOM   3972   H HB2  . ALA C 1 51  ? -2.376  6.583   -13.249 1.00 0.00 ? 51  ALA C HB2  1  
ATOM   3973   H HB3  . ALA C 1 51  ? -2.613  8.276   -12.815 1.00 0.00 ? 51  ALA C HB3  1  
ATOM   3974   N N    . HIS C 1 52  ? -5.795  6.788   -11.378 1.00 0.00 ? 52  HIS C N    1  
ATOM   3975   C CA   . HIS C 1 52  ? -6.692  6.008   -10.530 1.00 0.00 ? 52  HIS C CA   1  
ATOM   3976   C C    . HIS C 1 52  ? -7.994  5.692   -11.260 1.00 0.00 ? 52  HIS C C    1  
ATOM   3977   O O    . HIS C 1 52  ? -8.523  4.581   -11.155 1.00 0.00 ? 52  HIS C O    1  
ATOM   3978   C CB   . HIS C 1 52  ? -6.999  6.785   -9.249  1.00 0.00 ? 52  HIS C CB   1  
ATOM   3979   C CG   . HIS C 1 52  ? -7.847  5.938   -8.344  1.00 0.00 ? 52  HIS C CG   1  
ATOM   3980   N ND1  . HIS C 1 52  ? -9.207  5.773   -8.550  1.00 0.00 ? 52  HIS C ND1  1  
ATOM   3981   C CD2  . HIS C 1 52  ? -7.544  5.198   -7.228  1.00 0.00 ? 52  HIS C CD2  1  
ATOM   3982   C CE1  . HIS C 1 52  ? -9.668  4.962   -7.582  1.00 0.00 ? 52  HIS C CE1  1  
ATOM   3983   N NE2  . HIS C 1 52  ? -8.696  4.583   -6.748  1.00 0.00 ? 52  HIS C NE2  1  
ATOM   3984   H H    . HIS C 1 52  ? -5.531  7.693   -11.096 1.00 0.00 ? 52  HIS C H    1  
ATOM   3985   H HA   . HIS C 1 52  ? -6.208  5.081   -10.265 1.00 0.00 ? 52  HIS C HA   1  
ATOM   3986   H HB2  . HIS C 1 52  ? -6.075  7.036   -8.749  1.00 0.00 ? 52  HIS C HB2  1  
ATOM   3987   H HB3  . HIS C 1 52  ? -7.532  7.691   -9.497  1.00 0.00 ? 52  HIS C HB3  1  
ATOM   3988   H HD1  . HIS C 1 52  ? -9.737  6.175   -9.270  1.00 0.00 ? 52  HIS C HD1  1  
ATOM   3989   H HD2  . HIS C 1 52  ? -6.560  5.107   -6.790  1.00 0.00 ? 52  HIS C HD2  1  
ATOM   3990   H HE1  . HIS C 1 52  ? -10.698 4.653   -7.493  1.00 0.00 ? 52  HIS C HE1  1  
ATOM   3991   H HE2  . HIS C 1 52  ? -8.776  3.997   -5.966  1.00 0.00 ? 52  HIS C HE2  1  
ATOM   3992   N N    . LEU C 1 53  ? -8.506  6.672   -12.002 1.00 0.00 ? 53  LEU C N    1  
ATOM   3993   C CA   . LEU C 1 53  ? -9.746  6.488   -12.748 1.00 0.00 ? 53  LEU C CA   1  
ATOM   3994   C C    . LEU C 1 53  ? -9.589  5.353   -13.756 1.00 0.00 ? 53  LEU C C    1  
ATOM   3995   O O    . LEU C 1 53  ? -10.470 4.497   -13.889 1.00 0.00 ? 53  LEU C O    1  
ATOM   3996   C CB   . LEU C 1 53  ? -10.110 7.782   -13.486 1.00 0.00 ? 53  LEU C CB   1  
ATOM   3997   C CG   . LEU C 1 53  ? -10.727 8.791   -12.508 1.00 0.00 ? 53  LEU C CG   1  
ATOM   3998   C CD1  . LEU C 1 53  ? -10.714 10.183  -13.144 1.00 0.00 ? 53  LEU C CD1  1  
ATOM   3999   C CD2  . LEU C 1 53  ? -12.178 8.404   -12.189 1.00 0.00 ? 53  LEU C CD2  1  
ATOM   4000   H H    . LEU C 1 53  ? -8.036  7.535   -12.050 1.00 0.00 ? 53  LEU C H    1  
ATOM   4001   H HA   . LEU C 1 53  ? -10.539 6.236   -12.060 1.00 0.00 ? 53  LEU C HA   1  
ATOM   4002   H HB2  . LEU C 1 53  ? -9.216  8.207   -13.920 1.00 0.00 ? 53  LEU C HB2  1  
ATOM   4003   H HB3  . LEU C 1 53  ? -10.817 7.561   -14.271 1.00 0.00 ? 53  LEU C HB3  1  
ATOM   4004   H HG   . LEU C 1 53  ? -10.147 8.808   -11.596 1.00 0.00 ? 53  LEU C HG   1  
ATOM   4005   H HD11 . LEU C 1 53  ? -10.929 10.099  -14.199 1.00 0.00 ? 53  LEU C HD11 1  
ATOM   4006   H HD12 . LEU C 1 53  ? -11.462 10.802  -12.671 1.00 0.00 ? 53  LEU C HD12 1  
ATOM   4007   H HD13 . LEU C 1 53  ? -9.740  10.631  -13.010 1.00 0.00 ? 53  LEU C HD13 1  
ATOM   4008   H HD21 . LEU C 1 53  ? -12.664 8.042   -13.082 1.00 0.00 ? 53  LEU C HD21 1  
ATOM   4009   H HD22 . LEU C 1 53  ? -12.190 7.633   -11.434 1.00 0.00 ? 53  LEU C HD22 1  
ATOM   4010   H HD23 . LEU C 1 53  ? -12.706 9.271   -11.822 1.00 0.00 ? 53  LEU C HD23 1  
ATOM   4011   N N    . VAL C 1 54  ? -8.461  5.345   -14.454 1.00 0.00 ? 54  VAL C N    1  
ATOM   4012   C CA   . VAL C 1 54  ? -8.197  4.302   -15.436 1.00 0.00 ? 54  VAL C CA   1  
ATOM   4013   C C    . VAL C 1 54  ? -8.117  2.951   -14.730 1.00 0.00 ? 54  VAL C C    1  
ATOM   4014   O O    . VAL C 1 54  ? -8.685  1.964   -15.197 1.00 0.00 ? 54  VAL C O    1  
ATOM   4015   C CB   . VAL C 1 54  ? -6.887  4.595   -16.185 1.00 0.00 ? 54  VAL C CB   1  
ATOM   4016   C CG1  . VAL C 1 54  ? -6.496  3.383   -17.044 1.00 0.00 ? 54  VAL C CG1  1  
ATOM   4017   C CG2  . VAL C 1 54  ? -7.065  5.833   -17.085 1.00 0.00 ? 54  VAL C CG2  1  
ATOM   4018   H H    . VAL C 1 54  ? -7.790  6.047   -14.300 1.00 0.00 ? 54  VAL C H    1  
ATOM   4019   H HA   . VAL C 1 54  ? -9.011  4.274   -16.143 1.00 0.00 ? 54  VAL C HA   1  
ATOM   4020   H HB   . VAL C 1 54  ? -6.103  4.786   -15.463 1.00 0.00 ? 54  VAL C HB   1  
ATOM   4021   H HG11 . VAL C 1 54  ? -7.382  2.918   -17.448 1.00 0.00 ? 54  VAL C HG11 1  
ATOM   4022   H HG12 . VAL C 1 54  ? -5.856  3.703   -17.853 1.00 0.00 ? 54  VAL C HG12 1  
ATOM   4023   H HG13 . VAL C 1 54  ? -5.965  2.667   -16.431 1.00 0.00 ? 54  VAL C HG13 1  
ATOM   4024   H HG21 . VAL C 1 54  ? -8.071  5.863   -17.474 1.00 0.00 ? 54  VAL C HG21 1  
ATOM   4025   H HG22 . VAL C 1 54  ? -6.879  6.728   -16.506 1.00 0.00 ? 54  VAL C HG22 1  
ATOM   4026   H HG23 . VAL C 1 54  ? -6.365  5.787   -17.906 1.00 0.00 ? 54  VAL C HG23 1  
ATOM   4027   N N    . GLN C 1 55  ? -7.431  2.912   -13.590 1.00 0.00 ? 55  GLN C N    1  
ATOM   4028   C CA   . GLN C 1 55  ? -7.323  1.663   -12.842 1.00 0.00 ? 55  GLN C CA   1  
ATOM   4029   C C    . GLN C 1 55  ? -8.712  1.199   -12.392 1.00 0.00 ? 55  GLN C C    1  
ATOM   4030   O O    . GLN C 1 55  ? -9.034  0.017   -12.484 1.00 0.00 ? 55  GLN C O    1  
ATOM   4031   C CB   . GLN C 1 55  ? -6.379  1.829   -11.635 1.00 0.00 ? 55  GLN C CB   1  
ATOM   4032   C CG   . GLN C 1 55  ? -6.593  0.681   -10.616 1.00 0.00 ? 55  GLN C CG   1  
ATOM   4033   C CD   . GLN C 1 55  ? -5.269  0.252   -9.983  1.00 0.00 ? 55  GLN C CD   1  
ATOM   4034   O OE1  . GLN C 1 55  ? -4.599  1.049   -9.335  1.00 0.00 ? 55  GLN C OE1  1  
ATOM   4035   N NE2  . GLN C 1 55  ? -4.865  -0.977  -10.118 1.00 0.00 ? 55  GLN C NE2  1  
ATOM   4036   H H    . GLN C 1 55  ? -7.008  3.731   -13.245 1.00 0.00 ? 55  GLN C H    1  
ATOM   4037   H HA   . GLN C 1 55  ? -6.912  0.914   -13.503 1.00 0.00 ? 55  GLN C HA   1  
ATOM   4038   H HB2  . GLN C 1 55  ? -5.357  1.813   -11.985 1.00 0.00 ? 55  GLN C HB2  1  
ATOM   4039   H HB3  . GLN C 1 55  ? -6.575  2.776   -11.154 1.00 0.00 ? 55  GLN C HB3  1  
ATOM   4040   H HG2  . GLN C 1 55  ? -7.258  1.017   -9.836  1.00 0.00 ? 55  GLN C HG2  1  
ATOM   4041   H HG3  . GLN C 1 55  ? -7.032  -0.169  -11.115 1.00 0.00 ? 55  GLN C HG3  1  
ATOM   4042   H HE21 . GLN C 1 55  ? -5.405  -1.616  -10.623 1.00 0.00 ? 55  GLN C HE21 1  
ATOM   4043   H HE22 . GLN C 1 55  ? -4.021  -1.262  -9.712  1.00 0.00 ? 55  GLN C HE22 1  
ATOM   4044   N N    . THR C 1 56  ? -9.542  2.136   -11.925 1.00 0.00 ? 56  THR C N    1  
ATOM   4045   C CA   . THR C 1 56  ? -10.899 1.789   -11.487 1.00 0.00 ? 56  THR C CA   1  
ATOM   4046   C C    . THR C 1 56  ? -11.604 0.968   -12.568 1.00 0.00 ? 56  THR C C    1  
ATOM   4047   O O    . THR C 1 56  ? -12.174 -0.086  -12.290 1.00 0.00 ? 56  THR C O    1  
ATOM   4048   C CB   . THR C 1 56  ? -11.703 3.052   -11.183 1.00 0.00 ? 56  THR C CB   1  
ATOM   4049   O OG1  . THR C 1 56  ? -10.951 3.893   -10.319 1.00 0.00 ? 56  THR C OG1  1  
ATOM   4050   C CG2  . THR C 1 56  ? -13.023 2.671   -10.513 1.00 0.00 ? 56  THR C CG2  1  
ATOM   4051   H H    . THR C 1 56  ? -9.246  3.072   -11.885 1.00 0.00 ? 56  THR C H    1  
ATOM   4052   H HA   . THR C 1 56  ? -10.825 1.185   -10.595 1.00 0.00 ? 56  THR C HA   1  
ATOM   4053   H HB   . THR C 1 56  ? -11.911 3.575   -12.103 1.00 0.00 ? 56  THR C HB   1  
ATOM   4054   H HG1  . THR C 1 56  ? -10.397 3.336   -9.770  1.00 0.00 ? 56  THR C HG1  1  
ATOM   4055   H HG21 . THR C 1 56  ? -13.331 1.689   -10.845 1.00 0.00 ? 56  THR C HG21 1  
ATOM   4056   H HG22 . THR C 1 56  ? -12.895 2.665   -9.441  1.00 0.00 ? 56  THR C HG22 1  
ATOM   4057   H HG23 . THR C 1 56  ? -13.777 3.390   -10.783 1.00 0.00 ? 56  THR C HG23 1  
ATOM   4058   N N    . LYS C 1 57  ? -11.524 1.438   -13.809 1.00 0.00 ? 57  LYS C N    1  
ATOM   4059   C CA   . LYS C 1 57  ? -12.133 0.713   -14.924 1.00 0.00 ? 57  LYS C CA   1  
ATOM   4060   C C    . LYS C 1 57  ? -11.472 -0.649  -15.069 1.00 0.00 ? 57  LYS C C    1  
ATOM   4061   O O    . LYS C 1 57  ? -12.133 -1.652  -15.349 1.00 0.00 ? 57  LYS C O    1  
ATOM   4062   C CB   . LYS C 1 57  ? -11.968 1.506   -16.222 1.00 0.00 ? 57  LYS C CB   1  
ATOM   4063   C CG   . LYS C 1 57  ? -12.750 0.812   -17.339 1.00 0.00 ? 57  LYS C CG   1  
ATOM   4064   C CD   . LYS C 1 57  ? -12.653 1.633   -18.625 1.00 0.00 ? 57  LYS C CD   1  
ATOM   4065   C CE   . LYS C 1 57  ? -13.461 0.946   -19.727 1.00 0.00 ? 57  LYS C CE   1  
ATOM   4066   N NZ   . LYS C 1 57  ? -13.073 1.506   -21.053 1.00 0.00 ? 57  LYS C NZ   1  
ATOM   4067   H H    . LYS C 1 57  ? -11.032 2.268   -13.981 1.00 0.00 ? 57  LYS C H    1  
ATOM   4068   H HA   . LYS C 1 57  ? -13.186 0.577   -14.733 1.00 0.00 ? 57  LYS C HA   1  
ATOM   4069   H HB2  . LYS C 1 57  ? -12.346 2.509   -16.083 1.00 0.00 ? 57  LYS C HB2  1  
ATOM   4070   H HB3  . LYS C 1 57  ? -10.923 1.548   -16.489 1.00 0.00 ? 57  LYS C HB3  1  
ATOM   4071   H HG2  . LYS C 1 57  ? -12.338 -0.172  -17.507 1.00 0.00 ? 57  LYS C HG2  1  
ATOM   4072   H HG3  . LYS C 1 57  ? -13.786 0.724   -17.049 1.00 0.00 ? 57  LYS C HG3  1  
ATOM   4073   H HD2  . LYS C 1 57  ? -13.047 2.624   -18.451 1.00 0.00 ? 57  LYS C HD2  1  
ATOM   4074   H HD3  . LYS C 1 57  ? -11.620 1.705   -18.930 1.00 0.00 ? 57  LYS C HD3  1  
ATOM   4075   H HE2  . LYS C 1 57  ? -13.261 -0.115  -19.712 1.00 0.00 ? 57  LYS C HE2  1  
ATOM   4076   H HE3  . LYS C 1 57  ? -14.515 1.117   -19.560 1.00 0.00 ? 57  LYS C HE3  1  
ATOM   4077   H HZ1  . LYS C 1 57  ? -12.502 2.364   -20.912 1.00 0.00 ? 57  LYS C HZ1  1  
ATOM   4078   H HZ2  . LYS C 1 57  ? -12.518 0.801   -21.578 1.00 0.00 ? 57  LYS C HZ2  1  
ATOM   4079   H HZ3  . LYS C 1 57  ? -13.929 1.742   -21.593 1.00 0.00 ? 57  LYS C HZ3  1  
ATOM   4080   N N    . LEU C 1 58  ? -10.158 -0.677  -14.891 1.00 0.00 ? 58  LEU C N    1  
ATOM   4081   C CA   . LEU C 1 58  ? -9.416  -1.919  -15.020 1.00 0.00 ? 58  LEU C CA   1  
ATOM   4082   C C    . LEU C 1 58  ? -9.772  -2.914  -13.902 1.00 0.00 ? 58  LEU C C    1  
ATOM   4083   O O    . LEU C 1 58  ? -9.542  -4.108  -14.053 1.00 0.00 ? 58  LEU C O    1  
ATOM   4084   C CB   . LEU C 1 58  ? -7.916  -1.648  -15.034 1.00 0.00 ? 58  LEU C CB   1  
ATOM   4085   C CG   . LEU C 1 58  ? -7.532  -0.872  -16.302 1.00 0.00 ? 58  LEU C CG   1  
ATOM   4086   C CD1  . LEU C 1 58  ? -6.064  -0.450  -16.199 1.00 0.00 ? 58  LEU C CD1  1  
ATOM   4087   C CD2  . LEU C 1 58  ? -7.745  -1.750  -17.554 1.00 0.00 ? 58  LEU C CD2  1  
ATOM   4088   H H    . LEU C 1 58  ? -9.681  0.153   -14.679 1.00 0.00 ? 58  LEU C H    1  
ATOM   4089   H HA   . LEU C 1 58  ? -9.685  -2.364  -15.968 1.00 0.00 ? 58  LEU C HA   1  
ATOM   4090   H HB2  . LEU C 1 58  ? -7.652  -1.069  -14.161 1.00 0.00 ? 58  LEU C HB2  1  
ATOM   4091   H HB3  . LEU C 1 58  ? -7.389  -2.590  -15.016 1.00 0.00 ? 58  LEU C HB3  1  
ATOM   4092   H HG   . LEU C 1 58  ? -8.149  0.014   -16.378 1.00 0.00 ? 58  LEU C HG   1  
ATOM   4093   H HD11 . LEU C 1 58  ? -5.500  -1.219  -15.689 1.00 0.00 ? 58  LEU C HD11 1  
ATOM   4094   H HD12 . LEU C 1 58  ? -5.658  -0.299  -17.186 1.00 0.00 ? 58  LEU C HD12 1  
ATOM   4095   H HD13 . LEU C 1 58  ? -5.998  0.472   -15.640 1.00 0.00 ? 58  LEU C HD13 1  
ATOM   4096   H HD21 . LEU C 1 58  ? -7.679  -2.795  -17.288 1.00 0.00 ? 58  LEU C HD21 1  
ATOM   4097   H HD22 . LEU C 1 58  ? -8.723  -1.549  -17.969 1.00 0.00 ? 58  LEU C HD22 1  
ATOM   4098   H HD23 . LEU C 1 58  ? -6.991  -1.520  -18.294 1.00 0.00 ? 58  LEU C HD23 1  
ATOM   4099   N N    . ILE C 1 59  ? -10.340 -2.429  -12.794 1.00 0.00 ? 59  ILE C N    1  
ATOM   4100   C CA   . ILE C 1 59  ? -10.741 -3.328  -11.705 1.00 0.00 ? 59  ILE C CA   1  
ATOM   4101   C C    . ILE C 1 59  ? -12.223 -3.723  -11.839 1.00 0.00 ? 59  ILE C C    1  
ATOM   4102   O O    . ILE C 1 59  ? -12.601 -4.844  -11.522 1.00 0.00 ? 59  ILE C O    1  
ATOM   4103   C CB   . ILE C 1 59  ? -10.431 -2.654  -10.349 1.00 0.00 ? 59  ILE C CB   1  
ATOM   4104   C CG1  . ILE C 1 59  ? -10.044 -3.713  -9.317  1.00 0.00 ? 59  ILE C CG1  1  
ATOM   4105   C CG2  . ILE C 1 59  ? -11.641 -1.890  -9.815  1.00 0.00 ? 59  ILE C CG2  1  
ATOM   4106   C CD1  . ILE C 1 59  ? -9.495  -3.024  -8.068  1.00 0.00 ? 59  ILE C CD1  1  
ATOM   4107   H H    . ILE C 1 59  ? -10.506 -1.463  -12.716 1.00 0.00 ? 59  ILE C H    1  
ATOM   4108   H HA   . ILE C 1 59  ? -10.149 -4.230  -11.769 1.00 0.00 ? 59  ILE C HA   1  
ATOM   4109   H HB   . ILE C 1 59  ? -9.608  -1.968  -10.479 1.00 0.00 ? 59  ILE C HB   1  
ATOM   4110   H HG12 . ILE C 1 59  ? -10.913 -4.291  -9.063  1.00 0.00 ? 59  ILE C HG12 1  
ATOM   4111   H HG13 . ILE C 1 59  ? -9.283  -4.363  -9.725  1.00 0.00 ? 59  ILE C HG13 1  
ATOM   4112   H HG21 . ILE C 1 59  ? -12.476 -2.547  -9.743  1.00 0.00 ? 59  ILE C HG21 1  
ATOM   4113   H HG22 . ILE C 1 59  ? -11.417 -1.497  -8.841  1.00 0.00 ? 59  ILE C HG22 1  
ATOM   4114   H HG23 . ILE C 1 59  ? -11.879 -1.088  -10.468 1.00 0.00 ? 59  ILE C HG23 1  
ATOM   4115   H HD11 . ILE C 1 59  ? -8.828  -2.229  -8.359  1.00 0.00 ? 59  ILE C HD11 1  
ATOM   4116   H HD12 . ILE C 1 59  ? -10.310 -2.617  -7.494  1.00 0.00 ? 59  ILE C HD12 1  
ATOM   4117   H HD13 . ILE C 1 59  ? -8.955  -3.740  -7.471  1.00 0.00 ? 59  ILE C HD13 1  
ATOM   4118   N N    . GLU C 1 60  ? -13.058 -2.802  -12.327 1.00 0.00 ? 60  GLU C N    1  
ATOM   4119   C CA   . GLU C 1 60  ? -14.489 -3.095  -12.501 1.00 0.00 ? 60  GLU C CA   1  
ATOM   4120   C C    . GLU C 1 60  ? -14.700 -4.174  -13.557 1.00 0.00 ? 60  GLU C C    1  
ATOM   4121   O O    . GLU C 1 60  ? -15.593 -5.007  -13.433 1.00 0.00 ? 60  GLU C O    1  
ATOM   4122   C CB   . GLU C 1 60  ? -15.220 -1.822  -12.947 1.00 0.00 ? 60  GLU C CB   1  
ATOM   4123   C CG   . GLU C 1 60  ? -16.709 -2.108  -13.189 1.00 0.00 ? 60  GLU C CG   1  
ATOM   4124   C CD   . GLU C 1 60  ? -17.331 -0.950  -13.951 1.00 0.00 ? 60  GLU C CD   1  
ATOM   4125   O OE1  . GLU C 1 60  ? -16.688 0.081   -14.062 1.00 0.00 ? 60  GLU C OE1  1  
ATOM   4126   O OE2  . GLU C 1 60  ? -18.435 -1.123  -14.438 1.00 0.00 ? 60  GLU C OE2  1  
ATOM   4127   H H    . GLU C 1 60  ? -12.712 -1.920  -12.576 1.00 0.00 ? 60  GLU C H    1  
ATOM   4128   H HA   . GLU C 1 60  ? -14.893 -3.441  -11.561 1.00 0.00 ? 60  GLU C HA   1  
ATOM   4129   H HB2  . GLU C 1 60  ? -15.123 -1.068  -12.181 1.00 0.00 ? 60  GLU C HB2  1  
ATOM   4130   H HB3  . GLU C 1 60  ? -14.777 -1.458  -13.863 1.00 0.00 ? 60  GLU C HB3  1  
ATOM   4131   H HG2  . GLU C 1 60  ? -16.827 -3.009  -13.769 1.00 0.00 ? 60  GLU C HG2  1  
ATOM   4132   H HG3  . GLU C 1 60  ? -17.214 -2.222  -12.243 1.00 0.00 ? 60  GLU C HG3  1  
ATOM   4133   N N    . GLY C 1 61  ? -13.898 -4.129  -14.618 1.00 0.00 ? 61  GLY C N    1  
ATOM   4134   C CA   . GLY C 1 61  ? -14.027 -5.095  -15.708 1.00 0.00 ? 61  GLY C CA   1  
ATOM   4135   C C    . GLY C 1 61  ? -12.833 -6.036  -15.754 1.00 0.00 ? 61  GLY C C    1  
ATOM   4136   O O    . GLY C 1 61  ? -12.399 -6.442  -16.832 1.00 0.00 ? 61  GLY C O    1  
ATOM   4137   H H    . GLY C 1 61  ? -13.222 -3.422  -14.677 1.00 0.00 ? 61  GLY C H    1  
ATOM   4138   H HA2  . GLY C 1 61  ? -14.930 -5.670  -15.566 1.00 0.00 ? 61  GLY C HA2  1  
ATOM   4139   H HA3  . GLY C 1 61  ? -14.088 -4.564  -16.645 1.00 0.00 ? 61  GLY C HA3  1  
ATOM   4140   N N    . ASP C 1 62  ? -12.308 -6.367  -14.585 1.00 0.00 ? 62  ASP C N    1  
ATOM   4141   C CA   . ASP C 1 62  ? -11.153 -7.249  -14.496 1.00 0.00 ? 62  ASP C CA   1  
ATOM   4142   C C    . ASP C 1 62  ? -11.502 -8.672  -14.930 1.00 0.00 ? 62  ASP C C    1  
ATOM   4143   O O    . ASP C 1 62  ? -10.623 -9.527  -15.036 1.00 0.00 ? 62  ASP C O    1  
ATOM   4144   C CB   . ASP C 1 62  ? -10.637 -7.264  -13.059 1.00 0.00 ? 62  ASP C CB   1  
ATOM   4145   C CG   . ASP C 1 62  ? -11.764 -7.643  -12.104 1.00 0.00 ? 62  ASP C CG   1  
ATOM   4146   O OD1  . ASP C 1 62  ? -12.886 -7.773  -12.564 1.00 0.00 ? 62  ASP C OD1  1  
ATOM   4147   O OD2  . ASP C 1 62  ? -11.488 -7.798  -10.925 1.00 0.00 ? 62  ASP C OD2  1  
ATOM   4148   H H    . ASP C 1 62  ? -12.698 -6.002  -13.763 1.00 0.00 ? 62  ASP C H    1  
ATOM   4149   H HA   . ASP C 1 62  ? -10.374 -6.869  -15.138 1.00 0.00 ? 62  ASP C HA   1  
ATOM   4150   H HB2  . ASP C 1 62  ? -9.838  -7.983  -12.975 1.00 0.00 ? 62  ASP C HB2  1  
ATOM   4151   H HB3  . ASP C 1 62  ? -10.265 -6.284  -12.801 1.00 0.00 ? 62  ASP C HB3  1  
ATOM   4152   N N    . ALA C 1 63  ? -12.782 -8.924  -15.184 1.00 0.00 ? 63  ALA C N    1  
ATOM   4153   C CA   . ALA C 1 63  ? -13.218 -10.252 -15.608 1.00 0.00 ? 63  ALA C CA   1  
ATOM   4154   C C    . ALA C 1 63  ? -13.010 -10.434 -17.111 1.00 0.00 ? 63  ALA C C    1  
ATOM   4155   O O    . ALA C 1 63  ? -12.666 -9.486  -17.816 1.00 0.00 ? 63  ALA C O    1  
ATOM   4156   C CB   . ALA C 1 63  ? -14.696 -10.452 -15.269 1.00 0.00 ? 63  ALA C CB   1  
ATOM   4157   H H    . ALA C 1 63  ? -13.443 -8.207  -15.086 1.00 0.00 ? 63  ALA C H    1  
ATOM   4158   H HA   . ALA C 1 63  ? -12.637 -10.995 -15.083 1.00 0.00 ? 63  ALA C HA   1  
ATOM   4159   H HB1  . ALA C 1 63  ? -15.306 -10.015 -16.046 1.00 0.00 ? 63  ALA C HB1  1  
ATOM   4160   H HB2  . ALA C 1 63  ? -14.917 -9.974  -14.326 1.00 0.00 ? 63  ALA C HB2  1  
ATOM   4161   H HB3  . ALA C 1 63  ? -14.909 -11.508 -15.196 1.00 0.00 ? 63  ALA C HB3  1  
ATOM   4162   N N    . GLY C 1 64  ? -13.228 -11.657 -17.595 1.00 0.00 ? 64  GLY C N    1  
ATOM   4163   C CA   . GLY C 1 64  ? -13.066 -11.948 -19.020 1.00 0.00 ? 64  GLY C CA   1  
ATOM   4164   C C    . GLY C 1 64  ? -12.216 -13.198 -19.247 1.00 0.00 ? 64  GLY C C    1  
ATOM   4165   O O    . GLY C 1 64  ? -12.669 -14.157 -19.871 1.00 0.00 ? 64  GLY C O    1  
ATOM   4166   H H    . GLY C 1 64  ? -13.505 -12.373 -16.987 1.00 0.00 ? 64  GLY C H    1  
ATOM   4167   H HA2  . GLY C 1 64  ? -14.041 -12.101 -19.460 1.00 0.00 ? 64  GLY C HA2  1  
ATOM   4168   H HA3  . GLY C 1 64  ? -12.589 -11.108 -19.504 1.00 0.00 ? 64  GLY C HA3  1  
ATOM   4169   N N    . GLU C 1 65  ? -10.983 -13.181 -18.749 1.00 0.00 ? 65  GLU C N    1  
ATOM   4170   C CA   . GLU C 1 65  ? -10.088 -14.323 -18.921 1.00 0.00 ? 65  GLU C CA   1  
ATOM   4171   C C    . GLU C 1 65  ? -10.606 -15.545 -18.171 1.00 0.00 ? 65  GLU C C    1  
ATOM   4172   O O    . GLU C 1 65  ? -10.513 -16.670 -18.662 1.00 0.00 ? 65  GLU C O    1  
ATOM   4173   C CB   . GLU C 1 65  ? -8.687  -13.977 -18.414 1.00 0.00 ? 65  GLU C CB   1  
ATOM   4174   C CG   . GLU C 1 65  ? -8.052  -12.931 -19.331 1.00 0.00 ? 65  GLU C CG   1  
ATOM   4175   C CD   . GLU C 1 65  ? -6.684  -12.530 -18.791 1.00 0.00 ? 65  GLU C CD   1  
ATOM   4176   O OE1  . GLU C 1 65  ? -6.286  -13.078 -17.776 1.00 0.00 ? 65  GLU C OE1  1  
ATOM   4177   O OE2  . GLU C 1 65  ? -6.053  -11.683 -19.401 1.00 0.00 ? 65  GLU C OE2  1  
ATOM   4178   H H    . GLU C 1 65  ? -10.668 -12.388 -18.266 1.00 0.00 ? 65  GLU C H    1  
ATOM   4179   H HA   . GLU C 1 65  ? -10.026 -14.560 -19.973 1.00 0.00 ? 65  GLU C HA   1  
ATOM   4180   H HB2  . GLU C 1 65  ? -8.755  -13.584 -17.411 1.00 0.00 ? 65  GLU C HB2  1  
ATOM   4181   H HB3  . GLU C 1 65  ? -8.076  -14.867 -18.411 1.00 0.00 ? 65  GLU C HB3  1  
ATOM   4182   H HG2  . GLU C 1 65  ? -7.940  -13.344 -20.323 1.00 0.00 ? 65  GLU C HG2  1  
ATOM   4183   H HG3  . GLU C 1 65  ? -8.688  -12.059 -19.375 1.00 0.00 ? 65  GLU C HG3  1  
ATOM   4184   N N    . GLY C 1 66  ? -11.145 -15.321 -16.979 1.00 0.00 ? 66  GLY C N    1  
ATOM   4185   C CA   . GLY C 1 66  ? -11.664 -16.419 -16.173 1.00 0.00 ? 66  GLY C CA   1  
ATOM   4186   C C    . GLY C 1 66  ? -12.626 -15.908 -15.108 1.00 0.00 ? 66  GLY C C    1  
ATOM   4187   O O    . GLY C 1 66  ? -12.785 -14.701 -14.927 1.00 0.00 ? 66  GLY C O    1  
ATOM   4188   H H    . GLY C 1 66  ? -11.189 -14.405 -16.633 1.00 0.00 ? 66  GLY C H    1  
ATOM   4189   H HA2  . GLY C 1 66  ? -12.184 -17.115 -16.817 1.00 0.00 ? 66  GLY C HA2  1  
ATOM   4190   H HA3  . GLY C 1 66  ? -10.842 -16.926 -15.692 1.00 0.00 ? 66  GLY C HA3  1  
ATOM   4191   N N    . LYS C 1 67  ? -13.272 -16.837 -14.414 1.00 0.00 ? 67  LYS C N    1  
ATOM   4192   C CA   . LYS C 1 67  ? -14.227 -16.475 -13.374 1.00 0.00 ? 67  LYS C CA   1  
ATOM   4193   C C    . LYS C 1 67  ? -13.526 -15.815 -12.185 1.00 0.00 ? 67  LYS C C    1  
ATOM   4194   O O    . LYS C 1 67  ? -13.521 -14.591 -12.053 1.00 0.00 ? 67  LYS C O    1  
ATOM   4195   C CB   . LYS C 1 67  ? -14.961 -17.731 -12.888 1.00 0.00 ? 67  LYS C CB   1  
ATOM   4196   C CG   . LYS C 1 67  ? -15.619 -18.460 -14.068 1.00 0.00 ? 67  LYS C CG   1  
ATOM   4197   C CD   . LYS C 1 67  ? -16.758 -17.615 -14.646 1.00 0.00 ? 67  LYS C CD   1  
ATOM   4198   C CE   . LYS C 1 67  ? -17.618 -18.488 -15.563 1.00 0.00 ? 67  LYS C CE   1  
ATOM   4199   N NZ   . LYS C 1 67  ? -18.808 -17.714 -16.014 1.00 0.00 ? 67  LYS C NZ   1  
ATOM   4200   H H    . LYS C 1 67  ? -13.109 -17.784 -14.609 1.00 0.00 ? 67  LYS C H    1  
ATOM   4201   H HA   . LYS C 1 67  ? -14.947 -15.785 -13.781 1.00 0.00 ? 67  LYS C HA   1  
ATOM   4202   H HB2  . LYS C 1 67  ? -14.257 -18.395 -12.409 1.00 0.00 ? 67  LYS C HB2  1  
ATOM   4203   H HB3  . LYS C 1 67  ? -15.723 -17.447 -12.177 1.00 0.00 ? 67  LYS C HB3  1  
ATOM   4204   H HG2  . LYS C 1 67  ? -14.879 -18.637 -14.835 1.00 0.00 ? 67  LYS C HG2  1  
ATOM   4205   H HG3  . LYS C 1 67  ? -16.014 -19.406 -13.728 1.00 0.00 ? 67  LYS C HG3  1  
ATOM   4206   H HD2  . LYS C 1 67  ? -17.365 -17.227 -13.841 1.00 0.00 ? 67  LYS C HD2  1  
ATOM   4207   H HD3  . LYS C 1 67  ? -16.348 -16.798 -15.218 1.00 0.00 ? 67  LYS C HD3  1  
ATOM   4208   H HE2  . LYS C 1 67  ? -17.037 -18.789 -16.422 1.00 0.00 ? 67  LYS C HE2  1  
ATOM   4209   H HE3  . LYS C 1 67  ? -17.943 -19.366 -15.023 1.00 0.00 ? 67  LYS C HE3  1  
ATOM   4210   H HZ1  . LYS C 1 67  ? -18.570 -16.704 -16.057 1.00 0.00 ? 67  LYS C HZ1  1  
ATOM   4211   H HZ2  . LYS C 1 67  ? -19.098 -18.044 -16.958 1.00 0.00 ? 67  LYS C HZ2  1  
ATOM   4212   H HZ3  . LYS C 1 67  ? -19.589 -17.856 -15.343 1.00 0.00 ? 67  LYS C HZ3  1  
ATOM   4213   N N    . MET C 1 68  ? -12.962 -16.643 -11.311 1.00 0.00 ? 68  MET C N    1  
ATOM   4214   C CA   . MET C 1 68  ? -12.283 -16.158 -10.110 1.00 0.00 ? 68  MET C CA   1  
ATOM   4215   C C    . MET C 1 68  ? -11.006 -15.372 -10.423 1.00 0.00 ? 68  MET C C    1  
ATOM   4216   O O    . MET C 1 68  ? -10.698 -14.389 -9.749  1.00 0.00 ? 68  MET C O    1  
ATOM   4217   C CB   . MET C 1 68  ? -11.930 -17.346 -9.213  1.00 0.00 ? 68  MET C CB   1  
ATOM   4218   C CG   . MET C 1 68  ? -13.172 -17.793 -8.439  1.00 0.00 ? 68  MET C CG   1  
ATOM   4219   S SD   . MET C 1 68  ? -13.631 -16.515 -7.242  1.00 0.00 ? 68  MET C SD   1  
ATOM   4220   C CE   . MET C 1 68  ? -15.407 -16.507 -7.586  1.00 0.00 ? 68  MET C CE   1  
ATOM   4221   H H    . MET C 1 68  ? -13.019 -17.608 -11.466 1.00 0.00 ? 68  MET C H    1  
ATOM   4222   H HA   . MET C 1 68  ? -12.958 -15.514 -9.570  1.00 0.00 ? 68  MET C HA   1  
ATOM   4223   H HB2  . MET C 1 68  ? -11.573 -18.163 -9.824  1.00 0.00 ? 68  MET C HB2  1  
ATOM   4224   H HB3  . MET C 1 68  ? -11.160 -17.055 -8.516  1.00 0.00 ? 68  MET C HB3  1  
ATOM   4225   H HG2  . MET C 1 68  ? -13.988 -17.951 -9.129  1.00 0.00 ? 68  MET C HG2  1  
ATOM   4226   H HG3  . MET C 1 68  ? -12.959 -18.715 -7.918  1.00 0.00 ? 68  MET C HG3  1  
ATOM   4227   H HE1  . MET C 1 68  ? -15.784 -17.520 -7.555  1.00 0.00 ? 68  MET C HE1  1  
ATOM   4228   H HE2  . MET C 1 68  ? -15.916 -15.913 -6.845  1.00 0.00 ? 68  MET C HE2  1  
ATOM   4229   H HE3  . MET C 1 68  ? -15.581 -16.083 -8.566  1.00 0.00 ? 68  MET C HE3  1  
ATOM   4230   N N    . LYS C 1 69  ? -10.243 -15.831 -11.411 1.00 0.00 ? 69  LYS C N    1  
ATOM   4231   C CA   . LYS C 1 69  ? -8.977  -15.179 -11.752 1.00 0.00 ? 69  LYS C CA   1  
ATOM   4232   C C    . LYS C 1 69  ? -9.174  -13.836 -12.456 1.00 0.00 ? 69  LYS C C    1  
ATOM   4233   O O    . LYS C 1 69  ? -10.181 -13.604 -13.125 1.00 0.00 ? 69  LYS C O    1  
ATOM   4234   C CB   . LYS C 1 69  ? -8.135  -16.109 -12.623 1.00 0.00 ? 69  LYS C CB   1  
ATOM   4235   C CG   . LYS C 1 69  ? -7.705  -17.315 -11.785 1.00 0.00 ? 69  LYS C CG   1  
ATOM   4236   C CD   . LYS C 1 69  ? -6.859  -18.264 -12.634 1.00 0.00 ? 69  LYS C CD   1  
ATOM   4237   C CE   . LYS C 1 69  ? -6.493  -19.495 -11.803 1.00 0.00 ? 69  LYS C CE   1  
ATOM   4238   N NZ   . LYS C 1 69  ? -5.596  -19.089 -10.683 1.00 0.00 ? 69  LYS C NZ   1  
ATOM   4239   H H    . LYS C 1 69  ? -10.516 -16.637 -11.896 1.00 0.00 ? 69  LYS C H    1  
ATOM   4240   H HA   . LYS C 1 69  ? -8.435  -15.000 -10.836 1.00 0.00 ? 69  LYS C HA   1  
ATOM   4241   H HB2  . LYS C 1 69  ? -8.721  -16.443 -13.468 1.00 0.00 ? 69  LYS C HB2  1  
ATOM   4242   H HB3  . LYS C 1 69  ? -7.260  -15.584 -12.973 1.00 0.00 ? 69  LYS C HB3  1  
ATOM   4243   H HG2  . LYS C 1 69  ? -7.124  -16.975 -10.940 1.00 0.00 ? 69  LYS C HG2  1  
ATOM   4244   H HG3  . LYS C 1 69  ? -8.582  -17.837 -11.432 1.00 0.00 ? 69  LYS C HG3  1  
ATOM   4245   H HD2  . LYS C 1 69  ? -7.423  -18.569 -13.504 1.00 0.00 ? 69  LYS C HD2  1  
ATOM   4246   H HD3  . LYS C 1 69  ? -5.956  -17.761 -12.947 1.00 0.00 ? 69  LYS C HD3  1  
ATOM   4247   H HE2  . LYS C 1 69  ? -7.392  -19.938 -11.401 1.00 0.00 ? 69  LYS C HE2  1  
ATOM   4248   H HE3  . LYS C 1 69  ? -5.986  -20.214 -12.428 1.00 0.00 ? 69  LYS C HE3  1  
ATOM   4249   H HZ1  . LYS C 1 69  ? -5.693  -18.068 -10.514 1.00 0.00 ? 69  LYS C HZ1  1  
ATOM   4250   H HZ2  . LYS C 1 69  ? -5.860  -19.608 -9.822  1.00 0.00 ? 69  LYS C HZ2  1  
ATOM   4251   H HZ3  . LYS C 1 69  ? -4.610  -19.308 -10.933 1.00 0.00 ? 69  LYS C HZ3  1  
ATOM   4252   N N    . VAL C 1 70  ? -8.186  -12.956 -12.278 1.00 0.00 ? 70  VAL C N    1  
ATOM   4253   C CA   . VAL C 1 70  ? -8.211  -11.618 -12.869 1.00 0.00 ? 70  VAL C CA   1  
ATOM   4254   C C    . VAL C 1 70  ? -6.874  -11.309 -13.547 1.00 0.00 ? 70  VAL C C    1  
ATOM   4255   O O    . VAL C 1 70  ? -5.916  -12.071 -13.417 1.00 0.00 ? 70  VAL C O    1  
ATOM   4256   C CB   . VAL C 1 70  ? -8.474  -10.579 -11.779 1.00 0.00 ? 70  VAL C CB   1  
ATOM   4257   C CG1  . VAL C 1 70  ? -9.844  -10.830 -11.149 1.00 0.00 ? 70  VAL C CG1  1  
ATOM   4258   C CG2  . VAL C 1 70  ? -7.391  -10.688 -10.703 1.00 0.00 ? 70  VAL C CG2  1  
ATOM   4259   H H    . VAL C 1 70  ? -7.419  -13.213 -11.726 1.00 0.00 ? 70  VAL C H    1  
ATOM   4260   H HA   . VAL C 1 70  ? -9.001  -11.567 -13.602 1.00 0.00 ? 70  VAL C HA   1  
ATOM   4261   H HB   . VAL C 1 70  ? -8.452  -9.592  -12.213 1.00 0.00 ? 70  VAL C HB   1  
ATOM   4262   H HG11 . VAL C 1 70  ? -9.883  -11.838 -10.761 1.00 0.00 ? 70  VAL C HG11 1  
ATOM   4263   H HG12 . VAL C 1 70  ? -10.004 -10.128 -10.344 1.00 0.00 ? 70  VAL C HG12 1  
ATOM   4264   H HG13 . VAL C 1 70  ? -10.613 -10.703 -11.896 1.00 0.00 ? 70  VAL C HG13 1  
ATOM   4265   H HG21 . VAL C 1 70  ? -6.421  -10.526 -11.151 1.00 0.00 ? 70  VAL C HG21 1  
ATOM   4266   H HG22 . VAL C 1 70  ? -7.564  -9.942  -9.941  1.00 0.00 ? 70  VAL C HG22 1  
ATOM   4267   H HG23 . VAL C 1 70  ? -7.422  -11.672 -10.258 1.00 0.00 ? 70  VAL C HG23 1  
ATOM   4268   N N    . SER C 1 71  ? -6.809  -10.187 -14.269 1.00 0.00 ? 71  SER C N    1  
ATOM   4269   C CA   . SER C 1 71  ? -5.572  -9.805  -14.951 1.00 0.00 ? 71  SER C CA   1  
ATOM   4270   C C    . SER C 1 71  ? -4.447  -9.654  -13.931 1.00 0.00 ? 71  SER C C    1  
ATOM   4271   O O    . SER C 1 71  ? -4.620  -9.013  -12.894 1.00 0.00 ? 71  SER C O    1  
ATOM   4272   C CB   . SER C 1 71  ? -5.770  -8.488  -15.700 1.00 0.00 ? 71  SER C CB   1  
ATOM   4273   O OG   . SER C 1 71  ? -4.610  -8.211  -16.473 1.00 0.00 ? 71  SER C OG   1  
ATOM   4274   H H    . SER C 1 71  ? -7.599  -9.611  -14.340 1.00 0.00 ? 71  SER C H    1  
ATOM   4275   H HA   . SER C 1 71  ? -5.306  -10.577 -15.658 1.00 0.00 ? 71  SER C HA   1  
ATOM   4276   H HB2  . SER C 1 71  ? -6.622  -8.567  -16.354 1.00 0.00 ? 71  SER C HB2  1  
ATOM   4277   H HB3  . SER C 1 71  ? -5.938  -7.692  -14.987 1.00 0.00 ? 71  SER C HB3  1  
ATOM   4278   H HG   . SER C 1 71  ? -3.841  -8.428  -15.942 1.00 0.00 ? 71  SER C HG   1  
ATOM   4279   N N    . LEU C 1 72  ? -3.316  -10.297 -14.204 1.00 0.00 ? 72  LEU C N    1  
ATOM   4280   C CA   . LEU C 1 72  ? -2.190  -10.280 -13.271 1.00 0.00 ? 72  LEU C CA   1  
ATOM   4281   C C    . LEU C 1 72  ? -1.586  -8.881  -13.134 1.00 0.00 ? 72  LEU C C    1  
ATOM   4282   O O    . LEU C 1 72  ? -1.195  -8.455  -12.049 1.00 0.00 ? 72  LEU C O    1  
ATOM   4283   C CB   . LEU C 1 72  ? -1.104  -11.241 -13.762 1.00 0.00 ? 72  LEU C CB   1  
ATOM   4284   C CG   . LEU C 1 72  ? -1.589  -12.688 -13.624 1.00 0.00 ? 72  LEU C CG   1  
ATOM   4285   C CD1  . LEU C 1 72  ? -0.609  -13.621 -14.340 1.00 0.00 ? 72  LEU C CD1  1  
ATOM   4286   C CD2  . LEU C 1 72  ? -1.671  -13.073 -12.139 1.00 0.00 ? 72  LEU C CD2  1  
ATOM   4287   H H    . LEU C 1 72  ? -3.250  -10.833 -15.016 1.00 0.00 ? 72  LEU C H    1  
ATOM   4288   H HA   . LEU C 1 72  ? -2.528  -10.616 -12.305 1.00 0.00 ? 72  LEU C HA   1  
ATOM   4289   H HB2  . LEU C 1 72  ? -0.889  -11.034 -14.801 1.00 0.00 ? 72  LEU C HB2  1  
ATOM   4290   H HB3  . LEU C 1 72  ? -0.208  -11.103 -13.177 1.00 0.00 ? 72  LEU C HB3  1  
ATOM   4291   H HG   . LEU C 1 72  ? -2.566  -12.782 -14.075 1.00 0.00 ? 72  LEU C HG   1  
ATOM   4292   H HD11 . LEU C 1 72  ? -0.425  -13.251 -15.338 1.00 0.00 ? 72  LEU C HD11 1  
ATOM   4293   H HD12 . LEU C 1 72  ? 0.321   -13.655 -13.792 1.00 0.00 ? 72  LEU C HD12 1  
ATOM   4294   H HD13 . LEU C 1 72  ? -1.031  -14.613 -14.396 1.00 0.00 ? 72  LEU C HD13 1  
ATOM   4295   H HD21 . LEU C 1 72  ? -0.921  -12.533 -11.580 1.00 0.00 ? 72  LEU C HD21 1  
ATOM   4296   H HD22 . LEU C 1 72  ? -2.651  -12.826 -11.757 1.00 0.00 ? 72  LEU C HD22 1  
ATOM   4297   H HD23 . LEU C 1 72  ? -1.502  -14.135 -12.031 1.00 0.00 ? 72  LEU C HD23 1  
ATOM   4298   N N    . VAL C 1 73  ? -1.497  -8.191  -14.261 1.00 0.00 ? 73  VAL C N    1  
ATOM   4299   C CA   . VAL C 1 73  ? -0.922  -6.850  -14.316 1.00 0.00 ? 73  VAL C CA   1  
ATOM   4300   C C    . VAL C 1 73  ? -1.682  -5.847  -13.435 1.00 0.00 ? 73  VAL C C    1  
ATOM   4301   O O    . VAL C 1 73  ? -1.153  -4.790  -13.075 1.00 0.00 ? 73  VAL C O    1  
ATOM   4302   C CB   . VAL C 1 73  ? -0.935  -6.346  -15.760 1.00 0.00 ? 73  VAL C CB   1  
ATOM   4303   C CG1  . VAL C 1 73  ? -0.380  -7.427  -16.690 1.00 0.00 ? 73  VAL C CG1  1  
ATOM   4304   C CG2  . VAL C 1 73  ? -2.370  -6.008  -16.167 1.00 0.00 ? 73  VAL C CG2  1  
ATOM   4305   H H    . VAL C 1 73  ? -1.816  -8.600  -15.087 1.00 0.00 ? 73  VAL C H    1  
ATOM   4306   H HA   . VAL C 1 73  ? 0.103   -6.899  -13.985 1.00 0.00 ? 73  VAL C HA   1  
ATOM   4307   H HB   . VAL C 1 73  ? -0.321  -5.460  -15.835 1.00 0.00 ? 73  VAL C HB   1  
ATOM   4308   H HG11 . VAL C 1 73  ? -0.964  -8.329  -16.586 1.00 0.00 ? 73  VAL C HG11 1  
ATOM   4309   H HG12 . VAL C 1 73  ? -0.430  -7.082  -17.712 1.00 0.00 ? 73  VAL C HG12 1  
ATOM   4310   H HG13 . VAL C 1 73  ? 0.648   -7.633  -16.430 1.00 0.00 ? 73  VAL C HG13 1  
ATOM   4311   H HG21 . VAL C 1 73  ? -3.048  -6.717  -15.716 1.00 0.00 ? 73  VAL C HG21 1  
ATOM   4312   H HG22 . VAL C 1 73  ? -2.615  -5.012  -15.829 1.00 0.00 ? 73  VAL C HG22 1  
ATOM   4313   H HG23 . VAL C 1 73  ? -2.461  -6.056  -17.242 1.00 0.00 ? 73  VAL C HG23 1  
ATOM   4314   N N    . LEU C 1 74  ? -2.925  -6.180  -13.107 1.00 0.00 ? 74  LEU C N    1  
ATOM   4315   C CA   . LEU C 1 74  ? -3.739  -5.299  -12.284 1.00 0.00 ? 74  LEU C CA   1  
ATOM   4316   C C    . LEU C 1 74  ? -2.951  -4.919  -11.040 1.00 0.00 ? 74  LEU C C    1  
ATOM   4317   O O    . LEU C 1 74  ? -2.986  -3.774  -10.588 1.00 0.00 ? 74  LEU C O    1  
ATOM   4318   C CB   . LEU C 1 74  ? -5.041  -6.018  -11.893 1.00 0.00 ? 74  LEU C CB   1  
ATOM   4319   C CG   . LEU C 1 74  ? -5.845  -5.198  -10.866 1.00 0.00 ? 74  LEU C CG   1  
ATOM   4320   C CD1  . LEU C 1 74  ? -6.337  -3.892  -11.501 1.00 0.00 ? 74  LEU C CD1  1  
ATOM   4321   C CD2  . LEU C 1 74  ? -7.055  -6.020  -10.388 1.00 0.00 ? 74  LEU C CD2  1  
ATOM   4322   H H    . LEU C 1 74  ? -3.301  -7.026  -13.428 1.00 0.00 ? 74  LEU C H    1  
ATOM   4323   H HA   . LEU C 1 74  ? -3.974  -4.408  -12.845 1.00 0.00 ? 74  LEU C HA   1  
ATOM   4324   H HB2  . LEU C 1 74  ? -5.642  -6.164  -12.778 1.00 0.00 ? 74  LEU C HB2  1  
ATOM   4325   H HB3  . LEU C 1 74  ? -4.798  -6.980  -11.467 1.00 0.00 ? 74  LEU C HB3  1  
ATOM   4326   H HG   . LEU C 1 74  ? -5.219  -4.965  -10.018 1.00 0.00 ? 74  LEU C HG   1  
ATOM   4327   H HD11 . LEU C 1 74  ? -6.840  -4.111  -12.433 1.00 0.00 ? 74  LEU C HD11 1  
ATOM   4328   H HD12 . LEU C 1 74  ? -7.028  -3.406  -10.827 1.00 0.00 ? 74  LEU C HD12 1  
ATOM   4329   H HD13 . LEU C 1 74  ? -5.499  -3.239  -11.687 1.00 0.00 ? 74  LEU C HD13 1  
ATOM   4330   H HD21 . LEU C 1 74  ? -6.850  -7.075  -10.500 1.00 0.00 ? 74  LEU C HD21 1  
ATOM   4331   H HD22 . LEU C 1 74  ? -7.242  -5.804  -9.346  1.00 0.00 ? 74  LEU C HD22 1  
ATOM   4332   H HD23 . LEU C 1 74  ? -7.929  -5.759  -10.972 1.00 0.00 ? 74  LEU C HD23 1  
ATOM   4333   N N    . VAL C 1 75  ? -2.240  -5.894  -10.498 1.00 0.00 ? 75  VAL C N    1  
ATOM   4334   C CA   . VAL C 1 75  ? -1.435  -5.678  -9.307  1.00 0.00 ? 75  VAL C CA   1  
ATOM   4335   C C    . VAL C 1 75  ? -0.287  -4.723  -9.577  1.00 0.00 ? 75  VAL C C    1  
ATOM   4336   O O    . VAL C 1 75  ? 0.006   -3.838  -8.777  1.00 0.00 ? 75  VAL C O    1  
ATOM   4337   C CB   . VAL C 1 75  ? -0.859  -7.003  -8.829  1.00 0.00 ? 75  VAL C CB   1  
ATOM   4338   C CG1  . VAL C 1 75  ? 0.118   -6.747  -7.671  1.00 0.00 ? 75  VAL C CG1  1  
ATOM   4339   C CG2  . VAL C 1 75  ? -2.006  -7.908  -8.370  1.00 0.00 ? 75  VAL C CG2  1  
ATOM   4340   H H    . VAL C 1 75  ? -2.255  -6.782  -10.911 1.00 0.00 ? 75  VAL C H    1  
ATOM   4341   H HA   . VAL C 1 75  ? -2.058  -5.268  -8.530  1.00 0.00 ? 75  VAL C HA   1  
ATOM   4342   H HB   . VAL C 1 75  ? -0.331  -7.476  -9.646  1.00 0.00 ? 75  VAL C HB   1  
ATOM   4343   H HG11 . VAL C 1 75  ? -0.041  -5.759  -7.263  1.00 0.00 ? 75  VAL C HG11 1  
ATOM   4344   H HG12 . VAL C 1 75  ? -0.043  -7.479  -6.901  1.00 0.00 ? 75  VAL C HG12 1  
ATOM   4345   H HG13 . VAL C 1 75  ? 1.132   -6.824  -8.031  1.00 0.00 ? 75  VAL C HG13 1  
ATOM   4346   H HG21 . VAL C 1 75  ? -2.732  -7.997  -9.164  1.00 0.00 ? 75  VAL C HG21 1  
ATOM   4347   H HG22 . VAL C 1 75  ? -1.617  -8.885  -8.125  1.00 0.00 ? 75  VAL C HG22 1  
ATOM   4348   H HG23 . VAL C 1 75  ? -2.476  -7.478  -7.499  1.00 0.00 ? 75  VAL C HG23 1  
ATOM   4349   N N    . HIS C 1 76  ? 0.377   -4.922  -10.696 1.00 0.00 ? 76  HIS C N    1  
ATOM   4350   C CA   . HIS C 1 76  ? 1.508   -4.084  -11.034 1.00 0.00 ? 76  HIS C CA   1  
ATOM   4351   C C    . HIS C 1 76  ? 1.080   -2.622  -11.055 1.00 0.00 ? 76  HIS C C    1  
ATOM   4352   O O    . HIS C 1 76  ? 1.751   -1.760  -10.486 1.00 0.00 ? 76  HIS C O    1  
ATOM   4353   C CB   . HIS C 1 76  ? 2.064   -4.497  -12.396 1.00 0.00 ? 76  HIS C CB   1  
ATOM   4354   C CG   . HIS C 1 76  ? 3.471   -3.995  -12.526 1.00 0.00 ? 76  HIS C CG   1  
ATOM   4355   N ND1  . HIS C 1 76  ? 3.831   -3.030  -13.451 1.00 0.00 ? 76  HIS C ND1  1  
ATOM   4356   C CD2  . HIS C 1 76  ? 4.618   -4.311  -11.843 1.00 0.00 ? 76  HIS C CD2  1  
ATOM   4357   C CE1  . HIS C 1 76  ? 5.148   -2.801  -13.302 1.00 0.00 ? 76  HIS C CE1  1  
ATOM   4358   N NE2  . HIS C 1 76  ? 5.676   -3.555  -12.335 1.00 0.00 ? 76  HIS C NE2  1  
ATOM   4359   H H    . HIS C 1 76  ? 0.116   -5.653  -11.293 1.00 0.00 ? 76  HIS C H    1  
ATOM   4360   H HA   . HIS C 1 76  ? 2.277   -4.215  -10.288 1.00 0.00 ? 76  HIS C HA   1  
ATOM   4361   H HB2  . HIS C 1 76  ? 2.056   -5.574  -12.476 1.00 0.00 ? 76  HIS C HB2  1  
ATOM   4362   H HB3  . HIS C 1 76  ? 1.454   -4.073  -13.180 1.00 0.00 ? 76  HIS C HB3  1  
ATOM   4363   H HD1  . HIS C 1 76  ? 3.234   -2.594  -14.096 1.00 0.00 ? 76  HIS C HD1  1  
ATOM   4364   H HD2  . HIS C 1 76  ? 4.686   -5.035  -11.045 1.00 0.00 ? 76  HIS C HD2  1  
ATOM   4365   H HE1  . HIS C 1 76  ? 5.709   -2.092  -13.890 1.00 0.00 ? 76  HIS C HE1  1  
ATOM   4366   N N    . ALA C 1 77  ? -0.056  -2.351  -11.688 1.00 0.00 ? 77  ALA C N    1  
ATOM   4367   C CA   . ALA C 1 77  ? -0.577  -0.991  -11.746 1.00 0.00 ? 77  ALA C CA   1  
ATOM   4368   C C    . ALA C 1 77  ? -1.030  -0.539  -10.356 1.00 0.00 ? 77  ALA C C    1  
ATOM   4369   O O    . ALA C 1 77  ? -0.810  0.607   -9.964  1.00 0.00 ? 77  ALA C O    1  
ATOM   4370   C CB   . ALA C 1 77  ? -1.755  -0.925  -12.723 1.00 0.00 ? 77  ALA C CB   1  
ATOM   4371   H H    . ALA C 1 77  ? -0.560  -3.078  -12.104 1.00 0.00 ? 77  ALA C H    1  
ATOM   4372   H HA   . ALA C 1 77  ? 0.203   -0.330  -12.094 1.00 0.00 ? 77  ALA C HA   1  
ATOM   4373   H HB1  . ALA C 1 77  ? -2.264  -1.877  -12.736 1.00 0.00 ? 77  ALA C HB1  1  
ATOM   4374   H HB2  . ALA C 1 77  ? -2.444  -0.153  -12.410 1.00 0.00 ? 77  ALA C HB2  1  
ATOM   4375   H HB3  . ALA C 1 77  ? -1.389  -0.699  -13.713 1.00 0.00 ? 77  ALA C HB3  1  
ATOM   4376   N N    . GLN C 1 78  ? -1.664  -1.448  -9.616  1.00 0.00 ? 78  GLN C N    1  
ATOM   4377   C CA   . GLN C 1 78  ? -2.147  -1.129  -8.272  1.00 0.00 ? 78  GLN C CA   1  
ATOM   4378   C C    . GLN C 1 78  ? -0.972  -0.817  -7.347  1.00 0.00 ? 78  GLN C C    1  
ATOM   4379   O O    . GLN C 1 78  ? -0.982  0.178   -6.622  1.00 0.00 ? 78  GLN C O    1  
ATOM   4380   C CB   . GLN C 1 78  ? -2.939  -2.312  -7.717  1.00 0.00 ? 78  GLN C CB   1  
ATOM   4381   C CG   . GLN C 1 78  ? -3.790  -1.849  -6.536  1.00 0.00 ? 78  GLN C CG   1  
ATOM   4382   C CD   . GLN C 1 78  ? -4.546  -3.036  -5.948  1.00 0.00 ? 78  GLN C CD   1  
ATOM   4383   O OE1  . GLN C 1 78  ? -4.401  -4.162  -6.424  1.00 0.00 ? 78  GLN C OE1  1  
ATOM   4384   N NE2  . GLN C 1 78  ? -5.347  -2.852  -4.936  1.00 0.00 ? 78  GLN C NE2  1  
ATOM   4385   H H    . GLN C 1 78  ? -1.813  -2.346  -9.980  1.00 0.00 ? 78  GLN C H    1  
ATOM   4386   H HA   . GLN C 1 78  ? -2.794  -0.267  -8.325  1.00 0.00 ? 78  GLN C HA   1  
ATOM   4387   H HB2  . GLN C 1 78  ? -3.580  -2.710  -8.491  1.00 0.00 ? 78  GLN C HB2  1  
ATOM   4388   H HB3  . GLN C 1 78  ? -2.255  -3.080  -7.387  1.00 0.00 ? 78  GLN C HB3  1  
ATOM   4389   H HG2  . GLN C 1 78  ? -3.152  -1.414  -5.782  1.00 0.00 ? 78  GLN C HG2  1  
ATOM   4390   H HG3  . GLN C 1 78  ? -4.499  -1.109  -6.875  1.00 0.00 ? 78  GLN C HG3  1  
ATOM   4391   H HE21 . GLN C 1 78  ? -5.461  -1.955  -4.558  1.00 0.00 ? 78  GLN C HE21 1  
ATOM   4392   H HE22 . GLN C 1 78  ? -5.835  -3.610  -4.553  1.00 0.00 ? 78  GLN C HE22 1  
ATOM   4393   N N    . LEU C 1 79  ? 0.042   -1.673  -7.393  1.00 0.00 ? 79  LEU C N    1  
ATOM   4394   C CA   . LEU C 1 79  ? 1.238   -1.493  -6.573  1.00 0.00 ? 79  LEU C CA   1  
ATOM   4395   C C    . LEU C 1 79  ? 1.879   -0.135  -6.829  1.00 0.00 ? 79  LEU C C    1  
ATOM   4396   O O    . LEU C 1 79  ? 2.186   0.599   -5.894  1.00 0.00 ? 79  LEU C O    1  
ATOM   4397   C CB   . LEU C 1 79  ? 2.254   -2.606  -6.878  1.00 0.00 ? 79  LEU C CB   1  
ATOM   4398   C CG   . LEU C 1 79  ? 3.560   -2.378  -6.093  1.00 0.00 ? 79  LEU C CG   1  
ATOM   4399   C CD1  . LEU C 1 79  ? 3.249   -2.251  -4.598  1.00 0.00 ? 79  LEU C CD1  1  
ATOM   4400   C CD2  . LEU C 1 79  ? 4.520   -3.556  -6.331  1.00 0.00 ? 79  LEU C CD2  1  
ATOM   4401   H H    . LEU C 1 79  ? -0.019  -2.449  -7.992  1.00 0.00 ? 79  LEU C H    1  
ATOM   4402   H HA   . LEU C 1 79  ? 0.956   -1.550  -5.535  1.00 0.00 ? 79  LEU C HA   1  
ATOM   4403   H HB2  . LEU C 1 79  ? 1.830   -3.558  -6.602  1.00 0.00 ? 79  LEU C HB2  1  
ATOM   4404   H HB3  . LEU C 1 79  ? 2.473   -2.605  -7.936  1.00 0.00 ? 79  LEU C HB3  1  
ATOM   4405   H HG   . LEU C 1 79  ? 4.028   -1.463  -6.434  1.00 0.00 ? 79  LEU C HG   1  
ATOM   4406   H HD11 . LEU C 1 79  ? 2.399   -2.868  -4.351  1.00 0.00 ? 79  LEU C HD11 1  
ATOM   4407   H HD12 . LEU C 1 79  ? 4.104   -2.566  -4.022  1.00 0.00 ? 79  LEU C HD12 1  
ATOM   4408   H HD13 . LEU C 1 79  ? 3.023   -1.218  -4.366  1.00 0.00 ? 79  LEU C HD13 1  
ATOM   4409   H HD21 . LEU C 1 79  ? 3.963   -4.481  -6.375  1.00 0.00 ? 79  LEU C HD21 1  
ATOM   4410   H HD22 . LEU C 1 79  ? 5.038   -3.410  -7.268  1.00 0.00 ? 79  LEU C HD22 1  
ATOM   4411   H HD23 . LEU C 1 79  ? 5.243   -3.608  -5.530  1.00 0.00 ? 79  LEU C HD23 1  
ATOM   4412   N N    . HIS C 1 80  ? 2.086   0.193   -8.096  1.00 0.00 ? 80  HIS C N    1  
ATOM   4413   C CA   . HIS C 1 80  ? 2.706   1.467   -8.440  1.00 0.00 ? 80  HIS C CA   1  
ATOM   4414   C C    . HIS C 1 80  ? 1.803   2.636   -8.067  1.00 0.00 ? 80  HIS C C    1  
ATOM   4415   O O    . HIS C 1 80  ? 2.257   3.629   -7.495  1.00 0.00 ? 80  HIS C O    1  
ATOM   4416   C CB   . HIS C 1 80  ? 3.050   1.496   -9.928  1.00 0.00 ? 80  HIS C CB   1  
ATOM   4417   C CG   . HIS C 1 80  ? 4.455   0.976   -10.110 1.00 0.00 ? 80  HIS C CG   1  
ATOM   4418   N ND1  . HIS C 1 80  ? 5.523   1.812   -10.392 1.00 0.00 ? 80  HIS C ND1  1  
ATOM   4419   C CD2  . HIS C 1 80  ? 4.975   -0.294  -10.059 1.00 0.00 ? 80  HIS C CD2  1  
ATOM   4420   C CE1  . HIS C 1 80  ? 6.622   1.043   -10.500 1.00 0.00 ? 80  HIS C CE1  1  
ATOM   4421   N NE2  . HIS C 1 80  ? 6.344   -0.249  -10.305 1.00 0.00 ? 80  HIS C NE2  1  
ATOM   4422   H H    . HIS C 1 80  ? 1.823   -0.433  -8.809  1.00 0.00 ? 80  HIS C H    1  
ATOM   4423   H HA   . HIS C 1 80  ? 3.627   1.559   -7.888  1.00 0.00 ? 80  HIS C HA   1  
ATOM   4424   H HB2  . HIS C 1 80  ? 2.357   0.871   -10.472 1.00 0.00 ? 80  HIS C HB2  1  
ATOM   4425   H HB3  . HIS C 1 80  ? 2.991   2.509   -10.298 1.00 0.00 ? 80  HIS C HB3  1  
ATOM   4426   H HD1  . HIS C 1 80  ? 5.484   2.786   -10.495 1.00 0.00 ? 80  HIS C HD1  1  
ATOM   4427   H HD2  . HIS C 1 80  ? 4.408   -1.191  -9.856  1.00 0.00 ? 80  HIS C HD2  1  
ATOM   4428   H HE1  . HIS C 1 80  ? 7.608   1.424   -10.721 1.00 0.00 ? 80  HIS C HE1  1  
ATOM   4429   H HE2  . HIS C 1 80  ? 6.968   -1.002  -10.333 1.00 0.00 ? 80  HIS C HE2  1  
ATOM   4430   N N    . LEU C 1 81  ? 0.529   2.520   -8.404  1.00 0.00 ? 81  LEU C N    1  
ATOM   4431   C CA   . LEU C 1 81  ? -0.428  3.585   -8.108  1.00 0.00 ? 81  LEU C CA   1  
ATOM   4432   C C    . LEU C 1 81  ? -0.596  3.793   -6.601  1.00 0.00 ? 81  LEU C C    1  
ATOM   4433   O O    . LEU C 1 81  ? -0.609  4.932   -6.122  1.00 0.00 ? 81  LEU C O    1  
ATOM   4434   C CB   . LEU C 1 81  ? -1.783  3.258   -8.734  1.00 0.00 ? 81  LEU C CB   1  
ATOM   4435   C CG   . LEU C 1 81  ? -1.693  3.362   -10.262 1.00 0.00 ? 81  LEU C CG   1  
ATOM   4436   C CD1  . LEU C 1 81  ? -2.954  2.762   -10.887 1.00 0.00 ? 81  LEU C CD1  1  
ATOM   4437   C CD2  . LEU C 1 81  ? -1.557  4.833   -10.692 1.00 0.00 ? 81  LEU C CD2  1  
ATOM   4438   H H    . LEU C 1 81  ? 0.222   1.710   -8.867  1.00 0.00 ? 81  LEU C H    1  
ATOM   4439   H HA   . LEU C 1 81  ? -0.060  4.502   -8.538  1.00 0.00 ? 81  LEU C HA   1  
ATOM   4440   H HB2  . LEU C 1 81  ? -2.069  2.251   -8.457  1.00 0.00 ? 81  LEU C HB2  1  
ATOM   4441   H HB3  . LEU C 1 81  ? -2.526  3.953   -8.366  1.00 0.00 ? 81  LEU C HB3  1  
ATOM   4442   H HG   . LEU C 1 81  ? -0.830  2.807   -10.602 1.00 0.00 ? 81  LEU C HG   1  
ATOM   4443   H HD11 . LEU C 1 81  ? -3.818  3.050   -10.309 1.00 0.00 ? 81  LEU C HD11 1  
ATOM   4444   H HD12 . LEU C 1 81  ? -3.063  3.120   -11.901 1.00 0.00 ? 81  LEU C HD12 1  
ATOM   4445   H HD13 . LEU C 1 81  ? -2.871  1.685   -10.896 1.00 0.00 ? 81  LEU C HD13 1  
ATOM   4446   H HD21 . LEU C 1 81  ? -2.123  5.467   -10.026 1.00 0.00 ? 81  LEU C HD21 1  
ATOM   4447   H HD22 . LEU C 1 81  ? -0.517  5.123   -10.666 1.00 0.00 ? 81  LEU C HD22 1  
ATOM   4448   H HD23 . LEU C 1 81  ? -1.933  4.948   -11.700 1.00 0.00 ? 81  LEU C HD23 1  
ATOM   4449   N N    . MET C 1 82  ? -0.730  2.699   -5.858  1.00 0.00 ? 82  MET C N    1  
ATOM   4450   C CA   . MET C 1 82  ? -0.901  2.793   -4.410  1.00 0.00 ? 82  MET C CA   1  
ATOM   4451   C C    . MET C 1 82  ? 0.318   3.445   -3.766  1.00 0.00 ? 82  MET C C    1  
ATOM   4452   O O    . MET C 1 82  ? 0.194   4.316   -2.902  1.00 0.00 ? 82  MET C O    1  
ATOM   4453   C CB   . MET C 1 82  ? -1.109  1.396   -3.812  1.00 0.00 ? 82  MET C CB   1  
ATOM   4454   C CG   . MET C 1 82  ? -2.524  0.892   -4.117  1.00 0.00 ? 82  MET C CG   1  
ATOM   4455   S SD   . MET C 1 82  ? -3.754  1.917   -3.263  1.00 0.00 ? 82  MET C SD   1  
ATOM   4456   C CE   . MET C 1 82  ? -3.474  1.300   -1.581  1.00 0.00 ? 82  MET C CE   1  
ATOM   4457   H H    . MET C 1 82  ? -0.711  1.814   -6.288  1.00 0.00 ? 82  MET C H    1  
ATOM   4458   H HA   . MET C 1 82  ? -1.768  3.398   -4.201  1.00 0.00 ? 82  MET C HA   1  
ATOM   4459   H HB2  . MET C 1 82  ? -0.386  0.715   -4.239  1.00 0.00 ? 82  MET C HB2  1  
ATOM   4460   H HB3  . MET C 1 82  ? -0.967  1.439   -2.742  1.00 0.00 ? 82  MET C HB3  1  
ATOM   4461   H HG2  . MET C 1 82  ? -2.698  0.939   -5.183  1.00 0.00 ? 82  MET C HG2  1  
ATOM   4462   H HG3  . MET C 1 82  ? -2.616  -0.134  -3.787  1.00 0.00 ? 82  MET C HG3  1  
ATOM   4463   H HE1  . MET C 1 82  ? -3.298  0.234   -1.611  1.00 0.00 ? 82  MET C HE1  1  
ATOM   4464   H HE2  . MET C 1 82  ? -2.615  1.794   -1.157  1.00 0.00 ? 82  MET C HE2  1  
ATOM   4465   H HE3  . MET C 1 82  ? -4.344  1.510   -0.973  1.00 0.00 ? 82  MET C HE3  1  
ATOM   4466   N N    . THR C 1 83  ? 1.497   3.016   -4.195  1.00 0.00 ? 83  THR C N    1  
ATOM   4467   C CA   . THR C 1 83  ? 2.741   3.560   -3.660  1.00 0.00 ? 83  THR C CA   1  
ATOM   4468   C C    . THR C 1 83  ? 2.860   5.046   -3.977  1.00 0.00 ? 83  THR C C    1  
ATOM   4469   O O    . THR C 1 83  ? 3.175   5.859   -3.106  1.00 0.00 ? 83  THR C O    1  
ATOM   4470   C CB   . THR C 1 83  ? 3.946   2.819   -4.259  1.00 0.00 ? 83  THR C CB   1  
ATOM   4471   O OG1  . THR C 1 83  ? 3.766   2.695   -5.658  1.00 0.00 ? 83  THR C OG1  1  
ATOM   4472   C CG2  . THR C 1 83  ? 4.077   1.420   -3.641  1.00 0.00 ? 83  THR C CG2  1  
ATOM   4473   H H    . THR C 1 83  ? 1.536   2.323   -4.890  1.00 0.00 ? 83  THR C H    1  
ATOM   4474   H HA   . THR C 1 83  ? 2.750   3.432   -2.590  1.00 0.00 ? 83  THR C HA   1  
ATOM   4475   H HB   . THR C 1 83  ? 4.845   3.383   -4.064  1.00 0.00 ? 83  THR C HB   1  
ATOM   4476   H HG1  . THR C 1 83  ? 4.607   2.855   -6.088  1.00 0.00 ? 83  THR C HG1  1  
ATOM   4477   H HG21 . THR C 1 83  ? 3.119   1.099   -3.255  1.00 0.00 ? 83  THR C HG21 1  
ATOM   4478   H HG22 . THR C 1 83  ? 4.410   0.723   -4.395  1.00 0.00 ? 83  THR C HG22 1  
ATOM   4479   H HG23 . THR C 1 83  ? 4.797   1.448   -2.836  1.00 0.00 ? 83  THR C HG23 1  
ATOM   4480   N N    . SER C 1 84  ? 2.615   5.399   -5.232  1.00 0.00 ? 84  SER C N    1  
ATOM   4481   C CA   . SER C 1 84  ? 2.713   6.798   -5.658  1.00 0.00 ? 84  SER C CA   1  
ATOM   4482   C C    . SER C 1 84  ? 1.708   7.687   -4.927  1.00 0.00 ? 84  SER C C    1  
ATOM   4483   O O    . SER C 1 84  ? 2.064   8.761   -4.434  1.00 0.00 ? 84  SER C O    1  
ATOM   4484   C CB   . SER C 1 84  ? 2.491   6.908   -7.167  1.00 0.00 ? 84  SER C CB   1  
ATOM   4485   O OG   . SER C 1 84  ? 3.648   6.429   -7.843  1.00 0.00 ? 84  SER C OG   1  
ATOM   4486   H H    . SER C 1 84  ? 2.375   4.709   -5.891  1.00 0.00 ? 84  SER C H    1  
ATOM   4487   H HA   . SER C 1 84  ? 3.706   7.154   -5.436  1.00 0.00 ? 84  SER C HA   1  
ATOM   4488   H HB2  . SER C 1 84  ? 1.639   6.314   -7.455  1.00 0.00 ? 84  SER C HB2  1  
ATOM   4489   H HB3  . SER C 1 84  ? 2.311   7.944   -7.430  1.00 0.00 ? 84  SER C HB3  1  
ATOM   4490   H HG   . SER C 1 84  ? 3.692   5.473   -7.721  1.00 0.00 ? 84  SER C HG   1  
ATOM   4491   N N    . MET C 1 85  ? 0.452   7.249   -4.858  1.00 0.00 ? 85  MET C N    1  
ATOM   4492   C CA   . MET C 1 85  ? -0.578  8.036   -4.178  1.00 0.00 ? 85  MET C CA   1  
ATOM   4493   C C    . MET C 1 85  ? -0.220  8.260   -2.712  1.00 0.00 ? 85  MET C C    1  
ATOM   4494   O O    . MET C 1 85  ? -0.326  9.376   -2.196  1.00 0.00 ? 85  MET C O    1  
ATOM   4495   C CB   . MET C 1 85  ? -1.930  7.329   -4.288  1.00 0.00 ? 85  MET C CB   1  
ATOM   4496   C CG   . MET C 1 85  ? -3.031  8.249   -3.753  1.00 0.00 ? 85  MET C CG   1  
ATOM   4497   S SD   . MET C 1 85  ? -4.657  7.581   -4.193  1.00 0.00 ? 85  MET C SD   1  
ATOM   4498   C CE   . MET C 1 85  ? -4.738  6.269   -2.950  1.00 0.00 ? 85  MET C CE   1  
ATOM   4499   H H    . MET C 1 85  ? 0.214   6.386   -5.264  1.00 0.00 ? 85  MET C H    1  
ATOM   4500   H HA   . MET C 1 85  ? -0.656  8.993   -4.664  1.00 0.00 ? 85  MET C HA   1  
ATOM   4501   H HB2  . MET C 1 85  ? -2.129  7.090   -5.323  1.00 0.00 ? 85  MET C HB2  1  
ATOM   4502   H HB3  . MET C 1 85  ? -1.907  6.421   -3.706  1.00 0.00 ? 85  MET C HB3  1  
ATOM   4503   H HG2  . MET C 1 85  ? -2.950  8.317   -2.678  1.00 0.00 ? 85  MET C HG2  1  
ATOM   4504   H HG3  . MET C 1 85  ? -2.917  9.233   -4.184  1.00 0.00 ? 85  MET C HG3  1  
ATOM   4505   H HE1  . MET C 1 85  ? -3.915  5.588   -3.085  1.00 0.00 ? 85  MET C HE1  1  
ATOM   4506   H HE2  . MET C 1 85  ? -4.686  6.706   -1.963  1.00 0.00 ? 85  MET C HE2  1  
ATOM   4507   H HE3  . MET C 1 85  ? -5.669  5.730   -3.061  1.00 0.00 ? 85  MET C HE3  1  
ATOM   4508   N N    . LEU C 1 86  ? 0.205   7.195   -2.051  1.00 0.00 ? 86  LEU C N    1  
ATOM   4509   C CA   . LEU C 1 86  ? 0.576   7.272   -0.644  1.00 0.00 ? 86  LEU C CA   1  
ATOM   4510   C C    . LEU C 1 86  ? 1.754   8.222   -0.451  1.00 0.00 ? 86  LEU C C    1  
ATOM   4511   O O    . LEU C 1 86  ? 1.746   9.086   0.431   1.00 0.00 ? 86  LEU C O    1  
ATOM   4512   C CB   . LEU C 1 86  ? 0.955   5.875   -0.148  1.00 0.00 ? 86  LEU C CB   1  
ATOM   4513   C CG   . LEU C 1 86  ? 1.048   5.876   1.384   1.00 0.00 ? 86  LEU C CG   1  
ATOM   4514   C CD1  . LEU C 1 86  ? -0.362  5.894   2.009   1.00 0.00 ? 86  LEU C CD1  1  
ATOM   4515   C CD2  . LEU C 1 86  ? 1.816   4.628   1.853   1.00 0.00 ? 86  LEU C CD2  1  
ATOM   4516   H H    . LEU C 1 86  ? 0.273   6.334   -2.519  1.00 0.00 ? 86  LEU C H    1  
ATOM   4517   H HA   . LEU C 1 86  ? -0.264  7.636   -0.077  1.00 0.00 ? 86  LEU C HA   1  
ATOM   4518   H HB2  . LEU C 1 86  ? 0.207   5.166   -0.471  1.00 0.00 ? 86  LEU C HB2  1  
ATOM   4519   H HB3  . LEU C 1 86  ? 1.913   5.601   -0.566  1.00 0.00 ? 86  LEU C HB3  1  
ATOM   4520   H HG   . LEU C 1 86  ? 1.585   6.761   1.702   1.00 0.00 ? 86  LEU C HG   1  
ATOM   4521   H HD11 . LEU C 1 86  ? -1.108  5.988   1.231   1.00 0.00 ? 86  LEU C HD11 1  
ATOM   4522   H HD12 . LEU C 1 86  ? -0.530  4.980   2.562   1.00 0.00 ? 86  LEU C HD12 1  
ATOM   4523   H HD13 . LEU C 1 86  ? -0.443  6.737   2.681   1.00 0.00 ? 86  LEU C HD13 1  
ATOM   4524   H HD21 . LEU C 1 86  ? 2.665   4.456   1.205   1.00 0.00 ? 86  LEU C HD21 1  
ATOM   4525   H HD22 . LEU C 1 86  ? 2.164   4.780   2.864   1.00 0.00 ? 86  LEU C HD22 1  
ATOM   4526   H HD23 . LEU C 1 86  ? 1.164   3.767   1.824   1.00 0.00 ? 86  LEU C HD23 1  
ATOM   4527   N N    . ALA C 1 87  ? 2.769   8.053   -1.284  1.00 0.00 ? 87  ALA C N    1  
ATOM   4528   C CA   . ALA C 1 87  ? 3.959   8.895   -1.207  1.00 0.00 ? 87  ALA C CA   1  
ATOM   4529   C C    . ALA C 1 87  ? 3.583   10.360  -1.375  1.00 0.00 ? 87  ALA C C    1  
ATOM   4530   O O    . ALA C 1 87  ? 4.013   11.228  -0.611  1.00 0.00 ? 87  ALA C O    1  
ATOM   4531   C CB   . ALA C 1 87  ? 4.962   8.492   -2.304  1.00 0.00 ? 87  ALA C CB   1  
ATOM   4532   H H    . ALA C 1 87  ? 2.717   7.349   -1.967  1.00 0.00 ? 87  ALA C H    1  
ATOM   4533   H HA   . ALA C 1 87  ? 4.420   8.763   -0.242  1.00 0.00 ? 87  ALA C HA   1  
ATOM   4534   H HB1  . ALA C 1 87  ? 5.233   9.363   -2.893  1.00 0.00 ? 87  ALA C HB1  1  
ATOM   4535   H HB2  . ALA C 1 87  ? 5.851   8.084   -1.849  1.00 0.00 ? 87  ALA C HB2  1  
ATOM   4536   H HB3  . ALA C 1 87  ? 4.517   7.750   -2.950  1.00 0.00 ? 87  ALA C HB3  1  
ATOM   4537   N N    . ARG C 1 88  ? 2.781   10.628  -2.388  1.00 0.00 ? 88  ARG C N    1  
ATOM   4538   C CA   . ARG C 1 88  ? 2.358   11.990  -2.667  1.00 0.00 ? 88  ARG C CA   1  
ATOM   4539   C C    . ARG C 1 88  ? 1.610   12.589  -1.473  1.00 0.00 ? 88  ARG C C    1  
ATOM   4540   O O    . ARG C 1 88  ? 1.850   13.737  -1.097  1.00 0.00 ? 88  ARG C O    1  
ATOM   4541   C CB   . ARG C 1 88  ? 1.492   12.012  -3.933  1.00 0.00 ? 88  ARG C CB   1  
ATOM   4542   C CG   . ARG C 1 88  ? 1.307   13.459  -4.431  1.00 0.00 ? 88  ARG C CG   1  
ATOM   4543   C CD   . ARG C 1 88  ? -0.138  13.680  -4.883  1.00 0.00 ? 88  ARG C CD   1  
ATOM   4544   N NE   . ARG C 1 88  ? -0.644  14.939  -4.338  1.00 0.00 ? 88  ARG C NE   1  
ATOM   4545   C CZ   . ARG C 1 88  ? -0.699  15.152  -3.037  1.00 0.00 ? 88  ARG C CZ   1  
ATOM   4546   N NH1  . ARG C 1 88  ? -0.291  14.240  -2.222  1.00 0.00 ? 88  ARG C NH1  1  
ATOM   4547   N NH2  . ARG C 1 88  ? -1.162  16.265  -2.584  1.00 0.00 ? 88  ARG C NH2  1  
ATOM   4548   H H    . ARG C 1 88  ? 2.470   9.895   -2.963  1.00 0.00 ? 88  ARG C H    1  
ATOM   4549   H HA   . ARG C 1 88  ? 3.239   12.586  -2.846  1.00 0.00 ? 88  ARG C HA   1  
ATOM   4550   H HB2  . ARG C 1 88  ? 1.987   11.431  -4.703  1.00 0.00 ? 88  ARG C HB2  1  
ATOM   4551   H HB3  . ARG C 1 88  ? 0.530   11.571  -3.719  1.00 0.00 ? 88  ARG C HB3  1  
ATOM   4552   H HG2  . ARG C 1 88  ? 1.545   14.153  -3.636  1.00 0.00 ? 88  ARG C HG2  1  
ATOM   4553   H HG3  . ARG C 1 88  ? 1.970   13.640  -5.267  1.00 0.00 ? 88  ARG C HG3  1  
ATOM   4554   H HD2  . ARG C 1 88  ? -0.172  13.717  -5.964  1.00 0.00 ? 88  ARG C HD2  1  
ATOM   4555   H HD3  . ARG C 1 88  ? -0.757  12.863  -4.536  1.00 0.00 ? 88  ARG C HD3  1  
ATOM   4556   H HE   . ARG C 1 88  ? -0.950  15.640  -4.953  1.00 0.00 ? 88  ARG C HE   1  
ATOM   4557   H HH11 . ARG C 1 88  ? 0.069   13.379  -2.580  1.00 0.00 ? 88  ARG C HH11 1  
ATOM   4558   H HH12 . ARG C 1 88  ? -0.323  14.393  -1.238  1.00 0.00 ? 88  ARG C HH12 1  
ATOM   4559   H HH21 . ARG C 1 88  ? -1.479  16.968  -3.215  1.00 0.00 ? 88  ARG C HH21 1  
ATOM   4560   H HH22 . ARG C 1 88  ? -1.182  16.431  -1.598  1.00 0.00 ? 88  ARG C HH22 1  
ATOM   4561   N N    . GLU C 1 89  ? 0.703   11.821  -0.875  1.00 0.00 ? 89  GLU C N    1  
ATOM   4562   C CA   . GLU C 1 89  ? -0.049  12.321  0.283   1.00 0.00 ? 89  GLU C CA   1  
ATOM   4563   C C    . GLU C 1 89  ? 0.893   12.646  1.438   1.00 0.00 ? 89  GLU C C    1  
ATOM   4564   O O    . GLU C 1 89  ? 0.781   13.700  2.062   1.00 0.00 ? 89  GLU C O    1  
ATOM   4565   C CB   . GLU C 1 89  ? -1.074  11.283  0.750   1.00 0.00 ? 89  GLU C CB   1  
ATOM   4566   C CG   . GLU C 1 89  ? -1.976  11.889  1.839   1.00 0.00 ? 89  GLU C CG   1  
ATOM   4567   C CD   . GLU C 1 89  ? -3.068  10.890  2.223   1.00 0.00 ? 89  GLU C CD   1  
ATOM   4568   O OE1  . GLU C 1 89  ? -3.184  9.876   1.551   1.00 0.00 ? 89  GLU C OE1  1  
ATOM   4569   O OE2  . GLU C 1 89  ? -3.767  11.150  3.182   1.00 0.00 ? 89  GLU C OE2  1  
ATOM   4570   H H    . GLU C 1 89  ? 0.538   10.908  -1.205  1.00 0.00 ? 89  GLU C H    1  
ATOM   4571   H HA   . GLU C 1 89  ? -0.571  13.218  0.001   1.00 0.00 ? 89  GLU C HA   1  
ATOM   4572   H HB2  . GLU C 1 89  ? -1.687  10.978  -0.086  1.00 0.00 ? 89  GLU C HB2  1  
ATOM   4573   H HB3  . GLU C 1 89  ? -0.562  10.423  1.154   1.00 0.00 ? 89  GLU C HB3  1  
ATOM   4574   H HG2  . GLU C 1 89  ? -1.383  12.121  2.714   1.00 0.00 ? 89  GLU C HG2  1  
ATOM   4575   H HG3  . GLU C 1 89  ? -2.437  12.791  1.471   1.00 0.00 ? 89  GLU C HG3  1  
ATOM   4576   N N    . LEU C 1 90  ? 1.828   11.749  1.710   1.00 0.00 ? 90  LEU C N    1  
ATOM   4577   C CA   . LEU C 1 90  ? 2.781   11.967  2.792   1.00 0.00 ? 90  LEU C CA   1  
ATOM   4578   C C    . LEU C 1 90  ? 3.669   13.163  2.474   1.00 0.00 ? 90  LEU C C    1  
ATOM   4579   O O    . LEU C 1 90  ? 3.943   14.004  3.335   1.00 0.00 ? 90  LEU C O    1  
ATOM   4580   C CB   . LEU C 1 90  ? 3.618   10.713  2.984   1.00 0.00 ? 90  LEU C CB   1  
ATOM   4581   C CG   . LEU C 1 90  ? 2.725   9.606   3.561   1.00 0.00 ? 90  LEU C CG   1  
ATOM   4582   C CD1  . LEU C 1 90  ? 3.446   8.272   3.423   1.00 0.00 ? 90  LEU C CD1  1  
ATOM   4583   C CD2  . LEU C 1 90  ? 2.418   9.876   5.045   1.00 0.00 ? 90  LEU C CD2  1  
ATOM   4584   H H    . LEU C 1 90  ? 1.882   10.928  1.173   1.00 0.00 ? 90  LEU C H    1  
ATOM   4585   H HA   . LEU C 1 90  ? 2.238   12.172  3.703   1.00 0.00 ? 90  LEU C HA   1  
ATOM   4586   H HB2  . LEU C 1 90  ? 4.012   10.400  2.025   1.00 0.00 ? 90  LEU C HB2  1  
ATOM   4587   H HB3  . LEU C 1 90  ? 4.431   10.916  3.663   1.00 0.00 ? 90  LEU C HB3  1  
ATOM   4588   H HG   . LEU C 1 90  ? 1.797   9.569   3.003   1.00 0.00 ? 90  LEU C HG   1  
ATOM   4589   H HD11 . LEU C 1 90  ? 4.461   8.380   3.768   1.00 0.00 ? 90  LEU C HD11 1  
ATOM   4590   H HD12 . LEU C 1 90  ? 2.939   7.523   4.010   1.00 0.00 ? 90  LEU C HD12 1  
ATOM   4591   H HD13 . LEU C 1 90  ? 3.448   7.973   2.381   1.00 0.00 ? 90  LEU C HD13 1  
ATOM   4592   H HD21 . LEU C 1 90  ? 3.251   10.385  5.507   1.00 0.00 ? 90  LEU C HD21 1  
ATOM   4593   H HD22 . LEU C 1 90  ? 1.533   10.492  5.125   1.00 0.00 ? 90  LEU C HD22 1  
ATOM   4594   H HD23 . LEU C 1 90  ? 2.245   8.937   5.555   1.00 0.00 ? 90  LEU C HD23 1  
ATOM   4595   N N    . ILE C 1 91  ? 4.100   13.246  1.223   1.00 0.00 ? 91  ILE C N    1  
ATOM   4596   C CA   . ILE C 1 91  ? 4.933   14.363  0.797   1.00 0.00 ? 91  ILE C CA   1  
ATOM   4597   C C    . ILE C 1 91  ? 4.173   15.668  1.008   1.00 0.00 ? 91  ILE C C    1  
ATOM   4598   O O    . ILE C 1 91  ? 4.741   16.663  1.458   1.00 0.00 ? 91  ILE C O    1  
ATOM   4599   C CB   . ILE C 1 91  ? 5.362   14.176  -0.668  1.00 0.00 ? 91  ILE C CB   1  
ATOM   4600   C CG1  . ILE C 1 91  ? 6.409   13.052  -0.711  1.00 0.00 ? 91  ILE C CG1  1  
ATOM   4601   C CG2  . ILE C 1 91  ? 5.970   15.481  -1.219  1.00 0.00 ? 91  ILE C CG2  1  
ATOM   4602   C CD1  . ILE C 1 91  ? 6.643   12.601  -2.153  1.00 0.00 ? 91  ILE C CD1  1  
ATOM   4603   H H    . ILE C 1 91  ? 3.840   12.556  0.576   1.00 0.00 ? 91  ILE C H    1  
ATOM   4604   H HA   . ILE C 1 91  ? 5.817   14.388  1.415   1.00 0.00 ? 91  ILE C HA   1  
ATOM   4605   H HB   . ILE C 1 91  ? 4.504   13.898  -1.265  1.00 0.00 ? 91  ILE C HB   1  
ATOM   4606   H HG12 . ILE C 1 91  ? 7.337   13.410  -0.292  1.00 0.00 ? 91  ILE C HG12 1  
ATOM   4607   H HG13 . ILE C 1 91  ? 6.056   12.213  -0.129  1.00 0.00 ? 91  ILE C HG13 1  
ATOM   4608   H HG21 . ILE C 1 91  ? 6.417   16.045  -0.412  1.00 0.00 ? 91  ILE C HG21 1  
ATOM   4609   H HG22 . ILE C 1 91  ? 6.727   15.245  -1.954  1.00 0.00 ? 91  ILE C HG22 1  
ATOM   4610   H HG23 . ILE C 1 91  ? 5.194   16.074  -1.681  1.00 0.00 ? 91  ILE C HG23 1  
ATOM   4611   H HD11 . ILE C 1 91  ? 6.605   13.456  -2.809  1.00 0.00 ? 91  ILE C HD11 1  
ATOM   4612   H HD12 . ILE C 1 91  ? 7.616   12.133  -2.224  1.00 0.00 ? 91  ILE C HD12 1  
ATOM   4613   H HD13 . ILE C 1 91  ? 5.882   11.890  -2.437  1.00 0.00 ? 91  ILE C HD13 1  
ATOM   4614   N N    . THR C 1 92  ? 2.871   15.648  0.732   1.00 0.00 ? 92  THR C N    1  
ATOM   4615   C CA   . THR C 1 92  ? 2.048   16.837  0.952   1.00 0.00 ? 92  THR C CA   1  
ATOM   4616   C C    . THR C 1 92  ? 2.133   17.244  2.423   1.00 0.00 ? 92  THR C C    1  
ATOM   4617   O O    . THR C 1 92  ? 2.332   18.416  2.744   1.00 0.00 ? 92  THR C O    1  
ATOM   4618   C CB   . THR C 1 92  ? 0.588   16.559  0.567   1.00 0.00 ? 92  THR C CB   1  
ATOM   4619   O OG1  . THR C 1 92  ? 0.490   16.406  -0.839  1.00 0.00 ? 92  THR C OG1  1  
ATOM   4620   C CG2  . THR C 1 92  ? -0.311  17.715  1.013   1.00 0.00 ? 92  THR C CG2  1  
ATOM   4621   H H    . THR C 1 92  ? 2.455   14.820  0.408   1.00 0.00 ? 92  THR C H    1  
ATOM   4622   H HA   . THR C 1 92  ? 2.429   17.644  0.349   1.00 0.00 ? 92  THR C HA   1  
ATOM   4623   H HB   . THR C 1 92  ? 0.261   15.649  1.048   1.00 0.00 ? 92  THR C HB   1  
ATOM   4624   H HG1  . THR C 1 92  ? 0.565   15.471  -1.037  1.00 0.00 ? 92  THR C HG1  1  
ATOM   4625   H HG21 . THR C 1 92  ? 0.253   18.636  1.025   1.00 0.00 ? 92  THR C HG21 1  
ATOM   4626   H HG22 . THR C 1 92  ? -1.140  17.812  0.328   1.00 0.00 ? 92  THR C HG22 1  
ATOM   4627   H HG23 . THR C 1 92  ? -0.688  17.515  2.006   1.00 0.00 ? 92  THR C HG23 1  
ATOM   4628   N N    . GLU C 1 93  ? 2.016   16.264  3.311   1.00 0.00 ? 93  GLU C N    1  
ATOM   4629   C CA   . GLU C 1 93  ? 2.112   16.531  4.743   1.00 0.00 ? 93  GLU C CA   1  
ATOM   4630   C C    . GLU C 1 93  ? 3.487   17.107  5.075   1.00 0.00 ? 93  GLU C C    1  
ATOM   4631   O O    . GLU C 1 93  ? 3.613   18.063  5.848   1.00 0.00 ? 93  GLU C O    1  
ATOM   4632   C CB   . GLU C 1 93  ? 1.903   15.237  5.531   1.00 0.00 ? 93  GLU C CB   1  
ATOM   4633   C CG   . GLU C 1 93  ? 0.519   14.664  5.220   1.00 0.00 ? 93  GLU C CG   1  
ATOM   4634   C CD   . GLU C 1 93  ? -0.572  15.496  5.895   1.00 0.00 ? 93  GLU C CD   1  
ATOM   4635   O OE1  . GLU C 1 93  ? -0.240  16.446  6.593   1.00 0.00 ? 93  GLU C OE1  1  
ATOM   4636   O OE2  . GLU C 1 93  ? -1.724  15.178  5.711   1.00 0.00 ? 93  GLU C OE2  1  
ATOM   4637   H H    . GLU C 1 93  ? 1.881   15.343  3.002   1.00 0.00 ? 93  GLU C H    1  
ATOM   4638   H HA   . GLU C 1 93  ? 1.350   17.246  5.022   1.00 0.00 ? 93  GLU C HA   1  
ATOM   4639   H HB2  . GLU C 1 93  ? 2.663   14.521  5.256   1.00 0.00 ? 93  GLU C HB2  1  
ATOM   4640   H HB3  . GLU C 1 93  ? 1.973   15.448  6.590   1.00 0.00 ? 93  GLU C HB3  1  
ATOM   4641   H HG2  . GLU C 1 93  ? 0.359   14.671  4.151   1.00 0.00 ? 93  GLU C HG2  1  
ATOM   4642   H HG3  . GLU C 1 93  ? 0.461   13.648  5.579   1.00 0.00 ? 93  GLU C HG3  1  
ATOM   4643   N N    . LEU C 1 94  ? 4.519   16.516  4.480   1.00 0.00 ? 94  LEU C N    1  
ATOM   4644   C CA   . LEU C 1 94  ? 5.889   16.976  4.706   1.00 0.00 ? 94  LEU C CA   1  
ATOM   4645   C C    . LEU C 1 94  ? 6.029   18.436  4.269   1.00 0.00 ? 94  LEU C C    1  
ATOM   4646   O O    . LEU C 1 94  ? 6.644   19.253  4.960   1.00 0.00 ? 94  LEU C O    1  
ATOM   4647   C CB   . LEU C 1 94  ? 6.883   16.097  3.926   1.00 0.00 ? 94  LEU C CB   1  
ATOM   4648   C CG   . LEU C 1 94  ? 7.055   14.733  4.626   1.00 0.00 ? 94  LEU C CG   1  
ATOM   4649   C CD1  . LEU C 1 94  ? 7.579   13.692  3.624   1.00 0.00 ? 94  LEU C CD1  1  
ATOM   4650   C CD2  . LEU C 1 94  ? 8.053   14.853  5.786   1.00 0.00 ? 94  LEU C CD2  1  
ATOM   4651   H H    . LEU C 1 94  ? 4.356   15.764  3.870   1.00 0.00 ? 94  LEU C H    1  
ATOM   4652   H HA   . LEU C 1 94  ? 6.108   16.910  5.758   1.00 0.00 ? 94  LEU C HA   1  
ATOM   4653   H HB2  . LEU C 1 94  ? 6.508   15.943  2.926   1.00 0.00 ? 94  LEU C HB2  1  
ATOM   4654   H HB3  . LEU C 1 94  ? 7.838   16.600  3.875   1.00 0.00 ? 94  LEU C HB3  1  
ATOM   4655   H HG   . LEU C 1 94  ? 6.098   14.405  5.010   1.00 0.00 ? 94  LEU C HG   1  
ATOM   4656   H HD11 . LEU C 1 94  ? 8.193   14.179  2.878   1.00 0.00 ? 94  LEU C HD11 1  
ATOM   4657   H HD12 . LEU C 1 94  ? 8.172   12.952  4.146   1.00 0.00 ? 94  LEU C HD12 1  
ATOM   4658   H HD13 . LEU C 1 94  ? 6.746   13.205  3.140   1.00 0.00 ? 94  LEU C HD13 1  
ATOM   4659   H HD21 . LEU C 1 94  ? 8.960   15.325  5.436   1.00 0.00 ? 94  LEU C HD21 1  
ATOM   4660   H HD22 . LEU C 1 94  ? 7.622   15.445  6.579   1.00 0.00 ? 94  LEU C HD22 1  
ATOM   4661   H HD23 . LEU C 1 94  ? 8.288   13.867  6.162   1.00 0.00 ? 94  LEU C HD23 1  
ATOM   4662   N N    . ILE C 1 95  ? 5.449   18.769  3.122   1.00 0.00 ? 95  ILE C N    1  
ATOM   4663   C CA   . ILE C 1 95  ? 5.507   20.141  2.623   1.00 0.00 ? 95  ILE C CA   1  
ATOM   4664   C C    . ILE C 1 95  ? 4.802   21.086  3.595   1.00 0.00 ? 95  ILE C C    1  
ATOM   4665   O O    . ILE C 1 95  ? 5.309   22.165  3.898   1.00 0.00 ? 95  ILE C O    1  
ATOM   4666   C CB   . ILE C 1 95  ? 4.869   20.230  1.233   1.00 0.00 ? 95  ILE C CB   1  
ATOM   4667   C CG1  . ILE C 1 95  ? 5.782   19.516  0.236   1.00 0.00 ? 95  ILE C CG1  1  
ATOM   4668   C CG2  . ILE C 1 95  ? 4.723   21.700  0.822   1.00 0.00 ? 95  ILE C CG2  1  
ATOM   4669   C CD1  . ILE C 1 95  ? 5.079   19.360  -1.116  1.00 0.00 ? 95  ILE C CD1  1  
ATOM   4670   H H    . ILE C 1 95  ? 4.968   18.083  2.609   1.00 0.00 ? 95  ILE C H    1  
ATOM   4671   H HA   . ILE C 1 95  ? 6.540   20.440  2.549   1.00 0.00 ? 95  ILE C HA   1  
ATOM   4672   H HB   . ILE C 1 95  ? 3.896   19.757  1.245   1.00 0.00 ? 95  ILE C HB   1  
ATOM   4673   H HG12 . ILE C 1 95  ? 6.684   20.094  0.107   1.00 0.00 ? 95  ILE C HG12 1  
ATOM   4674   H HG13 . ILE C 1 95  ? 6.034   18.541  0.621   1.00 0.00 ? 95  ILE C HG13 1  
ATOM   4675   H HG21 . ILE C 1 95  ? 5.646   22.224  1.025   1.00 0.00 ? 95  ILE C HG21 1  
ATOM   4676   H HG22 . ILE C 1 95  ? 4.503   21.757  -0.235  1.00 0.00 ? 95  ILE C HG22 1  
ATOM   4677   H HG23 . ILE C 1 95  ? 3.921   22.157  1.381   1.00 0.00 ? 95  ILE C HG23 1  
ATOM   4678   H HD11 . ILE C 1 95  ? 4.451   20.219  -1.302  1.00 0.00 ? 95  ILE C HD11 1  
ATOM   4679   H HD12 . ILE C 1 95  ? 5.823   19.284  -1.895  1.00 0.00 ? 95  ILE C HD12 1  
ATOM   4680   H HD13 . ILE C 1 95  ? 4.474   18.466  -1.107  1.00 0.00 ? 95  ILE C HD13 1  
ATOM   4681   N N    . GLU C 1 96  ? 3.647   20.667  4.104   1.00 0.00 ? 96  GLU C N    1  
ATOM   4682   C CA   . GLU C 1 96  ? 2.916   21.493  5.062   1.00 0.00 ? 96  GLU C CA   1  
ATOM   4683   C C    . GLU C 1 96  ? 3.797   21.756  6.283   1.00 0.00 ? 96  GLU C C    1  
ATOM   4684   O O    . GLU C 1 96  ? 3.817   22.860  6.829   1.00 0.00 ? 96  GLU C O    1  
ATOM   4685   C CB   . GLU C 1 96  ? 1.620   20.791  5.484   1.00 0.00 ? 96  GLU C CB   1  
ATOM   4686   C CG   . GLU C 1 96  ? 0.863   21.642  6.538   1.00 0.00 ? 96  GLU C CG   1  
ATOM   4687   C CD   . GLU C 1 96  ? -0.574  21.925  6.099   1.00 0.00 ? 96  GLU C CD   1  
ATOM   4688   O OE1  . GLU C 1 96  ? -1.125  21.128  5.360   1.00 0.00 ? 96  GLU C OE1  1  
ATOM   4689   O OE2  . GLU C 1 96  ? -1.120  22.917  6.548   1.00 0.00 ? 96  GLU C OE2  1  
ATOM   4690   H H    . GLU C 1 96  ? 3.292   19.789  3.846   1.00 0.00 ? 96  GLU C H    1  
ATOM   4691   H HA   . GLU C 1 96  ? 2.673   22.436  4.598   1.00 0.00 ? 96  GLU C HA   1  
ATOM   4692   H HB2  . GLU C 1 96  ? 0.998   20.653  4.610   1.00 0.00 ? 96  GLU C HB2  1  
ATOM   4693   H HB3  . GLU C 1 96  ? 1.860   19.825  5.904   1.00 0.00 ? 96  GLU C HB3  1  
ATOM   4694   H HG2  . GLU C 1 96  ? 0.840   21.108  7.475   1.00 0.00 ? 96  GLU C HG2  1  
ATOM   4695   H HG3  . GLU C 1 96  ? 1.376   22.582  6.678   1.00 0.00 ? 96  GLU C HG3  1  
ATOM   4696   N N    . LEU C 1 97  ? 4.553   20.740  6.699   1.00 0.00 ? 97  LEU C N    1  
ATOM   4697   C CA   . LEU C 1 97  ? 5.450   20.895  7.843   1.00 0.00 ? 97  LEU C CA   1  
ATOM   4698   C C    . LEU C 1 97  ? 6.511   21.950  7.532   1.00 0.00 ? 97  LEU C C    1  
ATOM   4699   O O    . LEU C 1 97  ? 6.827   22.791  8.375   1.00 0.00 ? 97  LEU C O    1  
ATOM   4700   C CB   . LEU C 1 97  ? 6.120   19.561  8.190   1.00 0.00 ? 97  LEU C CB   1  
ATOM   4701   C CG   . LEU C 1 97  ? 5.151   18.662  8.973   1.00 0.00 ? 97  LEU C CG   1  
ATOM   4702   C CD1  . LEU C 1 97  ? 5.714   17.242  9.010   1.00 0.00 ? 97  LEU C CD1  1  
ATOM   4703   C CD2  . LEU C 1 97  ? 4.987   19.169  10.414  1.00 0.00 ? 97  LEU C CD2  1  
ATOM   4704   H H    . LEU C 1 97  ? 4.515   19.883  6.222   1.00 0.00 ? 97  LEU C H    1  
ATOM   4705   H HA   . LEU C 1 97  ? 4.874   21.231  8.693   1.00 0.00 ? 97  LEU C HA   1  
ATOM   4706   H HB2  . LEU C 1 97  ? 6.410   19.061  7.277   1.00 0.00 ? 97  LEU C HB2  1  
ATOM   4707   H HB3  . LEU C 1 97  ? 7.001   19.745  8.789   1.00 0.00 ? 97  LEU C HB3  1  
ATOM   4708   H HG   . LEU C 1 97  ? 4.190   18.654  8.479   1.00 0.00 ? 97  LEU C HG   1  
ATOM   4709   H HD11 . LEU C 1 97  ? 6.741   17.270  9.346   1.00 0.00 ? 97  LEU C HD11 1  
ATOM   4710   H HD12 . LEU C 1 97  ? 5.129   16.640  9.691   1.00 0.00 ? 97  LEU C HD12 1  
ATOM   4711   H HD13 . LEU C 1 97  ? 5.670   16.814  8.021   1.00 0.00 ? 97  LEU C HD13 1  
ATOM   4712   H HD21 . LEU C 1 97  ? 5.936   19.529  10.784  1.00 0.00 ? 97  LEU C HD21 1  
ATOM   4713   H HD22 . LEU C 1 97  ? 4.265   19.970  10.439  1.00 0.00 ? 97  LEU C HD22 1  
ATOM   4714   H HD23 . LEU C 1 97  ? 4.644   18.358  11.043  1.00 0.00 ? 97  LEU C HD23 1  
ATOM   4715   N N    . HIS C 1 98  ? 7.042   21.922  6.311   1.00 0.00 ? 98  HIS C N    1  
ATOM   4716   C CA   . HIS C 1 98  ? 8.039   22.912  5.918   1.00 0.00 ? 98  HIS C CA   1  
ATOM   4717   C C    . HIS C 1 98  ? 7.449   24.308  6.075   1.00 0.00 ? 98  HIS C C    1  
ATOM   4718   O O    . HIS C 1 98  ? 8.122   25.231  6.527   1.00 0.00 ? 98  HIS C O    1  
ATOM   4719   C CB   . HIS C 1 98  ? 8.477   22.692  4.466   1.00 0.00 ? 98  HIS C CB   1  
ATOM   4720   C CG   . HIS C 1 98  ? 9.333   21.460  4.382   1.00 0.00 ? 98  HIS C CG   1  
ATOM   4721   N ND1  . HIS C 1 98  ? 8.792   20.197  4.221   1.00 0.00 ? 98  HIS C ND1  1  
ATOM   4722   C CD2  . HIS C 1 98  ? 10.691  21.280  4.449   1.00 0.00 ? 98  HIS C CD2  1  
ATOM   4723   C CE1  . HIS C 1 98  ? 9.810   19.317  4.197   1.00 0.00 ? 98  HIS C CE1  1  
ATOM   4724   N NE2  . HIS C 1 98  ? 10.989  19.922  4.331   1.00 0.00 ? 98  HIS C NE2  1  
ATOM   4725   H H    . HIS C 1 98  ? 6.744   21.246  5.666   1.00 0.00 ? 98  HIS C H    1  
ATOM   4726   H HA   . HIS C 1 98  ? 8.899   22.824  6.565   1.00 0.00 ? 98  HIS C HA   1  
ATOM   4727   H HB2  . HIS C 1 98  ? 7.605   22.571  3.840   1.00 0.00 ? 98  HIS C HB2  1  
ATOM   4728   H HB3  . HIS C 1 98  ? 9.046   23.548  4.130   1.00 0.00 ? 98  HIS C HB3  1  
ATOM   4729   H HD1  . HIS C 1 98  ? 7.831   19.978  4.149   1.00 0.00 ? 98  HIS C HD1  1  
ATOM   4730   H HD2  . HIS C 1 98  ? 11.415  22.071  4.573   1.00 0.00 ? 98  HIS C HD2  1  
ATOM   4731   H HE1  . HIS C 1 98  ? 9.684   18.247  4.091   1.00 0.00 ? 98  HIS C HE1  1  
ATOM   4732   H HE2  . HIS C 1 98  ? 11.870  19.501  4.349   1.00 0.00 ? 98  HIS C HE2  1  
ATOM   4733   N N    . GLU C 1 99  ? 6.173   24.442  5.725   1.00 0.00 ? 99  GLU C N    1  
ATOM   4734   C CA   . GLU C 1 99  ? 5.491   25.723  5.854   1.00 0.00 ? 99  GLU C CA   1  
ATOM   4735   C C    . GLU C 1 99  ? 5.393   26.121  7.325   1.00 0.00 ? 99  GLU C C    1  
ATOM   4736   O O    . GLU C 1 99  ? 5.614   27.276  7.685   1.00 0.00 ? 99  GLU C O    1  
ATOM   4737   C CB   . GLU C 1 99  ? 4.097   25.644  5.228   1.00 0.00 ? 99  GLU C CB   1  
ATOM   4738   C CG   . GLU C 1 99  ? 3.442   27.031  5.260   1.00 0.00 ? 99  GLU C CG   1  
ATOM   4739   C CD   . GLU C 1 99  ? 2.087   26.995  4.560   1.00 0.00 ? 99  GLU C CD   1  
ATOM   4740   O OE1  . GLU C 1 99  ? 1.608   25.908  4.285   1.00 0.00 ? 99  GLU C OE1  1  
ATOM   4741   O OE2  . GLU C 1 99  ? 1.549   28.057  4.305   1.00 0.00 ? 99  GLU C OE2  1  
ATOM   4742   H H    . GLU C 1 99  ? 5.679   23.662  5.392   1.00 0.00 ? 99  GLU C H    1  
ATOM   4743   H HA   . GLU C 1 99  ? 6.061   26.477  5.334   1.00 0.00 ? 99  GLU C HA   1  
ATOM   4744   H HB2  . GLU C 1 99  ? 4.180   25.310  4.204   1.00 0.00 ? 99  GLU C HB2  1  
ATOM   4745   H HB3  . GLU C 1 99  ? 3.484   24.949  5.783   1.00 0.00 ? 99  GLU C HB3  1  
ATOM   4746   H HG2  . GLU C 1 99  ? 3.307   27.341  6.285   1.00 0.00 ? 99  GLU C HG2  1  
ATOM   4747   H HG3  . GLU C 1 99  ? 4.083   27.740  4.756   1.00 0.00 ? 99  GLU C HG3  1  
ATOM   4748   N N    . LYS C 1 100 ? 5.082   25.154  8.185   1.00 0.00 ? 100 LYS C N    1  
ATOM   4749   C CA   . LYS C 1 100 ? 4.989   25.441  9.614   1.00 0.00 ? 100 LYS C CA   1  
ATOM   4750   C C    . LYS C 1 100 ? 6.374   25.796  10.162  1.00 0.00 ? 100 LYS C C    1  
ATOM   4751   O O    . LYS C 1 100 ? 6.499   26.662  11.026  1.00 0.00 ? 100 LYS C O    1  
ATOM   4752   C CB   . LYS C 1 100 ? 4.389   24.249  10.364  1.00 0.00 ? 100 LYS C CB   1  
ATOM   4753   C CG   . LYS C 1 100 ? 2.908   24.120  9.983   1.00 0.00 ? 100 LYS C CG   1  
ATOM   4754   C CD   . LYS C 1 100 ? 2.254   23.003  10.800  1.00 0.00 ? 100 LYS C CD   1  
ATOM   4755   C CE   . LYS C 1 100 ? 0.775   22.901  10.421  1.00 0.00 ? 100 LYS C CE   1  
ATOM   4756   N NZ   . LYS C 1 100 ? 0.126   21.852  11.262  1.00 0.00 ? 100 LYS C NZ   1  
ATOM   4757   H H    . LYS C 1 100 ? 4.929   24.242  7.856   1.00 0.00 ? 100 LYS C H    1  
ATOM   4758   H HA   . LYS C 1 100 ? 4.345   26.296  9.751   1.00 0.00 ? 100 LYS C HA   1  
ATOM   4759   H HB2  . LYS C 1 100 ? 4.917   23.344  10.095  1.00 0.00 ? 100 LYS C HB2  1  
ATOM   4760   H HB3  . LYS C 1 100 ? 4.472   24.417  11.428  1.00 0.00 ? 100 LYS C HB3  1  
ATOM   4761   H HG2  . LYS C 1 100 ? 2.406   25.057  10.181  1.00 0.00 ? 100 LYS C HG2  1  
ATOM   4762   H HG3  . LYS C 1 100 ? 2.831   23.888  8.928   1.00 0.00 ? 100 LYS C HG3  1  
ATOM   4763   H HD2  . LYS C 1 100 ? 2.752   22.067  10.589  1.00 0.00 ? 100 LYS C HD2  1  
ATOM   4764   H HD3  . LYS C 1 100 ? 2.344   23.230  11.853  1.00 0.00 ? 100 LYS C HD3  1  
ATOM   4765   H HE2  . LYS C 1 100 ? 0.291   23.854  10.591  1.00 0.00 ? 100 LYS C HE2  1  
ATOM   4766   H HE3  . LYS C 1 100 ? 0.689   22.634  9.374   1.00 0.00 ? 100 LYS C HE3  1  
ATOM   4767   H HZ1  . LYS C 1 100 ? 0.423   21.967  12.255  1.00 0.00 ? 100 LYS C HZ1  1  
ATOM   4768   H HZ2  . LYS C 1 100 ? -0.908  21.955  11.200  1.00 0.00 ? 100 LYS C HZ2  1  
ATOM   4769   H HZ3  . LYS C 1 100 ? 0.406   20.914  10.920  1.00 0.00 ? 100 LYS C HZ3  1  
ATOM   4770   N N    . LEU C 1 101 ? 7.417   25.158  9.623   1.00 0.00 ? 101 LEU C N    1  
ATOM   4771   C CA   . LEU C 1 101 ? 8.789   25.461  10.050  1.00 0.00 ? 101 LEU C CA   1  
ATOM   4772   C C    . LEU C 1 101 ? 9.129   26.911  9.704   1.00 0.00 ? 101 LEU C C    1  
ATOM   4773   O O    . LEU C 1 101 ? 10.253  27.365  9.930   1.00 0.00 ? 101 LEU C O    1  
ATOM   4774   C CB   . LEU C 1 101 ? 9.795   24.530  9.351   1.00 0.00 ? 101 LEU C CB   1  
ATOM   4775   C CG   . LEU C 1 101 ? 9.912   23.195  10.098  1.00 0.00 ? 101 LEU C CG   1  
ATOM   4776   C CD1  . LEU C 1 101 ? 10.561  22.156  9.178   1.00 0.00 ? 101 LEU C CD1  1  
ATOM   4777   C CD2  . LEU C 1 101 ? 10.787  23.360  11.350  1.00 0.00 ? 101 LEU C CD2  1  
ATOM   4778   H H    . LEU C 1 101 ? 7.266   24.497  8.915   1.00 0.00 ? 101 LEU C H    1  
ATOM   4779   H HA   . LEU C 1 101 ? 8.867   25.333  11.119  1.00 0.00 ? 101 LEU C HA   1  
ATOM   4780   H HB2  . LEU C 1 101 ? 9.459   24.347  8.340   1.00 0.00 ? 101 LEU C HB2  1  
ATOM   4781   H HB3  . LEU C 1 101 ? 10.762  25.010  9.321   1.00 0.00 ? 101 LEU C HB3  1  
ATOM   4782   H HG   . LEU C 1 101 ? 8.927   22.856  10.384  1.00 0.00 ? 101 LEU C HG   1  
ATOM   4783   H HD11 . LEU C 1 101 ? 11.347  22.621  8.603   1.00 0.00 ? 101 LEU C HD11 1  
ATOM   4784   H HD12 . LEU C 1 101 ? 10.978  21.358  9.775   1.00 0.00 ? 101 LEU C HD12 1  
ATOM   4785   H HD13 . LEU C 1 101 ? 9.817   21.750  8.509   1.00 0.00 ? 101 LEU C HD13 1  
ATOM   4786   H HD21 . LEU C 1 101 ? 11.653  23.959  11.112  1.00 0.00 ? 101 LEU C HD21 1  
ATOM   4787   H HD22 . LEU C 1 101 ? 10.218  23.845  12.130  1.00 0.00 ? 101 LEU C HD22 1  
ATOM   4788   H HD23 . LEU C 1 101 ? 11.108  22.387  11.691  1.00 0.00 ? 101 LEU C HD23 1  
ATOM   4789   N N    . LYS C 1 102 ? 8.153   27.627  9.144   1.00 0.00 ? 102 LYS C N    1  
ATOM   4790   C CA   . LYS C 1 102 ? 8.338   29.026  8.753   1.00 0.00 ? 102 LYS C CA   1  
ATOM   4791   C C    . LYS C 1 102 ? 9.021   29.110  7.395   1.00 0.00 ? 102 LYS C C    1  
ATOM   4792   O O    . LYS C 1 102 ? 8.461   29.679  6.475   1.00 0.00 ? 102 LYS C O    1  
ATOM   4793   C CB   . LYS C 1 102 ? 9.188   29.768  9.808   1.00 0.00 ? 102 LYS C CB   1  
ATOM   4794   C CG   . LYS C 1 102 ? 8.960   31.310  9.832   1.00 0.00 ? 102 LYS C CG   1  
ATOM   4795   C CD   . LYS C 1 102 ? 8.653   31.937  8.445   1.00 0.00 ? 102 LYS C CD   1  
ATOM   4796   C CE   . LYS C 1 102 ? 9.908   32.035  7.546   1.00 0.00 ? 102 LYS C CE   1  
ATOM   4797   N NZ   . LYS C 1 102 ? 10.988  31.137  8.040   1.00 0.00 ? 102 LYS C NZ   1  
ATOM   4798   H H    . LYS C 1 102 ? 7.286   27.200  8.979   1.00 0.00 ? 102 LYS C H    1  
ATOM   4799   H HA   . LYS C 1 102 ? 7.367   29.493  8.688   1.00 0.00 ? 102 LYS C HA   1  
ATOM   4800   H HB2  . LYS C 1 102 ? 8.932   29.374  10.786  1.00 0.00 ? 102 LYS C HB2  1  
ATOM   4801   H HB3  . LYS C 1 102 ? 10.232  29.567  9.626   1.00 0.00 ? 102 LYS C HB3  1  
ATOM   4802   H HG2  . LYS C 1 102 ? 8.130   31.523  10.490  1.00 0.00 ? 102 LYS C HG2  1  
ATOM   4803   H HG3  . LYS C 1 102 ? 9.843   31.780  10.238  1.00 0.00 ? 102 LYS C HG3  1  
ATOM   4804   H HD2  . LYS C 1 102 ? 7.890   31.362  7.938   1.00 0.00 ? 102 LYS C HD2  1  
ATOM   4805   H HD3  . LYS C 1 102 ? 8.276   32.940  8.607   1.00 0.00 ? 102 LYS C HD3  1  
ATOM   4806   H HE2  . LYS C 1 102 ? 9.646   31.754  6.533   1.00 0.00 ? 102 LYS C HE2  1  
ATOM   4807   H HE3  . LYS C 1 102 ? 10.265  33.059  7.544   1.00 0.00 ? 102 LYS C HE3  1  
ATOM   4808   H HZ1  . LYS C 1 102 ? 10.619  30.171  8.110   1.00 0.00 ? 102 LYS C HZ1  1  
ATOM   4809   H HZ2  . LYS C 1 102 ? 11.782  31.152  7.368   1.00 0.00 ? 102 LYS C HZ2  1  
ATOM   4810   H HZ3  . LYS C 1 102 ? 11.314  31.457  8.970   1.00 0.00 ? 102 LYS C HZ3  1  
ATOM   4811   N N    . ALA C 1 103 ? 10.244  28.567  7.319   1.00 0.00 ? 103 ALA C N    1  
ATOM   4812   C CA   . ALA C 1 103 ? 11.048  28.592  6.090   1.00 0.00 ? 103 ALA C CA   1  
ATOM   4813   C C    . ALA C 1 103 ? 10.184  28.477  4.833   1.00 0.00 ? 103 ALA C C    1  
ATOM   4814   O O    . ALA C 1 103 ? 10.110  27.389  4.286   1.00 0.00 ? 103 ALA C O    1  
ATOM   4815   C CB   . ALA C 1 103 ? 12.064  27.446  6.112   1.00 0.00 ? 103 ALA C CB   1  
ATOM   4816   O OXT  . ALA C 1 103 ? 9.637   29.486  4.417   1.00 0.00 ? 103 ALA C OXT  1  
ATOM   4817   H H    . ALA C 1 103 ? 10.621  28.148  8.122   1.00 0.00 ? 103 ALA C H    1  
ATOM   4818   H HA   . ALA C 1 103 ? 11.587  29.524  6.046   1.00 0.00 ? 103 ALA C HA   1  
ATOM   4819   H HB1  . ALA C 1 103 ? 11.572  26.536  6.423   1.00 0.00 ? 103 ALA C HB1  1  
ATOM   4820   H HB2  . ALA C 1 103 ? 12.468  27.309  5.117   1.00 0.00 ? 103 ALA C HB2  1  
ATOM   4821   H HB3  . ALA C 1 103 ? 12.863  27.677  6.796   1.00 0.00 ? 103 ALA C HB3  1  
ATOM   4822   N N    . LYS D 2 1   ? -30.941 5.232   -20.393 1.00 0.00 ? 3   LYS D N    1  
ATOM   4823   C CA   . LYS D 2 1   ? -30.127 4.263   -19.594 1.00 0.00 ? 3   LYS D CA   1  
ATOM   4824   C C    . LYS D 2 1   ? -29.826 4.791   -18.199 1.00 0.00 ? 3   LYS D C    1  
ATOM   4825   O O    . LYS D 2 1   ? -29.204 5.842   -18.037 1.00 0.00 ? 3   LYS D O    1  
ATOM   4826   C CB   . LYS D 2 1   ? -28.806 3.910   -20.291 1.00 0.00 ? 3   LYS D CB   1  
ATOM   4827   C CG   . LYS D 2 1   ? -28.937 2.801   -21.323 1.00 0.00 ? 3   LYS D CG   1  
ATOM   4828   C CD   . LYS D 2 1   ? -27.580 2.275   -21.776 1.00 0.00 ? 3   LYS D CD   1  
ATOM   4829   C CE   . LYS D 2 1   ? -27.741 1.257   -22.896 1.00 0.00 ? 3   LYS D CE   1  
ATOM   4830   N NZ   . LYS D 2 1   ? -26.515 0.414   -23.117 1.00 0.00 ? 3   LYS D NZ   1  
ATOM   4831   H H1   . LYS D 2 1   ? -31.330 5.962   -19.763 1.00 0.00 ? 3   LYS D H1   1  
ATOM   4832   H H2   . LYS D 2 1   ? -30.337 5.682   -21.112 1.00 0.00 ? 3   LYS D H2   1  
ATOM   4833   H H3   . LYS D 2 1   ? -31.720 4.728   -20.862 1.00 0.00 ? 3   LYS D H3   1  
ATOM   4834   H HA   . LYS D 2 1   ? -30.700 3.358   -19.453 1.00 0.00 ? 3   LYS D HA   1  
ATOM   4835   H HB2  . LYS D 2 1   ? -28.436 4.795   -20.788 1.00 0.00 ? 3   LYS D HB2  1  
ATOM   4836   H HB3  . LYS D 2 1   ? -28.096 3.595   -19.541 1.00 0.00 ? 3   LYS D HB3  1  
ATOM   4837   H HG2  . LYS D 2 1   ? -29.497 1.986   -20.887 1.00 0.00 ? 3   LYS D HG2  1  
ATOM   4838   H HG3  . LYS D 2 1   ? -29.465 3.183   -22.182 1.00 0.00 ? 3   LYS D HG3  1  
ATOM   4839   H HD2  . LYS D 2 1   ? -26.982 3.102   -22.129 1.00 0.00 ? 3   LYS D HD2  1  
ATOM   4840   H HD3  . LYS D 2 1   ? -27.084 1.805   -20.938 1.00 0.00 ? 3   LYS D HD3  1  
ATOM   4841   H HE2  . LYS D 2 1   ? -28.566 0.605   -22.651 1.00 0.00 ? 3   LYS D HE2  1  
ATOM   4842   H HE3  . LYS D 2 1   ? -27.961 1.786   -23.811 1.00 0.00 ? 3   LYS D HE3  1  
ATOM   4843   H HZ1  . LYS D 2 1   ? -25.790 0.667   -22.417 1.00 0.00 ? 3   LYS D HZ1  1  
ATOM   4844   H HZ2  . LYS D 2 1   ? -26.762 -0.591  -23.011 1.00 0.00 ? 3   LYS D HZ2  1  
ATOM   4845   H HZ3  . LYS D 2 1   ? -26.147 0.581   -24.075 1.00 0.00 ? 3   LYS D HZ3  1  
ATOM   4846   N N    . LYS D 2 2   ? -30.272 4.053   -17.196 1.00 0.00 ? 4   LYS D N    1  
ATOM   4847   C CA   . LYS D 2 2   ? -30.065 4.445   -15.817 1.00 0.00 ? 4   LYS D CA   1  
ATOM   4848   C C    . LYS D 2 2   ? -28.695 4.006   -15.305 1.00 0.00 ? 4   LYS D C    1  
ATOM   4849   O O    . LYS D 2 2   ? -28.183 2.955   -15.690 1.00 0.00 ? 4   LYS D O    1  
ATOM   4850   C CB   . LYS D 2 2   ? -31.203 3.893   -14.948 1.00 0.00 ? 4   LYS D CB   1  
ATOM   4851   C CG   . LYS D 2 2   ? -32.569 4.446   -15.360 1.00 0.00 ? 4   LYS D CG   1  
ATOM   4852   C CD   . LYS D 2 2   ? -32.549 5.981   -15.399 1.00 0.00 ? 4   LYS D CD   1  
ATOM   4853   C CE   . LYS D 2 2   ? -33.672 6.578   -16.243 1.00 0.00 ? 4   LYS D CE   1  
ATOM   4854   N NZ   . LYS D 2 2   ? -35.021 6.276   -15.695 1.00 0.00 ? 4   LYS D NZ   1  
ATOM   4855   H H    . LYS D 2 2   ? -30.752 3.222   -17.391 1.00 0.00 ? 4   LYS D H    1  
ATOM   4856   H HA   . LYS D 2 2   ? -30.052 5.522   -15.748 1.00 0.00 ? 4   LYS D HA   1  
ATOM   4857   H HB2  . LYS D 2 2   ? -31.221 2.818   -15.040 1.00 0.00 ? 4   LYS D HB2  1  
ATOM   4858   H HB3  . LYS D 2 2   ? -31.016 4.162   -13.919 1.00 0.00 ? 4   LYS D HB3  1  
ATOM   4859   H HG2  . LYS D 2 2   ? -32.822 4.069   -16.341 1.00 0.00 ? 4   LYS D HG2  1  
ATOM   4860   H HG3  . LYS D 2 2   ? -33.314 4.120   -14.649 1.00 0.00 ? 4   LYS D HG3  1  
ATOM   4861   H HD2  . LYS D 2 2   ? -32.645 6.352   -14.390 1.00 0.00 ? 4   LYS D HD2  1  
ATOM   4862   H HD3  . LYS D 2 2   ? -31.603 6.300   -15.812 1.00 0.00 ? 4   LYS D HD3  1  
ATOM   4863   H HE2  . LYS D 2 2   ? -33.546 7.650   -16.281 1.00 0.00 ? 4   LYS D HE2  1  
ATOM   4864   H HE3  . LYS D 2 2   ? -33.607 6.173   -17.243 1.00 0.00 ? 4   LYS D HE3  1  
ATOM   4865   H HZ1  . LYS D 2 2   ? -35.089 6.636   -14.721 1.00 0.00 ? 4   LYS D HZ1  1  
ATOM   4866   H HZ2  . LYS D 2 2   ? -35.746 6.734   -16.284 1.00 0.00 ? 4   LYS D HZ2  1  
ATOM   4867   H HZ3  . LYS D 2 2   ? -35.173 5.248   -15.694 1.00 0.00 ? 4   LYS D HZ3  1  
ATOM   4868   N N    . HIS D 2 3   ? -28.113 4.816   -14.430 1.00 0.00 ? 5   HIS D N    1  
ATOM   4869   C CA   . HIS D 2 3   ? -26.798 4.545   -13.863 1.00 0.00 ? 5   HIS D CA   1  
ATOM   4870   C C    . HIS D 2 3   ? -26.880 3.938   -12.483 1.00 0.00 ? 5   HIS D C    1  
ATOM   4871   O O    . HIS D 2 3   ? -27.414 4.556   -11.556 1.00 0.00 ? 5   HIS D O    1  
ATOM   4872   C CB   . HIS D 2 3   ? -25.990 5.835   -13.804 1.00 0.00 ? 5   HIS D CB   1  
ATOM   4873   C CG   . HIS D 2 3   ? -25.639 6.363   -15.157 1.00 0.00 ? 5   HIS D CG   1  
ATOM   4874   N ND1  . HIS D 2 3   ? -24.371 6.783   -15.479 1.00 0.00 ? 5   HIS D ND1  1  
ATOM   4875   C CD2  . HIS D 2 3   ? -26.367 6.431   -16.298 1.00 0.00 ? 5   HIS D CD2  1  
ATOM   4876   C CE1  . HIS D 2 3   ? -24.324 7.077   -16.769 1.00 0.00 ? 5   HIS D CE1  1  
ATOM   4877   N NE2  . HIS D 2 3   ? -25.522 6.871   -17.286 1.00 0.00 ? 5   HIS D NE2  1  
ATOM   4878   H H    . HIS D 2 3   ? -28.586 5.630   -14.156 1.00 0.00 ? 5   HIS D H    1  
ATOM   4879   H HA   . HIS D 2 3   ? -26.282 3.825   -14.480 1.00 0.00 ? 5   HIS D HA   1  
ATOM   4880   H HB2  . HIS D 2 3   ? -26.568 6.581   -13.283 1.00 0.00 ? 5   HIS D HB2  1  
ATOM   4881   H HB3  . HIS D 2 3   ? -25.076 5.644   -13.262 1.00 0.00 ? 5   HIS D HB3  1  
ATOM   4882   H HD1  . HIS D 2 3   ? -23.619 6.854   -14.855 1.00 0.00 ? 5   HIS D HD1  1  
ATOM   4883   H HD2  . HIS D 2 3   ? -27.411 6.187   -16.409 1.00 0.00 ? 5   HIS D HD2  1  
ATOM   4884   H HE1  . HIS D 2 3   ? -23.456 7.428   -17.306 1.00 0.00 ? 5   HIS D HE1  1  
ATOM   4885   H HE2  . HIS D 2 3   ? -25.768 7.009   -18.223 1.00 0.00 ? 5   HIS D HE2  1  
ATOM   4886   N N    . ILE D 2 4   ? -26.391 2.710   -12.363 1.00 0.00 ? 6   ILE D N    1  
ATOM   4887   C CA   . ILE D 2 4   ? -26.364 2.018   -11.089 1.00 0.00 ? 6   ILE D CA   1  
ATOM   4888   C C    . ILE D 2 4   ? -24.892 1.991   -10.660 1.00 0.00 ? 6   ILE D C    1  
ATOM   4889   O O    . ILE D 2 4   ? -24.058 1.371   -11.333 1.00 0.00 ? 6   ILE D O    1  
ATOM   4890   C CB   . ILE D 2 4   ? -26.830 0.580   -11.248 1.00 0.00 ? 6   ILE D CB   1  
ATOM   4891   C CG1  . ILE D 2 4   ? -28.250 0.545   -11.809 1.00 0.00 ? 6   ILE D CG1  1  
ATOM   4892   C CG2  . ILE D 2 4   ? -26.750 -0.141  -9.895  1.00 0.00 ? 6   ILE D CG2  1  
ATOM   4893   C CD1  . ILE D 2 4   ? -28.726 -0.843  -12.134 1.00 0.00 ? 6   ILE D CD1  1  
ATOM   4894   H H    . ILE D 2 4   ? -26.037 2.260   -13.158 1.00 0.00 ? 6   ILE D H    1  
ATOM   4895   H HA   . ILE D 2 4   ? -27.017 2.527   -10.395 1.00 0.00 ? 6   ILE D HA   1  
ATOM   4896   H HB   . ILE D 2 4   ? -26.166 0.064   -11.924 1.00 0.00 ? 6   ILE D HB   1  
ATOM   4897   H HG12 . ILE D 2 4   ? -28.919 0.974   -11.077 1.00 0.00 ? 6   ILE D HG12 1  
ATOM   4898   H HG13 . ILE D 2 4   ? -28.277 1.138   -12.712 1.00 0.00 ? 6   ILE D HG13 1  
ATOM   4899   H HG21 . ILE D 2 4   ? -25.971 0.305   -9.295  1.00 0.00 ? 6   ILE D HG21 1  
ATOM   4900   H HG22 . ILE D 2 4   ? -27.696 -0.049  -9.385  1.00 0.00 ? 6   ILE D HG22 1  
ATOM   4901   H HG23 . ILE D 2 4   ? -26.527 -1.186  -10.059 1.00 0.00 ? 6   ILE D HG23 1  
ATOM   4902   H HD11 . ILE D 2 4   ? -28.071 -1.566  -11.668 1.00 0.00 ? 6   ILE D HD11 1  
ATOM   4903   H HD12 . ILE D 2 4   ? -29.731 -0.976  -11.763 1.00 0.00 ? 6   ILE D HD12 1  
ATOM   4904   H HD13 . ILE D 2 4   ? -28.715 -0.988  -13.205 1.00 0.00 ? 6   ILE D HD13 1  
ATOM   4905   N N    . TYR D 2 5   ? -24.566 2.690   -9.581  1.00 0.00 ? 7   TYR D N    1  
ATOM   4906   C CA   . TYR D 2 5   ? -23.205 2.738   -9.079  1.00 0.00 ? 7   TYR D CA   1  
ATOM   4907   C C    . TYR D 2 5   ? -23.084 2.014   -7.749  1.00 0.00 ? 7   TYR D C    1  
ATOM   4908   O O    . TYR D 2 5   ? -23.866 2.276   -6.831  1.00 0.00 ? 7   TYR D O    1  
ATOM   4909   C CB   . TYR D 2 5   ? -22.777 4.179   -8.891  1.00 0.00 ? 7   TYR D CB   1  
ATOM   4910   C CG   . TYR D 2 5   ? -22.581 4.931   -10.176 1.00 0.00 ? 7   TYR D CG   1  
ATOM   4911   C CD1  . TYR D 2 5   ? -22.294 6.291   -10.164 1.00 0.00 ? 7   TYR D CD1  1  
ATOM   4912   C CD2  . TYR D 2 5   ? -22.643 4.281   -11.402 1.00 0.00 ? 7   TYR D CD2  1  
ATOM   4913   C CE1  . TYR D 2 5   ? -22.075 6.986   -11.336 1.00 0.00 ? 7   TYR D CE1  1  
ATOM   4914   C CE2  . TYR D 2 5   ? -22.412 4.971   -12.584 1.00 0.00 ? 7   TYR D CE2  1  
ATOM   4915   C CZ   . TYR D 2 5   ? -22.131 6.324   -12.538 1.00 0.00 ? 7   TYR D CZ   1  
ATOM   4916   O OH   . TYR D 2 5   ? -21.935 7.013   -13.717 1.00 0.00 ? 7   TYR D OH   1  
ATOM   4917   H H    . TYR D 2 5   ? -25.266 3.190   -9.109  1.00 0.00 ? 7   TYR D H    1  
ATOM   4918   H HA   . TYR D 2 5   ? -22.544 2.258   -9.784  1.00 0.00 ? 7   TYR D HA   1  
ATOM   4919   H HB2  . TYR D 2 5   ? -23.533 4.688   -8.312  1.00 0.00 ? 7   TYR D HB2  1  
ATOM   4920   H HB3  . TYR D 2 5   ? -21.844 4.189   -8.348  1.00 0.00 ? 7   TYR D HB3  1  
ATOM   4921   H HD1  . TYR D 2 5   ? -22.239 6.812   -9.221  1.00 0.00 ? 7   TYR D HD1  1  
ATOM   4922   H HD2  . TYR D 2 5   ? -22.872 3.225   -11.436 1.00 0.00 ? 7   TYR D HD2  1  
ATOM   4923   H HE1  . TYR D 2 5   ? -21.860 8.044   -11.308 1.00 0.00 ? 7   TYR D HE1  1  
ATOM   4924   H HE2  . TYR D 2 5   ? -22.451 4.452   -13.531 1.00 0.00 ? 7   TYR D HE2  1  
ATOM   4925   H HH   . TYR D 2 5   ? -22.076 7.948   -13.540 1.00 0.00 ? 7   TYR D HH   1  
ATOM   4926   N N    . LEU D 2 6   ? -22.120 1.092   -7.660  1.00 0.00 ? 8   LEU D N    1  
ATOM   4927   C CA   . LEU D 2 6   ? -21.852 0.324   -6.435  1.00 0.00 ? 8   LEU D CA   1  
ATOM   4928   C C    . LEU D 2 6   ? -20.589 0.900   -5.798  1.00 0.00 ? 8   LEU D C    1  
ATOM   4929   O O    . LEU D 2 6   ? -19.621 1.191   -6.500  1.00 0.00 ? 8   LEU D O    1  
ATOM   4930   C CB   . LEU D 2 6   ? -21.633 -1.164  -6.740  1.00 0.00 ? 8   LEU D CB   1  
ATOM   4931   C CG   . LEU D 2 6   ? -22.884 -1.993  -7.058  1.00 0.00 ? 8   LEU D CG   1  
ATOM   4932   C CD1  . LEU D 2 6   ? -23.450 -1.626  -8.426  1.00 0.00 ? 8   LEU D CD1  1  
ATOM   4933   C CD2  . LEU D 2 6   ? -22.569 -3.479  -6.998  1.00 0.00 ? 8   LEU D CD2  1  
ATOM   4934   H H    . LEU D 2 6   ? -21.567 0.920   -8.450  1.00 0.00 ? 8   LEU D H    1  
ATOM   4935   H HA   . LEU D 2 6   ? -22.693 0.424   -5.765  1.00 0.00 ? 8   LEU D HA   1  
ATOM   4936   H HB2  . LEU D 2 6   ? -20.974 -1.229  -7.592  1.00 0.00 ? 8   LEU D HB2  1  
ATOM   4937   H HB3  . LEU D 2 6   ? -21.156 -1.607  -5.880  1.00 0.00 ? 8   LEU D HB3  1  
ATOM   4938   H HG   . LEU D 2 6   ? -23.635 -1.805  -6.304  1.00 0.00 ? 8   LEU D HG   1  
ATOM   4939   H HD11 . LEU D 2 6   ? -22.685 -1.756  -9.178  1.00 0.00 ? 8   LEU D HD11 1  
ATOM   4940   H HD12 . LEU D 2 6   ? -24.288 -2.268  -8.652  1.00 0.00 ? 8   LEU D HD12 1  
ATOM   4941   H HD13 . LEU D 2 6   ? -23.775 -0.597  -8.417  1.00 0.00 ? 8   LEU D HD13 1  
ATOM   4942   H HD21 . LEU D 2 6   ? -21.722 -3.642  -6.350  1.00 0.00 ? 8   LEU D HD21 1  
ATOM   4943   H HD22 . LEU D 2 6   ? -23.425 -4.012  -6.612  1.00 0.00 ? 8   LEU D HD22 1  
ATOM   4944   H HD23 . LEU D 2 6   ? -22.340 -3.839  -7.989  1.00 0.00 ? 8   LEU D HD23 1  
ATOM   4945   N N    . PHE D 2 7   ? -20.533 0.924   -4.448  1.00 0.00 ? 9   PHE D N    1  
ATOM   4946   C CA   . PHE D 2 7   ? -19.302 1.342   -3.743  1.00 0.00 ? 9   PHE D CA   1  
ATOM   4947   C C    . PHE D 2 7   ? -18.723 0.235   -2.779  1.00 0.00 ? 9   PHE D C    1  
ATOM   4948   O O    . PHE D 2 7   ? -19.474 -0.500  -2.139  1.00 0.00 ? 9   PHE D O    1  
ATOM   4949   C CB   . PHE D 2 7   ? -19.597 2.611   -2.945  1.00 0.00 ? 9   PHE D CB   1  
ATOM   4950   C CG   . PHE D 2 7   ? -19.921 3.729   -3.905  1.00 0.00 ? 9   PHE D CG   1  
ATOM   4951   C CD1  . PHE D 2 7   ? -21.256 4.053   -4.177  1.00 0.00 ? 9   PHE D CD1  1  
ATOM   4952   C CD2  . PHE D 2 7   ? -18.888 4.433   -4.534  1.00 0.00 ? 9   PHE D CD2  1  
ATOM   4953   C CE1  . PHE D 2 7   ? -21.557 5.085   -5.076  1.00 0.00 ? 9   PHE D CE1  1  
ATOM   4954   C CE2  . PHE D 2 7   ? -19.189 5.462   -5.432  1.00 0.00 ? 9   PHE D CE2  1  
ATOM   4955   C CZ   . PHE D 2 7   ? -20.524 5.788   -5.704  1.00 0.00 ? 9   PHE D CZ   1  
ATOM   4956   H H    . PHE D 2 7   ? -21.312 0.653   -3.923  1.00 0.00 ? 9   PHE D H    1  
ATOM   4957   H HA   . PHE D 2 7   ? -18.553 1.578   -4.480  1.00 0.00 ? 9   PHE D HA   1  
ATOM   4958   H HB2  . PHE D 2 7   ? -20.439 2.437   -2.291  1.00 0.00 ? 9   PHE D HB2  1  
ATOM   4959   H HB3  . PHE D 2 7   ? -18.732 2.877   -2.358  1.00 0.00 ? 9   PHE D HB3  1  
ATOM   4960   H HD1  . PHE D 2 7   ? -22.053 3.510   -3.692  1.00 0.00 ? 9   PHE D HD1  1  
ATOM   4961   H HD2  . PHE D 2 7   ? -17.858 4.183   -4.325  1.00 0.00 ? 9   PHE D HD2  1  
ATOM   4962   H HE1  . PHE D 2 7   ? -22.585 5.335   -5.284  1.00 0.00 ? 9   PHE D HE1  1  
ATOM   4963   H HE2  . PHE D 2 7   ? -18.391 6.008   -5.919  1.00 0.00 ? 9   PHE D HE2  1  
ATOM   4964   H HZ   . PHE D 2 7   ? -20.755 6.583   -6.398  1.00 0.00 ? 9   PHE D HZ   1  
ATOM   4965   N N    . CYS D 2 8   ? -17.362 0.214   -2.639  1.00 0.00 ? 10  CYS D N    1  
ATOM   4966   C CA   . CYS D 2 8   ? -16.588 -0.685  -1.700  1.00 0.00 ? 10  CYS D CA   1  
ATOM   4967   C C    . CYS D 2 8   ? -15.283 0.056   -1.438  1.00 0.00 ? 10  CYS D C    1  
ATOM   4968   O O    . CYS D 2 8   ? -15.193 1.206   -1.819  1.00 0.00 ? 10  CYS D O    1  
ATOM   4969   C CB   . CYS D 2 8   ? -16.260 -2.109  -2.233  1.00 0.00 ? 10  CYS D CB   1  
ATOM   4970   S SG   . CYS D 2 8   ? -15.095 -2.007  -3.615  1.00 0.00 ? 10  CYS D SG   1  
ATOM   4971   H H    . CYS D 2 8   ? -16.851 0.899   -3.122  1.00 0.00 ? 10  CYS D H    1  
ATOM   4972   H HA   . CYS D 2 8   ? -17.136 -0.764  -0.768  1.00 0.00 ? 10  CYS D HA   1  
ATOM   4973   H HB2  . CYS D 2 8   ? -15.823 -2.695  -1.440  1.00 0.00 ? 10  CYS D HB2  1  
ATOM   4974   H HB3  . CYS D 2 8   ? -17.172 -2.584  -2.569  1.00 0.00 ? 10  CYS D HB3  1  
ATOM   4975   N N    . SER D 2 9   ? -14.281 -0.515  -0.772  1.00 0.00 ? 11  SER D N    1  
ATOM   4976   C CA   . SER D 2 9   ? -13.066 0.282   -0.527  1.00 0.00 ? 11  SER D CA   1  
ATOM   4977   C C    . SER D 2 9   ? -12.250 0.568   -1.796  1.00 0.00 ? 11  SER D C    1  
ATOM   4978   O O    . SER D 2 9   ? -11.893 1.717   -2.038  1.00 0.00 ? 11  SER D O    1  
ATOM   4979   C CB   . SER D 2 9   ? -12.151 -0.414  0.479   1.00 0.00 ? 11  SER D CB   1  
ATOM   4980   O OG   . SER D 2 9   ? -12.402 -1.815  0.447   1.00 0.00 ? 11  SER D OG   1  
ATOM   4981   H H    . SER D 2 9   ? -14.350 -1.423  -0.408  1.00 0.00 ? 11  SER D H    1  
ATOM   4982   H HA   . SER D 2 9   ? -13.367 1.228   -0.102  1.00 0.00 ? 11  SER D HA   1  
ATOM   4983   H HB2  . SER D 2 9   ? -11.122 -0.224  0.219   1.00 0.00 ? 11  SER D HB2  1  
ATOM   4984   H HB3  . SER D 2 9   ? -12.330 -0.022  1.467   1.00 0.00 ? 11  SER D HB3  1  
ATOM   4985   H HG   . SER D 2 9   ? -12.283 -2.158  1.338   1.00 0.00 ? 11  SER D HG   1  
ATOM   4986   N N    . ALA D 2 10  ? -11.898 -0.470  -2.562  1.00 0.00 ? 12  ALA D N    1  
ATOM   4987   C CA   . ALA D 2 10  ? -11.062 -0.273  -3.764  1.00 0.00 ? 12  ALA D CA   1  
ATOM   4988   C C    . ALA D 2 10  ? -11.863 -0.460  -5.063  1.00 0.00 ? 12  ALA D C    1  
ATOM   4989   O O    . ALA D 2 10  ? -11.505 0.101   -6.096  1.00 0.00 ? 12  ALA D O    1  
ATOM   4990   C CB   . ALA D 2 10  ? -9.848  -1.225  -3.727  1.00 0.00 ? 12  ALA D CB   1  
ATOM   4991   H H    . ALA D 2 10  ? -12.156 -1.375  -2.287  1.00 0.00 ? 12  ALA D H    1  
ATOM   4992   H HA   . ALA D 2 10  ? -10.687 0.738   -3.748  1.00 0.00 ? 12  ALA D HA   1  
ATOM   4993   H HB1  . ALA D 2 10  ? -9.996  -1.970  -2.956  1.00 0.00 ? 12  ALA D HB1  1  
ATOM   4994   H HB2  . ALA D 2 10  ? -9.729  -1.708  -4.689  1.00 0.00 ? 12  ALA D HB2  1  
ATOM   4995   H HB3  . ALA D 2 10  ? -8.952  -0.656  -3.505  1.00 0.00 ? 12  ALA D HB3  1  
ATOM   4996   N N    . GLY D 2 11  ? -12.948 -1.234  -5.005  1.00 0.00 ? 13  GLY D N    1  
ATOM   4997   C CA   . GLY D 2 11  ? -13.780 -1.455  -6.201  1.00 0.00 ? 13  GLY D CA   1  
ATOM   4998   C C    . GLY D 2 11  ? -13.475 -2.781  -6.894  1.00 0.00 ? 13  GLY D C    1  
ATOM   4999   O O    . GLY D 2 11  ? -13.670 -2.884  -8.088  1.00 0.00 ? 13  GLY D O    1  
ATOM   5000   H H    . GLY D 2 11  ? -13.181 -1.648  -4.149  1.00 0.00 ? 13  GLY D H    1  
ATOM   5001   H HA2  . GLY D 2 11  ? -14.821 -1.421  -5.949  1.00 0.00 ? 13  GLY D HA2  1  
ATOM   5002   H HA3  . GLY D 2 11  ? -13.579 -0.659  -6.902  1.00 0.00 ? 13  GLY D HA3  1  
ATOM   5003   N N    . MET D 2 12  ? -12.986 -3.786  -6.166  1.00 0.00 ? 14  MET D N    1  
ATOM   5004   C CA   . MET D 2 12  ? -12.633 -5.072  -6.785  1.00 0.00 ? 14  MET D CA   1  
ATOM   5005   C C    . MET D 2 12  ? -13.605 -6.185  -6.445  1.00 0.00 ? 14  MET D C    1  
ATOM   5006   O O    . MET D 2 12  ? -14.358 -6.660  -7.280  1.00 0.00 ? 14  MET D O    1  
ATOM   5007   C CB   . MET D 2 12  ? -11.251 -5.490  -6.289  1.00 0.00 ? 14  MET D CB   1  
ATOM   5008   C CG   . MET D 2 12  ? -10.699 -6.645  -7.132  1.00 0.00 ? 14  MET D CG   1  
ATOM   5009   S SD   . MET D 2 12  ? -9.186  -7.274  -6.351  1.00 0.00 ? 14  MET D SD   1  
ATOM   5010   C CE   . MET D 2 12  ? -8.405  -8.032  -7.802  1.00 0.00 ? 14  MET D CE   1  
ATOM   5011   H H    . MET D 2 12  ? -12.836 -3.679  -5.216  1.00 0.00 ? 14  MET D H    1  
ATOM   5012   H HA   . MET D 2 12  ? -12.600 -4.959  -7.853  1.00 0.00 ? 14  MET D HA   1  
ATOM   5013   H HB2  . MET D 2 12  ? -10.584 -4.651  -6.344  1.00 0.00 ? 14  MET D HB2  1  
ATOM   5014   H HB3  . MET D 2 12  ? -11.331 -5.814  -5.261  1.00 0.00 ? 14  MET D HB3  1  
ATOM   5015   H HG2  . MET D 2 12  ? -11.433 -7.436  -7.191  1.00 0.00 ? 14  MET D HG2  1  
ATOM   5016   H HG3  . MET D 2 12  ? -10.475 -6.287  -8.123  1.00 0.00 ? 14  MET D HG3  1  
ATOM   5017   H HE1  . MET D 2 12  ? -9.007  -7.855  -8.681  1.00 0.00 ? 14  MET D HE1  1  
ATOM   5018   H HE2  . MET D 2 12  ? -7.427  -7.603  -7.948  1.00 0.00 ? 14  MET D HE2  1  
ATOM   5019   H HE3  . MET D 2 12  ? -8.304  -9.096  -7.637  1.00 0.00 ? 14  MET D HE3  1  
ATOM   5020   N N    . SER D 2 13  ? -13.563 -6.643  -5.228  1.00 0.00 ? 15  SER D N    1  
ATOM   5021   C CA   . SER D 2 13  ? -14.430 -7.735  -4.853  1.00 0.00 ? 15  SER D CA   1  
ATOM   5022   C C    . SER D 2 13  ? -15.856 -7.487  -5.326  1.00 0.00 ? 15  SER D C    1  
ATOM   5023   O O    . SER D 2 13  ? -16.608 -8.434  -5.548  1.00 0.00 ? 15  SER D O    1  
ATOM   5024   C CB   . SER D 2 13  ? -14.415 -7.893  -3.360  1.00 0.00 ? 15  SER D CB   1  
ATOM   5025   O OG   . SER D 2 13  ? -13.205 -8.524  -2.964  1.00 0.00 ? 15  SER D OG   1  
ATOM   5026   H H    . SER D 2 13  ? -12.928 -6.271  -4.582  1.00 0.00 ? 15  SER D H    1  
ATOM   5027   H HA   . SER D 2 13  ? -14.063 -8.644  -5.305  1.00 0.00 ? 15  SER D HA   1  
ATOM   5028   H HB2  . SER D 2 13  ? -14.478 -6.920  -2.917  1.00 0.00 ? 15  SER D HB2  1  
ATOM   5029   H HB3  . SER D 2 13  ? -15.261 -8.488  -3.062  1.00 0.00 ? 15  SER D HB3  1  
ATOM   5030   H HG   . SER D 2 13  ? -13.150 -9.369  -3.416  1.00 0.00 ? 15  SER D HG   1  
ATOM   5031   N N    . THR D 2 14  ? -16.227 -6.220  -5.511  1.00 0.00 ? 16  THR D N    1  
ATOM   5032   C CA   . THR D 2 14  ? -17.561 -5.877  -5.992  1.00 0.00 ? 16  THR D CA   1  
ATOM   5033   C C    . THR D 2 14  ? -17.567 -5.897  -7.512  1.00 0.00 ? 16  THR D C    1  
ATOM   5034   O O    . THR D 2 14  ? -18.610 -6.005  -8.154  1.00 0.00 ? 16  THR D O    1  
ATOM   5035   C CB   . THR D 2 14  ? -17.933 -4.485  -5.487  1.00 0.00 ? 16  THR D CB   1  
ATOM   5036   O OG1  . THR D 2 14  ? -17.801 -4.446  -4.073  1.00 0.00 ? 16  THR D OG1  1  
ATOM   5037   C CG2  . THR D 2 14  ? -19.368 -4.171  -5.876  1.00 0.00 ? 16  THR D CG2  1  
ATOM   5038   H H    . THR D 2 14  ? -15.610 -5.471  -5.370  1.00 0.00 ? 16  THR D H    1  
ATOM   5039   H HA   . THR D 2 14  ? -18.275 -6.597  -5.630  1.00 0.00 ? 16  THR D HA   1  
ATOM   5040   H HB   . THR D 2 14  ? -17.275 -3.755  -5.930  1.00 0.00 ? 16  THR D HB   1  
ATOM   5041   H HG1  . THR D 2 14  ? -16.945 -4.063  -3.864  1.00 0.00 ? 16  THR D HG1  1  
ATOM   5042   H HG21 . THR D 2 14  ? -20.004 -4.999  -5.602  1.00 0.00 ? 16  THR D HG21 1  
ATOM   5043   H HG22 . THR D 2 14  ? -19.692 -3.280  -5.360  1.00 0.00 ? 16  THR D HG22 1  
ATOM   5044   H HG23 . THR D 2 14  ? -19.424 -4.011  -6.942  1.00 0.00 ? 16  THR D HG23 1  
ATOM   5045   N N    . SER D 2 15  ? -16.368 -5.816  -8.058  1.00 0.00 ? 17  SER D N    1  
ATOM   5046   C CA   . SER D 2 15  ? -16.152 -5.847  -9.518  1.00 0.00 ? 17  SER D CA   1  
ATOM   5047   C C    . SER D 2 15  ? -16.677 -7.152  -10.130 1.00 0.00 ? 17  SER D C    1  
ATOM   5048   O O    . SER D 2 15  ? -17.159 -7.173  -11.270 1.00 0.00 ? 17  SER D O    1  
ATOM   5049   C CB   . SER D 2 15  ? -14.672 -5.676  -9.868  1.00 0.00 ? 17  SER D CB   1  
ATOM   5050   O OG   . SER D 2 15  ? -14.276 -4.332  -9.629  1.00 0.00 ? 17  SER D OG   1  
ATOM   5051   H H    . SER D 2 15  ? -15.588 -5.768  -7.467  1.00 0.00 ? 17  SER D H    1  
ATOM   5052   H HA   . SER D 2 15  ? -16.718 -5.049  -9.973  1.00 0.00 ? 17  SER D HA   1  
ATOM   5053   H HB2  . SER D 2 15  ? -14.078 -6.332  -9.259  1.00 0.00 ? 17  SER D HB2  1  
ATOM   5054   H HB3  . SER D 2 15  ? -14.522 -5.925  -10.910 1.00 0.00 ? 17  SER D HB3  1  
ATOM   5055   H HG   . SER D 2 15  ? -14.731 -4.025  -8.842  1.00 0.00 ? 17  SER D HG   1  
ATOM   5056   N N    . LEU D 2 16  ? -16.550 -8.242  -9.389  1.00 0.00 ? 18  LEU D N    1  
ATOM   5057   C CA   . LEU D 2 16  ? -17.040 -9.524  -9.858  1.00 0.00 ? 18  LEU D CA   1  
ATOM   5058   C C    . LEU D 2 16  ? -18.582 -9.487  -9.898  1.00 0.00 ? 18  LEU D C    1  
ATOM   5059   O O    . LEU D 2 16  ? -19.196 -10.001 -10.843 1.00 0.00 ? 18  LEU D O    1  
ATOM   5060   C CB   . LEU D 2 16  ? -16.555 -10.645 -8.934  1.00 0.00 ? 18  LEU D CB   1  
ATOM   5061   C CG   . LEU D 2 16  ? -17.077 -11.997 -9.430  1.00 0.00 ? 18  LEU D CG   1  
ATOM   5062   C CD1  . LEU D 2 16  ? -16.480 -12.315 -10.811 1.00 0.00 ? 18  LEU D CD1  1  
ATOM   5063   C CD2  . LEU D 2 16  ? -16.676 -13.085 -8.427  1.00 0.00 ? 18  LEU D CD2  1  
ATOM   5064   H H    . LEU D 2 16  ? -16.119 -8.182  -8.511  1.00 0.00 ? 18  LEU D H    1  
ATOM   5065   H HA   . LEU D 2 16  ? -16.685 -9.698  -10.862 1.00 0.00 ? 18  LEU D HA   1  
ATOM   5066   H HB2  . LEU D 2 16  ? -15.475 -10.658 -8.924  1.00 0.00 ? 18  LEU D HB2  1  
ATOM   5067   H HB3  . LEU D 2 16  ? -16.921 -10.467 -7.934  1.00 0.00 ? 18  LEU D HB3  1  
ATOM   5068   H HG   . LEU D 2 16  ? -18.153 -11.959 -9.507  1.00 0.00 ? 18  LEU D HG   1  
ATOM   5069   H HD11 . LEU D 2 16  ? -15.555 -11.772 -10.943 1.00 0.00 ? 18  LEU D HD11 1  
ATOM   5070   H HD12 . LEU D 2 16  ? -16.288 -13.376 -10.890 1.00 0.00 ? 18  LEU D HD12 1  
ATOM   5071   H HD13 . LEU D 2 16  ? -17.180 -12.022 -11.579 1.00 0.00 ? 18  LEU D HD13 1  
ATOM   5072   H HD21 . LEU D 2 16  ? -16.788 -12.705 -7.422  1.00 0.00 ? 18  LEU D HD21 1  
ATOM   5073   H HD22 . LEU D 2 16  ? -17.313 -13.947 -8.559  1.00 0.00 ? 18  LEU D HD22 1  
ATOM   5074   H HD23 . LEU D 2 16  ? -15.647 -13.367 -8.594  1.00 0.00 ? 18  LEU D HD23 1  
ATOM   5075   N N    . LEU D 2 17  ? -19.204 -8.874  -8.892  1.00 0.00 ? 19  LEU D N    1  
ATOM   5076   C CA   . LEU D 2 17  ? -20.674 -8.741  -8.854  1.00 0.00 ? 19  LEU D CA   1  
ATOM   5077   C C    . LEU D 2 17  ? -21.139 -7.850  -10.026 1.00 0.00 ? 19  LEU D C    1  
ATOM   5078   O O    . LEU D 2 17  ? -22.103 -8.180  -10.718 1.00 0.00 ? 19  LEU D O    1  
ATOM   5079   C CB   . LEU D 2 17  ? -21.121 -8.153  -7.500  1.00 0.00 ? 19  LEU D CB   1  
ATOM   5080   C CG   . LEU D 2 17  ? -22.635 -7.831  -7.484  1.00 0.00 ? 19  LEU D CG   1  
ATOM   5081   C CD1  . LEU D 2 17  ? -23.488 -9.116  -7.495  1.00 0.00 ? 19  LEU D CD1  1  
ATOM   5082   C CD2  . LEU D 2 17  ? -22.970 -7.031  -6.215  1.00 0.00 ? 19  LEU D CD2  1  
ATOM   5083   H H    . LEU D 2 17  ? -18.671 -8.500  -8.159  1.00 0.00 ? 19  LEU D H    1  
ATOM   5084   H HA   . LEU D 2 17  ? -21.121 -9.713  -8.991  1.00 0.00 ? 19  LEU D HA   1  
ATOM   5085   H HB2  . LEU D 2 17  ? -20.904 -8.866  -6.718  1.00 0.00 ? 19  LEU D HB2  1  
ATOM   5086   H HB3  . LEU D 2 17  ? -20.563 -7.247  -7.315  1.00 0.00 ? 19  LEU D HB3  1  
ATOM   5087   H HG   . LEU D 2 17  ? -22.885 -7.235  -8.348  1.00 0.00 ? 19  LEU D HG   1  
ATOM   5088   H HD11 . LEU D 2 17  ? -22.982 -9.897  -8.028  1.00 0.00 ? 19  LEU D HD11 1  
ATOM   5089   H HD12 . LEU D 2 17  ? -23.670 -9.439  -6.481  1.00 0.00 ? 19  LEU D HD12 1  
ATOM   5090   H HD13 . LEU D 2 17  ? -24.432 -8.911  -7.977  1.00 0.00 ? 19  LEU D HD13 1  
ATOM   5091   H HD21 . LEU D 2 17  ? -22.127 -6.416  -5.937  1.00 0.00 ? 19  LEU D HD21 1  
ATOM   5092   H HD22 . LEU D 2 17  ? -23.826 -6.401  -6.404  1.00 0.00 ? 19  LEU D HD22 1  
ATOM   5093   H HD23 . LEU D 2 17  ? -23.197 -7.712  -5.408  1.00 0.00 ? 19  LEU D HD23 1  
ATOM   5094   N N    . VAL D 2 18  ? -20.422 -6.751  -10.270 1.00 0.00 ? 20  VAL D N    1  
ATOM   5095   C CA   . VAL D 2 18  ? -20.754 -5.852  -11.383 1.00 0.00 ? 20  VAL D CA   1  
ATOM   5096   C C    . VAL D 2 18  ? -20.714 -6.594  -12.727 1.00 0.00 ? 20  VAL D C    1  
ATOM   5097   O O    . VAL D 2 18  ? -21.624 -6.439  -13.542 1.00 0.00 ? 20  VAL D O    1  
ATOM   5098   C CB   . VAL D 2 18  ? -19.827 -4.633  -11.401 1.00 0.00 ? 20  VAL D CB   1  
ATOM   5099   C CG1  . VAL D 2 18  ? -20.053 -3.815  -12.687 1.00 0.00 ? 20  VAL D CG1  1  
ATOM   5100   C CG2  . VAL D 2 18  ? -20.122 -3.765  -10.171 1.00 0.00 ? 20  VAL D CG2  1  
ATOM   5101   H H    . VAL D 2 18  ? -19.657 -6.539  -9.696  1.00 0.00 ? 20  VAL D H    1  
ATOM   5102   H HA   . VAL D 2 18  ? -21.777 -5.527  -11.272 1.00 0.00 ? 20  VAL D HA   1  
ATOM   5103   H HB   . VAL D 2 18  ? -18.800 -4.966  -11.366 1.00 0.00 ? 20  VAL D HB   1  
ATOM   5104   H HG11 . VAL D 2 18  ? -21.005 -4.079  -13.127 1.00 0.00 ? 20  VAL D HG11 1  
ATOM   5105   H HG12 . VAL D 2 18  ? -20.048 -2.759  -12.455 1.00 0.00 ? 20  VAL D HG12 1  
ATOM   5106   H HG13 . VAL D 2 18  ? -19.263 -4.028  -13.391 1.00 0.00 ? 20  VAL D HG13 1  
ATOM   5107   H HG21 . VAL D 2 18  ? -21.190 -3.659  -10.053 1.00 0.00 ? 20  VAL D HG21 1  
ATOM   5108   H HG22 . VAL D 2 18  ? -19.709 -4.236  -9.291  1.00 0.00 ? 20  VAL D HG22 1  
ATOM   5109   H HG23 . VAL D 2 18  ? -19.675 -2.791  -10.301 1.00 0.00 ? 20  VAL D HG23 1  
ATOM   5110   N N    . SER D 2 19  ? -19.698 -7.428  -12.960 1.00 0.00 ? 21  SER D N    1  
ATOM   5111   C CA   . SER D 2 19  ? -19.641 -8.159  -14.229 1.00 0.00 ? 21  SER D CA   1  
ATOM   5112   C C    . SER D 2 19  ? -20.839 -9.117  -14.398 1.00 0.00 ? 21  SER D C    1  
ATOM   5113   O O    . SER D 2 19  ? -21.378 -9.240  -15.503 1.00 0.00 ? 21  SER D O    1  
ATOM   5114   C CB   . SER D 2 19  ? -18.317 -8.903  -14.394 1.00 0.00 ? 21  SER D CB   1  
ATOM   5115   O OG   . SER D 2 19  ? -18.160 -9.825  -13.323 1.00 0.00 ? 21  SER D OG   1  
ATOM   5116   H H    . SER D 2 19  ? -18.996 -7.551  -12.287 1.00 0.00 ? 21  SER D H    1  
ATOM   5117   H HA   . SER D 2 19  ? -19.777 -7.458  -15.039 1.00 0.00 ? 21  SER D HA   1  
ATOM   5118   H HB2  . SER D 2 19  ? -18.317 -9.440  -15.328 1.00 0.00 ? 21  SER D HB2  1  
ATOM   5119   H HB3  . SER D 2 19  ? -17.502 -8.191  -14.392 1.00 0.00 ? 21  SER D HB3  1  
ATOM   5120   H HG   . SER D 2 19  ? -17.590 -9.421  -12.664 1.00 0.00 ? 21  SER D HG   1  
ATOM   5121   N N    . LYS D 2 20  ? -21.279 -9.769  -13.320 1.00 0.00 ? 22  LYS D N    1  
ATOM   5122   C CA   . LYS D 2 20  ? -22.441 -10.665 -13.404 1.00 0.00 ? 22  LYS D CA   1  
ATOM   5123   C C    . LYS D 2 20  ? -23.743 -9.863  -13.591 1.00 0.00 ? 22  LYS D C    1  
ATOM   5124   O O    . LYS D 2 20  ? -24.662 -10.309 -14.272 1.00 0.00 ? 22  LYS D O    1  
ATOM   5125   C CB   . LYS D 2 20  ? -22.512 -11.532 -12.148 1.00 0.00 ? 22  LYS D CB   1  
ATOM   5126   C CG   . LYS D 2 20  ? -23.148 -12.887 -12.476 1.00 0.00 ? 22  LYS D CG   1  
ATOM   5127   C CD   . LYS D 2 20  ? -22.156 -13.759 -13.293 1.00 0.00 ? 22  LYS D CD   1  
ATOM   5128   C CE   . LYS D 2 20  ? -21.815 -15.072 -12.561 1.00 0.00 ? 22  LYS D CE   1  
ATOM   5129   N NZ   . LYS D 2 20  ? -21.714 -16.175 -13.559 1.00 0.00 ? 22  LYS D NZ   1  
ATOM   5130   H H    . LYS D 2 20  ? -20.823 -9.646  -12.462 1.00 0.00 ? 22  LYS D H    1  
ATOM   5131   H HA   . LYS D 2 20  ? -22.341 -11.289 -14.280 1.00 0.00 ? 22  LYS D HA   1  
ATOM   5132   H HB2  . LYS D 2 20  ? -21.515 -11.686 -11.763 1.00 0.00 ? 22  LYS D HB2  1  
ATOM   5133   H HB3  . LYS D 2 20  ? -23.111 -11.028 -11.403 1.00 0.00 ? 22  LYS D HB3  1  
ATOM   5134   H HG2  . LYS D 2 20  ? -23.411 -13.378 -11.554 1.00 0.00 ? 22  LYS D HG2  1  
ATOM   5135   H HG3  . LYS D 2 20  ? -24.042 -12.723 -13.058 1.00 0.00 ? 22  LYS D HG3  1  
ATOM   5136   H HD2  . LYS D 2 20  ? -22.600 -14.001 -14.247 1.00 0.00 ? 22  LYS D HD2  1  
ATOM   5137   H HD3  . LYS D 2 20  ? -21.242 -13.206 -13.464 1.00 0.00 ? 22  LYS D HD3  1  
ATOM   5138   H HE2  . LYS D 2 20  ? -20.867 -14.966 -12.052 1.00 0.00 ? 22  LYS D HE2  1  
ATOM   5139   H HE3  . LYS D 2 20  ? -22.581 -15.316 -11.843 1.00 0.00 ? 22  LYS D HE3  1  
ATOM   5140   H HZ1  . LYS D 2 20  ? -22.492 -16.093 -14.244 1.00 0.00 ? 22  LYS D HZ1  1  
ATOM   5141   H HZ2  . LYS D 2 20  ? -20.806 -16.109 -14.060 1.00 0.00 ? 22  LYS D HZ2  1  
ATOM   5142   H HZ3  . LYS D 2 20  ? -21.777 -17.092 -13.070 1.00 0.00 ? 22  LYS D HZ3  1  
ATOM   5143   N N    . MET D 2 21  ? -23.833 -8.688  -12.985 1.00 0.00 ? 23  MET D N    1  
ATOM   5144   C CA   . MET D 2 21  ? -25.035 -7.874  -13.161 1.00 0.00 ? 23  MET D CA   1  
ATOM   5145   C C    . MET D 2 21  ? -25.122 -7.420  -14.629 1.00 0.00 ? 23  MET D C    1  
ATOM   5146   O O    . MET D 2 21  ? -26.202 -7.420  -15.209 1.00 0.00 ? 23  MET D O    1  
ATOM   5147   C CB   . MET D 2 21  ? -25.025 -6.649  -12.238 1.00 0.00 ? 23  MET D CB   1  
ATOM   5148   C CG   . MET D 2 21  ? -25.205 -6.934  -10.746 1.00 0.00 ? 23  MET D CG   1  
ATOM   5149   S SD   . MET D 2 21  ? -24.934 -5.424  -9.743  1.00 0.00 ? 23  MET D SD   1  
ATOM   5150   C CE   . MET D 2 21  ? -26.364 -4.427  -10.174 1.00 0.00 ? 23  MET D CE   1  
ATOM   5151   H H    . MET D 2 21  ? -23.098 -8.367  -12.424 1.00 0.00 ? 23  MET D H    1  
ATOM   5152   H HA   . MET D 2 21  ? -25.904 -8.475  -12.935 1.00 0.00 ? 23  MET D HA   1  
ATOM   5153   H HB2  . MET D 2 21  ? -24.080 -6.146  -12.367 1.00 0.00 ? 23  MET D HB2  1  
ATOM   5154   H HB3  . MET D 2 21  ? -25.826 -5.995  -12.549 1.00 0.00 ? 23  MET D HB3  1  
ATOM   5155   H HG2  . MET D 2 21  ? -26.209 -7.295  -10.575 1.00 0.00 ? 23  MET D HG2  1  
ATOM   5156   H HG3  . MET D 2 21  ? -24.495 -7.690  -10.445 1.00 0.00 ? 23  MET D HG3  1  
ATOM   5157   H HE1  . MET D 2 21  ? -27.072 -5.032  -10.721 1.00 0.00 ? 23  MET D HE1  1  
ATOM   5158   H HE2  . MET D 2 21  ? -26.830 -4.056  -9.273  1.00 0.00 ? 23  MET D HE2  1  
ATOM   5159   H HE3  . MET D 2 21  ? -26.050 -3.595  -10.788 1.00 0.00 ? 23  MET D HE3  1  
ATOM   5160   N N    . ARG D 2 22  ? -23.997 -7.019  -15.225 1.00 0.00 ? 24  ARG D N    1  
ATOM   5161   C CA   . ARG D 2 22  ? -23.974 -6.565  -16.617 1.00 0.00 ? 24  ARG D CA   1  
ATOM   5162   C C    . ARG D 2 22  ? -24.442 -7.695  -17.554 1.00 0.00 ? 24  ARG D C    1  
ATOM   5163   O O    . ARG D 2 22  ? -25.098 -7.425  -18.567 1.00 0.00 ? 24  ARG D O    1  
ATOM   5164   C CB   . ARG D 2 22  ? -22.576 -6.069  -17.030 1.00 0.00 ? 24  ARG D CB   1  
ATOM   5165   C CG   . ARG D 2 22  ? -22.742 -4.834  -17.935 1.00 0.00 ? 24  ARG D CG   1  
ATOM   5166   C CD   . ARG D 2 22  ? -21.481 -4.589  -18.760 1.00 0.00 ? 24  ARG D CD   1  
ATOM   5167   N NE   . ARG D 2 22  ? -20.384 -4.138  -17.916 1.00 0.00 ? 24  ARG D NE   1  
ATOM   5168   C CZ   . ARG D 2 22  ? -19.149 -4.077  -18.397 1.00 0.00 ? 24  ARG D CZ   1  
ATOM   5169   N NH1  . ARG D 2 22  ? -18.914 -4.451  -19.625 1.00 0.00 ? 24  ARG D NH1  1  
ATOM   5170   N NH2  . ARG D 2 22  ? -18.173 -3.647  -17.648 1.00 0.00 ? 24  ARG D NH2  1  
ATOM   5171   H H    . ARG D 2 22  ? -23.160 -7.027  -14.718 1.00 0.00 ? 24  ARG D H    1  
ATOM   5172   H HA   . ARG D 2 22  ? -24.665 -5.748  -16.725 1.00 0.00 ? 24  ARG D HA   1  
ATOM   5173   H HB2  . ARG D 2 22  ? -22.011 -5.802  -16.148 1.00 0.00 ? 24  ARG D HB2  1  
ATOM   5174   H HB3  . ARG D 2 22  ? -22.057 -6.845  -17.573 1.00 0.00 ? 24  ARG D HB3  1  
ATOM   5175   H HG2  . ARG D 2 22  ? -23.578 -4.990  -18.600 1.00 0.00 ? 24  ARG D HG2  1  
ATOM   5176   H HG3  . ARG D 2 22  ? -22.937 -3.968  -17.318 1.00 0.00 ? 24  ARG D HG3  1  
ATOM   5177   H HD2  . ARG D 2 22  ? -21.194 -5.503  -19.252 1.00 0.00 ? 24  ARG D HD2  1  
ATOM   5178   H HD3  . ARG D 2 22  ? -21.691 -3.835  -19.505 1.00 0.00 ? 24  ARG D HD3  1  
ATOM   5179   H HE   . ARG D 2 22  ? -20.561 -3.864  -16.991 1.00 0.00 ? 24  ARG D HE   1  
ATOM   5180   H HH11 . ARG D 2 22  ? -19.663 -4.781  -20.199 1.00 0.00 ? 24  ARG D HH11 1  
ATOM   5181   H HH12 . ARG D 2 22  ? -17.985 -4.408  -19.991 1.00 0.00 ? 24  ARG D HH12 1  
ATOM   5182   H HH21 . ARG D 2 22  ? -18.353 -3.361  -16.708 1.00 0.00 ? 24  ARG D HH21 1  
ATOM   5183   H HH22 . ARG D 2 22  ? -17.244 -3.604  -18.016 1.00 0.00 ? 24  ARG D HH22 1  
ATOM   5184   N N    . ALA D 2 23  ? -24.061 -8.935  -17.237 1.00 0.00 ? 25  ALA D N    1  
ATOM   5185   C CA   . ALA D 2 23  ? -24.438 -10.091 -18.051 1.00 0.00 ? 25  ALA D CA   1  
ATOM   5186   C C    . ALA D 2 23  ? -25.957 -10.247 -18.024 1.00 0.00 ? 25  ALA D C    1  
ATOM   5187   O O    . ALA D 2 23  ? -26.594 -10.410 -19.066 1.00 0.00 ? 25  ALA D O    1  
ATOM   5188   C CB   . ALA D 2 23  ? -23.770 -11.353 -17.535 1.00 0.00 ? 25  ALA D CB   1  
ATOM   5189   H H    . ALA D 2 23  ? -23.516 -9.074  -16.436 1.00 0.00 ? 25  ALA D H    1  
ATOM   5190   H HA   . ALA D 2 23  ? -24.131 -9.920  -19.071 1.00 0.00 ? 25  ALA D HA   1  
ATOM   5191   H HB1  . ALA D 2 23  ? -23.420 -11.943 -18.368 1.00 0.00 ? 25  ALA D HB1  1  
ATOM   5192   H HB2  . ALA D 2 23  ? -22.933 -11.087 -16.906 1.00 0.00 ? 25  ALA D HB2  1  
ATOM   5193   H HB3  . ALA D 2 23  ? -24.480 -11.927 -16.959 1.00 0.00 ? 25  ALA D HB3  1  
ATOM   5194   N N    . GLN D 2 24  ? -26.530 -10.135 -16.832 1.00 0.00 ? 26  GLN D N    1  
ATOM   5195   C CA   . GLN D 2 24  ? -27.964 -10.253 -16.642 1.00 0.00 ? 26  GLN D CA   1  
ATOM   5196   C C    . GLN D 2 24  ? -28.724 -9.134  -17.319 1.00 0.00 ? 26  GLN D C    1  
ATOM   5197   O O    . GLN D 2 24  ? -29.752 -9.376  -17.952 1.00 0.00 ? 26  GLN D O    1  
ATOM   5198   C CB   . GLN D 2 24  ? -28.291 -10.268 -15.161 1.00 0.00 ? 26  GLN D CB   1  
ATOM   5199   C CG   . GLN D 2 24  ? -27.837 -11.533 -14.493 1.00 0.00 ? 26  GLN D CG   1  
ATOM   5200   C CD   . GLN D 2 24  ? -28.449 -12.745 -15.145 1.00 0.00 ? 26  GLN D CD   1  
ATOM   5201   O OE1  . GLN D 2 24  ? -29.572 -12.689 -15.628 1.00 0.00 ? 26  GLN D OE1  1  
ATOM   5202   N NE2  . GLN D 2 24  ? -27.723 -13.846 -15.157 1.00 0.00 ? 26  GLN D NE2  1  
ATOM   5203   H H    . GLN D 2 24  ? -25.963 -9.964  -16.052 1.00 0.00 ? 26  GLN D H    1  
ATOM   5204   H HA   . GLN D 2 24  ? -28.295 -11.188 -17.069 1.00 0.00 ? 26  GLN D HA   1  
ATOM   5205   H HB2  . GLN D 2 24  ? -27.802 -9.430  -14.686 1.00 0.00 ? 26  GLN D HB2  1  
ATOM   5206   H HB3  . GLN D 2 24  ? -29.358 -10.167 -15.038 1.00 0.00 ? 26  GLN D HB3  1  
ATOM   5207   H HG2  . GLN D 2 24  ? -26.762 -11.602 -14.559 1.00 0.00 ? 26  GLN D HG2  1  
ATOM   5208   H HG3  . GLN D 2 24  ? -28.125 -11.507 -13.453 1.00 0.00 ? 26  GLN D HG3  1  
ATOM   5209   H HE21 . GLN D 2 24  ? -26.888 -13.665 -14.720 1.00 0.00 ? 26  GLN D HE21 1  
ATOM   5210   H HE22 . GLN D 2 24  ? -27.921 -14.723 -15.517 1.00 0.00 ? 26  GLN D HE22 1  
ATOM   5211   N N    . ALA D 2 25  ? -28.214 -7.911  -17.197 1.00 0.00 ? 27  ALA D N    1  
ATOM   5212   C CA   . ALA D 2 25  ? -28.861 -6.764  -17.816 1.00 0.00 ? 27  ALA D CA   1  
ATOM   5213   C C    . ALA D 2 25  ? -28.911 -6.933  -19.333 1.00 0.00 ? 27  ALA D C    1  
ATOM   5214   O O    . ALA D 2 25  ? -29.858 -6.487  -19.980 1.00 0.00 ? 27  ALA D O    1  
ATOM   5215   C CB   . ALA D 2 25  ? -28.139 -5.464  -17.437 1.00 0.00 ? 27  ALA D CB   1  
ATOM   5216   H H    . ALA D 2 25  ? -27.389 -7.783  -16.685 1.00 0.00 ? 27  ALA D H    1  
ATOM   5217   H HA   . ALA D 2 25  ? -29.886 -6.711  -17.477 1.00 0.00 ? 27  ALA D HA   1  
ATOM   5218   H HB1  . ALA D 2 25  ? -28.088 -5.379  -16.361 1.00 0.00 ? 27  ALA D HB1  1  
ATOM   5219   H HB2  . ALA D 2 25  ? -27.140 -5.477  -17.846 1.00 0.00 ? 27  ALA D HB2  1  
ATOM   5220   H HB3  . ALA D 2 25  ? -28.682 -4.622  -17.841 1.00 0.00 ? 27  ALA D HB3  1  
ATOM   5221   N N    . GLU D 2 26  ? -27.898 -7.579  -19.902 1.00 0.00 ? 28  GLU D N    1  
ATOM   5222   C CA   . GLU D 2 26  ? -27.835 -7.800  -21.347 1.00 0.00 ? 28  GLU D CA   1  
ATOM   5223   C C    . GLU D 2 26  ? -28.826 -8.885  -21.754 1.00 0.00 ? 28  GLU D C    1  
ATOM   5224   O O    . GLU D 2 26  ? -29.569 -8.738  -22.724 1.00 0.00 ? 28  GLU D O    1  
ATOM   5225   C CB   . GLU D 2 26  ? -26.419 -8.203  -21.746 1.00 0.00 ? 28  GLU D CB   1  
ATOM   5226   C CG   . GLU D 2 26  ? -26.129 -8.116  -23.232 1.00 0.00 ? 28  GLU D CG   1  
ATOM   5227   C CD   . GLU D 2 26  ? -26.287 -6.712  -23.821 1.00 0.00 ? 28  GLU D CD   1  
ATOM   5228   O OE1  . GLU D 2 26  ? -25.996 -5.698  -23.142 1.00 0.00 ? 28  GLU D OE1  1  
ATOM   5229   O OE2  . GLU D 2 26  ? -26.684 -6.634  -25.000 1.00 0.00 ? 28  GLU D OE2  1  
ATOM   5230   H H    . GLU D 2 26  ? -27.171 -7.918  -19.337 1.00 0.00 ? 28  GLU D H    1  
ATOM   5231   H HA   . GLU D 2 26  ? -28.109 -6.891  -21.862 1.00 0.00 ? 28  GLU D HA   1  
ATOM   5232   H HB2  . GLU D 2 26  ? -25.727 -7.555  -21.231 1.00 0.00 ? 28  GLU D HB2  1  
ATOM   5233   H HB3  . GLU D 2 26  ? -26.258 -9.223  -21.430 1.00 0.00 ? 28  GLU D HB3  1  
ATOM   5234   H HG2  . GLU D 2 26  ? -25.114 -8.442  -23.397 1.00 0.00 ? 28  GLU D HG2  1  
ATOM   5235   H HG3  . GLU D 2 26  ? -26.807 -8.779  -23.749 1.00 0.00 ? 28  GLU D HG3  1  
ATOM   5236   N N    . LYS D 2 27  ? -28.855 -9.957  -20.972 1.00 0.00 ? 29  LYS D N    1  
ATOM   5237   C CA   . LYS D 2 27  ? -29.744 -11.074 -21.223 1.00 0.00 ? 29  LYS D CA   1  
ATOM   5238   C C    . LYS D 2 27  ? -31.214 -10.634 -21.250 1.00 0.00 ? 29  LYS D C    1  
ATOM   5239   O O    . LYS D 2 27  ? -31.985 -11.109 -22.091 1.00 0.00 ? 29  LYS D O    1  
ATOM   5240   C CB   . LYS D 2 27  ? -29.529 -12.161 -20.172 1.00 0.00 ? 29  LYS D CB   1  
ATOM   5241   C CG   . LYS D 2 27  ? -30.375 -13.400 -20.390 1.00 0.00 ? 29  LYS D CG   1  
ATOM   5242   C CD   . LYS D 2 27  ? -30.026 -14.509 -19.393 1.00 0.00 ? 29  LYS D CD   1  
ATOM   5243   C CE   . LYS D 2 27  ? -31.065 -15.640 -19.396 1.00 0.00 ? 29  LYS D CE   1  
ATOM   5244   N NZ   . LYS D 2 27  ? -31.293 -16.180 -20.771 1.00 0.00 ? 29  LYS D NZ   1  
ATOM   5245   H H    . LYS D 2 27  ? -28.255 -9.995  -20.199 1.00 0.00 ? 29  LYS D H    1  
ATOM   5246   H HA   . LYS D 2 27  ? -29.542 -11.479 -22.203 1.00 0.00 ? 29  LYS D HA   1  
ATOM   5247   H HB2  . LYS D 2 27  ? -28.489 -12.450 -20.194 1.00 0.00 ? 29  LYS D HB2  1  
ATOM   5248   H HB3  . LYS D 2 27  ? -29.768 -11.752 -19.203 1.00 0.00 ? 29  LYS D HB3  1  
ATOM   5249   H HG2  . LYS D 2 27  ? -31.416 -13.138 -20.272 1.00 0.00 ? 29  LYS D HG2  1  
ATOM   5250   H HG3  . LYS D 2 27  ? -30.210 -13.767 -21.392 1.00 0.00 ? 29  LYS D HG3  1  
ATOM   5251   H HD2  . LYS D 2 27  ? -29.063 -14.921 -19.654 1.00 0.00 ? 29  LYS D HD2  1  
ATOM   5252   H HD3  . LYS D 2 27  ? -29.979 -14.085 -18.403 1.00 0.00 ? 29  LYS D HD3  1  
ATOM   5253   H HE2  . LYS D 2 27  ? -30.712 -16.440 -18.761 1.00 0.00 ? 29  LYS D HE2  1  
ATOM   5254   H HE3  . LYS D 2 27  ? -31.998 -15.258 -19.010 1.00 0.00 ? 29  LYS D HE3  1  
ATOM   5255   H HZ1  . LYS D 2 27  ? -31.428 -15.391 -21.436 1.00 0.00 ? 29  LYS D HZ1  1  
ATOM   5256   H HZ2  . LYS D 2 27  ? -30.468 -16.742 -21.064 1.00 0.00 ? 29  LYS D HZ2  1  
ATOM   5257   H HZ3  . LYS D 2 27  ? -32.138 -16.783 -20.770 1.00 0.00 ? 29  LYS D HZ3  1  
ATOM   5258   N N    . TYR D 2 28  ? -31.608 -9.729  -20.348 1.00 0.00 ? 30  TYR D N    1  
ATOM   5259   C CA   . TYR D 2 28  ? -33.005 -9.244  -20.299 1.00 0.00 ? 30  TYR D CA   1  
ATOM   5260   C C    . TYR D 2 28  ? -33.248 -7.848  -20.869 1.00 0.00 ? 30  TYR D C    1  
ATOM   5261   O O    . TYR D 2 28  ? -34.295 -7.251  -20.615 1.00 0.00 ? 30  TYR D O    1  
ATOM   5262   C CB   . TYR D 2 28  ? -33.569 -9.320  -18.873 1.00 0.00 ? 30  TYR D CB   1  
ATOM   5263   C CG   . TYR D 2 28  ? -33.566 -10.713 -18.308 1.00 0.00 ? 30  TYR D CG   1  
ATOM   5264   C CD1  . TYR D 2 28  ? -32.475 -11.176 -17.594 1.00 0.00 ? 30  TYR D CD1  1  
ATOM   5265   C CD2  . TYR D 2 28  ? -34.612 -11.597 -18.550 1.00 0.00 ? 30  TYR D CD2  1  
ATOM   5266   C CE1  . TYR D 2 28  ? -32.414 -12.474 -17.142 1.00 0.00 ? 30  TYR D CE1  1  
ATOM   5267   C CE2  . TYR D 2 28  ? -34.558 -12.905 -18.099 1.00 0.00 ? 30  TYR D CE2  1  
ATOM   5268   C CZ   . TYR D 2 28  ? -33.450 -13.335 -17.394 1.00 0.00 ? 30  TYR D CZ   1  
ATOM   5269   O OH   . TYR D 2 28  ? -33.362 -14.621 -16.934 1.00 0.00 ? 30  TYR D OH   1  
ATOM   5270   H H    . TYR D 2 28  ? -30.956 -9.380  -19.706 1.00 0.00 ? 30  TYR D H    1  
ATOM   5271   H HA   . TYR D 2 28  ? -33.612 -9.852  -20.951 1.00 0.00 ? 30  TYR D HA   1  
ATOM   5272   H HB2  . TYR D 2 28  ? -32.974 -8.688  -18.231 1.00 0.00 ? 30  TYR D HB2  1  
ATOM   5273   H HB3  . TYR D 2 28  ? -34.588 -8.959  -18.887 1.00 0.00 ? 30  TYR D HB3  1  
ATOM   5274   H HD1  . TYR D 2 28  ? -31.655 -10.504 -17.389 1.00 0.00 ? 30  TYR D HD1  1  
ATOM   5275   H HD2  . TYR D 2 28  ? -35.480 -11.259 -19.098 1.00 0.00 ? 30  TYR D HD2  1  
ATOM   5276   H HE1  . TYR D 2 28  ? -31.549 -12.816 -16.591 1.00 0.00 ? 30  TYR D HE1  1  
ATOM   5277   H HE2  . TYR D 2 28  ? -35.374 -13.585 -18.298 1.00 0.00 ? 30  TYR D HE2  1  
ATOM   5278   H HH   . TYR D 2 28  ? -33.168 -15.190 -17.683 1.00 0.00 ? 30  TYR D HH   1  
ATOM   5279   N N    . GLU D 2 29  ? -32.278 -7.324  -21.613 1.00 0.00 ? 31  GLU D N    1  
ATOM   5280   C CA   . GLU D 2 29  ? -32.379 -5.998  -22.240 1.00 0.00 ? 31  GLU D CA   1  
ATOM   5281   C C    . GLU D 2 29  ? -32.748 -4.840  -21.306 1.00 0.00 ? 31  GLU D C    1  
ATOM   5282   O O    . GLU D 2 29  ? -33.502 -3.952  -21.681 1.00 0.00 ? 31  GLU D O    1  
ATOM   5283   C CB   . GLU D 2 29  ? -33.335 -6.054  -23.433 1.00 0.00 ? 31  GLU D CB   1  
ATOM   5284   C CG   . GLU D 2 29  ? -32.827 -6.955  -24.550 1.00 0.00 ? 31  GLU D CG   1  
ATOM   5285   C CD   . GLU D 2 29  ? -33.868 -7.222  -25.621 1.00 0.00 ? 31  GLU D CD   1  
ATOM   5286   O OE1  . GLU D 2 29  ? -34.344 -6.252  -26.255 1.00 0.00 ? 31  GLU D OE1  1  
ATOM   5287   O OE2  . GLU D 2 29  ? -34.202 -8.408  -25.827 1.00 0.00 ? 31  GLU D OE2  1  
ATOM   5288   H H    . GLU D 2 29  ? -31.461 -7.844  -21.751 1.00 0.00 ? 31  GLU D H    1  
ATOM   5289   H HA   . GLU D 2 29  ? -31.402 -5.688  -22.577 1.00 0.00 ? 31  GLU D HA   1  
ATOM   5290   H HB2  . GLU D 2 29  ? -34.290 -6.428  -23.094 1.00 0.00 ? 31  GLU D HB2  1  
ATOM   5291   H HB3  . GLU D 2 29  ? -33.459 -5.055  -23.825 1.00 0.00 ? 31  GLU D HB3  1  
ATOM   5292   H HG2  . GLU D 2 29  ? -31.972 -6.483  -25.011 1.00 0.00 ? 31  GLU D HG2  1  
ATOM   5293   H HG3  . GLU D 2 29  ? -32.527 -7.900  -24.121 1.00 0.00 ? 31  GLU D HG3  1  
ATOM   5294   N N    . VAL D 2 30  ? -32.200 -4.845  -20.096 1.00 0.00 ? 32  VAL D N    1  
ATOM   5295   C CA   . VAL D 2 30  ? -32.452 -3.779  -19.131 1.00 0.00 ? 32  VAL D CA   1  
ATOM   5296   C C    . VAL D 2 30  ? -31.503 -2.646  -19.520 1.00 0.00 ? 32  VAL D C    1  
ATOM   5297   O O    . VAL D 2 30  ? -30.300 -2.854  -19.651 1.00 0.00 ? 32  VAL D O    1  
ATOM   5298   C CB   . VAL D 2 30  ? -32.148 -4.252  -17.697 1.00 0.00 ? 32  VAL D CB   1  
ATOM   5299   C CG1  . VAL D 2 30  ? -32.537 -3.193  -16.691 1.00 0.00 ? 32  VAL D CG1  1  
ATOM   5300   C CG2  . VAL D 2 30  ? -32.866 -5.572  -17.413 1.00 0.00 ? 32  VAL D CG2  1  
ATOM   5301   H H    . VAL D 2 30  ? -31.608 -5.584  -19.846 1.00 0.00 ? 32  VAL D H    1  
ATOM   5302   H HA   . VAL D 2 30  ? -33.489 -3.486  -19.195 1.00 0.00 ? 32  VAL D HA   1  
ATOM   5303   H HB   . VAL D 2 30  ? -31.092 -4.456  -17.607 1.00 0.00 ? 32  VAL D HB   1  
ATOM   5304   H HG11 . VAL D 2 30  ? -33.477 -2.747  -16.983 1.00 0.00 ? 32  VAL D HG11 1  
ATOM   5305   H HG12 . VAL D 2 30  ? -32.638 -3.643  -15.716 1.00 0.00 ? 32  VAL D HG12 1  
ATOM   5306   H HG13 . VAL D 2 30  ? -31.774 -2.429  -16.660 1.00 0.00 ? 32  VAL D HG13 1  
ATOM   5307   H HG21 . VAL D 2 30  ? -32.843 -6.193  -18.296 1.00 0.00 ? 32  VAL D HG21 1  
ATOM   5308   H HG22 . VAL D 2 30  ? -32.371 -6.082  -16.601 1.00 0.00 ? 32  VAL D HG22 1  
ATOM   5309   H HG23 . VAL D 2 30  ? -33.893 -5.372  -17.140 1.00 0.00 ? 32  VAL D HG23 1  
ATOM   5310   N N    . PRO D 2 31  ? -32.043 -1.444  -19.773 1.00 0.00 ? 33  PRO D N    1  
ATOM   5311   C CA   . PRO D 2 31  ? -31.254 -0.266  -20.162 1.00 0.00 ? 33  PRO D CA   1  
ATOM   5312   C C    . PRO D 2 31  ? -30.542 0.430   -18.998 1.00 0.00 ? 33  PRO D C    1  
ATOM   5313   O O    . PRO D 2 31  ? -30.915 1.537   -18.576 1.00 0.00 ? 33  PRO D O    1  
ATOM   5314   C CB   . PRO D 2 31  ? -32.300 0.637   -20.810 1.00 0.00 ? 33  PRO D CB   1  
ATOM   5315   C CG   . PRO D 2 31  ? -33.506 0.360   -19.977 1.00 0.00 ? 33  PRO D CG   1  
ATOM   5316   C CD   . PRO D 2 31  ? -33.481 -1.136  -19.770 1.00 0.00 ? 33  PRO D CD   1  
ATOM   5317   H HA   . PRO D 2 31  ? -30.480 -0.533  -20.866 1.00 0.00 ? 33  PRO D HA   1  
ATOM   5318   H HB2  . PRO D 2 31  ? -32.012 1.676   -20.749 1.00 0.00 ? 33  PRO D HB2  1  
ATOM   5319   H HB3  . PRO D 2 31  ? -32.466 0.368   -21.842 1.00 0.00 ? 33  PRO D HB3  1  
ATOM   5320   H HG2  . PRO D 2 31  ? -33.445 0.880   -19.032 1.00 0.00 ? 33  PRO D HG2  1  
ATOM   5321   H HG3  . PRO D 2 31  ? -34.405 0.660   -20.496 1.00 0.00 ? 33  PRO D HG3  1  
ATOM   5322   H HD2  . PRO D 2 31  ? -33.933 -1.406  -18.826 1.00 0.00 ? 33  PRO D HD2  1  
ATOM   5323   H HD3  . PRO D 2 31  ? -33.989 -1.650  -20.572 1.00 0.00 ? 33  PRO D HD3  1  
ATOM   5324   N N    . VAL D 2 32  ? -29.482 -0.210  -18.513 1.00 0.00 ? 34  VAL D N    1  
ATOM   5325   C CA   . VAL D 2 32  ? -28.711 0.324   -17.404 1.00 0.00 ? 34  VAL D CA   1  
ATOM   5326   C C    . VAL D 2 32  ? -27.206 0.266   -17.638 1.00 0.00 ? 34  VAL D C    1  
ATOM   5327   O O    . VAL D 2 32  ? -26.712 -0.535  -18.443 1.00 0.00 ? 34  VAL D O    1  
ATOM   5328   C CB   . VAL D 2 32  ? -29.021 -0.434  -16.116 1.00 0.00 ? 34  VAL D CB   1  
ATOM   5329   C CG1  . VAL D 2 32  ? -30.463 -0.205  -15.708 1.00 0.00 ? 34  VAL D CG1  1  
ATOM   5330   C CG2  . VAL D 2 32  ? -28.731 -1.910  -16.292 1.00 0.00 ? 34  VAL D CG2  1  
ATOM   5331   H H    . VAL D 2 32  ? -29.215 -1.063  -18.914 1.00 0.00 ? 34  VAL D H    1  
ATOM   5332   H HA   . VAL D 2 32  ? -28.958 1.367   -17.269 1.00 0.00 ? 34  VAL D HA   1  
ATOM   5333   H HB   . VAL D 2 32  ? -28.367 -0.085  -15.329 1.00 0.00 ? 34  VAL D HB   1  
ATOM   5334   H HG11 . VAL D 2 32  ? -31.092 -0.226  -16.585 1.00 0.00 ? 34  VAL D HG11 1  
ATOM   5335   H HG12 . VAL D 2 32  ? -30.771 -0.981  -15.024 1.00 0.00 ? 34  VAL D HG12 1  
ATOM   5336   H HG13 . VAL D 2 32  ? -30.551 0.758   -15.224 1.00 0.00 ? 34  VAL D HG13 1  
ATOM   5337   H HG21 . VAL D 2 32  ? -28.528 -2.116  -17.334 1.00 0.00 ? 34  VAL D HG21 1  
ATOM   5338   H HG22 . VAL D 2 32  ? -27.870 -2.181  -15.699 1.00 0.00 ? 34  VAL D HG22 1  
ATOM   5339   H HG23 . VAL D 2 32  ? -29.585 -2.485  -15.970 1.00 0.00 ? 34  VAL D HG23 1  
ATOM   5340   N N    . ILE D 2 33  ? -26.500 1.167   -16.968 1.00 0.00 ? 35  ILE D N    1  
ATOM   5341   C CA   . ILE D 2 33  ? -25.045 1.244   -16.983 1.00 0.00 ? 35  ILE D CA   1  
ATOM   5342   C C    . ILE D 2 33  ? -24.680 0.953   -15.512 1.00 0.00 ? 35  ILE D C    1  
ATOM   5343   O O    . ILE D 2 33  ? -25.220 1.591   -14.596 1.00 0.00 ? 35  ILE D O    1  
ATOM   5344   C CB   . ILE D 2 33  ? -24.531 2.644   -17.398 1.00 0.00 ? 35  ILE D CB   1  
ATOM   5345   C CG1  . ILE D 2 33  ? -24.694 2.842   -18.907 1.00 0.00 ? 35  ILE D CG1  1  
ATOM   5346   C CG2  . ILE D 2 33  ? -23.051 2.816   -17.000 1.00 0.00 ? 35  ILE D CG2  1  
ATOM   5347   C CD1  . ILE D 2 33  ? -24.261 4.211   -19.373 1.00 0.00 ? 35  ILE D CD1  1  
ATOM   5348   H H    . ILE D 2 33  ? -26.987 1.823   -16.426 1.00 0.00 ? 35  ILE D H    1  
ATOM   5349   H HA   . ILE D 2 33  ? -24.668 0.515   -17.683 1.00 0.00 ? 35  ILE D HA   1  
ATOM   5350   H HB   . ILE D 2 33  ? -25.098 3.402   -16.877 1.00 0.00 ? 35  ILE D HB   1  
ATOM   5351   H HG12 . ILE D 2 33  ? -24.097 2.101   -19.418 1.00 0.00 ? 35  ILE D HG12 1  
ATOM   5352   H HG13 . ILE D 2 33  ? -25.734 2.706   -19.162 1.00 0.00 ? 35  ILE D HG13 1  
ATOM   5353   H HG21 . ILE D 2 33  ? -22.520 1.894   -17.178 1.00 0.00 ? 35  ILE D HG21 1  
ATOM   5354   H HG22 . ILE D 2 33  ? -22.609 3.606   -17.589 1.00 0.00 ? 35  ILE D HG22 1  
ATOM   5355   H HG23 . ILE D 2 33  ? -22.988 3.070   -15.953 1.00 0.00 ? 35  ILE D HG23 1  
ATOM   5356   H HD11 . ILE D 2 33  ? -24.356 4.915   -18.562 1.00 0.00 ? 35  ILE D HD11 1  
ATOM   5357   H HD12 . ILE D 2 33  ? -23.231 4.172   -19.699 1.00 0.00 ? 35  ILE D HD12 1  
ATOM   5358   H HD13 . ILE D 2 33  ? -24.886 4.524   -20.198 1.00 0.00 ? 35  ILE D HD13 1  
ATOM   5359   N N    . ILE D 2 34  ? -23.806 -0.034  -15.300 1.00 0.00 ? 36  ILE D N    1  
ATOM   5360   C CA   . ILE D 2 34  ? -23.375 -0.468  -13.960 1.00 0.00 ? 36  ILE D CA   1  
ATOM   5361   C C    . ILE D 2 34  ? -21.852 -0.279  -13.783 1.00 0.00 ? 36  ILE D C    1  
ATOM   5362   O O    . ILE D 2 34  ? -21.077 -0.757  -14.608 1.00 0.00 ? 36  ILE D O    1  
ATOM   5363   C CB   . ILE D 2 34  ? -23.722 -1.965  -13.757 1.00 0.00 ? 36  ILE D CB   1  
ATOM   5364   C CG1  . ILE D 2 34  ? -25.149 -2.239  -14.256 1.00 0.00 ? 36  ILE D CG1  1  
ATOM   5365   C CG2  . ILE D 2 34  ? -23.587 -2.350  -12.280 1.00 0.00 ? 36  ILE D CG2  1  
ATOM   5366   C CD1  . ILE D 2 34  ? -25.477 -3.698  -14.390 1.00 0.00 ? 36  ILE D CD1  1  
ATOM   5367   H H    . ILE D 2 34  ? -23.430 -0.494  -16.079 1.00 0.00 ? 36  ILE D H    1  
ATOM   5368   H HA   . ILE D 2 34  ? -23.881 0.121   -13.211 1.00 0.00 ? 36  ILE D HA   1  
ATOM   5369   H HB   . ILE D 2 34  ? -23.025 -2.575  -14.314 1.00 0.00 ? 36  ILE D HB   1  
ATOM   5370   H HG12 . ILE D 2 34  ? -25.842 -1.796  -13.556 1.00 0.00 ? 36  ILE D HG12 1  
ATOM   5371   H HG13 . ILE D 2 34  ? -25.267 -1.772  -15.224 1.00 0.00 ? 36  ILE D HG13 1  
ATOM   5372   H HG21 . ILE D 2 34  ? -22.786 -1.783  -11.832 1.00 0.00 ? 36  ILE D HG21 1  
ATOM   5373   H HG22 . ILE D 2 34  ? -24.513 -2.132  -11.764 1.00 0.00 ? 36  ILE D HG22 1  
ATOM   5374   H HG23 . ILE D 2 34  ? -23.371 -3.405  -12.200 1.00 0.00 ? 36  ILE D HG23 1  
ATOM   5375   H HD11 . ILE D 2 34  ? -24.777 -4.278  -13.807 1.00 0.00 ? 36  ILE D HD11 1  
ATOM   5376   H HD12 . ILE D 2 34  ? -26.479 -3.875  -14.030 1.00 0.00 ? 36  ILE D HD12 1  
ATOM   5377   H HD13 . ILE D 2 34  ? -25.410 -3.988  -15.427 1.00 0.00 ? 36  ILE D HD13 1  
ATOM   5378   N N    . GLU D 2 35  ? -21.438 0.418   -12.725 1.00 0.00 ? 37  GLU D N    1  
ATOM   5379   C CA   . GLU D 2 35  ? -20.018 0.683   -12.442 1.00 0.00 ? 37  GLU D CA   1  
ATOM   5380   C C    . GLU D 2 35  ? -19.744 0.503   -10.944 1.00 0.00 ? 37  GLU D C    1  
ATOM   5381   O O    . GLU D 2 35  ? -20.625 0.750   -10.118 1.00 0.00 ? 37  GLU D O    1  
ATOM   5382   C CB   . GLU D 2 35  ? -19.655 2.110   -12.858 1.00 0.00 ? 37  GLU D CB   1  
ATOM   5383   C CG   . GLU D 2 35  ? -19.714 2.223   -14.382 1.00 0.00 ? 37  GLU D CG   1  
ATOM   5384   C CD   . GLU D 2 35  ? -19.200 3.587   -14.827 1.00 0.00 ? 37  GLU D CD   1  
ATOM   5385   O OE1  . GLU D 2 35  ? -19.550 4.568   -14.191 1.00 0.00 ? 37  GLU D OE1  1  
ATOM   5386   O OE2  . GLU D 2 35  ? -18.458 3.630   -15.795 1.00 0.00 ? 37  GLU D OE2  1  
ATOM   5387   H H    . GLU D 2 35  ? -22.109 0.770   -12.104 1.00 0.00 ? 37  GLU D H    1  
ATOM   5388   H HA   . GLU D 2 35  ? -19.409 0.000   -13.014 1.00 0.00 ? 37  GLU D HA   1  
ATOM   5389   H HB2  . GLU D 2 35  ? -20.358 2.801   -12.417 1.00 0.00 ? 37  GLU D HB2  1  
ATOM   5390   H HB3  . GLU D 2 35  ? -18.657 2.342   -12.519 1.00 0.00 ? 37  GLU D HB3  1  
ATOM   5391   H HG2  . GLU D 2 35  ? -19.106 1.447   -14.824 1.00 0.00 ? 37  GLU D HG2  1  
ATOM   5392   H HG3  . GLU D 2 35  ? -20.737 2.104   -14.709 1.00 0.00 ? 37  GLU D HG3  1  
ATOM   5393   N N    . ALA D 2 36  ? -18.544 0.019   -10.609 1.00 0.00 ? 38  ALA D N    1  
ATOM   5394   C CA   . ALA D 2 36  ? -18.111 -0.173  -9.216  1.00 0.00 ? 38  ALA D CA   1  
ATOM   5395   C C    . ALA D 2 36  ? -17.039 0.894   -8.928  1.00 0.00 ? 38  ALA D C    1  
ATOM   5396   O O    . ALA D 2 36  ? -16.227 1.210   -9.796  1.00 0.00 ? 38  ALA D O    1  
ATOM   5397   C CB   . ALA D 2 36  ? -17.527 -1.572  -9.023  1.00 0.00 ? 38  ALA D CB   1  
ATOM   5398   H H    . ALA D 2 36  ? -17.923 -0.220  -11.329 1.00 0.00 ? 38  ALA D H    1  
ATOM   5399   H HA   . ALA D 2 36  ? -18.961 -0.049  -8.559  1.00 0.00 ? 38  ALA D HA   1  
ATOM   5400   H HB1  . ALA D 2 36  ? -17.224 -1.971  -9.980  1.00 0.00 ? 38  ALA D HB1  1  
ATOM   5401   H HB2  . ALA D 2 36  ? -16.669 -1.516  -8.369  1.00 0.00 ? 38  ALA D HB2  1  
ATOM   5402   H HB3  . ALA D 2 36  ? -18.274 -2.217  -8.584  1.00 0.00 ? 38  ALA D HB3  1  
ATOM   5403   N N    . PHE D 2 37  ? -17.051 1.455   -7.729  1.00 0.00 ? 39  PHE D N    1  
ATOM   5404   C CA   . PHE D 2 37  ? -16.084 2.468   -7.331  1.00 0.00 ? 39  PHE D CA   1  
ATOM   5405   C C    . PHE D 2 37  ? -15.745 2.256   -5.865  1.00 0.00 ? 39  PHE D C    1  
ATOM   5406   O O    . PHE D 2 37  ? -16.451 1.519   -5.148  1.00 0.00 ? 39  PHE D O    1  
ATOM   5407   C CB   . PHE D 2 37  ? -16.760 3.844   -7.470  1.00 0.00 ? 39  PHE D CB   1  
ATOM   5408   C CG   . PHE D 2 37  ? -16.976 4.203   -8.919  1.00 0.00 ? 39  PHE D CG   1  
ATOM   5409   C CD1  . PHE D 2 37  ? -18.270 4.177   -9.452  1.00 0.00 ? 39  PHE D CD1  1  
ATOM   5410   C CD2  . PHE D 2 37  ? -15.895 4.585   -9.722  1.00 0.00 ? 39  PHE D CD2  1  
ATOM   5411   C CE1  . PHE D 2 37  ? -18.485 4.528   -10.788 1.00 0.00 ? 39  PHE D CE1  1  
ATOM   5412   C CE2  . PHE D 2 37  ? -16.111 4.939   -11.060 1.00 0.00 ? 39  PHE D CE2  1  
ATOM   5413   C CZ   . PHE D 2 37  ? -17.406 4.911   -11.593 1.00 0.00 ? 39  PHE D CZ   1  
ATOM   5414   H H    . PHE D 2 37  ? -17.736 1.177   -7.086  1.00 0.00 ? 39  PHE D H    1  
ATOM   5415   H HA   . PHE D 2 37  ? -15.223 2.406   -7.979  1.00 0.00 ? 39  PHE D HA   1  
ATOM   5416   H HB2  . PHE D 2 37  ? -17.721 3.809   -6.978  1.00 0.00 ? 39  PHE D HB2  1  
ATOM   5417   H HB3  . PHE D 2 37  ? -16.162 4.601   -7.000  1.00 0.00 ? 39  PHE D HB3  1  
ATOM   5418   H HD1  . PHE D 2 37  ? -19.103 3.881   -8.831  1.00 0.00 ? 39  PHE D HD1  1  
ATOM   5419   H HD2  . PHE D 2 37  ? -14.897 4.605   -9.312  1.00 0.00 ? 39  PHE D HD2  1  
ATOM   5420   H HE1  . PHE D 2 37  ? -19.483 4.508   -11.197 1.00 0.00 ? 39  PHE D HE1  1  
ATOM   5421   H HE2  . PHE D 2 37  ? -15.278 5.235   -11.681 1.00 0.00 ? 39  PHE D HE2  1  
ATOM   5422   H HZ   . PHE D 2 37  ? -17.572 5.185   -12.624 1.00 0.00 ? 39  PHE D HZ   1  
ATOM   5423   N N    . PRO D 2 38  ? -14.615 2.827   -5.418  1.00 0.00 ? 40  PRO D N    1  
ATOM   5424   C CA   . PRO D 2 38  ? -14.228 2.697   -4.013  1.00 0.00 ? 40  PRO D CA   1  
ATOM   5425   C C    . PRO D 2 38  ? -15.141 3.674   -3.251  1.00 0.00 ? 40  PRO D C    1  
ATOM   5426   O O    . PRO D 2 38  ? -15.605 4.661   -3.819  1.00 0.00 ? 40  PRO D O    1  
ATOM   5427   C CB   . PRO D 2 38  ? -12.773 3.172   -3.989  1.00 0.00 ? 40  PRO D CB   1  
ATOM   5428   C CG   . PRO D 2 38  ? -12.660 4.116   -5.131  1.00 0.00 ? 40  PRO D CG   1  
ATOM   5429   C CD   . PRO D 2 38  ? -13.625 3.601   -6.198  1.00 0.00 ? 40  PRO D CD   1  
ATOM   5430   H HA   . PRO D 2 38  ? -14.285 1.669   -3.690  1.00 0.00 ? 40  PRO D HA   1  
ATOM   5431   H HB2  . PRO D 2 38  ? -12.559 3.677   -3.057  1.00 0.00 ? 40  PRO D HB2  1  
ATOM   5432   H HB3  . PRO D 2 38  ? -12.102 2.338   -4.130  1.00 0.00 ? 40  PRO D HB3  1  
ATOM   5433   H HG2  . PRO D 2 38  ? -12.941 5.113   -4.818  1.00 0.00 ? 40  PRO D HG2  1  
ATOM   5434   H HG3  . PRO D 2 38  ? -11.655 4.113   -5.516  1.00 0.00 ? 40  PRO D HG3  1  
ATOM   5435   H HD2  . PRO D 2 38  ? -14.081 4.426   -6.713  1.00 0.00 ? 40  PRO D HD2  1  
ATOM   5436   H HD3  . PRO D 2 38  ? -13.111 2.956   -6.893  1.00 0.00 ? 40  PRO D HD3  1  
ATOM   5437   N N    . GLU D 2 39  ? -15.350 3.425   -1.966  1.00 0.00 ? 41  GLU D N    1  
ATOM   5438   C CA   . GLU D 2 39  ? -16.193 4.276   -1.132  1.00 0.00 ? 41  GLU D CA   1  
ATOM   5439   C C    . GLU D 2 39  ? -15.752 5.735   -1.082  1.00 0.00 ? 41  GLU D C    1  
ATOM   5440   O O    . GLU D 2 39  ? -16.561 6.616   -0.801  1.00 0.00 ? 41  GLU D O    1  
ATOM   5441   C CB   . GLU D 2 39  ? -16.332 3.726   0.293   1.00 0.00 ? 41  GLU D CB   1  
ATOM   5442   C CG   . GLU D 2 39  ? -14.954 3.479   0.929   1.00 0.00 ? 41  GLU D CG   1  
ATOM   5443   C CD   . GLU D 2 39  ? -14.773 4.335   2.182   1.00 0.00 ? 41  GLU D CD   1  
ATOM   5444   O OE1  . GLU D 2 39  ? -15.138 5.499   2.141   1.00 0.00 ? 41  GLU D OE1  1  
ATOM   5445   O OE2  . GLU D 2 39  ? -14.278 3.810   3.165   1.00 0.00 ? 41  GLU D OE2  1  
ATOM   5446   H H    . GLU D 2 39  ? -14.921 2.643   -1.563  1.00 0.00 ? 41  GLU D H    1  
ATOM   5447   H HA   . GLU D 2 39  ? -17.187 4.317   -1.553  1.00 0.00 ? 41  GLU D HA   1  
ATOM   5448   H HB2  . GLU D 2 39  ? -16.887 4.437   0.889   1.00 0.00 ? 41  GLU D HB2  1  
ATOM   5449   H HB3  . GLU D 2 39  ? -16.881 2.796   0.255   1.00 0.00 ? 41  GLU D HB3  1  
ATOM   5450   H HG2  . GLU D 2 39  ? -14.885 2.443   1.208   1.00 0.00 ? 41  GLU D HG2  1  
ATOM   5451   H HG3  . GLU D 2 39  ? -14.173 3.714   0.220   1.00 0.00 ? 41  GLU D HG3  1  
ATOM   5452   N N    . THR D 2 40  ? -14.476 6.007   -1.365  1.00 0.00 ? 42  THR D N    1  
ATOM   5453   C CA   . THR D 2 40  ? -13.973 7.378   -1.330  1.00 0.00 ? 42  THR D CA   1  
ATOM   5454   C C    . THR D 2 40  ? -14.587 8.292   -2.382  1.00 0.00 ? 42  THR D C    1  
ATOM   5455   O O    . THR D 2 40  ? -14.525 9.510   -2.258  1.00 0.00 ? 42  THR D O    1  
ATOM   5456   C CB   . THR D 2 40  ? -12.445 7.391   -1.445  1.00 0.00 ? 42  THR D CB   1  
ATOM   5457   O OG1  . THR D 2 40  ? -12.067 6.797   -2.679  1.00 0.00 ? 42  THR D OG1  1  
ATOM   5458   C CG2  . THR D 2 40  ? -11.813 6.602   -0.286  1.00 0.00 ? 42  THR D CG2  1  
ATOM   5459   H H    . THR D 2 40  ? -13.868 5.277   -1.600  1.00 0.00 ? 42  THR D H    1  
ATOM   5460   H HA   . THR D 2 40  ? -14.256 7.834   -0.392  1.00 0.00 ? 42  THR D HA   1  
ATOM   5461   H HB   . THR D 2 40  ? -12.093 8.411   -1.417  1.00 0.00 ? 42  THR D HB   1  
ATOM   5462   H HG1  . THR D 2 40  ? -11.386 6.145   -2.498  1.00 0.00 ? 42  THR D HG1  1  
ATOM   5463   H HG21 . THR D 2 40  ? -12.583 6.102   0.285   1.00 0.00 ? 42  THR D HG21 1  
ATOM   5464   H HG22 . THR D 2 40  ? -11.131 5.866   -0.685  1.00 0.00 ? 42  THR D HG22 1  
ATOM   5465   H HG23 . THR D 2 40  ? -11.271 7.279   0.360   1.00 0.00 ? 42  THR D HG23 1  
ATOM   5466   N N    . LEU D 2 41  ? -15.149 7.703   -3.435  1.00 0.00 ? 43  LEU D N    1  
ATOM   5467   C CA   . LEU D 2 41  ? -15.778 8.471   -4.508  1.00 0.00 ? 43  LEU D CA   1  
ATOM   5468   C C    . LEU D 2 41  ? -17.314 8.563   -4.396  1.00 0.00 ? 43  LEU D C    1  
ATOM   5469   O O    . LEU D 2 41  ? -17.944 9.123   -5.287  1.00 0.00 ? 43  LEU D O    1  
ATOM   5470   C CB   . LEU D 2 41  ? -15.395 7.877   -5.870  1.00 0.00 ? 43  LEU D CB   1  
ATOM   5471   C CG   . LEU D 2 41  ? -13.876 7.995   -6.114  1.00 0.00 ? 43  LEU D CG   1  
ATOM   5472   C CD1  . LEU D 2 41  ? -13.471 7.102   -7.308  1.00 0.00 ? 43  LEU D CD1  1  
ATOM   5473   C CD2  . LEU D 2 41  ? -13.491 9.454   -6.426  1.00 0.00 ? 43  LEU D CD2  1  
ATOM   5474   H H    . LEU D 2 41  ? -15.141 6.723   -3.493  1.00 0.00 ? 43  LEU D H    1  
ATOM   5475   H HA   . LEU D 2 41  ? -15.428 9.491   -4.468  1.00 0.00 ? 43  LEU D HA   1  
ATOM   5476   H HB2  . LEU D 2 41  ? -15.678 6.836   -5.896  1.00 0.00 ? 43  LEU D HB2  1  
ATOM   5477   H HB3  . LEU D 2 41  ? -15.920 8.406   -6.645  1.00 0.00 ? 43  LEU D HB3  1  
ATOM   5478   H HG   . LEU D 2 41  ? -13.347 7.665   -5.231  1.00 0.00 ? 43  LEU D HG   1  
ATOM   5479   H HD11 . LEU D 2 41  ? -14.353 6.674   -7.767  1.00 0.00 ? 43  LEU D HD11 1  
ATOM   5480   H HD12 . LEU D 2 41  ? -12.935 7.687   -8.044  1.00 0.00 ? 43  LEU D HD12 1  
ATOM   5481   H HD13 . LEU D 2 41  ? -12.831 6.307   -6.958  1.00 0.00 ? 43  LEU D HD13 1  
ATOM   5482   H HD21 . LEU D 2 41  ? -14.089 9.816   -7.249  1.00 0.00 ? 43  LEU D HD21 1  
ATOM   5483   H HD22 . LEU D 2 41  ? -13.653 10.074  -5.561  1.00 0.00 ? 43  LEU D HD22 1  
ATOM   5484   H HD23 . LEU D 2 41  ? -12.446 9.495   -6.698  1.00 0.00 ? 43  LEU D HD23 1  
ATOM   5485   N N    . ALA D 2 42  ? -17.910 8.042   -3.317  1.00 0.00 ? 44  ALA D N    1  
ATOM   5486   C CA   . ALA D 2 42  ? -19.376 8.044   -3.145  1.00 0.00 ? 44  ALA D CA   1  
ATOM   5487   C C    . ALA D 2 42  ? -20.006 9.418   -3.308  1.00 0.00 ? 44  ALA D C    1  
ATOM   5488   O O    . ALA D 2 42  ? -21.062 9.550   -3.912  1.00 0.00 ? 44  ALA D O    1  
ATOM   5489   C CB   . ALA D 2 42  ? -19.776 7.432   -1.796  1.00 0.00 ? 44  ALA D CB   1  
ATOM   5490   H H    . ALA D 2 42  ? -17.353 7.644   -2.615  1.00 0.00 ? 44  ALA D H    1  
ATOM   5491   H HA   . ALA D 2 42  ? -19.826 7.468   -3.942  1.00 0.00 ? 44  ALA D HA   1  
ATOM   5492   H HB1  . ALA D 2 42  ? -19.134 7.819   -1.020  1.00 0.00 ? 44  ALA D HB1  1  
ATOM   5493   H HB2  . ALA D 2 42  ? -19.677 6.358   -1.843  1.00 0.00 ? 44  ALA D HB2  1  
ATOM   5494   H HB3  . ALA D 2 42  ? -20.803 7.688   -1.574  1.00 0.00 ? 44  ALA D HB3  1  
ATOM   5495   N N    . GLY D 2 43  ? -19.314 10.443  -2.839  1.00 0.00 ? 45  GLY D N    1  
ATOM   5496   C CA   . GLY D 2 43  ? -19.837 11.786  -2.952  1.00 0.00 ? 45  GLY D CA   1  
ATOM   5497   C C    . GLY D 2 43  ? -19.587 12.409  -4.309  1.00 0.00 ? 45  GLY D C    1  
ATOM   5498   O O    . GLY D 2 43  ? -20.415 13.177  -4.801  1.00 0.00 ? 45  GLY D O    1  
ATOM   5499   H H    . GLY D 2 43  ? -18.446 10.290  -2.411  1.00 0.00 ? 45  GLY D H    1  
ATOM   5500   H HA2  . GLY D 2 43  ? -20.902 11.757  -2.779  1.00 0.00 ? 45  GLY D HA2  1  
ATOM   5501   H HA3  . GLY D 2 43  ? -19.366 12.403  -2.200  1.00 0.00 ? 45  GLY D HA3  1  
ATOM   5502   N N    . GLU D 2 44  ? -18.447 12.099  -4.917  1.00 0.00 ? 46  GLU D N    1  
ATOM   5503   C CA   . GLU D 2 44  ? -18.127 12.668  -6.215  1.00 0.00 ? 46  GLU D CA   1  
ATOM   5504   C C    . GLU D 2 44  ? -18.876 11.965  -7.365  1.00 0.00 ? 46  GLU D C    1  
ATOM   5505   O O    . GLU D 2 44  ? -19.530 12.617  -8.186  1.00 0.00 ? 46  GLU D O    1  
ATOM   5506   C CB   . GLU D 2 44  ? -16.613 12.654  -6.457  1.00 0.00 ? 46  GLU D CB   1  
ATOM   5507   C CG   . GLU D 2 44  ? -16.002 13.966  -5.953  1.00 0.00 ? 46  GLU D CG   1  
ATOM   5508   C CD   . GLU D 2 44  ? -14.480 13.877  -5.962  1.00 0.00 ? 46  GLU D CD   1  
ATOM   5509   O OE1  . GLU D 2 44  ? -13.966 12.891  -6.465  1.00 0.00 ? 46  GLU D OE1  1  
ATOM   5510   O OE2  . GLU D 2 44  ? -13.850 14.794  -5.462  1.00 0.00 ? 46  GLU D OE2  1  
ATOM   5511   H H    . GLU D 2 44  ? -17.819 11.482  -4.486  1.00 0.00 ? 46  GLU D H    1  
ATOM   5512   H HA   . GLU D 2 44  ? -18.483 13.686  -6.261  1.00 0.00 ? 46  GLU D HA   1  
ATOM   5513   H HB2  . GLU D 2 44  ? -16.172 11.824  -5.923  1.00 0.00 ? 46  GLU D HB2  1  
ATOM   5514   H HB3  . GLU D 2 44  ? -16.414 12.549  -7.513  1.00 0.00 ? 46  GLU D HB3  1  
ATOM   5515   H HG2  . GLU D 2 44  ? -16.314 14.774  -6.600  1.00 0.00 ? 46  GLU D HG2  1  
ATOM   5516   H HG3  . GLU D 2 44  ? -16.344 14.160  -4.948  1.00 0.00 ? 46  GLU D HG3  1  
ATOM   5517   N N    . LYS D 2 45  ? -18.818 10.634  -7.391  1.00 0.00 ? 47  LYS D N    1  
ATOM   5518   C CA   . LYS D 2 45  ? -19.477 9.845   -8.427  1.00 0.00 ? 47  LYS D CA   1  
ATOM   5519   C C    . LYS D 2 45  ? -20.976 9.659   -8.203  1.00 0.00 ? 47  LYS D C    1  
ATOM   5520   O O    . LYS D 2 45  ? -21.737 9.595   -9.166  1.00 0.00 ? 47  LYS D O    1  
ATOM   5521   C CB   . LYS D 2 45  ? -18.807 8.480   -8.577  1.00 0.00 ? 47  LYS D CB   1  
ATOM   5522   C CG   . LYS D 2 45  ? -17.365 8.646   -9.066  1.00 0.00 ? 47  LYS D CG   1  
ATOM   5523   C CD   . LYS D 2 45  ? -17.346 9.169   -10.506 1.00 0.00 ? 47  LYS D CD   1  
ATOM   5524   C CE   . LYS D 2 45  ? -16.009 8.807   -11.168 1.00 0.00 ? 47  LYS D CE   1  
ATOM   5525   N NZ   . LYS D 2 45  ? -15.579 9.916   -12.065 1.00 0.00 ? 47  LYS D NZ   1  
ATOM   5526   H H    . LYS D 2 45  ? -18.316 10.169  -6.689  1.00 0.00 ? 47  LYS D H    1  
ATOM   5527   H HA   . LYS D 2 45  ? -19.412 10.369  -9.367  1.00 0.00 ? 47  LYS D HA   1  
ATOM   5528   H HB2  . LYS D 2 45  ? -18.804 7.977   -7.621  1.00 0.00 ? 47  LYS D HB2  1  
ATOM   5529   H HB3  . LYS D 2 45  ? -19.359 7.887   -9.291  1.00 0.00 ? 47  LYS D HB3  1  
ATOM   5530   H HG2  . LYS D 2 45  ? -16.855 9.353   -8.431  1.00 0.00 ? 47  LYS D HG2  1  
ATOM   5531   H HG3  . LYS D 2 45  ? -16.858 7.693   -9.025  1.00 0.00 ? 47  LYS D HG3  1  
ATOM   5532   H HD2  . LYS D 2 45  ? -18.158 8.724   -11.063 1.00 0.00 ? 47  LYS D HD2  1  
ATOM   5533   H HD3  . LYS D 2 45  ? -17.459 10.243  -10.500 1.00 0.00 ? 47  LYS D HD3  1  
ATOM   5534   H HE2  . LYS D 2 45  ? -15.255 8.646   -10.410 1.00 0.00 ? 47  LYS D HE2  1  
ATOM   5535   H HE3  . LYS D 2 45  ? -16.132 7.905   -11.749 1.00 0.00 ? 47  LYS D HE3  1  
ATOM   5536   H HZ1  . LYS D 2 45  ? -15.764 10.829  -11.599 1.00 0.00 ? 47  LYS D HZ1  1  
ATOM   5537   H HZ2  . LYS D 2 45  ? -14.562 9.827   -12.262 1.00 0.00 ? 47  LYS D HZ2  1  
ATOM   5538   H HZ3  . LYS D 2 45  ? -16.108 9.867   -12.958 1.00 0.00 ? 47  LYS D HZ3  1  
ATOM   5539   N N    . GLY D 2 46  ? -21.390 9.549   -6.942  1.00 0.00 ? 48  GLY D N    1  
ATOM   5540   C CA   . GLY D 2 46  ? -22.797 9.355   -6.600  1.00 0.00 ? 48  GLY D CA   1  
ATOM   5541   C C    . GLY D 2 46  ? -23.744 10.394  -7.184  1.00 0.00 ? 48  GLY D C    1  
ATOM   5542   O O    . GLY D 2 46  ? -24.893 10.077  -7.504  1.00 0.00 ? 48  GLY D O    1  
ATOM   5543   H H    . GLY D 2 46  ? -20.730 9.600   -6.220  1.00 0.00 ? 48  GLY D H    1  
ATOM   5544   H HA2  . GLY D 2 46  ? -23.099 8.383   -6.963  1.00 0.00 ? 48  GLY D HA2  1  
ATOM   5545   H HA3  . GLY D 2 46  ? -22.889 9.382   -5.525  1.00 0.00 ? 48  GLY D HA3  1  
ATOM   5546   N N    . GLN D 2 47  ? -23.264 11.623  -7.353  1.00 0.00 ? 49  GLN D N    1  
ATOM   5547   C CA   . GLN D 2 47  ? -24.077 12.700  -7.913  1.00 0.00 ? 49  GLN D CA   1  
ATOM   5548   C C    . GLN D 2 47  ? -24.634 12.380  -9.300  1.00 0.00 ? 49  GLN D C    1  
ATOM   5549   O O    . GLN D 2 47  ? -25.621 12.990  -9.730  1.00 0.00 ? 49  GLN D O    1  
ATOM   5550   C CB   . GLN D 2 47  ? -23.255 13.983  -8.017  1.00 0.00 ? 49  GLN D CB   1  
ATOM   5551   C CG   . GLN D 2 47  ? -22.815 14.542  -6.680  1.00 0.00 ? 49  GLN D CG   1  
ATOM   5552   C CD   . GLN D 2 47  ? -21.984 15.816  -6.800  1.00 0.00 ? 49  GLN D CD   1  
ATOM   5553   O OE1  . GLN D 2 47  ? -21.555 16.214  -7.896  1.00 0.00 ? 49  GLN D OE1  1  
ATOM   5554   N NE2  . GLN D 2 47  ? -21.747 16.463  -5.665  1.00 0.00 ? 49  GLN D NE2  1  
ATOM   5555   H H    . GLN D 2 47  ? -22.335 11.810  -7.100  1.00 0.00 ? 49  GLN D H    1  
ATOM   5556   H HA   . GLN D 2 47  ? -24.908 12.887  -7.250  1.00 0.00 ? 49  GLN D HA   1  
ATOM   5557   H HB2  . GLN D 2 47  ? -22.374 13.782  -8.607  1.00 0.00 ? 49  GLN D HB2  1  
ATOM   5558   H HB3  . GLN D 2 47  ? -23.849 14.729  -8.528  1.00 0.00 ? 49  GLN D HB3  1  
ATOM   5559   H HG2  . GLN D 2 47  ? -23.694 14.758  -6.090  1.00 0.00 ? 49  GLN D HG2  1  
ATOM   5560   H HG3  . GLN D 2 47  ? -22.232 13.792  -6.169  1.00 0.00 ? 49  GLN D HG3  1  
ATOM   5561   H HE21 . GLN D 2 47  ? -22.146 16.023  -4.900  1.00 0.00 ? 49  GLN D HE21 1  
ATOM   5562   H HE22 . GLN D 2 47  ? -21.238 17.290  -5.548  1.00 0.00 ? 49  GLN D HE22 1  
ATOM   5563   N N    . ASN D 2 48  ? -23.992 11.460  -10.012 1.00 0.00 ? 50  ASN D N    1  
ATOM   5564   C CA   . ASN D 2 48  ? -24.414 11.106  -11.362 1.00 0.00 ? 50  ASN D CA   1  
ATOM   5565   C C    . ASN D 2 48  ? -25.137 9.784   -11.453 1.00 0.00 ? 50  ASN D C    1  
ATOM   5566   O O    . ASN D 2 48  ? -25.488 9.337   -12.547 1.00 0.00 ? 50  ASN D O    1  
ATOM   5567   C CB   . ASN D 2 48  ? -23.210 11.082  -12.310 1.00 0.00 ? 50  ASN D CB   1  
ATOM   5568   C CG   . ASN D 2 48  ? -22.536 12.429  -12.423 1.00 0.00 ? 50  ASN D CG   1  
ATOM   5569   O OD1  . ASN D 2 48  ? -23.143 13.405  -12.867 1.00 0.00 ? 50  ASN D OD1  1  
ATOM   5570   N ND2  . ASN D 2 48  ? -21.277 12.497  -12.012 1.00 0.00 ? 50  ASN D ND2  1  
ATOM   5571   H H    . ASN D 2 48  ? -23.201 11.025  -9.631  1.00 0.00 ? 50  ASN D H    1  
ATOM   5572   H HA   . ASN D 2 48  ? -25.092 11.869  -11.718 1.00 0.00 ? 50  ASN D HA   1  
ATOM   5573   H HB2  . ASN D 2 48  ? -22.491 10.363  -11.944 1.00 0.00 ? 50  ASN D HB2  1  
ATOM   5574   H HB3  . ASN D 2 48  ? -23.545 10.772  -13.290 1.00 0.00 ? 50  ASN D HB3  1  
ATOM   5575   H HD21 . ASN D 2 48  ? -20.923 11.655  -11.676 1.00 0.00 ? 50  ASN D HD21 1  
ATOM   5576   H HD22 . ASN D 2 48  ? -20.710 13.292  -12.022 1.00 0.00 ? 50  ASN D HD22 1  
ATOM   5577   N N    . ALA D 2 49  ? -25.347 9.135   -10.319 1.00 0.00 ? 51  ALA D N    1  
ATOM   5578   C CA   . ALA D 2 49  ? -26.017 7.848   -10.352 1.00 0.00 ? 51  ALA D CA   1  
ATOM   5579   C C    . ALA D 2 49  ? -27.517 8.036   -10.253 1.00 0.00 ? 51  ALA D C    1  
ATOM   5580   O O    . ALA D 2 49  ? -28.013 9.066   -9.790  1.00 0.00 ? 51  ALA D O    1  
ATOM   5581   C CB   . ALA D 2 49  ? -25.535 6.973   -9.212  1.00 0.00 ? 51  ALA D CB   1  
ATOM   5582   H H    . ALA D 2 49  ? -25.051 9.517   -9.467  1.00 0.00 ? 51  ALA D H    1  
ATOM   5583   H HA   . ALA D 2 49  ? -25.805 7.359   -11.291 1.00 0.00 ? 51  ALA D HA   1  
ATOM   5584   H HB1  . ALA D 2 49  ? -24.711 7.458   -8.708  1.00 0.00 ? 51  ALA D HB1  1  
ATOM   5585   H HB2  . ALA D 2 49  ? -25.208 6.021   -9.601  1.00 0.00 ? 51  ALA D HB2  1  
ATOM   5586   H HB3  . ALA D 2 49  ? -26.342 6.817   -8.512  1.00 0.00 ? 51  ALA D HB3  1  
ATOM   5587   N N    . ASP D 2 50  ? -28.241 7.042   -10.728 1.00 0.00 ? 52  ASP D N    1  
ATOM   5588   C CA   . ASP D 2 50  ? -29.671 7.069   -10.631 1.00 0.00 ? 52  ASP D CA   1  
ATOM   5589   C C    . ASP D 2 50  ? -30.036 6.320   -9.349  1.00 0.00 ? 52  ASP D C    1  
ATOM   5590   O O    . ASP D 2 50  ? -31.070 6.596   -8.734  1.00 0.00 ? 52  ASP D O    1  
ATOM   5591   C CB   . ASP D 2 50  ? -30.286 6.499   -11.906 1.00 0.00 ? 52  ASP D CB   1  
ATOM   5592   C CG   . ASP D 2 50  ? -30.164 7.483   -13.087 1.00 0.00 ? 52  ASP D CG   1  
ATOM   5593   O OD1  . ASP D 2 50  ? -30.731 8.594   -12.998 1.00 0.00 ? 52  ASP D OD1  1  
ATOM   5594   O OD2  . ASP D 2 50  ? -29.488 7.175   -14.090 1.00 0.00 ? 52  ASP D OD2  1  
ATOM   5595   H H    . ASP D 2 50  ? -27.797 6.279   -11.153 1.00 0.00 ? 52  ASP D H    1  
ATOM   5596   H HA   . ASP D 2 50  ? -30.002 8.087   -10.495 1.00 0.00 ? 52  ASP D HA   1  
ATOM   5597   H HB2  . ASP D 2 50  ? -29.777 5.582   -12.159 1.00 0.00 ? 52  ASP D HB2  1  
ATOM   5598   H HB3  . ASP D 2 50  ? -31.331 6.296   -11.729 1.00 0.00 ? 52  ASP D HB3  1  
ATOM   5599   N N    . VAL D 2 51  ? -29.161 5.406   -8.923  1.00 0.00 ? 53  VAL D N    1  
ATOM   5600   C CA   . VAL D 2 51  ? -29.342 4.676   -7.669  1.00 0.00 ? 53  VAL D CA   1  
ATOM   5601   C C    . VAL D 2 51  ? -27.943 4.354   -7.125  1.00 0.00 ? 53  VAL D C    1  
ATOM   5602   O O    . VAL D 2 51  ? -27.044 4.009   -7.882  1.00 0.00 ? 53  VAL D O    1  
ATOM   5603   C CB   . VAL D 2 51  ? -30.223 3.392   -7.812  1.00 0.00 ? 53  VAL D CB   1  
ATOM   5604   C CG1  . VAL D 2 51  ? -29.593 2.377   -8.751  1.00 0.00 ? 53  VAL D CG1  1  
ATOM   5605   C CG2  . VAL D 2 51  ? -30.482 2.780   -6.448  1.00 0.00 ? 53  VAL D CG2  1  
ATOM   5606   H H    . VAL D 2 51  ? -28.368 5.219   -9.471  1.00 0.00 ? 53  VAL D H    1  
ATOM   5607   H HA   . VAL D 2 51  ? -29.814 5.334   -6.956  1.00 0.00 ? 53  VAL D HA   1  
ATOM   5608   H HB   . VAL D 2 51  ? -31.191 3.673   -8.200  1.00 0.00 ? 53  VAL D HB   1  
ATOM   5609   H HG11 . VAL D 2 51  ? -29.431 2.831   -9.718  1.00 0.00 ? 53  VAL D HG11 1  
ATOM   5610   H HG12 . VAL D 2 51  ? -28.647 2.051   -8.345  1.00 0.00 ? 53  VAL D HG12 1  
ATOM   5611   H HG13 . VAL D 2 51  ? -30.251 1.528   -8.857  1.00 0.00 ? 53  VAL D HG13 1  
ATOM   5612   H HG21 . VAL D 2 51  ? -29.790 3.194   -5.730  1.00 0.00 ? 53  VAL D HG21 1  
ATOM   5613   H HG22 . VAL D 2 51  ? -31.494 3.001   -6.141  1.00 0.00 ? 53  VAL D HG22 1  
ATOM   5614   H HG23 . VAL D 2 51  ? -30.349 1.709   -6.503  1.00 0.00 ? 53  VAL D HG23 1  
ATOM   5615   N N    . VAL D 2 52  ? -27.752 4.576   -5.830  1.00 0.00 ? 54  VAL D N    1  
ATOM   5616   C CA   . VAL D 2 52  ? -26.480 4.330   -5.163  1.00 0.00 ? 54  VAL D CA   1  
ATOM   5617   C C    . VAL D 2 52  ? -26.609 3.082   -4.273  1.00 0.00 ? 54  VAL D C    1  
ATOM   5618   O O    . VAL D 2 52  ? -27.504 2.999   -3.433  1.00 0.00 ? 54  VAL D O    1  
ATOM   5619   C CB   . VAL D 2 52  ? -26.032 5.599   -4.344  1.00 0.00 ? 54  VAL D CB   1  
ATOM   5620   C CG1  . VAL D 2 52  ? -24.739 5.340   -3.537  1.00 0.00 ? 54  VAL D CG1  1  
ATOM   5621   C CG2  . VAL D 2 52  ? -25.821 6.764   -5.290  1.00 0.00 ? 54  VAL D CG2  1  
ATOM   5622   H H    . VAL D 2 52  ? -28.499 4.919   -5.298  1.00 0.00 ? 54  VAL D H    1  
ATOM   5623   H HA   . VAL D 2 52  ? -25.728 4.101   -5.904  1.00 0.00 ? 54  VAL D HA   1  
ATOM   5624   H HB   . VAL D 2 52  ? -26.823 5.871   -3.659  1.00 0.00 ? 54  VAL D HB   1  
ATOM   5625   H HG11 . VAL D 2 52  ? -24.227 4.480   -3.943  1.00 0.00 ? 54  VAL D HG11 1  
ATOM   5626   H HG12 . VAL D 2 52  ? -24.095 6.206   -3.601  1.00 0.00 ? 54  VAL D HG12 1  
ATOM   5627   H HG13 . VAL D 2 52  ? -24.991 5.154   -2.504  1.00 0.00 ? 54  VAL D HG13 1  
ATOM   5628   H HG21 . VAL D 2 52  ? -26.516 6.694   -6.112  1.00 0.00 ? 54  VAL D HG21 1  
ATOM   5629   H HG22 . VAL D 2 52  ? -25.982 7.693   -4.761  1.00 0.00 ? 54  VAL D HG22 1  
ATOM   5630   H HG23 . VAL D 2 52  ? -24.810 6.739   -5.671  1.00 0.00 ? 54  VAL D HG23 1  
ATOM   5631   N N    . LEU D 2 53  ? -25.763 2.087   -4.527  1.00 0.00 ? 55  LEU D N    1  
ATOM   5632   C CA   . LEU D 2 53  ? -25.769 0.859   -3.755  1.00 0.00 ? 55  LEU D CA   1  
ATOM   5633   C C    . LEU D 2 53  ? -24.466 0.758   -2.949  1.00 0.00 ? 55  LEU D C    1  
ATOM   5634   O O    . LEU D 2 53  ? -23.375 0.978   -3.496  1.00 0.00 ? 55  LEU D O    1  
ATOM   5635   C CB   . LEU D 2 53  ? -25.875 -0.346  -4.695  1.00 0.00 ? 55  LEU D CB   1  
ATOM   5636   C CG   . LEU D 2 53  ? -27.132 -0.517  -5.552  1.00 0.00 ? 55  LEU D CG   1  
ATOM   5637   C CD1  . LEU D 2 53  ? -26.998 -1.775  -6.377  1.00 0.00 ? 55  LEU D CD1  1  
ATOM   5638   C CD2  . LEU D 2 53  ? -28.363 -0.597  -4.655  1.00 0.00 ? 55  LEU D CD2  1  
ATOM   5639   H H    . LEU D 2 53  ? -25.116 2.188   -5.257  1.00 0.00 ? 55  LEU D H    1  
ATOM   5640   H HA   . LEU D 2 53  ? -26.612 0.863   -3.081  1.00 0.00 ? 55  LEU D HA   1  
ATOM   5641   H HB2  . LEU D 2 53  ? -25.039 -0.291  -5.372  1.00 0.00 ? 55  LEU D HB2  1  
ATOM   5642   H HB3  . LEU D 2 53  ? -25.791 -1.231  -4.083  1.00 0.00 ? 55  LEU D HB3  1  
ATOM   5643   H HG   . LEU D 2 53  ? -27.241 0.336   -6.205  1.00 0.00 ? 55  LEU D HG   1  
ATOM   5644   H HD11 . LEU D 2 53  ? -26.114 -2.314  -6.073  1.00 0.00 ? 55  LEU D HD11 1  
ATOM   5645   H HD12 . LEU D 2 53  ? -27.869 -2.399  -6.226  1.00 0.00 ? 55  LEU D HD12 1  
ATOM   5646   H HD13 . LEU D 2 53  ? -26.919 -1.515  -7.421  1.00 0.00 ? 55  LEU D HD13 1  
ATOM   5647   H HD21 . LEU D 2 53  ? -28.212 0.022   -3.783  1.00 0.00 ? 55  LEU D HD21 1  
ATOM   5648   H HD22 . LEU D 2 53  ? -29.227 -0.248  -5.200  1.00 0.00 ? 55  LEU D HD22 1  
ATOM   5649   H HD23 . LEU D 2 53  ? -28.518 -1.621  -4.349  1.00 0.00 ? 55  LEU D HD23 1  
ATOM   5650   N N    . LEU D 2 54  ? -24.569 0.433   -1.660  1.00 0.00 ? 56  LEU D N    1  
ATOM   5651   C CA   . LEU D 2 54  ? -23.378 0.290   -0.808  1.00 0.00 ? 56  LEU D CA   1  
ATOM   5652   C C    . LEU D 2 54  ? -23.104 -1.173  -0.527  1.00 0.00 ? 56  LEU D C    1  
ATOM   5653   O O    . LEU D 2 54  ? -24.035 -1.952  -0.276  1.00 0.00 ? 56  LEU D O    1  
ATOM   5654   C CB   . LEU D 2 54  ? -23.560 1.011   0.534   1.00 0.00 ? 56  LEU D CB   1  
ATOM   5655   C CG   . LEU D 2 54  ? -23.948 2.483   0.505   1.00 0.00 ? 56  LEU D CG   1  
ATOM   5656   C CD1  . LEU D 2 54  ? -23.918 3.037   1.917   1.00 0.00 ? 56  LEU D CD1  1  
ATOM   5657   C CD2  . LEU D 2 54  ? -23.029 3.272   -0.405  1.00 0.00 ? 56  LEU D CD2  1  
ATOM   5658   H H    . LEU D 2 54  ? -25.457 0.286   -1.273  1.00 0.00 ? 56  LEU D H    1  
ATOM   5659   H HA   . LEU D 2 54  ? -22.527 0.713   -1.319  1.00 0.00 ? 56  LEU D HA   1  
ATOM   5660   H HB2  . LEU D 2 54  ? -24.331 0.487   1.077   1.00 0.00 ? 56  LEU D HB2  1  
ATOM   5661   H HB3  . LEU D 2 54  ? -22.627 0.935   1.068   1.00 0.00 ? 56  LEU D HB3  1  
ATOM   5662   H HG   . LEU D 2 54  ? -24.943 2.587   0.098   1.00 0.00 ? 56  LEU D HG   1  
ATOM   5663   H HD11 . LEU D 2 54  ? -23.828 2.221   2.621   1.00 0.00 ? 56  LEU D HD11 1  
ATOM   5664   H HD12 . LEU D 2 54  ? -23.075 3.702   2.025   1.00 0.00 ? 56  LEU D HD12 1  
ATOM   5665   H HD13 . LEU D 2 54  ? -24.832 3.579   2.111   1.00 0.00 ? 56  LEU D HD13 1  
ATOM   5666   H HD21 . LEU D 2 54  ? -22.029 2.867   -0.345  1.00 0.00 ? 56  LEU D HD21 1  
ATOM   5667   H HD22 . LEU D 2 54  ? -23.384 3.203   -1.422  1.00 0.00 ? 56  LEU D HD22 1  
ATOM   5668   H HD23 . LEU D 2 54  ? -23.016 4.305   -0.096  1.00 0.00 ? 56  LEU D HD23 1  
ATOM   5669   N N    . GLY D 2 55  ? -21.828 -1.559  -0.572  1.00 0.00 ? 57  GLY D N    1  
ATOM   5670   C CA   . GLY D 2 55  ? -21.463 -2.945  -0.318  1.00 0.00 ? 57  GLY D CA   1  
ATOM   5671   C C    . GLY D 2 55  ? -21.795 -3.257  1.129   1.00 0.00 ? 57  GLY D C    1  
ATOM   5672   O O    . GLY D 2 55  ? -21.879 -2.337  1.945   1.00 0.00 ? 57  GLY D O    1  
ATOM   5673   H H    . GLY D 2 55  ? -21.130 -0.901  -0.780  1.00 0.00 ? 57  GLY D H    1  
ATOM   5674   H HA2  . GLY D 2 55  ? -22.024 -3.598  -0.971  1.00 0.00 ? 57  GLY D HA2  1  
ATOM   5675   H HA3  . GLY D 2 55  ? -20.407 -3.084  -0.492  1.00 0.00 ? 57  GLY D HA3  1  
ATOM   5676   N N    . PRO D 2 56  ? -21.999 -4.494  1.485   1.00 0.00 ? 58  PRO D N    1  
ATOM   5677   C CA   . PRO D 2 56  ? -22.359 -4.873  2.893   1.00 0.00 ? 58  PRO D CA   1  
ATOM   5678   C C    . PRO D 2 56  ? -21.316 -4.455  3.946   1.00 0.00 ? 58  PRO D C    1  
ATOM   5679   O O    . PRO D 2 56  ? -21.661 -4.217  5.103   1.00 0.00 ? 58  PRO D O    1  
ATOM   5680   C CB   . PRO D 2 56  ? -22.513 -6.401  2.836   1.00 0.00 ? 58  PRO D CB   1  
ATOM   5681   C CG   . PRO D 2 56  ? -21.928 -6.827  1.558   1.00 0.00 ? 58  PRO D CG   1  
ATOM   5682   C CD   . PRO D 2 56  ? -21.909 -5.664  0.606   1.00 0.00 ? 58  PRO D CD   1  
ATOM   5683   H HA   . PRO D 2 56  ? -23.312 -4.439  3.147   1.00 0.00 ? 58  PRO D HA   1  
ATOM   5684   H HB2  . PRO D 2 56  ? -21.995 -6.861  3.642   1.00 0.00 ? 58  PRO D HB2  1  
ATOM   5685   H HB3  . PRO D 2 56  ? -23.537 -6.674  2.865   1.00 0.00 ? 58  PRO D HB3  1  
ATOM   5686   H HG2  . PRO D 2 56  ? -20.969 -7.158  1.720   1.00 0.00 ? 58  PRO D HG2  1  
ATOM   5687   H HG3  . PRO D 2 56  ? -22.499 -7.579  1.158   1.00 0.00 ? 58  PRO D HG3  1  
ATOM   5688   H HD2  . PRO D 2 56  ? -21.000 -5.655  0.047   1.00 0.00 ? 58  PRO D HD2  1  
ATOM   5689   H HD3  . PRO D 2 56  ? -22.747 -5.705  -0.049  1.00 0.00 ? 58  PRO D HD3  1  
ATOM   5690   N N    . GLN D 2 57  ? -20.053 -4.380  3.548   1.00 0.00 ? 59  GLN D N    1  
ATOM   5691   C CA   . GLN D 2 57  ? -18.979 -4.005  4.475   1.00 0.00 ? 59  GLN D CA   1  
ATOM   5692   C C    . GLN D 2 57  ? -19.063 -2.524  4.851   1.00 0.00 ? 59  GLN D C    1  
ATOM   5693   O O    . GLN D 2 57  ? -18.545 -2.123  5.886   1.00 0.00 ? 59  GLN D O    1  
ATOM   5694   C CB   . GLN D 2 57  ? -17.607 -4.277  3.869   1.00 0.00 ? 59  GLN D CB   1  
ATOM   5695   C CG   . GLN D 2 57  ? -17.307 -5.789  3.632   1.00 0.00 ? 59  GLN D CG   1  
ATOM   5696   C CD   . GLN D 2 57  ? -18.504 -6.745  3.836   1.00 0.00 ? 59  GLN D CD   1  
ATOM   5697   O OE1  . GLN D 2 57  ? -19.507 -6.423  4.461   1.00 0.00 ? 59  GLN D OE1  1  
ATOM   5698   N NE2  . GLN D 2 57  ? -18.429 -7.952  3.343   1.00 0.00 ? 59  GLN D NE2  1  
ATOM   5699   H H    . GLN D 2 57  ? -19.835 -4.584  2.616   1.00 0.00 ? 59  GLN D H    1  
ATOM   5700   H HA   . GLN D 2 57  ? -19.084 -4.588  5.378   1.00 0.00 ? 59  GLN D HA   1  
ATOM   5701   H HB2  . GLN D 2 57  ? -17.534 -3.753  2.929   1.00 0.00 ? 59  GLN D HB2  1  
ATOM   5702   H HB3  . GLN D 2 57  ? -16.865 -3.878  4.545   1.00 0.00 ? 59  GLN D HB3  1  
ATOM   5703   H HG2  . GLN D 2 57  ? -16.956 -5.909  2.621   1.00 0.00 ? 59  GLN D HG2  1  
ATOM   5704   H HG3  . GLN D 2 57  ? -16.510 -6.088  4.300   1.00 0.00 ? 59  GLN D HG3  1  
ATOM   5705   H HE21 . GLN D 2 57  ? -17.626 -8.234  2.856   1.00 0.00 ? 59  GLN D HE21 1  
ATOM   5706   H HE22 . GLN D 2 57  ? -19.173 -8.578  3.466   1.00 0.00 ? 59  GLN D HE22 1  
ATOM   5707   N N    . ILE D 2 58  ? -19.666 -1.703  3.998   1.00 0.00 ? 60  ILE D N    1  
ATOM   5708   C CA   . ILE D 2 58  ? -19.771 -0.284  4.303   1.00 0.00 ? 60  ILE D CA   1  
ATOM   5709   C C    . ILE D 2 58  ? -21.178 0.166   4.701   1.00 0.00 ? 60  ILE D C    1  
ATOM   5710   O O    . ILE D 2 58  ? -21.504 1.358   4.643   1.00 0.00 ? 60  ILE D O    1  
ATOM   5711   C CB   . ILE D 2 58  ? -19.235 0.591   3.167   1.00 0.00 ? 60  ILE D CB   1  
ATOM   5712   C CG1  . ILE D 2 58  ? -19.841 0.117   1.841   1.00 0.00 ? 60  ILE D CG1  1  
ATOM   5713   C CG2  . ILE D 2 58  ? -17.702 0.504   3.101   1.00 0.00 ? 60  ILE D CG2  1  
ATOM   5714   C CD1  . ILE D 2 58  ? -19.753 1.229   0.788   1.00 0.00 ? 60  ILE D CD1  1  
ATOM   5715   H H    . ILE D 2 58  ? -20.041 -2.052  3.163   1.00 0.00 ? 60  ILE D H    1  
ATOM   5716   H HA   . ILE D 2 58  ? -19.212 -0.082  5.206   1.00 0.00 ? 60  ILE D HA   1  
ATOM   5717   H HB   . ILE D 2 58  ? -19.523 1.615   3.350   1.00 0.00 ? 60  ILE D HB   1  
ATOM   5718   H HG12 . ILE D 2 58  ? -19.298 -0.749  1.492   1.00 0.00 ? 60  ILE D HG12 1  
ATOM   5719   H HG13 . ILE D 2 58  ? -20.874 -0.149  1.996   1.00 0.00 ? 60  ILE D HG13 1  
ATOM   5720   H HG21 . ILE D 2 58  ? -17.305 0.265   4.076   1.00 0.00 ? 60  ILE D HG21 1  
ATOM   5721   H HG22 . ILE D 2 58  ? -17.411 -0.262  2.397   1.00 0.00 ? 60  ILE D HG22 1  
ATOM   5722   H HG23 . ILE D 2 58  ? -17.305 1.455   2.779   1.00 0.00 ? 60  ILE D HG23 1  
ATOM   5723   H HD11 . ILE D 2 58  ? -19.946 2.186   1.247   1.00 0.00 ? 60  ILE D HD11 1  
ATOM   5724   H HD12 . ILE D 2 58  ? -18.766 1.232   0.349   1.00 0.00 ? 60  ILE D HD12 1  
ATOM   5725   H HD13 . ILE D 2 58  ? -20.488 1.050   0.018   1.00 0.00 ? 60  ILE D HD13 1  
ATOM   5726   N N    . ALA D 2 59  ? -21.979 -0.773  5.200   1.00 0.00 ? 61  ALA D N    1  
ATOM   5727   C CA   . ALA D 2 59  ? -23.336 -0.461  5.638   1.00 0.00 ? 61  ALA D CA   1  
ATOM   5728   C C    . ALA D 2 59  ? -23.343 0.614   6.732   1.00 0.00 ? 61  ALA D C    1  
ATOM   5729   O O    . ALA D 2 59  ? -24.229 1.460   6.761   1.00 0.00 ? 61  ALA D O    1  
ATOM   5730   C CB   . ALA D 2 59  ? -24.026 -1.706  6.136   1.00 0.00 ? 61  ALA D CB   1  
ATOM   5731   H H    . ALA D 2 59  ? -21.651 -1.693  5.274   1.00 0.00 ? 61  ALA D H    1  
ATOM   5732   H HA   . ALA D 2 59  ? -23.893 -0.052  4.808   1.00 0.00 ? 61  ALA D HA   1  
ATOM   5733   H HB1  . ALA D 2 59  ? -25.095 -1.552  6.135   1.00 0.00 ? 61  ALA D HB1  1  
ATOM   5734   H HB2  . ALA D 2 59  ? -23.695 -1.924  7.140   1.00 0.00 ? 61  ALA D HB2  1  
ATOM   5735   H HB3  . ALA D 2 59  ? -23.781 -2.535  5.489   1.00 0.00 ? 61  ALA D HB3  1  
ATOM   5736   N N    . TYR D 2 60  ? -22.372 0.568   7.639   1.00 0.00 ? 62  TYR D N    1  
ATOM   5737   C CA   . TYR D 2 60  ? -22.337 1.553   8.724   1.00 0.00 ? 62  TYR D CA   1  
ATOM   5738   C C    . TYR D 2 60  ? -22.256 2.999   8.214   1.00 0.00 ? 62  TYR D C    1  
ATOM   5739   O O    . TYR D 2 60  ? -22.507 3.951   8.969   1.00 0.00 ? 62  TYR D O    1  
ATOM   5740   C CB   . TYR D 2 60  ? -21.195 1.254   9.704   1.00 0.00 ? 62  TYR D CB   1  
ATOM   5741   C CG   . TYR D 2 60  ? -19.848 1.412   9.038   1.00 0.00 ? 62  TYR D CG   1  
ATOM   5742   C CD1  . TYR D 2 60  ? -19.162 2.629   9.126   1.00 0.00 ? 62  TYR D CD1  1  
ATOM   5743   C CD2  . TYR D 2 60  ? -19.274 0.333   8.354   1.00 0.00 ? 62  TYR D CD2  1  
ATOM   5744   C CE1  . TYR D 2 60  ? -17.903 2.769   8.529   1.00 0.00 ? 62  TYR D CE1  1  
ATOM   5745   C CE2  . TYR D 2 60  ? -18.014 0.472   7.759   1.00 0.00 ? 62  TYR D CE2  1  
ATOM   5746   C CZ   . TYR D 2 60  ? -17.329 1.691   7.845   1.00 0.00 ? 62  TYR D CZ   1  
ATOM   5747   O OH   . TYR D 2 60  ? -16.087 1.827   7.260   1.00 0.00 ? 62  TYR D OH   1  
ATOM   5748   H H    . TYR D 2 60  ? -21.689 -0.135  7.609   1.00 0.00 ? 62  TYR D H    1  
ATOM   5749   H HA   . TYR D 2 60  ? -23.264 1.509   9.274   1.00 0.00 ? 62  TYR D HA   1  
ATOM   5750   H HB2  . TYR D 2 60  ? -21.257 1.936   10.539  1.00 0.00 ? 62  TYR D HB2  1  
ATOM   5751   H HB3  . TYR D 2 60  ? -21.295 0.241   10.066  1.00 0.00 ? 62  TYR D HB3  1  
ATOM   5752   H HD1  . TYR D 2 60  ? -19.605 3.462   9.653   1.00 0.00 ? 62  TYR D HD1  1  
ATOM   5753   H HD2  . TYR D 2 60  ? -19.803 -0.606  8.286   1.00 0.00 ? 62  TYR D HD2  1  
ATOM   5754   H HE1  . TYR D 2 60  ? -17.375 3.709   8.595   1.00 0.00 ? 62  TYR D HE1  1  
ATOM   5755   H HE2  . TYR D 2 60  ? -17.571 -0.360  7.233   1.00 0.00 ? 62  TYR D HE2  1  
ATOM   5756   H HH   . TYR D 2 60  ? -16.217 2.045   6.335   1.00 0.00 ? 62  TYR D HH   1  
ATOM   5757   N N    . MET D 2 61  ? -21.852 3.168   6.955   1.00 0.00 ? 63  MET D N    1  
ATOM   5758   C CA   . MET D 2 61  ? -21.738 4.493   6.344   1.00 0.00 ? 63  MET D CA   1  
ATOM   5759   C C    . MET D 2 61  ? -23.046 5.023   5.720   1.00 0.00 ? 63  MET D C    1  
ATOM   5760   O O    . MET D 2 61  ? -23.086 6.171   5.257   1.00 0.00 ? 63  MET D O    1  
ATOM   5761   C CB   . MET D 2 61  ? -20.638 4.482   5.281   1.00 0.00 ? 63  MET D CB   1  
ATOM   5762   C CG   . MET D 2 61  ? -19.287 4.216   5.942   1.00 0.00 ? 63  MET D CG   1  
ATOM   5763   S SD   . MET D 2 61  ? -18.024 3.965   4.668   1.00 0.00 ? 63  MET D SD   1  
ATOM   5764   C CE   . MET D 2 61  ? -17.669 5.707   4.334   1.00 0.00 ? 63  MET D CE   1  
ATOM   5765   H H    . MET D 2 61  ? -21.626 2.379   6.419   1.00 0.00 ? 63  MET D H    1  
ATOM   5766   H HA   . MET D 2 61  ? -21.488 5.213   7.107   1.00 0.00 ? 63  MET D HA   1  
ATOM   5767   H HB2  . MET D 2 61  ? -20.845 3.706   4.558   1.00 0.00 ? 63  MET D HB2  1  
ATOM   5768   H HB3  . MET D 2 61  ? -20.611 5.439   4.783   1.00 0.00 ? 63  MET D HB3  1  
ATOM   5769   H HG2  . MET D 2 61  ? -19.014 5.059   6.559   1.00 0.00 ? 63  MET D HG2  1  
ATOM   5770   H HG3  . MET D 2 61  ? -19.360 3.331   6.554   1.00 0.00 ? 63  MET D HG3  1  
ATOM   5771   H HE1  . MET D 2 61  ? -18.586 6.220   4.084   1.00 0.00 ? 63  MET D HE1  1  
ATOM   5772   H HE2  . MET D 2 61  ? -17.224 6.157   5.211   1.00 0.00 ? 63  MET D HE2  1  
ATOM   5773   H HE3  . MET D 2 61  ? -16.981 5.782   3.507   1.00 0.00 ? 63  MET D HE3  1  
ATOM   5774   N N    . LEU D 2 62  ? -24.108 4.216   5.726   1.00 0.00 ? 64  LEU D N    1  
ATOM   5775   C CA   . LEU D 2 62  ? -25.383 4.617   5.127   1.00 0.00 ? 64  LEU D CA   1  
ATOM   5776   C C    . LEU D 2 62  ? -25.884 6.033   5.490   1.00 0.00 ? 64  LEU D C    1  
ATOM   5777   O O    . LEU D 2 62  ? -26.132 6.853   4.582   1.00 0.00 ? 64  LEU D O    1  
ATOM   5778   C CB   . LEU D 2 62  ? -26.465 3.556   5.389   1.00 0.00 ? 64  LEU D CB   1  
ATOM   5779   C CG   . LEU D 2 62  ? -27.872 3.789   4.810   1.00 0.00 ? 64  LEU D CG   1  
ATOM   5780   C CD1  . LEU D 2 62  ? -27.839 3.908   3.276   1.00 0.00 ? 64  LEU D CD1  1  
ATOM   5781   C CD2  . LEU D 2 62  ? -28.760 2.643   5.246   1.00 0.00 ? 64  LEU D CD2  1  
ATOM   5782   H H    . LEU D 2 62  ? -24.033 3.333   6.142   1.00 0.00 ? 64  LEU D H    1  
ATOM   5783   H HA   . LEU D 2 62  ? -25.253 4.735   4.059   1.00 0.00 ? 64  LEU D HA   1  
ATOM   5784   H HB2  . LEU D 2 62  ? -26.103 2.623   4.980   1.00 0.00 ? 64  LEU D HB2  1  
ATOM   5785   H HB3  . LEU D 2 62  ? -26.569 3.463   6.458   1.00 0.00 ? 64  LEU D HB3  1  
ATOM   5786   H HG   . LEU D 2 62  ? -28.275 4.700   5.225   1.00 0.00 ? 64  LEU D HG   1  
ATOM   5787   H HD11 . LEU D 2 62  ? -26.880 3.573   2.910   1.00 0.00 ? 64  LEU D HD11 1  
ATOM   5788   H HD12 . LEU D 2 62  ? -28.622 3.297   2.850   1.00 0.00 ? 64  LEU D HD12 1  
ATOM   5789   H HD13 . LEU D 2 62  ? -27.991 4.939   2.992   1.00 0.00 ? 64  LEU D HD13 1  
ATOM   5790   H HD21 . LEU D 2 62  ? -28.385 2.228   6.168   1.00 0.00 ? 64  LEU D HD21 1  
ATOM   5791   H HD22 . LEU D 2 62  ? -29.766 3.007   5.399   1.00 0.00 ? 64  LEU D HD22 1  
ATOM   5792   H HD23 . LEU D 2 62  ? -28.766 1.881   4.482   1.00 0.00 ? 64  LEU D HD23 1  
ATOM   5793   N N    . PRO D 2 63  ? -25.988 6.363   6.800   1.00 0.00 ? 65  PRO D N    1  
ATOM   5794   C CA   . PRO D 2 63  ? -26.462 7.709   7.162   1.00 0.00 ? 65  PRO D CA   1  
ATOM   5795   C C    . PRO D 2 63  ? -25.623 8.842   6.579   1.00 0.00 ? 65  PRO D C    1  
ATOM   5796   O O    . PRO D 2 63  ? -26.176 9.847   6.147   1.00 0.00 ? 65  PRO D O    1  
ATOM   5797   C CB   . PRO D 2 63  ? -26.425 7.706   8.695   1.00 0.00 ? 65  PRO D CB   1  
ATOM   5798   C CG   . PRO D 2 63  ? -26.633 6.286   9.042   1.00 0.00 ? 65  PRO D CG   1  
ATOM   5799   C CD   . PRO D 2 63  ? -25.839 5.524   8.000   1.00 0.00 ? 65  PRO D CD   1  
ATOM   5800   H HA   . PRO D 2 63  ? -27.466 7.874   6.801   1.00 0.00 ? 65  PRO D HA   1  
ATOM   5801   H HB2  . PRO D 2 63  ? -25.469 8.055   9.057   1.00 0.00 ? 65  PRO D HB2  1  
ATOM   5802   H HB3  . PRO D 2 63  ? -27.211 8.321   9.101   1.00 0.00 ? 65  PRO D HB3  1  
ATOM   5803   H HG2  . PRO D 2 63  ? -26.262 6.077   10.033  1.00 0.00 ? 65  PRO D HG2  1  
ATOM   5804   H HG3  . PRO D 2 63  ? -27.680 6.029   8.987   1.00 0.00 ? 65  PRO D HG3  1  
ATOM   5805   H HD2  . PRO D 2 63  ? -24.802 5.439   8.288   1.00 0.00 ? 65  PRO D HD2  1  
ATOM   5806   H HD3  . PRO D 2 63  ? -26.251 4.539   7.841   1.00 0.00 ? 65  PRO D HD3  1  
ATOM   5807   N N    . GLU D 2 64  ? -24.302 8.678   6.533   1.00 0.00 ? 66  GLU D N    1  
ATOM   5808   C CA   . GLU D 2 64  ? -23.427 9.710   5.980   1.00 0.00 ? 66  GLU D CA   1  
ATOM   5809   C C    . GLU D 2 64  ? -23.631 9.885   4.491   1.00 0.00 ? 66  GLU D C    1  
ATOM   5810   O O    . GLU D 2 64  ? -23.615 11.012  3.981   1.00 0.00 ? 66  GLU D O    1  
ATOM   5811   C CB   . GLU D 2 64  ? -21.961 9.358   6.190   1.00 0.00 ? 66  GLU D CB   1  
ATOM   5812   C CG   . GLU D 2 64  ? -21.484 9.414   7.615   1.00 0.00 ? 66  GLU D CG   1  
ATOM   5813   C CD   . GLU D 2 64  ? -20.033 8.987   7.739   1.00 0.00 ? 66  GLU D CD   1  
ATOM   5814   O OE1  . GLU D 2 64  ? -19.170 9.641   7.113   1.00 0.00 ? 66  GLU D OE1  1  
ATOM   5815   O OE2  . GLU D 2 64  ? -19.776 7.979   8.439   1.00 0.00 ? 66  GLU D OE2  1  
ATOM   5816   H H    . GLU D 2 64  ? -23.910 7.850   6.878   1.00 0.00 ? 66  GLU D H    1  
ATOM   5817   H HA   . GLU D 2 64  ? -23.635 10.650  6.468   1.00 0.00 ? 66  GLU D HA   1  
ATOM   5818   H HB2  . GLU D 2 64  ? -21.802 8.356   5.824   1.00 0.00 ? 66  GLU D HB2  1  
ATOM   5819   H HB3  . GLU D 2 64  ? -21.367 10.052  5.613   1.00 0.00 ? 66  GLU D HB3  1  
ATOM   5820   H HG2  . GLU D 2 64  ? -21.584 10.426  7.980   1.00 0.00 ? 66  GLU D HG2  1  
ATOM   5821   H HG3  . GLU D 2 64  ? -22.096 8.755   8.215   1.00 0.00 ? 66  GLU D HG3  1  
ATOM   5822   N N    . ILE D 2 65  ? -23.754 8.771   3.776   1.00 0.00 ? 67  ILE D N    1  
ATOM   5823   C CA   . ILE D 2 65  ? -23.948 8.839   2.332   1.00 0.00 ? 67  ILE D CA   1  
ATOM   5824   C C    . ILE D 2 65  ? -25.324 9.425   1.970   1.00 0.00 ? 67  ILE D C    1  
ATOM   5825   O O    . ILE D 2 65  ? -25.428 10.238  1.036   1.00 0.00 ? 67  ILE D O    1  
ATOM   5826   C CB   . ILE D 2 65  ? -23.609 7.487   1.654   1.00 0.00 ? 67  ILE D CB   1  
ATOM   5827   C CG1  . ILE D 2 65  ? -22.102 7.225   1.851   1.00 0.00 ? 67  ILE D CG1  1  
ATOM   5828   C CG2  . ILE D 2 65  ? -23.908 7.549   0.162   1.00 0.00 ? 67  ILE D CG2  1  
ATOM   5829   C CD1  . ILE D 2 65  ? -21.644 5.801   1.580   1.00 0.00 ? 67  ILE D CD1  1  
ATOM   5830   H H    . ILE D 2 65  ? -23.711 7.899   4.222   1.00 0.00 ? 67  ILE D H    1  
ATOM   5831   H HA   . ILE D 2 65  ? -23.307 9.606   1.926   1.00 0.00 ? 67  ILE D HA   1  
ATOM   5832   H HB   . ILE D 2 65  ? -24.182 6.692   2.110   1.00 0.00 ? 67  ILE D HB   1  
ATOM   5833   H HG12 . ILE D 2 65  ? -21.561 7.880   1.189   1.00 0.00 ? 67  ILE D HG12 1  
ATOM   5834   H HG13 . ILE D 2 65  ? -21.854 7.462   2.876   1.00 0.00 ? 67  ILE D HG13 1  
ATOM   5835   H HG21 . ILE D 2 65  ? -24.137 8.566   -0.119  1.00 0.00 ? 67  ILE D HG21 1  
ATOM   5836   H HG22 . ILE D 2 65  ? -23.043 7.211   -0.392  1.00 0.00 ? 67  ILE D HG22 1  
ATOM   5837   H HG23 . ILE D 2 65  ? -24.749 6.914   -0.065  1.00 0.00 ? 67  ILE D HG23 1  
ATOM   5838   H HD11 . ILE D 2 65  ? -22.429 5.112   1.852   1.00 0.00 ? 67  ILE D HD11 1  
ATOM   5839   H HD12 . ILE D 2 65  ? -21.418 5.689   0.530   1.00 0.00 ? 67  ILE D HD12 1  
ATOM   5840   H HD13 . ILE D 2 65  ? -20.760 5.589   2.163   1.00 0.00 ? 67  ILE D HD13 1  
ATOM   5841   N N    . GLN D 2 66  ? -26.338 9.110   2.784   1.00 0.00 ? 68  GLN D N    1  
ATOM   5842   C CA   . GLN D 2 66  ? -27.682 9.677   2.586   1.00 0.00 ? 68  GLN D CA   1  
ATOM   5843   C C    . GLN D 2 66  ? -27.642 11.213  2.732   1.00 0.00 ? 68  GLN D C    1  
ATOM   5844   O O    . GLN D 2 66  ? -28.262 11.925  1.949   1.00 0.00 ? 68  GLN D O    1  
ATOM   5845   C CB   . GLN D 2 66  ? -28.688 9.073   3.572   1.00 0.00 ? 68  GLN D CB   1  
ATOM   5846   C CG   . GLN D 2 66  ? -29.057 7.645   3.232   1.00 0.00 ? 68  GLN D CG   1  
ATOM   5847   C CD   . GLN D 2 66  ? -29.916 6.953   4.281   1.00 0.00 ? 68  GLN D CD   1  
ATOM   5848   O OE1  . GLN D 2 66  ? -30.001 7.378   5.432   1.00 0.00 ? 68  GLN D OE1  1  
ATOM   5849   N NE2  . GLN D 2 66  ? -30.539 5.855   3.884   1.00 0.00 ? 68  GLN D NE2  1  
ATOM   5850   H H    . GLN D 2 66  ? -26.171 8.534   3.557   1.00 0.00 ? 68  GLN D H    1  
ATOM   5851   H HA   . GLN D 2 66  ? -28.004 9.447   1.580   1.00 0.00 ? 68  GLN D HA   1  
ATOM   5852   H HB2  . GLN D 2 66  ? -28.261 9.094   4.563   1.00 0.00 ? 68  GLN D HB2  1  
ATOM   5853   H HB3  . GLN D 2 66  ? -29.583 9.677   3.568   1.00 0.00 ? 68  GLN D HB3  1  
ATOM   5854   H HG2  . GLN D 2 66  ? -29.596 7.645   2.296   1.00 0.00 ? 68  GLN D HG2  1  
ATOM   5855   H HG3  . GLN D 2 66  ? -28.144 7.080   3.101   1.00 0.00 ? 68  GLN D HG3  1  
ATOM   5856   H HE21 . GLN D 2 66  ? -30.313 5.707   2.966   1.00 0.00 ? 68  GLN D HE21 1  
ATOM   5857   H HE22 . GLN D 2 66  ? -31.140 5.248   4.382   1.00 0.00 ? 68  GLN D HE22 1  
ATOM   5858   N N    . ARG D 2 67  ? -26.904 11.730  3.717   1.00 0.00 ? 69  ARG D N    1  
ATOM   5859   C CA   . ARG D 2 67  ? -26.807 13.188  3.904   1.00 0.00 ? 69  ARG D CA   1  
ATOM   5860   C C    . ARG D 2 67  ? -26.007 13.854  2.771   1.00 0.00 ? 69  ARG D C    1  
ATOM   5861   O O    . ARG D 2 67  ? -26.274 14.993  2.396   1.00 0.00 ? 69  ARG D O    1  
ATOM   5862   C CB   . ARG D 2 67  ? -26.111 13.505  5.243   1.00 0.00 ? 69  ARG D CB   1  
ATOM   5863   C CG   . ARG D 2 67  ? -27.129 13.688  6.383   1.00 0.00 ? 69  ARG D CG   1  
ATOM   5864   C CD   . ARG D 2 67  ? -26.389 14.143  7.659   1.00 0.00 ? 69  ARG D CD   1  
ATOM   5865   N NE   . ARG D 2 67  ? -25.330 13.201  7.983   1.00 0.00 ? 69  ARG D NE   1  
ATOM   5866   C CZ   . ARG D 2 67  ? -25.508 12.238  8.887   1.00 0.00 ? 69  ARG D CZ   1  
ATOM   5867   N NH1  . ARG D 2 67  ? -26.669 12.105  9.465   1.00 0.00 ? 69  ARG D NH1  1  
ATOM   5868   N NH2  . ARG D 2 67  ? -24.533 11.427  9.183   1.00 0.00 ? 69  ARG D NH2  1  
ATOM   5869   H H    . ARG D 2 67  ? -26.413 11.130  4.316   1.00 0.00 ? 69  ARG D H    1  
ATOM   5870   H HA   . ARG D 2 67  ? -27.792 13.603  3.904   1.00 0.00 ? 69  ARG D HA   1  
ATOM   5871   H HB2  . ARG D 2 67  ? -25.443 12.690  5.496   1.00 0.00 ? 69  ARG D HB2  1  
ATOM   5872   H HB3  . ARG D 2 67  ? -25.533 14.409  5.134   1.00 0.00 ? 69  ARG D HB3  1  
ATOM   5873   H HG2  . ARG D 2 67  ? -27.850 14.440  6.104   1.00 0.00 ? 69  ARG D HG2  1  
ATOM   5874   H HG3  . ARG D 2 67  ? -27.632 12.752  6.581   1.00 0.00 ? 69  ARG D HG3  1  
ATOM   5875   H HD2  . ARG D 2 67  ? -25.954 15.118  7.492   1.00 0.00 ? 69  ARG D HD2  1  
ATOM   5876   H HD3  . ARG D 2 67  ? -27.079 14.208  8.487   1.00 0.00 ? 69  ARG D HD3  1  
ATOM   5877   H HE   . ARG D 2 67  ? -24.461 13.290  7.541   1.00 0.00 ? 69  ARG D HE   1  
ATOM   5878   H HH11 . ARG D 2 67  ? -27.416 12.729  9.237   1.00 0.00 ? 69  ARG D HH11 1  
ATOM   5879   H HH12 . ARG D 2 67  ? -26.804 11.388  10.149  1.00 0.00 ? 69  ARG D HH12 1  
ATOM   5880   H HH21 . ARG D 2 67  ? -23.643 11.533  8.741   1.00 0.00 ? 69  ARG D HH21 1  
ATOM   5881   H HH22 . ARG D 2 67  ? -24.668 10.714  9.871   1.00 0.00 ? 69  ARG D HH22 1  
ATOM   5882   N N    . LEU D 2 68  ? -25.049 13.120  2.216   1.00 0.00 ? 70  LEU D N    1  
ATOM   5883   C CA   . LEU D 2 68  ? -24.192 13.598  1.135   1.00 0.00 ? 70  LEU D CA   1  
ATOM   5884   C C    . LEU D 2 68  ? -24.962 13.695  -0.177  1.00 0.00 ? 70  LEU D C    1  
ATOM   5885   O O    . LEU D 2 68  ? -24.745 14.610  -0.960  1.00 0.00 ? 70  LEU D O    1  
ATOM   5886   C CB   . LEU D 2 68  ? -23.029 12.611  0.981   1.00 0.00 ? 70  LEU D CB   1  
ATOM   5887   C CG   . LEU D 2 68  ? -21.685 12.969  0.355   1.00 0.00 ? 70  LEU D CG   1  
ATOM   5888   C CD1  . LEU D 2 68  ? -21.083 14.198  1.027   1.00 0.00 ? 70  LEU D CD1  1  
ATOM   5889   C CD2  . LEU D 2 68  ? -20.761 11.760  0.511   1.00 0.00 ? 70  LEU D CD2  1  
ATOM   5890   H H    . LEU D 2 68  ? -24.912 12.210  2.549   1.00 0.00 ? 70  LEU D H    1  
ATOM   5891   H HA   . LEU D 2 68  ? -23.810 14.579  1.377   1.00 0.00 ? 70  LEU D HA   1  
ATOM   5892   H HB2  . LEU D 2 68  ? -22.804 12.268  1.977   1.00 0.00 ? 70  LEU D HB2  1  
ATOM   5893   H HB3  . LEU D 2 68  ? -23.415 11.796  0.392   1.00 0.00 ? 70  LEU D HB3  1  
ATOM   5894   H HG   . LEU D 2 68  ? -21.829 13.174  -0.695  1.00 0.00 ? 70  LEU D HG   1  
ATOM   5895   H HD11 . LEU D 2 68  ? -21.013 14.028  2.092   1.00 0.00 ? 70  LEU D HD11 1  
ATOM   5896   H HD12 . LEU D 2 68  ? -20.097 14.383  0.624   1.00 0.00 ? 70  LEU D HD12 1  
ATOM   5897   H HD13 . LEU D 2 68  ? -21.713 15.056  0.841   1.00 0.00 ? 70  LEU D HD13 1  
ATOM   5898   H HD21 . LEU D 2 68  ? -21.311 10.941  0.950   1.00 0.00 ? 70  LEU D HD21 1  
ATOM   5899   H HD22 . LEU D 2 68  ? -20.387 11.466  -0.458  1.00 0.00 ? 70  LEU D HD22 1  
ATOM   5900   H HD23 . LEU D 2 68  ? -19.932 12.021  1.153   1.00 0.00 ? 70  LEU D HD23 1  
ATOM   5901   N N    . LEU D 2 69  ? -25.846 12.726  -0.409  1.00 0.00 ? 71  LEU D N    1  
ATOM   5902   C CA   . LEU D 2 69  ? -26.676 12.648  -1.627  1.00 0.00 ? 71  LEU D CA   1  
ATOM   5903   C C    . LEU D 2 69  ? -28.168 12.628  -1.227  1.00 0.00 ? 71  LEU D C    1  
ATOM   5904   O O    . LEU D 2 69  ? -28.847 11.620  -1.390  1.00 0.00 ? 71  LEU D O    1  
ATOM   5905   C CB   . LEU D 2 69  ? -26.314 11.362  -2.375  1.00 0.00 ? 71  LEU D CB   1  
ATOM   5906   C CG   . LEU D 2 69  ? -24.809 11.196  -2.598  1.00 0.00 ? 71  LEU D CG   1  
ATOM   5907   C CD1  . LEU D 2 69  ? -24.503 9.786   -3.038  1.00 0.00 ? 71  LEU D CD1  1  
ATOM   5908   C CD2  . LEU D 2 69  ? -24.302 12.229  -3.597  1.00 0.00 ? 71  LEU D CD2  1  
ATOM   5909   H H    . LEU D 2 69  ? -25.951 12.023  0.265   1.00 0.00 ? 71  LEU D H    1  
ATOM   5910   H HA   . LEU D 2 69  ? -26.480 13.504  -2.255  1.00 0.00 ? 71  LEU D HA   1  
ATOM   5911   H HB2  . LEU D 2 69  ? -26.673 10.519  -1.803  1.00 0.00 ? 71  LEU D HB2  1  
ATOM   5912   H HB3  . LEU D 2 69  ? -26.804 11.376  -3.338  1.00 0.00 ? 71  LEU D HB3  1  
ATOM   5913   H HG   . LEU D 2 69  ? -24.286 11.403  -1.675  1.00 0.00 ? 71  LEU D HG   1  
ATOM   5914   H HD11 . LEU D 2 69  ? -25.339 9.145   -2.801  1.00 0.00 ? 71  LEU D HD11 1  
ATOM   5915   H HD12 . LEU D 2 69  ? -24.330 9.770   -4.105  1.00 0.00 ? 71  LEU D HD12 1  
ATOM   5916   H HD13 . LEU D 2 69  ? -23.621 9.432   -2.526  1.00 0.00 ? 71  LEU D HD13 1  
ATOM   5917   H HD21 . LEU D 2 69  ? -24.887 12.169  -4.503  1.00 0.00 ? 71  LEU D HD21 1  
ATOM   5918   H HD22 . LEU D 2 69  ? -24.395 13.216  -3.173  1.00 0.00 ? 71  LEU D HD22 1  
ATOM   5919   H HD23 . LEU D 2 69  ? -23.266 12.030  -3.824  1.00 0.00 ? 71  LEU D HD23 1  
ATOM   5920   N N    . PRO D 2 70  ? -28.706 13.772  -0.752  1.00 0.00 ? 72  PRO D N    1  
ATOM   5921   C CA   . PRO D 2 70  ? -30.114 13.835  -0.334  1.00 0.00 ? 72  PRO D CA   1  
ATOM   5922   C C    . PRO D 2 70  ? -31.130 13.671  -1.466  1.00 0.00 ? 72  PRO D C    1  
ATOM   5923   O O    . PRO D 2 70  ? -32.304 13.404  -1.218  1.00 0.00 ? 72  PRO D O    1  
ATOM   5924   C CB   . PRO D 2 70  ? -30.209 15.209  0.338   1.00 0.00 ? 72  PRO D CB   1  
ATOM   5925   C CG   . PRO D 2 70  ? -29.264 16.035  -0.455  1.00 0.00 ? 72  PRO D CG   1  
ATOM   5926   C CD   . PRO D 2 70  ? -28.084 15.115  -0.717  1.00 0.00 ? 72  PRO D CD   1  
ATOM   5927   H HA   . PRO D 2 70  ? -30.346 13.045  0.365   1.00 0.00 ? 72  PRO D HA   1  
ATOM   5928   H HB2  . PRO D 2 70  ? -31.212 15.604  0.278   1.00 0.00 ? 72  PRO D HB2  1  
ATOM   5929   H HB3  . PRO D 2 70  ? -29.902 15.158  1.372   1.00 0.00 ? 72  PRO D HB3  1  
ATOM   5930   H HG2  . PRO D 2 70  ? -29.719 16.348  -1.385  1.00 0.00 ? 72  PRO D HG2  1  
ATOM   5931   H HG3  . PRO D 2 70  ? -28.954 16.904  0.105   1.00 0.00 ? 72  PRO D HG3  1  
ATOM   5932   H HD2  . PRO D 2 70  ? -27.611 15.347  -1.658  1.00 0.00 ? 72  PRO D HD2  1  
ATOM   5933   H HD3  . PRO D 2 70  ? -27.357 15.184  0.079   1.00 0.00 ? 72  PRO D HD3  1  
ATOM   5934   N N    . ASN D 2 71  ? -30.673 13.802  -2.704  1.00 0.00 ? 73  ASN D N    1  
ATOM   5935   C CA   . ASN D 2 71  ? -31.566 13.664  -3.850  1.00 0.00 ? 73  ASN D CA   1  
ATOM   5936   C C    . ASN D 2 71  ? -31.398 12.358  -4.636  1.00 0.00 ? 73  ASN D C    1  
ATOM   5937   O O    . ASN D 2 71  ? -31.815 12.274  -5.794  1.00 0.00 ? 73  ASN D O    1  
ATOM   5938   C CB   . ASN D 2 71  ? -31.400 14.862  -4.782  1.00 0.00 ? 73  ASN D CB   1  
ATOM   5939   C CG   . ASN D 2 71  ? -30.030 14.945  -5.373  1.00 0.00 ? 73  ASN D CG   1  
ATOM   5940   O OD1  . ASN D 2 71  ? -29.052 14.486  -4.772  1.00 0.00 ? 73  ASN D OD1  1  
ATOM   5941   N ND2  . ASN D 2 71  ? -29.938 15.513  -6.562  1.00 0.00 ? 73  ASN D ND2  1  
ATOM   5942   H H    . ASN D 2 71  ? -29.724 13.996  -2.851  1.00 0.00 ? 73  ASN D H    1  
ATOM   5943   H HA   . ASN D 2 71  ? -32.583 13.679  -3.485  1.00 0.00 ? 73  ASN D HA   1  
ATOM   5944   H HB2  . ASN D 2 71  ? -32.119 14.783  -5.583  1.00 0.00 ? 73  ASN D HB2  1  
ATOM   5945   H HB3  . ASN D 2 71  ? -31.600 15.766  -4.223  1.00 0.00 ? 73  ASN D HB3  1  
ATOM   5946   H HD21 . ASN D 2 71  ? -30.802 15.808  -6.900  1.00 0.00 ? 73  ASN D HD21 1  
ATOM   5947   H HD22 . ASN D 2 71  ? -29.133 15.650  -7.092  1.00 0.00 ? 73  ASN D HD22 1  
ATOM   5948   N N    . LYS D 2 72  ? -30.853 11.327  -3.996  1.00 0.00 ? 74  LYS D N    1  
ATOM   5949   C CA   . LYS D 2 72  ? -30.625 10.043  -4.662  1.00 0.00 ? 74  LYS D CA   1  
ATOM   5950   C C    . LYS D 2 72  ? -31.057 8.902   -3.765  1.00 0.00 ? 74  LYS D C    1  
ATOM   5951   O O    . LYS D 2 72  ? -30.973 9.021   -2.543  1.00 0.00 ? 74  LYS D O    1  
ATOM   5952   C CB   . LYS D 2 72  ? -29.126 9.841   -4.931  1.00 0.00 ? 74  LYS D CB   1  
ATOM   5953   C CG   . LYS D 2 72  ? -28.445 10.941  -5.692  1.00 0.00 ? 74  LYS D CG   1  
ATOM   5954   C CD   . LYS D 2 72  ? -28.833 10.849  -7.144  1.00 0.00 ? 74  LYS D CD   1  
ATOM   5955   C CE   . LYS D 2 72  ? -28.227 11.970  -7.949  1.00 0.00 ? 74  LYS D CE   1  
ATOM   5956   N NZ   . LYS D 2 72  ? -28.460 11.713  -9.396  1.00 0.00 ? 74  LYS D NZ   1  
ATOM   5957   H H    . LYS D 2 72  ? -30.597 11.429  -3.054  1.00 0.00 ? 74  LYS D H    1  
ATOM   5958   H HA   . LYS D 2 72  ? -31.161 10.028  -5.600  1.00 0.00 ? 74  LYS D HA   1  
ATOM   5959   H HB2  . LYS D 2 72  ? -28.628 9.743   -3.976  1.00 0.00 ? 74  LYS D HB2  1  
ATOM   5960   H HB3  . LYS D 2 72  ? -29.010 8.927   -5.493  1.00 0.00 ? 74  LYS D HB3  1  
ATOM   5961   H HG2  . LYS D 2 72  ? -28.750 11.898  -5.297  1.00 0.00 ? 74  LYS D HG2  1  
ATOM   5962   H HG3  . LYS D 2 72  ? -27.374 10.838  -5.598  1.00 0.00 ? 74  LYS D HG3  1  
ATOM   5963   H HD2  . LYS D 2 72  ? -28.489 9.904   -7.540  1.00 0.00 ? 74  LYS D HD2  1  
ATOM   5964   H HD3  . LYS D 2 72  ? -29.909 10.900  -7.223  1.00 0.00 ? 74  LYS D HD3  1  
ATOM   5965   H HE2  . LYS D 2 72  ? -28.687 12.907  -7.669  1.00 0.00 ? 74  LYS D HE2  1  
ATOM   5966   H HE3  . LYS D 2 72  ? -27.165 12.020  -7.757  1.00 0.00 ? 74  LYS D HE3  1  
ATOM   5967   H HZ1  . LYS D 2 72  ? -29.287 11.093  -9.509  1.00 0.00 ? 74  LYS D HZ1  1  
ATOM   5968   H HZ2  . LYS D 2 72  ? -28.635 12.616  -9.885  1.00 0.00 ? 74  LYS D HZ2  1  
ATOM   5969   H HZ3  . LYS D 2 72  ? -27.623 11.255  -9.806  1.00 0.00 ? 74  LYS D HZ3  1  
ATOM   5970   N N    . PRO D 2 73  ? -31.632 7.827   -4.350  1.00 0.00 ? 75  PRO D N    1  
ATOM   5971   C CA   . PRO D 2 73  ? -32.028 6.702   -3.501  1.00 0.00 ? 75  PRO D CA   1  
ATOM   5972   C C    . PRO D 2 73  ? -30.707 5.971   -3.200  1.00 0.00 ? 75  PRO D C    1  
ATOM   5973   O O    . PRO D 2 73  ? -29.918 5.724   -4.105  1.00 0.00 ? 75  PRO D O    1  
ATOM   5974   C CB   . PRO D 2 73  ? -32.958 5.880   -4.411  1.00 0.00 ? 75  PRO D CB   1  
ATOM   5975   C CG   . PRO D 2 73  ? -32.503 6.184   -5.780  1.00 0.00 ? 75  PRO D CG   1  
ATOM   5976   C CD   . PRO D 2 73  ? -32.128 7.655   -5.732  1.00 0.00 ? 75  PRO D CD   1  
ATOM   5977   H HA   . PRO D 2 73  ? -32.554 7.047   -2.624  1.00 0.00 ? 75  PRO D HA   1  
ATOM   5978   H HB2  . PRO D 2 73  ? -32.859 4.825   -4.202  1.00 0.00 ? 75  PRO D HB2  1  
ATOM   5979   H HB3  . PRO D 2 73  ? -33.987 6.179   -4.275  1.00 0.00 ? 75  PRO D HB3  1  
ATOM   5980   H HG2  . PRO D 2 73  ? -31.648 5.580   -6.043  1.00 0.00 ? 75  PRO D HG2  1  
ATOM   5981   H HG3  . PRO D 2 73  ? -33.296 6.015   -6.492  1.00 0.00 ? 75  PRO D HG3  1  
ATOM   5982   H HD2  . PRO D 2 73  ? -31.356 7.882   -6.451  1.00 0.00 ? 75  PRO D HD2  1  
ATOM   5983   H HD3  . PRO D 2 73  ? -32.989 8.281   -5.915  1.00 0.00 ? 75  PRO D HD3  1  
ATOM   5984   N N    . VAL D 2 74  ? -30.445 5.727   -1.923  1.00 0.00 ? 76  VAL D N    1  
ATOM   5985   C CA   . VAL D 2 74  ? -29.213 5.067   -1.483  1.00 0.00 ? 76  VAL D CA   1  
ATOM   5986   C C    . VAL D 2 74  ? -29.550 3.862   -0.626  1.00 0.00 ? 76  VAL D C    1  
ATOM   5987   O O    . VAL D 2 74  ? -30.336 3.973   0.309   1.00 0.00 ? 76  VAL D O    1  
ATOM   5988   C CB   . VAL D 2 74  ? -28.366 6.017   -0.590  1.00 0.00 ? 76  VAL D CB   1  
ATOM   5989   C CG1  . VAL D 2 74  ? -27.059 5.343   -0.196  1.00 0.00 ? 76  VAL D CG1  1  
ATOM   5990   C CG2  . VAL D 2 74  ? -28.112 7.349   -1.288  1.00 0.00 ? 76  VAL D CG2  1  
ATOM   5991   H H    . VAL D 2 74  ? -31.101 5.996   -1.248  1.00 0.00 ? 76  VAL D H    1  
ATOM   5992   H HA   . VAL D 2 74  ? -28.634 4.786   -2.351  1.00 0.00 ? 76  VAL D HA   1  
ATOM   5993   H HB   . VAL D 2 74  ? -28.925 6.258   0.304   1.00 0.00 ? 76  VAL D HB   1  
ATOM   5994   H HG11 . VAL D 2 74  ? -26.567 4.970   -1.084  1.00 0.00 ? 76  VAL D HG11 1  
ATOM   5995   H HG12 . VAL D 2 74  ? -26.419 6.059   0.297   1.00 0.00 ? 76  VAL D HG12 1  
ATOM   5996   H HG13 . VAL D 2 74  ? -27.264 4.522   0.475   1.00 0.00 ? 76  VAL D HG13 1  
ATOM   5997   H HG21 . VAL D 2 74  ? -28.799 7.458   -2.114  1.00 0.00 ? 76  VAL D HG21 1  
ATOM   5998   H HG22 . VAL D 2 74  ? -28.258 8.158   -0.587  1.00 0.00 ? 76  VAL D HG22 1  
ATOM   5999   H HG23 . VAL D 2 74  ? -27.096 7.372   -1.657  1.00 0.00 ? 76  VAL D HG23 1  
ATOM   6000   N N    . GLU D 2 75  ? -28.994 2.706   -0.945  1.00 0.00 ? 77  GLU D N    1  
ATOM   6001   C CA   . GLU D 2 75  ? -29.252 1.551   -0.114  1.00 0.00 ? 77  GLU D CA   1  
ATOM   6002   C C    . GLU D 2 75  ? -28.136 0.522   -0.097  1.00 0.00 ? 77  GLU D C    1  
ATOM   6003   O O    . GLU D 2 75  ? -27.233 0.559   -0.918  1.00 0.00 ? 77  GLU D O    1  
ATOM   6004   C CB   . GLU D 2 75  ? -30.629 0.930   -0.382  1.00 0.00 ? 77  GLU D CB   1  
ATOM   6005   C CG   . GLU D 2 75  ? -30.845 0.240   -1.701  1.00 0.00 ? 77  GLU D CG   1  
ATOM   6006   C CD   . GLU D 2 75  ? -32.233 -0.381  -1.753  1.00 0.00 ? 77  GLU D CD   1  
ATOM   6007   O OE1  . GLU D 2 75  ? -33.209 0.363   -1.992  1.00 0.00 ? 77  GLU D OE1  1  
ATOM   6008   O OE2  . GLU D 2 75  ? -32.361 -1.599  -1.522  1.00 0.00 ? 77  GLU D OE2  1  
ATOM   6009   H H    . GLU D 2 75  ? -28.416 2.634   -1.733  1.00 0.00 ? 77  GLU D H    1  
ATOM   6010   H HA   . GLU D 2 75  ? -29.203 1.851   0.922   1.00 0.00 ? 77  GLU D HA   1  
ATOM   6011   H HB2  . GLU D 2 75  ? -30.809 0.201   0.393   1.00 0.00 ? 77  GLU D HB2  1  
ATOM   6012   H HB3  . GLU D 2 75  ? -31.359 1.723   -0.312  1.00 0.00 ? 77  GLU D HB3  1  
ATOM   6013   H HG2  . GLU D 2 75  ? -30.747 0.960   -2.497  1.00 0.00 ? 77  GLU D HG2  1  
ATOM   6014   H HG3  . GLU D 2 75  ? -30.104 -0.535  -1.821  1.00 0.00 ? 77  GLU D HG3  1  
ATOM   6015   N N    . VAL D 2 76  ? -28.153 -0.312  0.929   1.00 0.00 ? 78  VAL D N    1  
ATOM   6016   C CA   . VAL D 2 76  ? -27.143 -1.339  1.121   1.00 0.00 ? 78  VAL D CA   1  
ATOM   6017   C C    . VAL D 2 76  ? -27.549 -2.609  0.399   1.00 0.00 ? 78  VAL D C    1  
ATOM   6018   O O    . VAL D 2 76  ? -28.716 -2.988  0.422   1.00 0.00 ? 78  VAL D O    1  
ATOM   6019   C CB   . VAL D 2 76  ? -26.959 -1.621  2.643   1.00 0.00 ? 78  VAL D CB   1  
ATOM   6020   C CG1  . VAL D 2 76  ? -25.972 -2.770  2.891   1.00 0.00 ? 78  VAL D CG1  1  
ATOM   6021   C CG2  . VAL D 2 76  ? -26.501 -0.351  3.339   1.00 0.00 ? 78  VAL D CG2  1  
ATOM   6022   H H    . VAL D 2 76  ? -28.874 -0.234  1.586   1.00 0.00 ? 78  VAL D H    1  
ATOM   6023   H HA   . VAL D 2 76  ? -26.208 -1.004  0.702   1.00 0.00 ? 78  VAL D HA   1  
ATOM   6024   H HB   . VAL D 2 76  ? -27.917 -1.886  3.068   1.00 0.00 ? 78  VAL D HB   1  
ATOM   6025   H HG11 . VAL D 2 76  ? -25.575 -3.114  1.948   1.00 0.00 ? 78  VAL D HG11 1  
ATOM   6026   H HG12 . VAL D 2 76  ? -25.165 -2.420  3.516   1.00 0.00 ? 78  VAL D HG12 1  
ATOM   6027   H HG13 . VAL D 2 76  ? -26.483 -3.582  3.387   1.00 0.00 ? 78  VAL D HG13 1  
ATOM   6028   H HG21 . VAL D 2 76  ? -27.196 0.448   3.126   1.00 0.00 ? 78  VAL D HG21 1  
ATOM   6029   H HG22 . VAL D 2 76  ? -26.460 -0.518  4.405   1.00 0.00 ? 78  VAL D HG22 1  
ATOM   6030   H HG23 . VAL D 2 76  ? -25.518 -0.078  2.980   1.00 0.00 ? 78  VAL D HG23 1  
ATOM   6031   N N    . ILE D 2 77  ? -26.580 -3.271  -0.228  1.00 0.00 ? 79  ILE D N    1  
ATOM   6032   C CA   . ILE D 2 77  ? -26.828 -4.511  -0.955  1.00 0.00 ? 79  ILE D CA   1  
ATOM   6033   C C    . ILE D 2 77  ? -27.016 -5.621  0.054   1.00 0.00 ? 79  ILE D C    1  
ATOM   6034   O O    . ILE D 2 77  ? -26.296 -5.698  1.044   1.00 0.00 ? 79  ILE D O    1  
ATOM   6035   C CB   . ILE D 2 77  ? -25.647 -4.860  -1.893  1.00 0.00 ? 79  ILE D CB   1  
ATOM   6036   C CG1  . ILE D 2 77  ? -25.510 -3.769  -2.958  1.00 0.00 ? 79  ILE D CG1  1  
ATOM   6037   C CG2  . ILE D 2 77  ? -25.859 -6.225  -2.564  1.00 0.00 ? 79  ILE D CG2  1  
ATOM   6038   C CD1  . ILE D 2 77  ? -24.276 -3.875  -3.799  1.00 0.00 ? 79  ILE D CD1  1  
ATOM   6039   H H    . ILE D 2 77  ? -25.667 -2.914  -0.198  1.00 0.00 ? 79  ILE D H    1  
ATOM   6040   H HA   . ILE D 2 77  ? -27.725 -4.398  -1.544  1.00 0.00 ? 79  ILE D HA   1  
ATOM   6041   H HB   . ILE D 2 77  ? -24.733 -4.920  -1.319  1.00 0.00 ? 79  ILE D HB   1  
ATOM   6042   H HG12 . ILE D 2 77  ? -26.369 -3.823  -3.611  1.00 0.00 ? 79  ILE D HG12 1  
ATOM   6043   H HG13 . ILE D 2 77  ? -25.497 -2.810  -2.460  1.00 0.00 ? 79  ILE D HG13 1  
ATOM   6044   H HG21 . ILE D 2 77  ? -26.817 -6.626  -2.269  1.00 0.00 ? 79  ILE D HG21 1  
ATOM   6045   H HG22 . ILE D 2 77  ? -25.832 -6.107  -3.636  1.00 0.00 ? 79  ILE D HG22 1  
ATOM   6046   H HG23 . ILE D 2 77  ? -25.076 -6.903  -2.256  1.00 0.00 ? 79  ILE D HG23 1  
ATOM   6047   H HD11 . ILE D 2 77  ? -23.437 -4.142  -3.173  1.00 0.00 ? 79  ILE D HD11 1  
ATOM   6048   H HD12 . ILE D 2 77  ? -24.419 -4.636  -4.553  1.00 0.00 ? 79  ILE D HD12 1  
ATOM   6049   H HD13 . ILE D 2 77  ? -24.082 -2.926  -4.277  1.00 0.00 ? 79  ILE D HD13 1  
ATOM   6050   N N    . ASP D 2 78  ? -28.012 -6.460  -0.177  1.00 0.00 ? 80  ASP D N    1  
ATOM   6051   C CA   . ASP D 2 78  ? -28.268 -7.583  0.713   1.00 0.00 ? 80  ASP D CA   1  
ATOM   6052   C C    . ASP D 2 78  ? -26.996 -8.441  0.826   1.00 0.00 ? 80  ASP D C    1  
ATOM   6053   O O    . ASP D 2 78  ? -26.487 -8.919  -0.178  1.00 0.00 ? 80  ASP D O    1  
ATOM   6054   C CB   . ASP D 2 78  ? -29.415 -8.424  0.155   1.00 0.00 ? 80  ASP D CB   1  
ATOM   6055   C CG   . ASP D 2 78  ? -29.754 -9.584  1.048   1.00 0.00 ? 80  ASP D CG   1  
ATOM   6056   O OD1  . ASP D 2 78  ? -30.385 -9.356  2.110   1.00 0.00 ? 80  ASP D OD1  1  
ATOM   6057   O OD2  . ASP D 2 78  ? -29.369 -10.723 0.712   1.00 0.00 ? 80  ASP D OD2  1  
ATOM   6058   H H    . ASP D 2 78  ? -28.587 -6.321  -0.957  1.00 0.00 ? 80  ASP D H    1  
ATOM   6059   H HA   . ASP D 2 78  ? -28.536 -7.214  1.692   1.00 0.00 ? 80  ASP D HA   1  
ATOM   6060   H HB2  . ASP D 2 78  ? -30.287 -7.796  0.051   1.00 0.00 ? 80  ASP D HB2  1  
ATOM   6061   H HB3  . ASP D 2 78  ? -29.127 -8.805  -0.814  1.00 0.00 ? 80  ASP D HB3  1  
ATOM   6062   N N    . SER D 2 79  ? -26.520 -8.687  2.044   1.00 0.00 ? 81  SER D N    1  
ATOM   6063   C CA   . SER D 2 79  ? -25.289 -9.461  2.237   1.00 0.00 ? 81  SER D CA   1  
ATOM   6064   C C    . SER D 2 79  ? -25.251 -10.874 1.653   1.00 0.00 ? 81  SER D C    1  
ATOM   6065   O O    . SER D 2 79  ? -24.199 -11.324 1.185   1.00 0.00 ? 81  SER D O    1  
ATOM   6066   C CB   . SER D 2 79  ? -24.855 -9.460  3.701   1.00 0.00 ? 81  SER D CB   1  
ATOM   6067   O OG   . SER D 2 79  ? -25.819 -10.160 4.476   1.00 0.00 ? 81  SER D OG   1  
ATOM   6068   H H    . SER D 2 79  ? -27.000 -8.344  2.826   1.00 0.00 ? 81  SER D H    1  
ATOM   6069   H HA   . SER D 2 79  ? -24.501 -9.026  1.638   1.00 0.00 ? 81  SER D HA   1  
ATOM   6070   H HB2  . SER D 2 79  ? -23.900 -9.950  3.796   1.00 0.00 ? 81  SER D HB2  1  
ATOM   6071   H HB3  . SER D 2 79  ? -24.769 -8.439  4.049   1.00 0.00 ? 81  SER D HB3  1  
ATOM   6072   H HG   . SER D 2 79  ? -26.627 -9.641  4.484   1.00 0.00 ? 81  SER D HG   1  
ATOM   6073   N N    . LEU D 2 80  ? -26.398 -11.545 1.616   1.00 0.00 ? 82  LEU D N    1  
ATOM   6074   C CA   . LEU D 2 80  ? -26.481 -12.899 1.074   1.00 0.00 ? 82  LEU D CA   1  
ATOM   6075   C C    . LEU D 2 80  ? -26.400 -12.854 -0.445  1.00 0.00 ? 82  LEU D C    1  
ATOM   6076   O O    . LEU D 2 80  ? -25.730 -13.677 -1.075  1.00 0.00 ? 82  LEU D O    1  
ATOM   6077   C CB   . LEU D 2 80  ? -27.808 -13.558 1.484   1.00 0.00 ? 82  LEU D CB   1  
ATOM   6078   C CG   . LEU D 2 80  ? -27.913 -13.697 3.021   1.00 0.00 ? 82  LEU D CG   1  
ATOM   6079   C CD1  . LEU D 2 80  ? -29.365 -14.041 3.418   1.00 0.00 ? 82  LEU D CD1  1  
ATOM   6080   C CD2  . LEU D 2 80  ? -26.989 -14.816 3.545   1.00 0.00 ? 82  LEU D CD2  1  
ATOM   6081   H H    . LEU D 2 80  ? -27.210 -11.120 1.963   1.00 0.00 ? 82  LEU D H    1  
ATOM   6082   H HA   . LEU D 2 80  ? -25.659 -13.488 1.450   1.00 0.00 ? 82  LEU D HA   1  
ATOM   6083   H HB2  . LEU D 2 80  ? -28.624 -12.950 1.122   1.00 0.00 ? 82  LEU D HB2  1  
ATOM   6084   H HB3  . LEU D 2 80  ? -27.870 -14.539 1.034   1.00 0.00 ? 82  LEU D HB3  1  
ATOM   6085   H HG   . LEU D 2 80  ? -27.636 -12.759 3.480   1.00 0.00 ? 82  LEU D HG   1  
ATOM   6086   H HD11 . LEU D 2 80  ? -30.042 -13.774 2.620   1.00 0.00 ? 82  LEU D HD11 1  
ATOM   6087   H HD12 . LEU D 2 80  ? -29.451 -15.101 3.617   1.00 0.00 ? 82  LEU D HD12 1  
ATOM   6088   H HD13 . LEU D 2 80  ? -29.632 -13.490 4.307   1.00 0.00 ? 82  LEU D HD13 1  
ATOM   6089   H HD21 . LEU D 2 80  ? -26.034 -14.778 3.057   1.00 0.00 ? 82  LEU D HD21 1  
ATOM   6090   H HD22 . LEU D 2 80  ? -26.846 -14.689 4.608   1.00 0.00 ? 82  LEU D HD22 1  
ATOM   6091   H HD23 . LEU D 2 80  ? -27.449 -15.775 3.361   1.00 0.00 ? 82  LEU D HD23 1  
ATOM   6092   N N    . LEU D 2 81  ? -27.095 -11.884 -1.033  1.00 0.00 ? 83  LEU D N    1  
ATOM   6093   C CA   . LEU D 2 81  ? -27.102 -11.710 -2.481  1.00 0.00 ? 83  LEU D CA   1  
ATOM   6094   C C    . LEU D 2 81  ? -25.702 -11.343 -2.921  1.00 0.00 ? 83  LEU D C    1  
ATOM   6095   O O    . LEU D 2 81  ? -25.242 -11.781 -3.978  1.00 0.00 ? 83  LEU D O    1  
ATOM   6096   C CB   . LEU D 2 81  ? -28.071 -10.585 -2.908  1.00 0.00 ? 83  LEU D CB   1  
ATOM   6097   C CG   . LEU D 2 81  ? -29.594 -10.773 -2.806  1.00 0.00 ? 83  LEU D CG   1  
ATOM   6098   C CD1  . LEU D 2 81  ? -30.281 -9.638  -3.549  1.00 0.00 ? 83  LEU D CD1  1  
ATOM   6099   C CD2  . LEU D 2 81  ? -30.012 -12.108 -3.414  1.00 0.00 ? 83  LEU D CD2  1  
ATOM   6100   H H    . LEU D 2 81  ? -27.618 -11.270 -0.477  1.00 0.00 ? 83  LEU D H    1  
ATOM   6101   H HA   . LEU D 2 81  ? -27.413 -12.635 -2.944  1.00 0.00 ? 83  LEU D HA   1  
ATOM   6102   H HB2  . LEU D 2 81  ? -27.827 -9.726  -2.305  1.00 0.00 ? 83  LEU D HB2  1  
ATOM   6103   H HB3  . LEU D 2 81  ? -27.856 -10.375 -3.943  1.00 0.00 ? 83  LEU D HB3  1  
ATOM   6104   H HG   . LEU D 2 81  ? -29.892 -10.759 -1.768  1.00 0.00 ? 83  LEU D HG   1  
ATOM   6105   H HD11 . LEU D 2 81  ? -29.576 -9.165  -4.213  1.00 0.00 ? 83  LEU D HD11 1  
ATOM   6106   H HD12 . LEU D 2 81  ? -31.109 -10.032 -4.121  1.00 0.00 ? 83  LEU D HD12 1  
ATOM   6107   H HD13 . LEU D 2 81  ? -30.649 -8.915  -2.838  1.00 0.00 ? 83  LEU D HD13 1  
ATOM   6108   H HD21 . LEU D 2 81  ? -29.308 -12.873 -3.121  1.00 0.00 ? 83  LEU D HD21 1  
ATOM   6109   H HD22 . LEU D 2 81  ? -30.997 -12.371 -3.060  1.00 0.00 ? 83  LEU D HD22 1  
ATOM   6110   H HD23 . LEU D 2 81  ? -30.027 -12.025 -4.489  1.00 0.00 ? 83  LEU D HD23 1  
ATOM   6111   N N    . TYR D 2 82  ? -25.029 -10.543 -2.097  1.00 0.00 ? 84  TYR D N    1  
ATOM   6112   C CA   . TYR D 2 82  ? -23.663 -10.099 -2.379  1.00 0.00 ? 84  TYR D CA   1  
ATOM   6113   C C    . TYR D 2 82  ? -22.652 -11.252 -2.261  1.00 0.00 ? 84  TYR D C    1  
ATOM   6114   O O    . TYR D 2 82  ? -21.867 -11.499 -3.184  1.00 0.00 ? 84  TYR D O    1  
ATOM   6115   C CB   . TYR D 2 82  ? -23.213 -9.000  -1.413  1.00 0.00 ? 84  TYR D CB   1  
ATOM   6116   C CG   . TYR D 2 82  ? -21.959 -8.341  -1.945  1.00 0.00 ? 84  TYR D CG   1  
ATOM   6117   C CD1  . TYR D 2 82  ? -22.020 -7.085  -2.566  1.00 0.00 ? 84  TYR D CD1  1  
ATOM   6118   C CD2  . TYR D 2 82  ? -20.727 -8.989  -1.806  1.00 0.00 ? 84  TYR D CD2  1  
ATOM   6119   C CE1  . TYR D 2 82  ? -20.853 -6.485  -3.050  1.00 0.00 ? 84  TYR D CE1  1  
ATOM   6120   C CE2  . TYR D 2 82  ? -19.561 -8.387  -2.289  1.00 0.00 ? 84  TYR D CE2  1  
ATOM   6121   C CZ   . TYR D 2 82  ? -19.623 -7.135  -2.909  1.00 0.00 ? 84  TYR D CZ   1  
ATOM   6122   O OH   . TYR D 2 82  ? -18.470 -6.539  -3.377  1.00 0.00 ? 84  TYR D OH   1  
ATOM   6123   H H    . TYR D 2 82  ? -25.463 -10.242 -1.272  1.00 0.00 ? 84  TYR D H    1  
ATOM   6124   H HA   . TYR D 2 82  ? -23.600 -9.759  -3.403  1.00 0.00 ? 84  TYR D HA   1  
ATOM   6125   H HB2  . TYR D 2 82  ? -23.987 -8.279  -1.289  1.00 0.00 ? 84  TYR D HB2  1  
ATOM   6126   H HB3  . TYR D 2 82  ? -22.994 -9.446  -0.454  1.00 0.00 ? 84  TYR D HB3  1  
ATOM   6127   H HD1  . TYR D 2 82  ? -22.961 -6.580  -2.675  1.00 0.00 ? 84  TYR D HD1  1  
ATOM   6128   H HD2  . TYR D 2 82  ? -20.676 -9.954  -1.326  1.00 0.00 ? 84  TYR D HD2  1  
ATOM   6129   H HE1  . TYR D 2 82  ? -20.902 -5.518  -3.530  1.00 0.00 ? 84  TYR D HE1  1  
ATOM   6130   H HE2  . TYR D 2 82  ? -18.611 -8.888  -2.182  1.00 0.00 ? 84  TYR D HE2  1  
ATOM   6131   H HH   . TYR D 2 82  ? -18.087 -7.114  -4.044  1.00 0.00 ? 84  TYR D HH   1  
ATOM   6132   N N    . GLY D 2 83  ? -22.702 -11.974 -1.142  1.00 0.00 ? 85  GLY D N    1  
ATOM   6133   C CA   . GLY D 2 83  ? -21.790 -13.080 -0.941  1.00 0.00 ? 85  GLY D CA   1  
ATOM   6134   C C    . GLY D 2 83  ? -21.885 -14.139 -2.022  1.00 0.00 ? 85  GLY D C    1  
ATOM   6135   O O    . GLY D 2 83  ? -20.878 -14.678 -2.478  1.00 0.00 ? 85  GLY D O    1  
ATOM   6136   H H    . GLY D 2 83  ? -23.361 -11.753 -0.449  1.00 0.00 ? 85  GLY D H    1  
ATOM   6137   H HA2  . GLY D 2 83  ? -20.781 -12.694 -0.928  1.00 0.00 ? 85  GLY D HA2  1  
ATOM   6138   H HA3  . GLY D 2 83  ? -22.012 -13.540 0.011   1.00 0.00 ? 85  GLY D HA3  1  
ATOM   6139   N N    . LYS D 2 84  ? -23.109 -14.415 -2.444  1.00 0.00 ? 86  LYS D N    1  
ATOM   6140   C CA   . LYS D 2 84  ? -23.405 -15.418 -3.463  1.00 0.00 ? 86  LYS D CA   1  
ATOM   6141   C C    . LYS D 2 84  ? -23.122 -14.926 -4.886  1.00 0.00 ? 86  LYS D C    1  
ATOM   6142   O O    . LYS D 2 84  ? -23.186 -15.702 -5.844  1.00 0.00 ? 86  LYS D O    1  
ATOM   6143   C CB   . LYS D 2 84  ? -24.887 -15.808 -3.351  1.00 0.00 ? 86  LYS D CB   1  
ATOM   6144   C CG   . LYS D 2 84  ? -25.080 -17.295 -3.654  1.00 0.00 ? 86  LYS D CG   1  
ATOM   6145   C CD   . LYS D 2 84  ? -26.542 -17.669 -3.396  1.00 0.00 ? 86  LYS D CD   1  
ATOM   6146   C CE   . LYS D 2 84  ? -26.759 -19.153 -3.693  1.00 0.00 ? 86  LYS D CE   1  
ATOM   6147   N NZ   . LYS D 2 84  ? -28.191 -19.496 -3.464  1.00 0.00 ? 86  LYS D NZ   1  
ATOM   6148   H H    . LYS D 2 84  ? -23.856 -13.921 -2.050  1.00 0.00 ? 86  LYS D H    1  
ATOM   6149   H HA   . LYS D 2 84  ? -22.800 -16.297 -3.301  1.00 0.00 ? 86  LYS D HA   1  
ATOM   6150   H HB2  . LYS D 2 84  ? -25.231 -15.604 -2.347  1.00 0.00 ? 86  LYS D HB2  1  
ATOM   6151   H HB3  . LYS D 2 84  ? -25.469 -15.224 -4.049  1.00 0.00 ? 86  LYS D HB3  1  
ATOM   6152   H HG2  . LYS D 2 84  ? -24.831 -17.490 -4.688  1.00 0.00 ? 86  LYS D HG2  1  
ATOM   6153   H HG3  . LYS D 2 84  ? -24.441 -17.882 -3.011  1.00 0.00 ? 86  LYS D HG3  1  
ATOM   6154   H HD2  . LYS D 2 84  ? -26.786 -17.469 -2.363  1.00 0.00 ? 86  LYS D HD2  1  
ATOM   6155   H HD3  . LYS D 2 84  ? -27.180 -17.079 -4.037  1.00 0.00 ? 86  LYS D HD3  1  
ATOM   6156   H HE2  . LYS D 2 84  ? -26.498 -19.357 -4.721  1.00 0.00 ? 86  LYS D HE2  1  
ATOM   6157   H HE3  . LYS D 2 84  ? -26.137 -19.745 -3.038  1.00 0.00 ? 86  LYS D HE3  1  
ATOM   6158   H HZ1  . LYS D 2 84  ? -28.795 -18.759 -3.880  1.00 0.00 ? 86  LYS D HZ1  1  
ATOM   6159   H HZ2  . LYS D 2 84  ? -28.403 -20.412 -3.910  1.00 0.00 ? 86  LYS D HZ2  1  
ATOM   6160   H HZ3  . LYS D 2 84  ? -28.375 -19.556 -2.443  1.00 0.00 ? 86  LYS D HZ3  1  
ATOM   6161   N N    . VAL D 2 85  ? -22.831 -13.634 -5.014  1.00 0.00 ? 87  VAL D N    1  
ATOM   6162   C CA   . VAL D 2 85  ? -22.566 -12.983 -6.307  1.00 0.00 ? 87  VAL D CA   1  
ATOM   6163   C C    . VAL D 2 85  ? -23.771 -13.131 -7.261  1.00 0.00 ? 87  VAL D C    1  
ATOM   6164   O O    . VAL D 2 85  ? -23.627 -13.438 -8.451  1.00 0.00 ? 87  VAL D O    1  
ATOM   6165   C CB   . VAL D 2 85  ? -21.284 -13.511 -6.951  1.00 0.00 ? 87  VAL D CB   1  
ATOM   6166   C CG1  . VAL D 2 85  ? -20.803 -12.524 -8.016  1.00 0.00 ? 87  VAL D CG1  1  
ATOM   6167   C CG2  . VAL D 2 85  ? -20.203 -13.669 -5.879  1.00 0.00 ? 87  VAL D CG2  1  
ATOM   6168   H H    . VAL D 2 85  ? -22.791 -13.085 -4.205  1.00 0.00 ? 87  VAL D H    1  
ATOM   6169   H HA   . VAL D 2 85  ? -22.491 -11.917 -6.149  1.00 0.00 ? 87  VAL D HA   1  
ATOM   6170   H HB   . VAL D 2 85  ? -21.480 -14.469 -7.411  1.00 0.00 ? 87  VAL D HB   1  
ATOM   6171   H HG11 . VAL D 2 85  ? -21.616 -12.295 -8.688  1.00 0.00 ? 87  VAL D HG11 1  
ATOM   6172   H HG12 . VAL D 2 85  ? -20.464 -11.616 -7.538  1.00 0.00 ? 87  VAL D HG12 1  
ATOM   6173   H HG13 . VAL D 2 85  ? -19.988 -12.963 -8.573  1.00 0.00 ? 87  VAL D HG13 1  
ATOM   6174   H HG21 . VAL D 2 85  ? -20.127 -12.756 -5.307  1.00 0.00 ? 87  VAL D HG21 1  
ATOM   6175   H HG22 . VAL D 2 85  ? -20.465 -14.485 -5.221  1.00 0.00 ? 87  VAL D HG22 1  
ATOM   6176   H HG23 . VAL D 2 85  ? -19.255 -13.878 -6.352  1.00 0.00 ? 87  VAL D HG23 1  
ATOM   6177   N N    . ASP D 2 86  ? -24.964 -12.853 -6.731  1.00 0.00 ? 88  ASP D N    1  
ATOM   6178   C CA   . ASP D 2 86  ? -26.208 -12.967 -7.493  1.00 0.00 ? 88  ASP D CA   1  
ATOM   6179   C C    . ASP D 2 86  ? -26.458 -11.717 -8.331  1.00 0.00 ? 88  ASP D C    1  
ATOM   6180   O O    . ASP D 2 86  ? -27.127 -10.773 -7.884  1.00 0.00 ? 88  ASP D O    1  
ATOM   6181   C CB   . ASP D 2 86  ? -27.390 -13.225 -6.539  1.00 0.00 ? 88  ASP D CB   1  
ATOM   6182   C CG   . ASP D 2 86  ? -28.688 -13.620 -7.270  1.00 0.00 ? 88  ASP D CG   1  
ATOM   6183   O OD1  . ASP D 2 86  ? -28.717 -13.734 -8.519  1.00 0.00 ? 88  ASP D OD1  1  
ATOM   6184   O OD2  . ASP D 2 86  ? -29.693 -13.823 -6.561  1.00 0.00 ? 88  ASP D OD2  1  
ATOM   6185   H H    . ASP D 2 86  ? -25.007 -12.561 -5.798  1.00 0.00 ? 88  ASP D H    1  
ATOM   6186   H HA   . ASP D 2 86  ? -26.125 -13.787 -8.192  1.00 0.00 ? 88  ASP D HA   1  
ATOM   6187   H HB2  . ASP D 2 86  ? -27.122 -14.026 -5.868  1.00 0.00 ? 88  ASP D HB2  1  
ATOM   6188   H HB3  . ASP D 2 86  ? -27.577 -12.325 -5.973  1.00 0.00 ? 88  ASP D HB3  1  
ATOM   6189   N N    . GLY D 2 87  ? -25.926 -11.742 -9.554  1.00 0.00 ? 89  GLY D N    1  
ATOM   6190   C CA   . GLY D 2 87  ? -26.075 -10.634 -10.478 1.00 0.00 ? 89  GLY D CA   1  
ATOM   6191   C C    . GLY D 2 87  ? -27.524 -10.303 -10.781 1.00 0.00 ? 89  GLY D C    1  
ATOM   6192   O O    . GLY D 2 87  ? -27.897 -9.126  -10.803 1.00 0.00 ? 89  GLY D O    1  
ATOM   6193   H H    . GLY D 2 87  ? -25.421 -12.533 -9.836  1.00 0.00 ? 89  GLY D H    1  
ATOM   6194   H HA2  . GLY D 2 87  ? -25.606 -9.762  -10.047 1.00 0.00 ? 89  GLY D HA2  1  
ATOM   6195   H HA3  . GLY D 2 87  ? -25.580 -10.887 -11.403 1.00 0.00 ? 89  GLY D HA3  1  
ATOM   6196   N N    . LEU D 2 88  ? -28.358 -11.320 -10.997 1.00 0.00 ? 90  LEU D N    1  
ATOM   6197   C CA   . LEU D 2 88  ? -29.772 -11.068 -11.303 1.00 0.00 ? 90  LEU D CA   1  
ATOM   6198   C C    . LEU D 2 88  ? -30.525 -10.472 -10.105 1.00 0.00 ? 90  LEU D C    1  
ATOM   6199   O O    . LEU D 2 88  ? -31.213 -9.462  -10.227 1.00 0.00 ? 90  LEU D O    1  
ATOM   6200   C CB   . LEU D 2 88  ? -30.457 -12.348 -11.795 1.00 0.00 ? 90  LEU D CB   1  
ATOM   6201   C CG   . LEU D 2 88  ? -31.928 -12.232 -12.219 1.00 0.00 ? 90  LEU D CG   1  
ATOM   6202   C CD1  . LEU D 2 88  ? -32.096 -11.169 -13.301 1.00 0.00 ? 90  LEU D CD1  1  
ATOM   6203   C CD2  . LEU D 2 88  ? -32.435 -13.590 -12.713 1.00 0.00 ? 90  LEU D CD2  1  
ATOM   6204   H H    . LEU D 2 88  ? -28.024 -12.241 -10.952 1.00 0.00 ? 90  LEU D H    1  
ATOM   6205   H HA   . LEU D 2 88  ? -29.839 -10.313 -12.072 1.00 0.00 ? 90  LEU D HA   1  
ATOM   6206   H HB2  . LEU D 2 88  ? -29.899 -12.710 -12.645 1.00 0.00 ? 90  LEU D HB2  1  
ATOM   6207   H HB3  . LEU D 2 88  ? -30.404 -13.073 -10.994 1.00 0.00 ? 90  LEU D HB3  1  
ATOM   6208   H HG   . LEU D 2 88  ? -32.526 -11.960 -11.362 1.00 0.00 ? 90  LEU D HG   1  
ATOM   6209   H HD11 . LEU D 2 88  ? -31.172 -11.067 -13.853 1.00 0.00 ? 90  LEU D HD11 1  
ATOM   6210   H HD12 . LEU D 2 88  ? -32.885 -11.465 -13.976 1.00 0.00 ? 90  LEU D HD12 1  
ATOM   6211   H HD13 . LEU D 2 88  ? -32.348 -10.223 -12.843 1.00 0.00 ? 90  LEU D HD13 1  
ATOM   6212   H HD21 . LEU D 2 88  ? -31.776 -14.369 -12.357 1.00 0.00 ? 90  LEU D HD21 1  
ATOM   6213   H HD22 . LEU D 2 88  ? -33.432 -13.759 -12.335 1.00 0.00 ? 90  LEU D HD22 1  
ATOM   6214   H HD23 . LEU D 2 88  ? -32.452 -13.598 -13.792 1.00 0.00 ? 90  LEU D HD23 1  
ATOM   6215   N N    . GLY D 2 89  ? -30.294 -11.049 -8.930  1.00 0.00 ? 91  GLY D N    1  
ATOM   6216   C CA   . GLY D 2 89  ? -30.943 -10.590 -7.718  1.00 0.00 ? 91  GLY D CA   1  
ATOM   6217   C C    . GLY D 2 89  ? -30.648 -9.153  -7.352  1.00 0.00 ? 91  GLY D C    1  
ATOM   6218   O O    . GLY D 2 89  ? -31.550 -8.403  -6.976  1.00 0.00 ? 91  GLY D O    1  
ATOM   6219   H H    . GLY D 2 89  ? -29.669 -11.803 -8.883  1.00 0.00 ? 91  GLY D H    1  
ATOM   6220   H HA2  . GLY D 2 89  ? -32.010 -10.691 -7.848  1.00 0.00 ? 91  GLY D HA2  1  
ATOM   6221   H HA3  . GLY D 2 89  ? -30.617 -11.218 -6.903  1.00 0.00 ? 91  GLY D HA3  1  
ATOM   6222   N N    . VAL D 2 90  ? -29.383 -8.757  -7.461  1.00 0.00 ? 92  VAL D N    1  
ATOM   6223   C CA   . VAL D 2 90  ? -28.991 -7.385  -7.130  1.00 0.00 ? 92  VAL D CA   1  
ATOM   6224   C C    . VAL D 2 90  ? -29.498 -6.431  -8.195  1.00 0.00 ? 92  VAL D C    1  
ATOM   6225   O O    . VAL D 2 90  ? -29.933 -5.315  -7.885  1.00 0.00 ? 92  VAL D O    1  
ATOM   6226   C CB   . VAL D 2 90  ? -27.463 -7.260  -6.914  1.00 0.00 ? 92  VAL D CB   1  
ATOM   6227   C CG1  . VAL D 2 90  ? -27.086 -5.800  -6.569  1.00 0.00 ? 92  VAL D CG1  1  
ATOM   6228   C CG2  . VAL D 2 90  ? -27.038 -8.194  -5.799  1.00 0.00 ? 92  VAL D CG2  1  
ATOM   6229   H H    . VAL D 2 90  ? -28.702 -9.391  -7.766  1.00 0.00 ? 92  VAL D H    1  
ATOM   6230   H HA   . VAL D 2 90  ? -29.498 -7.086  -6.224  1.00 0.00 ? 92  VAL D HA   1  
ATOM   6231   H HB   . VAL D 2 90  ? -26.950 -7.556  -7.818  1.00 0.00 ? 92  VAL D HB   1  
ATOM   6232   H HG11 . VAL D 2 90  ? -27.785 -5.126  -7.041  1.00 0.00 ? 92  VAL D HG11 1  
ATOM   6233   H HG12 . VAL D 2 90  ? -27.119 -5.663  -5.497  1.00 0.00 ? 92  VAL D HG12 1  
ATOM   6234   H HG13 . VAL D 2 90  ? -26.089 -5.591  -6.928  1.00 0.00 ? 92  VAL D HG13 1  
ATOM   6235   H HG21 . VAL D 2 90  ? -27.871 -8.357  -5.130  1.00 0.00 ? 92  VAL D HG21 1  
ATOM   6236   H HG22 . VAL D 2 90  ? -26.725 -9.138  -6.220  1.00 0.00 ? 92  VAL D HG22 1  
ATOM   6237   H HG23 . VAL D 2 90  ? -26.219 -7.752  -5.252  1.00 0.00 ? 92  VAL D HG23 1  
ATOM   6238   N N    . LEU D 2 91  ? -29.466 -6.875  -9.449  1.00 0.00 ? 93  LEU D N    1  
ATOM   6239   C CA   . LEU D 2 91  ? -29.988 -6.054  -10.541 1.00 0.00 ? 93  LEU D CA   1  
ATOM   6240   C C    . LEU D 2 91  ? -31.479 -5.770  -10.245 1.00 0.00 ? 93  LEU D C    1  
ATOM   6241   O O    . LEU D 2 91  ? -31.927 -4.640  -10.347 1.00 0.00 ? 93  LEU D O    1  
ATOM   6242   C CB   . LEU D 2 91  ? -29.843 -6.785  -11.879 1.00 0.00 ? 93  LEU D CB   1  
ATOM   6243   C CG   . LEU D 2 91  ? -30.366 -6.026  -13.105 1.00 0.00 ? 93  LEU D CG   1  
ATOM   6244   C CD1  . LEU D 2 91  ? -29.552 -4.758  -13.340 1.00 0.00 ? 93  LEU D CD1  1  
ATOM   6245   C CD2  . LEU D 2 91  ? -30.336 -6.934  -14.332 1.00 0.00 ? 93  LEU D CD2  1  
ATOM   6246   H H    . LEU D 2 91  ? -29.089 -7.759  -9.642  1.00 0.00 ? 93  LEU D H    1  
ATOM   6247   H HA   . LEU D 2 91  ? -29.440 -5.127  -10.581 1.00 0.00 ? 93  LEU D HA   1  
ATOM   6248   H HB2  . LEU D 2 91  ? -28.794 -6.985  -12.036 1.00 0.00 ? 93  LEU D HB2  1  
ATOM   6249   H HB3  . LEU D 2 91  ? -30.384 -7.715  -11.810 1.00 0.00 ? 93  LEU D HB3  1  
ATOM   6250   H HG   . LEU D 2 91  ? -31.400 -5.759  -12.942 1.00 0.00 ? 93  LEU D HG   1  
ATOM   6251   H HD11 . LEU D 2 91  ? -29.551 -4.157  -12.443 1.00 0.00 ? 93  LEU D HD11 1  
ATOM   6252   H HD12 . LEU D 2 91  ? -28.537 -5.023  -13.597 1.00 0.00 ? 93  LEU D HD12 1  
ATOM   6253   H HD13 . LEU D 2 91  ? -29.991 -4.194  -14.151 1.00 0.00 ? 93  LEU D HD13 1  
ATOM   6254   H HD21 . LEU D 2 91  ? -29.435 -7.527  -14.319 1.00 0.00 ? 93  LEU D HD21 1  
ATOM   6255   H HD22 . LEU D 2 91  ? -31.199 -7.586  -14.317 1.00 0.00 ? 93  LEU D HD22 1  
ATOM   6256   H HD23 . LEU D 2 91  ? -30.359 -6.331  -15.227 1.00 0.00 ? 93  LEU D HD23 1  
ATOM   6257   N N    . LYS D 2 92  ? -32.222 -6.791  -9.818  1.00 0.00 ? 94  LYS D N    1  
ATOM   6258   C CA   . LYS D 2 92  ? -33.638 -6.621  -9.487  1.00 0.00 ? 94  LYS D CA   1  
ATOM   6259   C C    . LYS D 2 92  ? -33.858 -5.603  -8.368  1.00 0.00 ? 94  LYS D C    1  
ATOM   6260   O O    . LYS D 2 92  ? -34.779 -4.789  -8.440  1.00 0.00 ? 94  LYS D O    1  
ATOM   6261   C CB   . LYS D 2 92  ? -34.286 -7.954  -9.061  1.00 0.00 ? 94  LYS D CB   1  
ATOM   6262   C CG   . LYS D 2 92  ? -34.533 -8.965  -10.175 1.00 0.00 ? 94  LYS D CG   1  
ATOM   6263   C CD   . LYS D 2 92  ? -35.247 -10.212 -9.631  1.00 0.00 ? 94  LYS D CD   1  
ATOM   6264   C CE   . LYS D 2 92  ? -35.317 -11.305 -10.695 1.00 0.00 ? 94  LYS D CE   1  
ATOM   6265   N NZ   . LYS D 2 92  ? -36.162 -12.475 -10.293 1.00 0.00 ? 94  LYS D NZ   1  
ATOM   6266   H H    . LYS D 2 92  ? -31.810 -7.675  -9.723  1.00 0.00 ? 94  LYS D H    1  
ATOM   6267   H HA   . LYS D 2 92  ? -34.157 -6.241  -10.352 1.00 0.00 ? 94  LYS D HA   1  
ATOM   6268   H HB2  . LYS D 2 92  ? -33.639 -8.417  -8.333  1.00 0.00 ? 94  LYS D HB2  1  
ATOM   6269   H HB3  . LYS D 2 92  ? -35.237 -7.727  -8.603  1.00 0.00 ? 94  LYS D HB3  1  
ATOM   6270   H HG2  . LYS D 2 92  ? -35.149 -8.509  -10.935 1.00 0.00 ? 94  LYS D HG2  1  
ATOM   6271   H HG3  . LYS D 2 92  ? -33.587 -9.256  -10.605 1.00 0.00 ? 94  LYS D HG3  1  
ATOM   6272   H HD2  . LYS D 2 92  ? -34.705 -10.586 -8.775  1.00 0.00 ? 94  LYS D HD2  1  
ATOM   6273   H HD3  . LYS D 2 92  ? -36.249 -9.944  -9.332  1.00 0.00 ? 94  LYS D HD3  1  
ATOM   6274   H HE2  . LYS D 2 92  ? -35.732 -10.879 -11.596 1.00 0.00 ? 94  LYS D HE2  1  
ATOM   6275   H HE3  . LYS D 2 92  ? -34.316 -11.657 -10.890 1.00 0.00 ? 94  LYS D HE3  1  
ATOM   6276   H HZ1  . LYS D 2 92  ? -35.777 -12.899 -9.426  1.00 0.00 ? 94  LYS D HZ1  1  
ATOM   6277   H HZ2  . LYS D 2 92  ? -37.137 -12.156 -10.117 1.00 0.00 ? 94  LYS D HZ2  1  
ATOM   6278   H HZ3  . LYS D 2 92  ? -36.162 -13.183 -11.055 1.00 0.00 ? 94  LYS D HZ3  1  
ATOM   6279   N N    . ALA D 2 93  ? -33.038 -5.667  -7.317  1.00 0.00 ? 95  ALA D N    1  
ATOM   6280   C CA   . ALA D 2 93  ? -33.167 -4.751  -6.187  1.00 0.00 ? 95  ALA D CA   1  
ATOM   6281   C C    . ALA D 2 93  ? -32.897 -3.304  -6.593  1.00 0.00 ? 95  ALA D C    1  
ATOM   6282   O O    . ALA D 2 93  ? -33.546 -2.377  -6.107  1.00 0.00 ? 95  ALA D O    1  
ATOM   6283   C CB   . ALA D 2 93  ? -32.234 -5.167  -5.063  1.00 0.00 ? 95  ALA D CB   1  
ATOM   6284   H H    . ALA D 2 93  ? -32.333 -6.347  -7.304  1.00 0.00 ? 95  ALA D H    1  
ATOM   6285   H HA   . ALA D 2 93  ? -34.186 -4.766  -5.830  1.00 0.00 ? 95  ALA D HA   1  
ATOM   6286   H HB1  . ALA D 2 93  ? -31.441 -4.441  -4.961  1.00 0.00 ? 95  ALA D HB1  1  
ATOM   6287   H HB2  . ALA D 2 93  ? -31.808 -6.135  -5.288  1.00 0.00 ? 95  ALA D HB2  1  
ATOM   6288   H HB3  . ALA D 2 93  ? -32.788 -5.228  -4.137  1.00 0.00 ? 95  ALA D HB3  1  
ATOM   6289   N N    . ALA D 2 94  ? -31.979 -3.129  -7.539  1.00 0.00 ? 96  ALA D N    1  
ATOM   6290   C CA   . ALA D 2 94  ? -31.598 -1.805  -8.012  1.00 0.00 ? 96  ALA D CA   1  
ATOM   6291   C C    . ALA D 2 94  ? -32.707 -1.166  -8.844  1.00 0.00 ? 96  ALA D C    1  
ATOM   6292   O O    . ALA D 2 94  ? -32.995 0.021   -8.690  1.00 0.00 ? 96  ALA D O    1  
ATOM   6293   C CB   . ALA D 2 94  ? -30.295 -1.885  -8.820  1.00 0.00 ? 96  ALA D CB   1  
ATOM   6294   H H    . ALA D 2 94  ? -31.546 -3.914  -7.929  1.00 0.00 ? 96  ALA D H    1  
ATOM   6295   H HA   . ALA D 2 94  ? -31.455 -1.149  -7.164  1.00 0.00 ? 96  ALA D HA   1  
ATOM   6296   H HB1  . ALA D 2 94  ? -29.480 -2.151  -8.161  1.00 0.00 ? 96  ALA D HB1  1  
ATOM   6297   H HB2  . ALA D 2 94  ? -30.093 -0.928  -9.274  1.00 0.00 ? 96  ALA D HB2  1  
ATOM   6298   H HB3  . ALA D 2 94  ? -30.394 -2.637  -9.589  1.00 0.00 ? 96  ALA D HB3  1  
ATOM   6299   N N    . VAL D 2 95  ? -33.292 -1.951  -9.747  1.00 0.00 ? 97  VAL D N    1  
ATOM   6300   C CA   . VAL D 2 95  ? -34.378 -1.472  -10.590 1.00 0.00 ? 97  VAL D CA   1  
ATOM   6301   C C    . VAL D 2 95  ? -35.549 -1.111  -9.664  1.00 0.00 ? 97  VAL D C    1  
ATOM   6302   O O    . VAL D 2 95  ? -36.167 -0.054  -9.811  1.00 0.00 ? 97  VAL D O    1  
ATOM   6303   C CB   . VAL D 2 95  ? -34.784 -2.549  -11.633 1.00 0.00 ? 97  VAL D CB   1  
ATOM   6304   C CG1  . VAL D 2 95  ? -36.128 -2.200  -12.269 1.00 0.00 ? 97  VAL D CG1  1  
ATOM   6305   C CG2  . VAL D 2 95  ? -33.722 -2.650  -12.720 1.00 0.00 ? 97  VAL D CG2  1  
ATOM   6306   H H    . VAL D 2 95  ? -32.984 -2.876  -9.845  1.00 0.00 ? 97  VAL D H    1  
ATOM   6307   H HA   . VAL D 2 95  ? -34.056 -0.581  -11.108 1.00 0.00 ? 97  VAL D HA   1  
ATOM   6308   H HB   . VAL D 2 95  ? -34.862 -3.507  -11.141 1.00 0.00 ? 97  VAL D HB   1  
ATOM   6309   H HG11 . VAL D 2 95  ? -36.658 -1.505  -11.634 1.00 0.00 ? 97  VAL D HG11 1  
ATOM   6310   H HG12 . VAL D 2 95  ? -35.963 -1.752  -13.237 1.00 0.00 ? 97  VAL D HG12 1  
ATOM   6311   H HG13 . VAL D 2 95  ? -36.715 -3.101  -12.384 1.00 0.00 ? 97  VAL D HG13 1  
ATOM   6312   H HG21 . VAL D 2 95  ? -33.586 -1.685  -13.182 1.00 0.00 ? 97  VAL D HG21 1  
ATOM   6313   H HG22 . VAL D 2 95  ? -32.789 -2.974  -12.282 1.00 0.00 ? 97  VAL D HG22 1  
ATOM   6314   H HG23 . VAL D 2 95  ? -34.037 -3.366  -13.466 1.00 0.00 ? 97  VAL D HG23 1  
ATOM   6315   N N    . ALA D 2 96  ? -35.791 -1.950  -8.658  1.00 0.00 ? 98  ALA D N    1  
ATOM   6316   C CA   . ALA D 2 96  ? -36.860 -1.704  -7.690  1.00 0.00 ? 98  ALA D CA   1  
ATOM   6317   C C    . ALA D 2 96  ? -36.641 -0.373  -6.959  1.00 0.00 ? 98  ALA D C    1  
ATOM   6318   O O    . ALA D 2 96  ? -37.558 0.442   -6.858  1.00 0.00 ? 98  ALA D O    1  
ATOM   6319   C CB   . ALA D 2 96  ? -36.972 -2.862  -6.675  1.00 0.00 ? 98  ALA D CB   1  
ATOM   6320   H H    . ALA D 2 96  ? -35.237 -2.753  -8.564  1.00 0.00 ? 98  ALA D H    1  
ATOM   6321   H HA   . ALA D 2 96  ? -37.799 -1.605  -8.217  1.00 0.00 ? 98  ALA D HA   1  
ATOM   6322   H HB1  . ALA D 2 96  ? -36.784 -3.800  -7.178  1.00 0.00 ? 98  ALA D HB1  1  
ATOM   6323   H HB2  . ALA D 2 96  ? -36.244 -2.724  -5.890  1.00 0.00 ? 98  ALA D HB2  1  
ATOM   6324   H HB3  . ALA D 2 96  ? -37.965 -2.875  -6.249  1.00 0.00 ? 98  ALA D HB3  1  
ATOM   6325   N N    . ALA D 2 97  ? -35.434 -0.137  -6.462  1.00 0.00 ? 99  ALA D N    1  
ATOM   6326   C CA   . ALA D 2 97  ? -35.169 1.104   -5.750  1.00 0.00 ? 99  ALA D CA   1  
ATOM   6327   C C    . ALA D 2 97  ? -35.441 2.307   -6.654  1.00 0.00 ? 99  ALA D C    1  
ATOM   6328   O O    . ALA D 2 97  ? -35.906 3.343   -6.182  1.00 0.00 ? 99  ALA D O    1  
ATOM   6329   C CB   . ALA D 2 97  ? -33.748 1.127   -5.241  1.00 0.00 ? 99  ALA D CB   1  
ATOM   6330   H H    . ALA D 2 97  ? -34.720 -0.801  -6.573  1.00 0.00 ? 99  ALA D H    1  
ATOM   6331   H HA   . ALA D 2 97  ? -35.849 1.188   -4.916  1.00 0.00 ? 99  ALA D HA   1  
ATOM   6332   H HB1  . ALA D 2 97  ? -33.201 0.296   -5.661  1.00 0.00 ? 99  ALA D HB1  1  
ATOM   6333   H HB2  . ALA D 2 97  ? -33.750 1.051   -4.165  1.00 0.00 ? 99  ALA D HB2  1  
ATOM   6334   H HB3  . ALA D 2 97  ? -33.275 2.053   -5.535  1.00 0.00 ? 99  ALA D HB3  1  
ATOM   6335   N N    . ILE D 2 98  ? -35.172 2.161   -7.949  1.00 0.00 ? 100 ILE D N    1  
ATOM   6336   C CA   . ILE D 2 98  ? -35.407 3.245   -8.900  1.00 0.00 ? 100 ILE D CA   1  
ATOM   6337   C C    . ILE D 2 98  ? -36.911 3.508   -9.089  1.00 0.00 ? 100 ILE D C    1  
ATOM   6338   O O    . ILE D 2 98  ? -37.337 4.669   -9.108  1.00 0.00 ? 100 ILE D O    1  
ATOM   6339   C CB   . ILE D 2 98  ? -34.760 2.964   -10.279 1.00 0.00 ? 100 ILE D CB   1  
ATOM   6340   C CG1  . ILE D 2 98  ? -33.237 2.976   -10.162 1.00 0.00 ? 100 ILE D CG1  1  
ATOM   6341   C CG2  . ILE D 2 98  ? -35.190 4.025   -11.292 1.00 0.00 ? 100 ILE D CG2  1  
ATOM   6342   C CD1  . ILE D 2 98  ? -32.520 2.484   -11.402 1.00 0.00 ? 100 ILE D CD1  1  
ATOM   6343   H H    . ILE D 2 98  ? -34.810 1.309   -8.272  1.00 0.00 ? 100 ILE D H    1  
ATOM   6344   H HA   . ILE D 2 98  ? -34.987 4.157   -8.499  1.00 0.00 ? 100 ILE D HA   1  
ATOM   6345   H HB   . ILE D 2 98  ? -35.084 1.997   -10.632 1.00 0.00 ? 100 ILE D HB   1  
ATOM   6346   H HG12 . ILE D 2 98  ? -32.918 3.990   -9.967  1.00 0.00 ? 100 ILE D HG12 1  
ATOM   6347   H HG13 . ILE D 2 98  ? -32.956 2.344   -9.332  1.00 0.00 ? 100 ILE D HG13 1  
ATOM   6348   H HG21 . ILE D 2 98  ? -35.505 4.917   -10.770 1.00 0.00 ? 100 ILE D HG21 1  
ATOM   6349   H HG22 . ILE D 2 98  ? -34.359 4.260   -11.940 1.00 0.00 ? 100 ILE D HG22 1  
ATOM   6350   H HG23 . ILE D 2 98  ? -36.012 3.645   -11.883 1.00 0.00 ? 100 ILE D HG23 1  
ATOM   6351   H HD11 . ILE D 2 98  ? -33.086 1.681   -11.850 1.00 0.00 ? 100 ILE D HD11 1  
ATOM   6352   H HD12 . ILE D 2 98  ? -32.424 3.295   -12.109 1.00 0.00 ? 100 ILE D HD12 1  
ATOM   6353   H HD13 . ILE D 2 98  ? -31.538 2.125   -11.131 1.00 0.00 ? 100 ILE D HD13 1  
ATOM   6354   N N    . LYS D 2 99  ? -37.696 2.434   -9.229  1.00 0.00 ? 101 LYS D N    1  
ATOM   6355   C CA   . LYS D 2 99  ? -39.146 2.527   -9.400  1.00 0.00 ? 101 LYS D CA   1  
ATOM   6356   C C    . LYS D 2 99  ? -39.790 3.090   -8.144  1.00 0.00 ? 101 LYS D C    1  
ATOM   6357   O O    . LYS D 2 99  ? -40.534 4.066   -8.197  1.00 0.00 ? 101 LYS D O    1  
ATOM   6358   C CB   . LYS D 2 99  ? -39.752 1.157   -9.697  1.00 0.00 ? 101 LYS D CB   1  
ATOM   6359   C CG   . LYS D 2 99  ? -39.640 0.732   -11.137 1.00 0.00 ? 101 LYS D CG   1  
ATOM   6360   C CD   . LYS D 2 99  ? -39.970 -0.751  -11.310 1.00 0.00 ? 101 LYS D CD   1  
ATOM   6361   C CE   . LYS D 2 99  ? -41.381 -1.126  -10.838 1.00 0.00 ? 101 LYS D CE   1  
ATOM   6362   N NZ   . LYS D 2 99  ? -42.321 -1.382  -11.981 1.00 0.00 ? 101 LYS D NZ   1  
ATOM   6363   H H    . LYS D 2 99  ? -37.282 1.548   -9.218  1.00 0.00 ? 101 LYS D H    1  
ATOM   6364   H HA   . LYS D 2 99  ? -39.363 3.196   -10.221 1.00 0.00 ? 101 LYS D HA   1  
ATOM   6365   H HB2  . LYS D 2 99  ? -39.249 0.424   -9.087  1.00 0.00 ? 101 LYS D HB2  1  
ATOM   6366   H HB3  . LYS D 2 99  ? -40.800 1.186   -9.435  1.00 0.00 ? 101 LYS D HB3  1  
ATOM   6367   H HG2  . LYS D 2 99  ? -40.326 1.315   -11.732 1.00 0.00 ? 101 LYS D HG2  1  
ATOM   6368   H HG3  . LYS D 2 99  ? -38.631 0.909   -11.477 1.00 0.00 ? 101 LYS D HG3  1  
ATOM   6369   H HD2  . LYS D 2 99  ? -39.882 -1.000  -12.358 1.00 0.00 ? 101 LYS D HD2  1  
ATOM   6370   H HD3  . LYS D 2 99  ? -39.255 -1.327  -10.742 1.00 0.00 ? 101 LYS D HD3  1  
ATOM   6371   H HE2  . LYS D 2 99  ? -41.319 -2.019  -10.234 1.00 0.00 ? 101 LYS D HE2  1  
ATOM   6372   H HE3  . LYS D 2 99  ? -41.773 -0.314  -10.241 1.00 0.00 ? 101 LYS D HE3  1  
ATOM   6373   H HZ1  . LYS D 2 99  ? -41.821 -1.903  -12.731 1.00 0.00 ? 101 LYS D HZ1  1  
ATOM   6374   H HZ2  . LYS D 2 99  ? -43.128 -1.947  -11.647 1.00 0.00 ? 101 LYS D HZ2  1  
ATOM   6375   H HZ3  . LYS D 2 99  ? -42.665 -0.475  -12.358 1.00 0.00 ? 101 LYS D HZ3  1  
ATOM   6376   N N    . LYS D 2 100 ? -39.484 2.491   -7.006  1.00 0.00 ? 102 LYS D N    1  
ATOM   6377   C CA   . LYS D 2 100 ? -40.041 2.959   -5.757  1.00 0.00 ? 102 LYS D CA   1  
ATOM   6378   C C    . LYS D 2 100 ? -39.663 4.418   -5.509  1.00 0.00 ? 102 LYS D C    1  
ATOM   6379   O O    . LYS D 2 100 ? -40.302 5.095   -4.706  1.00 0.00 ? 102 LYS D O    1  
ATOM   6380   C CB   . LYS D 2 100 ? -39.569 2.074   -4.600  1.00 0.00 ? 102 LYS D CB   1  
ATOM   6381   C CG   . LYS D 2 100 ? -40.124 2.499   -3.256  1.00 0.00 ? 102 LYS D CG   1  
ATOM   6382   C CD   . LYS D 2 100 ? -39.660 1.615   -2.098  1.00 0.00 ? 102 LYS D CD   1  
ATOM   6383   C CE   . LYS D 2 100 ? -40.273 2.119   -0.785  1.00 0.00 ? 102 LYS D CE   1  
ATOM   6384   N NZ   . LYS D 2 100 ? -39.915 1.311   0.416   1.00 0.00 ? 102 LYS D NZ   1  
ATOM   6385   H H    . LYS D 2 100 ? -38.872 1.725   -7.010  1.00 0.00 ? 102 LYS D H    1  
ATOM   6386   H HA   . LYS D 2 100 ? -41.118 2.925   -5.814  1.00 0.00 ? 102 LYS D HA   1  
ATOM   6387   H HB2  . LYS D 2 100 ? -39.883 1.059   -4.795  1.00 0.00 ? 102 LYS D HB2  1  
ATOM   6388   H HB3  . LYS D 2 100 ? -38.491 2.114   -4.554  1.00 0.00 ? 102 LYS D HB3  1  
ATOM   6389   H HG2  . LYS D 2 100 ? -39.807 3.512   -3.060  1.00 0.00 ? 102 LYS D HG2  1  
ATOM   6390   H HG3  . LYS D 2 100 ? -41.202 2.462   -3.303  1.00 0.00 ? 102 LYS D HG3  1  
ATOM   6391   H HD2  . LYS D 2 100 ? -39.977 0.597   -2.273  1.00 0.00 ? 102 LYS D HD2  1  
ATOM   6392   H HD3  . LYS D 2 100 ? -38.583 1.650   -2.028  1.00 0.00 ? 102 LYS D HD3  1  
ATOM   6393   H HE2  . LYS D 2 100 ? -39.936 3.131   -0.623  1.00 0.00 ? 102 LYS D HE2  1  
ATOM   6394   H HE3  . LYS D 2 100 ? -41.348 2.110   -0.889  1.00 0.00 ? 102 LYS D HE3  1  
ATOM   6395   H HZ1  . LYS D 2 100 ? -39.629 0.356   0.118   1.00 0.00 ? 102 LYS D HZ1  1  
ATOM   6396   H HZ2  . LYS D 2 100 ? -39.128 1.767   0.919   1.00 0.00 ? 102 LYS D HZ2  1  
ATOM   6397   H HZ3  . LYS D 2 100 ? -40.739 1.244   1.047   1.00 0.00 ? 102 LYS D HZ3  1  
ATOM   6398   N N    . ALA D 2 101 ? -38.627 4.901   -6.200  1.00 0.00 ? 103 ALA D N    1  
ATOM   6399   C CA   . ALA D 2 101 ? -38.158 6.284   -6.049  1.00 0.00 ? 103 ALA D CA   1  
ATOM   6400   C C    . ALA D 2 101 ? -38.873 7.271   -6.957  1.00 0.00 ? 103 ALA D C    1  
ATOM   6401   O O    . ALA D 2 101 ? -39.052 8.435   -6.601  1.00 0.00 ? 103 ALA D O    1  
ATOM   6402   C CB   . ALA D 2 101 ? -36.648 6.370   -6.281  1.00 0.00 ? 103 ALA D CB   1  
ATOM   6403   H H    . ALA D 2 101 ? -38.163 4.312   -6.829  1.00 0.00 ? 103 ALA D H    1  
ATOM   6404   H HA   . ALA D 2 101 ? -38.384 6.630   -5.052  1.00 0.00 ? 103 ALA D HA   1  
ATOM   6405   H HB1  . ALA D 2 101 ? -36.131 6.167   -5.356  1.00 0.00 ? 103 ALA D HB1  1  
ATOM   6406   H HB2  . ALA D 2 101 ? -36.391 7.360   -6.629  1.00 0.00 ? 103 ALA D HB2  1  
ATOM   6407   H HB3  . ALA D 2 101 ? -36.358 5.641   -7.024  1.00 0.00 ? 103 ALA D HB3  1  
ATOM   6408   N N    . ALA D 2 102 ? -39.222 6.818   -8.157  1.00 0.00 ? 104 ALA D N    1  
ATOM   6409   C CA   . ALA D 2 102 ? -39.917 7.653   -9.129  1.00 0.00 ? 104 ALA D CA   1  
ATOM   6410   C C    . ALA D 2 102 ? -41.440 7.676   -8.866  1.00 0.00 ? 104 ALA D C    1  
ATOM   6411   O O    . ALA D 2 102 ? -42.210 8.272   -9.636  1.00 0.00 ? 104 ALA D O    1  
ATOM   6412   C CB   . ALA D 2 102 ? -39.614 7.168   -10.544 1.00 0.00 ? 104 ALA D CB   1  
ATOM   6413   H H    . ALA D 2 102 ? -39.005 5.894   -8.397  1.00 0.00 ? 104 ALA D H    1  
ATOM   6414   H HA   . ALA D 2 102 ? -39.587 8.677   -9.024  1.00 0.00 ? 104 ALA D HA   1  
ATOM   6415   H HB1  . ALA D 2 102 ? -40.360 6.445   -10.844 1.00 0.00 ? 104 ALA D HB1  1  
ATOM   6416   H HB2  . ALA D 2 102 ? -39.631 8.005   -11.225 1.00 0.00 ? 104 ALA D HB2  1  
ATOM   6417   H HB3  . ALA D 2 102 ? -38.636 6.707   -10.565 1.00 0.00 ? 104 ALA D HB3  1  
ATOM   6418   N N    . ALA D 2 103 ? -41.860 7.031   -7.777  1.00 0.00 ? 105 ALA D N    1  
ATOM   6419   C CA   . ALA D 2 103 ? -43.264 6.973   -7.390  1.00 0.00 ? 105 ALA D CA   1  
ATOM   6420   C C    . ALA D 2 103 ? -43.434 6.193   -6.078  1.00 0.00 ? 105 ALA D C    1  
ATOM   6421   O O    . ALA D 2 103 ? -43.546 6.853   -5.021  1.00 0.00 ? 105 ALA D O    1  
ATOM   6422   C CB   . ALA D 2 103 ? -44.105 6.349   -8.509  1.00 0.00 ? 105 ALA D CB   1  
ATOM   6423   O OXT  . ALA D 2 103 ? -43.437 4.937   -6.105  1.00 0.00 ? 105 ALA D OXT  1  
ATOM   6424   H H    . ALA D 2 103 ? -41.198 6.577   -7.216  1.00 0.00 ? 105 ALA D H    1  
ATOM   6425   H HA   . ALA D 2 103 ? -43.622 7.973   -7.192  1.00 0.00 ? 105 ALA D HA   1  
ATOM   6426   H HB1  . ALA D 2 103 ? -43.534 5.573   -8.998  1.00 0.00 ? 105 ALA D HB1  1  
ATOM   6427   H HB2  . ALA D 2 103 ? -44.367 7.110   -9.229  1.00 0.00 ? 105 ALA D HB2  1  
ATOM   6428   H HB3  . ALA D 2 103 ? -45.004 5.925   -8.090  1.00 0.00 ? 105 ALA D HB3  1  
HETATM 6429   P P    . PO3 E 3 .   ? -12.199 -3.679  -3.109  1.00 0.00 ? 200 PO3 D P    1  
HETATM 6430   O O1   . PO3 E 3 .   ? -11.993 -3.056  -1.738  1.00 0.00 ? 200 PO3 D O1   1  
HETATM 6431   O O2   . PO3 E 3 .   ? -12.868 -5.030  -3.235  1.00 0.00 ? 200 PO3 D O2   1  
HETATM 6432   O O3   . PO3 E 3 .   ? -11.566 -3.048  -4.329  1.00 0.00 ? 200 PO3 D O3   1  
ATOM   6433   N N    . ALA A 1 1   ? -12.226 -16.475 -3.134  1.00 0.00 ? 1   ALA A N    2  
ATOM   6434   C CA   . ALA A 1 1   ? -13.262 -17.518 -2.881  1.00 0.00 ? 1   ALA A CA   2  
ATOM   6435   C C    . ALA A 1 1   ? -14.204 -17.019 -1.788  1.00 0.00 ? 1   ALA A C    2  
ATOM   6436   O O    . ALA A 1 1   ? -13.926 -16.005 -1.159  1.00 0.00 ? 1   ALA A O    2  
ATOM   6437   C CB   . ALA A 1 1   ? -12.572 -18.824 -2.457  1.00 0.00 ? 1   ALA A CB   2  
ATOM   6438   H H1   . ALA A 1 1   ? -12.230 -15.784 -2.353  1.00 0.00 ? 1   ALA A H1   2  
ATOM   6439   H H2   . ALA A 1 1   ? -11.289 -16.925 -3.195  1.00 0.00 ? 1   ALA A H2   2  
ATOM   6440   H H3   . ALA A 1 1   ? -12.435 -15.983 -4.027  1.00 0.00 ? 1   ALA A H3   2  
ATOM   6441   H HA   . ALA A 1 1   ? -13.831 -17.685 -3.784  1.00 0.00 ? 1   ALA A HA   2  
ATOM   6442   H HB1  . ALA A 1 1   ? -13.185 -19.343 -1.734  1.00 0.00 ? 1   ALA A HB1  2  
ATOM   6443   H HB2  . ALA A 1 1   ? -11.611 -18.600 -2.018  1.00 0.00 ? 1   ALA A HB2  2  
ATOM   6444   H HB3  . ALA A 1 1   ? -12.432 -19.455 -3.324  1.00 0.00 ? 1   ALA A HB3  2  
ATOM   6445   N N    . GLU A 1 2   ? -15.304 -17.740 -1.585  1.00 0.00 ? 2   GLU A N    2  
ATOM   6446   C CA   . GLU A 1 2   ? -16.316 -17.385 -0.581  1.00 0.00 ? 2   GLU A CA   2  
ATOM   6447   C C    . GLU A 1 2   ? -15.750 -16.533 0.562   1.00 0.00 ? 2   GLU A C    2  
ATOM   6448   O O    . GLU A 1 2   ? -15.822 -15.305 0.530   1.00 0.00 ? 2   GLU A O    2  
ATOM   6449   C CB   . GLU A 1 2   ? -16.929 -18.664 0.001   1.00 0.00 ? 2   GLU A CB   2  
ATOM   6450   C CG   . GLU A 1 2   ? -17.587 -19.503 -1.121  1.00 0.00 ? 2   GLU A CG   2  
ATOM   6451   C CD   . GLU A 1 2   ? -17.108 -20.953 -1.070  1.00 0.00 ? 2   GLU A CD   2  
ATOM   6452   O OE1  . GLU A 1 2   ? -16.943 -21.467 0.020   1.00 0.00 ? 2   GLU A OE1  2  
ATOM   6453   O OE2  . GLU A 1 2   ? -16.918 -21.528 -2.126  1.00 0.00 ? 2   GLU A OE2  2  
ATOM   6454   H H    . GLU A 1 2   ? -15.450 -18.541 -2.127  1.00 0.00 ? 2   GLU A H    2  
ATOM   6455   H HA   . GLU A 1 2   ? -17.099 -16.823 -1.066  1.00 0.00 ? 2   GLU A HA   2  
ATOM   6456   H HB2  . GLU A 1 2   ? -16.153 -19.247 0.478   1.00 0.00 ? 2   GLU A HB2  2  
ATOM   6457   H HB3  . GLU A 1 2   ? -17.678 -18.399 0.735   1.00 0.00 ? 2   GLU A HB3  2  
ATOM   6458   H HG2  . GLU A 1 2   ? -18.659 -19.487 -0.998  1.00 0.00 ? 2   GLU A HG2  2  
ATOM   6459   H HG3  . GLU A 1 2   ? -17.339 -19.085 -2.085  1.00 0.00 ? 2   GLU A HG3  2  
ATOM   6460   N N    . GLU A 1 3   ? -15.202 -17.194 1.573   1.00 0.00 ? 3   GLU A N    2  
ATOM   6461   C CA   . GLU A 1 3   ? -14.648 -16.487 2.725   1.00 0.00 ? 3   GLU A CA   2  
ATOM   6462   C C    . GLU A 1 3   ? -13.425 -15.663 2.332   1.00 0.00 ? 3   GLU A C    2  
ATOM   6463   O O    . GLU A 1 3   ? -13.413 -14.446 2.492   1.00 0.00 ? 3   GLU A O    2  
ATOM   6464   C CB   . GLU A 1 3   ? -14.274 -17.497 3.813   1.00 0.00 ? 3   GLU A CB   2  
ATOM   6465   C CG   . GLU A 1 3   ? -15.541 -17.929 4.570   1.00 0.00 ? 3   GLU A CG   2  
ATOM   6466   C CD   . GLU A 1 3   ? -15.331 -19.286 5.236   1.00 0.00 ? 3   GLU A CD   2  
ATOM   6467   O OE1  . GLU A 1 3   ? -14.402 -19.401 6.016   1.00 0.00 ? 3   GLU A OE1  2  
ATOM   6468   O OE2  . GLU A 1 3   ? -16.105 -20.183 4.959   1.00 0.00 ? 3   GLU A OE2  2  
ATOM   6469   H H    . GLU A 1 3   ? -15.180 -18.173 1.554   1.00 0.00 ? 3   GLU A H    2  
ATOM   6470   H HA   . GLU A 1 3   ? -15.402 -15.819 3.111   1.00 0.00 ? 3   GLU A HA   2  
ATOM   6471   H HB2  . GLU A 1 3   ? -13.813 -18.363 3.360   1.00 0.00 ? 3   GLU A HB2  2  
ATOM   6472   H HB3  . GLU A 1 3   ? -13.581 -17.043 4.506   1.00 0.00 ? 3   GLU A HB3  2  
ATOM   6473   H HG2  . GLU A 1 3   ? -15.773 -17.197 5.328   1.00 0.00 ? 3   GLU A HG2  2  
ATOM   6474   H HG3  . GLU A 1 3   ? -16.369 -17.998 3.881   1.00 0.00 ? 3   GLU A HG3  2  
ATOM   6475   N N    . LEU A 1 4   ? -12.393 -16.324 1.822   1.00 0.00 ? 4   LEU A N    2  
ATOM   6476   C CA   . LEU A 1 4   ? -11.176 -15.618 1.421   1.00 0.00 ? 4   LEU A CA   2  
ATOM   6477   C C    . LEU A 1 4   ? -11.493 -14.307 0.694   1.00 0.00 ? 4   LEU A C    2  
ATOM   6478   O O    . LEU A 1 4   ? -10.860 -13.286 0.940   1.00 0.00 ? 4   LEU A O    2  
ATOM   6479   C CB   . LEU A 1 4   ? -10.311 -16.493 0.501   1.00 0.00 ? 4   LEU A CB   2  
ATOM   6480   C CG   . LEU A 1 4   ? -9.971  -17.821 1.185   1.00 0.00 ? 4   LEU A CG   2  
ATOM   6481   C CD1  . LEU A 1 4   ? -9.086  -18.666 0.253   1.00 0.00 ? 4   LEU A CD1  2  
ATOM   6482   C CD2  . LEU A 1 4   ? -9.232  -17.561 2.508   1.00 0.00 ? 4   LEU A CD2  2  
ATOM   6483   H H    . LEU A 1 4   ? -12.448 -17.294 1.716   1.00 0.00 ? 4   LEU A H    2  
ATOM   6484   H HA   . LEU A 1 4   ? -10.615 -15.388 2.310   1.00 0.00 ? 4   LEU A HA   2  
ATOM   6485   H HB2  . LEU A 1 4   ? -10.848 -16.687 -0.414  1.00 0.00 ? 4   LEU A HB2  2  
ATOM   6486   H HB3  . LEU A 1 4   ? -9.396  -15.964 0.269   1.00 0.00 ? 4   LEU A HB3  2  
ATOM   6487   H HG   . LEU A 1 4   ? -10.885 -18.363 1.385   1.00 0.00 ? 4   LEU A HG   2  
ATOM   6488   H HD11 . LEU A 1 4   ? -9.335  -18.456 -0.777  1.00 0.00 ? 4   LEU A HD11 2  
ATOM   6489   H HD12 . LEU A 1 4   ? -8.044  -18.432 0.424   1.00 0.00 ? 4   LEU A HD12 2  
ATOM   6490   H HD13 . LEU A 1 4   ? -9.252  -19.717 0.453   1.00 0.00 ? 4   LEU A HD13 2  
ATOM   6491   H HD21 . LEU A 1 4   ? -8.593  -16.695 2.409   1.00 0.00 ? 4   LEU A HD21 2  
ATOM   6492   H HD22 . LEU A 1 4   ? -9.953  -17.385 3.293   1.00 0.00 ? 4   LEU A HD22 2  
ATOM   6493   H HD23 . LEU A 1 4   ? -8.632  -18.423 2.763   1.00 0.00 ? 4   LEU A HD23 2  
ATOM   6494   N N    . GLU A 1 5   ? -12.470 -14.344 -0.203  1.00 0.00 ? 5   GLU A N    2  
ATOM   6495   C CA   . GLU A 1 5   ? -12.846 -13.152 -0.957  1.00 0.00 ? 5   GLU A CA   2  
ATOM   6496   C C    . GLU A 1 5   ? -13.543 -12.139 -0.056  1.00 0.00 ? 5   GLU A C    2  
ATOM   6497   O O    . GLU A 1 5   ? -13.223 -10.944 -0.077  1.00 0.00 ? 5   GLU A O    2  
ATOM   6498   C CB   . GLU A 1 5   ? -13.769 -13.534 -2.117  1.00 0.00 ? 5   GLU A CB   2  
ATOM   6499   C CG   . GLU A 1 5   ? -14.067 -12.290 -2.959  1.00 0.00 ? 5   GLU A CG   2  
ATOM   6500   C CD   . GLU A 1 5   ? -14.949 -12.663 -4.147  1.00 0.00 ? 5   GLU A CD   2  
ATOM   6501   O OE1  . GLU A 1 5   ? -15.467 -13.767 -4.148  1.00 0.00 ? 5   GLU A OE1  2  
ATOM   6502   O OE2  . GLU A 1 5   ? -15.091 -11.841 -5.036  1.00 0.00 ? 5   GLU A OE2  2  
ATOM   6503   H H    . GLU A 1 5   ? -12.954 -15.185 -0.360  1.00 0.00 ? 5   GLU A H    2  
ATOM   6504   H HA   . GLU A 1 5   ? -11.956 -12.701 -1.363  1.00 0.00 ? 5   GLU A HA   2  
ATOM   6505   H HB2  . GLU A 1 5   ? -13.286 -14.280 -2.731  1.00 0.00 ? 5   GLU A HB2  2  
ATOM   6506   H HB3  . GLU A 1 5   ? -14.694 -13.931 -1.726  1.00 0.00 ? 5   GLU A HB3  2  
ATOM   6507   H HG2  . GLU A 1 5   ? -14.579 -11.560 -2.349  1.00 0.00 ? 5   GLU A HG2  2  
ATOM   6508   H HG3  . GLU A 1 5   ? -13.140 -11.870 -3.319  1.00 0.00 ? 5   GLU A HG3  2  
ATOM   6509   N N    . GLU A 1 6   ? -14.478 -12.622 0.748   1.00 0.00 ? 6   GLU A N    2  
ATOM   6510   C CA   . GLU A 1 6   ? -15.196 -11.757 1.672   1.00 0.00 ? 6   GLU A CA   2  
ATOM   6511   C C    . GLU A 1 6   ? -14.240 -11.264 2.757   1.00 0.00 ? 6   GLU A C    2  
ATOM   6512   O O    . GLU A 1 6   ? -14.333 -10.125 3.224   1.00 0.00 ? 6   GLU A O    2  
ATOM   6513   C CB   . GLU A 1 6   ? -16.367 -12.529 2.292   1.00 0.00 ? 6   GLU A CB   2  
ATOM   6514   C CG   . GLU A 1 6   ? -17.464 -11.557 2.740   1.00 0.00 ? 6   GLU A CG   2  
ATOM   6515   C CD   . GLU A 1 6   ? -18.755 -12.324 3.007   1.00 0.00 ? 6   GLU A CD   2  
ATOM   6516   O OE1  . GLU A 1 6   ? -18.679 -13.527 3.196   1.00 0.00 ? 6   GLU A OE1  2  
ATOM   6517   O OE2  . GLU A 1 6   ? -19.801 -11.696 3.026   1.00 0.00 ? 6   GLU A OE2  2  
ATOM   6518   H H    . GLU A 1 6   ? -14.676 -13.582 0.734   1.00 0.00 ? 6   GLU A H    2  
ATOM   6519   H HA   . GLU A 1 6   ? -15.584 -10.906 1.133   1.00 0.00 ? 6   GLU A HA   2  
ATOM   6520   H HB2  . GLU A 1 6   ? -16.772 -13.211 1.558   1.00 0.00 ? 6   GLU A HB2  2  
ATOM   6521   H HB3  . GLU A 1 6   ? -16.015 -13.089 3.145   1.00 0.00 ? 6   GLU A HB3  2  
ATOM   6522   H HG2  . GLU A 1 6   ? -17.152 -11.058 3.647   1.00 0.00 ? 6   GLU A HG2  2  
ATOM   6523   H HG3  . GLU A 1 6   ? -17.641 -10.822 1.969   1.00 0.00 ? 6   GLU A HG3  2  
ATOM   6524   N N    . VAL A 1 7   ? -13.301 -12.127 3.130   1.00 0.00 ? 7   VAL A N    2  
ATOM   6525   C CA   . VAL A 1 7   ? -12.302 -11.786 4.139   1.00 0.00 ? 7   VAL A CA   2  
ATOM   6526   C C    . VAL A 1 7   ? -11.392 -10.672 3.616   1.00 0.00 ? 7   VAL A C    2  
ATOM   6527   O O    . VAL A 1 7   ? -11.074 -9.725  4.337   1.00 0.00 ? 7   VAL A O    2  
ATOM   6528   C CB   . VAL A 1 7   ? -11.473 -13.029 4.488   1.00 0.00 ? 7   VAL A CB   2  
ATOM   6529   C CG1  . VAL A 1 7   ? -10.292 -12.633 5.379   1.00 0.00 ? 7   VAL A CG1  2  
ATOM   6530   C CG2  . VAL A 1 7   ? -12.355 -14.043 5.231   1.00 0.00 ? 7   VAL A CG2  2  
ATOM   6531   H H    . VAL A 1 7   ? -13.271 -13.013 2.702   1.00 0.00 ? 7   VAL A H    2  
ATOM   6532   H HA   . VAL A 1 7   ? -12.803 -11.437 5.028   1.00 0.00 ? 7   VAL A HA   2  
ATOM   6533   H HB   . VAL A 1 7   ? -11.100 -13.479 3.577   1.00 0.00 ? 7   VAL A HB   2  
ATOM   6534   H HG11 . VAL A 1 7   ? -10.629 -11.944 6.139   1.00 0.00 ? 7   VAL A HG11 2  
ATOM   6535   H HG12 . VAL A 1 7   ? -9.881  -13.515 5.848   1.00 0.00 ? 7   VAL A HG12 2  
ATOM   6536   H HG13 . VAL A 1 7   ? -9.531  -12.158 4.777   1.00 0.00 ? 7   VAL A HG13 2  
ATOM   6537   H HG21 . VAL A 1 7   ? -13.348 -14.045 4.800   1.00 0.00 ? 7   VAL A HG21 2  
ATOM   6538   H HG22 . VAL A 1 7   ? -11.926 -15.029 5.144   1.00 0.00 ? 7   VAL A HG22 2  
ATOM   6539   H HG23 . VAL A 1 7   ? -12.419 -13.770 6.274   1.00 0.00 ? 7   VAL A HG23 2  
ATOM   6540   N N    . VAL A 1 8   ? -10.997 -10.783 2.349   1.00 0.00 ? 8   VAL A N    2  
ATOM   6541   C CA   . VAL A 1 8   ? -10.144 -9.768  1.732   1.00 0.00 ? 8   VAL A CA   2  
ATOM   6542   C C    . VAL A 1 8   ? -10.871 -8.425  1.748   1.00 0.00 ? 8   VAL A C    2  
ATOM   6543   O O    . VAL A 1 8   ? -10.296 -7.401  2.108   1.00 0.00 ? 8   VAL A O    2  
ATOM   6544   C CB   . VAL A 1 8   ? -9.799  -10.172 0.292   1.00 0.00 ? 8   VAL A CB   2  
ATOM   6545   C CG1  . VAL A 1 8   ? -9.133  -8.988  -0.440  1.00 0.00 ? 8   VAL A CG1  2  
ATOM   6546   C CG2  . VAL A 1 8   ? -8.849  -11.392 0.312   1.00 0.00 ? 8   VAL A CG2  2  
ATOM   6547   H H    . VAL A 1 8   ? -11.297 -11.551 1.816   1.00 0.00 ? 8   VAL A H    2  
ATOM   6548   H HA   . VAL A 1 8   ? -9.235  -9.675  2.305   1.00 0.00 ? 8   VAL A HA   2  
ATOM   6549   H HB   . VAL A 1 8   ? -10.711 -10.438 -0.224  1.00 0.00 ? 8   VAL A HB   2  
ATOM   6550   H HG11 . VAL A 1 8   ? -8.772  -8.267  0.279   1.00 0.00 ? 8   VAL A HG11 2  
ATOM   6551   H HG12 . VAL A 1 8   ? -8.304  -9.346  -1.033  1.00 0.00 ? 8   VAL A HG12 2  
ATOM   6552   H HG13 . VAL A 1 8   ? -9.857  -8.514  -1.088  1.00 0.00 ? 8   VAL A HG13 2  
ATOM   6553   H HG21 . VAL A 1 8   ? -8.794  -11.801 1.311   1.00 0.00 ? 8   VAL A HG21 2  
ATOM   6554   H HG22 . VAL A 1 8   ? -9.224  -12.149 -0.361  1.00 0.00 ? 8   VAL A HG22 2  
ATOM   6555   H HG23 . VAL A 1 8   ? -7.860  -11.092 -0.006  1.00 0.00 ? 8   VAL A HG23 2  
ATOM   6556   N N    . MET A 1 9   ? -12.158 -8.441  1.397   1.00 0.00 ? 9   MET A N    2  
ATOM   6557   C CA   . MET A 1 9   ? -12.946 -7.214  1.416   1.00 0.00 ? 9   MET A CA   2  
ATOM   6558   C C    . MET A 1 9   ? -12.890 -6.602  2.812   1.00 0.00 ? 9   MET A C    2  
ATOM   6559   O O    . MET A 1 9   ? -12.690 -5.397  2.968   1.00 0.00 ? 9   MET A O    2  
ATOM   6560   C CB   . MET A 1 9   ? -14.394 -7.527  1.041   1.00 0.00 ? 9   MET A CB   2  
ATOM   6561   C CG   . MET A 1 9   ? -14.503 -7.721  -0.470  1.00 0.00 ? 9   MET A CG   2  
ATOM   6562   S SD   . MET A 1 9   ? -16.188 -8.229  -0.884  1.00 0.00 ? 9   MET A SD   2  
ATOM   6563   C CE   . MET A 1 9   ? -16.999 -6.656  -0.527  1.00 0.00 ? 9   MET A CE   2  
ATOM   6564   H H    . MET A 1 9   ? -12.583 -9.290  1.149   1.00 0.00 ? 9   MET A H    2  
ATOM   6565   H HA   . MET A 1 9   ? -12.524 -6.513  0.714   1.00 0.00 ? 9   MET A HA   2  
ATOM   6566   H HB2  . MET A 1 9   ? -14.708 -8.431  1.543   1.00 0.00 ? 9   MET A HB2  2  
ATOM   6567   H HB3  . MET A 1 9   ? -15.030 -6.709  1.343   1.00 0.00 ? 9   MET A HB3  2  
ATOM   6568   H HG2  . MET A 1 9   ? -14.275 -6.792  -0.970  1.00 0.00 ? 9   MET A HG2  2  
ATOM   6569   H HG3  . MET A 1 9   ? -13.807 -8.482  -0.789  1.00 0.00 ? 9   MET A HG3  2  
ATOM   6570   H HE1  . MET A 1 9   ? -16.307 -5.846  -0.708  1.00 0.00 ? 9   MET A HE1  2  
ATOM   6571   H HE2  . MET A 1 9   ? -17.864 -6.545  -1.162  1.00 0.00 ? 9   MET A HE2  2  
ATOM   6572   H HE3  . MET A 1 9   ? -17.310 -6.638  0.502   1.00 0.00 ? 9   MET A HE3  2  
ATOM   6573   N N    . GLY A 1 10  ? -13.043 -7.448  3.826   1.00 0.00 ? 10  GLY A N    2  
ATOM   6574   C CA   . GLY A 1 10  ? -12.977 -6.980  5.206   1.00 0.00 ? 10  GLY A CA   2  
ATOM   6575   C C    . GLY A 1 10  ? -11.600 -6.395  5.497   1.00 0.00 ? 10  GLY A C    2  
ATOM   6576   O O    . GLY A 1 10  ? -11.480 -5.329  6.104   1.00 0.00 ? 10  GLY A O    2  
ATOM   6577   H H    . GLY A 1 10  ? -13.180 -8.404  3.643   1.00 0.00 ? 10  GLY A H    2  
ATOM   6578   H HA2  . GLY A 1 10  ? -13.729 -6.220  5.361   1.00 0.00 ? 10  GLY A HA2  2  
ATOM   6579   H HA3  . GLY A 1 10  ? -13.161 -7.807  5.875   1.00 0.00 ? 10  GLY A HA3  2  
ATOM   6580   N N    . LEU A 1 11  ? -10.561 -7.090  5.045   1.00 0.00 ? 11  LEU A N    2  
ATOM   6581   C CA   . LEU A 1 11  ? -9.189  -6.622  5.253   1.00 0.00 ? 11  LEU A CA   2  
ATOM   6582   C C    . LEU A 1 11  ? -8.961  -5.290  4.551   1.00 0.00 ? 11  LEU A C    2  
ATOM   6583   O O    . LEU A 1 11  ? -8.358  -4.375  5.117   1.00 0.00 ? 11  LEU A O    2  
ATOM   6584   C CB   . LEU A 1 11  ? -8.189  -7.645  4.712   1.00 0.00 ? 11  LEU A CB   2  
ATOM   6585   C CG   . LEU A 1 11  ? -8.183  -8.898  5.592   1.00 0.00 ? 11  LEU A CG   2  
ATOM   6586   C CD1  . LEU A 1 11  ? -7.365  -9.990  4.898   1.00 0.00 ? 11  LEU A CD1  2  
ATOM   6587   C CD2  . LEU A 1 11  ? -7.571  -8.584  6.969   1.00 0.00 ? 11  LEU A CD2  2  
ATOM   6588   H H    . LEU A 1 11  ? -10.717 -7.928  4.557   1.00 0.00 ? 11  LEU A H    2  
ATOM   6589   H HA   . LEU A 1 11  ? -9.017  -6.491  6.311   1.00 0.00 ? 11  LEU A HA   2  
ATOM   6590   H HB2  . LEU A 1 11  ? -8.471  -7.915  3.703   1.00 0.00 ? 11  LEU A HB2  2  
ATOM   6591   H HB3  . LEU A 1 11  ? -7.201  -7.208  4.700   1.00 0.00 ? 11  LEU A HB3  2  
ATOM   6592   H HG   . LEU A 1 11  ? -9.198  -9.244  5.720   1.00 0.00 ? 11  LEU A HG   2  
ATOM   6593   H HD11 . LEU A 1 11  ? -6.502  -9.551  4.419   1.00 0.00 ? 11  LEU A HD11 2  
ATOM   6594   H HD12 . LEU A 1 11  ? -7.039  -10.716 5.628   1.00 0.00 ? 11  LEU A HD12 2  
ATOM   6595   H HD13 . LEU A 1 11  ? -7.977  -10.480 4.154   1.00 0.00 ? 11  LEU A HD13 2  
ATOM   6596   H HD21 . LEU A 1 11  ? -6.808  -7.825  6.870   1.00 0.00 ? 11  LEU A HD21 2  
ATOM   6597   H HD22 . LEU A 1 11  ? -8.344  -8.229  7.635   1.00 0.00 ? 11  LEU A HD22 2  
ATOM   6598   H HD23 . LEU A 1 11  ? -7.130  -9.482  7.380   1.00 0.00 ? 11  LEU A HD23 2  
ATOM   6599   N N    . ILE A 1 12  ? -9.448  -5.184  3.321   1.00 0.00 ? 12  ILE A N    2  
ATOM   6600   C CA   . ILE A 1 12  ? -9.289  -3.949  2.558   1.00 0.00 ? 12  ILE A CA   2  
ATOM   6601   C C    . ILE A 1 12  ? -10.000 -2.816  3.278   1.00 0.00 ? 12  ILE A C    2  
ATOM   6602   O O    . ILE A 1 12  ? -9.452  -1.725  3.447   1.00 0.00 ? 12  ILE A O    2  
ATOM   6603   C CB   . ILE A 1 12  ? -9.897  -4.137  1.164   1.00 0.00 ? 12  ILE A CB   2  
ATOM   6604   C CG1  . ILE A 1 12  ? -9.196  -5.274  0.393   1.00 0.00 ? 12  ILE A CG1  2  
ATOM   6605   C CG2  . ILE A 1 12  ? -9.778  -2.848  0.368   1.00 0.00 ? 12  ILE A CG2  2  
ATOM   6606   C CD1  . ILE A 1 12  ? -7.724  -4.970  0.134   1.00 0.00 ? 12  ILE A CD1  2  
ATOM   6607   H H    . ILE A 1 12  ? -9.924  -5.947  2.922   1.00 0.00 ? 12  ILE A H    2  
ATOM   6608   H HA   . ILE A 1 12  ? -8.237  -3.715  2.492   1.00 0.00 ? 12  ILE A HA   2  
ATOM   6609   H HB   . ILE A 1 12  ? -10.944 -4.381  1.274   1.00 0.00 ? 12  ILE A HB   2  
ATOM   6610   H HG12 . ILE A 1 12  ? -9.255  -6.176  0.968   1.00 0.00 ? 12  ILE A HG12 2  
ATOM   6611   H HG13 . ILE A 1 12  ? -9.698  -5.423  -0.551  1.00 0.00 ? 12  ILE A HG13 2  
ATOM   6612   H HG21 . ILE A 1 12  ? -10.229 -2.036  0.917   1.00 0.00 ? 12  ILE A HG21 2  
ATOM   6613   H HG22 . ILE A 1 12  ? -8.735  -2.631  0.189   1.00 0.00 ? 12  ILE A HG22 2  
ATOM   6614   H HG23 . ILE A 1 12  ? -10.279 -2.983  -0.575  1.00 0.00 ? 12  ILE A HG23 2  
ATOM   6615   H HD11 . ILE A 1 12  ? -7.634  -3.977  -0.283  1.00 0.00 ? 12  ILE A HD11 2  
ATOM   6616   H HD12 . ILE A 1 12  ? -7.164  -5.021  1.047   1.00 0.00 ? 12  ILE A HD12 2  
ATOM   6617   H HD13 . ILE A 1 12  ? -7.340  -5.687  -0.569  1.00 0.00 ? 12  ILE A HD13 2  
ATOM   6618   N N    . ILE A 1 13  ? -11.215 -3.093  3.731   1.00 0.00 ? 13  ILE A N    2  
ATOM   6619   C CA   . ILE A 1 13  ? -11.978 -2.093  4.464   1.00 0.00 ? 13  ILE A CA   2  
ATOM   6620   C C    . ILE A 1 13  ? -11.259 -1.744  5.765   1.00 0.00 ? 13  ILE A C    2  
ATOM   6621   O O    . ILE A 1 13  ? -11.114 -0.572  6.117   1.00 0.00 ? 13  ILE A O    2  
ATOM   6622   C CB   . ILE A 1 13  ? -13.374 -2.634  4.770   1.00 0.00 ? 13  ILE A CB   2  
ATOM   6623   C CG1  . ILE A 1 13  ? -14.164 -2.773  3.457   1.00 0.00 ? 13  ILE A CG1  2  
ATOM   6624   C CG2  . ILE A 1 13  ? -14.096 -1.682  5.730   1.00 0.00 ? 13  ILE A CG2  2  
ATOM   6625   C CD1  . ILE A 1 13  ? -14.830 -1.443  3.083   1.00 0.00 ? 13  ILE A CD1  2  
ATOM   6626   H H    . ILE A 1 13  ? -11.596 -3.988  3.590   1.00 0.00 ? 13  ILE A H    2  
ATOM   6627   H HA   . ILE A 1 13  ? -12.062 -1.202  3.859   1.00 0.00 ? 13  ILE A HA   2  
ATOM   6628   H HB   . ILE A 1 13  ? -13.282 -3.605  5.236   1.00 0.00 ? 13  ILE A HB   2  
ATOM   6629   H HG12 . ILE A 1 13  ? -13.491 -3.069  2.665   1.00 0.00 ? 13  ILE A HG12 2  
ATOM   6630   H HG13 . ILE A 1 13  ? -14.919 -3.529  3.577   1.00 0.00 ? 13  ILE A HG13 2  
ATOM   6631   H HG21 . ILE A 1 13  ? -13.959 -0.664  5.398   1.00 0.00 ? 13  ILE A HG21 2  
ATOM   6632   H HG22 . ILE A 1 13  ? -15.150 -1.918  5.745   1.00 0.00 ? 13  ILE A HG22 2  
ATOM   6633   H HG23 . ILE A 1 13  ? -13.688 -1.796  6.723   1.00 0.00 ? 13  ILE A HG23 2  
ATOM   6634   H HD11 . ILE A 1 13  ? -14.209 -0.625  3.416   1.00 0.00 ? 13  ILE A HD11 2  
ATOM   6635   H HD12 . ILE A 1 13  ? -14.949 -1.390  2.013   1.00 0.00 ? 13  ILE A HD12 2  
ATOM   6636   H HD13 . ILE A 1 13  ? -15.797 -1.375  3.554   1.00 0.00 ? 13  ILE A HD13 2  
ATOM   6637   N N    . ASN A 1 14  ? -10.803 -2.775  6.471   1.00 0.00 ? 14  ASN A N    2  
ATOM   6638   C CA   . ASN A 1 14  ? -10.094 -2.575  7.734   1.00 0.00 ? 14  ASN A CA   2  
ATOM   6639   C C    . ASN A 1 14  ? -8.842  -1.734  7.501   1.00 0.00 ? 14  ASN A C    2  
ATOM   6640   O O    . ASN A 1 14  ? -8.580  -0.766  8.217   1.00 0.00 ? 14  ASN A O    2  
ATOM   6641   C CB   . ASN A 1 14  ? -9.719  -3.934  8.343   1.00 0.00 ? 14  ASN A CB   2  
ATOM   6642   C CG   . ASN A 1 14  ? -9.605  -3.836  9.862   1.00 0.00 ? 14  ASN A CG   2  
ATOM   6643   O OD1  . ASN A 1 14  ? -9.659  -2.748  10.423  1.00 0.00 ? 14  ASN A OD1  2  
ATOM   6644   N ND2  . ASN A 1 14  ? -9.449  -4.922  10.563  1.00 0.00 ? 14  ASN A ND2  2  
ATOM   6645   H H    . ASN A 1 14  ? -10.942 -3.689  6.133   1.00 0.00 ? 14  ASN A H    2  
ATOM   6646   H HA   . ASN A 1 14  ? -10.742 -2.049  8.418   1.00 0.00 ? 14  ASN A HA   2  
ATOM   6647   H HB2  . ASN A 1 14  ? -10.483 -4.656  8.097   1.00 0.00 ? 14  ASN A HB2  2  
ATOM   6648   H HB3  . ASN A 1 14  ? -8.775  -4.264  7.937   1.00 0.00 ? 14  ASN A HB3  2  
ATOM   6649   H HD21 . ASN A 1 14  ? -9.405  -5.789  10.115  1.00 0.00 ? 14  ASN A HD21 2  
ATOM   6650   H HD22 . ASN A 1 14  ? -9.378  -4.868  11.539  1.00 0.00 ? 14  ASN A HD22 2  
ATOM   6651   N N    . SER A 1 15  ? -8.077  -2.097  6.476   1.00 0.00 ? 15  SER A N    2  
ATOM   6652   C CA   . SER A 1 15  ? -6.867  -1.350  6.145   1.00 0.00 ? 15  SER A CA   2  
ATOM   6653   C C    . SER A 1 15  ? -7.224  0.097   5.824   1.00 0.00 ? 15  SER A C    2  
ATOM   6654   O O    . SER A 1 15  ? -6.556  1.030   6.268   1.00 0.00 ? 15  SER A O    2  
ATOM   6655   C CB   . SER A 1 15  ? -6.171  -1.981  4.939   1.00 0.00 ? 15  SER A CB   2  
ATOM   6656   O OG   . SER A 1 15  ? -6.882  -1.640  3.757   1.00 0.00 ? 15  SER A OG   2  
ATOM   6657   H H    . SER A 1 15  ? -8.341  -2.867  5.924   1.00 0.00 ? 15  SER A H    2  
ATOM   6658   H HA   . SER A 1 15  ? -6.201  -1.367  6.992   1.00 0.00 ? 15  SER A HA   2  
ATOM   6659   H HB2  . SER A 1 15  ? -5.162  -1.611  4.867   1.00 0.00 ? 15  SER A HB2  2  
ATOM   6660   H HB3  . SER A 1 15  ? -6.151  -3.054  5.059   1.00 0.00 ? 15  SER A HB3  2  
ATOM   6661   H HG   . SER A 1 15  ? -6.812  -2.377  3.146   1.00 0.00 ? 15  SER A HG   2  
ATOM   6662   N N    . GLY A 1 16  ? -8.303  0.273   5.060   1.00 0.00 ? 16  GLY A N    2  
ATOM   6663   C CA   . GLY A 1 16  ? -8.760  1.611   4.697   1.00 0.00 ? 16  GLY A CA   2  
ATOM   6664   C C    . GLY A 1 16  ? -9.165  2.396   5.939   1.00 0.00 ? 16  GLY A C    2  
ATOM   6665   O O    . GLY A 1 16  ? -8.809  3.567   6.086   1.00 0.00 ? 16  GLY A O    2  
ATOM   6666   H H    . GLY A 1 16  ? -8.808  -0.510  4.748   1.00 0.00 ? 16  GLY A H    2  
ATOM   6667   H HA2  . GLY A 1 16  ? -7.959  2.133   4.193   1.00 0.00 ? 16  GLY A HA2  2  
ATOM   6668   H HA3  . GLY A 1 16  ? -9.608  1.533   4.034   1.00 0.00 ? 16  GLY A HA3  2  
ATOM   6669   N N    . GLN A 1 17  ? -9.899  1.747   6.844   1.00 0.00 ? 17  GLN A N    2  
ATOM   6670   C CA   . GLN A 1 17  ? -10.317 2.413   8.078   1.00 0.00 ? 17  GLN A CA   2  
ATOM   6671   C C    . GLN A 1 17  ? -9.088  2.793   8.891   1.00 0.00 ? 17  GLN A C    2  
ATOM   6672   O O    . GLN A 1 17  ? -9.024  3.880   9.466   1.00 0.00 ? 17  GLN A O    2  
ATOM   6673   C CB   . GLN A 1 17  ? -11.231 1.489   8.890   1.00 0.00 ? 17  GLN A CB   2  
ATOM   6674   C CG   . GLN A 1 17  ? -12.046 2.302   9.912   1.00 0.00 ? 17  GLN A CG   2  
ATOM   6675   C CD   . GLN A 1 17  ? -13.410 1.651   10.126  1.00 0.00 ? 17  GLN A CD   2  
ATOM   6676   O OE1  . GLN A 1 17  ? -13.596 0.477   9.805   1.00 0.00 ? 17  GLN A OE1  2  
ATOM   6677   N NE2  . GLN A 1 17  ? -14.382 2.351   10.644  1.00 0.00 ? 17  GLN A NE2  2  
ATOM   6678   H H    . GLN A 1 17  ? -10.145 0.807   6.685   1.00 0.00 ? 17  GLN A H    2  
ATOM   6679   H HA   . GLN A 1 17  ? -10.860 3.310   7.825   1.00 0.00 ? 17  GLN A HA   2  
ATOM   6680   H HB2  . GLN A 1 17  ? -11.904 0.976   8.218   1.00 0.00 ? 17  GLN A HB2  2  
ATOM   6681   H HB3  . GLN A 1 17  ? -10.628 0.763   9.414   1.00 0.00 ? 17  GLN A HB3  2  
ATOM   6682   H HG2  . GLN A 1 17  ? -11.515 2.329   10.852  1.00 0.00 ? 17  GLN A HG2  2  
ATOM   6683   H HG3  . GLN A 1 17  ? -12.189 3.310   9.555   1.00 0.00 ? 17  GLN A HG3  2  
ATOM   6684   H HE21 . GLN A 1 17  ? -14.233 3.287   10.893  1.00 0.00 ? 17  GLN A HE21 2  
ATOM   6685   H HE22 . GLN A 1 17  ? -15.261 1.941   10.781  1.00 0.00 ? 17  GLN A HE22 2  
ATOM   6686   N N    . ALA A 1 18  ? -8.113  1.888   8.928   1.00 0.00 ? 18  ALA A N    2  
ATOM   6687   C CA   . ALA A 1 18  ? -6.883  2.136   9.666   1.00 0.00 ? 18  ALA A CA   2  
ATOM   6688   C C    . ALA A 1 18  ? -6.222  3.414   9.161   1.00 0.00 ? 18  ALA A C    2  
ATOM   6689   O O    . ALA A 1 18  ? -5.883  4.308   9.943   1.00 0.00 ? 18  ALA A O    2  
ATOM   6690   C CB   . ALA A 1 18  ? -5.934  0.945   9.511   1.00 0.00 ? 18  ALA A CB   2  
ATOM   6691   H H    . ALA A 1 18  ? -8.222  1.039   8.442   1.00 0.00 ? 18  ALA A H    2  
ATOM   6692   H HA   . ALA A 1 18  ? -7.127  2.261   10.711  1.00 0.00 ? 18  ALA A HA   2  
ATOM   6693   H HB1  . ALA A 1 18  ? -5.274  1.113   8.672   1.00 0.00 ? 18  ALA A HB1  2  
ATOM   6694   H HB2  . ALA A 1 18  ? -6.510  0.047   9.344   1.00 0.00 ? 18  ALA A HB2  2  
ATOM   6695   H HB3  . ALA A 1 18  ? -5.349  0.835   10.413  1.00 0.00 ? 18  ALA A HB3  2  
ATOM   6696   N N    . ARG A 1 19  ? -6.058  3.515   7.846   1.00 0.00 ? 19  ARG A N    2  
ATOM   6697   C CA   . ARG A 1 19  ? -5.458  4.711   7.269   1.00 0.00 ? 19  ARG A CA   2  
ATOM   6698   C C    . ARG A 1 19  ? -6.308  5.927   7.616   1.00 0.00 ? 19  ARG A C    2  
ATOM   6699   O O    . ARG A 1 19  ? -5.791  6.963   8.041   1.00 0.00 ? 19  ARG A O    2  
ATOM   6700   C CB   . ARG A 1 19  ? -5.349  4.588   5.744   1.00 0.00 ? 19  ARG A CB   2  
ATOM   6701   C CG   . ARG A 1 19  ? -4.626  5.826   5.191   1.00 0.00 ? 19  ARG A CG   2  
ATOM   6702   C CD   . ARG A 1 19  ? -4.400  5.683   3.685   1.00 0.00 ? 19  ARG A CD   2  
ATOM   6703   N NE   . ARG A 1 19  ? -5.677  5.687   2.970   1.00 0.00 ? 19  ARG A NE   2  
ATOM   6704   C CZ   . ARG A 1 19  ? -5.721  5.765   1.650   1.00 0.00 ? 19  ARG A CZ   2  
ATOM   6705   N NH1  . ARG A 1 19  ? -4.621  5.778   0.970   1.00 0.00 ? 19  ARG A NH1  2  
ATOM   6706   N NH2  . ARG A 1 19  ? -6.860  5.821   1.041   1.00 0.00 ? 19  ARG A NH2  2  
ATOM   6707   H H    . ARG A 1 19  ? -6.361  2.786   7.261   1.00 0.00 ? 19  ARG A H    2  
ATOM   6708   H HA   . ARG A 1 19  ? -4.471  4.841   7.686   1.00 0.00 ? 19  ARG A HA   2  
ATOM   6709   H HB2  . ARG A 1 19  ? -4.795  3.697   5.492   1.00 0.00 ? 19  ARG A HB2  2  
ATOM   6710   H HB3  . ARG A 1 19  ? -6.341  4.531   5.316   1.00 0.00 ? 19  ARG A HB3  2  
ATOM   6711   H HG2  . ARG A 1 19  ? -5.222  6.708   5.382   1.00 0.00 ? 19  ARG A HG2  2  
ATOM   6712   H HG3  . ARG A 1 19  ? -3.670  5.929   5.685   1.00 0.00 ? 19  ARG A HG3  2  
ATOM   6713   H HD2  . ARG A 1 19  ? -3.800  6.517   3.341   1.00 0.00 ? 19  ARG A HD2  2  
ATOM   6714   H HD3  . ARG A 1 19  ? -3.877  4.757   3.488   1.00 0.00 ? 19  ARG A HD3  2  
ATOM   6715   H HE   . ARG A 1 19  ? -6.514  5.654   3.483   1.00 0.00 ? 19  ARG A HE   2  
ATOM   6716   H HH11 . ARG A 1 19  ? -3.742  5.729   1.446   1.00 0.00 ? 19  ARG A HH11 2  
ATOM   6717   H HH12 . ARG A 1 19  ? -4.643  5.839   -0.022  1.00 0.00 ? 19  ARG A HH12 2  
ATOM   6718   H HH21 . ARG A 1 19  ? -7.712  5.804   1.566   1.00 0.00 ? 19  ARG A HH21 2  
ATOM   6719   H HH22 . ARG A 1 19  ? -6.892  5.884   0.045   1.00 0.00 ? 19  ARG A HH22 2  
ATOM   6720   N N    . SER A 1 20  ? -7.616  5.793   7.429   1.00 0.00 ? 20  SER A N    2  
ATOM   6721   C CA   . SER A 1 20  ? -8.535  6.885   7.725   1.00 0.00 ? 20  SER A CA   2  
ATOM   6722   C C    . SER A 1 20  ? -8.317  7.389   9.148   1.00 0.00 ? 20  SER A C    2  
ATOM   6723   O O    . SER A 1 20  ? -8.193  8.595   9.385   1.00 0.00 ? 20  SER A O    2  
ATOM   6724   C CB   . SER A 1 20  ? -9.979  6.421   7.555   1.00 0.00 ? 20  SER A CB   2  
ATOM   6725   O OG   . SER A 1 20  ? -10.849 7.367   8.161   1.00 0.00 ? 20  SER A OG   2  
ATOM   6726   H H    . SER A 1 20  ? -7.970  4.940   7.090   1.00 0.00 ? 20  SER A H    2  
ATOM   6727   H HA   . SER A 1 20  ? -8.341  7.694   7.039   1.00 0.00 ? 20  SER A HA   2  
ATOM   6728   H HB2  . SER A 1 20  ? -10.213 6.344   6.507   1.00 0.00 ? 20  SER A HB2  2  
ATOM   6729   H HB3  . SER A 1 20  ? -10.100 5.453   8.022   1.00 0.00 ? 20  SER A HB3  2  
ATOM   6730   H HG   . SER A 1 20  ? -10.606 8.239   7.842   1.00 0.00 ? 20  SER A HG   2  
ATOM   6731   N N    . LEU A 1 21  ? -8.243  6.460   10.092  1.00 0.00 ? 21  LEU A N    2  
ATOM   6732   C CA   . LEU A 1 21  ? -8.009  6.821   11.486  1.00 0.00 ? 21  LEU A CA   2  
ATOM   6733   C C    . LEU A 1 21  ? -6.645  7.498   11.630  1.00 0.00 ? 21  LEU A C    2  
ATOM   6734   O O    . LEU A 1 21  ? -6.506  8.501   12.333  1.00 0.00 ? 21  LEU A O    2  
ATOM   6735   C CB   . LEU A 1 21  ? -8.047  5.568   12.368  1.00 0.00 ? 21  LEU A CB   2  
ATOM   6736   C CG   . LEU A 1 21  ? -9.482  5.025   12.441  1.00 0.00 ? 21  LEU A CG   2  
ATOM   6737   C CD1  . LEU A 1 21  ? -9.477  3.618   13.065  1.00 0.00 ? 21  LEU A CD1  2  
ATOM   6738   C CD2  . LEU A 1 21  ? -10.363 5.971   13.289  1.00 0.00 ? 21  LEU A CD2  2  
ATOM   6739   H H    . LEU A 1 21  ? -8.327  5.513   9.846   1.00 0.00 ? 21  LEU A H    2  
ATOM   6740   H HA   . LEU A 1 21  ? -8.776  7.508   11.809  1.00 0.00 ? 21  LEU A HA   2  
ATOM   6741   H HB2  . LEU A 1 21  ? -7.395  4.819   11.944  1.00 0.00 ? 21  LEU A HB2  2  
ATOM   6742   H HB3  . LEU A 1 21  ? -7.707  5.818   13.362  1.00 0.00 ? 21  LEU A HB3  2  
ATOM   6743   H HG   . LEU A 1 21  ? -9.886  4.964   11.441  1.00 0.00 ? 21  LEU A HG   2  
ATOM   6744   H HD11 . LEU A 1 21  ? -8.540  3.125   12.854  1.00 0.00 ? 21  LEU A HD11 2  
ATOM   6745   H HD12 . LEU A 1 21  ? -9.607  3.698   14.134  1.00 0.00 ? 21  LEU A HD12 2  
ATOM   6746   H HD13 . LEU A 1 21  ? -10.288 3.039   12.649  1.00 0.00 ? 21  LEU A HD13 2  
ATOM   6747   H HD21 . LEU A 1 21  ? -9.757  6.754   13.722  1.00 0.00 ? 21  LEU A HD21 2  
ATOM   6748   H HD22 . LEU A 1 21  ? -11.119 6.414   12.657  1.00 0.00 ? 21  LEU A HD22 2  
ATOM   6749   H HD23 . LEU A 1 21  ? -10.844 5.416   14.083  1.00 0.00 ? 21  LEU A HD23 2  
ATOM   6750   N N    . ALA A 1 22  ? -5.643  6.944   10.949  1.00 0.00 ? 22  ALA A N    2  
ATOM   6751   C CA   . ALA A 1 22  ? -4.295  7.505   11.000  1.00 0.00 ? 22  ALA A CA   2  
ATOM   6752   C C    . ALA A 1 22  ? -4.301  8.964   10.532  1.00 0.00 ? 22  ALA A C    2  
ATOM   6753   O O    . ALA A 1 22  ? -3.807  9.848   11.233  1.00 0.00 ? 22  ALA A O    2  
ATOM   6754   C CB   . ALA A 1 22  ? -3.355  6.669   10.129  1.00 0.00 ? 22  ALA A CB   2  
ATOM   6755   H H    . ALA A 1 22  ? -5.818  6.149   10.400  1.00 0.00 ? 22  ALA A H    2  
ATOM   6756   H HA   . ALA A 1 22  ? -3.944  7.474   12.019  1.00 0.00 ? 22  ALA A HA   2  
ATOM   6757   H HB1  . ALA A 1 22  ? -2.330  6.923   10.362  1.00 0.00 ? 22  ALA A HB1  2  
ATOM   6758   H HB2  . ALA A 1 22  ? -3.519  5.621   10.329  1.00 0.00 ? 22  ALA A HB2  2  
ATOM   6759   H HB3  . ALA A 1 22  ? -3.549  6.872   9.087   1.00 0.00 ? 22  ALA A HB3  2  
ATOM   6760   N N    . TYR A 1 23  ? -4.876  9.218   9.357   1.00 0.00 ? 23  TYR A N    2  
ATOM   6761   C CA   . TYR A 1 23  ? -4.948  10.593  8.850   1.00 0.00 ? 23  TYR A CA   2  
ATOM   6762   C C    . TYR A 1 23  ? -5.722  11.458  9.838   1.00 0.00 ? 23  TYR A C    2  
ATOM   6763   O O    . TYR A 1 23  ? -5.339  12.594  10.122  1.00 0.00 ? 23  TYR A O    2  
ATOM   6764   C CB   . TYR A 1 23  ? -5.624  10.619  7.481   1.00 0.00 ? 23  TYR A CB   2  
ATOM   6765   C CG   . TYR A 1 23  ? -5.772  12.047  7.022   1.00 0.00 ? 23  TYR A CG   2  
ATOM   6766   C CD1  . TYR A 1 23  ? -4.672  12.732  6.494   1.00 0.00 ? 23  TYR A CD1  2  
ATOM   6767   C CD2  . TYR A 1 23  ? -7.012  12.687  7.125   1.00 0.00 ? 23  TYR A CD2  2  
ATOM   6768   C CE1  . TYR A 1 23  ? -4.812  14.058  6.067   1.00 0.00 ? 23  TYR A CE1  2  
ATOM   6769   C CE2  . TYR A 1 23  ? -7.153  14.012  6.699   1.00 0.00 ? 23  TYR A CE2  2  
ATOM   6770   C CZ   . TYR A 1 23  ? -6.054  14.698  6.170   1.00 0.00 ? 23  TYR A CZ   2  
ATOM   6771   O OH   . TYR A 1 23  ? -6.193  16.005  5.749   1.00 0.00 ? 23  TYR A OH   2  
ATOM   6772   H H    . TYR A 1 23  ? -5.269  8.481   8.837   1.00 0.00 ? 23  TYR A H    2  
ATOM   6773   H HA   . TYR A 1 23  ? -3.946  10.984  8.764   1.00 0.00 ? 23  TYR A HA   2  
ATOM   6774   H HB2  . TYR A 1 23  ? -5.021  10.072  6.772   1.00 0.00 ? 23  TYR A HB2  2  
ATOM   6775   H HB3  . TYR A 1 23  ? -6.600  10.161  7.553   1.00 0.00 ? 23  TYR A HB3  2  
ATOM   6776   H HD1  . TYR A 1 23  ? -3.715  12.238  6.415   1.00 0.00 ? 23  TYR A HD1  2  
ATOM   6777   H HD2  . TYR A 1 23  ? -7.861  12.158  7.533   1.00 0.00 ? 23  TYR A HD2  2  
ATOM   6778   H HE1  . TYR A 1 23  ? -3.964  14.587  5.660   1.00 0.00 ? 23  TYR A HE1  2  
ATOM   6779   H HE2  . TYR A 1 23  ? -8.111  14.506  6.778   1.00 0.00 ? 23  TYR A HE2  2  
ATOM   6780   H HH   . TYR A 1 23  ? -5.382  16.261  5.305   1.00 0.00 ? 23  TYR A HH   2  
ATOM   6781   N N    . ALA A 1 24  ? -6.803  10.907  10.387  1.00 0.00 ? 24  ALA A N    2  
ATOM   6782   C CA   . ALA A 1 24  ? -7.591  11.645  11.361  1.00 0.00 ? 24  ALA A CA   2  
ATOM   6783   C C    . ALA A 1 24  ? -6.715  11.960  12.576  1.00 0.00 ? 24  ALA A C    2  
ATOM   6784   O O    . ALA A 1 24  ? -6.749  13.068  13.114  1.00 0.00 ? 24  ALA A O    2  
ATOM   6785   C CB   . ALA A 1 24  ? -8.831  10.828  11.759  1.00 0.00 ? 24  ALA A CB   2  
ATOM   6786   H H    . ALA A 1 24  ? -7.059  9.991   10.146  1.00 0.00 ? 24  ALA A H    2  
ATOM   6787   H HA   . ALA A 1 24  ? -7.909  12.577  10.916  1.00 0.00 ? 24  ALA A HA   2  
ATOM   6788   H HB1  . ALA A 1 24  ? -9.721  11.317  11.386  1.00 0.00 ? 24  ALA A HB1  2  
ATOM   6789   H HB2  . ALA A 1 24  ? -8.890  10.751  12.833  1.00 0.00 ? 24  ALA A HB2  2  
ATOM   6790   H HB3  . ALA A 1 24  ? -8.762  9.838   11.331  1.00 0.00 ? 24  ALA A HB3  2  
ATOM   6791   N N    . ALA A 1 25  ? -5.898  10.984  12.976  1.00 0.00 ? 25  ALA A N    2  
ATOM   6792   C CA   . ALA A 1 25  ? -4.987  11.177  14.102  1.00 0.00 ? 25  ALA A CA   2  
ATOM   6793   C C    . ALA A 1 25  ? -4.063  12.356  13.815  1.00 0.00 ? 25  ALA A C    2  
ATOM   6794   O O    . ALA A 1 25  ? -3.837  13.216  14.671  1.00 0.00 ? 25  ALA A O    2  
ATOM   6795   C CB   . ALA A 1 25  ? -4.158  9.909   14.323  1.00 0.00 ? 25  ALA A CB   2  
ATOM   6796   H H    . ALA A 1 25  ? -5.893  10.131  12.490  1.00 0.00 ? 25  ALA A H    2  
ATOM   6797   H HA   . ALA A 1 25  ? -5.560  11.388  14.991  1.00 0.00 ? 25  ALA A HA   2  
ATOM   6798   H HB1  . ALA A 1 25  ? -3.335  9.888   13.621  1.00 0.00 ? 25  ALA A HB1  2  
ATOM   6799   H HB2  . ALA A 1 25  ? -4.781  9.039   14.172  1.00 0.00 ? 25  ALA A HB2  2  
ATOM   6800   H HB3  . ALA A 1 25  ? -3.769  9.904   15.331  1.00 0.00 ? 25  ALA A HB3  2  
ATOM   6801   N N    . LEU A 1 26  ? -3.546  12.400  12.594  1.00 0.00 ? 26  LEU A N    2  
ATOM   6802   C CA   . LEU A 1 26  ? -2.662  13.490  12.187  1.00 0.00 ? 26  LEU A CA   2  
ATOM   6803   C C    . LEU A 1 26  ? -3.408  14.819  12.255  1.00 0.00 ? 26  LEU A C    2  
ATOM   6804   O O    . LEU A 1 26  ? -2.883  15.821  12.747  1.00 0.00 ? 26  LEU A O    2  
ATOM   6805   C CB   . LEU A 1 26  ? -2.152  13.243  10.762  1.00 0.00 ? 26  LEU A CB   2  
ATOM   6806   C CG   . LEU A 1 26  ? -1.356  14.454  10.254  1.00 0.00 ? 26  LEU A CG   2  
ATOM   6807   C CD1  . LEU A 1 26  ? -0.152  14.717  11.159  1.00 0.00 ? 26  LEU A CD1  2  
ATOM   6808   C CD2  . LEU A 1 26  ? -0.863  14.163  8.835   1.00 0.00 ? 26  LEU A CD2  2  
ATOM   6809   H H    . LEU A 1 26  ? -3.773  11.694  11.949  1.00 0.00 ? 26  LEU A H    2  
ATOM   6810   H HA   . LEU A 1 26  ? -1.823  13.525  12.862  1.00 0.00 ? 26  LEU A HA   2  
ATOM   6811   H HB2  . LEU A 1 26  ? -1.517  12.373  10.759  1.00 0.00 ? 26  LEU A HB2  2  
ATOM   6812   H HB3  . LEU A 1 26  ? -2.995  13.073  10.105  1.00 0.00 ? 26  LEU A HB3  2  
ATOM   6813   H HG   . LEU A 1 26  ? -1.992  15.328  10.238  1.00 0.00 ? 26  LEU A HG   2  
ATOM   6814   H HD11 . LEU A 1 26  ? 0.332   13.781  11.396  1.00 0.00 ? 26  LEU A HD11 2  
ATOM   6815   H HD12 . LEU A 1 26  ? 0.546   15.362  10.650  1.00 0.00 ? 26  LEU A HD12 2  
ATOM   6816   H HD13 . LEU A 1 26  ? -0.483  15.192  12.072  1.00 0.00 ? 26  LEU A HD13 2  
ATOM   6817   H HD21 . LEU A 1 26  ? -0.239  13.282  8.843   1.00 0.00 ? 26  LEU A HD21 2  
ATOM   6818   H HD22 . LEU A 1 26  ? -1.710  13.997  8.185   1.00 0.00 ? 26  LEU A HD22 2  
ATOM   6819   H HD23 . LEU A 1 26  ? -0.292  15.003  8.472   1.00 0.00 ? 26  LEU A HD23 2  
ATOM   6820   N N    . LYS A 1 27  ? -4.640  14.819  11.762  1.00 0.00 ? 27  LYS A N    2  
ATOM   6821   C CA   . LYS A 1 27  ? -5.456  16.026  11.783  1.00 0.00 ? 27  LYS A CA   2  
ATOM   6822   C C    . LYS A 1 27  ? -5.593  16.550  13.215  1.00 0.00 ? 27  LYS A C    2  
ATOM   6823   O O    . LYS A 1 27  ? -5.490  17.755  13.455  1.00 0.00 ? 27  LYS A O    2  
ATOM   6824   C CB   . LYS A 1 27  ? -6.831  15.727  11.183  1.00 0.00 ? 27  LYS A CB   2  
ATOM   6825   C CG   . LYS A 1 27  ? -7.639  17.022  11.066  1.00 0.00 ? 27  LYS A CG   2  
ATOM   6826   C CD   . LYS A 1 27  ? -8.988  16.718  10.409  1.00 0.00 ? 27  LYS A CD   2  
ATOM   6827   C CE   . LYS A 1 27  ? -9.801  18.005  10.276  1.00 0.00 ? 27  LYS A CE   2  
ATOM   6828   N NZ   . LYS A 1 27  ? -11.099 17.700  9.607   1.00 0.00 ? 27  LYS A NZ   2  
ATOM   6829   H H    . LYS A 1 27  ? -5.009  13.990  11.387  1.00 0.00 ? 27  LYS A H    2  
ATOM   6830   H HA   . LYS A 1 27  ? -4.968  16.778  11.186  1.00 0.00 ? 27  LYS A HA   2  
ATOM   6831   H HB2  . LYS A 1 27  ? -6.704  15.290  10.203  1.00 0.00 ? 27  LYS A HB2  2  
ATOM   6832   H HB3  . LYS A 1 27  ? -7.359  15.032  11.820  1.00 0.00 ? 27  LYS A HB3  2  
ATOM   6833   H HG2  . LYS A 1 27  ? -7.800  17.436  12.054  1.00 0.00 ? 27  LYS A HG2  2  
ATOM   6834   H HG3  . LYS A 1 27  ? -7.095  17.735  10.462  1.00 0.00 ? 27  LYS A HG3  2  
ATOM   6835   H HD2  . LYS A 1 27  ? -8.820  16.291  9.429   1.00 0.00 ? 27  LYS A HD2  2  
ATOM   6836   H HD3  . LYS A 1 27  ? -9.532  16.009  11.019  1.00 0.00 ? 27  LYS A HD3  2  
ATOM   6837   H HE2  . LYS A 1 27  ? -9.986  18.418  11.261  1.00 0.00 ? 27  LYS A HE2  2  
ATOM   6838   H HE3  . LYS A 1 27  ? -9.247  18.722  9.685   1.00 0.00 ? 27  LYS A HE3  2  
ATOM   6839   H HZ1  . LYS A 1 27  ? -10.921 17.235  8.694   1.00 0.00 ? 27  LYS A HZ1  2  
ATOM   6840   H HZ2  . LYS A 1 27  ? -11.664 17.069  10.216  1.00 0.00 ? 27  LYS A HZ2  2  
ATOM   6841   H HZ3  . LYS A 1 27  ? -11.623 18.585  9.445   1.00 0.00 ? 27  LYS A HZ3  2  
ATOM   6842   N N    . GLN A 1 28  ? -5.793  15.639  14.163  1.00 0.00 ? 28  GLN A N    2  
ATOM   6843   C CA   . GLN A 1 28  ? -5.905  16.027  15.567  1.00 0.00 ? 28  GLN A CA   2  
ATOM   6844   C C    . GLN A 1 28  ? -4.631  16.743  16.001  1.00 0.00 ? 28  GLN A C    2  
ATOM   6845   O O    . GLN A 1 28  ? -4.672  17.753  16.701  1.00 0.00 ? 28  GLN A O    2  
ATOM   6846   C CB   . GLN A 1 28  ? -6.115  14.786  16.438  1.00 0.00 ? 28  GLN A CB   2  
ATOM   6847   C CG   . GLN A 1 28  ? -7.484  14.175  16.139  1.00 0.00 ? 28  GLN A CG   2  
ATOM   6848   C CD   . GLN A 1 28  ? -8.588  15.141  16.557  1.00 0.00 ? 28  GLN A CD   2  
ATOM   6849   O OE1  . GLN A 1 28  ? -8.609  15.603  17.698  1.00 0.00 ? 28  GLN A OE1  2  
ATOM   6850   N NE2  . GLN A 1 28  ? -9.511  15.476  15.698  1.00 0.00 ? 28  GLN A NE2  2  
ATOM   6851   H H    . GLN A 1 28  ? -5.845  14.690  13.916  1.00 0.00 ? 28  GLN A H    2  
ATOM   6852   H HA   . GLN A 1 28  ? -6.748  16.691  15.691  1.00 0.00 ? 28  GLN A HA   2  
ATOM   6853   H HB2  . GLN A 1 28  ? -5.342  14.062  16.225  1.00 0.00 ? 28  GLN A HB2  2  
ATOM   6854   H HB3  . GLN A 1 28  ? -6.069  15.066  17.480  1.00 0.00 ? 28  GLN A HB3  2  
ATOM   6855   H HG2  . GLN A 1 28  ? -7.564  13.977  15.080  1.00 0.00 ? 28  GLN A HG2  2  
ATOM   6856   H HG3  . GLN A 1 28  ? -7.592  13.251  16.686  1.00 0.00 ? 28  GLN A HG3  2  
ATOM   6857   H HE21 . GLN A 1 28  ? -9.492  15.107  14.790  1.00 0.00 ? 28  GLN A HE21 2  
ATOM   6858   H HE22 . GLN A 1 28  ? -10.223 16.096  15.961  1.00 0.00 ? 28  GLN A HE22 2  
ATOM   6859   N N    . ALA A 1 29  ? -3.494  16.210  15.564  1.00 0.00 ? 29  ALA A N    2  
ATOM   6860   C CA   . ALA A 1 29  ? -2.200  16.799  15.901  1.00 0.00 ? 29  ALA A CA   2  
ATOM   6861   C C    . ALA A 1 29  ? -2.119  18.233  15.383  1.00 0.00 ? 29  ALA A C    2  
ATOM   6862   O O    . ALA A 1 29  ? -1.657  19.134  16.078  1.00 0.00 ? 29  ALA A O    2  
ATOM   6863   C CB   . ALA A 1 29  ? -1.067  15.961  15.298  1.00 0.00 ? 29  ALA A CB   2  
ATOM   6864   H H    . ALA A 1 29  ? -3.524  15.408  15.000  1.00 0.00 ? 29  ALA A H    2  
ATOM   6865   H HA   . ALA A 1 29  ? -2.090  16.814  16.976  1.00 0.00 ? 29  ALA A HA   2  
ATOM   6866   H HB1  . ALA A 1 29  ? -0.158  16.129  15.856  1.00 0.00 ? 29  ALA A HB1  2  
ATOM   6867   H HB2  . ALA A 1 29  ? -1.330  14.916  15.343  1.00 0.00 ? 29  ALA A HB2  2  
ATOM   6868   H HB3  . ALA A 1 29  ? -0.914  16.249  14.267  1.00 0.00 ? 29  ALA A HB3  2  
ATOM   6869   N N    . LYS A 1 30  ? -2.585  18.440  14.156  1.00 0.00 ? 30  LYS A N    2  
ATOM   6870   C CA   . LYS A 1 30  ? -2.568  19.778  13.570  1.00 0.00 ? 30  LYS A CA   2  
ATOM   6871   C C    . LYS A 1 30  ? -3.395  20.743  14.414  1.00 0.00 ? 30  LYS A C    2  
ATOM   6872   O O    . LYS A 1 30  ? -3.080  21.928  14.486  1.00 0.00 ? 30  LYS A O    2  
ATOM   6873   C CB   . LYS A 1 30  ? -3.123  19.752  12.141  1.00 0.00 ? 30  LYS A CB   2  
ATOM   6874   C CG   . LYS A 1 30  ? -2.153  19.014  11.218  1.00 0.00 ? 30  LYS A CG   2  
ATOM   6875   C CD   . LYS A 1 30  ? -2.677  19.090  9.781   1.00 0.00 ? 30  LYS A CD   2  
ATOM   6876   C CE   . LYS A 1 30  ? -1.709  18.374  8.838   1.00 0.00 ? 30  LYS A CE   2  
ATOM   6877   N NZ   . LYS A 1 30  ? -2.216  18.480  7.444   1.00 0.00 ? 30  LYS A NZ   2  
ATOM   6878   H H    . LYS A 1 30  ? -2.954  17.687  13.647  1.00 0.00 ? 30  LYS A H    2  
ATOM   6879   H HA   . LYS A 1 30  ? -1.551  20.131  13.543  1.00 0.00 ? 30  LYS A HA   2  
ATOM   6880   H HB2  . LYS A 1 30  ? -4.081  19.249  12.137  1.00 0.00 ? 30  LYS A HB2  2  
ATOM   6881   H HB3  . LYS A 1 30  ? -3.251  20.766  11.791  1.00 0.00 ? 30  LYS A HB3  2  
ATOM   6882   H HG2  . LYS A 1 30  ? -1.179  19.477  11.277  1.00 0.00 ? 30  LYS A HG2  2  
ATOM   6883   H HG3  . LYS A 1 30  ? -2.081  17.980  11.524  1.00 0.00 ? 30  LYS A HG3  2  
ATOM   6884   H HD2  . LYS A 1 30  ? -3.649  18.615  9.730   1.00 0.00 ? 30  LYS A HD2  2  
ATOM   6885   H HD3  . LYS A 1 30  ? -2.769  20.125  9.485   1.00 0.00 ? 30  LYS A HD3  2  
ATOM   6886   H HE2  . LYS A 1 30  ? -0.734  18.836  8.905   1.00 0.00 ? 30  LYS A HE2  2  
ATOM   6887   H HE3  . LYS A 1 30  ? -1.633  17.331  9.119   1.00 0.00 ? 30  LYS A HE3  2  
ATOM   6888   H HZ1  . LYS A 1 30  ? -2.507  19.462  7.244   1.00 0.00 ? 30  LYS A HZ1  2  
ATOM   6889   H HZ2  . LYS A 1 30  ? -1.461  18.201  6.776   1.00 0.00 ? 30  LYS A HZ2  2  
ATOM   6890   H HZ3  . LYS A 1 30  ? -3.028  17.844  7.317   1.00 0.00 ? 30  LYS A HZ3  2  
ATOM   6891   N N    . GLN A 1 31  ? -4.445  20.230  15.050  1.00 0.00 ? 31  GLN A N    2  
ATOM   6892   C CA   . GLN A 1 31  ? -5.295  21.069  15.887  1.00 0.00 ? 31  GLN A CA   2  
ATOM   6893   C C    . GLN A 1 31  ? -4.637  21.284  17.250  1.00 0.00 ? 31  GLN A C    2  
ATOM   6894   O O    . GLN A 1 31  ? -5.159  22.005  18.096  1.00 0.00 ? 31  GLN A O    2  
ATOM   6895   C CB   . GLN A 1 31  ? -6.677  20.427  16.063  1.00 0.00 ? 31  GLN A CB   2  
ATOM   6896   C CG   . GLN A 1 31  ? -7.229  19.948  14.699  1.00 0.00 ? 31  GLN A CG   2  
ATOM   6897   C CD   . GLN A 1 31  ? -8.688  20.367  14.523  1.00 0.00 ? 31  GLN A CD   2  
ATOM   6898   O OE1  . GLN A 1 31  ? -9.419  20.518  15.494  1.00 0.00 ? 31  GLN A OE1  2  
ATOM   6899   N NE2  . GLN A 1 31  ? -9.159  20.562  13.325  1.00 0.00 ? 31  GLN A NE2  2  
ATOM   6900   H H    . GLN A 1 31  ? -4.648  19.275  14.959  1.00 0.00 ? 31  GLN A H    2  
ATOM   6901   H HA   . GLN A 1 31  ? -5.415  22.030  15.410  1.00 0.00 ? 31  GLN A HA   2  
ATOM   6902   H HB2  . GLN A 1 31  ? -6.590  19.584  16.736  1.00 0.00 ? 31  GLN A HB2  2  
ATOM   6903   H HB3  . GLN A 1 31  ? -7.352  21.154  16.490  1.00 0.00 ? 31  GLN A HB3  2  
ATOM   6904   H HG2  . GLN A 1 31  ? -6.643  20.376  13.900  1.00 0.00 ? 31  GLN A HG2  2  
ATOM   6905   H HG3  . GLN A 1 31  ? -7.165  18.872  14.648  1.00 0.00 ? 31  GLN A HG3  2  
ATOM   6906   H HE21 . GLN A 1 31  ? -8.580  20.443  12.547  1.00 0.00 ? 31  GLN A HE21 2  
ATOM   6907   H HE22 . GLN A 1 31  ? -10.093 20.833  13.207  1.00 0.00 ? 31  GLN A HE22 2  
ATOM   6908   N N    . GLY A 1 32  ? -3.476  20.661  17.446  1.00 0.00 ? 32  GLY A N    2  
ATOM   6909   C CA   . GLY A 1 32  ? -2.741  20.797  18.703  1.00 0.00 ? 32  GLY A CA   2  
ATOM   6910   C C    . GLY A 1 32  ? -3.281  19.852  19.775  1.00 0.00 ? 32  GLY A C    2  
ATOM   6911   O O    . GLY A 1 32  ? -2.991  20.018  20.961  1.00 0.00 ? 32  GLY A O    2  
ATOM   6912   H H    . GLY A 1 32  ? -3.099  20.106  16.729  1.00 0.00 ? 32  GLY A H    2  
ATOM   6913   H HA2  . GLY A 1 32  ? -1.697  20.570  18.529  1.00 0.00 ? 32  GLY A HA2  2  
ATOM   6914   H HA3  . GLY A 1 32  ? -2.826  21.813  19.053  1.00 0.00 ? 32  GLY A HA3  2  
ATOM   6915   N N    . ASP A 1 33  ? -4.056  18.855  19.353  1.00 0.00 ? 33  ASP A N    2  
ATOM   6916   C CA   . ASP A 1 33  ? -4.626  17.883  20.282  1.00 0.00 ? 33  ASP A CA   2  
ATOM   6917   C C    . ASP A 1 33  ? -3.778  16.614  20.313  1.00 0.00 ? 33  ASP A C    2  
ATOM   6918   O O    . ASP A 1 33  ? -4.093  15.621  19.648  1.00 0.00 ? 33  ASP A O    2  
ATOM   6919   C CB   . ASP A 1 33  ? -6.054  17.541  19.853  1.00 0.00 ? 33  ASP A CB   2  
ATOM   6920   C CG   . ASP A 1 33  ? -6.978  18.726  20.105  1.00 0.00 ? 33  ASP A CG   2  
ATOM   6921   O OD1  . ASP A 1 33  ? -6.549  19.659  20.760  1.00 0.00 ? 33  ASP A OD1  2  
ATOM   6922   O OD2  . ASP A 1 33  ? -8.104  18.673  19.650  1.00 0.00 ? 33  ASP A OD2  2  
ATOM   6923   H H    . ASP A 1 33  ? -4.247  18.772  18.395  1.00 0.00 ? 33  ASP A H    2  
ATOM   6924   H HA   . ASP A 1 33  ? -4.654  18.315  21.275  1.00 0.00 ? 33  ASP A HA   2  
ATOM   6925   H HB2  . ASP A 1 33  ? -6.063  17.302  18.800  1.00 0.00 ? 33  ASP A HB2  2  
ATOM   6926   H HB3  . ASP A 1 33  ? -6.406  16.692  20.417  1.00 0.00 ? 33  ASP A HB3  2  
ATOM   6927   N N    . PHE A 1 34  ? -2.694  16.647  21.078  1.00 0.00 ? 34  PHE A N    2  
ATOM   6928   C CA   . PHE A 1 34  ? -1.800  15.494  21.172  1.00 0.00 ? 34  PHE A CA   2  
ATOM   6929   C C    . PHE A 1 34  ? -2.483  14.295  21.823  1.00 0.00 ? 34  PHE A C    2  
ATOM   6930   O O    . PHE A 1 34  ? -2.212  13.149  21.465  1.00 0.00 ? 34  PHE A O    2  
ATOM   6931   C CB   . PHE A 1 34  ? -0.562  15.854  21.992  1.00 0.00 ? 34  PHE A CB   2  
ATOM   6932   C CG   . PHE A 1 34  ? 0.221   16.936  21.294  1.00 0.00 ? 34  PHE A CG   2  
ATOM   6933   C CD1  . PHE A 1 34  ? 0.348   18.200  21.880  1.00 0.00 ? 34  PHE A CD1  2  
ATOM   6934   C CD2  . PHE A 1 34  ? 0.815   16.676  20.053  1.00 0.00 ? 34  PHE A CD2  2  
ATOM   6935   C CE1  . PHE A 1 34  ? 1.082   19.199  21.232  1.00 0.00 ? 34  PHE A CE1  2  
ATOM   6936   C CE2  . PHE A 1 34  ? 1.547   17.676  19.406  1.00 0.00 ? 34  PHE A CE2  2  
ATOM   6937   C CZ   . PHE A 1 34  ? 1.673   18.937  19.993  1.00 0.00 ? 34  PHE A CZ   2  
ATOM   6938   H H    . PHE A 1 34  ? -2.485  17.466  21.578  1.00 0.00 ? 34  PHE A H    2  
ATOM   6939   H HA   . PHE A 1 34  ? -1.485  15.217  20.177  1.00 0.00 ? 34  PHE A HA   2  
ATOM   6940   H HB2  . PHE A 1 34  ? -0.865  16.203  22.970  1.00 0.00 ? 34  PHE A HB2  2  
ATOM   6941   H HB3  . PHE A 1 34  ? 0.063   14.980  22.102  1.00 0.00 ? 34  PHE A HB3  2  
ATOM   6942   H HD1  . PHE A 1 34  ? -0.110  18.406  22.836  1.00 0.00 ? 34  PHE A HD1  2  
ATOM   6943   H HD2  . PHE A 1 34  ? 0.718   15.702  19.601  1.00 0.00 ? 34  PHE A HD2  2  
ATOM   6944   H HE1  . PHE A 1 34  ? 1.183   20.177  21.680  1.00 0.00 ? 34  PHE A HE1  2  
ATOM   6945   H HE2  . PHE A 1 34  ? 2.006   17.476  18.450  1.00 0.00 ? 34  PHE A HE2  2  
ATOM   6946   H HZ   . PHE A 1 34  ? 2.240   19.711  19.494  1.00 0.00 ? 34  PHE A HZ   2  
ATOM   6947   N N    . ALA A 1 35  ? -3.354  14.563  22.792  1.00 0.00 ? 35  ALA A N    2  
ATOM   6948   C CA   . ALA A 1 35  ? -4.044  13.490  23.503  1.00 0.00 ? 35  ALA A CA   2  
ATOM   6949   C C    . ALA A 1 35  ? -4.917  12.678  22.549  1.00 0.00 ? 35  ALA A C    2  
ATOM   6950   O O    . ALA A 1 35  ? -4.839  11.449  22.515  1.00 0.00 ? 35  ALA A O    2  
ATOM   6951   C CB   . ALA A 1 35  ? -4.902  14.087  24.626  1.00 0.00 ? 35  ALA A CB   2  
ATOM   6952   H H    . ALA A 1 35  ? -3.521  15.494  23.042  1.00 0.00 ? 35  ALA A H    2  
ATOM   6953   H HA   . ALA A 1 35  ? -3.306  12.832  23.939  1.00 0.00 ? 35  ALA A HA   2  
ATOM   6954   H HB1  . ALA A 1 35  ? -5.231  15.075  24.343  1.00 0.00 ? 35  ALA A HB1  2  
ATOM   6955   H HB2  . ALA A 1 35  ? -4.315  14.152  25.533  1.00 0.00 ? 35  ALA A HB2  2  
ATOM   6956   H HB3  . ALA A 1 35  ? -5.763  13.457  24.800  1.00 0.00 ? 35  ALA A HB3  2  
ATOM   6957   N N    . ALA A 1 36  ? -5.744  13.370  21.777  1.00 0.00 ? 36  ALA A N    2  
ATOM   6958   C CA   . ALA A 1 36  ? -6.624  12.693  20.835  1.00 0.00 ? 36  ALA A CA   2  
ATOM   6959   C C    . ALA A 1 36  ? -5.805  12.006  19.744  1.00 0.00 ? 36  ALA A C    2  
ATOM   6960   O O    . ALA A 1 36  ? -6.127  10.897  19.319  1.00 0.00 ? 36  ALA A O    2  
ATOM   6961   C CB   . ALA A 1 36  ? -7.622  13.697  20.228  1.00 0.00 ? 36  ALA A CB   2  
ATOM   6962   H H    . ALA A 1 36  ? -5.760  14.347  21.842  1.00 0.00 ? 36  ALA A H    2  
ATOM   6963   H HA   . ALA A 1 36  ? -7.175  11.934  21.367  1.00 0.00 ? 36  ALA A HA   2  
ATOM   6964   H HB1  . ALA A 1 36  ? -8.632  13.356  20.413  1.00 0.00 ? 36  ALA A HB1  2  
ATOM   6965   H HB2  . ALA A 1 36  ? -7.485  14.665  20.686  1.00 0.00 ? 36  ALA A HB2  2  
ATOM   6966   H HB3  . ALA A 1 36  ? -7.462  13.777  19.162  1.00 0.00 ? 36  ALA A HB3  2  
ATOM   6967   N N    . ALA A 1 37  ? -4.730  12.650  19.313  1.00 0.00 ? 37  ALA A N    2  
ATOM   6968   C CA   . ALA A 1 37  ? -3.879  12.056  18.290  1.00 0.00 ? 37  ALA A CA   2  
ATOM   6969   C C    . ALA A 1 37  ? -3.343  10.715  18.790  1.00 0.00 ? 37  ALA A C    2  
ATOM   6970   O O    . ALA A 1 37  ? -3.468  9.692   18.114  1.00 0.00 ? 37  ALA A O    2  
ATOM   6971   C CB   . ALA A 1 37  ? -2.716  13.003  17.951  1.00 0.00 ? 37  ALA A CB   2  
ATOM   6972   H H    . ALA A 1 37  ? -4.497  13.523  19.695  1.00 0.00 ? 37  ALA A H    2  
ATOM   6973   H HA   . ALA A 1 37  ? -4.465  11.887  17.398  1.00 0.00 ? 37  ALA A HA   2  
ATOM   6974   H HB1  . ALA A 1 37  ? -1.849  12.426  17.658  1.00 0.00 ? 37  ALA A HB1  2  
ATOM   6975   H HB2  . ALA A 1 37  ? -3.004  13.655  17.138  1.00 0.00 ? 37  ALA A HB2  2  
ATOM   6976   H HB3  . ALA A 1 37  ? -2.471  13.600  18.817  1.00 0.00 ? 37  ALA A HB3  2  
ATOM   6977   N N    . LYS A 1 38  ? -2.758  10.733  19.983  1.00 0.00 ? 38  LYS A N    2  
ATOM   6978   C CA   . LYS A 1 38  ? -2.200  9.525   20.591  1.00 0.00 ? 38  LYS A CA   2  
ATOM   6979   C C    . LYS A 1 38  ? -3.246  8.406   20.668  1.00 0.00 ? 38  LYS A C    2  
ATOM   6980   O O    . LYS A 1 38  ? -2.967  7.258   20.320  1.00 0.00 ? 38  LYS A O    2  
ATOM   6981   C CB   . LYS A 1 38  ? -1.676  9.873   22.001  1.00 0.00 ? 38  LYS A CB   2  
ATOM   6982   C CG   . LYS A 1 38  ? -0.235  9.378   22.198  1.00 0.00 ? 38  LYS A CG   2  
ATOM   6983   C CD   . LYS A 1 38  ? 0.302   9.914   23.534  1.00 0.00 ? 38  LYS A CD   2  
ATOM   6984   C CE   . LYS A 1 38  ? 1.544   9.127   23.957  1.00 0.00 ? 38  LYS A CE   2  
ATOM   6985   N NZ   . LYS A 1 38  ? 2.615   9.295   22.932  1.00 0.00 ? 38  LYS A NZ   2  
ATOM   6986   H H    . LYS A 1 38  ? -2.703  11.582  20.474  1.00 0.00 ? 38  LYS A H    2  
ATOM   6987   H HA   . LYS A 1 38  ? -1.377  9.183   19.983  1.00 0.00 ? 38  LYS A HA   2  
ATOM   6988   H HB2  . LYS A 1 38  ? -1.698  10.946  22.129  1.00 0.00 ? 38  LYS A HB2  2  
ATOM   6989   H HB3  . LYS A 1 38  ? -2.316  9.416   22.746  1.00 0.00 ? 38  LYS A HB3  2  
ATOM   6990   H HG2  . LYS A 1 38  ? -0.222  8.296   22.207  1.00 0.00 ? 38  LYS A HG2  2  
ATOM   6991   H HG3  . LYS A 1 38  ? 0.385   9.742   21.392  1.00 0.00 ? 38  LYS A HG3  2  
ATOM   6992   H HD2  . LYS A 1 38  ? 0.556   10.961  23.427  1.00 0.00 ? 38  LYS A HD2  2  
ATOM   6993   H HD3  . LYS A 1 38  ? -0.461  9.810   24.296  1.00 0.00 ? 38  LYS A HD3  2  
ATOM   6994   H HE2  . LYS A 1 38  ? 1.895   9.496   24.912  1.00 0.00 ? 38  LYS A HE2  2  
ATOM   6995   H HE3  . LYS A 1 38  ? 1.291   8.079   24.049  1.00 0.00 ? 38  LYS A HE3  2  
ATOM   6996   H HZ1  . LYS A 1 38  ? 2.464   10.186  22.411  1.00 0.00 ? 38  LYS A HZ1  2  
ATOM   6997   H HZ2  . LYS A 1 38  ? 3.545   9.327   23.401  1.00 0.00 ? 38  LYS A HZ2  2  
ATOM   6998   H HZ3  . LYS A 1 38  ? 2.589   8.498   22.266  1.00 0.00 ? 38  LYS A HZ3  2  
ATOM   6999   N N    . ALA A 1 39  ? -4.446  8.745   21.129  1.00 0.00 ? 39  ALA A N    2  
ATOM   7000   C CA   . ALA A 1 39  ? -5.514  7.755   21.254  1.00 0.00 ? 39  ALA A CA   2  
ATOM   7001   C C    . ALA A 1 39  ? -5.888  7.164   19.896  1.00 0.00 ? 39  ALA A C    2  
ATOM   7002   O O    . ALA A 1 39  ? -6.119  5.960   19.768  1.00 0.00 ? 39  ALA A O    2  
ATOM   7003   C CB   . ALA A 1 39  ? -6.748  8.405   21.894  1.00 0.00 ? 39  ALA A CB   2  
ATOM   7004   H H    . ALA A 1 39  ? -4.614  9.676   21.390  1.00 0.00 ? 39  ALA A H    2  
ATOM   7005   H HA   . ALA A 1 39  ? -5.172  6.957   21.896  1.00 0.00 ? 39  ALA A HA   2  
ATOM   7006   H HB1  . ALA A 1 39  ? -7.349  7.643   22.369  1.00 0.00 ? 39  ALA A HB1  2  
ATOM   7007   H HB2  . ALA A 1 39  ? -6.433  9.128   22.631  1.00 0.00 ? 39  ALA A HB2  2  
ATOM   7008   H HB3  . ALA A 1 39  ? -7.333  8.900   21.131  1.00 0.00 ? 39  ALA A HB3  2  
ATOM   7009   N N    . MET A 1 40  ? -5.951  8.022   18.887  1.00 0.00 ? 40  MET A N    2  
ATOM   7010   C CA   . MET A 1 40  ? -6.307  7.581   17.540  1.00 0.00 ? 40  MET A CA   2  
ATOM   7011   C C    . MET A 1 40  ? -5.237  6.652   16.963  1.00 0.00 ? 40  MET A C    2  
ATOM   7012   O O    . MET A 1 40  ? -5.559  5.644   16.327  1.00 0.00 ? 40  MET A O    2  
ATOM   7013   C CB   . MET A 1 40  ? -6.508  8.800   16.634  1.00 0.00 ? 40  MET A CB   2  
ATOM   7014   C CG   . MET A 1 40  ? -7.737  9.589   17.104  1.00 0.00 ? 40  MET A CG   2  
ATOM   7015   S SD   . MET A 1 40  ? -9.246  8.686   16.682  1.00 0.00 ? 40  MET A SD   2  
ATOM   7016   C CE   . MET A 1 40  ? -9.436  9.338   15.007  1.00 0.00 ? 40  MET A CE   2  
ATOM   7017   H H    . MET A 1 40  ? -5.762  8.969   19.050  1.00 0.00 ? 40  MET A H    2  
ATOM   7018   H HA   . MET A 1 40  ? -7.239  7.036   17.591  1.00 0.00 ? 40  MET A HA   2  
ATOM   7019   H HB2  . MET A 1 40  ? -5.632  9.432   16.684  1.00 0.00 ? 40  MET A HB2  2  
ATOM   7020   H HB3  . MET A 1 40  ? -6.659  8.472   15.616  1.00 0.00 ? 40  MET A HB3  2  
ATOM   7021   H HG2  . MET A 1 40  ? -7.691  9.721   18.175  1.00 0.00 ? 40  MET A HG2  2  
ATOM   7022   H HG3  . MET A 1 40  ? -7.751  10.555  16.624  1.00 0.00 ? 40  MET A HG3  2  
ATOM   7023   H HE1  . MET A 1 40  ? -9.501  10.417  15.048  1.00 0.00 ? 40  MET A HE1  2  
ATOM   7024   H HE2  . MET A 1 40  ? -8.584  9.052   14.413  1.00 0.00 ? 40  MET A HE2  2  
ATOM   7025   H HE3  . MET A 1 40  ? -10.336 8.934   14.564  1.00 0.00 ? 40  MET A HE3  2  
ATOM   7026   N N    . MET A 1 41  ? -3.965  6.972   17.189  1.00 0.00 ? 41  MET A N    2  
ATOM   7027   C CA   . MET A 1 41  ? -2.889  6.117   16.679  1.00 0.00 ? 41  MET A CA   2  
ATOM   7028   C C    . MET A 1 41  ? -2.960  4.735   17.311  1.00 0.00 ? 41  MET A C    2  
ATOM   7029   O O    . MET A 1 41  ? -2.743  3.721   16.639  1.00 0.00 ? 41  MET A O    2  
ATOM   7030   C CB   . MET A 1 41  ? -1.503  6.684   17.005  1.00 0.00 ? 41  MET A CB   2  
ATOM   7031   C CG   . MET A 1 41  ? -1.337  8.107   16.464  1.00 0.00 ? 41  MET A CG   2  
ATOM   7032   S SD   . MET A 1 41  ? 0.414   8.421   16.097  1.00 0.00 ? 41  MET A SD   2  
ATOM   7033   C CE   . MET A 1 41  ? 1.117   7.788   17.642  1.00 0.00 ? 41  MET A CE   2  
ATOM   7034   H H    . MET A 1 41  ? -3.748  7.776   17.709  1.00 0.00 ? 41  MET A H    2  
ATOM   7035   H HA   . MET A 1 41  ? -2.991  6.022   15.608  1.00 0.00 ? 41  MET A HA   2  
ATOM   7036   H HB2  . MET A 1 41  ? -1.372  6.691   18.079  1.00 0.00 ? 41  MET A HB2  2  
ATOM   7037   H HB3  . MET A 1 41  ? -0.756  6.043   16.563  1.00 0.00 ? 41  MET A HB3  2  
ATOM   7038   H HG2  . MET A 1 41  ? -1.916  8.224   15.560  1.00 0.00 ? 41  MET A HG2  2  
ATOM   7039   H HG3  . MET A 1 41  ? -1.678  8.813   17.204  1.00 0.00 ? 41  MET A HG3  2  
ATOM   7040   H HE1  . MET A 1 41  ? 0.454   8.010   18.461  1.00 0.00 ? 41  MET A HE1  2  
ATOM   7041   H HE2  . MET A 1 41  ? 1.243   6.717   17.562  1.00 0.00 ? 41  MET A HE2  2  
ATOM   7042   H HE3  . MET A 1 41  ? 2.076   8.256   17.816  1.00 0.00 ? 41  MET A HE3  2  
ATOM   7043   N N    . ASP A 1 42  ? -3.230  4.707   18.610  1.00 0.00 ? 42  ASP A N    2  
ATOM   7044   C CA   . ASP A 1 42  ? -3.288  3.449   19.342  1.00 0.00 ? 42  ASP A CA   2  
ATOM   7045   C C    . ASP A 1 42  ? -4.363  2.543   18.752  1.00 0.00 ? 42  ASP A C    2  
ATOM   7046   O O    . ASP A 1 42  ? -4.122  1.362   18.475  1.00 0.00 ? 42  ASP A O    2  
ATOM   7047   C CB   . ASP A 1 42  ? -3.570  3.731   20.826  1.00 0.00 ? 42  ASP A CB   2  
ATOM   7048   C CG   . ASP A 1 42  ? -2.868  2.705   21.714  1.00 0.00 ? 42  ASP A CG   2  
ATOM   7049   O OD1  . ASP A 1 42  ? -1.718  2.399   21.441  1.00 0.00 ? 42  ASP A OD1  2  
ATOM   7050   O OD2  . ASP A 1 42  ? -3.490  2.248   22.656  1.00 0.00 ? 42  ASP A OD2  2  
ATOM   7051   H H    . ASP A 1 42  ? -3.371  5.549   19.095  1.00 0.00 ? 42  ASP A H    2  
ATOM   7052   H HA   . ASP A 1 42  ? -2.332  2.956   19.254  1.00 0.00 ? 42  ASP A HA   2  
ATOM   7053   H HB2  . ASP A 1 42  ? -3.206  4.715   21.077  1.00 0.00 ? 42  ASP A HB2  2  
ATOM   7054   H HB3  . ASP A 1 42  ? -4.632  3.688   21.007  1.00 0.00 ? 42  ASP A HB3  2  
ATOM   7055   N N    . GLN A 1 43  ? -5.541  3.108   18.537  1.00 0.00 ? 43  GLN A N    2  
ATOM   7056   C CA   . GLN A 1 43  ? -6.641  2.344   17.959  1.00 0.00 ? 43  GLN A CA   2  
ATOM   7057   C C    . GLN A 1 43  ? -6.296  1.902   16.545  1.00 0.00 ? 43  GLN A C    2  
ATOM   7058   O O    . GLN A 1 43  ? -6.574  0.765   16.152  1.00 0.00 ? 43  GLN A O    2  
ATOM   7059   C CB   . GLN A 1 43  ? -7.921  3.180   17.940  1.00 0.00 ? 43  GLN A CB   2  
ATOM   7060   C CG   . GLN A 1 43  ? -8.376  3.448   19.376  1.00 0.00 ? 43  GLN A CG   2  
ATOM   7061   C CD   . GLN A 1 43  ? -9.765  4.069   19.382  1.00 0.00 ? 43  GLN A CD   2  
ATOM   7062   O OE1  . GLN A 1 43  ? -10.358 4.284   18.330  1.00 0.00 ? 43  GLN A OE1  2  
ATOM   7063   N NE2  . GLN A 1 43  ? -10.326 4.372   20.514  1.00 0.00 ? 43  GLN A NE2  2  
ATOM   7064   H H    . GLN A 1 43  ? -5.668  4.056   18.758  1.00 0.00 ? 43  GLN A H    2  
ATOM   7065   H HA   . GLN A 1 43  ? -6.808  1.467   18.564  1.00 0.00 ? 43  GLN A HA   2  
ATOM   7066   H HB2  . GLN A 1 43  ? -7.736  4.118   17.436  1.00 0.00 ? 43  GLN A HB2  2  
ATOM   7067   H HB3  . GLN A 1 43  ? -8.697  2.637   17.415  1.00 0.00 ? 43  GLN A HB3  2  
ATOM   7068   H HG2  . GLN A 1 43  ? -8.400  2.517   19.923  1.00 0.00 ? 43  GLN A HG2  2  
ATOM   7069   H HG3  . GLN A 1 43  ? -7.678  4.123   19.850  1.00 0.00 ? 43  GLN A HG3  2  
ATOM   7070   H HE21 . GLN A 1 43  ? -9.856  4.200   21.353  1.00 0.00 ? 43  GLN A HE21 2  
ATOM   7071   H HE22 . GLN A 1 43  ? -11.218 4.773   20.523  1.00 0.00 ? 43  GLN A HE22 2  
ATOM   7072   N N    . SER A 1 44  ? -5.679  2.795   15.784  1.00 0.00 ? 44  SER A N    2  
ATOM   7073   C CA   . SER A 1 44  ? -5.289  2.470   14.419  1.00 0.00 ? 44  SER A CA   2  
ATOM   7074   C C    . SER A 1 44  ? -4.325  1.277   14.426  1.00 0.00 ? 44  SER A C    2  
ATOM   7075   O O    . SER A 1 44  ? -4.475  0.334   13.649  1.00 0.00 ? 44  SER A O    2  
ATOM   7076   C CB   . SER A 1 44  ? -4.644  3.692   13.762  1.00 0.00 ? 44  SER A CB   2  
ATOM   7077   O OG   . SER A 1 44  ? -5.110  3.801   12.424  1.00 0.00 ? 44  SER A OG   2  
ATOM   7078   H H    . SER A 1 44  ? -5.473  3.682   16.151  1.00 0.00 ? 44  SER A H    2  
ATOM   7079   H HA   . SER A 1 44  ? -6.175  2.197   13.863  1.00 0.00 ? 44  SER A HA   2  
ATOM   7080   H HB2  . SER A 1 44  ? -4.921  4.582   14.305  1.00 0.00 ? 44  SER A HB2  2  
ATOM   7081   H HB3  . SER A 1 44  ? -3.567  3.588   13.773  1.00 0.00 ? 44  SER A HB3  2  
ATOM   7082   H HG   . SER A 1 44  ? -4.682  4.558   12.011  1.00 0.00 ? 44  SER A HG   2  
ATOM   7083   N N    . ARG A 1 45  ? -3.347  1.319   15.333  1.00 0.00 ? 45  ARG A N    2  
ATOM   7084   C CA   . ARG A 1 45  ? -2.369  0.237   15.476  1.00 0.00 ? 45  ARG A CA   2  
ATOM   7085   C C    . ARG A 1 45  ? -3.063  -1.093  15.790  1.00 0.00 ? 45  ARG A C    2  
ATOM   7086   O O    . ARG A 1 45  ? -2.745  -2.132  15.206  1.00 0.00 ? 45  ARG A O    2  
ATOM   7087   C CB   . ARG A 1 45  ? -1.405  0.593   16.616  1.00 0.00 ? 45  ARG A CB   2  
ATOM   7088   C CG   . ARG A 1 45  ? -0.287  -0.457  16.738  1.00 0.00 ? 45  ARG A CG   2  
ATOM   7089   C CD   . ARG A 1 45  ? 0.648   -0.105  17.915  1.00 0.00 ? 45  ARG A CD   2  
ATOM   7090   N NE   . ARG A 1 45  ? 1.778   -1.047  17.936  1.00 0.00 ? 45  ARG A NE   2  
ATOM   7091   C CZ   . ARG A 1 45  ? 2.769   -0.965  18.815  1.00 0.00 ? 45  ARG A CZ   2  
ATOM   7092   N NH1  . ARG A 1 45  ? 2.822   0.012   19.656  1.00 0.00 ? 45  ARG A NH1  2  
ATOM   7093   N NH2  . ARG A 1 45  ? 3.727   -1.843  18.779  1.00 0.00 ? 45  ARG A NH2  2  
ATOM   7094   H H    . ARG A 1 45  ? -3.295  2.088   15.940  1.00 0.00 ? 45  ARG A H    2  
ATOM   7095   H HA   . ARG A 1 45  ? -1.814  0.136   14.556  1.00 0.00 ? 45  ARG A HA   2  
ATOM   7096   H HB2  . ARG A 1 45  ? -0.972  1.558   16.424  1.00 0.00 ? 45  ARG A HB2  2  
ATOM   7097   H HB3  . ARG A 1 45  ? -1.960  0.627   17.545  1.00 0.00 ? 45  ARG A HB3  2  
ATOM   7098   H HG2  . ARG A 1 45  ? -0.727  -1.430  16.901  1.00 0.00 ? 45  ARG A HG2  2  
ATOM   7099   H HG3  . ARG A 1 45  ? 0.286   -0.474  15.822  1.00 0.00 ? 45  ARG A HG3  2  
ATOM   7100   H HD2  . ARG A 1 45  ? 1.021   0.908   17.777  1.00 0.00 ? 45  ARG A HD2  2  
ATOM   7101   H HD3  . ARG A 1 45  ? 0.101   -0.168  18.851  1.00 0.00 ? 45  ARG A HD3  2  
ATOM   7102   H HE   . ARG A 1 45  ? 1.801   -1.762  17.269  1.00 0.00 ? 45  ARG A HE   2  
ATOM   7103   H HH11 . ARG A 1 45  ? 2.103   0.705   19.658  1.00 0.00 ? 45  ARG A HH11 2  
ATOM   7104   H HH12 . ARG A 1 45  ? 3.570   0.069   20.312  1.00 0.00 ? 45  ARG A HH12 2  
ATOM   7105   H HH21 . ARG A 1 45  ? 3.703   -2.582  18.104  1.00 0.00 ? 45  ARG A HH21 2  
ATOM   7106   H HH22 . ARG A 1 45  ? 4.476   -1.795  19.434  1.00 0.00 ? 45  ARG A HH22 2  
ATOM   7107   N N    . MET A 1 46  ? -4.005  -1.046  16.727  1.00 0.00 ? 46  MET A N    2  
ATOM   7108   C CA   . MET A 1 46  ? -4.741  -2.242  17.132  1.00 0.00 ? 46  MET A CA   2  
ATOM   7109   C C    . MET A 1 46  ? -5.520  -2.812  15.944  1.00 0.00 ? 46  MET A C    2  
ATOM   7110   O O    . MET A 1 46  ? -5.550  -4.027  15.730  1.00 0.00 ? 46  MET A O    2  
ATOM   7111   C CB   . MET A 1 46  ? -5.688  -1.906  18.289  1.00 0.00 ? 46  MET A CB   2  
ATOM   7112   C CG   . MET A 1 46  ? -4.856  -1.521  19.517  1.00 0.00 ? 46  MET A CG   2  
ATOM   7113   S SD   . MET A 1 46  ? -5.934  -0.872  20.826  1.00 0.00 ? 46  MET A SD   2  
ATOM   7114   C CE   . MET A 1 46  ? -6.599  -2.440  21.446  1.00 0.00 ? 46  MET A CE   2  
ATOM   7115   H H    . MET A 1 46  ? -4.208  -0.188  17.159  1.00 0.00 ? 46  MET A H    2  
ATOM   7116   H HA   . MET A 1 46  ? -4.037  -2.987  17.465  1.00 0.00 ? 46  MET A HA   2  
ATOM   7117   H HB2  . MET A 1 46  ? -6.322  -1.077  18.007  1.00 0.00 ? 46  MET A HB2  2  
ATOM   7118   H HB3  . MET A 1 46  ? -6.297  -2.766  18.523  1.00 0.00 ? 46  MET A HB3  2  
ATOM   7119   H HG2  . MET A 1 46  ? -4.331  -2.392  19.880  1.00 0.00 ? 46  MET A HG2  2  
ATOM   7120   H HG3  . MET A 1 46  ? -4.136  -0.767  19.239  1.00 0.00 ? 46  MET A HG3  2  
ATOM   7121   H HE1  . MET A 1 46  ? -5.911  -3.242  21.228  1.00 0.00 ? 46  MET A HE1  2  
ATOM   7122   H HE2  . MET A 1 46  ? -6.744  -2.366  22.515  1.00 0.00 ? 46  MET A HE2  2  
ATOM   7123   H HE3  . MET A 1 46  ? -7.544  -2.644  20.974  1.00 0.00 ? 46  MET A HE3  2  
ATOM   7124   N N    . ALA A 1 47  ? -6.133  -1.928  15.164  1.00 0.00 ? 47  ALA A N    2  
ATOM   7125   C CA   . ALA A 1 47  ? -6.893  -2.354  13.990  1.00 0.00 ? 47  ALA A CA   2  
ATOM   7126   C C    . ALA A 1 47  ? -5.987  -3.093  13.007  1.00 0.00 ? 47  ALA A C    2  
ATOM   7127   O O    . ALA A 1 47  ? -6.349  -4.141  12.467  1.00 0.00 ? 47  ALA A O    2  
ATOM   7128   C CB   . ALA A 1 47  ? -7.526  -1.139  13.305  1.00 0.00 ? 47  ALA A CB   2  
ATOM   7129   H H    . ALA A 1 47  ? -6.061  -0.972  15.373  1.00 0.00 ? 47  ALA A H    2  
ATOM   7130   H HA   . ALA A 1 47  ? -7.678  -3.024  14.308  1.00 0.00 ? 47  ALA A HA   2  
ATOM   7131   H HB1  . ALA A 1 47  ? -7.872  -1.420  12.321  1.00 0.00 ? 47  ALA A HB1  2  
ATOM   7132   H HB2  . ALA A 1 47  ? -6.792  -0.351  13.217  1.00 0.00 ? 47  ALA A HB2  2  
ATOM   7133   H HB3  . ALA A 1 47  ? -8.360  -0.787  13.893  1.00 0.00 ? 47  ALA A HB3  2  
ATOM   7134   N N    . LEU A 1 48  ? -4.797  -2.545  12.790  1.00 0.00 ? 48  LEU A N    2  
ATOM   7135   C CA   . LEU A 1 48  ? -3.828  -3.154  11.880  1.00 0.00 ? 48  LEU A CA   2  
ATOM   7136   C C    . LEU A 1 48  ? -3.338  -4.486  12.425  1.00 0.00 ? 48  LEU A C    2  
ATOM   7137   O O    . LEU A 1 48  ? -3.164  -5.452  11.680  1.00 0.00 ? 48  LEU A O    2  
ATOM   7138   C CB   . LEU A 1 48  ? -2.616  -2.244  11.735  1.00 0.00 ? 48  LEU A CB   2  
ATOM   7139   C CG   . LEU A 1 48  ? -3.010  -0.940  11.051  1.00 0.00 ? 48  LEU A CG   2  
ATOM   7140   C CD1  . LEU A 1 48  ? -1.848  0.042   11.178  1.00 0.00 ? 48  LEU A CD1  2  
ATOM   7141   C CD2  . LEU A 1 48  ? -3.326  -1.186  9.566   1.00 0.00 ? 48  LEU A CD2  2  
ATOM   7142   H H    . LEU A 1 48  ? -4.561  -1.713  13.255  1.00 0.00 ? 48  LEU A H    2  
ATOM   7143   H HA   . LEU A 1 48  ? -4.281  -3.303  10.913  1.00 0.00 ? 48  LEU A HA   2  
ATOM   7144   H HB2  . LEU A 1 48  ? -2.223  -2.024  12.720  1.00 0.00 ? 48  LEU A HB2  2  
ATOM   7145   H HB3  . LEU A 1 48  ? -1.855  -2.744  11.152  1.00 0.00 ? 48  LEU A HB3  2  
ATOM   7146   H HG   . LEU A 1 48  ? -3.879  -0.527  11.544  1.00 0.00 ? 48  LEU A HG   2  
ATOM   7147   H HD11 . LEU A 1 48  ? -0.935  -0.443  10.864  1.00 0.00 ? 48  LEU A HD11 2  
ATOM   7148   H HD12 . LEU A 1 48  ? -2.033  0.903   10.556  1.00 0.00 ? 48  LEU A HD12 2  
ATOM   7149   H HD13 . LEU A 1 48  ? -1.757  0.349   12.208  1.00 0.00 ? 48  LEU A HD13 2  
ATOM   7150   H HD21 . LEU A 1 48  ? -2.669  -1.947  9.172   1.00 0.00 ? 48  LEU A HD21 2  
ATOM   7151   H HD22 . LEU A 1 48  ? -4.352  -1.512  9.468   1.00 0.00 ? 48  LEU A HD22 2  
ATOM   7152   H HD23 . LEU A 1 48  ? -3.188  -0.267  9.013   1.00 0.00 ? 48  LEU A HD23 2  
ATOM   7153   N N    . ASN A 1 49  ? -3.086  -4.511  13.724  1.00 0.00 ? 49  ASN A N    2  
ATOM   7154   C CA   . ASN A 1 49  ? -2.582  -5.710  14.371  1.00 0.00 ? 49  ASN A CA   2  
ATOM   7155   C C    . ASN A 1 49  ? -3.550  -6.868  14.149  1.00 0.00 ? 49  ASN A C    2  
ATOM   7156   O O    . ASN A 1 49  ? -3.146  -7.973  13.783  1.00 0.00 ? 49  ASN A O    2  
ATOM   7157   C CB   . ASN A 1 49  ? -2.383  -5.466  15.868  1.00 0.00 ? 49  ASN A CB   2  
ATOM   7158   C CG   . ASN A 1 49  ? -1.869  -6.737  16.536  1.00 0.00 ? 49  ASN A CG   2  
ATOM   7159   O OD1  . ASN A 1 49  ? -2.091  -7.837  16.030  1.00 0.00 ? 49  ASN A OD1  2  
ATOM   7160   N ND2  . ASN A 1 49  ? -1.188  -6.652  17.645  1.00 0.00 ? 49  ASN A ND2  2  
ATOM   7161   H H    . ASN A 1 49  ? -3.233  -3.701  14.258  1.00 0.00 ? 49  ASN A H    2  
ATOM   7162   H HA   . ASN A 1 49  ? -1.631  -5.964  13.926  1.00 0.00 ? 49  ASN A HA   2  
ATOM   7163   H HB2  . ASN A 1 49  ? -1.665  -4.671  16.010  1.00 0.00 ? 49  ASN A HB2  2  
ATOM   7164   H HB3  . ASN A 1 49  ? -3.324  -5.183  16.315  1.00 0.00 ? 49  ASN A HB3  2  
ATOM   7165   H HD21 . ASN A 1 49  ? -1.008  -5.775  18.045  1.00 0.00 ? 49  ASN A HD21 2  
ATOM   7166   H HD22 . ASN A 1 49  ? -0.855  -7.466  18.079  1.00 0.00 ? 49  ASN A HD22 2  
ATOM   7167   N N    . GLU A 1 50  ? -4.831  -6.595  14.337  1.00 0.00 ? 50  GLU A N    2  
ATOM   7168   C CA   . GLU A 1 50  ? -5.851  -7.615  14.122  1.00 0.00 ? 50  GLU A CA   2  
ATOM   7169   C C    . GLU A 1 50  ? -5.884  -8.007  12.650  1.00 0.00 ? 50  GLU A C    2  
ATOM   7170   O O    . GLU A 1 50  ? -5.989  -9.184  12.303  1.00 0.00 ? 50  GLU A O    2  
ATOM   7171   C CB   . GLU A 1 50  ? -7.227  -7.089  14.546  1.00 0.00 ? 50  GLU A CB   2  
ATOM   7172   C CG   . GLU A 1 50  ? -8.277  -8.189  14.352  1.00 0.00 ? 50  GLU A CG   2  
ATOM   7173   C CD   . GLU A 1 50  ? -9.632  -7.723  14.864  1.00 0.00 ? 50  GLU A CD   2  
ATOM   7174   O OE1  . GLU A 1 50  ? -10.282 -6.974  14.155  1.00 0.00 ? 50  GLU A OE1  2  
ATOM   7175   O OE2  . GLU A 1 50  ? -9.998  -8.120  15.955  1.00 0.00 ? 50  GLU A OE2  2  
ATOM   7176   H H    . GLU A 1 50  ? -5.099  -5.687  14.600  1.00 0.00 ? 50  GLU A H    2  
ATOM   7177   H HA   . GLU A 1 50  ? -5.613  -8.486  14.709  1.00 0.00 ? 50  GLU A HA   2  
ATOM   7178   H HB2  . GLU A 1 50  ? -7.197  -6.798  15.586  1.00 0.00 ? 50  GLU A HB2  2  
ATOM   7179   H HB3  . GLU A 1 50  ? -7.491  -6.233  13.940  1.00 0.00 ? 50  GLU A HB3  2  
ATOM   7180   H HG2  . GLU A 1 50  ? -8.358  -8.429  13.302  1.00 0.00 ? 50  GLU A HG2  2  
ATOM   7181   H HG3  . GLU A 1 50  ? -7.976  -9.073  14.895  1.00 0.00 ? 50  GLU A HG3  2  
ATOM   7182   N N    . ALA A 1 51  ? -5.776  -7.005  11.781  1.00 0.00 ? 51  ALA A N    2  
ATOM   7183   C CA   . ALA A 1 51  ? -5.782  -7.253  10.343  1.00 0.00 ? 51  ALA A CA   2  
ATOM   7184   C C    . ALA A 1 51  ? -4.554  -8.078  9.948   1.00 0.00 ? 51  ALA A C    2  
ATOM   7185   O O    . ALA A 1 51  ? -4.659  -9.054  9.202   1.00 0.00 ? 51  ALA A O    2  
ATOM   7186   C CB   . ALA A 1 51  ? -5.808  -5.915  9.588   1.00 0.00 ? 51  ALA A CB   2  
ATOM   7187   H H    . ALA A 1 51  ? -5.681  -6.087  12.113  1.00 0.00 ? 51  ALA A H    2  
ATOM   7188   H HA   . ALA A 1 51  ? -6.669  -7.814  10.091  1.00 0.00 ? 51  ALA A HA   2  
ATOM   7189   H HB1  . ALA A 1 51  ? -4.808  -5.654  9.270   1.00 0.00 ? 51  ALA A HB1  2  
ATOM   7190   H HB2  . ALA A 1 51  ? -6.448  -6.001  8.723   1.00 0.00 ? 51  ALA A HB2  2  
ATOM   7191   H HB3  . ALA A 1 51  ? -6.191  -5.141  10.240  1.00 0.00 ? 51  ALA A HB3  2  
ATOM   7192   N N    . HIS A 1 52  ? -3.395  -7.690  10.473  1.00 0.00 ? 52  HIS A N    2  
ATOM   7193   C CA   . HIS A 1 52  ? -2.153  -8.404  10.189  1.00 0.00 ? 52  HIS A CA   2  
ATOM   7194   C C    . HIS A 1 52  ? -2.238  -9.853  10.669  1.00 0.00 ? 52  HIS A C    2  
ATOM   7195   O O    . HIS A 1 52  ? -1.774  -10.770 9.988   1.00 0.00 ? 52  HIS A O    2  
ATOM   7196   C CB   . HIS A 1 52  ? -0.980  -7.702  10.878  1.00 0.00 ? 52  HIS A CB   2  
ATOM   7197   C CG   . HIS A 1 52  ? 0.308   -8.362  10.469  1.00 0.00 ? 52  HIS A CG   2  
ATOM   7198   N ND1  . HIS A 1 52  ? 0.711   -9.580  10.990  1.00 0.00 ? 52  HIS A ND1  2  
ATOM   7199   C CD2  . HIS A 1 52  ? 1.295   -7.985  9.591   1.00 0.00 ? 52  HIS A CD2  2  
ATOM   7200   C CE1  . HIS A 1 52  ? 1.892   -9.892  10.427  1.00 0.00 ? 52  HIS A CE1  2  
ATOM   7201   N NE2  . HIS A 1 52  ? 2.294   -8.953  9.566   1.00 0.00 ? 52  HIS A NE2  2  
ATOM   7202   H H    . HIS A 1 52  ? -3.377  -6.911  11.073  1.00 0.00 ? 52  HIS A H    2  
ATOM   7203   H HA   . HIS A 1 52  ? -1.981  -8.402  9.123   1.00 0.00 ? 52  HIS A HA   2  
ATOM   7204   H HB2  . HIS A 1 52  ? -0.961  -6.662  10.586  1.00 0.00 ? 52  HIS A HB2  2  
ATOM   7205   H HB3  . HIS A 1 52  ? -1.096  -7.773  11.948  1.00 0.00 ? 52  HIS A HB3  2  
ATOM   7206   H HD1  . HIS A 1 52  ? 0.224   -10.117 11.651  1.00 0.00 ? 52  HIS A HD1  2  
ATOM   7207   H HD2  . HIS A 1 52  ? 1.294   -7.075  9.009   1.00 0.00 ? 52  HIS A HD2  2  
ATOM   7208   H HE1  . HIS A 1 52  ? 2.448   -10.793 10.644  1.00 0.00 ? 52  HIS A HE1  2  
ATOM   7209   H HE2  . HIS A 1 52  ? 3.115   -8.947  9.032   1.00 0.00 ? 52  HIS A HE2  2  
ATOM   7210   N N    . LEU A 1 53  ? -2.837  -10.049 11.841  1.00 0.00 ? 53  LEU A N    2  
ATOM   7211   C CA   . LEU A 1 53  ? -2.978  -11.388 12.402  1.00 0.00 ? 53  LEU A CA   2  
ATOM   7212   C C    . LEU A 1 53  ? -3.792  -12.270 11.458  1.00 0.00 ? 53  LEU A C    2  
ATOM   7213   O O    . LEU A 1 53  ? -3.438  -13.424 11.203  1.00 0.00 ? 53  LEU A O    2  
ATOM   7214   C CB   . LEU A 1 53  ? -3.674  -11.313 13.764  1.00 0.00 ? 53  LEU A CB   2  
ATOM   7215   C CG   . LEU A 1 53  ? -2.681  -10.854 14.840  1.00 0.00 ? 53  LEU A CG   2  
ATOM   7216   C CD1  . LEU A 1 53  ? -3.454  -10.403 16.080  1.00 0.00 ? 53  LEU A CD1  2  
ATOM   7217   C CD2  . LEU A 1 53  ? -1.746  -12.008 15.229  1.00 0.00 ? 53  LEU A CD2  2  
ATOM   7218   H H    . LEU A 1 53  ? -3.192  -9.278  12.335  1.00 0.00 ? 53  LEU A H    2  
ATOM   7219   H HA   . LEU A 1 53  ? -1.999  -11.824 12.528  1.00 0.00 ? 53  LEU A HA   2  
ATOM   7220   H HB2  . LEU A 1 53  ? -4.490  -10.607 13.707  1.00 0.00 ? 53  LEU A HB2  2  
ATOM   7221   H HB3  . LEU A 1 53  ? -4.063  -12.286 14.023  1.00 0.00 ? 53  LEU A HB3  2  
ATOM   7222   H HG   . LEU A 1 53  ? -2.097  -10.027 14.461  1.00 0.00 ? 53  LEU A HG   2  
ATOM   7223   H HD11 . LEU A 1 53  ? -4.306  -11.051 16.228  1.00 0.00 ? 53  LEU A HD11 2  
ATOM   7224   H HD12 . LEU A 1 53  ? -2.809  -10.453 16.945  1.00 0.00 ? 53  LEU A HD12 2  
ATOM   7225   H HD13 . LEU A 1 53  ? -3.794  -9.387  15.943  1.00 0.00 ? 53  LEU A HD13 2  
ATOM   7226   H HD21 . LEU A 1 53  ? -2.302  -12.933 15.262  1.00 0.00 ? 53  LEU A HD21 2  
ATOM   7227   H HD22 . LEU A 1 53  ? -0.950  -12.091 14.504  1.00 0.00 ? 53  LEU A HD22 2  
ATOM   7228   H HD23 . LEU A 1 53  ? -1.322  -11.811 16.202  1.00 0.00 ? 53  LEU A HD23 2  
ATOM   7229   N N    . VAL A 1 54  ? -4.879  -11.714 10.936  1.00 0.00 ? 54  VAL A N    2  
ATOM   7230   C CA   . VAL A 1 54  ? -5.725  -12.456 10.012  1.00 0.00 ? 54  VAL A CA   2  
ATOM   7231   C C    . VAL A 1 54  ? -4.930  -12.786 8.752   1.00 0.00 ? 54  VAL A C    2  
ATOM   7232   O O    . VAL A 1 54  ? -4.980  -13.911 8.255   1.00 0.00 ? 54  VAL A O    2  
ATOM   7233   C CB   . VAL A 1 54  ? -6.976  -11.636 9.659   1.00 0.00 ? 54  VAL A CB   2  
ATOM   7234   C CG1  . VAL A 1 54  ? -7.736  -12.313 8.508   1.00 0.00 ? 54  VAL A CG1  2  
ATOM   7235   C CG2  . VAL A 1 54  ? -7.892  -11.522 10.893  1.00 0.00 ? 54  VAL A CG2  2  
ATOM   7236   H H    . VAL A 1 54  ? -5.109  -10.788 11.168  1.00 0.00 ? 54  VAL A H    2  
ATOM   7237   H HA   . VAL A 1 54  ? -6.029  -13.380 10.480  1.00 0.00 ? 54  VAL A HA   2  
ATOM   7238   H HB   . VAL A 1 54  ? -6.670  -10.646 9.347   1.00 0.00 ? 54  VAL A HB   2  
ATOM   7239   H HG11 . VAL A 1 54  ? -7.667  -13.387 8.607   1.00 0.00 ? 54  VAL A HG11 2  
ATOM   7240   H HG12 . VAL A 1 54  ? -8.776  -12.019 8.536   1.00 0.00 ? 54  VAL A HG12 2  
ATOM   7241   H HG13 . VAL A 1 54  ? -7.305  -12.013 7.565   1.00 0.00 ? 54  VAL A HG13 2  
ATOM   7242   H HG21 . VAL A 1 54  ? -7.834  -12.425 11.479  1.00 0.00 ? 54  VAL A HG21 2  
ATOM   7243   H HG22 . VAL A 1 54  ? -7.576  -10.682 11.499  1.00 0.00 ? 54  VAL A HG22 2  
ATOM   7244   H HG23 . VAL A 1 54  ? -8.913  -11.365 10.574  1.00 0.00 ? 54  VAL A HG23 2  
ATOM   7245   N N    . GLN A 1 55  ? -4.176  -11.811 8.248   1.00 0.00 ? 55  GLN A N    2  
ATOM   7246   C CA   . GLN A 1 55  ? -3.370  -12.051 7.056   1.00 0.00 ? 55  GLN A CA   2  
ATOM   7247   C C    . GLN A 1 55  ? -2.329  -13.143 7.336   1.00 0.00 ? 55  GLN A C    2  
ATOM   7248   O O    . GLN A 1 55  ? -2.112  -14.022 6.503   1.00 0.00 ? 55  GLN A O    2  
ATOM   7249   C CB   . GLN A 1 55  ? -2.687  -10.748 6.588   1.00 0.00 ? 55  GLN A CB   2  
ATOM   7250   C CG   . GLN A 1 55  ? -1.520  -11.063 5.620   1.00 0.00 ? 55  GLN A CG   2  
ATOM   7251   C CD   . GLN A 1 55  ? -1.431  -10.020 4.505   1.00 0.00 ? 55  GLN A CD   2  
ATOM   7252   O OE1  . GLN A 1 55  ? -1.236  -8.838  4.768   1.00 0.00 ? 55  GLN A OE1  2  
ATOM   7253   N NE2  . GLN A 1 55  ? -1.543  -10.400 3.266   1.00 0.00 ? 55  GLN A NE2  2  
ATOM   7254   H H    . GLN A 1 55  ? -4.152  -10.933 8.691   1.00 0.00 ? 55  GLN A H    2  
ATOM   7255   H HA   . GLN A 1 55  ? -4.027  -12.397 6.273   1.00 0.00 ? 55  GLN A HA   2  
ATOM   7256   H HB2  . GLN A 1 55  ? -3.418  -10.134 6.083   1.00 0.00 ? 55  GLN A HB2  2  
ATOM   7257   H HB3  . GLN A 1 55  ? -2.307  -10.213 7.448   1.00 0.00 ? 55  GLN A HB3  2  
ATOM   7258   H HG2  . GLN A 1 55  ? -0.592  -11.063 6.170   1.00 0.00 ? 55  GLN A HG2  2  
ATOM   7259   H HG3  . GLN A 1 55  ? -1.669  -12.035 5.176   1.00 0.00 ? 55  GLN A HG3  2  
ATOM   7260   H HE21 . GLN A 1 55  ? -1.685  -11.345 3.055   1.00 0.00 ? 55  GLN A HE21 2  
ATOM   7261   H HE22 . GLN A 1 55  ? -1.483  -9.740  2.545   1.00 0.00 ? 55  GLN A HE22 2  
ATOM   7262   N N    . THR A 1 56  ? -1.703  -13.097 8.512   1.00 0.00 ? 56  THR A N    2  
ATOM   7263   C CA   . THR A 1 56  ? -0.705  -14.110 8.873   1.00 0.00 ? 56  THR A CA   2  
ATOM   7264   C C    . THR A 1 56  ? -1.275  -15.510 8.650   1.00 0.00 ? 56  THR A C    2  
ATOM   7265   O O    . THR A 1 56  ? -0.641  -16.360 8.020   1.00 0.00 ? 56  THR A O    2  
ATOM   7266   C CB   . THR A 1 56  ? -0.276  -13.943 10.337  1.00 0.00 ? 56  THR A CB   2  
ATOM   7267   O OG1  . THR A 1 56  ? 0.072   -12.585 10.569  1.00 0.00 ? 56  THR A OG1  2  
ATOM   7268   C CG2  . THR A 1 56  ? 0.935   -14.841 10.647  1.00 0.00 ? 56  THR A CG2  2  
ATOM   7269   H H    . THR A 1 56  ? -1.920  -12.382 9.152   1.00 0.00 ? 56  THR A H    2  
ATOM   7270   H HA   . THR A 1 56  ? 0.154   -13.986 8.233   1.00 0.00 ? 56  THR A HA   2  
ATOM   7271   H HB   . THR A 1 56  ? -1.097  -14.215 10.983  1.00 0.00 ? 56  THR A HB   2  
ATOM   7272   H HG1  . THR A 1 56  ? 0.911   -12.415 10.134  1.00 0.00 ? 56  THR A HG1  2  
ATOM   7273   H HG21 . THR A 1 56  ? 0.959   -15.681 9.968   1.00 0.00 ? 56  THR A HG21 2  
ATOM   7274   H HG22 . THR A 1 56  ? 1.843   -14.265 10.536  1.00 0.00 ? 56  THR A HG22 2  
ATOM   7275   H HG23 . THR A 1 56  ? 0.866   -15.204 11.662  1.00 0.00 ? 56  THR A HG23 2  
ATOM   7276   N N    . LYS A 1 57  ? -2.495  -15.733 9.131   1.00 0.00 ? 57  LYS A N    2  
ATOM   7277   C CA   . LYS A 1 57  ? -3.152  -17.027 8.943   1.00 0.00 ? 57  LYS A CA   2  
ATOM   7278   C C    . LYS A 1 57  ? -3.362  -17.284 7.456   1.00 0.00 ? 57  LYS A C    2  
ATOM   7279   O O    . LYS A 1 57  ? -3.204  -18.406 6.973   1.00 0.00 ? 57  LYS A O    2  
ATOM   7280   C CB   . LYS A 1 57  ? -4.500  -17.045 9.666   1.00 0.00 ? 57  LYS A CB   2  
ATOM   7281   C CG   . LYS A 1 57  ? -5.089  -18.455 9.593   1.00 0.00 ? 57  LYS A CG   2  
ATOM   7282   C CD   . LYS A 1 57  ? -6.405  -18.504 10.372  1.00 0.00 ? 57  LYS A CD   2  
ATOM   7283   C CE   . LYS A 1 57  ? -6.972  -19.924 10.319  1.00 0.00 ? 57  LYS A CE   2  
ATOM   7284   N NZ   . LYS A 1 57  ? -8.404  -19.904 10.728  1.00 0.00 ? 57  LYS A NZ   2  
ATOM   7285   H H    . LYS A 1 57  ? -2.968  -15.014 9.598   1.00 0.00 ? 57  LYS A H    2  
ATOM   7286   H HA   . LYS A 1 57  ? -2.531  -17.811 9.351   1.00 0.00 ? 57  LYS A HA   2  
ATOM   7287   H HB2  . LYS A 1 57  ? -4.359  -16.763 10.699  1.00 0.00 ? 57  LYS A HB2  2  
ATOM   7288   H HB3  . LYS A 1 57  ? -5.174  -16.349 9.190   1.00 0.00 ? 57  LYS A HB3  2  
ATOM   7289   H HG2  . LYS A 1 57  ? -5.271  -18.716 8.561   1.00 0.00 ? 57  LYS A HG2  2  
ATOM   7290   H HG3  . LYS A 1 57  ? -4.392  -19.157 10.025  1.00 0.00 ? 57  LYS A HG3  2  
ATOM   7291   H HD2  . LYS A 1 57  ? -6.226  -18.224 11.400  1.00 0.00 ? 57  LYS A HD2  2  
ATOM   7292   H HD3  . LYS A 1 57  ? -7.112  -17.819 9.929   1.00 0.00 ? 57  LYS A HD3  2  
ATOM   7293   H HE2  . LYS A 1 57  ? -6.890  -20.307 9.312   1.00 0.00 ? 57  LYS A HE2  2  
ATOM   7294   H HE3  . LYS A 1 57  ? -6.414  -20.559 10.992  1.00 0.00 ? 57  LYS A HE3  2  
ATOM   7295   H HZ1  . LYS A 1 57  ? -8.632  -18.979 11.148  1.00 0.00 ? 57  LYS A HZ1  2  
ATOM   7296   H HZ2  . LYS A 1 57  ? -9.005  -20.065 9.895   1.00 0.00 ? 57  LYS A HZ2  2  
ATOM   7297   H HZ3  . LYS A 1 57  ? -8.576  -20.655 11.426  1.00 0.00 ? 57  LYS A HZ3  2  
ATOM   7298   N N    . LEU A 1 58  ? -3.736  -16.233 6.738   1.00 0.00 ? 58  LEU A N    2  
ATOM   7299   C CA   . LEU A 1 58  ? -3.983  -16.358 5.313   1.00 0.00 ? 58  LEU A CA   2  
ATOM   7300   C C    . LEU A 1 58  ? -2.691  -16.660 4.536   1.00 0.00 ? 58  LEU A C    2  
ATOM   7301   O O    . LEU A 1 58  ? -2.754  -17.152 3.415   1.00 0.00 ? 58  LEU A O    2  
ATOM   7302   C CB   . LEU A 1 58  ? -4.648  -15.099 4.769   1.00 0.00 ? 58  LEU A CB   2  
ATOM   7303   C CG   . LEU A 1 58  ? -6.055  -14.951 5.363   1.00 0.00 ? 58  LEU A CG   2  
ATOM   7304   C CD1  . LEU A 1 58  ? -6.626  -13.590 4.950   1.00 0.00 ? 58  LEU A CD1  2  
ATOM   7305   C CD2  . LEU A 1 58  ? -6.973  -16.084 4.859   1.00 0.00 ? 58  LEU A CD2  2  
ATOM   7306   H H    . LEU A 1 58  ? -3.856  -15.364 7.177   1.00 0.00 ? 58  LEU A H    2  
ATOM   7307   H HA   . LEU A 1 58  ? -4.665  -17.186 5.170   1.00 0.00 ? 58  LEU A HA   2  
ATOM   7308   H HB2  . LEU A 1 58  ? -4.049  -14.240 5.035   1.00 0.00 ? 58  LEU A HB2  2  
ATOM   7309   H HB3  . LEU A 1 58  ? -4.716  -15.174 3.695   1.00 0.00 ? 58  LEU A HB3  2  
ATOM   7310   H HG   . LEU A 1 58  ? -5.994  -14.991 6.444   1.00 0.00 ? 58  LEU A HG   2  
ATOM   7311   H HD11 . LEU A 1 58  ? -6.290  -13.343 3.953   1.00 0.00 ? 58  LEU A HD11 2  
ATOM   7312   H HD12 . LEU A 1 58  ? -7.703  -13.624 4.970   1.00 0.00 ? 58  LEU A HD12 2  
ATOM   7313   H HD13 . LEU A 1 58  ? -6.278  -12.836 5.642   1.00 0.00 ? 58  LEU A HD13 2  
ATOM   7314   H HD21 . LEU A 1 58  ? -6.623  -16.446 3.903   1.00 0.00 ? 58  LEU A HD21 2  
ATOM   7315   H HD22 . LEU A 1 58  ? -6.963  -16.897 5.574   1.00 0.00 ? 58  LEU A HD22 2  
ATOM   7316   H HD23 . LEU A 1 58  ? -7.984  -15.716 4.755   1.00 0.00 ? 58  LEU A HD23 2  
ATOM   7317   N N    . ILE A 1 59  ? -1.526  -16.379 5.129   1.00 0.00 ? 59  ILE A N    2  
ATOM   7318   C CA   . ILE A 1 59  ? -0.256  -16.681 4.461   1.00 0.00 ? 59  ILE A CA   2  
ATOM   7319   C C    . ILE A 1 59  ? 0.283   -18.056 4.902   1.00 0.00 ? 59  ILE A C    2  
ATOM   7320   O O    . ILE A 1 59  ? 0.894   -18.772 4.116   1.00 0.00 ? 59  ILE A O    2  
ATOM   7321   C CB   . ILE A 1 59  ? 0.806   -15.567 4.727   1.00 0.00 ? 59  ILE A CB   2  
ATOM   7322   C CG1  . ILE A 1 59  ? 1.723   -15.403 3.509   1.00 0.00 ? 59  ILE A CG1  2  
ATOM   7323   C CG2  . ILE A 1 59  ? 1.710   -15.888 5.926   1.00 0.00 ? 59  ILE A CG2  2  
ATOM   7324   C CD1  . ILE A 1 59  ? 2.506   -14.094 3.642   1.00 0.00 ? 59  ILE A CD1  2  
ATOM   7325   H H    . ILE A 1 59  ? -1.525  -15.985 6.030   1.00 0.00 ? 59  ILE A H    2  
ATOM   7326   H HA   . ILE A 1 59  ? -0.431  -16.716 3.393   1.00 0.00 ? 59  ILE A HA   2  
ATOM   7327   H HB   . ILE A 1 59  ? 0.298   -14.634 4.911   1.00 0.00 ? 59  ILE A HB   2  
ATOM   7328   H HG12 . ILE A 1 59  ? 2.414   -16.231 3.466   1.00 0.00 ? 59  ILE A HG12 2  
ATOM   7329   H HG13 . ILE A 1 59  ? 1.141   -15.376 2.609   1.00 0.00 ? 59  ILE A HG13 2  
ATOM   7330   H HG21 . ILE A 1 59  ? 1.117   -16.012 6.801   1.00 0.00 ? 59  ILE A HG21 2  
ATOM   7331   H HG22 . ILE A 1 59  ? 2.279   -16.785 5.737   1.00 0.00 ? 59  ILE A HG22 2  
ATOM   7332   H HG23 . ILE A 1 59  ? 2.392   -15.066 6.081   1.00 0.00 ? 59  ILE A HG23 2  
ATOM   7333   H HD11 . ILE A 1 59  ? 1.830   -13.296 3.917   1.00 0.00 ? 59  ILE A HD11 2  
ATOM   7334   H HD12 . ILE A 1 59  ? 3.263   -14.201 4.404   1.00 0.00 ? 59  ILE A HD12 2  
ATOM   7335   H HD13 . ILE A 1 59  ? 2.976   -13.858 2.699   1.00 0.00 ? 59  ILE A HD13 2  
ATOM   7336   N N    . GLU A 1 60  ? 0.048   -18.426 6.164   1.00 0.00 ? 60  GLU A N    2  
ATOM   7337   C CA   . GLU A 1 60  ? 0.519   -19.725 6.677   1.00 0.00 ? 60  GLU A CA   2  
ATOM   7338   C C    . GLU A 1 60  ? -0.188  -20.883 5.974   1.00 0.00 ? 60  GLU A C    2  
ATOM   7339   O O    . GLU A 1 60  ? 0.426   -21.904 5.666   1.00 0.00 ? 60  GLU A O    2  
ATOM   7340   C CB   . GLU A 1 60  ? 0.244   -19.814 8.185   1.00 0.00 ? 60  GLU A CB   2  
ATOM   7341   C CG   . GLU A 1 60  ? 0.690   -21.175 8.741   1.00 0.00 ? 60  GLU A CG   2  
ATOM   7342   C CD   . GLU A 1 60  ? 0.159   -21.351 10.158  1.00 0.00 ? 60  GLU A CD   2  
ATOM   7343   O OE1  . GLU A 1 60  ? -0.467  -20.429 10.655  1.00 0.00 ? 60  GLU A OE1  2  
ATOM   7344   O OE2  . GLU A 1 60  ? 0.355   -22.419 10.714  1.00 0.00 ? 60  GLU A OE2  2  
ATOM   7345   H H    . GLU A 1 60  ? -0.444  -17.822 6.760   1.00 0.00 ? 60  GLU A H    2  
ATOM   7346   H HA   . GLU A 1 60  ? 1.581   -19.807 6.495   1.00 0.00 ? 60  GLU A HA   2  
ATOM   7347   H HB2  . GLU A 1 60  ? 0.790   -19.031 8.691   1.00 0.00 ? 60  GLU A HB2  2  
ATOM   7348   H HB3  . GLU A 1 60  ? -0.813  -19.683 8.364   1.00 0.00 ? 60  GLU A HB3  2  
ATOM   7349   H HG2  . GLU A 1 60  ? 0.306   -21.970 8.121   1.00 0.00 ? 60  GLU A HG2  2  
ATOM   7350   H HG3  . GLU A 1 60  ? 1.767   -21.221 8.757   1.00 0.00 ? 60  GLU A HG3  2  
ATOM   7351   N N    . GLY A 1 61  ? -1.489  -20.725 5.734   1.00 0.00 ? 61  GLY A N    2  
ATOM   7352   C CA   . GLY A 1 61  ? -2.272  -21.774 5.078   1.00 0.00 ? 61  GLY A CA   2  
ATOM   7353   C C    . GLY A 1 61  ? -2.655  -21.379 3.656   1.00 0.00 ? 61  GLY A C    2  
ATOM   7354   O O    . GLY A 1 61  ? -3.723  -21.744 3.170   1.00 0.00 ? 61  GLY A O    2  
ATOM   7355   H H    . GLY A 1 61  ? -1.930  -19.893 6.010   1.00 0.00 ? 61  GLY A H    2  
ATOM   7356   H HA2  . GLY A 1 61  ? -1.692  -22.687 5.051   1.00 0.00 ? 61  GLY A HA2  2  
ATOM   7357   H HA3  . GLY A 1 61  ? -3.174  -21.946 5.645   1.00 0.00 ? 61  GLY A HA3  2  
ATOM   7358   N N    . ASP A 1 62  ? -1.779  -20.624 2.999   1.00 0.00 ? 62  ASP A N    2  
ATOM   7359   C CA   . ASP A 1 62  ? -2.040  -20.165 1.638   1.00 0.00 ? 62  ASP A CA   2  
ATOM   7360   C C    . ASP A 1 62  ? -2.089  -21.330 0.650   1.00 0.00 ? 62  ASP A C    2  
ATOM   7361   O O    . ASP A 1 62  ? -2.423  -21.144 -0.520  1.00 0.00 ? 62  ASP A O    2  
ATOM   7362   C CB   . ASP A 1 62  ? -0.952  -19.179 1.211   1.00 0.00 ? 62  ASP A CB   2  
ATOM   7363   C CG   . ASP A 1 62  ? 0.423   -19.817 1.373   1.00 0.00 ? 62  ASP A CG   2  
ATOM   7364   O OD1  . ASP A 1 62  ? 0.486   -20.921 1.889   1.00 0.00 ? 62  ASP A OD1  2  
ATOM   7365   O OD2  . ASP A 1 62  ? 1.394   -19.192 0.979   1.00 0.00 ? 62  ASP A OD2  2  
ATOM   7366   H H    . ASP A 1 62  ? -0.946  -20.361 3.443   1.00 0.00 ? 62  ASP A H    2  
ATOM   7367   H HA   . ASP A 1 62  ? -2.991  -19.655 1.620   1.00 0.00 ? 62  ASP A HA   2  
ATOM   7368   H HB2  . ASP A 1 62  ? -1.103  -18.907 0.178   1.00 0.00 ? 62  ASP A HB2  2  
ATOM   7369   H HB3  . ASP A 1 62  ? -1.010  -18.293 1.826   1.00 0.00 ? 62  ASP A HB3  2  
ATOM   7370   N N    . ALA A 1 63  ? -1.759  -22.526 1.122   1.00 0.00 ? 63  ALA A N    2  
ATOM   7371   C CA   . ALA A 1 63  ? -1.777  -23.705 0.260   1.00 0.00 ? 63  ALA A CA   2  
ATOM   7372   C C    . ALA A 1 63  ? -3.191  -24.271 0.151   1.00 0.00 ? 63  ALA A C    2  
ATOM   7373   O O    . ALA A 1 63  ? -4.102  -23.825 0.850   1.00 0.00 ? 63  ALA A O    2  
ATOM   7374   C CB   . ALA A 1 63  ? -0.840  -24.776 0.820   1.00 0.00 ? 63  ALA A CB   2  
ATOM   7375   H H    . ALA A 1 63  ? -1.502  -22.620 2.063   1.00 0.00 ? 63  ALA A H    2  
ATOM   7376   H HA   . ALA A 1 63  ? -1.435  -23.424 -0.725  1.00 0.00 ? 63  ALA A HA   2  
ATOM   7377   H HB1  . ALA A 1 63  ? -1.353  -25.339 1.586   1.00 0.00 ? 63  ALA A HB1  2  
ATOM   7378   H HB2  . ALA A 1 63  ? 0.034   -24.304 1.245   1.00 0.00 ? 63  ALA A HB2  2  
ATOM   7379   H HB3  . ALA A 1 63  ? -0.538  -25.442 0.025   1.00 0.00 ? 63  ALA A HB3  2  
ATOM   7380   N N    . GLY A 1 64  ? -3.368  -25.258 -0.727  1.00 0.00 ? 64  GLY A N    2  
ATOM   7381   C CA   . GLY A 1 64  ? -4.678  -25.882 -0.914  1.00 0.00 ? 64  GLY A CA   2  
ATOM   7382   C C    . GLY A 1 64  ? -5.054  -25.972 -2.393  1.00 0.00 ? 64  GLY A C    2  
ATOM   7383   O O    . GLY A 1 64  ? -5.296  -27.062 -2.911  1.00 0.00 ? 64  GLY A O    2  
ATOM   7384   H H    . GLY A 1 64  ? -2.606  -25.575 -1.254  1.00 0.00 ? 64  GLY A H    2  
ATOM   7385   H HA2  . GLY A 1 64  ? -4.656  -26.877 -0.495  1.00 0.00 ? 64  GLY A HA2  2  
ATOM   7386   H HA3  . GLY A 1 64  ? -5.428  -25.299 -0.398  1.00 0.00 ? 64  GLY A HA3  2  
ATOM   7387   N N    . GLU A 1 65  ? -5.111  -24.827 -3.067  1.00 0.00 ? 65  GLU A N    2  
ATOM   7388   C CA   . GLU A 1 65  ? -5.470  -24.806 -4.483  1.00 0.00 ? 65  GLU A CA   2  
ATOM   7389   C C    . GLU A 1 65  ? -4.410  -25.502 -5.329  1.00 0.00 ? 65  GLU A C    2  
ATOM   7390   O O    . GLU A 1 65  ? -4.732  -26.210 -6.284  1.00 0.00 ? 65  GLU A O    2  
ATOM   7391   C CB   . GLU A 1 65  ? -5.633  -23.364 -4.965  1.00 0.00 ? 65  GLU A CB   2  
ATOM   7392   C CG   . GLU A 1 65  ? -6.866  -22.739 -4.312  1.00 0.00 ? 65  GLU A CG   2  
ATOM   7393   C CD   . GLU A 1 65  ? -6.993  -21.280 -4.734  1.00 0.00 ? 65  GLU A CD   2  
ATOM   7394   O OE1  . GLU A 1 65  ? -6.163  -20.833 -5.508  1.00 0.00 ? 65  GLU A OE1  2  
ATOM   7395   O OE2  . GLU A 1 65  ? -7.920  -20.631 -4.278  1.00 0.00 ? 65  GLU A OE2  2  
ATOM   7396   H H    . GLU A 1 65  ? -4.915  -23.985 -2.605  1.00 0.00 ? 65  GLU A H    2  
ATOM   7397   H HA   . GLU A 1 65  ? -6.410  -25.321 -4.611  1.00 0.00 ? 65  GLU A HA   2  
ATOM   7398   H HB2  . GLU A 1 65  ? -4.755  -22.794 -4.698  1.00 0.00 ? 65  GLU A HB2  2  
ATOM   7399   H HB3  . GLU A 1 65  ? -5.754  -23.356 -6.038  1.00 0.00 ? 65  GLU A HB3  2  
ATOM   7400   H HG2  . GLU A 1 65  ? -7.748  -23.281 -4.620  1.00 0.00 ? 65  GLU A HG2  2  
ATOM   7401   H HG3  . GLU A 1 65  ? -6.769  -22.794 -3.238  1.00 0.00 ? 65  GLU A HG3  2  
ATOM   7402   N N    . GLY A 1 66  ? -3.146  -25.294 -4.981  1.00 0.00 ? 66  GLY A N    2  
ATOM   7403   C CA   . GLY A 1 66  ? -2.053  -25.905 -5.727  1.00 0.00 ? 66  GLY A CA   2  
ATOM   7404   C C    . GLY A 1 66  ? -0.771  -25.921 -4.903  1.00 0.00 ? 66  GLY A C    2  
ATOM   7405   O O    . GLY A 1 66  ? -0.713  -25.352 -3.814  1.00 0.00 ? 66  GLY A O    2  
ATOM   7406   H H    . GLY A 1 66  ? -2.945  -24.717 -4.215  1.00 0.00 ? 66  GLY A H    2  
ATOM   7407   H HA2  . GLY A 1 66  ? -2.323  -26.919 -5.984  1.00 0.00 ? 66  GLY A HA2  2  
ATOM   7408   H HA3  . GLY A 1 66  ? -1.882  -25.342 -6.632  1.00 0.00 ? 66  GLY A HA3  2  
ATOM   7409   N N    . LYS A 1 67  ? 0.249   -26.588 -5.429  1.00 0.00 ? 67  LYS A N    2  
ATOM   7410   C CA   . LYS A 1 67  ? 1.526   -26.687 -4.733  1.00 0.00 ? 67  LYS A CA   2  
ATOM   7411   C C    . LYS A 1 67  ? 2.220   -25.325 -4.654  1.00 0.00 ? 67  LYS A C    2  
ATOM   7412   O O    . LYS A 1 67  ? 2.164   -24.644 -3.631  1.00 0.00 ? 67  LYS A O    2  
ATOM   7413   C CB   . LYS A 1 67  ? 2.441   -27.673 -5.469  1.00 0.00 ? 67  LYS A CB   2  
ATOM   7414   C CG   . LYS A 1 67  ? 1.747   -29.033 -5.628  1.00 0.00 ? 67  LYS A CG   2  
ATOM   7415   C CD   . LYS A 1 67  ? 1.571   -29.703 -4.263  1.00 0.00 ? 67  LYS A CD   2  
ATOM   7416   C CE   . LYS A 1 67  ? 1.218   -31.178 -4.467  1.00 0.00 ? 67  LYS A CE   2  
ATOM   7417   N NZ   . LYS A 1 67  ? 1.187   -31.870 -3.148  1.00 0.00 ? 67  LYS A NZ   2  
ATOM   7418   H H    . LYS A 1 67  ? 0.140   -27.028 -6.298  1.00 0.00 ? 67  LYS A H    2  
ATOM   7419   H HA   . LYS A 1 67  ? 1.355   -27.048 -3.732  1.00 0.00 ? 67  LYS A HA   2  
ATOM   7420   H HB2  . LYS A 1 67  ? 2.678   -27.279 -6.446  1.00 0.00 ? 67  LYS A HB2  2  
ATOM   7421   H HB3  . LYS A 1 67  ? 3.352   -27.803 -4.905  1.00 0.00 ? 67  LYS A HB3  2  
ATOM   7422   H HG2  . LYS A 1 67  ? 0.778   -28.888 -6.084  1.00 0.00 ? 67  LYS A HG2  2  
ATOM   7423   H HG3  . LYS A 1 67  ? 2.348   -29.668 -6.262  1.00 0.00 ? 67  LYS A HG3  2  
ATOM   7424   H HD2  . LYS A 1 67  ? 2.490   -29.625 -3.700  1.00 0.00 ? 67  LYS A HD2  2  
ATOM   7425   H HD3  . LYS A 1 67  ? 0.773   -29.220 -3.722  1.00 0.00 ? 67  LYS A HD3  2  
ATOM   7426   H HE2  . LYS A 1 67  ? 0.249   -31.255 -4.936  1.00 0.00 ? 67  LYS A HE2  2  
ATOM   7427   H HE3  . LYS A 1 67  ? 1.961   -31.642 -5.099  1.00 0.00 ? 67  LYS A HE3  2  
ATOM   7428   H HZ1  . LYS A 1 67  ? 0.909   -31.195 -2.408  1.00 0.00 ? 67  LYS A HZ1  2  
ATOM   7429   H HZ2  . LYS A 1 67  ? 0.500   -32.651 -3.182  1.00 0.00 ? 67  LYS A HZ2  2  
ATOM   7430   H HZ3  . LYS A 1 67  ? 2.132   -32.248 -2.932  1.00 0.00 ? 67  LYS A HZ3  2  
ATOM   7431   N N    . MET A 1 68  ? 2.895   -24.955 -5.738  1.00 0.00 ? 68  MET A N    2  
ATOM   7432   C CA   . MET A 1 68  ? 3.633   -23.694 -5.799  1.00 0.00 ? 68  MET A CA   2  
ATOM   7433   C C    . MET A 1 68  ? 2.719   -22.465 -5.760  1.00 0.00 ? 68  MET A C    2  
ATOM   7434   O O    . MET A 1 68  ? 3.063   -21.452 -5.153  1.00 0.00 ? 68  MET A O    2  
ATOM   7435   C CB   . MET A 1 68  ? 4.465   -23.656 -7.082  1.00 0.00 ? 68  MET A CB   2  
ATOM   7436   C CG   . MET A 1 68  ? 5.733   -24.493 -6.898  1.00 0.00 ? 68  MET A CG   2  
ATOM   7437   S SD   . MET A 1 68  ? 6.820   -23.686 -5.696  1.00 0.00 ? 68  MET A SD   2  
ATOM   7438   C CE   . MET A 1 68  ? 7.233   -25.163 -4.735  1.00 0.00 ? 68  MET A CE   2  
ATOM   7439   H H    . MET A 1 68  ? 2.915   -25.554 -6.513  1.00 0.00 ? 68  MET A H    2  
ATOM   7440   H HA   . MET A 1 68  ? 4.305   -23.648 -4.957  1.00 0.00 ? 68  MET A HA   2  
ATOM   7441   H HB2  . MET A 1 68  ? 3.884   -24.059 -7.899  1.00 0.00 ? 68  MET A HB2  2  
ATOM   7442   H HB3  . MET A 1 68  ? 4.739   -22.636 -7.304  1.00 0.00 ? 68  MET A HB3  2  
ATOM   7443   H HG2  . MET A 1 68  ? 5.466   -25.476 -6.540  1.00 0.00 ? 68  MET A HG2  2  
ATOM   7444   H HG3  . MET A 1 68  ? 6.246   -24.582 -7.844  1.00 0.00 ? 68  MET A HG3  2  
ATOM   7445   H HE1  . MET A 1 68  ? 7.558   -25.948 -5.404  1.00 0.00 ? 68  MET A HE1  2  
ATOM   7446   H HE2  . MET A 1 68  ? 8.026   -24.933 -4.042  1.00 0.00 ? 68  MET A HE2  2  
ATOM   7447   H HE3  . MET A 1 68  ? 6.360   -25.489 -4.185  1.00 0.00 ? 68  MET A HE3  2  
ATOM   7448   N N    . LYS A 1 69  ? 1.582   -22.539 -6.445  1.00 0.00 ? 69  LYS A N    2  
ATOM   7449   C CA   . LYS A 1 69  ? 0.666   -21.399 -6.511  1.00 0.00 ? 69  LYS A CA   2  
ATOM   7450   C C    . LYS A 1 69  ? -0.078  -21.161 -5.197  1.00 0.00 ? 69  LYS A C    2  
ATOM   7451   O O    . LYS A 1 69  ? -0.304  -22.082 -4.412  1.00 0.00 ? 69  LYS A O    2  
ATOM   7452   C CB   . LYS A 1 69  ? -0.333  -21.604 -7.649  1.00 0.00 ? 69  LYS A CB   2  
ATOM   7453   C CG   . LYS A 1 69  ? 0.417   -21.541 -8.981  1.00 0.00 ? 69  LYS A CG   2  
ATOM   7454   C CD   . LYS A 1 69  ? -0.560  -21.743 -10.139 1.00 0.00 ? 69  LYS A CD   2  
ATOM   7455   C CE   . LYS A 1 69  ? 0.214   -21.744 -11.459 1.00 0.00 ? 69  LYS A CE   2  
ATOM   7456   N NZ   . LYS A 1 69  ? 0.801   -20.394 -11.691 1.00 0.00 ? 69  LYS A NZ   2  
ATOM   7457   H H    . LYS A 1 69  ? 1.369   -23.358 -6.940  1.00 0.00 ? 69  LYS A H    2  
ATOM   7458   H HA   . LYS A 1 69  ? 1.246   -20.516 -6.732  1.00 0.00 ? 69  LYS A HA   2  
ATOM   7459   H HB2  . LYS A 1 69  ? -0.808  -22.568 -7.544  1.00 0.00 ? 69  LYS A HB2  2  
ATOM   7460   H HB3  . LYS A 1 69  ? -1.080  -20.825 -7.621  1.00 0.00 ? 69  LYS A HB3  2  
ATOM   7461   H HG2  . LYS A 1 69  ? 0.895   -20.577 -9.078  1.00 0.00 ? 69  LYS A HG2  2  
ATOM   7462   H HG3  . LYS A 1 69  ? 1.167   -22.317 -9.008  1.00 0.00 ? 69  LYS A HG3  2  
ATOM   7463   H HD2  . LYS A 1 69  ? -1.072  -22.687 -10.018 1.00 0.00 ? 69  LYS A HD2  2  
ATOM   7464   H HD3  . LYS A 1 69  ? -1.281  -20.939 -10.147 1.00 0.00 ? 69  LYS A HD3  2  
ATOM   7465   H HE2  . LYS A 1 69  ? 1.005   -22.477 -11.411 1.00 0.00 ? 69  LYS A HE2  2  
ATOM   7466   H HE3  . LYS A 1 69  ? -0.456  -21.990 -12.269 1.00 0.00 ? 69  LYS A HE3  2  
ATOM   7467   H HZ1  . LYS A 1 69  ? 0.850   -19.877 -10.791 1.00 0.00 ? 69  LYS A HZ1  2  
ATOM   7468   H HZ2  . LYS A 1 69  ? 1.759   -20.494 -12.082 1.00 0.00 ? 69  LYS A HZ2  2  
ATOM   7469   H HZ3  . LYS A 1 69  ? 0.205   -19.868 -12.362 1.00 0.00 ? 69  LYS A HZ3  2  
ATOM   7470   N N    . VAL A 1 70  ? -0.443  -19.896 -4.978  1.00 0.00 ? 70  VAL A N    2  
ATOM   7471   C CA   . VAL A 1 70  ? -1.155  -19.484 -3.768  1.00 0.00 ? 70  VAL A CA   2  
ATOM   7472   C C    . VAL A 1 70  ? -2.353  -18.605 -4.129  1.00 0.00 ? 70  VAL A C    2  
ATOM   7473   O O    . VAL A 1 70  ? -2.517  -18.216 -5.285  1.00 0.00 ? 70  VAL A O    2  
ATOM   7474   C CB   . VAL A 1 70  ? -0.211  -18.696 -2.859  1.00 0.00 ? 70  VAL A CB   2  
ATOM   7475   C CG1  . VAL A 1 70  ? 0.953   -19.590 -2.428  1.00 0.00 ? 70  VAL A CG1  2  
ATOM   7476   C CG2  . VAL A 1 70  ? 0.332   -17.484 -3.620  1.00 0.00 ? 70  VAL A CG2  2  
ATOM   7477   H H    . VAL A 1 70  ? -0.221  -19.218 -5.649  1.00 0.00 ? 70  VAL A H    2  
ATOM   7478   H HA   . VAL A 1 70  ? -1.501  -20.360 -3.242  1.00 0.00 ? 70  VAL A HA   2  
ATOM   7479   H HB   . VAL A 1 70  ? -0.751  -18.361 -1.987  1.00 0.00 ? 70  VAL A HB   2  
ATOM   7480   H HG11 . VAL A 1 70  ? 1.460   -19.967 -3.304  1.00 0.00 ? 70  VAL A HG11 2  
ATOM   7481   H HG12 . VAL A 1 70  ? 1.645   -19.015 -1.830  1.00 0.00 ? 70  VAL A HG12 2  
ATOM   7482   H HG13 . VAL A 1 70  ? 0.575   -20.417 -1.846  1.00 0.00 ? 70  VAL A HG13 2  
ATOM   7483   H HG21 . VAL A 1 70  ? -0.491  -16.861 -3.939  1.00 0.00 ? 70  VAL A HG21 2  
ATOM   7484   H HG22 . VAL A 1 70  ? 0.985   -16.916 -2.974  1.00 0.00 ? 70  VAL A HG22 2  
ATOM   7485   H HG23 . VAL A 1 70  ? 0.885   -17.820 -4.485  1.00 0.00 ? 70  VAL A HG23 2  
ATOM   7486   N N    . SER A 1 71  ? -3.187  -18.289 -3.137  1.00 0.00 ? 71  SER A N    2  
ATOM   7487   C CA   . SER A 1 71  ? -4.355  -17.447 -3.387  1.00 0.00 ? 71  SER A CA   2  
ATOM   7488   C C    . SER A 1 71  ? -3.903  -16.098 -3.943  1.00 0.00 ? 71  SER A C    2  
ATOM   7489   O O    . SER A 1 71  ? -2.999  -15.464 -3.400  1.00 0.00 ? 71  SER A O    2  
ATOM   7490   C CB   . SER A 1 71  ? -5.140  -17.240 -2.090  1.00 0.00 ? 71  SER A CB   2  
ATOM   7491   O OG   . SER A 1 71  ? -6.351  -16.555 -2.378  1.00 0.00 ? 71  SER A OG   2  
ATOM   7492   H H    . SER A 1 71  ? -3.012  -18.620 -2.231  1.00 0.00 ? 71  SER A H    2  
ATOM   7493   H HA   . SER A 1 71  ? -4.993  -17.933 -4.111  1.00 0.00 ? 71  SER A HA   2  
ATOM   7494   H HB2  . SER A 1 71  ? -5.370  -18.195 -1.649  1.00 0.00 ? 71  SER A HB2  2  
ATOM   7495   H HB3  . SER A 1 71  ? -4.543  -16.661 -1.398  1.00 0.00 ? 71  SER A HB3  2  
ATOM   7496   H HG   . SER A 1 71  ? -6.156  -15.860 -3.011  1.00 0.00 ? 71  SER A HG   2  
ATOM   7497   N N    . LEU A 1 72  ? -4.512  -15.688 -5.049  1.00 0.00 ? 72  LEU A N    2  
ATOM   7498   C CA   . LEU A 1 72  ? -4.148  -14.433 -5.714  1.00 0.00 ? 72  LEU A CA   2  
ATOM   7499   C C    . LEU A 1 72  ? -4.477  -13.215 -4.847  1.00 0.00 ? 72  LEU A C    2  
ATOM   7500   O O    . LEU A 1 72  ? -3.722  -12.243 -4.789  1.00 0.00 ? 72  LEU A O    2  
ATOM   7501   C CB   . LEU A 1 72  ? -4.912  -14.317 -7.036  1.00 0.00 ? 72  LEU A CB   2  
ATOM   7502   C CG   . LEU A 1 72  ? -4.387  -15.359 -8.029  1.00 0.00 ? 72  LEU A CG   2  
ATOM   7503   C CD1  . LEU A 1 72  ? -5.303  -15.397 -9.255  1.00 0.00 ? 72  LEU A CD1  2  
ATOM   7504   C CD2  . LEU A 1 72  ? -2.960  -14.994 -8.465  1.00 0.00 ? 72  LEU A CD2  2  
ATOM   7505   H H    . LEU A 1 72  ? -5.203  -16.244 -5.452  1.00 0.00 ? 72  LEU A H    2  
ATOM   7506   H HA   . LEU A 1 72  ? -3.091  -14.437 -5.935  1.00 0.00 ? 72  LEU A HA   2  
ATOM   7507   H HB2  . LEU A 1 72  ? -5.964  -14.490 -6.857  1.00 0.00 ? 72  LEU A HB2  2  
ATOM   7508   H HB3  . LEU A 1 72  ? -4.776  -13.328 -7.445  1.00 0.00 ? 72  LEU A HB3  2  
ATOM   7509   H HG   . LEU A 1 72  ? -4.383  -16.331 -7.557  1.00 0.00 ? 72  LEU A HG   2  
ATOM   7510   H HD11 . LEU A 1 72  ? -6.330  -15.490 -8.934  1.00 0.00 ? 72  LEU A HD11 2  
ATOM   7511   H HD12 . LEU A 1 72  ? -5.184  -14.485 -9.822  1.00 0.00 ? 72  LEU A HD12 2  
ATOM   7512   H HD13 . LEU A 1 72  ? -5.041  -16.243 -9.874  1.00 0.00 ? 72  LEU A HD13 2  
ATOM   7513   H HD21 . LEU A 1 72  ? -2.837  -13.922 -8.449  1.00 0.00 ? 72  LEU A HD21 2  
ATOM   7514   H HD22 . LEU A 1 72  ? -2.251  -15.448 -7.789  1.00 0.00 ? 72  LEU A HD22 2  
ATOM   7515   H HD23 . LEU A 1 72  ? -2.783  -15.360 -9.467  1.00 0.00 ? 72  LEU A HD23 2  
ATOM   7516   N N    . VAL A 1 73  ? -5.628  -13.278 -4.197  1.00 0.00 ? 73  VAL A N    2  
ATOM   7517   C CA   . VAL A 1 73  ? -6.106  -12.190 -3.344  1.00 0.00 ? 73  VAL A CA   2  
ATOM   7518   C C    . VAL A 1 73  ? -5.142  -11.884 -2.186  1.00 0.00 ? 73  VAL A C    2  
ATOM   7519   O O    . VAL A 1 73  ? -5.195  -10.808 -1.587  1.00 0.00 ? 73  VAL A O    2  
ATOM   7520   C CB   . VAL A 1 73  ? -7.474  -12.548 -2.762  1.00 0.00 ? 73  VAL A CB   2  
ATOM   7521   C CG1  . VAL A 1 73  ? -8.388  -13.069 -3.873  1.00 0.00 ? 73  VAL A CG1  2  
ATOM   7522   C CG2  . VAL A 1 73  ? -7.304  -13.626 -1.690  1.00 0.00 ? 73  VAL A CG2  2  
ATOM   7523   H H    . VAL A 1 73  ? -6.182  -14.074 -4.301  1.00 0.00 ? 73  VAL A H    2  
ATOM   7524   H HA   . VAL A 1 73  ? -6.220  -11.303 -3.947  1.00 0.00 ? 73  VAL A HA   2  
ATOM   7525   H HB   . VAL A 1 73  ? -7.916  -11.667 -2.320  1.00 0.00 ? 73  VAL A HB   2  
ATOM   7526   H HG11 . VAL A 1 73  ? -7.928  -13.923 -4.348  1.00 0.00 ? 73  VAL A HG11 2  
ATOM   7527   H HG12 . VAL A 1 73  ? -9.338  -13.360 -3.450  1.00 0.00 ? 73  VAL A HG12 2  
ATOM   7528   H HG13 . VAL A 1 73  ? -8.544  -12.290 -4.605  1.00 0.00 ? 73  VAL A HG13 2  
ATOM   7529   H HG21 . VAL A 1 73  ? -6.521  -14.307 -1.986  1.00 0.00 ? 73  VAL A HG21 2  
ATOM   7530   H HG22 . VAL A 1 73  ? -7.040  -13.160 -0.752  1.00 0.00 ? 73  VAL A HG22 2  
ATOM   7531   H HG23 . VAL A 1 73  ? -8.230  -14.169 -1.574  1.00 0.00 ? 73  VAL A HG23 2  
ATOM   7532   N N    . LEU A 1 74  ? -4.293  -12.832 -1.864  1.00 0.00 ? 74  LEU A N    2  
ATOM   7533   C CA   . LEU A 1 74  ? -3.345  -12.629 -0.766  1.00 0.00 ? 74  LEU A CA   2  
ATOM   7534   C C    . LEU A 1 74  ? -2.576  -11.336 -0.946  1.00 0.00 ? 74  LEU A C    2  
ATOM   7535   O O    . LEU A 1 74  ? -2.172  -10.684 0.023   1.00 0.00 ? 74  LEU A O    2  
ATOM   7536   C CB   . LEU A 1 74  ? -2.406  -13.834 -0.753  1.00 0.00 ? 74  LEU A CB   2  
ATOM   7537   C CG   . LEU A 1 74  ? -1.295  -13.661 0.277   1.00 0.00 ? 74  LEU A CG   2  
ATOM   7538   C CD1  . LEU A 1 74  ? -1.906  -13.571 1.680   1.00 0.00 ? 74  LEU A CD1  2  
ATOM   7539   C CD2  . LEU A 1 74  ? -0.346  -14.871 0.188   1.00 0.00 ? 74  LEU A CD2  2  
ATOM   7540   H H    . LEU A 1 74  ? -4.291  -13.681 -2.346  1.00 0.00 ? 74  LEU A H    2  
ATOM   7541   H HA   . LEU A 1 74  ? -3.886  -12.583 0.163   1.00 0.00 ? 74  LEU A HA   2  
ATOM   7542   H HB2  . LEU A 1 74  ? -2.974  -14.721 -0.513  1.00 0.00 ? 74  LEU A HB2  2  
ATOM   7543   H HB3  . LEU A 1 74  ? -1.967  -13.949 -1.733  1.00 0.00 ? 74  LEU A HB3  2  
ATOM   7544   H HG   . LEU A 1 74  ? -0.746  -12.756 0.065   1.00 0.00 ? 74  LEU A HG   2  
ATOM   7545   H HD11 . LEU A 1 74  ? -2.748  -14.246 1.754   1.00 0.00 ? 74  LEU A HD11 2  
ATOM   7546   H HD12 . LEU A 1 74  ? -1.162  -13.845 2.414   1.00 0.00 ? 74  LEU A HD12 2  
ATOM   7547   H HD13 . LEU A 1 74  ? -2.237  -12.562 1.863   1.00 0.00 ? 74  LEU A HD13 2  
ATOM   7548   H HD21 . LEU A 1 74  ? -0.282  -15.208 -0.830  1.00 0.00 ? 74  LEU A HD21 2  
ATOM   7549   H HD22 . LEU A 1 74  ? 0.642   -14.592 0.528   1.00 0.00 ? 74  LEU A HD22 2  
ATOM   7550   H HD23 . LEU A 1 74  ? -0.725  -15.668 0.810   1.00 0.00 ? 74  LEU A HD23 2  
ATOM   7551   N N    . VAL A 1 75  ? -2.346  -10.987 -2.209  1.00 0.00 ? 75  VAL A N    2  
ATOM   7552   C CA   . VAL A 1 75  ? -1.584  -9.788  -2.531  1.00 0.00 ? 75  VAL A CA   2  
ATOM   7553   C C    . VAL A 1 75  ? -2.455  -8.558  -2.277  1.00 0.00 ? 75  VAL A C    2  
ATOM   7554   O O    . VAL A 1 75  ? -2.029  -7.618  -1.620  1.00 0.00 ? 75  VAL A O    2  
ATOM   7555   C CB   . VAL A 1 75  ? -1.136  -9.827  -3.996  1.00 0.00 ? 75  VAL A CB   2  
ATOM   7556   C CG1  . VAL A 1 75  ? -0.316  -8.574  -4.317  1.00 0.00 ? 75  VAL A CG1  2  
ATOM   7557   C CG2  . VAL A 1 75  ? -0.289  -11.085 -4.246  1.00 0.00 ? 75  VAL A CG2  2  
ATOM   7558   H H    . VAL A 1 75  ? -2.673  -11.566 -2.928  1.00 0.00 ? 75  VAL A H    2  
ATOM   7559   H HA   . VAL A 1 75  ? -0.718  -9.738  -1.889  1.00 0.00 ? 75  VAL A HA   2  
ATOM   7560   H HB   . VAL A 1 75  ? -2.010  -9.851  -4.633  1.00 0.00 ? 75  VAL A HB   2  
ATOM   7561   H HG11 . VAL A 1 75  ? 0.176   -8.228  -3.420  1.00 0.00 ? 75  VAL A HG11 2  
ATOM   7562   H HG12 . VAL A 1 75  ? 0.426   -8.812  -5.064  1.00 0.00 ? 75  VAL A HG12 2  
ATOM   7563   H HG13 . VAL A 1 75  ? -0.968  -7.801  -4.691  1.00 0.00 ? 75  VAL A HG13 2  
ATOM   7564   H HG21 . VAL A 1 75  ? -0.827  -11.955 -3.899  1.00 0.00 ? 75  VAL A HG21 2  
ATOM   7565   H HG22 . VAL A 1 75  ? -0.091  -11.187 -5.303  1.00 0.00 ? 75  VAL A HG22 2  
ATOM   7566   H HG23 . VAL A 1 75  ? 0.648   -11.007 -3.713  1.00 0.00 ? 75  VAL A HG23 2  
ATOM   7567   N N    . HIS A 1 76  ? -4.018  -8.516  -2.785  1.00 0.00 ? 76  HIS A N    2  
ATOM   7568   C CA   . HIS A 1 76  ? -4.972  -7.403  -2.577  1.00 0.00 ? 76  HIS A CA   2  
ATOM   7569   C C    . HIS A 1 76  ? -4.994  -7.014  -1.107  1.00 0.00 ? 76  HIS A C    2  
ATOM   7570   O O    . HIS A 1 76  ? -5.122  -5.836  -0.768  1.00 0.00 ? 76  HIS A O    2  
ATOM   7571   C CB   . HIS A 1 76  ? -6.400  -7.799  -3.020  1.00 0.00 ? 76  HIS A CB   2  
ATOM   7572   C CG   . HIS A 1 76  ? -7.372  -6.623  -2.895  1.00 0.00 ? 76  HIS A CG   2  
ATOM   7573   N ND1  . HIS A 1 76  ? -6.946  -5.297  -2.777  1.00 0.00 ? 76  HIS A ND1  2  
ATOM   7574   C CD2  . HIS A 1 76  ? -8.761  -6.563  -2.891  1.00 0.00 ? 76  HIS A CD2  2  
ATOM   7575   C CE1  . HIS A 1 76  ? -8.050  -4.508  -2.708  1.00 0.00 ? 76  HIS A CE1  2  
ATOM   7576   N NE2  . HIS A 1 76  ? -9.171  -5.230  -2.775  1.00 0.00 ? 76  HIS A NE2  2  
ATOM   7577   H H    . HIS A 1 76  ? -4.311  -9.316  -3.266  1.00 0.00 ? 76  HIS A H    2  
ATOM   7578   H HA   . HIS A 1 76  ? -4.647  -6.552  -3.159  1.00 0.00 ? 76  HIS A HA   2  
ATOM   7579   H HB2  . HIS A 1 76  ? -6.371  -8.123  -4.049  1.00 0.00 ? 76  HIS A HB2  2  
ATOM   7580   H HB3  . HIS A 1 76  ? -6.747  -8.613  -2.403  1.00 0.00 ? 76  HIS A HB3  2  
ATOM   7581   H HD1  . HIS A 1 76  ? -6.015  -4.990  -2.748  1.00 0.00 ? 76  HIS A HD1  2  
ATOM   7582   H HD2  . HIS A 1 76  ? -9.421  -7.413  -2.962  1.00 0.00 ? 76  HIS A HD2  2  
ATOM   7583   H HE1  . HIS A 1 76  ? -8.024  -3.433  -2.613  1.00 0.00 ? 76  HIS A HE1  2  
ATOM   7584   N N    . ALA A 1 77  ? -4.829  -8.021  -0.240  1.00 0.00 ? 77  ALA A N    2  
ATOM   7585   C CA   . ALA A 1 77  ? -4.801  -7.790  1.197   1.00 0.00 ? 77  ALA A CA   2  
ATOM   7586   C C    . ALA A 1 77  ? -3.420  -7.324  1.644   1.00 0.00 ? 77  ALA A C    2  
ATOM   7587   O O    . ALA A 1 77  ? -3.290  -6.384  2.431   1.00 0.00 ? 77  ALA A O    2  
ATOM   7588   C CB   . ALA A 1 77  ? -5.181  -9.075  1.943   1.00 0.00 ? 77  ALA A CB   2  
ATOM   7589   H H    . ALA A 1 77  ? -4.706  -8.932  -0.592  1.00 0.00 ? 77  ALA A H    2  
ATOM   7590   H HA   . ALA A 1 77  ? -5.526  -7.024  1.438   1.00 0.00 ? 77  ALA A HA   2  
ATOM   7591   H HB1  . ALA A 1 77  ? -4.737  -9.923  1.444   1.00 0.00 ? 77  ALA A HB1  2  
ATOM   7592   H HB2  . ALA A 1 77  ? -4.814  -9.022  2.958   1.00 0.00 ? 77  ALA A HB2  2  
ATOM   7593   H HB3  . ALA A 1 77  ? -6.256  -9.185  1.953   1.00 0.00 ? 77  ALA A HB3  2  
ATOM   7594   N N    . GLN A 1 78  ? -2.365  -7.999  1.167   1.00 0.00 ? 78  GLN A N    2  
ATOM   7595   C CA   . GLN A 1 78  ? -1.008  -7.644  1.563   1.00 0.00 ? 78  GLN A CA   2  
ATOM   7596   C C    . GLN A 1 78  ? -0.684  -6.220  1.111   1.00 0.00 ? 78  GLN A C    2  
ATOM   7597   O O    . GLN A 1 78  ? -0.191  -5.401  1.888   1.00 0.00 ? 78  GLN A O    2  
ATOM   7598   C CB   . GLN A 1 78  ? -0.018  -8.635  0.947   1.00 0.00 ? 78  GLN A CB   2  
ATOM   7599   C CG   . GLN A 1 78  ? 1.331   -8.535  1.658   1.00 0.00 ? 78  GLN A CG   2  
ATOM   7600   C CD   . GLN A 1 78  ? 2.317   -9.520  1.038   1.00 0.00 ? 78  GLN A CD   2  
ATOM   7601   O OE1  . GLN A 1 78  ? 2.960   -10.288 1.753   1.00 0.00 ? 78  GLN A OE1  2  
ATOM   7602   N NE2  . GLN A 1 78  ? 2.478   -9.543  -0.257  1.00 0.00 ? 78  GLN A NE2  2  
ATOM   7603   H H    . GLN A 1 78  ? -2.509  -8.756  0.557   1.00 0.00 ? 78  GLN A H    2  
ATOM   7604   H HA   . GLN A 1 78  ? -0.935  -7.693  2.639   1.00 0.00 ? 78  GLN A HA   2  
ATOM   7605   H HB2  . GLN A 1 78  ? -0.404  -9.639  1.050   1.00 0.00 ? 78  GLN A HB2  2  
ATOM   7606   H HB3  . GLN A 1 78  ? 0.113   -8.407  -0.100  1.00 0.00 ? 78  GLN A HB3  2  
ATOM   7607   H HG2  . GLN A 1 78  ? 1.712   -7.533  1.557   1.00 0.00 ? 78  GLN A HG2  2  
ATOM   7608   H HG3  . GLN A 1 78  ? 1.203   -8.768  2.704   1.00 0.00 ? 78  GLN A HG3  2  
ATOM   7609   H HE21 . GLN A 1 78  ? 1.969   -8.930  -0.826  1.00 0.00 ? 78  GLN A HE21 2  
ATOM   7610   H HE22 . GLN A 1 78  ? 3.111   -10.175 -0.661  1.00 0.00 ? 78  GLN A HE22 2  
ATOM   7611   N N    . LEU A 1 79  ? -0.993  -5.926  -0.144  1.00 0.00 ? 79  LEU A N    2  
ATOM   7612   C CA   . LEU A 1 79  ? -0.767  -4.590  -0.693  1.00 0.00 ? 79  LEU A CA   2  
ATOM   7613   C C    . LEU A 1 79  ? -1.449  -3.526  0.157   1.00 0.00 ? 79  LEU A C    2  
ATOM   7614   O O    . LEU A 1 79  ? -0.835  -2.531  0.528   1.00 0.00 ? 79  LEU A O    2  
ATOM   7615   C CB   . LEU A 1 79  ? -1.300  -4.517  -2.134  1.00 0.00 ? 79  LEU A CB   2  
ATOM   7616   C CG   . LEU A 1 79  ? -1.163  -3.087  -2.690  1.00 0.00 ? 79  LEU A CG   2  
ATOM   7617   C CD1  . LEU A 1 79  ? 0.293   -2.624  -2.578  1.00 0.00 ? 79  LEU A CD1  2  
ATOM   7618   C CD2  . LEU A 1 79  ? -1.612  -3.057  -4.161  1.00 0.00 ? 79  LEU A CD2  2  
ATOM   7619   H H    . LEU A 1 79  ? -1.399  -6.618  -0.712  1.00 0.00 ? 79  LEU A H    2  
ATOM   7620   H HA   . LEU A 1 79  ? 0.294   -4.396  -0.699  1.00 0.00 ? 79  LEU A HA   2  
ATOM   7621   H HB2  . LEU A 1 79  ? -0.738  -5.198  -2.752  1.00 0.00 ? 79  LEU A HB2  2  
ATOM   7622   H HB3  . LEU A 1 79  ? -2.340  -4.802  -2.141  1.00 0.00 ? 79  LEU A HB3  2  
ATOM   7623   H HG   . LEU A 1 79  ? -1.789  -2.417  -2.113  1.00 0.00 ? 79  LEU A HG   2  
ATOM   7624   H HD11 . LEU A 1 79  ? 0.951   -3.471  -2.699  1.00 0.00 ? 79  LEU A HD11 2  
ATOM   7625   H HD12 . LEU A 1 79  ? 0.500   -1.892  -3.343  1.00 0.00 ? 79  LEU A HD12 2  
ATOM   7626   H HD13 . LEU A 1 79  ? 0.453   -2.180  -1.604  1.00 0.00 ? 79  LEU A HD13 2  
ATOM   7627   H HD21 . LEU A 1 79  ? -1.317  -3.974  -4.653  1.00 0.00 ? 79  LEU A HD21 2  
ATOM   7628   H HD22 . LEU A 1 79  ? -2.686  -2.961  -4.206  1.00 0.00 ? 79  LEU A HD22 2  
ATOM   7629   H HD23 . LEU A 1 79  ? -1.158  -2.217  -4.666  1.00 0.00 ? 79  LEU A HD23 2  
ATOM   7630   N N    . HIS A 1 80  ? -2.723  -3.734  0.456   1.00 0.00 ? 80  HIS A N    2  
ATOM   7631   C CA   . HIS A 1 80  ? -3.463  -2.764  1.253   1.00 0.00 ? 80  HIS A CA   2  
ATOM   7632   C C    . HIS A 1 80  ? -2.924  -2.695  2.676   1.00 0.00 ? 80  HIS A C    2  
ATOM   7633   O O    . HIS A 1 80  ? -2.730  -1.608  3.226   1.00 0.00 ? 80  HIS A O    2  
ATOM   7634   C CB   . HIS A 1 80  ? -4.948  -3.131  1.273   1.00 0.00 ? 80  HIS A CB   2  
ATOM   7635   C CG   . HIS A 1 80  ? -5.634  -2.454  0.118   1.00 0.00 ? 80  HIS A CG   2  
ATOM   7636   N ND1  . HIS A 1 80  ? -6.478  -1.374  0.297   1.00 0.00 ? 80  HIS A ND1  2  
ATOM   7637   C CD2  . HIS A 1 80  ? -5.600  -2.682  -1.235  1.00 0.00 ? 80  HIS A CD2  2  
ATOM   7638   C CE1  . HIS A 1 80  ? -6.913  -0.991  -0.918  1.00 0.00 ? 80  HIS A CE1  2  
ATOM   7639   N NE2  . HIS A 1 80  ? -6.407  -1.758  -1.887  1.00 0.00 ? 80  HIS A NE2  2  
ATOM   7640   H H    . HIS A 1 80  ? -3.172  -4.549  0.133   1.00 0.00 ? 80  HIS A H    2  
ATOM   7641   H HA   . HIS A 1 80  ? -3.353  -1.792  0.799   1.00 0.00 ? 80  HIS A HA   2  
ATOM   7642   H HB2  . HIS A 1 80  ? -5.058  -4.203  1.182   1.00 0.00 ? 80  HIS A HB2  2  
ATOM   7643   H HB3  . HIS A 1 80  ? -5.391  -2.798  2.199   1.00 0.00 ? 80  HIS A HB3  2  
ATOM   7644   H HD1  . HIS A 1 80  ? -6.720  -0.964  1.159   1.00 0.00 ? 80  HIS A HD1  2  
ATOM   7645   H HD2  . HIS A 1 80  ? -5.029  -3.464  -1.717  1.00 0.00 ? 80  HIS A HD2  2  
ATOM   7646   H HE1  . HIS A 1 80  ? -7.594  -0.166  -1.089  1.00 0.00 ? 80  HIS A HE1  2  
ATOM   7647   H HE2  . HIS A 1 80  ? -6.569  -1.685  -2.851  1.00 0.00 ? 80  HIS A HE2  2  
ATOM   7648   N N    . LEU A 1 81  ? -2.691  -3.854  3.272   1.00 0.00 ? 81  LEU A N    2  
ATOM   7649   C CA   . LEU A 1 81  ? -2.184  -3.906  4.640   1.00 0.00 ? 81  LEU A CA   2  
ATOM   7650   C C    . LEU A 1 81  ? -0.785  -3.296  4.751   1.00 0.00 ? 81  LEU A C    2  
ATOM   7651   O O    . LEU A 1 81  ? -0.508  -2.527  5.678   1.00 0.00 ? 81  LEU A O    2  
ATOM   7652   C CB   . LEU A 1 81  ? -2.149  -5.356  5.128   1.00 0.00 ? 81  LEU A CB   2  
ATOM   7653   C CG   . LEU A 1 81  ? -3.580  -5.874  5.325   1.00 0.00 ? 81  LEU A CG   2  
ATOM   7654   C CD1  . LEU A 1 81  ? -3.547  -7.391  5.529   1.00 0.00 ? 81  LEU A CD1  2  
ATOM   7655   C CD2  . LEU A 1 81  ? -4.231  -5.206  6.548   1.00 0.00 ? 81  LEU A CD2  2  
ATOM   7656   H H    . LEU A 1 81  ? -2.871  -4.691  2.789   1.00 0.00 ? 81  LEU A H    2  
ATOM   7657   H HA   . LEU A 1 81  ? -2.850  -3.346  5.274   1.00 0.00 ? 81  LEU A HA   2  
ATOM   7658   H HB2  . LEU A 1 81  ? -1.642  -5.966  4.390   1.00 0.00 ? 81  LEU A HB2  2  
ATOM   7659   H HB3  . LEU A 1 81  ? -1.612  -5.409  6.064   1.00 0.00 ? 81  LEU A HB3  2  
ATOM   7660   H HG   . LEU A 1 81  ? -4.161  -5.650  4.440   1.00 0.00 ? 81  LEU A HG   2  
ATOM   7661   H HD11 . LEU A 1 81  ? -2.716  -7.652  6.169   1.00 0.00 ? 81  LEU A HD11 2  
ATOM   7662   H HD12 . LEU A 1 81  ? -4.469  -7.716  5.986   1.00 0.00 ? 81  LEU A HD12 2  
ATOM   7663   H HD13 . LEU A 1 81  ? -3.428  -7.878  4.571   1.00 0.00 ? 81  LEU A HD13 2  
ATOM   7664   H HD21 . LEU A 1 81  ? -3.486  -5.030  7.311   1.00 0.00 ? 81  LEU A HD21 2  
ATOM   7665   H HD22 . LEU A 1 81  ? -4.671  -4.264  6.253   1.00 0.00 ? 81  LEU A HD22 2  
ATOM   7666   H HD23 . LEU A 1 81  ? -5.001  -5.853  6.942   1.00 0.00 ? 81  LEU A HD23 2  
ATOM   7667   N N    . MET A 1 82  ? 0.094   -3.643  3.815   1.00 0.00 ? 82  MET A N    2  
ATOM   7668   C CA   . MET A 1 82  ? 1.457   -3.115  3.837   1.00 0.00 ? 82  MET A CA   2  
ATOM   7669   C C    . MET A 1 82  ? 1.447   -1.597  3.696   1.00 0.00 ? 82  MET A C    2  
ATOM   7670   O O    . MET A 1 82  ? 2.154   -0.885  4.413   1.00 0.00 ? 82  MET A O    2  
ATOM   7671   C CB   . MET A 1 82  ? 2.279   -3.727  2.695   1.00 0.00 ? 82  MET A CB   2  
ATOM   7672   C CG   . MET A 1 82  ? 2.655   -5.177  3.029   1.00 0.00 ? 82  MET A CG   2  
ATOM   7673   S SD   . MET A 1 82  ? 3.792   -5.218  4.443   1.00 0.00 ? 82  MET A SD   2  
ATOM   7674   C CE   . MET A 1 82  ? 5.273   -4.609  3.596   1.00 0.00 ? 82  MET A CE   2  
ATOM   7675   H H    . MET A 1 82  ? -0.176  -4.258  3.098   1.00 0.00 ? 82  MET A H    2  
ATOM   7676   H HA   . MET A 1 82  ? 1.913   -3.373  4.779   1.00 0.00 ? 82  MET A HA   2  
ATOM   7677   H HB2  . MET A 1 82  ? 1.692   -3.711  1.787   1.00 0.00 ? 82  MET A HB2  2  
ATOM   7678   H HB3  . MET A 1 82  ? 3.178   -3.147  2.549   1.00 0.00 ? 82  MET A HB3  2  
ATOM   7679   H HG2  . MET A 1 82  ? 1.761   -5.731  3.273   1.00 0.00 ? 82  MET A HG2  2  
ATOM   7680   H HG3  . MET A 1 82  ? 3.132   -5.626  2.171   1.00 0.00 ? 82  MET A HG3  2  
ATOM   7681   H HE1  . MET A 1 82  ? 5.316   -5.022  2.598   1.00 0.00 ? 82  MET A HE1  2  
ATOM   7682   H HE2  . MET A 1 82  ? 5.235   -3.533  3.535   1.00 0.00 ? 82  MET A HE2  2  
ATOM   7683   H HE3  . MET A 1 82  ? 6.153   -4.904  4.150   1.00 0.00 ? 82  MET A HE3  2  
ATOM   7684   N N    . THR A 1 83  ? 0.639   -1.107  2.765   1.00 0.00 ? 83  THR A N    2  
ATOM   7685   C CA   . THR A 1 83  ? 0.538   0.329   2.532   1.00 0.00 ? 83  THR A CA   2  
ATOM   7686   C C    . THR A 1 83  ? -0.010  1.039   3.766   1.00 0.00 ? 83  THR A C    2  
ATOM   7687   O O    . THR A 1 83  ? 0.534   2.053   4.210   1.00 0.00 ? 83  THR A O    2  
ATOM   7688   C CB   . THR A 1 83  ? -0.386  0.610   1.336   1.00 0.00 ? 83  THR A CB   2  
ATOM   7689   O OG1  . THR A 1 83  ? -1.558  -0.176  1.461   1.00 0.00 ? 83  THR A OG1  2  
ATOM   7690   C CG2  . THR A 1 83  ? 0.318   0.261   0.020   1.00 0.00 ? 83  THR A CG2  2  
ATOM   7691   H H    . THR A 1 83  ? 0.094   -1.721  2.227   1.00 0.00 ? 83  THR A H    2  
ATOM   7692   H HA   . THR A 1 83  ? 1.516   0.721   2.313   1.00 0.00 ? 83  THR A HA   2  
ATOM   7693   H HB   . THR A 1 83  ? -0.658  1.656   1.332   1.00 0.00 ? 83  THR A HB   2  
ATOM   7694   H HG1  . THR A 1 83  ? -2.314  0.366   1.226   1.00 0.00 ? 83  THR A HG1  2  
ATOM   7695   H HG21 . THR A 1 83  ? 1.102   -0.461  0.203   1.00 0.00 ? 83  THR A HG21 2  
ATOM   7696   H HG22 . THR A 1 83  ? -0.398  -0.161  -0.671  1.00 0.00 ? 83  THR A HG22 2  
ATOM   7697   H HG23 . THR A 1 83  ? 0.747   1.154   -0.410  1.00 0.00 ? 83  THR A HG23 2  
ATOM   7698   N N    . SER A 1 84  ? -1.094  0.507   4.317   1.00 0.00 ? 84  SER A N    2  
ATOM   7699   C CA   . SER A 1 84  ? -1.716  1.110   5.499   1.00 0.00 ? 84  SER A CA   2  
ATOM   7700   C C    . SER A 1 84  ? -0.768  1.114   6.696   1.00 0.00 ? 84  SER A C    2  
ATOM   7701   O O    . SER A 1 84  ? -0.623  2.132   7.376   1.00 0.00 ? 84  SER A O    2  
ATOM   7702   C CB   . SER A 1 84  ? -2.997  0.359   5.863   1.00 0.00 ? 84  SER A CB   2  
ATOM   7703   O OG   . SER A 1 84  ? -4.015  0.697   4.931   1.00 0.00 ? 84  SER A OG   2  
ATOM   7704   H H    . SER A 1 84  ? -1.492  -0.300  3.919   1.00 0.00 ? 84  SER A H    2  
ATOM   7705   H HA   . SER A 1 84  ? -1.975  2.131   5.266   1.00 0.00 ? 84  SER A HA   2  
ATOM   7706   H HB2  . SER A 1 84  ? -2.819  -0.703  5.830   1.00 0.00 ? 84  SER A HB2  2  
ATOM   7707   H HB3  . SER A 1 84  ? -3.305  0.639   6.865   1.00 0.00 ? 84  SER A HB3  2  
ATOM   7708   H HG   . SER A 1 84  ? -3.770  0.329   4.073   1.00 0.00 ? 84  SER A HG   2  
ATOM   7709   N N    . MET A 1 85  ? -0.129  -0.022  6.961   1.00 0.00 ? 85  MET A N    2  
ATOM   7710   C CA   . MET A 1 85  ? 0.796   -0.113  8.092   1.00 0.00 ? 85  MET A CA   2  
ATOM   7711   C C    . MET A 1 85  ? 1.933   0.890   7.950   1.00 0.00 ? 85  MET A C    2  
ATOM   7712   O O    . MET A 1 85  ? 2.280   1.596   8.900   1.00 0.00 ? 85  MET A O    2  
ATOM   7713   C CB   . MET A 1 85  ? 1.353   -1.534  8.206   1.00 0.00 ? 85  MET A CB   2  
ATOM   7714   C CG   . MET A 1 85  ? 2.155   -1.666  9.505   1.00 0.00 ? 85  MET A CG   2  
ATOM   7715   S SD   . MET A 1 85  ? 2.516   -3.413  9.828   1.00 0.00 ? 85  MET A SD   2  
ATOM   7716   C CE   . MET A 1 85  ? 3.856   -3.621  8.630   1.00 0.00 ? 85  MET A CE   2  
ATOM   7717   H H    . MET A 1 85  ? -0.276  -0.809  6.390   1.00 0.00 ? 85  MET A H    2  
ATOM   7718   H HA   . MET A 1 85  ? 0.252   0.113   8.994   1.00 0.00 ? 85  MET A HA   2  
ATOM   7719   H HB2  . MET A 1 85  ? 0.536   -2.241  8.212   1.00 0.00 ? 85  MET A HB2  2  
ATOM   7720   H HB3  . MET A 1 85  ? 1.997   -1.734  7.365   1.00 0.00 ? 85  MET A HB3  2  
ATOM   7721   H HG2  . MET A 1 85  ? 3.081   -1.119  9.413   1.00 0.00 ? 85  MET A HG2  2  
ATOM   7722   H HG3  . MET A 1 85  ? 1.580   -1.261  10.325  1.00 0.00 ? 85  MET A HG3  2  
ATOM   7723   H HE1  . MET A 1 85  ? 3.495   -3.404  7.639   1.00 0.00 ? 85  MET A HE1  2  
ATOM   7724   H HE2  . MET A 1 85  ? 4.664   -2.945  8.874   1.00 0.00 ? 85  MET A HE2  2  
ATOM   7725   H HE3  . MET A 1 85  ? 4.211   -4.642  8.664   1.00 0.00 ? 85  MET A HE3  2  
ATOM   7726   N N    . LEU A 1 86  ? 2.508   0.945   6.760   1.00 0.00 ? 86  LEU A N    2  
ATOM   7727   C CA   . LEU A 1 86  ? 3.607   1.861   6.497   1.00 0.00 ? 86  LEU A CA   2  
ATOM   7728   C C    . LEU A 1 86  ? 3.149   3.307   6.669   1.00 0.00 ? 86  LEU A C    2  
ATOM   7729   O O    . LEU A 1 86  ? 3.824   4.122   7.302   1.00 0.00 ? 86  LEU A O    2  
ATOM   7730   C CB   . LEU A 1 86  ? 4.113   1.641   5.071   1.00 0.00 ? 86  LEU A CB   2  
ATOM   7731   C CG   . LEU A 1 86  ? 5.476   2.323   4.894   1.00 0.00 ? 86  LEU A CG   2  
ATOM   7732   C CD1  . LEU A 1 86  ? 6.580   1.490   5.577   1.00 0.00 ? 86  LEU A CD1  2  
ATOM   7733   C CD2  . LEU A 1 86  ? 5.786   2.476   3.393   1.00 0.00 ? 86  LEU A CD2  2  
ATOM   7734   H H    . LEU A 1 86  ? 2.183   0.362   6.040   1.00 0.00 ? 86  LEU A H    2  
ATOM   7735   H HA   . LEU A 1 86  ? 4.406   1.661   7.193   1.00 0.00 ? 86  LEU A HA   2  
ATOM   7736   H HB2  . LEU A 1 86  ? 4.205   0.581   4.884   1.00 0.00 ? 86  LEU A HB2  2  
ATOM   7737   H HB3  . LEU A 1 86  ? 3.403   2.067   4.374   1.00 0.00 ? 86  LEU A HB3  2  
ATOM   7738   H HG   . LEU A 1 86  ? 5.439   3.302   5.351   1.00 0.00 ? 86  LEU A HG   2  
ATOM   7739   H HD11 . LEU A 1 86  ? 6.133   0.687   6.148   1.00 0.00 ? 86  LEU A HD11 2  
ATOM   7740   H HD12 . LEU A 1 86  ? 7.245   1.079   4.832   1.00 0.00 ? 86  LEU A HD12 2  
ATOM   7741   H HD13 . LEU A 1 86  ? 7.144   2.127   6.244   1.00 0.00 ? 86  LEU A HD13 2  
ATOM   7742   H HD21 . LEU A 1 86  ? 4.889   2.773   2.865   1.00 0.00 ? 86  LEU A HD21 2  
ATOM   7743   H HD22 . LEU A 1 86  ? 6.545   3.233   3.261   1.00 0.00 ? 86  LEU A HD22 2  
ATOM   7744   H HD23 . LEU A 1 86  ? 6.143   1.537   2.998   1.00 0.00 ? 86  LEU A HD23 2  
ATOM   7745   N N    . ALA A 1 87  ? 1.991   3.613   6.102   1.00 0.00 ? 87  ALA A N    2  
ATOM   7746   C CA   . ALA A 1 87  ? 1.438   4.963   6.193   1.00 0.00 ? 87  ALA A CA   2  
ATOM   7747   C C    . ALA A 1 87  ? 1.299   5.385   7.650   1.00 0.00 ? 87  ALA A C    2  
ATOM   7748   O O    . ALA A 1 87  ? 1.708   6.482   8.044   1.00 0.00 ? 87  ALA A O    2  
ATOM   7749   C CB   . ALA A 1 87  ? 0.060   5.017   5.506   1.00 0.00 ? 87  ALA A CB   2  
ATOM   7750   H H    . ALA A 1 87  ? 1.496   2.920   5.614   1.00 0.00 ? 87  ALA A H    2  
ATOM   7751   H HA   . ALA A 1 87  ? 2.104   5.646   5.699   1.00 0.00 ? 87  ALA A HA   2  
ATOM   7752   H HB1  . ALA A 1 87  ? -0.214  4.030   5.161   1.00 0.00 ? 87  ALA A HB1  2  
ATOM   7753   H HB2  . ALA A 1 87  ? -0.688  5.371   6.206   1.00 0.00 ? 87  ALA A HB2  2  
ATOM   7754   H HB3  . ALA A 1 87  ? 0.104   5.690   4.661   1.00 0.00 ? 87  ALA A HB3  2  
ATOM   7755   N N    . ARG A 1 88  ? 0.716   4.512   8.453   1.00 0.00 ? 88  ARG A N    2  
ATOM   7756   C CA   . ARG A 1 88  ? 0.524   4.819   9.862   1.00 0.00 ? 88  ARG A CA   2  
ATOM   7757   C C    . ARG A 1 88  ? 1.849   5.081   10.566  1.00 0.00 ? 88  ARG A C    2  
ATOM   7758   O O    . ARG A 1 88  ? 1.968   6.028   11.345  1.00 0.00 ? 88  ARG A O    2  
ATOM   7759   C CB   . ARG A 1 88  ? -0.185  3.673   10.585  1.00 0.00 ? 88  ARG A CB   2  
ATOM   7760   C CG   . ARG A 1 88  ? -0.646  4.172   11.966  1.00 0.00 ? 88  ARG A CG   2  
ATOM   7761   C CD   . ARG A 1 88  ? -0.701  3.026   12.968  1.00 0.00 ? 88  ARG A CD   2  
ATOM   7762   N NE   . ARG A 1 88  ? -0.124  3.464   14.245  1.00 0.00 ? 88  ARG A NE   2  
ATOM   7763   C CZ   . ARG A 1 88  ? 1.099   3.969   14.351  1.00 0.00 ? 88  ARG A CZ   2  
ATOM   7764   N NH1  . ARG A 1 88  ? 1.896   3.980   13.335  1.00 0.00 ? 88  ARG A NH1  2  
ATOM   7765   N NH2  . ARG A 1 88  ? 1.493   4.450   15.490  1.00 0.00 ? 88  ARG A NH2  2  
ATOM   7766   H H    . ARG A 1 88  ? 0.409   3.652   8.091   1.00 0.00 ? 88  ARG A H    2  
ATOM   7767   H HA   . ARG A 1 88  ? -0.089  5.702   9.940   1.00 0.00 ? 88  ARG A HA   2  
ATOM   7768   H HB2  . ARG A 1 88  ? -1.039  3.355   10.006  1.00 0.00 ? 88  ARG A HB2  2  
ATOM   7769   H HB3  . ARG A 1 88  ? 0.501   2.847   10.709  1.00 0.00 ? 88  ARG A HB3  2  
ATOM   7770   H HG2  . ARG A 1 88  ? 0.037   4.922   12.331  1.00 0.00 ? 88  ARG A HG2  2  
ATOM   7771   H HG3  . ARG A 1 88  ? -1.632  4.606   11.878  1.00 0.00 ? 88  ARG A HG3  2  
ATOM   7772   H HD2  . ARG A 1 88  ? -1.746  2.756   13.123  1.00 0.00 ? 88  ARG A HD2  2  
ATOM   7773   H HD3  . ARG A 1 88  ? -0.160  2.167   12.589  1.00 0.00 ? 88  ARG A HD3  2  
ATOM   7774   H HE   . ARG A 1 88  ? -0.683  3.432   15.045  1.00 0.00 ? 88  ARG A HE   2  
ATOM   7775   H HH11 . ARG A 1 88  ? 1.593   3.603   12.464  1.00 0.00 ? 88  ARG A HH11 2  
ATOM   7776   H HH12 . ARG A 1 88  ? 2.813   4.368   13.424  1.00 0.00 ? 88  ARG A HH12 2  
ATOM   7777   H HH21 . ARG A 1 88  ? 0.882   4.435   16.281  1.00 0.00 ? 88  ARG A HH21 2  
ATOM   7778   H HH22 . ARG A 1 88  ? 2.402   4.855   15.574  1.00 0.00 ? 88  ARG A HH22 2  
ATOM   7779   N N    . GLU A 1 89  ? 2.836   4.228   10.326  1.00 0.00 ? 89  GLU A N    2  
ATOM   7780   C CA   . GLU A 1 89  ? 4.123   4.402   10.988  1.00 0.00 ? 89  GLU A CA   2  
ATOM   7781   C C    . GLU A 1 89  ? 4.717   5.760   10.658  1.00 0.00 ? 89  GLU A C    2  
ATOM   7782   O O    . GLU A 1 89  ? 5.175   6.478   11.542  1.00 0.00 ? 89  GLU A O    2  
ATOM   7783   C CB   . GLU A 1 89  ? 5.094   3.293   10.589  1.00 0.00 ? 89  GLU A CB   2  
ATOM   7784   C CG   . GLU A 1 89  ? 6.342   3.343   11.485  1.00 0.00 ? 89  GLU A CG   2  
ATOM   7785   C CD   . GLU A 1 89  ? 7.253   2.154   11.185  1.00 0.00 ? 89  GLU A CD   2  
ATOM   7786   O OE1  . GLU A 1 89  ? 6.825   1.267   10.459  1.00 0.00 ? 89  GLU A OE1  2  
ATOM   7787   O OE2  . GLU A 1 89  ? 8.361   2.147   11.681  1.00 0.00 ? 89  GLU A OE2  2  
ATOM   7788   H H    . GLU A 1 89  ? 2.696   3.470   9.710   1.00 0.00 ? 89  GLU A H    2  
ATOM   7789   H HA   . GLU A 1 89  ? 3.966   4.352   12.052  1.00 0.00 ? 89  GLU A HA   2  
ATOM   7790   H HB2  . GLU A 1 89  ? 4.613   2.331   10.706  1.00 0.00 ? 89  GLU A HB2  2  
ATOM   7791   H HB3  . GLU A 1 89  ? 5.392   3.422   9.559   1.00 0.00 ? 89  GLU A HB3  2  
ATOM   7792   H HG2  . GLU A 1 89  ? 6.884   4.261   11.300  1.00 0.00 ? 89  GLU A HG2  2  
ATOM   7793   H HG3  . GLU A 1 89  ? 6.047   3.308   12.522  1.00 0.00 ? 89  GLU A HG3  2  
ATOM   7794   N N    . LEU A 1 90  ? 4.681   6.118   9.388   1.00 0.00 ? 90  LEU A N    2  
ATOM   7795   C CA   . LEU A 1 90  ? 5.206   7.403   8.960   1.00 0.00 ? 90  LEU A CA   2  
ATOM   7796   C C    . LEU A 1 90  ? 4.372   8.536   9.550   1.00 0.00 ? 90  LEU A C    2  
ATOM   7797   O O    . LEU A 1 90  ? 4.909   9.540   10.026  1.00 0.00 ? 90  LEU A O    2  
ATOM   7798   C CB   . LEU A 1 90  ? 5.199   7.451   7.441   1.00 0.00 ? 90  LEU A CB   2  
ATOM   7799   C CG   . LEU A 1 90  ? 6.232   6.447   6.915   1.00 0.00 ? 90  LEU A CG   2  
ATOM   7800   C CD1  . LEU A 1 90  ? 5.997   6.229   5.426   1.00 0.00 ? 90  LEU A CD1  2  
ATOM   7801   C CD2  . LEU A 1 90  ? 7.661   6.975   7.144   1.00 0.00 ? 90  LEU A CD2  2  
ATOM   7802   H H    . LEU A 1 90  ? 4.282   5.510   8.725   1.00 0.00 ? 90  LEU A H    2  
ATOM   7803   H HA   . LEU A 1 90  ? 6.222   7.502   9.307   1.00 0.00 ? 90  LEU A HA   2  
ATOM   7804   H HB2  . LEU A 1 90  ? 4.211   7.180   7.083   1.00 0.00 ? 90  LEU A HB2  2  
ATOM   7805   H HB3  . LEU A 1 90  ? 5.447   8.445   7.103   1.00 0.00 ? 90  LEU A HB3  2  
ATOM   7806   H HG   . LEU A 1 90  ? 6.109   5.506   7.434   1.00 0.00 ? 90  LEU A HG   2  
ATOM   7807   H HD11 . LEU A 1 90  ? 5.845   7.182   4.947   1.00 0.00 ? 90  LEU A HD11 2  
ATOM   7808   H HD12 . LEU A 1 90  ? 6.854   5.737   4.993   1.00 0.00 ? 90  LEU A HD12 2  
ATOM   7809   H HD13 . LEU A 1 90  ? 5.119   5.612   5.291   1.00 0.00 ? 90  LEU A HD13 2  
ATOM   7810   H HD21 . LEU A 1 90  ? 7.666   8.054   7.108   1.00 0.00 ? 90  LEU A HD21 2  
ATOM   7811   H HD22 . LEU A 1 90  ? 8.012   6.647   8.114   1.00 0.00 ? 90  LEU A HD22 2  
ATOM   7812   H HD23 . LEU A 1 90  ? 8.319   6.587   6.379   1.00 0.00 ? 90  LEU A HD23 2  
ATOM   7813   N N    . ILE A 1 91  ? 3.057   8.357   9.542   1.00 0.00 ? 91  ILE A N    2  
ATOM   7814   C CA   . ILE A 1 91  ? 2.167   9.365   10.111  1.00 0.00 ? 91  ILE A CA   2  
ATOM   7815   C C    . ILE A 1 91  ? 2.485   9.539   11.593  1.00 0.00 ? 91  ILE A C    2  
ATOM   7816   O O    . ILE A 1 91  ? 2.528   10.660  12.102  1.00 0.00 ? 91  ILE A O    2  
ATOM   7817   C CB   . ILE A 1 91  ? 0.697   8.972   9.888   1.00 0.00 ? 91  ILE A CB   2  
ATOM   7818   C CG1  . ILE A 1 91  ? 0.375   9.164   8.399   1.00 0.00 ? 91  ILE A CG1  2  
ATOM   7819   C CG2  . ILE A 1 91  ? -0.229  9.863   10.740  1.00 0.00 ? 91  ILE A CG2  2  
ATOM   7820   C CD1  . ILE A 1 91  ? -0.953  8.490   8.051   1.00 0.00 ? 91  ILE A CD1  2  
ATOM   7821   H H    . ILE A 1 91  ? 2.683   7.532   9.165   1.00 0.00 ? 91  ILE A H    2  
ATOM   7822   H HA   . ILE A 1 91  ? 2.353   10.305  9.617   1.00 0.00 ? 91  ILE A HA   2  
ATOM   7823   H HB   . ILE A 1 91  ? 0.553   7.937   10.162  1.00 0.00 ? 91  ILE A HB   2  
ATOM   7824   H HG12 . ILE A 1 91  ? 0.311   10.220  8.178   1.00 0.00 ? 91  ILE A HG12 2  
ATOM   7825   H HG13 . ILE A 1 91  ? 1.164   8.722   7.804   1.00 0.00 ? 91  ILE A HG13 2  
ATOM   7826   H HG21 . ILE A 1 91  ? 0.235   10.826  10.900  1.00 0.00 ? 91  ILE A HG21 2  
ATOM   7827   H HG22 . ILE A 1 91  ? -1.171  10.001  10.229  1.00 0.00 ? 91  ILE A HG22 2  
ATOM   7828   H HG23 . ILE A 1 91  ? -0.406  9.391   11.697  1.00 0.00 ? 91  ILE A HG23 2  
ATOM   7829   H HD11 . ILE A 1 91  ? -1.639  8.596   8.876   1.00 0.00 ? 91  ILE A HD11 2  
ATOM   7830   H HD12 . ILE A 1 91  ? -1.370  8.960   7.171   1.00 0.00 ? 91  ILE A HD12 2  
ATOM   7831   H HD13 . ILE A 1 91  ? -0.785  7.442   7.851   1.00 0.00 ? 91  ILE A HD13 2  
ATOM   7832   N N    . THR A 1 92  ? 2.763   8.431   12.274  1.00 0.00 ? 92  THR A N    2  
ATOM   7833   C CA   . THR A 1 92  ? 3.130   8.500   13.688  1.00 0.00 ? 92  THR A CA   2  
ATOM   7834   C C    . THR A 1 92  ? 4.361   9.388   13.845  1.00 0.00 ? 92  THR A C    2  
ATOM   7835   O O    . THR A 1 92  ? 4.402   10.268  14.708  1.00 0.00 ? 92  THR A O    2  
ATOM   7836   C CB   . THR A 1 92  ? 3.420   7.096   14.231  1.00 0.00 ? 92  THR A CB   2  
ATOM   7837   O OG1  . THR A 1 92  ? 2.213   6.357   14.287  1.00 0.00 ? 92  THR A OG1  2  
ATOM   7838   C CG2  . THR A 1 92  ? 4.025   7.178   15.636  1.00 0.00 ? 92  THR A CG2  2  
ATOM   7839   H H    . THR A 1 92  ? 2.750   7.562   11.817  1.00 0.00 ? 92  THR A H    2  
ATOM   7840   H HA   . THR A 1 92  ? 2.315   8.936   14.242  1.00 0.00 ? 92  THR A HA   2  
ATOM   7841   H HB   . THR A 1 92  ? 4.114   6.595   13.573  1.00 0.00 ? 92  THR A HB   2  
ATOM   7842   H HG1  . THR A 1 92  ? 2.143   5.845   13.476  1.00 0.00 ? 92  THR A HG1  2  
ATOM   7843   H HG21 . THR A 1 92  ? 3.675   8.071   16.135  1.00 0.00 ? 92  THR A HG21 2  
ATOM   7844   H HG22 . THR A 1 92  ? 3.734   6.311   16.208  1.00 0.00 ? 92  THR A HG22 2  
ATOM   7845   H HG23 . THR A 1 92  ? 5.104   7.211   15.560  1.00 0.00 ? 92  THR A HG23 2  
ATOM   7846   N N    . GLU A 1 93  ? 5.353   9.176   12.987  1.00 0.00 ? 93  GLU A N    2  
ATOM   7847   C CA   . GLU A 1 93  ? 6.566   9.988   13.023  1.00 0.00 ? 93  GLU A CA   2  
ATOM   7848   C C    . GLU A 1 93  ? 6.218   11.453  12.767  1.00 0.00 ? 93  GLU A C    2  
ATOM   7849   O O    . GLU A 1 93  ? 6.719   12.358  13.443  1.00 0.00 ? 93  GLU A O    2  
ATOM   7850   C CB   . GLU A 1 93  ? 7.556   9.503   11.961  1.00 0.00 ? 93  GLU A CB   2  
ATOM   7851   C CG   . GLU A 1 93  ? 7.927   8.042   12.236  1.00 0.00 ? 93  GLU A CG   2  
ATOM   7852   C CD   . GLU A 1 93  ? 8.871   7.942   13.435  1.00 0.00 ? 93  GLU A CD   2  
ATOM   7853   O OE1  . GLU A 1 93  ? 9.221   8.972   13.997  1.00 0.00 ? 93  GLU A OE1  2  
ATOM   7854   O OE2  . GLU A 1 93  ? 9.232   6.839   13.783  1.00 0.00 ? 93  GLU A OE2  2  
ATOM   7855   H H    . GLU A 1 93  ? 5.261   8.478   12.303  1.00 0.00 ? 93  GLU A H    2  
ATOM   7856   H HA   . GLU A 1 93  ? 7.022   9.899   13.998  1.00 0.00 ? 93  GLU A HA   2  
ATOM   7857   H HB2  . GLU A 1 93  ? 7.105   9.585   10.983  1.00 0.00 ? 93  GLU A HB2  2  
ATOM   7858   H HB3  . GLU A 1 93  ? 8.449   10.110  11.995  1.00 0.00 ? 93  GLU A HB3  2  
ATOM   7859   H HG2  . GLU A 1 93  ? 7.032   7.478   12.444  1.00 0.00 ? 93  GLU A HG2  2  
ATOM   7860   H HG3  . GLU A 1 93  ? 8.414   7.626   11.366  1.00 0.00 ? 93  GLU A HG3  2  
ATOM   7861   N N    . LEU A 1 94  ? 5.345   11.681  11.786  1.00 0.00 ? 94  LEU A N    2  
ATOM   7862   C CA   . LEU A 1 94  ? 4.918   13.041  11.454  1.00 0.00 ? 94  LEU A CA   2  
ATOM   7863   C C    . LEU A 1 94  ? 4.254   13.693  12.669  1.00 0.00 ? 94  LEU A C    2  
ATOM   7864   O O    . LEU A 1 94  ? 4.505   14.861  12.981  1.00 0.00 ? 94  LEU A O    2  
ATOM   7865   C CB   . LEU A 1 94  ? 3.937   13.027  10.267  1.00 0.00 ? 94  LEU A CB   2  
ATOM   7866   C CG   . LEU A 1 94  ? 4.688   12.730  8.953   1.00 0.00 ? 94  LEU A CG   2  
ATOM   7867   C CD1  . LEU A 1 94  ? 3.714   12.174  7.901   1.00 0.00 ? 94  LEU A CD1  2  
ATOM   7868   C CD2  . LEU A 1 94  ? 5.327   14.017  8.412   1.00 0.00 ? 94  LEU A CD2  2  
ATOM   7869   H H    . LEU A 1 94  ? 4.973   10.921  11.289  1.00 0.00 ? 94  LEU A H    2  
ATOM   7870   H HA   . LEU A 1 94  ? 5.785   13.622  11.188  1.00 0.00 ? 94  LEU A HA   2  
ATOM   7871   H HB2  . LEU A 1 94  ? 3.190   12.264  10.437  1.00 0.00 ? 94  LEU A HB2  2  
ATOM   7872   H HB3  . LEU A 1 94  ? 3.453   13.991  10.196  1.00 0.00 ? 94  LEU A HB3  2  
ATOM   7873   H HG   . LEU A 1 94  ? 5.463   11.998  9.142   1.00 0.00 ? 94  LEU A HG   2  
ATOM   7874   H HD11 . LEU A 1 94  ? 2.721   12.556  8.084   1.00 0.00 ? 94  LEU A HD11 2  
ATOM   7875   H HD12 . LEU A 1 94  ? 4.038   12.477  6.912   1.00 0.00 ? 94  LEU A HD12 2  
ATOM   7876   H HD13 . LEU A 1 94  ? 3.700   11.097  7.957   1.00 0.00 ? 94  LEU A HD13 2  
ATOM   7877   H HD21 . LEU A 1 94  ? 4.583   14.797  8.365   1.00 0.00 ? 94  LEU A HD21 2  
ATOM   7878   H HD22 . LEU A 1 94  ? 6.134   14.325  9.061   1.00 0.00 ? 94  LEU A HD22 2  
ATOM   7879   H HD23 . LEU A 1 94  ? 5.716   13.834  7.420   1.00 0.00 ? 94  LEU A HD23 2  
ATOM   7880   N N    . ILE A 1 95  ? 3.412   12.938  13.364  1.00 0.00 ? 95  ILE A N    2  
ATOM   7881   C CA   . ILE A 1 95  ? 2.744   13.467  14.553  1.00 0.00 ? 95  ILE A CA   2  
ATOM   7882   C C    . ILE A 1 95  ? 3.776   13.828  15.618  1.00 0.00 ? 95  ILE A C    2  
ATOM   7883   O O    . ILE A 1 95  ? 3.690   14.887  16.241  1.00 0.00 ? 95  ILE A O    2  
ATOM   7884   C CB   . ILE A 1 95  ? 1.742   12.446  15.101  1.00 0.00 ? 95  ILE A CB   2  
ATOM   7885   C CG1  . ILE A 1 95  ? 0.573   12.345  14.122  1.00 0.00 ? 95  ILE A CG1  2  
ATOM   7886   C CG2  . ILE A 1 95  ? 1.221   12.913  16.464  1.00 0.00 ? 95  ILE A CG2  2  
ATOM   7887   C CD1  . ILE A 1 95  ? -0.332  11.166  14.492  1.00 0.00 ? 95  ILE A CD1  2  
ATOM   7888   H H    . ILE A 1 95  ? 3.246   12.011  13.082  1.00 0.00 ? 95  ILE A H    2  
ATOM   7889   H HA   . ILE A 1 95  ? 2.210   14.363  14.279  1.00 0.00 ? 95  ILE A HA   2  
ATOM   7890   H HB   . ILE A 1 95  ? 2.222   11.481  15.203  1.00 0.00 ? 95  ILE A HB   2  
ATOM   7891   H HG12 . ILE A 1 95  ? 0.004   13.260  14.157  1.00 0.00 ? 95  ILE A HG12 2  
ATOM   7892   H HG13 . ILE A 1 95  ? 0.957   12.199  13.124  1.00 0.00 ? 95  ILE A HG13 2  
ATOM   7893   H HG21 . ILE A 1 95  ? 0.947   13.957  16.407  1.00 0.00 ? 95  ILE A HG21 2  
ATOM   7894   H HG22 . ILE A 1 95  ? 0.357   12.328  16.737  1.00 0.00 ? 95  ILE A HG22 2  
ATOM   7895   H HG23 . ILE A 1 95  ? 1.993   12.785  17.210  1.00 0.00 ? 95  ILE A HG23 2  
ATOM   7896   H HD11 . ILE A 1 95  ? -0.363  11.054  15.566  1.00 0.00 ? 95  ILE A HD11 2  
ATOM   7897   H HD12 . ILE A 1 95  ? -1.329  11.354  14.122  1.00 0.00 ? 95  ILE A HD12 2  
ATOM   7898   H HD13 . ILE A 1 95  ? 0.051   10.262  14.044  1.00 0.00 ? 95  ILE A HD13 2  
ATOM   7899   N N    . GLU A 1 96  ? 4.767   12.961  15.806  1.00 0.00 ? 96  GLU A N    2  
ATOM   7900   C CA   . GLU A 1 96  ? 5.815   13.236  16.788  1.00 0.00 ? 96  GLU A CA   2  
ATOM   7901   C C    . GLU A 1 96  ? 6.518   14.545  16.433  1.00 0.00 ? 96  GLU A C    2  
ATOM   7902   O O    . GLU A 1 96  ? 6.847   15.348  17.305  1.00 0.00 ? 96  GLU A O    2  
ATOM   7903   C CB   . GLU A 1 96  ? 6.823   12.081  16.819  1.00 0.00 ? 96  GLU A CB   2  
ATOM   7904   C CG   . GLU A 1 96  ? 7.962   12.385  17.826  1.00 0.00 ? 96  GLU A CG   2  
ATOM   7905   C CD   . GLU A 1 96  ? 8.112   11.261  18.854  1.00 0.00 ? 96  GLU A CD   2  
ATOM   7906   O OE1  . GLU A 1 96  ? 7.793   10.131  18.531  1.00 0.00 ? 96  GLU A OE1  2  
ATOM   7907   O OE2  . GLU A 1 96  ? 8.591   11.545  19.938  1.00 0.00 ? 96  GLU A OE2  2  
ATOM   7908   H H    . GLU A 1 96  ? 4.802   12.139  15.271  1.00 0.00 ? 96  GLU A H    2  
ATOM   7909   H HA   . GLU A 1 96  ? 5.363   13.337  17.762  1.00 0.00 ? 96  GLU A HA   2  
ATOM   7910   H HB2  . GLU A 1 96  ? 6.306   11.176  17.113  1.00 0.00 ? 96  GLU A HB2  2  
ATOM   7911   H HB3  . GLU A 1 96  ? 7.239   11.948  15.832  1.00 0.00 ? 96  GLU A HB3  2  
ATOM   7912   H HG2  . GLU A 1 96  ? 8.890   12.493  17.293  1.00 0.00 ? 96  GLU A HG2  2  
ATOM   7913   H HG3  . GLU A 1 96  ? 7.746   13.308  18.349  1.00 0.00 ? 96  GLU A HG3  2  
ATOM   7914   N N    . LEU A 1 97  ? 6.729   14.771  15.135  1.00 0.00 ? 97  LEU A N    2  
ATOM   7915   C CA   . LEU A 1 97  ? 7.373   16.005  14.689  1.00 0.00 ? 97  LEU A CA   2  
ATOM   7916   C C    . LEU A 1 97  ? 6.508   17.207  15.066  1.00 0.00 ? 97  LEU A C    2  
ATOM   7917   O O    . LEU A 1 97  ? 7.020   18.227  15.533  1.00 0.00 ? 97  LEU A O    2  
ATOM   7918   C CB   . LEU A 1 97  ? 7.599   15.976  13.172  1.00 0.00 ? 97  LEU A CB   2  
ATOM   7919   C CG   . LEU A 1 97  ? 8.830   15.121  12.831  1.00 0.00 ? 97  LEU A CG   2  
ATOM   7920   C CD1  . LEU A 1 97  ? 8.836   14.840  11.329  1.00 0.00 ? 97  LEU A CD1  2  
ATOM   7921   C CD2  . LEU A 1 97  ? 10.124  15.862  13.205  1.00 0.00 ? 97  LEU A CD2  2  
ATOM   7922   H H    . LEU A 1 97  ? 6.434   14.107  14.475  1.00 0.00 ? 97  LEU A H    2  
ATOM   7923   H HA   . LEU A 1 97  ? 8.324   16.100  15.185  1.00 0.00 ? 97  LEU A HA   2  
ATOM   7924   H HB2  . LEU A 1 97  ? 6.729   15.554  12.691  1.00 0.00 ? 97  LEU A HB2  2  
ATOM   7925   H HB3  . LEU A 1 97  ? 7.751   16.984  12.812  1.00 0.00 ? 97  LEU A HB3  2  
ATOM   7926   H HG   . LEU A 1 97  ? 8.776   14.184  13.370  1.00 0.00 ? 97  LEU A HG   2  
ATOM   7927   H HD11 . LEU A 1 97  ? 8.721   15.769  10.790  1.00 0.00 ? 97  LEU A HD11 2  
ATOM   7928   H HD12 . LEU A 1 97  ? 9.770   14.377  11.052  1.00 0.00 ? 97  LEU A HD12 2  
ATOM   7929   H HD13 . LEU A 1 97  ? 8.020   14.178  11.085  1.00 0.00 ? 97  LEU A HD13 2  
ATOM   7930   H HD21 . LEU A 1 97  ? 10.016  16.914  12.987  1.00 0.00 ? 97  LEU A HD21 2  
ATOM   7931   H HD22 . LEU A 1 97  ? 10.330  15.731  14.255  1.00 0.00 ? 97  LEU A HD22 2  
ATOM   7932   H HD23 . LEU A 1 97  ? 10.946  15.460  12.625  1.00 0.00 ? 97  LEU A HD23 2  
ATOM   7933   N N    . HIS A 1 98  ? 5.195   17.079  14.889  1.00 0.00 ? 98  HIS A N    2  
ATOM   7934   C CA   . HIS A 1 98  ? 4.292   18.167  15.256  1.00 0.00 ? 98  HIS A CA   2  
ATOM   7935   C C    . HIS A 1 98  ? 4.477   18.498  16.732  1.00 0.00 ? 98  HIS A C    2  
ATOM   7936   O O    . HIS A 1 98  ? 4.481   19.662  17.121  1.00 0.00 ? 98  HIS A O    2  
ATOM   7937   C CB   . HIS A 1 98  ? 2.836   17.773  14.987  1.00 0.00 ? 98  HIS A CB   2  
ATOM   7938   C CG   . HIS A 1 98  ? 2.586   17.758  13.506  1.00 0.00 ? 98  HIS A CG   2  
ATOM   7939   N ND1  . HIS A 1 98  ? 2.839   16.642  12.730  1.00 0.00 ? 98  HIS A ND1  2  
ATOM   7940   C CD2  . HIS A 1 98  ? 2.119   18.714  12.644  1.00 0.00 ? 98  HIS A CD2  2  
ATOM   7941   C CE1  . HIS A 1 98  ? 2.527   16.949  11.458  1.00 0.00 ? 98  HIS A CE1  2  
ATOM   7942   N NE2  . HIS A 1 98  ? 2.084   18.202  11.348  1.00 0.00 ? 98  HIS A NE2  2  
ATOM   7943   H H    . HIS A 1 98  ? 4.832   16.240  14.535  1.00 0.00 ? 98  HIS A H    2  
ATOM   7944   H HA   . HIS A 1 98  ? 4.536   19.040  14.670  1.00 0.00 ? 98  HIS A HA   2  
ATOM   7945   H HB2  . HIS A 1 98  ? 2.645   16.792  15.398  1.00 0.00 ? 98  HIS A HB2  2  
ATOM   7946   H HB3  . HIS A 1 98  ? 2.180   18.493  15.455  1.00 0.00 ? 98  HIS A HB3  2  
ATOM   7947   H HD1  . HIS A 1 98  ? 3.195   15.777  13.049  1.00 0.00 ? 98  HIS A HD1  2  
ATOM   7948   H HD2  . HIS A 1 98  ? 1.823   19.712  12.928  1.00 0.00 ? 98  HIS A HD2  2  
ATOM   7949   H HE1  . HIS A 1 98  ? 2.634   16.266  10.625  1.00 0.00 ? 98  HIS A HE1  2  
ATOM   7950   H HE2  . HIS A 1 98  ? 1.802   18.657  10.531  1.00 0.00 ? 98  HIS A HE2  2  
ATOM   7951   N N    . GLU A 1 99  ? 4.662   17.460  17.542  1.00 0.00 ? 99  GLU A N    2  
ATOM   7952   C CA   . GLU A 1 99  ? 4.873   17.651  18.970  1.00 0.00 ? 99  GLU A CA   2  
ATOM   7953   C C    . GLU A 1 99  ? 6.186   18.395  19.210  1.00 0.00 ? 99  GLU A C    2  
ATOM   7954   O O    . GLU A 1 99  ? 6.258   19.301  20.041  1.00 0.00 ? 99  GLU A O    2  
ATOM   7955   C CB   . GLU A 1 99  ? 4.888   16.299  19.686  1.00 0.00 ? 99  GLU A CB   2  
ATOM   7956   C CG   . GLU A 1 99  ? 4.992   16.523  21.200  1.00 0.00 ? 99  GLU A CG   2  
ATOM   7957   C CD   . GLU A 1 99  ? 4.922   15.189  21.939  1.00 0.00 ? 99  GLU A CD   2  
ATOM   7958   O OE1  . GLU A 1 99  ? 5.021   14.163  21.289  1.00 0.00 ? 99  GLU A OE1  2  
ATOM   7959   O OE2  . GLU A 1 99  ? 4.764   15.214  23.146  1.00 0.00 ? 99  GLU A OE2  2  
ATOM   7960   H H    . GLU A 1 99  ? 4.670   16.551  17.169  1.00 0.00 ? 99  GLU A H    2  
ATOM   7961   H HA   . GLU A 1 99  ? 4.066   18.246  19.368  1.00 0.00 ? 99  GLU A HA   2  
ATOM   7962   H HB2  . GLU A 1 99  ? 3.975   15.764  19.465  1.00 0.00 ? 99  GLU A HB2  2  
ATOM   7963   H HB3  . GLU A 1 99  ? 5.735   15.717  19.354  1.00 0.00 ? 99  GLU A HB3  2  
ATOM   7964   H HG2  . GLU A 1 99  ? 5.927   17.009  21.428  1.00 0.00 ? 99  GLU A HG2  2  
ATOM   7965   H HG3  . GLU A 1 99  ? 4.175   17.152  21.526  1.00 0.00 ? 99  GLU A HG3  2  
ATOM   7966   N N    . LYS A 1 100 ? 7.223   18.030  18.461  1.00 0.00 ? 100 LYS A N    2  
ATOM   7967   C CA   . LYS A 1 100 ? 8.510   18.704  18.606  1.00 0.00 ? 100 LYS A CA   2  
ATOM   7968   C C    . LYS A 1 100 ? 8.389   20.155  18.136  1.00 0.00 ? 100 LYS A C    2  
ATOM   7969   O O    . LYS A 1 100 ? 8.997   21.052  18.717  1.00 0.00 ? 100 LYS A O    2  
ATOM   7970   C CB   . LYS A 1 100 ? 9.601   17.962  17.829  1.00 0.00 ? 100 LYS A CB   2  
ATOM   7971   C CG   . LYS A 1 100 ? 9.877   16.622  18.524  1.00 0.00 ? 100 LYS A CG   2  
ATOM   7972   C CD   . LYS A 1 100 ? 11.042  15.908  17.835  1.00 0.00 ? 100 LYS A CD   2  
ATOM   7973   C CE   . LYS A 1 100 ? 11.317  14.585  18.552  1.00 0.00 ? 100 LYS A CE   2  
ATOM   7974   N NZ   . LYS A 1 100 ? 12.495  13.920  17.920  1.00 0.00 ? 100 LYS A NZ   2  
ATOM   7975   H H    . LYS A 1 100 ? 7.117   17.312  17.799  1.00 0.00 ? 100 LYS A H    2  
ATOM   7976   H HA   . LYS A 1 100 ? 8.776   18.711  19.654  1.00 0.00 ? 100 LYS A HA   2  
ATOM   7977   H HB2  . LYS A 1 100 ? 9.270   17.786  16.815  1.00 0.00 ? 100 LYS A HB2  2  
ATOM   7978   H HB3  . LYS A 1 100 ? 10.502  18.554  17.821  1.00 0.00 ? 100 LYS A HB3  2  
ATOM   7979   H HG2  . LYS A 1 100 ? 10.126  16.804  19.563  1.00 0.00 ? 100 LYS A HG2  2  
ATOM   7980   H HG3  . LYS A 1 100 ? 8.992   16.002  18.473  1.00 0.00 ? 100 LYS A HG3  2  
ATOM   7981   H HD2  . LYS A 1 100 ? 10.784  15.717  16.803  1.00 0.00 ? 100 LYS A HD2  2  
ATOM   7982   H HD3  . LYS A 1 100 ? 11.923  16.532  17.878  1.00 0.00 ? 100 LYS A HD3  2  
ATOM   7983   H HE2  . LYS A 1 100 ? 11.527  14.776  19.597  1.00 0.00 ? 100 LYS A HE2  2  
ATOM   7984   H HE3  . LYS A 1 100 ? 10.449  13.942  18.473  1.00 0.00 ? 100 LYS A HE3  2  
ATOM   7985   H HZ1  . LYS A 1 100 ? 13.270  14.608  17.814  1.00 0.00 ? 100 LYS A HZ1  2  
ATOM   7986   H HZ2  . LYS A 1 100 ? 12.814  13.135  18.524  1.00 0.00 ? 100 LYS A HZ2  2  
ATOM   7987   H HZ3  . LYS A 1 100 ? 12.224  13.555  16.987  1.00 0.00 ? 100 LYS A HZ3  2  
ATOM   7988   N N    . LEU A 1 101 ? 7.564   20.387  17.112  1.00 0.00 ? 101 LEU A N    2  
ATOM   7989   C CA   . LEU A 1 101 ? 7.345   21.751  16.615  1.00 0.00 ? 101 LEU A CA   2  
ATOM   7990   C C    . LEU A 1 101 ? 6.683   22.597  17.703  1.00 0.00 ? 101 LEU A C    2  
ATOM   7991   O O    . LEU A 1 101 ? 6.355   23.764  17.484  1.00 0.00 ? 101 LEU A O    2  
ATOM   7992   C CB   . LEU A 1 101 ? 6.445   21.738  15.367  1.00 0.00 ? 101 LEU A CB   2  
ATOM   7993   C CG   . LEU A 1 101 ? 7.272   21.466  14.104  1.00 0.00 ? 101 LEU A CG   2  
ATOM   7994   C CD1  . LEU A 1 101 ? 6.338   21.031  12.971  1.00 0.00 ? 101 LEU A CD1  2  
ATOM   7995   C CD2  . LEU A 1 101 ? 8.017   22.737  13.669  1.00 0.00 ? 101 LEU A CD2  2  
ATOM   7996   H H    . LEU A 1 101 ? 7.080   19.640  16.701  1.00 0.00 ? 101 LEU A H    2  
ATOM   7997   H HA   . LEU A 1 101 ? 8.296   22.196  16.365  1.00 0.00 ? 101 LEU A HA   2  
ATOM   7998   H HB2  . LEU A 1 101 ? 5.698   20.965  15.481  1.00 0.00 ? 101 LEU A HB2  2  
ATOM   7999   H HB3  . LEU A 1 101 ? 5.951   22.696  15.273  1.00 0.00 ? 101 LEU A HB3  2  
ATOM   8000   H HG   . LEU A 1 101 ? 7.984   20.677  14.305  1.00 0.00 ? 101 LEU A HG   2  
ATOM   8001   H HD11 . LEU A 1 101 ? 5.430   21.617  13.004  1.00 0.00 ? 101 LEU A HD11 2  
ATOM   8002   H HD12 . LEU A 1 101 ? 6.828   21.185  12.021  1.00 0.00 ? 101 LEU A HD12 2  
ATOM   8003   H HD13 . LEU A 1 101 ? 6.093   19.985  13.084  1.00 0.00 ? 101 LEU A HD13 2  
ATOM   8004   H HD21 . LEU A 1 101 ? 7.359   23.591  13.750  1.00 0.00 ? 101 LEU A HD21 2  
ATOM   8005   H HD22 . LEU A 1 101 ? 8.881   22.886  14.300  1.00 0.00 ? 101 LEU A HD22 2  
ATOM   8006   H HD23 . LEU A 1 101 ? 8.337   22.630  12.642  1.00 0.00 ? 101 LEU A HD23 2  
ATOM   8007   N N    . LYS A 1 102 ? 6.485   21.993  18.876  1.00 0.00 ? 102 LYS A N    2  
ATOM   8008   C CA   . LYS A 1 102 ? 5.863   22.679  20.010  1.00 0.00 ? 102 LYS A CA   2  
ATOM   8009   C C    . LYS A 1 102 ? 4.349   22.678  19.870  1.00 0.00 ? 102 LYS A C    2  
ATOM   8010   O O    . LYS A 1 102 ? 3.662   22.170  20.739  1.00 0.00 ? 102 LYS A O    2  
ATOM   8011   C CB   . LYS A 1 102 ? 6.379   24.131  20.100  1.00 0.00 ? 102 LYS A CB   2  
ATOM   8012   C CG   . LYS A 1 102 ? 6.293   24.743  21.531  1.00 0.00 ? 102 LYS A CG   2  
ATOM   8013   C CD   . LYS A 1 102 ? 5.079   24.258  22.368  1.00 0.00 ? 102 LYS A CD   2  
ATOM   8014   C CE   . LYS A 1 102 ? 3.747   24.897  21.909  1.00 0.00 ? 102 LYS A CE   2  
ATOM   8015   N NZ   . LYS A 1 102 ? 3.872   25.459  20.537  1.00 0.00 ? 102 LYS A NZ   2  
ATOM   8016   H H    . LYS A 1 102 ? 6.761   21.059  18.982  1.00 0.00 ? 102 LYS A H    2  
ATOM   8017   H HA   . LYS A 1 102 ? 6.133   22.151  20.915  1.00 0.00 ? 102 LYS A HA   2  
ATOM   8018   H HB2  . LYS A 1 102 ? 7.416   24.140  19.790  1.00 0.00 ? 102 LYS A HB2  2  
ATOM   8019   H HB3  . LYS A 1 102 ? 5.818   24.747  19.416  1.00 0.00 ? 102 LYS A HB3  2  
ATOM   8020   H HG2  . LYS A 1 102 ? 7.198   24.489  22.066  1.00 0.00 ? 102 LYS A HG2  2  
ATOM   8021   H HG3  . LYS A 1 102 ? 6.246   25.819  21.439  1.00 0.00 ? 102 LYS A HG3  2  
ATOM   8022   H HD2  . LYS A 1 102 ? 5.000   23.184  22.319  1.00 0.00 ? 102 LYS A HD2  2  
ATOM   8023   H HD3  . LYS A 1 102 ? 5.252   24.544  23.402  1.00 0.00 ? 102 LYS A HD3  2  
ATOM   8024   H HE2  . LYS A 1 102 ? 2.970   24.145  21.916  1.00 0.00 ? 102 LYS A HE2  2  
ATOM   8025   H HE3  . LYS A 1 102 ? 3.476   25.690  22.598  1.00 0.00 ? 102 LYS A HE3  2  
ATOM   8026   H HZ1  . LYS A 1 102 ? 4.202   24.716  19.894  1.00 0.00 ? 102 LYS A HZ1  2  
ATOM   8027   H HZ2  . LYS A 1 102 ? 2.943   25.799  20.219  1.00 0.00 ? 102 LYS A HZ2  2  
ATOM   8028   H HZ3  . LYS A 1 102 ? 4.548   26.245  20.536  1.00 0.00 ? 102 LYS A HZ3  2  
ATOM   8029   N N    . ALA A 1 103 ? 3.860   23.296  18.784  1.00 0.00 ? 103 ALA A N    2  
ATOM   8030   C CA   . ALA A 1 103 ? 2.420   23.412  18.518  1.00 0.00 ? 103 ALA A CA   2  
ATOM   8031   C C    . ALA A 1 103 ? 1.643   22.185  18.997  1.00 0.00 ? 103 ALA A C    2  
ATOM   8032   O O    . ALA A 1 103 ? 1.316   21.354  18.167  1.00 0.00 ? 103 ALA A O    2  
ATOM   8033   C CB   . ALA A 1 103 ? 2.184   23.608  17.017  1.00 0.00 ? 103 ALA A CB   2  
ATOM   8034   O OXT  . ALA A 1 103 ? 1.358   22.112  20.182  1.00 0.00 ? 103 ALA A OXT  2  
ATOM   8035   H H    . ALA A 1 103 ? 4.493   23.697  18.150  1.00 0.00 ? 103 ALA A H    2  
ATOM   8036   H HA   . ALA A 1 103 ? 2.041   24.277  19.038  1.00 0.00 ? 103 ALA A HA   2  
ATOM   8037   H HB1  . ALA A 1 103 ? 1.138   23.437  16.797  1.00 0.00 ? 103 ALA A HB1  2  
ATOM   8038   H HB2  . ALA A 1 103 ? 2.785   22.898  16.465  1.00 0.00 ? 103 ALA A HB2  2  
ATOM   8039   H HB3  . ALA A 1 103 ? 2.453   24.610  16.732  1.00 0.00 ? 103 ALA A HB3  2  
ATOM   8040   N N    . ALA B 1 1   ? 9.933   -20.893 -6.784  1.00 0.00 ? 1   ALA B N    2  
ATOM   8041   C CA   . ALA B 1 1   ? 10.730  -22.096 -7.163  1.00 0.00 ? 1   ALA B CA   2  
ATOM   8042   C C    . ALA B 1 1   ? 12.028  -22.095 -6.363  1.00 0.00 ? 1   ALA B C    2  
ATOM   8043   O O    . ALA B 1 1   ? 12.337  -21.110 -5.704  1.00 0.00 ? 1   ALA B O    2  
ATOM   8044   C CB   . ALA B 1 1   ? 11.016  -22.057 -8.672  1.00 0.00 ? 1   ALA B CB   2  
ATOM   8045   H H1   . ALA B 1 1   ? 10.538  -20.229 -6.259  1.00 0.00 ? 1   ALA B H1   2  
ATOM   8046   H H2   . ALA B 1 1   ? 9.572   -20.433 -7.644  1.00 0.00 ? 1   ALA B H2   2  
ATOM   8047   H H3   . ALA B 1 1   ? 9.135   -21.179 -6.181  1.00 0.00 ? 1   ALA B H3   2  
ATOM   8048   H HA   . ALA B 1 1   ? 10.170  -22.990 -6.922  1.00 0.00 ? 1   ALA B HA   2  
ATOM   8049   H HB1  . ALA B 1 1   ? 10.263  -22.630 -9.198  1.00 0.00 ? 1   ALA B HB1  2  
ATOM   8050   H HB2  . ALA B 1 1   ? 11.991  -22.483 -8.871  1.00 0.00 ? 1   ALA B HB2  2  
ATOM   8051   H HB3  . ALA B 1 1   ? 10.995  -21.034 -9.020  1.00 0.00 ? 1   ALA B HB3  2  
ATOM   8052   N N    . GLU B 1 2   ? 12.765  -23.201 -6.430  1.00 0.00 ? 2   GLU B N    2  
ATOM   8053   C CA   . GLU B 1 2   ? 14.034  -23.360 -5.705  1.00 0.00 ? 2   GLU B CA   2  
ATOM   8054   C C    . GLU B 1 2   ? 14.712  -22.021 -5.389  1.00 0.00 ? 2   GLU B C    2  
ATOM   8055   O O    . GLU B 1 2   ? 14.539  -21.466 -4.305  1.00 0.00 ? 2   GLU B O    2  
ATOM   8056   C CB   . GLU B 1 2   ? 14.989  -24.229 -6.532  1.00 0.00 ? 2   GLU B CB   2  
ATOM   8057   C CG   . GLU B 1 2   ? 14.360  -25.618 -6.796  1.00 0.00 ? 2   GLU B CG   2  
ATOM   8058   C CD   . GLU B 1 2   ? 14.436  -25.977 -8.280  1.00 0.00 ? 2   GLU B CD   2  
ATOM   8059   O OE1  . GLU B 1 2   ? 15.433  -25.659 -8.899  1.00 0.00 ? 2   GLU B OE1  2  
ATOM   8060   O OE2  . GLU B 1 2   ? 13.489  -26.564 -8.772  1.00 0.00 ? 2   GLU B OE2  2  
ATOM   8061   H H    . GLU B 1 2   ? 12.451  -23.945 -6.984  1.00 0.00 ? 2   GLU B H    2  
ATOM   8062   H HA   . GLU B 1 2   ? 13.836  -23.867 -4.774  1.00 0.00 ? 2   GLU B HA   2  
ATOM   8063   H HB2  . GLU B 1 2   ? 15.189  -23.738 -7.475  1.00 0.00 ? 2   GLU B HB2  2  
ATOM   8064   H HB3  . GLU B 1 2   ? 15.918  -24.351 -5.992  1.00 0.00 ? 2   GLU B HB3  2  
ATOM   8065   H HG2  . GLU B 1 2   ? 14.896  -26.365 -6.231  1.00 0.00 ? 2   GLU B HG2  2  
ATOM   8066   H HG3  . GLU B 1 2   ? 13.326  -25.616 -6.488  1.00 0.00 ? 2   GLU B HG3  2  
ATOM   8067   N N    . GLU B 1 3   ? 15.493  -21.519 -6.335  1.00 0.00 ? 3   GLU B N    2  
ATOM   8068   C CA   . GLU B 1 3   ? 16.205  -20.259 -6.138  1.00 0.00 ? 3   GLU B CA   2  
ATOM   8069   C C    . GLU B 1 3   ? 15.236  -19.088 -6.033  1.00 0.00 ? 3   GLU B C    2  
ATOM   8070   O O    . GLU B 1 3   ? 15.220  -18.372 -5.035  1.00 0.00 ? 3   GLU B O    2  
ATOM   8071   C CB   . GLU B 1 3   ? 17.179  -20.036 -7.299  1.00 0.00 ? 3   GLU B CB   2  
ATOM   8072   C CG   . GLU B 1 3   ? 18.441  -20.888 -7.085  1.00 0.00 ? 3   GLU B CG   2  
ATOM   8073   C CD   . GLU B 1 3   ? 19.146  -21.144 -8.414  1.00 0.00 ? 3   GLU B CD   2  
ATOM   8074   O OE1  . GLU B 1 3   ? 19.488  -20.181 -9.075  1.00 0.00 ? 3   GLU B OE1  2  
ATOM   8075   O OE2  . GLU B 1 3   ? 19.335  -22.301 -8.746  1.00 0.00 ? 3   GLU B OE2  2  
ATOM   8076   H H    . GLU B 1 3   ? 15.608  -22.006 -7.178  1.00 0.00 ? 3   GLU B H    2  
ATOM   8077   H HA   . GLU B 1 3   ? 16.768  -20.322 -5.219  1.00 0.00 ? 3   GLU B HA   2  
ATOM   8078   H HB2  . GLU B 1 3   ? 16.708  -20.319 -8.229  1.00 0.00 ? 3   GLU B HB2  2  
ATOM   8079   H HB3  . GLU B 1 3   ? 17.458  -18.992 -7.343  1.00 0.00 ? 3   GLU B HB3  2  
ATOM   8080   H HG2  . GLU B 1 3   ? 19.119  -20.370 -6.423  1.00 0.00 ? 3   GLU B HG2  2  
ATOM   8081   H HG3  . GLU B 1 3   ? 18.169  -21.835 -6.643  1.00 0.00 ? 3   GLU B HG3  2  
ATOM   8082   N N    . LEU B 1 4   ? 14.434  -18.877 -7.068  1.00 0.00 ? 4   LEU B N    2  
ATOM   8083   C CA   . LEU B 1 4   ? 13.480  -17.770 -7.054  1.00 0.00 ? 4   LEU B CA   2  
ATOM   8084   C C    . LEU B 1 4   ? 12.768  -17.652 -5.701  1.00 0.00 ? 4   LEU B C    2  
ATOM   8085   O O    . LEU B 1 4   ? 12.591  -16.555 -5.183  1.00 0.00 ? 4   LEU B O    2  
ATOM   8086   C CB   . LEU B 1 4   ? 12.427  -17.939 -8.158  1.00 0.00 ? 4   LEU B CB   2  
ATOM   8087   C CG   . LEU B 1 4   ? 13.100  -18.069 -9.531  1.00 0.00 ? 4   LEU B CG   2  
ATOM   8088   C CD1  . LEU B 1 4   ? 12.025  -18.221 -10.618 1.00 0.00 ? 4   LEU B CD1  2  
ATOM   8089   C CD2  . LEU B 1 4   ? 13.956  -16.823 -9.817  1.00 0.00 ? 4   LEU B CD2  2  
ATOM   8090   H H    . LEU B 1 4   ? 14.484  -19.468 -7.846  1.00 0.00 ? 4   LEU B H    2  
ATOM   8091   H HA   . LEU B 1 4   ? 14.025  -16.858 -7.233  1.00 0.00 ? 4   LEU B HA   2  
ATOM   8092   H HB2  . LEU B 1 4   ? 11.844  -18.827 -7.960  1.00 0.00 ? 4   LEU B HB2  2  
ATOM   8093   H HB3  . LEU B 1 4   ? 11.773  -17.078 -8.158  1.00 0.00 ? 4   LEU B HB3  2  
ATOM   8094   H HG   . LEU B 1 4   ? 13.730  -18.946 -9.535  1.00 0.00 ? 4   LEU B HG   2  
ATOM   8095   H HD11 . LEU B 1 4   ? 11.167  -18.736 -10.212 1.00 0.00 ? 4   LEU B HD11 2  
ATOM   8096   H HD12 . LEU B 1 4   ? 11.723  -17.246 -10.974 1.00 0.00 ? 4   LEU B HD12 2  
ATOM   8097   H HD13 . LEU B 1 4   ? 12.426  -18.793 -11.443 1.00 0.00 ? 4   LEU B HD13 2  
ATOM   8098   H HD21 . LEU B 1 4   ? 13.482  -15.946 -9.405  1.00 0.00 ? 4   LEU B HD21 2  
ATOM   8099   H HD22 . LEU B 1 4   ? 14.932  -16.946 -9.368  1.00 0.00 ? 4   LEU B HD22 2  
ATOM   8100   H HD23 . LEU B 1 4   ? 14.070  -16.701 -10.886 1.00 0.00 ? 4   LEU B HD23 2  
ATOM   8101   N N    . GLU B 1 5   ? 12.362  -18.784 -5.137  1.00 0.00 ? 5   GLU B N    2  
ATOM   8102   C CA   . GLU B 1 5   ? 11.668  -18.783 -3.850  1.00 0.00 ? 5   GLU B CA   2  
ATOM   8103   C C    . GLU B 1 5   ? 12.624  -18.403 -2.725  1.00 0.00 ? 5   GLU B C    2  
ATOM   8104   O O    . GLU B 1 5   ? 12.305  -17.564 -1.876  1.00 0.00 ? 5   GLU B O    2  
ATOM   8105   C CB   . GLU B 1 5   ? 11.064  -20.155 -3.583  1.00 0.00 ? 5   GLU B CB   2  
ATOM   8106   C CG   . GLU B 1 5   ? 10.247  -20.092 -2.295  1.00 0.00 ? 5   GLU B CG   2  
ATOM   8107   C CD   . GLU B 1 5   ? 9.585   -21.439 -2.032  1.00 0.00 ? 5   GLU B CD   2  
ATOM   8108   O OE1  . GLU B 1 5   ? 9.954   -22.394 -2.695  1.00 0.00 ? 5   GLU B OE1  2  
ATOM   8109   O OE2  . GLU B 1 5   ? 8.723   -21.495 -1.173  1.00 0.00 ? 5   GLU B OE2  2  
ATOM   8110   H H    . GLU B 1 5   ? 12.536  -19.639 -5.589  1.00 0.00 ? 5   GLU B H    2  
ATOM   8111   H HA   . GLU B 1 5   ? 10.865  -18.064 -3.883  1.00 0.00 ? 5   GLU B HA   2  
ATOM   8112   H HB2  . GLU B 1 5   ? 10.422  -20.432 -4.408  1.00 0.00 ? 5   GLU B HB2  2  
ATOM   8113   H HB3  . GLU B 1 5   ? 11.853  -20.884 -3.476  1.00 0.00 ? 5   GLU B HB3  2  
ATOM   8114   H HG2  . GLU B 1 5   ? 10.900  -19.846 -1.470  1.00 0.00 ? 5   GLU B HG2  2  
ATOM   8115   H HG3  . GLU B 1 5   ? 9.486   -19.331 -2.389  1.00 0.00 ? 5   GLU B HG3  2  
ATOM   8116   N N    . GLU B 1 6   ? 13.805  -19.005 -2.735  1.00 0.00 ? 6   GLU B N    2  
ATOM   8117   C CA   . GLU B 1 6   ? 14.813  -18.712 -1.727  1.00 0.00 ? 6   GLU B CA   2  
ATOM   8118   C C    . GLU B 1 6   ? 15.334  -17.289 -1.916  1.00 0.00 ? 6   GLU B C    2  
ATOM   8119   O O    . GLU B 1 6   ? 15.639  -16.583 -0.950  1.00 0.00 ? 6   GLU B O    2  
ATOM   8120   C CB   . GLU B 1 6   ? 15.958  -19.727 -1.841  1.00 0.00 ? 6   GLU B CB   2  
ATOM   8121   C CG   . GLU B 1 6   ? 16.673  -19.872 -0.492  1.00 0.00 ? 6   GLU B CG   2  
ATOM   8122   C CD   . GLU B 1 6   ? 17.546  -21.122 -0.504  1.00 0.00 ? 6   GLU B CD   2  
ATOM   8123   O OE1  . GLU B 1 6   ? 17.855  -21.597 -1.584  1.00 0.00 ? 6   GLU B OE1  2  
ATOM   8124   O OE2  . GLU B 1 6   ? 17.901  -21.582 0.570   1.00 0.00 ? 6   GLU B OE2  2  
ATOM   8125   H H    . GLU B 1 6   ? 14.009  -19.651 -3.446  1.00 0.00 ? 6   GLU B H    2  
ATOM   8126   H HA   . GLU B 1 6   ? 14.368  -18.797 -0.748  1.00 0.00 ? 6   GLU B HA   2  
ATOM   8127   H HB2  . GLU B 1 6   ? 15.556  -20.686 -2.137  1.00 0.00 ? 6   GLU B HB2  2  
ATOM   8128   H HB3  . GLU B 1 6   ? 16.664  -19.390 -2.585  1.00 0.00 ? 6   GLU B HB3  2  
ATOM   8129   H HG2  . GLU B 1 6   ? 17.294  -19.005 -0.321  1.00 0.00 ? 6   GLU B HG2  2  
ATOM   8130   H HG3  . GLU B 1 6   ? 15.946  -19.955 0.302   1.00 0.00 ? 6   GLU B HG3  2  
ATOM   8131   N N    . VAL B 1 7   ? 15.407  -16.864 -3.175  1.00 0.00 ? 7   VAL B N    2  
ATOM   8132   C CA   . VAL B 1 7   ? 15.867  -15.518 -3.504  1.00 0.00 ? 7   VAL B CA   2  
ATOM   8133   C C    . VAL B 1 7   ? 14.870  -14.484 -2.975  1.00 0.00 ? 7   VAL B C    2  
ATOM   8134   O O    . VAL B 1 7   ? 15.259  -13.460 -2.408  1.00 0.00 ? 7   VAL B O    2  
ATOM   8135   C CB   . VAL B 1 7   ? 16.023  -15.378 -5.024  1.00 0.00 ? 7   VAL B CB   2  
ATOM   8136   C CG1  . VAL B 1 7   ? 16.288  -13.913 -5.387  1.00 0.00 ? 7   VAL B CG1  2  
ATOM   8137   C CG2  . VAL B 1 7   ? 17.199  -16.241 -5.502  1.00 0.00 ? 7   VAL B CG2  2  
ATOM   8138   H H    . VAL B 1 7   ? 15.131  -17.471 -3.899  1.00 0.00 ? 7   VAL B H    2  
ATOM   8139   H HA   . VAL B 1 7   ? 16.823  -15.348 -3.036  1.00 0.00 ? 7   VAL B HA   2  
ATOM   8140   H HB   . VAL B 1 7   ? 15.112  -15.707 -5.510  1.00 0.00 ? 7   VAL B HB   2  
ATOM   8141   H HG11 . VAL B 1 7   ? 17.012  -13.498 -4.701  1.00 0.00 ? 7   VAL B HG11 2  
ATOM   8142   H HG12 . VAL B 1 7   ? 16.675  -13.857 -6.394  1.00 0.00 ? 7   VAL B HG12 2  
ATOM   8143   H HG13 . VAL B 1 7   ? 15.369  -13.352 -5.321  1.00 0.00 ? 7   VAL B HG13 2  
ATOM   8144   H HG21 . VAL B 1 7   ? 17.217  -17.168 -4.946  1.00 0.00 ? 7   VAL B HG21 2  
ATOM   8145   H HG22 . VAL B 1 7   ? 17.085  -16.456 -6.555  1.00 0.00 ? 7   VAL B HG22 2  
ATOM   8146   H HG23 . VAL B 1 7   ? 18.125  -15.709 -5.345  1.00 0.00 ? 7   VAL B HG23 2  
ATOM   8147   N N    . VAL B 1 8   ? 13.581  -14.772 -3.145  1.00 0.00 ? 8   VAL B N    2  
ATOM   8148   C CA   . VAL B 1 8   ? 12.534  -13.873 -2.663  1.00 0.00 ? 8   VAL B CA   2  
ATOM   8149   C C    . VAL B 1 8   ? 12.657  -13.731 -1.147  1.00 0.00 ? 8   VAL B C    2  
ATOM   8150   O O    . VAL B 1 8   ? 12.603  -12.625 -0.611  1.00 0.00 ? 8   VAL B O    2  
ATOM   8151   C CB   . VAL B 1 8   ? 11.150  -14.423 -3.039  1.00 0.00 ? 8   VAL B CB   2  
ATOM   8152   C CG1  . VAL B 1 8   ? 10.050  -13.630 -2.305  1.00 0.00 ? 8   VAL B CG1  2  
ATOM   8153   C CG2  . VAL B 1 8   ? 10.952  -14.323 -4.569  1.00 0.00 ? 8   VAL B CG2  2  
ATOM   8154   H H    . VAL B 1 8   ? 13.329  -15.611 -3.587  1.00 0.00 ? 8   VAL B H    2  
ATOM   8155   H HA   . VAL B 1 8   ? 12.669  -12.901 -3.113  1.00 0.00 ? 8   VAL B HA   2  
ATOM   8156   H HB   . VAL B 1 8   ? 11.094  -15.461 -2.740  1.00 0.00 ? 8   VAL B HB   2  
ATOM   8157   H HG11 . VAL B 1 8   ? 10.449  -12.690 -1.950  1.00 0.00 ? 8   VAL B HG11 2  
ATOM   8158   H HG12 . VAL B 1 8   ? 9.228   -13.435 -2.979  1.00 0.00 ? 8   VAL B HG12 2  
ATOM   8159   H HG13 . VAL B 1 8   ? 9.692   -14.206 -1.463  1.00 0.00 ? 8   VAL B HG13 2  
ATOM   8160   H HG21 . VAL B 1 8   ? 11.889  -14.072 -5.048  1.00 0.00 ? 8   VAL B HG21 2  
ATOM   8161   H HG22 . VAL B 1 8   ? 10.604  -15.273 -4.949  1.00 0.00 ? 8   VAL B HG22 2  
ATOM   8162   H HG23 . VAL B 1 8   ? 10.220  -13.560 -4.795  1.00 0.00 ? 8   VAL B HG23 2  
ATOM   8163   N N    . MET B 1 9   ? 12.865  -14.852 -0.460  1.00 0.00 ? 9   MET B N    2  
ATOM   8164   C CA   . MET B 1 9   ? 13.031  -14.815 0.989   1.00 0.00 ? 9   MET B CA   2  
ATOM   8165   C C    . MET B 1 9   ? 14.181  -13.878 1.339   1.00 0.00 ? 9   MET B C    2  
ATOM   8166   O O    . MET B 1 9   ? 14.071  -13.047 2.243   1.00 0.00 ? 9   MET B O    2  
ATOM   8167   C CB   . MET B 1 9   ? 13.322  -16.224 1.509   1.00 0.00 ? 9   MET B CB   2  
ATOM   8168   C CG   . MET B 1 9   ? 12.027  -17.036 1.539   1.00 0.00 ? 9   MET B CG   2  
ATOM   8169   S SD   . MET B 1 9   ? 12.392  -18.735 2.047   1.00 0.00 ? 9   MET B SD   2  
ATOM   8170   C CE   . MET B 1 9   ? 12.824  -18.380 3.766   1.00 0.00 ? 9   MET B CE   2  
ATOM   8171   H H    . MET B 1 9   ? 12.935  -15.709 -0.935  1.00 0.00 ? 9   MET B H    2  
ATOM   8172   H HA   . MET B 1 9   ? 12.126  -14.436 1.437   1.00 0.00 ? 9   MET B HA   2  
ATOM   8173   H HB2  . MET B 1 9   ? 14.036  -16.707 0.857   1.00 0.00 ? 9   MET B HB2  2  
ATOM   8174   H HB3  . MET B 1 9   ? 13.730  -16.163 2.506   1.00 0.00 ? 9   MET B HB3  2  
ATOM   8175   H HG2  . MET B 1 9   ? 11.339  -16.589 2.243   1.00 0.00 ? 9   MET B HG2  2  
ATOM   8176   H HG3  . MET B 1 9   ? 11.583  -17.041 0.555   1.00 0.00 ? 9   MET B HG3  2  
ATOM   8177   H HE1  . MET B 1 9   ? 12.252  -17.530 4.112   1.00 0.00 ? 9   MET B HE1  2  
ATOM   8178   H HE2  . MET B 1 9   ? 12.601  -19.243 4.377   1.00 0.00 ? 9   MET B HE2  2  
ATOM   8179   H HE3  . MET B 1 9   ? 13.876  -18.154 3.835   1.00 0.00 ? 9   MET B HE3  2  
ATOM   8180   N N    . GLY B 1 10  ? 15.278  -13.998 0.598   1.00 0.00 ? 10  GLY B N    2  
ATOM   8181   C CA   . GLY B 1 10  ? 16.432  -13.134 0.824   1.00 0.00 ? 10  GLY B CA   2  
ATOM   8182   C C    . GLY B 1 10  ? 16.051  -11.678 0.579   1.00 0.00 ? 10  GLY B C    2  
ATOM   8183   O O    . GLY B 1 10  ? 16.401  -10.791 1.359   1.00 0.00 ? 10  GLY B O    2  
ATOM   8184   H H    . GLY B 1 10  ? 15.304  -14.665 -0.124  1.00 0.00 ? 10  GLY B H    2  
ATOM   8185   H HA2  . GLY B 1 10  ? 16.768  -13.247 1.844   1.00 0.00 ? 10  GLY B HA2  2  
ATOM   8186   H HA3  . GLY B 1 10  ? 17.228  -13.412 0.149   1.00 0.00 ? 10  GLY B HA3  2  
ATOM   8187   N N    . LEU B 1 11  ? 15.319  -11.439 -0.505  1.00 0.00 ? 11  LEU B N    2  
ATOM   8188   C CA   . LEU B 1 11  ? 14.882  -10.082 -0.839  1.00 0.00 ? 11  LEU B CA   2  
ATOM   8189   C C    . LEU B 1 11  ? 13.967  -9.527  0.244   1.00 0.00 ? 11  LEU B C    2  
ATOM   8190   O O    . LEU B 1 11  ? 14.101  -8.370  0.652   1.00 0.00 ? 11  LEU B O    2  
ATOM   8191   C CB   . LEU B 1 11  ? 14.133  -10.077 -2.173  1.00 0.00 ? 11  LEU B CB   2  
ATOM   8192   C CG   . LEU B 1 11  ? 15.103  -10.342 -3.328  1.00 0.00 ? 11  LEU B CG   2  
ATOM   8193   C CD1  . LEU B 1 11  ? 14.301  -10.575 -4.610  1.00 0.00 ? 11  LEU B CD1  2  
ATOM   8194   C CD2  . LEU B 1 11  ? 16.050  -9.144  -3.516  1.00 0.00 ? 11  LEU B CD2  2  
ATOM   8195   H H    . LEU B 1 11  ? 15.059  -12.188 -1.086  1.00 0.00 ? 11  LEU B H    2  
ATOM   8196   H HA   . LEU B 1 11  ? 15.747  -9.444  -0.923  1.00 0.00 ? 11  LEU B HA   2  
ATOM   8197   H HB2  . LEU B 1 11  ? 13.376  -10.851 -2.155  1.00 0.00 ? 11  LEU B HB2  2  
ATOM   8198   H HB3  . LEU B 1 11  ? 13.658  -9.116  -2.314  1.00 0.00 ? 11  LEU B HB3  2  
ATOM   8199   H HG   . LEU B 1 11  ? 15.682  -11.227 -3.106  1.00 0.00 ? 11  LEU B HG   2  
ATOM   8200   H HD11 . LEU B 1 11  ? 13.465  -9.891  -4.644  1.00 0.00 ? 11  LEU B HD11 2  
ATOM   8201   H HD12 . LEU B 1 11  ? 14.936  -10.410 -5.465  1.00 0.00 ? 11  LEU B HD12 2  
ATOM   8202   H HD13 . LEU B 1 11  ? 13.934  -11.591 -4.623  1.00 0.00 ? 11  LEU B HD13 2  
ATOM   8203   H HD21 . LEU B 1 11  ? 15.541  -8.226  -3.258  1.00 0.00 ? 11  LEU B HD21 2  
ATOM   8204   H HD22 . LEU B 1 11  ? 16.916  -9.264  -2.881  1.00 0.00 ? 11  LEU B HD22 2  
ATOM   8205   H HD23 . LEU B 1 11  ? 16.369  -9.095  -4.548  1.00 0.00 ? 11  LEU B HD23 2  
ATOM   8206   N N    . ILE B 1 12  ? 13.038  -10.354 0.709   1.00 0.00 ? 12  ILE B N    2  
ATOM   8207   C CA   . ILE B 1 12  ? 12.109  -9.926  1.752   1.00 0.00 ? 12  ILE B CA   2  
ATOM   8208   C C    . ILE B 1 12  ? 12.888  -9.584  3.010   1.00 0.00 ? 12  ILE B C    2  
ATOM   8209   O O    . ILE B 1 12  ? 12.663  -8.545  3.637   1.00 0.00 ? 12  ILE B O    2  
ATOM   8210   C CB   . ILE B 1 12  ? 11.119  -11.066 2.060   1.00 0.00 ? 12  ILE B CB   2  
ATOM   8211   C CG1  . ILE B 1 12  ? 10.229  -11.378 0.836   1.00 0.00 ? 12  ILE B CG1  2  
ATOM   8212   C CG2  . ILE B 1 12  ? 10.238  -10.694 3.256   1.00 0.00 ? 12  ILE B CG2  2  
ATOM   8213   C CD1  . ILE B 1 12  ? 9.305   -10.219 0.483   1.00 0.00 ? 12  ILE B CD1  2  
ATOM   8214   H H    . ILE B 1 12  ? 12.979  -11.268 0.348   1.00 0.00 ? 12  ILE B H    2  
ATOM   8215   H HA   . ILE B 1 12  ? 11.589  -9.044  1.411   1.00 0.00 ? 12  ILE B HA   2  
ATOM   8216   H HB   . ILE B 1 12  ? 11.685  -11.951 2.314   1.00 0.00 ? 12  ILE B HB   2  
ATOM   8217   H HG12 . ILE B 1 12  ? 10.856  -11.574 -0.011  1.00 0.00 ? 12  ILE B HG12 2  
ATOM   8218   H HG13 . ILE B 1 12  ? 9.635   -12.255 1.045   1.00 0.00 ? 12  ILE B HG13 2  
ATOM   8219   H HG21 . ILE B 1 12  ? 9.708   -9.778  3.041   1.00 0.00 ? 12  ILE B HG21 2  
ATOM   8220   H HG22 . ILE B 1 12  ? 9.525   -11.486 3.434   1.00 0.00 ? 12  ILE B HG22 2  
ATOM   8221   H HG23 . ILE B 1 12  ? 10.851  -10.559 4.133   1.00 0.00 ? 12  ILE B HG23 2  
ATOM   8222   H HD11 . ILE B 1 12  ? 8.814   -9.869  1.381   1.00 0.00 ? 12  ILE B HD11 2  
ATOM   8223   H HD12 . ILE B 1 12  ? 9.868   -9.414  0.054   1.00 0.00 ? 12  ILE B HD12 2  
ATOM   8224   H HD13 . ILE B 1 12  ? 8.565   -10.562 -0.216  1.00 0.00 ? 12  ILE B HD13 2  
ATOM   8225   N N    . ILE B 1 13  ? 13.831  -10.448 3.361   1.00 0.00 ? 13  ILE B N    2  
ATOM   8226   C CA   . ILE B 1 13  ? 14.660  -10.208 4.532   1.00 0.00 ? 13  ILE B CA   2  
ATOM   8227   C C    . ILE B 1 13  ? 15.490  -8.945  4.324   1.00 0.00 ? 13  ILE B C    2  
ATOM   8228   O O    . ILE B 1 13  ? 15.580  -8.090  5.210   1.00 0.00 ? 13  ILE B O    2  
ATOM   8229   C CB   . ILE B 1 13  ? 15.584  -11.405 4.765   1.00 0.00 ? 13  ILE B CB   2  
ATOM   8230   C CG1  . ILE B 1 13  ? 14.748  -12.626 5.194   1.00 0.00 ? 13  ILE B CG1  2  
ATOM   8231   C CG2  . ILE B 1 13  ? 16.610  -11.059 5.850   1.00 0.00 ? 13  ILE B CG2  2  
ATOM   8232   C CD1  . ILE B 1 13  ? 14.466  -12.589 6.700   1.00 0.00 ? 13  ILE B CD1  2  
ATOM   8233   H H    . ILE B 1 13  ? 13.983  -11.250 2.812   1.00 0.00 ? 13  ILE B H    2  
ATOM   8234   H HA   . ILE B 1 13  ? 14.023  -10.071 5.393   1.00 0.00 ? 13  ILE B HA   2  
ATOM   8235   H HB   . ILE B 1 13  ? 16.105  -11.633 3.846   1.00 0.00 ? 13  ILE B HB   2  
ATOM   8236   H HG12 . ILE B 1 13  ? 13.812  -12.620 4.656   1.00 0.00 ? 13  ILE B HG12 2  
ATOM   8237   H HG13 . ILE B 1 13  ? 15.289  -13.528 4.954   1.00 0.00 ? 13  ILE B HG13 2  
ATOM   8238   H HG21 . ILE B 1 13  ? 16.109  -10.578 6.677   1.00 0.00 ? 13  ILE B HG21 2  
ATOM   8239   H HG22 . ILE B 1 13  ? 17.088  -11.963 6.194   1.00 0.00 ? 13  ILE B HG22 2  
ATOM   8240   H HG23 . ILE B 1 13  ? 17.352  -10.391 5.441   1.00 0.00 ? 13  ILE B HG23 2  
ATOM   8241   H HD11 . ILE B 1 13  ? 14.416  -11.562 7.032   1.00 0.00 ? 13  ILE B HD11 2  
ATOM   8242   H HD12 . ILE B 1 13  ? 13.524  -13.077 6.901   1.00 0.00 ? 13  ILE B HD12 2  
ATOM   8243   H HD13 . ILE B 1 13  ? 15.254  -13.100 7.232   1.00 0.00 ? 13  ILE B HD13 2  
ATOM   8244   N N    . ASN B 1 14  ? 16.090  -8.830  3.141   1.00 0.00 ? 14  ASN B N    2  
ATOM   8245   C CA   . ASN B 1 14  ? 16.910  -7.662  2.817   1.00 0.00 ? 14  ASN B CA   2  
ATOM   8246   C C    . ASN B 1 14  ? 16.071  -6.391  2.904   1.00 0.00 ? 14  ASN B C    2  
ATOM   8247   O O    . ASN B 1 14  ? 16.476  -5.402  3.517   1.00 0.00 ? 14  ASN B O    2  
ATOM   8248   C CB   . ASN B 1 14  ? 17.501  -7.817  1.407   1.00 0.00 ? 14  ASN B CB   2  
ATOM   8249   C CG   . ASN B 1 14  ? 18.810  -7.045  1.279   1.00 0.00 ? 14  ASN B CG   2  
ATOM   8250   O OD1  . ASN B 1 14  ? 19.186  -6.296  2.174   1.00 0.00 ? 14  ASN B OD1  2  
ATOM   8251   N ND2  . ASN B 1 14  ? 19.532  -7.186  0.206   1.00 0.00 ? 14  ASN B ND2  2  
ATOM   8252   H H    . ASN B 1 14  ? 15.972  -9.538  2.472   1.00 0.00 ? 14  ASN B H    2  
ATOM   8253   H HA   . ASN B 1 14  ? 17.716  -7.596  3.531   1.00 0.00 ? 14  ASN B HA   2  
ATOM   8254   H HB2  . ASN B 1 14  ? 17.691  -8.861  1.215   1.00 0.00 ? 14  ASN B HB2  2  
ATOM   8255   H HB3  . ASN B 1 14  ? 16.796  -7.445  0.680   1.00 0.00 ? 14  ASN B HB3  2  
ATOM   8256   H HD21 . ASN B 1 14  ? 19.235  -7.782  -0.509  1.00 0.00 ? 14  ASN B HD21 2  
ATOM   8257   H HD22 . ASN B 1 14  ? 20.378  -6.697  0.117   1.00 0.00 ? 14  ASN B HD22 2  
ATOM   8258   N N    . SER B 1 15  ? 14.886  -6.430  2.304   1.00 0.00 ? 15  SER B N    2  
ATOM   8259   C CA   . SER B 1 15  ? 13.990  -5.280  2.346   1.00 0.00 ? 15  SER B CA   2  
ATOM   8260   C C    . SER B 1 15  ? 13.642  -4.944  3.791   1.00 0.00 ? 15  SER B C    2  
ATOM   8261   O O    . SER B 1 15  ? 13.638  -3.781  4.192   1.00 0.00 ? 15  SER B O    2  
ATOM   8262   C CB   . SER B 1 15  ? 12.708  -5.583  1.571   1.00 0.00 ? 15  SER B CB   2  
ATOM   8263   O OG   . SER B 1 15  ? 11.882  -6.441  2.348   1.00 0.00 ? 15  SER B OG   2  
ATOM   8264   H H    . SER B 1 15  ? 14.603  -7.251  1.843   1.00 0.00 ? 15  SER B H    2  
ATOM   8265   H HA   . SER B 1 15  ? 14.487  -4.431  1.901   1.00 0.00 ? 15  SER B HA   2  
ATOM   8266   H HB2  . SER B 1 15  ? 12.179  -4.667  1.369   1.00 0.00 ? 15  SER B HB2  2  
ATOM   8267   H HB3  . SER B 1 15  ? 12.960  -6.065  0.637   1.00 0.00 ? 15  SER B HB3  2  
ATOM   8268   H HG   . SER B 1 15  ? 11.408  -7.020  1.748   1.00 0.00 ? 15  SER B HG   2  
ATOM   8269   N N    . GLY B 1 16  ? 13.367  -5.985  4.577   1.00 0.00 ? 16  GLY B N    2  
ATOM   8270   C CA   . GLY B 1 16  ? 13.034  -5.800  5.985   1.00 0.00 ? 16  GLY B CA   2  
ATOM   8271   C C    . GLY B 1 16  ? 14.206  -5.180  6.737   1.00 0.00 ? 16  GLY B C    2  
ATOM   8272   O O    . GLY B 1 16  ? 14.026  -4.255  7.528   1.00 0.00 ? 16  GLY B O    2  
ATOM   8273   H H    . GLY B 1 16  ? 13.400  -6.893  4.205   1.00 0.00 ? 16  GLY B H    2  
ATOM   8274   H HA2  . GLY B 1 16  ? 12.179  -5.147  6.065   1.00 0.00 ? 16  GLY B HA2  2  
ATOM   8275   H HA3  . GLY B 1 16  ? 12.796  -6.755  6.426   1.00 0.00 ? 16  GLY B HA3  2  
ATOM   8276   N N    . GLN B 1 17  ? 15.414  -5.685  6.481   1.00 0.00 ? 17  GLN B N    2  
ATOM   8277   C CA   . GLN B 1 17  ? 16.603  -5.139  7.140   1.00 0.00 ? 17  GLN B CA   2  
ATOM   8278   C C    . GLN B 1 17  ? 16.782  -3.682  6.739   1.00 0.00 ? 17  GLN B C    2  
ATOM   8279   O O    . GLN B 1 17  ? 17.121  -2.837  7.569   1.00 0.00 ? 17  GLN B O    2  
ATOM   8280   C CB   . GLN B 1 17  ? 17.839  -5.964  6.748   1.00 0.00 ? 17  GLN B CB   2  
ATOM   8281   C CG   . GLN B 1 17  ? 18.979  -5.741  7.756   1.00 0.00 ? 17  GLN B CG   2  
ATOM   8282   C CD   . GLN B 1 17  ? 19.819  -7.010  7.883   1.00 0.00 ? 17  GLN B CD   2  
ATOM   8283   O OE1  . GLN B 1 17  ? 19.769  -7.880  7.013   1.00 0.00 ? 17  GLN B OE1  2  
ATOM   8284   N NE2  . GLN B 1 17  ? 20.585  -7.170  8.928   1.00 0.00 ? 17  GLN B NE2  2  
ATOM   8285   H H    . GLN B 1 17  ? 15.506  -6.417  5.830   1.00 0.00 ? 17  GLN B H    2  
ATOM   8286   H HA   . GLN B 1 17  ? 16.464  -5.195  8.210   1.00 0.00 ? 17  GLN B HA   2  
ATOM   8287   H HB2  . GLN B 1 17  ? 17.574  -7.012  6.728   1.00 0.00 ? 17  GLN B HB2  2  
ATOM   8288   H HB3  . GLN B 1 17  ? 18.169  -5.662  5.765   1.00 0.00 ? 17  GLN B HB3  2  
ATOM   8289   H HG2  . GLN B 1 17  ? 19.608  -4.934  7.410   1.00 0.00 ? 17  GLN B HG2  2  
ATOM   8290   H HG3  . GLN B 1 17  ? 18.574  -5.488  8.722   1.00 0.00 ? 17  GLN B HG3  2  
ATOM   8291   H HE21 . GLN B 1 17  ? 20.619  -6.479  9.621   1.00 0.00 ? 17  GLN B HE21 2  
ATOM   8292   H HE22 . GLN B 1 17  ? 21.126  -7.983  9.019   1.00 0.00 ? 17  GLN B HE22 2  
ATOM   8293   N N    . ALA B 1 18  ? 16.545  -3.398  5.462   1.00 0.00 ? 18  ALA B N    2  
ATOM   8294   C CA   . ALA B 1 18  ? 16.675  -2.040  4.957   1.00 0.00 ? 18  ALA B CA   2  
ATOM   8295   C C    . ALA B 1 18  ? 15.773  -1.098  5.748   1.00 0.00 ? 18  ALA B C    2  
ATOM   8296   O O    . ALA B 1 18  ? 16.219  -0.061  6.248   1.00 0.00 ? 18  ALA B O    2  
ATOM   8297   C CB   . ALA B 1 18  ? 16.309  -2.000  3.472   1.00 0.00 ? 18  ALA B CB   2  
ATOM   8298   H H    . ALA B 1 18  ? 16.269  -4.116  4.850   1.00 0.00 ? 18  ALA B H    2  
ATOM   8299   H HA   . ALA B 1 18  ? 17.700  -1.721  5.076   1.00 0.00 ? 18  ALA B HA   2  
ATOM   8300   H HB1  . ALA B 1 18  ? 15.246  -1.843  3.366   1.00 0.00 ? 18  ALA B HB1  2  
ATOM   8301   H HB2  . ALA B 1 18  ? 16.582  -2.937  3.010   1.00 0.00 ? 18  ALA B HB2  2  
ATOM   8302   H HB3  . ALA B 1 18  ? 16.843  -1.193  2.994   1.00 0.00 ? 18  ALA B HB3  2  
ATOM   8303   N N    . ARG B 1 19  ? 14.506  -1.472  5.879   1.00 0.00 ? 19  ARG B N    2  
ATOM   8304   C CA   . ARG B 1 19  ? 13.571  -0.651  6.638   1.00 0.00 ? 19  ARG B CA   2  
ATOM   8305   C C    . ARG B 1 19  ? 14.057  -0.524  8.076   1.00 0.00 ? 19  ARG B C    2  
ATOM   8306   O O    . ARG B 1 19  ? 14.085  0.570   8.645   1.00 0.00 ? 19  ARG B O    2  
ATOM   8307   C CB   . ARG B 1 19  ? 12.170  -1.271  6.627   1.00 0.00 ? 19  ARG B CB   2  
ATOM   8308   C CG   . ARG B 1 19  ? 11.195  -0.327  7.346   1.00 0.00 ? 19  ARG B CG   2  
ATOM   8309   C CD   . ARG B 1 19  ? 9.770   -0.877  7.263   1.00 0.00 ? 19  ARG B CD   2  
ATOM   8310   N NE   . ARG B 1 19  ? 9.660   -2.141  7.992   1.00 0.00 ? 19  ARG B NE   2  
ATOM   8311   C CZ   . ARG B 1 19  ? 8.481   -2.692  8.227   1.00 0.00 ? 19  ARG B CZ   2  
ATOM   8312   N NH1  . ARG B 1 19  ? 7.407   -2.131  7.768   1.00 0.00 ? 19  ARG B NH1  2  
ATOM   8313   N NH2  . ARG B 1 19  ? 8.399   -3.783  8.916   1.00 0.00 ? 19  ARG B NH2  2  
ATOM   8314   H H    . ARG B 1 19  ? 14.202  -2.316  5.477   1.00 0.00 ? 19  ARG B H    2  
ATOM   8315   H HA   . ARG B 1 19  ? 13.529  0.332   6.194   1.00 0.00 ? 19  ARG B HA   2  
ATOM   8316   H HB2  . ARG B 1 19  ? 11.851  -1.422  5.608   1.00 0.00 ? 19  ARG B HB2  2  
ATOM   8317   H HB3  . ARG B 1 19  ? 12.196  -2.220  7.145   1.00 0.00 ? 19  ARG B HB3  2  
ATOM   8318   H HG2  . ARG B 1 19  ? 11.482  -0.231  8.385   1.00 0.00 ? 19  ARG B HG2  2  
ATOM   8319   H HG3  . ARG B 1 19  ? 11.229  0.645   6.877   1.00 0.00 ? 19  ARG B HG3  2  
ATOM   8320   H HD2  . ARG B 1 19  ? 9.090   -0.156  7.700   1.00 0.00 ? 19  ARG B HD2  2  
ATOM   8321   H HD3  . ARG B 1 19  ? 9.509   -1.034  6.223   1.00 0.00 ? 19  ARG B HD3  2  
ATOM   8322   H HE   . ARG B 1 19  ? 10.473  -2.575  8.326   1.00 0.00 ? 19  ARG B HE   2  
ATOM   8323   H HH11 . ARG B 1 19  ? 7.475   -1.288  7.235   1.00 0.00 ? 19  ARG B HH11 2  
ATOM   8324   H HH12 . ARG B 1 19  ? 6.517   -2.536  7.943   1.00 0.00 ? 19  ARG B HH12 2  
ATOM   8325   H HH21 . ARG B 1 19  ? 9.229   -4.218  9.266   1.00 0.00 ? 19  ARG B HH21 2  
ATOM   8326   H HH22 . ARG B 1 19  ? 7.509   -4.194  9.097   1.00 0.00 ? 19  ARG B HH22 2  
ATOM   8327   N N    . SER B 1 20  ? 14.437  -1.655  8.658   1.00 0.00 ? 20  SER B N    2  
ATOM   8328   C CA   . SER B 1 20  ? 14.926  -1.670  10.033  1.00 0.00 ? 20  SER B CA   2  
ATOM   8329   C C    . SER B 1 20  ? 16.052  -0.658  10.207  1.00 0.00 ? 20  SER B C    2  
ATOM   8330   O O    . SER B 1 20  ? 16.046  0.146   11.143  1.00 0.00 ? 20  SER B O    2  
ATOM   8331   C CB   . SER B 1 20  ? 15.425  -3.067  10.407  1.00 0.00 ? 20  SER B CB   2  
ATOM   8332   O OG   . SER B 1 20  ? 16.195  -2.988  11.600  1.00 0.00 ? 20  SER B OG   2  
ATOM   8333   H H    . SER B 1 20  ? 14.395  -2.497  8.151   1.00 0.00 ? 20  SER B H    2  
ATOM   8334   H HA   . SER B 1 20  ? 14.113  -1.399  10.689  1.00 0.00 ? 20  SER B HA   2  
ATOM   8335   H HB2  . SER B 1 20  ? 14.585  -3.721  10.570  1.00 0.00 ? 20  SER B HB2  2  
ATOM   8336   H HB3  . SER B 1 20  ? 16.031  -3.457  9.601   1.00 0.00 ? 20  SER B HB3  2  
ATOM   8337   H HG   . SER B 1 20  ? 15.682  -2.508  12.254  1.00 0.00 ? 20  SER B HG   2  
ATOM   8338   N N    . LEU B 1 21  ? 17.008  -0.683  9.287   1.00 0.00 ? 21  LEU B N    2  
ATOM   8339   C CA   . LEU B 1 21  ? 18.126  0.255   9.336   1.00 0.00 ? 21  LEU B CA   2  
ATOM   8340   C C    . LEU B 1 21  ? 17.611  1.689   9.193   1.00 0.00 ? 21  LEU B C    2  
ATOM   8341   O O    . LEU B 1 21  ? 18.049  2.595   9.907   1.00 0.00 ? 21  LEU B O    2  
ATOM   8342   C CB   . LEU B 1 21  ? 19.114  -0.045  8.205   1.00 0.00 ? 21  LEU B CB   2  
ATOM   8343   C CG   . LEU B 1 21  ? 19.838  -1.372  8.480   1.00 0.00 ? 21  LEU B CG   2  
ATOM   8344   C CD1  . LEU B 1 21  ? 20.597  -1.823  7.220   1.00 0.00 ? 21  LEU B CD1  2  
ATOM   8345   C CD2  . LEU B 1 21  ? 20.827  -1.200  9.655   1.00 0.00 ? 21  LEU B CD2  2  
ATOM   8346   H H    . LEU B 1 21  ? 16.953  -1.330  8.550   1.00 0.00 ? 21  LEU B H    2  
ATOM   8347   H HA   . LEU B 1 21  ? 18.626  0.159   10.287  1.00 0.00 ? 21  LEU B HA   2  
ATOM   8348   H HB2  . LEU B 1 21  ? 18.572  -0.113  7.273   1.00 0.00 ? 21  LEU B HB2  2  
ATOM   8349   H HB3  . LEU B 1 21  ? 19.839  0.753   8.141   1.00 0.00 ? 21  LEU B HB3  2  
ATOM   8350   H HG   . LEU B 1 21  ? 19.106  -2.124  8.738   1.00 0.00 ? 21  LEU B HG   2  
ATOM   8351   H HD11 . LEU B 1 21  ? 20.095  -1.458  6.337   1.00 0.00 ? 21  LEU B HD11 2  
ATOM   8352   H HD12 . LEU B 1 21  ? 21.604  -1.432  7.247   1.00 0.00 ? 21  LEU B HD12 2  
ATOM   8353   H HD13 . LEU B 1 21  ? 20.633  -2.902  7.190   1.00 0.00 ? 21  LEU B HD13 2  
ATOM   8354   H HD21 . LEU B 1 21  ? 20.860  -0.165  9.965   1.00 0.00 ? 21  LEU B HD21 2  
ATOM   8355   H HD22 . LEU B 1 21  ? 20.502  -1.810  10.485  1.00 0.00 ? 21  LEU B HD22 2  
ATOM   8356   H HD23 . LEU B 1 21  ? 21.818  -1.510  9.353   1.00 0.00 ? 21  LEU B HD23 2  
ATOM   8357   N N    . ALA B 1 22  ? 16.673  1.887   8.268   1.00 0.00 ? 22  ALA B N    2  
ATOM   8358   C CA   . ALA B 1 22  ? 16.100  3.211   8.044   1.00 0.00 ? 22  ALA B CA   2  
ATOM   8359   C C    . ALA B 1 22  ? 15.467  3.747   9.332   1.00 0.00 ? 22  ALA B C    2  
ATOM   8360   O O    . ALA B 1 22  ? 15.771  4.862   9.761   1.00 0.00 ? 22  ALA B O    2  
ATOM   8361   C CB   . ALA B 1 22  ? 15.063  3.148   6.923   1.00 0.00 ? 22  ALA B CB   2  
ATOM   8362   H H    . ALA B 1 22  ? 16.358  1.124   7.733   1.00 0.00 ? 22  ALA B H    2  
ATOM   8363   H HA   . ALA B 1 22  ? 16.891  3.883   7.748   1.00 0.00 ? 22  ALA B HA   2  
ATOM   8364   H HB1  . ALA B 1 22  ? 14.193  2.609   7.266   1.00 0.00 ? 22  ALA B HB1  2  
ATOM   8365   H HB2  . ALA B 1 22  ? 14.780  4.150   6.639   1.00 0.00 ? 22  ALA B HB2  2  
ATOM   8366   H HB3  . ALA B 1 22  ? 15.489  2.638   6.071   1.00 0.00 ? 22  ALA B HB3  2  
ATOM   8367   N N    . TYR B 1 23  ? 14.603  2.949   9.959   1.00 0.00 ? 23  TYR B N    2  
ATOM   8368   C CA   . TYR B 1 23  ? 13.973  3.380   11.212  1.00 0.00 ? 23  TYR B CA   2  
ATOM   8369   C C    . TYR B 1 23  ? 15.055  3.649   12.253  1.00 0.00 ? 23  TYR B C    2  
ATOM   8370   O O    . TYR B 1 23  ? 14.994  4.634   12.989  1.00 0.00 ? 23  TYR B O    2  
ATOM   8371   C CB   . TYR B 1 23  ? 13.007  2.306   11.724  1.00 0.00 ? 23  TYR B CB   2  
ATOM   8372   C CG   . TYR B 1 23  ? 12.449  2.724   13.063  1.00 0.00 ? 23  TYR B CG   2  
ATOM   8373   C CD1  . TYR B 1 23  ? 11.426  3.677   13.131  1.00 0.00 ? 23  TYR B CD1  2  
ATOM   8374   C CD2  . TYR B 1 23  ? 12.956  2.157   14.239  1.00 0.00 ? 23  TYR B CD2  2  
ATOM   8375   C CE1  . TYR B 1 23  ? 10.910  4.064   14.374  1.00 0.00 ? 23  TYR B CE1  2  
ATOM   8376   C CE2  . TYR B 1 23  ? 12.440  2.543   15.482  1.00 0.00 ? 23  TYR B CE2  2  
ATOM   8377   C CZ   . TYR B 1 23  ? 11.417  3.497   15.550  1.00 0.00 ? 23  TYR B CZ   2  
ATOM   8378   O OH   . TYR B 1 23  ? 10.909  3.878   16.775  1.00 0.00 ? 23  TYR B OH   2  
ATOM   8379   H H    . TYR B 1 23  ? 14.399  2.061   9.585   1.00 0.00 ? 23  TYR B H    2  
ATOM   8380   H HA   . TYR B 1 23  ? 13.434  4.296   11.036  1.00 0.00 ? 23  TYR B HA   2  
ATOM   8381   H HB2  . TYR B 1 23  ? 12.198  2.184   11.018  1.00 0.00 ? 23  TYR B HB2  2  
ATOM   8382   H HB3  . TYR B 1 23  ? 13.535  1.370   11.831  1.00 0.00 ? 23  TYR B HB3  2  
ATOM   8383   H HD1  . TYR B 1 23  ? 11.034  4.114   12.224  1.00 0.00 ? 23  TYR B HD1  2  
ATOM   8384   H HD2  . TYR B 1 23  ? 13.745  1.421   14.188  1.00 0.00 ? 23  TYR B HD2  2  
ATOM   8385   H HE1  . TYR B 1 23  ? 10.121  4.799   14.426  1.00 0.00 ? 23  TYR B HE1  2  
ATOM   8386   H HE2  . TYR B 1 23  ? 12.831  2.106   16.389  1.00 0.00 ? 23  TYR B HE2  2  
ATOM   8387   H HH   . TYR B 1 23  ? 10.143  4.435   16.618  1.00 0.00 ? 23  TYR B HH   2  
ATOM   8388   N N    . ALA B 1 24  ? 16.067  2.786   12.292  1.00 0.00 ? 24  ALA B N    2  
ATOM   8389   C CA   . ALA B 1 24  ? 17.159  2.973   13.232  1.00 0.00 ? 24  ALA B CA   2  
ATOM   8390   C C    . ALA B 1 24  ? 17.857  4.300   12.924  1.00 0.00 ? 24  ALA B C    2  
ATOM   8391   O O    . ALA B 1 24  ? 18.199  5.062   13.830  1.00 0.00 ? 24  ALA B O    2  
ATOM   8392   C CB   . ALA B 1 24  ? 18.139  1.789   13.140  1.00 0.00 ? 24  ALA B CB   2  
ATOM   8393   H H    . ALA B 1 24  ? 16.084  2.025   11.669  1.00 0.00 ? 24  ALA B H    2  
ATOM   8394   H HA   . ALA B 1 24  ? 16.754  3.020   14.233  1.00 0.00 ? 24  ALA B HA   2  
ATOM   8395   H HB1  . ALA B 1 24  ? 18.114  1.230   14.066  1.00 0.00 ? 24  ALA B HB1  2  
ATOM   8396   H HB2  . ALA B 1 24  ? 17.845  1.143   12.326  1.00 0.00 ? 24  ALA B HB2  2  
ATOM   8397   H HB3  . ALA B 1 24  ? 19.139  2.153   12.966  1.00 0.00 ? 24  ALA B HB3  2  
ATOM   8398   N N    . ALA B 1 25  ? 18.025  4.586   11.634  1.00 0.00 ? 25  ALA B N    2  
ATOM   8399   C CA   . ALA B 1 25  ? 18.643  5.841   11.212  1.00 0.00 ? 25  ALA B CA   2  
ATOM   8400   C C    . ALA B 1 25  ? 17.842  7.015   11.764  1.00 0.00 ? 25  ALA B C    2  
ATOM   8401   O O    . ALA B 1 25  ? 18.400  7.981   12.288  1.00 0.00 ? 25  ALA B O    2  
ATOM   8402   C CB   . ALA B 1 25  ? 18.684  5.913   9.683   1.00 0.00 ? 25  ALA B CB   2  
ATOM   8403   H H    . ALA B 1 25  ? 17.707  3.952   10.953  1.00 0.00 ? 25  ALA B H    2  
ATOM   8404   H HA   . ALA B 1 25  ? 19.650  5.890   11.598  1.00 0.00 ? 25  ALA B HA   2  
ATOM   8405   H HB1  . ALA B 1 25  ? 18.932  4.941   9.283   1.00 0.00 ? 25  ALA B HB1  2  
ATOM   8406   H HB2  . ALA B 1 25  ? 17.717  6.220   9.309   1.00 0.00 ? 25  ALA B HB2  2  
ATOM   8407   H HB3  . ALA B 1 25  ? 19.431  6.630   9.376   1.00 0.00 ? 25  ALA B HB3  2  
ATOM   8408   N N    . LEU B 1 26  ? 16.524  6.914   11.656  1.00 0.00 ? 26  LEU B N    2  
ATOM   8409   C CA   . LEU B 1 26  ? 15.643  7.962   12.164  1.00 0.00 ? 26  LEU B CA   2  
ATOM   8410   C C    . LEU B 1 26  ? 15.819  8.104   13.672  1.00 0.00 ? 26  LEU B C    2  
ATOM   8411   O O    . LEU B 1 26  ? 15.909  9.216   14.203  1.00 0.00 ? 26  LEU B O    2  
ATOM   8412   C CB   . LEU B 1 26  ? 14.185  7.623   11.833  1.00 0.00 ? 26  LEU B CB   2  
ATOM   8413   C CG   . LEU B 1 26  ? 13.229  8.626   12.501  1.00 0.00 ? 26  LEU B CG   2  
ATOM   8414   C CD1  . LEU B 1 26  ? 13.520  10.046  12.007  1.00 0.00 ? 26  LEU B CD1  2  
ATOM   8415   C CD2  . LEU B 1 26  ? 11.791  8.255   12.138  1.00 0.00 ? 26  LEU B CD2  2  
ATOM   8416   H H    . LEU B 1 26  ? 16.134  6.114   11.240  1.00 0.00 ? 26  LEU B H    2  
ATOM   8417   H HA   . LEU B 1 26  ? 15.907  8.895   11.693  1.00 0.00 ? 26  LEU B HA   2  
ATOM   8418   H HB2  . LEU B 1 26  ? 14.046  7.657   10.766  1.00 0.00 ? 26  LEU B HB2  2  
ATOM   8419   H HB3  . LEU B 1 26  ? 13.958  6.629   12.191  1.00 0.00 ? 26  LEU B HB3  2  
ATOM   8420   H HG   . LEU B 1 26  ? 13.351  8.585   13.572  1.00 0.00 ? 26  LEU B HG   2  
ATOM   8421   H HD11 . LEU B 1 26  ? 13.666  10.034  10.938  1.00 0.00 ? 26  LEU B HD11 2  
ATOM   8422   H HD12 . LEU B 1 26  ? 12.686  10.686  12.249  1.00 0.00 ? 26  LEU B HD12 2  
ATOM   8423   H HD13 . LEU B 1 26  ? 14.412  10.420  12.490  1.00 0.00 ? 26  LEU B HD13 2  
ATOM   8424   H HD21 . LEU B 1 26  ? 11.673  8.271   11.064  1.00 0.00 ? 26  LEU B HD21 2  
ATOM   8425   H HD22 . LEU B 1 26  ? 11.567  7.267   12.510  1.00 0.00 ? 26  LEU B HD22 2  
ATOM   8426   H HD23 . LEU B 1 26  ? 11.113  8.968   12.582  1.00 0.00 ? 26  LEU B HD23 2  
ATOM   8427   N N    . LYS B 1 27  ? 15.874  6.971   14.361  1.00 0.00 ? 27  LYS B N    2  
ATOM   8428   C CA   . LYS B 1 27  ? 16.055  6.979   15.806  1.00 0.00 ? 27  LYS B CA   2  
ATOM   8429   C C    . LYS B 1 27  ? 17.327  7.743   16.178  1.00 0.00 ? 27  LYS B C    2  
ATOM   8430   O O    . LYS B 1 27  ? 17.332  8.533   17.125  1.00 0.00 ? 27  LYS B O    2  
ATOM   8431   C CB   . LYS B 1 27  ? 16.115  5.541   16.325  1.00 0.00 ? 27  LYS B CB   2  
ATOM   8432   C CG   . LYS B 1 27  ? 16.155  5.541   17.856  1.00 0.00 ? 27  LYS B CG   2  
ATOM   8433   C CD   . LYS B 1 27  ? 16.151  4.094   18.361  1.00 0.00 ? 27  LYS B CD   2  
ATOM   8434   C CE   . LYS B 1 27  ? 16.166  4.081   19.890  1.00 0.00 ? 27  LYS B CE   2  
ATOM   8435   N NZ   . LYS B 1 27  ? 16.139  2.670   20.370  1.00 0.00 ? 27  LYS B NZ   2  
ATOM   8436   H H    . LYS B 1 27  ? 15.803  6.114   13.884  1.00 0.00 ? 27  LYS B H    2  
ATOM   8437   H HA   . LYS B 1 27  ? 15.212  7.479   16.254  1.00 0.00 ? 27  LYS B HA   2  
ATOM   8438   H HB2  . LYS B 1 27  ? 15.241  5.003   15.987  1.00 0.00 ? 27  LYS B HB2  2  
ATOM   8439   H HB3  . LYS B 1 27  ? 17.004  5.057   15.942  1.00 0.00 ? 27  LYS B HB3  2  
ATOM   8440   H HG2  . LYS B 1 27  ? 17.055  6.042   18.192  1.00 0.00 ? 27  LYS B HG2  2  
ATOM   8441   H HG3  . LYS B 1 27  ? 15.288  6.059   18.239  1.00 0.00 ? 27  LYS B HG3  2  
ATOM   8442   H HD2  . LYS B 1 27  ? 15.264  3.592   18.001  1.00 0.00 ? 27  LYS B HD2  2  
ATOM   8443   H HD3  . LYS B 1 27  ? 17.029  3.583   17.988  1.00 0.00 ? 27  LYS B HD3  2  
ATOM   8444   H HE2  . LYS B 1 27  ? 17.064  4.571   20.245  1.00 0.00 ? 27  LYS B HE2  2  
ATOM   8445   H HE3  . LYS B 1 27  ? 15.299  4.610   20.261  1.00 0.00 ? 27  LYS B HE3  2  
ATOM   8446   H HZ1  . LYS B 1 27  ? 15.306  2.184   19.980  1.00 0.00 ? 27  LYS B HZ1  2  
ATOM   8447   H HZ2  . LYS B 1 27  ? 17.004  2.180   20.058  1.00 0.00 ? 27  LYS B HZ2  2  
ATOM   8448   H HZ3  . LYS B 1 27  ? 16.089  2.658   21.410  1.00 0.00 ? 27  LYS B HZ3  2  
ATOM   8449   N N    . GLN B 1 28  ? 18.394  7.524   15.413  1.00 0.00 ? 28  GLN B N    2  
ATOM   8450   C CA   . GLN B 1 28  ? 19.652  8.226   15.660  1.00 0.00 ? 28  GLN B CA   2  
ATOM   8451   C C    . GLN B 1 28  ? 19.422  9.732   15.565  1.00 0.00 ? 28  GLN B C    2  
ATOM   8452   O O    . GLN B 1 28  ? 19.929  10.507  16.374  1.00 0.00 ? 28  GLN B O    2  
ATOM   8453   C CB   . GLN B 1 28  ? 20.698  7.801   14.626  1.00 0.00 ? 28  GLN B CB   2  
ATOM   8454   C CG   . GLN B 1 28  ? 21.069  6.333   14.845  1.00 0.00 ? 28  GLN B CG   2  
ATOM   8455   C CD   . GLN B 1 28  ? 21.760  6.168   16.195  1.00 0.00 ? 28  GLN B CD   2  
ATOM   8456   O OE1  . GLN B 1 28  ? 22.733  6.864   16.483  1.00 0.00 ? 28  GLN B OE1  2  
ATOM   8457   N NE2  . GLN B 1 28  ? 21.313  5.284   17.043  1.00 0.00 ? 28  GLN B NE2  2  
ATOM   8458   H H    . GLN B 1 28  ? 18.327  6.899   14.659  1.00 0.00 ? 28  GLN B H    2  
ATOM   8459   H HA   . GLN B 1 28  ? 20.013  7.982   16.648  1.00 0.00 ? 28  GLN B HA   2  
ATOM   8460   H HB2  . GLN B 1 28  ? 20.292  7.926   13.632  1.00 0.00 ? 28  GLN B HB2  2  
ATOM   8461   H HB3  . GLN B 1 28  ? 21.580  8.414   14.734  1.00 0.00 ? 28  GLN B HB3  2  
ATOM   8462   H HG2  . GLN B 1 28  ? 20.173  5.730   14.824  1.00 0.00 ? 28  GLN B HG2  2  
ATOM   8463   H HG3  . GLN B 1 28  ? 21.737  6.011   14.060  1.00 0.00 ? 28  GLN B HG3  2  
ATOM   8464   H HE21 . GLN B 1 28  ? 20.538  4.731   16.812  1.00 0.00 ? 28  GLN B HE21 2  
ATOM   8465   H HE22 . GLN B 1 28  ? 21.752  5.173   17.912  1.00 0.00 ? 28  GLN B HE22 2  
ATOM   8466   N N    . ALA B 1 29  ? 18.641  10.134  14.565  1.00 0.00 ? 29  ALA B N    2  
ATOM   8467   C CA   . ALA B 1 29  ? 18.334  11.548  14.364  1.00 0.00 ? 29  ALA B CA   2  
ATOM   8468   C C    . ALA B 1 29  ? 17.631  12.118  15.592  1.00 0.00 ? 29  ALA B C    2  
ATOM   8469   O O    . ALA B 1 29  ? 17.943  13.215  16.049  1.00 0.00 ? 29  ALA B O    2  
ATOM   8470   C CB   . ALA B 1 29  ? 17.447  11.720  13.126  1.00 0.00 ? 29  ALA B CB   2  
ATOM   8471   H H    . ALA B 1 29  ? 18.258  9.466   13.958  1.00 0.00 ? 29  ALA B H    2  
ATOM   8472   H HA   . ALA B 1 29  ? 19.258  12.086  14.212  1.00 0.00 ? 29  ALA B HA   2  
ATOM   8473   H HB1  . ALA B 1 29  ? 16.414  11.551  13.394  1.00 0.00 ? 29  ALA B HB1  2  
ATOM   8474   H HB2  . ALA B 1 29  ? 17.558  12.724  12.742  1.00 0.00 ? 29  ALA B HB2  2  
ATOM   8475   H HB3  . ALA B 1 29  ? 17.743  11.009  12.369  1.00 0.00 ? 29  ALA B HB3  2  
ATOM   8476   N N    . LYS B 1 30  ? 16.684  11.359  16.134  1.00 0.00 ? 30  LYS B N    2  
ATOM   8477   C CA   . LYS B 1 30  ? 15.959  11.806  17.319  1.00 0.00 ? 30  LYS B CA   2  
ATOM   8478   C C    . LYS B 1 30  ? 16.921  12.029  18.482  1.00 0.00 ? 30  LYS B C    2  
ATOM   8479   O O    . LYS B 1 30  ? 16.692  12.897  19.320  1.00 0.00 ? 30  LYS B O    2  
ATOM   8480   C CB   . LYS B 1 30  ? 14.901  10.776  17.727  1.00 0.00 ? 30  LYS B CB   2  
ATOM   8481   C CG   . LYS B 1 30  ? 13.775  10.746  16.692  1.00 0.00 ? 30  LYS B CG   2  
ATOM   8482   C CD   . LYS B 1 30  ? 12.682  9.787   17.171  1.00 0.00 ? 30  LYS B CD   2  
ATOM   8483   C CE   . LYS B 1 30  ? 11.539  9.756   16.156  1.00 0.00 ? 30  LYS B CE   2  
ATOM   8484   N NZ   . LYS B 1 30  ? 10.469  8.844   16.648  1.00 0.00 ? 30  LYS B NZ   2  
ATOM   8485   H H    . LYS B 1 30  ? 16.482  10.487  15.734  1.00 0.00 ? 30  LYS B H    2  
ATOM   8486   H HA   . LYS B 1 30  ? 15.470  12.740  17.094  1.00 0.00 ? 30  LYS B HA   2  
ATOM   8487   H HB2  . LYS B 1 30  ? 15.357  9.799   17.796  1.00 0.00 ? 30  LYS B HB2  2  
ATOM   8488   H HB3  . LYS B 1 30  ? 14.493  11.049  18.691  1.00 0.00 ? 30  LYS B HB3  2  
ATOM   8489   H HG2  . LYS B 1 30  ? 13.367  11.737  16.574  1.00 0.00 ? 30  LYS B HG2  2  
ATOM   8490   H HG3  . LYS B 1 30  ? 14.170  10.401  15.746  1.00 0.00 ? 30  LYS B HG3  2  
ATOM   8491   H HD2  . LYS B 1 30  ? 13.098  8.793   17.275  1.00 0.00 ? 30  LYS B HD2  2  
ATOM   8492   H HD3  . LYS B 1 30  ? 12.305  10.119  18.127  1.00 0.00 ? 30  LYS B HD3  2  
ATOM   8493   H HE2  . LYS B 1 30  ? 11.136  10.754  16.036  1.00 0.00 ? 30  LYS B HE2  2  
ATOM   8494   H HE3  . LYS B 1 30  ? 11.908  9.399   15.203  1.00 0.00 ? 30  LYS B HE3  2  
ATOM   8495   H HZ1  . LYS B 1 30  ? 10.270  9.043   17.652  1.00 0.00 ? 30  LYS B HZ1  2  
ATOM   8496   H HZ2  . LYS B 1 30  ? 9.600   8.991   16.085  1.00 0.00 ? 30  LYS B HZ2  2  
ATOM   8497   H HZ3  . LYS B 1 30  ? 10.776  7.858   16.540  1.00 0.00 ? 30  LYS B HZ3  2  
ATOM   8498   N N    . GLN B 1 31  ? 17.995  11.245  18.525  1.00 0.00 ? 31  GLN B N    2  
ATOM   8499   C CA   . GLN B 1 31  ? 18.977  11.384  19.592  1.00 0.00 ? 31  GLN B CA   2  
ATOM   8500   C C    . GLN B 1 31  ? 19.909  12.559  19.297  1.00 0.00 ? 31  GLN B C    2  
ATOM   8501   O O    . GLN B 1 31  ? 20.783  12.888  20.096  1.00 0.00 ? 31  GLN B O    2  
ATOM   8502   C CB   . GLN B 1 31  ? 19.790  10.090  19.744  1.00 0.00 ? 31  GLN B CB   2  
ATOM   8503   C CG   . GLN B 1 31  ? 18.853  8.860   19.761  1.00 0.00 ? 31  GLN B CG   2  
ATOM   8504   C CD   . GLN B 1 31  ? 19.229  7.901   20.891  1.00 0.00 ? 31  GLN B CD   2  
ATOM   8505   O OE1  . GLN B 1 31  ? 20.379  7.834   21.300  1.00 0.00 ? 31  GLN B OE1  2  
ATOM   8506   N NE2  . GLN B 1 31  ? 18.311  7.143   21.422  1.00 0.00 ? 31  GLN B NE2  2  
ATOM   8507   H H    . GLN B 1 31  ? 18.130  10.568  17.827  1.00 0.00 ? 31  GLN B H    2  
ATOM   8508   H HA   . GLN B 1 31  ? 18.461  11.580  20.521  1.00 0.00 ? 31  GLN B HA   2  
ATOM   8509   H HB2  . GLN B 1 31  ? 20.481  10.008  18.914  1.00 0.00 ? 31  GLN B HB2  2  
ATOM   8510   H HB3  . GLN B 1 31  ? 20.348  10.132  20.668  1.00 0.00 ? 31  GLN B HB3  2  
ATOM   8511   H HG2  . GLN B 1 31  ? 17.833  9.183   19.902  1.00 0.00 ? 31  GLN B HG2  2  
ATOM   8512   H HG3  . GLN B 1 31  ? 18.933  8.338   18.820  1.00 0.00 ? 31  GLN B HG3  2  
ATOM   8513   H HE21 . GLN B 1 31  ? 17.391  7.192   21.097  1.00 0.00 ? 31  GLN B HE21 2  
ATOM   8514   H HE22 . GLN B 1 31  ? 18.547  6.529   22.146  1.00 0.00 ? 31  GLN B HE22 2  
ATOM   8515   N N    . GLY B 1 32  ? 19.701  13.198  18.148  1.00 0.00 ? 32  GLY B N    2  
ATOM   8516   C CA   . GLY B 1 32  ? 20.516  14.348  17.756  1.00 0.00 ? 32  GLY B CA   2  
ATOM   8517   C C    . GLY B 1 32  ? 21.836  13.911  17.124  1.00 0.00 ? 32  GLY B C    2  
ATOM   8518   O O    . GLY B 1 32  ? 22.763  14.712  16.995  1.00 0.00 ? 32  GLY B O    2  
ATOM   8519   H H    . GLY B 1 32  ? 18.979  12.899  17.555  1.00 0.00 ? 32  GLY B H    2  
ATOM   8520   H HA2  . GLY B 1 32  ? 19.964  14.943  17.041  1.00 0.00 ? 32  GLY B HA2  2  
ATOM   8521   H HA3  . GLY B 1 32  ? 20.723  14.946  18.628  1.00 0.00 ? 32  GLY B HA3  2  
ATOM   8522   N N    . ASP B 1 33  ? 21.912  12.645  16.724  1.00 0.00 ? 33  ASP B N    2  
ATOM   8523   C CA   . ASP B 1 33  ? 23.122  12.112  16.100  1.00 0.00 ? 33  ASP B CA   2  
ATOM   8524   C C    . ASP B 1 33  ? 22.986  12.115  14.576  1.00 0.00 ? 33  ASP B C    2  
ATOM   8525   O O    . ASP B 1 33  ? 22.652  11.096  13.966  1.00 0.00 ? 33  ASP B O    2  
ATOM   8526   C CB   . ASP B 1 33  ? 23.366  10.684  16.594  1.00 0.00 ? 33  ASP B CB   2  
ATOM   8527   C CG   . ASP B 1 33  ? 23.796  10.699  18.055  1.00 0.00 ? 33  ASP B CG   2  
ATOM   8528   O OD1  . ASP B 1 33  ? 24.080  11.769  18.560  1.00 0.00 ? 33  ASP B OD1  2  
ATOM   8529   O OD2  . ASP B 1 33  ? 23.848  9.635   18.639  1.00 0.00 ? 33  ASP B OD2  2  
ATOM   8530   H H    . ASP B 1 33  ? 21.141  12.055  16.849  1.00 0.00 ? 33  ASP B H    2  
ATOM   8531   H HA   . ASP B 1 33  ? 23.966  12.727  16.381  1.00 0.00 ? 33  ASP B HA   2  
ATOM   8532   H HB2  . ASP B 1 33  ? 22.455  10.113  16.497  1.00 0.00 ? 33  ASP B HB2  2  
ATOM   8533   H HB3  . ASP B 1 33  ? 24.141  10.228  16.000  1.00 0.00 ? 33  ASP B HB3  2  
ATOM   8534   N N    . PHE B 1 34  ? 23.233  13.268  13.967  1.00 0.00 ? 34  PHE B N    2  
ATOM   8535   C CA   . PHE B 1 34  ? 23.119  13.391  12.514  1.00 0.00 ? 34  PHE B CA   2  
ATOM   8536   C C    . PHE B 1 34  ? 24.153  12.536  11.787  1.00 0.00 ? 34  PHE B C    2  
ATOM   8537   O O    . PHE B 1 34  ? 23.881  12.006  10.710  1.00 0.00 ? 34  PHE B O    2  
ATOM   8538   C CB   . PHE B 1 34  ? 23.309  14.849  12.091  1.00 0.00 ? 34  PHE B CB   2  
ATOM   8539   C CG   . PHE B 1 34  ? 22.210  15.699  12.674  1.00 0.00 ? 34  PHE B CG   2  
ATOM   8540   C CD1  . PHE B 1 34  ? 22.513  16.689  13.614  1.00 0.00 ? 34  PHE B CD1  2  
ATOM   8541   C CD2  . PHE B 1 34  ? 20.885  15.497  12.269  1.00 0.00 ? 34  PHE B CD2  2  
ATOM   8542   C CE1  . PHE B 1 34  ? 21.491  17.478  14.147  1.00 0.00 ? 34  PHE B CE1  2  
ATOM   8543   C CE2  . PHE B 1 34  ? 19.865  16.287  12.804  1.00 0.00 ? 34  PHE B CE2  2  
ATOM   8544   C CZ   . PHE B 1 34  ? 20.167  17.275  13.744  1.00 0.00 ? 34  PHE B CZ   2  
ATOM   8545   H H    . PHE B 1 34  ? 23.484  14.052  14.501  1.00 0.00 ? 34  PHE B H    2  
ATOM   8546   H HA   . PHE B 1 34  ? 22.132  13.071  12.214  1.00 0.00 ? 34  PHE B HA   2  
ATOM   8547   H HB2  . PHE B 1 34  ? 24.265  15.203  12.443  1.00 0.00 ? 34  PHE B HB2  2  
ATOM   8548   H HB3  . PHE B 1 34  ? 23.278  14.914  11.012  1.00 0.00 ? 34  PHE B HB3  2  
ATOM   8549   H HD1  . PHE B 1 34  ? 23.534  16.846  13.927  1.00 0.00 ? 34  PHE B HD1  2  
ATOM   8550   H HD2  . PHE B 1 34  ? 20.652  14.734  11.543  1.00 0.00 ? 34  PHE B HD2  2  
ATOM   8551   H HE1  . PHE B 1 34  ? 21.719  18.245  14.877  1.00 0.00 ? 34  PHE B HE1  2  
ATOM   8552   H HE2  . PHE B 1 34  ? 18.841  16.133  12.495  1.00 0.00 ? 34  PHE B HE2  2  
ATOM   8553   H HZ   . PHE B 1 34  ? 19.379  17.889  14.158  1.00 0.00 ? 34  PHE B HZ   2  
ATOM   8554   N N    . ALA B 1 35  ? 25.343  12.425  12.366  1.00 0.00 ? 35  ALA B N    2  
ATOM   8555   C CA   . ALA B 1 35  ? 26.417  11.657  11.743  1.00 0.00 ? 35  ALA B CA   2  
ATOM   8556   C C    . ALA B 1 35  ? 26.024  10.188  11.599  1.00 0.00 ? 35  ALA B C    2  
ATOM   8557   O O    . ALA B 1 35  ? 26.134  9.609   10.517  1.00 0.00 ? 35  ALA B O    2  
ATOM   8558   C CB   . ALA B 1 35  ? 27.694  11.781  12.585  1.00 0.00 ? 35  ALA B CB   2  
ATOM   8559   H H    . ALA B 1 35  ? 25.507  12.880  13.218  1.00 0.00 ? 35  ALA B H    2  
ATOM   8560   H HA   . ALA B 1 35  ? 26.610  12.060  10.760  1.00 0.00 ? 35  ALA B HA   2  
ATOM   8561   H HB1  . ALA B 1 35  ? 28.265  12.637  12.251  1.00 0.00 ? 35  ALA B HB1  2  
ATOM   8562   H HB2  . ALA B 1 35  ? 27.429  11.913  13.624  1.00 0.00 ? 35  ALA B HB2  2  
ATOM   8563   H HB3  . ALA B 1 35  ? 28.291  10.888  12.477  1.00 0.00 ? 35  ALA B HB3  2  
ATOM   8564   N N    . ALA B 1 36  ? 25.566  9.594   12.692  1.00 0.00 ? 36  ALA B N    2  
ATOM   8565   C CA   . ALA B 1 36  ? 25.167  8.193   12.664  1.00 0.00 ? 36  ALA B CA   2  
ATOM   8566   C C    . ALA B 1 36  ? 23.944  8.006   11.769  1.00 0.00 ? 36  ALA B C    2  
ATOM   8567   O O    . ALA B 1 36  ? 23.844  7.021   11.036  1.00 0.00 ? 36  ALA B O    2  
ATOM   8568   C CB   . ALA B 1 36  ? 24.887  7.694   14.094  1.00 0.00 ? 36  ALA B CB   2  
ATOM   8569   H H    . ALA B 1 36  ? 25.496  10.103  13.525  1.00 0.00 ? 36  ALA B H    2  
ATOM   8570   H HA   . ALA B 1 36  ? 25.978  7.616   12.247  1.00 0.00 ? 36  ALA B HA   2  
ATOM   8571   H HB1  . ALA B 1 36  ? 25.063  8.495   14.797  1.00 0.00 ? 36  ALA B HB1  2  
ATOM   8572   H HB2  . ALA B 1 36  ? 25.549  6.868   14.323  1.00 0.00 ? 36  ALA B HB2  2  
ATOM   8573   H HB3  . ALA B 1 36  ? 23.861  7.364   14.175  1.00 0.00 ? 36  ALA B HB3  2  
ATOM   8574   N N    . ALA B 1 37  ? 23.027  8.963   11.802  1.00 0.00 ? 37  ALA B N    2  
ATOM   8575   C CA   . ALA B 1 37  ? 21.842  8.874   10.962  1.00 0.00 ? 37  ALA B CA   2  
ATOM   8576   C C    . ALA B 1 37  ? 22.264  8.805   9.496   1.00 0.00 ? 37  ALA B C    2  
ATOM   8577   O O    . ALA B 1 37  ? 21.852  7.907   8.760   1.00 0.00 ? 37  ALA B O    2  
ATOM   8578   C CB   . ALA B 1 37  ? 20.930  10.088  11.200  1.00 0.00 ? 37  ALA B CB   2  
ATOM   8579   H H    . ALA B 1 37  ? 23.157  9.742   12.385  1.00 0.00 ? 37  ALA B H    2  
ATOM   8580   H HA   . ALA B 1 37  ? 21.299  7.974   11.210  1.00 0.00 ? 37  ALA B HA   2  
ATOM   8581   H HB1  . ALA B 1 37  ? 20.214  9.858   11.977  1.00 0.00 ? 37  ALA B HB1  2  
ATOM   8582   H HB2  . ALA B 1 37  ? 20.401  10.331  10.288  1.00 0.00 ? 37  ALA B HB2  2  
ATOM   8583   H HB3  . ALA B 1 37  ? 21.525  10.936  11.504  1.00 0.00 ? 37  ALA B HB3  2  
ATOM   8584   N N    . LYS B 1 38  ? 23.097  9.757   9.087   1.00 0.00 ? 38  LYS B N    2  
ATOM   8585   C CA   . LYS B 1 38  ? 23.589  9.817   7.710   1.00 0.00 ? 38  LYS B CA   2  
ATOM   8586   C C    . LYS B 1 38  ? 24.245  8.494   7.291   1.00 0.00 ? 38  LYS B C    2  
ATOM   8587   O O    . LYS B 1 38  ? 23.979  7.976   6.207   1.00 0.00 ? 38  LYS B O    2  
ATOM   8588   C CB   . LYS B 1 38  ? 24.601  10.979  7.594   1.00 0.00 ? 38  LYS B CB   2  
ATOM   8589   C CG   . LYS B 1 38  ? 24.268  11.887  6.399   1.00 0.00 ? 38  LYS B CG   2  
ATOM   8590   C CD   . LYS B 1 38  ? 25.181  13.124  6.443   1.00 0.00 ? 38  LYS B CD   2  
ATOM   8591   C CE   . LYS B 1 38  ? 25.166  13.838  5.088   1.00 0.00 ? 38  LYS B CE   2  
ATOM   8592   N NZ   . LYS B 1 38  ? 23.782  14.300  4.785   1.00 0.00 ? 38  LYS B NZ   2  
ATOM   8593   H H    . LYS B 1 38  ? 23.397  10.436  9.731   1.00 0.00 ? 38  LYS B H    2  
ATOM   8594   H HA   . LYS B 1 38  ? 22.754  10.010  7.054   1.00 0.00 ? 38  LYS B HA   2  
ATOM   8595   H HB2  . LYS B 1 38  ? 24.565  11.566  8.498   1.00 0.00 ? 38  LYS B HB2  2  
ATOM   8596   H HB3  . LYS B 1 38  ? 25.598  10.578  7.471   1.00 0.00 ? 38  LYS B HB3  2  
ATOM   8597   H HG2  . LYS B 1 38  ? 24.431  11.349  5.476   1.00 0.00 ? 38  LYS B HG2  2  
ATOM   8598   H HG3  . LYS B 1 38  ? 23.237  12.203  6.459   1.00 0.00 ? 38  LYS B HG3  2  
ATOM   8599   H HD2  . LYS B 1 38  ? 24.832  13.801  7.211   1.00 0.00 ? 38  LYS B HD2  2  
ATOM   8600   H HD3  . LYS B 1 38  ? 26.192  12.816  6.673   1.00 0.00 ? 38  LYS B HD3  2  
ATOM   8601   H HE2  . LYS B 1 38  ? 25.833  14.688  5.123   1.00 0.00 ? 38  LYS B HE2  2  
ATOM   8602   H HE3  . LYS B 1 38  ? 25.498  13.151  4.318   1.00 0.00 ? 38  LYS B HE3  2  
ATOM   8603   H HZ1  . LYS B 1 38  ? 23.250  14.425  5.671   1.00 0.00 ? 38  LYS B HZ1  2  
ATOM   8604   H HZ2  . LYS B 1 38  ? 23.822  15.210  4.279   1.00 0.00 ? 38  LYS B HZ2  2  
ATOM   8605   H HZ3  . LYS B 1 38  ? 23.301  13.595  4.191   1.00 0.00 ? 38  LYS B HZ3  2  
ATOM   8606   N N    . ALA B 1 39  ? 25.098  7.958   8.155   1.00 0.00 ? 39  ALA B N    2  
ATOM   8607   C CA   . ALA B 1 39  ? 25.788  6.703   7.855   1.00 0.00 ? 39  ALA B CA   2  
ATOM   8608   C C    . ALA B 1 39  ? 24.797  5.552   7.680   1.00 0.00 ? 39  ALA B C    2  
ATOM   8609   O O    . ALA B 1 39  ? 24.946  4.712   6.789   1.00 0.00 ? 39  ALA B O    2  
ATOM   8610   C CB   . ALA B 1 39  ? 26.774  6.373   8.980   1.00 0.00 ? 39  ALA B CB   2  
ATOM   8611   H H    . ALA B 1 39  ? 25.271  8.412   9.006   1.00 0.00 ? 39  ALA B H    2  
ATOM   8612   H HA   . ALA B 1 39  ? 26.340  6.825   6.935   1.00 0.00 ? 39  ALA B HA   2  
ATOM   8613   H HB1  . ALA B 1 39  ? 27.206  7.287   9.362   1.00 0.00 ? 39  ALA B HB1  2  
ATOM   8614   H HB2  . ALA B 1 39  ? 26.254  5.860   9.778   1.00 0.00 ? 39  ALA B HB2  2  
ATOM   8615   H HB3  . ALA B 1 39  ? 27.557  5.737   8.597   1.00 0.00 ? 39  ALA B HB3  2  
ATOM   8616   N N    . MET B 1 40  ? 23.792  5.515   8.543   1.00 0.00 ? 40  MET B N    2  
ATOM   8617   C CA   . MET B 1 40  ? 22.786  4.458   8.488   1.00 0.00 ? 40  MET B CA   2  
ATOM   8618   C C    . MET B 1 40  ? 21.959  4.550   7.204   1.00 0.00 ? 40  MET B C    2  
ATOM   8619   O O    . MET B 1 40  ? 21.658  3.530   6.579   1.00 0.00 ? 40  MET B O    2  
ATOM   8620   C CB   . MET B 1 40  ? 21.876  4.543   9.718   1.00 0.00 ? 40  MET B CB   2  
ATOM   8621   C CG   . MET B 1 40  ? 22.690  4.221   10.978  1.00 0.00 ? 40  MET B CG   2  
ATOM   8622   S SD   . MET B 1 40  ? 23.059  2.449   11.036  1.00 0.00 ? 40  MET B SD   2  
ATOM   8623   C CE   . MET B 1 40  ? 21.533  1.931   11.852  1.00 0.00 ? 40  MET B CE   2  
ATOM   8624   H H    . MET B 1 40  ? 23.729  6.206   9.235   1.00 0.00 ? 40  MET B H    2  
ATOM   8625   H HA   . MET B 1 40  ? 23.288  3.501   8.500   1.00 0.00 ? 40  MET B HA   2  
ATOM   8626   H HB2  . MET B 1 40  ? 21.471  5.543   9.795   1.00 0.00 ? 40  MET B HB2  2  
ATOM   8627   H HB3  . MET B 1 40  ? 21.066  3.833   9.620   1.00 0.00 ? 40  MET B HB3  2  
ATOM   8628   H HG2  . MET B 1 40  ? 23.616  4.776   10.959  1.00 0.00 ? 40  MET B HG2  2  
ATOM   8629   H HG3  . MET B 1 40  ? 22.123  4.498   11.853  1.00 0.00 ? 40  MET B HG3  2  
ATOM   8630   H HE1  . MET B 1 40  ? 21.434  2.453   12.794  1.00 0.00 ? 40  MET B HE1  2  
ATOM   8631   H HE2  . MET B 1 40  ? 20.692  2.166   11.222  1.00 0.00 ? 40  MET B HE2  2  
ATOM   8632   H HE3  . MET B 1 40  ? 21.563  0.864   12.027  1.00 0.00 ? 40  MET B HE3  2  
ATOM   8633   N N    . MET B 1 41  ? 21.601  5.766   6.796   1.00 0.00 ? 41  MET B N    2  
ATOM   8634   C CA   . MET B 1 41  ? 20.824  5.930   5.567   1.00 0.00 ? 41  MET B CA   2  
ATOM   8635   C C    . MET B 1 41  ? 21.618  5.437   4.363   1.00 0.00 ? 41  MET B C    2  
ATOM   8636   O O    . MET B 1 41  ? 21.066  4.804   3.456   1.00 0.00 ? 41  MET B O    2  
ATOM   8637   C CB   . MET B 1 41  ? 20.475  7.399   5.302   1.00 0.00 ? 41  MET B CB   2  
ATOM   8638   C CG   . MET B 1 41  ? 19.718  8.018   6.482   1.00 0.00 ? 41  MET B CG   2  
ATOM   8639   S SD   . MET B 1 41  ? 18.640  9.349   5.884   1.00 0.00 ? 41  MET B SD   2  
ATOM   8640   C CE   . MET B 1 41  ? 19.835  10.195  4.818   1.00 0.00 ? 41  MET B CE   2  
ATOM   8641   H H    . MET B 1 41  ? 21.870  6.554   7.316   1.00 0.00 ? 41  MET B H    2  
ATOM   8642   H HA   . MET B 1 41  ? 19.912  5.358   5.645   1.00 0.00 ? 41  MET B HA   2  
ATOM   8643   H HB2  . MET B 1 41  ? 21.390  7.950   5.132   1.00 0.00 ? 41  MET B HB2  2  
ATOM   8644   H HB3  . MET B 1 41  ? 19.861  7.455   4.415   1.00 0.00 ? 41  MET B HB3  2  
ATOM   8645   H HG2  . MET B 1 41  ? 19.119  7.264   6.967   1.00 0.00 ? 41  MET B HG2  2  
ATOM   8646   H HG3  . MET B 1 41  ? 20.426  8.423   7.188   1.00 0.00 ? 41  MET B HG3  2  
ATOM   8647   H HE1  . MET B 1 41  ? 20.816  10.152  5.264   1.00 0.00 ? 41  MET B HE1  2  
ATOM   8648   H HE2  . MET B 1 41  ? 19.858  9.712   3.853   1.00 0.00 ? 41  MET B HE2  2  
ATOM   8649   H HE3  . MET B 1 41  ? 19.541  11.230  4.702   1.00 0.00 ? 41  MET B HE3  2  
ATOM   8650   N N    . ASP B 1 42  ? 22.906  5.763   4.347   1.00 0.00 ? 42  ASP B N    2  
ATOM   8651   C CA   . ASP B 1 42  ? 23.767  5.382   3.237   1.00 0.00 ? 42  ASP B CA   2  
ATOM   8652   C C    . ASP B 1 42  ? 23.800  3.865   3.085   1.00 0.00 ? 42  ASP B C    2  
ATOM   8653   O O    . ASP B 1 42  ? 23.630  3.328   1.984   1.00 0.00 ? 42  ASP B O    2  
ATOM   8654   C CB   . ASP B 1 42  ? 25.184  5.935   3.474   1.00 0.00 ? 42  ASP B CB   2  
ATOM   8655   C CG   . ASP B 1 42  ? 25.846  6.312   2.151   1.00 0.00 ? 42  ASP B CG   2  
ATOM   8656   O OD1  . ASP B 1 42  ? 25.177  6.911   1.322   1.00 0.00 ? 42  ASP B OD1  2  
ATOM   8657   O OD2  . ASP B 1 42  ? 27.016  6.008   1.993   1.00 0.00 ? 42  ASP B OD2  2  
ATOM   8658   H H    . ASP B 1 42  ? 23.283  6.285   5.089   1.00 0.00 ? 42  ASP B H    2  
ATOM   8659   H HA   . ASP B 1 42  ? 23.372  5.813   2.331   1.00 0.00 ? 42  ASP B HA   2  
ATOM   8660   H HB2  . ASP B 1 42  ? 25.124  6.812   4.099   1.00 0.00 ? 42  ASP B HB2  2  
ATOM   8661   H HB3  . ASP B 1 42  ? 25.783  5.187   3.970   1.00 0.00 ? 42  ASP B HB3  2  
ATOM   8662   N N    . GLN B 1 43  ? 23.993  3.176   4.201   1.00 0.00 ? 43  GLN B N    2  
ATOM   8663   C CA   . GLN B 1 43  ? 24.027  1.718   4.181   1.00 0.00 ? 43  GLN B CA   2  
ATOM   8664   C C    . GLN B 1 43  ? 22.674  1.157   3.756   1.00 0.00 ? 43  GLN B C    2  
ATOM   8665   O O    . GLN B 1 43  ? 22.602  0.202   2.982   1.00 0.00 ? 43  GLN B O    2  
ATOM   8666   C CB   . GLN B 1 43  ? 24.411  1.173   5.558   1.00 0.00 ? 43  GLN B CB   2  
ATOM   8667   C CG   . GLN B 1 43  ? 25.857  1.569   5.874   1.00 0.00 ? 43  GLN B CG   2  
ATOM   8668   C CD   . GLN B 1 43  ? 26.344  0.840   7.119   1.00 0.00 ? 43  GLN B CD   2  
ATOM   8669   O OE1  . GLN B 1 43  ? 25.607  0.060   7.714   1.00 0.00 ? 43  GLN B OE1  2  
ATOM   8670   N NE2  . GLN B 1 43  ? 27.552  1.044   7.550   1.00 0.00 ? 43  GLN B NE2  2  
ATOM   8671   H H    . GLN B 1 43  ? 24.102  3.657   5.050   1.00 0.00 ? 43  GLN B H    2  
ATOM   8672   H HA   . GLN B 1 43  ? 24.768  1.402   3.465   1.00 0.00 ? 43  GLN B HA   2  
ATOM   8673   H HB2  . GLN B 1 43  ? 23.748  1.582   6.310   1.00 0.00 ? 43  GLN B HB2  2  
ATOM   8674   H HB3  . GLN B 1 43  ? 24.328  0.094   5.553   1.00 0.00 ? 43  GLN B HB3  2  
ATOM   8675   H HG2  . GLN B 1 43  ? 26.490  1.308   5.040   1.00 0.00 ? 43  GLN B HG2  2  
ATOM   8676   H HG3  . GLN B 1 43  ? 25.906  2.634   6.041   1.00 0.00 ? 43  GLN B HG3  2  
ATOM   8677   H HE21 . GLN B 1 43  ? 28.142  1.663   7.075   1.00 0.00 ? 43  GLN B HE21 2  
ATOM   8678   H HE22 . GLN B 1 43  ? 27.870  0.579   8.351   1.00 0.00 ? 43  GLN B HE22 2  
ATOM   8679   N N    . SER B 1 44  ? 21.602  1.764   4.250   1.00 0.00 ? 44  SER B N    2  
ATOM   8680   C CA   . SER B 1 44  ? 20.260  1.318   3.887   1.00 0.00 ? 44  SER B CA   2  
ATOM   8681   C C    . SER B 1 44  ? 20.076  1.421   2.370   1.00 0.00 ? 44  SER B C    2  
ATOM   8682   O O    . SER B 1 44  ? 19.596  0.491   1.723   1.00 0.00 ? 44  SER B O    2  
ATOM   8683   C CB   . SER B 1 44  ? 19.213  2.166   4.618   1.00 0.00 ? 44  SER B CB   2  
ATOM   8684   O OG   . SER B 1 44  ? 18.323  1.304   5.312   1.00 0.00 ? 44  SER B OG   2  
ATOM   8685   H H    . SER B 1 44  ? 21.712  2.530   4.854   1.00 0.00 ? 44  SER B H    2  
ATOM   8686   H HA   . SER B 1 44  ? 20.146  0.285   4.182   1.00 0.00 ? 44  SER B HA   2  
ATOM   8687   H HB2  . SER B 1 44  ? 19.702  2.813   5.329   1.00 0.00 ? 44  SER B HB2  2  
ATOM   8688   H HB3  . SER B 1 44  ? 18.666  2.769   3.905   1.00 0.00 ? 44  SER B HB3  2  
ATOM   8689   H HG   . SER B 1 44  ? 17.576  1.824   5.629   1.00 0.00 ? 44  SER B HG   2  
ATOM   8690   N N    . ARG B 1 45  ? 20.487  2.555   1.810   1.00 0.00 ? 45  ARG B N    2  
ATOM   8691   C CA   . ARG B 1 45  ? 20.393  2.785   0.369   1.00 0.00 ? 45  ARG B CA   2  
ATOM   8692   C C    . ARG B 1 45  ? 21.152  1.711   -0.412  1.00 0.00 ? 45  ARG B C    2  
ATOM   8693   O O    . ARG B 1 45  ? 20.647  1.164   -1.397  1.00 0.00 ? 45  ARG B O    2  
ATOM   8694   C CB   . ARG B 1 45  ? 20.981  4.162   0.050   1.00 0.00 ? 45  ARG B CB   2  
ATOM   8695   C CG   . ARG B 1 45  ? 20.780  4.501   -1.434  1.00 0.00 ? 45  ARG B CG   2  
ATOM   8696   C CD   . ARG B 1 45  ? 21.387  5.882   -1.756  1.00 0.00 ? 45  ARG B CD   2  
ATOM   8697   N NE   . ARG B 1 45  ? 21.045  6.246   -3.139  1.00 0.00 ? 45  ARG B NE   2  
ATOM   8698   C CZ   . ARG B 1 45  ? 21.389  7.406   -3.686  1.00 0.00 ? 45  ARG B CZ   2  
ATOM   8699   N NH1  . ARG B 1 45  ? 22.012  8.298   -2.994  1.00 0.00 ? 45  ARG B NH1  2  
ATOM   8700   N NH2  . ARG B 1 45  ? 21.030  7.662   -4.909  1.00 0.00 ? 45  ARG B NH2  2  
ATOM   8701   H H    . ARG B 1 45  ? 20.882  3.252   2.378   1.00 0.00 ? 45  ARG B H    2  
ATOM   8702   H HA   . ARG B 1 45  ? 19.355  2.766   0.074   1.00 0.00 ? 45  ARG B HA   2  
ATOM   8703   H HB2  . ARG B 1 45  ? 20.495  4.903   0.659   1.00 0.00 ? 45  ARG B HB2  2  
ATOM   8704   H HB3  . ARG B 1 45  ? 22.040  4.151   0.271   1.00 0.00 ? 45  ARG B HB3  2  
ATOM   8705   H HG2  . ARG B 1 45  ? 21.255  3.746   -2.043  1.00 0.00 ? 45  ARG B HG2  2  
ATOM   8706   H HG3  . ARG B 1 45  ? 19.722  4.521   -1.654  1.00 0.00 ? 45  ARG B HG3  2  
ATOM   8707   H HD2  . ARG B 1 45  ? 20.970  6.619   -1.070  1.00 0.00 ? 45  ARG B HD2  2  
ATOM   8708   H HD3  . ARG B 1 45  ? 22.467  5.847   -1.641  1.00 0.00 ? 45  ARG B HD3  2  
ATOM   8709   H HE   . ARG B 1 45  ? 20.534  5.608   -3.675  1.00 0.00 ? 45  ARG B HE   2  
ATOM   8710   H HH11 . ARG B 1 45  ? 22.264  8.108   -2.049  1.00 0.00 ? 45  ARG B HH11 2  
ATOM   8711   H HH12 . ARG B 1 45  ? 22.263  9.168   -3.411  1.00 0.00 ? 45  ARG B HH12 2  
ATOM   8712   H HH21 . ARG B 1 45  ? 20.524  6.978   -5.437  1.00 0.00 ? 45  ARG B HH21 2  
ATOM   8713   H HH22 . ARG B 1 45  ? 21.279  8.529   -5.333  1.00 0.00 ? 45  ARG B HH22 2  
ATOM   8714   N N    . MET B 1 46  ? 22.371  1.421   0.029   1.00 0.00 ? 46  MET B N    2  
ATOM   8715   C CA   . MET B 1 46  ? 23.201  0.421   -0.634  1.00 0.00 ? 46  MET B CA   2  
ATOM   8716   C C    . MET B 1 46  ? 22.512  -0.945  -0.587  1.00 0.00 ? 46  MET B C    2  
ATOM   8717   O O    . MET B 1 46  ? 22.494  -1.679  -1.577  1.00 0.00 ? 46  MET B O    2  
ATOM   8718   C CB   . MET B 1 46  ? 24.575  0.382   0.035   1.00 0.00 ? 46  MET B CB   2  
ATOM   8719   C CG   . MET B 1 46  ? 25.272  1.731   -0.187  1.00 0.00 ? 46  MET B CG   2  
ATOM   8720   S SD   . MET B 1 46  ? 26.801  1.813   0.786   1.00 0.00 ? 46  MET B SD   2  
ATOM   8721   C CE   . MET B 1 46  ? 27.851  0.772   -0.262  1.00 0.00 ? 46  MET B CE   2  
ATOM   8722   H H    . MET B 1 46  ? 22.721  1.894   0.817   1.00 0.00 ? 46  MET B H    2  
ATOM   8723   H HA   . MET B 1 46  ? 23.325  0.703   -1.669  1.00 0.00 ? 46  MET B HA   2  
ATOM   8724   H HB2  . MET B 1 46  ? 24.454  0.208   1.095   1.00 0.00 ? 46  MET B HB2  2  
ATOM   8725   H HB3  . MET B 1 46  ? 25.169  -0.406  -0.399  1.00 0.00 ? 46  MET B HB3  2  
ATOM   8726   H HG2  . MET B 1 46  ? 25.505  1.845   -1.235  1.00 0.00 ? 46  MET B HG2  2  
ATOM   8727   H HG3  . MET B 1 46  ? 24.612  2.528   0.115   1.00 0.00 ? 46  MET B HG3  2  
ATOM   8728   H HE1  . MET B 1 46  ? 27.489  0.792   -1.278  1.00 0.00 ? 46  MET B HE1  2  
ATOM   8729   H HE2  . MET B 1 46  ? 28.865  1.146   -0.231  1.00 0.00 ? 46  MET B HE2  2  
ATOM   8730   H HE3  . MET B 1 46  ? 27.836  -0.240  0.101   1.00 0.00 ? 46  MET B HE3  2  
ATOM   8731   N N    . ALA B 1 47  ? 21.920  -1.265  0.560   1.00 0.00 ? 47  ALA B N    2  
ATOM   8732   C CA   . ALA B 1 47  ? 21.211  -2.534  0.714   1.00 0.00 ? 47  ALA B CA   2  
ATOM   8733   C C    . ALA B 1 47  ? 20.045  -2.608  -0.272  1.00 0.00 ? 47  ALA B C    2  
ATOM   8734   O O    . ALA B 1 47  ? 19.824  -3.630  -0.922  1.00 0.00 ? 47  ALA B O    2  
ATOM   8735   C CB   . ALA B 1 47  ? 20.692  -2.676  2.148   1.00 0.00 ? 47  ALA B CB   2  
ATOM   8736   H H    . ALA B 1 47  ? 21.947  -0.632  1.309   1.00 0.00 ? 47  ALA B H    2  
ATOM   8737   H HA   . ALA B 1 47  ? 21.893  -3.345  0.505   1.00 0.00 ? 47  ALA B HA   2  
ATOM   8738   H HB1  . ALA B 1 47  ? 20.210  -1.758  2.452   1.00 0.00 ? 47  ALA B HB1  2  
ATOM   8739   H HB2  . ALA B 1 47  ? 21.518  -2.886  2.810   1.00 0.00 ? 47  ALA B HB2  2  
ATOM   8740   H HB3  . ALA B 1 47  ? 19.981  -3.489  2.193   1.00 0.00 ? 47  ALA B HB3  2  
ATOM   8741   N N    . LEU B 1 48  ? 19.309  -1.505  -0.386  1.00 0.00 ? 48  LEU B N    2  
ATOM   8742   C CA   . LEU B 1 48  ? 18.171  -1.438  -1.301  1.00 0.00 ? 48  LEU B CA   2  
ATOM   8743   C C    . LEU B 1 48  ? 18.637  -1.524  -2.749  1.00 0.00 ? 48  LEU B C    2  
ATOM   8744   O O    . LEU B 1 48  ? 18.008  -2.181  -3.581  1.00 0.00 ? 48  LEU B O    2  
ATOM   8745   C CB   . LEU B 1 48  ? 17.435  -0.110  -1.114  1.00 0.00 ? 48  LEU B CB   2  
ATOM   8746   C CG   . LEU B 1 48  ? 16.790  -0.055  0.272   1.00 0.00 ? 48  LEU B CG   2  
ATOM   8747   C CD1  . LEU B 1 48  ? 16.283  1.364   0.541   1.00 0.00 ? 48  LEU B CD1  2  
ATOM   8748   C CD2  . LEU B 1 48  ? 15.624  -1.052  0.356   1.00 0.00 ? 48  LEU B CD2  2  
ATOM   8749   H H    . LEU B 1 48  ? 19.539  -0.719  0.153   1.00 0.00 ? 48  LEU B H    2  
ATOM   8750   H HA   . LEU B 1 48  ? 17.492  -2.252  -1.095  1.00 0.00 ? 48  LEU B HA   2  
ATOM   8751   H HB2  . LEU B 1 48  ? 18.146  0.703   -1.209  1.00 0.00 ? 48  LEU B HB2  2  
ATOM   8752   H HB3  . LEU B 1 48  ? 16.674  -0.008  -1.874  1.00 0.00 ? 48  LEU B HB3  2  
ATOM   8753   H HG   . LEU B 1 48  ? 17.533  -0.311  1.013   1.00 0.00 ? 48  LEU B HG   2  
ATOM   8754   H HD11 . LEU B 1 48  ? 15.825  1.765   -0.351  1.00 0.00 ? 48  LEU B HD11 2  
ATOM   8755   H HD12 . LEU B 1 48  ? 15.557  1.342   1.340   1.00 0.00 ? 48  LEU B HD12 2  
ATOM   8756   H HD13 . LEU B 1 48  ? 17.115  1.990   0.828   1.00 0.00 ? 48  LEU B HD13 2  
ATOM   8757   H HD21 . LEU B 1 48  ? 15.127  -1.122  -0.601  1.00 0.00 ? 48  LEU B HD21 2  
ATOM   8758   H HD22 . LEU B 1 48  ? 16.004  -2.025  0.635   1.00 0.00 ? 48  LEU B HD22 2  
ATOM   8759   H HD23 . LEU B 1 48  ? 14.918  -0.718  1.103   1.00 0.00 ? 48  LEU B HD23 2  
ATOM   8760   N N    . ASN B 1 49  ? 19.731  -0.834  -3.041  1.00 0.00 ? 49  ASN B N    2  
ATOM   8761   C CA   . ASN B 1 49  ? 20.274  -0.808  -4.389  1.00 0.00 ? 49  ASN B CA   2  
ATOM   8762   C C    . ASN B 1 49  ? 20.627  -2.220  -4.849  1.00 0.00 ? 49  ASN B C    2  
ATOM   8763   O O    . ASN B 1 49  ? 20.288  -2.630  -5.962  1.00 0.00 ? 49  ASN B O    2  
ATOM   8764   C CB   . ASN B 1 49  ? 21.517  0.082   -4.447  1.00 0.00 ? 49  ASN B CB   2  
ATOM   8765   C CG   . ASN B 1 49  ? 22.087  0.092   -5.862  1.00 0.00 ? 49  ASN B CG   2  
ATOM   8766   O OD1  . ASN B 1 49  ? 21.873  -0.849  -6.626  1.00 0.00 ? 49  ASN B OD1  2  
ATOM   8767   N ND2  . ASN B 1 49  ? 22.802  1.109   -6.260  1.00 0.00 ? 49  ASN B ND2  2  
ATOM   8768   H H    . ASN B 1 49  ? 20.178  -0.323  -2.330  1.00 0.00 ? 49  ASN B H    2  
ATOM   8769   H HA   . ASN B 1 49  ? 19.521  -0.406  -5.053  1.00 0.00 ? 49  ASN B HA   2  
ATOM   8770   H HB2  . ASN B 1 49  ? 21.249  1.089   -4.161  1.00 0.00 ? 49  ASN B HB2  2  
ATOM   8771   H HB3  . ASN B 1 49  ? 22.262  -0.298  -3.765  1.00 0.00 ? 49  ASN B HB3  2  
ATOM   8772   H HD21 . ASN B 1 49  ? 22.969  1.859   -5.651  1.00 0.00 ? 49  ASN B HD21 2  
ATOM   8773   H HD22 . ASN B 1 49  ? 23.172  1.123   -7.167  1.00 0.00 ? 49  ASN B HD22 2  
ATOM   8774   N N    . GLU B 1 50  ? 21.286  -2.970  -3.976  1.00 0.00 ? 50  GLU B N    2  
ATOM   8775   C CA   . GLU B 1 50  ? 21.652  -4.346  -4.298  1.00 0.00 ? 50  GLU B CA   2  
ATOM   8776   C C    . GLU B 1 50  ? 20.396  -5.192  -4.467  1.00 0.00 ? 50  GLU B C    2  
ATOM   8777   O O    . GLU B 1 50  ? 20.295  -6.016  -5.378  1.00 0.00 ? 50  GLU B O    2  
ATOM   8778   C CB   . GLU B 1 50  ? 22.523  -4.939  -3.186  1.00 0.00 ? 50  GLU B CB   2  
ATOM   8779   C CG   . GLU B 1 50  ? 22.933  -6.369  -3.565  1.00 0.00 ? 50  GLU B CG   2  
ATOM   8780   C CD   . GLU B 1 50  ? 23.883  -6.939  -2.518  1.00 0.00 ? 50  GLU B CD   2  
ATOM   8781   O OE1  . GLU B 1 50  ? 23.403  -7.349  -1.475  1.00 0.00 ? 50  GLU B OE1  2  
ATOM   8782   O OE2  . GLU B 1 50  ? 25.074  -6.957  -2.778  1.00 0.00 ? 50  GLU B OE2  2  
ATOM   8783   H H    . GLU B 1 50  ? 21.509  -2.602  -3.095  1.00 0.00 ? 50  GLU B H    2  
ATOM   8784   H HA   . GLU B 1 50  ? 22.206  -4.357  -5.223  1.00 0.00 ? 50  GLU B HA   2  
ATOM   8785   H HB2  . GLU B 1 50  ? 23.408  -4.333  -3.059  1.00 0.00 ? 50  GLU B HB2  2  
ATOM   8786   H HB3  . GLU B 1 50  ? 21.968  -4.960  -2.260  1.00 0.00 ? 50  GLU B HB3  2  
ATOM   8787   H HG2  . GLU B 1 50  ? 22.053  -6.993  -3.619  1.00 0.00 ? 50  GLU B HG2  2  
ATOM   8788   H HG3  . GLU B 1 50  ? 23.427  -6.361  -4.523  1.00 0.00 ? 50  GLU B HG3  2  
ATOM   8789   N N    . ALA B 1 51  ? 19.425  -4.969  -3.587  1.00 0.00 ? 51  ALA B N    2  
ATOM   8790   C CA   . ALA B 1 51  ? 18.170  -5.706  -3.652  1.00 0.00 ? 51  ALA B CA   2  
ATOM   8791   C C    . ALA B 1 51  ? 17.429  -5.367  -4.949  1.00 0.00 ? 51  ALA B C    2  
ATOM   8792   O O    . ALA B 1 51  ? 16.938  -6.255  -5.648  1.00 0.00 ? 51  ALA B O    2  
ATOM   8793   C CB   . ALA B 1 51  ? 17.308  -5.368  -2.424  1.00 0.00 ? 51  ALA B CB   2  
ATOM   8794   H H    . ALA B 1 51  ? 19.555  -4.291  -2.890  1.00 0.00 ? 51  ALA B H    2  
ATOM   8795   H HA   . ALA B 1 51  ? 18.386  -6.764  -3.645  1.00 0.00 ? 51  ALA B HA   2  
ATOM   8796   H HB1  . ALA B 1 51  ? 16.584  -4.611  -2.684  1.00 0.00 ? 51  ALA B HB1  2  
ATOM   8797   H HB2  . ALA B 1 51  ? 17.945  -4.998  -1.631  1.00 0.00 ? 51  ALA B HB2  2  
ATOM   8798   H HB3  . ALA B 1 51  ? 16.798  -6.258  -2.086  1.00 0.00 ? 51  ALA B HB3  2  
ATOM   8799   N N    . HIS B 1 52  ? 17.375  -4.078  -5.270  1.00 0.00 ? 52  HIS B N    2  
ATOM   8800   C CA   . HIS B 1 52  ? 16.713  -3.624  -6.492  1.00 0.00 ? 52  HIS B CA   2  
ATOM   8801   C C    . HIS B 1 52  ? 17.388  -4.224  -7.728  1.00 0.00 ? 52  HIS B C    2  
ATOM   8802   O O    . HIS B 1 52  ? 16.713  -4.630  -8.677  1.00 0.00 ? 52  HIS B O    2  
ATOM   8803   C CB   . HIS B 1 52  ? 16.759  -2.098  -6.575  1.00 0.00 ? 52  HIS B CB   2  
ATOM   8804   C CG   . HIS B 1 52  ? 15.960  -1.638  -7.762  1.00 0.00 ? 52  HIS B CG   2  
ATOM   8805   N ND1  . HIS B 1 52  ? 16.442  -1.735  -9.058  1.00 0.00 ? 52  HIS B ND1  2  
ATOM   8806   C CD2  . HIS B 1 52  ? 14.713  -1.075  -7.867  1.00 0.00 ? 52  HIS B CD2  2  
ATOM   8807   C CE1  . HIS B 1 52  ? 15.497  -1.243  -9.880  1.00 0.00 ? 52  HIS B CE1  2  
ATOM   8808   N NE2  . HIS B 1 52  ? 14.422  -0.827  -9.205  1.00 0.00 ? 52  HIS B NE2  2  
ATOM   8809   H H    . HIS B 1 52  ? 17.799  -3.416  -4.679  1.00 0.00 ? 52  HIS B H    2  
ATOM   8810   H HA   . HIS B 1 52  ? 15.681  -3.942  -6.473  1.00 0.00 ? 52  HIS B HA   2  
ATOM   8811   H HB2  . HIS B 1 52  ? 16.340  -1.676  -5.673  1.00 0.00 ? 52  HIS B HB2  2  
ATOM   8812   H HB3  . HIS B 1 52  ? 17.783  -1.774  -6.683  1.00 0.00 ? 52  HIS B HB3  2  
ATOM   8813   H HD1  . HIS B 1 52  ? 17.312  -2.097  -9.327  1.00 0.00 ? 52  HIS B HD1  2  
ATOM   8814   H HD2  . HIS B 1 52  ? 14.057  -0.859  -7.037  1.00 0.00 ? 52  HIS B HD2  2  
ATOM   8815   H HE1  . HIS B 1 52  ? 15.595  -1.192  -10.954 1.00 0.00 ? 52  HIS B HE1  2  
ATOM   8816   H HE2  . HIS B 1 52  ? 13.605  -0.431  -9.573  1.00 0.00 ? 52  HIS B HE2  2  
ATOM   8817   N N    . LEU B 1 53  ? 18.717  -4.280  -7.703  1.00 0.00 ? 53  LEU B N    2  
ATOM   8818   C CA   . LEU B 1 53  ? 19.470  -4.832  -8.826  1.00 0.00 ? 53  LEU B CA   2  
ATOM   8819   C C    . LEU B 1 53  ? 19.074  -6.288  -9.058  1.00 0.00 ? 53  LEU B C    2  
ATOM   8820   O O    . LEU B 1 53  ? 18.861  -6.715  -10.196 1.00 0.00 ? 53  LEU B O    2  
ATOM   8821   C CB   . LEU B 1 53  ? 20.972  -4.752  -8.539  1.00 0.00 ? 53  LEU B CB   2  
ATOM   8822   C CG   . LEU B 1 53  ? 21.475  -3.322  -8.773  1.00 0.00 ? 53  LEU B CG   2  
ATOM   8823   C CD1  . LEU B 1 53  ? 22.845  -3.157  -8.114  1.00 0.00 ? 53  LEU B CD1  2  
ATOM   8824   C CD2  . LEU B 1 53  ? 21.608  -3.044  -10.277 1.00 0.00 ? 53  LEU B CD2  2  
ATOM   8825   H H    . LEU B 1 53  ? 19.199  -3.948  -6.915  1.00 0.00 ? 53  LEU B H    2  
ATOM   8826   H HA   . LEU B 1 53  ? 19.249  -4.264  -9.715  1.00 0.00 ? 53  LEU B HA   2  
ATOM   8827   H HB2  . LEU B 1 53  ? 21.153  -5.031  -7.511  1.00 0.00 ? 53  LEU B HB2  2  
ATOM   8828   H HB3  . LEU B 1 53  ? 21.499  -5.432  -9.191  1.00 0.00 ? 53  LEU B HB3  2  
ATOM   8829   H HG   . LEU B 1 53  ? 20.780  -2.621  -8.334  1.00 0.00 ? 53  LEU B HG   2  
ATOM   8830   H HD11 . LEU B 1 53  ? 23.416  -4.066  -8.238  1.00 0.00 ? 53  LEU B HD11 2  
ATOM   8831   H HD12 . LEU B 1 53  ? 23.371  -2.336  -8.578  1.00 0.00 ? 53  LEU B HD12 2  
ATOM   8832   H HD13 . LEU B 1 53  ? 22.717  -2.954  -7.061  1.00 0.00 ? 53  LEU B HD13 2  
ATOM   8833   H HD21 . LEU B 1 53  ? 21.994  -3.919  -10.777 1.00 0.00 ? 53  LEU B HD21 2  
ATOM   8834   H HD22 . LEU B 1 53  ? 20.642  -2.791  -10.686 1.00 0.00 ? 53  LEU B HD22 2  
ATOM   8835   H HD23 . LEU B 1 53  ? 22.286  -2.218  -10.428 1.00 0.00 ? 53  LEU B HD23 2  
ATOM   8836   N N    . VAL B 1 54  ? 18.969  -7.045  -7.971  1.00 0.00 ? 54  VAL B N    2  
ATOM   8837   C CA   . VAL B 1 54  ? 18.585  -8.445  -8.072  1.00 0.00 ? 54  VAL B CA   2  
ATOM   8838   C C    . VAL B 1 54  ? 17.172  -8.544  -8.636  1.00 0.00 ? 54  VAL B C    2  
ATOM   8839   O O    . VAL B 1 54  ? 16.902  -9.361  -9.516  1.00 0.00 ? 54  VAL B O    2  
ATOM   8840   C CB   . VAL B 1 54  ? 18.662  -9.119  -6.693  1.00 0.00 ? 54  VAL B CB   2  
ATOM   8841   C CG1  . VAL B 1 54  ? 18.035  -10.520 -6.761  1.00 0.00 ? 54  VAL B CG1  2  
ATOM   8842   C CG2  . VAL B 1 54  ? 20.132  -9.229  -6.245  1.00 0.00 ? 54  VAL B CG2  2  
ATOM   8843   H H    . VAL B 1 54  ? 19.143  -6.650  -7.089  1.00 0.00 ? 54  VAL B H    2  
ATOM   8844   H HA   . VAL B 1 54  ? 19.262  -8.945  -8.748  1.00 0.00 ? 54  VAL B HA   2  
ATOM   8845   H HB   . VAL B 1 54  ? 18.114  -8.521  -5.978  1.00 0.00 ? 54  VAL B HB   2  
ATOM   8846   H HG11 . VAL B 1 54  ? 18.250  -10.971 -7.719  1.00 0.00 ? 54  VAL B HG11 2  
ATOM   8847   H HG12 . VAL B 1 54  ? 18.439  -11.139 -5.974  1.00 0.00 ? 54  VAL B HG12 2  
ATOM   8848   H HG13 . VAL B 1 54  ? 16.964  -10.440 -6.637  1.00 0.00 ? 54  VAL B HG13 2  
ATOM   8849   H HG21 . VAL B 1 54  ? 20.765  -9.402  -7.103  1.00 0.00 ? 54  VAL B HG21 2  
ATOM   8850   H HG22 . VAL B 1 54  ? 20.431  -8.310  -5.761  1.00 0.00 ? 54  VAL B HG22 2  
ATOM   8851   H HG23 . VAL B 1 54  ? 20.239  -10.049 -5.549  1.00 0.00 ? 54  VAL B HG23 2  
ATOM   8852   N N    . GLN B 1 55  ? 16.273  -7.693  -8.149  1.00 0.00 ? 55  GLN B N    2  
ATOM   8853   C CA   . GLN B 1 55  ? 14.901  -7.708  -8.651  1.00 0.00 ? 55  GLN B CA   2  
ATOM   8854   C C    . GLN B 1 55  ? 14.886  -7.365  -10.144 1.00 0.00 ? 55  GLN B C    2  
ATOM   8855   O O    . GLN B 1 55  ? 14.172  -7.999  -10.922 1.00 0.00 ? 55  GLN B O    2  
ATOM   8856   C CB   . GLN B 1 55  ? 14.015  -6.732  -7.850  1.00 0.00 ? 55  GLN B CB   2  
ATOM   8857   C CG   . GLN B 1 55  ? 12.712  -6.419  -8.627  1.00 0.00 ? 55  GLN B CG   2  
ATOM   8858   C CD   . GLN B 1 55  ? 11.522  -6.290  -7.675  1.00 0.00 ? 55  GLN B CD   2  
ATOM   8859   O OE1  . GLN B 1 55  ? 11.513  -5.432  -6.800  1.00 0.00 ? 55  GLN B OE1  2  
ATOM   8860   N NE2  . GLN B 1 55  ? 10.503  -7.086  -7.814  1.00 0.00 ? 55  GLN B NE2  2  
ATOM   8861   H H    . GLN B 1 55  ? 16.536  -7.043  -7.459  1.00 0.00 ? 55  GLN B H    2  
ATOM   8862   H HA   . GLN B 1 55  ? 14.513  -8.708  -8.527  1.00 0.00 ? 55  GLN B HA   2  
ATOM   8863   H HB2  . GLN B 1 55  ? 13.768  -7.182  -6.899  1.00 0.00 ? 55  GLN B HB2  2  
ATOM   8864   H HB3  . GLN B 1 55  ? 14.559  -5.814  -7.678  1.00 0.00 ? 55  GLN B HB3  2  
ATOM   8865   H HG2  . GLN B 1 55  ? 12.831  -5.491  -9.163  1.00 0.00 ? 55  GLN B HG2  2  
ATOM   8866   H HG3  . GLN B 1 55  ? 12.509  -7.211  -9.332  1.00 0.00 ? 55  GLN B HG3  2  
ATOM   8867   H HE21 . GLN B 1 55  ? 10.505  -7.761  -8.522  1.00 0.00 ? 55  GLN B HE21 2  
ATOM   8868   H HE22 . GLN B 1 55  ? 9.734   -7.007  -7.212  1.00 0.00 ? 55  GLN B HE22 2  
ATOM   8869   N N    . THR B 1 56  ? 15.685  -6.374  -10.547 1.00 0.00 ? 56  THR B N    2  
ATOM   8870   C CA   . THR B 1 56  ? 15.748  -5.988  -11.961 1.00 0.00 ? 56  THR B CA   2  
ATOM   8871   C C    . THR B 1 56  ? 15.979  -7.221  -12.833 1.00 0.00 ? 56  THR B C    2  
ATOM   8872   O O    . THR B 1 56  ? 15.271  -7.443  -13.819 1.00 0.00 ? 56  THR B O    2  
ATOM   8873   C CB   . THR B 1 56  ? 16.869  -4.968  -12.189 1.00 0.00 ? 56  THR B CB   2  
ATOM   8874   O OG1  . THR B 1 56  ? 16.744  -3.918  -11.240 1.00 0.00 ? 56  THR B OG1  2  
ATOM   8875   C CG2  . THR B 1 56  ? 16.783  -4.386  -13.610 1.00 0.00 ? 56  THR B CG2  2  
ATOM   8876   H H    . THR B 1 56  ? 16.248  -5.908  -9.892  1.00 0.00 ? 56  THR B H    2  
ATOM   8877   H HA   . THR B 1 56  ? 14.804  -5.547  -12.237 1.00 0.00 ? 56  THR B HA   2  
ATOM   8878   H HB   . THR B 1 56  ? 17.825  -5.454  -12.060 1.00 0.00 ? 56  THR B HB   2  
ATOM   8879   H HG1  . THR B 1 56  ? 15.984  -3.387  -11.485 1.00 0.00 ? 56  THR B HG1  2  
ATOM   8880   H HG21 . THR B 1 56  ? 16.278  -5.082  -14.266 1.00 0.00 ? 56  THR B HG21 2  
ATOM   8881   H HG22 . THR B 1 56  ? 16.233  -3.458  -13.583 1.00 0.00 ? 56  THR B HG22 2  
ATOM   8882   H HG23 . THR B 1 56  ? 17.779  -4.200  -13.987 1.00 0.00 ? 56  THR B HG23 2  
ATOM   8883   N N    . LYS B 1 57  ? 16.945  -8.050  -12.442 1.00 0.00 ? 57  LYS B N    2  
ATOM   8884   C CA   . LYS B 1 57  ? 17.224  -9.278  -13.181 1.00 0.00 ? 57  LYS B CA   2  
ATOM   8885   C C    . LYS B 1 57  ? 16.007  -10.191 -13.143 1.00 0.00 ? 57  LYS B C    2  
ATOM   8886   O O    . LYS B 1 57  ? 15.666  -10.844 -14.130 1.00 0.00 ? 57  LYS B O    2  
ATOM   8887   C CB   . LYS B 1 57  ? 18.424  -10.003 -12.570 1.00 0.00 ? 57  LYS B CB   2  
ATOM   8888   C CG   . LYS B 1 57  ? 18.795  -11.196 -13.454 1.00 0.00 ? 57  LYS B CG   2  
ATOM   8889   C CD   . LYS B 1 57  ? 20.038  -11.887 -12.893 1.00 0.00 ? 57  LYS B CD   2  
ATOM   8890   C CE   . LYS B 1 57  ? 20.420  -13.059 -13.799 1.00 0.00 ? 57  LYS B CE   2  
ATOM   8891   N NZ   . LYS B 1 57  ? 21.369  -13.955 -13.081 1.00 0.00 ? 57  LYS B NZ   2  
ATOM   8892   H H    . LYS B 1 57  ? 17.457  -7.842  -11.631 1.00 0.00 ? 57  LYS B H    2  
ATOM   8893   H HA   . LYS B 1 57  ? 17.452  -9.038  -14.209 1.00 0.00 ? 57  LYS B HA   2  
ATOM   8894   H HB2  . LYS B 1 57  ? 19.262  -9.324  -12.505 1.00 0.00 ? 57  LYS B HB2  2  
ATOM   8895   H HB3  . LYS B 1 57  ? 18.168  -10.356 -11.582 1.00 0.00 ? 57  LYS B HB3  2  
ATOM   8896   H HG2  . LYS B 1 57  ? 17.972  -11.896 -13.476 1.00 0.00 ? 57  LYS B HG2  2  
ATOM   8897   H HG3  . LYS B 1 57  ? 19.000  -10.850 -14.456 1.00 0.00 ? 57  LYS B HG3  2  
ATOM   8898   H HD2  . LYS B 1 57  ? 20.855  -11.180 -12.851 1.00 0.00 ? 57  LYS B HD2  2  
ATOM   8899   H HD3  . LYS B 1 57  ? 19.829  -12.256 -11.900 1.00 0.00 ? 57  LYS B HD3  2  
ATOM   8900   H HE2  . LYS B 1 57  ? 19.532  -13.613 -14.065 1.00 0.00 ? 57  LYS B HE2  2  
ATOM   8901   H HE3  . LYS B 1 57  ? 20.890  -12.681 -14.696 1.00 0.00 ? 57  LYS B HE3  2  
ATOM   8902   H HZ1  . LYS B 1 57  ? 21.710  -13.481 -12.220 1.00 0.00 ? 57  LYS B HZ1  2  
ATOM   8903   H HZ2  . LYS B 1 57  ? 20.885  -14.838 -12.823 1.00 0.00 ? 57  LYS B HZ2  2  
ATOM   8904   H HZ3  . LYS B 1 57  ? 22.176  -14.174 -13.700 1.00 0.00 ? 57  LYS B HZ3  2  
ATOM   8905   N N    . LEU B 1 58  ? 15.360  -10.240 -11.986 1.00 0.00 ? 58  LEU B N    2  
ATOM   8906   C CA   . LEU B 1 58  ? 14.191  -11.088 -11.824 1.00 0.00 ? 58  LEU B CA   2  
ATOM   8907   C C    . LEU B 1 58  ? 13.009  -10.595 -12.673 1.00 0.00 ? 58  LEU B C    2  
ATOM   8908   O O    . LEU B 1 58  ? 12.098  -11.364 -12.954 1.00 0.00 ? 58  LEU B O    2  
ATOM   8909   C CB   . LEU B 1 58  ? 13.792  -11.174 -10.355 1.00 0.00 ? 58  LEU B CB   2  
ATOM   8910   C CG   . LEU B 1 58  ? 14.879  -11.910 -9.556  1.00 0.00 ? 58  LEU B CG   2  
ATOM   8911   C CD1  . LEU B 1 58  ? 14.543  -11.818 -8.064  1.00 0.00 ? 58  LEU B CD1  2  
ATOM   8912   C CD2  . LEU B 1 58  ? 14.958  -13.387 -9.992  1.00 0.00 ? 58  LEU B CD2  2  
ATOM   8913   H H    . LEU B 1 58  ? 15.680  -9.706  -11.229 1.00 0.00 ? 58  LEU B H    2  
ATOM   8914   H HA   . LEU B 1 58  ? 14.458  -12.081 -12.159 1.00 0.00 ? 58  LEU B HA   2  
ATOM   8915   H HB2  . LEU B 1 58  ? 13.667  -10.175 -9.962  1.00 0.00 ? 58  LEU B HB2  2  
ATOM   8916   H HB3  . LEU B 1 58  ? 12.861  -11.714 -10.276 1.00 0.00 ? 58  LEU B HB3  2  
ATOM   8917   H HG   . LEU B 1 58  ? 15.835  -11.432 -9.729  1.00 0.00 ? 58  LEU B HG   2  
ATOM   8918   H HD11 . LEU B 1 58  ? 13.469  -11.852 -7.930  1.00 0.00 ? 58  LEU B HD11 2  
ATOM   8919   H HD12 . LEU B 1 58  ? 14.997  -12.642 -7.536  1.00 0.00 ? 58  LEU B HD12 2  
ATOM   8920   H HD13 . LEU B 1 58  ? 14.922  -10.886 -7.672  1.00 0.00 ? 58  LEU B HD13 2  
ATOM   8921   H HD21 . LEU B 1 58  ? 14.005  -13.706 -10.390 1.00 0.00 ? 58  LEU B HD21 2  
ATOM   8922   H HD22 . LEU B 1 58  ? 15.717  -13.495 -10.755 1.00 0.00 ? 58  LEU B HD22 2  
ATOM   8923   H HD23 . LEU B 1 58  ? 15.217  -14.005 -9.144  1.00 0.00 ? 58  LEU B HD23 2  
ATOM   8924   N N    . ILE B 1 59  ? 13.028  -9.325  -13.091 1.00 0.00 ? 59  ILE B N    2  
ATOM   8925   C CA   . ILE B 1 59  ? 11.951  -8.801  -13.939 1.00 0.00 ? 59  ILE B CA   2  
ATOM   8926   C C    . ILE B 1 59  ? 12.325  -8.906  -15.430 1.00 0.00 ? 59  ILE B C    2  
ATOM   8927   O O    . ILE B 1 59  ? 11.471  -9.147  -16.276 1.00 0.00 ? 59  ILE B O    2  
ATOM   8928   C CB   . ILE B 1 59  ? 11.598  -7.328  -13.565 1.00 0.00 ? 59  ILE B CB   2  
ATOM   8929   C CG1  . ILE B 1 59  ? 10.101  -7.069  -13.780 1.00 0.00 ? 59  ILE B CG1  2  
ATOM   8930   C CG2  . ILE B 1 59  ? 12.358  -6.308  -14.422 1.00 0.00 ? 59  ILE B CG2  2  
ATOM   8931   C CD1  . ILE B 1 59  ? 9.715   -5.760  -13.087 1.00 0.00 ? 59  ILE B CD1  2  
ATOM   8932   H H    . ILE B 1 59  ? 13.781  -8.745  -12.842 1.00 0.00 ? 59  ILE B H    2  
ATOM   8933   H HA   . ILE B 1 59  ? 11.064  -9.398  -13.774 1.00 0.00 ? 59  ILE B HA   2  
ATOM   8934   H HB   . ILE B 1 59  ? 11.837  -7.162  -12.526 1.00 0.00 ? 59  ILE B HB   2  
ATOM   8935   H HG12 . ILE B 1 59  ? 9.900   -6.988  -14.838 1.00 0.00 ? 59  ILE B HG12 2  
ATOM   8936   H HG13 . ILE B 1 59  ? 9.523   -7.872  -13.367 1.00 0.00 ? 59  ILE B HG13 2  
ATOM   8937   H HG21 . ILE B 1 59  ? 13.406  -6.453  -14.307 1.00 0.00 ? 59  ILE B HG21 2  
ATOM   8938   H HG22 . ILE B 1 59  ? 12.084  -6.411  -15.460 1.00 0.00 ? 59  ILE B HG22 2  
ATOM   8939   H HG23 . ILE B 1 59  ? 12.105  -5.313  -14.089 1.00 0.00 ? 59  ILE B HG23 2  
ATOM   8940   H HD11 . ILE B 1 59  ? 10.123  -5.747  -12.088 1.00 0.00 ? 59  ILE B HD11 2  
ATOM   8941   H HD12 . ILE B 1 59  ? 10.110  -4.925  -13.648 1.00 0.00 ? 59  ILE B HD12 2  
ATOM   8942   H HD13 . ILE B 1 59  ? 8.639   -5.683  -13.038 1.00 0.00 ? 59  ILE B HD13 2  
ATOM   8943   N N    . GLU B 1 60  ? 13.611  -8.733  -15.747 1.00 0.00 ? 60  GLU B N    2  
ATOM   8944   C CA   . GLU B 1 60  ? 14.061  -8.824  -17.145 1.00 0.00 ? 60  GLU B CA   2  
ATOM   8945   C C    . GLU B 1 60  ? 13.884  -10.241 -17.687 1.00 0.00 ? 60  GLU B C    2  
ATOM   8946   O O    . GLU B 1 60  ? 13.514  -10.433 -18.846 1.00 0.00 ? 60  GLU B O    2  
ATOM   8947   C CB   . GLU B 1 60  ? 15.546  -8.452  -17.230 1.00 0.00 ? 60  GLU B CB   2  
ATOM   8948   C CG   . GLU B 1 60  ? 16.058  -8.589  -18.672 1.00 0.00 ? 60  GLU B CG   2  
ATOM   8949   C CD   . GLU B 1 60  ? 17.578  -8.489  -18.689 1.00 0.00 ? 60  GLU B CD   2  
ATOM   8950   O OE1  . GLU B 1 60  ? 18.150  -8.286  -17.632 1.00 0.00 ? 60  GLU B OE1  2  
ATOM   8951   O OE2  . GLU B 1 60  ? 18.149  -8.634  -19.757 1.00 0.00 ? 60  GLU B OE2  2  
ATOM   8952   H H    . GLU B 1 60  ? 14.263  -8.542  -15.041 1.00 0.00 ? 60  GLU B H    2  
ATOM   8953   H HA   . GLU B 1 60  ? 13.476  -8.145  -17.748 1.00 0.00 ? 60  GLU B HA   2  
ATOM   8954   H HB2  . GLU B 1 60  ? 15.675  -7.431  -16.903 1.00 0.00 ? 60  GLU B HB2  2  
ATOM   8955   H HB3  . GLU B 1 60  ? 16.115  -9.107  -16.587 1.00 0.00 ? 60  GLU B HB3  2  
ATOM   8956   H HG2  . GLU B 1 60  ? 15.763  -9.542  -19.083 1.00 0.00 ? 60  GLU B HG2  2  
ATOM   8957   H HG3  . GLU B 1 60  ? 15.644  -7.796  -19.275 1.00 0.00 ? 60  GLU B HG3  2  
ATOM   8958   N N    . GLY B 1 61  ? 14.164  -11.234 -16.846 1.00 0.00 ? 61  GLY B N    2  
ATOM   8959   C CA   . GLY B 1 61  ? 14.048  -12.632 -17.260 1.00 0.00 ? 61  GLY B CA   2  
ATOM   8960   C C    . GLY B 1 61  ? 12.869  -13.316 -16.582 1.00 0.00 ? 61  GLY B C    2  
ATOM   8961   O O    . GLY B 1 61  ? 12.927  -14.506 -16.280 1.00 0.00 ? 61  GLY B O    2  
ATOM   8962   H H    . GLY B 1 61  ? 14.462  -11.024 -15.934 1.00 0.00 ? 61  GLY B H    2  
ATOM   8963   H HA2  . GLY B 1 61  ? 13.916  -12.674 -18.333 1.00 0.00 ? 61  GLY B HA2  2  
ATOM   8964   H HA3  . GLY B 1 61  ? 14.953  -13.153 -16.993 1.00 0.00 ? 61  GLY B HA3  2  
ATOM   8965   N N    . ASP B 1 62  ? 11.803  -12.561 -16.343 1.00 0.00 ? 62  ASP B N    2  
ATOM   8966   C CA   . ASP B 1 62  ? 10.616  -13.103 -15.682 1.00 0.00 ? 62  ASP B CA   2  
ATOM   8967   C C    . ASP B 1 62  ? 9.910   -14.148 -16.548 1.00 0.00 ? 62  ASP B C    2  
ATOM   8968   O O    . ASP B 1 62  ? 8.965   -14.795 -16.098 1.00 0.00 ? 62  ASP B O    2  
ATOM   8969   C CB   . ASP B 1 62  ? 9.646   -11.966 -15.364 1.00 0.00 ? 62  ASP B CB   2  
ATOM   8970   C CG   . ASP B 1 62  ? 9.321   -11.188 -16.635 1.00 0.00 ? 62  ASP B CG   2  
ATOM   8971   O OD1  . ASP B 1 62  ? 9.918   -11.485 -17.657 1.00 0.00 ? 62  ASP B OD1  2  
ATOM   8972   O OD2  . ASP B 1 62  ? 8.481   -10.306 -16.568 1.00 0.00 ? 62  ASP B OD2  2  
ATOM   8973   H H    . ASP B 1 62  ? 11.815  -11.617 -16.605 1.00 0.00 ? 62  ASP B H    2  
ATOM   8974   H HA   . ASP B 1 62  ? 10.917  -13.566 -14.755 1.00 0.00 ? 62  ASP B HA   2  
ATOM   8975   H HB2  . ASP B 1 62  ? 8.738   -12.376 -14.953 1.00 0.00 ? 62  ASP B HB2  2  
ATOM   8976   H HB3  . ASP B 1 62  ? 10.097  -11.300 -14.644 1.00 0.00 ? 62  ASP B HB3  2  
ATOM   8977   N N    . ALA B 1 63  ? 10.369  -14.311 -17.782 1.00 0.00 ? 63  ALA B N    2  
ATOM   8978   C CA   . ALA B 1 63  ? 9.764   -15.287 -18.687 1.00 0.00 ? 63  ALA B CA   2  
ATOM   8979   C C    . ALA B 1 63  ? 10.320  -16.684 -18.423 1.00 0.00 ? 63  ALA B C    2  
ATOM   8980   O O    . ALA B 1 63  ? 11.259  -16.851 -17.644 1.00 0.00 ? 63  ALA B O    2  
ATOM   8981   C CB   . ALA B 1 63  ? 10.038  -14.893 -20.139 1.00 0.00 ? 63  ALA B CB   2  
ATOM   8982   H H    . ALA B 1 63  ? 11.126  -13.771 -18.091 1.00 0.00 ? 63  ALA B H    2  
ATOM   8983   H HA   . ALA B 1 63  ? 8.696   -15.299 -18.525 1.00 0.00 ? 63  ALA B HA   2  
ATOM   8984   H HB1  . ALA B 1 63  ? 11.017  -15.244 -20.429 1.00 0.00 ? 63  ALA B HB1  2  
ATOM   8985   H HB2  . ALA B 1 63  ? 9.291   -15.338 -20.780 1.00 0.00 ? 63  ALA B HB2  2  
ATOM   8986   H HB3  . ALA B 1 63  ? 9.999   -13.818 -20.234 1.00 0.00 ? 63  ALA B HB3  2  
ATOM   8987   N N    . GLY B 1 64  ? 9.739   -17.688 -19.082 1.00 0.00 ? 64  GLY B N    2  
ATOM   8988   C CA   . GLY B 1 64  ? 10.191  -19.069 -18.915 1.00 0.00 ? 64  GLY B CA   2  
ATOM   8989   C C    . GLY B 1 64  ? 9.022   -20.017 -18.648 1.00 0.00 ? 64  GLY B C    2  
ATOM   8990   O O    . GLY B 1 64  ? 8.808   -20.970 -19.397 1.00 0.00 ? 64  GLY B O    2  
ATOM   8991   H H    . GLY B 1 64  ? 8.998   -17.495 -19.693 1.00 0.00 ? 64  GLY B H    2  
ATOM   8992   H HA2  . GLY B 1 64  ? 10.701  -19.383 -19.814 1.00 0.00 ? 64  GLY B HA2  2  
ATOM   8993   H HA3  . GLY B 1 64  ? 10.880  -19.121 -18.084 1.00 0.00 ? 64  GLY B HA3  2  
ATOM   8994   N N    . GLU B 1 65  ? 8.276   -19.760 -17.578 1.00 0.00 ? 65  GLU B N    2  
ATOM   8995   C CA   . GLU B 1 65  ? 7.141   -20.613 -17.231 1.00 0.00 ? 65  GLU B CA   2  
ATOM   8996   C C    . GLU B 1 65  ? 6.044   -20.524 -18.287 1.00 0.00 ? 65  GLU B C    2  
ATOM   8997   O O    . GLU B 1 65  ? 5.414   -21.526 -18.624 1.00 0.00 ? 65  GLU B O    2  
ATOM   8998   C CB   . GLU B 1 65  ? 6.568   -20.204 -15.873 1.00 0.00 ? 65  GLU B CB   2  
ATOM   8999   C CG   . GLU B 1 65  ? 7.572   -20.540 -14.770 1.00 0.00 ? 65  GLU B CG   2  
ATOM   9000   C CD   . GLU B 1 65  ? 7.037   -20.071 -13.422 1.00 0.00 ? 65  GLU B CD   2  
ATOM   9001   O OE1  . GLU B 1 65  ? 5.937   -19.544 -13.394 1.00 0.00 ? 65  GLU B OE1  2  
ATOM   9002   O OE2  . GLU B 1 65  ? 7.734   -20.248 -12.436 1.00 0.00 ? 65  GLU B OE2  2  
ATOM   9003   H H    . GLU B 1 65  ? 8.494   -18.991 -17.011 1.00 0.00 ? 65  GLU B H    2  
ATOM   9004   H HA   . GLU B 1 65  ? 7.481   -21.635 -17.169 1.00 0.00 ? 65  GLU B HA   2  
ATOM   9005   H HB2  . GLU B 1 65  ? 6.372   -19.142 -15.871 1.00 0.00 ? 65  GLU B HB2  2  
ATOM   9006   H HB3  . GLU B 1 65  ? 5.648   -20.740 -15.696 1.00 0.00 ? 65  GLU B HB3  2  
ATOM   9007   H HG2  . GLU B 1 65  ? 7.729   -21.609 -14.742 1.00 0.00 ? 65  GLU B HG2  2  
ATOM   9008   H HG3  . GLU B 1 65  ? 8.509   -20.045 -14.975 1.00 0.00 ? 65  GLU B HG3  2  
ATOM   9009   N N    . GLY B 1 66  ? 5.814   -19.321 -18.799 1.00 0.00 ? 66  GLY B N    2  
ATOM   9010   C CA   . GLY B 1 66  ? 4.782   -19.122 -19.809 1.00 0.00 ? 66  GLY B CA   2  
ATOM   9011   C C    . GLY B 1 66  ? 5.006   -17.821 -20.570 1.00 0.00 ? 66  GLY B C    2  
ATOM   9012   O O    . GLY B 1 66  ? 5.885   -17.031 -20.227 1.00 0.00 ? 66  GLY B O    2  
ATOM   9013   H H    . GLY B 1 66  ? 6.342   -18.555 -18.491 1.00 0.00 ? 66  GLY B H    2  
ATOM   9014   H HA2  . GLY B 1 66  ? 4.803   -19.949 -20.505 1.00 0.00 ? 66  GLY B HA2  2  
ATOM   9015   H HA3  . GLY B 1 66  ? 3.817   -19.087 -19.328 1.00 0.00 ? 66  GLY B HA3  2  
ATOM   9016   N N    . LYS B 1 67  ? 4.210   -17.613 -21.612 1.00 0.00 ? 67  LYS B N    2  
ATOM   9017   C CA   . LYS B 1 67  ? 4.333   -16.411 -22.427 1.00 0.00 ? 67  LYS B CA   2  
ATOM   9018   C C    . LYS B 1 67  ? 3.929   -15.163 -21.638 1.00 0.00 ? 67  LYS B C    2  
ATOM   9019   O O    . LYS B 1 67  ? 4.779   -14.430 -21.134 1.00 0.00 ? 67  LYS B O    2  
ATOM   9020   C CB   . LYS B 1 67  ? 3.435   -16.533 -23.665 1.00 0.00 ? 67  LYS B CB   2  
ATOM   9021   C CG   . LYS B 1 67  ? 3.765   -17.812 -24.445 1.00 0.00 ? 67  LYS B CG   2  
ATOM   9022   C CD   . LYS B 1 67  ? 5.164   -17.714 -25.060 1.00 0.00 ? 67  LYS B CD   2  
ATOM   9023   C CE   . LYS B 1 67  ? 5.332   -18.815 -26.110 1.00 0.00 ? 67  LYS B CE   2  
ATOM   9024   N NZ   . LYS B 1 67  ? 6.633   -18.637 -26.815 1.00 0.00 ? 67  LYS B NZ   2  
ATOM   9025   H H    . LYS B 1 67  ? 3.533   -18.282 -21.842 1.00 0.00 ? 67  LYS B H    2  
ATOM   9026   H HA   . LYS B 1 67  ? 5.356   -16.304 -22.747 1.00 0.00 ? 67  LYS B HA   2  
ATOM   9027   H HB2  . LYS B 1 67  ? 2.401   -16.563 -23.355 1.00 0.00 ? 67  LYS B HB2  2  
ATOM   9028   H HB3  . LYS B 1 67  ? 3.591   -15.677 -24.304 1.00 0.00 ? 67  LYS B HB3  2  
ATOM   9029   H HG2  . LYS B 1 67  ? 3.729   -18.658 -23.774 1.00 0.00 ? 67  LYS B HG2  2  
ATOM   9030   H HG3  . LYS B 1 67  ? 3.039   -17.949 -25.232 1.00 0.00 ? 67  LYS B HG3  2  
ATOM   9031   H HD2  . LYS B 1 67  ? 5.287   -16.747 -25.527 1.00 0.00 ? 67  LYS B HD2  2  
ATOM   9032   H HD3  . LYS B 1 67  ? 5.909   -17.842 -24.291 1.00 0.00 ? 67  LYS B HD3  2  
ATOM   9033   H HE2  . LYS B 1 67  ? 5.314   -19.780 -25.626 1.00 0.00 ? 67  LYS B HE2  2  
ATOM   9034   H HE3  . LYS B 1 67  ? 4.524   -18.757 -26.825 1.00 0.00 ? 67  LYS B HE3  2  
ATOM   9035   H HZ1  . LYS B 1 67  ? 7.318   -18.193 -26.172 1.00 0.00 ? 67  LYS B HZ1  2  
ATOM   9036   H HZ2  . LYS B 1 67  ? 6.991   -19.566 -27.119 1.00 0.00 ? 67  LYS B HZ2  2  
ATOM   9037   H HZ3  . LYS B 1 67  ? 6.497   -18.028 -27.646 1.00 0.00 ? 67  LYS B HZ3  2  
ATOM   9038   N N    . MET B 1 68  ? 2.624   -14.922 -21.564 1.00 0.00 ? 68  MET B N    2  
ATOM   9039   C CA   . MET B 1 68  ? 2.090   -13.751 -20.868 1.00 0.00 ? 68  MET B CA   2  
ATOM   9040   C C    . MET B 1 68  ? 2.324   -13.798 -19.355 1.00 0.00 ? 68  MET B C    2  
ATOM   9041   O O    . MET B 1 68  ? 2.589   -12.769 -18.734 1.00 0.00 ? 68  MET B O    2  
ATOM   9042   C CB   . MET B 1 68  ? 0.588   -13.643 -21.139 1.00 0.00 ? 68  MET B CB   2  
ATOM   9043   C CG   . MET B 1 68  ? 0.356   -13.037 -22.524 1.00 0.00 ? 68  MET B CG   2  
ATOM   9044   S SD   . MET B 1 68  ? 0.884   -11.306 -22.524 1.00 0.00 ? 68  MET B SD   2  
ATOM   9045   C CE   . MET B 1 68  ? 1.792   -11.343 -24.089 1.00 0.00 ? 68  MET B CE   2  
ATOM   9046   H H    . MET B 1 68  ? 2.001   -15.536 -22.004 1.00 0.00 ? 68  MET B H    2  
ATOM   9047   H HA   . MET B 1 68  ? 2.570   -12.869 -21.263 1.00 0.00 ? 68  MET B HA   2  
ATOM   9048   H HB2  . MET B 1 68  ? 0.144   -14.627 -21.097 1.00 0.00 ? 68  MET B HB2  2  
ATOM   9049   H HB3  . MET B 1 68  ? 0.133   -13.011 -20.391 1.00 0.00 ? 68  MET B HB3  2  
ATOM   9050   H HG2  . MET B 1 68  ? 0.927   -13.588 -23.258 1.00 0.00 ? 68  MET B HG2  2  
ATOM   9051   H HG3  . MET B 1 68  ? -0.694  -13.093 -22.770 1.00 0.00 ? 68  MET B HG3  2  
ATOM   9052   H HE1  . MET B 1 68  ? 1.167   -11.779 -24.856 1.00 0.00 ? 68  MET B HE1  2  
ATOM   9053   H HE2  . MET B 1 68  ? 2.062   -10.340 -24.374 1.00 0.00 ? 68  MET B HE2  2  
ATOM   9054   H HE3  . MET B 1 68  ? 2.689   -11.935 -23.969 1.00 0.00 ? 68  MET B HE3  2  
ATOM   9055   N N    . LYS B 1 69  ? 2.180   -14.977 -18.760 1.00 0.00 ? 69  LYS B N    2  
ATOM   9056   C CA   . LYS B 1 69  ? 2.332   -15.114 -17.310 1.00 0.00 ? 69  LYS B CA   2  
ATOM   9057   C C    . LYS B 1 69  ? 3.787   -15.003 -16.855 1.00 0.00 ? 69  LYS B C    2  
ATOM   9058   O O    . LYS B 1 69  ? 4.718   -15.310 -17.599 1.00 0.00 ? 69  LYS B O    2  
ATOM   9059   C CB   . LYS B 1 69  ? 1.740   -16.446 -16.852 1.00 0.00 ? 69  LYS B CB   2  
ATOM   9060   C CG   . LYS B 1 69  ? 0.224   -16.408 -17.053 1.00 0.00 ? 69  LYS B CG   2  
ATOM   9061   C CD   . LYS B 1 69  ? -0.394  -17.731 -16.602 1.00 0.00 ? 69  LYS B CD   2  
ATOM   9062   C CE   . LYS B 1 69  ? -1.900  -17.702 -16.871 1.00 0.00 ? 69  LYS B CE   2  
ATOM   9063   N NZ   . LYS B 1 69  ? -2.540  -16.672 -16.005 1.00 0.00 ? 69  LYS B NZ   2  
ATOM   9064   H H    . LYS B 1 69  ? 1.935   -15.761 -19.295 1.00 0.00 ? 69  LYS B H    2  
ATOM   9065   H HA   . LYS B 1 69  ? 1.772   -14.321 -16.838 1.00 0.00 ? 69  LYS B HA   2  
ATOM   9066   H HB2  . LYS B 1 69  ? 2.165   -17.251 -17.436 1.00 0.00 ? 69  LYS B HB2  2  
ATOM   9067   H HB3  . LYS B 1 69  ? 1.960   -16.600 -15.807 1.00 0.00 ? 69  LYS B HB3  2  
ATOM   9068   H HG2  . LYS B 1 69  ? -0.194  -15.599 -16.472 1.00 0.00 ? 69  LYS B HG2  2  
ATOM   9069   H HG3  . LYS B 1 69  ? 0.005   -16.250 -18.099 1.00 0.00 ? 69  LYS B HG3  2  
ATOM   9070   H HD2  . LYS B 1 69  ? 0.056   -18.545 -17.151 1.00 0.00 ? 69  LYS B HD2  2  
ATOM   9071   H HD3  . LYS B 1 69  ? -0.222  -17.868 -15.545 1.00 0.00 ? 69  LYS B HD3  2  
ATOM   9072   H HE2  . LYS B 1 69  ? -2.076  -17.460 -17.909 1.00 0.00 ? 69  LYS B HE2  2  
ATOM   9073   H HE3  . LYS B 1 69  ? -2.324  -18.671 -16.651 1.00 0.00 ? 69  LYS B HE3  2  
ATOM   9074   H HZ1  . LYS B 1 69  ? -1.820  -15.995 -15.681 1.00 0.00 ? 69  LYS B HZ1  2  
ATOM   9075   H HZ2  . LYS B 1 69  ? -3.269  -16.166 -16.547 1.00 0.00 ? 69  LYS B HZ2  2  
ATOM   9076   H HZ3  . LYS B 1 69  ? -2.977  -17.134 -15.181 1.00 0.00 ? 69  LYS B HZ3  2  
ATOM   9077   N N    . VAL B 1 70  ? 3.956   -14.543 -15.612 1.00 0.00 ? 70  VAL B N    2  
ATOM   9078   C CA   . VAL B 1 70  ? 5.279   -14.362 -15.015 1.00 0.00 ? 70  VAL B CA   2  
ATOM   9079   C C    . VAL B 1 70  ? 5.319   -14.970 -13.610 1.00 0.00 ? 70  VAL B C    2  
ATOM   9080   O O    . VAL B 1 70  ? 4.288   -15.383 -13.079 1.00 0.00 ? 70  VAL B O    2  
ATOM   9081   C CB   . VAL B 1 70  ? 5.603   -12.871 -14.926 1.00 0.00 ? 70  VAL B CB   2  
ATOM   9082   C CG1  . VAL B 1 70  ? 5.645   -12.269 -16.332 1.00 0.00 ? 70  VAL B CG1  2  
ATOM   9083   C CG2  . VAL B 1 70  ? 4.524   -12.165 -14.103 1.00 0.00 ? 70  VAL B CG2  2  
ATOM   9084   H H    . VAL B 1 70  ? 3.164   -14.313 -15.083 1.00 0.00 ? 70  VAL B H    2  
ATOM   9085   H HA   . VAL B 1 70  ? 6.018   -14.848 -15.633 1.00 0.00 ? 70  VAL B HA   2  
ATOM   9086   H HB   . VAL B 1 70  ? 6.563   -12.740 -14.450 1.00 0.00 ? 70  VAL B HB   2  
ATOM   9087   H HG11 . VAL B 1 70  ? 4.701   -12.446 -16.827 1.00 0.00 ? 70  VAL B HG11 2  
ATOM   9088   H HG12 . VAL B 1 70  ? 5.821   -11.206 -16.264 1.00 0.00 ? 70  VAL B HG12 2  
ATOM   9089   H HG13 . VAL B 1 70  ? 6.440   -12.731 -16.898 1.00 0.00 ? 70  VAL B HG13 2  
ATOM   9090   H HG21 . VAL B 1 70  ? 4.483   -12.600 -13.115 1.00 0.00 ? 70  VAL B HG21 2  
ATOM   9091   H HG22 . VAL B 1 70  ? 4.761   -11.114 -14.024 1.00 0.00 ? 70  VAL B HG22 2  
ATOM   9092   H HG23 . VAL B 1 70  ? 3.566   -12.282 -14.588 1.00 0.00 ? 70  VAL B HG23 2  
ATOM   9093   N N    . SER B 1 71  ? 6.510   -15.022 -13.009 1.00 0.00 ? 71  SER B N    2  
ATOM   9094   C CA   . SER B 1 71  ? 6.646   -15.584 -11.663 1.00 0.00 ? 71  SER B CA   2  
ATOM   9095   C C    . SER B 1 71  ? 5.769   -14.801 -10.691 1.00 0.00 ? 71  SER B C    2  
ATOM   9096   O O    . SER B 1 71  ? 5.773   -13.569 -10.692 1.00 0.00 ? 71  SER B O    2  
ATOM   9097   C CB   . SER B 1 71  ? 8.105   -15.520 -11.213 1.00 0.00 ? 71  SER B CB   2  
ATOM   9098   O OG   . SER B 1 71  ? 8.242   -16.200 -9.974  1.00 0.00 ? 71  SER B OG   2  
ATOM   9099   H H    . SER B 1 71  ? 7.302   -14.678 -13.472 1.00 0.00 ? 71  SER B H    2  
ATOM   9100   H HA   . SER B 1 71  ? 6.325   -16.615 -11.677 1.00 0.00 ? 71  SER B HA   2  
ATOM   9101   H HB2  . SER B 1 71  ? 8.732   -15.993 -11.950 1.00 0.00 ? 71  SER B HB2  2  
ATOM   9102   H HB3  . SER B 1 71  ? 8.401   -14.484 -11.103 1.00 0.00 ? 71  SER B HB3  2  
ATOM   9103   H HG   . SER B 1 71  ? 7.491   -15.968 -9.423  1.00 0.00 ? 71  SER B HG   2  
ATOM   9104   N N    . LEU B 1 72  ? 4.972   -15.521 -9.904  1.00 0.00 ? 72  LEU B N    2  
ATOM   9105   C CA   . LEU B 1 72  ? 4.035   -14.874 -8.977  1.00 0.00 ? 72  LEU B CA   2  
ATOM   9106   C C    . LEU B 1 72  ? 4.773   -14.125 -7.864  1.00 0.00 ? 72  LEU B C    2  
ATOM   9107   O O    . LEU B 1 72  ? 4.371   -13.039 -7.442  1.00 0.00 ? 72  LEU B O    2  
ATOM   9108   C CB   . LEU B 1 72  ? 3.127   -15.932 -8.350  1.00 0.00 ? 72  LEU B CB   2  
ATOM   9109   C CG   . LEU B 1 72  ? 2.166   -16.482 -9.408  1.00 0.00 ? 72  LEU B CG   2  
ATOM   9110   C CD1  . LEU B 1 72  ? 1.437   -17.703 -8.844  1.00 0.00 ? 72  LEU B CD1  2  
ATOM   9111   C CD2  . LEU B 1 72  ? 1.141   -15.405 -9.795  1.00 0.00 ? 72  LEU B CD2  2  
ATOM   9112   H H    . LEU B 1 72  ? 4.971   -16.491 -9.973  1.00 0.00 ? 72  LEU B H    2  
ATOM   9113   H HA   . LEU B 1 72  ? 3.420   -14.179 -9.525  1.00 0.00 ? 72  LEU B HA   2  
ATOM   9114   H HB2  . LEU B 1 72  ? 3.734   -16.739 -7.963  1.00 0.00 ? 72  LEU B HB2  2  
ATOM   9115   H HB3  . LEU B 1 72  ? 2.562   -15.492 -7.543  1.00 0.00 ? 72  LEU B HB3  2  
ATOM   9116   H HG   . LEU B 1 72  ? 2.729   -16.775 -10.283 1.00 0.00 ? 72  LEU B HG   2  
ATOM   9117   H HD11 . LEU B 1 72  ? 2.157   -18.389 -8.423  1.00 0.00 ? 72  LEU B HD11 2  
ATOM   9118   H HD12 . LEU B 1 72  ? 0.749   -17.387 -8.074  1.00 0.00 ? 72  LEU B HD12 2  
ATOM   9119   H HD13 . LEU B 1 72  ? 0.891   -18.194 -9.636  1.00 0.00 ? 72  LEU B HD13 2  
ATOM   9120   H HD21 . LEU B 1 72  ? 0.953   -14.760 -8.950  1.00 0.00 ? 72  LEU B HD21 2  
ATOM   9121   H HD22 . LEU B 1 72  ? 1.528   -14.819 -10.616 1.00 0.00 ? 72  LEU B HD22 2  
ATOM   9122   H HD23 . LEU B 1 72  ? 0.218   -15.877 -10.098 1.00 0.00 ? 72  LEU B HD23 2  
ATOM   9123   N N    . VAL B 1 73  ? 5.837   -14.746 -7.383  1.00 0.00 ? 73  VAL B N    2  
ATOM   9124   C CA   . VAL B 1 73  ? 6.646   -14.195 -6.299  1.00 0.00 ? 73  VAL B CA   2  
ATOM   9125   C C    . VAL B 1 73  ? 7.258   -12.833 -6.658  1.00 0.00 ? 73  VAL B C    2  
ATOM   9126   O O    . VAL B 1 73  ? 7.664   -12.070 -5.778  1.00 0.00 ? 73  VAL B O    2  
ATOM   9127   C CB   . VAL B 1 73  ? 7.778   -15.165 -5.953  1.00 0.00 ? 73  VAL B CB   2  
ATOM   9128   C CG1  . VAL B 1 73  ? 7.221   -16.582 -5.810  1.00 0.00 ? 73  VAL B CG1  2  
ATOM   9129   C CG2  . VAL B 1 73  ? 8.829   -15.136 -7.064  1.00 0.00 ? 73  VAL B CG2  2  
ATOM   9130   H H    . VAL B 1 73  ? 6.081   -15.613 -7.757  1.00 0.00 ? 73  VAL B H    2  
ATOM   9131   H HA   . VAL B 1 73  ? 6.023   -14.080 -5.425  1.00 0.00 ? 73  VAL B HA   2  
ATOM   9132   H HB   . VAL B 1 73  ? 8.233   -14.864 -5.020  1.00 0.00 ? 73  VAL B HB   2  
ATOM   9133   H HG11 . VAL B 1 73  ? 6.727   -16.870 -6.726  1.00 0.00 ? 73  VAL B HG11 2  
ATOM   9134   H HG12 . VAL B 1 73  ? 8.031   -17.268 -5.608  1.00 0.00 ? 73  VAL B HG12 2  
ATOM   9135   H HG13 . VAL B 1 73  ? 6.514   -16.611 -4.995  1.00 0.00 ? 73  VAL B HG13 2  
ATOM   9136   H HG21 . VAL B 1 73  ? 8.340   -15.017 -8.019  1.00 0.00 ? 73  VAL B HG21 2  
ATOM   9137   H HG22 . VAL B 1 73  ? 9.503   -14.308 -6.900  1.00 0.00 ? 73  VAL B HG22 2  
ATOM   9138   H HG23 . VAL B 1 73  ? 9.387   -16.061 -7.058  1.00 0.00 ? 73  VAL B HG23 2  
ATOM   9139   N N    . LEU B 1 74  ? 7.332   -12.537 -7.944  1.00 0.00 ? 74  LEU B N    2  
ATOM   9140   C CA   . LEU B 1 74  ? 7.905   -11.263 -8.379  1.00 0.00 ? 74  LEU B CA   2  
ATOM   9141   C C    . LEU B 1 74  ? 7.234   -10.099 -7.677  1.00 0.00 ? 74  LEU B C    2  
ATOM   9142   O O    . LEU B 1 74  ? 7.877   -9.109  -7.308  1.00 0.00 ? 74  LEU B O    2  
ATOM   9143   C CB   . LEU B 1 74  ? 7.716   -11.171 -9.892  1.00 0.00 ? 74  LEU B CB   2  
ATOM   9144   C CG   . LEU B 1 74  ? 8.167   -9.816  -10.426 1.00 0.00 ? 74  LEU B CG   2  
ATOM   9145   C CD1  . LEU B 1 74  ? 9.667   -9.637  -10.172 1.00 0.00 ? 74  LEU B CD1  2  
ATOM   9146   C CD2  . LEU B 1 74  ? 7.874   -9.759  -11.937 1.00 0.00 ? 74  LEU B CD2  2  
ATOM   9147   H H    . LEU B 1 74  ? 7.008   -13.169 -8.614  1.00 0.00 ? 74  LEU B H    2  
ATOM   9148   H HA   . LEU B 1 74  ? 8.956   -11.249 -8.143  1.00 0.00 ? 74  LEU B HA   2  
ATOM   9149   H HB2  . LEU B 1 74  ? 8.295   -11.948 -10.367 1.00 0.00 ? 74  LEU B HB2  2  
ATOM   9150   H HB3  . LEU B 1 74  ? 6.671   -11.315 -10.125 1.00 0.00 ? 74  LEU B HB3  2  
ATOM   9151   H HG   . LEU B 1 74  ? 7.621   -9.031  -9.924  1.00 0.00 ? 74  LEU B HG   2  
ATOM   9152   H HD11 . LEU B 1 74  ? 10.176  -10.579 -10.317 1.00 0.00 ? 74  LEU B HD11 2  
ATOM   9153   H HD12 . LEU B 1 74  ? 10.065  -8.905  -10.860 1.00 0.00 ? 74  LEU B HD12 2  
ATOM   9154   H HD13 . LEU B 1 74  ? 9.821   -9.299  -9.159  1.00 0.00 ? 74  LEU B HD13 2  
ATOM   9155   H HD21 . LEU B 1 74  ? 6.979   -10.312 -12.154 1.00 0.00 ? 74  LEU B HD21 2  
ATOM   9156   H HD22 . LEU B 1 74  ? 7.737   -8.733  -12.250 1.00 0.00 ? 74  LEU B HD22 2  
ATOM   9157   H HD23 . LEU B 1 74  ? 8.704   -10.188 -12.478 1.00 0.00 ? 74  LEU B HD23 2  
ATOM   9158   N N    . VAL B 1 75  ? 5.927   -10.228 -7.501  1.00 0.00 ? 75  VAL B N    2  
ATOM   9159   C CA   . VAL B 1 75  ? 5.143   -9.192  -6.845  1.00 0.00 ? 75  VAL B CA   2  
ATOM   9160   C C    . VAL B 1 75  ? 5.533   -9.124  -5.369  1.00 0.00 ? 75  VAL B C    2  
ATOM   9161   O O    . VAL B 1 75  ? 5.729   -8.046  -4.823  1.00 0.00 ? 75  VAL B O    2  
ATOM   9162   C CB   . VAL B 1 75  ? 3.646   -9.494  -6.981  1.00 0.00 ? 75  VAL B CB   2  
ATOM   9163   C CG1  . VAL B 1 75  ? 2.834   -8.421  -6.247  1.00 0.00 ? 75  VAL B CG1  2  
ATOM   9164   C CG2  . VAL B 1 75  ? 3.256   -9.517  -8.468  1.00 0.00 ? 75  VAL B CG2  2  
ATOM   9165   H H    . VAL B 1 75  ? 5.488   -11.043 -7.823  1.00 0.00 ? 75  VAL B H    2  
ATOM   9166   H HA   . VAL B 1 75  ? 5.360   -8.240  -7.305  1.00 0.00 ? 75  VAL B HA   2  
ATOM   9167   H HB   . VAL B 1 75  ? 3.437   -10.459 -6.540  1.00 0.00 ? 75  VAL B HB   2  
ATOM   9168   H HG11 . VAL B 1 75  ? 3.361   -7.479  -6.291  1.00 0.00 ? 75  VAL B HG11 2  
ATOM   9169   H HG12 . VAL B 1 75  ? 1.869   -8.316  -6.721  1.00 0.00 ? 75  VAL B HG12 2  
ATOM   9170   H HG13 . VAL B 1 75  ? 2.698   -8.711  -5.216  1.00 0.00 ? 75  VAL B HG13 2  
ATOM   9171   H HG21 . VAL B 1 75  ? 3.899   -10.206 -8.996  1.00 0.00 ? 75  VAL B HG21 2  
ATOM   9172   H HG22 . VAL B 1 75  ? 2.230   -9.837  -8.571  1.00 0.00 ? 75  VAL B HG22 2  
ATOM   9173   H HG23 . VAL B 1 75  ? 3.367   -8.528  -8.889  1.00 0.00 ? 75  VAL B HG23 2  
ATOM   9174   N N    . HIS B 1 76  ? 5.692   -10.338 -4.640  1.00 0.00 ? 76  HIS B N    2  
ATOM   9175   C CA   . HIS B 1 76  ? 6.069   -10.361 -3.230  1.00 0.00 ? 76  HIS B CA   2  
ATOM   9176   C C    . HIS B 1 76  ? 7.357   -9.567  -3.013  1.00 0.00 ? 76  HIS B C    2  
ATOM   9177   O O    . HIS B 1 76  ? 7.448   -8.760  -2.089  1.00 0.00 ? 76  HIS B O    2  
ATOM   9178   C CB   . HIS B 1 76  ? 6.273   -11.799 -2.754  1.00 0.00 ? 76  HIS B CB   2  
ATOM   9179   C CG   . HIS B 1 76  ? 6.360   -11.808 -1.253  1.00 0.00 ? 76  HIS B CG   2  
ATOM   9180   N ND1  . HIS B 1 76  ? 5.672   -10.899 -0.467  1.00 0.00 ? 76  HIS B ND1  2  
ATOM   9181   C CD2  . HIS B 1 76  ? 7.060   -12.606 -0.377  1.00 0.00 ? 76  HIS B CD2  2  
ATOM   9182   C CE1  . HIS B 1 76  ? 5.965   -11.165 0.818   1.00 0.00 ? 76  HIS B CE1  2  
ATOM   9183   N NE2  . HIS B 1 76  ? 6.806   -12.198 0.930   1.00 0.00 ? 76  HIS B NE2  2  
ATOM   9184   H H    . HIS B 1 76  ? 5.556   -11.180 -5.122  1.00 0.00 ? 76  HIS B H    2  
ATOM   9185   H HA   . HIS B 1 76  ? 5.278   -9.911  -2.650  1.00 0.00 ? 76  HIS B HA   2  
ATOM   9186   H HB2  . HIS B 1 76  ? 5.439   -12.407 -3.074  1.00 0.00 ? 76  HIS B HB2  2  
ATOM   9187   H HB3  . HIS B 1 76  ? 7.188   -12.192 -3.171  1.00 0.00 ? 76  HIS B HB3  2  
ATOM   9188   H HD1  . HIS B 1 76  ? 5.078   -10.188 -0.790  1.00 0.00 ? 76  HIS B HD1  2  
ATOM   9189   H HD2  . HIS B 1 76  ? 7.704   -13.424 -0.660  1.00 0.00 ? 76  HIS B HD2  2  
ATOM   9190   H HE1  . HIS B 1 76  ? 5.570   -10.614 1.657   1.00 0.00 ? 76  HIS B HE1  2  
ATOM   9191   N N    . ALA B 1 77  ? 8.336   -9.786  -3.880  1.00 0.00 ? 77  ALA B N    2  
ATOM   9192   C CA   . ALA B 1 77  ? 9.598   -9.066  -3.778  1.00 0.00 ? 77  ALA B CA   2  
ATOM   9193   C C    . ALA B 1 77  ? 9.404   -7.595  -4.128  1.00 0.00 ? 77  ALA B C    2  
ATOM   9194   O O    . ALA B 1 77  ? 9.963   -6.708  -3.478  1.00 0.00 ? 77  ALA B O    2  
ATOM   9195   C CB   . ALA B 1 77  ? 10.634  -9.694  -4.714  1.00 0.00 ? 77  ALA B CB   2  
ATOM   9196   H H    . ALA B 1 77  ? 8.199   -10.435 -4.610  1.00 0.00 ? 77  ALA B H    2  
ATOM   9197   H HA   . ALA B 1 77  ? 9.956   -9.141  -2.762  1.00 0.00 ? 77  ALA B HA   2  
ATOM   9198   H HB1  . ALA B 1 77  ? 11.092  -10.546 -4.231  1.00 0.00 ? 77  ALA B HB1  2  
ATOM   9199   H HB2  . ALA B 1 77  ? 10.149  -10.016 -5.624  1.00 0.00 ? 77  ALA B HB2  2  
ATOM   9200   H HB3  . ALA B 1 77  ? 11.393  -8.964  -4.952  1.00 0.00 ? 77  ALA B HB3  2  
ATOM   9201   N N    . GLN B 1 78  ? 8.608   -7.336  -5.164  1.00 0.00 ? 78  GLN B N    2  
ATOM   9202   C CA   . GLN B 1 78  ? 8.353   -5.966  -5.594  1.00 0.00 ? 78  GLN B CA   2  
ATOM   9203   C C    . GLN B 1 78  ? 7.612   -5.200  -4.497  1.00 0.00 ? 78  GLN B C    2  
ATOM   9204   O O    . GLN B 1 78  ? 7.982   -4.078  -4.145  1.00 0.00 ? 78  GLN B O    2  
ATOM   9205   C CB   . GLN B 1 78  ? 7.526   -5.982  -6.882  1.00 0.00 ? 78  GLN B CB   2  
ATOM   9206   C CG   . GLN B 1 78  ? 7.611   -4.623  -7.572  1.00 0.00 ? 78  GLN B CG   2  
ATOM   9207   C CD   . GLN B 1 78  ? 6.788   -4.643  -8.856  1.00 0.00 ? 78  GLN B CD   2  
ATOM   9208   O OE1  . GLN B 1 78  ? 7.275   -4.239  -9.913  1.00 0.00 ? 78  GLN B OE1  2  
ATOM   9209   N NE2  . GLN B 1 78  ? 5.561   -5.085  -8.828  1.00 0.00 ? 78  GLN B NE2  2  
ATOM   9210   H H    . GLN B 1 78  ? 8.187   -8.080  -5.650  1.00 0.00 ? 78  GLN B H    2  
ATOM   9211   H HA   . GLN B 1 78  ? 9.296   -5.480  -5.783  1.00 0.00 ? 78  GLN B HA   2  
ATOM   9212   H HB2  . GLN B 1 78  ? 7.907   -6.747  -7.544  1.00 0.00 ? 78  GLN B HB2  2  
ATOM   9213   H HB3  . GLN B 1 78  ? 6.495   -6.197  -6.643  1.00 0.00 ? 78  GLN B HB3  2  
ATOM   9214   H HG2  . GLN B 1 78  ? 7.228   -3.863  -6.911  1.00 0.00 ? 78  GLN B HG2  2  
ATOM   9215   H HG3  . GLN B 1 78  ? 8.642   -4.406  -7.812  1.00 0.00 ? 78  GLN B HG3  2  
ATOM   9216   H HE21 . GLN B 1 78  ? 5.174   -5.403  -7.985  1.00 0.00 ? 78  GLN B HE21 2  
ATOM   9217   H HE22 . GLN B 1 78  ? 5.027   -5.101  -9.649  1.00 0.00 ? 78  GLN B HE22 2  
ATOM   9218   N N    . LEU B 1 79  ? 6.573   -5.823  -3.950  1.00 0.00 ? 79  LEU B N    2  
ATOM   9219   C CA   . LEU B 1 79  ? 5.796   -5.202  -2.879  1.00 0.00 ? 79  LEU B CA   2  
ATOM   9220   C C    . LEU B 1 79  ? 6.690   -4.819  -1.704  1.00 0.00 ? 79  LEU B C    2  
ATOM   9221   O O    . LEU B 1 79  ? 6.633   -3.695  -1.216  1.00 0.00 ? 79  LEU B O    2  
ATOM   9222   C CB   . LEU B 1 79  ? 4.703   -6.170  -2.396  1.00 0.00 ? 79  LEU B CB   2  
ATOM   9223   C CG   . LEU B 1 79  ? 3.936   -5.570  -1.202  1.00 0.00 ? 79  LEU B CG   2  
ATOM   9224   C CD1  . LEU B 1 79  ? 3.382   -4.193  -1.582  1.00 0.00 ? 79  LEU B CD1  2  
ATOM   9225   C CD2  . LEU B 1 79  ? 2.783   -6.510  -0.803  1.00 0.00 ? 79  LEU B CD2  2  
ATOM   9226   H H    . LEU B 1 79  ? 6.325   -6.716  -4.272  1.00 0.00 ? 79  LEU B H    2  
ATOM   9227   H HA   . LEU B 1 79  ? 5.330   -4.309  -3.262  1.00 0.00 ? 79  LEU B HA   2  
ATOM   9228   H HB2  . LEU B 1 79  ? 4.017   -6.362  -3.205  1.00 0.00 ? 79  LEU B HB2  2  
ATOM   9229   H HB3  . LEU B 1 79  ? 5.163   -7.100  -2.091  1.00 0.00 ? 79  LEU B HB3  2  
ATOM   9230   H HG   . LEU B 1 79  ? 4.610   -5.459  -0.363  1.00 0.00 ? 79  LEU B HG   2  
ATOM   9231   H HD11 . LEU B 1 79  ? 3.098   -4.193  -2.623  1.00 0.00 ? 79  LEU B HD11 2  
ATOM   9232   H HD12 . LEU B 1 79  ? 2.518   -3.971  -0.974  1.00 0.00 ? 79  LEU B HD12 2  
ATOM   9233   H HD13 . LEU B 1 79  ? 4.143   -3.444  -1.414  1.00 0.00 ? 79  LEU B HD13 2  
ATOM   9234   H HD21 . LEU B 1 79  ? 2.350   -6.954  -1.689  1.00 0.00 ? 79  LEU B HD21 2  
ATOM   9235   H HD22 . LEU B 1 79  ? 3.164   -7.291  -0.164  1.00 0.00 ? 79  LEU B HD22 2  
ATOM   9236   H HD23 . LEU B 1 79  ? 2.024   -5.952  -0.272  1.00 0.00 ? 79  LEU B HD23 2  
ATOM   9237   N N    . HIS B 1 80  ? 7.509   -5.756  -1.253  1.00 0.00 ? 80  HIS B N    2  
ATOM   9238   C CA   . HIS B 1 80  ? 8.392   -5.489  -0.126  1.00 0.00 ? 80  HIS B CA   2  
ATOM   9239   C C    . HIS B 1 80  ? 9.447   -4.450  -0.491  1.00 0.00 ? 80  HIS B C    2  
ATOM   9240   O O    . HIS B 1 80  ? 9.711   -3.522  0.276   1.00 0.00 ? 80  HIS B O    2  
ATOM   9241   C CB   . HIS B 1 80  ? 9.063   -6.784  0.327   1.00 0.00 ? 80  HIS B CB   2  
ATOM   9242   C CG   . HIS B 1 80  ? 8.208   -7.441  1.372   1.00 0.00 ? 80  HIS B CG   2  
ATOM   9243   N ND1  . HIS B 1 80  ? 8.565   -7.458  2.709   1.00 0.00 ? 80  HIS B ND1  2  
ATOM   9244   C CD2  . HIS B 1 80  ? 7.004   -8.095  1.298   1.00 0.00 ? 80  HIS B CD2  2  
ATOM   9245   C CE1  . HIS B 1 80  ? 7.591   -8.102  3.381   1.00 0.00 ? 80  HIS B CE1  2  
ATOM   9246   N NE2  . HIS B 1 80  ? 6.615   -8.510  2.566   1.00 0.00 ? 80  HIS B NE2  2  
ATOM   9247   H H    . HIS B 1 80  ? 7.514   -6.644  -1.680  1.00 0.00 ? 80  HIS B H    2  
ATOM   9248   H HA   . HIS B 1 80  ? 7.802   -5.102  0.689   1.00 0.00 ? 80  HIS B HA   2  
ATOM   9249   H HB2  . HIS B 1 80  ? 9.176   -7.448  -0.519  1.00 0.00 ? 80  HIS B HB2  2  
ATOM   9250   H HB3  . HIS B 1 80  ? 10.035  -6.563  0.744   1.00 0.00 ? 80  HIS B HB3  2  
ATOM   9251   H HD1  . HIS B 1 80  ? 9.385   -7.073  3.093   1.00 0.00 ? 80  HIS B HD1  2  
ATOM   9252   H HD2  . HIS B 1 80  ? 6.443   -8.262  0.389   1.00 0.00 ? 80  HIS B HD2  2  
ATOM   9253   H HE1  . HIS B 1 80  ? 7.599   -8.266  4.450   1.00 0.00 ? 80  HIS B HE1  2  
ATOM   9254   H HE2  . HIS B 1 80  ? 5.800   -8.996  2.810   1.00 0.00 ? 80  HIS B HE2  2  
ATOM   9255   N N    . LEU B 1 81  ? 10.053  -4.615  -1.655  1.00 0.00 ? 81  LEU B N    2  
ATOM   9256   C CA   . LEU B 1 81  ? 11.088  -3.686  -2.103  1.00 0.00 ? 81  LEU B CA   2  
ATOM   9257   C C    . LEU B 1 81  ? 10.532  -2.278  -2.319  1.00 0.00 ? 81  LEU B C    2  
ATOM   9258   O O    . LEU B 1 81  ? 11.148  -1.289  -1.903  1.00 0.00 ? 81  LEU B O    2  
ATOM   9259   C CB   . LEU B 1 81  ? 11.718  -4.192  -3.401  1.00 0.00 ? 81  LEU B CB   2  
ATOM   9260   C CG   . LEU B 1 81  ? 12.551  -5.450  -3.122  1.00 0.00 ? 81  LEU B CG   2  
ATOM   9261   C CD1  . LEU B 1 81  ? 12.937  -6.107  -4.449  1.00 0.00 ? 81  LEU B CD1  2  
ATOM   9262   C CD2  . LEU B 1 81  ? 13.824  -5.088  -2.337  1.00 0.00 ? 81  LEU B CD2  2  
ATOM   9263   H H    . LEU B 1 81  ? 9.807   -5.378  -2.223  1.00 0.00 ? 81  LEU B H    2  
ATOM   9264   H HA   . LEU B 1 81  ? 11.852  -3.637  -1.345  1.00 0.00 ? 81  LEU B HA   2  
ATOM   9265   H HB2  . LEU B 1 81  ? 10.931  -4.429  -4.108  1.00 0.00 ? 81  LEU B HB2  2  
ATOM   9266   H HB3  . LEU B 1 81  ? 12.351  -3.423  -3.817  1.00 0.00 ? 81  LEU B HB3  2  
ATOM   9267   H HG   . LEU B 1 81  ? 11.958  -6.144  -2.544  1.00 0.00 ? 81  LEU B HG   2  
ATOM   9268   H HD11 . LEU B 1 81  ? 13.208  -5.347  -5.165  1.00 0.00 ? 81  LEU B HD11 2  
ATOM   9269   H HD12 . LEU B 1 81  ? 13.774  -6.771  -4.294  1.00 0.00 ? 81  LEU B HD12 2  
ATOM   9270   H HD13 . LEU B 1 81  ? 12.096  -6.671  -4.827  1.00 0.00 ? 81  LEU B HD13 2  
ATOM   9271   H HD21 . LEU B 1 81  ? 14.183  -4.117  -2.646  1.00 0.00 ? 81  LEU B HD21 2  
ATOM   9272   H HD22 . LEU B 1 81  ? 13.604  -5.069  -1.279  1.00 0.00 ? 81  LEU B HD22 2  
ATOM   9273   H HD23 . LEU B 1 81  ? 14.586  -5.830  -2.530  1.00 0.00 ? 81  LEU B HD23 2  
ATOM   9274   N N    . MET B 1 82  ? 9.378   -2.182  -2.972  1.00 0.00 ? 82  MET B N    2  
ATOM   9275   C CA   . MET B 1 82  ? 8.770   -0.879  -3.232  1.00 0.00 ? 82  MET B CA   2  
ATOM   9276   C C    . MET B 1 82  ? 8.430   -0.172  -1.923  1.00 0.00 ? 82  MET B C    2  
ATOM   9277   O O    . MET B 1 82  ? 8.687   1.024   -1.758  1.00 0.00 ? 82  MET B O    2  
ATOM   9278   C CB   . MET B 1 82  ? 7.493   -1.051  -4.064  1.00 0.00 ? 82  MET B CB   2  
ATOM   9279   C CG   . MET B 1 82  ? 7.848   -1.362  -5.525  1.00 0.00 ? 82  MET B CG   2  
ATOM   9280   S SD   . MET B 1 82  ? 8.668   0.066   -6.287  1.00 0.00 ? 82  MET B SD   2  
ATOM   9281   C CE   . MET B 1 82  ? 7.212   1.129   -6.466  1.00 0.00 ? 82  MET B CE   2  
ATOM   9282   H H    . MET B 1 82  ? 8.929   -2.999  -3.282  1.00 0.00 ? 82  MET B H    2  
ATOM   9283   H HA   . MET B 1 82  ? 9.470   -0.274  -3.782  1.00 0.00 ? 82  MET B HA   2  
ATOM   9284   H HB2  . MET B 1 82  ? 6.910   -1.866  -3.658  1.00 0.00 ? 82  MET B HB2  2  
ATOM   9285   H HB3  . MET B 1 82  ? 6.911   -0.142  -4.022  1.00 0.00 ? 82  MET B HB3  2  
ATOM   9286   H HG2  . MET B 1 82  ? 8.510   -2.216  -5.557  1.00 0.00 ? 82  MET B HG2  2  
ATOM   9287   H HG3  . MET B 1 82  ? 6.943   -1.593  -6.070  1.00 0.00 ? 82  MET B HG3  2  
ATOM   9288   H HE1  . MET B 1 82  ? 6.353   0.527   -6.729  1.00 0.00 ? 82  MET B HE1  2  
ATOM   9289   H HE2  . MET B 1 82  ? 7.019   1.636   -5.535  1.00 0.00 ? 82  MET B HE2  2  
ATOM   9290   H HE3  . MET B 1 82  ? 7.394   1.862   -7.241  1.00 0.00 ? 82  MET B HE3  2  
ATOM   9291   N N    . THR B 1 83  ? 7.852   -0.921  -0.993  1.00 0.00 ? 83  THR B N    2  
ATOM   9292   C CA   . THR B 1 83  ? 7.478   -0.365  0.304   1.00 0.00 ? 83  THR B CA   2  
ATOM   9293   C C    . THR B 1 83  ? 8.712   0.101   1.068   1.00 0.00 ? 83  THR B C    2  
ATOM   9294   O O    . THR B 1 83  ? 8.743   1.208   1.613   1.00 0.00 ? 83  THR B O    2  
ATOM   9295   C CB   . THR B 1 83  ? 6.737   -1.421  1.137   1.00 0.00 ? 83  THR B CB   2  
ATOM   9296   O OG1  . THR B 1 83  ? 7.440   -2.649  1.064   1.00 0.00 ? 83  THR B OG1  2  
ATOM   9297   C CG2  . THR B 1 83  ? 5.312   -1.621  0.605   1.00 0.00 ? 83  THR B CG2  2  
ATOM   9298   H H    . THR B 1 83  ? 7.677   -1.871  -1.177  1.00 0.00 ? 83  THR B H    2  
ATOM   9299   H HA   . THR B 1 83  ? 6.828   0.478   0.149   1.00 0.00 ? 83  THR B HA   2  
ATOM   9300   H HB   . THR B 1 83  ? 6.692   -1.097  2.167   1.00 0.00 ? 83  THR B HB   2  
ATOM   9301   H HG1  . THR B 1 83  ? 7.447   -3.047  1.937   1.00 0.00 ? 83  THR B HG1  2  
ATOM   9302   H HG21 . THR B 1 83  ? 5.265   -1.333  -0.433  1.00 0.00 ? 83  THR B HG21 2  
ATOM   9303   H HG22 . THR B 1 83  ? 5.038   -2.661  0.698   1.00 0.00 ? 83  THR B HG22 2  
ATOM   9304   H HG23 . THR B 1 83  ? 4.625   -1.017  1.180   1.00 0.00 ? 83  THR B HG23 2  
ATOM   9305   N N    . SER B 1 84  ? 9.729   -0.751  1.117   1.00 0.00 ? 84  SER B N    2  
ATOM   9306   C CA   . SER B 1 84  ? 10.962  -0.417  1.835   1.00 0.00 ? 84  SER B CA   2  
ATOM   9307   C C    . SER B 1 84  ? 11.659  0.800   1.230   1.00 0.00 ? 84  SER B C    2  
ATOM   9308   O O    . SER B 1 84  ? 12.064  1.714   1.954   1.00 0.00 ? 84  SER B O    2  
ATOM   9309   C CB   . SER B 1 84  ? 11.917  -1.612  1.824   1.00 0.00 ? 84  SER B CB   2  
ATOM   9310   O OG   . SER B 1 84  ? 11.442  -2.595  2.736   1.00 0.00 ? 84  SER B OG   2  
ATOM   9311   H H    . SER B 1 84  ? 9.649   -1.623  0.670   1.00 0.00 ? 84  SER B H    2  
ATOM   9312   H HA   . SER B 1 84  ? 10.710  -0.193  2.859   1.00 0.00 ? 84  SER B HA   2  
ATOM   9313   H HB2  . SER B 1 84  ? 11.962  -2.037  0.834   1.00 0.00 ? 84  SER B HB2  2  
ATOM   9314   H HB3  . SER B 1 84  ? 12.909  -1.285  2.116   1.00 0.00 ? 84  SER B HB3  2  
ATOM   9315   H HG   . SER B 1 84  ? 10.632  -2.972  2.375   1.00 0.00 ? 84  SER B HG   2  
ATOM   9316   N N    . MET B 1 85  ? 11.804  0.818   -0.092  1.00 0.00 ? 85  MET B N    2  
ATOM   9317   C CA   . MET B 1 85  ? 12.461  1.943   -0.761  1.00 0.00 ? 85  MET B CA   2  
ATOM   9318   C C    . MET B 1 85  ? 11.723  3.251   -0.492  1.00 0.00 ? 85  MET B C    2  
ATOM   9319   O O    . MET B 1 85  ? 12.338  4.270   -0.169  1.00 0.00 ? 85  MET B O    2  
ATOM   9320   C CB   . MET B 1 85  ? 12.537  1.679   -2.268  1.00 0.00 ? 85  MET B CB   2  
ATOM   9321   C CG   . MET B 1 85  ? 13.399  2.755   -2.934  1.00 0.00 ? 85  MET B CG   2  
ATOM   9322   S SD   . MET B 1 85  ? 13.785  2.267   -4.637  1.00 0.00 ? 85  MET B SD   2  
ATOM   9323   C CE   . MET B 1 85  ? 12.187  2.668   -5.386  1.00 0.00 ? 85  MET B CE   2  
ATOM   9324   H H    . MET B 1 85  ? 11.464  0.067   -0.629  1.00 0.00 ? 85  MET B H    2  
ATOM   9325   H HA   . MET B 1 85  ? 13.464  2.030   -0.378  1.00 0.00 ? 85  MET B HA   2  
ATOM   9326   H HB2  . MET B 1 85  ? 12.974  0.706   -2.442  1.00 0.00 ? 85  MET B HB2  2  
ATOM   9327   H HB3  . MET B 1 85  ? 11.543  1.706   -2.687  1.00 0.00 ? 85  MET B HB3  2  
ATOM   9328   H HG2  . MET B 1 85  ? 12.861  3.691   -2.942  1.00 0.00 ? 85  MET B HG2  2  
ATOM   9329   H HG3  . MET B 1 85  ? 14.317  2.874   -2.377  1.00 0.00 ? 85  MET B HG3  2  
ATOM   9330   H HE1  . MET B 1 85  ? 11.409  2.092   -4.914  1.00 0.00 ? 85  MET B HE1  2  
ATOM   9331   H HE2  . MET B 1 85  ? 11.984  3.722   -5.256  1.00 0.00 ? 85  MET B HE2  2  
ATOM   9332   H HE3  . MET B 1 85  ? 12.218  2.430   -6.441  1.00 0.00 ? 85  MET B HE3  2  
ATOM   9333   N N    . LEU B 1 86  ? 10.407  3.213   -0.631  1.00 0.00 ? 86  LEU B N    2  
ATOM   9334   C CA   . LEU B 1 86  ? 9.587   4.397   -0.407  1.00 0.00 ? 86  LEU B CA   2  
ATOM   9335   C C    . LEU B 1 86  ? 9.715   4.874   1.034   1.00 0.00 ? 86  LEU B C    2  
ATOM   9336   O O    . LEU B 1 86  ? 9.908   6.062   1.306   1.00 0.00 ? 86  LEU B O    2  
ATOM   9337   C CB   . LEU B 1 86  ? 8.126   4.060   -0.709  1.00 0.00 ? 86  LEU B CB   2  
ATOM   9338   C CG   . LEU B 1 86  ? 7.303   5.352   -0.791  1.00 0.00 ? 86  LEU B CG   2  
ATOM   9339   C CD1  . LEU B 1 86  ? 7.588   6.084   -2.120  1.00 0.00 ? 86  LEU B CD1  2  
ATOM   9340   C CD2  . LEU B 1 86  ? 5.806   5.016   -0.684  1.00 0.00 ? 86  LEU B CD2  2  
ATOM   9341   H H    . LEU B 1 86  ? 9.975   2.369   -0.887  1.00 0.00 ? 86  LEU B H    2  
ATOM   9342   H HA   . LEU B 1 86  ? 9.915   5.182   -1.069  1.00 0.00 ? 86  LEU B HA   2  
ATOM   9343   H HB2  . LEU B 1 86  ? 8.069   3.525   -1.645  1.00 0.00 ? 86  LEU B HB2  2  
ATOM   9344   H HB3  . LEU B 1 86  ? 7.738   3.436   0.085   1.00 0.00 ? 86  LEU B HB3  2  
ATOM   9345   H HG   . LEU B 1 86  ? 7.581   5.997   0.033   1.00 0.00 ? 86  LEU B HG   2  
ATOM   9346   H HD11 . LEU B 1 86  ? 8.357   5.560   -2.669  1.00 0.00 ? 86  LEU B HD11 2  
ATOM   9347   H HD12 . LEU B 1 86  ? 6.685   6.127   -2.714  1.00 0.00 ? 86  LEU B HD12 2  
ATOM   9348   H HD13 . LEU B 1 86  ? 7.923   7.088   -1.908  1.00 0.00 ? 86  LEU B HD13 2  
ATOM   9349   H HD21 . LEU B 1 86  ? 5.654   4.263   0.079   1.00 0.00 ? 86  LEU B HD21 2  
ATOM   9350   H HD22 . LEU B 1 86  ? 5.257   5.908   -0.414  1.00 0.00 ? 86  LEU B HD22 2  
ATOM   9351   H HD23 . LEU B 1 86  ? 5.446   4.648   -1.630  1.00 0.00 ? 86  LEU B HD23 2  
ATOM   9352   N N    . ALA B 1 87  ? 9.598   3.934   1.958   1.00 0.00 ? 87  ALA B N    2  
ATOM   9353   C CA   . ALA B 1 87  ? 9.695   4.245   3.379   1.00 0.00 ? 87  ALA B CA   2  
ATOM   9354   C C    . ALA B 1 87  ? 11.027  4.911   3.690   1.00 0.00 ? 87  ALA B C    2  
ATOM   9355   O O    . ALA B 1 87  ? 11.093  5.942   4.364   1.00 0.00 ? 87  ALA B O    2  
ATOM   9356   C CB   . ALA B 1 87  ? 9.560   2.955   4.204   1.00 0.00 ? 87  ALA B CB   2  
ATOM   9357   H H    . ALA B 1 87  ? 9.445   3.004   1.677   1.00 0.00 ? 87  ALA B H    2  
ATOM   9358   H HA   . ALA B 1 87  ? 8.899   4.919   3.647   1.00 0.00 ? 87  ALA B HA   2  
ATOM   9359   H HB1  . ALA B 1 87  ? 9.702   2.098   3.560   1.00 0.00 ? 87  ALA B HB1  2  
ATOM   9360   H HB2  . ALA B 1 87  ? 10.307  2.940   4.990   1.00 0.00 ? 87  ALA B HB2  2  
ATOM   9361   H HB3  . ALA B 1 87  ? 8.578   2.911   4.646   1.00 0.00 ? 87  ALA B HB3  2  
ATOM   9362   N N    . ARG B 1 88  ? 12.092  4.308   3.197   1.00 0.00 ? 88  ARG B N    2  
ATOM   9363   C CA   . ARG B 1 88  ? 13.427  4.836   3.434   1.00 0.00 ? 88  ARG B CA   2  
ATOM   9364   C C    . ARG B 1 88  ? 13.555  6.260   2.886   1.00 0.00 ? 88  ARG B C    2  
ATOM   9365   O O    . ARG B 1 88  ? 14.111  7.137   3.551   1.00 0.00 ? 88  ARG B O    2  
ATOM   9366   C CB   . ARG B 1 88  ? 14.470  3.909   2.798   1.00 0.00 ? 88  ARG B CB   2  
ATOM   9367   C CG   . ARG B 1 88  ? 15.890  4.289   3.273   1.00 0.00 ? 88  ARG B CG   2  
ATOM   9368   C CD   . ARG B 1 88  ? 16.878  4.209   2.104   1.00 0.00 ? 88  ARG B CD   2  
ATOM   9369   N NE   . ARG B 1 88  ? 17.764  5.373   2.123   1.00 0.00 ? 88  ARG B NE   2  
ATOM   9370   C CZ   . ARG B 1 88  ? 17.289  6.597   1.984   1.00 0.00 ? 88  ARG B CZ   2  
ATOM   9371   N NH1  . ARG B 1 88  ? 16.012  6.783   1.907   1.00 0.00 ? 88  ARG B NH1  2  
ATOM   9372   N NH2  . ARG B 1 88  ? 18.096  7.603   1.958   1.00 0.00 ? 88  ARG B NH2  2  
ATOM   9373   H H    . ARG B 1 88  ? 11.981  3.490   2.666   1.00 0.00 ? 88  ARG B H    2  
ATOM   9374   H HA   . ARG B 1 88  ? 13.592  4.865   4.499   1.00 0.00 ? 88  ARG B HA   2  
ATOM   9375   H HB2  . ARG B 1 88  ? 14.256  2.890   3.095   1.00 0.00 ? 88  ARG B HB2  2  
ATOM   9376   H HB3  . ARG B 1 88  ? 14.411  3.983   1.722   1.00 0.00 ? 88  ARG B HB3  2  
ATOM   9377   H HG2  . ARG B 1 88  ? 15.886  5.294   3.669   1.00 0.00 ? 88  ARG B HG2  2  
ATOM   9378   H HG3  . ARG B 1 88  ? 16.204  3.604   4.047   1.00 0.00 ? 88  ARG B HG3  2  
ATOM   9379   H HD2  . ARG B 1 88  ? 17.470  3.306   2.201   1.00 0.00 ? 88  ARG B HD2  2  
ATOM   9380   H HD3  . ARG B 1 88  ? 16.335  4.179   1.168   1.00 0.00 ? 88  ARG B HD3  2  
ATOM   9381   H HE   . ARG B 1 88  ? 18.731  5.239   2.215   1.00 0.00 ? 88  ARG B HE   2  
ATOM   9382   H HH11 . ARG B 1 88  ? 15.393  5.998   1.937   1.00 0.00 ? 88  ARG B HH11 2  
ATOM   9383   H HH12 . ARG B 1 88  ? 15.642  7.702   1.806   1.00 0.00 ? 88  ARG B HH12 2  
ATOM   9384   H HH21 . ARG B 1 88  ? 19.080  7.457   2.021   1.00 0.00 ? 88  ARG B HH21 2  
ATOM   9385   H HH22 . ARG B 1 88  ? 17.731  8.531   1.878   1.00 0.00 ? 88  ARG B HH22 2  
ATOM   9386   N N    . GLU B 1 89  ? 13.054  6.495   1.676   1.00 0.00 ? 89  GLU B N    2  
ATOM   9387   C CA   . GLU B 1 89  ? 13.137  7.834   1.083   1.00 0.00 ? 89  GLU B CA   2  
ATOM   9388   C C    . GLU B 1 89  ? 12.402  8.853   1.946   1.00 0.00 ? 89  GLU B C    2  
ATOM   9389   O O    . GLU B 1 89  ? 12.920  9.934   2.222   1.00 0.00 ? 89  GLU B O    2  
ATOM   9390   C CB   . GLU B 1 89  ? 12.540  7.837   -0.325  1.00 0.00 ? 89  GLU B CB   2  
ATOM   9391   C CG   . GLU B 1 89  ? 12.743  9.213   -0.981  1.00 0.00 ? 89  GLU B CG   2  
ATOM   9392   C CD   . GLU B 1 89  ? 12.249  9.178   -2.426  1.00 0.00 ? 89  GLU B CD   2  
ATOM   9393   O OE1  . GLU B 1 89  ? 11.674  8.172   -2.817  1.00 0.00 ? 89  GLU B OE1  2  
ATOM   9394   O OE2  . GLU B 1 89  ? 12.450  10.156  -3.120  1.00 0.00 ? 89  GLU B OE2  2  
ATOM   9395   H H    . GLU B 1 89  ? 12.620  5.765   1.176   1.00 0.00 ? 89  GLU B H    2  
ATOM   9396   H HA   . GLU B 1 89  ? 14.171  8.122   1.019   1.00 0.00 ? 89  GLU B HA   2  
ATOM   9397   H HB2  . GLU B 1 89  ? 13.025  7.083   -0.929  1.00 0.00 ? 89  GLU B HB2  2  
ATOM   9398   H HB3  . GLU B 1 89  ? 11.481  7.627   -0.270  1.00 0.00 ? 89  GLU B HB3  2  
ATOM   9399   H HG2  . GLU B 1 89  ? 12.187  9.963   -0.433  1.00 0.00 ? 89  GLU B HG2  2  
ATOM   9400   H HG3  . GLU B 1 89  ? 13.790  9.470   -0.970  1.00 0.00 ? 89  GLU B HG3  2  
ATOM   9401   N N    . LEU B 1 90  ? 11.206  8.499   2.386   1.00 0.00 ? 90  LEU B N    2  
ATOM   9402   C CA   . LEU B 1 90  ? 10.424  9.399   3.224   1.00 0.00 ? 90  LEU B CA   2  
ATOM   9403   C C    . LEU B 1 90  ? 11.125  9.612   4.559   1.00 0.00 ? 90  LEU B C    2  
ATOM   9404   O O    . LEU B 1 90  ? 11.201  10.733  5.072   1.00 0.00 ? 90  LEU B O    2  
ATOM   9405   C CB   . LEU B 1 90  ? 9.037   8.809   3.428   1.00 0.00 ? 90  LEU B CB   2  
ATOM   9406   C CG   . LEU B 1 90  ? 8.277   8.861   2.096   1.00 0.00 ? 90  LEU B CG   2  
ATOM   9407   C CD1  . LEU B 1 90  ? 7.049   7.966   2.194   1.00 0.00 ? 90  LEU B CD1  2  
ATOM   9408   C CD2  . LEU B 1 90  ? 7.841   10.303  1.779   1.00 0.00 ? 90  LEU B CD2  2  
ATOM   9409   H H    . LEU B 1 90  ? 10.841  7.618   2.149   1.00 0.00 ? 90  LEU B H    2  
ATOM   9410   H HA   . LEU B 1 90  ? 10.331  10.352  2.725   1.00 0.00 ? 90  LEU B HA   2  
ATOM   9411   H HB2  . LEU B 1 90  ? 9.132   7.781   3.752   1.00 0.00 ? 90  LEU B HB2  2  
ATOM   9412   H HB3  . LEU B 1 90  ? 8.504   9.377   4.175   1.00 0.00 ? 90  LEU B HB3  2  
ATOM   9413   H HG   . LEU B 1 90  ? 8.920   8.497   1.306   1.00 0.00 ? 90  LEU B HG   2  
ATOM   9414   H HD11 . LEU B 1 90  ? 6.541   8.161   3.126   1.00 0.00 ? 90  LEU B HD11 2  
ATOM   9415   H HD12 . LEU B 1 90  ? 6.386   8.172   1.369   1.00 0.00 ? 90  LEU B HD12 2  
ATOM   9416   H HD13 . LEU B 1 90  ? 7.357   6.930   2.161   1.00 0.00 ? 90  LEU B HD13 2  
ATOM   9417   H HD21 . LEU B 1 90  ? 7.644   10.839  2.693   1.00 0.00 ? 90  LEU B HD21 2  
ATOM   9418   H HD22 . LEU B 1 90  ? 8.630   10.805  1.233   1.00 0.00 ? 90  LEU B HD22 2  
ATOM   9419   H HD23 . LEU B 1 90  ? 6.945   10.285  1.172   1.00 0.00 ? 90  LEU B HD23 2  
ATOM   9420   N N    . ILE B 1 91  ? 11.665  8.530   5.106   1.00 0.00 ? 91  ILE B N    2  
ATOM   9421   C CA   . ILE B 1 91  ? 12.391  8.618   6.368   1.00 0.00 ? 91  ILE B CA   2  
ATOM   9422   C C    . ILE B 1 91  ? 13.574  9.566   6.203   1.00 0.00 ? 91  ILE B C    2  
ATOM   9423   O O    . ILE B 1 91  ? 13.858  10.379  7.084   1.00 0.00 ? 91  ILE B O    2  
ATOM   9424   C CB   . ILE B 1 91  ? 12.835  7.219   6.822   1.00 0.00 ? 91  ILE B CB   2  
ATOM   9425   C CG1  . ILE B 1 91  ? 11.589  6.460   7.302   1.00 0.00 ? 91  ILE B CG1  2  
ATOM   9426   C CG2  . ILE B 1 91  ? 13.855  7.328   7.973   1.00 0.00 ? 91  ILE B CG2  2  
ATOM   9427   C CD1  . ILE B 1 91  ? 11.898  4.972   7.459   1.00 0.00 ? 91  ILE B CD1  2  
ATOM   9428   H H    . ILE B 1 91  ? 11.590  7.669   4.647   1.00 0.00 ? 91  ILE B H    2  
ATOM   9429   H HA   . ILE B 1 91  ? 11.733  9.033   7.115   1.00 0.00 ? 91  ILE B HA   2  
ATOM   9430   H HB   . ILE B 1 91  ? 13.283  6.692   5.991   1.00 0.00 ? 91  ILE B HB   2  
ATOM   9431   H HG12 . ILE B 1 91  ? 11.267  6.862   8.251   1.00 0.00 ? 91  ILE B HG12 2  
ATOM   9432   H HG13 . ILE B 1 91  ? 10.796  6.582   6.575   1.00 0.00 ? 91  ILE B HG13 2  
ATOM   9433   H HG21 . ILE B 1 91  ? 13.680  8.236   8.530   1.00 0.00 ? 91  ILE B HG21 2  
ATOM   9434   H HG22 . ILE B 1 91  ? 13.753  6.477   8.631   1.00 0.00 ? 91  ILE B HG22 2  
ATOM   9435   H HG23 . ILE B 1 91  ? 14.857  7.346   7.565   1.00 0.00 ? 91  ILE B HG23 2  
ATOM   9436   H HD11 . ILE B 1 91  ? 12.904  4.848   7.826   1.00 0.00 ? 91  ILE B HD11 2  
ATOM   9437   H HD12 . ILE B 1 91  ? 11.202  4.538   8.164   1.00 0.00 ? 91  ILE B HD12 2  
ATOM   9438   H HD13 . ILE B 1 91  ? 11.795  4.479   6.504   1.00 0.00 ? 91  ILE B HD13 2  
ATOM   9439   N N    . THR B 1 92  ? 14.234  9.501   5.048   1.00 0.00 ? 92  THR B N    2  
ATOM   9440   C CA   . THR B 1 92  ? 15.350  10.406  4.780   1.00 0.00 ? 92  THR B CA   2  
ATOM   9441   C C    . THR B 1 92  ? 14.860  11.848  4.876   1.00 0.00 ? 92  THR B C    2  
ATOM   9442   O O    . THR B 1 92  ? 15.493  12.692  5.513   1.00 0.00 ? 92  THR B O    2  
ATOM   9443   C CB   . THR B 1 92  ? 15.933  10.138  3.384   1.00 0.00 ? 92  THR B CB   2  
ATOM   9444   O OG1  . THR B 1 92  ? 16.586  8.881   3.377   1.00 0.00 ? 92  THR B OG1  2  
ATOM   9445   C CG2  . THR B 1 92  ? 16.936  11.232  3.005   1.00 0.00 ? 92  THR B CG2  2  
ATOM   9446   H H    . THR B 1 92  ? 13.949  8.861   4.363   1.00 0.00 ? 92  THR B H    2  
ATOM   9447   H HA   . THR B 1 92  ? 16.117  10.250  5.522   1.00 0.00 ? 92  THR B HA   2  
ATOM   9448   H HB   . THR B 1 92  ? 15.130  10.127  2.661   1.00 0.00 ? 92  THR B HB   2  
ATOM   9449   H HG1  . THR B 1 92  ? 15.958  8.229   3.066   1.00 0.00 ? 92  THR B HG1  2  
ATOM   9450   H HG21 . THR B 1 92  ? 17.394  11.635  3.897   1.00 0.00 ? 92  THR B HG21 2  
ATOM   9451   H HG22 . THR B 1 92  ? 17.701  10.813  2.367   1.00 0.00 ? 92  THR B HG22 2  
ATOM   9452   H HG23 . THR B 1 92  ? 16.424  12.024  2.477   1.00 0.00 ? 92  THR B HG23 2  
ATOM   9453   N N    . GLU B 1 93  ? 13.709  12.120  4.268   1.00 0.00 ? 93  GLU B N    2  
ATOM   9454   C CA   . GLU B 1 93  ? 13.128  13.460  4.323   1.00 0.00 ? 93  GLU B CA   2  
ATOM   9455   C C    . GLU B 1 93  ? 12.835  13.841  5.772   1.00 0.00 ? 93  GLU B C    2  
ATOM   9456   O O    . GLU B 1 93  ? 13.112  14.961  6.209   1.00 0.00 ? 93  GLU B O    2  
ATOM   9457   C CB   . GLU B 1 93  ? 11.832  13.502  3.509   1.00 0.00 ? 93  GLU B CB   2  
ATOM   9458   C CG   . GLU B 1 93  ? 12.129  13.140  2.051   1.00 0.00 ? 93  GLU B CG   2  
ATOM   9459   C CD   . GLU B 1 93  ? 12.859  14.284  1.351   1.00 0.00 ? 93  GLU B CD   2  
ATOM   9460   O OE1  . GLU B 1 93  ? 13.080  15.315  1.977   1.00 0.00 ? 93  GLU B OE1  2  
ATOM   9461   O OE2  . GLU B 1 93  ? 13.190  14.124  0.197   1.00 0.00 ? 93  GLU B OE2  2  
ATOM   9462   H H    . GLU B 1 93  ? 13.231  11.408  3.794   1.00 0.00 ? 93  GLU B H    2  
ATOM   9463   H HA   . GLU B 1 93  ? 13.830  14.168  3.908   1.00 0.00 ? 93  GLU B HA   2  
ATOM   9464   H HB2  . GLU B 1 93  ? 11.124  12.800  3.923   1.00 0.00 ? 93  GLU B HB2  2  
ATOM   9465   H HB3  . GLU B 1 93  ? 11.414  14.499  3.552   1.00 0.00 ? 93  GLU B HB3  2  
ATOM   9466   H HG2  . GLU B 1 93  ? 12.748  12.255  2.023   1.00 0.00 ? 93  GLU B HG2  2  
ATOM   9467   H HG3  . GLU B 1 93  ? 11.202  12.940  1.536   1.00 0.00 ? 93  GLU B HG3  2  
ATOM   9468   N N    . LEU B 1 94  ? 12.274  12.891  6.520   1.00 0.00 ? 94  LEU B N    2  
ATOM   9469   C CA   . LEU B 1 94  ? 11.956  13.126  7.928   1.00 0.00 ? 94  LEU B CA   2  
ATOM   9470   C C    . LEU B 1 94  ? 13.229  13.470  8.704   1.00 0.00 ? 94  LEU B C    2  
ATOM   9471   O O    . LEU B 1 94  ? 13.243  14.383  9.532   1.00 0.00 ? 94  LEU B O    2  
ATOM   9472   C CB   . LEU B 1 94  ? 11.286  11.884  8.544   1.00 0.00 ? 94  LEU B CB   2  
ATOM   9473   C CG   . LEU B 1 94  ? 9.836   11.747  8.035   1.00 0.00 ? 94  LEU B CG   2  
ATOM   9474   C CD1  . LEU B 1 94  ? 9.362   10.292  8.175   1.00 0.00 ? 94  LEU B CD1  2  
ATOM   9475   C CD2  . LEU B 1 94  ? 8.905   12.654  8.851   1.00 0.00 ? 94  LEU B CD2  2  
ATOM   9476   H H    . LEU B 1 94  ? 12.085  12.014  6.120   1.00 0.00 ? 94  LEU B H    2  
ATOM   9477   H HA   . LEU B 1 94  ? 11.279  13.962  7.997   1.00 0.00 ? 94  LEU B HA   2  
ATOM   9478   H HB2  . LEU B 1 94  ? 11.850  11.006  8.270   1.00 0.00 ? 94  LEU B HB2  2  
ATOM   9479   H HB3  . LEU B 1 94  ? 11.281  11.982  9.621   1.00 0.00 ? 94  LEU B HB3  2  
ATOM   9480   H HG   . LEU B 1 94  ? 9.796   12.036  6.992   1.00 0.00 ? 94  LEU B HG   2  
ATOM   9481   H HD11 . LEU B 1 94  ? 9.876   9.815   8.996   1.00 0.00 ? 94  LEU B HD11 2  
ATOM   9482   H HD12 . LEU B 1 94  ? 8.296   10.273  8.360   1.00 0.00 ? 94  LEU B HD12 2  
ATOM   9483   H HD13 . LEU B 1 94  ? 9.573   9.754   7.262   1.00 0.00 ? 94  LEU B HD13 2  
ATOM   9484   H HD21 . LEU B 1 94  ? 9.054   12.474  9.904   1.00 0.00 ? 94  LEU B HD21 2  
ATOM   9485   H HD22 . LEU B 1 94  ? 9.118   13.691  8.630   1.00 0.00 ? 94  LEU B HD22 2  
ATOM   9486   H HD23 . LEU B 1 94  ? 7.877   12.439  8.593   1.00 0.00 ? 94  LEU B HD23 2  
ATOM   9487   N N    . ILE B 1 95  ? 14.306  12.744  8.430   1.00 0.00 ? 95  ILE B N    2  
ATOM   9488   C CA   . ILE B 1 95  ? 15.575  13.008  9.104   1.00 0.00 ? 95  ILE B CA   2  
ATOM   9489   C C    . ILE B 1 95  ? 16.066  14.413  8.768   1.00 0.00 ? 95  ILE B C    2  
ATOM   9490   O O    . ILE B 1 95  ? 16.513  15.149  9.649   1.00 0.00 ? 95  ILE B O    2  
ATOM   9491   C CB   . ILE B 1 95  ? 16.620  11.965  8.700   1.00 0.00 ? 95  ILE B CB   2  
ATOM   9492   C CG1  . ILE B 1 95  ? 16.228  10.623  9.319   1.00 0.00 ? 95  ILE B CG1  2  
ATOM   9493   C CG2  . ILE B 1 95  ? 17.999  12.381  9.229   1.00 0.00 ? 95  ILE B CG2  2  
ATOM   9494   C CD1  . ILE B 1 95  ? 17.098  9.497   8.755   1.00 0.00 ? 95  ILE B CD1  2  
ATOM   9495   H H    . ILE B 1 95  ? 14.250  12.028  7.758   1.00 0.00 ? 95  ILE B H    2  
ATOM   9496   H HA   . ILE B 1 95  ? 15.420  12.947  10.172  1.00 0.00 ? 95  ILE B HA   2  
ATOM   9497   H HB   . ILE B 1 95  ? 16.656  11.877  7.623   1.00 0.00 ? 95  ILE B HB   2  
ATOM   9498   H HG12 . ILE B 1 95  ? 16.360  10.676  10.390  1.00 0.00 ? 95  ILE B HG12 2  
ATOM   9499   H HG13 . ILE B 1 95  ? 15.192  10.420  9.096   1.00 0.00 ? 95  ILE B HG13 2  
ATOM   9500   H HG21 . ILE B 1 95  ? 17.914  12.681  10.265  1.00 0.00 ? 95  ILE B HG21 2  
ATOM   9501   H HG22 . ILE B 1 95  ? 18.680  11.548  9.153   1.00 0.00 ? 95  ILE B HG22 2  
ATOM   9502   H HG23 . ILE B 1 95  ? 18.376  13.209  8.645   1.00 0.00 ? 95  ILE B HG23 2  
ATOM   9503   H HD11 . ILE B 1 95  ? 18.097  9.867   8.568   1.00 0.00 ? 95  ILE B HD11 2  
ATOM   9504   H HD12 . ILE B 1 95  ? 17.142  8.689   9.467   1.00 0.00 ? 95  ILE B HD12 2  
ATOM   9505   H HD13 . ILE B 1 95  ? 16.669  9.139   7.832   1.00 0.00 ? 95  ILE B HD13 2  
ATOM   9506   N N    . GLU B 1 96  ? 15.955  14.798  7.501   1.00 0.00 ? 96  GLU B N    2  
ATOM   9507   C CA   . GLU B 1 96  ? 16.375  16.136  7.092   1.00 0.00 ? 96  GLU B CA   2  
ATOM   9508   C C    . GLU B 1 96  ? 15.583  17.183  7.876   1.00 0.00 ? 96  GLU B C    2  
ATOM   9509   O O    . GLU B 1 96  ? 16.122  18.206  8.299   1.00 0.00 ? 96  GLU B O    2  
ATOM   9510   C CB   . GLU B 1 96  ? 16.157  16.321  5.585   1.00 0.00 ? 96  GLU B CB   2  
ATOM   9511   C CG   . GLU B 1 96  ? 16.560  17.755  5.153   1.00 0.00 ? 96  GLU B CG   2  
ATOM   9512   C CD   . GLU B 1 96  ? 17.589  17.728  4.019   1.00 0.00 ? 96  GLU B CD   2  
ATOM   9513   O OE1  . GLU B 1 96  ? 17.592  16.774  3.260   1.00 0.00 ? 96  GLU B OE1  2  
ATOM   9514   O OE2  . GLU B 1 96  ? 18.331  18.687  3.904   1.00 0.00 ? 96  GLU B OE2  2  
ATOM   9515   H H    . GLU B 1 96  ? 15.575  14.181  6.837   1.00 0.00 ? 96  GLU B H    2  
ATOM   9516   H HA   . GLU B 1 96  ? 17.425  16.257  7.314   1.00 0.00 ? 96  GLU B HA   2  
ATOM   9517   H HB2  . GLU B 1 96  ? 16.758  15.596  5.055   1.00 0.00 ? 96  GLU B HB2  2  
ATOM   9518   H HB3  . GLU B 1 96  ? 15.116  16.155  5.356   1.00 0.00 ? 96  GLU B HB3  2  
ATOM   9519   H HG2  . GLU B 1 96  ? 15.685  18.284  4.814   1.00 0.00 ? 96  GLU B HG2  2  
ATOM   9520   H HG3  . GLU B 1 96  ? 16.985  18.282  5.995   1.00 0.00 ? 96  GLU B HG3  2  
ATOM   9521   N N    . LEU B 1 97  ? 14.297  16.912  8.090   1.00 0.00 ? 97  LEU B N    2  
ATOM   9522   C CA   . LEU B 1 97  ? 13.454  17.836  8.850   1.00 0.00 ? 97  LEU B CA   2  
ATOM   9523   C C    . LEU B 1 97  ? 13.978  17.958  10.281  1.00 0.00 ? 97  LEU B C    2  
ATOM   9524   O O    . LEU B 1 97  ? 14.047  19.055  10.834  1.00 0.00 ? 97  LEU B O    2  
ATOM   9525   C CB   . LEU B 1 97  ? 11.998  17.358  8.860   1.00 0.00 ? 97  LEU B CB   2  
ATOM   9526   C CG   . LEU B 1 97  ? 11.310  17.706  7.532   1.00 0.00 ? 97  LEU B CG   2  
ATOM   9527   C CD1  . LEU B 1 97  ? 9.993   16.938  7.439   1.00 0.00 ? 97  LEU B CD1  2  
ATOM   9528   C CD2  . LEU B 1 97  ? 11.013  19.212  7.454   1.00 0.00 ? 97  LEU B CD2  2  
ATOM   9529   H H    . LEU B 1 97  ? 13.913  16.075  7.745   1.00 0.00 ? 97  LEU B H    2  
ATOM   9530   H HA   . LEU B 1 97  ? 13.502  18.810  8.388   1.00 0.00 ? 97  LEU B HA   2  
ATOM   9531   H HB2  . LEU B 1 97  ? 11.980  16.286  9.002   1.00 0.00 ? 97  LEU B HB2  2  
ATOM   9532   H HB3  . LEU B 1 97  ? 11.470  17.834  9.674   1.00 0.00 ? 97  LEU B HB3  2  
ATOM   9533   H HG   . LEU B 1 97  ? 11.950  17.418  6.709   1.00 0.00 ? 97  LEU B HG   2  
ATOM   9534   H HD11 . LEU B 1 97  ? 9.421   17.094  8.342   1.00 0.00 ? 97  LEU B HD11 2  
ATOM   9535   H HD12 . LEU B 1 97  ? 9.427   17.294  6.592   1.00 0.00 ? 97  LEU B HD12 2  
ATOM   9536   H HD13 . LEU B 1 97  ? 10.199  15.885  7.320   1.00 0.00 ? 97  LEU B HD13 2  
ATOM   9537   H HD21 . LEU B 1 97  ? 10.710  19.573  8.425   1.00 0.00 ? 97  LEU B HD21 2  
ATOM   9538   H HD22 . LEU B 1 97  ? 11.898  19.741  7.134   1.00 0.00 ? 97  LEU B HD22 2  
ATOM   9539   H HD23 . LEU B 1 97  ? 10.216  19.385  6.743   1.00 0.00 ? 97  LEU B HD23 2  
ATOM   9540   N N    . HIS B 1 98  ? 14.373  16.831  10.871  1.00 0.00 ? 98  HIS B N    2  
ATOM   9541   C CA   . HIS B 1 98  ? 14.918  16.859  12.224  1.00 0.00 ? 98  HIS B CA   2  
ATOM   9542   C C    . HIS B 1 98  ? 16.128  17.786  12.260  1.00 0.00 ? 98  HIS B C    2  
ATOM   9543   O O    . HIS B 1 98  ? 16.314  18.543  13.206  1.00 0.00 ? 98  HIS B O    2  
ATOM   9544   C CB   . HIS B 1 98  ? 15.323  15.452  12.671  1.00 0.00 ? 98  HIS B CB   2  
ATOM   9545   C CG   . HIS B 1 98  ? 14.091  14.634  12.936  1.00 0.00 ? 98  HIS B CG   2  
ATOM   9546   N ND1  . HIS B 1 98  ? 13.444  13.931  11.937  1.00 0.00 ? 98  HIS B ND1  2  
ATOM   9547   C CD2  . HIS B 1 98  ? 13.368  14.409  14.080  1.00 0.00 ? 98  HIS B CD2  2  
ATOM   9548   C CE1  . HIS B 1 98  ? 12.380  13.321  12.488  1.00 0.00 ? 98  HIS B CE1  2  
ATOM   9549   N NE2  . HIS B 1 98  ? 12.287  13.578  13.792  1.00 0.00 ? 98  HIS B NE2  2  
ATOM   9550   H H    . HIS B 1 98  ? 14.320  15.982  10.382  1.00 0.00 ? 98  HIS B H    2  
ATOM   9551   H HA   . HIS B 1 98  ? 14.166  17.242  12.898  1.00 0.00 ? 98  HIS B HA   2  
ATOM   9552   H HB2  . HIS B 1 98  ? 15.911  14.982  11.895  1.00 0.00 ? 98  HIS B HB2  2  
ATOM   9553   H HB3  . HIS B 1 98  ? 15.912  15.520  13.576  1.00 0.00 ? 98  HIS B HB3  2  
ATOM   9554   H HD1  . HIS B 1 98  ? 13.708  13.895  10.985  1.00 0.00 ? 98  HIS B HD1  2  
ATOM   9555   H HD2  . HIS B 1 98  ? 13.605  14.814  15.050  1.00 0.00 ? 98  HIS B HD2  2  
ATOM   9556   H HE1  . HIS B 1 98  ? 11.682  12.704  11.939  1.00 0.00 ? 98  HIS B HE1  2  
ATOM   9557   H HE2  . HIS B 1 98  ? 11.599  13.255  14.410  1.00 0.00 ? 98  HIS B HE2  2  
ATOM   9558   N N    . GLU B 1 99  ? 16.929  17.734  11.199  1.00 0.00 ? 99  GLU B N    2  
ATOM   9559   C CA   . GLU B 1 99  ? 18.104  18.590  11.107  1.00 0.00 ? 99  GLU B CA   2  
ATOM   9560   C C    . GLU B 1 99  ? 17.682  20.055  11.036  1.00 0.00 ? 99  GLU B C    2  
ATOM   9561   O O    . GLU B 1 99  ? 18.275  20.918  11.686  1.00 0.00 ? 99  GLU B O    2  
ATOM   9562   C CB   . GLU B 1 99  ? 18.935  18.215  9.880   1.00 0.00 ? 99  GLU B CB   2  
ATOM   9563   C CG   . GLU B 1 99  ? 20.228  19.039  9.867   1.00 0.00 ? 99  GLU B CG   2  
ATOM   9564   C CD   . GLU B 1 99  ? 21.115  18.618  8.698   1.00 0.00 ? 99  GLU B CD   2  
ATOM   9565   O OE1  . GLU B 1 99  ? 20.635  17.898  7.839   1.00 0.00 ? 99  GLU B OE1  2  
ATOM   9566   O OE2  . GLU B 1 99  ? 22.265  19.017  8.682   1.00 0.00 ? 99  GLU B OE2  2  
ATOM   9567   H H    . GLU B 1 99  ? 16.718  17.123  10.462  1.00 0.00 ? 99  GLU B H    2  
ATOM   9568   H HA   . GLU B 1 99  ? 18.707  18.451  11.990  1.00 0.00 ? 99  GLU B HA   2  
ATOM   9569   H HB2  . GLU B 1 99  ? 19.182  17.163  9.920   1.00 0.00 ? 99  GLU B HB2  2  
ATOM   9570   H HB3  . GLU B 1 99  ? 18.374  18.420  8.980   1.00 0.00 ? 99  GLU B HB3  2  
ATOM   9571   H HG2  . GLU B 1 99  ? 19.986  20.087  9.770   1.00 0.00 ? 99  GLU B HG2  2  
ATOM   9572   H HG3  . GLU B 1 99  ? 20.763  18.883  10.792  1.00 0.00 ? 99  GLU B HG3  2  
ATOM   9573   N N    . LYS B 1 100 ? 16.636  20.339  10.263  1.00 0.00 ? 100 LYS B N    2  
ATOM   9574   C CA   . LYS B 1 100 ? 16.150  21.711  10.156  1.00 0.00 ? 100 LYS B CA   2  
ATOM   9575   C C    . LYS B 1 100 ? 15.572  22.160  11.499  1.00 0.00 ? 100 LYS B C    2  
ATOM   9576   O O    . LYS B 1 100 ? 15.720  23.318  11.887  1.00 0.00 ? 100 LYS B O    2  
ATOM   9577   C CB   . LYS B 1 100 ? 15.110  21.831  9.039   1.00 0.00 ? 100 LYS B CB   2  
ATOM   9578   C CG   . LYS B 1 100 ? 15.811  21.645  7.689   1.00 0.00 ? 100 LYS B CG   2  
ATOM   9579   C CD   . LYS B 1 100 ? 14.814  21.873  6.549   1.00 0.00 ? 100 LYS B CD   2  
ATOM   9580   C CE   . LYS B 1 100 ? 15.534  21.700  5.208   1.00 0.00 ? 100 LYS B CE   2  
ATOM   9581   N NZ   . LYS B 1 100 ? 14.578  21.987  4.098   1.00 0.00 ? 100 LYS B NZ   2  
ATOM   9582   H H    . LYS B 1 100 ? 16.183  19.619  9.776   1.00 0.00 ? 100 LYS B H    2  
ATOM   9583   H HA   . LYS B 1 100 ? 16.986  22.354  9.920   1.00 0.00 ? 100 LYS B HA   2  
ATOM   9584   H HB2  . LYS B 1 100 ? 14.350  21.071  9.167   1.00 0.00 ? 100 LYS B HB2  2  
ATOM   9585   H HB3  . LYS B 1 100 ? 14.653  22.809  9.076   1.00 0.00 ? 100 LYS B HB3  2  
ATOM   9586   H HG2  . LYS B 1 100 ? 16.624  22.356  7.608   1.00 0.00 ? 100 LYS B HG2  2  
ATOM   9587   H HG3  . LYS B 1 100 ? 16.207  20.640  7.626   1.00 0.00 ? 100 LYS B HG3  2  
ATOM   9588   H HD2  . LYS B 1 100 ? 14.012  21.154  6.627   1.00 0.00 ? 100 LYS B HD2  2  
ATOM   9589   H HD3  . LYS B 1 100 ? 14.412  22.873  6.617   1.00 0.00 ? 100 LYS B HD3  2  
ATOM   9590   H HE2  . LYS B 1 100 ? 16.369  22.388  5.156   1.00 0.00 ? 100 LYS B HE2  2  
ATOM   9591   H HE3  . LYS B 1 100 ? 15.900  20.685  5.122   1.00 0.00 ? 100 LYS B HE3  2  
ATOM   9592   H HZ1  . LYS B 1 100 ? 14.079  22.882  4.289   1.00 0.00 ? 100 LYS B HZ1  2  
ATOM   9593   H HZ2  . LYS B 1 100 ? 15.103  22.072  3.205   1.00 0.00 ? 100 LYS B HZ2  2  
ATOM   9594   H HZ3  . LYS B 1 100 ? 13.891  21.213  4.027   1.00 0.00 ? 100 LYS B HZ3  2  
ATOM   9595   N N    . LEU B 1 101 ? 14.952  21.229  12.229  1.00 0.00 ? 101 LEU B N    2  
ATOM   9596   C CA   . LEU B 1 101 ? 14.401  21.546  13.552  1.00 0.00 ? 101 LEU B CA   2  
ATOM   9597   C C    . LEU B 1 101 ? 15.534  21.929  14.505  1.00 0.00 ? 101 LEU B C    2  
ATOM   9598   O O    . LEU B 1 101 ? 15.305  22.166  15.694  1.00 0.00 ? 101 LEU B O    2  
ATOM   9599   C CB   . LEU B 1 101 ? 13.646  20.339  14.132  1.00 0.00 ? 101 LEU B CB   2  
ATOM   9600   C CG   . LEU B 1 101 ? 12.206  20.291  13.602  1.00 0.00 ? 101 LEU B CG   2  
ATOM   9601   C CD1  . LEU B 1 101 ? 11.625  18.893  13.838  1.00 0.00 ? 101 LEU B CD1  2  
ATOM   9602   C CD2  . LEU B 1 101 ? 11.335  21.320  14.336  1.00 0.00 ? 101 LEU B CD2  2  
ATOM   9603   H H    . LEU B 1 101 ? 14.886  20.312  11.886  1.00 0.00 ? 101 LEU B H    2  
ATOM   9604   H HA   . LEU B 1 101 ? 13.726  22.382  13.466  1.00 0.00 ? 101 LEU B HA   2  
ATOM   9605   H HB2  . LEU B 1 101 ? 14.161  19.431  13.848  1.00 0.00 ? 101 LEU B HB2  2  
ATOM   9606   H HB3  . LEU B 1 101 ? 13.629  20.412  15.210  1.00 0.00 ? 101 LEU B HB3  2  
ATOM   9607   H HG   . LEU B 1 101 ? 12.209  20.505  12.542  1.00 0.00 ? 101 LEU B HG   2  
ATOM   9608   H HD11 . LEU B 1 101 ? 11.941  18.528  14.805  1.00 0.00 ? 101 LEU B HD11 2  
ATOM   9609   H HD12 . LEU B 1 101 ? 10.547  18.944  13.812  1.00 0.00 ? 101 LEU B HD12 2  
ATOM   9610   H HD13 . LEU B 1 101 ? 11.973  18.222  13.068  1.00 0.00 ? 101 LEU B HD13 2  
ATOM   9611   H HD21 . LEU B 1 101 ? 11.556  21.298  15.395  1.00 0.00 ? 101 LEU B HD21 2  
ATOM   9612   H HD22 . LEU B 1 101 ? 11.531  22.308  13.947  1.00 0.00 ? 101 LEU B HD22 2  
ATOM   9613   H HD23 . LEU B 1 101 ? 10.293  21.076  14.186  1.00 0.00 ? 101 LEU B HD23 2  
ATOM   9614   N N    . LYS B 1 102 ? 16.755  21.978  13.977  1.00 0.00 ? 102 LYS B N    2  
ATOM   9615   C CA   . LYS B 1 102 ? 17.935  22.325  14.773  1.00 0.00 ? 102 LYS B CA   2  
ATOM   9616   C C    . LYS B 1 102 ? 18.408  21.115  15.565  1.00 0.00 ? 102 LYS B C    2  
ATOM   9617   O O    . LYS B 1 102 ? 19.538  20.690  15.402  1.00 0.00 ? 102 LYS B O    2  
ATOM   9618   C CB   . LYS B 1 102 ? 17.604  23.486  15.734  1.00 0.00 ? 102 LYS B CB   2  
ATOM   9619   C CG   . LYS B 1 102 ? 18.849  24.316  16.170  1.00 0.00 ? 102 LYS B CG   2  
ATOM   9620   C CD   . LYS B 1 102 ? 20.156  23.489  16.304  1.00 0.00 ? 102 LYS B CD   2  
ATOM   9621   C CE   . LYS B 1 102 ? 20.175  22.610  17.576  1.00 0.00 ? 102 LYS B CE   2  
ATOM   9622   N NZ   . LYS B 1 102 ? 18.801  22.442  18.125  1.00 0.00 ? 102 LYS B NZ   2  
ATOM   9623   H H    . LYS B 1 102 ? 16.871  21.767  13.027  1.00 0.00 ? 102 LYS B H    2  
ATOM   9624   H HA   . LYS B 1 102 ? 18.721  22.633  14.098  1.00 0.00 ? 102 LYS B HA   2  
ATOM   9625   H HB2  . LYS B 1 102 ? 16.911  24.152  15.233  1.00 0.00 ? 102 LYS B HB2  2  
ATOM   9626   H HB3  . LYS B 1 102 ? 17.117  23.089  16.610  1.00 0.00 ? 102 LYS B HB3  2  
ATOM   9627   H HG2  . LYS B 1 102 ? 19.014  25.095  15.440  1.00 0.00 ? 102 LYS B HG2  2  
ATOM   9628   H HG3  . LYS B 1 102 ? 18.632  24.781  17.119  1.00 0.00 ? 102 LYS B HG3  2  
ATOM   9629   H HD2  . LYS B 1 102 ? 20.293  22.866  15.431  1.00 0.00 ? 102 LYS B HD2  2  
ATOM   9630   H HD3  . LYS B 1 102 ? 20.987  24.186  16.364  1.00 0.00 ? 102 LYS B HD3  2  
ATOM   9631   H HE2  . LYS B 1 102 ? 20.583  21.637  17.332  1.00 0.00 ? 102 LYS B HE2  2  
ATOM   9632   H HE3  . LYS B 1 102 ? 20.806  23.078  18.323  1.00 0.00 ? 102 LYS B HE3  2  
ATOM   9633   H HZ1  . LYS B 1 102 ? 18.190  22.031  17.394  1.00 0.00 ? 102 LYS B HZ1  2  
ATOM   9634   H HZ2  . LYS B 1 102 ? 18.835  21.799  18.942  1.00 0.00 ? 102 LYS B HZ2  2  
ATOM   9635   H HZ3  . LYS B 1 102 ? 18.424  23.360  18.420  1.00 0.00 ? 102 LYS B HZ3  2  
ATOM   9636   N N    . ALA B 1 103 ? 17.530  20.609  16.443  1.00 0.00 ? 103 ALA B N    2  
ATOM   9637   C CA   . ALA B 1 103 ? 17.847  19.462  17.302  1.00 0.00 ? 103 ALA B CA   2  
ATOM   9638   C C    . ALA B 1 103 ? 18.728  18.439  16.587  1.00 0.00 ? 103 ALA B C    2  
ATOM   9639   O O    . ALA B 1 103 ? 18.191  17.457  16.103  1.00 0.00 ? 103 ALA B O    2  
ATOM   9640   C CB   . ALA B 1 103 ? 16.550  18.786  17.759  1.00 0.00 ? 103 ALA B CB   2  
ATOM   9641   O OXT  . ALA B 1 103 ? 19.931  18.638  16.560  1.00 0.00 ? 103 ALA B OXT  2  
ATOM   9642   H H    . ALA B 1 103 ? 16.647  21.032  16.521  1.00 0.00 ? 103 ALA B H    2  
ATOM   9643   H HA   . ALA B 1 103 ? 18.372  19.816  18.174  1.00 0.00 ? 103 ALA B HA   2  
ATOM   9644   H HB1  . ALA B 1 103 ? 15.889  18.669  16.912  1.00 0.00 ? 103 ALA B HB1  2  
ATOM   9645   H HB2  . ALA B 1 103 ? 16.783  17.813  18.169  1.00 0.00 ? 103 ALA B HB2  2  
ATOM   9646   H HB3  . ALA B 1 103 ? 16.070  19.389  18.511  1.00 0.00 ? 103 ALA B HB3  2  
ATOM   9647   N N    . ALA C 1 1   ? -1.769  -7.984  -21.649 1.00 0.00 ? 1   ALA C N    2  
ATOM   9648   C CA   . ALA C 1 1   ? -2.260  -8.153  -23.047 1.00 0.00 ? 1   ALA C CA   2  
ATOM   9649   C C    . ALA C 1 1   ? -2.069  -6.838  -23.798 1.00 0.00 ? 1   ALA C C    2  
ATOM   9650   O O    . ALA C 1 1   ? -1.758  -5.824  -23.185 1.00 0.00 ? 1   ALA C O    2  
ATOM   9651   C CB   . ALA C 1 1   ? -3.744  -8.558  -23.017 1.00 0.00 ? 1   ALA C CB   2  
ATOM   9652   H H1   . ALA C 1 1   ? -1.657  -6.970  -21.441 1.00 0.00 ? 1   ALA C H1   2  
ATOM   9653   H H2   . ALA C 1 1   ? -2.455  -8.403  -20.988 1.00 0.00 ? 1   ALA C H2   2  
ATOM   9654   H H3   . ALA C 1 1   ? -0.848  -8.458  -21.544 1.00 0.00 ? 1   ALA C H3   2  
ATOM   9655   H HA   . ALA C 1 1   ? -1.685  -8.924  -23.540 1.00 0.00 ? 1   ALA C HA   2  
ATOM   9656   H HB1  . ALA C 1 1   ? -3.824  -9.636  -23.066 1.00 0.00 ? 1   ALA C HB1  2  
ATOM   9657   H HB2  . ALA C 1 1   ? -4.259  -8.123  -23.862 1.00 0.00 ? 1   ALA C HB2  2  
ATOM   9658   H HB3  . ALA C 1 1   ? -4.197  -8.205  -22.103 1.00 0.00 ? 1   ALA C HB3  2  
ATOM   9659   N N    . GLU C 1 2   ? -2.260  -6.879  -25.115 1.00 0.00 ? 2   GLU C N    2  
ATOM   9660   C CA   . GLU C 1 2   ? -2.102  -5.704  -25.984 1.00 0.00 ? 2   GLU C CA   2  
ATOM   9661   C C    . GLU C 1 2   ? -2.285  -4.378  -25.234 1.00 0.00 ? 2   GLU C C    2  
ATOM   9662   O O    . GLU C 1 2   ? -1.315  -3.770  -24.782 1.00 0.00 ? 2   GLU C O    2  
ATOM   9663   C CB   . GLU C 1 2   ? -3.116  -5.779  -27.131 1.00 0.00 ? 2   GLU C CB   2  
ATOM   9664   C CG   . GLU C 1 2   ? -2.898  -7.067  -27.959 1.00 0.00 ? 2   GLU C CG   2  
ATOM   9665   C CD   . GLU C 1 2   ? -4.215  -7.815  -28.159 1.00 0.00 ? 2   GLU C CD   2  
ATOM   9666   O OE1  . GLU C 1 2   ? -5.224  -7.164  -28.355 1.00 0.00 ? 2   GLU C OE1  2  
ATOM   9667   O OE2  . GLU C 1 2   ? -4.191  -9.031  -28.113 1.00 0.00 ? 2   GLU C OE2  2  
ATOM   9668   H H    . GLU C 1 2   ? -2.513  -7.730  -25.528 1.00 0.00 ? 2   GLU C H    2  
ATOM   9669   H HA   . GLU C 1 2   ? -1.108  -5.720  -26.406 1.00 0.00 ? 2   GLU C HA   2  
ATOM   9670   H HB2  . GLU C 1 2   ? -4.116  -5.777  -26.722 1.00 0.00 ? 2   GLU C HB2  2  
ATOM   9671   H HB3  . GLU C 1 2   ? -2.993  -4.917  -27.771 1.00 0.00 ? 2   GLU C HB3  2  
ATOM   9672   H HG2  . GLU C 1 2   ? -2.497  -6.808  -28.928 1.00 0.00 ? 2   GLU C HG2  2  
ATOM   9673   H HG3  . GLU C 1 2   ? -2.201  -7.715  -27.451 1.00 0.00 ? 2   GLU C HG3  2  
ATOM   9674   N N    . GLU C 1 3   ? -3.528  -3.936  -25.116 1.00 0.00 ? 3   GLU C N    2  
ATOM   9675   C CA   . GLU C 1 3   ? -3.821  -2.677  -24.437 1.00 0.00 ? 3   GLU C CA   2  
ATOM   9676   C C    . GLU C 1 3   ? -3.499  -2.763  -22.948 1.00 0.00 ? 3   GLU C C    2  
ATOM   9677   O O    . GLU C 1 3   ? -2.679  -2.005  -22.439 1.00 0.00 ? 3   GLU C O    2  
ATOM   9678   C CB   . GLU C 1 3   ? -5.296  -2.316  -24.639 1.00 0.00 ? 3   GLU C CB   2  
ATOM   9679   C CG   . GLU C 1 3   ? -5.494  -1.717  -26.040 1.00 0.00 ? 3   GLU C CG   2  
ATOM   9680   C CD   . GLU C 1 3   ? -6.945  -1.869  -26.487 1.00 0.00 ? 3   GLU C CD   2  
ATOM   9681   O OE1  . GLU C 1 3   ? -7.815  -1.398  -25.778 1.00 0.00 ? 3   GLU C OE1  2  
ATOM   9682   O OE2  . GLU C 1 3   ? -7.160  -2.449  -27.536 1.00 0.00 ? 3   GLU C OE2  2  
ATOM   9683   H H    . GLU C 1 3   ? -4.264  -4.454  -25.503 1.00 0.00 ? 3   GLU C H    2  
ATOM   9684   H HA   . GLU C 1 3   ? -3.210  -1.901  -24.874 1.00 0.00 ? 3   GLU C HA   2  
ATOM   9685   H HB2  . GLU C 1 3   ? -5.901  -3.208  -24.541 1.00 0.00 ? 3   GLU C HB2  2  
ATOM   9686   H HB3  . GLU C 1 3   ? -5.598  -1.594  -23.894 1.00 0.00 ? 3   GLU C HB3  2  
ATOM   9687   H HG2  . GLU C 1 3   ? -5.240  -0.667  -26.020 1.00 0.00 ? 3   GLU C HG2  2  
ATOM   9688   H HG3  . GLU C 1 3   ? -4.851  -2.223  -26.745 1.00 0.00 ? 3   GLU C HG3  2  
ATOM   9689   N N    . LEU C 1 4   ? -4.156  -3.677  -22.246 1.00 0.00 ? 4   LEU C N    2  
ATOM   9690   C CA   . LEU C 1 4   ? -3.917  -3.826  -20.812 1.00 0.00 ? 4   LEU C CA   2  
ATOM   9691   C C    . LEU C 1 4   ? -2.427  -3.726  -20.472 1.00 0.00 ? 4   LEU C C    2  
ATOM   9692   O O    . LEU C 1 4   ? -2.047  -3.074  -19.505 1.00 0.00 ? 4   LEU C O    2  
ATOM   9693   C CB   . LEU C 1 4   ? -4.451  -5.173  -20.302 1.00 0.00 ? 4   LEU C CB   2  
ATOM   9694   C CG   . LEU C 1 4   ? -5.943  -5.320  -20.622 1.00 0.00 ? 4   LEU C CG   2  
ATOM   9695   C CD1  . LEU C 1 4   ? -6.453  -6.666  -20.084 1.00 0.00 ? 4   LEU C CD1  2  
ATOM   9696   C CD2  . LEU C 1 4   ? -6.736  -4.169  -19.978 1.00 0.00 ? 4   LEU C CD2  2  
ATOM   9697   H H    . LEU C 1 4   ? -4.806  -4.256  -22.695 1.00 0.00 ? 4   LEU C H    2  
ATOM   9698   H HA   . LEU C 1 4   ? -4.437  -3.031  -20.303 1.00 0.00 ? 4   LEU C HA   2  
ATOM   9699   H HB2  . LEU C 1 4   ? -3.903  -5.974  -20.775 1.00 0.00 ? 4   LEU C HB2  2  
ATOM   9700   H HB3  . LEU C 1 4   ? -4.305  -5.227  -19.230 1.00 0.00 ? 4   LEU C HB3  2  
ATOM   9701   H HG   . LEU C 1 4   ? -6.080  -5.294  -21.693 1.00 0.00 ? 4   LEU C HG   2  
ATOM   9702   H HD11 . LEU C 1 4   ? -5.658  -7.397  -20.117 1.00 0.00 ? 4   LEU C HD11 2  
ATOM   9703   H HD12 . LEU C 1 4   ? -6.790  -6.551  -19.064 1.00 0.00 ? 4   LEU C HD12 2  
ATOM   9704   H HD13 . LEU C 1 4   ? -7.278  -7.008  -20.696 1.00 0.00 ? 4   LEU C HD13 2  
ATOM   9705   H HD21 . LEU C 1 4   ? -6.294  -3.902  -19.029 1.00 0.00 ? 4   LEU C HD21 2  
ATOM   9706   H HD22 . LEU C 1 4   ? -6.719  -3.310  -20.634 1.00 0.00 ? 4   LEU C HD22 2  
ATOM   9707   H HD23 . LEU C 1 4   ? -7.761  -4.478  -19.824 1.00 0.00 ? 4   LEU C HD23 2  
ATOM   9708   N N    . GLU C 1 5   ? -1.591  -4.378  -21.271 1.00 0.00 ? 5   GLU C N    2  
ATOM   9709   C CA   . GLU C 1 5   ? -0.150  -4.361  -21.034 1.00 0.00 ? 5   GLU C CA   2  
ATOM   9710   C C    . GLU C 1 5   ? 0.433   -2.981  -21.328 1.00 0.00 ? 5   GLU C C    2  
ATOM   9711   O O    . GLU C 1 5   ? 1.205   -2.435  -20.533 1.00 0.00 ? 5   GLU C O    2  
ATOM   9712   C CB   . GLU C 1 5   ? 0.544   -5.411  -21.913 1.00 0.00 ? 5   GLU C CB   2  
ATOM   9713   C CG   . GLU C 1 5   ? 2.039   -5.455  -21.578 1.00 0.00 ? 5   GLU C CG   2  
ATOM   9714   C CD   . GLU C 1 5   ? 2.734   -6.529  -22.411 1.00 0.00 ? 5   GLU C CD   2  
ATOM   9715   O OE1  . GLU C 1 5   ? 2.117   -7.019  -23.343 1.00 0.00 ? 5   GLU C OE1  2  
ATOM   9716   O OE2  . GLU C 1 5   ? 3.872   -6.847  -22.104 1.00 0.00 ? 5   GLU C OE2  2  
ATOM   9717   H H    . GLU C 1 5   ? -1.945  -4.880  -22.036 1.00 0.00 ? 5   GLU C H    2  
ATOM   9718   H HA   . GLU C 1 5   ? 0.041   -4.604  -20.001 1.00 0.00 ? 5   GLU C HA   2  
ATOM   9719   H HB2  . GLU C 1 5   ? 0.105   -6.382  -21.731 1.00 0.00 ? 5   GLU C HB2  2  
ATOM   9720   H HB3  . GLU C 1 5   ? 0.420   -5.149  -22.954 1.00 0.00 ? 5   GLU C HB3  2  
ATOM   9721   H HG2  . GLU C 1 5   ? 2.482   -4.495  -21.795 1.00 0.00 ? 5   GLU C HG2  2  
ATOM   9722   H HG3  . GLU C 1 5   ? 2.166   -5.679  -20.530 1.00 0.00 ? 5   GLU C HG3  2  
ATOM   9723   N N    . GLU C 1 6   ? 0.039   -2.413  -22.460 1.00 0.00 ? 6   GLU C N    2  
ATOM   9724   C CA   . GLU C 1 6   ? 0.509   -1.088  -22.839 1.00 0.00 ? 6   GLU C CA   2  
ATOM   9725   C C    . GLU C 1 6   ? -0.072  -0.047  -21.883 1.00 0.00 ? 6   GLU C C    2  
ATOM   9726   O O    . GLU C 1 6   ? 0.579   0.945   -21.541 1.00 0.00 ? 6   GLU C O    2  
ATOM   9727   C CB   . GLU C 1 6   ? 0.088   -0.792  -24.285 1.00 0.00 ? 6   GLU C CB   2  
ATOM   9728   C CG   . GLU C 1 6   ? 1.036   0.236   -24.913 1.00 0.00 ? 6   GLU C CG   2  
ATOM   9729   C CD   . GLU C 1 6   ? 0.846   0.254   -26.427 1.00 0.00 ? 6   GLU C CD   2  
ATOM   9730   O OE1  . GLU C 1 6   ? -0.188  -0.208  -26.881 1.00 0.00 ? 6   GLU C OE1  2  
ATOM   9731   O OE2  . GLU C 1 6   ? 1.735   0.736   -27.109 1.00 0.00 ? 6   GLU C OE2  2  
ATOM   9732   H H    . GLU C 1 6   ? -0.591  -2.887  -23.044 1.00 0.00 ? 6   GLU C H    2  
ATOM   9733   H HA   . GLU C 1 6   ? 1.585   -1.062  -22.776 1.00 0.00 ? 6   GLU C HA   2  
ATOM   9734   H HB2  . GLU C 1 6   ? 0.121   -1.707  -24.860 1.00 0.00 ? 6   GLU C HB2  2  
ATOM   9735   H HB3  . GLU C 1 6   ? -0.919  -0.402  -24.292 1.00 0.00 ? 6   GLU C HB3  2  
ATOM   9736   H HG2  . GLU C 1 6   ? 0.815   1.216   -24.515 1.00 0.00 ? 6   GLU C HG2  2  
ATOM   9737   H HG3  . GLU C 1 6   ? 2.059   -0.021  -24.687 1.00 0.00 ? 6   GLU C HG3  2  
ATOM   9738   N N    . VAL C 1 7   ? -1.296  -0.304  -21.431 1.00 0.00 ? 7   VAL C N    2  
ATOM   9739   C CA   . VAL C 1 7   ? -1.969  0.587   -20.492 1.00 0.00 ? 7   VAL C CA   2  
ATOM   9740   C C    . VAL C 1 7   ? -1.226  0.587   -19.153 1.00 0.00 ? 7   VAL C C    2  
ATOM   9741   O O    . VAL C 1 7   ? -1.018  1.639   -18.543 1.00 0.00 ? 7   VAL C O    2  
ATOM   9742   C CB   . VAL C 1 7   ? -3.422  0.130   -20.294 1.00 0.00 ? 7   VAL C CB   2  
ATOM   9743   C CG1  . VAL C 1 7   ? -4.063  0.921   -19.149 1.00 0.00 ? 7   VAL C CG1  2  
ATOM   9744   C CG2  . VAL C 1 7   ? -4.215  0.373   -21.586 1.00 0.00 ? 7   VAL C CG2  2  
ATOM   9745   H H    . VAL C 1 7   ? -1.753  -1.124  -21.729 1.00 0.00 ? 7   VAL C H    2  
ATOM   9746   H HA   . VAL C 1 7   ? -1.966  1.589   -20.891 1.00 0.00 ? 7   VAL C HA   2  
ATOM   9747   H HB   . VAL C 1 7   ? -3.435  -0.924  -20.056 1.00 0.00 ? 7   VAL C HB   2  
ATOM   9748   H HG11 . VAL C 1 7   ? -3.801  1.965   -19.239 1.00 0.00 ? 7   VAL C HG11 2  
ATOM   9749   H HG12 . VAL C 1 7   ? -5.137  0.814   -19.197 1.00 0.00 ? 7   VAL C HG12 2  
ATOM   9750   H HG13 . VAL C 1 7   ? -3.705  0.539   -18.205 1.00 0.00 ? 7   VAL C HG13 2  
ATOM   9751   H HG21 . VAL C 1 7   ? -3.590  0.154   -22.443 1.00 0.00 ? 7   VAL C HG21 2  
ATOM   9752   H HG22 . VAL C 1 7   ? -5.082  -0.271  -21.604 1.00 0.00 ? 7   VAL C HG22 2  
ATOM   9753   H HG23 . VAL C 1 7   ? -4.531  1.405   -21.630 1.00 0.00 ? 7   VAL C HG23 2  
ATOM   9754   N N    . VAL C 1 8   ? -0.807  -0.600  -18.714 1.00 0.00 ? 8   VAL C N    2  
ATOM   9755   C CA   . VAL C 1 8   ? -0.066  -0.727  -17.459 1.00 0.00 ? 8   VAL C CA   2  
ATOM   9756   C C    . VAL C 1 8   ? 1.229   0.075   -17.557 1.00 0.00 ? 8   VAL C C    2  
ATOM   9757   O O    . VAL C 1 8   ? 1.581   0.818   -16.642 1.00 0.00 ? 8   VAL C O    2  
ATOM   9758   C CB   . VAL C 1 8   ? 0.228   -2.209  -17.172 1.00 0.00 ? 8   VAL C CB   2  
ATOM   9759   C CG1  . VAL C 1 8   ? 1.221   -2.331  -15.999 1.00 0.00 ? 8   VAL C CG1  2  
ATOM   9760   C CG2  . VAL C 1 8   ? -1.090  -2.947  -16.832 1.00 0.00 ? 8   VAL C CG2  2  
ATOM   9761   H H    . VAL C 1 8   ? -0.987  -1.400  -19.250 1.00 0.00 ? 8   VAL C H    2  
ATOM   9762   H HA   . VAL C 1 8   ? -0.663  -0.323  -16.654 1.00 0.00 ? 8   VAL C HA   2  
ATOM   9763   H HB   . VAL C 1 8   ? 0.667   -2.656  -18.054 1.00 0.00 ? 8   VAL C HB   2  
ATOM   9764   H HG11 . VAL C 1 8   ? 1.246   -1.406  -15.442 1.00 0.00 ? 8   VAL C HG11 2  
ATOM   9765   H HG12 . VAL C 1 8   ? 0.915   -3.133  -15.343 1.00 0.00 ? 8   VAL C HG12 2  
ATOM   9766   H HG13 . VAL C 1 8   ? 2.208   -2.543  -16.385 1.00 0.00 ? 8   VAL C HG13 2  
ATOM   9767   H HG21 . VAL C 1 8   ? -1.937  -2.312  -17.055 1.00 0.00 ? 8   VAL C HG21 2  
ATOM   9768   H HG22 . VAL C 1 8   ? -1.160  -3.850  -17.420 1.00 0.00 ? 8   VAL C HG22 2  
ATOM   9769   H HG23 . VAL C 1 8   ? -1.106  -3.206  -15.782 1.00 0.00 ? 8   VAL C HG23 2  
ATOM   9770   N N    . MET C 1 9   ? 1.918   -0.048  -18.688 1.00 0.00 ? 9   MET C N    2  
ATOM   9771   C CA   . MET C 1 9   ? 3.153   0.704   -18.889 1.00 0.00 ? 9   MET C CA   2  
ATOM   9772   C C    . MET C 1 9   ? 2.866   2.192   -18.723 1.00 0.00 ? 9   MET C C    2  
ATOM   9773   O O    . MET C 1 9   ? 3.609   2.912   -18.054 1.00 0.00 ? 9   MET C O    2  
ATOM   9774   C CB   . MET C 1 9   ? 3.698   0.417   -20.288 1.00 0.00 ? 9   MET C CB   2  
ATOM   9775   C CG   . MET C 1 9   ? 4.364   -0.960  -20.306 1.00 0.00 ? 9   MET C CG   2  
ATOM   9776   S SD   . MET C 1 9   ? 4.913   -1.341  -21.988 1.00 0.00 ? 9   MET C SD   2  
ATOM   9777   C CE   . MET C 1 9   ? 6.238   -0.116  -22.082 1.00 0.00 ? 9   MET C CE   2  
ATOM   9778   H H    . MET C 1 9   ? 1.583   -0.630  -19.403 1.00 0.00 ? 9   MET C H    2  
ATOM   9779   H HA   . MET C 1 9   ? 3.873   0.405   -18.143 1.00 0.00 ? 9   MET C HA   2  
ATOM   9780   H HB2  . MET C 1 9   ? 2.885   0.433   -21.000 1.00 0.00 ? 9   MET C HB2  2  
ATOM   9781   H HB3  . MET C 1 9   ? 4.425   1.170   -20.553 1.00 0.00 ? 9   MET C HB3  2  
ATOM   9782   H HG2  . MET C 1 9   ? 5.214   -0.957  -19.641 1.00 0.00 ? 9   MET C HG2  2  
ATOM   9783   H HG3  . MET C 1 9   ? 3.654   -1.707  -19.980 1.00 0.00 ? 9   MET C HG3  2  
ATOM   9784   H HE1  . MET C 1 9   ? 6.660   0.034   -21.099 1.00 0.00 ? 9   MET C HE1  2  
ATOM   9785   H HE2  . MET C 1 9   ? 7.004   -0.466  -22.760 1.00 0.00 ? 9   MET C HE2  2  
ATOM   9786   H HE3  . MET C 1 9   ? 5.840   0.818   -22.446 1.00 0.00 ? 9   MET C HE3  2  
ATOM   9787   N N    . GLY C 1 10  ? 1.762   2.641   -19.313 1.00 0.00 ? 10  GLY C N    2  
ATOM   9788   C CA   . GLY C 1 10  ? 1.370   4.041   -19.197 1.00 0.00 ? 10  GLY C CA   2  
ATOM   9789   C C    . GLY C 1 10  ? 1.098   4.390   -17.737 1.00 0.00 ? 10  GLY C C    2  
ATOM   9790   O O    . GLY C 1 10  ? 1.536   5.430   -17.243 1.00 0.00 ? 10  GLY C O    2  
ATOM   9791   H H    . GLY C 1 10  ? 1.194   2.018   -19.817 1.00 0.00 ? 10  GLY C H    2  
ATOM   9792   H HA2  . GLY C 1 10  ? 2.167   4.668   -19.572 1.00 0.00 ? 10  GLY C HA2  2  
ATOM   9793   H HA3  . GLY C 1 10  ? 0.476   4.214   -19.775 1.00 0.00 ? 10  GLY C HA3  2  
ATOM   9794   N N    . LEU C 1 11  ? 0.385   3.506   -17.047 1.00 0.00 ? 11  LEU C N    2  
ATOM   9795   C CA   . LEU C 1 11  ? 0.070   3.725   -15.632 1.00 0.00 ? 11  LEU C CA   2  
ATOM   9796   C C    . LEU C 1 11  ? 1.343   3.772   -14.798 1.00 0.00 ? 11  LEU C C    2  
ATOM   9797   O O    . LEU C 1 11  ? 1.495   4.632   -13.927 1.00 0.00 ? 11  LEU C O    2  
ATOM   9798   C CB   . LEU C 1 11  ? -0.827  2.603   -15.108 1.00 0.00 ? 11  LEU C CB   2  
ATOM   9799   C CG   . LEU C 1 11  ? -2.226  2.713   -15.719 1.00 0.00 ? 11  LEU C CG   2  
ATOM   9800   C CD1  . LEU C 1 11  ? -3.021  1.452   -15.375 1.00 0.00 ? 11  LEU C CD1  2  
ATOM   9801   C CD2  . LEU C 1 11  ? -2.956  3.953   -15.170 1.00 0.00 ? 11  LEU C CD2  2  
ATOM   9802   H H    . LEU C 1 11  ? 0.073   2.687   -17.490 1.00 0.00 ? 11  LEU C H    2  
ATOM   9803   H HA   . LEU C 1 11  ? -0.448  4.664   -15.528 1.00 0.00 ? 11  LEU C HA   2  
ATOM   9804   H HB2  . LEU C 1 11  ? -0.393  1.648   -15.375 1.00 0.00 ? 11  LEU C HB2  2  
ATOM   9805   H HB3  . LEU C 1 11  ? -0.896  2.672   -14.031 1.00 0.00 ? 11  LEU C HB3  2  
ATOM   9806   H HG   . LEU C 1 11  ? -2.137  2.793   -16.793 1.00 0.00 ? 11  LEU C HG   2  
ATOM   9807   H HD11 . LEU C 1 11  ? -2.820  1.163   -14.353 1.00 0.00 ? 11  LEU C HD11 2  
ATOM   9808   H HD12 . LEU C 1 11  ? -4.075  1.649   -15.491 1.00 0.00 ? 11  LEU C HD12 2  
ATOM   9809   H HD13 . LEU C 1 11  ? -2.729  0.652   -16.039 1.00 0.00 ? 11  LEU C HD13 2  
ATOM   9810   H HD21 . LEU C 1 11  ? -2.645  4.143   -14.154 1.00 0.00 ? 11  LEU C HD21 2  
ATOM   9811   H HD22 . LEU C 1 11  ? -2.719  4.811   -15.784 1.00 0.00 ? 11  LEU C HD22 2  
ATOM   9812   H HD23 . LEU C 1 11  ? -4.023  3.784   -15.195 1.00 0.00 ? 11  LEU C HD23 2  
ATOM   9813   N N    . ILE C 1 12  ? 2.256   2.847   -15.066 1.00 0.00 ? 12  ILE C N    2  
ATOM   9814   C CA   . ILE C 1 12  ? 3.514   2.803   -14.327 1.00 0.00 ? 12  ILE C CA   2  
ATOM   9815   C C    . ILE C 1 12  ? 4.286   4.089   -14.564 1.00 0.00 ? 12  ILE C C    2  
ATOM   9816   O O    . ILE C 1 12  ? 4.796   4.711   -13.630 1.00 0.00 ? 12  ILE C O    2  
ATOM   9817   C CB   . ILE C 1 12  ? 4.354   1.606   -14.814 1.00 0.00 ? 12  ILE C CB   2  
ATOM   9818   C CG1  . ILE C 1 12  ? 3.657   0.263   -14.497 1.00 0.00 ? 12  ILE C CG1  2  
ATOM   9819   C CG2  . ILE C 1 12  ? 5.738   1.631   -14.162 1.00 0.00 ? 12  ILE C CG2  2  
ATOM   9820   C CD1  . ILE C 1 12  ? 3.557   0.002   -12.998 1.00 0.00 ? 12  ILE C CD1  2  
ATOM   9821   H H    . ILE C 1 12  ? 2.084   2.187   -15.776 1.00 0.00 ? 12  ILE C H    2  
ATOM   9822   H HA   . ILE C 1 12  ? 3.295   2.718   -13.273 1.00 0.00 ? 12  ILE C HA   2  
ATOM   9823   H HB   . ILE C 1 12  ? 4.480   1.689   -15.887 1.00 0.00 ? 12  ILE C HB   2  
ATOM   9824   H HG12 . ILE C 1 12  ? 2.665   0.281   -14.898 1.00 0.00 ? 12  ILE C HG12 2  
ATOM   9825   H HG13 . ILE C 1 12  ? 4.209   -0.541  -14.959 1.00 0.00 ? 12  ILE C HG13 2  
ATOM   9826   H HG21 . ILE C 1 12  ? 5.629   1.613   -13.087 1.00 0.00 ? 12  ILE C HG21 2  
ATOM   9827   H HG22 . ILE C 1 12  ? 6.299   0.766   -14.480 1.00 0.00 ? 12  ILE C HG22 2  
ATOM   9828   H HG23 . ILE C 1 12  ? 6.263   2.527   -14.456 1.00 0.00 ? 12  ILE C HG23 2  
ATOM   9829   H HD11 . ILE C 1 12  ? 4.521   0.182   -12.540 1.00 0.00 ? 12  ILE C HD11 2  
ATOM   9830   H HD12 . ILE C 1 12  ? 2.830   0.653   -12.556 1.00 0.00 ? 12  ILE C HD12 2  
ATOM   9831   H HD13 . ILE C 1 12  ? 3.274   -1.022  -12.840 1.00 0.00 ? 12  ILE C HD13 2  
ATOM   9832   N N    . ILE C 1 13  ? 4.342   4.504   -15.824 1.00 0.00 ? 13  ILE C N    2  
ATOM   9833   C CA   . ILE C 1 13  ? 5.027   5.740   -16.166 1.00 0.00 ? 13  ILE C CA   2  
ATOM   9834   C C    . ILE C 1 13  ? 4.323   6.920   -15.502 1.00 0.00 ? 13  ILE C C    2  
ATOM   9835   O O    . ILE C 1 13  ? 4.963   7.794   -14.913 1.00 0.00 ? 13  ILE C O    2  
ATOM   9836   C CB   . ILE C 1 13  ? 5.030   5.924   -17.685 1.00 0.00 ? 13  ILE C CB   2  
ATOM   9837   C CG1  . ILE C 1 13  ? 5.928   4.855   -18.334 1.00 0.00 ? 13  ILE C CG1  2  
ATOM   9838   C CG2  . ILE C 1 13  ? 5.540   7.326   -18.032 1.00 0.00 ? 13  ILE C CG2  2  
ATOM   9839   C CD1  . ILE C 1 13  ? 7.399   5.291   -18.308 1.00 0.00 ? 13  ILE C CD1  2  
ATOM   9840   H H    . ILE C 1 13  ? 3.898   3.981   -16.529 1.00 0.00 ? 13  ILE C H    2  
ATOM   9841   H HA   . ILE C 1 13  ? 6.044   5.691   -15.806 1.00 0.00 ? 13  ILE C HA   2  
ATOM   9842   H HB   . ILE C 1 13  ? 4.020   5.814   -18.056 1.00 0.00 ? 13  ILE C HB   2  
ATOM   9843   H HG12 . ILE C 1 13  ? 5.824   3.927   -17.790 1.00 0.00 ? 13  ILE C HG12 2  
ATOM   9844   H HG13 . ILE C 1 13  ? 5.620   4.704   -19.357 1.00 0.00 ? 13  ILE C HG13 2  
ATOM   9845   H HG21 . ILE C 1 13  ? 6.422   7.543   -17.448 1.00 0.00 ? 13  ILE C HG21 2  
ATOM   9846   H HG22 . ILE C 1 13  ? 5.786   7.368   -19.083 1.00 0.00 ? 13  ILE C HG22 2  
ATOM   9847   H HG23 . ILE C 1 13  ? 4.773   8.053   -17.812 1.00 0.00 ? 13  ILE C HG23 2  
ATOM   9848   H HD11 . ILE C 1 13  ? 7.573   5.915   -17.444 1.00 0.00 ? 13  ILE C HD11 2  
ATOM   9849   H HD12 . ILE C 1 13  ? 8.031   4.417   -18.253 1.00 0.00 ? 13  ILE C HD12 2  
ATOM   9850   H HD13 . ILE C 1 13  ? 7.630   5.846   -19.204 1.00 0.00 ? 13  ILE C HD13 2  
ATOM   9851   N N    . ASN C 1 14  ? 2.995   6.933   -15.596 1.00 0.00 ? 14  ASN C N    2  
ATOM   9852   C CA   . ASN C 1 14  ? 2.202   8.006   -14.996 1.00 0.00 ? 14  ASN C CA   2  
ATOM   9853   C C    . ASN C 1 14  ? 2.443   8.057   -13.491 1.00 0.00 ? 14  ASN C C    2  
ATOM   9854   O O    . ASN C 1 14  ? 2.693   9.122   -12.922 1.00 0.00 ? 14  ASN C O    2  
ATOM   9855   C CB   . ASN C 1 14  ? 0.712   7.781   -15.292 1.00 0.00 ? 14  ASN C CB   2  
ATOM   9856   C CG   . ASN C 1 14  ? -0.047  9.107   -15.300 1.00 0.00 ? 14  ASN C CG   2  
ATOM   9857   O OD1  . ASN C 1 14  ? 0.502   10.143  -14.945 1.00 0.00 ? 14  ASN C OD1  2  
ATOM   9858   N ND2  . ASN C 1 14  ? -1.288  9.128   -15.686 1.00 0.00 ? 14  ASN C ND2  2  
ATOM   9859   H H    . ASN C 1 14  ? 2.539   6.202   -16.069 1.00 0.00 ? 14  ASN C H    2  
ATOM   9860   H HA   . ASN C 1 14  ? 2.509   8.947   -15.430 1.00 0.00 ? 14  ASN C HA   2  
ATOM   9861   H HB2  . ASN C 1 14  ? 0.608   7.314   -16.259 1.00 0.00 ? 14  ASN C HB2  2  
ATOM   9862   H HB3  . ASN C 1 14  ? 0.288   7.136   -14.538 1.00 0.00 ? 14  ASN C HB3  2  
ATOM   9863   H HD21 . ASN C 1 14  ? -1.729  8.302   -15.967 1.00 0.00 ? 14  ASN C HD21 2  
ATOM   9864   H HD22 . ASN C 1 14  ? -1.783  9.975   -15.698 1.00 0.00 ? 14  ASN C HD22 2  
ATOM   9865   N N    . SER C 1 15  ? 2.389   6.894   -12.851 1.00 0.00 ? 15  SER C N    2  
ATOM   9866   C CA   . SER C 1 15  ? 2.629   6.821   -11.412 1.00 0.00 ? 15  SER C CA   2  
ATOM   9867   C C    . SER C 1 15  ? 4.029   7.334   -11.096 1.00 0.00 ? 15  SER C C    2  
ATOM   9868   O O    . SER C 1 15  ? 4.231   8.091   -10.145 1.00 0.00 ? 15  SER C O    2  
ATOM   9869   C CB   . SER C 1 15  ? 2.494   5.378   -10.928 1.00 0.00 ? 15  SER C CB   2  
ATOM   9870   O OG   . SER C 1 15  ? 3.652   4.647   -11.309 1.00 0.00 ? 15  SER C OG   2  
ATOM   9871   H H    . SER C 1 15  ? 2.204   6.070   -13.355 1.00 0.00 ? 15  SER C H    2  
ATOM   9872   H HA   . SER C 1 15  ? 1.907   7.440   -10.905 1.00 0.00 ? 15  SER C HA   2  
ATOM   9873   H HB2  . SER C 1 15  ? 2.398   5.361   -9.856  1.00 0.00 ? 15  SER C HB2  2  
ATOM   9874   H HB3  . SER C 1 15  ? 1.616   4.932   -11.374 1.00 0.00 ? 15  SER C HB3  2  
ATOM   9875   H HG   . SER C 1 15  ? 3.385   3.744   -11.496 1.00 0.00 ? 15  SER C HG   2  
ATOM   9876   N N    . GLY C 1 16  ? 4.997   6.925   -11.917 1.00 0.00 ? 16  GLY C N    2  
ATOM   9877   C CA   . GLY C 1 16  ? 6.378   7.358   -11.732 1.00 0.00 ? 16  GLY C CA   2  
ATOM   9878   C C    . GLY C 1 16  ? 6.493   8.869   -11.888 1.00 0.00 ? 16  GLY C C    2  
ATOM   9879   O O    . GLY C 1 16  ? 7.147   9.537   -11.085 1.00 0.00 ? 16  GLY C O    2  
ATOM   9880   H H    . GLY C 1 16  ? 4.775   6.332   -12.669 1.00 0.00 ? 16  GLY C H    2  
ATOM   9881   H HA2  . GLY C 1 16  ? 6.706   7.080   -10.740 1.00 0.00 ? 16  GLY C HA2  2  
ATOM   9882   H HA3  . GLY C 1 16  ? 7.006   6.877   -12.464 1.00 0.00 ? 16  GLY C HA3  2  
ATOM   9883   N N    . GLN C 1 17  ? 5.843   9.416   -12.916 1.00 0.00 ? 17  GLN C N    2  
ATOM   9884   C CA   . GLN C 1 17  ? 5.880   10.864  -13.134 1.00 0.00 ? 17  GLN C CA   2  
ATOM   9885   C C    . GLN C 1 17  ? 5.240   11.571  -11.949 1.00 0.00 ? 17  GLN C C    2  
ATOM   9886   O O    . GLN C 1 17  ? 5.729   12.603  -11.491 1.00 0.00 ? 17  GLN C O    2  
ATOM   9887   C CB   . GLN C 1 17  ? 5.137   11.213  -14.433 1.00 0.00 ? 17  GLN C CB   2  
ATOM   9888   C CG   . GLN C 1 17  ? 5.549   12.608  -14.935 1.00 0.00 ? 17  GLN C CG   2  
ATOM   9889   C CD   . GLN C 1 17  ? 5.500   12.650  -16.461 1.00 0.00 ? 17  GLN C CD   2  
ATOM   9890   O OE1  . GLN C 1 17  ? 4.857   11.807  -17.086 1.00 0.00 ? 17  GLN C OE1  2  
ATOM   9891   N NE2  . GLN C 1 17  ? 6.152   13.583  -17.099 1.00 0.00 ? 17  GLN C NE2  2  
ATOM   9892   H H    . GLN C 1 17  ? 5.323   8.842   -13.523 1.00 0.00 ? 17  GLN C H    2  
ATOM   9893   H HA   . GLN C 1 17  ? 6.909   11.178  -13.216 1.00 0.00 ? 17  GLN C HA   2  
ATOM   9894   H HB2  . GLN C 1 17  ? 5.374   10.475  -15.187 1.00 0.00 ? 17  GLN C HB2  2  
ATOM   9895   H HB3  . GLN C 1 17  ? 4.073   11.202  -14.248 1.00 0.00 ? 17  GLN C HB3  2  
ATOM   9896   H HG2  . GLN C 1 17  ? 4.866   13.345  -14.538 1.00 0.00 ? 17  GLN C HG2  2  
ATOM   9897   H HG3  . GLN C 1 17  ? 6.550   12.838  -14.608 1.00 0.00 ? 17  GLN C HG3  2  
ATOM   9898   H HE21 . GLN C 1 17  ? 6.667   14.250  -16.599 1.00 0.00 ? 17  GLN C HE21 2  
ATOM   9899   H HE22 . GLN C 1 17  ? 6.129   13.615  -18.078 1.00 0.00 ? 17  GLN C HE22 2  
ATOM   9900   N N    . ALA C 1 18  ? 4.145   10.999  -11.455 1.00 0.00 ? 18  ALA C N    2  
ATOM   9901   C CA   . ALA C 1 18  ? 3.441   11.575  -10.321 1.00 0.00 ? 18  ALA C CA   2  
ATOM   9902   C C    . ALA C 1 18  ? 4.389   11.706  -9.131  1.00 0.00 ? 18  ALA C C    2  
ATOM   9903   O O    . ALA C 1 18  ? 4.514   12.778  -8.531  1.00 0.00 ? 18  ALA C O    2  
ATOM   9904   C CB   . ALA C 1 18  ? 2.238   10.698  -9.958  1.00 0.00 ? 18  ALA C CB   2  
ATOM   9905   H H    . ALA C 1 18  ? 3.807   10.170  -11.863 1.00 0.00 ? 18  ALA C H    2  
ATOM   9906   H HA   . ALA C 1 18  ? 3.092   12.560  -10.595 1.00 0.00 ? 18  ALA C HA   2  
ATOM   9907   H HB1  . ALA C 1 18  ? 1.954   10.107  -10.817 1.00 0.00 ? 18  ALA C HB1  2  
ATOM   9908   H HB2  . ALA C 1 18  ? 1.411   11.328  -9.669  1.00 0.00 ? 18  ALA C HB2  2  
ATOM   9909   H HB3  . ALA C 1 18  ? 2.498   10.042  -9.141  1.00 0.00 ? 18  ALA C HB3  2  
ATOM   9910   N N    . ARG C 1 19  ? 5.075   10.618  -8.802  1.00 0.00 ? 19  ARG C N    2  
ATOM   9911   C CA   . ARG C 1 19  ? 6.023   10.657  -7.697  1.00 0.00 ? 19  ARG C CA   2  
ATOM   9912   C C    . ARG C 1 19  ? 7.106   11.687  -7.987  1.00 0.00 ? 19  ARG C C    2  
ATOM   9913   O O    . ARG C 1 19  ? 7.455   12.504  -7.133  1.00 0.00 ? 19  ARG C O    2  
ATOM   9914   C CB   . ARG C 1 19  ? 6.672   9.283   -7.482  1.00 0.00 ? 19  ARG C CB   2  
ATOM   9915   C CG   . ARG C 1 19  ? 7.587   9.348   -6.249  1.00 0.00 ? 19  ARG C CG   2  
ATOM   9916   C CD   . ARG C 1 19  ? 8.189   7.973   -5.954  1.00 0.00 ? 19  ARG C CD   2  
ATOM   9917   N NE   . ARG C 1 19  ? 9.065   7.542   -7.044  1.00 0.00 ? 19  ARG C NE   2  
ATOM   9918   C CZ   . ARG C 1 19  ? 9.825   6.467   -6.926  1.00 0.00 ? 19  ARG C CZ   2  
ATOM   9919   N NH1  . ARG C 1 19  ? 9.778   5.765   -5.838  1.00 0.00 ? 19  ARG C NH1  2  
ATOM   9920   N NH2  . ARG C 1 19  ? 10.616  6.120   -7.889  1.00 0.00 ? 19  ARG C NH2  2  
ATOM   9921   H H    . ARG C 1 19  ? 4.959   9.790   -9.320  1.00 0.00 ? 19  ARG C H    2  
ATOM   9922   H HA   . ARG C 1 19  ? 5.498   10.944  -6.798  1.00 0.00 ? 19  ARG C HA   2  
ATOM   9923   H HB2  . ARG C 1 19  ? 5.904   8.540   -7.327  1.00 0.00 ? 19  ARG C HB2  2  
ATOM   9924   H HB3  . ARG C 1 19  ? 7.260   9.023   -8.350  1.00 0.00 ? 19  ARG C HB3  2  
ATOM   9925   H HG2  . ARG C 1 19  ? 8.385   10.058  -6.428  1.00 0.00 ? 19  ARG C HG2  2  
ATOM   9926   H HG3  . ARG C 1 19  ? 7.010   9.673   -5.395  1.00 0.00 ? 19  ARG C HG3  2  
ATOM   9927   H HD2  . ARG C 1 19  ? 8.767   8.033   -5.041  1.00 0.00 ? 19  ARG C HD2  2  
ATOM   9928   H HD3  . ARG C 1 19  ? 7.390   7.255   -5.825  1.00 0.00 ? 19  ARG C HD3  2  
ATOM   9929   H HE   . ARG C 1 19  ? 9.094   8.071   -7.874  1.00 0.00 ? 19  ARG C HE   2  
ATOM   9930   H HH11 . ARG C 1 19  ? 9.164   6.038   -5.097  1.00 0.00 ? 19  ARG C HH11 2  
ATOM   9931   H HH12 . ARG C 1 19  ? 10.348  4.958   -5.737  1.00 0.00 ? 19  ARG C HH12 2  
ATOM   9932   H HH21 . ARG C 1 19  ? 10.649  6.662   -8.727  1.00 0.00 ? 19  ARG C HH21 2  
ATOM   9933   H HH22 . ARG C 1 19  ? 11.192  5.312   -7.793  1.00 0.00 ? 19  ARG C HH22 2  
ATOM   9934   N N    . SER C 1 20  ? 7.633   11.642  -9.207  1.00 0.00 ? 20  SER C N    2  
ATOM   9935   C CA   . SER C 1 20  ? 8.677   12.579  -9.611  1.00 0.00 ? 20  SER C CA   2  
ATOM   9936   C C    . SER C 1 20  ? 8.232   14.015  -9.351  1.00 0.00 ? 20  SER C C    2  
ATOM   9937   O O    . SER C 1 20  ? 8.967   14.811  -8.760  1.00 0.00 ? 20  SER C O    2  
ATOM   9938   C CB   . SER C 1 20  ? 9.008   12.403  -11.093 1.00 0.00 ? 20  SER C CB   2  
ATOM   9939   O OG   . SER C 1 20  ? 9.760   13.523  -11.544 1.00 0.00 ? 20  SER C OG   2  
ATOM   9940   H H    . SER C 1 20  ? 7.311   10.971  -9.849  1.00 0.00 ? 20  SER C H    2  
ATOM   9941   H HA   . SER C 1 20  ? 9.561   12.380  -9.027  1.00 0.00 ? 20  SER C HA   2  
ATOM   9942   H HB2  . SER C 1 20  ? 9.590   11.507  -11.231 1.00 0.00 ? 20  SER C HB2  2  
ATOM   9943   H HB3  . SER C 1 20  ? 8.090   12.324  -11.657 1.00 0.00 ? 20  SER C HB3  2  
ATOM   9944   H HG   . SER C 1 20  ? 10.490  13.656  -10.934 1.00 0.00 ? 20  SER C HG   2  
ATOM   9945   N N    . LEU C 1 21  ? 7.015   14.336  -9.773  1.00 0.00 ? 21  LEU C N    2  
ATOM   9946   C CA   . LEU C 1 21  ? 6.473   15.674  -9.558  1.00 0.00 ? 21  LEU C CA   2  
ATOM   9947   C C    . LEU C 1 21  ? 6.349   15.956  -8.060  1.00 0.00 ? 21  LEU C C    2  
ATOM   9948   O O    . LEU C 1 21  ? 6.687   17.044  -7.588  1.00 0.00 ? 21  LEU C O    2  
ATOM   9949   C CB   . LEU C 1 21  ? 5.093   15.793  -10.211 1.00 0.00 ? 21  LEU C CB   2  
ATOM   9950   C CG   . LEU C 1 21  ? 5.234   15.780  -11.741 1.00 0.00 ? 21  LEU C CG   2  
ATOM   9951   C CD1  . LEU C 1 21  ? 3.852   15.595  -12.391 1.00 0.00 ? 21  LEU C CD1  2  
ATOM   9952   C CD2  . LEU C 1 21  ? 5.867   17.104  -12.225 1.00 0.00 ? 21  LEU C CD2  2  
ATOM   9953   H H    . LEU C 1 21  ? 6.463   13.658  -10.219 1.00 0.00 ? 21  LEU C H    2  
ATOM   9954   H HA   . LEU C 1 21  ? 7.141   16.402  -9.994  1.00 0.00 ? 21  LEU C HA   2  
ATOM   9955   H HB2  . LEU C 1 21  ? 4.481   14.961  -9.895  1.00 0.00 ? 21  LEU C HB2  2  
ATOM   9956   H HB3  . LEU C 1 21  ? 4.628   16.718  -9.902  1.00 0.00 ? 21  LEU C HB3  2  
ATOM   9957   H HG   . LEU C 1 21  ? 5.871   14.955  -12.028 1.00 0.00 ? 21  LEU C HG   2  
ATOM   9958   H HD11 . LEU C 1 21  ? 3.207   15.032  -11.732 1.00 0.00 ? 21  LEU C HD11 2  
ATOM   9959   H HD12 . LEU C 1 21  ? 3.411   16.562  -12.583 1.00 0.00 ? 21  LEU C HD12 2  
ATOM   9960   H HD13 . LEU C 1 21  ? 3.962   15.060  -13.323 1.00 0.00 ? 21  LEU C HD13 2  
ATOM   9961   H HD21 . LEU C 1 21  ? 5.987   17.784  -11.393 1.00 0.00 ? 21  LEU C HD21 2  
ATOM   9962   H HD22 . LEU C 1 21  ? 6.835   16.898  -12.659 1.00 0.00 ? 21  LEU C HD22 2  
ATOM   9963   H HD23 . LEU C 1 21  ? 5.235   17.565  -12.971 1.00 0.00 ? 21  LEU C HD23 2  
ATOM   9964   N N    . ALA C 1 22  ? 5.871   14.962  -7.314  1.00 0.00 ? 22  ALA C N    2  
ATOM   9965   C CA   . ALA C 1 22  ? 5.714   15.110  -5.868  1.00 0.00 ? 22  ALA C CA   2  
ATOM   9966   C C    . ALA C 1 22  ? 7.058   15.445  -5.215  1.00 0.00 ? 22  ALA C C    2  
ATOM   9967   O O    . ALA C 1 22  ? 7.165   16.420  -4.469  1.00 0.00 ? 22  ALA C O    2  
ATOM   9968   C CB   . ALA C 1 22  ? 5.136   13.825  -5.275  1.00 0.00 ? 22  ALA C CB   2  
ATOM   9969   H H    . ALA C 1 22  ? 5.627   14.114  -7.745  1.00 0.00 ? 22  ALA C H    2  
ATOM   9970   H HA   . ALA C 1 22  ? 5.029   15.921  -5.676  1.00 0.00 ? 22  ALA C HA   2  
ATOM   9971   H HB1  . ALA C 1 22  ? 5.875   13.041  -5.319  1.00 0.00 ? 22  ALA C HB1  2  
ATOM   9972   H HB2  . ALA C 1 22  ? 4.855   14.000  -4.246  1.00 0.00 ? 22  ALA C HB2  2  
ATOM   9973   H HB3  . ALA C 1 22  ? 4.264   13.530  -5.840  1.00 0.00 ? 22  ALA C HB3  2  
ATOM   9974   N N    . TYR C 1 23  ? 8.089   14.652  -5.509  1.00 0.00 ? 23  TYR C N    2  
ATOM   9975   C CA   . TYR C 1 23  ? 9.416   14.923  -4.945  1.00 0.00 ? 23  TYR C CA   2  
ATOM   9976   C C    . TYR C 1 23  ? 9.877   16.310  -5.380  1.00 0.00 ? 23  TYR C C    2  
ATOM   9977   O O    . TYR C 1 23  ? 10.427  17.072  -4.584  1.00 0.00 ? 23  TYR C O    2  
ATOM   9978   C CB   . TYR C 1 23  ? 10.423  13.867  -5.409  1.00 0.00 ? 23  TYR C CB   2  
ATOM   9979   C CG   . TYR C 1 23  ? 11.800  14.221  -4.899  1.00 0.00 ? 23  TYR C CG   2  
ATOM   9980   C CD1  . TYR C 1 23  ? 12.142  13.965  -3.565  1.00 0.00 ? 23  TYR C CD1  2  
ATOM   9981   C CD2  . TYR C 1 23  ? 12.735  14.808  -5.761  1.00 0.00 ? 23  TYR C CD2  2  
ATOM   9982   C CE1  . TYR C 1 23  ? 13.419  14.295  -3.095  1.00 0.00 ? 23  TYR C CE1  2  
ATOM   9983   C CE2  . TYR C 1 23  ? 14.012  15.137  -5.290  1.00 0.00 ? 23  TYR C CE2  2  
ATOM   9984   C CZ   . TYR C 1 23  ? 14.354  14.881  -3.957  1.00 0.00 ? 23  TYR C CZ   2  
ATOM   9985   O OH   . TYR C 1 23  ? 15.612  15.206  -3.493  1.00 0.00 ? 23  TYR C OH   2  
ATOM   9986   H H    . TYR C 1 23  ? 7.960   13.891  -6.120  1.00 0.00 ? 23  TYR C H    2  
ATOM   9987   H HA   . TYR C 1 23  ? 9.347   14.907  -3.868  1.00 0.00 ? 23  TYR C HA   2  
ATOM   9988   H HB2  . TYR C 1 23  ? 10.134  12.900  -5.022  1.00 0.00 ? 23  TYR C HB2  2  
ATOM   9989   H HB3  . TYR C 1 23  ? 10.438  13.833  -6.488  1.00 0.00 ? 23  TYR C HB3  2  
ATOM   9990   H HD1  . TYR C 1 23  ? 11.422  13.513  -2.900  1.00 0.00 ? 23  TYR C HD1  2  
ATOM   9991   H HD2  . TYR C 1 23  ? 12.471  15.005  -6.789  1.00 0.00 ? 23  TYR C HD2  2  
ATOM   9992   H HE1  . TYR C 1 23  ? 13.684  14.097  -2.066  1.00 0.00 ? 23  TYR C HE1  2  
ATOM   9993   H HE2  . TYR C 1 23  ? 14.732  15.589  -5.955  1.00 0.00 ? 23  TYR C HE2  2  
ATOM   9994   H HH   . TYR C 1 23  ? 15.705  14.846  -2.608  1.00 0.00 ? 23  TYR C HH   2  
ATOM   9995   N N    . ALA C 1 24  ? 9.622   16.649  -6.641  1.00 0.00 ? 24  ALA C N    2  
ATOM   9996   C CA   . ALA C 1 24  ? 10.000  17.961  -7.141  1.00 0.00 ? 24  ALA C CA   2  
ATOM   9997   C C    . ALA C 1 24  ? 9.250   19.032  -6.345  1.00 0.00 ? 24  ALA C C    2  
ATOM   9998   O O    . ALA C 1 24  ? 9.820   20.057  -5.966  1.00 0.00 ? 24  ALA C O    2  
ATOM   9999   C CB   . ALA C 1 24  ? 9.690   18.059  -8.644  1.00 0.00 ? 24  ALA C CB   2  
ATOM   10000  H H    . ALA C 1 24  ? 9.161   16.016  -7.234  1.00 0.00 ? 24  ALA C H    2  
ATOM   10001  H HA   . ALA C 1 24  ? 11.059  18.099  -6.989  1.00 0.00 ? 24  ALA C HA   2  
ATOM   10002  H HB1  . ALA C 1 24  ? 9.183   17.161  -8.966  1.00 0.00 ? 24  ALA C HB1  2  
ATOM   10003  H HB2  . ALA C 1 24  ? 10.614  18.163  -9.197  1.00 0.00 ? 24  ALA C HB2  2  
ATOM   10004  H HB3  . ALA C 1 24  ? 9.060   18.914  -8.835  1.00 0.00 ? 24  ALA C HB3  2  
ATOM   10005  N N    . ALA C 1 25  ? 7.976   18.766  -6.059  1.00 0.00 ? 25  ALA C N    2  
ATOM   10006  C CA   . ALA C 1 25  ? 7.168   19.692  -5.272  1.00 0.00 ? 25  ALA C CA   2  
ATOM   10007  C C    . ALA C 1 25  ? 7.824   19.917  -3.914  1.00 0.00 ? 25  ALA C C    2  
ATOM   10008  O O    . ALA C 1 25  ? 7.936   21.047  -3.436  1.00 0.00 ? 25  ALA C O    2  
ATOM   10009  C CB   . ALA C 1 25  ? 5.758   19.122  -5.081  1.00 0.00 ? 25  ALA C CB   2  
ATOM   10010  H H    . ALA C 1 25  ? 7.581   17.917  -6.363  1.00 0.00 ? 25  ALA C H    2  
ATOM   10011  H HA   . ALA C 1 25  ? 7.103   20.635  -5.792  1.00 0.00 ? 25  ALA C HA   2  
ATOM   10012  H HB1  . ALA C 1 25  ? 5.441   18.638  -5.992  1.00 0.00 ? 25  ALA C HB1  2  
ATOM   10013  H HB2  . ALA C 1 25  ? 5.075   19.926  -4.842  1.00 0.00 ? 25  ALA C HB2  2  
ATOM   10014  H HB3  . ALA C 1 25  ? 5.765   18.404  -4.273  1.00 0.00 ? 25  ALA C HB3  2  
ATOM   10015  N N    . LEU C 1 26  ? 8.278   18.827  -3.307  1.00 0.00 ? 26  LEU C N    2  
ATOM   10016  C CA   . LEU C 1 26  ? 8.947   18.909  -2.012  1.00 0.00 ? 26  LEU C CA   2  
ATOM   10017  C C    . LEU C 1 26  ? 10.217  19.747  -2.132  1.00 0.00 ? 26  LEU C C    2  
ATOM   10018  O O    . LEU C 1 26  ? 10.500  20.602  -1.289  1.00 0.00 ? 26  LEU C O    2  
ATOM   10019  C CB   . LEU C 1 26  ? 9.289   17.500  -1.511  1.00 0.00 ? 26  LEU C CB   2  
ATOM   10020  C CG   . LEU C 1 26  ? 10.139  17.570  -0.232  1.00 0.00 ? 26  LEU C CG   2  
ATOM   10021  C CD1  . LEU C 1 26  ? 9.373   18.303  0.873   1.00 0.00 ? 26  LEU C CD1  2  
ATOM   10022  C CD2  . LEU C 1 26  ? 10.451  16.149  0.233   1.00 0.00 ? 26  LEU C CD2  2  
ATOM   10023  H H    . LEU C 1 26  ? 8.173   17.954  -3.745  1.00 0.00 ? 26  LEU C H    2  
ATOM   10024  H HA   . LEU C 1 26  ? 8.282   19.383  -1.307  1.00 0.00 ? 26  LEU C HA   2  
ATOM   10025  H HB2  . LEU C 1 26  ? 8.377   16.967  -1.303  1.00 0.00 ? 26  LEU C HB2  2  
ATOM   10026  H HB3  . LEU C 1 26  ? 9.846   16.975  -2.276  1.00 0.00 ? 26  LEU C HB3  2  
ATOM   10027  H HG   . LEU C 1 26  ? 11.063  18.092  -0.437  1.00 0.00 ? 26  LEU C HG   2  
ATOM   10028  H HD11 . LEU C 1 26  ? 8.351   17.961  0.892   1.00 0.00 ? 26  LEU C HD11 2  
ATOM   10029  H HD12 . LEU C 1 26  ? 9.840   18.098  1.825   1.00 0.00 ? 26  LEU C HD12 2  
ATOM   10030  H HD13 . LEU C 1 26  ? 9.395   19.367  0.683   1.00 0.00 ? 26  LEU C HD13 2  
ATOM   10031  H HD21 . LEU C 1 26  ? 9.530   15.623  0.437   1.00 0.00 ? 26  LEU C HD21 2  
ATOM   10032  H HD22 . LEU C 1 26  ? 10.999  15.627  -0.537  1.00 0.00 ? 26  LEU C HD22 2  
ATOM   10033  H HD23 . LEU C 1 26  ? 11.047  16.185  1.133   1.00 0.00 ? 26  LEU C HD23 2  
ATOM   10034  N N    . LYS C 1 27  ? 10.974  19.500  -3.193  1.00 0.00 ? 27  LYS C N    2  
ATOM   10035  C CA   . LYS C 1 27  ? 12.204  20.248  -3.424  1.00 0.00 ? 27  LYS C CA   2  
ATOM   10036  C C    . LYS C 1 27  ? 11.913  21.747  -3.473  1.00 0.00 ? 27  LYS C C    2  
ATOM   10037  O O    . LYS C 1 27  ? 12.653  22.550  -2.899  1.00 0.00 ? 27  LYS C O    2  
ATOM   10038  C CB   . LYS C 1 27  ? 12.851  19.778  -4.732  1.00 0.00 ? 27  LYS C CB   2  
ATOM   10039  C CG   . LYS C 1 27  ? 14.215  20.452  -4.908  1.00 0.00 ? 27  LYS C CG   2  
ATOM   10040  C CD   . LYS C 1 27  ? 14.879  19.918  -6.182  1.00 0.00 ? 27  LYS C CD   2  
ATOM   10041  C CE   . LYS C 1 27  ? 16.259  20.556  -6.347  1.00 0.00 ? 27  LYS C CE   2  
ATOM   10042  N NZ   . LYS C 1 27  ? 16.899  20.025  -7.585  1.00 0.00 ? 27  LYS C NZ   2  
ATOM   10043  H H    . LYS C 1 27  ? 10.695  18.812  -3.835  1.00 0.00 ? 27  LYS C H    2  
ATOM   10044  H HA   . LYS C 1 27  ? 12.880  20.053  -2.610  1.00 0.00 ? 27  LYS C HA   2  
ATOM   10045  H HB2  . LYS C 1 27  ? 12.979  18.706  -4.700  1.00 0.00 ? 27  LYS C HB2  2  
ATOM   10046  H HB3  . LYS C 1 27  ? 12.212  20.038  -5.564  1.00 0.00 ? 27  LYS C HB3  2  
ATOM   10047  H HG2  . LYS C 1 27  ? 14.078  21.524  -4.988  1.00 0.00 ? 27  LYS C HG2  2  
ATOM   10048  H HG3  . LYS C 1 27  ? 14.840  20.231  -4.054  1.00 0.00 ? 27  LYS C HG3  2  
ATOM   10049  H HD2  . LYS C 1 27  ? 14.981  18.845  -6.108  1.00 0.00 ? 27  LYS C HD2  2  
ATOM   10050  H HD3  . LYS C 1 27  ? 14.264  20.163  -7.035  1.00 0.00 ? 27  LYS C HD3  2  
ATOM   10051  H HE2  . LYS C 1 27  ? 16.151  21.630  -6.424  1.00 0.00 ? 27  LYS C HE2  2  
ATOM   10052  H HE3  . LYS C 1 27  ? 16.872  20.316  -5.489  1.00 0.00 ? 27  LYS C HE3  2  
ATOM   10053  H HZ1  . LYS C 1 27  ? 16.957  18.988  -7.532  1.00 0.00 ? 27  LYS C HZ1  2  
ATOM   10054  H HZ2  . LYS C 1 27  ? 16.332  20.298  -8.415  1.00 0.00 ? 27  LYS C HZ2  2  
ATOM   10055  H HZ3  . LYS C 1 27  ? 17.859  20.417  -7.676  1.00 0.00 ? 27  LYS C HZ3  2  
ATOM   10056  N N    . GLN C 1 28  ? 10.818  22.119  -4.133  1.00 0.00 ? 28  GLN C N    2  
ATOM   10057  C CA   . GLN C 1 28  ? 10.430  23.524  -4.214  1.00 0.00 ? 28  GLN C CA   2  
ATOM   10058  C C    . GLN C 1 28  ? 10.226  24.078  -2.806  1.00 0.00 ? 28  GLN C C    2  
ATOM   10059  O O    . GLN C 1 28  ? 10.639  25.192  -2.491  1.00 0.00 ? 28  GLN C O    2  
ATOM   10060  C CB   . GLN C 1 28  ? 9.133   23.664  -5.014  1.00 0.00 ? 28  GLN C CB   2  
ATOM   10061  C CG   . GLN C 1 28  ? 9.389   23.290  -6.475  1.00 0.00 ? 28  GLN C CG   2  
ATOM   10062  C CD   . GLN C 1 28  ? 10.349  24.291  -7.108  1.00 0.00 ? 28  GLN C CD   2  
ATOM   10063  O OE1  . GLN C 1 28  ? 10.116  25.498  -7.050  1.00 0.00 ? 28  GLN C OE1  2  
ATOM   10064  N NE2  . GLN C 1 28  ? 11.422  23.860  -7.713  1.00 0.00 ? 28  GLN C NE2  2  
ATOM   10065  H H    . GLN C 1 28  ? 10.255  21.434  -4.554  1.00 0.00 ? 28  GLN C H    2  
ATOM   10066  H HA   . GLN C 1 28  ? 11.212  24.087  -4.707  1.00 0.00 ? 28  GLN C HA   2  
ATOM   10067  H HB2  . GLN C 1 28  ? 8.383   23.006  -4.599  1.00 0.00 ? 28  GLN C HB2  2  
ATOM   10068  H HB3  . GLN C 1 28  ? 8.786   24.684  -4.961  1.00 0.00 ? 28  GLN C HB3  2  
ATOM   10069  H HG2  . GLN C 1 28  ? 9.820   22.300  -6.521  1.00 0.00 ? 28  GLN C HG2  2  
ATOM   10070  H HG3  . GLN C 1 28  ? 8.455   23.299  -7.016  1.00 0.00 ? 28  GLN C HG3  2  
ATOM   10071  H HE21 . GLN C 1 28  ? 11.607  22.899  -7.759  1.00 0.00 ? 28  GLN C HE21 2  
ATOM   10072  H HE22 . GLN C 1 28  ? 12.043  24.499  -8.123  1.00 0.00 ? 28  GLN C HE22 2  
ATOM   10073  N N    . ALA C 1 29  ? 9.584   23.275  -1.960  1.00 0.00 ? 29  ALA C N    2  
ATOM   10074  C CA   . ALA C 1 29  ? 9.327   23.679  -0.581  1.00 0.00 ? 29  ALA C CA   2  
ATOM   10075  C C    . ALA C 1 29  ? 10.641  23.954  0.146   1.00 0.00 ? 29  ALA C C    2  
ATOM   10076  O O    . ALA C 1 29  ? 10.770  24.939  0.870   1.00 0.00 ? 29  ALA C O    2  
ATOM   10077  C CB   . ALA C 1 29  ? 8.547   22.580  0.150   1.00 0.00 ? 29  ALA C CB   2  
ATOM   10078  H H    . ALA C 1 29  ? 9.285   22.393  -2.269  1.00 0.00 ? 29  ALA C H    2  
ATOM   10079  H HA   . ALA C 1 29  ? 8.736   24.583  -0.585  1.00 0.00 ? 29  ALA C HA   2  
ATOM   10080  H HB1  . ALA C 1 29  ? 9.232   21.831  0.516   1.00 0.00 ? 29  ALA C HB1  2  
ATOM   10081  H HB2  . ALA C 1 29  ? 8.011   23.013  0.983   1.00 0.00 ? 29  ALA C HB2  2  
ATOM   10082  H HB3  . ALA C 1 29  ? 7.845   22.123  -0.530  1.00 0.00 ? 29  ALA C HB3  2  
ATOM   10083  N N    . LYS C 1 30  ? 11.622  23.084  -0.064  1.00 0.00 ? 30  LYS C N    2  
ATOM   10084  C CA   . LYS C 1 30  ? 12.923  23.261  0.571   1.00 0.00 ? 30  LYS C CA   2  
ATOM   10085  C C    . LYS C 1 30  ? 13.550  24.585  0.146   1.00 0.00 ? 30  LYS C C    2  
ATOM   10086  O O    . LYS C 1 30  ? 14.277  25.205  0.920   1.00 0.00 ? 30  LYS C O    2  
ATOM   10087  C CB   . LYS C 1 30  ? 13.869  22.113  0.204   1.00 0.00 ? 30  LYS C CB   2  
ATOM   10088  C CG   . LYS C 1 30  ? 13.396  20.818  0.864   1.00 0.00 ? 30  LYS C CG   2  
ATOM   10089  C CD   . LYS C 1 30  ? 14.410  19.707  0.568   1.00 0.00 ? 30  LYS C CD   2  
ATOM   10090  C CE   . LYS C 1 30  ? 13.964  18.406  1.237   1.00 0.00 ? 30  LYS C CE   2  
ATOM   10091  N NZ   . LYS C 1 30  ? 14.974  17.346  0.966   1.00 0.00 ? 30  LYS C NZ   2  
ATOM   10092  H H    . LYS C 1 30  ? 11.468  22.319  -0.660  1.00 0.00 ? 30  LYS C H    2  
ATOM   10093  H HA   . LYS C 1 30  ? 12.789  23.273  1.641   1.00 0.00 ? 30  LYS C HA   2  
ATOM   10094  H HB2  . LYS C 1 30  ? 13.883  21.989  -0.871  1.00 0.00 ? 30  LYS C HB2  2  
ATOM   10095  H HB3  . LYS C 1 30  ? 14.867  22.349  0.549   1.00 0.00 ? 30  LYS C HB3  2  
ATOM   10096  H HG2  . LYS C 1 30  ? 13.317  20.964  1.930   1.00 0.00 ? 30  LYS C HG2  2  
ATOM   10097  H HG3  . LYS C 1 30  ? 12.430  20.542  0.462   1.00 0.00 ? 30  LYS C HG3  2  
ATOM   10098  H HD2  . LYS C 1 30  ? 14.475  19.558  -0.503  1.00 0.00 ? 30  LYS C HD2  2  
ATOM   10099  H HD3  . LYS C 1 30  ? 15.381  19.994  0.948   1.00 0.00 ? 30  LYS C HD3  2  
ATOM   10100  H HE2  . LYS C 1 30  ? 13.879  18.561  2.304   1.00 0.00 ? 30  LYS C HE2  2  
ATOM   10101  H HE3  . LYS C 1 30  ? 13.004  18.105  0.837   1.00 0.00 ? 30  LYS C HE3  2  
ATOM   10102  H HZ1  . LYS C 1 30  ? 15.933  17.717  1.142   1.00 0.00 ? 30  LYS C HZ1  2  
ATOM   10103  H HZ2  . LYS C 1 30  ? 14.798  16.528  1.595   1.00 0.00 ? 30  LYS C HZ2  2  
ATOM   10104  H HZ3  . LYS C 1 30  ? 14.897  17.032  -0.021  1.00 0.00 ? 30  LYS C HZ3  2  
ATOM   10105  N N    . GLN C 1 31  ? 13.261  25.014  -1.080  1.00 0.00 ? 31  GLN C N    2  
ATOM   10106  C CA   . GLN C 1 31  ? 13.806  26.272  -1.579  1.00 0.00 ? 31  GLN C CA   2  
ATOM   10107  C C    . GLN C 1 31  ? 12.992  27.447  -1.034  1.00 0.00 ? 31  GLN C C    2  
ATOM   10108  O O    . GLN C 1 31  ? 13.310  28.605  -1.290  1.00 0.00 ? 31  GLN C O    2  
ATOM   10109  C CB   . GLN C 1 31  ? 13.795  26.290  -3.114  1.00 0.00 ? 31  GLN C CB   2  
ATOM   10110  C CG   . GLN C 1 31  ? 14.367  24.967  -3.674  1.00 0.00 ? 31  GLN C CG   2  
ATOM   10111  C CD   . GLN C 1 31  ? 15.368  25.235  -4.797  1.00 0.00 ? 31  GLN C CD   2  
ATOM   10112  O OE1  . GLN C 1 31  ? 15.278  26.239  -5.491  1.00 0.00 ? 31  GLN C OE1  2  
ATOM   10113  N NE2  . GLN C 1 31  ? 16.325  24.381  -5.021  1.00 0.00 ? 31  GLN C NE2  2  
ATOM   10114  H H    . GLN C 1 31  ? 12.673  24.479  -1.655  1.00 0.00 ? 31  GLN C H    2  
ATOM   10115  H HA   . GLN C 1 31  ? 14.825  26.375  -1.235  1.00 0.00 ? 31  GLN C HA   2  
ATOM   10116  H HB2  . GLN C 1 31  ? 12.778  26.420  -3.457  1.00 0.00 ? 31  GLN C HB2  2  
ATOM   10117  H HB3  . GLN C 1 31  ? 14.397  27.118  -3.460  1.00 0.00 ? 31  GLN C HB3  2  
ATOM   10118  H HG2  . GLN C 1 31  ? 14.864  24.422  -2.886  1.00 0.00 ? 31  GLN C HG2  2  
ATOM   10119  H HG3  . GLN C 1 31  ? 13.558  24.367  -4.063  1.00 0.00 ? 31  GLN C HG3  2  
ATOM   10120  H HE21 . GLN C 1 31  ? 16.402  23.577  -4.472  1.00 0.00 ? 31  GLN C HE21 2  
ATOM   10121  H HE22 . GLN C 1 31  ? 16.971  24.552  -5.738  1.00 0.00 ? 31  GLN C HE22 2  
ATOM   10122  N N    . GLY C 1 32  ? 11.950  27.132  -0.266  1.00 0.00 ? 32  GLY C N    2  
ATOM   10123  C CA   . GLY C 1 32  ? 11.100  28.166  0.325   1.00 0.00 ? 32  GLY C CA   2  
ATOM   10124  C C    . GLY C 1 32  ? 10.056  28.673  -0.667  1.00 0.00 ? 32  GLY C C    2  
ATOM   10125  O O    . GLY C 1 32  ? 9.448   29.723  -0.456  1.00 0.00 ? 32  GLY C O    2  
ATOM   10126  H H    . GLY C 1 32  ? 11.752  26.188  -0.085  1.00 0.00 ? 32  GLY C H    2  
ATOM   10127  H HA2  . GLY C 1 32  ? 10.596  27.755  1.190   1.00 0.00 ? 32  GLY C HA2  2  
ATOM   10128  H HA3  . GLY C 1 32  ? 11.719  28.992  0.639   1.00 0.00 ? 32  GLY C HA3  2  
ATOM   10129  N N    . ASP C 1 33  ? 9.842   27.916  -1.741  1.00 0.00 ? 33  ASP C N    2  
ATOM   10130  C CA   . ASP C 1 33  ? 8.862   28.292  -2.759  1.00 0.00 ? 33  ASP C CA   2  
ATOM   10131  C C    . ASP C 1 33  ? 7.545   27.554  -2.532  1.00 0.00 ? 33  ASP C C    2  
ATOM   10132  O O    . ASP C 1 33  ? 7.273   26.528  -3.165  1.00 0.00 ? 33  ASP C O    2  
ATOM   10133  C CB   . ASP C 1 33  ? 9.412   27.957  -4.146  1.00 0.00 ? 33  ASP C CB   2  
ATOM   10134  C CG   . ASP C 1 33  ? 10.550  28.902  -4.504  1.00 0.00 ? 33  ASP C CG   2  
ATOM   10135  O OD1  . ASP C 1 33  ? 10.739  29.872  -3.793  1.00 0.00 ? 33  ASP C OD1  2  
ATOM   10136  O OD2  . ASP C 1 33  ? 11.208  28.646  -5.494  1.00 0.00 ? 33  ASP C OD2  2  
ATOM   10137  H H    . ASP C 1 33  ? 10.353  27.087  -1.852  1.00 0.00 ? 33  ASP C H    2  
ATOM   10138  H HA   . ASP C 1 33  ? 8.685   29.358  -2.704  1.00 0.00 ? 33  ASP C HA   2  
ATOM   10139  H HB2  . ASP C 1 33  ? 9.779   26.941  -4.149  1.00 0.00 ? 33  ASP C HB2  2  
ATOM   10140  H HB3  . ASP C 1 33  ? 8.625   28.055  -4.877  1.00 0.00 ? 33  ASP C HB3  2  
ATOM   10141  N N    . PHE C 1 34  ? 6.730   28.068  -1.619  1.00 0.00 ? 34  PHE C N    2  
ATOM   10142  C CA   . PHE C 1 34  ? 5.448   27.436  -1.310  1.00 0.00 ? 34  PHE C CA   2  
ATOM   10143  C C    . PHE C 1 34  ? 4.491   27.477  -2.498  1.00 0.00 ? 34  PHE C C    2  
ATOM   10144  O O    . PHE C 1 34  ? 3.704   26.552  -2.701  1.00 0.00 ? 34  PHE C O    2  
ATOM   10145  C CB   . PHE C 1 34  ? 4.782   28.143  -0.128  1.00 0.00 ? 34  PHE C CB   2  
ATOM   10146  C CG   . PHE C 1 34  ? 5.631   27.996  1.107   1.00 0.00 ? 34  PHE C CG   2  
ATOM   10147  C CD1  . PHE C 1 34  ? 6.221   29.123  1.692   1.00 0.00 ? 34  PHE C CD1  2  
ATOM   10148  C CD2  . PHE C 1 34  ? 5.841   26.729  1.662   1.00 0.00 ? 34  PHE C CD2  2  
ATOM   10149  C CE1  . PHE C 1 34  ? 7.000   28.983  2.845   1.00 0.00 ? 34  PHE C CE1  2  
ATOM   10150  C CE2  . PHE C 1 34  ? 6.620   26.590  2.813   1.00 0.00 ? 34  PHE C CE2  2  
ATOM   10151  C CZ   . PHE C 1 34  ? 7.207   27.715  3.396   1.00 0.00 ? 34  PHE C CZ   2  
ATOM   10152  H H    . PHE C 1 34  ? 6.999   28.880  -1.138  1.00 0.00 ? 34  PHE C H    2  
ATOM   10153  H HA   . PHE C 1 34  ? 5.623   26.406  -1.041  1.00 0.00 ? 34  PHE C HA   2  
ATOM   10154  H HB2  . PHE C 1 34  ? 4.660   29.192  -0.359  1.00 0.00 ? 34  PHE C HB2  2  
ATOM   10155  H HB3  . PHE C 1 34  ? 3.813   27.700  0.053   1.00 0.00 ? 34  PHE C HB3  2  
ATOM   10156  H HD1  . PHE C 1 34  ? 6.062   30.100  1.265   1.00 0.00 ? 34  PHE C HD1  2  
ATOM   10157  H HD2  . PHE C 1 34  ? 5.387   25.859  1.211   1.00 0.00 ? 34  PHE C HD2  2  
ATOM   10158  H HE1  . PHE C 1 34  ? 7.456   29.851  3.300   1.00 0.00 ? 34  PHE C HE1  2  
ATOM   10159  H HE2  . PHE C 1 34  ? 6.783   25.613  3.243   1.00 0.00 ? 34  PHE C HE2  2  
ATOM   10160  H HZ   . PHE C 1 34  ? 7.812   27.610  4.287   1.00 0.00 ? 34  PHE C HZ   2  
ATOM   10161  N N    . ALA C 1 35  ? 4.547   28.560  -3.267  1.00 0.00 ? 35  ALA C N    2  
ATOM   10162  C CA   . ALA C 1 35  ? 3.658   28.719  -4.414  1.00 0.00 ? 35  ALA C CA   2  
ATOM   10163  C C    . ALA C 1 35  ? 3.897   27.618  -5.445  1.00 0.00 ? 35  ALA C C    2  
ATOM   10164  O O    . ALA C 1 35  ? 2.959   26.954  -5.890  1.00 0.00 ? 35  ALA C O    2  
ATOM   10165  C CB   . ALA C 1 35  ? 3.879   30.099  -5.048  1.00 0.00 ? 35  ALA C CB   2  
ATOM   10166  H H    . ALA C 1 35  ? 5.186   29.270  -3.050  1.00 0.00 ? 35  ALA C H    2  
ATOM   10167  H HA   . ALA C 1 35  ? 2.634   28.653  -4.072  1.00 0.00 ? 35  ALA C HA   2  
ATOM   10168  H HB1  . ALA C 1 35  ? 3.209   30.816  -4.595  1.00 0.00 ? 35  ALA C HB1  2  
ATOM   10169  H HB2  . ALA C 1 35  ? 4.900   30.410  -4.888  1.00 0.00 ? 35  ALA C HB2  2  
ATOM   10170  H HB3  . ALA C 1 35  ? 3.681   30.047  -6.110  1.00 0.00 ? 35  ALA C HB3  2  
ATOM   10171  N N    . ALA C 1 36  ? 5.155   27.430  -5.821  1.00 0.00 ? 36  ALA C N    2  
ATOM   10172  C CA   . ALA C 1 36  ? 5.493   26.410  -6.803  1.00 0.00 ? 36  ALA C CA   2  
ATOM   10173  C C    . ALA C 1 36  ? 5.206   25.018  -6.245  1.00 0.00 ? 36  ALA C C    2  
ATOM   10174  O O    . ALA C 1 36  ? 4.724   24.138  -6.959  1.00 0.00 ? 36  ALA C O    2  
ATOM   10175  C CB   . ALA C 1 36  ? 6.969   26.546  -7.221  1.00 0.00 ? 36  ALA C CB   2  
ATOM   10176  H H    . ALA C 1 36  ? 5.861   27.984  -5.431  1.00 0.00 ? 36  ALA C H    2  
ATOM   10177  H HA   . ALA C 1 36  ? 4.871   26.555  -7.674  1.00 0.00 ? 36  ALA C HA   2  
ATOM   10178  H HB1  . ALA C 1 36  ? 7.406   27.401  -6.727  1.00 0.00 ? 36  ALA C HB1  2  
ATOM   10179  H HB2  . ALA C 1 36  ? 7.513   25.654  -6.944  1.00 0.00 ? 36  ALA C HB2  2  
ATOM   10180  H HB3  . ALA C 1 36  ? 7.028   26.683  -8.293  1.00 0.00 ? 36  ALA C HB3  2  
ATOM   10181  N N    . ALA C 1 37  ? 5.472   24.825  -4.960  1.00 0.00 ? 37  ALA C N    2  
ATOM   10182  C CA   . ALA C 1 37  ? 5.207   23.534  -4.340  1.00 0.00 ? 37  ALA C CA   2  
ATOM   10183  C C    . ALA C 1 37  ? 3.721   23.204  -4.471  1.00 0.00 ? 37  ALA C C    2  
ATOM   10184  O O    . ALA C 1 37  ? 3.349   22.135  -4.958  1.00 0.00 ? 37  ALA C O    2  
ATOM   10185  C CB   . ALA C 1 37  ? 5.621   23.561  -2.859  1.00 0.00 ? 37  ALA C CB   2  
ATOM   10186  H H    . ALA C 1 37  ? 5.833   25.560  -4.421  1.00 0.00 ? 37  ALA C H    2  
ATOM   10187  H HA   . ALA C 1 37  ? 5.777   22.772  -4.851  1.00 0.00 ? 37  ALA C HA   2  
ATOM   10188  H HB1  . ALA C 1 37  ? 6.652   23.246  -2.766  1.00 0.00 ? 37  ALA C HB1  2  
ATOM   10189  H HB2  . ALA C 1 37  ? 5.518   24.562  -2.472  1.00 0.00 ? 37  ALA C HB2  2  
ATOM   10190  H HB3  . ALA C 1 37  ? 4.992   22.890  -2.293  1.00 0.00 ? 37  ALA C HB3  2  
ATOM   10191  N N    . LYS C 1 38  ? 2.880   24.141  -4.043  1.00 0.00 ? 38  LYS C N    2  
ATOM   10192  C CA   . LYS C 1 38  ? 1.429   23.967  -4.110  1.00 0.00 ? 38  LYS C CA   2  
ATOM   10193  C C    . LYS C 1 38  ? 0.975   23.616  -5.533  1.00 0.00 ? 38  LYS C C    2  
ATOM   10194  O O    . LYS C 1 38  ? 0.175   22.700  -5.732  1.00 0.00 ? 38  LYS C O    2  
ATOM   10195  C CB   . LYS C 1 38  ? 0.747   25.269  -3.635  1.00 0.00 ? 38  LYS C CB   2  
ATOM   10196  C CG   . LYS C 1 38  ? -0.330  24.978  -2.577  1.00 0.00 ? 38  LYS C CG   2  
ATOM   10197  C CD   . LYS C 1 38  ? -0.836  26.310  -2.003  1.00 0.00 ? 38  LYS C CD   2  
ATOM   10198  C CE   . LYS C 1 38  ? -2.148  26.090  -1.243  1.00 0.00 ? 38  LYS C CE   2  
ATOM   10199  N NZ   . LYS C 1 38  ? -1.912  25.163  -0.098  1.00 0.00 ? 38  LYS C NZ   2  
ATOM   10200  H H    . LYS C 1 38  ? 3.243   24.976  -3.678  1.00 0.00 ? 38  LYS C H    2  
ATOM   10201  H HA   . LYS C 1 38  ? 1.147   23.160  -3.453  1.00 0.00 ? 38  LYS C HA   2  
ATOM   10202  H HB2  . LYS C 1 38  ? 1.495   25.917  -3.201  1.00 0.00 ? 38  LYS C HB2  2  
ATOM   10203  H HB3  . LYS C 1 38  ? 0.294   25.769  -4.479  1.00 0.00 ? 38  LYS C HB3  2  
ATOM   10204  H HG2  . LYS C 1 38  ? -1.152  24.442  -3.034  1.00 0.00 ? 38  LYS C HG2  2  
ATOM   10205  H HG3  . LYS C 1 38  ? 0.095   24.383  -1.780  1.00 0.00 ? 38  LYS C HG3  2  
ATOM   10206  H HD2  . LYS C 1 38  ? -0.094  26.720  -1.331  1.00 0.00 ? 38  LYS C HD2  2  
ATOM   10207  H HD3  . LYS C 1 38  ? -1.009  27.008  -2.812  1.00 0.00 ? 38  LYS C HD3  2  
ATOM   10208  H HE2  . LYS C 1 38  ? -2.509  27.039  -0.870  1.00 0.00 ? 38  LYS C HE2  2  
ATOM   10209  H HE3  . LYS C 1 38  ? -2.883  25.663  -1.912  1.00 0.00 ? 38  LYS C HE3  2  
ATOM   10210  H HZ1  . LYS C 1 38  ? -0.909  25.200  0.182   1.00 0.00 ? 38  LYS C HZ1  2  
ATOM   10211  H HZ2  . LYS C 1 38  ? -2.504  25.449  0.709   1.00 0.00 ? 38  LYS C HZ2  2  
ATOM   10212  H HZ3  . LYS C 1 38  ? -2.153  24.192  -0.381  1.00 0.00 ? 38  LYS C HZ3  2  
ATOM   10213  N N    . ALA C 1 39  ? 1.486   24.349  -6.517  1.00 0.00 ? 39  ALA C N    2  
ATOM   10214  C CA   . ALA C 1 39  ? 1.113   24.109  -7.911  1.00 0.00 ? 39  ALA C CA   2  
ATOM   10215  C C    . ALA C 1 39  ? 1.529   22.708  -8.366  1.00 0.00 ? 39  ALA C C    2  
ATOM   10216  O O    . ALA C 1 39  ? 0.779   22.016  -9.056  1.00 0.00 ? 39  ALA C O    2  
ATOM   10217  C CB   . ALA C 1 39  ? 1.772   25.160  -8.812  1.00 0.00 ? 39  ALA C CB   2  
ATOM   10218  H H    . ALA C 1 39  ? 2.119   25.065  -6.303  1.00 0.00 ? 39  ALA C H    2  
ATOM   10219  H HA   . ALA C 1 39  ? 0.042   24.196  -8.003  1.00 0.00 ? 39  ALA C HA   2  
ATOM   10220  H HB1  . ALA C 1 39  ? 1.809   26.108  -8.293  1.00 0.00 ? 39  ALA C HB1  2  
ATOM   10221  H HB2  . ALA C 1 39  ? 2.776   24.848  -9.060  1.00 0.00 ? 39  ALA C HB2  2  
ATOM   10222  H HB3  . ALA C 1 39  ? 1.195   25.271  -9.719  1.00 0.00 ? 39  ALA C HB3  2  
ATOM   10223  N N    . MET C 1 40  ? 2.730   22.304  -7.976  1.00 0.00 ? 40  MET C N    2  
ATOM   10224  C CA   . MET C 1 40  ? 3.245   20.988  -8.349  1.00 0.00 ? 40  MET C CA   2  
ATOM   10225  C C    . MET C 1 40  ? 2.417   19.881  -7.702  1.00 0.00 ? 40  MET C C    2  
ATOM   10226  O O    . MET C 1 40  ? 2.129   18.859  -8.332  1.00 0.00 ? 40  MET C O    2  
ATOM   10227  C CB   . MET C 1 40  ? 4.711   20.865  -7.924  1.00 0.00 ? 40  MET C CB   2  
ATOM   10228  C CG   . MET C 1 40  ? 5.567   21.833  -8.749  1.00 0.00 ? 40  MET C CG   2  
ATOM   10229  S SD   . MET C 1 40  ? 5.713   21.233  -10.450 1.00 0.00 ? 40  MET C SD   2  
ATOM   10230  C CE   . MET C 1 40  ? 7.132   20.147  -10.181 1.00 0.00 ? 40  MET C CE   2  
ATOM   10231  H H    . MET C 1 40  ? 3.283   22.901  -7.429  1.00 0.00 ? 40  MET C H    2  
ATOM   10232  H HA   . MET C 1 40  ? 3.185   20.882  -9.421  1.00 0.00 ? 40  MET C HA   2  
ATOM   10233  H HB2  . MET C 1 40  ? 4.800   21.107  -6.875  1.00 0.00 ? 40  MET C HB2  2  
ATOM   10234  H HB3  . MET C 1 40  ? 5.051   19.852  -8.090  1.00 0.00 ? 40  MET C HB3  2  
ATOM   10235  H HG2  . MET C 1 40  ? 5.103   22.808  -8.754  1.00 0.00 ? 40  MET C HG2  2  
ATOM   10236  H HG3  . MET C 1 40  ? 6.551   21.908  -8.308  1.00 0.00 ? 40  MET C HG3  2  
ATOM   10237  H HE1  . MET C 1 40  ? 7.955   20.723  -9.781  1.00 0.00 ? 40  MET C HE1  2  
ATOM   10238  H HE2  . MET C 1 40  ? 6.862   19.374  -9.480  1.00 0.00 ? 40  MET C HE2  2  
ATOM   10239  H HE3  . MET C 1 40  ? 7.423   19.695  -11.119 1.00 0.00 ? 40  MET C HE3  2  
ATOM   10240  N N    . MET C 1 41  ? 2.026   20.086  -6.451  1.00 0.00 ? 41  MET C N    2  
ATOM   10241  C CA   . MET C 1 41  ? 1.218   19.095  -5.747  1.00 0.00 ? 41  MET C CA   2  
ATOM   10242  C C    . MET C 1 41  ? -0.122  18.897  -6.447  1.00 0.00 ? 41  MET C C    2  
ATOM   10243  O O    . MET C 1 41  ? -0.608  17.769  -6.585  1.00 0.00 ? 41  MET C O    2  
ATOM   10244  C CB   . MET C 1 41  ? 0.915   19.554  -4.320  1.00 0.00 ? 41  MET C CB   2  
ATOM   10245  C CG   . MET C 1 41  ? 2.199   19.690  -3.487  1.00 0.00 ? 41  MET C CG   2  
ATOM   10246  S SD   . MET C 1 41  ? 1.873   19.191  -1.769  1.00 0.00 ? 41  MET C SD   2  
ATOM   10247  C CE   . MET C 1 41  ? 0.325   20.098  -1.519  1.00 0.00 ? 41  MET C CE   2  
ATOM   10248  H H    . MET C 1 41  ? 2.275   20.921  -5.996  1.00 0.00 ? 41  MET C H    2  
ATOM   10249  H HA   . MET C 1 41  ? 1.748   18.156  -5.718  1.00 0.00 ? 41  MET C HA   2  
ATOM   10250  H HB2  . MET C 1 41  ? 0.413   20.510  -4.364  1.00 0.00 ? 41  MET C HB2  2  
ATOM   10251  H HB3  . MET C 1 41  ? 0.261   18.832  -3.857  1.00 0.00 ? 41  MET C HB3  2  
ATOM   10252  H HG2  . MET C 1 41  ? 2.971   19.060  -3.898  1.00 0.00 ? 41  MET C HG2  2  
ATOM   10253  H HG3  . MET C 1 41  ? 2.528   20.717  -3.501  1.00 0.00 ? 41  MET C HG3  2  
ATOM   10254  H HE1  . MET C 1 41  ? 0.307   20.973  -2.149  1.00 0.00 ? 41  MET C HE1  2  
ATOM   10255  H HE2  . MET C 1 41  ? -0.506  19.458  -1.771  1.00 0.00 ? 41  MET C HE2  2  
ATOM   10256  H HE3  . MET C 1 41  ? 0.252   20.401  -0.481  1.00 0.00 ? 41  MET C HE3  2  
ATOM   10257  N N    . ASP C 1 42  ? -0.727  20.010  -6.847  1.00 0.00 ? 42  ASP C N    2  
ATOM   10258  C CA   . ASP C 1 42  ? -2.030  19.973  -7.494  1.00 0.00 ? 42  ASP C CA   2  
ATOM   10259  C C    . ASP C 1 42  ? -1.968  19.156  -8.781  1.00 0.00 ? 42  ASP C C    2  
ATOM   10260  O O    . ASP C 1 42  ? -2.815  18.290  -9.029  1.00 0.00 ? 42  ASP C O    2  
ATOM   10261  C CB   . ASP C 1 42  ? -2.490  21.412  -7.789  1.00 0.00 ? 42  ASP C CB   2  
ATOM   10262  C CG   . ASP C 1 42  ? -4.008  21.529  -7.676  1.00 0.00 ? 42  ASP C CG   2  
ATOM   10263  O OD1  . ASP C 1 42  ? -4.559  20.975  -6.736  1.00 0.00 ? 42  ASP C OD1  2  
ATOM   10264  O OD2  . ASP C 1 42  ? -4.593  22.182  -8.521  1.00 0.00 ? 42  ASP C OD2  2  
ATOM   10265  H H    . ASP C 1 42  ? -0.297  20.877  -6.688  1.00 0.00 ? 42  ASP C H    2  
ATOM   10266  H HA   . ASP C 1 42  ? -2.735  19.512  -6.821  1.00 0.00 ? 42  ASP C HA   2  
ATOM   10267  H HB2  . ASP C 1 42  ? -2.034  22.084  -7.078  1.00 0.00 ? 42  ASP C HB2  2  
ATOM   10268  H HB3  . ASP C 1 42  ? -2.186  21.689  -8.786  1.00 0.00 ? 42  ASP C HB3  2  
ATOM   10269  N N    . GLN C 1 43  ? -0.950  19.420  -9.586  1.00 0.00 ? 43  GLN C N    2  
ATOM   10270  C CA   . GLN C 1 43  ? -0.779  18.693  -10.838 1.00 0.00 ? 43  GLN C CA   2  
ATOM   10271  C C    . GLN C 1 43  ? -0.531  17.213  -10.571 1.00 0.00 ? 43  GLN C C    2  
ATOM   10272  O O    . GLN C 1 43  ? -1.071  16.347  -11.262 1.00 0.00 ? 43  GLN C O    2  
ATOM   10273  C CB   . GLN C 1 43  ? 0.377   19.281  -11.646 1.00 0.00 ? 43  GLN C CB   2  
ATOM   10274  C CG   . GLN C 1 43  ? 0.015   20.702  -12.092 1.00 0.00 ? 43  GLN C CG   2  
ATOM   10275  C CD   . GLN C 1 43  ? 1.040   21.221  -13.091 1.00 0.00 ? 43  GLN C CD   2  
ATOM   10276  O OE1  . GLN C 1 43  ? 1.989   20.522  -13.434 1.00 0.00 ? 43  GLN C OE1  2  
ATOM   10277  N NE2  . GLN C 1 43  ? 0.905   22.414  -13.585 1.00 0.00 ? 43  GLN C NE2  2  
ATOM   10278  H H    . GLN C 1 43  ? -0.299  20.109  -9.327  1.00 0.00 ? 43  GLN C H    2  
ATOM   10279  H HA   . GLN C 1 43  ? -1.687  18.788  -11.415 1.00 0.00 ? 43  GLN C HA   2  
ATOM   10280  H HB2  . GLN C 1 43  ? 1.271   19.309  -11.037 1.00 0.00 ? 43  GLN C HB2  2  
ATOM   10281  H HB3  . GLN C 1 43  ? 0.556   18.669  -12.519 1.00 0.00 ? 43  GLN C HB3  2  
ATOM   10282  H HG2  . GLN C 1 43  ? -0.960  20.693  -12.557 1.00 0.00 ? 43  GLN C HG2  2  
ATOM   10283  H HG3  . GLN C 1 43  ? -0.006  21.350  -11.230 1.00 0.00 ? 43  GLN C HG3  2  
ATOM   10284  H HE21 . GLN C 1 43  ? 0.149   22.972  -13.316 1.00 0.00 ? 43  GLN C HE21 2  
ATOM   10285  H HE22 . GLN C 1 43  ? 1.563   22.754  -14.225 1.00 0.00 ? 43  GLN C HE22 2  
ATOM   10286  N N    . SER C 1 44  ? 0.273   16.923  -9.556  1.00 0.00 ? 44  SER C N    2  
ATOM   10287  C CA   . SER C 1 44  ? 0.559   15.535  -9.204  1.00 0.00 ? 44  SER C CA   2  
ATOM   10288  C C    . SER C 1 44  ? -0.742  14.812  -8.847  1.00 0.00 ? 44  SER C C    2  
ATOM   10289  O O    . SER C 1 44  ? -1.002  13.702  -9.312  1.00 0.00 ? 44  SER C O    2  
ATOM   10290  C CB   . SER C 1 44  ? 1.543   15.491  -8.027  1.00 0.00 ? 44  SER C CB   2  
ATOM   10291  O OG   . SER C 1 44  ? 2.642   14.664  -8.374  1.00 0.00 ? 44  SER C OG   2  
ATOM   10292  H H    . SER C 1 44  ? 0.669   17.651  -9.028  1.00 0.00 ? 44  SER C H    2  
ATOM   10293  H HA   . SER C 1 44  ? 1.008   15.046  -10.055 1.00 0.00 ? 44  SER C HA   2  
ATOM   10294  H HB2  . SER C 1 44  ? 1.903   16.485  -7.819  1.00 0.00 ? 44  SER C HB2  2  
ATOM   10295  H HB3  . SER C 1 44  ? 1.045   15.100  -7.148  1.00 0.00 ? 44  SER C HB3  2  
ATOM   10296  H HG   . SER C 1 44  ? 3.156   14.484  -7.578  1.00 0.00 ? 44  SER C HG   2  
ATOM   10297  N N    . ARG C 1 45  ? -1.567  15.466  -8.032  1.00 0.00 ? 45  ARG C N    2  
ATOM   10298  C CA   . ARG C 1 45  ? -2.857  14.911  -7.622  1.00 0.00 ? 45  ARG C CA   2  
ATOM   10299  C C    . ARG C 1 45  ? -3.739  14.614  -8.838  1.00 0.00 ? 45  ARG C C    2  
ATOM   10300  O O    . ARG C 1 45  ? -4.352  13.548  -8.935  1.00 0.00 ? 45  ARG C O    2  
ATOM   10301  C CB   . ARG C 1 45  ? -3.549  15.926  -6.704  1.00 0.00 ? 45  ARG C CB   2  
ATOM   10302  C CG   . ARG C 1 45  ? -4.870  15.363  -6.158  1.00 0.00 ? 45  ARG C CG   2  
ATOM   10303  C CD   . ARG C 1 45  ? -5.569  16.422  -5.277  1.00 0.00 ? 45  ARG C CD   2  
ATOM   10304  N NE   . ARG C 1 45  ? -6.756  15.823  -4.648  1.00 0.00 ? 45  ARG C NE   2  
ATOM   10305  C CZ   . ARG C 1 45  ? -7.547  16.495  -3.819  1.00 0.00 ? 45  ARG C CZ   2  
ATOM   10306  N NH1  . ARG C 1 45  ? -7.253  17.698  -3.463  1.00 0.00 ? 45  ARG C NH1  2  
ATOM   10307  N NH2  . ARG C 1 45  ? -8.592  15.906  -3.321  1.00 0.00 ? 45  ARG C NH2  2  
ATOM   10308  H H    . ARG C 1 45  ? -1.311  16.358  -7.713  1.00 0.00 ? 45  ARG C H    2  
ATOM   10309  H HA   . ARG C 1 45  ? -2.691  13.994  -7.077  1.00 0.00 ? 45  ARG C HA   2  
ATOM   10310  H HB2  . ARG C 1 45  ? -2.892  16.160  -5.884  1.00 0.00 ? 45  ARG C HB2  2  
ATOM   10311  H HB3  . ARG C 1 45  ? -3.751  16.825  -7.269  1.00 0.00 ? 45  ARG C HB3  2  
ATOM   10312  H HG2  . ARG C 1 45  ? -5.513  15.095  -6.984  1.00 0.00 ? 45  ARG C HG2  2  
ATOM   10313  H HG3  . ARG C 1 45  ? -4.665  14.485  -5.562  1.00 0.00 ? 45  ARG C HG3  2  
ATOM   10314  H HD2  . ARG C 1 45  ? -4.875  16.750  -4.505  1.00 0.00 ? 45  ARG C HD2  2  
ATOM   10315  H HD3  . ARG C 1 45  ? -5.865  17.269  -5.886  1.00 0.00 ? 45  ARG C HD3  2  
ATOM   10316  H HE   . ARG C 1 45  ? -6.968  14.890  -4.845  1.00 0.00 ? 45  ARG C HE   2  
ATOM   10317  H HH11 . ARG C 1 45  ? -6.429  18.137  -3.820  1.00 0.00 ? 45  ARG C HH11 2  
ATOM   10318  H HH12 . ARG C 1 45  ? -7.850  18.197  -2.841  1.00 0.00 ? 45  ARG C HH12 2  
ATOM   10319  H HH21 . ARG C 1 45  ? -8.802  14.960  -3.571  1.00 0.00 ? 45  ARG C HH21 2  
ATOM   10320  H HH22 . ARG C 1 45  ? -9.199  16.398  -2.701  1.00 0.00 ? 45  ARG C HH22 2  
ATOM   10321  N N    . MET C 1 46  ? -3.796  15.570  -9.761  1.00 0.00 ? 46  MET C N    2  
ATOM   10322  C CA   . MET C 1 46  ? -4.601  15.415  -10.971 1.00 0.00 ? 46  MET C CA   2  
ATOM   10323  C C    . MET C 1 46  ? -4.096  14.228  -11.793 1.00 0.00 ? 46  MET C C    2  
ATOM   10324  O O    . MET C 1 46  ? -4.885  13.430  -12.308 1.00 0.00 ? 46  MET C O    2  
ATOM   10325  C CB   . MET C 1 46  ? -4.551  16.696  -11.807 1.00 0.00 ? 46  MET C CB   2  
ATOM   10326  C CG   . MET C 1 46  ? -5.238  17.820  -11.032 1.00 0.00 ? 46  MET C CG   2  
ATOM   10327  S SD   . MET C 1 46  ? -4.983  19.408  -11.874 1.00 0.00 ? 46  MET C SD   2  
ATOM   10328  C CE   . MET C 1 46  ? -6.229  19.244  -13.181 1.00 0.00 ? 46  MET C CE   2  
ATOM   10329  H H    . MET C 1 46  ? -3.285  16.398  -9.625  1.00 0.00 ? 46  MET C H    2  
ATOM   10330  H HA   . MET C 1 46  ? -5.623  15.220  -10.684 1.00 0.00 ? 46  MET C HA   2  
ATOM   10331  H HB2  . MET C 1 46  ? -3.520  16.961  -11.994 1.00 0.00 ? 46  MET C HB2  2  
ATOM   10332  H HB3  . MET C 1 46  ? -5.061  16.538  -12.745 1.00 0.00 ? 46  MET C HB3  2  
ATOM   10333  H HG2  . MET C 1 46  ? -6.295  17.612  -10.965 1.00 0.00 ? 46  MET C HG2  2  
ATOM   10334  H HG3  . MET C 1 46  ? -4.825  17.871  -10.037 1.00 0.00 ? 46  MET C HG3  2  
ATOM   10335  H HE1  . MET C 1 46  ? -7.025  18.600  -12.847 1.00 0.00 ? 46  MET C HE1  2  
ATOM   10336  H HE2  . MET C 1 46  ? -6.626  20.223  -13.409 1.00 0.00 ? 46  MET C HE2  2  
ATOM   10337  H HE3  . MET C 1 46  ? -5.781  18.826  -14.069 1.00 0.00 ? 46  MET C HE3  2  
ATOM   10338  N N    . ALA C 1 47  ? -2.777  14.099  -11.892 1.00 0.00 ? 47  ALA C N    2  
ATOM   10339  C CA   . ALA C 1 47  ? -2.182  12.991  -12.640 1.00 0.00 ? 47  ALA C CA   2  
ATOM   10340  C C    . ALA C 1 47  ? -2.589  11.654  -12.018 1.00 0.00 ? 47  ALA C C    2  
ATOM   10341  O O    . ALA C 1 47  ? -2.943  10.706  -12.720 1.00 0.00 ? 47  ALA C O    2  
ATOM   10342  C CB   . ALA C 1 47  ? -0.655  13.121  -12.641 1.00 0.00 ? 47  ALA C CB   2  
ATOM   10343  H H    . ALA C 1 47  ? -2.194  14.750  -11.447 1.00 0.00 ? 47  ALA C H    2  
ATOM   10344  H HA   . ALA C 1 47  ? -2.538  13.023  -13.658 1.00 0.00 ? 47  ALA C HA   2  
ATOM   10345  H HB1  . ALA C 1 47  ? -0.310  13.341  -11.642 1.00 0.00 ? 47  ALA C HB1  2  
ATOM   10346  H HB2  . ALA C 1 47  ? -0.216  12.190  -12.976 1.00 0.00 ? 47  ALA C HB2  2  
ATOM   10347  H HB3  . ALA C 1 47  ? -0.362  13.918  -13.309 1.00 0.00 ? 47  ALA C HB3  2  
ATOM   10348  N N    . LEU C 1 48  ? -2.546  11.594  -10.691 1.00 0.00 ? 48  LEU C N    2  
ATOM   10349  C CA   . LEU C 1 48  ? -2.920  10.379  -9.967  1.00 0.00 ? 48  LEU C CA   2  
ATOM   10350  C C    . LEU C 1 48  ? -4.404  10.086  -10.132 1.00 0.00 ? 48  LEU C C    2  
ATOM   10351  O O    . LEU C 1 48  ? -4.812  8.934   -10.289 1.00 0.00 ? 48  LEU C O    2  
ATOM   10352  C CB   . LEU C 1 48  ? -2.628  10.558  -8.477  1.00 0.00 ? 48  LEU C CB   2  
ATOM   10353  C CG   . LEU C 1 48  ? -1.121  10.674  -8.251  1.00 0.00 ? 48  LEU C CG   2  
ATOM   10354  C CD1  . LEU C 1 48  ? -0.855  11.120  -6.812  1.00 0.00 ? 48  LEU C CD1  2  
ATOM   10355  C CD2  . LEU C 1 48  ? -0.436  9.323   -8.516  1.00 0.00 ? 48  LEU C CD2  2  
ATOM   10356  H H    . LEU C 1 48  ? -2.262  12.386  -10.185 1.00 0.00 ? 48  LEU C H    2  
ATOM   10357  H HA   . LEU C 1 48  ? -2.348  9.546   -10.344 1.00 0.00 ? 48  LEU C HA   2  
ATOM   10358  H HB2  . LEU C 1 48  ? -3.114  11.461  -8.129  1.00 0.00 ? 48  LEU C HB2  2  
ATOM   10359  H HB3  . LEU C 1 48  ? -3.015  9.711   -7.929  1.00 0.00 ? 48  LEU C HB3  2  
ATOM   10360  H HG   . LEU C 1 48  ? -0.723  11.417  -8.929  1.00 0.00 ? 48  LEU C HG   2  
ATOM   10361  H HD11 . LEU C 1 48  ? -1.534  10.613  -6.141  1.00 0.00 ? 48  LEU C HD11 2  
ATOM   10362  H HD12 . LEU C 1 48  ? 0.163   10.881  -6.541  1.00 0.00 ? 48  LEU C HD12 2  
ATOM   10363  H HD13 . LEU C 1 48  ? -1.004  12.185  -6.737  1.00 0.00 ? 48  LEU C HD13 2  
ATOM   10364  H HD21 . LEU C 1 48  ? -1.084  8.515   -8.214  1.00 0.00 ? 48  LEU C HD21 2  
ATOM   10365  H HD22 . LEU C 1 48  ? -0.218  9.233   -9.571  1.00 0.00 ? 48  LEU C HD22 2  
ATOM   10366  H HD23 . LEU C 1 48  ? 0.487   9.272   -7.956  1.00 0.00 ? 48  LEU C HD23 2  
ATOM   10367  N N    . ASN C 1 49  ? -5.206  11.140  -10.074 1.00 0.00 ? 49  ASN C N    2  
ATOM   10368  C CA   . ASN C 1 49  ? -6.650  11.000  -10.193 1.00 0.00 ? 49  ASN C CA   2  
ATOM   10369  C C    . ASN C 1 49  ? -7.007  10.356  -11.532 1.00 0.00 ? 49  ASN C C    2  
ATOM   10370  O O    . ASN C 1 49  ? -7.815  9.426   -11.593 1.00 0.00 ? 49  ASN C O    2  
ATOM   10371  C CB   . ASN C 1 49  ? -7.327  12.365  -10.074 1.00 0.00 ? 49  ASN C CB   2  
ATOM   10372  C CG   . ASN C 1 49  ? -8.837  12.210  -10.218 1.00 0.00 ? 49  ASN C CG   2  
ATOM   10373  O OD1  . ASN C 1 49  ? -9.308  11.252  -10.830 1.00 0.00 ? 49  ASN C OD1  2  
ATOM   10374  N ND2  . ASN C 1 49  ? -9.628  13.100  -9.684  1.00 0.00 ? 49  ASN C ND2  2  
ATOM   10375  H H    . ASN C 1 49  ? -4.818  12.031  -9.938  1.00 0.00 ? 49  ASN C H    2  
ATOM   10376  H HA   . ASN C 1 49  ? -6.998  10.360  -9.397  1.00 0.00 ? 49  ASN C HA   2  
ATOM   10377  H HB2  . ASN C 1 49  ? -7.100  12.795  -9.110  1.00 0.00 ? 49  ASN C HB2  2  
ATOM   10378  H HB3  . ASN C 1 49  ? -6.959  13.017  -10.853 1.00 0.00 ? 49  ASN C HB3  2  
ATOM   10379  H HD21 . ASN C 1 49  ? -9.251  13.860  -9.194  1.00 0.00 ? 49  ASN C HD21 2  
ATOM   10380  H HD22 . ASN C 1 49  ? -10.599 13.007  -9.772  1.00 0.00 ? 49  ASN C HD22 2  
ATOM   10381  N N    . GLU C 1 50  ? -6.380  10.836  -12.596 1.00 0.00 ? 50  GLU C N    2  
ATOM   10382  C CA   . GLU C 1 50  ? -6.621  10.278  -13.921 1.00 0.00 ? 50  GLU C CA   2  
ATOM   10383  C C    . GLU C 1 50  ? -6.142  8.832   -13.971 1.00 0.00 ? 50  GLU C C    2  
ATOM   10384  O O    . GLU C 1 50  ? -6.807  7.955   -14.528 1.00 0.00 ? 50  GLU C O    2  
ATOM   10385  C CB   . GLU C 1 50  ? -5.888  11.100  -14.987 1.00 0.00 ? 50  GLU C CB   2  
ATOM   10386  C CG   . GLU C 1 50  ? -6.190  10.521  -16.377 1.00 0.00 ? 50  GLU C CG   2  
ATOM   10387  C CD   . GLU C 1 50  ? -5.551  11.385  -17.456 1.00 0.00 ? 50  GLU C CD   2  
ATOM   10388  O OE1  . GLU C 1 50  ? -4.356  11.254  -17.659 1.00 0.00 ? 50  GLU C OE1  2  
ATOM   10389  O OE2  . GLU C 1 50  ? -6.266  12.163  -18.062 1.00 0.00 ? 50  GLU C OE2  2  
ATOM   10390  H H    . GLU C 1 50  ? -5.726  11.562  -12.485 1.00 0.00 ? 50  GLU C H    2  
ATOM   10391  H HA   . GLU C 1 50  ? -7.679  10.301  -14.129 1.00 0.00 ? 50  GLU C HA   2  
ATOM   10392  H HB2  . GLU C 1 50  ? -6.220  12.125  -14.944 1.00 0.00 ? 50  GLU C HB2  2  
ATOM   10393  H HB3  . GLU C 1 50  ? -4.822  11.057  -14.808 1.00 0.00 ? 50  GLU C HB3  2  
ATOM   10394  H HG2  . GLU C 1 50  ? -5.793  9.519   -16.444 1.00 0.00 ? 50  GLU C HG2  2  
ATOM   10395  H HG3  . GLU C 1 50  ? -7.257  10.493  -16.530 1.00 0.00 ? 50  GLU C HG3  2  
ATOM   10396  N N    . ALA C 1 51  ? -4.986  8.585   -13.366 1.00 0.00 ? 51  ALA C N    2  
ATOM   10397  C CA   . ALA C 1 51  ? -4.426  7.238   -13.335 1.00 0.00 ? 51  ALA C CA   2  
ATOM   10398  C C    . ALA C 1 51  ? -5.343  6.308   -12.533 1.00 0.00 ? 51  ALA C C    2  
ATOM   10399  O O    . ALA C 1 51  ? -5.645  5.192   -12.961 1.00 0.00 ? 51  ALA C O    2  
ATOM   10400  C CB   . ALA C 1 51  ? -3.017  7.276   -12.724 1.00 0.00 ? 51  ALA C CB   2  
ATOM   10401  H H    . ALA C 1 51  ? -4.504  9.318   -12.928 1.00 0.00 ? 51  ALA C H    2  
ATOM   10402  H HA   . ALA C 1 51  ? -4.359  6.866   -14.347 1.00 0.00 ? 51  ALA C HA   2  
ATOM   10403  H HB1  . ALA C 1 51  ? -3.063  7.003   -11.681 1.00 0.00 ? 51  ALA C HB1  2  
ATOM   10404  H HB2  . ALA C 1 51  ? -2.376  6.583   -13.249 1.00 0.00 ? 51  ALA C HB2  2  
ATOM   10405  H HB3  . ALA C 1 51  ? -2.613  8.276   -12.815 1.00 0.00 ? 51  ALA C HB3  2  
ATOM   10406  N N    . HIS C 1 52  ? -5.795  6.788   -11.378 1.00 0.00 ? 52  HIS C N    2  
ATOM   10407  C CA   . HIS C 1 52  ? -6.692  6.008   -10.530 1.00 0.00 ? 52  HIS C CA   2  
ATOM   10408  C C    . HIS C 1 52  ? -7.994  5.692   -11.260 1.00 0.00 ? 52  HIS C C    2  
ATOM   10409  O O    . HIS C 1 52  ? -8.523  4.581   -11.155 1.00 0.00 ? 52  HIS C O    2  
ATOM   10410  C CB   . HIS C 1 52  ? -6.998  6.786   -9.250  1.00 0.00 ? 52  HIS C CB   2  
ATOM   10411  C CG   . HIS C 1 52  ? -7.814  5.927   -8.328  1.00 0.00 ? 52  HIS C CG   2  
ATOM   10412  N ND1  . HIS C 1 52  ? -9.161  5.687   -8.544  1.00 0.00 ? 52  HIS C ND1  2  
ATOM   10413  C CD2  . HIS C 1 52  ? -7.488  5.240   -7.184  1.00 0.00 ? 52  HIS C CD2  2  
ATOM   10414  C CE1  . HIS C 1 52  ? -9.593  4.886   -7.555  1.00 0.00 ? 52  HIS C CE1  2  
ATOM   10415  N NE2  . HIS C 1 52  ? -8.614  4.584   -6.697  1.00 0.00 ? 52  HIS C NE2  2  
ATOM   10416  H H    . HIS C 1 52  ? -5.531  7.693   -11.096 1.00 0.00 ? 52  HIS C H    2  
ATOM   10417  H HA   . HIS C 1 52  ? -6.208  5.081   -10.265 1.00 0.00 ? 52  HIS C HA   2  
ATOM   10418  H HB2  . HIS C 1 52  ? -6.073  7.059   -8.765  1.00 0.00 ? 52  HIS C HB2  2  
ATOM   10419  H HB3  . HIS C 1 52  ? -7.553  7.679   -9.495  1.00 0.00 ? 52  HIS C HB3  2  
ATOM   10420  H HD1  . HIS C 1 52  ? -9.700  6.037   -9.282  1.00 0.00 ? 52  HIS C HD1  2  
ATOM   10421  H HD2  . HIS C 1 52  ? -6.508  5.214   -6.732  1.00 0.00 ? 52  HIS C HD2  2  
ATOM   10422  H HE1  . HIS C 1 52  ? -10.607 4.529   -7.468  1.00 0.00 ? 52  HIS C HE1  2  
ATOM   10423  H HE2  . HIS C 1 52  ? -8.675  4.021   -5.897  1.00 0.00 ? 52  HIS C HE2  2  
ATOM   10424  N N    . LEU C 1 53  ? -8.506  6.672   -12.002 1.00 0.00 ? 53  LEU C N    2  
ATOM   10425  C CA   . LEU C 1 53  ? -9.746  6.488   -12.748 1.00 0.00 ? 53  LEU C CA   2  
ATOM   10426  C C    . LEU C 1 53  ? -9.589  5.353   -13.756 1.00 0.00 ? 53  LEU C C    2  
ATOM   10427  O O    . LEU C 1 53  ? -10.470 4.497   -13.889 1.00 0.00 ? 53  LEU C O    2  
ATOM   10428  C CB   . LEU C 1 53  ? -10.110 7.782   -13.486 1.00 0.00 ? 53  LEU C CB   2  
ATOM   10429  C CG   . LEU C 1 53  ? -10.727 8.791   -12.508 1.00 0.00 ? 53  LEU C CG   2  
ATOM   10430  C CD1  . LEU C 1 53  ? -10.714 10.183  -13.144 1.00 0.00 ? 53  LEU C CD1  2  
ATOM   10431  C CD2  . LEU C 1 53  ? -12.178 8.404   -12.189 1.00 0.00 ? 53  LEU C CD2  2  
ATOM   10432  H H    . LEU C 1 53  ? -8.036  7.535   -12.050 1.00 0.00 ? 53  LEU C H    2  
ATOM   10433  H HA   . LEU C 1 53  ? -10.539 6.236   -12.060 1.00 0.00 ? 53  LEU C HA   2  
ATOM   10434  H HB2  . LEU C 1 53  ? -9.216  8.207   -13.920 1.00 0.00 ? 53  LEU C HB2  2  
ATOM   10435  H HB3  . LEU C 1 53  ? -10.817 7.561   -14.271 1.00 0.00 ? 53  LEU C HB3  2  
ATOM   10436  H HG   . LEU C 1 53  ? -10.147 8.808   -11.596 1.00 0.00 ? 53  LEU C HG   2  
ATOM   10437  H HD11 . LEU C 1 53  ? -10.929 10.099  -14.199 1.00 0.00 ? 53  LEU C HD11 2  
ATOM   10438  H HD12 . LEU C 1 53  ? -11.462 10.802  -12.671 1.00 0.00 ? 53  LEU C HD12 2  
ATOM   10439  H HD13 . LEU C 1 53  ? -9.740  10.631  -13.010 1.00 0.00 ? 53  LEU C HD13 2  
ATOM   10440  H HD21 . LEU C 1 53  ? -12.664 8.042   -13.082 1.00 0.00 ? 53  LEU C HD21 2  
ATOM   10441  H HD22 . LEU C 1 53  ? -12.190 7.633   -11.434 1.00 0.00 ? 53  LEU C HD22 2  
ATOM   10442  H HD23 . LEU C 1 53  ? -12.706 9.271   -11.822 1.00 0.00 ? 53  LEU C HD23 2  
ATOM   10443  N N    . VAL C 1 54  ? -8.461  5.345   -14.454 1.00 0.00 ? 54  VAL C N    2  
ATOM   10444  C CA   . VAL C 1 54  ? -8.197  4.302   -15.436 1.00 0.00 ? 54  VAL C CA   2  
ATOM   10445  C C    . VAL C 1 54  ? -8.117  2.951   -14.730 1.00 0.00 ? 54  VAL C C    2  
ATOM   10446  O O    . VAL C 1 54  ? -8.685  1.964   -15.197 1.00 0.00 ? 54  VAL C O    2  
ATOM   10447  C CB   . VAL C 1 54  ? -6.887  4.595   -16.185 1.00 0.00 ? 54  VAL C CB   2  
ATOM   10448  C CG1  . VAL C 1 54  ? -6.496  3.383   -17.044 1.00 0.00 ? 54  VAL C CG1  2  
ATOM   10449  C CG2  . VAL C 1 54  ? -7.065  5.833   -17.085 1.00 0.00 ? 54  VAL C CG2  2  
ATOM   10450  H H    . VAL C 1 54  ? -7.790  6.047   -14.300 1.00 0.00 ? 54  VAL C H    2  
ATOM   10451  H HA   . VAL C 1 54  ? -9.011  4.274   -16.143 1.00 0.00 ? 54  VAL C HA   2  
ATOM   10452  H HB   . VAL C 1 54  ? -6.103  4.786   -15.463 1.00 0.00 ? 54  VAL C HB   2  
ATOM   10453  H HG11 . VAL C 1 54  ? -7.382  2.918   -17.448 1.00 0.00 ? 54  VAL C HG11 2  
ATOM   10454  H HG12 . VAL C 1 54  ? -5.856  3.703   -17.853 1.00 0.00 ? 54  VAL C HG12 2  
ATOM   10455  H HG13 . VAL C 1 54  ? -5.965  2.667   -16.431 1.00 0.00 ? 54  VAL C HG13 2  
ATOM   10456  H HG21 . VAL C 1 54  ? -8.071  5.863   -17.474 1.00 0.00 ? 54  VAL C HG21 2  
ATOM   10457  H HG22 . VAL C 1 54  ? -6.879  6.728   -16.506 1.00 0.00 ? 54  VAL C HG22 2  
ATOM   10458  H HG23 . VAL C 1 54  ? -6.365  5.787   -17.906 1.00 0.00 ? 54  VAL C HG23 2  
ATOM   10459  N N    . GLN C 1 55  ? -7.431  2.912   -13.590 1.00 0.00 ? 55  GLN C N    2  
ATOM   10460  C CA   . GLN C 1 55  ? -7.323  1.663   -12.842 1.00 0.00 ? 55  GLN C CA   2  
ATOM   10461  C C    . GLN C 1 55  ? -8.712  1.199   -12.392 1.00 0.00 ? 55  GLN C C    2  
ATOM   10462  O O    . GLN C 1 55  ? -9.034  0.017   -12.484 1.00 0.00 ? 55  GLN C O    2  
ATOM   10463  C CB   . GLN C 1 55  ? -6.379  1.829   -11.635 1.00 0.00 ? 55  GLN C CB   2  
ATOM   10464  C CG   . GLN C 1 55  ? -6.593  0.681   -10.616 1.00 0.00 ? 55  GLN C CG   2  
ATOM   10465  C CD   . GLN C 1 55  ? -5.269  0.252   -9.983  1.00 0.00 ? 55  GLN C CD   2  
ATOM   10466  O OE1  . GLN C 1 55  ? -4.599  1.049   -9.335  1.00 0.00 ? 55  GLN C OE1  2  
ATOM   10467  N NE2  . GLN C 1 55  ? -4.865  -0.977  -10.118 1.00 0.00 ? 55  GLN C NE2  2  
ATOM   10468  H H    . GLN C 1 55  ? -7.008  3.731   -13.245 1.00 0.00 ? 55  GLN C H    2  
ATOM   10469  H HA   . GLN C 1 55  ? -6.912  0.914   -13.503 1.00 0.00 ? 55  GLN C HA   2  
ATOM   10470  H HB2  . GLN C 1 55  ? -5.357  1.813   -11.985 1.00 0.00 ? 55  GLN C HB2  2  
ATOM   10471  H HB3  . GLN C 1 55  ? -6.575  2.776   -11.154 1.00 0.00 ? 55  GLN C HB3  2  
ATOM   10472  H HG2  . GLN C 1 55  ? -7.258  1.017   -9.836  1.00 0.00 ? 55  GLN C HG2  2  
ATOM   10473  H HG3  . GLN C 1 55  ? -7.032  -0.169  -11.115 1.00 0.00 ? 55  GLN C HG3  2  
ATOM   10474  H HE21 . GLN C 1 55  ? -5.405  -1.616  -10.623 1.00 0.00 ? 55  GLN C HE21 2  
ATOM   10475  H HE22 . GLN C 1 55  ? -4.021  -1.262  -9.712  1.00 0.00 ? 55  GLN C HE22 2  
ATOM   10476  N N    . THR C 1 56  ? -9.542  2.136   -11.925 1.00 0.00 ? 56  THR C N    2  
ATOM   10477  C CA   . THR C 1 56  ? -10.899 1.789   -11.487 1.00 0.00 ? 56  THR C CA   2  
ATOM   10478  C C    . THR C 1 56  ? -11.604 0.968   -12.568 1.00 0.00 ? 56  THR C C    2  
ATOM   10479  O O    . THR C 1 56  ? -12.174 -0.086  -12.290 1.00 0.00 ? 56  THR C O    2  
ATOM   10480  C CB   . THR C 1 56  ? -11.704 3.058   -11.179 1.00 0.00 ? 56  THR C CB   2  
ATOM   10481  O OG1  . THR C 1 56  ? -10.949 3.889   -10.309 1.00 0.00 ? 56  THR C OG1  2  
ATOM   10482  C CG2  . THR C 1 56  ? -13.039 2.694   -10.506 1.00 0.00 ? 56  THR C CG2  2  
ATOM   10483  H H    . THR C 1 56  ? -9.246  3.072   -11.885 1.00 0.00 ? 56  THR C H    2  
ATOM   10484  H HA   . THR C 1 56  ? -10.825 1.185   -10.595 1.00 0.00 ? 56  THR C HA   2  
ATOM   10485  H HB   . THR C 1 56  ? -11.900 3.588   -12.099 1.00 0.00 ? 56  THR C HB   2  
ATOM   10486  H HG1  . THR C 1 56  ? -10.930 3.475   -9.444  1.00 0.00 ? 56  THR C HG1  2  
ATOM   10487  H HG21 . THR C 1 56  ? -13.306 1.673   -10.739 1.00 0.00 ? 56  THR C HG21 2  
ATOM   10488  H HG22 . THR C 1 56  ? -12.941 2.805   -9.437  1.00 0.00 ? 56  THR C HG22 2  
ATOM   10489  H HG23 . THR C 1 56  ? -13.816 3.356   -10.863 1.00 0.00 ? 56  THR C HG23 2  
ATOM   10490  N N    . LYS C 1 57  ? -11.524 1.438   -13.809 1.00 0.00 ? 57  LYS C N    2  
ATOM   10491  C CA   . LYS C 1 57  ? -12.133 0.713   -14.924 1.00 0.00 ? 57  LYS C CA   2  
ATOM   10492  C C    . LYS C 1 57  ? -11.472 -0.649  -15.069 1.00 0.00 ? 57  LYS C C    2  
ATOM   10493  O O    . LYS C 1 57  ? -12.133 -1.652  -15.349 1.00 0.00 ? 57  LYS C O    2  
ATOM   10494  C CB   . LYS C 1 57  ? -11.968 1.506   -16.222 1.00 0.00 ? 57  LYS C CB   2  
ATOM   10495  C CG   . LYS C 1 57  ? -12.750 0.812   -17.339 1.00 0.00 ? 57  LYS C CG   2  
ATOM   10496  C CD   . LYS C 1 57  ? -12.653 1.633   -18.625 1.00 0.00 ? 57  LYS C CD   2  
ATOM   10497  C CE   . LYS C 1 57  ? -13.461 0.946   -19.727 1.00 0.00 ? 57  LYS C CE   2  
ATOM   10498  N NZ   . LYS C 1 57  ? -13.073 1.506   -21.053 1.00 0.00 ? 57  LYS C NZ   2  
ATOM   10499  H H    . LYS C 1 57  ? -11.032 2.268   -13.981 1.00 0.00 ? 57  LYS C H    2  
ATOM   10500  H HA   . LYS C 1 57  ? -13.186 0.577   -14.733 1.00 0.00 ? 57  LYS C HA   2  
ATOM   10501  H HB2  . LYS C 1 57  ? -12.346 2.509   -16.083 1.00 0.00 ? 57  LYS C HB2  2  
ATOM   10502  H HB3  . LYS C 1 57  ? -10.923 1.548   -16.489 1.00 0.00 ? 57  LYS C HB3  2  
ATOM   10503  H HG2  . LYS C 1 57  ? -12.338 -0.172  -17.507 1.00 0.00 ? 57  LYS C HG2  2  
ATOM   10504  H HG3  . LYS C 1 57  ? -13.786 0.724   -17.049 1.00 0.00 ? 57  LYS C HG3  2  
ATOM   10505  H HD2  . LYS C 1 57  ? -13.047 2.624   -18.451 1.00 0.00 ? 57  LYS C HD2  2  
ATOM   10506  H HD3  . LYS C 1 57  ? -11.620 1.705   -18.930 1.00 0.00 ? 57  LYS C HD3  2  
ATOM   10507  H HE2  . LYS C 1 57  ? -13.261 -0.115  -19.712 1.00 0.00 ? 57  LYS C HE2  2  
ATOM   10508  H HE3  . LYS C 1 57  ? -14.515 1.117   -19.560 1.00 0.00 ? 57  LYS C HE3  2  
ATOM   10509  H HZ1  . LYS C 1 57  ? -12.502 2.364   -20.912 1.00 0.00 ? 57  LYS C HZ1  2  
ATOM   10510  H HZ2  . LYS C 1 57  ? -12.518 0.801   -21.578 1.00 0.00 ? 57  LYS C HZ2  2  
ATOM   10511  H HZ3  . LYS C 1 57  ? -13.929 1.742   -21.593 1.00 0.00 ? 57  LYS C HZ3  2  
ATOM   10512  N N    . LEU C 1 58  ? -10.158 -0.677  -14.891 1.00 0.00 ? 58  LEU C N    2  
ATOM   10513  C CA   . LEU C 1 58  ? -9.416  -1.919  -15.020 1.00 0.00 ? 58  LEU C CA   2  
ATOM   10514  C C    . LEU C 1 58  ? -9.772  -2.914  -13.902 1.00 0.00 ? 58  LEU C C    2  
ATOM   10515  O O    . LEU C 1 58  ? -9.542  -4.108  -14.053 1.00 0.00 ? 58  LEU C O    2  
ATOM   10516  C CB   . LEU C 1 58  ? -7.916  -1.648  -15.034 1.00 0.00 ? 58  LEU C CB   2  
ATOM   10517  C CG   . LEU C 1 58  ? -7.532  -0.872  -16.302 1.00 0.00 ? 58  LEU C CG   2  
ATOM   10518  C CD1  . LEU C 1 58  ? -6.064  -0.450  -16.199 1.00 0.00 ? 58  LEU C CD1  2  
ATOM   10519  C CD2  . LEU C 1 58  ? -7.745  -1.750  -17.554 1.00 0.00 ? 58  LEU C CD2  2  
ATOM   10520  H H    . LEU C 1 58  ? -9.681  0.153   -14.679 1.00 0.00 ? 58  LEU C H    2  
ATOM   10521  H HA   . LEU C 1 58  ? -9.685  -2.364  -15.968 1.00 0.00 ? 58  LEU C HA   2  
ATOM   10522  H HB2  . LEU C 1 58  ? -7.652  -1.069  -14.161 1.00 0.00 ? 58  LEU C HB2  2  
ATOM   10523  H HB3  . LEU C 1 58  ? -7.389  -2.590  -15.016 1.00 0.00 ? 58  LEU C HB3  2  
ATOM   10524  H HG   . LEU C 1 58  ? -8.149  0.014   -16.378 1.00 0.00 ? 58  LEU C HG   2  
ATOM   10525  H HD11 . LEU C 1 58  ? -5.500  -1.219  -15.689 1.00 0.00 ? 58  LEU C HD11 2  
ATOM   10526  H HD12 . LEU C 1 58  ? -5.658  -0.299  -17.186 1.00 0.00 ? 58  LEU C HD12 2  
ATOM   10527  H HD13 . LEU C 1 58  ? -5.998  0.472   -15.640 1.00 0.00 ? 58  LEU C HD13 2  
ATOM   10528  H HD21 . LEU C 1 58  ? -7.679  -2.795  -17.288 1.00 0.00 ? 58  LEU C HD21 2  
ATOM   10529  H HD22 . LEU C 1 58  ? -8.723  -1.549  -17.969 1.00 0.00 ? 58  LEU C HD22 2  
ATOM   10530  H HD23 . LEU C 1 58  ? -6.991  -1.520  -18.294 1.00 0.00 ? 58  LEU C HD23 2  
ATOM   10531  N N    . ILE C 1 59  ? -10.340 -2.429  -12.794 1.00 0.00 ? 59  ILE C N    2  
ATOM   10532  C CA   . ILE C 1 59  ? -10.741 -3.328  -11.705 1.00 0.00 ? 59  ILE C CA   2  
ATOM   10533  C C    . ILE C 1 59  ? -12.223 -3.723  -11.839 1.00 0.00 ? 59  ILE C C    2  
ATOM   10534  O O    . ILE C 1 59  ? -12.601 -4.844  -11.522 1.00 0.00 ? 59  ILE C O    2  
ATOM   10535  C CB   . ILE C 1 59  ? -10.468 -2.685  -10.311 1.00 0.00 ? 59  ILE C CB   2  
ATOM   10536  C CG1  . ILE C 1 59  ? -10.055 -3.762  -9.303  1.00 0.00 ? 59  ILE C CG1  2  
ATOM   10537  C CG2  . ILE C 1 59  ? -11.705 -1.982  -9.736  1.00 0.00 ? 59  ILE C CG2  2  
ATOM   10538  C CD1  . ILE C 1 59  ? -9.354  -3.096  -8.116  1.00 0.00 ? 59  ILE C CD1  2  
ATOM   10539  H H    . ILE C 1 59  ? -10.506 -1.463  -12.716 1.00 0.00 ? 59  ILE C H    2  
ATOM   10540  H HA   . ILE C 1 59  ? -10.149 -4.230  -11.769 1.00 0.00 ? 59  ILE C HA   2  
ATOM   10541  H HB   . ILE C 1 59  ? -9.667  -1.968  -10.406 1.00 0.00 ? 59  ILE C HB   2  
ATOM   10542  H HG12 . ILE C 1 59  ? -10.933 -4.284  -8.954  1.00 0.00 ? 59  ILE C HG12 2  
ATOM   10543  H HG13 . ILE C 1 59  ? -9.384  -4.461  -9.762  1.00 0.00 ? 59  ILE C HG13 2  
ATOM   10544  H HG21 . ILE C 1 59  ? -12.552 -2.648  -9.741  1.00 0.00 ? 59  ILE C HG21 2  
ATOM   10545  H HG22 . ILE C 1 59  ? -11.499 -1.683  -8.720  1.00 0.00 ? 59  ILE C HG22 2  
ATOM   10546  H HG23 . ILE C 1 59  ? -11.924 -1.113  -10.312 1.00 0.00 ? 59  ILE C HG23 2  
ATOM   10547  H HD11 . ILE C 1 59  ? -8.694  -2.322  -8.475  1.00 0.00 ? 59  ILE C HD11 2  
ATOM   10548  H HD12 . ILE C 1 59  ? -10.093 -2.663  -7.458  1.00 0.00 ? 59  ILE C HD12 2  
ATOM   10549  H HD13 . ILE C 1 59  ? -8.782  -3.835  -7.576  1.00 0.00 ? 59  ILE C HD13 2  
ATOM   10550  N N    . GLU C 1 60  ? -13.058 -2.802  -12.327 1.00 0.00 ? 60  GLU C N    2  
ATOM   10551  C CA   . GLU C 1 60  ? -14.489 -3.095  -12.501 1.00 0.00 ? 60  GLU C CA   2  
ATOM   10552  C C    . GLU C 1 60  ? -14.700 -4.174  -13.557 1.00 0.00 ? 60  GLU C C    2  
ATOM   10553  O O    . GLU C 1 60  ? -15.593 -5.007  -13.433 1.00 0.00 ? 60  GLU C O    2  
ATOM   10554  C CB   . GLU C 1 60  ? -15.220 -1.822  -12.947 1.00 0.00 ? 60  GLU C CB   2  
ATOM   10555  C CG   . GLU C 1 60  ? -16.709 -2.108  -13.189 1.00 0.00 ? 60  GLU C CG   2  
ATOM   10556  C CD   . GLU C 1 60  ? -17.331 -0.950  -13.951 1.00 0.00 ? 60  GLU C CD   2  
ATOM   10557  O OE1  . GLU C 1 60  ? -16.688 0.081   -14.062 1.00 0.00 ? 60  GLU C OE1  2  
ATOM   10558  O OE2  . GLU C 1 60  ? -18.435 -1.123  -14.438 1.00 0.00 ? 60  GLU C OE2  2  
ATOM   10559  H H    . GLU C 1 60  ? -12.712 -1.920  -12.576 1.00 0.00 ? 60  GLU C H    2  
ATOM   10560  H HA   . GLU C 1 60  ? -14.893 -3.441  -11.561 1.00 0.00 ? 60  GLU C HA   2  
ATOM   10561  H HB2  . GLU C 1 60  ? -15.123 -1.068  -12.181 1.00 0.00 ? 60  GLU C HB2  2  
ATOM   10562  H HB3  . GLU C 1 60  ? -14.777 -1.458  -13.863 1.00 0.00 ? 60  GLU C HB3  2  
ATOM   10563  H HG2  . GLU C 1 60  ? -16.827 -3.009  -13.769 1.00 0.00 ? 60  GLU C HG2  2  
ATOM   10564  H HG3  . GLU C 1 60  ? -17.214 -2.222  -12.243 1.00 0.00 ? 60  GLU C HG3  2  
ATOM   10565  N N    . GLY C 1 61  ? -13.898 -4.129  -14.618 1.00 0.00 ? 61  GLY C N    2  
ATOM   10566  C CA   . GLY C 1 61  ? -14.027 -5.095  -15.708 1.00 0.00 ? 61  GLY C CA   2  
ATOM   10567  C C    . GLY C 1 61  ? -12.833 -6.036  -15.754 1.00 0.00 ? 61  GLY C C    2  
ATOM   10568  O O    . GLY C 1 61  ? -12.399 -6.442  -16.832 1.00 0.00 ? 61  GLY C O    2  
ATOM   10569  H H    . GLY C 1 61  ? -13.222 -3.422  -14.677 1.00 0.00 ? 61  GLY C H    2  
ATOM   10570  H HA2  . GLY C 1 61  ? -14.930 -5.670  -15.566 1.00 0.00 ? 61  GLY C HA2  2  
ATOM   10571  H HA3  . GLY C 1 61  ? -14.088 -4.564  -16.645 1.00 0.00 ? 61  GLY C HA3  2  
ATOM   10572  N N    . ASP C 1 62  ? -12.308 -6.367  -14.585 1.00 0.00 ? 62  ASP C N    2  
ATOM   10573  C CA   . ASP C 1 62  ? -11.153 -7.249  -14.496 1.00 0.00 ? 62  ASP C CA   2  
ATOM   10574  C C    . ASP C 1 62  ? -11.502 -8.672  -14.930 1.00 0.00 ? 62  ASP C C    2  
ATOM   10575  O O    . ASP C 1 62  ? -10.623 -9.527  -15.036 1.00 0.00 ? 62  ASP C O    2  
ATOM   10576  C CB   . ASP C 1 62  ? -10.637 -7.264  -13.059 1.00 0.00 ? 62  ASP C CB   2  
ATOM   10577  C CG   . ASP C 1 62  ? -11.764 -7.643  -12.104 1.00 0.00 ? 62  ASP C CG   2  
ATOM   10578  O OD1  . ASP C 1 62  ? -12.886 -7.773  -12.564 1.00 0.00 ? 62  ASP C OD1  2  
ATOM   10579  O OD2  . ASP C 1 62  ? -11.488 -7.798  -10.925 1.00 0.00 ? 62  ASP C OD2  2  
ATOM   10580  H H    . ASP C 1 62  ? -12.698 -6.002  -13.763 1.00 0.00 ? 62  ASP C H    2  
ATOM   10581  H HA   . ASP C 1 62  ? -10.374 -6.869  -15.138 1.00 0.00 ? 62  ASP C HA   2  
ATOM   10582  H HB2  . ASP C 1 62  ? -9.838  -7.983  -12.975 1.00 0.00 ? 62  ASP C HB2  2  
ATOM   10583  H HB3  . ASP C 1 62  ? -10.265 -6.284  -12.801 1.00 0.00 ? 62  ASP C HB3  2  
ATOM   10584  N N    . ALA C 1 63  ? -12.782 -8.924  -15.184 1.00 0.00 ? 63  ALA C N    2  
ATOM   10585  C CA   . ALA C 1 63  ? -13.218 -10.252 -15.608 1.00 0.00 ? 63  ALA C CA   2  
ATOM   10586  C C    . ALA C 1 63  ? -13.010 -10.434 -17.111 1.00 0.00 ? 63  ALA C C    2  
ATOM   10587  O O    . ALA C 1 63  ? -12.666 -9.486  -17.816 1.00 0.00 ? 63  ALA C O    2  
ATOM   10588  C CB   . ALA C 1 63  ? -14.696 -10.452 -15.269 1.00 0.00 ? 63  ALA C CB   2  
ATOM   10589  H H    . ALA C 1 63  ? -13.443 -8.207  -15.086 1.00 0.00 ? 63  ALA C H    2  
ATOM   10590  H HA   . ALA C 1 63  ? -12.637 -10.995 -15.083 1.00 0.00 ? 63  ALA C HA   2  
ATOM   10591  H HB1  . ALA C 1 63  ? -15.306 -10.015 -16.046 1.00 0.00 ? 63  ALA C HB1  2  
ATOM   10592  H HB2  . ALA C 1 63  ? -14.917 -9.974  -14.326 1.00 0.00 ? 63  ALA C HB2  2  
ATOM   10593  H HB3  . ALA C 1 63  ? -14.909 -11.508 -15.196 1.00 0.00 ? 63  ALA C HB3  2  
ATOM   10594  N N    . GLY C 1 64  ? -13.228 -11.657 -17.595 1.00 0.00 ? 64  GLY C N    2  
ATOM   10595  C CA   . GLY C 1 64  ? -13.066 -11.948 -19.020 1.00 0.00 ? 64  GLY C CA   2  
ATOM   10596  C C    . GLY C 1 64  ? -12.216 -13.198 -19.247 1.00 0.00 ? 64  GLY C C    2  
ATOM   10597  O O    . GLY C 1 64  ? -12.669 -14.157 -19.871 1.00 0.00 ? 64  GLY C O    2  
ATOM   10598  H H    . GLY C 1 64  ? -13.505 -12.373 -16.987 1.00 0.00 ? 64  GLY C H    2  
ATOM   10599  H HA2  . GLY C 1 64  ? -14.041 -12.101 -19.460 1.00 0.00 ? 64  GLY C HA2  2  
ATOM   10600  H HA3  . GLY C 1 64  ? -12.589 -11.108 -19.504 1.00 0.00 ? 64  GLY C HA3  2  
ATOM   10601  N N    . GLU C 1 65  ? -10.983 -13.181 -18.749 1.00 0.00 ? 65  GLU C N    2  
ATOM   10602  C CA   . GLU C 1 65  ? -10.088 -14.323 -18.921 1.00 0.00 ? 65  GLU C CA   2  
ATOM   10603  C C    . GLU C 1 65  ? -10.606 -15.545 -18.171 1.00 0.00 ? 65  GLU C C    2  
ATOM   10604  O O    . GLU C 1 65  ? -10.513 -16.670 -18.662 1.00 0.00 ? 65  GLU C O    2  
ATOM   10605  C CB   . GLU C 1 65  ? -8.687  -13.977 -18.414 1.00 0.00 ? 65  GLU C CB   2  
ATOM   10606  C CG   . GLU C 1 65  ? -8.052  -12.931 -19.331 1.00 0.00 ? 65  GLU C CG   2  
ATOM   10607  C CD   . GLU C 1 65  ? -6.684  -12.530 -18.791 1.00 0.00 ? 65  GLU C CD   2  
ATOM   10608  O OE1  . GLU C 1 65  ? -6.286  -13.078 -17.776 1.00 0.00 ? 65  GLU C OE1  2  
ATOM   10609  O OE2  . GLU C 1 65  ? -6.053  -11.683 -19.401 1.00 0.00 ? 65  GLU C OE2  2  
ATOM   10610  H H    . GLU C 1 65  ? -10.668 -12.388 -18.266 1.00 0.00 ? 65  GLU C H    2  
ATOM   10611  H HA   . GLU C 1 65  ? -10.026 -14.560 -19.973 1.00 0.00 ? 65  GLU C HA   2  
ATOM   10612  H HB2  . GLU C 1 65  ? -8.755  -13.584 -17.411 1.00 0.00 ? 65  GLU C HB2  2  
ATOM   10613  H HB3  . GLU C 1 65  ? -8.076  -14.867 -18.411 1.00 0.00 ? 65  GLU C HB3  2  
ATOM   10614  H HG2  . GLU C 1 65  ? -7.940  -13.344 -20.323 1.00 0.00 ? 65  GLU C HG2  2  
ATOM   10615  H HG3  . GLU C 1 65  ? -8.688  -12.059 -19.375 1.00 0.00 ? 65  GLU C HG3  2  
ATOM   10616  N N    . GLY C 1 66  ? -11.145 -15.321 -16.979 1.00 0.00 ? 66  GLY C N    2  
ATOM   10617  C CA   . GLY C 1 66  ? -11.664 -16.419 -16.173 1.00 0.00 ? 66  GLY C CA   2  
ATOM   10618  C C    . GLY C 1 66  ? -12.626 -15.908 -15.108 1.00 0.00 ? 66  GLY C C    2  
ATOM   10619  O O    . GLY C 1 66  ? -12.785 -14.701 -14.927 1.00 0.00 ? 66  GLY C O    2  
ATOM   10620  H H    . GLY C 1 66  ? -11.189 -14.405 -16.633 1.00 0.00 ? 66  GLY C H    2  
ATOM   10621  H HA2  . GLY C 1 66  ? -12.184 -17.115 -16.817 1.00 0.00 ? 66  GLY C HA2  2  
ATOM   10622  H HA3  . GLY C 1 66  ? -10.842 -16.926 -15.692 1.00 0.00 ? 66  GLY C HA3  2  
ATOM   10623  N N    . LYS C 1 67  ? -13.272 -16.837 -14.414 1.00 0.00 ? 67  LYS C N    2  
ATOM   10624  C CA   . LYS C 1 67  ? -14.227 -16.475 -13.374 1.00 0.00 ? 67  LYS C CA   2  
ATOM   10625  C C    . LYS C 1 67  ? -13.526 -15.815 -12.185 1.00 0.00 ? 67  LYS C C    2  
ATOM   10626  O O    . LYS C 1 67  ? -13.521 -14.591 -12.053 1.00 0.00 ? 67  LYS C O    2  
ATOM   10627  C CB   . LYS C 1 67  ? -14.961 -17.731 -12.888 1.00 0.00 ? 67  LYS C CB   2  
ATOM   10628  C CG   . LYS C 1 67  ? -15.619 -18.460 -14.068 1.00 0.00 ? 67  LYS C CG   2  
ATOM   10629  C CD   . LYS C 1 67  ? -16.758 -17.615 -14.646 1.00 0.00 ? 67  LYS C CD   2  
ATOM   10630  C CE   . LYS C 1 67  ? -17.618 -18.488 -15.563 1.00 0.00 ? 67  LYS C CE   2  
ATOM   10631  N NZ   . LYS C 1 67  ? -18.808 -17.714 -16.014 1.00 0.00 ? 67  LYS C NZ   2  
ATOM   10632  H H    . LYS C 1 67  ? -13.109 -17.784 -14.609 1.00 0.00 ? 67  LYS C H    2  
ATOM   10633  H HA   . LYS C 1 67  ? -14.947 -15.785 -13.781 1.00 0.00 ? 67  LYS C HA   2  
ATOM   10634  H HB2  . LYS C 1 67  ? -14.257 -18.395 -12.409 1.00 0.00 ? 67  LYS C HB2  2  
ATOM   10635  H HB3  . LYS C 1 67  ? -15.723 -17.447 -12.177 1.00 0.00 ? 67  LYS C HB3  2  
ATOM   10636  H HG2  . LYS C 1 67  ? -14.879 -18.637 -14.835 1.00 0.00 ? 67  LYS C HG2  2  
ATOM   10637  H HG3  . LYS C 1 67  ? -16.014 -19.406 -13.728 1.00 0.00 ? 67  LYS C HG3  2  
ATOM   10638  H HD2  . LYS C 1 67  ? -17.365 -17.227 -13.841 1.00 0.00 ? 67  LYS C HD2  2  
ATOM   10639  H HD3  . LYS C 1 67  ? -16.348 -16.798 -15.218 1.00 0.00 ? 67  LYS C HD3  2  
ATOM   10640  H HE2  . LYS C 1 67  ? -17.037 -18.789 -16.422 1.00 0.00 ? 67  LYS C HE2  2  
ATOM   10641  H HE3  . LYS C 1 67  ? -17.943 -19.366 -15.023 1.00 0.00 ? 67  LYS C HE3  2  
ATOM   10642  H HZ1  . LYS C 1 67  ? -18.570 -16.704 -16.057 1.00 0.00 ? 67  LYS C HZ1  2  
ATOM   10643  H HZ2  . LYS C 1 67  ? -19.098 -18.044 -16.958 1.00 0.00 ? 67  LYS C HZ2  2  
ATOM   10644  H HZ3  . LYS C 1 67  ? -19.589 -17.856 -15.343 1.00 0.00 ? 67  LYS C HZ3  2  
ATOM   10645  N N    . MET C 1 68  ? -12.962 -16.643 -11.311 1.00 0.00 ? 68  MET C N    2  
ATOM   10646  C CA   . MET C 1 68  ? -12.283 -16.158 -10.110 1.00 0.00 ? 68  MET C CA   2  
ATOM   10647  C C    . MET C 1 68  ? -11.006 -15.372 -10.423 1.00 0.00 ? 68  MET C C    2  
ATOM   10648  O O    . MET C 1 68  ? -10.698 -14.389 -9.749  1.00 0.00 ? 68  MET C O    2  
ATOM   10649  C CB   . MET C 1 68  ? -11.930 -17.346 -9.213  1.00 0.00 ? 68  MET C CB   2  
ATOM   10650  C CG   . MET C 1 68  ? -13.172 -17.793 -8.439  1.00 0.00 ? 68  MET C CG   2  
ATOM   10651  S SD   . MET C 1 68  ? -13.631 -16.515 -7.242  1.00 0.00 ? 68  MET C SD   2  
ATOM   10652  C CE   . MET C 1 68  ? -15.407 -16.507 -7.586  1.00 0.00 ? 68  MET C CE   2  
ATOM   10653  H H    . MET C 1 68  ? -13.019 -17.608 -11.466 1.00 0.00 ? 68  MET C H    2  
ATOM   10654  H HA   . MET C 1 68  ? -12.958 -15.514 -9.570  1.00 0.00 ? 68  MET C HA   2  
ATOM   10655  H HB2  . MET C 1 68  ? -11.573 -18.163 -9.824  1.00 0.00 ? 68  MET C HB2  2  
ATOM   10656  H HB3  . MET C 1 68  ? -11.160 -17.055 -8.516  1.00 0.00 ? 68  MET C HB3  2  
ATOM   10657  H HG2  . MET C 1 68  ? -13.988 -17.951 -9.129  1.00 0.00 ? 68  MET C HG2  2  
ATOM   10658  H HG3  . MET C 1 68  ? -12.959 -18.715 -7.918  1.00 0.00 ? 68  MET C HG3  2  
ATOM   10659  H HE1  . MET C 1 68  ? -15.784 -17.520 -7.555  1.00 0.00 ? 68  MET C HE1  2  
ATOM   10660  H HE2  . MET C 1 68  ? -15.916 -15.913 -6.845  1.00 0.00 ? 68  MET C HE2  2  
ATOM   10661  H HE3  . MET C 1 68  ? -15.581 -16.083 -8.566  1.00 0.00 ? 68  MET C HE3  2  
ATOM   10662  N N    . LYS C 1 69  ? -10.243 -15.831 -11.411 1.00 0.00 ? 69  LYS C N    2  
ATOM   10663  C CA   . LYS C 1 69  ? -8.977  -15.179 -11.752 1.00 0.00 ? 69  LYS C CA   2  
ATOM   10664  C C    . LYS C 1 69  ? -9.174  -13.836 -12.456 1.00 0.00 ? 69  LYS C C    2  
ATOM   10665  O O    . LYS C 1 69  ? -10.181 -13.604 -13.125 1.00 0.00 ? 69  LYS C O    2  
ATOM   10666  C CB   . LYS C 1 69  ? -8.135  -16.109 -12.623 1.00 0.00 ? 69  LYS C CB   2  
ATOM   10667  C CG   . LYS C 1 69  ? -7.705  -17.315 -11.785 1.00 0.00 ? 69  LYS C CG   2  
ATOM   10668  C CD   . LYS C 1 69  ? -6.859  -18.264 -12.634 1.00 0.00 ? 69  LYS C CD   2  
ATOM   10669  C CE   . LYS C 1 69  ? -6.493  -19.495 -11.803 1.00 0.00 ? 69  LYS C CE   2  
ATOM   10670  N NZ   . LYS C 1 69  ? -5.596  -19.089 -10.683 1.00 0.00 ? 69  LYS C NZ   2  
ATOM   10671  H H    . LYS C 1 69  ? -10.516 -16.637 -11.896 1.00 0.00 ? 69  LYS C H    2  
ATOM   10672  H HA   . LYS C 1 69  ? -8.435  -15.000 -10.836 1.00 0.00 ? 69  LYS C HA   2  
ATOM   10673  H HB2  . LYS C 1 69  ? -8.721  -16.443 -13.468 1.00 0.00 ? 69  LYS C HB2  2  
ATOM   10674  H HB3  . LYS C 1 69  ? -7.260  -15.584 -12.973 1.00 0.00 ? 69  LYS C HB3  2  
ATOM   10675  H HG2  . LYS C 1 69  ? -7.124  -16.975 -10.940 1.00 0.00 ? 69  LYS C HG2  2  
ATOM   10676  H HG3  . LYS C 1 69  ? -8.582  -17.837 -11.432 1.00 0.00 ? 69  LYS C HG3  2  
ATOM   10677  H HD2  . LYS C 1 69  ? -7.423  -18.569 -13.504 1.00 0.00 ? 69  LYS C HD2  2  
ATOM   10678  H HD3  . LYS C 1 69  ? -5.956  -17.761 -12.947 1.00 0.00 ? 69  LYS C HD3  2  
ATOM   10679  H HE2  . LYS C 1 69  ? -7.392  -19.938 -11.401 1.00 0.00 ? 69  LYS C HE2  2  
ATOM   10680  H HE3  . LYS C 1 69  ? -5.986  -20.214 -12.428 1.00 0.00 ? 69  LYS C HE3  2  
ATOM   10681  H HZ1  . LYS C 1 69  ? -5.693  -18.068 -10.514 1.00 0.00 ? 69  LYS C HZ1  2  
ATOM   10682  H HZ2  . LYS C 1 69  ? -5.860  -19.608 -9.822  1.00 0.00 ? 69  LYS C HZ2  2  
ATOM   10683  H HZ3  . LYS C 1 69  ? -4.610  -19.308 -10.933 1.00 0.00 ? 69  LYS C HZ3  2  
ATOM   10684  N N    . VAL C 1 70  ? -8.186  -12.956 -12.278 1.00 0.00 ? 70  VAL C N    2  
ATOM   10685  C CA   . VAL C 1 70  ? -8.211  -11.618 -12.869 1.00 0.00 ? 70  VAL C CA   2  
ATOM   10686  C C    . VAL C 1 70  ? -6.874  -11.309 -13.547 1.00 0.00 ? 70  VAL C C    2  
ATOM   10687  O O    . VAL C 1 70  ? -5.916  -12.071 -13.417 1.00 0.00 ? 70  VAL C O    2  
ATOM   10688  C CB   . VAL C 1 70  ? -8.474  -10.579 -11.779 1.00 0.00 ? 70  VAL C CB   2  
ATOM   10689  C CG1  . VAL C 1 70  ? -9.844  -10.830 -11.149 1.00 0.00 ? 70  VAL C CG1  2  
ATOM   10690  C CG2  . VAL C 1 70  ? -7.391  -10.688 -10.703 1.00 0.00 ? 70  VAL C CG2  2  
ATOM   10691  H H    . VAL C 1 70  ? -7.419  -13.213 -11.726 1.00 0.00 ? 70  VAL C H    2  
ATOM   10692  H HA   . VAL C 1 70  ? -9.001  -11.567 -13.602 1.00 0.00 ? 70  VAL C HA   2  
ATOM   10693  H HB   . VAL C 1 70  ? -8.452  -9.592  -12.213 1.00 0.00 ? 70  VAL C HB   2  
ATOM   10694  H HG11 . VAL C 1 70  ? -9.883  -11.838 -10.761 1.00 0.00 ? 70  VAL C HG11 2  
ATOM   10695  H HG12 . VAL C 1 70  ? -10.004 -10.128 -10.344 1.00 0.00 ? 70  VAL C HG12 2  
ATOM   10696  H HG13 . VAL C 1 70  ? -10.613 -10.703 -11.896 1.00 0.00 ? 70  VAL C HG13 2  
ATOM   10697  H HG21 . VAL C 1 70  ? -6.421  -10.526 -11.151 1.00 0.00 ? 70  VAL C HG21 2  
ATOM   10698  H HG22 . VAL C 1 70  ? -7.564  -9.942  -9.941  1.00 0.00 ? 70  VAL C HG22 2  
ATOM   10699  H HG23 . VAL C 1 70  ? -7.422  -11.672 -10.258 1.00 0.00 ? 70  VAL C HG23 2  
ATOM   10700  N N    . SER C 1 71  ? -6.809  -10.187 -14.269 1.00 0.00 ? 71  SER C N    2  
ATOM   10701  C CA   . SER C 1 71  ? -5.572  -9.805  -14.951 1.00 0.00 ? 71  SER C CA   2  
ATOM   10702  C C    . SER C 1 71  ? -4.447  -9.654  -13.931 1.00 0.00 ? 71  SER C C    2  
ATOM   10703  O O    . SER C 1 71  ? -4.620  -9.013  -12.894 1.00 0.00 ? 71  SER C O    2  
ATOM   10704  C CB   . SER C 1 71  ? -5.770  -8.488  -15.700 1.00 0.00 ? 71  SER C CB   2  
ATOM   10705  O OG   . SER C 1 71  ? -4.610  -8.211  -16.473 1.00 0.00 ? 71  SER C OG   2  
ATOM   10706  H H    . SER C 1 71  ? -7.599  -9.611  -14.340 1.00 0.00 ? 71  SER C H    2  
ATOM   10707  H HA   . SER C 1 71  ? -5.306  -10.577 -15.658 1.00 0.00 ? 71  SER C HA   2  
ATOM   10708  H HB2  . SER C 1 71  ? -6.622  -8.567  -16.354 1.00 0.00 ? 71  SER C HB2  2  
ATOM   10709  H HB3  . SER C 1 71  ? -5.938  -7.692  -14.987 1.00 0.00 ? 71  SER C HB3  2  
ATOM   10710  H HG   . SER C 1 71  ? -3.841  -8.428  -15.942 1.00 0.00 ? 71  SER C HG   2  
ATOM   10711  N N    . LEU C 1 72  ? -3.316  -10.297 -14.204 1.00 0.00 ? 72  LEU C N    2  
ATOM   10712  C CA   . LEU C 1 72  ? -2.190  -10.280 -13.271 1.00 0.00 ? 72  LEU C CA   2  
ATOM   10713  C C    . LEU C 1 72  ? -1.586  -8.881  -13.134 1.00 0.00 ? 72  LEU C C    2  
ATOM   10714  O O    . LEU C 1 72  ? -1.195  -8.455  -12.049 1.00 0.00 ? 72  LEU C O    2  
ATOM   10715  C CB   . LEU C 1 72  ? -1.104  -11.241 -13.762 1.00 0.00 ? 72  LEU C CB   2  
ATOM   10716  C CG   . LEU C 1 72  ? -1.589  -12.688 -13.624 1.00 0.00 ? 72  LEU C CG   2  
ATOM   10717  C CD1  . LEU C 1 72  ? -0.609  -13.621 -14.340 1.00 0.00 ? 72  LEU C CD1  2  
ATOM   10718  C CD2  . LEU C 1 72  ? -1.671  -13.073 -12.139 1.00 0.00 ? 72  LEU C CD2  2  
ATOM   10719  H H    . LEU C 1 72  ? -3.250  -10.833 -15.016 1.00 0.00 ? 72  LEU C H    2  
ATOM   10720  H HA   . LEU C 1 72  ? -2.528  -10.616 -12.305 1.00 0.00 ? 72  LEU C HA   2  
ATOM   10721  H HB2  . LEU C 1 72  ? -0.889  -11.034 -14.801 1.00 0.00 ? 72  LEU C HB2  2  
ATOM   10722  H HB3  . LEU C 1 72  ? -0.208  -11.103 -13.177 1.00 0.00 ? 72  LEU C HB3  2  
ATOM   10723  H HG   . LEU C 1 72  ? -2.566  -12.782 -14.075 1.00 0.00 ? 72  LEU C HG   2  
ATOM   10724  H HD11 . LEU C 1 72  ? -0.425  -13.251 -15.338 1.00 0.00 ? 72  LEU C HD11 2  
ATOM   10725  H HD12 . LEU C 1 72  ? 0.321   -13.655 -13.792 1.00 0.00 ? 72  LEU C HD12 2  
ATOM   10726  H HD13 . LEU C 1 72  ? -1.031  -14.613 -14.396 1.00 0.00 ? 72  LEU C HD13 2  
ATOM   10727  H HD21 . LEU C 1 72  ? -0.921  -12.533 -11.580 1.00 0.00 ? 72  LEU C HD21 2  
ATOM   10728  H HD22 . LEU C 1 72  ? -2.651  -12.826 -11.757 1.00 0.00 ? 72  LEU C HD22 2  
ATOM   10729  H HD23 . LEU C 1 72  ? -1.502  -14.135 -12.031 1.00 0.00 ? 72  LEU C HD23 2  
ATOM   10730  N N    . VAL C 1 73  ? -1.497  -8.191  -14.261 1.00 0.00 ? 73  VAL C N    2  
ATOM   10731  C CA   . VAL C 1 73  ? -0.922  -6.850  -14.316 1.00 0.00 ? 73  VAL C CA   2  
ATOM   10732  C C    . VAL C 1 73  ? -1.682  -5.847  -13.435 1.00 0.00 ? 73  VAL C C    2  
ATOM   10733  O O    . VAL C 1 73  ? -1.153  -4.790  -13.075 1.00 0.00 ? 73  VAL C O    2  
ATOM   10734  C CB   . VAL C 1 73  ? -0.935  -6.346  -15.760 1.00 0.00 ? 73  VAL C CB   2  
ATOM   10735  C CG1  . VAL C 1 73  ? -0.380  -7.427  -16.690 1.00 0.00 ? 73  VAL C CG1  2  
ATOM   10736  C CG2  . VAL C 1 73  ? -2.370  -6.008  -16.167 1.00 0.00 ? 73  VAL C CG2  2  
ATOM   10737  H H    . VAL C 1 73  ? -1.816  -8.600  -15.087 1.00 0.00 ? 73  VAL C H    2  
ATOM   10738  H HA   . VAL C 1 73  ? 0.103   -6.899  -13.985 1.00 0.00 ? 73  VAL C HA   2  
ATOM   10739  H HB   . VAL C 1 73  ? -0.321  -5.460  -15.835 1.00 0.00 ? 73  VAL C HB   2  
ATOM   10740  H HG11 . VAL C 1 73  ? -0.964  -8.329  -16.586 1.00 0.00 ? 73  VAL C HG11 2  
ATOM   10741  H HG12 . VAL C 1 73  ? -0.430  -7.082  -17.712 1.00 0.00 ? 73  VAL C HG12 2  
ATOM   10742  H HG13 . VAL C 1 73  ? 0.648   -7.633  -16.430 1.00 0.00 ? 73  VAL C HG13 2  
ATOM   10743  H HG21 . VAL C 1 73  ? -3.048  -6.717  -15.716 1.00 0.00 ? 73  VAL C HG21 2  
ATOM   10744  H HG22 . VAL C 1 73  ? -2.615  -5.012  -15.829 1.00 0.00 ? 73  VAL C HG22 2  
ATOM   10745  H HG23 . VAL C 1 73  ? -2.461  -6.056  -17.242 1.00 0.00 ? 73  VAL C HG23 2  
ATOM   10746  N N    . LEU C 1 74  ? -2.922  -6.170  -13.107 1.00 0.00 ? 74  LEU C N    2  
ATOM   10747  C CA   . LEU C 1 74  ? -3.731  -5.275  -12.278 1.00 0.00 ? 74  LEU C CA   2  
ATOM   10748  C C    . LEU C 1 74  ? -2.988  -4.894  -11.013 1.00 0.00 ? 74  LEU C C    2  
ATOM   10749  O O    . LEU C 1 74  ? -3.053  -3.750  -10.546 1.00 0.00 ? 74  LEU C O    2  
ATOM   10750  C CB   . LEU C 1 74  ? -5.030  -6.010  -11.949 1.00 0.00 ? 74  LEU C CB   2  
ATOM   10751  C CG   . LEU C 1 74  ? -5.889  -5.213  -10.973 1.00 0.00 ? 74  LEU C CG   2  
ATOM   10752  C CD1  . LEU C 1 74  ? -6.298  -3.884  -11.617 1.00 0.00 ? 74  LEU C CD1  2  
ATOM   10753  C CD2  . LEU C 1 74  ? -7.140  -6.039  -10.621 1.00 0.00 ? 74  LEU C CD2  2  
ATOM   10754  H H    . LEU C 1 74  ? -3.311  -7.009  -13.422 1.00 0.00 ? 74  LEU C H    2  
ATOM   10755  H HA   . LEU C 1 74  ? -3.949  -4.378  -12.836 1.00 0.00 ? 74  LEU C HA   2  
ATOM   10756  H HB2  . LEU C 1 74  ? -5.588  -6.169  -12.860 1.00 0.00 ? 74  LEU C HB2  2  
ATOM   10757  H HB3  . LEU C 1 74  ? -4.792  -6.969  -11.510 1.00 0.00 ? 74  LEU C HB3  2  
ATOM   10758  H HG   . LEU C 1 74  ? -5.322  -5.016  -10.073 1.00 0.00 ? 74  LEU C HG   2  
ATOM   10759  H HD11 . LEU C 1 74  ? -6.503  -4.038  -12.666 1.00 0.00 ? 74  LEU C HD11 2  
ATOM   10760  H HD12 . LEU C 1 74  ? -7.185  -3.507  -11.130 1.00 0.00 ? 74  LEU C HD12 2  
ATOM   10761  H HD13 . LEU C 1 74  ? -5.496  -3.172  -11.508 1.00 0.00 ? 74  LEU C HD13 2  
ATOM   10762  H HD21 . LEU C 1 74  ? -6.893  -7.086  -10.609 1.00 0.00 ? 74  LEU C HD21 2  
ATOM   10763  H HD22 . LEU C 1 74  ? -7.511  -5.755  -9.646  1.00 0.00 ? 74  LEU C HD22 2  
ATOM   10764  H HD23 . LEU C 1 74  ? -7.907  -5.860  -11.360 1.00 0.00 ? 74  LEU C HD23 2  
ATOM   10765  N N    . VAL C 1 75  ? -2.285  -5.869  -10.465 1.00 0.00 ? 75  VAL C N    2  
ATOM   10766  C CA   . VAL C 1 75  ? -1.518  -5.659  -9.245  1.00 0.00 ? 75  VAL C CA   2  
ATOM   10767  C C    . VAL C 1 75  ? -0.349  -4.719  -9.542  1.00 0.00 ? 75  VAL C C    2  
ATOM   10768  O O    . VAL C 1 75  ? -0.084  -3.794  -8.785  1.00 0.00 ? 75  VAL C O    2  
ATOM   10769  C CB   . VAL C 1 75  ? -0.996  -6.994  -8.699  1.00 0.00 ? 75  VAL C CB   2  
ATOM   10770  C CG1  . VAL C 1 75  ? -0.172  -6.743  -7.429  1.00 0.00 ? 75  VAL C CG1  2  
ATOM   10771  C CG2  . VAL C 1 75  ? -2.183  -7.917  -8.372  1.00 0.00 ? 75  VAL C CG2  2  
ATOM   10772  H H    . VAL C 1 75  ? -2.285  -6.747  -10.895 1.00 0.00 ? 75  VAL C H    2  
ATOM   10773  H HA   . VAL C 1 75  ? -2.153  -5.201  -8.502  1.00 0.00 ? 75  VAL C HA   2  
ATOM   10774  H HB   . VAL C 1 75  ? -0.369  -7.463  -9.442  1.00 0.00 ? 75  VAL C HB   2  
ATOM   10775  H HG11 . VAL C 1 75  ? -0.571  -5.886  -6.905  1.00 0.00 ? 75  VAL C HG11 2  
ATOM   10776  H HG12 . VAL C 1 75  ? -0.225  -7.611  -6.789  1.00 0.00 ? 75  VAL C HG12 2  
ATOM   10777  H HG13 . VAL C 1 75  ? 0.856   -6.555  -7.696  1.00 0.00 ? 75  VAL C HG13 2  
ATOM   10778  H HG21 . VAL C 1 75  ? -2.825  -7.992  -9.236  1.00 0.00 ? 75  VAL C HG21 2  
ATOM   10779  H HG22 . VAL C 1 75  ? -1.819  -8.901  -8.110  1.00 0.00 ? 75  VAL C HG22 2  
ATOM   10780  H HG23 . VAL C 1 75  ? -2.744  -7.511  -7.542  1.00 0.00 ? 75  VAL C HG23 2  
ATOM   10781  N N    . HIS C 1 76  ? 0.406   -4.914  -10.719 1.00 0.00 ? 76  HIS C N    2  
ATOM   10782  C CA   . HIS C 1 76  ? 1.531   -4.056  -11.074 1.00 0.00 ? 76  HIS C CA   2  
ATOM   10783  C C    . HIS C 1 76  ? 1.099   -2.591  -11.084 1.00 0.00 ? 76  HIS C C    2  
ATOM   10784  O O    . HIS C 1 76  ? 1.786   -1.728  -10.536 1.00 0.00 ? 76  HIS C O    2  
ATOM   10785  C CB   . HIS C 1 76  ? 2.081   -4.433  -12.449 1.00 0.00 ? 76  HIS C CB   2  
ATOM   10786  C CG   . HIS C 1 76  ? 3.418   -3.771  -12.642 1.00 0.00 ? 76  HIS C CG   2  
ATOM   10787  N ND1  . HIS C 1 76  ? 3.812   -3.245  -13.862 1.00 0.00 ? 76  HIS C ND1  2  
ATOM   10788  C CD2  . HIS C 1 76  ? 4.467   -3.548  -11.782 1.00 0.00 ? 76  HIS C CD2  2  
ATOM   10789  C CE1  . HIS C 1 76  ? 5.048   -2.738  -13.705 1.00 0.00 ? 76  HIS C CE1  2  
ATOM   10790  N NE2  . HIS C 1 76  ? 5.495   -2.896  -12.455 1.00 0.00 ? 76  HIS C NE2  2  
ATOM   10791  H H    . HIS C 1 76  ? 0.145   -5.645  -11.318 1.00 0.00 ? 76  HIS C H    2  
ATOM   10792  H HA   . HIS C 1 76  ? 2.314   -4.183  -10.340 1.00 0.00 ? 76  HIS C HA   2  
ATOM   10793  H HB2  . HIS C 1 76  ? 2.195   -5.505  -12.512 1.00 0.00 ? 76  HIS C HB2  2  
ATOM   10794  H HB3  . HIS C 1 76  ? 1.400   -4.097  -13.216 1.00 0.00 ? 76  HIS C HB3  2  
ATOM   10795  H HD1  . HIS C 1 76  ? 3.287   -3.244  -14.689 1.00 0.00 ? 76  HIS C HD1  2  
ATOM   10796  H HD2  . HIS C 1 76  ? 4.489   -3.837  -10.742 1.00 0.00 ? 76  HIS C HD2  2  
ATOM   10797  H HE1  . HIS C 1 76  ? 5.612   -2.261  -14.494 1.00 0.00 ? 76  HIS C HE1  2  
ATOM   10798  N N    . ALA C 1 77  ? -0.052  -2.326  -11.686 1.00 0.00 ? 77  ALA C N    2  
ATOM   10799  C CA   . ALA C 1 77  ? -0.574  -0.966  -11.731 1.00 0.00 ? 77  ALA C CA   2  
ATOM   10800  C C    . ALA C 1 77  ? -1.019  -0.513  -10.348 1.00 0.00 ? 77  ALA C C    2  
ATOM   10801  O O    . ALA C 1 77  ? -0.791  0.631   -9.950  1.00 0.00 ? 77  ALA C O    2  
ATOM   10802  C CB   . ALA C 1 77  ? -1.753  -0.898  -12.709 1.00 0.00 ? 77  ALA C CB   2  
ATOM   10803  H H    . ALA C 1 77  ? -0.567  -3.061  -12.091 1.00 0.00 ? 77  ALA C H    2  
ATOM   10804  H HA   . ALA C 1 77  ? 0.209   -0.308  -12.082 1.00 0.00 ? 77  ALA C HA   2  
ATOM   10805  H HB1  . ALA C 1 77  ? -1.383  -0.786  -13.719 1.00 0.00 ? 77  ALA C HB1  2  
ATOM   10806  H HB2  . ALA C 1 77  ? -2.378  -0.054  -12.459 1.00 0.00 ? 77  ALA C HB2  2  
ATOM   10807  H HB3  . ALA C 1 77  ? -2.331  -1.807  -12.639 1.00 0.00 ? 77  ALA C HB3  2  
ATOM   10808  N N    . GLN C 1 78  ? -1.664  -1.418  -9.610  1.00 0.00 ? 78  GLN C N    2  
ATOM   10809  C CA   . GLN C 1 78  ? -2.145  -1.096  -8.273  1.00 0.00 ? 78  GLN C CA   2  
ATOM   10810  C C    . GLN C 1 78  ? -0.964  -0.803  -7.348  1.00 0.00 ? 78  GLN C C    2  
ATOM   10811  O O    . GLN C 1 78  ? -0.954  0.194   -6.623  1.00 0.00 ? 78  GLN C O    2  
ATOM   10812  C CB   . GLN C 1 78  ? -2.971  -2.262  -7.732  1.00 0.00 ? 78  GLN C CB   2  
ATOM   10813  C CG   . GLN C 1 78  ? -3.823  -1.792  -6.557  1.00 0.00 ? 78  GLN C CG   2  
ATOM   10814  C CD   . GLN C 1 78  ? -4.646  -2.956  -6.016  1.00 0.00 ? 78  GLN C CD   2  
ATOM   10815  O OE1  . GLN C 1 78  ? -5.855  -2.826  -5.825  1.00 0.00 ? 78  GLN C OE1  2  
ATOM   10816  N NE2  . GLN C 1 78  ? -4.059  -4.091  -5.750  1.00 0.00 ? 78  GLN C NE2  2  
ATOM   10817  H H    . GLN C 1 78  ? -1.822  -2.317  -9.977  1.00 0.00 ? 78  GLN C H    2  
ATOM   10818  H HA   . GLN C 1 78  ? -2.766  -0.215  -8.332  1.00 0.00 ? 78  GLN C HA   2  
ATOM   10819  H HB2  . GLN C 1 78  ? -3.614  -2.639  -8.515  1.00 0.00 ? 78  GLN C HB2  2  
ATOM   10820  H HB3  . GLN C 1 78  ? -2.310  -3.049  -7.402  1.00 0.00 ? 78  GLN C HB3  2  
ATOM   10821  H HG2  . GLN C 1 78  ? -3.178  -1.414  -5.780  1.00 0.00 ? 78  GLN C HG2  2  
ATOM   10822  H HG3  . GLN C 1 78  ? -4.488  -1.007  -6.887  1.00 0.00 ? 78  GLN C HG3  2  
ATOM   10823  H HE21 . GLN C 1 78  ? -3.097  -4.191  -5.899  1.00 0.00 ? 78  GLN C HE21 2  
ATOM   10824  H HE22 . GLN C 1 78  ? -4.583  -4.843  -5.402  1.00 0.00 ? 78  GLN C HE22 2  
ATOM   10825  N N    . LEU C 1 79  ? 0.042   -1.673  -7.393  1.00 0.00 ? 79  LEU C N    2  
ATOM   10826  C CA   . LEU C 1 79  ? 1.238   -1.493  -6.573  1.00 0.00 ? 79  LEU C CA   2  
ATOM   10827  C C    . LEU C 1 79  ? 1.879   -0.135  -6.829  1.00 0.00 ? 79  LEU C C    2  
ATOM   10828  O O    . LEU C 1 79  ? 2.186   0.599   -5.894  1.00 0.00 ? 79  LEU C O    2  
ATOM   10829  C CB   . LEU C 1 79  ? 2.254   -2.606  -6.878  1.00 0.00 ? 79  LEU C CB   2  
ATOM   10830  C CG   . LEU C 1 79  ? 3.560   -2.378  -6.093  1.00 0.00 ? 79  LEU C CG   2  
ATOM   10831  C CD1  . LEU C 1 79  ? 3.249   -2.251  -4.598  1.00 0.00 ? 79  LEU C CD1  2  
ATOM   10832  C CD2  . LEU C 1 79  ? 4.520   -3.556  -6.331  1.00 0.00 ? 79  LEU C CD2  2  
ATOM   10833  H H    . LEU C 1 79  ? -0.019  -2.449  -7.992  1.00 0.00 ? 79  LEU C H    2  
ATOM   10834  H HA   . LEU C 1 79  ? 0.956   -1.550  -5.535  1.00 0.00 ? 79  LEU C HA   2  
ATOM   10835  H HB2  . LEU C 1 79  ? 1.830   -3.558  -6.602  1.00 0.00 ? 79  LEU C HB2  2  
ATOM   10836  H HB3  . LEU C 1 79  ? 2.473   -2.605  -7.936  1.00 0.00 ? 79  LEU C HB3  2  
ATOM   10837  H HG   . LEU C 1 79  ? 4.028   -1.463  -6.434  1.00 0.00 ? 79  LEU C HG   2  
ATOM   10838  H HD11 . LEU C 1 79  ? 2.399   -2.868  -4.351  1.00 0.00 ? 79  LEU C HD11 2  
ATOM   10839  H HD12 . LEU C 1 79  ? 4.104   -2.566  -4.022  1.00 0.00 ? 79  LEU C HD12 2  
ATOM   10840  H HD13 . LEU C 1 79  ? 3.023   -1.218  -4.366  1.00 0.00 ? 79  LEU C HD13 2  
ATOM   10841  H HD21 . LEU C 1 79  ? 3.963   -4.481  -6.375  1.00 0.00 ? 79  LEU C HD21 2  
ATOM   10842  H HD22 . LEU C 1 79  ? 5.038   -3.410  -7.268  1.00 0.00 ? 79  LEU C HD22 2  
ATOM   10843  H HD23 . LEU C 1 79  ? 5.243   -3.608  -5.530  1.00 0.00 ? 79  LEU C HD23 2  
ATOM   10844  N N    . HIS C 1 80  ? 2.086   0.193   -8.096  1.00 0.00 ? 80  HIS C N    2  
ATOM   10845  C CA   . HIS C 1 80  ? 2.706   1.467   -8.440  1.00 0.00 ? 80  HIS C CA   2  
ATOM   10846  C C    . HIS C 1 80  ? 1.803   2.636   -8.067  1.00 0.00 ? 80  HIS C C    2  
ATOM   10847  O O    . HIS C 1 80  ? 2.257   3.629   -7.495  1.00 0.00 ? 80  HIS C O    2  
ATOM   10848  C CB   . HIS C 1 80  ? 3.025   1.504   -9.935  1.00 0.00 ? 80  HIS C CB   2  
ATOM   10849  C CG   . HIS C 1 80  ? 4.412   0.964   -10.158 1.00 0.00 ? 80  HIS C CG   2  
ATOM   10850  N ND1  . HIS C 1 80  ? 5.473   1.784   -10.489 1.00 0.00 ? 80  HIS C ND1  2  
ATOM   10851  C CD2  . HIS C 1 80  ? 4.925   -0.305  -10.083 1.00 0.00 ? 80  HIS C CD2  2  
ATOM   10852  C CE1  . HIS C 1 80  ? 6.568   1.009   -10.601 1.00 0.00 ? 80  HIS C CE1  2  
ATOM   10853  N NE2  . HIS C 1 80  ? 6.288   -0.276  -10.364 1.00 0.00 ? 80  HIS C NE2  2  
ATOM   10854  H H    . HIS C 1 80  ? 1.823   -0.433  -8.809  1.00 0.00 ? 80  HIS C H    2  
ATOM   10855  H HA   . HIS C 1 80  ? 3.627   1.559   -7.888  1.00 0.00 ? 80  HIS C HA   2  
ATOM   10856  H HB2  . HIS C 1 80  ? 2.310   0.898   -10.475 1.00 0.00 ? 80  HIS C HB2  2  
ATOM   10857  H HB3  . HIS C 1 80  ? 2.976   2.521   -10.290 1.00 0.00 ? 80  HIS C HB3  2  
ATOM   10858  H HD1  . HIS C 1 80  ? 5.430   2.757   -10.625 1.00 0.00 ? 80  HIS C HD1  2  
ATOM   10859  H HD2  . HIS C 1 80  ? 4.358   -1.194  -9.843  1.00 0.00 ? 80  HIS C HD2  2  
ATOM   10860  H HE1  . HIS C 1 80  ? 7.551   1.378   -10.853 1.00 0.00 ? 80  HIS C HE1  2  
ATOM   10861  H HE2  . HIS C 1 80  ? 6.909   -1.035  -10.380 1.00 0.00 ? 80  HIS C HE2  2  
ATOM   10862  N N    . LEU C 1 81  ? 0.529   2.520   -8.404  1.00 0.00 ? 81  LEU C N    2  
ATOM   10863  C CA   . LEU C 1 81  ? -0.428  3.585   -8.108  1.00 0.00 ? 81  LEU C CA   2  
ATOM   10864  C C    . LEU C 1 81  ? -0.596  3.793   -6.601  1.00 0.00 ? 81  LEU C C    2  
ATOM   10865  O O    . LEU C 1 81  ? -0.609  4.932   -6.122  1.00 0.00 ? 81  LEU C O    2  
ATOM   10866  C CB   . LEU C 1 81  ? -1.783  3.258   -8.734  1.00 0.00 ? 81  LEU C CB   2  
ATOM   10867  C CG   . LEU C 1 81  ? -1.693  3.362   -10.262 1.00 0.00 ? 81  LEU C CG   2  
ATOM   10868  C CD1  . LEU C 1 81  ? -2.954  2.762   -10.887 1.00 0.00 ? 81  LEU C CD1  2  
ATOM   10869  C CD2  . LEU C 1 81  ? -1.557  4.833   -10.692 1.00 0.00 ? 81  LEU C CD2  2  
ATOM   10870  H H    . LEU C 1 81  ? 0.222   1.710   -8.867  1.00 0.00 ? 81  LEU C H    2  
ATOM   10871  H HA   . LEU C 1 81  ? -0.060  4.502   -8.538  1.00 0.00 ? 81  LEU C HA   2  
ATOM   10872  H HB2  . LEU C 1 81  ? -2.069  2.251   -8.457  1.00 0.00 ? 81  LEU C HB2  2  
ATOM   10873  H HB3  . LEU C 1 81  ? -2.526  3.953   -8.366  1.00 0.00 ? 81  LEU C HB3  2  
ATOM   10874  H HG   . LEU C 1 81  ? -0.830  2.807   -10.602 1.00 0.00 ? 81  LEU C HG   2  
ATOM   10875  H HD11 . LEU C 1 81  ? -3.818  3.050   -10.309 1.00 0.00 ? 81  LEU C HD11 2  
ATOM   10876  H HD12 . LEU C 1 81  ? -3.063  3.120   -11.901 1.00 0.00 ? 81  LEU C HD12 2  
ATOM   10877  H HD13 . LEU C 1 81  ? -2.871  1.685   -10.896 1.00 0.00 ? 81  LEU C HD13 2  
ATOM   10878  H HD21 . LEU C 1 81  ? -2.123  5.467   -10.026 1.00 0.00 ? 81  LEU C HD21 2  
ATOM   10879  H HD22 . LEU C 1 81  ? -0.517  5.123   -10.666 1.00 0.00 ? 81  LEU C HD22 2  
ATOM   10880  H HD23 . LEU C 1 81  ? -1.933  4.948   -11.700 1.00 0.00 ? 81  LEU C HD23 2  
ATOM   10881  N N    . MET C 1 82  ? -0.730  2.699   -5.858  1.00 0.00 ? 82  MET C N    2  
ATOM   10882  C CA   . MET C 1 82  ? -0.901  2.793   -4.410  1.00 0.00 ? 82  MET C CA   2  
ATOM   10883  C C    . MET C 1 82  ? 0.318   3.445   -3.766  1.00 0.00 ? 82  MET C C    2  
ATOM   10884  O O    . MET C 1 82  ? 0.194   4.316   -2.902  1.00 0.00 ? 82  MET C O    2  
ATOM   10885  C CB   . MET C 1 82  ? -1.109  1.396   -3.812  1.00 0.00 ? 82  MET C CB   2  
ATOM   10886  C CG   . MET C 1 82  ? -2.524  0.892   -4.117  1.00 0.00 ? 82  MET C CG   2  
ATOM   10887  S SD   . MET C 1 82  ? -3.754  1.917   -3.263  1.00 0.00 ? 82  MET C SD   2  
ATOM   10888  C CE   . MET C 1 82  ? -3.474  1.300   -1.581  1.00 0.00 ? 82  MET C CE   2  
ATOM   10889  H H    . MET C 1 82  ? -0.711  1.814   -6.288  1.00 0.00 ? 82  MET C H    2  
ATOM   10890  H HA   . MET C 1 82  ? -1.768  3.398   -4.201  1.00 0.00 ? 82  MET C HA   2  
ATOM   10891  H HB2  . MET C 1 82  ? -0.386  0.715   -4.239  1.00 0.00 ? 82  MET C HB2  2  
ATOM   10892  H HB3  . MET C 1 82  ? -0.967  1.439   -2.742  1.00 0.00 ? 82  MET C HB3  2  
ATOM   10893  H HG2  . MET C 1 82  ? -2.698  0.939   -5.183  1.00 0.00 ? 82  MET C HG2  2  
ATOM   10894  H HG3  . MET C 1 82  ? -2.616  -0.134  -3.787  1.00 0.00 ? 82  MET C HG3  2  
ATOM   10895  H HE1  . MET C 1 82  ? -3.298  0.234   -1.611  1.00 0.00 ? 82  MET C HE1  2  
ATOM   10896  H HE2  . MET C 1 82  ? -2.615  1.794   -1.157  1.00 0.00 ? 82  MET C HE2  2  
ATOM   10897  H HE3  . MET C 1 82  ? -4.344  1.510   -0.973  1.00 0.00 ? 82  MET C HE3  2  
ATOM   10898  N N    . THR C 1 83  ? 1.497   3.016   -4.195  1.00 0.00 ? 83  THR C N    2  
ATOM   10899  C CA   . THR C 1 83  ? 2.741   3.560   -3.660  1.00 0.00 ? 83  THR C CA   2  
ATOM   10900  C C    . THR C 1 83  ? 2.860   5.046   -3.977  1.00 0.00 ? 83  THR C C    2  
ATOM   10901  O O    . THR C 1 83  ? 3.175   5.859   -3.106  1.00 0.00 ? 83  THR C O    2  
ATOM   10902  C CB   . THR C 1 83  ? 3.946   2.819   -4.259  1.00 0.00 ? 83  THR C CB   2  
ATOM   10903  O OG1  . THR C 1 83  ? 3.766   2.695   -5.658  1.00 0.00 ? 83  THR C OG1  2  
ATOM   10904  C CG2  . THR C 1 83  ? 4.077   1.420   -3.641  1.00 0.00 ? 83  THR C CG2  2  
ATOM   10905  H H    . THR C 1 83  ? 1.536   2.323   -4.890  1.00 0.00 ? 83  THR C H    2  
ATOM   10906  H HA   . THR C 1 83  ? 2.750   3.432   -2.590  1.00 0.00 ? 83  THR C HA   2  
ATOM   10907  H HB   . THR C 1 83  ? 4.845   3.383   -4.064  1.00 0.00 ? 83  THR C HB   2  
ATOM   10908  H HG1  . THR C 1 83  ? 4.607   2.855   -6.088  1.00 0.00 ? 83  THR C HG1  2  
ATOM   10909  H HG21 . THR C 1 83  ? 3.119   1.099   -3.255  1.00 0.00 ? 83  THR C HG21 2  
ATOM   10910  H HG22 . THR C 1 83  ? 4.410   0.723   -4.395  1.00 0.00 ? 83  THR C HG22 2  
ATOM   10911  H HG23 . THR C 1 83  ? 4.797   1.448   -2.836  1.00 0.00 ? 83  THR C HG23 2  
ATOM   10912  N N    . SER C 1 84  ? 2.615   5.399   -5.232  1.00 0.00 ? 84  SER C N    2  
ATOM   10913  C CA   . SER C 1 84  ? 2.713   6.798   -5.658  1.00 0.00 ? 84  SER C CA   2  
ATOM   10914  C C    . SER C 1 84  ? 1.708   7.687   -4.927  1.00 0.00 ? 84  SER C C    2  
ATOM   10915  O O    . SER C 1 84  ? 2.064   8.761   -4.434  1.00 0.00 ? 84  SER C O    2  
ATOM   10916  C CB   . SER C 1 84  ? 2.491   6.908   -7.167  1.00 0.00 ? 84  SER C CB   2  
ATOM   10917  O OG   . SER C 1 84  ? 3.648   6.429   -7.843  1.00 0.00 ? 84  SER C OG   2  
ATOM   10918  H H    . SER C 1 84  ? 2.375   4.709   -5.891  1.00 0.00 ? 84  SER C H    2  
ATOM   10919  H HA   . SER C 1 84  ? 3.706   7.154   -5.436  1.00 0.00 ? 84  SER C HA   2  
ATOM   10920  H HB2  . SER C 1 84  ? 1.639   6.314   -7.455  1.00 0.00 ? 84  SER C HB2  2  
ATOM   10921  H HB3  . SER C 1 84  ? 2.311   7.944   -7.430  1.00 0.00 ? 84  SER C HB3  2  
ATOM   10922  H HG   . SER C 1 84  ? 3.692   5.473   -7.721  1.00 0.00 ? 84  SER C HG   2  
ATOM   10923  N N    . MET C 1 85  ? 0.452   7.249   -4.858  1.00 0.00 ? 85  MET C N    2  
ATOM   10924  C CA   . MET C 1 85  ? -0.578  8.036   -4.178  1.00 0.00 ? 85  MET C CA   2  
ATOM   10925  C C    . MET C 1 85  ? -0.220  8.260   -2.712  1.00 0.00 ? 85  MET C C    2  
ATOM   10926  O O    . MET C 1 85  ? -0.326  9.376   -2.196  1.00 0.00 ? 85  MET C O    2  
ATOM   10927  C CB   . MET C 1 85  ? -1.930  7.329   -4.288  1.00 0.00 ? 85  MET C CB   2  
ATOM   10928  C CG   . MET C 1 85  ? -3.031  8.249   -3.753  1.00 0.00 ? 85  MET C CG   2  
ATOM   10929  S SD   . MET C 1 85  ? -4.657  7.581   -4.193  1.00 0.00 ? 85  MET C SD   2  
ATOM   10930  C CE   . MET C 1 85  ? -4.738  6.269   -2.950  1.00 0.00 ? 85  MET C CE   2  
ATOM   10931  H H    . MET C 1 85  ? 0.214   6.386   -5.264  1.00 0.00 ? 85  MET C H    2  
ATOM   10932  H HA   . MET C 1 85  ? -0.656  8.993   -4.664  1.00 0.00 ? 85  MET C HA   2  
ATOM   10933  H HB2  . MET C 1 85  ? -2.129  7.090   -5.323  1.00 0.00 ? 85  MET C HB2  2  
ATOM   10934  H HB3  . MET C 1 85  ? -1.907  6.421   -3.706  1.00 0.00 ? 85  MET C HB3  2  
ATOM   10935  H HG2  . MET C 1 85  ? -2.950  8.317   -2.678  1.00 0.00 ? 85  MET C HG2  2  
ATOM   10936  H HG3  . MET C 1 85  ? -2.917  9.233   -4.184  1.00 0.00 ? 85  MET C HG3  2  
ATOM   10937  H HE1  . MET C 1 85  ? -3.915  5.588   -3.085  1.00 0.00 ? 85  MET C HE1  2  
ATOM   10938  H HE2  . MET C 1 85  ? -4.686  6.706   -1.963  1.00 0.00 ? 85  MET C HE2  2  
ATOM   10939  H HE3  . MET C 1 85  ? -5.669  5.730   -3.061  1.00 0.00 ? 85  MET C HE3  2  
ATOM   10940  N N    . LEU C 1 86  ? 0.205   7.195   -2.051  1.00 0.00 ? 86  LEU C N    2  
ATOM   10941  C CA   . LEU C 1 86  ? 0.576   7.272   -0.644  1.00 0.00 ? 86  LEU C CA   2  
ATOM   10942  C C    . LEU C 1 86  ? 1.754   8.222   -0.451  1.00 0.00 ? 86  LEU C C    2  
ATOM   10943  O O    . LEU C 1 86  ? 1.746   9.086   0.431   1.00 0.00 ? 86  LEU C O    2  
ATOM   10944  C CB   . LEU C 1 86  ? 0.955   5.875   -0.148  1.00 0.00 ? 86  LEU C CB   2  
ATOM   10945  C CG   . LEU C 1 86  ? 1.048   5.876   1.384   1.00 0.00 ? 86  LEU C CG   2  
ATOM   10946  C CD1  . LEU C 1 86  ? -0.362  5.894   2.009   1.00 0.00 ? 86  LEU C CD1  2  
ATOM   10947  C CD2  . LEU C 1 86  ? 1.816   4.628   1.853   1.00 0.00 ? 86  LEU C CD2  2  
ATOM   10948  H H    . LEU C 1 86  ? 0.273   6.334   -2.519  1.00 0.00 ? 86  LEU C H    2  
ATOM   10949  H HA   . LEU C 1 86  ? -0.264  7.636   -0.077  1.00 0.00 ? 86  LEU C HA   2  
ATOM   10950  H HB2  . LEU C 1 86  ? 0.207   5.166   -0.471  1.00 0.00 ? 86  LEU C HB2  2  
ATOM   10951  H HB3  . LEU C 1 86  ? 1.913   5.601   -0.566  1.00 0.00 ? 86  LEU C HB3  2  
ATOM   10952  H HG   . LEU C 1 86  ? 1.585   6.761   1.702   1.00 0.00 ? 86  LEU C HG   2  
ATOM   10953  H HD11 . LEU C 1 86  ? -1.108  5.988   1.231   1.00 0.00 ? 86  LEU C HD11 2  
ATOM   10954  H HD12 . LEU C 1 86  ? -0.530  4.980   2.562   1.00 0.00 ? 86  LEU C HD12 2  
ATOM   10955  H HD13 . LEU C 1 86  ? -0.443  6.737   2.681   1.00 0.00 ? 86  LEU C HD13 2  
ATOM   10956  H HD21 . LEU C 1 86  ? 2.665   4.456   1.205   1.00 0.00 ? 86  LEU C HD21 2  
ATOM   10957  H HD22 . LEU C 1 86  ? 2.164   4.780   2.864   1.00 0.00 ? 86  LEU C HD22 2  
ATOM   10958  H HD23 . LEU C 1 86  ? 1.164   3.767   1.824   1.00 0.00 ? 86  LEU C HD23 2  
ATOM   10959  N N    . ALA C 1 87  ? 2.769   8.053   -1.284  1.00 0.00 ? 87  ALA C N    2  
ATOM   10960  C CA   . ALA C 1 87  ? 3.959   8.895   -1.207  1.00 0.00 ? 87  ALA C CA   2  
ATOM   10961  C C    . ALA C 1 87  ? 3.583   10.360  -1.375  1.00 0.00 ? 87  ALA C C    2  
ATOM   10962  O O    . ALA C 1 87  ? 4.013   11.228  -0.611  1.00 0.00 ? 87  ALA C O    2  
ATOM   10963  C CB   . ALA C 1 87  ? 4.962   8.492   -2.304  1.00 0.00 ? 87  ALA C CB   2  
ATOM   10964  H H    . ALA C 1 87  ? 2.717   7.349   -1.967  1.00 0.00 ? 87  ALA C H    2  
ATOM   10965  H HA   . ALA C 1 87  ? 4.420   8.763   -0.242  1.00 0.00 ? 87  ALA C HA   2  
ATOM   10966  H HB1  . ALA C 1 87  ? 5.233   9.363   -2.893  1.00 0.00 ? 87  ALA C HB1  2  
ATOM   10967  H HB2  . ALA C 1 87  ? 5.851   8.084   -1.849  1.00 0.00 ? 87  ALA C HB2  2  
ATOM   10968  H HB3  . ALA C 1 87  ? 4.517   7.750   -2.950  1.00 0.00 ? 87  ALA C HB3  2  
ATOM   10969  N N    . ARG C 1 88  ? 2.781   10.628  -2.388  1.00 0.00 ? 88  ARG C N    2  
ATOM   10970  C CA   . ARG C 1 88  ? 2.358   11.990  -2.667  1.00 0.00 ? 88  ARG C CA   2  
ATOM   10971  C C    . ARG C 1 88  ? 1.610   12.589  -1.473  1.00 0.00 ? 88  ARG C C    2  
ATOM   10972  O O    . ARG C 1 88  ? 1.850   13.737  -1.097  1.00 0.00 ? 88  ARG C O    2  
ATOM   10973  C CB   . ARG C 1 88  ? 1.492   12.012  -3.933  1.00 0.00 ? 88  ARG C CB   2  
ATOM   10974  C CG   . ARG C 1 88  ? 1.307   13.459  -4.431  1.00 0.00 ? 88  ARG C CG   2  
ATOM   10975  C CD   . ARG C 1 88  ? -0.138  13.680  -4.883  1.00 0.00 ? 88  ARG C CD   2  
ATOM   10976  N NE   . ARG C 1 88  ? -0.644  14.939  -4.338  1.00 0.00 ? 88  ARG C NE   2  
ATOM   10977  C CZ   . ARG C 1 88  ? -0.699  15.152  -3.037  1.00 0.00 ? 88  ARG C CZ   2  
ATOM   10978  N NH1  . ARG C 1 88  ? -0.291  14.240  -2.222  1.00 0.00 ? 88  ARG C NH1  2  
ATOM   10979  N NH2  . ARG C 1 88  ? -1.162  16.265  -2.584  1.00 0.00 ? 88  ARG C NH2  2  
ATOM   10980  H H    . ARG C 1 88  ? 2.470   9.895   -2.963  1.00 0.00 ? 88  ARG C H    2  
ATOM   10981  H HA   . ARG C 1 88  ? 3.239   12.586  -2.846  1.00 0.00 ? 88  ARG C HA   2  
ATOM   10982  H HB2  . ARG C 1 88  ? 1.987   11.431  -4.703  1.00 0.00 ? 88  ARG C HB2  2  
ATOM   10983  H HB3  . ARG C 1 88  ? 0.530   11.571  -3.719  1.00 0.00 ? 88  ARG C HB3  2  
ATOM   10984  H HG2  . ARG C 1 88  ? 1.545   14.153  -3.636  1.00 0.00 ? 88  ARG C HG2  2  
ATOM   10985  H HG3  . ARG C 1 88  ? 1.970   13.640  -5.267  1.00 0.00 ? 88  ARG C HG3  2  
ATOM   10986  H HD2  . ARG C 1 88  ? -0.172  13.717  -5.964  1.00 0.00 ? 88  ARG C HD2  2  
ATOM   10987  H HD3  . ARG C 1 88  ? -0.757  12.863  -4.536  1.00 0.00 ? 88  ARG C HD3  2  
ATOM   10988  H HE   . ARG C 1 88  ? -0.950  15.640  -4.953  1.00 0.00 ? 88  ARG C HE   2  
ATOM   10989  H HH11 . ARG C 1 88  ? 0.069   13.379  -2.580  1.00 0.00 ? 88  ARG C HH11 2  
ATOM   10990  H HH12 . ARG C 1 88  ? -0.323  14.393  -1.238  1.00 0.00 ? 88  ARG C HH12 2  
ATOM   10991  H HH21 . ARG C 1 88  ? -1.479  16.968  -3.215  1.00 0.00 ? 88  ARG C HH21 2  
ATOM   10992  H HH22 . ARG C 1 88  ? -1.182  16.431  -1.598  1.00 0.00 ? 88  ARG C HH22 2  
ATOM   10993  N N    . GLU C 1 89  ? 0.703   11.821  -0.875  1.00 0.00 ? 89  GLU C N    2  
ATOM   10994  C CA   . GLU C 1 89  ? -0.049  12.321  0.283   1.00 0.00 ? 89  GLU C CA   2  
ATOM   10995  C C    . GLU C 1 89  ? 0.893   12.646  1.438   1.00 0.00 ? 89  GLU C C    2  
ATOM   10996  O O    . GLU C 1 89  ? 0.781   13.700  2.062   1.00 0.00 ? 89  GLU C O    2  
ATOM   10997  C CB   . GLU C 1 89  ? -1.074  11.283  0.750   1.00 0.00 ? 89  GLU C CB   2  
ATOM   10998  C CG   . GLU C 1 89  ? -1.976  11.889  1.839   1.00 0.00 ? 89  GLU C CG   2  
ATOM   10999  C CD   . GLU C 1 89  ? -3.068  10.890  2.223   1.00 0.00 ? 89  GLU C CD   2  
ATOM   11000  O OE1  . GLU C 1 89  ? -3.184  9.876   1.551   1.00 0.00 ? 89  GLU C OE1  2  
ATOM   11001  O OE2  . GLU C 1 89  ? -3.767  11.150  3.182   1.00 0.00 ? 89  GLU C OE2  2  
ATOM   11002  H H    . GLU C 1 89  ? 0.538   10.908  -1.205  1.00 0.00 ? 89  GLU C H    2  
ATOM   11003  H HA   . GLU C 1 89  ? -0.571  13.218  0.001   1.00 0.00 ? 89  GLU C HA   2  
ATOM   11004  H HB2  . GLU C 1 89  ? -1.687  10.978  -0.086  1.00 0.00 ? 89  GLU C HB2  2  
ATOM   11005  H HB3  . GLU C 1 89  ? -0.562  10.423  1.154   1.00 0.00 ? 89  GLU C HB3  2  
ATOM   11006  H HG2  . GLU C 1 89  ? -1.383  12.121  2.714   1.00 0.00 ? 89  GLU C HG2  2  
ATOM   11007  H HG3  . GLU C 1 89  ? -2.437  12.791  1.471   1.00 0.00 ? 89  GLU C HG3  2  
ATOM   11008  N N    . LEU C 1 90  ? 1.828   11.749  1.710   1.00 0.00 ? 90  LEU C N    2  
ATOM   11009  C CA   . LEU C 1 90  ? 2.781   11.967  2.792   1.00 0.00 ? 90  LEU C CA   2  
ATOM   11010  C C    . LEU C 1 90  ? 3.669   13.163  2.474   1.00 0.00 ? 90  LEU C C    2  
ATOM   11011  O O    . LEU C 1 90  ? 3.943   14.004  3.335   1.00 0.00 ? 90  LEU C O    2  
ATOM   11012  C CB   . LEU C 1 90  ? 3.618   10.713  2.984   1.00 0.00 ? 90  LEU C CB   2  
ATOM   11013  C CG   . LEU C 1 90  ? 2.725   9.606   3.561   1.00 0.00 ? 90  LEU C CG   2  
ATOM   11014  C CD1  . LEU C 1 90  ? 3.446   8.272   3.423   1.00 0.00 ? 90  LEU C CD1  2  
ATOM   11015  C CD2  . LEU C 1 90  ? 2.418   9.876   5.045   1.00 0.00 ? 90  LEU C CD2  2  
ATOM   11016  H H    . LEU C 1 90  ? 1.882   10.928  1.173   1.00 0.00 ? 90  LEU C H    2  
ATOM   11017  H HA   . LEU C 1 90  ? 2.238   12.172  3.703   1.00 0.00 ? 90  LEU C HA   2  
ATOM   11018  H HB2  . LEU C 1 90  ? 4.012   10.400  2.025   1.00 0.00 ? 90  LEU C HB2  2  
ATOM   11019  H HB3  . LEU C 1 90  ? 4.431   10.916  3.663   1.00 0.00 ? 90  LEU C HB3  2  
ATOM   11020  H HG   . LEU C 1 90  ? 1.797   9.569   3.003   1.00 0.00 ? 90  LEU C HG   2  
ATOM   11021  H HD11 . LEU C 1 90  ? 4.461   8.380   3.768   1.00 0.00 ? 90  LEU C HD11 2  
ATOM   11022  H HD12 . LEU C 1 90  ? 2.939   7.523   4.010   1.00 0.00 ? 90  LEU C HD12 2  
ATOM   11023  H HD13 . LEU C 1 90  ? 3.448   7.973   2.381   1.00 0.00 ? 90  LEU C HD13 2  
ATOM   11024  H HD21 . LEU C 1 90  ? 3.251   10.385  5.507   1.00 0.00 ? 90  LEU C HD21 2  
ATOM   11025  H HD22 . LEU C 1 90  ? 1.533   10.492  5.125   1.00 0.00 ? 90  LEU C HD22 2  
ATOM   11026  H HD23 . LEU C 1 90  ? 2.245   8.937   5.555   1.00 0.00 ? 90  LEU C HD23 2  
ATOM   11027  N N    . ILE C 1 91  ? 4.100   13.246  1.223   1.00 0.00 ? 91  ILE C N    2  
ATOM   11028  C CA   . ILE C 1 91  ? 4.933   14.363  0.797   1.00 0.00 ? 91  ILE C CA   2  
ATOM   11029  C C    . ILE C 1 91  ? 4.173   15.668  1.008   1.00 0.00 ? 91  ILE C C    2  
ATOM   11030  O O    . ILE C 1 91  ? 4.741   16.663  1.458   1.00 0.00 ? 91  ILE C O    2  
ATOM   11031  C CB   . ILE C 1 91  ? 5.362   14.176  -0.668  1.00 0.00 ? 91  ILE C CB   2  
ATOM   11032  C CG1  . ILE C 1 91  ? 6.409   13.052  -0.711  1.00 0.00 ? 91  ILE C CG1  2  
ATOM   11033  C CG2  . ILE C 1 91  ? 5.970   15.481  -1.219  1.00 0.00 ? 91  ILE C CG2  2  
ATOM   11034  C CD1  . ILE C 1 91  ? 6.643   12.601  -2.153  1.00 0.00 ? 91  ILE C CD1  2  
ATOM   11035  H H    . ILE C 1 91  ? 3.840   12.556  0.576   1.00 0.00 ? 91  ILE C H    2  
ATOM   11036  H HA   . ILE C 1 91  ? 5.817   14.388  1.415   1.00 0.00 ? 91  ILE C HA   2  
ATOM   11037  H HB   . ILE C 1 91  ? 4.504   13.898  -1.265  1.00 0.00 ? 91  ILE C HB   2  
ATOM   11038  H HG12 . ILE C 1 91  ? 7.337   13.410  -0.292  1.00 0.00 ? 91  ILE C HG12 2  
ATOM   11039  H HG13 . ILE C 1 91  ? 6.056   12.213  -0.129  1.00 0.00 ? 91  ILE C HG13 2  
ATOM   11040  H HG21 . ILE C 1 91  ? 6.417   16.045  -0.412  1.00 0.00 ? 91  ILE C HG21 2  
ATOM   11041  H HG22 . ILE C 1 91  ? 6.727   15.245  -1.954  1.00 0.00 ? 91  ILE C HG22 2  
ATOM   11042  H HG23 . ILE C 1 91  ? 5.194   16.074  -1.681  1.00 0.00 ? 91  ILE C HG23 2  
ATOM   11043  H HD11 . ILE C 1 91  ? 6.605   13.456  -2.809  1.00 0.00 ? 91  ILE C HD11 2  
ATOM   11044  H HD12 . ILE C 1 91  ? 7.616   12.133  -2.224  1.00 0.00 ? 91  ILE C HD12 2  
ATOM   11045  H HD13 . ILE C 1 91  ? 5.882   11.890  -2.437  1.00 0.00 ? 91  ILE C HD13 2  
ATOM   11046  N N    . THR C 1 92  ? 2.871   15.648  0.732   1.00 0.00 ? 92  THR C N    2  
ATOM   11047  C CA   . THR C 1 92  ? 2.048   16.837  0.952   1.00 0.00 ? 92  THR C CA   2  
ATOM   11048  C C    . THR C 1 92  ? 2.133   17.244  2.423   1.00 0.00 ? 92  THR C C    2  
ATOM   11049  O O    . THR C 1 92  ? 2.332   18.416  2.744   1.00 0.00 ? 92  THR C O    2  
ATOM   11050  C CB   . THR C 1 92  ? 0.588   16.559  0.567   1.00 0.00 ? 92  THR C CB   2  
ATOM   11051  O OG1  . THR C 1 92  ? 0.490   16.406  -0.839  1.00 0.00 ? 92  THR C OG1  2  
ATOM   11052  C CG2  . THR C 1 92  ? -0.311  17.715  1.013   1.00 0.00 ? 92  THR C CG2  2  
ATOM   11053  H H    . THR C 1 92  ? 2.455   14.820  0.408   1.00 0.00 ? 92  THR C H    2  
ATOM   11054  H HA   . THR C 1 92  ? 2.429   17.644  0.349   1.00 0.00 ? 92  THR C HA   2  
ATOM   11055  H HB   . THR C 1 92  ? 0.261   15.649  1.048   1.00 0.00 ? 92  THR C HB   2  
ATOM   11056  H HG1  . THR C 1 92  ? 0.565   15.471  -1.037  1.00 0.00 ? 92  THR C HG1  2  
ATOM   11057  H HG21 . THR C 1 92  ? 0.253   18.636  1.025   1.00 0.00 ? 92  THR C HG21 2  
ATOM   11058  H HG22 . THR C 1 92  ? -1.140  17.812  0.328   1.00 0.00 ? 92  THR C HG22 2  
ATOM   11059  H HG23 . THR C 1 92  ? -0.688  17.515  2.006   1.00 0.00 ? 92  THR C HG23 2  
ATOM   11060  N N    . GLU C 1 93  ? 2.016   16.264  3.311   1.00 0.00 ? 93  GLU C N    2  
ATOM   11061  C CA   . GLU C 1 93  ? 2.112   16.531  4.743   1.00 0.00 ? 93  GLU C CA   2  
ATOM   11062  C C    . GLU C 1 93  ? 3.487   17.107  5.075   1.00 0.00 ? 93  GLU C C    2  
ATOM   11063  O O    . GLU C 1 93  ? 3.613   18.063  5.848   1.00 0.00 ? 93  GLU C O    2  
ATOM   11064  C CB   . GLU C 1 93  ? 1.903   15.237  5.531   1.00 0.00 ? 93  GLU C CB   2  
ATOM   11065  C CG   . GLU C 1 93  ? 0.519   14.664  5.220   1.00 0.00 ? 93  GLU C CG   2  
ATOM   11066  C CD   . GLU C 1 93  ? -0.572  15.496  5.895   1.00 0.00 ? 93  GLU C CD   2  
ATOM   11067  O OE1  . GLU C 1 93  ? -0.240  16.446  6.593   1.00 0.00 ? 93  GLU C OE1  2  
ATOM   11068  O OE2  . GLU C 1 93  ? -1.724  15.178  5.711   1.00 0.00 ? 93  GLU C OE2  2  
ATOM   11069  H H    . GLU C 1 93  ? 1.881   15.343  3.002   1.00 0.00 ? 93  GLU C H    2  
ATOM   11070  H HA   . GLU C 1 93  ? 1.350   17.246  5.022   1.00 0.00 ? 93  GLU C HA   2  
ATOM   11071  H HB2  . GLU C 1 93  ? 2.663   14.521  5.256   1.00 0.00 ? 93  GLU C HB2  2  
ATOM   11072  H HB3  . GLU C 1 93  ? 1.973   15.448  6.590   1.00 0.00 ? 93  GLU C HB3  2  
ATOM   11073  H HG2  . GLU C 1 93  ? 0.359   14.671  4.151   1.00 0.00 ? 93  GLU C HG2  2  
ATOM   11074  H HG3  . GLU C 1 93  ? 0.461   13.648  5.579   1.00 0.00 ? 93  GLU C HG3  2  
ATOM   11075  N N    . LEU C 1 94  ? 4.519   16.516  4.480   1.00 0.00 ? 94  LEU C N    2  
ATOM   11076  C CA   . LEU C 1 94  ? 5.889   16.976  4.706   1.00 0.00 ? 94  LEU C CA   2  
ATOM   11077  C C    . LEU C 1 94  ? 6.029   18.436  4.269   1.00 0.00 ? 94  LEU C C    2  
ATOM   11078  O O    . LEU C 1 94  ? 6.644   19.253  4.960   1.00 0.00 ? 94  LEU C O    2  
ATOM   11079  C CB   . LEU C 1 94  ? 6.883   16.097  3.926   1.00 0.00 ? 94  LEU C CB   2  
ATOM   11080  C CG   . LEU C 1 94  ? 7.055   14.733  4.626   1.00 0.00 ? 94  LEU C CG   2  
ATOM   11081  C CD1  . LEU C 1 94  ? 7.579   13.692  3.624   1.00 0.00 ? 94  LEU C CD1  2  
ATOM   11082  C CD2  . LEU C 1 94  ? 8.053   14.853  5.786   1.00 0.00 ? 94  LEU C CD2  2  
ATOM   11083  H H    . LEU C 1 94  ? 4.356   15.764  3.870   1.00 0.00 ? 94  LEU C H    2  
ATOM   11084  H HA   . LEU C 1 94  ? 6.108   16.910  5.758   1.00 0.00 ? 94  LEU C HA   2  
ATOM   11085  H HB2  . LEU C 1 94  ? 6.508   15.943  2.926   1.00 0.00 ? 94  LEU C HB2  2  
ATOM   11086  H HB3  . LEU C 1 94  ? 7.838   16.600  3.875   1.00 0.00 ? 94  LEU C HB3  2  
ATOM   11087  H HG   . LEU C 1 94  ? 6.098   14.405  5.010   1.00 0.00 ? 94  LEU C HG   2  
ATOM   11088  H HD11 . LEU C 1 94  ? 8.193   14.179  2.878   1.00 0.00 ? 94  LEU C HD11 2  
ATOM   11089  H HD12 . LEU C 1 94  ? 8.172   12.952  4.146   1.00 0.00 ? 94  LEU C HD12 2  
ATOM   11090  H HD13 . LEU C 1 94  ? 6.746   13.205  3.140   1.00 0.00 ? 94  LEU C HD13 2  
ATOM   11091  H HD21 . LEU C 1 94  ? 8.960   15.325  5.436   1.00 0.00 ? 94  LEU C HD21 2  
ATOM   11092  H HD22 . LEU C 1 94  ? 7.622   15.445  6.579   1.00 0.00 ? 94  LEU C HD22 2  
ATOM   11093  H HD23 . LEU C 1 94  ? 8.288   13.867  6.162   1.00 0.00 ? 94  LEU C HD23 2  
ATOM   11094  N N    . ILE C 1 95  ? 5.449   18.769  3.122   1.00 0.00 ? 95  ILE C N    2  
ATOM   11095  C CA   . ILE C 1 95  ? 5.507   20.141  2.623   1.00 0.00 ? 95  ILE C CA   2  
ATOM   11096  C C    . ILE C 1 95  ? 4.802   21.086  3.595   1.00 0.00 ? 95  ILE C C    2  
ATOM   11097  O O    . ILE C 1 95  ? 5.309   22.165  3.898   1.00 0.00 ? 95  ILE C O    2  
ATOM   11098  C CB   . ILE C 1 95  ? 4.869   20.230  1.233   1.00 0.00 ? 95  ILE C CB   2  
ATOM   11099  C CG1  . ILE C 1 95  ? 5.782   19.516  0.236   1.00 0.00 ? 95  ILE C CG1  2  
ATOM   11100  C CG2  . ILE C 1 95  ? 4.723   21.700  0.822   1.00 0.00 ? 95  ILE C CG2  2  
ATOM   11101  C CD1  . ILE C 1 95  ? 5.079   19.360  -1.116  1.00 0.00 ? 95  ILE C CD1  2  
ATOM   11102  H H    . ILE C 1 95  ? 4.968   18.083  2.609   1.00 0.00 ? 95  ILE C H    2  
ATOM   11103  H HA   . ILE C 1 95  ? 6.540   20.440  2.549   1.00 0.00 ? 95  ILE C HA   2  
ATOM   11104  H HB   . ILE C 1 95  ? 3.896   19.757  1.245   1.00 0.00 ? 95  ILE C HB   2  
ATOM   11105  H HG12 . ILE C 1 95  ? 6.684   20.094  0.107   1.00 0.00 ? 95  ILE C HG12 2  
ATOM   11106  H HG13 . ILE C 1 95  ? 6.034   18.541  0.621   1.00 0.00 ? 95  ILE C HG13 2  
ATOM   11107  H HG21 . ILE C 1 95  ? 5.646   22.224  1.025   1.00 0.00 ? 95  ILE C HG21 2  
ATOM   11108  H HG22 . ILE C 1 95  ? 4.503   21.757  -0.235  1.00 0.00 ? 95  ILE C HG22 2  
ATOM   11109  H HG23 . ILE C 1 95  ? 3.921   22.157  1.381   1.00 0.00 ? 95  ILE C HG23 2  
ATOM   11110  H HD11 . ILE C 1 95  ? 4.451   20.219  -1.302  1.00 0.00 ? 95  ILE C HD11 2  
ATOM   11111  H HD12 . ILE C 1 95  ? 5.823   19.284  -1.895  1.00 0.00 ? 95  ILE C HD12 2  
ATOM   11112  H HD13 . ILE C 1 95  ? 4.474   18.466  -1.107  1.00 0.00 ? 95  ILE C HD13 2  
ATOM   11113  N N    . GLU C 1 96  ? 3.647   20.667  4.104   1.00 0.00 ? 96  GLU C N    2  
ATOM   11114  C CA   . GLU C 1 96  ? 2.916   21.493  5.062   1.00 0.00 ? 96  GLU C CA   2  
ATOM   11115  C C    . GLU C 1 96  ? 3.797   21.756  6.283   1.00 0.00 ? 96  GLU C C    2  
ATOM   11116  O O    . GLU C 1 96  ? 3.817   22.860  6.829   1.00 0.00 ? 96  GLU C O    2  
ATOM   11117  C CB   . GLU C 1 96  ? 1.620   20.791  5.484   1.00 0.00 ? 96  GLU C CB   2  
ATOM   11118  C CG   . GLU C 1 96  ? 0.863   21.642  6.538   1.00 0.00 ? 96  GLU C CG   2  
ATOM   11119  C CD   . GLU C 1 96  ? -0.574  21.925  6.099   1.00 0.00 ? 96  GLU C CD   2  
ATOM   11120  O OE1  . GLU C 1 96  ? -1.125  21.128  5.360   1.00 0.00 ? 96  GLU C OE1  2  
ATOM   11121  O OE2  . GLU C 1 96  ? -1.120  22.917  6.548   1.00 0.00 ? 96  GLU C OE2  2  
ATOM   11122  H H    . GLU C 1 96  ? 3.292   19.789  3.846   1.00 0.00 ? 96  GLU C H    2  
ATOM   11123  H HA   . GLU C 1 96  ? 2.673   22.436  4.598   1.00 0.00 ? 96  GLU C HA   2  
ATOM   11124  H HB2  . GLU C 1 96  ? 0.998   20.653  4.610   1.00 0.00 ? 96  GLU C HB2  2  
ATOM   11125  H HB3  . GLU C 1 96  ? 1.860   19.825  5.904   1.00 0.00 ? 96  GLU C HB3  2  
ATOM   11126  H HG2  . GLU C 1 96  ? 0.840   21.108  7.475   1.00 0.00 ? 96  GLU C HG2  2  
ATOM   11127  H HG3  . GLU C 1 96  ? 1.376