data_2X36
# 
_entry.id   2X36 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2X36         
PDBE  EBI-42569    
WWPDB D_1290042569 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2X36 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-21 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Garcia, J.'      1 
'Ondrovicova, G.' 2 
'Blagova, E.'     3 
'Levdikov, V.M.'  4 
'Bauer, J.A.'     5 
'Kutejova, E.'    6 
'Wilkinson, A.J.' 7 
'Wilson, K.S.'    8 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Catalytic Domain of the Human Mitochondrial Lon Protease: Proposed Relation of Oligomer Formation and Activity.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            19 
_citation.page_first                987 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20222013 
_citation.pdbx_database_id_DOI      10.1002/PRO.376 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Garcia-Nafria, J.' 1 
primary 'Ondrovicova, G.'   2 
primary 'Blagova, E.'       3 
primary 'Levdikov, V.M.'    4 
primary 'Bauer, J.A.'       5 
primary 'Suzuki, C.K.'      6 
primary 'Kutejova, E.'      7 
primary 'Wilkinson, A.J.'   8 
primary 'Wilson, K.S.'      9 
# 
_cell.entry_id           2X36 
_cell.length_a           69.800 
_cell.length_b           83.750 
_cell.length_c           105.490 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.05 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2X36 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'LON PROTEASE HOMOLOG, MITOCHONDRIAL' 22425.717 6   3.4.21.- ? 'PROTEOLYTIC DOMAIN, RESIDUES 753-959' ? 
2 water   nat water                                 18.015    328 ?        ? ?                                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'LON PROTEASE-LIKE PROTEIN, LONP, LONHS, SERINE PROTEASE 15, MITOCHONDRIAL ATP-DEPENDENT PROTEASE LON' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAN
DYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVL
PAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALAVER
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAN
DYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVL
PAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALAVER
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   GLU n 
1 3   ARG n 
1 4   MET n 
1 5   TYR n 
1 6   ASP n 
1 7   VAL n 
1 8   THR n 
1 9   PRO n 
1 10  PRO n 
1 11  GLY n 
1 12  VAL n 
1 13  VAL n 
1 14  MET n 
1 15  GLY n 
1 16  LEU n 
1 17  ALA n 
1 18  TRP n 
1 19  THR n 
1 20  ALA n 
1 21  MET n 
1 22  GLY n 
1 23  GLY n 
1 24  SER n 
1 25  THR n 
1 26  LEU n 
1 27  PHE n 
1 28  VAL n 
1 29  GLU n 
1 30  THR n 
1 31  SER n 
1 32  LEU n 
1 33  ARG n 
1 34  ARG n 
1 35  PRO n 
1 36  GLN n 
1 37  ASP n 
1 38  LYS n 
1 39  ASP n 
1 40  ALA n 
1 41  LYS n 
1 42  GLY n 
1 43  ASP n 
1 44  LYS n 
1 45  ASP n 
1 46  GLY n 
1 47  SER n 
1 48  LEU n 
1 49  GLU n 
1 50  VAL n 
1 51  THR n 
1 52  GLY n 
1 53  GLN n 
1 54  LEU n 
1 55  GLY n 
1 56  GLU n 
1 57  VAL n 
1 58  MET n 
1 59  LYS n 
1 60  GLU n 
1 61  SER n 
1 62  ALA n 
1 63  ARG n 
1 64  ILE n 
1 65  ALA n 
1 66  TYR n 
1 67  THR n 
1 68  PHE n 
1 69  ALA n 
1 70  ARG n 
1 71  ALA n 
1 72  PHE n 
1 73  LEU n 
1 74  MET n 
1 75  GLN n 
1 76  HIS n 
1 77  ALA n 
1 78  PRO n 
1 79  ALA n 
1 80  ASN n 
1 81  ASP n 
1 82  TYR n 
1 83  LEU n 
1 84  VAL n 
1 85  THR n 
1 86  SER n 
1 87  HIS n 
1 88  ILE n 
1 89  HIS n 
1 90  LEU n 
1 91  HIS n 
1 92  VAL n 
1 93  PRO n 
1 94  GLU n 
1 95  GLY n 
1 96  ALA n 
1 97  THR n 
1 98  PRO n 
1 99  LYS n 
1 100 ASP n 
1 101 GLY n 
1 102 PRO n 
1 103 SER n 
1 104 ALA n 
1 105 GLY n 
1 106 CYS n 
1 107 THR n 
1 108 ILE n 
1 109 VAL n 
1 110 THR n 
1 111 ALA n 
1 112 LEU n 
1 113 LEU n 
1 114 SER n 
1 115 LEU n 
1 116 ALA n 
1 117 MET n 
1 118 GLY n 
1 119 ARG n 
1 120 PRO n 
1 121 VAL n 
1 122 ARG n 
1 123 GLN n 
1 124 ASN n 
1 125 LEU n 
1 126 ALA n 
1 127 MET n 
1 128 THR n 
1 129 GLY n 
1 130 GLU n 
1 131 VAL n 
1 132 SER n 
1 133 LEU n 
1 134 THR n 
1 135 GLY n 
1 136 LYS n 
1 137 ILE n 
1 138 LEU n 
1 139 PRO n 
1 140 VAL n 
1 141 GLY n 
1 142 GLY n 
1 143 ILE n 
1 144 LYS n 
1 145 GLU n 
1 146 LYS n 
1 147 THR n 
1 148 ILE n 
1 149 ALA n 
1 150 ALA n 
1 151 LYS n 
1 152 ARG n 
1 153 ALA n 
1 154 GLY n 
1 155 VAL n 
1 156 THR n 
1 157 CYS n 
1 158 ILE n 
1 159 VAL n 
1 160 LEU n 
1 161 PRO n 
1 162 ALA n 
1 163 GLU n 
1 164 ASN n 
1 165 LYS n 
1 166 LYS n 
1 167 ASP n 
1 168 PHE n 
1 169 TYR n 
1 170 ASP n 
1 171 LEU n 
1 172 ALA n 
1 173 ALA n 
1 174 PHE n 
1 175 ILE n 
1 176 THR n 
1 177 GLU n 
1 178 GLY n 
1 179 LEU n 
1 180 GLU n 
1 181 VAL n 
1 182 HIS n 
1 183 PHE n 
1 184 VAL n 
1 185 GLU n 
1 186 HIS n 
1 187 TYR n 
1 188 ARG n 
1 189 GLU n 
1 190 ILE n 
1 191 PHE n 
1 192 ASP n 
1 193 ILE n 
1 194 ALA n 
1 195 PHE n 
1 196 PRO n 
1 197 ASP n 
1 198 GLU n 
1 199 GLN n 
1 200 ALA n 
1 201 GLU n 
1 202 ALA n 
1 203 LEU n 
1 204 ALA n 
1 205 VAL n 
1 206 GLU n 
1 207 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'ROSETTA II' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PROEX 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LONM_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P36776 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2X36 A 1 ? 207 ? P36776 753 ? 959 ? 753 959 
2 1 2X36 B 1 ? 207 ? P36776 753 ? 959 ? 753 959 
3 1 2X36 C 1 ? 207 ? P36776 753 ? 959 ? 753 959 
4 1 2X36 D 1 ? 207 ? P36776 753 ? 959 ? 753 959 
5 1 2X36 E 1 ? 207 ? P36776 753 ? 959 ? 753 959 
6 1 2X36 F 1 ? 207 ? P36776 753 ? 959 ? 753 959 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2X36 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.53 
_exptl_crystal.density_percent_sol   51 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BIS-TRIS PROPANOL PH 6.5, 0.25 M SODIUM ACETATE, 28% PEG 3350' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-08-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9395 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9395, 0.9395' 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2X36 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             2.11 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   82419 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.73 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.70 
_reflns_shell.pdbx_redundancy        3.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2X36 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     77152 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.96 
_refine.ls_R_factor_obs                          0.19549 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19355 
_refine.ls_R_factor_R_free                       0.23230 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_number_reflns_R_free                  4394 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               40.803 
_refine.aniso_B[1][1]                            16.64 
_refine.aniso_B[2][2]                            17.57 
_refine.aniso_B[3][3]                            -34.21 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.51 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1RRE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.038 
_refine.pdbx_overall_ESU_R_Free                  0.034 
_refine.overall_SU_ML                            0.090 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.377 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8297 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             328 
_refine_hist.number_atoms_total               8625 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        34.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.027  0.022  ? 8558  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 5702  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.095  1.968  ? 11625 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.196  3.000  ? 13966 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.815  5.000  ? 1104  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.862 23.394 ? 327   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       20.004 15.000 ? 1401  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.568 15.000 ? 48    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.139  0.200  ? 1352  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.011  0.021  ? 9505  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1690  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  4.470  4.000  ? 5492  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.586  4.000  ? 2250  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.686  6.000  ? 8847  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  7.911  8.000  ? 3066  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 9.057  10.000 ? 2777  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.998 
_refine_ls_shell.d_res_low                        2.050 
_refine_ls_shell.number_reflns_R_work             5400 
_refine_ls_shell.R_factor_R_work                  0.230 
_refine_ls_shell.percent_reflns_obs               95.18 
_refine_ls_shell.R_factor_R_free                  0.294 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             371 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2X36 
_struct.title                     'Structure of the proteolytic domain of the Human Mitochondrial Lon protease' 
_struct.pdbx_descriptor           'LON PROTEASE HOMOLOG, MITOCHONDRIAL (E.C.3.4.21.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2X36 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, CATALYTIC DYAD, TRANSIT PEPTIDE, MITOCHONDRIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 55  ? ALA A 77  ? GLY A 807 ALA A 829 1 ? 23 
HELX_P HELX_P2  2  ASP A 81  ? SER A 86  ? ASP A 833 SER A 838 1 ? 6  
HELX_P HELX_P3  3  ASP A 100 ? SER A 103 ? ASP A 852 SER A 855 5 ? 4  
HELX_P HELX_P4  4  ALA A 104 ? GLY A 118 ? ALA A 856 GLY A 870 1 ? 15 
HELX_P HELX_P5  5  GLY A 142 ? ALA A 153 ? GLY A 894 ALA A 905 1 ? 12 
HELX_P HELX_P6  6  ASN A 164 ? ASP A 170 ? ASN A 916 ASP A 922 1 ? 7  
HELX_P HELX_P7  7  ALA A 172 ? GLU A 177 ? ALA A 924 GLU A 929 1 ? 6  
HELX_P HELX_P8  8  HIS A 186 ? PHE A 195 ? HIS A 938 PHE A 947 1 ? 10 
HELX_P HELX_P9  9  GLY B 55  ? ALA B 77  ? GLY B 807 ALA B 829 1 ? 23 
HELX_P HELX_P10 10 ASP B 81  ? SER B 86  ? ASP B 833 SER B 838 1 ? 6  
HELX_P HELX_P11 11 ASP B 100 ? SER B 103 ? ASP B 852 SER B 855 5 ? 4  
HELX_P HELX_P12 12 ALA B 104 ? MET B 117 ? ALA B 856 MET B 869 1 ? 14 
HELX_P HELX_P13 13 GLY B 142 ? ALA B 153 ? GLY B 894 ALA B 905 1 ? 12 
HELX_P HELX_P14 14 ASN B 164 ? ASP B 170 ? ASN B 916 ASP B 922 1 ? 7  
HELX_P HELX_P15 15 ALA B 172 ? GLU B 177 ? ALA B 924 GLU B 929 1 ? 6  
HELX_P HELX_P16 16 HIS B 186 ? PHE B 195 ? HIS B 938 PHE B 947 1 ? 10 
HELX_P HELX_P17 17 GLY C 55  ? ALA C 77  ? GLY C 807 ALA C 829 1 ? 23 
HELX_P HELX_P18 18 ASP C 81  ? SER C 86  ? ASP C 833 SER C 838 1 ? 6  
HELX_P HELX_P19 19 ASP C 100 ? SER C 103 ? ASP C 852 SER C 855 5 ? 4  
HELX_P HELX_P20 20 ALA C 104 ? MET C 117 ? ALA C 856 MET C 869 1 ? 14 
HELX_P HELX_P21 21 GLY C 142 ? ALA C 153 ? GLY C 894 ALA C 905 1 ? 12 
HELX_P HELX_P22 22 ASN C 164 ? ASP C 170 ? ASN C 916 ASP C 922 1 ? 7  
HELX_P HELX_P23 23 ALA C 172 ? GLU C 177 ? ALA C 924 GLU C 929 1 ? 6  
HELX_P HELX_P24 24 HIS C 186 ? PHE C 195 ? HIS C 938 PHE C 947 1 ? 10 
HELX_P HELX_P25 25 GLY D 55  ? ALA D 77  ? GLY D 807 ALA D 829 1 ? 23 
HELX_P HELX_P26 26 ASP D 81  ? SER D 86  ? ASP D 833 SER D 838 1 ? 6  
HELX_P HELX_P27 27 ASP D 100 ? SER D 103 ? ASP D 852 SER D 855 5 ? 4  
HELX_P HELX_P28 28 ALA D 104 ? GLY D 118 ? ALA D 856 GLY D 870 1 ? 15 
HELX_P HELX_P29 29 GLY D 142 ? GLY D 154 ? GLY D 894 GLY D 906 1 ? 13 
HELX_P HELX_P30 30 ASN D 164 ? ASP D 170 ? ASN D 916 ASP D 922 1 ? 7  
HELX_P HELX_P31 31 ALA D 172 ? GLU D 177 ? ALA D 924 GLU D 929 1 ? 6  
HELX_P HELX_P32 32 HIS D 186 ? PHE D 195 ? HIS D 938 PHE D 947 1 ? 10 
HELX_P HELX_P33 33 GLY E 55  ? ALA E 77  ? GLY E 807 ALA E 829 1 ? 23 
HELX_P HELX_P34 34 ASP E 81  ? SER E 86  ? ASP E 833 SER E 838 1 ? 6  
HELX_P HELX_P35 35 ASP E 100 ? SER E 103 ? ASP E 852 SER E 855 5 ? 4  
HELX_P HELX_P36 36 ALA E 104 ? GLY E 118 ? ALA E 856 GLY E 870 1 ? 15 
HELX_P HELX_P37 37 GLY E 142 ? ALA E 153 ? GLY E 894 ALA E 905 1 ? 12 
HELX_P HELX_P38 38 ASN E 164 ? ASP E 170 ? ASN E 916 ASP E 922 1 ? 7  
HELX_P HELX_P39 39 ALA E 172 ? GLU E 177 ? ALA E 924 GLU E 929 1 ? 6  
HELX_P HELX_P40 40 HIS E 186 ? PHE E 195 ? HIS E 938 PHE E 947 1 ? 10 
HELX_P HELX_P41 41 GLY F 55  ? ALA F 77  ? GLY F 807 ALA F 829 1 ? 23 
HELX_P HELX_P42 42 ASP F 81  ? SER F 86  ? ASP F 833 SER F 838 1 ? 6  
HELX_P HELX_P43 43 THR F 97  ? SER F 103 ? THR F 849 SER F 855 5 ? 7  
HELX_P HELX_P44 44 ALA F 104 ? MET F 117 ? ALA F 856 MET F 869 1 ? 14 
HELX_P HELX_P45 45 GLY F 142 ? ALA F 153 ? GLY F 894 ALA F 905 1 ? 12 
HELX_P HELX_P46 46 ASN F 164 ? ASP F 170 ? ASN F 916 ASP F 922 1 ? 7  
HELX_P HELX_P47 47 ALA F 172 ? GLU F 177 ? ALA F 924 GLU F 929 1 ? 6  
HELX_P HELX_P48 48 HIS F 186 ? PHE F 195 ? HIS F 938 PHE F 947 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 3 ? 
AC ? 2 ? 
BA ? 7 ? 
BB ? 2 ? 
CA ? 7 ? 
CB ? 2 ? 
DA ? 7 ? 
DB ? 2 ? 
EA ? 4 ? 
EB ? 3 ? 
EC ? 2 ? 
FA ? 4 ? 
FB ? 3 ? 
FC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? parallel      
BA 5 6 ? parallel      
BA 6 7 ? parallel      
BB 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? parallel      
CA 5 6 ? parallel      
CA 6 7 ? parallel      
CB 1 2 ? anti-parallel 
DA 1 2 ? parallel      
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? parallel      
DA 5 6 ? parallel      
DA 6 7 ? parallel      
DB 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? parallel      
EB 1 2 ? parallel      
EB 2 3 ? parallel      
EC 1 2 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? parallel      
FB 1 2 ? parallel      
FB 2 3 ? parallel      
FC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 12  ? TRP A 18  ? VAL A 764 TRP A 770 
AA 2 GLY A 23  ? LEU A 32  ? GLY A 775 LEU A 784 
AA 3 HIS A 87  ? HIS A 91  ? HIS A 839 HIS A 843 
AA 4 SER A 47  ? THR A 51  ? SER A 799 THR A 803 
AB 1 LEU A 125 ? MET A 127 ? LEU A 877 MET A 879 
AB 2 CYS A 157 ? PRO A 161 ? CYS A 909 PRO A 913 
AB 3 GLU A 180 ? VAL A 184 ? GLU A 932 VAL A 936 
AC 1 GLU A 130 ? VAL A 131 ? GLU A 882 VAL A 883 
AC 2 ILE A 137 ? LEU A 138 ? ILE A 889 LEU A 890 
BA 1 SER B 47  ? THR B 51  ? SER B 799 THR B 803 
BA 2 HIS B 87  ? HIS B 91  ? HIS B 839 HIS B 843 
BA 3 GLY B 23  ? SER B 31  ? GLY B 775 SER B 783 
BA 4 VAL B 12  ? TRP B 18  ? VAL B 764 TRP B 770 
BA 5 LEU B 125 ? MET B 127 ? LEU B 877 MET B 879 
BA 6 CYS B 157 ? PRO B 161 ? CYS B 909 PRO B 913 
BA 7 GLU B 180 ? VAL B 184 ? GLU B 932 VAL B 936 
BB 1 GLU B 130 ? VAL B 131 ? GLU B 882 VAL B 883 
BB 2 ILE B 137 ? LEU B 138 ? ILE B 889 LEU B 890 
CA 1 SER C 47  ? THR C 51  ? SER C 799 THR C 803 
CA 2 HIS C 87  ? HIS C 91  ? HIS C 839 HIS C 843 
CA 3 GLY C 22  ? LEU C 32  ? GLY C 774 LEU C 784 
CA 4 VAL C 13  ? THR C 19  ? VAL C 765 THR C 771 
CA 5 LEU C 125 ? MET C 127 ? LEU C 877 MET C 879 
CA 6 CYS C 157 ? PRO C 161 ? CYS C 909 PRO C 913 
CA 7 GLU C 180 ? VAL C 184 ? GLU C 932 VAL C 936 
CB 1 GLU C 130 ? VAL C 131 ? GLU C 882 VAL C 883 
CB 2 ILE C 137 ? LEU C 138 ? ILE C 889 LEU C 890 
DA 1 SER D 47  ? THR D 51  ? SER D 799 THR D 803 
DA 2 HIS D 87  ? HIS D 91  ? HIS D 839 HIS D 843 
DA 3 GLY D 23  ? LEU D 32  ? GLY D 775 LEU D 784 
DA 4 VAL D 12  ? TRP D 18  ? VAL D 764 TRP D 770 
DA 5 ALA D 126 ? MET D 127 ? ALA D 878 MET D 879 
DA 6 CYS D 157 ? PRO D 161 ? CYS D 909 PRO D 913 
DA 7 GLU D 180 ? VAL D 184 ? GLU D 932 VAL D 936 
DB 1 GLU D 130 ? VAL D 131 ? GLU D 882 VAL D 883 
DB 2 ILE D 137 ? LEU D 138 ? ILE D 889 LEU D 890 
EA 1 VAL E 12  ? THR E 19  ? VAL E 764 THR E 771 
EA 2 GLY E 22  ? LEU E 32  ? GLY E 774 LEU E 784 
EA 3 HIS E 87  ? HIS E 91  ? HIS E 839 HIS E 843 
EA 4 SER E 47  ? THR E 51  ? SER E 799 THR E 803 
EB 1 ALA E 126 ? MET E 127 ? ALA E 878 MET E 879 
EB 2 CYS E 157 ? PRO E 161 ? CYS E 909 PRO E 913 
EB 3 GLU E 180 ? VAL E 184 ? GLU E 932 VAL E 936 
EC 1 GLU E 130 ? VAL E 131 ? GLU E 882 VAL E 883 
EC 2 ILE E 137 ? LEU E 138 ? ILE E 889 LEU E 890 
FA 1 VAL F 12  ? THR F 19  ? VAL F 764 THR F 771 
FA 2 GLY F 22  ? LEU F 32  ? GLY F 774 LEU F 784 
FA 3 HIS F 87  ? HIS F 91  ? HIS F 839 HIS F 843 
FA 4 SER F 47  ? THR F 51  ? SER F 799 THR F 803 
FB 1 LEU F 125 ? MET F 127 ? LEU F 877 MET F 879 
FB 2 CYS F 157 ? PRO F 161 ? CYS F 909 PRO F 913 
FB 3 GLU F 180 ? VAL F 184 ? GLU F 932 VAL F 936 
FC 1 GLU F 130 ? VAL F 131 ? GLU F 882 VAL F 883 
FC 2 ILE F 137 ? LEU F 138 ? ILE F 889 LEU F 890 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 17  ? N ALA A 769 O SER A 24  ? O SER A 776 
AA 2 3 N SER A 31  ? N SER A 783 O HIS A 89  ? O HIS A 841 
AA 3 4 N ILE A 88  ? N ILE A 840 O SER A 47  ? O SER A 799 
AB 1 2 N ALA A 126 ? N ALA A 878 O CYS A 157 ? O CYS A 909 
AB 2 3 N ILE A 158 ? N ILE A 910 O GLU A 180 ? O GLU A 932 
AC 1 2 N GLU A 130 ? N GLU A 882 O LEU A 138 ? O LEU A 890 
BA 1 2 N GLU B 49  ? N GLU B 801 O ILE B 88  ? O ILE B 840 
BA 2 3 N HIS B 91  ? N HIS B 843 O GLU B 29  ? O GLU B 781 
BA 3 4 N VAL B 28  ? N VAL B 780 O VAL B 13  ? O VAL B 765 
BA 4 5 N MET B 14  ? N MET B 766 O LEU B 125 ? O LEU B 877 
BA 5 6 N ALA B 126 ? N ALA B 878 O CYS B 157 ? O CYS B 909 
BA 6 7 N ILE B 158 ? N ILE B 910 O GLU B 180 ? O GLU B 932 
BB 1 2 N GLU B 130 ? N GLU B 882 O LEU B 138 ? O LEU B 890 
CA 1 2 N GLU C 49  ? N GLU C 801 O ILE C 88  ? O ILE C 840 
CA 2 3 N HIS C 91  ? N HIS C 843 O GLU C 29  ? O GLU C 781 
CA 3 4 N VAL C 28  ? N VAL C 780 O VAL C 13  ? O VAL C 765 
CA 4 5 N MET C 14  ? N MET C 766 O LEU C 125 ? O LEU C 877 
CA 5 6 N ALA C 126 ? N ALA C 878 O CYS C 157 ? O CYS C 909 
CA 6 7 N ILE C 158 ? N ILE C 910 O GLU C 180 ? O GLU C 932 
CB 1 2 N GLU C 130 ? N GLU C 882 O LEU C 138 ? O LEU C 890 
DA 1 2 N GLU D 49  ? N GLU D 801 O ILE D 88  ? O ILE D 840 
DA 2 3 N HIS D 91  ? N HIS D 843 O GLU D 29  ? O GLU D 781 
DA 3 4 N VAL D 28  ? N VAL D 780 O VAL D 13  ? O VAL D 765 
DA 4 5 N LEU D 16  ? N LEU D 768 O MET D 127 ? O MET D 879 
DA 5 6 N ALA D 126 ? N ALA D 878 O CYS D 157 ? O CYS D 909 
DA 6 7 N ILE D 158 ? N ILE D 910 O GLU D 180 ? O GLU D 932 
DB 1 2 N GLU D 130 ? N GLU D 882 O LEU D 138 ? O LEU D 890 
EA 1 2 N THR E 19  ? N THR E 771 O GLY E 22  ? O GLY E 774 
EA 2 3 N SER E 31  ? N SER E 783 O HIS E 89  ? O HIS E 841 
EA 3 4 N ILE E 88  ? N ILE E 840 O SER E 47  ? O SER E 799 
EB 1 2 N ALA E 126 ? N ALA E 878 O CYS E 157 ? O CYS E 909 
EB 2 3 N ILE E 158 ? N ILE E 910 O GLU E 180 ? O GLU E 932 
EC 1 2 N GLU E 130 ? N GLU E 882 O LEU E 138 ? O LEU E 890 
FA 1 2 N THR F 19  ? N THR F 771 O GLY F 22  ? O GLY F 774 
FA 2 3 N SER F 31  ? N SER F 783 O HIS F 89  ? O HIS F 841 
FA 3 4 N ILE F 88  ? N ILE F 840 O SER F 47  ? O SER F 799 
FB 1 2 N ALA F 126 ? N ALA F 878 O CYS F 157 ? O CYS F 909 
FB 2 3 N ILE F 158 ? N ILE F 910 O GLU F 180 ? O GLU F 932 
FC 1 2 N GLU F 130 ? N GLU F 882 O LEU F 138 ? O LEU F 890 
# 
_database_PDB_matrix.entry_id          2X36 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2X36 
_atom_sites.fract_transf_matrix[1][1]   0.014327 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000013 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011940 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009480 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 4   ? -5.754  -1.692  40.703  1.00   66.07  ? 756  MET A N   1 
ATOM   2    C CA  . MET A 1 4   ? -6.124  -0.225  40.640  1.00   64.16  ? 756  MET A CA  1 
ATOM   3    C C   . MET A 1 4   ? -7.454  -0.082  39.918  1.00   62.36  ? 756  MET A C   1 
ATOM   4    O O   . MET A 1 4   ? -8.407  0.435   40.490  1.00   62.55  ? 756  MET A O   1 
ATOM   5    C CB  . MET A 1 4   ? -5.027  0.683   39.989  1.00   65.64  ? 756  MET A CB  1 
ATOM   6    C CG  . MET A 1 4   ? -5.118  2.187   40.445  1.00   66.33  ? 756  MET A CG  1 
ATOM   7    S SD  . MET A 1 4   ? -4.506  3.492   39.328  1.00   69.66  ? 756  MET A SD  1 
ATOM   8    C CE  . MET A 1 4   ? -2.861  3.760   40.021  1.00   67.52  ? 756  MET A CE  1 
ATOM   9    N N   . TYR A 1 5   ? -7.513  -0.546  38.665  1.00   61.29  ? 757  TYR A N   1 
ATOM   10   C CA  . TYR A 1 5   ? -8.732  -0.532  37.889  1.00   63.19  ? 757  TYR A CA  1 
ATOM   11   C C   . TYR A 1 5   ? -9.020  -1.966  37.469  1.00   67.38  ? 757  TYR A C   1 
ATOM   12   O O   . TYR A 1 5   ? -8.103  -2.805  37.304  1.00   66.29  ? 757  TYR A O   1 
ATOM   13   C CB  . TYR A 1 5   ? -8.606  0.369   36.645  1.00   65.45  ? 757  TYR A CB  1 
ATOM   14   C CG  . TYR A 1 5   ? -8.660  1.878   36.911  1.00   67.43  ? 757  TYR A CG  1 
ATOM   15   C CD1 . TYR A 1 5   ? -7.508  2.652   36.912  1.00   66.90  ? 757  TYR A CD1 1 
ATOM   16   C CD2 . TYR A 1 5   ? -9.891  2.532   37.151  1.00   78.68  ? 757  TYR A CD2 1 
ATOM   17   C CE1 . TYR A 1 5   ? -7.559  4.047   37.161  1.00   72.27  ? 757  TYR A CE1 1 
ATOM   18   C CE2 . TYR A 1 5   ? -9.956  3.936   37.396  1.00   66.46  ? 757  TYR A CE2 1 
ATOM   19   C CZ  . TYR A 1 5   ? -8.785  4.676   37.389  1.00   63.58  ? 757  TYR A CZ  1 
ATOM   20   O OH  . TYR A 1 5   ? -8.833  6.035   37.603  1.00   67.55  ? 757  TYR A OH  1 
ATOM   21   N N   . ASP A 1 6   ? -10.301 -2.256  37.319  1.00   69.35  ? 758  ASP A N   1 
ATOM   22   C CA  . ASP A 1 6   ? -10.720 -3.491  36.681  1.00   69.91  ? 758  ASP A CA  1 
ATOM   23   C C   . ASP A 1 6   ? -11.118 -3.130  35.278  1.00   68.20  ? 758  ASP A C   1 
ATOM   24   O O   . ASP A 1 6   ? -10.787 -3.838  34.347  1.00   67.15  ? 758  ASP A O   1 
ATOM   25   C CB  . ASP A 1 6   ? -11.882 -4.130  37.419  1.00   72.97  ? 758  ASP A CB  1 
ATOM   26   C CG  . ASP A 1 6   ? -11.489 -4.623  38.779  1.00   77.89  ? 758  ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 6   ? -11.346 -3.758  39.680  1.00   84.67  ? 758  ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 6   ? -11.322 -5.862  38.953  1.00   72.46  ? 758  ASP A OD2 1 
ATOM   29   N N   . VAL A 1 7   ? -11.844 -2.026  35.143  1.00   67.21  ? 759  VAL A N   1 
ATOM   30   C CA  . VAL A 1 7   ? -12.022 -1.375  33.855  1.00   65.13  ? 759  VAL A CA  1 
ATOM   31   C C   . VAL A 1 7   ? -11.345 -0.011  33.846  1.00   63.16  ? 759  VAL A C   1 
ATOM   32   O O   . VAL A 1 7   ? -11.564 0.815   34.733  1.00   62.73  ? 759  VAL A O   1 
ATOM   33   C CB  . VAL A 1 7   ? -13.513 -1.201  33.511  1.00   68.23  ? 759  VAL A CB  1 
ATOM   34   C CG1 . VAL A 1 7   ? -13.669 -0.513  32.163  1.00   57.70  ? 759  VAL A CG1 1 
ATOM   35   C CG2 . VAL A 1 7   ? -14.219 -2.548  33.515  1.00   60.46  ? 759  VAL A CG2 1 
ATOM   36   N N   . THR A 1 8   ? -10.520 0.211   32.831  1.00   60.02  ? 760  THR A N   1 
ATOM   37   C CA  . THR A 1 8   ? -9.719  1.414   32.722  1.00   55.22  ? 760  THR A CA  1 
ATOM   38   C C   . THR A 1 8   ? -10.459 2.459   31.948  1.00   52.47  ? 760  THR A C   1 
ATOM   39   O O   . THR A 1 8   ? -11.073 2.156   30.979  1.00   57.86  ? 760  THR A O   1 
ATOM   40   C CB  . THR A 1 8   ? -8.372  1.144   32.059  1.00   52.19  ? 760  THR A CB  1 
ATOM   41   O OG1 . THR A 1 8   ? -8.555  0.365   30.908  1.00   54.48  ? 760  THR A OG1 1 
ATOM   42   C CG2 . THR A 1 8   ? -7.524  0.382   32.922  1.00   47.26  ? 760  THR A CG2 1 
ATOM   43   N N   . PRO A 1 9   ? -10.403 3.693   32.403  1.00   52.82  ? 761  PRO A N   1 
ATOM   44   C CA  . PRO A 1 9   ? -11.070 4.788   31.736  1.00   51.19  ? 761  PRO A CA  1 
ATOM   45   C C   . PRO A 1 9   ? -10.188 5.146   30.605  1.00   57.61  ? 761  PRO A C   1 
ATOM   46   O O   . PRO A 1 9   ? -9.266  4.449   30.408  1.00   59.52  ? 761  PRO A O   1 
ATOM   47   C CB  . PRO A 1 9   ? -11.019 5.883   32.758  1.00   57.89  ? 761  PRO A CB  1 
ATOM   48   C CG  . PRO A 1 9   ? -9.972  5.549   33.615  1.00   53.13  ? 761  PRO A CG  1 
ATOM   49   C CD  . PRO A 1 9   ? -9.882  4.120   33.695  1.00   53.15  ? 761  PRO A CD  1 
ATOM   50   N N   . PRO A 1 10  ? -10.479 6.161   29.836  1.00   55.79  ? 762  PRO A N   1 
ATOM   51   C CA  . PRO A 1 10  ? -9.607  6.530   28.748  1.00   52.28  ? 762  PRO A CA  1 
ATOM   52   C C   . PRO A 1 10  ? -8.319  7.132   29.314  1.00   53.19  ? 762  PRO A C   1 
ATOM   53   O O   . PRO A 1 10  ? -8.326  7.506   30.451  1.00   52.52  ? 762  PRO A O   1 
ATOM   54   C CB  . PRO A 1 10  ? -10.420 7.566   28.012  1.00   54.02  ? 762  PRO A CB  1 
ATOM   55   C CG  . PRO A 1 10  ? -11.718 7.394   28.425  1.00   53.00  ? 762  PRO A CG  1 
ATOM   56   C CD  . PRO A 1 10  ? -11.721 6.910   29.773  1.00   52.28  ? 762  PRO A CD  1 
ATOM   57   N N   . GLY A 1 11  ? -7.245  7.164   28.543  1.00   40.92  ? 763  GLY A N   1 
ATOM   58   C CA  . GLY A 1 11  ? -5.924  7.666   29.011  1.00   45.89  ? 763  GLY A CA  1 
ATOM   59   C C   . GLY A 1 11  ? -5.177  6.770   29.976  1.00   46.50  ? 763  GLY A C   1 
ATOM   60   O O   . GLY A 1 11  ? -4.147  7.147   30.462  1.00   46.56  ? 763  GLY A O   1 
ATOM   61   N N   . VAL A 1 12  ? -5.709  5.581   30.266  1.00   46.74  ? 764  VAL A N   1 
ATOM   62   C CA  . VAL A 1 12  ? -5.136  4.772   31.319  1.00   46.76  ? 764  VAL A CA  1 
ATOM   63   C C   . VAL A 1 12  ? -4.805  3.366   30.796  1.00   39.13  ? 764  VAL A C   1 
ATOM   64   O O   . VAL A 1 12  ? -5.661  2.743   30.323  1.00   34.25  ? 764  VAL A O   1 
ATOM   65   C CB  . VAL A 1 12  ? -6.048  4.690   32.571  1.00   43.53  ? 764  VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 12  ? -5.310  3.901   33.586  1.00   47.12  ? 764  VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 12  ? -6.451  6.121   33.130  1.00   40.83  ? 764  VAL A CG2 1 
ATOM   68   N N   . VAL A 1 13  ? -3.583  2.894   30.928  1.00   42.09  ? 765  VAL A N   1 
ATOM   69   C CA  . VAL A 1 13  ? -3.170  1.604   30.369  1.00   43.53  ? 765  VAL A CA  1 
ATOM   70   C C   . VAL A 1 13  ? -2.266  0.761   31.307  1.00   42.32  ? 765  VAL A C   1 
ATOM   71   O O   . VAL A 1 13  ? -1.423  1.280   31.945  1.00   34.82  ? 765  VAL A O   1 
ATOM   72   C CB  . VAL A 1 13  ? -2.440  1.847   28.993  1.00   41.60  ? 765  VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 13  ? -1.996  0.609   28.363  1.00   35.22  ? 765  VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 13  ? -3.284  2.607   28.055  1.00   41.45  ? 765  VAL A CG2 1 
ATOM   75   N N   . MET A 1 14  ? -2.500  -0.533  31.372  1.00   40.34  ? 766  MET A N   1 
ATOM   76   C CA  . MET A 1 14  ? -1.695  -1.531  32.091  1.00   42.47  ? 766  MET A CA  1 
ATOM   77   C C   . MET A 1 14  ? -0.449  -1.794  31.340  1.00   27.95  ? 766  MET A C   1 
ATOM   78   O O   . MET A 1 14  ? -0.449  -2.151  30.143  1.00   38.81  ? 766  MET A O   1 
ATOM   79   C CB  . MET A 1 14  ? -2.426  -2.914  32.185  1.00   35.64  ? 766  MET A CB  1 
ATOM   80   C CG  . MET A 1 14  ? -3.525  -2.902  33.279  1.00   47.91  ? 766  MET A CG  1 
ATOM   81   S SD  . MET A 1 14  ? -3.822  -4.617  33.979  1.00   54.48  ? 766  MET A SD  1 
ATOM   82   C CE  . MET A 1 14  ? -2.209  -5.340  34.108  1.00   55.40  ? 766  MET A CE  1 
ATOM   83   N N   . GLY A 1 15  ? 0.653   -1.585  32.014  1.00   38.83  ? 767  GLY A N   1 
ATOM   84   C CA  . GLY A 1 15  ? 1.969   -1.831  31.452  1.00   35.95  ? 767  GLY A CA  1 
ATOM   85   C C   . GLY A 1 15  ? 2.735   -2.745  32.419  1.00   37.11  ? 767  GLY A C   1 
ATOM   86   O O   . GLY A 1 15  ? 2.421   -2.815  33.628  1.00   51.65  ? 767  GLY A O   1 
ATOM   87   N N   . LEU A 1 16  ? 3.587   -3.567  31.850  1.00   40.29  ? 768  LEU A N   1 
ATOM   88   C CA  . LEU A 1 16  ? 4.222   -4.619  32.583  1.00   37.35  ? 768  LEU A CA  1 
ATOM   89   C C   . LEU A 1 16  ? 5.639   -4.278  32.797  1.00   36.80  ? 768  LEU A C   1 
ATOM   90   O O   . LEU A 1 16  ? 6.371   -4.028  31.898  1.00   38.46  ? 768  LEU A O   1 
ATOM   91   C CB  . LEU A 1 16  ? 4.126   -5.924  31.856  1.00   40.49  ? 768  LEU A CB  1 
ATOM   92   C CG  . LEU A 1 16  ? 2.742   -6.495  31.621  1.00   29.73  ? 768  LEU A CG  1 
ATOM   93   C CD1 . LEU A 1 16  ? 2.810   -7.670  30.829  1.00   37.56  ? 768  LEU A CD1 1 
ATOM   94   C CD2 . LEU A 1 16  ? 1.996   -6.765  32.824  1.00   27.19  ? 768  LEU A CD2 1 
ATOM   95   N N   . ALA A 1 17  ? 6.020   -4.265  34.034  1.00   30.32  ? 769  ALA A N   1 
ATOM   96   C CA  . ALA A 1 17  ? 7.337   -3.764  34.374  1.00   40.95  ? 769  ALA A CA  1 
ATOM   97   C C   . ALA A 1 17  ? 8.256   -4.815  34.976  1.00   34.45  ? 769  ALA A C   1 
ATOM   98   O O   . ALA A 1 17  ? 7.854   -5.666  35.696  1.00   40.36  ? 769  ALA A O   1 
ATOM   99   C CB  . ALA A 1 17  ? 7.274   -2.585  35.295  1.00   32.93  ? 769  ALA A CB  1 
ATOM   100  N N   . TRP A 1 18  ? 9.538   -4.616  34.702  1.00   38.72  ? 770  TRP A N   1 
ATOM   101  C CA  . TRP A 1 18  ? 10.633  -5.373  35.364  1.00   39.30  ? 770  TRP A CA  1 
ATOM   102  C C   . TRP A 1 18  ? 11.232  -4.546  36.526  1.00   41.87  ? 770  TRP A C   1 
ATOM   103  O O   . TRP A 1 18  ? 11.892  -3.510  36.332  1.00   38.60  ? 770  TRP A O   1 
ATOM   104  C CB  . TRP A 1 18  ? 11.656  -5.779  34.288  1.00   37.69  ? 770  TRP A CB  1 
ATOM   105  C CG  . TRP A 1 18  ? 12.686  -6.748  34.714  1.00   42.14  ? 770  TRP A CG  1 
ATOM   106  C CD1 . TRP A 1 18  ? 12.673  -7.486  35.838  1.00   43.29  ? 770  TRP A CD1 1 
ATOM   107  C CD2 . TRP A 1 18  ? 13.931  -6.975  34.093  1.00   35.98  ? 770  TRP A CD2 1 
ATOM   108  N NE1 . TRP A 1 18  ? 13.801  -8.264  35.915  1.00   52.84  ? 770  TRP A NE1 1 
ATOM   109  C CE2 . TRP A 1 18  ? 14.613  -7.946  34.869  1.00   56.84  ? 770  TRP A CE2 1 
ATOM   110  C CE3 . TRP A 1 18  ? 14.540  -6.479  32.957  1.00   39.55  ? 770  TRP A CE3 1 
ATOM   111  C CZ2 . TRP A 1 18  ? 15.908  -8.418  34.550  1.00   51.14  ? 770  TRP A CZ2 1 
ATOM   112  C CZ3 . TRP A 1 18  ? 15.830  -6.973  32.611  1.00   57.21  ? 770  TRP A CZ3 1 
ATOM   113  C CH2 . TRP A 1 18  ? 16.482  -7.943  33.406  1.00   41.94  ? 770  TRP A CH2 1 
ATOM   114  N N   . THR A 1 19  ? 10.962  -4.973  37.757  1.00   43.72  ? 771  THR A N   1 
ATOM   115  C CA  . THR A 1 19  ? 11.407  -4.222  38.954  1.00   51.80  ? 771  THR A CA  1 
ATOM   116  C C   . THR A 1 19  ? 12.579  -4.887  39.675  1.00   54.16  ? 771  THR A C   1 
ATOM   117  O O   . THR A 1 19  ? 12.924  -6.043  39.403  1.00   44.14  ? 771  THR A O   1 
ATOM   118  C CB  . THR A 1 19  ? 10.329  -4.207  40.045  1.00   52.25  ? 771  THR A CB  1 
ATOM   119  O OG1 . THR A 1 19  ? 10.006  -5.568  40.408  1.00   60.27  ? 771  THR A OG1 1 
ATOM   120  C CG2 . THR A 1 19  ? 9.108   -3.495  39.591  1.00   55.33  ? 771  THR A CG2 1 
ATOM   121  N N   . ALA A 1 20  ? 13.093  -4.175  40.673  1.00   55.33  ? 772  ALA A N   1 
ATOM   122  C CA  . ALA A 1 20  ? 14.084  -4.718  41.592  1.00   57.27  ? 772  ALA A CA  1 
ATOM   123  C C   . ALA A 1 20  ? 13.611  -6.023  42.172  1.00   54.72  ? 772  ALA A C   1 
ATOM   124  O O   . ALA A 1 20  ? 14.300  -7.018  42.059  1.00   60.92  ? 772  ALA A O   1 
ATOM   125  C CB  . ALA A 1 20  ? 14.397  -3.729  42.674  1.00   54.48  ? 772  ALA A CB  1 
ATOM   126  N N   . MET A 1 21  ? 12.415  -6.035  42.740  1.00   59.58  ? 773  MET A N   1 
ATOM   127  C CA  . MET A 1 21  ? 11.877  -7.232  43.407  1.00   65.06  ? 773  MET A CA  1 
ATOM   128  C C   . MET A 1 21  ? 11.444  -8.368  42.478  1.00   63.28  ? 773  MET A C   1 
ATOM   129  O O   . MET A 1 21  ? 11.344  -9.537  42.931  1.00   64.25  ? 773  MET A O   1 
ATOM   130  C CB  . MET A 1 21  ? 10.663  -6.853  44.286  1.00   66.14  ? 773  MET A CB  1 
ATOM   131  C CG  . MET A 1 21  ? 10.893  -6.849  45.797  1.00   71.68  ? 773  MET A CG  1 
ATOM   132  S SD  . MET A 1 21  ? 12.249  -5.790  46.430  1.00   82.54  ? 773  MET A SD  1 
ATOM   133  C CE  . MET A 1 21  ? 11.655  -5.492  48.114  1.00   68.09  ? 773  MET A CE  1 
ATOM   134  N N   . GLY A 1 22  ? 11.068  -8.055  41.238  1.00   62.74  ? 774  GLY A N   1 
ATOM   135  C CA  . GLY A 1 22  ? 10.504  -9.058  40.327  1.00   58.24  ? 774  GLY A CA  1 
ATOM   136  C C   . GLY A 1 22  ? 9.775   -8.450  39.138  1.00   57.32  ? 774  GLY A C   1 
ATOM   137  O O   . GLY A 1 22  ? 10.349  -7.778  38.327  1.00   48.87  ? 774  GLY A O   1 
ATOM   138  N N   . GLY A 1 23  ? 8.497   -8.730  39.025  1.00   48.89  ? 775  GLY A N   1 
ATOM   139  C CA  . GLY A 1 23  ? 7.623   -7.966  38.171  1.00   48.62  ? 775  GLY A CA  1 
ATOM   140  C C   . GLY A 1 23  ? 6.450   -7.346  38.853  1.00   48.05  ? 775  GLY A C   1 
ATOM   141  O O   . GLY A 1 23  ? 6.146   -7.702  40.004  1.00   51.35  ? 775  GLY A O   1 
ATOM   142  N N   . SER A 1 24  ? 5.800   -6.406  38.132  1.00   43.97  ? 776  SER A N   1 
ATOM   143  C CA  . SER A 1 24  ? 4.614   -5.663  38.567  1.00   52.35  ? 776  SER A CA  1 
ATOM   144  C C   . SER A 1 24  ? 3.823   -5.144  37.356  1.00   51.53  ? 776  SER A C   1 
ATOM   145  O O   . SER A 1 24  ? 4.390   -4.740  36.324  1.00   45.39  ? 776  SER A O   1 
ATOM   146  C CB  . SER A 1 24  ? 4.986   -4.470  39.472  1.00   53.32  ? 776  SER A CB  1 
ATOM   147  O OG  . SER A 1 24  ? 6.003   -4.832  40.404  1.00   58.66  ? 776  SER A OG  1 
ATOM   148  N N   . THR A 1 25  ? 2.512   -5.200  37.471  1.00   46.11  ? 777  THR A N   1 
ATOM   149  C CA  . THR A 1 25  ? 1.693   -4.597  36.460  1.00   47.51  ? 777  THR A CA  1 
ATOM   150  C C   . THR A 1 25  ? 1.486   -3.247  37.029  1.00   40.28  ? 777  THR A C   1 
ATOM   151  O O   . THR A 1 25  ? 1.123   -3.112  38.178  1.00   45.75  ? 777  THR A O   1 
ATOM   152  C CB  . THR A 1 25  ? 0.396   -5.290  36.267  1.00   46.41  ? 777  THR A CB  1 
ATOM   153  O OG1 . THR A 1 25  ? -0.337  -5.246  37.523  1.00   59.44  ? 777  THR A OG1 1 
ATOM   154  C CG2 . THR A 1 25  ? 0.704   -6.739  35.887  1.00   52.22  ? 777  THR A CG2 1 
ATOM   155  N N   . LEU A 1 26  ? 1.755   -2.255  36.190  1.00   49.50  ? 778  LEU A N   1 
ATOM   156  C CA  . LEU A 1 26  ? 1.724   -0.830  36.491  1.00   39.81  ? 778  LEU A CA  1 
ATOM   157  C C   . LEU A 1 26  ? 0.655   -0.087  35.636  1.00   42.95  ? 778  LEU A C   1 
ATOM   158  O O   . LEU A 1 26  ? 0.419   -0.454  34.519  1.00   43.05  ? 778  LEU A O   1 
ATOM   159  C CB  . LEU A 1 26  ? 3.159   -0.283  36.177  1.00   36.02  ? 778  LEU A CB  1 
ATOM   160  C CG  . LEU A 1 26  ? 4.065   -0.173  37.418  1.00   46.33  ? 778  LEU A CG  1 
ATOM   161  C CD1 . LEU A 1 26  ? 3.960   -1.472  38.315  1.00   56.87  ? 778  LEU A CD1 1 
ATOM   162  C CD2 . LEU A 1 26  ? 5.517   0.294   37.154  1.00   41.96  ? 778  LEU A CD2 1 
ATOM   163  N N   . PHE A 1 27  ? -0.045  0.916   36.181  1.00   41.07  ? 779  PHE A N   1 
ATOM   164  C CA  . PHE A 1 27  ? -0.949  1.723   35.342  1.00   39.27  ? 779  PHE A CA  1 
ATOM   165  C C   . PHE A 1 27  ? -0.363  3.056   34.834  1.00   32.11  ? 779  PHE A C   1 
ATOM   166  O O   . PHE A 1 27  ? -0.196  3.974   35.619  1.00   44.80  ? 779  PHE A O   1 
ATOM   167  C CB  . PHE A 1 27  ? -2.230  2.001   36.118  1.00   41.11  ? 779  PHE A CB  1 
ATOM   168  C CG  . PHE A 1 27  ? -3.073  0.733   36.313  1.00   48.98  ? 779  PHE A CG  1 
ATOM   169  C CD1 . PHE A 1 27  ? -4.332  0.629   35.759  1.00   40.48  ? 779  PHE A CD1 1 
ATOM   170  C CD2 . PHE A 1 27  ? -2.546  -0.379  37.018  1.00   31.05  ? 779  PHE A CD2 1 
ATOM   171  C CE1 . PHE A 1 27  ? -5.105  -0.585  35.860  1.00   36.59  ? 779  PHE A CE1 1 
ATOM   172  C CE2 . PHE A 1 27  ? -3.310  -1.649  37.106  1.00   45.79  ? 779  PHE A CE2 1 
ATOM   173  C CZ  . PHE A 1 27  ? -4.564  -1.730  36.570  1.00   41.23  ? 779  PHE A CZ  1 
ATOM   174  N N   . VAL A 1 28  ? -0.257  3.203   33.509  1.00   42.02  ? 780  VAL A N   1 
ATOM   175  C CA  . VAL A 1 28  ? 0.103   4.478   32.947  1.00   38.34  ? 780  VAL A CA  1 
ATOM   176  C C   . VAL A 1 28  ? -1.189  5.319   32.929  1.00   30.53  ? 780  VAL A C   1 
ATOM   177  O O   . VAL A 1 28  ? -2.212  4.909   32.456  1.00   40.69  ? 780  VAL A O   1 
ATOM   178  C CB  . VAL A 1 28  ? 0.803   4.376   31.590  1.00   35.28  ? 780  VAL A CB  1 
ATOM   179  C CG1 . VAL A 1 28  ? 0.912   5.711   30.913  1.00   36.74  ? 780  VAL A CG1 1 
ATOM   180  C CG2 . VAL A 1 28  ? 2.168   3.803   31.737  1.00   28.59  ? 780  VAL A CG2 1 
ATOM   181  N N   . GLU A 1 29  ? -1.062  6.541   33.356  1.00   36.06  ? 781  GLU A N   1 
ATOM   182  C CA  . GLU A 1 29  ? -2.170  7.449   33.347  1.00   33.25  ? 781  GLU A CA  1 
ATOM   183  C C   . GLU A 1 29  ? -1.883  8.715   32.588  1.00   32.10  ? 781  GLU A C   1 
ATOM   184  O O   . GLU A 1 29  ? -0.769  9.270   32.634  1.00   41.57  ? 781  GLU A O   1 
ATOM   185  C CB  . GLU A 1 29  ? -2.507  7.728   34.763  1.00   30.22  ? 781  GLU A CB  1 
ATOM   186  C CG  . GLU A 1 29  ? -3.076  6.577   35.580  1.00   32.52  ? 781  GLU A CG  1 
ATOM   187  C CD  . GLU A 1 29  ? -3.271  6.953   37.019  1.00   41.84  ? 781  GLU A CD  1 
ATOM   188  O OE1 . GLU A 1 29  ? -2.275  6.890   37.833  1.00   48.50  ? 781  GLU A OE1 1 
ATOM   189  O OE2 . GLU A 1 29  ? -4.418  7.331   37.315  1.00   39.94  ? 781  GLU A OE2 1 
ATOM   190  N N   . THR A 1 30  ? -2.924  9.214   31.917  1.00   34.24  ? 782  THR A N   1 
ATOM   191  C CA  . THR A 1 30  ? -2.853  10.493  31.140  1.00   38.88  ? 782  THR A CA  1 
ATOM   192  C C   . THR A 1 30  ? -4.114  11.353  31.472  1.00   42.72  ? 782  THR A C   1 
ATOM   193  O O   . THR A 1 30  ? -5.175  10.783  31.805  1.00   39.99  ? 782  THR A O   1 
ATOM   194  C CB  . THR A 1 30  ? -2.714  10.304  29.593  1.00   40.73  ? 782  THR A CB  1 
ATOM   195  O OG1 . THR A 1 30  ? -3.855  9.668   29.048  1.00   40.35  ? 782  THR A OG1 1 
ATOM   196  C CG2 . THR A 1 30  ? -1.488  9.393   29.226  1.00   29.26  ? 782  THR A CG2 1 
ATOM   197  N N   . SER A 1 31  ? -3.977  12.691  31.476  1.00   33.87  ? 783  SER A N   1 
ATOM   198  C CA  . SER A 1 31  ? -5.181  13.599  31.657  1.00   39.09  ? 783  SER A CA  1 
ATOM   199  C C   . SER A 1 31  ? -4.864  15.047  31.251  1.00   43.68  ? 783  SER A C   1 
ATOM   200  O O   . SER A 1 31  ? -3.681  15.386  31.079  1.00   39.52  ? 783  SER A O   1 
ATOM   201  C CB  . SER A 1 31  ? -5.738  13.555  33.091  1.00   46.01  ? 783  SER A CB  1 
ATOM   202  O OG  . SER A 1 31  ? -5.630  14.776  33.823  1.00   40.25  ? 783  SER A OG  1 
ATOM   203  N N   . LEU A 1 32  ? -5.902  15.892  31.066  1.00   44.60  ? 784  LEU A N   1 
ATOM   204  C CA  . LEU A 1 32  ? -5.656  17.326  30.850  1.00   33.13  ? 784  LEU A CA  1 
ATOM   205  C C   . LEU A 1 32  ? -5.241  18.022  32.152  1.00   37.20  ? 784  LEU A C   1 
ATOM   206  O O   . LEU A 1 32  ? -5.459  17.526  33.266  1.00   40.37  ? 784  LEU A O   1 
ATOM   207  C CB  . LEU A 1 32  ? -6.924  17.980  30.179  1.00   50.78  ? 784  LEU A CB  1 
ATOM   208  C CG  . LEU A 1 32  ? -7.400  17.405  28.829  1.00   51.68  ? 784  LEU A CG  1 
ATOM   209  C CD1 . LEU A 1 32  ? -8.975  17.474  28.477  1.00   48.25  ? 784  LEU A CD1 1 
ATOM   210  C CD2 . LEU A 1 32  ? -6.581  18.098  27.734  1.00   49.55  ? 784  LEU A CD2 1 
ATOM   211  N N   . ARG A 1 33  ? -4.537  19.119  31.995  1.00   36.17  ? 785  ARG A N   1 
ATOM   212  C CA  . ARG A 1 33  ? -4.266  19.990  33.104  1.00   50.68  ? 785  ARG A CA  1 
ATOM   213  C C   . ARG A 1 33  ? -4.560  21.496  32.879  1.00   54.86  ? 785  ARG A C   1 
ATOM   214  O O   . ARG A 1 33  ? -4.445  22.285  33.782  1.00   53.74  ? 785  ARG A O   1 
ATOM   215  C CB  . ARG A 1 33  ? -2.881  19.771  33.648  1.00   51.09  ? 785  ARG A CB  1 
ATOM   216  C CG  . ARG A 1 33  ? -1.905  19.642  32.629  1.00   56.37  ? 785  ARG A CG  1 
ATOM   217  C CD  . ARG A 1 33  ? -0.822  20.593  32.834  1.00   67.36  ? 785  ARG A CD  1 
ATOM   218  N NE  . ARG A 1 33  ? -0.371  20.759  34.198  1.00   66.17  ? 785  ARG A NE  1 
ATOM   219  C CZ  . ARG A 1 33  ? 0.273   21.833  34.611  1.00   57.86  ? 785  ARG A CZ  1 
ATOM   220  N NH1 . ARG A 1 33  ? 0.522   22.826  33.794  1.00   53.65  ? 785  ARG A NH1 1 
ATOM   221  N NH2 . ARG A 1 33  ? 0.663   21.905  35.843  1.00   68.67  ? 785  ARG A NH2 1 
ATOM   222  N N   . ARG A 1 34  ? -4.905  21.849  31.652  1.00   50.09  ? 786  ARG A N   1 
ATOM   223  C CA  . ARG A 1 34  ? -5.343  23.159  31.240  1.00   54.07  ? 786  ARG A CA  1 
ATOM   224  C C   . ARG A 1 34  ? -6.436  22.786  30.301  1.00   57.52  ? 786  ARG A C   1 
ATOM   225  O O   . ARG A 1 34  ? -6.466  21.678  29.862  1.00   58.10  ? 786  ARG A O   1 
ATOM   226  C CB  . ARG A 1 34  ? -4.282  23.937  30.508  1.00   51.47  ? 786  ARG A CB  1 
ATOM   227  C CG  . ARG A 1 34  ? -3.117  24.193  31.308  1.00   52.07  ? 786  ARG A CG  1 
ATOM   228  C CD  . ARG A 1 34  ? -2.483  25.550  31.134  1.00   63.26  ? 786  ARG A CD  1 
ATOM   229  N NE  . ARG A 1 34  ? -1.397  25.574  32.093  1.00   69.06  ? 786  ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 34  ? -0.974  26.580  32.841  1.00   75.42  ? 786  ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 34  ? -0.027  26.323  33.721  1.00   46.82  ? 786  ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 34  ? -1.226  27.835  32.507  1.00   73.13  ? 786  ARG A NH2 1 
ATOM   233  N N   . PRO A 1 35  ? -7.376  23.672  30.033  1.00   61.32  ? 787  PRO A N   1 
ATOM   234  C CA  . PRO A 1 35  ? -8.494  23.338  29.186  1.00   53.50  ? 787  PRO A CA  1 
ATOM   235  C C   . PRO A 1 35  ? -8.154  23.800  27.822  1.00   47.82  ? 787  PRO A C   1 
ATOM   236  O O   . PRO A 1 35  ? -7.245  24.596  27.695  1.00   49.98  ? 787  PRO A O   1 
ATOM   237  C CB  . PRO A 1 35  ? -9.556  24.239  29.734  1.00   54.82  ? 787  PRO A CB  1 
ATOM   238  C CG  . PRO A 1 35  ? -8.840  25.445  29.937  1.00   57.16  ? 787  PRO A CG  1 
ATOM   239  C CD  . PRO A 1 35  ? -7.413  25.108  30.277  1.00   64.75  ? 787  PRO A CD  1 
ATOM   240  N N   . GLN A 1 36  ? -8.874  23.286  26.836  1.00   59.00  ? 788  GLN A N   1 
ATOM   241  C CA  . GLN A 1 36  ? -8.758  23.634  25.372  1.00   65.36  ? 788  GLN A CA  1 
ATOM   242  C C   . GLN A 1 36  ? -7.330  23.681  24.735  1.00   66.29  ? 788  GLN A C   1 
ATOM   243  O O   . GLN A 1 36  ? -7.161  23.871  23.488  1.00   69.03  ? 788  GLN A O   1 
ATOM   244  C CB  . GLN A 1 36  ? -9.551  24.947  25.009  1.00   67.59  ? 788  GLN A CB  1 
ATOM   245  C CG  . GLN A 1 36  ? -9.167  26.258  25.755  1.00   77.05  ? 788  GLN A CG  1 
ATOM   246  C CD  . GLN A 1 36  ? -7.941  26.968  25.173  1.00   78.18  ? 788  GLN A CD  1 
ATOM   247  O OE1 . GLN A 1 36  ? -6.912  26.350  24.937  1.00   89.51  ? 788  GLN A OE1 1 
ATOM   248  N NE2 . GLN A 1 36  ? -8.043  28.278  24.976  1.00   88.57  ? 788  GLN A NE2 1 
ATOM   249  N N   . ASP A 1 45  ? -0.489  25.912  21.088  1.00   64.73  ? 797  ASP A N   1 
ATOM   250  C CA  . ASP A 1 45  ? 0.153   24.624  20.927  1.00   62.43  ? 797  ASP A CA  1 
ATOM   251  C C   . ASP A 1 45  ? 0.274   23.817  22.209  1.00   59.68  ? 797  ASP A C   1 
ATOM   252  O O   . ASP A 1 45  ? 0.554   24.370  23.298  1.00   57.37  ? 797  ASP A O   1 
ATOM   253  C CB  . ASP A 1 45  ? 1.527   24.773  20.276  1.00   63.29  ? 797  ASP A CB  1 
ATOM   254  C CG  . ASP A 1 45  ? 1.527   24.275  18.846  1.00   57.42  ? 797  ASP A CG  1 
ATOM   255  O OD1 . ASP A 1 45  ? 2.361   23.393  18.544  1.00   60.62  ? 797  ASP A OD1 1 
ATOM   256  O OD2 . ASP A 1 45  ? 0.649   24.694  18.053  1.00   66.93  ? 797  ASP A OD2 1 
ATOM   257  N N   . GLY A 1 46  ? 0.116   22.497  22.060  1.00   53.08  ? 798  GLY A N   1 
ATOM   258  C CA  . GLY A 1 46  ? 0.046   21.619  23.195  1.00   51.26  ? 798  GLY A CA  1 
ATOM   259  C C   . GLY A 1 46  ? 1.333   21.378  23.948  1.00   47.84  ? 798  GLY A C   1 
ATOM   260  O O   . GLY A 1 46  ? 2.449   21.807  23.544  1.00   42.09  ? 798  GLY A O   1 
ATOM   261  N N   . SER A 1 47  ? 1.192   20.616  25.022  1.00   46.99  ? 799  SER A N   1 
ATOM   262  C CA  . SER A 1 47  ? 2.342   20.250  25.792  1.00   43.73  ? 799  SER A CA  1 
ATOM   263  C C   . SER A 1 47  ? 2.073   18.982  26.576  1.00   43.45  ? 799  SER A C   1 
ATOM   264  O O   . SER A 1 47  ? 0.936   18.487  26.618  1.00   44.22  ? 799  SER A O   1 
ATOM   265  C CB  . SER A 1 47  ? 2.812   21.407  26.682  1.00   50.50  ? 799  SER A CB  1 
ATOM   266  O OG  . SER A 1 47  ? 1.881   21.791  27.680  1.00   46.67  ? 799  SER A OG  1 
ATOM   267  N N   . LEU A 1 48  ? 3.150   18.439  27.109  1.00   45.98  ? 800  LEU A N   1 
ATOM   268  C CA  . LEU A 1 48  ? 3.161   17.232  27.974  1.00   45.07  ? 800  LEU A CA  1 
ATOM   269  C C   . LEU A 1 48  ? 3.954   17.525  29.231  1.00   43.66  ? 800  LEU A C   1 
ATOM   270  O O   . LEU A 1 48  ? 5.104   18.001  29.180  1.00   49.20  ? 800  LEU A O   1 
ATOM   271  C CB  . LEU A 1 48  ? 3.789   16.042  27.216  1.00   42.93  ? 800  LEU A CB  1 
ATOM   272  C CG  . LEU A 1 48  ? 3.599   14.689  27.895  1.00   42.21  ? 800  LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 48  ? 2.104   14.294  27.857  1.00   51.82  ? 800  LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 48  ? 4.497   13.670  27.188  1.00   36.05  ? 800  LEU A CD2 1 
ATOM   275  N N   . GLU A 1 49  ? 3.333   17.304  30.377  1.00   33.85  ? 801  GLU A N   1 
ATOM   276  C CA  . GLU A 1 49  ? 4.006   17.271  31.629  1.00   41.17  ? 801  GLU A CA  1 
ATOM   277  C C   . GLU A 1 49  ? 4.034   15.824  32.080  1.00   33.05  ? 801  GLU A C   1 
ATOM   278  O O   . GLU A 1 49  ? 3.034   15.082  31.990  1.00   39.43  ? 801  GLU A O   1 
ATOM   279  C CB  . GLU A 1 49  ? 3.270   18.128  32.691  1.00   43.00  ? 801  GLU A CB  1 
ATOM   280  C CG  . GLU A 1 49  ? 3.924   18.032  34.113  1.00   43.63  ? 801  GLU A CG  1 
ATOM   281  C CD  . GLU A 1 49  ? 3.194   18.889  35.174  1.00   46.35  ? 801  GLU A CD  1 
ATOM   282  O OE1 . GLU A 1 49  ? 2.174   19.542  34.840  1.00   52.95  ? 801  GLU A OE1 1 
ATOM   283  O OE2 . GLU A 1 49  ? 3.673   18.916  36.327  1.00   65.09  ? 801  GLU A OE2 1 
ATOM   284  N N   . VAL A 1 50  ? 5.167   15.461  32.610  1.00   36.90  ? 802  VAL A N   1 
ATOM   285  C CA  . VAL A 1 50  ? 5.434   14.069  32.925  1.00   39.11  ? 802  VAL A CA  1 
ATOM   286  C C   . VAL A 1 50  ? 5.798   13.895  34.352  1.00   33.92  ? 802  VAL A C   1 
ATOM   287  O O   . VAL A 1 50  ? 6.578   14.653  34.899  1.00   40.65  ? 802  VAL A O   1 
ATOM   288  C CB  . VAL A 1 50  ? 6.522   13.498  32.018  1.00   34.66  ? 802  VAL A CB  1 
ATOM   289  C CG1 . VAL A 1 50  ? 6.756   11.932  32.304  1.00   32.60  ? 802  VAL A CG1 1 
ATOM   290  C CG2 . VAL A 1 50  ? 6.177   13.629  30.542  1.00   28.29  ? 802  VAL A CG2 1 
ATOM   291  N N   . THR A 1 51  ? 5.206   12.918  35.038  1.00   31.01  ? 803  THR A N   1 
ATOM   292  C CA  . THR A 1 51  ? 5.655   12.622  36.369  1.00   32.41  ? 803  THR A CA  1 
ATOM   293  C C   . THR A 1 51  ? 5.874   11.068  36.514  1.00   38.52  ? 803  THR A C   1 
ATOM   294  O O   . THR A 1 51  ? 5.440   10.327  35.630  1.00   39.80  ? 803  THR A O   1 
ATOM   295  C CB  . THR A 1 51  ? 4.681   13.023  37.457  1.00   29.63  ? 803  THR A CB  1 
ATOM   296  O OG1 . THR A 1 51  ? 3.358   12.693  37.030  1.00   34.63  ? 803  THR A OG1 1 
ATOM   297  C CG2 . THR A 1 51  ? 4.865   14.542  37.847  1.00   33.93  ? 803  THR A CG2 1 
ATOM   298  N N   . GLY A 1 52  ? 6.555   10.699  37.610  1.00   38.03  ? 804  GLY A N   1 
ATOM   299  C CA  . GLY A 1 52  ? 7.085   9.336   37.940  1.00   43.02  ? 804  GLY A CA  1 
ATOM   300  C C   . GLY A 1 52  ? 8.527   9.279   38.440  1.00   46.31  ? 804  GLY A C   1 
ATOM   301  O O   . GLY A 1 52  ? 9.142   8.179   38.534  1.00   47.71  ? 804  GLY A O   1 
ATOM   302  N N   . GLN A 1 53  ? 9.097   10.433  38.700  1.00   45.24  ? 805  GLN A N   1 
ATOM   303  C CA  . GLN A 1 53  ? 10.458  10.524  39.193  1.00   54.66  ? 805  GLN A CA  1 
ATOM   304  C C   . GLN A 1 53  ? 11.475  9.973   38.223  1.00   53.26  ? 805  GLN A C   1 
ATOM   305  O O   . GLN A 1 53  ? 12.214  9.088   38.542  1.00   58.56  ? 805  GLN A O   1 
ATOM   306  C CB  . GLN A 1 53  ? 10.574  9.782   40.506  1.00   59.34  ? 805  GLN A CB  1 
ATOM   307  C CG  . GLN A 1 53  ? 11.237  10.571  41.582  1.00   60.84  ? 805  GLN A CG  1 
ATOM   308  C CD  . GLN A 1 53  ? 10.310  11.507  42.318  1.00   66.41  ? 805  GLN A CD  1 
ATOM   309  O OE1 . GLN A 1 53  ? 10.248  12.681  42.034  1.00   63.06  ? 805  GLN A OE1 1 
ATOM   310  N NE2 . GLN A 1 53  ? 9.619   10.986  43.277  1.00   58.45  ? 805  GLN A NE2 1 
ATOM   311  N N   . LEU A 1 54  ? 11.481  10.517  37.032  1.00   52.88  ? 806  LEU A N   1 
ATOM   312  C CA  . LEU A 1 54  ? 12.175  9.976   35.942  1.00   54.28  ? 806  LEU A CA  1 
ATOM   313  C C   . LEU A 1 54  ? 13.547  10.615  35.873  1.00   50.71  ? 806  LEU A C   1 
ATOM   314  O O   . LEU A 1 54  ? 13.704  11.846  36.074  1.00   47.95  ? 806  LEU A O   1 
ATOM   315  C CB  . LEU A 1 54  ? 11.377  10.200  34.650  1.00   52.21  ? 806  LEU A CB  1 
ATOM   316  C CG  . LEU A 1 54  ? 9.941   9.697   34.624  1.00   57.80  ? 806  LEU A CG  1 
ATOM   317  C CD1 . LEU A 1 54  ? 9.233   10.143  33.299  1.00   40.57  ? 806  LEU A CD1 1 
ATOM   318  C CD2 . LEU A 1 54  ? 9.860   8.179   34.807  1.00   38.60  ? 806  LEU A CD2 1 
ATOM   319  N N   . GLY A 1 55  ? 14.544  9.779   35.614  1.00   44.36  ? 807  GLY A N   1 
ATOM   320  C CA  . GLY A 1 55  ? 15.880  10.297  35.199  1.00   44.40  ? 807  GLY A CA  1 
ATOM   321  C C   . GLY A 1 55  ? 15.768  10.777  33.772  1.00   42.60  ? 807  GLY A C   1 
ATOM   322  O O   . GLY A 1 55  ? 14.744  10.615  33.128  1.00   42.35  ? 807  GLY A O   1 
ATOM   323  N N   . GLU A 1 56  ? 16.815  11.378  33.240  1.00   40.16  ? 808  GLU A N   1 
ATOM   324  C CA  . GLU A 1 56  ? 16.679  12.024  31.961  1.00   39.99  ? 808  GLU A CA  1 
ATOM   325  C C   . GLU A 1 56  ? 16.350  11.046  30.825  1.00   41.88  ? 808  GLU A C   1 
ATOM   326  O O   . GLU A 1 56  ? 15.679  11.423  29.812  1.00   43.02  ? 808  GLU A O   1 
ATOM   327  C CB  . GLU A 1 56  ? 17.952  12.718  31.621  1.00   45.09  ? 808  GLU A CB  1 
ATOM   328  C CG  . GLU A 1 56  ? 17.756  13.903  30.731  1.00   60.80  ? 808  GLU A CG  1 
ATOM   329  C CD  . GLU A 1 56  ? 16.995  15.026  31.431  1.00   59.46  ? 808  GLU A CD  1 
ATOM   330  O OE1 . GLU A 1 56  ? 16.285  15.776  30.704  1.00   66.55  ? 808  GLU A OE1 1 
ATOM   331  O OE2 . GLU A 1 56  ? 17.103  15.159  32.683  1.00   64.29  ? 808  GLU A OE2 1 
ATOM   332  N N   . VAL A 1 57  ? 16.867  9.844   30.912  1.00   37.26  ? 809  VAL A N   1 
ATOM   333  C CA  . VAL A 1 57  ? 16.668  8.925   29.850  1.00   41.88  ? 809  VAL A CA  1 
ATOM   334  C C   . VAL A 1 57  ? 15.208  8.632   29.709  1.00   35.98  ? 809  VAL A C   1 
ATOM   335  O O   . VAL A 1 57  ? 14.691  8.608   28.666  1.00   35.45  ? 809  VAL A O   1 
ATOM   336  C CB  . VAL A 1 57  ? 17.388  7.602   30.106  1.00   44.86  ? 809  VAL A CB  1 
ATOM   337  C CG1 . VAL A 1 57  ? 16.843  6.570   29.233  1.00   37.59  ? 809  VAL A CG1 1 
ATOM   338  C CG2 . VAL A 1 57  ? 18.821  7.732   29.866  1.00   40.87  ? 809  VAL A CG2 1 
ATOM   339  N N   . MET A 1 58  ? 14.575  8.411   30.816  1.00   37.46  ? 810  MET A N   1 
ATOM   340  C CA  . MET A 1 58  ? 13.191  8.105   30.843  1.00   31.96  ? 810  MET A CA  1 
ATOM   341  C C   . MET A 1 58  ? 12.360  9.299   30.413  1.00   35.96  ? 810  MET A C   1 
ATOM   342  O O   . MET A 1 58  ? 11.363  9.161   29.804  1.00   25.13  ? 810  MET A O   1 
ATOM   343  C CB  . MET A 1 58  ? 12.816  7.560   32.190  1.00   40.99  ? 810  MET A CB  1 
ATOM   344  C CG  . MET A 1 58  ? 11.805  6.468   32.174  1.00   45.78  ? 810  MET A CG  1 
ATOM   345  S SD  . MET A 1 58  ? 11.698  5.237   30.873  1.00   47.74  ? 810  MET A SD  1 
ATOM   346  C CE  . MET A 1 58  ? 9.973   5.174   30.868  1.00   30.40  ? 810  MET A CE  1 
ATOM   347  N N   . LYS A 1 59  ? 12.806  10.485  30.761  1.00   33.19  ? 811  LYS A N   1 
ATOM   348  C CA  . LYS A 1 59  ? 12.063  11.677  30.362  1.00   35.07  ? 811  LYS A CA  1 
ATOM   349  C C   . LYS A 1 59  ? 12.130  11.608  28.888  1.00   26.94  ? 811  LYS A C   1 
ATOM   350  O O   . LYS A 1 59  ? 11.238  12.040  28.230  1.00   30.46  ? 811  LYS A O   1 
ATOM   351  C CB  . LYS A 1 59  ? 12.678  12.995  30.897  1.00   35.66  ? 811  LYS A CB  1 
ATOM   352  C CG  . LYS A 1 59  ? 12.787  13.137  32.479  1.00   37.37  ? 811  LYS A CG  1 
ATOM   353  C CD  . LYS A 1 59  ? 13.284  14.597  32.827  1.00   39.23  ? 811  LYS A CD  1 
ATOM   354  C CE  . LYS A 1 59  ? 14.039  14.854  34.143  1.00   57.09  ? 811  LYS A CE  1 
ATOM   355  N NZ  . LYS A 1 59  ? 13.225  14.954  35.380  1.00   42.66  ? 811  LYS A NZ  1 
ATOM   356  N N   . GLU A 1 60  ? 13.288  11.205  28.299  1.00   37.52  ? 812  GLU A N   1 
ATOM   357  C CA  . GLU A 1 60  ? 13.399  11.244  26.880  1.00   36.96  ? 812  GLU A CA  1 
ATOM   358  C C   . GLU A 1 60  ? 12.512  10.136  26.304  1.00   35.16  ? 812  GLU A C   1 
ATOM   359  O O   . GLU A 1 60  ? 11.831  10.287  25.286  1.00   37.04  ? 812  GLU A O   1 
ATOM   360  C CB  . GLU A 1 60  ? 14.870  11.205  26.358  1.00   35.70  ? 812  GLU A CB  1 
ATOM   361  C CG  . GLU A 1 60  ? 15.072  11.398  24.892  1.00   41.89  ? 812  GLU A CG  1 
ATOM   362  C CD  . GLU A 1 60  ? 14.382  12.671  24.240  1.00   36.04  ? 812  GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 60  ? 13.657  12.545  23.190  1.00   45.66  ? 812  GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 60  ? 14.698  13.749  24.707  1.00   53.69  ? 812  GLU A OE2 1 
ATOM   365  N N   . SER A 1 61  ? 12.427  9.027   26.985  1.00   39.88  ? 813  SER A N   1 
ATOM   366  C CA  . SER A 1 61  ? 11.635  7.974   26.479  1.00   34.96  ? 813  SER A CA  1 
ATOM   367  C C   . SER A 1 61  ? 10.213  8.424   26.343  1.00   33.61  ? 813  SER A C   1 
ATOM   368  O O   . SER A 1 61  ? 9.581   8.048   25.426  1.00   35.47  ? 813  SER A O   1 
ATOM   369  C CB  . SER A 1 61  ? 11.706  6.785   27.392  1.00   30.55  ? 813  SER A CB  1 
ATOM   370  O OG  . SER A 1 61  ? 11.067  5.721   26.803  1.00   39.37  ? 813  SER A OG  1 
ATOM   371  N N   . ALA A 1 62  ? 9.703   9.187   27.283  1.00   34.11  ? 814  ALA A N   1 
ATOM   372  C CA  . ALA A 1 62  ? 8.340   9.660   27.209  1.00   33.91  ? 814  ALA A CA  1 
ATOM   373  C C   . ALA A 1 62  ? 8.094   10.599  26.059  1.00   36.90  ? 814  ALA A C   1 
ATOM   374  O O   . ALA A 1 62  ? 7.075   10.554  25.441  1.00   33.90  ? 814  ALA A O   1 
ATOM   375  C CB  . ALA A 1 62  ? 7.914   10.236  28.449  1.00   28.41  ? 814  ALA A CB  1 
ATOM   376  N N   . ARG A 1 63  ? 9.059   11.448  25.787  1.00   34.24  ? 815  ARG A N   1 
ATOM   377  C CA  . ARG A 1 63  ? 9.018   12.320  24.641  1.00   38.89  ? 815  ARG A CA  1 
ATOM   378  C C   . ARG A 1 63  ? 8.987   11.501  23.375  1.00   36.67  ? 815  ARG A C   1 
ATOM   379  O O   . ARG A 1 63  ? 8.351   11.863  22.491  1.00   36.74  ? 815  ARG A O   1 
ATOM   380  C CB  . ARG A 1 63  ? 10.216  13.228  24.582  1.00   41.59  ? 815  ARG A CB  1 
ATOM   381  C CG  . ARG A 1 63  ? 10.175  14.441  25.386  1.00   39.43  ? 815  ARG A CG  1 
ATOM   382  C CD  . ARG A 1 63  ? 11.535  15.132  25.385  1.00   49.89  ? 815  ARG A CD  1 
ATOM   383  N NE  . ARG A 1 63  ? 11.817  15.656  26.707  1.00   58.27  ? 815  ARG A NE  1 
ATOM   384  C CZ  . ARG A 1 63  ? 12.936  15.500  27.399  1.00   42.68  ? 815  ARG A CZ  1 
ATOM   385  N NH1 . ARG A 1 63  ? 13.010  16.009  28.598  1.00   57.53  ? 815  ARG A NH1 1 
ATOM   386  N NH2 . ARG A 1 63  ? 13.974  14.887  26.910  1.00   51.28  ? 815  ARG A NH2 1 
ATOM   387  N N   . ILE A 1 64  ? 9.700   10.396  23.292  1.00   38.96  ? 816  ILE A N   1 
ATOM   388  C CA  . ILE A 1 64  ? 9.686   9.601   22.083  1.00   34.28  ? 816  ILE A CA  1 
ATOM   389  C C   . ILE A 1 64  ? 8.279   9.107   21.816  1.00   32.83  ? 816  ILE A C   1 
ATOM   390  O O   . ILE A 1 64  ? 7.773   9.199   20.766  1.00   32.83  ? 816  ILE A O   1 
ATOM   391  C CB  . ILE A 1 64  ? 10.587  8.359   22.207  1.00   30.44  ? 816  ILE A CB  1 
ATOM   392  C CG1 . ILE A 1 64  ? 12.067  8.695   22.148  1.00   29.15  ? 816  ILE A CG1 1 
ATOM   393  C CG2 . ILE A 1 64  ? 10.318  7.404   21.143  1.00   36.54  ? 816  ILE A CG2 1 
ATOM   394  C CD1 . ILE A 1 64  ? 12.950  7.556   22.536  1.00   28.51  ? 816  ILE A CD1 1 
ATOM   395  N N   . ALA A 1 65  ? 7.634   8.636   22.832  1.00   29.93  ? 817  ALA A N   1 
ATOM   396  C CA  . ALA A 1 65  ? 6.242   8.111   22.745  1.00   38.20  ? 817  ALA A CA  1 
ATOM   397  C C   . ALA A 1 65  ? 5.236   9.268   22.392  1.00   30.20  ? 817  ALA A C   1 
ATOM   398  O O   . ALA A 1 65  ? 4.366   9.147   21.514  1.00   32.52  ? 817  ALA A O   1 
ATOM   399  C CB  . ALA A 1 65  ? 5.873   7.513   24.018  1.00   25.49  ? 817  ALA A CB  1 
ATOM   400  N N   . TYR A 1 66  ? 5.432   10.401  23.021  1.00   36.43  ? 818  TYR A N   1 
ATOM   401  C CA  . TYR A 1 66  ? 4.620   11.595  22.676  1.00   30.15  ? 818  TYR A CA  1 
ATOM   402  C C   . TYR A 1 66  ? 4.768   11.928  21.209  1.00   37.86  ? 818  TYR A C   1 
ATOM   403  O O   . TYR A 1 66  ? 3.764   11.991  20.534  1.00   36.30  ? 818  TYR A O   1 
ATOM   404  C CB  . TYR A 1 66  ? 5.055   12.740  23.539  1.00   31.52  ? 818  TYR A CB  1 
ATOM   405  C CG  . TYR A 1 66  ? 4.326   14.021  23.486  1.00   36.25  ? 818  TYR A CG  1 
ATOM   406  C CD1 . TYR A 1 66  ? 5.029   15.226  23.522  1.00   37.00  ? 818  TYR A CD1 1 
ATOM   407  C CD2 . TYR A 1 66  ? 2.967   14.057  23.557  1.00   33.47  ? 818  TYR A CD2 1 
ATOM   408  C CE1 . TYR A 1 66  ? 4.329   16.472  23.508  1.00   45.92  ? 818  TYR A CE1 1 
ATOM   409  C CE2 . TYR A 1 66  ? 2.277   15.233  23.587  1.00   39.90  ? 818  TYR A CE2 1 
ATOM   410  C CZ  . TYR A 1 66  ? 2.938   16.448  23.538  1.00   43.26  ? 818  TYR A CZ  1 
ATOM   411  O OH  . TYR A 1 66  ? 2.192   17.614  23.524  1.00   49.81  ? 818  TYR A OH  1 
ATOM   412  N N   . THR A 1 67  ? 5.989   12.162  20.725  1.00   43.24  ? 819  THR A N   1 
ATOM   413  C CA  . THR A 1 67  ? 6.180   12.464  19.299  1.00   46.12  ? 819  THR A CA  1 
ATOM   414  C C   . THR A 1 67  ? 5.550   11.414  18.372  1.00   40.02  ? 819  THR A C   1 
ATOM   415  O O   . THR A 1 67  ? 4.972   11.754  17.345  1.00   37.34  ? 819  THR A O   1 
ATOM   416  C CB  . THR A 1 67  ? 7.654   12.576  18.966  1.00   41.22  ? 819  THR A CB  1 
ATOM   417  O OG1 . THR A 1 67  ? 8.264   13.550  19.793  1.00   43.36  ? 819  THR A OG1 1 
ATOM   418  C CG2 . THR A 1 67  ? 7.902   12.971  17.506  1.00   52.57  ? 819  THR A CG2 1 
ATOM   419  N N   . PHE A 1 68  ? 5.786   10.129  18.635  1.00   33.97  ? 820  PHE A N   1 
ATOM   420  C CA  . PHE A 1 68  ? 5.203   9.097   17.811  1.00   31.59  ? 820  PHE A CA  1 
ATOM   421  C C   . PHE A 1 68  ? 3.737   9.069   17.941  1.00   27.65  ? 820  PHE A C   1 
ATOM   422  O O   . PHE A 1 68  ? 3.067   8.851   16.939  1.00   35.10  ? 820  PHE A O   1 
ATOM   423  C CB  . PHE A 1 68  ? 5.714   7.656   18.130  1.00   32.94  ? 820  PHE A CB  1 
ATOM   424  C CG  . PHE A 1 68  ? 5.129   6.625   17.215  1.00   38.72  ? 820  PHE A CG  1 
ATOM   425  C CD1 . PHE A 1 68  ? 4.165   5.747   17.705  1.00   28.68  ? 820  PHE A CD1 1 
ATOM   426  C CD2 . PHE A 1 68  ? 5.602   6.456   15.919  1.00   40.27  ? 820  PHE A CD2 1 
ATOM   427  C CE1 . PHE A 1 68  ? 3.644   4.762   16.909  1.00   24.40  ? 820  PHE A CE1 1 
ATOM   428  C CE2 . PHE A 1 68  ? 5.103   5.491   15.078  1.00   35.27  ? 820  PHE A CE2 1 
ATOM   429  C CZ  . PHE A 1 68  ? 4.028   4.633   15.550  1.00   29.73  ? 820  PHE A CZ  1 
ATOM   430  N N   . ALA A 1 69  ? 3.240   9.180   19.139  1.00   32.47  ? 821  ALA A N   1 
ATOM   431  C CA  . ALA A 1 69  ? 1.796   9.232   19.255  1.00   33.17  ? 821  ALA A CA  1 
ATOM   432  C C   . ALA A 1 69  ? 1.225   10.384  18.456  1.00   38.12  ? 821  ALA A C   1 
ATOM   433  O O   . ALA A 1 69  ? 0.273   10.252  17.795  1.00   44.35  ? 821  ALA A O   1 
ATOM   434  C CB  . ALA A 1 69  ? 1.328   9.212   20.682  1.00   25.34  ? 821  ALA A CB  1 
ATOM   435  N N   . ARG A 1 70  ? 1.843   11.549  18.502  1.00   45.59  ? 822  ARG A N   1 
ATOM   436  C CA  . ARG A 1 70  ? 1.303   12.646  17.727  1.00   45.11  ? 822  ARG A CA  1 
ATOM   437  C C   . ARG A 1 70  ? 1.369   12.273  16.239  1.00   45.22  ? 822  ARG A C   1 
ATOM   438  O O   . ARG A 1 70  ? 0.407   12.469  15.508  1.00   44.65  ? 822  ARG A O   1 
ATOM   439  C CB  . ARG A 1 70  ? 2.060   13.950  18.025  1.00   44.15  ? 822  ARG A CB  1 
ATOM   440  C CG  . ARG A 1 70  ? 1.753   14.636  19.312  1.00   51.56  ? 822  ARG A CG  1 
ATOM   441  C CD  . ARG A 1 70  ? 2.892   15.518  19.776  1.00   39.57  ? 822  ARG A CD  1 
ATOM   442  N NE  . ARG A 1 70  ? 3.079   16.733  18.973  1.00   63.53  ? 822  ARG A NE  1 
ATOM   443  C CZ  . ARG A 1 70  ? 2.692   17.976  19.301  1.00   66.20  ? 822  ARG A CZ  1 
ATOM   444  N NH1 . ARG A 1 70  ? 2.041   18.257  20.435  1.00   69.25  ? 822  ARG A NH1 1 
ATOM   445  N NH2 . ARG A 1 70  ? 2.958   18.973  18.462  1.00   68.57  ? 822  ARG A NH2 1 
ATOM   446  N N   . ALA A 1 71  ? 2.458   11.668  15.778  1.00   42.23  ? 823  ALA A N   1 
ATOM   447  C CA  . ALA A 1 71  ? 2.554   11.352  14.362  1.00   44.38  ? 823  ALA A CA  1 
ATOM   448  C C   . ALA A 1 71  ? 1.520   10.340  13.889  1.00   41.30  ? 823  ALA A C   1 
ATOM   449  O O   . ALA A 1 71  ? 0.994   10.415  12.731  1.00   38.33  ? 823  ALA A O   1 
ATOM   450  C CB  . ALA A 1 71  ? 3.956   10.915  13.957  1.00   44.11  ? 823  ALA A CB  1 
ATOM   451  N N   . PHE A 1 72  ? 1.220   9.398   14.756  1.00   39.54  ? 824  PHE A N   1 
ATOM   452  C CA  . PHE A 1 72  ? 0.379   8.272   14.419  1.00   31.89  ? 824  PHE A CA  1 
ATOM   453  C C   . PHE A 1 72  ? -1.084  8.742   14.339  1.00   37.34  ? 824  PHE A C   1 
ATOM   454  O O   . PHE A 1 72  ? -1.875  8.160   13.642  1.00   43.32  ? 824  PHE A O   1 
ATOM   455  C CB  . PHE A 1 72  ? 0.505   7.201   15.531  1.00   35.59  ? 824  PHE A CB  1 
ATOM   456  C CG  . PHE A 1 72  ? -0.353  5.989   15.298  1.00   31.33  ? 824  PHE A CG  1 
ATOM   457  C CD1 . PHE A 1 72  ? -1.598  5.951   15.762  1.00   43.20  ? 824  PHE A CD1 1 
ATOM   458  C CD2 . PHE A 1 72  ? 0.094   4.954   14.542  1.00   39.76  ? 824  PHE A CD2 1 
ATOM   459  C CE1 . PHE A 1 72  ? -2.378  4.868   15.508  1.00   30.69  ? 824  PHE A CE1 1 
ATOM   460  C CE2 . PHE A 1 72  ? -0.712  3.845   14.270  1.00   51.04  ? 824  PHE A CE2 1 
ATOM   461  C CZ  . PHE A 1 72  ? -1.941  3.813   14.742  1.00   37.66  ? 824  PHE A CZ  1 
ATOM   462  N N   . LEU A 1 73  ? -1.455  9.793   15.072  1.00   41.43  ? 825  LEU A N   1 
ATOM   463  C CA  . LEU A 1 73  ? -2.853  10.172  15.200  1.00   39.14  ? 825  LEU A CA  1 
ATOM   464  C C   . LEU A 1 73  ? -3.173  11.031  13.957  1.00   43.12  ? 825  LEU A C   1 
ATOM   465  O O   . LEU A 1 73  ? -4.187  10.849  13.369  1.00   45.84  ? 825  LEU A O   1 
ATOM   466  C CB  . LEU A 1 73  ? -3.152  10.974  16.463  1.00   42.62  ? 825  LEU A CB  1 
ATOM   467  C CG  . LEU A 1 73  ? -4.665  11.065  16.859  1.00   33.78  ? 825  LEU A CG  1 
ATOM   468  C CD1 . LEU A 1 73  ? -5.308  9.681   16.828  1.00   49.22  ? 825  LEU A CD1 1 
ATOM   469  C CD2 . LEU A 1 73  ? -4.827  11.690  18.199  1.00   55.30  ? 825  LEU A CD2 1 
ATOM   470  N N   . MET A 1 74  ? -2.258  11.915  13.598  1.00   54.57  ? 826  MET A N   1 
ATOM   471  C CA  . MET A 1 74  ? -2.301  12.714  12.376  1.00   60.84  ? 826  MET A CA  1 
ATOM   472  C C   . MET A 1 74  ? -2.664  11.883  11.162  1.00   59.26  ? 826  MET A C   1 
ATOM   473  O O   . MET A 1 74  ? -3.412  12.319  10.304  1.00   52.55  ? 826  MET A O   1 
ATOM   474  C CB  . MET A 1 74  ? -0.942  13.384  12.089  1.00   61.00  ? 826  MET A CB  1 
ATOM   475  C CG  . MET A 1 74  ? -0.902  14.863  12.476  1.00   68.35  ? 826  MET A CG  1 
ATOM   476  S SD  . MET A 1 74  ? -0.140  15.821  11.160  1.00   77.46  ? 826  MET A SD  1 
ATOM   477  C CE  . MET A 1 74  ? 1.566   15.193  11.299  1.00   58.32  ? 826  MET A CE  1 
ATOM   478  N N   . GLN A 1 75  ? -2.118  10.682  11.089  1.00   59.50  ? 827  GLN A N   1 
ATOM   479  C CA  . GLN A 1 75  ? -2.475  9.784   10.023  1.00   55.30  ? 827  GLN A CA  1 
ATOM   480  C C   . GLN A 1 75  ? -3.730  8.932   10.266  1.00   52.63  ? 827  GLN A C   1 
ATOM   481  O O   . GLN A 1 75  ? -4.594  8.779   9.386   1.00   48.53  ? 827  GLN A O   1 
ATOM   482  C CB  . GLN A 1 75  ? -1.289  8.861   9.745   1.00   55.60  ? 827  GLN A CB  1 
ATOM   483  C CG  . GLN A 1 75  ? -1.437  8.185   8.424   1.00   56.39  ? 827  GLN A CG  1 
ATOM   484  C CD  . GLN A 1 75  ? -0.209  7.416   7.980   1.00   58.88  ? 827  GLN A CD  1 
ATOM   485  O OE1 . GLN A 1 75  ? 0.896   7.937   7.980   1.00   74.17  ? 827  GLN A OE1 1 
ATOM   486  N NE2 . GLN A 1 75  ? -0.413  6.184   7.563   1.00   50.10  ? 827  GLN A NE2 1 
ATOM   487  N N   . HIS A 1 76  ? -3.825  8.329   11.433  1.00   52.04  ? 828  HIS A N   1 
ATOM   488  C CA  . HIS A 1 76  ? -4.996  7.484   11.766  1.00   51.08  ? 828  HIS A CA  1 
ATOM   489  C C   . HIS A 1 76  ? -6.343  8.237   11.886  1.00   46.95  ? 828  HIS A C   1 
ATOM   490  O O   . HIS A 1 76  ? -7.382  7.673   11.591  1.00   49.20  ? 828  HIS A O   1 
ATOM   491  C CB  . HIS A 1 76  ? -4.788  6.705   13.069  1.00   50.70  ? 828  HIS A CB  1 
ATOM   492  C CG  . HIS A 1 76  ? -6.008  5.905   13.483  1.00   32.58  ? 828  HIS A CG  1 
ATOM   493  N ND1 . HIS A 1 76  ? -6.732  6.191   14.598  1.00   35.24  ? 828  HIS A ND1 1 
ATOM   494  C CD2 . HIS A 1 76  ? -6.643  4.893   12.862  1.00   37.20  ? 828  HIS A CD2 1 
ATOM   495  C CE1 . HIS A 1 76  ? -7.731  5.318   14.693  1.00   42.11  ? 828  HIS A CE1 1 
ATOM   496  N NE2 . HIS A 1 76  ? -7.713  4.557   13.616  1.00   32.09  ? 828  HIS A NE2 1 
ATOM   497  N N   . ALA A 1 77  ? -6.323  9.453   12.413  1.00   52.83  ? 829  ALA A N   1 
ATOM   498  C CA  . ALA A 1 77  ? -7.536  10.279  12.631  1.00   47.59  ? 829  ALA A CA  1 
ATOM   499  C C   . ALA A 1 77  ? -7.099  11.650  12.288  1.00   52.78  ? 829  ALA A C   1 
ATOM   500  O O   . ALA A 1 77  ? -6.948  12.459  13.201  1.00   49.15  ? 829  ALA A O   1 
ATOM   501  C CB  . ALA A 1 77  ? -8.004  10.305  14.116  1.00   39.08  ? 829  ALA A CB  1 
ATOM   502  N N   . PRO A 1 78  ? -6.973  11.955  10.976  1.00   55.98  ? 830  PRO A N   1 
ATOM   503  C CA  . PRO A 1 78  ? -6.377  13.207  10.512  1.00   52.45  ? 830  PRO A CA  1 
ATOM   504  C C   . PRO A 1 78  ? -7.193  14.444  10.922  1.00   51.19  ? 830  PRO A C   1 
ATOM   505  O O   . PRO A 1 78  ? -6.670  15.542  10.871  1.00   44.03  ? 830  PRO A O   1 
ATOM   506  C CB  . PRO A 1 78  ? -6.344  13.046  9.010   1.00   54.38  ? 830  PRO A CB  1 
ATOM   507  C CG  . PRO A 1 78  ? -6.511  11.548  8.753   1.00   52.89  ? 830  PRO A CG  1 
ATOM   508  C CD  . PRO A 1 78  ? -7.400  11.111  9.864   1.00   52.99  ? 830  PRO A CD  1 
ATOM   509  N N   . ALA A 1 79  ? -8.415  14.225  11.392  1.00   52.49  ? 831  ALA A N   1 
ATOM   510  C CA  . ALA A 1 79  ? -9.281  15.285  11.921  1.00   55.10  ? 831  ALA A CA  1 
ATOM   511  C C   . ALA A 1 79  ? -9.021  15.584  13.394  1.00   52.77  ? 831  ALA A C   1 
ATOM   512  O O   . ALA A 1 79  ? -9.429  16.628  13.927  1.00   45.60  ? 831  ALA A O   1 
ATOM   513  C CB  . ALA A 1 79  ? -10.793 14.873  11.711  1.00   59.39  ? 831  ALA A CB  1 
ATOM   514  N N   . ASN A 1 80  ? -8.302  14.708  14.096  1.00   51.94  ? 832  ASN A N   1 
ATOM   515  C CA  . ASN A 1 80  ? -8.238  14.883  15.531  1.00   47.71  ? 832  ASN A CA  1 
ATOM   516  C C   . ASN A 1 80  ? -7.010  15.683  15.883  1.00   49.73  ? 832  ASN A C   1 
ATOM   517  O O   . ASN A 1 80  ? -5.886  15.195  15.748  1.00   41.19  ? 832  ASN A O   1 
ATOM   518  C CB  . ASN A 1 80  ? -8.302  13.495  16.183  1.00   49.33  ? 832  ASN A CB  1 
ATOM   519  C CG  . ASN A 1 80  ? -8.417  13.528  17.668  1.00   43.84  ? 832  ASN A CG  1 
ATOM   520  O OD1 . ASN A 1 80  ? -8.082  14.524  18.347  1.00   45.67  ? 832  ASN A OD1 1 
ATOM   521  N ND2 . ASN A 1 80  ? -8.868  12.357  18.235  1.00   47.19  ? 832  ASN A ND2 1 
ATOM   522  N N   . ASP A 1 81  ? -7.195  16.928  16.365  1.00   48.71  ? 833  ASP A N   1 
ATOM   523  C CA  . ASP A 1 81  ? -6.029  17.767  16.689  1.00   45.26  ? 833  ASP A CA  1 
ATOM   524  C C   . ASP A 1 81  ? -5.634  17.726  18.183  1.00   45.49  ? 833  ASP A C   1 
ATOM   525  O O   . ASP A 1 81  ? -4.723  18.452  18.643  1.00   50.96  ? 833  ASP A O   1 
ATOM   526  C CB  . ASP A 1 81  ? -6.237  19.208  16.202  1.00   53.39  ? 833  ASP A CB  1 
ATOM   527  C CG  . ASP A 1 81  ? -7.537  19.820  16.660  1.00   58.92  ? 833  ASP A CG  1 
ATOM   528  O OD1 . ASP A 1 81  ? -8.561  19.084  16.741  1.00   70.34  ? 833  ASP A OD1 1 
ATOM   529  O OD2 . ASP A 1 81  ? -7.544  21.059  16.862  1.00   67.85  ? 833  ASP A OD2 1 
ATOM   530  N N   . TYR A 1 82  ? -6.362  16.899  18.934  1.00   41.45  ? 834  TYR A N   1 
ATOM   531  C CA  . TYR A 1 82  ? -6.251  16.806  20.395  1.00   39.08  ? 834  TYR A CA  1 
ATOM   532  C C   . TYR A 1 82  ? -4.845  16.726  20.961  1.00   47.53  ? 834  TYR A C   1 
ATOM   533  O O   . TYR A 1 82  ? -4.597  17.414  21.960  1.00   50.32  ? 834  TYR A O   1 
ATOM   534  C CB  . TYR A 1 82  ? -7.120  15.637  20.922  1.00   41.97  ? 834  TYR A CB  1 
ATOM   535  C CG  . TYR A 1 82  ? -7.211  15.493  22.397  1.00   40.88  ? 834  TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 82  ? -8.421  15.737  23.051  1.00   54.73  ? 834  TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 82  ? -6.126  15.017  23.160  1.00   38.03  ? 834  TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 82  ? -8.528  15.599  24.345  1.00   48.30  ? 834  TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 82  ? -6.213  14.905  24.474  1.00   48.43  ? 834  TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 82  ? -7.425  15.168  25.074  1.00   54.28  ? 834  TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 82  ? -7.501  15.010  26.393  1.00   44.44  ? 834  TYR A OH  1 
ATOM   542  N N   . LEU A 1 83  ? -3.912  15.996  20.301  1.00   43.45  ? 835  LEU A N   1 
ATOM   543  C CA  . LEU A 1 83  ? -2.561  15.932  20.818  1.00   43.41  ? 835  LEU A CA  1 
ATOM   544  C C   . LEU A 1 83  ? -1.779  17.186  20.441  1.00   50.60  ? 835  LEU A C   1 
ATOM   545  O O   . LEU A 1 83  ? -0.959  17.649  21.232  1.00   51.42  ? 835  LEU A O   1 
ATOM   546  C CB  . LEU A 1 83  ? -1.781  14.731  20.366  1.00   40.77  ? 835  LEU A CB  1 
ATOM   547  C CG  . LEU A 1 83  ? -1.635  13.419  21.130  1.00   50.91  ? 835  LEU A CG  1 
ATOM   548  C CD1 . LEU A 1 83  ? -2.551  13.212  22.255  1.00   40.27  ? 835  LEU A CD1 1 
ATOM   549  C CD2 . LEU A 1 83  ? -1.773  12.294  20.184  1.00   42.40  ? 835  LEU A CD2 1 
ATOM   550  N N   . VAL A 1 84  ? -1.986  17.713  19.243  1.00   44.01  ? 836  VAL A N   1 
ATOM   551  C CA  . VAL A 1 84  ? -1.304  18.977  18.859  1.00   52.40  ? 836  VAL A CA  1 
ATOM   552  C C   . VAL A 1 84  ? -1.714  20.238  19.678  1.00   45.32  ? 836  VAL A C   1 
ATOM   553  O O   . VAL A 1 84  ? -0.925  21.122  19.925  1.00   53.18  ? 836  VAL A O   1 
ATOM   554  C CB  . VAL A 1 84  ? -1.529  19.263  17.358  1.00   53.91  ? 836  VAL A CB  1 
ATOM   555  C CG1 . VAL A 1 84  ? -0.760  20.537  16.910  1.00   61.47  ? 836  VAL A CG1 1 
ATOM   556  C CG2 . VAL A 1 84  ? -1.177  18.067  16.551  1.00   52.75  ? 836  VAL A CG2 1 
ATOM   557  N N   . THR A 1 85  ? -2.957  20.355  20.089  1.00   49.61  ? 837  THR A N   1 
ATOM   558  C CA  . THR A 1 85  ? -3.402  21.554  20.783  1.00   44.47  ? 837  THR A CA  1 
ATOM   559  C C   . THR A 1 85  ? -3.449  21.463  22.330  1.00   50.57  ? 837  THR A C   1 
ATOM   560  O O   . THR A 1 85  ? -3.445  22.497  22.992  1.00   50.43  ? 837  THR A O   1 
ATOM   561  C CB  . THR A 1 85  ? -4.820  21.879  20.341  1.00   49.45  ? 837  THR A CB  1 
ATOM   562  O OG1 . THR A 1 85  ? -5.686  20.885  20.874  1.00   48.89  ? 837  THR A OG1 1 
ATOM   563  C CG2 . THR A 1 85  ? -4.949  21.842  18.806  1.00   38.50  ? 837  THR A CG2 1 
ATOM   564  N N   . SER A 1 86  ? -3.508  20.248  22.888  1.00   51.12  ? 838  SER A N   1 
ATOM   565  C CA  . SER A 1 86  ? -3.738  20.059  24.321  1.00   41.29  ? 838  SER A CA  1 
ATOM   566  C C   . SER A 1 86  ? -2.568  20.114  25.289  1.00   49.00  ? 838  SER A C   1 
ATOM   567  O O   . SER A 1 86  ? -1.416  19.987  24.930  1.00   44.21  ? 838  SER A O   1 
ATOM   568  C CB  . SER A 1 86  ? -4.473  18.790  24.536  1.00   47.27  ? 838  SER A CB  1 
ATOM   569  O OG  . SER A 1 86  ? -5.647  18.903  23.793  1.00   41.73  ? 838  SER A OG  1 
ATOM   570  N N   . HIS A 1 87  ? -2.898  20.283  26.569  1.00   52.30  ? 839  HIS A N   1 
ATOM   571  C CA  . HIS A 1 87  ? -1.878  20.326  27.604  1.00   49.77  ? 839  HIS A CA  1 
ATOM   572  C C   . HIS A 1 87  ? -2.128  19.152  28.578  1.00   49.10  ? 839  HIS A C   1 
ATOM   573  O O   . HIS A 1 87  ? -3.099  19.141  29.384  1.00   55.04  ? 839  HIS A O   1 
ATOM   574  C CB  . HIS A 1 87  ? -1.891  21.656  28.280  1.00   50.80  ? 839  HIS A CB  1 
ATOM   575  C CG  . HIS A 1 87  ? -1.587  22.806  27.386  1.00   51.17  ? 839  HIS A CG  1 
ATOM   576  N ND1 . HIS A 1 87  ? -0.309  23.137  27.025  1.00   59.07  ? 839  HIS A ND1 1 
ATOM   577  C CD2 . HIS A 1 87  ? -2.398  23.733  26.809  1.00   56.65  ? 839  HIS A CD2 1 
ATOM   578  C CE1 . HIS A 1 87  ? -0.339  24.199  26.243  1.00   62.00  ? 839  HIS A CE1 1 
ATOM   579  N NE2 . HIS A 1 87  ? -1.592  24.590  26.117  1.00   54.46  ? 839  HIS A NE2 1 
ATOM   580  N N   . ILE A 1 88  ? -1.259  18.148  28.469  1.00   46.06  ? 840  ILE A N   1 
ATOM   581  C CA  . ILE A 1 88  ? -1.553  16.838  28.959  1.00   45.51  ? 840  ILE A CA  1 
ATOM   582  C C   . ILE A 1 88  ? -0.531  16.553  29.997  1.00   43.68  ? 840  ILE A C   1 
ATOM   583  O O   . ILE A 1 88  ? 0.571   17.062  29.962  1.00   45.97  ? 840  ILE A O   1 
ATOM   584  C CB  . ILE A 1 88  ? -1.571  15.765  27.812  1.00   50.31  ? 840  ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 88  ? -2.679  16.099  26.833  1.00   50.69  ? 840  ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 88  ? -1.854  14.343  28.367  1.00   49.83  ? 840  ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 88  ? -2.973  14.996  25.759  1.00   36.06  ? 840  ILE A CD1 1 
ATOM   588  N N   . HIS A 1 89  ? -0.927  15.724  30.940  1.00   44.30  ? 841  HIS A N   1 
ATOM   589  C CA  . HIS A 1 89  ? -0.067  15.219  31.938  1.00   41.38  ? 841  HIS A CA  1 
ATOM   590  C C   . HIS A 1 89  ? 0.075   13.697  31.683  1.00   36.92  ? 841  HIS A C   1 
ATOM   591  O O   . HIS A 1 89  ? -0.911  12.965  31.486  1.00   38.73  ? 841  HIS A O   1 
ATOM   592  C CB  . HIS A 1 89  ? -0.676  15.542  33.302  1.00   33.74  ? 841  HIS A CB  1 
ATOM   593  C CG  . HIS A 1 89  ? 0.224   15.320  34.512  1.00   47.86  ? 841  HIS A CG  1 
ATOM   594  N ND1 . HIS A 1 89  ? 1.072   14.252  34.634  1.00   36.98  ? 841  HIS A ND1 1 
ATOM   595  C CD2 . HIS A 1 89  ? 0.362   16.016  35.664  1.00   36.24  ? 841  HIS A CD2 1 
ATOM   596  C CE1 . HIS A 1 89  ? 1.659   14.259  35.819  1.00   34.09  ? 841  HIS A CE1 1 
ATOM   597  N NE2 . HIS A 1 89  ? 1.285   15.349  36.458  1.00   39.66  ? 841  HIS A NE2 1 
ATOM   598  N N   . LEU A 1 90  ? 1.271   13.226  31.855  1.00   35.20  ? 842  LEU A N   1 
ATOM   599  C CA  . LEU A 1 90  ? 1.503   11.831  31.794  1.00   36.61  ? 842  LEU A CA  1 
ATOM   600  C C   . LEU A 1 90  ? 2.152   11.356  33.052  1.00   32.11  ? 842  LEU A C   1 
ATOM   601  O O   . LEU A 1 90  ? 3.173   11.828  33.413  1.00   36.91  ? 842  LEU A O   1 
ATOM   602  C CB  . LEU A 1 90  ? 2.362   11.526  30.572  1.00   35.32  ? 842  LEU A CB  1 
ATOM   603  C CG  . LEU A 1 90  ? 3.169   10.271  30.561  1.00   31.00  ? 842  LEU A CG  1 
ATOM   604  C CD1 . LEU A 1 90  ? 2.289   9.152   30.394  1.00   40.74  ? 842  LEU A CD1 1 
ATOM   605  C CD2 . LEU A 1 90  ? 4.213   10.351  29.544  1.00   22.71  ? 842  LEU A CD2 1 
ATOM   606  N N   . HIS A 1 91  ? 1.554   10.395  33.701  1.00   32.96  ? 843  HIS A N   1 
ATOM   607  C CA  . HIS A 1 91  ? 2.199   9.793   34.816  1.00   34.57  ? 843  HIS A CA  1 
ATOM   608  C C   . HIS A 1 91  ? 2.666   8.387   34.522  1.00   37.54  ? 843  HIS A C   1 
ATOM   609  O O   . HIS A 1 91  ? 1.896   7.543   34.202  1.00   37.25  ? 843  HIS A O   1 
ATOM   610  C CB  . HIS A 1 91  ? 1.332   9.801   36.058  1.00   36.61  ? 843  HIS A CB  1 
ATOM   611  C CG  . HIS A 1 91  ? 2.077   9.419   37.279  1.00   38.73  ? 843  HIS A CG  1 
ATOM   612  N ND1 . HIS A 1 91  ? 1.813   8.279   37.980  1.00   46.37  ? 843  HIS A ND1 1 
ATOM   613  C CD2 . HIS A 1 91  ? 3.131   9.987   37.883  1.00   32.78  ? 843  HIS A CD2 1 
ATOM   614  C CE1 . HIS A 1 91  ? 2.640   8.180   38.990  1.00   41.12  ? 843  HIS A CE1 1 
ATOM   615  N NE2 . HIS A 1 91  ? 3.455   9.203   38.950  1.00   49.81  ? 843  HIS A NE2 1 
ATOM   616  N N   . VAL A 1 92  ? 3.952   8.166   34.650  1.00   38.35  ? 844  VAL A N   1 
ATOM   617  C CA  . VAL A 1 92  ? 4.541   6.843   34.547  1.00   34.30  ? 844  VAL A CA  1 
ATOM   618  C C   . VAL A 1 92  ? 4.912   6.455   35.930  1.00   34.10  ? 844  VAL A C   1 
ATOM   619  O O   . VAL A 1 92  ? 5.851   6.926   36.447  1.00   32.95  ? 844  VAL A O   1 
ATOM   620  C CB  . VAL A 1 92  ? 5.851   6.902   33.839  1.00   35.15  ? 844  VAL A CB  1 
ATOM   621  C CG1 . VAL A 1 92  ? 6.440   5.542   33.703  1.00   39.49  ? 844  VAL A CG1 1 
ATOM   622  C CG2 . VAL A 1 92  ? 5.707   7.500   32.534  1.00   48.83  ? 844  VAL A CG2 1 
ATOM   623  N N   . PRO A 1 93  ? 4.161   5.557   36.508  1.00   42.15  ? 845  PRO A N   1 
ATOM   624  C CA  . PRO A 1 93  ? 4.287   5.196   37.891  1.00   46.57  ? 845  PRO A CA  1 
ATOM   625  C C   . PRO A 1 93  ? 5.535   4.426   38.055  1.00   40.44  ? 845  PRO A C   1 
ATOM   626  O O   . PRO A 1 93  ? 6.077   3.892   37.146  1.00   44.62  ? 845  PRO A O   1 
ATOM   627  C CB  . PRO A 1 93  ? 3.119   4.295   38.084  1.00   49.53  ? 845  PRO A CB  1 
ATOM   628  C CG  . PRO A 1 93  ? 3.190   3.507   36.920  1.00   51.60  ? 845  PRO A CG  1 
ATOM   629  C CD  . PRO A 1 93  ? 3.709   4.389   35.781  1.00   55.17  ? 845  PRO A CD  1 
ATOM   630  N N   . GLU A 1 94  ? 5.986   4.412   39.269  1.00   40.31  ? 846  GLU A N   1 
ATOM   631  C CA  . GLU A 1 94  ? 7.332   4.051   39.611  1.00   41.00  ? 846  GLU A CA  1 
ATOM   632  C C   . GLU A 1 94  ? 7.374   2.540   39.607  1.00   43.62  ? 846  GLU A C   1 
ATOM   633  O O   . GLU A 1 94  ? 6.350   1.879   39.780  1.00   34.10  ? 846  GLU A O   1 
ATOM   634  C CB  . GLU A 1 94  ? 7.702   4.628   40.947  1.00   48.64  ? 846  GLU A CB  1 
ATOM   635  C CG  . GLU A 1 94  ? 9.135   5.050   41.030  1.00   56.76  ? 846  GLU A CG  1 
ATOM   636  C CD  . GLU A 1 94  ? 9.401   6.040   42.119  1.00   71.67  ? 846  GLU A CD  1 
ATOM   637  O OE1 . GLU A 1 94  ? 8.567   6.147   43.057  1.00   71.58  ? 846  GLU A OE1 1 
ATOM   638  O OE2 . GLU A 1 94  ? 10.462  6.718   42.027  1.00   61.19  ? 846  GLU A OE2 1 
ATOM   639  N N   . GLY A 1 95  ? 8.546   2.000   39.403  1.00   43.11  ? 847  GLY A N   1 
ATOM   640  C CA  . GLY A 1 95  ? 8.662   0.573   39.393  1.00   47.57  ? 847  GLY A CA  1 
ATOM   641  C C   . GLY A 1 95  ? 9.815   -0.059  38.686  1.00   40.40  ? 847  GLY A C   1 
ATOM   642  O O   . GLY A 1 95  ? 10.579  -0.759  39.222  1.00   41.79  ? 847  GLY A O   1 
ATOM   643  N N   . ALA A 1 96  ? 9.862   0.143   37.416  1.00   35.02  ? 848  ALA A N   1 
ATOM   644  C CA  . ALA A 1 96  ? 10.781  -0.576  36.600  1.00   40.25  ? 848  ALA A CA  1 
ATOM   645  C C   . ALA A 1 96  ? 12.173  -0.113  36.938  1.00   47.51  ? 848  ALA A C   1 
ATOM   646  O O   . ALA A 1 96  ? 12.365  1.056   37.281  1.00   37.10  ? 848  ALA A O   1 
ATOM   647  C CB  . ALA A 1 96  ? 10.481  -0.350  35.173  1.00   29.94  ? 848  ALA A CB  1 
ATOM   648  N N   . THR A 1 97  ? 13.150  -1.025  36.836  1.00   47.97  ? 849  THR A N   1 
ATOM   649  C CA  . THR A 1 97  ? 14.546  -0.602  36.847  1.00   44.56  ? 849  THR A CA  1 
ATOM   650  C C   . THR A 1 97  ? 14.851  0.413   35.826  1.00   50.06  ? 849  THR A C   1 
ATOM   651  O O   . THR A 1 97  ? 14.124  0.502   34.801  1.00   43.57  ? 849  THR A O   1 
ATOM   652  C CB  . THR A 1 97  ? 15.503  -1.782  36.553  1.00   48.34  ? 849  THR A CB  1 
ATOM   653  O OG1 . THR A 1 97  ? 15.091  -2.451  35.332  1.00   45.54  ? 849  THR A OG1 1 
ATOM   654  C CG2 . THR A 1 97  ? 15.435  -2.765  37.698  1.00   43.10  ? 849  THR A CG2 1 
ATOM   655  N N   . PRO A 1 98  ? 15.990  1.143   36.031  1.00   38.95  ? 850  PRO A N   1 
ATOM   656  C CA  . PRO A 1 98  ? 16.483  1.973   34.951  1.00   41.95  ? 850  PRO A CA  1 
ATOM   657  C C   . PRO A 1 98  ? 16.585  1.306   33.620  1.00   50.14  ? 850  PRO A C   1 
ATOM   658  O O   . PRO A 1 98  ? 16.373  1.961   32.594  1.00   48.97  ? 850  PRO A O   1 
ATOM   659  C CB  . PRO A 1 98  ? 17.900  2.429   35.443  1.00   44.05  ? 850  PRO A CB  1 
ATOM   660  C CG  . PRO A 1 98  ? 17.728  2.518   36.948  1.00   39.11  ? 850  PRO A CG  1 
ATOM   661  C CD  . PRO A 1 98  ? 16.691  1.383   37.310  1.00   46.47  ? 850  PRO A CD  1 
ATOM   662  N N   . LYS A 1 99  ? 16.983  0.034   33.589  1.00   46.71  ? 851  LYS A N   1 
ATOM   663  C CA  . LYS A 1 99  ? 17.142  -0.631  32.320  1.00   43.33  ? 851  LYS A CA  1 
ATOM   664  C C   . LYS A 1 99  ? 15.849  -0.869  31.571  1.00   34.76  ? 851  LYS A C   1 
ATOM   665  O O   . LYS A 1 99  ? 15.857  -0.802  30.336  1.00   36.07  ? 851  LYS A O   1 
ATOM   666  C CB  . LYS A 1 99  ? 17.894  -1.996  32.437  1.00   47.62  ? 851  LYS A CB  1 
ATOM   667  C CG  . LYS A 1 99  ? 19.366  -1.907  32.778  1.00   46.55  ? 851  LYS A CG  1 
ATOM   668  C CD  . LYS A 1 99  ? 20.277  -1.645  31.504  1.00   52.67  ? 851  LYS A CD  1 
ATOM   669  C CE  . LYS A 1 99  ? 21.326  -0.567  31.720  1.00   61.24  ? 851  LYS A CE  1 
ATOM   670  N NZ  . LYS A 1 99  ? 20.721  0.703   32.320  1.00   56.83  ? 851  LYS A NZ  1 
ATOM   671  N N   . ASP A 1 100 ? 14.779  -1.091  32.314  1.00   37.19  ? 852  ASP A N   1 
ATOM   672  C CA  . ASP A 1 100 ? 13.590  -1.559  31.784  1.00   40.08  ? 852  ASP A CA  1 
ATOM   673  C C   . ASP A 1 100 ? 12.656  -0.396  31.411  1.00   43.42  ? 852  ASP A C   1 
ATOM   674  O O   . ASP A 1 100 ? 11.723  -0.552  30.655  1.00   49.05  ? 852  ASP A O   1 
ATOM   675  C CB  . ASP A 1 100 ? 12.944  -2.411  32.819  1.00   33.76  ? 852  ASP A CB  1 
ATOM   676  C CG  . ASP A 1 100 ? 11.639  -3.135  32.219  1.00   29.24  ? 852  ASP A CG  1 
ATOM   677  O OD1 . ASP A 1 100 ? 11.675  -3.731  31.112  1.00   41.66  ? 852  ASP A OD1 1 
ATOM   678  O OD2 . ASP A 1 100 ? 10.632  -2.994  32.838  1.00   32.68  ? 852  ASP A OD2 1 
ATOM   679  N N   . GLY A 1 101 ? 13.011  0.791   31.814  1.00   36.60  ? 853  GLY A N   1 
ATOM   680  C CA  . GLY A 1 101 ? 12.149  1.905   31.605  1.00   37.05  ? 853  GLY A CA  1 
ATOM   681  C C   . GLY A 1 101 ? 11.701  2.200   30.204  1.00   31.01  ? 853  GLY A C   1 
ATOM   682  O O   . GLY A 1 101 ? 10.577  2.433   30.061  1.00   37.63  ? 853  GLY A O   1 
ATOM   683  N N   . PRO A 1 102 ? 12.525  2.172   29.188  1.00   30.53  ? 854  PRO A N   1 
ATOM   684  C CA  . PRO A 1 102 ? 12.075  2.229   27.830  1.00   35.30  ? 854  PRO A CA  1 
ATOM   685  C C   . PRO A 1 102 ? 10.972  1.307   27.322  1.00   32.14  ? 854  PRO A C   1 
ATOM   686  O O   . PRO A 1 102 ? 10.289  1.670   26.332  1.00   31.75  ? 854  PRO A O   1 
ATOM   687  C CB  . PRO A 1 102 ? 13.369  1.985   27.068  1.00   35.70  ? 854  PRO A CB  1 
ATOM   688  C CG  . PRO A 1 102 ? 14.340  2.690   27.920  1.00   39.54  ? 854  PRO A CG  1 
ATOM   689  C CD  . PRO A 1 102 ? 14.026  2.236   29.227  1.00   39.16  ? 854  PRO A CD  1 
ATOM   690  N N   . SER A 1 103 ? 10.792  0.195   27.983  1.00   31.09  ? 855  SER A N   1 
ATOM   691  C CA  . SER A 1 103 ? 9.819   -0.782  27.585  1.00   32.80  ? 855  SER A CA  1 
ATOM   692  C C   . SER A 1 103 ? 8.388   -0.323  27.804  1.00   33.79  ? 855  SER A C   1 
ATOM   693  O O   . SER A 1 103 ? 7.478   -0.919  27.359  1.00   38.54  ? 855  SER A O   1 
ATOM   694  C CB  . SER A 1 103 ? 10.082  -2.119  28.245  1.00   35.62  ? 855  SER A CB  1 
ATOM   695  O OG  . SER A 1 103 ? 9.745   -2.123  29.553  1.00   32.83  ? 855  SER A OG  1 
ATOM   696  N N   . ALA A 1 104 ? 8.219   0.744   28.514  1.00   29.77  ? 856  ALA A N   1 
ATOM   697  C CA  . ALA A 1 104 ? 6.929   1.278   28.724  1.00   31.46  ? 856  ALA A CA  1 
ATOM   698  C C   . ALA A 1 104 ? 6.447   2.094   27.503  1.00   23.07  ? 856  ALA A C   1 
ATOM   699  O O   . ALA A 1 104 ? 5.444   2.672   27.508  1.00   38.69  ? 856  ALA A O   1 
ATOM   700  C CB  . ALA A 1 104 ? 6.927   2.058   29.893  1.00   24.29  ? 856  ALA A CB  1 
ATOM   701  N N   . GLY A 1 105 ? 7.205   2.129   26.458  1.00   29.41  ? 857  GLY A N   1 
ATOM   702  C CA  . GLY A 1 105 ? 6.843   2.946   25.358  1.00   33.65  ? 857  GLY A CA  1 
ATOM   703  C C   . GLY A 1 105 ? 5.535   2.706   24.663  1.00   30.46  ? 857  GLY A C   1 
ATOM   704  O O   . GLY A 1 105 ? 4.847   3.652   24.505  1.00   32.32  ? 857  GLY A O   1 
ATOM   705  N N   . CYS A 1 106 ? 5.148   1.487   24.318  1.00   32.15  ? 858  CYS A N   1 
ATOM   706  C CA  . CYS A 1 106 ? 3.870   1.329   23.653  1.00   36.29  ? 858  CYS A CA  1 
ATOM   707  C C   . CYS A 1 106 ? 2.727   1.577   24.571  1.00   31.11  ? 858  CYS A C   1 
ATOM   708  O O   . CYS A 1 106 ? 1.581   2.032   24.136  1.00   33.98  ? 858  CYS A O   1 
ATOM   709  C CB  . CYS A 1 106 ? 3.777   -0.056  23.040  1.00   38.84  ? 858  CYS A CB  1 
ATOM   710  S SG  . CYS A 1 106 ? 4.065   -1.257  24.239  1.00   36.84  ? 858  CYS A SG  1 
ATOM   711  N N   . THR A 1 107 ? 2.958   1.290   25.825  1.00   30.54  ? 859  THR A N   1 
ATOM   712  C CA  . THR A 1 107 ? 1.999   1.560   26.820  1.00   33.08  ? 859  THR A CA  1 
ATOM   713  C C   . THR A 1 107 ? 1.668   3.036   26.792  1.00   37.23  ? 859  THR A C   1 
ATOM   714  O O   . THR A 1 107 ? 0.503   3.408   26.918  1.00   33.91  ? 859  THR A O   1 
ATOM   715  C CB  . THR A 1 107 ? 2.485   1.158   28.226  1.00   34.30  ? 859  THR A CB  1 
ATOM   716  O OG1 . THR A 1 107 ? 2.973   -0.216  28.194  1.00   35.05  ? 859  THR A OG1 1 
ATOM   717  C CG2 . THR A 1 107 ? 1.444   1.367   29.125  1.00   29.89  ? 859  THR A CG2 1 
ATOM   718  N N   . ILE A 1 108 ? 2.704   3.839   26.880  1.00   31.50  ? 860  ILE A N   1 
ATOM   719  C CA  . ILE A 1 108 ? 2.584   5.354   26.869  1.00   29.24  ? 860  ILE A CA  1 
ATOM   720  C C   . ILE A 1 108 ? 1.940   5.956   25.593  1.00   29.98  ? 860  ILE A C   1 
ATOM   721  O O   . ILE A 1 108 ? 1.160   6.988   25.703  1.00   36.04  ? 860  ILE A O   1 
ATOM   722  C CB  . ILE A 1 108 ? 3.887   6.060   27.122  1.00   26.08  ? 860  ILE A CB  1 
ATOM   723  C CG1 . ILE A 1 108 ? 4.393   5.818   28.516  1.00   36.34  ? 860  ILE A CG1 1 
ATOM   724  C CG2 . ILE A 1 108 ? 3.709   7.600   26.996  1.00   28.85  ? 860  ILE A CG2 1 
ATOM   725  C CD1 . ILE A 1 108 ? 5.964   6.231   28.687  1.00   29.86  ? 860  ILE A CD1 1 
ATOM   726  N N   . VAL A 1 109 ? 2.221   5.317   24.452  1.00   31.76  ? 861  VAL A N   1 
ATOM   727  C CA  . VAL A 1 109 ? 1.719   5.578   23.102  1.00   32.15  ? 861  VAL A CA  1 
ATOM   728  C C   . VAL A 1 109 ? 0.254   5.342   23.166  1.00   40.62  ? 861  VAL A C   1 
ATOM   729  O O   . VAL A 1 109 ? -0.481  6.304   22.880  1.00   33.81  ? 861  VAL A O   1 
ATOM   730  C CB  . VAL A 1 109 ? 2.345   4.833   21.966  1.00   27.39  ? 861  VAL A CB  1 
ATOM   731  C CG1 . VAL A 1 109 ? 1.577   5.118   20.581  1.00   34.65  ? 861  VAL A CG1 1 
ATOM   732  C CG2 . VAL A 1 109 ? 3.810   5.222   21.729  1.00   27.37  ? 861  VAL A CG2 1 
ATOM   733  N N   . THR A 1 110 ? -0.118  4.176   23.748  1.00   34.49  ? 862  THR A N   1 
ATOM   734  C CA  . THR A 1 110 ? -1.485  3.717   23.842  1.00   34.72  ? 862  THR A CA  1 
ATOM   735  C C   . THR A 1 110 ? -2.357  4.588   24.744  1.00   42.07  ? 862  THR A C   1 
ATOM   736  O O   . THR A 1 110 ? -3.438  4.951   24.337  1.00   44.20  ? 862  THR A O   1 
ATOM   737  C CB  . THR A 1 110 ? -1.548  2.275   24.325  1.00   32.72  ? 862  THR A CB  1 
ATOM   738  O OG1 . THR A 1 110 ? -0.689  1.467   23.499  1.00   36.82  ? 862  THR A OG1 1 
ATOM   739  C CG2 . THR A 1 110 ? -2.984  1.694   24.207  1.00   42.59  ? 862  THR A CG2 1 
ATOM   740  N N   . ALA A 1 111 ? -1.883  4.830   25.965  1.00   32.35  ? 863  ALA A N   1 
ATOM   741  C CA  . ALA A 1 111 ? -2.357  5.854   26.904  1.00   37.97  ? 863  ALA A CA  1 
ATOM   742  C C   . ALA A 1 111 ? -2.659  7.210   26.269  1.00   44.43  ? 863  ALA A C   1 
ATOM   743  O O   . ALA A 1 111 ? -3.772  7.737   26.437  1.00   42.45  ? 863  ALA A O   1 
ATOM   744  C CB  . ALA A 1 111 ? -1.367  6.013   28.060  1.00   30.21  ? 863  ALA A CB  1 
ATOM   745  N N   . LEU A 1 112 ? -1.717  7.750   25.482  1.00   41.45  ? 864  LEU A N   1 
ATOM   746  C CA  . LEU A 1 112 ? -1.952  9.012   24.746  1.00   41.21  ? 864  LEU A CA  1 
ATOM   747  C C   . LEU A 1 112 ? -3.126  9.088   23.721  1.00   44.45  ? 864  LEU A C   1 
ATOM   748  O O   . LEU A 1 112 ? -3.958  10.071  23.749  1.00   36.14  ? 864  LEU A O   1 
ATOM   749  C CB  . LEU A 1 112 ? -0.679  9.498   24.114  1.00   38.44  ? 864  LEU A CB  1 
ATOM   750  C CG  . LEU A 1 112 ? 0.358   9.908   25.125  1.00   37.68  ? 864  LEU A CG  1 
ATOM   751  C CD1 . LEU A 1 112 ? 1.818   9.852   24.556  1.00   30.20  ? 864  LEU A CD1 1 
ATOM   752  C CD2 . LEU A 1 112 ? 0.067   11.108  25.913  1.00   33.24  ? 864  LEU A CD2 1 
ATOM   753  N N   . LEU A 1 113 ? -3.193  8.033   22.934  1.00   37.01  ? 865  LEU A N   1 
ATOM   754  C CA  . LEU A 1 113 ? -4.037  7.803   21.840  1.00   39.88  ? 865  LEU A CA  1 
ATOM   755  C C   . LEU A 1 113 ? -5.412  7.520   22.430  1.00   47.06  ? 865  LEU A C   1 
ATOM   756  O O   . LEU A 1 113 ? -6.448  7.997   21.873  1.00   39.96  ? 865  LEU A O   1 
ATOM   757  C CB  . LEU A 1 113 ? -3.524  6.613   20.978  1.00   42.18  ? 865  LEU A CB  1 
ATOM   758  C CG  . LEU A 1 113 ? -2.261  6.848   20.132  1.00   37.76  ? 865  LEU A CG  1 
ATOM   759  C CD1 . LEU A 1 113 ? -1.801  5.650   19.366  1.00   33.61  ? 865  LEU A CD1 1 
ATOM   760  C CD2 . LEU A 1 113 ? -2.538  7.915   19.127  1.00   41.61  ? 865  LEU A CD2 1 
ATOM   761  N N   . SER A 1 114 ? -5.420  6.764   23.529  1.00   44.36  ? 866  SER A N   1 
ATOM   762  C CA  . SER A 1 114 ? -6.639  6.568   24.289  1.00   48.50  ? 866  SER A CA  1 
ATOM   763  C C   . SER A 1 114 ? -7.212  7.894   24.852  1.00   48.34  ? 866  SER A C   1 
ATOM   764  O O   . SER A 1 114 ? -8.382  8.143   24.652  1.00   54.70  ? 866  SER A O   1 
ATOM   765  C CB  . SER A 1 114 ? -6.442  5.593   25.390  1.00   40.76  ? 866  SER A CB  1 
ATOM   766  O OG  . SER A 1 114 ? -7.672  5.312   26.021  1.00   51.69  ? 866  SER A OG  1 
ATOM   767  N N   . LEU A 1 115 ? -6.391  8.770   25.423  1.00   42.01  ? 867  LEU A N   1 
ATOM   768  C CA  . LEU A 1 115 ? -6.904  10.083  25.922  1.00   48.26  ? 867  LEU A CA  1 
ATOM   769  C C   . LEU A 1 115 ? -7.436  10.927  24.776  1.00   42.62  ? 867  LEU A C   1 
ATOM   770  O O   . LEU A 1 115 ? -8.584  11.458  24.819  1.00   48.31  ? 867  LEU A O   1 
ATOM   771  C CB  . LEU A 1 115 ? -5.838  10.873  26.633  1.00   43.17  ? 867  LEU A CB  1 
ATOM   772  C CG  . LEU A 1 115 ? -6.212  11.793  27.783  1.00   50.18  ? 867  LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 115 ? -5.160  12.935  27.898  1.00   38.90  ? 867  LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 115 ? -7.661  12.290  27.657  1.00   47.47  ? 867  LEU A CD2 1 
ATOM   775  N N   . ALA A 1 116 ? -6.622  11.010  23.740  1.00   40.97  ? 868  ALA A N   1 
ATOM   776  C CA  . ALA A 1 116 ? -6.836  11.814  22.519  1.00   42.04  ? 868  ALA A CA  1 
ATOM   777  C C   . ALA A 1 116 ? -8.082  11.457  21.741  1.00   51.39  ? 868  ALA A C   1 
ATOM   778  O O   . ALA A 1 116 ? -8.803  12.357  21.287  1.00   55.69  ? 868  ALA A O   1 
ATOM   779  C CB  . ALA A 1 116 ? -5.669  11.626  21.596  1.00   45.33  ? 868  ALA A CB  1 
ATOM   780  N N   . MET A 1 117 ? -8.268  10.153  21.530  1.00   47.41  ? 869  MET A N   1 
ATOM   781  C CA  . MET A 1 117 ? -9.441  9.593   20.885  1.00   49.17  ? 869  MET A CA  1 
ATOM   782  C C   . MET A 1 117 ? -10.697 9.428   21.753  1.00   49.83  ? 869  MET A C   1 
ATOM   783  O O   . MET A 1 117 ? -11.749 9.036   21.214  1.00   54.53  ? 869  MET A O   1 
ATOM   784  C CB  . MET A 1 117 ? -9.101  8.202   20.379  1.00   47.95  ? 869  MET A CB  1 
ATOM   785  C CG  . MET A 1 117 ? -8.219  8.146   19.211  1.00   44.60  ? 869  MET A CG  1 
ATOM   786  S SD  . MET A 1 117 ? -7.982  6.490   18.534  1.00   46.28  ? 869  MET A SD  1 
ATOM   787  C CE  . MET A 1 117 ? -8.042  5.564   19.993  1.00   38.82  ? 869  MET A CE  1 
ATOM   788  N N   . GLY A 1 118 ? -10.606 9.693   23.065  1.00   50.44  ? 870  GLY A N   1 
ATOM   789  C CA  . GLY A 1 118 ? -11.593 9.273   24.048  1.00   52.08  ? 870  GLY A CA  1 
ATOM   790  C C   . GLY A 1 118 ? -12.121 7.814   23.972  1.00   57.50  ? 870  GLY A C   1 
ATOM   791  O O   . GLY A 1 118 ? -13.276 7.583   24.343  1.00   61.00  ? 870  GLY A O   1 
ATOM   792  N N   . ARG A 1 119 ? -11.324 6.849   23.482  1.00   59.23  ? 871  ARG A N   1 
ATOM   793  C CA  . ARG A 1 119 ? -11.674 5.405   23.547  1.00   59.16  ? 871  ARG A CA  1 
ATOM   794  C C   . ARG A 1 119 ? -10.830 4.606   24.568  1.00   65.41  ? 871  ARG A C   1 
ATOM   795  O O   . ARG A 1 119 ? -9.616  4.657   24.552  1.00   66.10  ? 871  ARG A O   1 
ATOM   796  C CB  . ARG A 1 119 ? -11.502 4.771   22.181  1.00   62.55  ? 871  ARG A CB  1 
ATOM   797  C CG  . ARG A 1 119 ? -12.571 5.109   21.165  1.00   62.98  ? 871  ARG A CG  1 
ATOM   798  C CD  . ARG A 1 119 ? -13.539 3.951   20.903  1.00   65.67  ? 871  ARG A CD  1 
ATOM   799  N NE  . ARG A 1 119 ? -12.933 2.873   20.110  1.00   69.73  ? 871  ARG A NE  1 
ATOM   800  C CZ  . ARG A 1 119 ? -12.528 1.681   20.570  1.00   72.05  ? 871  ARG A CZ  1 
ATOM   801  N NH1 . ARG A 1 119 ? -12.673 1.324   21.851  1.00   76.91  ? 871  ARG A NH1 1 
ATOM   802  N NH2 . ARG A 1 119 ? -11.984 0.801   19.725  1.00   75.84  ? 871  ARG A NH2 1 
ATOM   803  N N   . PRO A 1 120 ? -11.475 3.836   25.463  1.00   67.80  ? 872  PRO A N   1 
ATOM   804  C CA  . PRO A 1 120 ? -10.693 3.075   26.428  1.00   63.60  ? 872  PRO A CA  1 
ATOM   805  C C   . PRO A 1 120 ? -10.039 1.844   25.820  1.00   58.78  ? 872  PRO A C   1 
ATOM   806  O O   . PRO A 1 120 ? -10.485 1.310   24.852  1.00   54.39  ? 872  PRO A O   1 
ATOM   807  C CB  . PRO A 1 120 ? -11.732 2.638   27.477  1.00   66.61  ? 872  PRO A CB  1 
ATOM   808  C CG  . PRO A 1 120 ? -12.905 3.427   27.234  1.00   68.99  ? 872  PRO A CG  1 
ATOM   809  C CD  . PRO A 1 120 ? -12.907 3.742   25.756  1.00   68.09  ? 872  PRO A CD  1 
ATOM   810  N N   . VAL A 1 121 ? -8.992  1.384   26.439  1.00   57.32  ? 873  VAL A N   1 
ATOM   811  C CA  . VAL A 1 121 ? -8.285  0.235   25.976  1.00   46.28  ? 873  VAL A CA  1 
ATOM   812  C C   . VAL A 1 121 ? -9.049  -1.017  26.263  1.00   48.65  ? 873  VAL A C   1 
ATOM   813  O O   . VAL A 1 121 ? -9.702  -1.106  27.243  1.00   47.70  ? 873  VAL A O   1 
ATOM   814  C CB  . VAL A 1 121 ? -6.984  0.155   26.704  1.00   43.66  ? 873  VAL A CB  1 
ATOM   815  C CG1 . VAL A 1 121 ? -6.352  -1.060  26.392  1.00   37.01  ? 873  VAL A CG1 1 
ATOM   816  C CG2 . VAL A 1 121 ? -6.107  1.288   26.320  1.00   33.99  ? 873  VAL A CG2 1 
ATOM   817  N N   . ARG A 1 122 ? -8.890  -2.017  25.443  1.00   47.07  ? 874  ARG A N   1 
ATOM   818  C CA  . ARG A 1 122 ? -9.529  -3.284  25.651  1.00   54.42  ? 874  ARG A CA  1 
ATOM   819  C C   . ARG A 1 122 ? -9.176  -3.880  26.992  1.00   55.45  ? 874  ARG A C   1 
ATOM   820  O O   . ARG A 1 122 ? -8.079  -3.817  27.426  1.00   57.89  ? 874  ARG A O   1 
ATOM   821  C CB  . ARG A 1 122 ? -9.051  -4.228  24.578  1.00   55.19  ? 874  ARG A CB  1 
ATOM   822  C CG  . ARG A 1 122 ? -9.196  -5.615  24.938  1.00   58.17  ? 874  ARG A CG  1 
ATOM   823  C CD  . ARG A 1 122 ? -8.589  -6.561  23.952  1.00   62.84  ? 874  ARG A CD  1 
ATOM   824  N NE  . ARG A 1 122 ? -8.584  -7.862  24.562  1.00   64.44  ? 874  ARG A NE  1 
ATOM   825  C CZ  . ARG A 1 122 ? -8.241  -8.979  23.974  1.00   60.22  ? 874  ARG A CZ  1 
ATOM   826  N NH1 . ARG A 1 122 ? -7.867  -8.983  22.727  1.00   66.91  ? 874  ARG A NH1 1 
ATOM   827  N NH2 . ARG A 1 122 ? -8.271  -10.096 24.654  1.00   60.80  ? 874  ARG A NH2 1 
ATOM   828  N N   . GLN A 1 123 ? -10.146 -4.454  27.676  1.00   54.25  ? 875  GLN A N   1 
ATOM   829  C CA  . GLN A 1 123 ? -9.994  -4.933  29.043  1.00   51.88  ? 875  GLN A CA  1 
ATOM   830  C C   . GLN A 1 123 ? -9.037  -6.081  29.270  1.00   47.78  ? 875  GLN A C   1 
ATOM   831  O O   . GLN A 1 123 ? -9.030  -7.030  28.574  1.00   54.35  ? 875  GLN A O   1 
ATOM   832  C CB  . GLN A 1 123 ? -11.370 -5.304  29.585  1.00   53.10  ? 875  GLN A CB  1 
ATOM   833  C CG  . GLN A 1 123 ? -11.796 -4.647  30.883  1.00   62.00  ? 875  GLN A CG  1 
ATOM   834  C CD  . GLN A 1 123 ? -13.013 -5.347  31.599  1.00   76.54  ? 875  GLN A CD  1 
ATOM   835  O OE1 . GLN A 1 123 ? -12.839 -6.099  32.554  1.00   68.00  ? 875  GLN A OE1 1 
ATOM   836  N NE2 . GLN A 1 123 ? -14.226 -5.074  31.130  1.00   62.28  ? 875  GLN A NE2 1 
ATOM   837  N N   . ASN A 1 124 ? -8.237  -5.958  30.292  1.00   50.60  ? 876  ASN A N   1 
ATOM   838  C CA  . ASN A 1 124 ? -7.303  -6.996  30.774  1.00   56.50  ? 876  ASN A CA  1 
ATOM   839  C C   . ASN A 1 124 ? -6.135  -7.244  29.851  1.00   53.19  ? 876  ASN A C   1 
ATOM   840  O O   . ASN A 1 124 ? -5.477  -8.312  29.912  1.00   54.93  ? 876  ASN A O   1 
ATOM   841  C CB  . ASN A 1 124 ? -8.019  -8.305  31.133  1.00   55.36  ? 876  ASN A CB  1 
ATOM   842  C CG  . ASN A 1 124 ? -9.046  -8.112  32.240  1.00   52.60  ? 876  ASN A CG  1 
ATOM   843  O OD1 . ASN A 1 124 ? -8.722  -7.661  33.342  1.00   63.06  ? 876  ASN A OD1 1 
ATOM   844  N ND2 . ASN A 1 124 ? -10.308 -8.499  31.957  1.00   52.55  ? 876  ASN A ND2 1 
ATOM   845  N N   . LEU A 1 125 ? -5.925  -6.243  29.003  1.00   46.71  ? 877  LEU A N   1 
ATOM   846  C CA  . LEU A 1 125 ? -4.775  -6.068  28.134  1.00   41.93  ? 877  LEU A CA  1 
ATOM   847  C C   . LEU A 1 125 ? -3.580  -5.567  28.923  1.00   33.17  ? 877  LEU A C   1 
ATOM   848  O O   . LEU A 1 125 ? -3.690  -4.715  29.736  1.00   40.41  ? 877  LEU A O   1 
ATOM   849  C CB  . LEU A 1 125 ? -5.139  -5.067  26.996  1.00   43.99  ? 877  LEU A CB  1 
ATOM   850  C CG  . LEU A 1 125 ? -4.199  -4.905  25.794  1.00   48.05  ? 877  LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 125 ? -4.018  -6.255  25.082  1.00   57.86  ? 877  LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 125 ? -4.680  -3.844  24.829  1.00   50.96  ? 877  LEU A CD2 1 
ATOM   853  N N   . ALA A 1 126 ? -2.431  -6.146  28.671  1.00   35.04  ? 878  ALA A N   1 
ATOM   854  C CA  . ALA A 1 126 ? -1.204  -5.573  29.130  1.00   39.60  ? 878  ALA A CA  1 
ATOM   855  C C   . ALA A 1 126 ? -0.184  -5.802  28.091  1.00   39.74  ? 878  ALA A C   1 
ATOM   856  O O   . ALA A 1 126 ? -0.317  -6.746  27.293  1.00   41.51  ? 878  ALA A O   1 
ATOM   857  C CB  . ALA A 1 126 ? -0.765  -6.236  30.547  1.00   38.51  ? 878  ALA A CB  1 
ATOM   858  N N   . MET A 1 127 ? 0.880   -4.989  28.140  1.00   32.79  ? 879  MET A N   1 
ATOM   859  C CA  . MET A 1 127 ? 1.788   -4.836  27.101  1.00   39.68  ? 879  MET A CA  1 
ATOM   860  C C   . MET A 1 127 ? 3.121   -4.389  27.676  1.00   33.49  ? 879  MET A C   1 
ATOM   861  O O   . MET A 1 127 ? 3.206   -3.955  28.839  1.00   37.41  ? 879  MET A O   1 
ATOM   862  C CB  . MET A 1 127 ? 1.273   -3.880  26.010  1.00   33.84  ? 879  MET A CB  1 
ATOM   863  C CG  . MET A 1 127 ? 1.216   -2.364  26.356  1.00   34.87  ? 879  MET A CG  1 
ATOM   864  S SD  . MET A 1 127 ? 0.567   -1.218  25.107  1.00   39.25  ? 879  MET A SD  1 
ATOM   865  C CE  . MET A 1 127 ? -1.052  -1.852  24.814  1.00   21.79  ? 879  MET A CE  1 
ATOM   866  N N   . THR A 1 128 ? 4.149   -4.641  26.898  1.00   33.70  ? 880  THR A N   1 
ATOM   867  C CA  . THR A 1 128 ? 5.508   -4.180  27.084  1.00   26.69  ? 880  THR A CA  1 
ATOM   868  C C   . THR A 1 128 ? 6.172   -4.065  25.704  1.00   25.66  ? 880  THR A C   1 
ATOM   869  O O   . THR A 1 128 ? 5.812   -4.769  24.834  1.00   27.70  ? 880  THR A O   1 
ATOM   870  C CB  . THR A 1 128 ? 6.324   -5.081  28.070  1.00   31.78  ? 880  THR A CB  1 
ATOM   871  O OG1 . THR A 1 128 ? 7.573   -4.490  28.389  1.00   20.59  ? 880  THR A OG1 1 
ATOM   872  C CG2 . THR A 1 128 ? 6.519   -6.456  27.539  1.00   31.65  ? 880  THR A CG2 1 
ATOM   873  N N   . GLY A 1 129 ? 7.130   -3.173  25.549  1.00   19.87  ? 881  GLY A N   1 
ATOM   874  C CA  . GLY A 1 129 ? 7.866   -2.967  24.330  1.00   21.25  ? 881  GLY A CA  1 
ATOM   875  C C   . GLY A 1 129 ? 8.352   -1.532  24.076  1.00   30.05  ? 881  GLY A C   1 
ATOM   876  O O   . GLY A 1 129 ? 7.634   -0.625  24.188  1.00   28.25  ? 881  GLY A O   1 
ATOM   877  N N   . GLU A 1 130 ? 9.624   -1.391  23.716  1.00   32.05  ? 882  GLU A N   1 
ATOM   878  C CA  . GLU A 1 130 ? 10.174  -0.081  23.377  1.00   32.54  ? 882  GLU A CA  1 
ATOM   879  C C   . GLU A 1 130 ? 9.812   0.323   21.950  1.00   28.46  ? 882  GLU A C   1 
ATOM   880  O O   . GLU A 1 130 ? 9.862   -0.499  21.035  1.00   26.28  ? 882  GLU A O   1 
ATOM   881  C CB  . GLU A 1 130 ? 11.694  -0.076  23.556  1.00   38.07  ? 882  GLU A CB  1 
ATOM   882  C CG  . GLU A 1 130 ? 12.353  1.253   23.225  1.00   33.37  ? 882  GLU A CG  1 
ATOM   883  C CD  . GLU A 1 130 ? 13.857  1.221   23.414  1.00   43.65  ? 882  GLU A CD  1 
ATOM   884  O OE1 . GLU A 1 130 ? 14.510  2.258   23.173  1.00   30.16  ? 882  GLU A OE1 1 
ATOM   885  O OE2 . GLU A 1 130 ? 14.386  0.158   23.803  1.00   40.21  ? 882  GLU A OE2 1 
ATOM   886  N N   . VAL A 1 131 ? 9.449   1.590   21.761  1.00   32.02  ? 883  VAL A N   1 
ATOM   887  C CA  . VAL A 1 131 ? 9.003   2.042   20.489  1.00   22.35  ? 883  VAL A CA  1 
ATOM   888  C C   . VAL A 1 131 ? 9.993   2.965   19.819  1.00   27.06  ? 883  VAL A C   1 
ATOM   889  O O   . VAL A 1 131 ? 10.487  3.833   20.409  1.00   35.01  ? 883  VAL A O   1 
ATOM   890  C CB  . VAL A 1 131 ? 7.637   2.747   20.547  1.00   32.46  ? 883  VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 131 ? 7.062   2.810   19.225  1.00   29.66  ? 883  VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 131 ? 6.718   2.009   21.322  1.00   38.33  ? 883  VAL A CG2 1 
ATOM   893  N N   . SER A 1 132 ? 10.252  2.752   18.561  1.00   28.94  ? 884  SER A N   1 
ATOM   894  C CA  . SER A 1 132 ? 11.095  3.622   17.785  1.00   37.08  ? 884  SER A CA  1 
ATOM   895  C C   . SER A 1 132 ? 10.341  4.825   17.254  1.00   35.23  ? 884  SER A C   1 
ATOM   896  O O   . SER A 1 132 ? 9.178   4.917   17.428  1.00   34.02  ? 884  SER A O   1 
ATOM   897  C CB  . SER A 1 132 ? 11.751  2.884   16.664  1.00   28.29  ? 884  SER A CB  1 
ATOM   898  O OG  . SER A 1 132 ? 10.841  2.692   15.655  1.00   39.61  ? 884  SER A OG  1 
ATOM   899  N N   . LEU A 1 133 ? 11.051  5.755   16.642  1.00   42.88  ? 885  LEU A N   1 
ATOM   900  C CA  . LEU A 1 133 ? 10.449  6.936   16.113  1.00   40.90  ? 885  LEU A CA  1 
ATOM   901  C C   . LEU A 1 133 ? 9.570   6.672   14.902  1.00   39.82  ? 885  LEU A C   1 
ATOM   902  O O   . LEU A 1 133 ? 8.786   7.512   14.547  1.00   38.83  ? 885  LEU A O   1 
ATOM   903  C CB  . LEU A 1 133 ? 11.452  7.973   15.811  1.00   41.02  ? 885  LEU A CB  1 
ATOM   904  C CG  . LEU A 1 133 ? 12.074  8.682   16.971  1.00   35.02  ? 885  LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 133 ? 13.317  9.450   16.378  1.00   53.20  ? 885  LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 133 ? 11.238  9.665   17.575  1.00   44.77  ? 885  LEU A CD2 1 
ATOM   907  N N   . THR A 1 134 ? 9.657   5.478   14.333  1.00   38.39  ? 886  THR A N   1 
ATOM   908  C CA  . THR A 1 134 ? 8.763   5.025   13.345  1.00   36.70  ? 886  THR A CA  1 
ATOM   909  C C   . THR A 1 134 ? 7.855   3.917   13.778  1.00   36.78  ? 886  THR A C   1 
ATOM   910  O O   . THR A 1 134 ? 7.247   3.287   12.919  1.00   35.01  ? 886  THR A O   1 
ATOM   911  C CB  . THR A 1 134 ? 9.529   4.544   12.103  1.00   46.92  ? 886  THR A CB  1 
ATOM   912  O OG1 . THR A 1 134 ? 10.155  3.282   12.341  1.00   43.28  ? 886  THR A OG1 1 
ATOM   913  C CG2 . THR A 1 134 ? 10.613  5.585   11.713  1.00   52.03  ? 886  THR A CG2 1 
ATOM   914  N N   . GLY A 1 135 ? 7.707   3.693   15.084  1.00   29.52  ? 887  GLY A N   1 
ATOM   915  C CA  . GLY A 1 135 ? 6.685   2.773   15.553  1.00   30.01  ? 887  GLY A CA  1 
ATOM   916  C C   . GLY A 1 135 ? 7.230   1.342   15.582  1.00   30.63  ? 887  GLY A C   1 
ATOM   917  O O   . GLY A 1 135 ? 6.502   0.382   16.032  1.00   39.05  ? 887  GLY A O   1 
ATOM   918  N N   . LYS A 1 136 ? 8.463   1.155   15.153  1.00   29.30  ? 888  LYS A N   1 
ATOM   919  C CA  . LYS A 1 136 ? 9.063   -0.213  15.333  1.00   34.65  ? 888  LYS A CA  1 
ATOM   920  C C   . LYS A 1 136 ? 9.120   -0.632  16.841  1.00   28.36  ? 888  LYS A C   1 
ATOM   921  O O   . LYS A 1 136 ? 9.426   0.139   17.740  1.00   28.18  ? 888  LYS A O   1 
ATOM   922  C CB  . LYS A 1 136 ? 10.413  -0.308  14.639  1.00   32.07  ? 888  LYS A CB  1 
ATOM   923  C CG  . LYS A 1 136 ? 11.068  -1.698  14.732  1.00   31.07  ? 888  LYS A CG  1 
ATOM   924  C CD  . LYS A 1 136 ? 12.589  -1.641  14.204  1.00   44.34  ? 888  LYS A CD  1 
ATOM   925  C CE  . LYS A 1 136 ? 13.214  -3.034  14.198  1.00   37.44  ? 888  LYS A CE  1 
ATOM   926  N NZ  . LYS A 1 136 ? 12.517  -3.935  13.194  1.00   36.14  ? 888  LYS A NZ  1 
ATOM   927  N N   . ILE A 1 137 ? 8.694   -1.879  17.162  1.00   31.77  ? 889  ILE A N   1 
ATOM   928  C CA  . ILE A 1 137 ? 8.741   -2.368  18.514  1.00   27.23  ? 889  ILE A CA  1 
ATOM   929  C C   . ILE A 1 137 ? 9.978   -3.225  18.799  1.00   31.83  ? 889  ILE A C   1 
ATOM   930  O O   . ILE A 1 137 ? 10.166  -4.253  18.164  1.00   30.77  ? 889  ILE A O   1 
ATOM   931  C CB  . ILE A 1 137 ? 7.414   -3.118  18.878  1.00   27.64  ? 889  ILE A CB  1 
ATOM   932  C CG1 . ILE A 1 137 ? 6.240   -2.097  18.850  1.00   36.99  ? 889  ILE A CG1 1 
ATOM   933  C CG2 . ILE A 1 137 ? 7.388   -3.653  20.316  1.00   33.57  ? 889  ILE A CG2 1 
ATOM   934  C CD1 . ILE A 1 137 ? 5.239   -2.499  18.023  1.00   35.48  ? 889  ILE A CD1 1 
ATOM   935  N N   . LEU A 1 138 ? 10.807  -2.780  19.749  1.00   38.79  ? 890  LEU A N   1 
ATOM   936  C CA  . LEU A 1 138 ? 12.081  -3.401  20.096  1.00   35.93  ? 890  LEU A CA  1 
ATOM   937  C C   . LEU A 1 138 ? 11.868  -4.310  21.229  1.00   35.96  ? 890  LEU A C   1 
ATOM   938  O O   . LEU A 1 138 ? 10.964  -4.083  22.032  1.00   27.59  ? 890  LEU A O   1 
ATOM   939  C CB  . LEU A 1 138 ? 13.158  -2.327  20.504  1.00   29.75  ? 890  LEU A CB  1 
ATOM   940  C CG  . LEU A 1 138 ? 13.590  -1.454  19.316  1.00   44.59  ? 890  LEU A CG  1 
ATOM   941  C CD1 . LEU A 1 138 ? 12.698  -1.389  18.018  1.00   39.47  ? 890  LEU A CD1 1 
ATOM   942  C CD2 . LEU A 1 138 ? 13.899  -0.057  19.767  1.00   35.60  ? 890  LEU A CD2 1 
ATOM   943  N N   . PRO A 1 139 ? 12.676  -5.391  21.290  1.00   34.11  ? 891  PRO A N   1 
ATOM   944  C CA  . PRO A 1 139 ? 12.727  -6.298  22.387  1.00   33.99  ? 891  PRO A CA  1 
ATOM   945  C C   . PRO A 1 139 ? 13.144  -5.741  23.679  1.00   34.84  ? 891  PRO A C   1 
ATOM   946  O O   . PRO A 1 139 ? 13.953  -4.787  23.750  1.00   43.61  ? 891  PRO A O   1 
ATOM   947  C CB  . PRO A 1 139 ? 13.719  -7.408  21.929  1.00   29.19  ? 891  PRO A CB  1 
ATOM   948  C CG  . PRO A 1 139 ? 14.367  -6.859  20.771  1.00   33.60  ? 891  PRO A CG  1 
ATOM   949  C CD  . PRO A 1 139 ? 13.486  -5.837  20.139  1.00   34.64  ? 891  PRO A CD  1 
ATOM   950  N N   . VAL A 1 140 ? 12.554  -6.313  24.718  1.00   35.41  ? 892  VAL A N   1 
ATOM   951  C CA  . VAL A 1 140 ? 12.748  -5.885  26.122  1.00   33.20  ? 892  VAL A CA  1 
ATOM   952  C C   . VAL A 1 140 ? 13.242  -7.094  26.946  1.00   39.09  ? 892  VAL A C   1 
ATOM   953  O O   . VAL A 1 140 ? 13.512  -8.148  26.323  1.00   42.61  ? 892  VAL A O   1 
ATOM   954  C CB  . VAL A 1 140 ? 11.489  -5.294  26.721  1.00   36.32  ? 892  VAL A CB  1 
ATOM   955  C CG1 . VAL A 1 140 ? 10.994  -4.078  25.840  1.00   32.70  ? 892  VAL A CG1 1 
ATOM   956  C CG2 . VAL A 1 140 ? 10.364  -6.416  26.839  1.00   32.42  ? 892  VAL A CG2 1 
ATOM   957  N N   . GLY A 1 141 ? 13.581  -6.839  28.218  1.00   42.08  ? 893  GLY A N   1 
ATOM   958  C CA  . GLY A 1 141 ? 13.933  -7.883  29.254  1.00   44.61  ? 893  GLY A CA  1 
ATOM   959  C C   . GLY A 1 141 ? 12.772  -8.113  30.178  1.00   41.22  ? 893  GLY A C   1 
ATOM   960  O O   . GLY A 1 141 ? 11.675  -7.514  29.966  1.00   39.08  ? 893  GLY A O   1 
ATOM   961  N N   . GLY A 1 142 ? 13.033  -8.921  31.225  1.00   40.62  ? 894  GLY A N   1 
ATOM   962  C CA  . GLY A 1 142 ? 12.102  -9.253  32.251  1.00   43.80  ? 894  GLY A CA  1 
ATOM   963  C C   . GLY A 1 142 ? 10.862  -9.985  31.821  1.00   43.25  ? 894  GLY A C   1 
ATOM   964  O O   . GLY A 1 142 ? 9.833   -9.822  32.455  1.00   40.10  ? 894  GLY A O   1 
ATOM   965  N N   . ILE A 1 143 ? 10.924  -10.758 30.724  1.00   43.90  ? 895  ILE A N   1 
ATOM   966  C CA  . ILE A 1 143 ? 9.672   -11.351 30.169  1.00   41.42  ? 895  ILE A CA  1 
ATOM   967  C C   . ILE A 1 143 ? 8.984   -12.306 31.141  1.00   44.58  ? 895  ILE A C   1 
ATOM   968  O O   . ILE A 1 143 ? 7.746   -12.293 31.223  1.00   38.62  ? 895  ILE A O   1 
ATOM   969  C CB  . ILE A 1 143 ? 9.858   -12.045 28.838  1.00   35.36  ? 895  ILE A CB  1 
ATOM   970  C CG1 . ILE A 1 143 ? 10.415  -11.060 27.787  1.00   42.29  ? 895  ILE A CG1 1 
ATOM   971  C CG2 . ILE A 1 143 ? 8.524   -12.608 28.329  1.00   32.61  ? 895  ILE A CG2 1 
ATOM   972  C CD1 . ILE A 1 143 ? 9.308   -10.169 26.993  1.00   25.50  ? 895  ILE A CD1 1 
ATOM   973  N N   . LYS A 1 144 ? 9.770   -13.146 31.843  1.00   46.37  ? 896  LYS A N   1 
ATOM   974  C CA  . LYS A 1 144 ? 9.169   -14.072 32.813  1.00   47.74  ? 896  LYS A CA  1 
ATOM   975  C C   . LYS A 1 144 ? 8.558   -13.307 33.963  1.00   35.82  ? 896  LYS A C   1 
ATOM   976  O O   . LYS A 1 144 ? 7.515   -13.633 34.382  1.00   35.37  ? 896  LYS A O   1 
ATOM   977  C CB  . LYS A 1 144 ? 10.179  -15.066 33.381  1.00   47.20  ? 896  LYS A CB  1 
ATOM   978  C CG  . LYS A 1 144 ? 9.613   -15.948 34.523  1.00   51.07  ? 896  LYS A CG  1 
ATOM   979  C CD  . LYS A 1 144 ? 10.686  -16.953 34.993  1.00   49.53  ? 896  LYS A CD  1 
ATOM   980  C CE  . LYS A 1 144 ? 10.233  -17.790 36.195  1.00   61.05  ? 896  LYS A CE  1 
ATOM   981  N NZ  . LYS A 1 144 ? 11.214  -18.907 36.542  1.00   59.57  ? 896  LYS A NZ  1 
ATOM   982  N N   . GLU A 1 145 ? 9.238   -12.297 34.485  1.00   35.33  ? 897  GLU A N   1 
ATOM   983  C CA  . GLU A 1 145 ? 8.735   -11.545 35.634  1.00   39.82  ? 897  GLU A CA  1 
ATOM   984  C C   . GLU A 1 145 ? 7.441   -10.824 35.187  1.00   39.03  ? 897  GLU A C   1 
ATOM   985  O O   . GLU A 1 145 ? 6.482   -10.582 35.966  1.00   36.30  ? 897  GLU A O   1 
ATOM   986  C CB  . GLU A 1 145 ? 9.808   -10.508 36.092  1.00   40.82  ? 897  GLU A CB  1 
ATOM   987  C CG  . GLU A 1 145 ? 11.085  -11.094 36.742  1.00   51.78  ? 897  GLU A CG  1 
ATOM   988  C CD  . GLU A 1 145 ? 12.086  -11.590 35.704  1.00   60.62  ? 897  GLU A CD  1 
ATOM   989  O OE1 . GLU A 1 145 ? 13.204  -12.007 36.069  1.00   56.83  ? 897  GLU A OE1 1 
ATOM   990  O OE2 . GLU A 1 145 ? 11.744  -11.552 34.508  1.00   52.99  ? 897  GLU A OE2 1 
ATOM   991  N N   . LYS A 1 146 ? 7.451   -10.445 33.925  1.00   34.51  ? 898  LYS A N   1 
ATOM   992  C CA  . LYS A 1 146 ? 6.393   -9.605  33.414  1.00   36.70  ? 898  LYS A CA  1 
ATOM   993  C C   . LYS A 1 146 ? 5.169   -10.457 33.174  1.00   43.85  ? 898  LYS A C   1 
ATOM   994  O O   . LYS A 1 146 ? 4.046   -9.997  33.382  1.00   31.06  ? 898  LYS A O   1 
ATOM   995  C CB  . LYS A 1 146 ? 6.863   -8.877  32.170  1.00   33.18  ? 898  LYS A CB  1 
ATOM   996  C CG  . LYS A 1 146 ? 7.834   -7.664  32.468  1.00   29.46  ? 898  LYS A CG  1 
ATOM   997  C CD  . LYS A 1 146 ? 8.241   -6.998  31.135  1.00   33.85  ? 898  LYS A CD  1 
ATOM   998  C CE  . LYS A 1 146 ? 9.368   -5.918  31.309  1.00   35.09  ? 898  LYS A CE  1 
ATOM   999  N NZ  . LYS A 1 146 ? 9.879   -5.402  29.985  1.00   24.13  ? 898  LYS A NZ  1 
ATOM   1000 N N   . THR A 1 147 ? 5.368   -11.718 32.790  1.00   40.87  ? 899  THR A N   1 
ATOM   1001 C CA  . THR A 1 147 ? 4.192   -12.549 32.494  1.00   39.79  ? 899  THR A CA  1 
ATOM   1002 C C   . THR A 1 147 ? 3.594   -13.008 33.836  1.00   42.70  ? 899  THR A C   1 
ATOM   1003 O O   . THR A 1 147 ? 2.385   -13.127 33.949  1.00   50.62  ? 899  THR A O   1 
ATOM   1004 C CB  . THR A 1 147 ? 4.555   -13.632 31.543  1.00   43.01  ? 899  THR A CB  1 
ATOM   1005 O OG1 . THR A 1 147 ? 5.211   -13.045 30.372  1.00   44.53  ? 899  THR A OG1 1 
ATOM   1006 C CG2 . THR A 1 147 ? 3.352   -14.402 31.083  1.00   37.90  ? 899  THR A CG2 1 
ATOM   1007 N N   . ILE A 1 148 ? 4.457   -13.350 34.772  1.00   40.31  ? 900  ILE A N   1 
ATOM   1008 C CA  . ILE A 1 148 ? 4.131   -13.570 36.187  1.00   41.67  ? 900  ILE A CA  1 
ATOM   1009 C C   . ILE A 1 148 ? 3.272   -12.420 36.703  1.00   47.19  ? 900  ILE A C   1 
ATOM   1010 O O   . ILE A 1 148 ? 2.190   -12.665 37.138  1.00   50.48  ? 900  ILE A O   1 
ATOM   1011 C CB  . ILE A 1 148 ? 5.422   -13.903 37.047  1.00   40.05  ? 900  ILE A CB  1 
ATOM   1012 C CG1 . ILE A 1 148 ? 5.989   -15.300 36.607  1.00   40.20  ? 900  ILE A CG1 1 
ATOM   1013 C CG2 . ILE A 1 148 ? 5.097   -13.963 38.486  1.00   43.64  ? 900  ILE A CG2 1 
ATOM   1014 C CD1 . ILE A 1 148 ? 7.471   -15.596 37.109  1.00   46.89  ? 900  ILE A CD1 1 
ATOM   1015 N N   . ALA A 1 149 ? 3.669   -11.160 36.476  1.00   45.41  ? 901  ALA A N   1 
ATOM   1016 C CA  . ALA A 1 149 ? 2.881   -10.027 36.966  1.00   41.73  ? 901  ALA A CA  1 
ATOM   1017 C C   . ALA A 1 149 ? 1.517   -9.907  36.317  1.00   42.21  ? 901  ALA A C   1 
ATOM   1018 O O   . ALA A 1 149 ? 0.525   -9.682  37.008  1.00   38.71  ? 901  ALA A O   1 
ATOM   1019 C CB  . ALA A 1 149 ? 3.677   -8.769  36.825  1.00   39.25  ? 901  ALA A CB  1 
ATOM   1020 N N   . ALA A 1 150 ? 1.473   -10.077 34.995  1.00   42.30  ? 902  ALA A N   1 
ATOM   1021 C CA  . ALA A 1 150 ? 0.257   -10.147 34.260  1.00   40.82  ? 902  ALA A CA  1 
ATOM   1022 C C   . ALA A 1 150 ? -0.627  -11.228 34.866  1.00   48.81  ? 902  ALA A C   1 
ATOM   1023 O O   . ALA A 1 150 ? -1.833  -11.017 35.021  1.00   43.80  ? 902  ALA A O   1 
ATOM   1024 C CB  . ALA A 1 150 ? 0.523   -10.474 32.821  1.00   43.06  ? 902  ALA A CB  1 
ATOM   1025 N N   . LYS A 1 151 ? -0.035  -12.392 35.172  1.00   46.90  ? 903  LYS A N   1 
ATOM   1026 C CA  . LYS A 1 151 ? -0.841  -13.545 35.633  1.00   48.83  ? 903  LYS A CA  1 
ATOM   1027 C C   . LYS A 1 151 ? -1.427  -13.242 37.008  1.00   49.48  ? 903  LYS A C   1 
ATOM   1028 O O   . LYS A 1 151 ? -2.648  -13.308 37.209  1.00   51.76  ? 903  LYS A O   1 
ATOM   1029 C CB  . LYS A 1 151 ? -0.038  -14.862 35.654  1.00   44.91  ? 903  LYS A CB  1 
ATOM   1030 C CG  . LYS A 1 151 ? -0.111  -15.579 34.388  1.00   51.10  ? 903  LYS A CG  1 
ATOM   1031 C CD  . LYS A 1 151 ? -1.485  -16.269 34.204  1.00   49.78  ? 903  LYS A CD  1 
ATOM   1032 C CE  . LYS A 1 151 ? -1.433  -17.771 34.521  1.00   55.99  ? 903  LYS A CE  1 
ATOM   1033 N NZ  . LYS A 1 151 ? -0.775  -18.532 33.462  1.00   52.91  ? 903  LYS A NZ  1 
ATOM   1034 N N   . ARG A 1 152 ? -0.561  -12.791 37.902  1.00   54.82  ? 904  ARG A N   1 
ATOM   1035 C CA  . ARG A 1 152 ? -0.974  -12.334 39.217  1.00   57.25  ? 904  ARG A CA  1 
ATOM   1036 C C   . ARG A 1 152 ? -2.022  -11.226 39.140  1.00   59.96  ? 904  ARG A C   1 
ATOM   1037 O O   . ARG A 1 152 ? -2.907  -11.147 39.996  1.00   54.51  ? 904  ARG A O   1 
ATOM   1038 C CB  . ARG A 1 152 ? 0.259   -11.896 39.996  1.00   57.28  ? 904  ARG A CB  1 
ATOM   1039 C CG  . ARG A 1 152 ? 0.074   -11.265 41.351  1.00   64.15  ? 904  ARG A CG  1 
ATOM   1040 C CD  . ARG A 1 152 ? 1.418   -11.292 42.202  1.00   66.65  ? 904  ARG A CD  1 
ATOM   1041 N NE  . ARG A 1 152 ? 2.373   -10.233 41.837  1.00   75.12  ? 904  ARG A NE  1 
ATOM   1042 C CZ  . ARG A 1 152 ? 3.443   -10.354 41.040  1.00   76.86  ? 904  ARG A CZ  1 
ATOM   1043 N NH1 . ARG A 1 152 ? 3.804   -11.510 40.480  1.00   72.05  ? 904  ARG A NH1 1 
ATOM   1044 N NH2 . ARG A 1 152 ? 4.185   -9.286  40.794  1.00   74.83  ? 904  ARG A NH2 1 
ATOM   1045 N N   . ALA A 1 153 ? -1.930  -10.351 38.143  1.00   59.63  ? 905  ALA A N   1 
ATOM   1046 C CA  . ALA A 1 153 ? -2.863  -9.229  38.093  1.00   55.14  ? 905  ALA A CA  1 
ATOM   1047 C C   . ALA A 1 153 ? -4.149  -9.582  37.327  1.00   53.50  ? 905  ALA A C   1 
ATOM   1048 O O   . ALA A 1 153 ? -4.976  -8.741  37.114  1.00   50.25  ? 905  ALA A O   1 
ATOM   1049 C CB  . ALA A 1 153 ? -2.188  -7.992  37.511  1.00   61.13  ? 905  ALA A CB  1 
ATOM   1050 N N   . GLY A 1 154 ? -4.365  -10.851 36.957  1.00   56.48  ? 906  GLY A N   1 
ATOM   1051 C CA  . GLY A 1 154 ? -5.602  -11.196 36.238  1.00   53.78  ? 906  GLY A CA  1 
ATOM   1052 C C   . GLY A 1 154 ? -5.641  -10.833 34.754  1.00   56.56  ? 906  GLY A C   1 
ATOM   1053 O O   . GLY A 1 154 ? -6.715  -10.681 34.136  1.00   58.11  ? 906  GLY A O   1 
ATOM   1054 N N   . VAL A 1 155 ? -4.471  -10.685 34.149  1.00   56.81  ? 907  VAL A N   1 
ATOM   1055 C CA  . VAL A 1 155 ? -4.440  -10.260 32.767  1.00   48.09  ? 907  VAL A CA  1 
ATOM   1056 C C   . VAL A 1 155 ? -4.715  -11.424 31.875  1.00   45.05  ? 907  VAL A C   1 
ATOM   1057 O O   . VAL A 1 155 ? -4.136  -12.499 32.025  1.00   51.43  ? 907  VAL A O   1 
ATOM   1058 C CB  . VAL A 1 155 ? -3.137  -9.495  32.462  1.00   49.59  ? 907  VAL A CB  1 
ATOM   1059 C CG1 . VAL A 1 155 ? -2.871  -9.326  30.977  1.00   52.87  ? 907  VAL A CG1 1 
ATOM   1060 C CG2 . VAL A 1 155 ? -3.222  -8.132  33.162  1.00   53.34  ? 907  VAL A CG2 1 
ATOM   1061 N N   . THR A 1 156 ? -5.555  -11.192 30.893  1.00   42.22  ? 908  THR A N   1 
ATOM   1062 C CA  . THR A 1 156 ? -5.923  -12.257 29.956  1.00   51.48  ? 908  THR A CA  1 
ATOM   1063 C C   . THR A 1 156 ? -5.275  -12.228 28.590  1.00   47.99  ? 908  THR A C   1 
ATOM   1064 O O   . THR A 1 156 ? -5.498  -13.167 27.820  1.00   45.81  ? 908  THR A O   1 
ATOM   1065 C CB  . THR A 1 156 ? -7.445  -12.291 29.708  1.00   52.04  ? 908  THR A CB  1 
ATOM   1066 O OG1 . THR A 1 156 ? -7.760  -13.313 28.731  1.00   64.06  ? 908  THR A OG1 1 
ATOM   1067 C CG2 . THR A 1 156 ? -7.889  -10.988 29.172  1.00   47.54  ? 908  THR A CG2 1 
ATOM   1068 N N   . CYS A 1 157 ? -4.578  -11.125 28.249  1.00   41.63  ? 909  CYS A N   1 
ATOM   1069 C CA  . CYS A 1 157 ? -4.061  -10.892 26.914  1.00   50.07  ? 909  CYS A CA  1 
ATOM   1070 C C   . CYS A 1 157 ? -2.797  -10.064 26.989  1.00   44.53  ? 909  CYS A C   1 
ATOM   1071 O O   . CYS A 1 157 ? -2.823  -8.936  27.424  1.00   48.89  ? 909  CYS A O   1 
ATOM   1072 C CB  . CYS A 1 157 ? -5.076  -10.106 26.051  1.00   49.25  ? 909  CYS A CB  1 
ATOM   1073 S SG  . CYS A 1 157 ? -4.497  -9.691  24.374  1.00   58.38  ? 909  CYS A SG  1 
ATOM   1074 N N   . ILE A 1 158 ? -1.689  -10.643 26.595  1.00   48.27  ? 910  ILE A N   1 
ATOM   1075 C CA  . ILE A 1 158 ? -0.433  -9.971  26.717  1.00   47.33  ? 910  ILE A CA  1 
ATOM   1076 C C   . ILE A 1 158 ? 0.002   -9.666  25.308  1.00   43.56  ? 910  ILE A C   1 
ATOM   1077 O O   . ILE A 1 158 ? -0.184  -10.476 24.431  1.00   40.60  ? 910  ILE A O   1 
ATOM   1078 C CB  . ILE A 1 158 ? 0.565   -10.807 27.590  1.00   49.18  ? 910  ILE A CB  1 
ATOM   1079 C CG1 . ILE A 1 158 ? 1.733   -9.978  28.031  1.00   48.43  ? 910  ILE A CG1 1 
ATOM   1080 C CG2 . ILE A 1 158 ? 1.059   -12.019 26.899  1.00   43.19  ? 910  ILE A CG2 1 
ATOM   1081 C CD1 . ILE A 1 158 ? 2.167   -10.283 29.480  1.00   49.28  ? 910  ILE A CD1 1 
ATOM   1082 N N   . VAL A 1 159 ? 0.582   -8.473  25.097  1.00   37.48  ? 911  VAL A N   1 
ATOM   1083 C CA  . VAL A 1 159 ? 1.133   -8.093  23.798  1.00   41.27  ? 911  VAL A CA  1 
ATOM   1084 C C   . VAL A 1 159 ? 2.627   -7.879  24.033  1.00   33.77  ? 911  VAL A C   1 
ATOM   1085 O O   . VAL A 1 159 ? 2.991   -7.195  24.961  1.00   42.64  ? 911  VAL A O   1 
ATOM   1086 C CB  . VAL A 1 159 ? 0.520   -6.757  23.335  1.00   35.91  ? 911  VAL A CB  1 
ATOM   1087 C CG1 . VAL A 1 159 ? 1.229   -6.315  22.077  1.00   51.96  ? 911  VAL A CG1 1 
ATOM   1088 C CG2 . VAL A 1 159 ? -0.971  -6.865  23.121  1.00   45.83  ? 911  VAL A CG2 1 
ATOM   1089 N N   . LEU A 1 160 ? 3.455   -8.608  23.327  1.00   34.92  ? 912  LEU A N   1 
ATOM   1090 C CA  . LEU A 1 160 ? 4.893   -8.529  23.422  1.00   34.70  ? 912  LEU A CA  1 
ATOM   1091 C C   . LEU A 1 160 ? 5.538   -8.228  22.140  1.00   28.89  ? 912  LEU A C   1 
ATOM   1092 O O   . LEU A 1 160 ? 4.982   -8.411  21.104  1.00   32.09  ? 912  LEU A O   1 
ATOM   1093 C CB  . LEU A 1 160 ? 5.498   -9.899  23.936  1.00   34.20  ? 912  LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 160 ? 5.177   -10.320 25.343  1.00   32.77  ? 912  LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 160 ? 5.966   -11.664 25.624  1.00   36.17  ? 912  LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 160 ? 5.357   -9.301  26.481  1.00   33.14  ? 912  LEU A CD2 1 
ATOM   1097 N N   . PRO A 1 161 ? 6.838   -7.812  22.156  1.00   24.08  ? 913  PRO A N   1 
ATOM   1098 C CA  . PRO A 1 161 ? 7.590   -7.681  20.985  1.00   27.54  ? 913  PRO A CA  1 
ATOM   1099 C C   . PRO A 1 161 ? 7.883   -9.093  20.356  1.00   34.73  ? 913  PRO A C   1 
ATOM   1100 O O   . PRO A 1 161 ? 8.343   -10.000 21.051  1.00   36.37  ? 913  PRO A O   1 
ATOM   1101 C CB  . PRO A 1 161 ? 8.926   -7.065  21.529  1.00   27.19  ? 913  PRO A CB  1 
ATOM   1102 C CG  . PRO A 1 161 ? 8.680   -6.646  22.779  1.00   19.77  ? 913  PRO A CG  1 
ATOM   1103 C CD  . PRO A 1 161 ? 7.536   -7.401  23.343  1.00   34.06  ? 913  PRO A CD  1 
ATOM   1104 N N   . ALA A 1 162 ? 7.697   -9.221  19.059  1.00   33.54  ? 914  ALA A N   1 
ATOM   1105 C CA  . ALA A 1 162 ? 7.948   -10.475 18.300  1.00   43.35  ? 914  ALA A CA  1 
ATOM   1106 C C   . ALA A 1 162 ? 9.328   -11.101 18.564  1.00   40.99  ? 914  ALA A C   1 
ATOM   1107 O O   . ALA A 1 162 ? 9.462   -12.326 18.669  1.00   42.39  ? 914  ALA A O   1 
ATOM   1108 C CB  . ALA A 1 162 ? 7.746   -10.219 16.786  1.00   36.85  ? 914  ALA A CB  1 
ATOM   1109 N N   . GLU A 1 163 ? 10.328  -10.256 18.699  1.00   41.07  ? 915  GLU A N   1 
ATOM   1110 C CA  . GLU A 1 163 ? 11.666  -10.679 19.099  1.00   38.63  ? 915  GLU A CA  1 
ATOM   1111 C C   . GLU A 1 163 ? 11.812  -11.220 20.556  1.00   45.83  ? 915  GLU A C   1 
ATOM   1112 O O   . GLU A 1 163 ? 12.855  -11.785 20.898  1.00   47.41  ? 915  GLU A O   1 
ATOM   1113 C CB  . GLU A 1 163 ? 12.638  -9.516  18.843  1.00   38.64  ? 915  GLU A CB  1 
ATOM   1114 C CG  . GLU A 1 163 ? 13.106  -9.434  17.359  1.00   39.22  ? 915  GLU A CG  1 
ATOM   1115 C CD  . GLU A 1 163 ? 14.192  -8.365  17.116  1.00   57.18  ? 915  GLU A CD  1 
ATOM   1116 O OE1 . GLU A 1 163 ? 15.343  -8.564  17.557  1.00   66.92  ? 915  GLU A OE1 1 
ATOM   1117 O OE2 . GLU A 1 163 ? 13.911  -7.343  16.447  1.00   63.95  ? 915  GLU A OE2 1 
ATOM   1118 N N   . ASN A 1 164 ? 10.771  -11.133 21.386  1.00   34.86  ? 916  ASN A N   1 
ATOM   1119 C CA  . ASN A 1 164 ? 10.799  -11.817 22.669  1.00   39.31  ? 916  ASN A CA  1 
ATOM   1120 C C   . ASN A 1 164 ? 10.012  -13.161 22.594  1.00   32.68  ? 916  ASN A C   1 
ATOM   1121 O O   . ASN A 1 164 ? 9.627   -13.689 23.595  1.00   36.49  ? 916  ASN A O   1 
ATOM   1122 C CB  . ASN A 1 164 ? 10.242  -10.961 23.756  1.00   33.39  ? 916  ASN A CB  1 
ATOM   1123 C CG  . ASN A 1 164 ? 11.195  -9.911  24.202  1.00   42.67  ? 916  ASN A CG  1 
ATOM   1124 O OD1 . ASN A 1 164 ? 10.907  -8.750  24.101  1.00   31.53  ? 916  ASN A OD1 1 
ATOM   1125 N ND2 . ASN A 1 164 ? 12.348  -10.308 24.660  1.00   23.20  ? 916  ASN A ND2 1 
ATOM   1126 N N   . LYS A 1 165 ? 9.742   -13.622 21.396  1.00   34.55  ? 917  LYS A N   1 
ATOM   1127 C CA  . LYS A 1 165 ? 8.976   -14.869 21.239  1.00   44.93  ? 917  LYS A CA  1 
ATOM   1128 C C   . LYS A 1 165 ? 9.684   -15.978 21.971  1.00   41.78  ? 917  LYS A C   1 
ATOM   1129 O O   . LYS A 1 165 ? 9.038   -16.764 22.632  1.00   49.78  ? 917  LYS A O   1 
ATOM   1130 C CB  . LYS A 1 165 ? 8.895   -15.299 19.819  1.00   43.00  ? 917  LYS A CB  1 
ATOM   1131 C CG  . LYS A 1 165 ? 7.598   -15.165 19.139  1.00   55.26  ? 917  LYS A CG  1 
ATOM   1132 C CD  . LYS A 1 165 ? 7.846   -15.446 17.645  1.00   43.46  ? 917  LYS A CD  1 
ATOM   1133 C CE  . LYS A 1 165 ? 6.512   -15.772 16.995  1.00   55.10  ? 917  LYS A CE  1 
ATOM   1134 N NZ  . LYS A 1 165 ? 6.540   -15.827 15.521  1.00   59.87  ? 917  LYS A NZ  1 
ATOM   1135 N N   . LYS A 1 166 ? 11.010  -16.018 21.854  1.00   46.80  ? 918  LYS A N   1 
ATOM   1136 C CA  . LYS A 1 166 ? 11.823  -17.117 22.421  1.00   51.91  ? 918  LYS A CA  1 
ATOM   1137 C C   . LYS A 1 166 ? 11.970  -17.094 23.928  1.00   51.40  ? 918  LYS A C   1 
ATOM   1138 O O   . LYS A 1 166 ? 12.163  -18.130 24.531  1.00   53.45  ? 918  LYS A O   1 
ATOM   1139 C CB  . LYS A 1 166 ? 13.239  -17.192 21.801  1.00   53.35  ? 918  LYS A CB  1 
ATOM   1140 C CG  . LYS A 1 166 ? 14.335  -16.251 22.371  1.00   64.81  ? 918  LYS A CG  1 
ATOM   1141 C CD  . LYS A 1 166 ? 15.720  -16.955 22.616  1.00   65.20  ? 918  LYS A CD  1 
ATOM   1142 C CE  . LYS A 1 166 ? 15.668  -17.958 23.831  1.00   60.18  ? 918  LYS A CE  1 
ATOM   1143 N NZ  . LYS A 1 166 ? 17.052  -18.242 24.353  1.00   53.11  ? 918  LYS A NZ  1 
ATOM   1144 N N   . ASP A 1 167 ? 11.934  -15.897 24.507  1.00   48.12  ? 919  ASP A N   1 
ATOM   1145 C CA  . ASP A 1 167 ? 11.861  -15.720 25.932  1.00   45.47  ? 919  ASP A CA  1 
ATOM   1146 C C   . ASP A 1 167 ? 10.538  -16.212 26.430  1.00   40.75  ? 919  ASP A C   1 
ATOM   1147 O O   . ASP A 1 167 ? 10.449  -16.601 27.601  1.00   36.04  ? 919  ASP A O   1 
ATOM   1148 C CB  . ASP A 1 167 ? 12.047  -14.235 26.363  1.00   43.41  ? 919  ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 167 ? 13.294  -13.629 25.791  1.00   50.20  ? 919  ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 167 ? 14.373  -14.289 25.829  1.00   52.91  ? 919  ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 167 ? 13.210  -12.548 25.202  1.00   49.13  ? 919  ASP A OD2 1 
ATOM   1152 N N   . PHE A 1 168 ? 9.496   -16.145 25.605  1.00   43.22  ? 920  PHE A N   1 
ATOM   1153 C CA  . PHE A 1 168 ? 8.172   -16.415 26.167  1.00   47.41  ? 920  PHE A CA  1 
ATOM   1154 C C   . PHE A 1 168 ? 7.899   -17.902 26.036  1.00   51.33  ? 920  PHE A C   1 
ATOM   1155 O O   . PHE A 1 168 ? 7.218   -18.500 26.865  1.00   54.39  ? 920  PHE A O   1 
ATOM   1156 C CB  . PHE A 1 168 ? 7.088   -15.621 25.460  1.00   47.82  ? 920  PHE A CB  1 
ATOM   1157 C CG  . PHE A 1 168 ? 5.689   -15.920 25.950  1.00   36.54  ? 920  PHE A CG  1 
ATOM   1158 C CD1 . PHE A 1 168 ? 5.219   -15.391 27.135  1.00   33.05  ? 920  PHE A CD1 1 
ATOM   1159 C CD2 . PHE A 1 168 ? 4.858   -16.763 25.209  1.00   45.76  ? 920  PHE A CD2 1 
ATOM   1160 C CE1 . PHE A 1 168 ? 3.907   -15.652 27.542  1.00   50.13  ? 920  PHE A CE1 1 
ATOM   1161 C CE2 . PHE A 1 168 ? 3.565   -17.053 25.619  1.00   46.19  ? 920  PHE A CE2 1 
ATOM   1162 C CZ  . PHE A 1 168 ? 3.086   -16.523 26.762  1.00   40.80  ? 920  PHE A CZ  1 
ATOM   1163 N N   . TYR A 1 169 ? 8.405   -18.489 24.962  1.00   48.66  ? 921  TYR A N   1 
ATOM   1164 C CA  . TYR A 1 169 ? 8.206   -19.944 24.713  1.00   49.85  ? 921  TYR A CA  1 
ATOM   1165 C C   . TYR A 1 169 ? 9.009   -20.802 25.725  1.00   51.71  ? 921  TYR A C   1 
ATOM   1166 O O   . TYR A 1 169 ? 8.542   -21.840 26.229  1.00   53.67  ? 921  TYR A O   1 
ATOM   1167 C CB  . TYR A 1 169 ? 8.573   -20.275 23.273  1.00   45.46  ? 921  TYR A CB  1 
ATOM   1168 C CG  . TYR A 1 169 ? 7.583   -19.779 22.223  1.00   41.94  ? 921  TYR A CG  1 
ATOM   1169 C CD1 . TYR A 1 169 ? 6.228   -19.755 22.454  1.00   42.19  ? 921  TYR A CD1 1 
ATOM   1170 C CD2 . TYR A 1 169 ? 8.041   -19.246 21.010  1.00   42.06  ? 921  TYR A CD2 1 
ATOM   1171 C CE1 . TYR A 1 169 ? 5.338   -19.269 21.503  1.00   41.89  ? 921  TYR A CE1 1 
ATOM   1172 C CE2 . TYR A 1 169 ? 7.165   -18.766 20.069  1.00   45.63  ? 921  TYR A CE2 1 
ATOM   1173 C CZ  . TYR A 1 169 ? 5.819   -18.775 20.326  1.00   46.89  ? 921  TYR A CZ  1 
ATOM   1174 O OH  . TYR A 1 169 ? 4.963   -18.275 19.365  1.00   55.52  ? 921  TYR A OH  1 
ATOM   1175 N N   . ASP A 1 170 ? 10.183  -20.316 26.088  1.00   55.35  ? 922  ASP A N   1 
ATOM   1176 C CA  . ASP A 1 170 ? 11.077  -21.043 27.023  1.00   52.88  ? 922  ASP A CA  1 
ATOM   1177 C C   . ASP A 1 170 ? 10.728  -20.795 28.509  1.00   58.31  ? 922  ASP A C   1 
ATOM   1178 O O   . ASP A 1 170 ? 11.592  -20.892 29.417  1.00   61.86  ? 922  ASP A O   1 
ATOM   1179 C CB  . ASP A 1 170 ? 12.556  -20.833 26.640  1.00   61.17  ? 922  ASP A CB  1 
ATOM   1180 C CG  . ASP A 1 170 ? 13.356  -19.952 27.627  1.00   65.93  ? 922  ASP A CG  1 
ATOM   1181 O OD1 . ASP A 1 170 ? 13.140  -18.713 27.723  1.00   71.44  ? 922  ASP A OD1 1 
ATOM   1182 O OD2 . ASP A 1 170 ? 14.258  -20.535 28.275  1.00   58.51  ? 922  ASP A OD2 1 
ATOM   1183 N N   . LEU A 1 171 ? 9.447   -20.529 28.747  1.00   50.69  ? 923  LEU A N   1 
ATOM   1184 C CA  . LEU A 1 171 ? 8.871   -20.479 30.102  1.00   55.39  ? 923  LEU A CA  1 
ATOM   1185 C C   . LEU A 1 171 ? 8.032   -21.706 30.439  1.00   57.67  ? 923  LEU A C   1 
ATOM   1186 O O   . LEU A 1 171 ? 7.301   -22.230 29.589  1.00   54.30  ? 923  LEU A O   1 
ATOM   1187 C CB  . LEU A 1 171 ? 7.888   -19.316 30.209  1.00   48.72  ? 923  LEU A CB  1 
ATOM   1188 C CG  . LEU A 1 171 ? 8.393   -17.882 30.012  1.00   40.48  ? 923  LEU A CG  1 
ATOM   1189 C CD1 . LEU A 1 171 ? 7.149   -16.954 29.879  1.00   33.56  ? 923  LEU A CD1 1 
ATOM   1190 C CD2 . LEU A 1 171 ? 9.391   -17.459 31.048  1.00   41.29  ? 923  LEU A CD2 1 
ATOM   1191 N N   . ALA A 1 172 ? 8.033   -22.081 31.711  1.00   61.15  ? 924  ALA A N   1 
ATOM   1192 C CA  . ALA A 1 172 ? 7.160   -23.136 32.174  1.00   60.36  ? 924  ALA A CA  1 
ATOM   1193 C C   . ALA A 1 172 ? 5.771   -22.869 31.674  1.00   63.25  ? 924  ALA A C   1 
ATOM   1194 O O   . ALA A 1 172 ? 5.276   -21.725 31.739  1.00   61.68  ? 924  ALA A O   1 
ATOM   1195 C CB  . ALA A 1 172 ? 7.149   -23.219 33.657  1.00   58.87  ? 924  ALA A CB  1 
ATOM   1196 N N   . ALA A 1 173 ? 5.116   -23.940 31.235  1.00   54.80  ? 925  ALA A N   1 
ATOM   1197 C CA  . ALA A 1 173 ? 3.869   -23.800 30.523  1.00   61.08  ? 925  ALA A CA  1 
ATOM   1198 C C   . ALA A 1 173 ? 2.737   -23.302 31.403  1.00   62.02  ? 925  ALA A C   1 
ATOM   1199 O O   . ALA A 1 173 ? 1.752   -22.773 30.894  1.00   62.18  ? 925  ALA A O   1 
ATOM   1200 C CB  . ALA A 1 173 ? 3.490   -25.094 29.876  1.00   60.77  ? 925  ALA A CB  1 
ATOM   1201 N N   . PHE A 1 174 ? 2.852   -23.503 32.707  1.00   60.62  ? 926  PHE A N   1 
ATOM   1202 C CA  . PHE A 1 174 ? 1.779   -23.100 33.629  1.00   64.39  ? 926  PHE A CA  1 
ATOM   1203 C C   . PHE A 1 174 ? 1.826   -21.602 33.967  1.00   64.20  ? 926  PHE A C   1 
ATOM   1204 O O   . PHE A 1 174 ? 0.832   -21.014 34.419  1.00   59.09  ? 926  PHE A O   1 
ATOM   1205 C CB  . PHE A 1 174 ? 1.822   -23.917 34.923  1.00   66.32  ? 926  PHE A CB  1 
ATOM   1206 C CG  . PHE A 1 174 ? 3.058   -23.684 35.741  1.00   71.98  ? 926  PHE A CG  1 
ATOM   1207 C CD1 . PHE A 1 174 ? 4.227   -24.378 35.459  1.00   74.17  ? 926  PHE A CD1 1 
ATOM   1208 C CD2 . PHE A 1 174 ? 3.052   -22.785 36.796  1.00   59.64  ? 926  PHE A CD2 1 
ATOM   1209 C CE1 . PHE A 1 174 ? 5.392   -24.158 36.205  1.00   68.03  ? 926  PHE A CE1 1 
ATOM   1210 C CE2 . PHE A 1 174 ? 4.220   -22.546 37.528  1.00   73.60  ? 926  PHE A CE2 1 
ATOM   1211 C CZ  . PHE A 1 174 ? 5.391   -23.239 37.226  1.00   67.34  ? 926  PHE A CZ  1 
ATOM   1212 N N   . ILE A 1 175 ? 3.003   -21.008 33.832  1.00   62.28  ? 927  ILE A N   1 
ATOM   1213 C CA  . ILE A 1 175 ? 3.125   -19.548 33.787  1.00   60.26  ? 927  ILE A CA  1 
ATOM   1214 C C   . ILE A 1 175 ? 2.354   -19.094 32.541  1.00   61.70  ? 927  ILE A C   1 
ATOM   1215 O O   . ILE A 1 175 ? 1.326   -18.385 32.578  1.00   53.29  ? 927  ILE A O   1 
ATOM   1216 C CB  . ILE A 1 175 ? 4.620   -19.156 33.609  1.00   61.71  ? 927  ILE A CB  1 
ATOM   1217 C CG1 . ILE A 1 175 ? 5.410   -19.468 34.892  1.00   57.45  ? 927  ILE A CG1 1 
ATOM   1218 C CG2 . ILE A 1 175 ? 4.750   -17.693 33.110  1.00   62.37  ? 927  ILE A CG2 1 
ATOM   1219 C CD1 . ILE A 1 175 ? 6.920   -19.391 34.723  1.00   56.26  ? 927  ILE A CD1 1 
ATOM   1220 N N   . THR A 1 176 ? 2.836   -19.590 31.414  1.00   61.29  ? 928  THR A N   1 
ATOM   1221 C CA  . THR A 1 176 ? 2.385   -19.130 30.133  1.00   64.11  ? 928  THR A CA  1 
ATOM   1222 C C   . THR A 1 176 ? 0.989   -19.599 29.842  1.00   62.70  ? 928  THR A C   1 
ATOM   1223 O O   . THR A 1 176 ? 0.319   -19.038 29.003  1.00   57.90  ? 928  THR A O   1 
ATOM   1224 C CB  . THR A 1 176 ? 3.374   -19.574 29.094  1.00   65.01  ? 928  THR A CB  1 
ATOM   1225 O OG1 . THR A 1 176 ? 4.472   -18.656 29.142  1.00   64.49  ? 928  THR A OG1 1 
ATOM   1226 C CG2 . THR A 1 176 ? 2.759   -19.592 27.719  1.00   74.54  ? 928  THR A CG2 1 
ATOM   1227 N N   . GLU A 1 177 ? 0.528   -20.599 30.585  1.00   68.62  ? 929  GLU A N   1 
ATOM   1228 C CA  . GLU A 1 177 ? -0.800  -21.169 30.374  1.00   69.18  ? 929  GLU A CA  1 
ATOM   1229 C C   . GLU A 1 177 ? -1.909  -20.131 30.724  1.00   66.75  ? 929  GLU A C   1 
ATOM   1230 O O   . GLU A 1 177 ? -1.766  -19.365 31.682  1.00   63.66  ? 929  GLU A O   1 
ATOM   1231 C CB  . GLU A 1 177 ? -0.903  -22.445 31.229  1.00   73.05  ? 929  GLU A CB  1 
ATOM   1232 C CG  . GLU A 1 177 ? -1.748  -23.561 30.655  1.00   78.62  ? 929  GLU A CG  1 
ATOM   1233 C CD  . GLU A 1 177 ? -3.094  -23.601 31.294  1.00   84.18  ? 929  GLU A CD  1 
ATOM   1234 O OE1 . GLU A 1 177 ? -3.173  -24.163 32.410  1.00   82.36  ? 929  GLU A OE1 1 
ATOM   1235 O OE2 . GLU A 1 177 ? -4.052  -23.052 30.692  1.00   89.21  ? 929  GLU A OE2 1 
ATOM   1236 N N   . GLY A 1 178 ? -2.967  -20.088 29.911  1.00   64.95  ? 930  GLY A N   1 
ATOM   1237 C CA  . GLY A 1 178 ? -4.146  -19.251 30.155  1.00   67.09  ? 930  GLY A CA  1 
ATOM   1238 C C   . GLY A 1 178 ? -4.108  -17.794 29.638  1.00   67.27  ? 930  GLY A C   1 
ATOM   1239 O O   . GLY A 1 178 ? -5.040  -17.010 29.873  1.00   67.45  ? 930  GLY A O   1 
ATOM   1240 N N   . LEU A 1 179 ? -3.026  -17.414 28.973  1.00   64.58  ? 931  LEU A N   1 
ATOM   1241 C CA  . LEU A 1 179 ? -2.894  -16.070 28.409  1.00   58.06  ? 931  LEU A CA  1 
ATOM   1242 C C   . LEU A 1 179 ? -3.092  -16.118 26.930  1.00   60.88  ? 931  LEU A C   1 
ATOM   1243 O O   . LEU A 1 179 ? -2.589  -17.008 26.279  1.00   63.08  ? 931  LEU A O   1 
ATOM   1244 C CB  . LEU A 1 179 ? -1.506  -15.553 28.635  1.00   56.13  ? 931  LEU A CB  1 
ATOM   1245 C CG  . LEU A 1 179 ? -1.238  -15.207 30.068  1.00   54.72  ? 931  LEU A CG  1 
ATOM   1246 C CD1 . LEU A 1 179 ? 0.271   -15.049 30.191  1.00   54.46  ? 931  LEU A CD1 1 
ATOM   1247 C CD2 . LEU A 1 179 ? -2.010  -13.928 30.415  1.00   48.54  ? 931  LEU A CD2 1 
ATOM   1248 N N   . GLU A 1 180 ? -3.784  -15.125 26.389  1.00   54.94  ? 932  GLU A N   1 
ATOM   1249 C CA  . GLU A 1 180 ? -3.849  -14.951 24.960  1.00   54.82  ? 932  GLU A CA  1 
ATOM   1250 C C   . GLU A 1 180 ? -2.679  -13.960 24.614  1.00   49.67  ? 932  GLU A C   1 
ATOM   1251 O O   . GLU A 1 180 ? -2.567  -12.894 25.191  1.00   52.86  ? 932  GLU A O   1 
ATOM   1252 C CB  . GLU A 1 180 ? -5.258  -14.401 24.610  1.00   48.22  ? 932  GLU A CB  1 
ATOM   1253 C CG  . GLU A 1 180 ? -5.543  -14.213 23.172  1.00   50.15  ? 932  GLU A CG  1 
ATOM   1254 C CD  . GLU A 1 180 ? -6.606  -13.156 22.878  1.00   45.70  ? 932  GLU A CD  1 
ATOM   1255 O OE1 . GLU A 1 180 ? -7.276  -12.675 23.778  1.00   55.96  ? 932  GLU A OE1 1 
ATOM   1256 O OE2 . GLU A 1 180 ? -6.773  -12.769 21.698  1.00   67.41  ? 932  GLU A OE2 1 
ATOM   1257 N N   . VAL A 1 181 ? -1.791  -14.345 23.704  1.00   55.00  ? 933  VAL A N   1 
ATOM   1258 C CA  . VAL A 1 181 ? -0.544  -13.636 23.475  1.00   50.57  ? 933  VAL A CA  1 
ATOM   1259 C C   . VAL A 1 181 ? -0.472  -13.205 22.057  1.00   51.65  ? 933  VAL A C   1 
ATOM   1260 O O   . VAL A 1 181 ? -0.729  -14.027 21.156  1.00   49.42  ? 933  VAL A O   1 
ATOM   1261 C CB  . VAL A 1 181 ? 0.666   -14.553 23.673  1.00   50.86  ? 933  VAL A CB  1 
ATOM   1262 C CG1 . VAL A 1 181 ? 1.857   -13.746 23.655  1.00   42.39  ? 933  VAL A CG1 1 
ATOM   1263 C CG2 . VAL A 1 181 ? 0.562   -15.278 25.025  1.00   53.06  ? 933  VAL A CG2 1 
ATOM   1264 N N   . HIS A 1 182 ? -0.132  -11.930 21.850  1.00   41.96  ? 934  HIS A N   1 
ATOM   1265 C CA  . HIS A 1 182 ? 0.144   -11.428 20.546  1.00   41.62  ? 934  HIS A CA  1 
ATOM   1266 C C   . HIS A 1 182 ? 1.507   -10.821 20.547  1.00   43.23  ? 934  HIS A C   1 
ATOM   1267 O O   . HIS A 1 182 ? 1.844   -9.986  21.410  1.00   47.68  ? 934  HIS A O   1 
ATOM   1268 C CB  . HIS A 1 182 ? -0.778  -10.298 20.106  1.00   45.35  ? 934  HIS A CB  1 
ATOM   1269 C CG  . HIS A 1 182 ? -2.222  -10.656 20.087  1.00   45.37  ? 934  HIS A CG  1 
ATOM   1270 N ND1 . HIS A 1 182 ? -2.970  -10.761 21.228  1.00   41.71  ? 934  HIS A ND1 1 
ATOM   1271 C CD2 . HIS A 1 182 ? -3.061  -10.902 19.062  1.00   40.76  ? 934  HIS A CD2 1 
ATOM   1272 C CE1 . HIS A 1 182 ? -4.227  -11.016 20.908  1.00   39.75  ? 934  HIS A CE1 1 
ATOM   1273 N NE2 . HIS A 1 182 ? -4.298  -11.137 19.606  1.00   46.34  ? 934  HIS A NE2 1 
ATOM   1274 N N   . PHE A 1 183 ? 2.273   -11.208 19.559  1.00   41.11  ? 935  PHE A N   1 
ATOM   1275 C CA  . PHE A 1 183 ? 3.623   -10.775 19.353  1.00   37.19  ? 935  PHE A CA  1 
ATOM   1276 C C   . PHE A 1 183 ? 3.644   -9.802  18.184  1.00   32.17  ? 935  PHE A C   1 
ATOM   1277 O O   . PHE A 1 183 ? 3.173   -10.107 17.151  1.00   48.83  ? 935  PHE A O   1 
ATOM   1278 C CB  . PHE A 1 183 ? 4.475   -11.967 19.019  1.00   36.74  ? 935  PHE A CB  1 
ATOM   1279 C CG  . PHE A 1 183 ? 4.688   -12.917 20.147  1.00   45.82  ? 935  PHE A CG  1 
ATOM   1280 C CD1 . PHE A 1 183 ? 5.535   -12.614 21.156  1.00   32.04  ? 935  PHE A CD1 1 
ATOM   1281 C CD2 . PHE A 1 183 ? 4.095   -14.147 20.164  1.00   50.47  ? 935  PHE A CD2 1 
ATOM   1282 C CE1 . PHE A 1 183 ? 5.751   -13.456 22.148  1.00   44.88  ? 935  PHE A CE1 1 
ATOM   1283 C CE2 . PHE A 1 183 ? 4.330   -14.993 21.188  1.00   47.71  ? 935  PHE A CE2 1 
ATOM   1284 C CZ  . PHE A 1 183 ? 5.155   -14.645 22.163  1.00   37.83  ? 935  PHE A CZ  1 
ATOM   1285 N N   . VAL A 1 184 ? 4.203   -8.633  18.365  1.00   41.49  ? 936  VAL A N   1 
ATOM   1286 C CA  . VAL A 1 184 ? 4.117   -7.549  17.432  1.00   34.38  ? 936  VAL A CA  1 
ATOM   1287 C C   . VAL A 1 184 ? 5.457   -7.020  16.954  1.00   33.69  ? 936  VAL A C   1 
ATOM   1288 O O   . VAL A 1 184 ? 6.411   -7.072  17.651  1.00   36.06  ? 936  VAL A O   1 
ATOM   1289 C CB  . VAL A 1 184 ? 3.333   -6.391  18.045  1.00   33.49  ? 936  VAL A CB  1 
ATOM   1290 C CG1 . VAL A 1 184 ? 1.946   -6.777  18.328  1.00   30.30  ? 936  VAL A CG1 1 
ATOM   1291 C CG2 . VAL A 1 184 ? 3.976   -5.926  19.316  1.00   27.11  ? 936  VAL A CG2 1 
ATOM   1292 N N   . GLU A 1 185 ? 5.500   -6.545  15.726  1.00   29.91  ? 937  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 185 ? 6.649   -5.887  15.144  1.00   39.86  ? 937  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 185 ? 6.472   -4.378  15.040  1.00   30.80  ? 937  GLU A C   1 
ATOM   1295 O O   . GLU A 1 185 ? 7.401   -3.701  15.013  1.00   33.91  ? 937  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 185 ? 6.905   -6.446  13.749  1.00   42.67  ? 937  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 185 ? 7.737   -7.701  13.656  1.00   43.98  ? 937  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 185 ? 7.288   -8.656  12.547  1.00   49.98  ? 937  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 185 ? 8.114   -9.181  11.842  1.00   52.54  ? 937  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 185 ? 6.103   -8.944  12.402  1.00   65.01  ? 937  GLU A OE2 1 
ATOM   1301 N N   . HIS A 1 186 ? 5.258   -3.881  14.953  1.00   31.49  ? 938  HIS A N   1 
ATOM   1302 C CA  . HIS A 1 186 ? 5.012   -2.456  14.830  1.00   35.17  ? 938  HIS A CA  1 
ATOM   1303 C C   . HIS A 1 186 ? 3.872   -1.952  15.656  1.00   34.77  ? 938  HIS A C   1 
ATOM   1304 O O   . HIS A 1 186 ? 3.002   -2.671  15.997  1.00   45.81  ? 938  HIS A O   1 
ATOM   1305 C CB  . HIS A 1 186 ? 4.796   -2.039  13.392  1.00   39.35  ? 938  HIS A CB  1 
ATOM   1306 C CG  . HIS A 1 186 ? 5.989   -2.221  12.537  1.00   43.84  ? 938  HIS A CG  1 
ATOM   1307 N ND1 . HIS A 1 186 ? 6.185   -3.333  11.768  1.00   45.49  ? 938  HIS A ND1 1 
ATOM   1308 C CD2 . HIS A 1 186 ? 7.077   -1.458  12.373  1.00   45.45  ? 938  HIS A CD2 1 
ATOM   1309 C CE1 . HIS A 1 186 ? 7.333   -3.237  11.146  1.00   43.13  ? 938  HIS A CE1 1 
ATOM   1310 N NE2 . HIS A 1 186 ? 7.901   -2.114  11.509  1.00   47.59  ? 938  HIS A NE2 1 
ATOM   1311 N N   . TYR A 1 187 ? 3.866   -0.655  15.879  1.00   39.12  ? 939  TYR A N   1 
ATOM   1312 C CA  . TYR A 1 187 ? 2.899   -0.137  16.796  1.00   33.92  ? 939  TYR A CA  1 
ATOM   1313 C C   . TYR A 1 187 ? 1.467   -0.381  16.317  1.00   27.46  ? 939  TYR A C   1 
ATOM   1314 O O   . TYR A 1 187 ? 0.592   -0.719  17.114  1.00   25.08  ? 939  TYR A O   1 
ATOM   1315 C CB  . TYR A 1 187 ? 3.106   1.336   17.063  1.00   27.42  ? 939  TYR A CB  1 
ATOM   1316 C CG  . TYR A 1 187 ? 2.118   1.700   18.088  1.00   32.68  ? 939  TYR A CG  1 
ATOM   1317 C CD1 . TYR A 1 187 ? 2.430   1.590   19.428  1.00   22.65  ? 939  TYR A CD1 1 
ATOM   1318 C CD2 . TYR A 1 187 ? 0.824   2.017   17.725  1.00   29.20  ? 939  TYR A CD2 1 
ATOM   1319 C CE1 . TYR A 1 187 ? 1.511   1.864   20.371  1.00   22.79  ? 939  TYR A CE1 1 
ATOM   1320 C CE2 . TYR A 1 187 ? -0.102  2.292   18.660  1.00   29.33  ? 939  TYR A CE2 1 
ATOM   1321 C CZ  . TYR A 1 187 ? 0.246   2.200   19.976  1.00   28.69  ? 939  TYR A CZ  1 
ATOM   1322 O OH  . TYR A 1 187 ? -0.694  2.494   20.936  1.00   34.95  ? 939  TYR A OH  1 
ATOM   1323 N N   . ARG A 1 188 ? 1.230   -0.210  15.020  1.00   33.35  ? 940  ARG A N   1 
ATOM   1324 C CA  . ARG A 1 188 ? -0.094  -0.376  14.481  1.00   30.68  ? 940  ARG A CA  1 
ATOM   1325 C C   . ARG A 1 188 ? -0.709  -1.716  14.899  1.00   35.14  ? 940  ARG A C   1 
ATOM   1326 O O   . ARG A 1 188 ? -1.861  -1.807  15.108  1.00   33.99  ? 940  ARG A O   1 
ATOM   1327 C CB  . ARG A 1 188 ? -0.061  -0.245  12.985  1.00   31.03  ? 940  ARG A CB  1 
ATOM   1328 C CG  . ARG A 1 188 ? -1.388  -0.494  12.300  1.00   41.92  ? 940  ARG A CG  1 
ATOM   1329 C CD  . ARG A 1 188 ? -2.258  0.706   12.278  1.00   42.34  ? 940  ARG A CD  1 
ATOM   1330 N NE  . ARG A 1 188 ? -3.636  0.372   12.508  1.00   45.79  ? 940  ARG A NE  1 
ATOM   1331 C CZ  . ARG A 1 188 ? -4.640  1.199   12.315  1.00   44.06  ? 940  ARG A CZ  1 
ATOM   1332 N NH1 . ARG A 1 188 ? -4.433  2.397   11.844  1.00   54.23  ? 940  ARG A NH1 1 
ATOM   1333 N NH2 . ARG A 1 188 ? -5.854  0.810   12.558  1.00   46.48  ? 940  ARG A NH2 1 
ATOM   1334 N N   . GLU A 1 189 ? 0.122   -2.744  15.021  1.00   33.97  ? 941  GLU A N   1 
ATOM   1335 C CA  . GLU A 1 189 ? -0.355  -4.046  15.471  1.00   36.46  ? 941  GLU A CA  1 
ATOM   1336 C C   . GLU A 1 189 ? -0.909  -3.922  16.884  1.00   38.61  ? 941  GLU A C   1 
ATOM   1337 O O   . GLU A 1 189 ? -1.926  -4.525  17.226  1.00   43.56  ? 941  GLU A O   1 
ATOM   1338 C CB  . GLU A 1 189 ? 0.776   -5.075  15.435  1.00   32.54  ? 941  GLU A CB  1 
ATOM   1339 C CG  . GLU A 1 189 ? 1.384   -5.281  14.057  1.00   41.77  ? 941  GLU A CG  1 
ATOM   1340 C CD  . GLU A 1 189 ? 2.504   -6.303  14.061  1.00   44.16  ? 941  GLU A CD  1 
ATOM   1341 O OE1 . GLU A 1 189 ? 3.090   -6.549  12.986  1.00   38.55  ? 941  GLU A OE1 1 
ATOM   1342 O OE2 . GLU A 1 189 ? 2.798   -6.860  15.140  1.00   51.84  ? 941  GLU A OE2 1 
ATOM   1343 N N   . ILE A 1 190 ? -0.223  -3.128  17.698  1.00   36.72  ? 942  ILE A N   1 
ATOM   1344 C CA  . ILE A 1 190 ? -0.543  -2.979  19.112  1.00   38.43  ? 942  ILE A CA  1 
ATOM   1345 C C   . ILE A 1 190 ? -1.741  -2.056  19.309  1.00   40.10  ? 942  ILE A C   1 
ATOM   1346 O O   . ILE A 1 190 ? -2.478  -2.179  20.287  1.00   44.58  ? 942  ILE A O   1 
ATOM   1347 C CB  . ILE A 1 190 ? 0.655   -2.426  19.907  1.00   30.83  ? 942  ILE A CB  1 
ATOM   1348 C CG1 . ILE A 1 190 ? 1.854   -3.370  19.789  1.00   33.23  ? 942  ILE A CG1 1 
ATOM   1349 C CG2 . ILE A 1 190 ? 0.276   -2.217  21.365  1.00   27.91  ? 942  ILE A CG2 1 
ATOM   1350 C CD1 . ILE A 1 190 ? 3.078   -2.897  20.542  1.00   33.85  ? 942  ILE A CD1 1 
ATOM   1351 N N   . PHE A 1 191 ? -1.928  -1.132  18.373  1.00   39.61  ? 943  PHE A N   1 
ATOM   1352 C CA  . PHE A 1 191 ? -3.208  -0.301  18.308  1.00   40.45  ? 943  PHE A CA  1 
ATOM   1353 C C   . PHE A 1 191 ? -4.426  -1.143  17.978  1.00   40.98  ? 943  PHE A C   1 
ATOM   1354 O O   . PHE A 1 191 ? -5.499  -1.019  18.622  1.00   44.32  ? 943  PHE A O   1 
ATOM   1355 C CB  . PHE A 1 191 ? -3.094  0.687   17.189  1.00   44.07  ? 943  PHE A CB  1 
ATOM   1356 C CG  . PHE A 1 191 ? -4.293  1.576   16.985  1.00   33.95  ? 943  PHE A CG  1 
ATOM   1357 C CD1 . PHE A 1 191 ? -5.199  1.367   15.893  1.00   39.56  ? 943  PHE A CD1 1 
ATOM   1358 C CD2 . PHE A 1 191 ? -4.461  2.678   17.778  1.00   37.78  ? 943  PHE A CD2 1 
ATOM   1359 C CE1 . PHE A 1 191 ? -6.241  2.279   15.699  1.00   36.92  ? 943  PHE A CE1 1 
ATOM   1360 C CE2 . PHE A 1 191 ? -5.481  3.478   17.606  1.00   36.53  ? 943  PHE A CE2 1 
ATOM   1361 C CZ  . PHE A 1 191 ? -6.384  3.286   16.587  1.00   44.07  ? 943  PHE A CZ  1 
ATOM   1362 N N   . ASP A 1 192 ? -4.278  -1.970  16.971  1.00   45.01  ? 944  ASP A N   1 
ATOM   1363 C CA  . ASP A 1 192 ? -5.366  -2.881  16.592  1.00   49.18  ? 944  ASP A CA  1 
ATOM   1364 C C   . ASP A 1 192 ? -5.798  -3.877  17.680  1.00   53.83  ? 944  ASP A C   1 
ATOM   1365 O O   . ASP A 1 192 ? -6.975  -4.237  17.736  1.00   53.76  ? 944  ASP A O   1 
ATOM   1366 C CB  . ASP A 1 192 ? -5.050  -3.560  15.282  1.00   53.89  ? 944  ASP A CB  1 
ATOM   1367 C CG  . ASP A 1 192 ? -5.194  -2.618  14.082  1.00   56.63  ? 944  ASP A CG  1 
ATOM   1368 O OD1 . ASP A 1 192 ? -6.018  -1.688  14.120  1.00   54.70  ? 944  ASP A OD1 1 
ATOM   1369 O OD2 . ASP A 1 192 ? -4.493  -2.812  13.089  1.00   42.08  ? 944  ASP A OD2 1 
ATOM   1370 N N   . ILE A 1 193 ? -4.898  -4.284  18.577  1.00   50.80  ? 945  ILE A N   1 
ATOM   1371 C CA  . ILE A 1 193 ? -5.290  -5.171  19.679  1.00   50.54  ? 945  ILE A CA  1 
ATOM   1372 C C   . ILE A 1 193 ? -5.932  -4.378  20.775  1.00   48.77  ? 945  ILE A C   1 
ATOM   1373 O O   . ILE A 1 193 ? -6.645  -4.960  21.556  1.00   47.66  ? 945  ILE A O   1 
ATOM   1374 C CB  . ILE A 1 193 ? -4.118  -5.952  20.289  1.00   39.92  ? 945  ILE A CB  1 
ATOM   1375 C CG1 . ILE A 1 193 ? -3.559  -6.909  19.255  1.00   49.46  ? 945  ILE A CG1 1 
ATOM   1376 C CG2 . ILE A 1 193 ? -4.548  -6.689  21.524  1.00   44.71  ? 945  ILE A CG2 1 
ATOM   1377 C CD1 . ILE A 1 193 ? -2.101  -7.002  19.267  1.00   41.66  ? 945  ILE A CD1 1 
ATOM   1378 N N   . ALA A 1 194 ? -5.642  -3.070  20.880  1.00   47.68  ? 946  ALA A N   1 
ATOM   1379 C CA  . ALA A 1 194 ? -6.122  -2.283  22.004  1.00   45.07  ? 946  ALA A CA  1 
ATOM   1380 C C   . ALA A 1 194 ? -7.437  -1.563  21.744  1.00   41.29  ? 946  ALA A C   1 
ATOM   1381 O O   . ALA A 1 194 ? -8.127  -1.230  22.692  1.00   43.80  ? 946  ALA A O   1 
ATOM   1382 C CB  . ALA A 1 194 ? -5.075  -1.237  22.446  1.00   41.59  ? 946  ALA A CB  1 
ATOM   1383 N N   . PHE A 1 195 ? -7.679  -1.258  20.477  1.00   47.25  ? 947  PHE A N   1 
ATOM   1384 C CA  . PHE A 1 195 ? -8.756  -0.394  20.037  1.00   49.96  ? 947  PHE A CA  1 
ATOM   1385 C C   . PHE A 1 195 ? -9.397  -1.045  18.886  1.00   50.91  ? 947  PHE A C   1 
ATOM   1386 O O   . PHE A 1 195 ? -9.259  -0.543  17.756  1.00   55.23  ? 947  PHE A O   1 
ATOM   1387 C CB  . PHE A 1 195 ? -8.172  0.954   19.574  1.00   49.12  ? 947  PHE A CB  1 
ATOM   1388 C CG  . PHE A 1 195 ? -7.469  1.679   20.652  1.00   48.74  ? 947  PHE A CG  1 
ATOM   1389 C CD1 . PHE A 1 195 ? -8.199  2.255   21.682  1.00   46.16  ? 947  PHE A CD1 1 
ATOM   1390 C CD2 . PHE A 1 195 ? -6.078  1.778   20.653  1.00   43.10  ? 947  PHE A CD2 1 
ATOM   1391 C CE1 . PHE A 1 195 ? -7.597  2.928   22.707  1.00   39.09  ? 947  PHE A CE1 1 
ATOM   1392 C CE2 . PHE A 1 195 ? -5.414  2.475   21.683  1.00   48.52  ? 947  PHE A CE2 1 
ATOM   1393 C CZ  . PHE A 1 195 ? -6.158  3.062   22.706  1.00   47.94  ? 947  PHE A CZ  1 
ATOM   1394 N N   . PRO A 1 196 ? -10.042 -2.222  19.117  1.00   55.45  ? 948  PRO A N   1 
ATOM   1395 C CA  . PRO A 1 196 ? -10.461 -3.057  17.991  1.00   59.33  ? 948  PRO A CA  1 
ATOM   1396 C C   . PRO A 1 196 ? -11.585 -2.447  17.174  1.00   54.08  ? 948  PRO A C   1 
ATOM   1397 O O   . PRO A 1 196 ? -11.636 -2.645  15.984  1.00   56.48  ? 948  PRO A O   1 
ATOM   1398 C CB  . PRO A 1 196 ? -10.885 -4.358  18.658  1.00   57.82  ? 948  PRO A CB  1 
ATOM   1399 C CG  . PRO A 1 196 ? -11.234 -4.008  19.969  1.00   62.26  ? 948  PRO A CG  1 
ATOM   1400 C CD  . PRO A 1 196 ? -10.387 -2.850  20.389  1.00   60.00  ? 948  PRO A CD  1 
ATOM   1401 N N   . ASP A 1 197 ? -12.430 -1.651  17.800  1.00   63.38  ? 949  ASP A N   1 
ATOM   1402 C CA  . ASP A 1 197 ? -13.498 -0.992  17.066  1.00   70.60  ? 949  ASP A CA  1 
ATOM   1403 C C   . ASP A 1 197 ? -13.086 0.382   16.564  1.00   71.97  ? 949  ASP A C   1 
ATOM   1404 O O   . ASP A 1 197 ? -13.938 1.231   16.299  1.00   72.44  ? 949  ASP A O   1 
ATOM   1405 C CB  . ASP A 1 197 ? -14.763 -0.934  17.919  1.00   72.55  ? 949  ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 197 ? -15.197 -2.315  18.402  1.00   72.03  ? 949  ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 197 ? -15.543 -2.418  19.599  1.00   56.37  ? 949  ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 197 ? -15.190 -3.290  17.590  1.00   74.58  ? 949  ASP A OD2 1 
ATOM   1409 N N   . GLU A 1 198 ? -11.772 0.588   16.429  1.00   72.89  ? 950  GLU A N   1 
ATOM   1410 C CA  . GLU A 1 198 ? -11.233 1.697   15.640  1.00   70.63  ? 950  GLU A CA  1 
ATOM   1411 C C   . GLU A 1 198 ? -10.843 1.171   14.285  1.00   67.81  ? 950  GLU A C   1 
ATOM   1412 O O   . GLU A 1 198 ? -10.633 -0.035  14.087  1.00   72.01  ? 950  GLU A O   1 
ATOM   1413 C CB  . GLU A 1 198 ? -10.015 2.368   16.293  1.00   67.50  ? 950  GLU A CB  1 
ATOM   1414 C CG  . GLU A 1 198 ? -10.338 3.295   17.424  1.00   67.64  ? 950  GLU A CG  1 
ATOM   1415 C CD  . GLU A 1 198 ? -11.053 4.555   16.982  1.00   63.38  ? 950  GLU A CD  1 
ATOM   1416 O OE1 . GLU A 1 198 ? -10.711 5.104   15.913  1.00   60.23  ? 950  GLU A OE1 1 
ATOM   1417 O OE2 . GLU A 1 198 ? -11.968 4.992   17.713  1.00   69.22  ? 950  GLU A OE2 1 
ATOM   1418 N N   . GLN A 1 199 ? -10.685 2.110   13.366  1.00   65.48  ? 951  GLN A N   1 
ATOM   1419 C CA  . GLN A 1 199 ? -10.681 1.785   11.975  1.00   63.22  ? 951  GLN A CA  1 
ATOM   1420 C C   . GLN A 1 199 ? -9.373  1.229   11.521  1.00   61.55  ? 951  GLN A C   1 
ATOM   1421 O O   . GLN A 1 199 ? -8.343  1.862   11.734  1.00   66.27  ? 951  GLN A O   1 
ATOM   1422 C CB  . GLN A 1 199 ? -10.972 3.010   11.133  1.00   65.00  ? 951  GLN A CB  1 
ATOM   1423 C CG  . GLN A 1 199 ? -10.788 2.688   9.674   1.00   68.27  ? 951  GLN A CG  1 
ATOM   1424 C CD  . GLN A 1 199 ? -11.376 3.693   8.752   1.00   69.35  ? 951  GLN A CD  1 
ATOM   1425 O OE1 . GLN A 1 199 ? -11.658 4.827   9.140   1.00   77.16  ? 951  GLN A OE1 1 
ATOM   1426 N NE2 . GLN A 1 199 ? -11.563 3.283   7.500   1.00   50.30  ? 951  GLN A NE2 1 
ATOM   1427 N N   . ALA A 1 200 ? -9.438  0.133   10.768  1.00   58.82  ? 952  ALA A N   1 
ATOM   1428 C CA  . ALA A 1 200 ? -8.262  -0.645  10.377  1.00   62.18  ? 952  ALA A CA  1 
ATOM   1429 C C   . ALA A 1 200 ? -7.344  0.119   9.423   1.00   63.80  ? 952  ALA A C   1 
ATOM   1430 O O   . ALA A 1 200 ? -7.817  1.004   8.719   1.00   69.75  ? 952  ALA A O   1 
ATOM   1431 C CB  . ALA A 1 200 ? -8.712  -1.993  9.753   1.00   54.44  ? 952  ALA A CB  1 
ATOM   1432 N N   . GLU A 1 201 ? -6.036  -0.178  9.486   1.00   65.96  ? 953  GLU A N   1 
ATOM   1433 C CA  . GLU A 1 201 ? -5.016  0.205   8.472   1.00   64.29  ? 953  GLU A CA  1 
ATOM   1434 C C   . GLU A 1 201 ? -3.552  -0.079  8.870   1.00   68.13  ? 953  GLU A C   1 
ATOM   1435 O O   . GLU A 1 201 ? -2.709  -0.532  8.064   1.00   62.53  ? 953  GLU A O   1 
ATOM   1436 C CB  . GLU A 1 201 ? -5.159  1.648   7.977   1.00   70.08  ? 953  GLU A CB  1 
ATOM   1437 C CG  . GLU A 1 201 ? -5.806  1.753   6.585   1.00   67.09  ? 953  GLU A CG  1 
ATOM   1438 C CD  . GLU A 1 201 ? -4.857  1.487   5.432   1.00   75.63  ? 953  GLU A CD  1 
ATOM   1439 O OE1 . GLU A 1 201 ? -5.034  2.119   4.353   1.00   72.46  ? 953  GLU A OE1 1 
ATOM   1440 O OE2 . GLU A 1 201 ? -3.959  0.633   5.577   1.00   63.82  ? 953  GLU A OE2 1 
ATOM   1441 N N   . MET B 1 4   ? -3.546  23.360  64.820  1.00   63.43  ? 756  MET B N   1 
ATOM   1442 C CA  . MET B 1 4   ? -3.186  24.774  64.538  1.00   63.92  ? 756  MET B CA  1 
ATOM   1443 C C   . MET B 1 4   ? -4.401  25.577  64.060  1.00   61.45  ? 756  MET B C   1 
ATOM   1444 O O   . MET B 1 4   ? -4.260  26.768  63.821  1.00   67.20  ? 756  MET B O   1 
ATOM   1445 C CB  . MET B 1 4   ? -2.039  24.837  63.519  1.00   66.36  ? 756  MET B CB  1 
ATOM   1446 C CG  . MET B 1 4   ? -1.667  26.233  63.000  1.00   69.22  ? 756  MET B CG  1 
ATOM   1447 S SD  . MET B 1 4   ? -0.015  26.239  62.287  1.00   66.12  ? 756  MET B SD  1 
ATOM   1448 C CE  . MET B 1 4   ? -0.053  27.524  61.016  1.00   70.05  ? 756  MET B CE  1 
ATOM   1449 N N   . TYR B 1 5   ? -5.576  24.950  63.917  1.00   64.05  ? 757  TYR B N   1 
ATOM   1450 C CA  . TYR B 1 5   ? -6.861  25.688  63.655  1.00   66.18  ? 757  TYR B CA  1 
ATOM   1451 C C   . TYR B 1 5   ? -8.042  25.083  64.411  1.00   66.78  ? 757  TYR B C   1 
ATOM   1452 O O   . TYR B 1 5   ? -7.993  23.897  64.739  1.00   72.61  ? 757  TYR B O   1 
ATOM   1453 C CB  . TYR B 1 5   ? -7.232  25.683  62.152  1.00   68.39  ? 757  TYR B CB  1 
ATOM   1454 C CG  . TYR B 1 5   ? -6.240  26.371  61.230  1.00   67.28  ? 757  TYR B CG  1 
ATOM   1455 C CD1 . TYR B 1 5   ? -5.077  25.733  60.850  1.00   66.19  ? 757  TYR B CD1 1 
ATOM   1456 C CD2 . TYR B 1 5   ? -6.483  27.640  60.724  1.00   75.87  ? 757  TYR B CD2 1 
ATOM   1457 C CE1 . TYR B 1 5   ? -4.170  26.319  60.005  1.00   69.70  ? 757  TYR B CE1 1 
ATOM   1458 C CE2 . TYR B 1 5   ? -5.574  28.254  59.877  1.00   73.44  ? 757  TYR B CE2 1 
ATOM   1459 C CZ  . TYR B 1 5   ? -4.409  27.578  59.523  1.00   73.99  ? 757  TYR B CZ  1 
ATOM   1460 O OH  . TYR B 1 5   ? -3.477  28.127  58.672  1.00   62.05  ? 757  TYR B OH  1 
ATOM   1461 N N   . ASP B 1 6   ? -9.082  25.903  64.673  1.00   68.17  ? 758  ASP B N   1 
ATOM   1462 C CA  . ASP B 1 6   ? -10.431 25.486  65.212  1.00   74.43  ? 758  ASP B CA  1 
ATOM   1463 C C   . ASP B 1 6   ? -11.523 25.516  64.120  1.00   74.41  ? 758  ASP B C   1 
ATOM   1464 O O   . ASP B 1 6   ? -12.367 24.607  64.046  1.00   80.77  ? 758  ASP B O   1 
ATOM   1465 C CB  . ASP B 1 6   ? -10.904 26.391  66.401  1.00   75.09  ? 758  ASP B CB  1 
ATOM   1466 C CG  . ASP B 1 6   ? -12.299 25.961  67.004  1.00   76.64  ? 758  ASP B CG  1 
ATOM   1467 O OD1 . ASP B 1 6   ? -13.138 26.838  67.305  1.00   80.45  ? 758  ASP B OD1 1 
ATOM   1468 O OD2 . ASP B 1 6   ? -12.561 24.752  67.193  1.00   70.49  ? 758  ASP B OD2 1 
ATOM   1469 N N   . VAL B 1 7   ? -11.514 26.586  63.317  1.00   72.81  ? 759  VAL B N   1 
ATOM   1470 C CA  . VAL B 1 7   ? -12.365 26.731  62.141  1.00   71.49  ? 759  VAL B CA  1 
ATOM   1471 C C   . VAL B 1 7   ? -11.467 27.128  60.965  1.00   67.34  ? 759  VAL B C   1 
ATOM   1472 O O   . VAL B 1 7   ? -10.875 28.216  60.922  1.00   65.38  ? 759  VAL B O   1 
ATOM   1473 C CB  . VAL B 1 7   ? -13.511 27.753  62.359  1.00   76.38  ? 759  VAL B CB  1 
ATOM   1474 C CG1 . VAL B 1 7   ? -12.975 29.202  62.345  1.00   77.96  ? 759  VAL B CG1 1 
ATOM   1475 C CG2 . VAL B 1 7   ? -14.612 27.562  61.308  1.00   63.28  ? 759  VAL B CG2 1 
ATOM   1476 N N   . THR B 1 8   ? -11.359 26.211  60.025  1.00   59.25  ? 760  THR B N   1 
ATOM   1477 C CA  . THR B 1 8   ? -10.469 26.353  58.896  1.00   60.45  ? 760  THR B CA  1 
ATOM   1478 C C   . THR B 1 8   ? -10.856 27.391  57.903  1.00   55.58  ? 760  THR B C   1 
ATOM   1479 O O   . THR B 1 8   ? -11.936 27.399  57.397  1.00   53.80  ? 760  THR B O   1 
ATOM   1480 C CB  . THR B 1 8   ? -10.331 25.007  58.075  1.00   62.04  ? 760  THR B CB  1 
ATOM   1481 O OG1 . THR B 1 8   ? -11.613 24.513  57.716  1.00   52.76  ? 760  THR B OG1 1 
ATOM   1482 C CG2 . THR B 1 8   ? -9.647  23.949  58.837  1.00   54.19  ? 760  THR B CG2 1 
ATOM   1483 N N   . PRO B 1 9   ? -9.906  28.201  57.540  1.00   52.47  ? 761  PRO B N   1 
ATOM   1484 C CA  . PRO B 1 9   ? -10.103 29.147  56.480  1.00   51.41  ? 761  PRO B CA  1 
ATOM   1485 C C   . PRO B 1 9   ? -10.039 28.399  55.155  1.00   57.28  ? 761  PRO B C   1 
ATOM   1486 O O   . PRO B 1 9   ? -9.796  27.199  55.089  1.00   46.30  ? 761  PRO B O   1 
ATOM   1487 C CB  . PRO B 1 9   ? -8.895  30.046  56.612  1.00   54.24  ? 761  PRO B CB  1 
ATOM   1488 C CG  . PRO B 1 9   ? -7.902  29.246  57.160  1.00   56.38  ? 761  PRO B CG  1 
ATOM   1489 C CD  . PRO B 1 9   ? -8.541  28.260  58.045  1.00   46.88  ? 761  PRO B CD  1 
ATOM   1490 N N   . PRO B 1 10  ? -10.305 29.119  54.087  1.00   51.82  ? 762  PRO B N   1 
ATOM   1491 C CA  . PRO B 1 10  ? -10.196 28.554  52.758  1.00   56.34  ? 762  PRO B CA  1 
ATOM   1492 C C   . PRO B 1 10  ? -8.777  28.156  52.565  1.00   58.81  ? 762  PRO B C   1 
ATOM   1493 O O   . PRO B 1 10  ? -7.902  28.859  53.033  1.00   56.84  ? 762  PRO B O   1 
ATOM   1494 C CB  . PRO B 1 10  ? -10.455 29.736  51.866  1.00   56.26  ? 762  PRO B CB  1 
ATOM   1495 C CG  . PRO B 1 10  ? -11.213 30.671  52.677  1.00   61.61  ? 762  PRO B CG  1 
ATOM   1496 C CD  . PRO B 1 10  ? -10.802 30.494  54.066  1.00   55.51  ? 762  PRO B CD  1 
ATOM   1497 N N   . GLY B 1 11  ? -8.577  27.032  51.883  1.00   64.78  ? 763  GLY B N   1 
ATOM   1498 C CA  . GLY B 1 11  ? -7.278  26.421  51.570  1.00   57.77  ? 763  GLY B CA  1 
ATOM   1499 C C   . GLY B 1 11  ? -6.548  25.738  52.711  1.00   51.63  ? 763  GLY B C   1 
ATOM   1500 O O   . GLY B 1 11  ? -5.354  25.585  52.632  1.00   49.73  ? 763  GLY B O   1 
ATOM   1501 N N   . VAL B 1 12  ? -7.263  25.351  53.776  1.00   56.92  ? 764  VAL B N   1 
ATOM   1502 C CA  . VAL B 1 12  ? -6.651  24.636  54.936  1.00   52.15  ? 764  VAL B CA  1 
ATOM   1503 C C   . VAL B 1 12  ? -7.436  23.363  55.173  1.00   56.40  ? 764  VAL B C   1 
ATOM   1504 O O   . VAL B 1 12  ? -8.631  23.428  55.336  1.00   63.41  ? 764  VAL B O   1 
ATOM   1505 C CB  . VAL B 1 12  ? -6.645  25.527  56.188  1.00   57.27  ? 764  VAL B CB  1 
ATOM   1506 C CG1 . VAL B 1 12  ? -6.542  24.662  57.533  1.00   45.93  ? 764  VAL B CG1 1 
ATOM   1507 C CG2 . VAL B 1 12  ? -5.513  26.651  56.020  1.00   50.05  ? 764  VAL B CG2 1 
ATOM   1508 N N   . VAL B 1 13  ? -6.795  22.194  55.157  1.00   55.92  ? 765  VAL B N   1 
ATOM   1509 C CA  . VAL B 1 13  ? -7.530  20.912  55.362  1.00   45.23  ? 765  VAL B CA  1 
ATOM   1510 C C   . VAL B 1 13  ? -6.721  20.152  56.385  1.00   44.12  ? 765  VAL B C   1 
ATOM   1511 O O   . VAL B 1 13  ? -5.490  20.145  56.326  1.00   45.53  ? 765  VAL B O   1 
ATOM   1512 C CB  . VAL B 1 13  ? -7.706  20.116  54.025  1.00   49.34  ? 765  VAL B CB  1 
ATOM   1513 C CG1 . VAL B 1 13  ? -8.584  18.785  54.174  1.00   41.41  ? 765  VAL B CG1 1 
ATOM   1514 C CG2 . VAL B 1 13  ? -8.339  20.998  52.859  1.00   41.44  ? 765  VAL B CG2 1 
ATOM   1515 N N   . MET B 1 14  ? -7.409  19.588  57.372  1.00   38.24  ? 766  MET B N   1 
ATOM   1516 C CA  . MET B 1 14  ? -6.820  18.723  58.331  1.00   47.42  ? 766  MET B CA  1 
ATOM   1517 C C   . MET B 1 14  ? -6.600  17.368  57.654  1.00   49.06  ? 766  MET B C   1 
ATOM   1518 O O   . MET B 1 14  ? -7.547  16.631  57.269  1.00   47.37  ? 766  MET B O   1 
ATOM   1519 C CB  . MET B 1 14  ? -7.726  18.537  59.566  1.00   48.58  ? 766  MET B CB  1 
ATOM   1520 C CG  . MET B 1 14  ? -6.993  17.993  60.814  1.00   47.02  ? 766  MET B CG  1 
ATOM   1521 S SD  . MET B 1 14  ? -8.044  17.460  62.221  1.00   52.49  ? 766  MET B SD  1 
ATOM   1522 C CE  . MET B 1 14  ? -9.740  17.585  61.546  1.00   40.62  ? 766  MET B CE  1 
ATOM   1523 N N   . GLY B 1 15  ? -5.331  17.043  57.525  1.00   48.53  ? 767  GLY B N   1 
ATOM   1524 C CA  . GLY B 1 15  ? -4.927  15.694  57.116  1.00   52.11  ? 767  GLY B CA  1 
ATOM   1525 C C   . GLY B 1 15  ? -4.363  15.015  58.321  1.00   54.40  ? 767  GLY B C   1 
ATOM   1526 O O   . GLY B 1 15  ? -4.236  15.633  59.394  1.00   55.45  ? 767  GLY B O   1 
ATOM   1527 N N   . LEU B 1 16  ? -4.029  13.736  58.191  1.00   50.78  ? 768  LEU B N   1 
ATOM   1528 C CA  . LEU B 1 16  ? -3.617  13.010  59.362  1.00   47.31  ? 768  LEU B CA  1 
ATOM   1529 C C   . LEU B 1 16  ? -2.341  12.437  58.987  1.00   51.24  ? 768  LEU B C   1 
ATOM   1530 O O   . LEU B 1 16  ? -2.230  11.947  57.862  1.00   53.31  ? 768  LEU B O   1 
ATOM   1531 C CB  . LEU B 1 16  ? -4.548  11.848  59.672  1.00   48.36  ? 768  LEU B CB  1 
ATOM   1532 C CG  . LEU B 1 16  ? -5.993  12.111  59.951  1.00   35.84  ? 768  LEU B CG  1 
ATOM   1533 C CD1 . LEU B 1 16  ? -6.150  12.796  61.377  1.00   37.74  ? 768  LEU B CD1 1 
ATOM   1534 C CD2 . LEU B 1 16  ? -6.699  12.903  58.875  1.00   56.75  ? 768  LEU B CD2 1 
ATOM   1535 N N   . ALA B 1 17  ? -1.396  12.461  59.911  1.00   46.06  ? 769  ALA B N   1 
ATOM   1536 C CA  . ALA B 1 17  ? -0.027  12.126  59.573  1.00   52.53  ? 769  ALA B CA  1 
ATOM   1537 C C   . ALA B 1 17  ? 0.523   11.027  60.443  1.00   54.19  ? 769  ALA B C   1 
ATOM   1538 O O   . ALA B 1 17  ? 0.144   10.886  61.630  1.00   57.38  ? 769  ALA B O   1 
ATOM   1539 C CB  . ALA B 1 17  ? 0.824   13.317  59.704  1.00   46.38  ? 769  ALA B CB  1 
ATOM   1540 N N   . TRP B 1 18  ? 1.456   10.266  59.886  1.00   54.24  ? 770  TRP B N   1 
ATOM   1541 C CA  . TRP B 1 18  ? 2.075   9.192   60.661  1.00   57.29  ? 770  TRP B CA  1 
ATOM   1542 C C   . TRP B 1 18  ? 3.490   9.620   61.013  1.00   61.81  ? 770  TRP B C   1 
ATOM   1543 O O   . TRP B 1 18  ? 4.323   9.632   60.131  1.00   63.30  ? 770  TRP B O   1 
ATOM   1544 C CB  . TRP B 1 18  ? 2.045   7.913   59.854  1.00   55.30  ? 770  TRP B CB  1 
ATOM   1545 C CG  . TRP B 1 18  ? 2.582   6.718   60.552  1.00   64.20  ? 770  TRP B CG  1 
ATOM   1546 C CD1 . TRP B 1 18  ? 2.788   6.552   61.899  1.00   60.75  ? 770  TRP B CD1 1 
ATOM   1547 C CD2 . TRP B 1 18  ? 2.935   5.480   59.937  1.00   64.52  ? 770  TRP B CD2 1 
ATOM   1548 N NE1 . TRP B 1 18  ? 3.252   5.277   62.146  1.00   62.11  ? 770  TRP B NE1 1 
ATOM   1549 C CE2 . TRP B 1 18  ? 3.337   4.599   60.964  1.00   63.35  ? 770  TRP B CE2 1 
ATOM   1550 C CE3 . TRP B 1 18  ? 2.920   5.019   58.615  1.00   65.91  ? 770  TRP B CE3 1 
ATOM   1551 C CZ2 . TRP B 1 18  ? 3.759   3.297   60.707  1.00   72.03  ? 770  TRP B CZ2 1 
ATOM   1552 C CZ3 . TRP B 1 18  ? 3.340   3.724   58.362  1.00   76.76  ? 770  TRP B CZ3 1 
ATOM   1553 C CH2 . TRP B 1 18  ? 3.760   2.881   59.401  1.00   70.05  ? 770  TRP B CH2 1 
ATOM   1554 N N   . THR B 1 19  ? 3.754   10.005  62.280  1.00   64.46  ? 771  THR B N   1 
ATOM   1555 C CA  . THR B 1 19  ? 5.081   10.482  62.679  1.00   68.86  ? 771  THR B CA  1 
ATOM   1556 C C   . THR B 1 19  ? 5.969   9.409   63.359  1.00   74.83  ? 771  THR B C   1 
ATOM   1557 O O   . THR B 1 19  ? 5.576   8.243   63.529  1.00   71.49  ? 771  THR B O   1 
ATOM   1558 C CB  . THR B 1 19  ? 4.989   11.781  63.512  1.00   70.68  ? 771  THR B CB  1 
ATOM   1559 O OG1 . THR B 1 19  ? 4.409   11.513  64.793  1.00   63.83  ? 771  THR B OG1 1 
ATOM   1560 C CG2 . THR B 1 19  ? 4.145   12.820  62.748  1.00   65.98  ? 771  THR B CG2 1 
ATOM   1561 N N   . ALA B 1 20  ? 7.198   9.808   63.683  1.00   78.84  ? 772  ALA B N   1 
ATOM   1562 C CA  . ALA B 1 20  ? 8.194   8.891   64.253  1.00   81.77  ? 772  ALA B CA  1 
ATOM   1563 C C   . ALA B 1 20  ? 7.846   8.463   65.683  1.00   83.01  ? 772  ALA B C   1 
ATOM   1564 O O   . ALA B 1 20  ? 8.167   7.326   66.088  1.00   86.33  ? 772  ALA B O   1 
ATOM   1565 C CB  . ALA B 1 20  ? 9.602   9.516   64.198  1.00   80.80  ? 772  ALA B CB  1 
ATOM   1566 N N   . MET B 1 21  ? 7.190   9.345   66.446  1.00   81.93  ? 773  MET B N   1 
ATOM   1567 C CA  . MET B 1 21  ? 6.711   8.970   67.805  1.00   82.84  ? 773  MET B CA  1 
ATOM   1568 C C   . MET B 1 21  ? 5.248   8.448   67.794  1.00   80.96  ? 773  MET B C   1 
ATOM   1569 O O   . MET B 1 21  ? 4.917   7.464   68.490  1.00   83.73  ? 773  MET B O   1 
ATOM   1570 C CB  . MET B 1 21  ? 6.926   10.112  68.821  1.00   81.81  ? 773  MET B CB  1 
ATOM   1571 C CG  . MET B 1 21  ? 8.432   10.546  69.023  1.00   85.45  ? 773  MET B CG  1 
ATOM   1572 S SD  . MET B 1 21  ? 9.722   9.235   69.006  1.00   85.09  ? 773  MET B SD  1 
ATOM   1573 C CE  . MET B 1 21  ? 11.198  10.235  69.242  1.00   83.15  ? 773  MET B CE  1 
ATOM   1574 N N   . GLY B 1 22  ? 4.398   9.060   66.971  1.00   75.51  ? 774  GLY B N   1 
ATOM   1575 C CA  . GLY B 1 22  ? 3.006   8.618   66.849  1.00   71.95  ? 774  GLY B CA  1 
ATOM   1576 C C   . GLY B 1 22  ? 2.207   9.365   65.783  1.00   67.02  ? 774  GLY B C   1 
ATOM   1577 O O   . GLY B 1 22  ? 2.765   9.824   64.767  1.00   70.76  ? 774  GLY B O   1 
ATOM   1578 N N   . GLY B 1 23  ? 0.895   9.473   66.006  1.00   57.46  ? 775  GLY B N   1 
ATOM   1579 C CA  . GLY B 1 23  ? 0.005   10.093  65.041  1.00   56.32  ? 775  GLY B CA  1 
ATOM   1580 C C   . GLY B 1 23  ? -0.205  11.563  65.299  1.00   58.68  ? 775  GLY B C   1 
ATOM   1581 O O   . GLY B 1 23  ? -0.318  11.986  66.463  1.00   58.73  ? 775  GLY B O   1 
ATOM   1582 N N   . SER B 1 24  ? -0.298  12.353  64.226  1.00   56.28  ? 776  SER B N   1 
ATOM   1583 C CA  . SER B 1 24  ? -0.569  13.777  64.377  1.00   53.82  ? 776  SER B CA  1 
ATOM   1584 C C   . SER B 1 24  ? -1.689  14.213  63.477  1.00   53.19  ? 776  SER B C   1 
ATOM   1585 O O   . SER B 1 24  ? -2.063  13.525  62.572  1.00   47.02  ? 776  SER B O   1 
ATOM   1586 C CB  . SER B 1 24  ? 0.673   14.644  64.074  1.00   49.15  ? 776  SER B CB  1 
ATOM   1587 O OG  . SER B 1 24  ? 1.490   14.858  65.242  1.00   51.87  ? 776  SER B OG  1 
ATOM   1588 N N   . THR B 1 25  ? -2.171  15.407  63.737  1.00   52.20  ? 777  THR B N   1 
ATOM   1589 C CA  . THR B 1 25  ? -3.131  16.053  62.916  1.00   53.50  ? 777  THR B CA  1 
ATOM   1590 C C   . THR B 1 25  ? -2.383  17.295  62.376  1.00   60.27  ? 777  THR B C   1 
ATOM   1591 O O   . THR B 1 25  ? -2.037  18.226  63.135  1.00   62.74  ? 777  THR B O   1 
ATOM   1592 C CB  . THR B 1 25  ? -4.327  16.397  63.796  1.00   58.75  ? 777  THR B CB  1 
ATOM   1593 O OG1 . THR B 1 25  ? -5.523  16.518  63.002  1.00   69.58  ? 777  THR B OG1 1 
ATOM   1594 C CG2 . THR B 1 25  ? -4.038  17.642  64.673  1.00   58.19  ? 777  THR B CG2 1 
ATOM   1595 N N   . LEU B 1 26  ? -2.117  17.260  61.071  1.00   57.48  ? 778  LEU B N   1 
ATOM   1596 C CA  . LEU B 1 26  ? -1.402  18.292  60.340  1.00   58.60  ? 778  LEU B CA  1 
ATOM   1597 C C   . LEU B 1 26  ? -2.299  18.986  59.312  1.00   56.34  ? 778  LEU B C   1 
ATOM   1598 O O   . LEU B 1 26  ? -2.978  18.359  58.457  1.00   56.86  ? 778  LEU B O   1 
ATOM   1599 C CB  . LEU B 1 26  ? -0.165  17.731  59.637  1.00   51.60  ? 778  LEU B CB  1 
ATOM   1600 C CG  . LEU B 1 26  ? -0.258  16.617  58.621  1.00   59.77  ? 778  LEU B CG  1 
ATOM   1601 C CD1 . LEU B 1 26  ? -0.796  17.123  57.222  1.00   53.82  ? 778  LEU B CD1 1 
ATOM   1602 C CD2 . LEU B 1 26  ? 1.149   16.043  58.447  1.00   65.99  ? 778  LEU B CD2 1 
ATOM   1603 N N   . PHE B 1 27  ? -2.257  20.302  59.410  1.00   54.64  ? 779  PHE B N   1 
ATOM   1604 C CA  . PHE B 1 27  ? -2.961  21.185  58.484  1.00   53.23  ? 779  PHE B CA  1 
ATOM   1605 C C   . PHE B 1 27  ? -2.150  21.477  57.229  1.00   48.97  ? 779  PHE B C   1 
ATOM   1606 O O   . PHE B 1 27  ? -1.097  22.168  57.231  1.00   49.19  ? 779  PHE B O   1 
ATOM   1607 C CB  . PHE B 1 27  ? -3.442  22.430  59.225  1.00   53.17  ? 779  PHE B CB  1 
ATOM   1608 C CG  . PHE B 1 27  ? -4.486  22.113  60.259  1.00   50.74  ? 779  PHE B CG  1 
ATOM   1609 C CD1 . PHE B 1 27  ? -5.800  21.903  59.867  1.00   43.86  ? 779  PHE B CD1 1 
ATOM   1610 C CD2 . PHE B 1 27  ? -4.159  21.968  61.605  1.00   51.87  ? 779  PHE B CD2 1 
ATOM   1611 C CE1 . PHE B 1 27  ? -6.747  21.617  60.733  1.00   39.90  ? 779  PHE B CE1 1 
ATOM   1612 C CE2 . PHE B 1 27  ? -5.147  21.646  62.503  1.00   55.80  ? 779  PHE B CE2 1 
ATOM   1613 C CZ  . PHE B 1 27  ? -6.482  21.485  62.023  1.00   38.63  ? 779  PHE B CZ  1 
ATOM   1614 N N   . VAL B 1 28  ? -2.636  20.902  56.142  1.00   46.12  ? 780  VAL B N   1 
ATOM   1615 C CA  . VAL B 1 28  ? -2.163  21.281  54.816  1.00   43.87  ? 780  VAL B CA  1 
ATOM   1616 C C   . VAL B 1 28  ? -2.755  22.626  54.426  1.00   43.54  ? 780  VAL B C   1 
ATOM   1617 O O   . VAL B 1 28  ? -3.965  22.787  54.457  1.00   41.74  ? 780  VAL B O   1 
ATOM   1618 C CB  . VAL B 1 28  ? -2.546  20.253  53.819  1.00   45.05  ? 780  VAL B CB  1 
ATOM   1619 C CG1 . VAL B 1 28  ? -2.152  20.662  52.315  1.00   35.33  ? 780  VAL B CG1 1 
ATOM   1620 C CG2 . VAL B 1 28  ? -1.915  18.849  54.321  1.00   46.50  ? 780  VAL B CG2 1 
ATOM   1621 N N   . GLU B 1 29  ? -1.878  23.570  54.046  1.00   46.48  ? 781  GLU B N   1 
ATOM   1622 C CA  . GLU B 1 29  ? -2.303  24.936  53.647  1.00   55.58  ? 781  GLU B CA  1 
ATOM   1623 C C   . GLU B 1 29  ? -1.990  25.294  52.189  1.00   48.11  ? 781  GLU B C   1 
ATOM   1624 O O   . GLU B 1 29  ? -0.933  24.941  51.672  1.00   56.61  ? 781  GLU B O   1 
ATOM   1625 C CB  . GLU B 1 29  ? -1.662  25.990  54.568  1.00   54.30  ? 781  GLU B CB  1 
ATOM   1626 C CG  . GLU B 1 29  ? -1.762  25.630  56.062  1.00   63.72  ? 781  GLU B CG  1 
ATOM   1627 C CD  . GLU B 1 29  ? -1.234  26.731  56.992  1.00   70.66  ? 781  GLU B CD  1 
ATOM   1628 O OE1 . GLU B 1 29  ? -0.904  26.380  58.156  1.00   57.83  ? 781  GLU B OE1 1 
ATOM   1629 O OE2 . GLU B 1 29  ? -1.149  27.927  56.559  1.00   52.25  ? 781  GLU B OE2 1 
ATOM   1630 N N   . THR B 1 30  ? -2.915  26.018  51.544  1.00   53.62  ? 782  THR B N   1 
ATOM   1631 C CA  . THR B 1 30  ? -2.698  26.637  50.229  1.00   50.27  ? 782  THR B CA  1 
ATOM   1632 C C   . THR B 1 30  ? -3.037  28.142  50.258  1.00   57.44  ? 782  THR B C   1 
ATOM   1633 O O   . THR B 1 30  ? -4.154  28.534  50.728  1.00   55.33  ? 782  THR B O   1 
ATOM   1634 C CB  . THR B 1 30  ? -3.621  26.012  49.123  1.00   51.58  ? 782  THR B CB  1 
ATOM   1635 O OG1 . THR B 1 30  ? -4.930  25.745  49.682  1.00   59.62  ? 782  THR B OG1 1 
ATOM   1636 C CG2 . THR B 1 30  ? -2.965  24.745  48.488  1.00   43.13  ? 782  THR B CG2 1 
ATOM   1637 N N   . SER B 1 31  ? -2.116  28.967  49.737  1.00   54.80  ? 783  SER B N   1 
ATOM   1638 C CA  . SER B 1 31  ? -2.365  30.423  49.568  1.00   59.39  ? 783  SER B CA  1 
ATOM   1639 C C   . SER B 1 31  ? -1.670  30.997  48.331  1.00   60.77  ? 783  SER B C   1 
ATOM   1640 O O   . SER B 1 31  ? -0.743  30.356  47.787  1.00   53.37  ? 783  SER B O   1 
ATOM   1641 C CB  . SER B 1 31  ? -1.876  31.192  50.795  1.00   58.90  ? 783  SER B CB  1 
ATOM   1642 O OG  . SER B 1 31  ? -0.481  31.006  50.985  1.00   60.69  ? 783  SER B OG  1 
ATOM   1643 N N   . LEU B 1 32  ? -2.100  32.213  47.945  1.00   58.25  ? 784  LEU B N   1 
ATOM   1644 C CA  . LEU B 1 32  ? -1.571  32.993  46.803  1.00   61.29  ? 784  LEU B CA  1 
ATOM   1645 C C   . LEU B 1 32  ? -0.442  33.980  47.139  1.00   61.11  ? 784  LEU B C   1 
ATOM   1646 O O   . LEU B 1 32  ? 0.306   33.795  48.104  1.00   63.06  ? 784  LEU B O   1 
ATOM   1647 C CB  . LEU B 1 32  ? -2.700  33.817  46.179  1.00   61.13  ? 784  LEU B CB  1 
ATOM   1648 C CG  . LEU B 1 32  ? -3.948  33.014  45.818  1.00   60.18  ? 784  LEU B CG  1 
ATOM   1649 C CD1 . LEU B 1 32  ? -5.197  33.755  46.174  1.00   56.80  ? 784  LEU B CD1 1 
ATOM   1650 C CD2 . LEU B 1 32  ? -3.948  32.666  44.348  1.00   69.01  ? 784  LEU B CD2 1 
ATOM   1651 N N   . GLY B 1 46  ? -0.150  29.737  35.116  1.00   48.93  ? 798  GLY B N   1 
ATOM   1652 C CA  . GLY B 1 46  ? -0.391  29.339  36.576  1.00   51.01  ? 798  GLY B CA  1 
ATOM   1653 C C   . GLY B 1 46  ? 0.688   28.435  37.186  1.00   56.54  ? 798  GLY B C   1 
ATOM   1654 O O   . GLY B 1 46  ? 1.246   27.631  36.439  1.00   62.93  ? 798  GLY B O   1 
ATOM   1655 N N   . SER B 1 47  ? 0.949   28.526  38.517  1.00   55.45  ? 799  SER B N   1 
ATOM   1656 C CA  . SER B 1 47  ? 1.988   27.726  39.228  1.00   57.48  ? 799  SER B CA  1 
ATOM   1657 C C   . SER B 1 47  ? 1.601   27.143  40.594  1.00   54.67  ? 799  SER B C   1 
ATOM   1658 O O   . SER B 1 47  ? 0.584   27.512  41.181  1.00   64.52  ? 799  SER B O   1 
ATOM   1659 C CB  . SER B 1 47  ? 3.336   28.500  39.354  1.00   64.03  ? 799  SER B CB  1 
ATOM   1660 O OG  . SER B 1 47  ? 3.260   29.762  40.022  1.00   48.36  ? 799  SER B OG  1 
ATOM   1661 N N   . LEU B 1 48  ? 2.381   26.186  41.069  1.00   47.54  ? 800  LEU B N   1 
ATOM   1662 C CA  . LEU B 1 48  ? 2.274   25.690  42.443  1.00   51.01  ? 800  LEU B CA  1 
ATOM   1663 C C   . LEU B 1 48  ? 3.696   25.696  43.002  1.00   53.51  ? 800  LEU B C   1 
ATOM   1664 O O   . LEU B 1 48  ? 4.625   25.254  42.305  1.00   49.41  ? 800  LEU B O   1 
ATOM   1665 C CB  . LEU B 1 48  ? 1.720   24.268  42.460  1.00   50.92  ? 800  LEU B CB  1 
ATOM   1666 C CG  . LEU B 1 48  ? 0.804   23.901  43.651  1.00   53.04  ? 800  LEU B CG  1 
ATOM   1667 C CD1 . LEU B 1 48  ? 1.056   22.488  44.128  1.00   43.72  ? 800  LEU B CD1 1 
ATOM   1668 C CD2 . LEU B 1 48  ? 1.039   24.785  44.766  1.00   36.63  ? 800  LEU B CD2 1 
ATOM   1669 N N   . GLU B 1 49  ? 3.864   26.199  44.228  1.00   61.86  ? 801  GLU B N   1 
ATOM   1670 C CA  . GLU B 1 49  ? 5.177   26.309  44.906  1.00   63.39  ? 801  GLU B CA  1 
ATOM   1671 C C   . GLU B 1 49  ? 5.072   25.625  46.290  1.00   66.35  ? 801  GLU B C   1 
ATOM   1672 O O   . GLU B 1 49  ? 4.071   25.769  46.984  1.00   62.05  ? 801  GLU B O   1 
ATOM   1673 C CB  . GLU B 1 49  ? 5.533   27.798  45.056  1.00   66.93  ? 801  GLU B CB  1 
ATOM   1674 C CG  . GLU B 1 49  ? 7.034   28.182  45.323  1.00   55.95  ? 801  GLU B CG  1 
ATOM   1675 C CD  . GLU B 1 49  ? 7.194   29.678  45.693  1.00   75.96  ? 801  GLU B CD  1 
ATOM   1676 O OE1 . GLU B 1 49  ? 6.148   30.360  45.890  1.00   58.04  ? 801  GLU B OE1 1 
ATOM   1677 O OE2 . GLU B 1 49  ? 8.361   30.159  45.800  1.00   78.69  ? 801  GLU B OE2 1 
ATOM   1678 N N   . VAL B 1 50  ? 6.030   24.814  46.675  1.00   70.76  ? 802  VAL B N   1 
ATOM   1679 C CA  . VAL B 1 50  ? 5.815   24.053  47.874  1.00   73.11  ? 802  VAL B CA  1 
ATOM   1680 C C   . VAL B 1 50  ? 6.857   24.036  48.953  1.00   75.39  ? 802  VAL B C   1 
ATOM   1681 O O   . VAL B 1 50  ? 8.029   23.833  48.708  1.00   75.45  ? 802  VAL B O   1 
ATOM   1682 C CB  . VAL B 1 50  ? 5.387   22.594  47.567  1.00   75.90  ? 802  VAL B CB  1 
ATOM   1683 C CG1 . VAL B 1 50  ? 5.493   22.317  46.134  1.00   78.12  ? 802  VAL B CG1 1 
ATOM   1684 C CG2 . VAL B 1 50  ? 6.183   21.608  48.338  1.00   66.70  ? 802  VAL B CG2 1 
ATOM   1685 N N   . THR B 1 51  ? 6.379   24.354  50.165  1.00   77.96  ? 803  THR B N   1 
ATOM   1686 C CA  . THR B 1 51  ? 7.160   24.778  51.342  1.00   79.35  ? 803  THR B CA  1 
ATOM   1687 C C   . THR B 1 51  ? 6.763   23.949  52.564  1.00   83.19  ? 803  THR B C   1 
ATOM   1688 O O   . THR B 1 51  ? 5.691   23.345  52.573  1.00   84.20  ? 803  THR B O   1 
ATOM   1689 C CB  . THR B 1 51  ? 6.955   26.271  51.652  1.00   80.11  ? 803  THR B CB  1 
ATOM   1690 O OG1 . THR B 1 51  ? 5.569   26.523  51.911  1.00   61.60  ? 803  THR B OG1 1 
ATOM   1691 C CG2 . THR B 1 51  ? 7.411   27.125  50.478  1.00   77.43  ? 803  THR B CG2 1 
ATOM   1692 N N   . GLY B 1 52  ? 7.627   23.885  53.580  0.0000 88.76  ? 804  GLY B N   1 
ATOM   1693 C CA  . GLY B 1 52  ? 7.817   22.621  54.267  0.0000 92.60  ? 804  GLY B CA  1 
ATOM   1694 C C   . GLY B 1 52  ? 8.760   21.670  53.557  0.0000 95.82  ? 804  GLY B C   1 
ATOM   1695 O O   . GLY B 1 52  ? 8.853   20.493  53.909  0.0000 95.06  ? 804  GLY B O   1 
ATOM   1696 N N   . GLN B 1 53  ? 9.189   22.069  52.348  0.0000 98.02  ? 805  GLN B N   1 
ATOM   1697 C CA  . GLN B 1 53  ? 10.339  21.514  51.572  0.0000 98.36  ? 805  GLN B CA  1 
ATOM   1698 C C   . GLN B 1 53  ? 10.608  19.990  51.336  0.0000 96.48  ? 805  GLN B C   1 
ATOM   1699 O O   . GLN B 1 53  ? 11.634  19.532  51.840  0.0000 95.41  ? 805  GLN B O   1 
ATOM   1700 C CB  . GLN B 1 53  ? 11.639  22.163  52.068  0.0000 98.86  ? 805  GLN B CB  1 
ATOM   1701 C CG  . GLN B 1 53  ? 11.936  21.913  53.537  0.0000 101.85 ? 805  GLN B CG  1 
ATOM   1702 C CD  . GLN B 1 53  ? 13.231  22.560  53.988  0.0000 103.07 ? 805  GLN B CD  1 
ATOM   1703 O OE1 . GLN B 1 53  ? 13.918  23.214  53.203  0.0000 108.28 ? 805  GLN B OE1 1 
ATOM   1704 N NE2 . GLN B 1 53  ? 13.572  22.380  55.259  0.0000 98.70  ? 805  GLN B NE2 1 
ATOM   1705 N N   . LEU B 1 54  ? 9.727   19.175  50.856  0.0000 93.73  ? 806  LEU B N   1 
ATOM   1706 C CA  . LEU B 1 54  ? 9.979   17.781  51.128  0.0000 90.89  ? 806  LEU B CA  1 
ATOM   1707 C C   . LEU B 1 54  ? 10.921  17.263  50.061  0.0000 88.91  ? 806  LEU B C   1 
ATOM   1708 O O   . LEU B 1 54  ? 11.481  18.074  49.376  0.0000 85.04  ? 806  LEU B O   1 
ATOM   1709 C CB  . LEU B 1 54  ? 8.655   17.082  51.270  0.0000 88.91  ? 806  LEU B CB  1 
ATOM   1710 C CG  . LEU B 1 54  ? 7.727   18.095  51.966  0.0000 89.03  ? 806  LEU B CG  1 
ATOM   1711 C CD1 . LEU B 1 54  ? 8.203   18.469  53.340  0.0000 70.63  ? 806  LEU B CD1 1 
ATOM   1712 C CD2 . LEU B 1 54  ? 7.458   19.341  51.119  0.0000 80.47  ? 806  LEU B CD2 1 
ATOM   1713 N N   . GLY B 1 55  ? 11.203  15.971  49.944  1.00   88.55  ? 807  GLY B N   1 
ATOM   1714 C CA  . GLY B 1 55  ? 12.018  15.615  48.808  1.00   87.75  ? 807  GLY B CA  1 
ATOM   1715 C C   . GLY B 1 55  ? 11.131  15.211  47.672  1.00   84.12  ? 807  GLY B C   1 
ATOM   1716 O O   . GLY B 1 55  ? 9.957   15.133  47.826  1.00   83.92  ? 807  GLY B O   1 
ATOM   1717 N N   . GLU B 1 56  ? 11.694  14.979  46.519  1.00   82.05  ? 808  GLU B N   1 
ATOM   1718 C CA  . GLU B 1 56  ? 10.995  15.154  45.280  1.00   83.52  ? 808  GLU B CA  1 
ATOM   1719 C C   . GLU B 1 56  ? 9.717   14.360  45.423  1.00   82.70  ? 808  GLU B C   1 
ATOM   1720 O O   . GLU B 1 56  ? 8.737   14.625  44.750  1.00   83.19  ? 808  GLU B O   1 
ATOM   1721 C CB  . GLU B 1 56  ? 11.799  14.592  44.099  1.00   83.77  ? 808  GLU B CB  1 
ATOM   1722 C CG  . GLU B 1 56  ? 13.140  15.238  43.784  1.00   79.73  ? 808  GLU B CG  1 
ATOM   1723 C CD  . GLU B 1 56  ? 13.032  16.709  43.577  1.00   80.26  ? 808  GLU B CD  1 
ATOM   1724 O OE1 . GLU B 1 56  ? 13.730  17.449  44.268  1.00   77.81  ? 808  GLU B OE1 1 
ATOM   1725 O OE2 . GLU B 1 56  ? 12.239  17.119  42.744  1.00   62.14  ? 808  GLU B OE2 1 
ATOM   1726 N N   . VAL B 1 57  ? 9.732   13.387  46.311  1.00   78.65  ? 809  VAL B N   1 
ATOM   1727 C CA  . VAL B 1 57  ? 8.614   12.491  46.470  1.00   74.55  ? 809  VAL B CA  1 
ATOM   1728 C C   . VAL B 1 57  ? 7.353   13.216  46.819  1.00   71.36  ? 809  VAL B C   1 
ATOM   1729 O O   . VAL B 1 57  ? 6.336   12.951  46.267  1.00   66.33  ? 809  VAL B O   1 
ATOM   1730 C CB  . VAL B 1 57  ? 8.867   11.615  47.669  1.00   75.15  ? 809  VAL B CB  1 
ATOM   1731 C CG1 . VAL B 1 57  ? 7.618   10.842  48.028  1.00   69.90  ? 809  VAL B CG1 1 
ATOM   1732 C CG2 . VAL B 1 57  ? 10.073  10.721  47.426  1.00   76.79  ? 809  VAL B CG2 1 
ATOM   1733 N N   . MET B 1 58  ? 7.420   14.126  47.763  1.00   72.72  ? 810  MET B N   1 
ATOM   1734 C CA  . MET B 1 58  ? 6.278   14.929  48.078  1.00   71.32  ? 810  MET B CA  1 
ATOM   1735 C C   . MET B 1 58  ? 5.901   15.795  46.931  1.00   67.63  ? 810  MET B C   1 
ATOM   1736 O O   . MET B 1 58  ? 4.762   15.941  46.627  1.00   67.68  ? 810  MET B O   1 
ATOM   1737 C CB  . MET B 1 58  ? 6.578   15.817  49.244  1.00   71.95  ? 810  MET B CB  1 
ATOM   1738 C CG  . MET B 1 58  ? 6.171   15.234  50.512  1.00   80.94  ? 810  MET B CG  1 
ATOM   1739 S SD  . MET B 1 58  ? 4.450   14.842  50.504  1.00   87.44  ? 810  MET B SD  1 
ATOM   1740 C CE  . MET B 1 58  ? 3.795   16.429  50.150  1.00   99.04  ? 810  MET B CE  1 
ATOM   1741 N N   . LYS B 1 59  ? 6.890   16.378  46.305  1.00   64.81  ? 811  LYS B N   1 
ATOM   1742 C CA  . LYS B 1 59  ? 6.694   17.308  45.196  1.00   62.83  ? 811  LYS B CA  1 
ATOM   1743 C C   . LYS B 1 59  ? 5.913   16.731  44.020  1.00   59.51  ? 811  LYS B C   1 
ATOM   1744 O O   . LYS B 1 59  ? 5.036   17.407  43.470  1.00   50.99  ? 811  LYS B O   1 
ATOM   1745 C CB  . LYS B 1 59  ? 8.053   17.851  44.730  1.00   63.26  ? 811  LYS B CB  1 
ATOM   1746 C CG  . LYS B 1 59  ? 8.800   18.592  45.838  1.00   60.10  ? 811  LYS B CG  1 
ATOM   1747 C CD  . LYS B 1 59  ? 10.298  18.483  45.674  1.00   61.31  ? 811  LYS B CD  1 
ATOM   1748 C CE  . LYS B 1 59  ? 10.799  19.135  44.375  1.00   68.30  ? 811  LYS B CE  1 
ATOM   1749 N NZ  . LYS B 1 59  ? 12.324  19.267  44.275  1.00   75.35  ? 811  LYS B NZ  1 
ATOM   1750 N N   . GLU B 1 60  ? 6.196   15.477  43.656  1.00   56.15  ? 812  GLU B N   1 
ATOM   1751 C CA  . GLU B 1 60  ? 5.450   14.840  42.578  1.00   49.92  ? 812  GLU B CA  1 
ATOM   1752 C C   . GLU B 1 60  ? 4.096   14.460  43.081  1.00   42.11  ? 812  GLU B C   1 
ATOM   1753 O O   . GLU B 1 60  ? 3.113   14.563  42.370  1.00   45.85  ? 812  GLU B O   1 
ATOM   1754 C CB  . GLU B 1 60  ? 6.193   13.601  42.021  1.00   52.30  ? 812  GLU B CB  1 
ATOM   1755 C CG  . GLU B 1 60  ? 7.468   14.001  41.290  1.00   49.84  ? 812  GLU B CG  1 
ATOM   1756 C CD  . GLU B 1 60  ? 7.589   13.423  39.930  1.00   51.91  ? 812  GLU B CD  1 
ATOM   1757 O OE1 . GLU B 1 60  ? 7.001   12.338  39.691  1.00   50.17  ? 812  GLU B OE1 1 
ATOM   1758 O OE2 . GLU B 1 60  ? 8.319   14.037  39.116  1.00   48.49  ? 812  GLU B OE2 1 
ATOM   1759 N N   . SER B 1 61  ? 4.030   14.053  44.341  1.00   44.13  ? 813  SER B N   1 
ATOM   1760 C CA  . SER B 1 61  ? 2.778   13.621  44.838  1.00   51.86  ? 813  SER B CA  1 
ATOM   1761 C C   . SER B 1 61  ? 1.874   14.900  44.725  1.00   44.78  ? 813  SER B C   1 
ATOM   1762 O O   . SER B 1 61  ? 0.749   14.906  44.169  1.00   42.53  ? 813  SER B O   1 
ATOM   1763 C CB  . SER B 1 61  ? 3.024   13.000  46.218  1.00   52.45  ? 813  SER B CB  1 
ATOM   1764 O OG  . SER B 1 61  ? 1.911   13.025  47.049  1.00   54.37  ? 813  SER B OG  1 
ATOM   1765 N N   . ALA B 1 62  ? 2.445   16.033  45.087  1.00   45.88  ? 814  ALA B N   1 
ATOM   1766 C CA  . ALA B 1 62  ? 1.737   17.288  44.921  1.00   41.99  ? 814  ALA B CA  1 
ATOM   1767 C C   . ALA B 1 62  ? 1.411   17.684  43.485  1.00   34.67  ? 814  ALA B C   1 
ATOM   1768 O O   . ALA B 1 62  ? 0.290   18.180  43.213  1.00   46.49  ? 814  ALA B O   1 
ATOM   1769 C CB  . ALA B 1 62  ? 2.478   18.451  45.700  1.00   42.43  ? 814  ALA B CB  1 
ATOM   1770 N N   A ARG B 1 63  ? 2.291   17.463  42.527  0.50   35.15  ? 815  ARG B N   1 
ATOM   1771 N N   B ARG B 1 63  ? 2.331   17.484  42.542  0.50   37.84  ? 815  ARG B N   1 
ATOM   1772 C CA  A ARG B 1 63  ? 1.916   17.836  41.152  0.50   30.31  ? 815  ARG B CA  1 
ATOM   1773 C CA  B ARG B 1 63  ? 2.039   17.787  41.114  0.50   36.08  ? 815  ARG B CA  1 
ATOM   1774 C C   A ARG B 1 63  ? 0.879   16.930  40.516  0.50   35.55  ? 815  ARG B C   1 
ATOM   1775 C C   B ARG B 1 63  ? 0.874   16.946  40.571  0.50   38.04  ? 815  ARG B C   1 
ATOM   1776 O O   A ARG B 1 63  ? 0.070   17.386  39.743  0.50   33.95  ? 815  ARG B O   1 
ATOM   1777 O O   B ARG B 1 63  ? -0.018  17.456  39.917  0.50   34.41  ? 815  ARG B O   1 
ATOM   1778 C CB  A ARG B 1 63  ? 3.124   17.965  40.264  0.50   35.35  ? 815  ARG B CB  1 
ATOM   1779 C CB  B ARG B 1 63  ? 3.268   17.573  40.215  0.50   44.21  ? 815  ARG B CB  1 
ATOM   1780 C CG  A ARG B 1 63  ? 4.068   18.985  40.774  0.50   37.06  ? 815  ARG B CG  1 
ATOM   1781 C CG  B ARG B 1 63  ? 4.436   18.545  40.395  0.50   50.32  ? 815  ARG B CG  1 
ATOM   1782 C CD  A ARG B 1 63  ? 4.848   19.563  39.638  0.50   40.22  ? 815  ARG B CD  1 
ATOM   1783 C CD  B ARG B 1 63  ? 5.665   18.093  39.564  0.50   55.34  ? 815  ARG B CD  1 
ATOM   1784 N NE  A ARG B 1 63  ? 3.936   20.010  38.593  0.50   40.68  ? 815  ARG B NE  1 
ATOM   1785 N NE  B ARG B 1 63  ? 5.754   18.703  38.228  0.50   58.88  ? 815  ARG B NE  1 
ATOM   1786 C CZ  A ARG B 1 63  ? 3.492   21.260  38.490  0.50   31.00  ? 815  ARG B CZ  1 
ATOM   1787 C CZ  B ARG B 1 63  ? 6.281   18.108  37.152  0.50   52.37  ? 815  ARG B CZ  1 
ATOM   1788 N NH1 A ARG B 1 63  ? 2.704   21.588  37.487  0.50   54.62  ? 815  ARG B NH1 1 
ATOM   1789 N NH1 B ARG B 1 63  ? 6.350   18.760  36.012  0.50   53.32  ? 815  ARG B NH1 1 
ATOM   1790 N NH2 A ARG B 1 63  ? 3.890   22.188  39.333  0.50   38.35  ? 815  ARG B NH2 1 
ATOM   1791 N NH2 B ARG B 1 63  ? 6.751   16.869  37.218  0.50   48.18  ? 815  ARG B NH2 1 
ATOM   1792 N N   . ILE B 1 64  ? 0.842   15.647  40.891  1.00   35.37  ? 816  ILE B N   1 
ATOM   1793 C CA  . ILE B 1 64  ? -0.266  14.874  40.460  1.00   34.45  ? 816  ILE B CA  1 
ATOM   1794 C C   . ILE B 1 64  ? -1.522  15.343  41.176  1.00   30.96  ? 816  ILE B C   1 
ATOM   1795 O O   . ILE B 1 64  ? -2.600  15.249  40.581  1.00   35.08  ? 816  ILE B O   1 
ATOM   1796 C CB  . ILE B 1 64  ? -0.004  13.368  40.764  1.00   44.97  ? 816  ILE B CB  1 
ATOM   1797 C CG1 . ILE B 1 64  ? 1.181   12.873  39.863  1.00   38.15  ? 816  ILE B CG1 1 
ATOM   1798 C CG2 . ILE B 1 64  ? -1.201  12.607  40.372  1.00   29.90  ? 816  ILE B CG2 1 
ATOM   1799 C CD1 . ILE B 1 64  ? 2.289   12.162  40.716  1.00   44.01  ? 816  ILE B CD1 1 
ATOM   1800 N N   . ALA B 1 65  ? -1.439  15.671  42.488  1.00   29.53  ? 817  ALA B N   1 
ATOM   1801 C CA  . ALA B 1 65  ? -2.645  16.165  43.162  1.00   37.72  ? 817  ALA B CA  1 
ATOM   1802 C C   . ALA B 1 65  ? -3.076  17.472  42.429  1.00   40.82  ? 817  ALA B C   1 
ATOM   1803 O O   . ALA B 1 65  ? -4.235  17.638  42.088  1.00   34.32  ? 817  ALA B O   1 
ATOM   1804 C CB  . ALA B 1 65  ? -2.445  16.426  44.601  1.00   37.58  ? 817  ALA B CB  1 
ATOM   1805 N N   . TYR B 1 66  ? -2.095  18.357  42.213  1.00   40.10  ? 818  TYR B N   1 
ATOM   1806 C CA  . TYR B 1 66  ? -2.283  19.608  41.486  1.00   36.33  ? 818  TYR B CA  1 
ATOM   1807 C C   . TYR B 1 66  ? -2.982  19.419  40.128  1.00   42.95  ? 818  TYR B C   1 
ATOM   1808 O O   . TYR B 1 66  ? -3.974  20.103  39.890  1.00   42.05  ? 818  TYR B O   1 
ATOM   1809 C CB  . TYR B 1 66  ? -0.959  20.331  41.386  1.00   36.21  ? 818  TYR B CB  1 
ATOM   1810 C CG  . TYR B 1 66  ? -0.984  21.736  40.883  1.00   53.07  ? 818  TYR B CG  1 
ATOM   1811 C CD1 . TYR B 1 66  ? -0.011  22.176  40.015  1.00   48.05  ? 818  TYR B CD1 1 
ATOM   1812 C CD2 . TYR B 1 66  ? -1.944  22.650  41.310  1.00   45.73  ? 818  TYR B CD2 1 
ATOM   1813 C CE1 . TYR B 1 66  ? -0.002  23.476  39.562  1.00   58.83  ? 818  TYR B CE1 1 
ATOM   1814 C CE2 . TYR B 1 66  ? -1.932  23.920  40.855  1.00   51.00  ? 818  TYR B CE2 1 
ATOM   1815 C CZ  . TYR B 1 66  ? -0.967  24.330  39.997  1.00   50.98  ? 818  TYR B CZ  1 
ATOM   1816 O OH  . TYR B 1 66  ? -0.932  25.630  39.569  1.00   60.47  ? 818  TYR B OH  1 
ATOM   1817 N N   . THR B 1 67  ? -2.552  18.463  39.284  1.00   37.20  ? 819  THR B N   1 
ATOM   1818 C CA  . THR B 1 67  ? -3.179  18.239  38.039  1.00   32.50  ? 819  THR B CA  1 
ATOM   1819 C C   . THR B 1 67  ? -4.519  17.550  38.135  1.00   38.80  ? 819  THR B C   1 
ATOM   1820 O O   . THR B 1 67  ? -5.363  17.766  37.302  1.00   45.63  ? 819  THR B O   1 
ATOM   1821 C CB  . THR B 1 67  ? -2.249  17.444  36.993  1.00   37.00  ? 819  THR B CB  1 
ATOM   1822 O OG1 . THR B 1 67  ? -1.331  18.368  36.406  1.00   44.73  ? 819  THR B OG1 1 
ATOM   1823 C CG2 . THR B 1 67  ? -3.073  16.771  35.980  1.00   33.86  ? 819  THR B CG2 1 
ATOM   1824 N N   . PHE B 1 68  ? -4.680  16.615  39.054  1.00   44.55  ? 820  PHE B N   1 
ATOM   1825 C CA  . PHE B 1 68  ? -6.006  16.097  39.240  1.00   44.99  ? 820  PHE B CA  1 
ATOM   1826 C C   . PHE B 1 68  ? -6.993  17.213  39.716  1.00   46.10  ? 820  PHE B C   1 
ATOM   1827 O O   . PHE B 1 68  ? -8.145  17.182  39.384  1.00   34.91  ? 820  PHE B O   1 
ATOM   1828 C CB  . PHE B 1 68  ? -6.039  15.054  40.313  1.00   52.53  ? 820  PHE B CB  1 
ATOM   1829 C CG  . PHE B 1 68  ? -7.443  14.569  40.573  1.00   53.09  ? 820  PHE B CG  1 
ATOM   1830 C CD1 . PHE B 1 68  ? -8.090  14.829  41.777  1.00   48.46  ? 820  PHE B CD1 1 
ATOM   1831 C CD2 . PHE B 1 68  ? -8.163  14.003  39.538  1.00   40.83  ? 820  PHE B CD2 1 
ATOM   1832 C CE1 . PHE B 1 68  ? -9.427  14.387  41.984  1.00   41.45  ? 820  PHE B CE1 1 
ATOM   1833 C CE2 . PHE B 1 68  ? -9.492  13.567  39.720  1.00   42.95  ? 820  PHE B CE2 1 
ATOM   1834 C CZ  . PHE B 1 68  ? -10.114 13.764  40.942  1.00   44.49  ? 820  PHE B CZ  1 
ATOM   1835 N N   . ALA B 1 69  ? -6.532  18.070  40.613  1.00   44.90  ? 821  ALA B N   1 
ATOM   1836 C CA  . ALA B 1 69  ? -7.359  19.147  41.133  1.00   43.38  ? 821  ALA B CA  1 
ATOM   1837 C C   . ALA B 1 69  ? -7.736  20.096  39.979  1.00   42.41  ? 821  ALA B C   1 
ATOM   1838 O O   . ALA B 1 69  ? -8.895  20.423  39.844  1.00   46.02  ? 821  ALA B O   1 
ATOM   1839 C CB  . ALA B 1 69  ? -6.650  19.858  42.262  1.00   32.26  ? 821  ALA B CB  1 
ATOM   1840 N N   . ARG B 1 70  ? -6.789  20.455  39.114  1.00   49.48  ? 822  ARG B N   1 
ATOM   1841 C CA  . ARG B 1 70  ? -7.109  21.288  37.941  1.00   50.93  ? 822  ARG B CA  1 
ATOM   1842 C C   . ARG B 1 70  ? -8.183  20.668  37.127  1.00   46.38  ? 822  ARG B C   1 
ATOM   1843 O O   . ARG B 1 70  ? -9.162  21.330  36.888  1.00   52.38  ? 822  ARG B O   1 
ATOM   1844 C CB  . ARG B 1 70  ? -5.927  21.522  37.002  1.00   51.81  ? 822  ARG B CB  1 
ATOM   1845 C CG  . ARG B 1 70  ? -4.868  22.374  37.619  1.00   38.16  ? 822  ARG B CG  1 
ATOM   1846 C CD  . ARG B 1 70  ? -4.063  22.818  36.584  1.00   46.36  ? 822  ARG B CD  1 
ATOM   1847 N NE  . ARG B 1 70  ? -2.950  23.626  37.027  1.00   52.55  ? 822  ARG B NE  1 
ATOM   1848 C CZ  . ARG B 1 70  ? -2.289  24.433  36.215  1.00   53.37  ? 822  ARG B CZ  1 
ATOM   1849 N NH1 . ARG B 1 70  ? -2.658  24.511  34.940  1.00   57.40  ? 822  ARG B NH1 1 
ATOM   1850 N NH2 . ARG B 1 70  ? -1.272  25.160  36.685  1.00   61.10  ? 822  ARG B NH2 1 
ATOM   1851 N N   . ALA B 1 71  ? -8.046  19.407  36.737  1.00   52.98  ? 823  ALA B N   1 
ATOM   1852 C CA  . ALA B 1 71  ? -9.022  18.789  35.768  1.00   54.27  ? 823  ALA B CA  1 
ATOM   1853 C C   . ALA B 1 71  ? -10.313 18.666  36.426  1.00   54.82  ? 823  ALA B C   1 
ATOM   1854 O O   . ALA B 1 71  ? -11.319 18.900  35.753  1.00   46.66  ? 823  ALA B O   1 
ATOM   1855 C CB  . ALA B 1 71  ? -8.631  17.438  35.289  1.00   55.18  ? 823  ALA B CB  1 
ATOM   1856 N N   . PHE B 1 72  ? -10.282 18.405  37.753  1.00   48.10  ? 824  PHE B N   1 
ATOM   1857 C CA  . PHE B 1 72  ? -11.522 18.177  38.499  1.00   44.93  ? 824  PHE B CA  1 
ATOM   1858 C C   . PHE B 1 72  ? -12.361 19.457  38.516  1.00   51.18  ? 824  PHE B C   1 
ATOM   1859 O O   . PHE B 1 72  ? -13.601 19.373  38.468  1.00   52.06  ? 824  PHE B O   1 
ATOM   1860 C CB  . PHE B 1 72  ? -11.267 17.660  39.932  1.00   46.06  ? 824  PHE B CB  1 
ATOM   1861 C CG  . PHE B 1 72  ? -12.559 17.385  40.724  1.00   46.25  ? 824  PHE B CG  1 
ATOM   1862 C CD1 . PHE B 1 72  ? -13.300 18.444  41.277  1.00   56.38  ? 824  PHE B CD1 1 
ATOM   1863 C CD2 . PHE B 1 72  ? -13.063 16.097  40.821  1.00   53.63  ? 824  PHE B CD2 1 
ATOM   1864 C CE1 . PHE B 1 72  ? -14.507 18.204  41.986  1.00   66.21  ? 824  PHE B CE1 1 
ATOM   1865 C CE2 . PHE B 1 72  ? -14.277 15.824  41.539  1.00   60.27  ? 824  PHE B CE2 1 
ATOM   1866 C CZ  . PHE B 1 72  ? -14.999 16.887  42.126  1.00   58.61  ? 824  PHE B CZ  1 
ATOM   1867 N N   . LEU B 1 73  ? -11.666 20.609  38.535  1.00   52.88  ? 825  LEU B N   1 
ATOM   1868 C CA  . LEU B 1 73  ? -12.270 21.949  38.632  1.00   53.31  ? 825  LEU B CA  1 
ATOM   1869 C C   . LEU B 1 73  ? -12.789 22.392  37.265  1.00   59.12  ? 825  LEU B C   1 
ATOM   1870 O O   . LEU B 1 73  ? -13.838 23.031  37.184  1.00   57.10  ? 825  LEU B O   1 
ATOM   1871 C CB  . LEU B 1 73  ? -11.265 22.994  39.188  1.00   56.98  ? 825  LEU B CB  1 
ATOM   1872 C CG  . LEU B 1 73  ? -11.733 24.422  39.627  1.00   50.66  ? 825  LEU B CG  1 
ATOM   1873 C CD1 . LEU B 1 73  ? -12.583 24.475  40.879  1.00   32.76  ? 825  LEU B CD1 1 
ATOM   1874 C CD2 . LEU B 1 73  ? -10.564 25.355  39.900  1.00   50.73  ? 825  LEU B CD2 1 
ATOM   1875 N N   . MET B 1 74  ? -12.042 22.074  36.196  1.00   54.88  ? 826  MET B N   1 
ATOM   1876 C CA  . MET B 1 74  ? -12.572 22.138  34.824  1.00   52.97  ? 826  MET B CA  1 
ATOM   1877 C C   . MET B 1 74  ? -13.882 21.341  34.685  1.00   58.76  ? 826  MET B C   1 
ATOM   1878 O O   . MET B 1 74  ? -14.857 21.859  34.182  1.00   59.61  ? 826  MET B O   1 
ATOM   1879 C CB  . MET B 1 74  ? -11.544 21.640  33.798  1.00   52.19  ? 826  MET B CB  1 
ATOM   1880 C CG  . MET B 1 74  ? -10.137 22.382  33.839  1.00   46.82  ? 826  MET B CG  1 
ATOM   1881 S SD  . MET B 1 74  ? -8.983  21.728  32.497  1.00   65.95  ? 826  MET B SD  1 
ATOM   1882 C CE  . MET B 1 74  ? -7.413  22.055  33.258  1.00   75.56  ? 826  MET B CE  1 
ATOM   1883 N N   . GLN B 1 75  ? -13.922 20.108  35.172  1.00   61.90  ? 827  GLN B N   1 
ATOM   1884 C CA  . GLN B 1 75  ? -15.109 19.277  34.999  1.00   62.84  ? 827  GLN B CA  1 
ATOM   1885 C C   . GLN B 1 75  ? -16.293 19.619  35.911  1.00   70.65  ? 827  GLN B C   1 
ATOM   1886 O O   . GLN B 1 75  ? -17.454 19.510  35.472  1.00   73.46  ? 827  GLN B O   1 
ATOM   1887 C CB  . GLN B 1 75  ? -14.738 17.811  35.167  1.00   70.61  ? 827  GLN B CB  1 
ATOM   1888 C CG  . GLN B 1 75  ? -15.600 16.856  34.341  1.00   74.46  ? 827  GLN B CG  1 
ATOM   1889 C CD  . GLN B 1 75  ? -17.060 16.880  34.772  1.00   84.53  ? 827  GLN B CD  1 
ATOM   1890 O OE1 . GLN B 1 75  ? -17.965 17.110  33.961  1.00   77.30  ? 827  GLN B OE1 1 
ATOM   1891 N NE2 . GLN B 1 75  ? -17.293 16.660  36.066  1.00   90.18  ? 827  GLN B NE2 1 
ATOM   1892 N N   . HIS B 1 76  ? -16.008 19.993  37.167  1.00   68.73  ? 828  HIS B N   1 
ATOM   1893 C CA  . HIS B 1 76  ? -17.010 20.411  38.188  1.00   71.80  ? 828  HIS B CA  1 
ATOM   1894 C C   . HIS B 1 76  ? -17.551 21.802  37.921  1.00   71.21  ? 828  HIS B C   1 
ATOM   1895 O O   . HIS B 1 76  ? -18.754 22.009  37.927  1.00   74.35  ? 828  HIS B O   1 
ATOM   1896 C CB  . HIS B 1 76  ? -16.343 20.431  39.594  1.00   69.61  ? 828  HIS B CB  1 
ATOM   1897 C CG  . HIS B 1 76  ? -17.209 20.929  40.738  1.00   74.18  ? 828  HIS B CG  1 
ATOM   1898 N ND1 . HIS B 1 76  ? -17.169 22.235  41.198  1.00   65.13  ? 828  HIS B ND1 1 
ATOM   1899 C CD2 . HIS B 1 76  ? -18.042 20.263  41.586  1.00   66.01  ? 828  HIS B CD2 1 
ATOM   1900 C CE1 . HIS B 1 76  ? -17.932 22.350  42.271  1.00   56.81  ? 828  HIS B CE1 1 
ATOM   1901 N NE2 . HIS B 1 76  ? -18.485 21.173  42.520  1.00   64.78  ? 828  HIS B NE2 1 
ATOM   1902 N N   . ALA B 1 77  ? -16.673 22.763  37.747  1.00   70.05  ? 829  ALA B N   1 
ATOM   1903 C CA  . ALA B 1 77  ? -17.088 24.115  37.501  1.00   68.33  ? 829  ALA B CA  1 
ATOM   1904 C C   . ALA B 1 77  ? -16.347 24.732  36.345  1.00   68.18  ? 829  ALA B C   1 
ATOM   1905 O O   . ALA B 1 77  ? -15.491 25.586  36.530  1.00   71.37  ? 829  ALA B O   1 
ATOM   1906 C CB  . ALA B 1 77  ? -16.893 24.926  38.696  1.00   71.11  ? 829  ALA B CB  1 
ATOM   1907 N N   . PRO B 1 78  ? -16.778 24.422  35.145  1.00   65.23  ? 830  PRO B N   1 
ATOM   1908 C CA  . PRO B 1 78  ? -16.029 24.812  33.983  1.00   64.11  ? 830  PRO B CA  1 
ATOM   1909 C C   . PRO B 1 78  ? -15.759 26.238  34.147  1.00   64.56  ? 830  PRO B C   1 
ATOM   1910 O O   . PRO B 1 78  ? -14.806 26.772  33.700  1.00   66.79  ? 830  PRO B O   1 
ATOM   1911 C CB  . PRO B 1 78  ? -17.025 24.563  32.882  1.00   65.98  ? 830  PRO B CB  1 
ATOM   1912 C CG  . PRO B 1 78  ? -17.654 23.318  33.291  1.00   61.42  ? 830  PRO B CG  1 
ATOM   1913 C CD  . PRO B 1 78  ? -17.659 23.297  34.814  1.00   65.58  ? 830  PRO B CD  1 
ATOM   1914 N N   . ALA B 1 79  ? -16.603 26.868  34.873  1.00   67.14  ? 831  ALA B N   1 
ATOM   1915 C CA  . ALA B 1 79  ? -16.452 28.273  35.056  1.00   66.80  ? 831  ALA B CA  1 
ATOM   1916 C C   . ALA B 1 79  ? -15.153 28.763  35.674  1.00   67.57  ? 831  ALA B C   1 
ATOM   1917 O O   . ALA B 1 79  ? -14.682 29.826  35.329  1.00   67.01  ? 831  ALA B O   1 
ATOM   1918 C CB  . ALA B 1 79  ? -17.610 28.761  35.901  1.00   67.14  ? 831  ALA B CB  1 
ATOM   1919 N N   . ASN B 1 80  ? -14.604 28.023  36.622  1.00   68.07  ? 832  ASN B N   1 
ATOM   1920 C CA  . ASN B 1 80  ? -13.601 28.545  37.507  1.00   64.22  ? 832  ASN B CA  1 
ATOM   1921 C C   . ASN B 1 80  ? -12.197 28.346  36.991  1.00   64.14  ? 832  ASN B C   1 
ATOM   1922 O O   . ASN B 1 80  ? -11.803 27.234  36.682  1.00   68.42  ? 832  ASN B O   1 
ATOM   1923 C CB  . ASN B 1 80  ? -13.762 27.991  38.929  1.00   62.09  ? 832  ASN B CB  1 
ATOM   1924 C CG  . ASN B 1 80  ? -12.821 28.650  39.895  1.00   46.41  ? 832  ASN B CG  1 
ATOM   1925 O OD1 . ASN B 1 80  ? -11.754 29.143  39.504  1.00   57.75  ? 832  ASN B OD1 1 
ATOM   1926 N ND2 . ASN B 1 80  ? -13.206 28.710  41.144  1.00   45.06  ? 832  ASN B ND2 1 
ATOM   1927 N N   . ASP B 1 81  ? -11.434 29.436  36.975  1.00   62.20  ? 833  ASP B N   1 
ATOM   1928 C CA  . ASP B 1 81  ? -10.108 29.439  36.377  1.00   60.48  ? 833  ASP B CA  1 
ATOM   1929 C C   . ASP B 1 81  ? -8.956  29.505  37.390  1.00   58.43  ? 833  ASP B C   1 
ATOM   1930 O O   . ASP B 1 81  ? -7.756  29.528  36.982  1.00   55.75  ? 833  ASP B O   1 
ATOM   1931 C CB  . ASP B 1 81  ? -10.011 30.573  35.317  1.00   53.89  ? 833  ASP B CB  1 
ATOM   1932 C CG  . ASP B 1 81  ? -9.697  32.003  35.920  1.00   67.45  ? 833  ASP B CG  1 
ATOM   1933 O OD1 . ASP B 1 81  ? -9.490  32.171  37.149  1.00   68.70  ? 833  ASP B OD1 1 
ATOM   1934 O OD2 . ASP B 1 81  ? -9.609  32.990  35.133  1.00   62.66  ? 833  ASP B OD2 1 
ATOM   1935 N N   . TYR B 1 82  ? -9.306  29.628  38.685  1.00   58.15  ? 834  TYR B N   1 
ATOM   1936 C CA  . TYR B 1 82  ? -8.358  29.986  39.737  1.00   55.29  ? 834  TYR B CA  1 
ATOM   1937 C C   . TYR B 1 82  ? -7.122  29.035  39.737  1.00   54.84  ? 834  TYR B C   1 
ATOM   1938 O O   . TYR B 1 82  ? -5.977  29.497  39.616  1.00   52.67  ? 834  TYR B O   1 
ATOM   1939 C CB  . TYR B 1 82  ? -9.076  29.934  41.090  1.00   50.61  ? 834  TYR B CB  1 
ATOM   1940 C CG  . TYR B 1 82  ? -8.325  30.469  42.304  1.00   68.09  ? 834  TYR B CG  1 
ATOM   1941 C CD1 . TYR B 1 82  ? -8.612  31.746  42.836  1.00   62.59  ? 834  TYR B CD1 1 
ATOM   1942 C CD2 . TYR B 1 82  ? -7.388  29.666  42.984  1.00   43.84  ? 834  TYR B CD2 1 
ATOM   1943 C CE1 . TYR B 1 82  ? -7.957  32.198  43.958  1.00   66.91  ? 834  TYR B CE1 1 
ATOM   1944 C CE2 . TYR B 1 82  ? -6.744  30.108  44.097  1.00   67.58  ? 834  TYR B CE2 1 
ATOM   1945 C CZ  . TYR B 1 82  ? -7.028  31.362  44.597  1.00   69.15  ? 834  TYR B CZ  1 
ATOM   1946 O OH  . TYR B 1 82  ? -6.360  31.734  45.725  1.00   67.59  ? 834  TYR B OH  1 
ATOM   1947 N N   . LEU B 1 83  ? -7.372  27.723  39.814  1.00   46.68  ? 835  LEU B N   1 
ATOM   1948 C CA  . LEU B 1 83  ? -6.258  26.690  39.746  1.00   51.48  ? 835  LEU B CA  1 
ATOM   1949 C C   . LEU B 1 83  ? -5.355  26.758  38.473  1.00   50.66  ? 835  LEU B C   1 
ATOM   1950 O O   . LEU B 1 83  ? -4.121  26.852  38.568  1.00   54.46  ? 835  LEU B O   1 
ATOM   1951 C CB  . LEU B 1 83  ? -6.882  25.299  39.889  1.00   47.38  ? 835  LEU B CB  1 
ATOM   1952 C CG  . LEU B 1 83  ? -6.739  24.480  41.154  1.00   62.13  ? 835  LEU B CG  1 
ATOM   1953 C CD1 . LEU B 1 83  ? -6.255  25.244  42.386  1.00   57.68  ? 835  LEU B CD1 1 
ATOM   1954 C CD2 . LEU B 1 83  ? -8.060  23.798  41.397  1.00   48.81  ? 835  LEU B CD2 1 
ATOM   1955 N N   . VAL B 1 84  ? -5.976  26.775  37.280  1.00   51.86  ? 836  VAL B N   1 
ATOM   1956 C CA  . VAL B 1 84  ? -5.269  26.882  35.984  1.00   50.87  ? 836  VAL B CA  1 
ATOM   1957 C C   . VAL B 1 84  ? -4.478  28.203  35.792  1.00   57.71  ? 836  VAL B C   1 
ATOM   1958 O O   . VAL B 1 84  ? -3.544  28.258  34.989  1.00   41.88  ? 836  VAL B O   1 
ATOM   1959 C CB  . VAL B 1 84  ? -6.271  26.670  34.781  1.00   55.87  ? 836  VAL B CB  1 
ATOM   1960 C CG1 . VAL B 1 84  ? -5.654  27.079  33.456  1.00   58.81  ? 836  VAL B CG1 1 
ATOM   1961 C CG2 . VAL B 1 84  ? -6.757  25.204  34.726  1.00   55.14  ? 836  VAL B CG2 1 
ATOM   1962 N N   . THR B 1 85  ? -4.808  29.240  36.571  1.00   61.61  ? 837  THR B N   1 
ATOM   1963 C CA  . THR B 1 85  ? -4.257  30.618  36.399  1.00   62.44  ? 837  THR B CA  1 
ATOM   1964 C C   . THR B 1 85  ? -3.384  31.166  37.548  1.00   59.05  ? 837  THR B C   1 
ATOM   1965 O O   . THR B 1 85  ? -2.356  31.819  37.330  1.00   54.48  ? 837  THR B O   1 
ATOM   1966 C CB  . THR B 1 85  ? -5.418  31.582  36.248  1.00   64.07  ? 837  THR B CB  1 
ATOM   1967 O OG1 . THR B 1 85  ? -6.132  31.256  35.046  1.00   68.36  ? 837  THR B OG1 1 
ATOM   1968 C CG2 . THR B 1 85  ? -4.899  33.043  36.204  1.00   64.74  ? 837  THR B CG2 1 
ATOM   1969 N N   . SER B 1 86  ? -3.781  30.904  38.782  1.00   60.94  ? 838  SER B N   1 
ATOM   1970 C CA  . SER B 1 86  ? -3.104  31.558  39.909  1.00   63.03  ? 838  SER B CA  1 
ATOM   1971 C C   . SER B 1 86  ? -1.726  30.997  40.210  1.00   64.42  ? 838  SER B C   1 
ATOM   1972 O O   . SER B 1 86  ? -1.395  29.880  39.818  1.00   66.45  ? 838  SER B O   1 
ATOM   1973 C CB  . SER B 1 86  ? -3.963  31.480  41.161  1.00   64.64  ? 838  SER B CB  1 
ATOM   1974 O OG  . SER B 1 86  ? -5.323  31.651  40.833  1.00   64.78  ? 838  SER B OG  1 
ATOM   1975 N N   . HIS B 1 87  ? -0.922  31.790  40.909  1.00   66.28  ? 839  HIS B N   1 
ATOM   1976 C CA  . HIS B 1 87  ? 0.375   31.329  41.465  1.00   65.54  ? 839  HIS B CA  1 
ATOM   1977 C C   . HIS B 1 87  ? 0.231   30.993  42.931  1.00   66.88  ? 839  HIS B C   1 
ATOM   1978 O O   . HIS B 1 87  ? 0.435   31.843  43.809  1.00   70.56  ? 839  HIS B O   1 
ATOM   1979 C CB  . HIS B 1 87  ? 1.488   32.342  41.210  1.00   64.82  ? 839  HIS B CB  1 
ATOM   1980 C CG  . HIS B 1 87  ? 1.741   32.551  39.752  1.00   72.02  ? 839  HIS B CG  1 
ATOM   1981 N ND1 . HIS B 1 87  ? 2.832   32.020  39.098  1.00   63.24  ? 839  HIS B ND1 1 
ATOM   1982 C CD2 . HIS B 1 87  ? 0.991   33.161  38.803  1.00   68.19  ? 839  HIS B CD2 1 
ATOM   1983 C CE1 . HIS B 1 87  ? 2.756   32.321  37.815  1.00   64.97  ? 839  HIS B CE1 1 
ATOM   1984 N NE2 . HIS B 1 87  ? 1.649   33.012  37.611  1.00   72.30  ? 839  HIS B NE2 1 
ATOM   1985 N N   . ILE B 1 88  ? -0.143  29.724  43.155  1.00   64.62  ? 840  ILE B N   1 
ATOM   1986 C CA  . ILE B 1 88  ? -0.466  29.191  44.455  1.00   59.20  ? 840  ILE B CA  1 
ATOM   1987 C C   . ILE B 1 88  ? 0.786   28.703  45.220  1.00   60.94  ? 840  ILE B C   1 
ATOM   1988 O O   . ILE B 1 88  ? 1.846   28.356  44.634  1.00   64.20  ? 840  ILE B O   1 
ATOM   1989 C CB  . ILE B 1 88  ? -1.561  28.086  44.339  1.00   54.48  ? 840  ILE B CB  1 
ATOM   1990 C CG1 . ILE B 1 88  ? -2.771  28.621  43.583  1.00   48.33  ? 840  ILE B CG1 1 
ATOM   1991 C CG2 . ILE B 1 88  ? -1.997  27.598  45.713  1.00   65.83  ? 840  ILE B CG2 1 
ATOM   1992 C CD1 . ILE B 1 88  ? -3.938  27.730  43.547  1.00   51.27  ? 840  ILE B CD1 1 
ATOM   1993 N N   . HIS B 1 89  ? 0.648   28.725  46.543  1.00   59.60  ? 841  HIS B N   1 
ATOM   1994 C CA  . HIS B 1 89  ? 1.686   28.243  47.490  1.00   58.03  ? 841  HIS B CA  1 
ATOM   1995 C C   . HIS B 1 89  ? 1.152   27.065  48.318  1.00   51.44  ? 841  HIS B C   1 
ATOM   1996 O O   . HIS B 1 89  ? 0.107   27.154  48.946  1.00   54.62  ? 841  HIS B O   1 
ATOM   1997 C CB  . HIS B 1 89  ? 2.208   29.381  48.401  1.00   57.11  ? 841  HIS B CB  1 
ATOM   1998 C CG  . HIS B 1 89  ? 2.839   28.898  49.680  1.00   58.43  ? 841  HIS B CG  1 
ATOM   1999 N ND1 . HIS B 1 89  ? 2.167   28.897  50.882  1.00   74.74  ? 841  HIS B ND1 1 
ATOM   2000 C CD2 . HIS B 1 89  ? 4.063   28.369  49.932  1.00   60.75  ? 841  HIS B CD2 1 
ATOM   2001 C CE1 . HIS B 1 89  ? 2.954   28.410  51.828  1.00   78.36  ? 841  HIS B CE1 1 
ATOM   2002 N NE2 . HIS B 1 89  ? 4.110   28.075  51.278  1.00   66.04  ? 841  HIS B NE2 1 
ATOM   2003 N N   . LEU B 1 90  ? 1.880   25.961  48.315  1.00   48.95  ? 842  LEU B N   1 
ATOM   2004 C CA  . LEU B 1 90  ? 1.440   24.812  49.063  1.00   52.09  ? 842  LEU B CA  1 
ATOM   2005 C C   . LEU B 1 90  ? 2.394   24.663  50.214  1.00   47.56  ? 842  LEU B C   1 
ATOM   2006 O O   . LEU B 1 90  ? 3.616   24.654  50.056  1.00   53.29  ? 842  LEU B O   1 
ATOM   2007 C CB  . LEU B 1 90  ? 1.427   23.530  48.169  1.00   57.35  ? 842  LEU B CB  1 
ATOM   2008 C CG  . LEU B 1 90  ? 1.119   22.209  48.909  1.00   49.45  ? 842  LEU B CG  1 
ATOM   2009 C CD1 . LEU B 1 90  ? -0.378  22.209  49.470  1.00   44.32  ? 842  LEU B CD1 1 
ATOM   2010 C CD2 . LEU B 1 90  ? 1.388   21.043  47.980  1.00   46.97  ? 842  LEU B CD2 1 
ATOM   2011 N N   . HIS B 1 91  ? 1.812   24.561  51.390  1.00   52.81  ? 843  HIS B N   1 
ATOM   2012 C CA  . HIS B 1 91  ? 2.554   24.278  52.586  1.00   56.70  ? 843  HIS B CA  1 
ATOM   2013 C C   . HIS B 1 91  ? 2.060   22.941  53.237  1.00   51.30  ? 843  HIS B C   1 
ATOM   2014 O O   . HIS B 1 91  ? 0.887   22.757  53.593  1.00   56.35  ? 843  HIS B O   1 
ATOM   2015 C CB  . HIS B 1 91  ? 2.464   25.485  53.546  1.00   54.94  ? 843  HIS B CB  1 
ATOM   2016 C CG  . HIS B 1 91  ? 3.112   25.246  54.855  1.00   47.49  ? 843  HIS B CG  1 
ATOM   2017 N ND1 . HIS B 1 91  ? 2.392   25.010  56.006  1.00   58.23  ? 843  HIS B ND1 1 
ATOM   2018 C CD2 . HIS B 1 91  ? 4.422   25.186  55.202  1.00   55.69  ? 843  HIS B CD2 1 
ATOM   2019 C CE1 . HIS B 1 91  ? 3.233   24.833  57.012  1.00   68.59  ? 843  HIS B CE1 1 
ATOM   2020 N NE2 . HIS B 1 91  ? 4.469   24.922  56.546  1.00   53.10  ? 843  HIS B NE2 1 
ATOM   2021 N N   . VAL B 1 92  ? 2.993   22.013  53.367  1.00   55.14  ? 844  VAL B N   1 
ATOM   2022 C CA  . VAL B 1 92  ? 2.736   20.748  54.032  1.00   54.91  ? 844  VAL B CA  1 
ATOM   2023 C C   . VAL B 1 92  ? 3.615   20.703  55.282  1.00   47.15  ? 844  VAL B C   1 
ATOM   2024 O O   . VAL B 1 92  ? 4.823   20.731  55.170  1.00   50.08  ? 844  VAL B O   1 
ATOM   2025 C CB  . VAL B 1 92  ? 3.042   19.557  53.128  1.00   56.48  ? 844  VAL B CB  1 
ATOM   2026 C CG1 . VAL B 1 92  ? 3.001   18.241  53.962  1.00   56.64  ? 844  VAL B CG1 1 
ATOM   2027 C CG2 . VAL B 1 92  ? 2.016   19.543  51.909  1.00   54.56  ? 844  VAL B CG2 1 
ATOM   2028 N N   . PRO B 1 93  ? 3.007   20.649  56.466  1.00   44.30  ? 845  PRO B N   1 
ATOM   2029 C CA  . PRO B 1 93  ? 3.860   20.712  57.656  1.00   49.70  ? 845  PRO B CA  1 
ATOM   2030 C C   . PRO B 1 93  ? 4.840   19.526  57.734  1.00   56.01  ? 845  PRO B C   1 
ATOM   2031 O O   . PRO B 1 93  ? 4.511   18.404  57.346  1.00   54.72  ? 845  PRO B O   1 
ATOM   2032 C CB  . PRO B 1 93  ? 2.856   20.645  58.786  1.00   51.01  ? 845  PRO B CB  1 
ATOM   2033 C CG  . PRO B 1 93  ? 1.622   21.313  58.198  1.00   51.88  ? 845  PRO B CG  1 
ATOM   2034 C CD  . PRO B 1 93  ? 1.616   21.008  56.763  1.00   48.35  ? 845  PRO B CD  1 
ATOM   2035 N N   . GLU B 1 94  ? 6.041   19.779  58.218  1.00   61.20  ? 846  GLU B N   1 
ATOM   2036 C CA  . GLU B 1 94  ? 6.997   18.700  58.394  1.00   67.53  ? 846  GLU B CA  1 
ATOM   2037 C C   . GLU B 1 94  ? 6.513   17.848  59.599  1.00   71.09  ? 846  GLU B C   1 
ATOM   2038 O O   . GLU B 1 94  ? 5.914   18.380  60.528  1.00   70.57  ? 846  GLU B O   1 
ATOM   2039 C CB  . GLU B 1 94  ? 8.406   19.266  58.585  1.00   68.57  ? 846  GLU B CB  1 
ATOM   2040 C CG  . GLU B 1 94  ? 8.870   20.133  57.411  1.00   71.91  ? 846  GLU B CG  1 
ATOM   2041 C CD  . GLU B 1 94  ? 10.033  21.072  57.757  1.00   82.52  ? 846  GLU B CD  1 
ATOM   2042 O OE1 . GLU B 1 94  ? 10.618  21.641  56.808  1.00   81.63  ? 846  GLU B OE1 1 
ATOM   2043 O OE2 . GLU B 1 94  ? 10.362  21.264  58.954  1.00   80.60  ? 846  GLU B OE2 1 
ATOM   2044 N N   . GLY B 1 95  ? 6.717   16.529  59.553  1.00   73.31  ? 847  GLY B N   1 
ATOM   2045 C CA  . GLY B 1 95  ? 6.369   15.655  60.698  1.00   75.79  ? 847  GLY B CA  1 
ATOM   2046 C C   . GLY B 1 95  ? 6.038   14.226  60.300  1.00   74.83  ? 847  GLY B C   1 
ATOM   2047 O O   . GLY B 1 95  ? 6.398   13.283  61.012  1.00   82.03  ? 847  GLY B O   1 
ATOM   2048 N N   . ALA B 1 96  ? 5.324   14.091  59.180  1.00   68.94  ? 848  ALA B N   1 
ATOM   2049 C CA  . ALA B 1 96  ? 5.125   12.814  58.454  1.00   65.12  ? 848  ALA B CA  1 
ATOM   2050 C C   . ALA B 1 96  ? 6.424   12.096  58.039  1.00   58.68  ? 848  ALA B C   1 
ATOM   2051 O O   . ALA B 1 96  ? 7.350   12.730  57.565  1.00   60.85  ? 848  ALA B O   1 
ATOM   2052 C CB  . ALA B 1 96  ? 4.294   13.058  57.219  1.00   60.41  ? 848  ALA B CB  1 
ATOM   2053 N N   . THR B 1 97  ? 6.457   10.774  58.212  1.00   60.17  ? 849  THR B N   1 
ATOM   2054 C CA  . THR B 1 97  ? 7.570   9.932   57.755  1.00   63.95  ? 849  THR B CA  1 
ATOM   2055 C C   . THR B 1 97  ? 7.680   10.086  56.233  1.00   62.06  ? 849  THR B C   1 
ATOM   2056 O O   . THR B 1 97  ? 6.722   10.543  55.607  1.00   64.09  ? 849  THR B O   1 
ATOM   2057 C CB  . THR B 1 97  ? 7.353   8.428   58.118  1.00   60.58  ? 849  THR B CB  1 
ATOM   2058 O OG1 . THR B 1 97  ? 6.189   7.933   57.451  1.00   61.11  ? 849  THR B OG1 1 
ATOM   2059 C CG2 . THR B 1 97  ? 7.184   8.198   59.636  1.00   62.93  ? 849  THR B CG2 1 
ATOM   2060 N N   . PRO B 1 98  ? 8.852   9.735   55.640  1.00   62.83  ? 850  PRO B N   1 
ATOM   2061 C CA  . PRO B 1 98  ? 8.982   9.896   54.208  1.00   59.20  ? 850  PRO B CA  1 
ATOM   2062 C C   . PRO B 1 98  ? 7.940   9.050   53.508  1.00   56.24  ? 850  PRO B C   1 
ATOM   2063 O O   . PRO B 1 98  ? 7.179   9.544   52.695  1.00   52.60  ? 850  PRO B O   1 
ATOM   2064 C CB  . PRO B 1 98  ? 10.411  9.388   53.911  1.00   63.75  ? 850  PRO B CB  1 
ATOM   2065 C CG  . PRO B 1 98  ? 10.874  8.706   55.109  1.00   63.14  ? 850  PRO B CG  1 
ATOM   2066 C CD  . PRO B 1 98  ? 10.143  9.366   56.247  1.00   63.87  ? 850  PRO B CD  1 
ATOM   2067 N N   . LYS B 1 99  ? 7.860   7.783   53.913  1.00   59.16  ? 851  LYS B N   1 
ATOM   2068 C CA  . LYS B 1 99  ? 6.924   6.871   53.312  1.00   56.32  ? 851  LYS B CA  1 
ATOM   2069 C C   . LYS B 1 99  ? 5.472   7.375   53.406  1.00   49.85  ? 851  LYS B C   1 
ATOM   2070 O O   . LYS B 1 99  ? 4.664   7.041   52.583  1.00   52.31  ? 851  LYS B O   1 
ATOM   2071 C CB  . LYS B 1 99  ? 7.077   5.503   53.936  1.00   54.90  ? 851  LYS B CB  1 
ATOM   2072 C CG  . LYS B 1 99  ? 7.889   4.499   53.143  1.00   59.86  ? 851  LYS B CG  1 
ATOM   2073 C CD  . LYS B 1 99  ? 9.229   5.037   52.508  1.00   59.11  ? 851  LYS B CD  1 
ATOM   2074 C CE  . LYS B 1 99  ? 10.050  3.829   51.901  1.00   51.00  ? 851  LYS B CE  1 
ATOM   2075 N NZ  . LYS B 1 99  ? 10.752  4.076   50.565  1.00   49.08  ? 851  LYS B NZ  1 
ATOM   2076 N N   . ASP B 1 100 ? 5.146   8.182   54.401  1.00   50.64  ? 852  ASP B N   1 
ATOM   2077 C CA  . ASP B 1 100 ? 3.736   8.604   54.584  1.00   48.29  ? 852  ASP B CA  1 
ATOM   2078 C C   . ASP B 1 100 ? 3.348   9.832   53.790  1.00   43.62  ? 852  ASP B C   1 
ATOM   2079 O O   . ASP B 1 100 ? 2.201   10.323  53.848  1.00   45.19  ? 852  ASP B O   1 
ATOM   2080 C CB  . ASP B 1 100 ? 3.469   8.812   56.078  1.00   48.03  ? 852  ASP B CB  1 
ATOM   2081 C CG  . ASP B 1 100 ? 1.974   8.970   56.431  1.00   50.26  ? 852  ASP B CG  1 
ATOM   2082 O OD1 . ASP B 1 100 ? 1.725   9.951   57.159  1.00   46.22  ? 852  ASP B OD1 1 
ATOM   2083 O OD2 . ASP B 1 100 ? 1.092   8.121   56.036  1.00   45.55  ? 852  ASP B OD2 1 
ATOM   2084 N N   . GLY B 1 101 ? 4.288   10.395  53.095  1.00   54.54  ? 853  GLY B N   1 
ATOM   2085 C CA  . GLY B 1 101 ? 4.053   11.698  52.537  1.00   51.18  ? 853  GLY B CA  1 
ATOM   2086 C C   . GLY B 1 101 ? 2.947   11.843  51.531  1.00   47.57  ? 853  GLY B C   1 
ATOM   2087 O O   . GLY B 1 101 ? 2.219   12.783  51.604  1.00   49.92  ? 853  GLY B O   1 
ATOM   2088 N N   . PRO B 1 102 ? 2.824   10.910  50.607  1.00   48.58  ? 854  PRO B N   1 
ATOM   2089 C CA  . PRO B 1 102 ? 1.781   10.961  49.585  1.00   46.45  ? 854  PRO B CA  1 
ATOM   2090 C C   . PRO B 1 102 ? 0.351   10.731  50.009  1.00   35.29  ? 854  PRO B C   1 
ATOM   2091 O O   . PRO B 1 102 ? -0.582  11.000  49.197  1.00   37.65  ? 854  PRO B O   1 
ATOM   2092 C CB  . PRO B 1 102 ? 2.154   9.821   48.629  1.00   49.68  ? 854  PRO B CB  1 
ATOM   2093 C CG  . PRO B 1 102 ? 3.509   9.438   48.920  1.00   44.48  ? 854  PRO B CG  1 
ATOM   2094 C CD  . PRO B 1 102 ? 3.706   9.714   50.382  1.00   43.17  ? 854  PRO B CD  1 
ATOM   2095 N N   . SER B 1 103 ? 0.177   10.184  51.208  1.00   36.84  ? 855  SER B N   1 
ATOM   2096 C CA  . SER B 1 103 ? -1.157  9.998   51.797  1.00   42.08  ? 855  SER B CA  1 
ATOM   2097 C C   . SER B 1 103 ? -1.797  11.289  52.193  1.00   41.73  ? 855  SER B C   1 
ATOM   2098 O O   . SER B 1 103 ? -2.950  11.290  52.455  1.00   37.56  ? 855  SER B O   1 
ATOM   2099 C CB  . SER B 1 103 ? -1.123  9.214   53.074  1.00   39.21  ? 855  SER B CB  1 
ATOM   2100 O OG  . SER B 1 103 ? -0.393  9.851   54.136  1.00   40.38  ? 855  SER B OG  1 
ATOM   2101 N N   . ALA B 1 104 ? -1.011  12.366  52.254  1.00   41.81  ? 856  ALA B N   1 
ATOM   2102 C CA  . ALA B 1 104 ? -1.571  13.713  52.190  1.00   44.07  ? 856  ALA B CA  1 
ATOM   2103 C C   . ALA B 1 104 ? -2.215  14.021  50.832  1.00   41.09  ? 856  ALA B C   1 
ATOM   2104 O O   . ALA B 1 104 ? -2.845  15.057  50.661  1.00   44.54  ? 856  ALA B O   1 
ATOM   2105 C CB  . ALA B 1 104 ? -0.476  14.779  52.541  1.00   28.26  ? 856  ALA B CB  1 
ATOM   2106 N N   . GLY B 1 105 ? -1.982  13.181  49.828  1.00   38.24  ? 857  GLY B N   1 
ATOM   2107 C CA  . GLY B 1 105 ? -2.424  13.439  48.481  1.00   35.79  ? 857  GLY B CA  1 
ATOM   2108 C C   . GLY B 1 105 ? -3.890  13.894  48.370  1.00   41.87  ? 857  GLY B C   1 
ATOM   2109 O O   . GLY B 1 105 ? -4.176  14.907  47.702  1.00   40.21  ? 857  GLY B O   1 
ATOM   2110 N N   . CYS B 1 106 ? -4.838  13.222  49.035  1.00   44.80  ? 858  CYS B N   1 
ATOM   2111 C CA  . CYS B 1 106 ? -6.293  13.640  48.984  1.00   43.22  ? 858  CYS B CA  1 
ATOM   2112 C C   . CYS B 1 106 ? -6.591  14.975  49.804  1.00   48.38  ? 858  CYS B C   1 
ATOM   2113 O O   . CYS B 1 106 ? -7.517  15.740  49.500  1.00   46.27  ? 858  CYS B O   1 
ATOM   2114 C CB  . CYS B 1 106 ? -7.242  12.494  49.371  1.00   44.66  ? 858  CYS B CB  1 
ATOM   2115 S SG  . CYS B 1 106 ? -7.220  12.077  51.102  1.00   49.25  ? 858  CYS B SG  1 
ATOM   2116 N N   . THR B 1 107 ? -5.727  15.263  50.775  1.00   48.50  ? 859  THR B N   1 
ATOM   2117 C CA  . THR B 1 107 ? -5.694  16.517  51.524  1.00   43.22  ? 859  THR B CA  1 
ATOM   2118 C C   . THR B 1 107 ? -5.156  17.692  50.740  1.00   44.06  ? 859  THR B C   1 
ATOM   2119 O O   . THR B 1 107 ? -5.682  18.819  50.901  1.00   43.53  ? 859  THR B O   1 
ATOM   2120 C CB  . THR B 1 107 ? -4.772  16.338  52.754  1.00   50.63  ? 859  THR B CB  1 
ATOM   2121 O OG1 . THR B 1 107 ? -4.965  15.021  53.230  1.00   35.93  ? 859  THR B OG1 1 
ATOM   2122 C CG2 . THR B 1 107 ? -5.070  17.348  53.866  1.00   46.62  ? 859  THR B CG2 1 
ATOM   2123 N N   . ILE B 1 108 ? -4.162  17.441  49.904  1.00   42.17  ? 860  ILE B N   1 
ATOM   2124 C CA  . ILE B 1 108 ? -3.610  18.402  48.988  1.00   42.26  ? 860  ILE B CA  1 
ATOM   2125 C C   . ILE B 1 108 ? -4.606  18.787  47.903  1.00   42.40  ? 860  ILE B C   1 
ATOM   2126 O O   . ILE B 1 108 ? -4.675  19.902  47.518  1.00   44.75  ? 860  ILE B O   1 
ATOM   2127 C CB  . ILE B 1 108 ? -2.246  17.942  48.431  1.00   32.78  ? 860  ILE B CB  1 
ATOM   2128 C CG1 . ILE B 1 108 ? -1.204  17.990  49.507  1.00   42.75  ? 860  ILE B CG1 1 
ATOM   2129 C CG2 . ILE B 1 108 ? -1.779  18.806  47.389  1.00   26.69  ? 860  ILE B CG2 1 
ATOM   2130 C CD1 . ILE B 1 108 ? 0.036   17.318  49.169  1.00   32.70  ? 860  ILE B CD1 1 
ATOM   2131 N N   . VAL B 1 109 ? -5.354  17.847  47.385  1.00   41.89  ? 861  VAL B N   1 
ATOM   2132 C CA  . VAL B 1 109 ? -6.343  18.185  46.385  1.00   37.81  ? 861  VAL B CA  1 
ATOM   2133 C C   . VAL B 1 109 ? -7.448  19.014  46.978  1.00   46.37  ? 861  VAL B C   1 
ATOM   2134 O O   . VAL B 1 109 ? -7.800  20.012  46.438  1.00   44.57  ? 861  VAL B O   1 
ATOM   2135 C CB  . VAL B 1 109 ? -6.851  16.964  45.600  1.00   42.64  ? 861  VAL B CB  1 
ATOM   2136 C CG1 . VAL B 1 109 ? -6.940  15.832  46.470  1.00   46.00  ? 861  VAL B CG1 1 
ATOM   2137 C CG2 . VAL B 1 109 ? -8.214  17.205  44.956  1.00   30.55  ? 861  VAL B CG2 1 
ATOM   2138 N N   . THR B 1 110 ? -7.895  18.636  48.157  1.00   47.40  ? 862  THR B N   1 
ATOM   2139 C CA  . THR B 1 110 ? -8.972  19.300  48.836  1.00   49.73  ? 862  THR B CA  1 
ATOM   2140 C C   . THR B 1 110 ? -8.656  20.778  49.125  1.00   42.41  ? 862  THR B C   1 
ATOM   2141 O O   . THR B 1 110 ? -9.463  21.611  48.916  1.00   42.41  ? 862  THR B O   1 
ATOM   2142 C CB  . THR B 1 110 ? -9.334  18.565  50.154  1.00   50.26  ? 862  THR B CB  1 
ATOM   2143 O OG1 . THR B 1 110 ? -9.619  17.205  49.912  1.00   40.19  ? 862  THR B OG1 1 
ATOM   2144 C CG2 . THR B 1 110 ? -10.548 19.154  50.779  1.00   41.77  ? 862  THR B CG2 1 
ATOM   2145 N N   . ALA B 1 111 ? -7.463  21.086  49.559  1.00   46.03  ? 863  ALA B N   1 
ATOM   2146 C CA  . ALA B 1 111 ? -7.041  22.465  49.826  1.00   44.08  ? 863  ALA B CA  1 
ATOM   2147 C C   . ALA B 1 111 ? -7.037  23.331  48.611  1.00   51.55  ? 863  ALA B C   1 
ATOM   2148 O O   . ALA B 1 111 ? -7.294  24.562  48.716  1.00   47.62  ? 863  ALA B O   1 
ATOM   2149 C CB  . ALA B 1 111 ? -5.570  22.521  50.466  1.00   41.57  ? 863  ALA B CB  1 
ATOM   2150 N N   . LEU B 1 112 ? -6.595  22.745  47.485  1.00   47.15  ? 864  LEU B N   1 
ATOM   2151 C CA  . LEU B 1 112 ? -6.436  23.485  46.250  1.00   49.20  ? 864  LEU B CA  1 
ATOM   2152 C C   . LEU B 1 112 ? -7.831  23.911  45.898  1.00   42.44  ? 864  LEU B C   1 
ATOM   2153 O O   . LEU B 1 112 ? -8.013  25.039  45.532  1.00   44.90  ? 864  LEU B O   1 
ATOM   2154 C CB  . LEU B 1 112 ? -5.853  22.665  45.056  1.00   41.11  ? 864  LEU B CB  1 
ATOM   2155 C CG  . LEU B 1 112 ? -4.395  22.247  45.249  1.00   49.53  ? 864  LEU B CG  1 
ATOM   2156 C CD1 . LEU B 1 112 ? -3.988  21.156  44.288  1.00   53.82  ? 864  LEU B CD1 1 
ATOM   2157 C CD2 . LEU B 1 112 ? -3.461  23.468  45.143  1.00   45.66  ? 864  LEU B CD2 1 
ATOM   2158 N N   . LEU B 1 113 ? -8.769  22.982  46.003  1.00   40.99  ? 865  LEU B N   1 
ATOM   2159 C CA  . LEU B 1 113 ? -10.135 23.176  45.561  1.00   49.74  ? 865  LEU B CA  1 
ATOM   2160 C C   . LEU B 1 113 ? -10.774 24.119  46.588  1.00   51.45  ? 865  LEU B C   1 
ATOM   2161 O O   . LEU B 1 113 ? -11.376 25.125  46.198  1.00   60.94  ? 865  LEU B O   1 
ATOM   2162 C CB  . LEU B 1 113 ? -10.874 21.830  45.407  1.00   41.62  ? 865  LEU B CB  1 
ATOM   2163 C CG  . LEU B 1 113 ? -10.475 20.816  44.317  1.00   44.08  ? 865  LEU B CG  1 
ATOM   2164 C CD1 . LEU B 1 113 ? -10.914 19.356  44.760  1.00   42.23  ? 865  LEU B CD1 1 
ATOM   2165 C CD2 . LEU B 1 113 ? -10.956 21.140  42.867  1.00   44.98  ? 865  LEU B CD2 1 
ATOM   2166 N N   . SER B 1 114 ? -10.581 23.858  47.891  1.00   47.41  ? 866  SER B N   1 
ATOM   2167 C CA  . SER B 1 114 ? -11.061 24.803  48.913  1.00   49.53  ? 866  SER B CA  1 
ATOM   2168 C C   . SER B 1 114 ? -10.580 26.239  48.662  1.00   44.13  ? 866  SER B C   1 
ATOM   2169 O O   . SER B 1 114 ? -11.395 27.126  48.805  1.00   47.05  ? 866  SER B O   1 
ATOM   2170 C CB  . SER B 1 114 ? -10.757 24.380  50.334  1.00   47.12  ? 866  SER B CB  1 
ATOM   2171 O OG  . SER B 1 114 ? -11.005 25.415  51.254  1.00   53.02  ? 866  SER B OG  1 
ATOM   2172 N N   . LEU B 1 115 ? -9.309  26.458  48.287  1.00   48.06  ? 867  LEU B N   1 
ATOM   2173 C CA  . LEU B 1 115 ? -8.849  27.813  47.840  1.00   50.87  ? 867  LEU B CA  1 
ATOM   2174 C C   . LEU B 1 115 ? -9.647  28.223  46.598  1.00   55.44  ? 867  LEU B C   1 
ATOM   2175 O O   . LEU B 1 115 ? -10.347 29.239  46.590  1.00   58.82  ? 867  LEU B O   1 
ATOM   2176 C CB  . LEU B 1 115 ? -7.350  27.883  47.526  1.00   49.85  ? 867  LEU B CB  1 
ATOM   2177 C CG  . LEU B 1 115 ? -6.570  29.204  47.795  1.00   51.60  ? 867  LEU B CG  1 
ATOM   2178 C CD1 . LEU B 1 115 ? -6.699  29.696  49.190  1.00   41.18  ? 867  LEU B CD1 1 
ATOM   2179 C CD2 . LEU B 1 115 ? -5.088  29.160  47.495  1.00   43.14  ? 867  LEU B CD2 1 
ATOM   2180 N N   . ALA B 1 116 ? -9.577  27.388  45.571  1.00   50.41  ? 868  ALA B N   1 
ATOM   2181 C CA  . ALA B 1 116 ? -10.128 27.701  44.277  1.00   50.01  ? 868  ALA B CA  1 
ATOM   2182 C C   . ALA B 1 116 ? -11.547 28.287  44.376  1.00   54.15  ? 868  ALA B C   1 
ATOM   2183 O O   . ALA B 1 116 ? -11.917 29.244  43.653  1.00   49.80  ? 868  ALA B O   1 
ATOM   2184 C CB  . ALA B 1 116 ? -10.136 26.403  43.353  1.00   47.85  ? 868  ALA B CB  1 
ATOM   2185 N N   . MET B 1 117 ? -12.353 27.684  45.253  1.00   50.94  ? 869  MET B N   1 
ATOM   2186 C CA  . MET B 1 117 ? -13.732 28.066  45.358  1.00   48.94  ? 869  MET B CA  1 
ATOM   2187 C C   . MET B 1 117 ? -13.992 29.150  46.507  1.00   55.62  ? 869  MET B C   1 
ATOM   2188 O O   . MET B 1 117 ? -15.167 29.418  46.853  1.00   55.01  ? 869  MET B O   1 
ATOM   2189 C CB  . MET B 1 117 ? -14.580 26.807  45.485  1.00   50.89  ? 869  MET B CB  1 
ATOM   2190 C CG  . MET B 1 117 ? -14.356 25.744  44.426  1.00   49.43  ? 869  MET B CG  1 
ATOM   2191 S SD  . MET B 1 117 ? -15.302 24.209  44.699  1.00   60.03  ? 869  MET B SD  1 
ATOM   2192 C CE  . MET B 1 117 ? -14.858 23.891  46.430  1.00   74.17  ? 869  MET B CE  1 
ATOM   2193 N N   . GLY B 1 118 ? -12.912 29.609  47.133  1.00   54.68  ? 870  GLY B N   1 
ATOM   2194 C CA  . GLY B 1 118 ? -12.945 30.532  48.248  1.00   52.88  ? 870  GLY B CA  1 
ATOM   2195 C C   . GLY B 1 118 ? -13.804 29.975  49.362  1.00   57.06  ? 870  GLY B C   1 
ATOM   2196 O O   . GLY B 1 118 ? -14.364 30.706  50.134  1.00   55.62  ? 870  GLY B O   1 
ATOM   2197 N N   . ARG B 1 119 ? -13.869 28.664  49.449  1.00   57.29  ? 871  ARG B N   1 
ATOM   2198 C CA  . ARG B 1 119 ? -14.845 27.978  50.236  1.00   53.57  ? 871  ARG B CA  1 
ATOM   2199 C C   . ARG B 1 119 ? -14.156 27.099  51.270  1.00   54.81  ? 871  ARG B C   1 
ATOM   2200 O O   . ARG B 1 119 ? -13.448 26.155  50.913  1.00   51.67  ? 871  ARG B O   1 
ATOM   2201 C CB  . ARG B 1 119 ? -15.688 27.121  49.330  1.00   55.70  ? 871  ARG B CB  1 
ATOM   2202 C CG  . ARG B 1 119 ? -16.792 26.355  50.030  1.00   53.96  ? 871  ARG B CG  1 
ATOM   2203 C CD  . ARG B 1 119 ? -17.908 26.185  49.059  1.00   59.14  ? 871  ARG B CD  1 
ATOM   2204 N NE  . ARG B 1 119 ? -18.652 24.938  49.245  1.00   59.47  ? 871  ARG B NE  1 
ATOM   2205 C CZ  . ARG B 1 119 ? -19.467 24.674  50.262  1.00   56.76  ? 871  ARG B CZ  1 
ATOM   2206 N NH1 . ARG B 1 119 ? -19.657 25.554  51.228  1.00   59.28  ? 871  ARG B NH1 1 
ATOM   2207 N NH2 . ARG B 1 119 ? -20.122 23.499  50.320  1.00   52.58  ? 871  ARG B NH2 1 
ATOM   2208 N N   . PRO B 1 120 ? -14.359 27.409  52.561  1.00   52.91  ? 872  PRO B N   1 
ATOM   2209 C CA  . PRO B 1 120 ? -13.805 26.556  53.614  1.00   48.08  ? 872  PRO B CA  1 
ATOM   2210 C C   . PRO B 1 120 ? -14.306 25.139  53.579  1.00   51.76  ? 872  PRO B C   1 
ATOM   2211 O O   . PRO B 1 120 ? -15.442 24.835  53.158  1.00   50.90  ? 872  PRO B O   1 
ATOM   2212 C CB  . PRO B 1 120 ? -14.243 27.273  54.919  1.00   54.81  ? 872  PRO B CB  1 
ATOM   2213 C CG  . PRO B 1 120 ? -14.290 28.770  54.518  1.00   46.28  ? 872  PRO B CG  1 
ATOM   2214 C CD  . PRO B 1 120 ? -14.682 28.773  53.044  1.00   48.16  ? 872  PRO B CD  1 
ATOM   2215 N N   . VAL B 1 121 ? -13.469 24.257  54.052  1.00   54.05  ? 873  VAL B N   1 
ATOM   2216 C CA  . VAL B 1 121 ? -13.824 22.885  54.141  1.00   51.13  ? 873  VAL B CA  1 
ATOM   2217 C C   . VAL B 1 121 ? -14.755 22.712  55.310  1.00   55.19  ? 873  VAL B C   1 
ATOM   2218 O O   . VAL B 1 121 ? -14.744 23.467  56.233  1.00   46.78  ? 873  VAL B O   1 
ATOM   2219 C CB  . VAL B 1 121 ? -12.586 22.017  54.363  1.00   58.59  ? 873  VAL B CB  1 
ATOM   2220 C CG1 . VAL B 1 121 ? -12.114 21.459  53.080  1.00   39.21  ? 873  VAL B CG1 1 
ATOM   2221 C CG2 . VAL B 1 121 ? -11.485 22.848  54.985  1.00   55.81  ? 873  VAL B CG2 1 
ATOM   2222 N N   . ARG B 1 122 ? -15.510 21.645  55.262  1.00   56.60  ? 874  ARG B N   1 
ATOM   2223 C CA  . ARG B 1 122 ? -16.393 21.296  56.297  1.00   56.08  ? 874  ARG B CA  1 
ATOM   2224 C C   . ARG B 1 122 ? -15.599 21.221  57.603  1.00   61.68  ? 874  ARG B C   1 
ATOM   2225 O O   . ARG B 1 122 ? -14.504 20.725  57.663  1.00   59.40  ? 874  ARG B O   1 
ATOM   2226 C CB  . ARG B 1 122 ? -16.973 19.939  55.966  1.00   57.36  ? 874  ARG B CB  1 
ATOM   2227 C CG  . ARG B 1 122 ? -17.744 19.314  57.049  1.00   58.35  ? 874  ARG B CG  1 
ATOM   2228 C CD  . ARG B 1 122 ? -18.060 17.955  56.686  1.00   50.14  ? 874  ARG B CD  1 
ATOM   2229 N NE  . ARG B 1 122 ? -18.456 17.164  57.815  1.00   45.72  ? 874  ARG B NE  1 
ATOM   2230 C CZ  . ARG B 1 122 ? -19.297 16.153  57.707  1.00   60.33  ? 874  ARG B CZ  1 
ATOM   2231 N NH1 . ARG B 1 122 ? -19.785 15.835  56.531  1.00   49.12  ? 874  ARG B NH1 1 
ATOM   2232 N NH2 . ARG B 1 122 ? -19.657 15.464  58.765  1.00   55.46  ? 874  ARG B NH2 1 
ATOM   2233 N N   . GLN B 1 123 ? -16.185 21.769  58.649  1.00   59.43  ? 875  GLN B N   1 
ATOM   2234 C CA  . GLN B 1 123 ? -15.606 21.805  59.953  1.00   61.87  ? 875  GLN B CA  1 
ATOM   2235 C C   . GLN B 1 123 ? -15.621 20.374  60.431  1.00   56.62  ? 875  GLN B C   1 
ATOM   2236 O O   . GLN B 1 123 ? -16.457 19.622  60.011  1.00   57.79  ? 875  GLN B O   1 
ATOM   2237 C CB  . GLN B 1 123 ? -16.507 22.677  60.819  1.00   63.78  ? 875  GLN B CB  1 
ATOM   2238 C CG  . GLN B 1 123 ? -15.845 23.467  61.960  1.00   69.85  ? 875  GLN B CG  1 
ATOM   2239 C CD  . GLN B 1 123 ? -16.847 24.156  62.907  1.00   76.20  ? 875  GLN B CD  1 
ATOM   2240 O OE1 . GLN B 1 123 ? -17.653 23.507  63.571  1.00   68.67  ? 875  GLN B OE1 1 
ATOM   2241 N NE2 . GLN B 1 123 ? -16.771 25.476  62.974  1.00   72.43  ? 875  GLN B NE2 1 
ATOM   2242 N N   . ASN B 1 124 ? -14.680 19.991  61.278  1.00   59.98  ? 876  ASN B N   1 
ATOM   2243 C CA  . ASN B 1 124 ? -14.648 18.623  61.868  1.00   59.56  ? 876  ASN B CA  1 
ATOM   2244 C C   . ASN B 1 124 ? -14.334 17.437  60.892  1.00   61.61  ? 876  ASN B C   1 
ATOM   2245 O O   . ASN B 1 124 ? -14.795 16.268  61.098  1.00   54.42  ? 876  ASN B O   1 
ATOM   2246 C CB  . ASN B 1 124 ? -15.967 18.315  62.617  1.00   62.17  ? 876  ASN B CB  1 
ATOM   2247 C CG  . ASN B 1 124 ? -15.950 16.936  63.267  1.00   65.39  ? 876  ASN B CG  1 
ATOM   2248 O OD1 . ASN B 1 124 ? -14.957 16.554  63.876  1.00   68.02  ? 876  ASN B OD1 1 
ATOM   2249 N ND2 . ASN B 1 124 ? -17.034 16.182  63.129  1.00   57.78  ? 876  ASN B ND2 1 
ATOM   2250 N N   . LEU B 1 125 ? -13.573 17.722  59.837  1.00   50.79  ? 877  LEU B N   1 
ATOM   2251 C CA  . LEU B 1 125 ? -13.232 16.693  58.870  1.00   52.59  ? 877  LEU B CA  1 
ATOM   2252 C C   . LEU B 1 125 ? -11.758 16.473  58.836  1.00   49.18  ? 877  LEU B C   1 
ATOM   2253 O O   . LEU B 1 125 ? -10.978 17.440  58.798  1.00   44.45  ? 877  LEU B O   1 
ATOM   2254 C CB  . LEU B 1 125 ? -13.661 17.084  57.453  1.00   52.41  ? 877  LEU B CB  1 
ATOM   2255 C CG  . LEU B 1 125 ? -13.767 15.902  56.505  1.00   62.51  ? 877  LEU B CG  1 
ATOM   2256 C CD1 . LEU B 1 125 ? -14.440 14.739  57.198  1.00   63.90  ? 877  LEU B CD1 1 
ATOM   2257 C CD2 . LEU B 1 125 ? -14.482 16.279  55.179  1.00   45.39  ? 877  LEU B CD2 1 
ATOM   2258 N N   . ALA B 1 126 ? -11.398 15.188  58.760  1.00   51.84  ? 878  ALA B N   1 
ATOM   2259 C CA  . ALA B 1 126 ? -10.050 14.722  58.557  1.00   45.56  ? 878  ALA B CA  1 
ATOM   2260 C C   . ALA B 1 126 ? -9.994  13.635  57.451  1.00   47.67  ? 878  ALA B C   1 
ATOM   2261 O O   . ALA B 1 126 ? -10.940 12.883  57.234  1.00   48.13  ? 878  ALA B O   1 
ATOM   2262 C CB  . ALA B 1 126 ? -9.541  14.232  59.828  1.00   43.06  ? 878  ALA B CB  1 
ATOM   2263 N N   . MET B 1 127 ? -8.907  13.609  56.677  1.00   53.97  ? 879  MET B N   1 
ATOM   2264 C CA  . MET B 1 127 ? -8.738  12.566  55.645  1.00   46.82  ? 879  MET B CA  1 
ATOM   2265 C C   . MET B 1 127 ? -7.294  12.174  55.476  1.00   42.37  ? 879  MET B C   1 
ATOM   2266 O O   . MET B 1 127 ? -6.348  12.893  55.880  1.00   40.85  ? 879  MET B O   1 
ATOM   2267 C CB  . MET B 1 127 ? -9.344  13.007  54.307  1.00   45.91  ? 879  MET B CB  1 
ATOM   2268 C CG  . MET B 1 127 ? -8.510  14.093  53.701  1.00   32.54  ? 879  MET B CG  1 
ATOM   2269 S SD  . MET B 1 127 ? -9.180  14.724  52.299  1.00   45.49  ? 879  MET B SD  1 
ATOM   2270 C CE  . MET B 1 127 ? -10.543 15.710  52.952  1.00   45.12  ? 879  MET B CE  1 
ATOM   2271 N N   . THR B 1 128 ? -7.117  10.983  54.920  1.00   40.00  ? 880  THR B N   1 
ATOM   2272 C CA  . THR B 1 128 ? -5.814  10.513  54.532  1.00   35.80  ? 880  THR B CA  1 
ATOM   2273 C C   . THR B 1 128 ? -6.073  9.708   53.324  1.00   40.31  ? 880  THR B C   1 
ATOM   2274 O O   . THR B 1 128 ? -7.197  9.147   53.159  1.00   41.77  ? 880  THR B O   1 
ATOM   2275 C CB  . THR B 1 128 ? -5.092  9.712   55.616  1.00   37.40  ? 880  THR B CB  1 
ATOM   2276 O OG1 . THR B 1 128 ? -3.706  9.517   55.208  1.00   35.13  ? 880  THR B OG1 1 
ATOM   2277 C CG2 . THR B 1 128 ? -5.750  8.288   55.878  1.00   45.85  ? 880  THR B CG2 1 
ATOM   2278 N N   . GLY B 1 129 ? -5.088  9.694   52.441  1.00   43.73  ? 881  GLY B N   1 
ATOM   2279 C CA  . GLY B 1 129 ? -5.172  8.872   51.244  1.00   42.50  ? 881  GLY B CA  1 
ATOM   2280 C C   . GLY B 1 129 ? -4.389  9.387   50.056  1.00   44.07  ? 881  GLY B C   1 
ATOM   2281 O O   . GLY B 1 129 ? -4.535  10.552  49.654  1.00   37.59  ? 881  GLY B O   1 
ATOM   2282 N N   . GLU B 1 130 ? -3.614  8.494   49.419  1.00   34.14  ? 882  GLU B N   1 
ATOM   2283 C CA  . GLU B 1 130 ? -2.964  8.809   48.150  1.00   40.08  ? 882  GLU B CA  1 
ATOM   2284 C C   . GLU B 1 130 ? -3.944  8.912   46.967  1.00   38.45  ? 882  GLU B C   1 
ATOM   2285 O O   . GLU B 1 130 ? -4.923  8.096   46.820  1.00   40.19  ? 882  GLU B O   1 
ATOM   2286 C CB  . GLU B 1 130 ? -1.801  7.791   47.949  1.00   47.83  ? 882  GLU B CB  1 
ATOM   2287 C CG  . GLU B 1 130 ? -1.030  7.933   46.694  1.00   43.82  ? 882  GLU B CG  1 
ATOM   2288 C CD  . GLU B 1 130 ? -0.053  6.751   46.488  1.00   46.13  ? 882  GLU B CD  1 
ATOM   2289 O OE1 . GLU B 1 130 ? 0.487   6.211   47.471  1.00   39.34  ? 882  GLU B OE1 1 
ATOM   2290 O OE2 . GLU B 1 130 ? 0.178   6.437   45.309  1.00   51.54  ? 882  GLU B OE2 1 
ATOM   2291 N N   . VAL B 1 131 ? -3.768  9.960   46.176  1.00   37.89  ? 883  VAL B N   1 
ATOM   2292 C CA  . VAL B 1 131 ? -4.477  10.114  44.933  1.00   35.88  ? 883  VAL B CA  1 
ATOM   2293 C C   . VAL B 1 131 ? -3.556  10.003  43.663  1.00   38.04  ? 883  VAL B C   1 
ATOM   2294 O O   . VAL B 1 131 ? -2.426  10.512  43.632  1.00   42.64  ? 883  VAL B O   1 
ATOM   2295 C CB  . VAL B 1 131 ? -5.285  11.456  44.892  1.00   42.66  ? 883  VAL B CB  1 
ATOM   2296 C CG1 . VAL B 1 131 ? -4.333  12.624  44.687  1.00   38.25  ? 883  VAL B CG1 1 
ATOM   2297 C CG2 . VAL B 1 131 ? -6.297  11.405  43.780  1.00   29.16  ? 883  VAL B CG2 1 
ATOM   2298 N N   . SER B 1 132 ? -4.093  9.305   42.679  1.00   31.38  ? 884  SER B N   1 
ATOM   2299 C CA  . SER B 1 132 ? -3.616  9.026   41.294  1.00   35.84  ? 884  SER B CA  1 
ATOM   2300 C C   . SER B 1 132 ? -4.141  10.129  40.425  1.00   41.79  ? 884  SER B C   1 
ATOM   2301 O O   . SER B 1 132 ? -5.067  10.901  40.866  1.00   39.15  ? 884  SER B O   1 
ATOM   2302 C CB  . SER B 1 132 ? -4.097  7.628   40.853  1.00   38.19  ? 884  SER B CB  1 
ATOM   2303 O OG  . SER B 1 132 ? -5.354  7.537   40.063  1.00   39.19  ? 884  SER B OG  1 
ATOM   2304 N N   . LEU B 1 133 ? -3.433  10.353  39.335  1.00   31.35  ? 885  LEU B N   1 
ATOM   2305 C CA  . LEU B 1 133 ? -3.793  11.350  38.236  1.00   37.68  ? 885  LEU B CA  1 
ATOM   2306 C C   . LEU B 1 133 ? -5.288  11.265  37.811  1.00   42.62  ? 885  LEU B C   1 
ATOM   2307 O O   . LEU B 1 133 ? -5.999  12.240  37.542  1.00   39.67  ? 885  LEU B O   1 
ATOM   2308 C CB  . LEU B 1 133 ? -2.994  11.027  36.970  1.00   33.05  ? 885  LEU B CB  1 
ATOM   2309 C CG  . LEU B 1 133 ? -2.057  12.041  36.281  1.00   29.94  ? 885  LEU B CG  1 
ATOM   2310 C CD1 . LEU B 1 133 ? -1.884  11.893  34.723  1.00   31.20  ? 885  LEU B CD1 1 
ATOM   2311 C CD2 . LEU B 1 133 ? -2.255  13.512  36.773  1.00   22.83  ? 885  LEU B CD2 1 
ATOM   2312 N N   . THR B 1 134 ? -5.776  10.072  37.618  1.00   40.98  ? 886  THR B N   1 
ATOM   2313 C CA  . THR B 1 134 ? -7.193  10.015  37.267  1.00   40.79  ? 886  THR B CA  1 
ATOM   2314 C C   . THR B 1 134 ? -8.102  10.046  38.498  1.00   42.40  ? 886  THR B C   1 
ATOM   2315 O O   . THR B 1 134 ? -9.326  10.254  38.373  1.00   50.35  ? 886  THR B O   1 
ATOM   2316 C CB  . THR B 1 134 ? -7.445  8.838   36.388  1.00   39.48  ? 886  THR B CB  1 
ATOM   2317 O OG1 . THR B 1 134 ? -6.851  7.710   36.983  1.00   46.76  ? 886  THR B OG1 1 
ATOM   2318 C CG2 . THR B 1 134 ? -6.782  9.027   34.990  1.00   43.02  ? 886  THR B CG2 1 
ATOM   2319 N N   . GLY B 1 135 ? -7.563  9.829   39.689  1.00   41.88  ? 887  GLY B N   1 
ATOM   2320 C CA  . GLY B 1 135 ? -8.290  10.200  40.879  1.00   44.75  ? 887  GLY B CA  1 
ATOM   2321 C C   . GLY B 1 135 ? -8.614  9.049   41.747  1.00   49.05  ? 887  GLY B C   1 
ATOM   2322 O O   . GLY B 1 135 ? -9.217  9.245   42.813  1.00   50.82  ? 887  GLY B O   1 
ATOM   2323 N N   . LYS B 1 136 ? -8.215  7.838   41.329  1.00   48.99  ? 888  LYS B N   1 
ATOM   2324 C CA  . LYS B 1 136 ? -8.257  6.688   42.235  1.00   48.95  ? 888  LYS B CA  1 
ATOM   2325 C C   . LYS B 1 136 ? -7.609  6.989   43.598  1.00   47.85  ? 888  LYS B C   1 
ATOM   2326 O O   . LYS B 1 136 ? -6.568  7.623   43.645  1.00   49.27  ? 888  LYS B O   1 
ATOM   2327 C CB  . LYS B 1 136 ? -7.550  5.510   41.587  1.00   49.23  ? 888  LYS B CB  1 
ATOM   2328 C CG  . LYS B 1 136 ? -7.697  4.202   42.312  1.00   46.01  ? 888  LYS B CG  1 
ATOM   2329 C CD  . LYS B 1 136 ? -8.988  3.493   42.005  1.00   64.02  ? 888  LYS B CD  1 
ATOM   2330 C CE  . LYS B 1 136 ? -9.186  2.289   42.869  1.00   48.79  ? 888  LYS B CE  1 
ATOM   2331 N NZ  . LYS B 1 136 ? -9.115  2.527   44.349  1.00   52.16  ? 888  LYS B NZ  1 
ATOM   2332 N N   . ILE B 1 137 ? -8.233  6.513   44.678  1.00   46.60  ? 889  ILE B N   1 
ATOM   2333 C CA  . ILE B 1 137 ? -7.768  6.671   46.042  1.00   39.71  ? 889  ILE B CA  1 
ATOM   2334 C C   . ILE B 1 137 ? -7.036  5.449   46.432  1.00   44.47  ? 889  ILE B C   1 
ATOM   2335 O O   . ILE B 1 137 ? -7.547  4.373   46.263  1.00   39.86  ? 889  ILE B O   1 
ATOM   2336 C CB  . ILE B 1 137 ? -8.934  6.964   47.002  1.00   40.38  ? 889  ILE B CB  1 
ATOM   2337 C CG1 . ILE B 1 137 ? -9.566  8.279   46.569  1.00   39.13  ? 889  ILE B CG1 1 
ATOM   2338 C CG2 . ILE B 1 137 ? -8.435  7.086   48.519  1.00   37.32  ? 889  ILE B CG2 1 
ATOM   2339 C CD1 . ILE B 1 137 ? -8.504  9.580   46.672  1.00   32.07  ? 889  ILE B CD1 1 
ATOM   2340 N N   . LEU B 1 138 ? -5.778  5.628   46.806  1.00   43.75  ? 890  LEU B N   1 
ATOM   2341 C CA  . LEU B 1 138 ? -4.874  4.534   47.104  1.00   52.20  ? 890  LEU B CA  1 
ATOM   2342 C C   . LEU B 1 138 ? -4.679  4.363   48.603  1.00   46.26  ? 890  LEU B C   1 
ATOM   2343 O O   . LEU B 1 138 ? -4.662  5.347   49.338  1.00   45.61  ? 890  LEU B O   1 
ATOM   2344 C CB  . LEU B 1 138 ? -3.512  4.754   46.406  1.00   47.05  ? 890  LEU B CB  1 
ATOM   2345 C CG  . LEU B 1 138 ? -3.326  4.018   45.073  1.00   50.06  ? 890  LEU B CG  1 
ATOM   2346 C CD1 . LEU B 1 138 ? -4.509  4.076   44.093  1.00   45.63  ? 890  LEU B CD1 1 
ATOM   2347 C CD2 . LEU B 1 138 ? -1.999  4.460   44.398  1.00   47.76  ? 890  LEU B CD2 1 
ATOM   2348 N N   . PRO B 1 139 ? -4.532  3.092   49.074  1.00   47.62  ? 891  PRO B N   1 
ATOM   2349 C CA  . PRO B 1 139 ? -4.423  2.865   50.489  1.00   43.08  ? 891  PRO B CA  1 
ATOM   2350 C C   . PRO B 1 139 ? -3.122  3.379   51.059  1.00   45.97  ? 891  PRO B C   1 
ATOM   2351 O O   . PRO B 1 139 ? -2.101  3.405   50.386  1.00   45.31  ? 891  PRO B O   1 
ATOM   2352 C CB  . PRO B 1 139 ? -4.385  1.314   50.604  1.00   53.15  ? 891  PRO B CB  1 
ATOM   2353 C CG  . PRO B 1 139 ? -3.978  0.841   49.188  1.00   45.44  ? 891  PRO B CG  1 
ATOM   2354 C CD  . PRO B 1 139 ? -4.732  1.807   48.351  1.00   44.37  ? 891  PRO B CD  1 
ATOM   2355 N N   . VAL B 1 140 ? -3.164  3.688   52.328  1.00   38.18  ? 892  VAL B N   1 
ATOM   2356 C CA  . VAL B 1 140 ? -2.014  4.193   53.099  1.00   43.38  ? 892  VAL B CA  1 
ATOM   2357 C C   . VAL B 1 140 ? -1.865  3.437   54.354  1.00   44.46  ? 892  VAL B C   1 
ATOM   2358 O O   . VAL B 1 140 ? -2.715  2.577   54.676  1.00   50.54  ? 892  VAL B O   1 
ATOM   2359 C CB  . VAL B 1 140 ? -2.260  5.672   53.378  1.00   35.97  ? 892  VAL B CB  1 
ATOM   2360 C CG1 . VAL B 1 140 ? -2.591  6.271   52.059  1.00   31.42  ? 892  VAL B CG1 1 
ATOM   2361 C CG2 . VAL B 1 140 ? -3.397  5.861   54.377  1.00   49.44  ? 892  VAL B CG2 1 
ATOM   2362 N N   . GLY B 1 141 ? -0.827  3.768   55.101  1.00   43.90  ? 893  GLY B N   1 
ATOM   2363 C CA  . GLY B 1 141 ? -0.628  3.226   56.406  1.00   46.46  ? 893  GLY B CA  1 
ATOM   2364 C C   . GLY B 1 141 ? -0.880  4.193   57.559  1.00   46.44  ? 893  GLY B C   1 
ATOM   2365 O O   . GLY B 1 141 ? -1.356  5.353   57.347  1.00   52.10  ? 893  GLY B O   1 
ATOM   2366 N N   . GLY B 1 142 ? -0.596  3.721   58.770  1.00   45.28  ? 894  GLY B N   1 
ATOM   2367 C CA  . GLY B 1 142 ? -0.836  4.489   59.994  1.00   44.73  ? 894  GLY B CA  1 
ATOM   2368 C C   . GLY B 1 142 ? -2.292  4.739   60.283  1.00   50.53  ? 894  GLY B C   1 
ATOM   2369 O O   . GLY B 1 142 ? -2.719  5.836   60.748  1.00   51.09  ? 894  GLY B O   1 
ATOM   2370 N N   . ILE B 1 143 ? -3.098  3.728   59.999  1.00   47.69  ? 895  ILE B N   1 
ATOM   2371 C CA  . ILE B 1 143 ? -4.506  3.915   60.122  1.00   46.61  ? 895  ILE B CA  1 
ATOM   2372 C C   . ILE B 1 143 ? -4.826  4.191   61.580  1.00   39.49  ? 895  ILE B C   1 
ATOM   2373 O O   . ILE B 1 143 ? -5.618  5.065   61.846  1.00   37.61  ? 895  ILE B O   1 
ATOM   2374 C CB  . ILE B 1 143 ? -5.305  2.740   59.544  1.00   38.71  ? 895  ILE B CB  1 
ATOM   2375 C CG1 . ILE B 1 143 ? -5.073  2.718   58.076  1.00   37.09  ? 895  ILE B CG1 1 
ATOM   2376 C CG2 . ILE B 1 143 ? -6.822  2.952   59.750  1.00   42.93  ? 895  ILE B CG2 1 
ATOM   2377 C CD1 . ILE B 1 143 ? -5.391  4.058   57.253  1.00   40.78  ? 895  ILE B CD1 1 
ATOM   2378 N N   . LYS B 1 144 ? -4.200  3.444   62.490  1.00   37.41  ? 896  LYS B N   1 
ATOM   2379 C CA  . LYS B 1 144 ? -4.437  3.514   63.875  1.00   37.09  ? 896  LYS B CA  1 
ATOM   2380 C C   . LYS B 1 144 ? -3.941  4.848   64.393  1.00   44.54  ? 896  LYS B C   1 
ATOM   2381 O O   . LYS B 1 144 ? -4.594  5.484   65.172  1.00   41.94  ? 896  LYS B O   1 
ATOM   2382 C CB  . LYS B 1 144 ? -3.703  2.371   64.633  1.00   46.49  ? 896  LYS B CB  1 
ATOM   2383 C CG  . LYS B 1 144 ? -3.557  2.538   66.167  1.00   46.06  ? 896  LYS B CG  1 
ATOM   2384 C CD  . LYS B 1 144 ? -2.557  1.469   66.789  1.00   58.60  ? 896  LYS B CD  1 
ATOM   2385 C CE  . LYS B 1 144 ? -2.657  1.395   68.301  1.00   57.18  ? 896  LYS B CE  1 
ATOM   2386 N NZ  . LYS B 1 144 ? -2.617  0.001   68.848  1.00   63.91  ? 896  LYS B NZ  1 
ATOM   2387 N N   . GLU B 1 145 ? -2.742  5.217   64.003  1.00   44.51  ? 897  GLU B N   1 
ATOM   2388 C CA  . GLU B 1 145 ? -2.088  6.356   64.572  1.00   49.95  ? 897  GLU B CA  1 
ATOM   2389 C C   . GLU B 1 145 ? -2.909  7.555   64.179  1.00   43.85  ? 897  GLU B C   1 
ATOM   2390 O O   . GLU B 1 145 ? -3.238  8.374   65.036  1.00   46.12  ? 897  GLU B O   1 
ATOM   2391 C CB  . GLU B 1 145 ? -0.635  6.469   64.138  1.00   45.54  ? 897  GLU B CB  1 
ATOM   2392 C CG  . GLU B 1 145 ? 0.270   5.583   64.876  1.00   56.24  ? 897  GLU B CG  1 
ATOM   2393 C CD  . GLU B 1 145 ? 0.385   4.165   64.322  1.00   61.14  ? 897  GLU B CD  1 
ATOM   2394 O OE1 . GLU B 1 145 ? 1.278   3.471   64.869  1.00   60.96  ? 897  GLU B OE1 1 
ATOM   2395 O OE2 . GLU B 1 145 ? -0.378  3.750   63.385  1.00   52.04  ? 897  GLU B OE2 1 
ATOM   2396 N N   . LYS B 1 146 ? -3.357  7.551   62.966  1.00   42.18  ? 898  LYS B N   1 
ATOM   2397 C CA  . LYS B 1 146 ? -4.125  8.634   62.405  1.00   47.15  ? 898  LYS B CA  1 
ATOM   2398 C C   . LYS B 1 146 ? -5.557  8.665   62.936  1.00   49.82  ? 898  LYS B C   1 
ATOM   2399 O O   . LYS B 1 146 ? -6.193  9.703   62.987  1.00   42.04  ? 898  LYS B O   1 
ATOM   2400 C CB  . LYS B 1 146 ? -4.162  8.435   60.908  1.00   50.85  ? 898  LYS B CB  1 
ATOM   2401 C CG  . LYS B 1 146 ? -2.767  8.582   60.233  1.00   50.40  ? 898  LYS B CG  1 
ATOM   2402 C CD  . LYS B 1 146 ? -2.871  8.175   58.788  1.00   43.83  ? 898  LYS B CD  1 
ATOM   2403 C CE  . LYS B 1 146 ? -1.563  8.303   58.096  1.00   31.28  ? 898  LYS B CE  1 
ATOM   2404 N NZ  . LYS B 1 146 ? -1.641  8.119   56.654  1.00   26.92  ? 898  LYS B NZ  1 
ATOM   2405 N N   . THR B 1 147 ? -6.117  7.509   63.261  1.00   45.53  ? 899  THR B N   1 
ATOM   2406 C CA  . THR B 1 147 ? -7.476  7.509   63.637  1.00   46.60  ? 899  THR B CA  1 
ATOM   2407 C C   . THR B 1 147 ? -7.449  7.964   65.089  1.00   42.56  ? 899  THR B C   1 
ATOM   2408 O O   . THR B 1 147 ? -8.336  8.728   65.485  1.00   45.44  ? 899  THR B O   1 
ATOM   2409 C CB  . THR B 1 147 ? -8.148  6.134   63.480  1.00   46.60  ? 899  THR B CB  1 
ATOM   2410 O OG1 . THR B 1 147 ? -8.135  5.756   62.111  1.00   50.71  ? 899  THR B OG1 1 
ATOM   2411 C CG2 . THR B 1 147 ? -9.609  6.177   64.014  1.00   41.88  ? 899  THR B CG2 1 
ATOM   2412 N N   . ILE B 1 148 ? -6.385  7.613   65.827  1.00   41.94  ? 900  ILE B N   1 
ATOM   2413 C CA  . ILE B 1 148 ? -6.244  8.044   67.223  1.00   41.56  ? 900  ILE B CA  1 
ATOM   2414 C C   . ILE B 1 148 ? -6.091  9.605   67.259  1.00   47.41  ? 900  ILE B C   1 
ATOM   2415 O O   . ILE B 1 148 ? -6.751  10.316  68.041  1.00   42.80  ? 900  ILE B O   1 
ATOM   2416 C CB  . ILE B 1 148 ? -5.044  7.365   67.991  1.00   41.10  ? 900  ILE B CB  1 
ATOM   2417 C CG1 . ILE B 1 148 ? -5.436  5.921   68.360  1.00   42.30  ? 900  ILE B CG1 1 
ATOM   2418 C CG2 . ILE B 1 148 ? -4.689  8.108   69.232  1.00   48.60  ? 900  ILE B CG2 1 
ATOM   2419 C CD1 . ILE B 1 148 ? -4.373  5.109   69.105  1.00   47.33  ? 900  ILE B CD1 1 
ATOM   2420 N N   . ALA B 1 149 ? -5.276  10.117  66.366  1.00   46.80  ? 901  ALA B N   1 
ATOM   2421 C CA  . ALA B 1 149 ? -5.087  11.578  66.238  1.00   48.70  ? 901  ALA B CA  1 
ATOM   2422 C C   . ALA B 1 149 ? -6.406  12.328  65.869  1.00   47.68  ? 901  ALA B C   1 
ATOM   2423 O O   . ALA B 1 149 ? -6.696  13.342  66.472  1.00   53.29  ? 901  ALA B O   1 
ATOM   2424 C CB  . ALA B 1 149 ? -3.978  11.850  65.226  1.00   45.59  ? 901  ALA B CB  1 
ATOM   2425 N N   . ALA B 1 150 ? -7.202  11.884  64.882  1.00   43.24  ? 902  ALA B N   1 
ATOM   2426 C CA  . ALA B 1 150 ? -8.538  12.479  64.699  1.00   47.88  ? 902  ALA B CA  1 
ATOM   2427 C C   . ALA B 1 150 ? -9.415  12.452  65.987  1.00   53.11  ? 902  ALA B C   1 
ATOM   2428 O O   . ALA B 1 150 ? -10.236 13.360  66.185  1.00   54.66  ? 902  ALA B O   1 
ATOM   2429 C CB  . ALA B 1 150 ? -9.295  11.833  63.618  1.00   42.42  ? 902  ALA B CB  1 
ATOM   2430 N N   . LYS B 1 151 ? -9.328  11.393  66.792  1.00   51.74  ? 903  LYS B N   1 
ATOM   2431 C CA  . LYS B 1 151 ? -10.161 11.340  67.986  1.00   57.00  ? 903  LYS B CA  1 
ATOM   2432 C C   . LYS B 1 151 ? -9.681  12.423  68.970  1.00   52.50  ? 903  LYS B C   1 
ATOM   2433 O O   . LYS B 1 151 ? -10.467 13.278  69.384  1.00   61.30  ? 903  LYS B O   1 
ATOM   2434 C CB  . LYS B 1 151 ? -10.174 9.968   68.657  1.00   58.35  ? 903  LYS B CB  1 
ATOM   2435 C CG  . LYS B 1 151 ? -11.474 9.714   69.475  1.00   59.96  ? 903  LYS B CG  1 
ATOM   2436 C CD  . LYS B 1 151 ? -11.659 8.233   69.846  1.00   65.71  ? 903  LYS B CD  1 
ATOM   2437 C CE  . LYS B 1 151 ? -13.004 7.963   70.525  1.00   67.87  ? 903  LYS B CE  1 
ATOM   2438 N NZ  . LYS B 1 151 ? -14.035 7.425   69.556  1.00   63.23  ? 903  LYS B NZ  1 
ATOM   2439 N N   . ARG B 1 152 ? -8.387  12.453  69.257  1.00   43.45  ? 904  ARG B N   1 
ATOM   2440 C CA  . ARG B 1 152 ? -7.845  13.411  70.243  1.00   50.78  ? 904  ARG B CA  1 
ATOM   2441 C C   . ARG B 1 152 ? -8.096  14.849  69.808  1.00   50.55  ? 904  ARG B C   1 
ATOM   2442 O O   . ARG B 1 152 ? -8.329  15.693  70.659  1.00   51.28  ? 904  ARG B O   1 
ATOM   2443 C CB  . ARG B 1 152 ? -6.332  13.257  70.437  1.00   43.56  ? 904  ARG B CB  1 
ATOM   2444 C CG  . ARG B 1 152 ? -5.908  11.878  70.897  1.00   40.64  ? 904  ARG B CG  1 
ATOM   2445 C CD  . ARG B 1 152 ? -4.402  11.835  70.632  1.00   50.81  ? 904  ARG B CD  1 
ATOM   2446 N NE  . ARG B 1 152 ? -3.709  12.414  71.736  1.00   42.94  ? 904  ARG B NE  1 
ATOM   2447 C CZ  . ARG B 1 152 ? -2.593  13.159  71.671  1.00   63.92  ? 904  ARG B CZ  1 
ATOM   2448 N NH1 . ARG B 1 152 ? -2.018  13.529  70.506  1.00   55.12  ? 904  ARG B NH1 1 
ATOM   2449 N NH2 . ARG B 1 152 ? -2.056  13.582  72.801  1.00   41.14  ? 904  ARG B NH2 1 
ATOM   2450 N N   . ALA B 1 153 ? -8.029  15.105  68.503  1.00   51.73  ? 905  ALA B N   1 
ATOM   2451 C CA  . ALA B 1 153 ? -8.389  16.426  67.916  1.00   50.55  ? 905  ALA B CA  1 
ATOM   2452 C C   . ALA B 1 153 ? -9.892  16.673  67.872  1.00   55.35  ? 905  ALA B C   1 
ATOM   2453 O O   . ALA B 1 153 ? -10.350 17.750  67.450  1.00   64.13  ? 905  ALA B O   1 
ATOM   2454 C CB  . ALA B 1 153 ? -7.808  16.587  66.566  1.00   54.07  ? 905  ALA B CB  1 
ATOM   2455 N N   . GLY B 1 154 ? -10.669 15.689  68.301  1.00   58.77  ? 906  GLY B N   1 
ATOM   2456 C CA  . GLY B 1 154 ? -12.121 15.812  68.301  1.00   54.18  ? 906  GLY B CA  1 
ATOM   2457 C C   . GLY B 1 154 ? -12.740 15.874  66.926  1.00   53.26  ? 906  GLY B C   1 
ATOM   2458 O O   . GLY B 1 154 ? -13.774 16.496  66.753  1.00   57.89  ? 906  GLY B O   1 
ATOM   2459 N N   . VAL B 1 155 ? -12.187 15.142  65.964  1.00   54.68  ? 907  VAL B N   1 
ATOM   2460 C CA  . VAL B 1 155 ? -12.881 14.984  64.704  1.00   58.62  ? 907  VAL B CA  1 
ATOM   2461 C C   . VAL B 1 155 ? -13.926 13.891  64.884  1.00   55.92  ? 907  VAL B C   1 
ATOM   2462 O O   . VAL B 1 155 ? -13.713 12.948  65.631  1.00   56.70  ? 907  VAL B O   1 
ATOM   2463 C CB  . VAL B 1 155 ? -11.956 14.582  63.511  1.00   63.89  ? 907  VAL B CB  1 
ATOM   2464 C CG1 . VAL B 1 155 ? -12.670 14.831  62.241  1.00   58.14  ? 907  VAL B CG1 1 
ATOM   2465 C CG2 . VAL B 1 155 ? -10.642 15.353  63.544  1.00   61.25  ? 907  VAL B CG2 1 
ATOM   2466 N N   . THR B 1 156 ? -14.996 13.964  64.116  1.00   56.81  ? 908  THR B N   1 
ATOM   2467 C CA  . THR B 1 156 ? -16.123 13.003  64.231  1.00   58.41  ? 908  THR B CA  1 
ATOM   2468 C C   . THR B 1 156 ? -16.569 12.434  62.875  1.00   59.84  ? 908  THR B C   1 
ATOM   2469 O O   . THR B 1 156 ? -17.382 11.465  62.798  1.00   58.00  ? 908  THR B O   1 
ATOM   2470 C CB  . THR B 1 156 ? -17.327 13.715  64.919  1.00   61.19  ? 908  THR B CB  1 
ATOM   2471 O OG1 . THR B 1 156 ? -16.897 14.200  66.206  1.00   56.21  ? 908  THR B OG1 1 
ATOM   2472 C CG2 . THR B 1 156 ? -18.574 12.785  65.056  1.00   68.41  ? 908  THR B CG2 1 
ATOM   2473 N N   . CYS B 1 157 ? -16.067 13.034  61.799  1.00   61.56  ? 909  CYS B N   1 
ATOM   2474 C CA  . CYS B 1 157 ? -16.082 12.392  60.500  1.00   58.45  ? 909  CYS B CA  1 
ATOM   2475 C C   . CYS B 1 157 ? -14.667 12.227  59.946  1.00   56.73  ? 909  CYS B C   1 
ATOM   2476 O O   . CYS B 1 157 ? -13.849 13.152  60.001  1.00   55.55  ? 909  CYS B O   1 
ATOM   2477 C CB  . CYS B 1 157 ? -16.930 13.193  59.500  1.00   64.85  ? 909  CYS B CB  1 
ATOM   2478 S SG  . CYS B 1 157 ? -17.045 12.328  57.907  1.00   65.36  ? 909  CYS B SG  1 
ATOM   2479 N N   . ILE B 1 158 ? -14.384 11.028  59.440  1.00   61.64  ? 910  ILE B N   1 
ATOM   2480 C CA  . ILE B 1 158 ? -13.062 10.642  58.955  1.00   57.68  ? 910  ILE B CA  1 
ATOM   2481 C C   . ILE B 1 158 ? -13.224 9.962   57.592  1.00   54.89  ? 910  ILE B C   1 
ATOM   2482 O O   . ILE B 1 158 ? -14.131 9.126   57.413  1.00   54.63  ? 910  ILE B O   1 
ATOM   2483 C CB  . ILE B 1 158 ? -12.368 9.652   59.957  1.00   54.45  ? 910  ILE B CB  1 
ATOM   2484 C CG1 . ILE B 1 158 ? -10.903 9.429   59.572  1.00   55.50  ? 910  ILE B CG1 1 
ATOM   2485 C CG2 . ILE B 1 158 ? -13.043 8.294   59.958  1.00   49.83  ? 910  ILE B CG2 1 
ATOM   2486 C CD1 . ILE B 1 158 ? -10.040 8.882   60.687  1.00   48.73  ? 910  ILE B CD1 1 
ATOM   2487 N N   . VAL B 1 159 ? -12.351 10.295  56.633  1.00   55.78  ? 911  VAL B N   1 
ATOM   2488 C CA  . VAL B 1 159 ? -12.376 9.648   55.296  1.00   46.59  ? 911  VAL B CA  1 
ATOM   2489 C C   . VAL B 1 159 ? -11.081 8.942   54.958  1.00   53.88  ? 911  VAL B C   1 
ATOM   2490 O O   . VAL B 1 159 ? -10.023 9.580   55.049  1.00   47.99  ? 911  VAL B O   1 
ATOM   2491 C CB  . VAL B 1 159 ? -12.539 10.675  54.202  1.00   52.23  ? 911  VAL B CB  1 
ATOM   2492 C CG1 . VAL B 1 159 ? -12.597 9.961   52.810  1.00   37.73  ? 911  VAL B CG1 1 
ATOM   2493 C CG2 . VAL B 1 159 ? -13.788 11.508  54.512  1.00   44.06  ? 911  VAL B CG2 1 
ATOM   2494 N N   . LEU B 1 160 ? -11.204 7.674   54.549  1.00   48.04  ? 912  LEU B N   1 
ATOM   2495 C CA  . LEU B 1 160 ? -10.094 6.665   54.433  1.00   52.34  ? 912  LEU B CA  1 
ATOM   2496 C C   . LEU B 1 160 ? -10.281 5.857   53.155  1.00   49.36  ? 912  LEU B C   1 
ATOM   2497 O O   . LEU B 1 160 ? -11.403 5.728   52.674  1.00   56.19  ? 912  LEU B O   1 
ATOM   2498 C CB  . LEU B 1 160 ? -10.165 5.647   55.580  1.00   51.99  ? 912  LEU B CB  1 
ATOM   2499 C CG  . LEU B 1 160 ? -9.423  5.854   56.882  1.00   55.62  ? 912  LEU B CG  1 
ATOM   2500 C CD1 . LEU B 1 160 ? -9.259  7.299   57.164  1.00   45.62  ? 912  LEU B CD1 1 
ATOM   2501 C CD2 . LEU B 1 160 ? -10.085 5.113   58.052  1.00   39.00  ? 912  LEU B CD2 1 
ATOM   2502 N N   . PRO B 1 161 ? -9.183  5.345   52.567  1.00   46.50  ? 913  PRO B N   1 
ATOM   2503 C CA  . PRO B 1 161 ? -9.310  4.590   51.363  1.00   48.04  ? 913  PRO B CA  1 
ATOM   2504 C C   . PRO B 1 161 ? -9.959  3.229   51.687  1.00   50.80  ? 913  PRO B C   1 
ATOM   2505 O O   . PRO B 1 161 ? -9.871  2.756   52.824  1.00   46.78  ? 913  PRO B O   1 
ATOM   2506 C CB  . PRO B 1 161 ? -7.868  4.379   50.942  1.00   44.25  ? 913  PRO B CB  1 
ATOM   2507 C CG  . PRO B 1 161 ? -7.065  5.292   51.771  1.00   39.25  ? 913  PRO B CG  1 
ATOM   2508 C CD  . PRO B 1 161 ? -7.788  5.355   53.033  1.00   34.57  ? 913  PRO B CD  1 
ATOM   2509 N N   . ALA B 1 162 ? -10.592 2.665   50.667  1.00   50.74  ? 914  ALA B N   1 
ATOM   2510 C CA  . ALA B 1 162 ? -11.414 1.462   50.744  1.00   49.92  ? 914  ALA B CA  1 
ATOM   2511 C C   . ALA B 1 162 ? -10.643 0.163   51.065  1.00   50.42  ? 914  ALA B C   1 
ATOM   2512 O O   . ALA B 1 162 ? -11.211 -0.729  51.658  1.00   59.05  ? 914  ALA B O   1 
ATOM   2513 C CB  . ALA B 1 162 ? -12.244 1.343   49.406  1.00   38.99  ? 914  ALA B CB  1 
ATOM   2514 N N   . GLU B 1 163 ? -9.347  0.038   50.734  1.00   57.81  ? 915  GLU B N   1 
ATOM   2515 C CA  . GLU B 1 163 ? -8.592  -1.173  51.160  1.00   55.28  ? 915  GLU B CA  1 
ATOM   2516 C C   . GLU B 1 163 ? -7.961  -0.973  52.497  1.00   52.33  ? 915  GLU B C   1 
ATOM   2517 O O   . GLU B 1 163 ? -7.247  -1.845  52.969  1.00   52.76  ? 915  GLU B O   1 
ATOM   2518 C CB  . GLU B 1 163 ? -7.470  -1.559  50.213  1.00   55.63  ? 915  GLU B CB  1 
ATOM   2519 C CG  . GLU B 1 163 ? -7.926  -2.226  48.915  1.00   60.52  ? 915  GLU B CG  1 
ATOM   2520 C CD  . GLU B 1 163 ? -6.886  -1.979  47.843  1.00   69.64  ? 915  GLU B CD  1 
ATOM   2521 O OE1 . GLU B 1 163 ? -5.710  -2.362  48.081  1.00   82.47  ? 915  GLU B OE1 1 
ATOM   2522 O OE2 . GLU B 1 163 ? -7.208  -1.341  46.814  1.00   56.57  ? 915  GLU B OE2 1 
ATOM   2523 N N   . ASN B 1 164 ? -8.190  0.181   53.099  1.00   51.54  ? 916  ASN B N   1 
ATOM   2524 C CA  . ASN B 1 164 ? -7.803  0.389   54.486  1.00   50.33  ? 916  ASN B CA  1 
ATOM   2525 C C   . ASN B 1 164 ? -8.965  0.055   55.429  1.00   50.11  ? 916  ASN B C   1 
ATOM   2526 O O   . ASN B 1 164 ? -8.992  0.478   56.596  1.00   49.81  ? 916  ASN B O   1 
ATOM   2527 C CB  . ASN B 1 164 ? -7.400  1.859   54.694  1.00   56.08  ? 916  ASN B CB  1 
ATOM   2528 C CG  . ASN B 1 164 ? -5.974  2.187   54.265  1.00   45.00  ? 916  ASN B CG  1 
ATOM   2529 O OD1 . ASN B 1 164 ? -5.789  3.209   53.672  1.00   40.64  ? 916  ASN B OD1 1 
ATOM   2530 N ND2 . ASN B 1 164 ? -4.975  1.427   54.686  1.00   33.74  ? 916  ASN B ND2 1 
ATOM   2531 N N   . LYS B 1 165 ? -9.949  -0.687  54.951  1.00   54.60  ? 917  LYS B N   1 
ATOM   2532 C CA  . LYS B 1 165 ? -11.172 -0.886  55.719  1.00   51.46  ? 917  LYS B CA  1 
ATOM   2533 C C   . LYS B 1 165 ? -10.934 -1.792  56.889  1.00   58.68  ? 917  LYS B C   1 
ATOM   2534 O O   . LYS B 1 165 ? -11.305 -1.434  58.031  1.00   55.15  ? 917  LYS B O   1 
ATOM   2535 C CB  . LYS B 1 165 ? -12.275 -1.493  54.882  1.00   58.38  ? 917  LYS B CB  1 
ATOM   2536 C CG  . LYS B 1 165 ? -13.439 -0.581  54.618  1.00   48.21  ? 917  LYS B CG  1 
ATOM   2537 C CD  . LYS B 1 165 ? -14.540 -1.350  53.838  1.00   61.29  ? 917  LYS B CD  1 
ATOM   2538 C CE  . LYS B 1 165 ? -15.945 -0.782  54.045  1.00   65.09  ? 917  LYS B CE  1 
ATOM   2539 N NZ  . LYS B 1 165 ? -16.963 -1.479  53.184  1.00   60.47  ? 917  LYS B NZ  1 
ATOM   2540 N N   . LYS B 1 166 ? -10.375 -2.971  56.597  1.00   54.56  ? 918  LYS B N   1 
ATOM   2541 C CA  . LYS B 1 166 ? -9.990  -3.943  57.601  1.00   56.37  ? 918  LYS B CA  1 
ATOM   2542 C C   . LYS B 1 166 ? -9.204  -3.213  58.640  1.00   51.85  ? 918  LYS B C   1 
ATOM   2543 O O   . LYS B 1 166 ? -9.420  -3.372  59.860  1.00   45.42  ? 918  LYS B O   1 
ATOM   2544 C CB  . LYS B 1 166 ? -9.194  -5.183  57.044  1.00   56.27  ? 918  LYS B CB  1 
ATOM   2545 C CG  . LYS B 1 166 ? -8.169  -4.989  55.862  1.00   69.40  ? 918  LYS B CG  1 
ATOM   2546 C CD  . LYS B 1 166 ? -6.840  -4.264  56.224  1.00   69.98  ? 918  LYS B CD  1 
ATOM   2547 C CE  . LYS B 1 166 ? -5.568  -4.958  55.669  1.00   69.64  ? 918  LYS B CE  1 
ATOM   2548 N NZ  . LYS B 1 166 ? -5.474  -5.009  54.154  1.00   72.81  ? 918  LYS B NZ  1 
ATOM   2549 N N   . ASP B 1 167 ? -8.317  -2.366  58.170  1.00   45.24  ? 919  ASP B N   1 
ATOM   2550 C CA  . ASP B 1 167 ? -7.378  -1.689  59.062  1.00   46.77  ? 919  ASP B CA  1 
ATOM   2551 C C   . ASP B 1 167 ? -8.113  -0.850  60.020  1.00   38.21  ? 919  ASP B C   1 
ATOM   2552 O O   . ASP B 1 167 ? -7.716  -0.757  61.151  1.00   44.14  ? 919  ASP B O   1 
ATOM   2553 C CB  . ASP B 1 167 ? -6.370  -0.817  58.272  1.00   55.88  ? 919  ASP B CB  1 
ATOM   2554 C CG  . ASP B 1 167 ? -5.319  -1.641  57.572  1.00   53.93  ? 919  ASP B CG  1 
ATOM   2555 O OD1 . ASP B 1 167 ? -4.579  -2.386  58.278  1.00   50.66  ? 919  ASP B OD1 1 
ATOM   2556 O OD2 . ASP B 1 167 ? -5.243  -1.547  56.318  1.00   60.07  ? 919  ASP B OD2 1 
ATOM   2557 N N   . PHE B 1 168 ? -9.221  -0.248  59.580  1.00   47.38  ? 920  PHE B N   1 
ATOM   2558 C CA  . PHE B 1 168 ? -10.054 0.538   60.462  1.00   50.89  ? 920  PHE B CA  1 
ATOM   2559 C C   . PHE B 1 168 ? -10.762 -0.308  61.559  1.00   55.28  ? 920  PHE B C   1 
ATOM   2560 O O   . PHE B 1 168 ? -10.578 -0.041  62.759  1.00   42.73  ? 920  PHE B O   1 
ATOM   2561 C CB  . PHE B 1 168 ? -11.090 1.346   59.693  1.00   55.50  ? 920  PHE B CB  1 
ATOM   2562 C CG  . PHE B 1 168 ? -11.851 2.292   60.559  1.00   56.05  ? 920  PHE B CG  1 
ATOM   2563 C CD1 . PHE B 1 168 ? -11.303 3.508   60.879  1.00   55.75  ? 920  PHE B CD1 1 
ATOM   2564 C CD2 . PHE B 1 168 ? -13.103 1.957   61.058  1.00   48.06  ? 920  PHE B CD2 1 
ATOM   2565 C CE1 . PHE B 1 168 ? -11.983 4.406   61.727  1.00   59.25  ? 920  PHE B CE1 1 
ATOM   2566 C CE2 . PHE B 1 168 ? -13.788 2.822   61.887  1.00   57.08  ? 920  PHE B CE2 1 
ATOM   2567 C CZ  . PHE B 1 168 ? -13.219 4.074   62.216  1.00   55.71  ? 920  PHE B CZ  1 
ATOM   2568 N N   . TYR B 1 169 ? -11.534 -1.320  61.147  1.00   51.81  ? 921  TYR B N   1 
ATOM   2569 C CA  . TYR B 1 169 ? -12.190 -2.252  62.104  1.00   56.42  ? 921  TYR B CA  1 
ATOM   2570 C C   . TYR B 1 169 ? -11.258 -3.191  62.945  1.00   57.30  ? 921  TYR B C   1 
ATOM   2571 O O   . TYR B 1 169 ? -11.684 -3.849  63.929  1.00   61.09  ? 921  TYR B O   1 
ATOM   2572 C CB  . TYR B 1 169 ? -13.255 -3.017  61.327  1.00   55.91  ? 921  TYR B CB  1 
ATOM   2573 C CG  . TYR B 1 169 ? -14.309 -2.098  60.783  1.00   50.86  ? 921  TYR B CG  1 
ATOM   2574 C CD1 . TYR B 1 169 ? -15.111 -1.370  61.643  1.00   49.43  ? 921  TYR B CD1 1 
ATOM   2575 C CD2 . TYR B 1 169 ? -14.514 -1.954  59.427  1.00   62.47  ? 921  TYR B CD2 1 
ATOM   2576 C CE1 . TYR B 1 169 ? -16.057 -0.544  61.202  1.00   53.19  ? 921  TYR B CE1 1 
ATOM   2577 C CE2 . TYR B 1 169 ? -15.493 -1.101  58.955  1.00   45.80  ? 921  TYR B CE2 1 
ATOM   2578 C CZ  . TYR B 1 169 ? -16.252 -0.397  59.860  1.00   50.56  ? 921  TYR B CZ  1 
ATOM   2579 O OH  . TYR B 1 169 ? -17.243 0.455   59.458  1.00   60.92  ? 921  TYR B OH  1 
ATOM   2580 N N   . ASP B 1 170 ? -9.971  -3.209  62.640  1.00   57.66  ? 922  ASP B N   1 
ATOM   2581 C CA  . ASP B 1 170 ? -9.025  -3.933  63.503  1.00   56.42  ? 922  ASP B CA  1 
ATOM   2582 C C   . ASP B 1 170 ? -8.701  -3.132  64.784  1.00   57.65  ? 922  ASP B C   1 
ATOM   2583 O O   . ASP B 1 170 ? -8.148  -3.676  65.727  1.00   55.86  ? 922  ASP B O   1 
ATOM   2584 C CB  . ASP B 1 170 ? -7.723  -4.289  62.741  1.00   54.83  ? 922  ASP B CB  1 
ATOM   2585 C CG  . ASP B 1 170 ? -7.986  -4.958  61.379  1.00   69.94  ? 922  ASP B CG  1 
ATOM   2586 O OD1 . ASP B 1 170 ? -8.876  -5.868  61.271  1.00   65.49  ? 922  ASP B OD1 1 
ATOM   2587 O OD2 . ASP B 1 170 ? -7.299  -4.545  60.394  1.00   55.68  ? 922  ASP B OD2 1 
ATOM   2588 N N   . LEU B 1 171 ? -9.068  -1.842  64.815  1.00   58.86  ? 923  LEU B N   1 
ATOM   2589 C CA  . LEU B 1 171 ? -8.793  -0.968  65.970  1.00   58.44  ? 923  LEU B CA  1 
ATOM   2590 C C   . LEU B 1 171 ? -9.745  -1.235  67.128  1.00   53.22  ? 923  LEU B C   1 
ATOM   2591 O O   . LEU B 1 171 ? -10.842 -1.713  66.942  1.00   58.11  ? 923  LEU B O   1 
ATOM   2592 C CB  . LEU B 1 171 ? -8.899  0.518   65.555  1.00   56.62  ? 923  LEU B CB  1 
ATOM   2593 C CG  . LEU B 1 171 ? -8.057  0.982   64.335  1.00   47.21  ? 923  LEU B CG  1 
ATOM   2594 C CD1 . LEU B 1 171 ? -8.190  2.443   64.181  1.00   37.74  ? 923  LEU B CD1 1 
ATOM   2595 C CD2 . LEU B 1 171 ? -6.653  0.672   64.505  1.00   41.64  ? 923  LEU B CD2 1 
ATOM   2596 N N   . ALA B 1 172 ? -9.339  -0.890  68.335  1.00   59.05  ? 924  ALA B N   1 
ATOM   2597 C CA  . ALA B 1 172 ? -10.259 -0.932  69.463  1.00   59.58  ? 924  ALA B CA  1 
ATOM   2598 C C   . ALA B 1 172 ? -11.689 -0.287  69.168  1.00   61.11  ? 924  ALA B C   1 
ATOM   2599 O O   . ALA B 1 172 ? -11.882 0.654   68.343  1.00   57.73  ? 924  ALA B O   1 
ATOM   2600 C CB  . ALA B 1 172 ? -9.585  -0.283  70.679  1.00   63.72  ? 924  ALA B CB  1 
ATOM   2601 N N   . ALA B 1 173 ? -12.705 -0.823  69.817  1.00   53.04  ? 925  ALA B N   1 
ATOM   2602 C CA  . ALA B 1 173 ? -14.010 -0.195  69.732  1.00   55.17  ? 925  ALA B CA  1 
ATOM   2603 C C   . ALA B 1 173 ? -13.998 1.198   70.407  1.00   47.83  ? 925  ALA B C   1 
ATOM   2604 O O   . ALA B 1 173 ? -14.631 2.118   69.915  1.00   58.38  ? 925  ALA B O   1 
ATOM   2605 C CB  . ALA B 1 173 ? -15.073 -1.082  70.307  1.00   61.84  ? 925  ALA B CB  1 
ATOM   2606 N N   . PHE B 1 174 ? -13.269 1.360   71.507  1.00   54.38  ? 926  PHE B N   1 
ATOM   2607 C CA  . PHE B 1 174 ? -13.110 2.692   72.144  1.00   49.11  ? 926  PHE B CA  1 
ATOM   2608 C C   . PHE B 1 174 ? -12.738 3.753   71.115  1.00   54.43  ? 926  PHE B C   1 
ATOM   2609 O O   . PHE B 1 174 ? -13.243 4.896   71.199  1.00   52.14  ? 926  PHE B O   1 
ATOM   2610 C CB  . PHE B 1 174 ? -12.113 2.702   73.316  1.00   46.10  ? 926  PHE B CB  1 
ATOM   2611 C CG  . PHE B 1 174 ? -12.153 3.977   74.145  1.00   50.21  ? 926  PHE B CG  1 
ATOM   2612 C CD1 . PHE B 1 174 ? -12.985 4.080   75.241  1.00   44.58  ? 926  PHE B CD1 1 
ATOM   2613 C CD2 . PHE B 1 174 ? -11.394 5.062   73.794  1.00   54.37  ? 926  PHE B CD2 1 
ATOM   2614 C CE1 . PHE B 1 174 ? -13.031 5.299   76.031  1.00   53.46  ? 926  PHE B CE1 1 
ATOM   2615 C CE2 . PHE B 1 174 ? -11.434 6.249   74.511  1.00   55.68  ? 926  PHE B CE2 1 
ATOM   2616 C CZ  . PHE B 1 174 ? -12.269 6.371   75.658  1.00   52.85  ? 926  PHE B CZ  1 
ATOM   2617 N N   . ILE B 1 175 ? -11.868 3.396   70.156  1.00   55.38  ? 927  ILE B N   1 
ATOM   2618 C CA  . ILE B 1 175 ? -11.404 4.368   69.149  1.00   52.24  ? 927  ILE B CA  1 
ATOM   2619 C C   . ILE B 1 175 ? -12.487 4.639   68.102  1.00   53.48  ? 927  ILE B C   1 
ATOM   2620 O O   . ILE B 1 175 ? -12.750 5.806   67.694  1.00   52.88  ? 927  ILE B O   1 
ATOM   2621 C CB  . ILE B 1 175 ? -10.072 3.924   68.459  1.00   53.83  ? 927  ILE B CB  1 
ATOM   2622 C CG1 . ILE B 1 175 ? -8.974  3.730   69.503  1.00   29.96  ? 927  ILE B CG1 1 
ATOM   2623 C CG2 . ILE B 1 175 ? -9.606  4.955   67.404  1.00   45.59  ? 927  ILE B CG2 1 
ATOM   2624 C CD1 . ILE B 1 175 ? -7.712  3.103   69.017  1.00   48.47  ? 927  ILE B CD1 1 
ATOM   2625 N N   . THR B 1 176 ? -13.151 3.579   67.687  1.00   48.58  ? 928  THR B N   1 
ATOM   2626 C CA  . THR B 1 176 ? -13.961 3.666   66.484  1.00   45.19  ? 928  THR B CA  1 
ATOM   2627 C C   . THR B 1 176 ? -15.417 3.989   66.693  1.00   51.04  ? 928  THR B C   1 
ATOM   2628 O O   . THR B 1 176 ? -15.960 4.663   65.881  1.00   44.78  ? 928  THR B O   1 
ATOM   2629 C CB  . THR B 1 176 ? -13.779 2.435   65.614  1.00   47.87  ? 928  THR B CB  1 
ATOM   2630 O OG1 . THR B 1 176 ? -14.291 1.278   66.300  1.00   47.38  ? 928  THR B OG1 1 
ATOM   2631 C CG2 . THR B 1 176 ? -12.232 2.290   65.245  1.00   43.49  ? 928  THR B CG2 1 
ATOM   2632 N N   . GLU B 1 177 ? -16.030 3.536   67.804  1.00   53.17  ? 929  GLU B N   1 
ATOM   2633 C CA  . GLU B 1 177 ? -17.456 3.722   68.005  1.00   49.10  ? 929  GLU B CA  1 
ATOM   2634 C C   . GLU B 1 177 ? -17.584 5.173   68.265  1.00   52.39  ? 929  GLU B C   1 
ATOM   2635 O O   . GLU B 1 177 ? -16.781 5.721   69.004  1.00   50.78  ? 929  GLU B O   1 
ATOM   2636 C CB  . GLU B 1 177 ? -17.986 2.961   69.243  1.00   53.67  ? 929  GLU B CB  1 
ATOM   2637 C CG  . GLU B 1 177 ? -18.244 1.502   69.017  1.00   62.04  ? 929  GLU B CG  1 
ATOM   2638 C CD  . GLU B 1 177 ? -19.694 1.222   68.685  1.00   59.48  ? 929  GLU B CD  1 
ATOM   2639 O OE1 . GLU B 1 177 ? -20.498 1.043   69.631  1.00   60.90  ? 929  GLU B OE1 1 
ATOM   2640 O OE2 . GLU B 1 177 ? -20.043 1.244   67.475  1.00   76.69  ? 929  GLU B OE2 1 
ATOM   2641 N N   . GLY B 1 178 ? -18.585 5.795   67.659  1.00   53.76  ? 930  GLY B N   1 
ATOM   2642 C CA  . GLY B 1 178 ? -18.718 7.237   67.650  1.00   54.85  ? 930  GLY B CA  1 
ATOM   2643 C C   . GLY B 1 178 ? -18.358 7.865   66.317  1.00   59.33  ? 930  GLY B C   1 
ATOM   2644 O O   . GLY B 1 178 ? -18.805 8.969   66.011  1.00   68.13  ? 930  GLY B O   1 
ATOM   2645 N N   . LEU B 1 179 ? -17.523 7.184   65.529  1.00   59.08  ? 931  LEU B N   1 
ATOM   2646 C CA  . LEU B 1 179 ? -16.885 7.817   64.371  1.00   60.71  ? 931  LEU B CA  1 
ATOM   2647 C C   . LEU B 1 179 ? -17.627 7.627   63.052  1.00   58.31  ? 931  LEU B C   1 
ATOM   2648 O O   . LEU B 1 179 ? -17.951 6.506   62.650  1.00   52.51  ? 931  LEU B O   1 
ATOM   2649 C CB  . LEU B 1 179 ? -15.433 7.360   64.267  1.00   56.39  ? 931  LEU B CB  1 
ATOM   2650 C CG  . LEU B 1 179 ? -14.420 8.486   64.078  1.00   56.60  ? 931  LEU B CG  1 
ATOM   2651 C CD1 . LEU B 1 179 ? -14.583 9.560   65.135  1.00   60.23  ? 931  LEU B CD1 1 
ATOM   2652 C CD2 . LEU B 1 179 ? -13.032 7.890   64.140  1.00   57.33  ? 931  LEU B CD2 1 
ATOM   2653 N N   . GLU B 1 180 ? -17.956 8.741   62.392  1.00   56.06  ? 932  GLU B N   1 
ATOM   2654 C CA  . GLU B 1 180 ? -18.555 8.675   61.082  1.00   55.77  ? 932  GLU B CA  1 
ATOM   2655 C C   . GLU B 1 180 ? -17.425 8.470   60.029  1.00   55.89  ? 932  GLU B C   1 
ATOM   2656 O O   . GLU B 1 180 ? -16.665 9.366   59.721  1.00   54.70  ? 932  GLU B O   1 
ATOM   2657 C CB  . GLU B 1 180 ? -19.348 9.959   60.803  1.00   57.14  ? 932  GLU B CB  1 
ATOM   2658 C CG  . GLU B 1 180 ? -20.138 10.033  59.496  1.00   61.11  ? 932  GLU B CG  1 
ATOM   2659 C CD  . GLU B 1 180 ? -20.563 11.474  59.219  1.00   55.85  ? 932  GLU B CD  1 
ATOM   2660 O OE1 . GLU B 1 180 ? -21.124 12.104  60.147  1.00   61.08  ? 932  GLU B OE1 1 
ATOM   2661 O OE2 . GLU B 1 180 ? -20.318 11.997  58.116  1.00   63.48  ? 932  GLU B OE2 1 
ATOM   2662 N N   . VAL B 1 181 ? -17.354 7.269   59.489  1.00   52.38  ? 933  VAL B N   1 
ATOM   2663 C CA  . VAL B 1 181 ? -16.250 6.853   58.674  1.00   54.38  ? 933  VAL B CA  1 
ATOM   2664 C C   . VAL B 1 181 ? -16.768 6.675   57.278  1.00   55.69  ? 933  VAL B C   1 
ATOM   2665 O O   . VAL B 1 181 ? -17.825 6.073   57.074  1.00   53.56  ? 933  VAL B O   1 
ATOM   2666 C CB  . VAL B 1 181 ? -15.693 5.528   59.142  1.00   55.94  ? 933  VAL B CB  1 
ATOM   2667 C CG1 . VAL B 1 181 ? -14.201 5.442   58.861  1.00   61.06  ? 933  VAL B CG1 1 
ATOM   2668 C CG2 . VAL B 1 181 ? -16.002 5.318   60.638  1.00   55.71  ? 933  VAL B CG2 1 
ATOM   2669 N N   . HIS B 1 182 ? -16.028 7.217   56.311  1.00   56.64  ? 934  HIS B N   1 
ATOM   2670 C CA  . HIS B 1 182 ? -16.233 6.897   54.939  1.00   55.84  ? 934  HIS B CA  1 
ATOM   2671 C C   . HIS B 1 182 ? -15.028 6.283   54.281  1.00   59.72  ? 934  HIS B C   1 
ATOM   2672 O O   . HIS B 1 182 ? -13.931 6.815   54.424  1.00   53.74  ? 934  HIS B O   1 
ATOM   2673 C CB  . HIS B 1 182 ? -16.548 8.162   54.204  1.00   61.00  ? 934  HIS B CB  1 
ATOM   2674 C CG  . HIS B 1 182 ? -17.744 8.843   54.738  1.00   65.05  ? 934  HIS B CG  1 
ATOM   2675 N ND1 . HIS B 1 182 ? -17.673 10.029  55.436  1.00   60.63  ? 934  HIS B ND1 1 
ATOM   2676 C CD2 . HIS B 1 182 ? -19.042 8.478   54.719  1.00   62.13  ? 934  HIS B CD2 1 
ATOM   2677 C CE1 . HIS B 1 182 ? -18.894 10.389  55.783  1.00   65.98  ? 934  HIS B CE1 1 
ATOM   2678 N NE2 . HIS B 1 182 ? -19.740 9.459   55.376  1.00   67.73  ? 934  HIS B NE2 1 
ATOM   2679 N N   . PHE B 1 183 ? -15.266 5.216   53.519  1.00   58.94  ? 935  PHE B N   1 
ATOM   2680 C CA  . PHE B 1 183 ? -14.229 4.515   52.789  1.00   63.43  ? 935  PHE B CA  1 
ATOM   2681 C C   . PHE B 1 183 ? -14.438 4.738   51.326  1.00   64.89  ? 935  PHE B C   1 
ATOM   2682 O O   . PHE B 1 183 ? -15.484 4.383   50.781  1.00   64.24  ? 935  PHE B O   1 
ATOM   2683 C CB  . PHE B 1 183 ? -14.253 3.051   53.104  1.00   62.80  ? 935  PHE B CB  1 
ATOM   2684 C CG  . PHE B 1 183 ? -14.213 2.791   54.543  1.00   63.55  ? 935  PHE B CG  1 
ATOM   2685 C CD1 . PHE B 1 183 ? -13.012 2.759   55.221  1.00   66.47  ? 935  PHE B CD1 1 
ATOM   2686 C CD2 . PHE B 1 183 ? -15.387 2.636   55.255  1.00   62.16  ? 935  PHE B CD2 1 
ATOM   2687 C CE1 . PHE B 1 183 ? -12.983 2.531   56.579  1.00   59.61  ? 935  PHE B CE1 1 
ATOM   2688 C CE2 . PHE B 1 183 ? -15.366 2.431   56.594  1.00   58.71  ? 935  PHE B CE2 1 
ATOM   2689 C CZ  . PHE B 1 183 ? -14.163 2.377   57.271  1.00   66.87  ? 935  PHE B CZ  1 
ATOM   2690 N N   . VAL B 1 184 ? -13.469 5.394   50.705  1.00   60.81  ? 936  VAL B N   1 
ATOM   2691 C CA  . VAL B 1 184 ? -13.645 5.794   49.337  1.00   63.08  ? 936  VAL B CA  1 
ATOM   2692 C C   . VAL B 1 184 ? -12.681 5.078   48.418  1.00   59.82  ? 936  VAL B C   1 
ATOM   2693 O O   . VAL B 1 184 ? -11.665 4.505   48.833  1.00   57.86  ? 936  VAL B O   1 
ATOM   2694 C CB  . VAL B 1 184 ? -13.608 7.341   49.160  1.00   63.82  ? 936  VAL B CB  1 
ATOM   2695 C CG1 . VAL B 1 184 ? -14.839 7.949   49.801  1.00   69.64  ? 936  VAL B CG1 1 
ATOM   2696 C CG2 . VAL B 1 184 ? -12.390 7.926   49.763  1.00   52.82  ? 936  VAL B CG2 1 
ATOM   2697 N N   . GLU B 1 185 ? -13.091 5.096   47.162  1.00   65.97  ? 937  GLU B N   1 
ATOM   2698 C CA  . GLU B 1 185 ? -12.471 4.387   46.067  1.00   61.97  ? 937  GLU B CA  1 
ATOM   2699 C C   . GLU B 1 185 ? -11.956 5.409   45.061  1.00   63.28  ? 937  GLU B C   1 
ATOM   2700 O O   . GLU B 1 185 ? -10.921 5.171   44.411  1.00   66.38  ? 937  GLU B O   1 
ATOM   2701 C CB  . GLU B 1 185 ? -13.502 3.411   45.452  1.00   61.29  ? 937  GLU B CB  1 
ATOM   2702 C CG  . GLU B 1 185 ? -13.493 1.997   46.063  1.00   56.07  ? 937  GLU B CG  1 
ATOM   2703 C CD  . GLU B 1 185 ? -14.521 1.023   45.449  1.00   68.68  ? 937  GLU B CD  1 
ATOM   2704 O OE1 . GLU B 1 185 ? -14.178 -0.177  45.227  1.00   64.23  ? 937  GLU B OE1 1 
ATOM   2705 O OE2 . GLU B 1 185 ? -15.678 1.450   45.180  1.00   65.64  ? 937  GLU B OE2 1 
ATOM   2706 N N   . HIS B 1 186 ? -12.665 6.538   44.943  1.00   60.16  ? 938  HIS B N   1 
ATOM   2707 C CA  . HIS B 1 186 ? -12.308 7.630   44.060  1.00   56.62  ? 938  HIS B CA  1 
ATOM   2708 C C   . HIS B 1 186 ? -12.482 9.005   44.739  1.00   54.69  ? 938  HIS B C   1 
ATOM   2709 O O   . HIS B 1 186 ? -13.368 9.171   45.584  1.00   60.42  ? 938  HIS B O   1 
ATOM   2710 C CB  . HIS B 1 186 ? -13.129 7.537   42.769  1.00   60.77  ? 938  HIS B CB  1 
ATOM   2711 C CG  . HIS B 1 186 ? -12.665 8.460   41.685  1.00   54.26  ? 938  HIS B CG  1 
ATOM   2712 N ND1 . HIS B 1 186 ? -12.916 9.814   41.703  1.00   55.83  ? 938  HIS B ND1 1 
ATOM   2713 C CD2 . HIS B 1 186 ? -11.952 8.225   40.553  1.00   62.60  ? 938  HIS B CD2 1 
ATOM   2714 C CE1 . HIS B 1 186 ? -12.382 10.381  40.632  1.00   46.44  ? 938  HIS B CE1 1 
ATOM   2715 N NE2 . HIS B 1 186 ? -11.773 9.437   39.928  1.00   56.73  ? 938  HIS B NE2 1 
ATOM   2716 N N   . TYR B 1 187 ? -11.653 9.990   44.372  1.00   56.88  ? 939  TYR B N   1 
ATOM   2717 C CA  . TYR B 1 187 ? -11.680 11.344  44.990  1.00   50.20  ? 939  TYR B CA  1 
ATOM   2718 C C   . TYR B 1 187 ? -13.049 11.951  44.991  1.00   57.74  ? 939  TYR B C   1 
ATOM   2719 O O   . TYR B 1 187 ? -13.535 12.361  46.045  1.00   55.79  ? 939  TYR B O   1 
ATOM   2720 C CB  . TYR B 1 187 ? -10.797 12.380  44.310  1.00   45.56  ? 939  TYR B CB  1 
ATOM   2721 C CG  . TYR B 1 187 ? -10.817 13.678  45.100  1.00   41.55  ? 939  TYR B CG  1 
ATOM   2722 C CD1 . TYR B 1 187 ? -10.007 13.835  46.239  1.00   42.67  ? 939  TYR B CD1 1 
ATOM   2723 C CD2 . TYR B 1 187 ? -11.647 14.742  44.752  1.00   51.23  ? 939  TYR B CD2 1 
ATOM   2724 C CE1 . TYR B 1 187 ? -10.034 15.075  47.034  1.00   52.23  ? 939  TYR B CE1 1 
ATOM   2725 C CE2 . TYR B 1 187 ? -11.685 15.963  45.523  1.00   48.92  ? 939  TYR B CE2 1 
ATOM   2726 C CZ  . TYR B 1 187 ? -10.881 16.121  46.647  1.00   48.70  ? 939  TYR B CZ  1 
ATOM   2727 O OH  . TYR B 1 187 ? -10.920 17.300  47.390  1.00   42.49  ? 939  TYR B OH  1 
ATOM   2728 N N   . ARG B 1 188 ? -13.766 11.812  43.912  1.00   57.80  ? 940  ARG B N   1 
ATOM   2729 C CA  . ARG B 1 188 ? -14.980 12.542  43.751  1.00   58.78  ? 940  ARG B CA  1 
ATOM   2730 C C   . ARG B 1 188 ? -15.807 12.419  45.027  1.00   57.43  ? 940  ARG B C   1 
ATOM   2731 O O   . ARG B 1 188 ? -16.405 13.375  45.455  1.00   54.10  ? 940  ARG B O   1 
ATOM   2732 C CB  . ARG B 1 188 ? -15.739 11.873  42.626  1.00   59.65  ? 940  ARG B CB  1 
ATOM   2733 C CG  . ARG B 1 188 ? -16.615 10.742  43.102  1.00   57.59  ? 940  ARG B CG  1 
ATOM   2734 C CD  . ARG B 1 188 ? -16.521 9.514   42.283  1.00   66.39  ? 940  ARG B CD  1 
ATOM   2735 N NE  . ARG B 1 188 ? -16.720 9.767   40.877  1.00   68.42  ? 940  ARG B NE  1 
ATOM   2736 C CZ  . ARG B 1 188 ? -16.436 8.892   39.927  1.00   73.92  ? 940  ARG B CZ  1 
ATOM   2737 N NH1 . ARG B 1 188 ? -15.949 7.716   40.236  1.00   72.30  ? 940  ARG B NH1 1 
ATOM   2738 N NH2 . ARG B 1 188 ? -16.645 9.186   38.665  1.00   71.40  ? 940  ARG B NH2 1 
ATOM   2739 N N   . GLU B 1 189 ? -15.786 11.241  45.624  1.00   57.23  ? 941  GLU B N   1 
ATOM   2740 C CA  . GLU B 1 189 ? -16.497 10.826  46.852  1.00   56.38  ? 941  GLU B CA  1 
ATOM   2741 C C   . GLU B 1 189 ? -16.093 11.618  48.078  1.00   59.99  ? 941  GLU B C   1 
ATOM   2742 O O   . GLU B 1 189 ? -16.971 12.095  48.861  1.00   65.32  ? 941  GLU B O   1 
ATOM   2743 C CB  . GLU B 1 189 ? -16.292 9.344   47.112  1.00   41.67  ? 941  GLU B CB  1 
ATOM   2744 C CG  . GLU B 1 189 ? -16.757 8.535   45.918  1.00   62.17  ? 941  GLU B CG  1 
ATOM   2745 C CD  . GLU B 1 189 ? -16.642 7.071   46.140  1.00   54.75  ? 941  GLU B CD  1 
ATOM   2746 O OE1 . GLU B 1 189 ? -16.028 6.378   45.291  1.00   75.94  ? 941  GLU B OE1 1 
ATOM   2747 O OE2 . GLU B 1 189 ? -17.194 6.606   47.144  1.00   61.14  ? 941  GLU B OE2 1 
ATOM   2748 N N   . ILE B 1 190 ? -14.778 11.778  48.251  1.00   60.34  ? 942  ILE B N   1 
ATOM   2749 C CA  . ILE B 1 190 ? -14.295 12.701  49.255  1.00   61.22  ? 942  ILE B CA  1 
ATOM   2750 C C   . ILE B 1 190 ? -14.832 14.114  48.973  1.00   54.93  ? 942  ILE B C   1 
ATOM   2751 O O   . ILE B 1 190 ? -15.306 14.765  49.901  1.00   45.12  ? 942  ILE B O   1 
ATOM   2752 C CB  . ILE B 1 190 ? -12.754 12.651  49.535  1.00   63.58  ? 942  ILE B CB  1 
ATOM   2753 C CG1 . ILE B 1 190 ? -12.005 13.834  48.930  1.00   67.76  ? 942  ILE B CG1 1 
ATOM   2754 C CG2 . ILE B 1 190 ? -12.115 11.267  49.182  1.00   57.91  ? 942  ILE B CG2 1 
ATOM   2755 C CD1 . ILE B 1 190 ? -11.727 15.043  49.882  1.00   54.57  ? 942  ILE B CD1 1 
ATOM   2756 N N   . PHE B 1 191 ? -14.833 14.557  47.710  1.00   51.94  ? 943  PHE B N   1 
ATOM   2757 C CA  . PHE B 1 191 ? -15.247 15.915  47.375  1.00   46.80  ? 943  PHE B CA  1 
ATOM   2758 C C   . PHE B 1 191 ? -16.643 16.281  47.835  1.00   53.94  ? 943  PHE B C   1 
ATOM   2759 O O   . PHE B 1 191 ? -16.853 17.387  48.290  1.00   49.75  ? 943  PHE B O   1 
ATOM   2760 C CB  . PHE B 1 191 ? -15.222 16.205  45.864  1.00   51.49  ? 943  PHE B CB  1 
ATOM   2761 C CG  . PHE B 1 191 ? -15.682 17.603  45.531  1.00   44.41  ? 943  PHE B CG  1 
ATOM   2762 C CD1 . PHE B 1 191 ? -17.017 17.907  45.435  1.00   54.08  ? 943  PHE B CD1 1 
ATOM   2763 C CD2 . PHE B 1 191 ? -14.767 18.634  45.338  1.00   45.98  ? 943  PHE B CD2 1 
ATOM   2764 C CE1 . PHE B 1 191 ? -17.404 19.194  45.133  1.00   44.04  ? 943  PHE B CE1 1 
ATOM   2765 C CE2 . PHE B 1 191 ? -15.171 19.895  45.107  1.00   49.40  ? 943  PHE B CE2 1 
ATOM   2766 C CZ  . PHE B 1 191 ? -16.505 20.166  44.971  1.00   57.89  ? 943  PHE B CZ  1 
ATOM   2767 N N   . ASP B 1 192 ? -17.607 15.378  47.631  1.00   58.81  ? 944  ASP B N   1 
ATOM   2768 C CA  . ASP B 1 192 ? -18.945 15.556  48.139  1.00   59.70  ? 944  ASP B CA  1 
ATOM   2769 C C   . ASP B 1 192 ? -18.960 15.797  49.672  1.00   63.50  ? 944  ASP B C   1 
ATOM   2770 O O   . ASP B 1 192 ? -19.478 16.825  50.136  1.00   66.08  ? 944  ASP B O   1 
ATOM   2771 C CB  . ASP B 1 192 ? -19.787 14.339  47.739  1.00   60.87  ? 944  ASP B CB  1 
ATOM   2772 C CG  . ASP B 1 192 ? -20.032 14.280  46.244  1.00   72.64  ? 944  ASP B CG  1 
ATOM   2773 O OD1 . ASP B 1 192 ? -19.893 15.362  45.585  1.00   73.48  ? 944  ASP B OD1 1 
ATOM   2774 O OD2 . ASP B 1 192 ? -20.366 13.171  45.738  1.00   70.86  ? 944  ASP B OD2 1 
ATOM   2775 N N   . ILE B 1 193 ? -18.382 14.871  50.441  1.00   63.45  ? 945  ILE B N   1 
ATOM   2776 C CA  . ILE B 1 193 ? -18.329 14.985  51.926  1.00   62.83  ? 945  ILE B CA  1 
ATOM   2777 C C   . ILE B 1 193 ? -17.779 16.348  52.452  1.00   64.05  ? 945  ILE B C   1 
ATOM   2778 O O   . ILE B 1 193 ? -18.297 16.951  53.432  1.00   63.12  ? 945  ILE B O   1 
ATOM   2779 C CB  . ILE B 1 193 ? -17.446 13.894  52.506  1.00   58.48  ? 945  ILE B CB  1 
ATOM   2780 C CG1 . ILE B 1 193 ? -18.165 12.534  52.468  1.00   58.50  ? 945  ILE B CG1 1 
ATOM   2781 C CG2 . ILE B 1 193 ? -17.053 14.233  53.952  1.00   63.37  ? 945  ILE B CG2 1 
ATOM   2782 C CD1 . ILE B 1 193 ? -17.203 11.369  52.590  1.00   57.24  ? 945  ILE B CD1 1 
ATOM   2783 N N   . ALA B 1 194 ? -16.715 16.816  51.813  1.00   61.69  ? 946  ALA B N   1 
ATOM   2784 C CA  . ALA B 1 194 ? -16.035 18.031  52.221  1.00   60.43  ? 946  ALA B CA  1 
ATOM   2785 C C   . ALA B 1 194 ? -16.801 19.262  51.783  1.00   64.15  ? 946  ALA B C   1 
ATOM   2786 O O   . ALA B 1 194 ? -16.522 20.375  52.267  1.00   62.81  ? 946  ALA B O   1 
ATOM   2787 C CB  . ALA B 1 194 ? -14.626 18.072  51.616  1.00   53.57  ? 946  ALA B CB  1 
ATOM   2788 N N   . PHE B 1 195 ? -17.703 19.070  50.814  1.00   68.26  ? 947  PHE B N   1 
ATOM   2789 C CA  . PHE B 1 195 ? -18.335 20.175  50.086  1.00   73.69  ? 947  PHE B CA  1 
ATOM   2790 C C   . PHE B 1 195 ? -19.785 19.834  49.723  1.00   77.00  ? 947  PHE B C   1 
ATOM   2791 O O   . PHE B 1 195 ? -20.040 19.365  48.602  1.00   75.23  ? 947  PHE B O   1 
ATOM   2792 C CB  . PHE B 1 195 ? -17.564 20.469  48.780  1.00   75.89  ? 947  PHE B CB  1 
ATOM   2793 C CG  . PHE B 1 195 ? -16.134 20.890  48.974  1.00   68.14  ? 947  PHE B CG  1 
ATOM   2794 C CD1 . PHE B 1 195 ? -15.831 22.115  49.568  1.00   67.28  ? 947  PHE B CD1 1 
ATOM   2795 C CD2 . PHE B 1 195 ? -15.089 20.089  48.515  1.00   67.77  ? 947  PHE B CD2 1 
ATOM   2796 C CE1 . PHE B 1 195 ? -14.493 22.535  49.743  1.00   62.64  ? 947  PHE B CE1 1 
ATOM   2797 C CE2 . PHE B 1 195 ? -13.735 20.493  48.681  1.00   66.78  ? 947  PHE B CE2 1 
ATOM   2798 C CZ  . PHE B 1 195 ? -13.440 21.703  49.292  1.00   58.80  ? 947  PHE B CZ  1 
ATOM   2799 N N   . PRO B 1 196 ? -20.730 20.057  50.667  1.00   80.47  ? 948  PRO B N   1 
ATOM   2800 C CA  . PRO B 1 196 ? -22.186 19.821  50.474  1.00   81.86  ? 948  PRO B CA  1 
ATOM   2801 C C   . PRO B 1 196 ? -22.840 20.708  49.402  1.00   80.72  ? 948  PRO B C   1 
ATOM   2802 O O   . PRO B 1 196 ? -23.188 20.212  48.326  1.00   80.75  ? 948  PRO B O   1 
ATOM   2803 C CB  . PRO B 1 196 ? -22.779 20.131  51.856  1.00   81.30  ? 948  PRO B CB  1 
ATOM   2804 C CG  . PRO B 1 196 ? -21.646 19.918  52.816  1.00   82.31  ? 948  PRO B CG  1 
ATOM   2805 C CD  . PRO B 1 196 ? -20.422 20.400  52.068  1.00   80.88  ? 948  PRO B CD  1 
ATOM   2806 N N   . ARG C 1 3   ? 41.077  -20.401 41.721  1.00   71.71  ? 755  ARG C N   1 
ATOM   2807 C CA  . ARG C 1 3   ? 40.612  -20.960 40.481  1.00   66.89  ? 755  ARG C CA  1 
ATOM   2808 C C   . ARG C 1 3   ? 41.265  -22.307 40.315  1.00   67.30  ? 755  ARG C C   1 
ATOM   2809 O O   . ARG C 1 3   ? 42.429  -22.468 40.605  1.00   63.16  ? 755  ARG C O   1 
ATOM   2810 C CB  . ARG C 1 3   ? 40.934  -20.018 39.316  1.00   69.96  ? 755  ARG C CB  1 
ATOM   2811 C CG  . ARG C 1 3   ? 40.191  -20.274 38.026  1.00   63.15  ? 755  ARG C CG  1 
ATOM   2812 C CD  . ARG C 1 3   ? 41.151  -20.338 36.876  1.00   76.59  ? 755  ARG C CD  1 
ATOM   2813 N NE  . ARG C 1 3   ? 41.392  -19.037 36.281  1.00   74.76  ? 755  ARG C NE  1 
ATOM   2814 C CZ  . ARG C 1 3   ? 42.048  -18.827 35.155  1.00   75.81  ? 755  ARG C CZ  1 
ATOM   2815 N NH1 . ARG C 1 3   ? 42.566  -19.813 34.471  1.00   72.05  ? 755  ARG C NH1 1 
ATOM   2816 N NH2 . ARG C 1 3   ? 42.180  -17.609 34.712  1.00   80.71  ? 755  ARG C NH2 1 
ATOM   2817 N N   . MET C 1 4   ? 40.504  -23.256 39.798  1.00   63.61  ? 756  MET C N   1 
ATOM   2818 C CA  . MET C 1 4   ? 40.918  -24.630 39.739  1.00   57.65  ? 756  MET C CA  1 
ATOM   2819 C C   . MET C 1 4   ? 42.182  -24.870 38.959  1.00   61.24  ? 756  MET C C   1 
ATOM   2820 O O   . MET C 1 4   ? 43.017  -25.628 39.377  1.00   58.40  ? 756  MET C O   1 
ATOM   2821 C CB  . MET C 1 4   ? 39.808  -25.480 39.143  1.00   60.12  ? 756  MET C CB  1 
ATOM   2822 C CG  . MET C 1 4   ? 40.210  -26.875 38.871  1.00   58.17  ? 756  MET C CG  1 
ATOM   2823 S SD  . MET C 1 4   ? 38.818  -27.950 38.815  1.00   65.31  ? 756  MET C SD  1 
ATOM   2824 C CE  . MET C 1 4   ? 39.464  -29.230 37.835  1.00   42.86  ? 756  MET C CE  1 
ATOM   2825 N N   . TYR C 1 5   ? 42.334  -24.237 37.826  1.00   59.99  ? 757  TYR C N   1 
ATOM   2826 C CA  . TYR C 1 5   ? 43.536  -24.457 37.091  1.00   62.30  ? 757  TYR C CA  1 
ATOM   2827 C C   . TYR C 1 5   ? 44.157  -23.141 36.803  1.00   66.32  ? 757  TYR C C   1 
ATOM   2828 O O   . TYR C 1 5   ? 43.505  -22.137 36.806  1.00   66.84  ? 757  TYR C O   1 
ATOM   2829 C CB  . TYR C 1 5   ? 43.348  -25.255 35.813  1.00   61.60  ? 757  TYR C CB  1 
ATOM   2830 C CG  . TYR C 1 5   ? 43.556  -26.739 35.962  1.00   63.43  ? 757  TYR C CG  1 
ATOM   2831 C CD1 . TYR C 1 5   ? 42.522  -27.583 35.819  1.00   62.60  ? 757  TYR C CD1 1 
ATOM   2832 C CD2 . TYR C 1 5   ? 44.788  -27.291 36.252  1.00   60.29  ? 757  TYR C CD2 1 
ATOM   2833 C CE1 . TYR C 1 5   ? 42.674  -28.915 35.942  1.00   56.49  ? 757  TYR C CE1 1 
ATOM   2834 C CE2 . TYR C 1 5   ? 44.945  -28.655 36.369  1.00   45.27  ? 757  TYR C CE2 1 
ATOM   2835 C CZ  . TYR C 1 5   ? 43.860  -29.451 36.207  1.00   52.91  ? 757  TYR C CZ  1 
ATOM   2836 O OH  . TYR C 1 5   ? 43.882  -30.799 36.306  1.00   56.74  ? 757  TYR C OH  1 
ATOM   2837 N N   . ASP C 1 6   ? 45.463  -23.197 36.593  1.00   66.46  ? 758  ASP C N   1 
ATOM   2838 C CA  . ASP C 1 6   ? 46.331  -22.055 36.421  1.00   65.09  ? 758  ASP C CA  1 
ATOM   2839 C C   . ASP C 1 6   ? 46.609  -21.875 34.939  1.00   63.31  ? 758  ASP C C   1 
ATOM   2840 O O   . ASP C 1 6   ? 46.496  -20.790 34.368  1.00   55.73  ? 758  ASP C O   1 
ATOM   2841 C CB  . ASP C 1 6   ? 47.630  -22.453 37.097  1.00   67.81  ? 758  ASP C CB  1 
ATOM   2842 C CG  . ASP C 1 6   ? 47.824  -23.976 37.104  1.00   71.31  ? 758  ASP C CG  1 
ATOM   2843 O OD1 . ASP C 1 6   ? 48.897  -24.439 36.663  1.00   58.89  ? 758  ASP C OD1 1 
ATOM   2844 O OD2 . ASP C 1 6   ? 46.912  -24.697 37.560  1.00   55.87  ? 758  ASP C OD2 1 
ATOM   2845 N N   . VAL C 1 7   ? 46.980  -23.001 34.348  1.00   59.11  ? 759  VAL C N   1 
ATOM   2846 C CA  . VAL C 1 7   ? 47.044  -23.262 32.955  1.00   58.18  ? 759  VAL C CA  1 
ATOM   2847 C C   . VAL C 1 7   ? 46.381  -24.587 32.844  1.00   61.00  ? 759  VAL C C   1 
ATOM   2848 O O   . VAL C 1 7   ? 46.672  -25.495 33.584  1.00   62.72  ? 759  VAL C O   1 
ATOM   2849 C CB  . VAL C 1 7   ? 48.448  -23.216 32.342  1.00   59.62  ? 759  VAL C CB  1 
ATOM   2850 C CG1 . VAL C 1 7   ? 49.485  -23.039 33.341  1.00   56.98  ? 759  VAL C CG1 1 
ATOM   2851 C CG2 . VAL C 1 7   ? 48.721  -24.430 31.561  1.00   50.54  ? 759  VAL C CG2 1 
ATOM   2852 N N   . THR C 1 8   ? 45.424  -24.646 31.935  1.00   55.93  ? 760  THR C N   1 
ATOM   2853 C CA  . THR C 1 8   ? 44.577  -25.774 31.760  1.00   51.34  ? 760  THR C CA  1 
ATOM   2854 C C   . THR C 1 8   ? 45.321  -26.750 30.933  1.00   54.74  ? 760  THR C C   1 
ATOM   2855 O O   . THR C 1 8   ? 45.950  -26.369 29.996  1.00   51.16  ? 760  THR C O   1 
ATOM   2856 C CB  . THR C 1 8   ? 43.272  -25.390 31.039  1.00   47.60  ? 760  THR C CB  1 
ATOM   2857 O OG1 . THR C 1 8   ? 43.543  -24.896 29.745  1.00   48.50  ? 760  THR C OG1 1 
ATOM   2858 C CG2 . THR C 1 8   ? 42.584  -24.311 31.742  1.00   54.91  ? 760  THR C CG2 1 
ATOM   2859 N N   . PRO C 1 9   ? 45.276  -28.009 31.320  1.00   52.37  ? 761  PRO C N   1 
ATOM   2860 C CA  . PRO C 1 9   ? 45.814  -29.083 30.511  1.00   54.35  ? 761  PRO C CA  1 
ATOM   2861 C C   . PRO C 1 9   ? 44.809  -29.576 29.457  1.00   51.93  ? 761  PRO C C   1 
ATOM   2862 O O   . PRO C 1 9   ? 43.617  -29.221 29.541  1.00   54.19  ? 761  PRO C O   1 
ATOM   2863 C CB  . PRO C 1 9   ? 46.097  -30.198 31.547  1.00   55.98  ? 761  PRO C CB  1 
ATOM   2864 C CG  . PRO C 1 9   ? 45.206  -29.942 32.644  1.00   52.93  ? 761  PRO C CG  1 
ATOM   2865 C CD  . PRO C 1 9   ? 44.923  -28.450 32.673  1.00   54.96  ? 761  PRO C CD  1 
ATOM   2866 N N   . PRO C 1 10  ? 45.260  -30.447 28.540  1.00   48.70  ? 762  PRO C N   1 
ATOM   2867 C CA  . PRO C 1 10  ? 44.434  -31.005 27.477  1.00   45.95  ? 762  PRO C CA  1 
ATOM   2868 C C   . PRO C 1 10  ? 43.237  -31.632 28.108  1.00   43.31  ? 762  PRO C C   1 
ATOM   2869 O O   . PRO C 1 10  ? 43.327  -32.137 29.209  1.00   40.03  ? 762  PRO C O   1 
ATOM   2870 C CB  . PRO C 1 10  ? 45.336  -32.067 26.830  1.00   47.62  ? 762  PRO C CB  1 
ATOM   2871 C CG  . PRO C 1 10  ? 46.691  -31.528 27.066  1.00   51.16  ? 762  PRO C CG  1 
ATOM   2872 C CD  . PRO C 1 10  ? 46.628  -31.030 28.478  1.00   52.59  ? 762  PRO C CD  1 
ATOM   2873 N N   . GLY C 1 11  ? 42.072  -31.405 27.506  1.00   42.21  ? 763  GLY C N   1 
ATOM   2874 C CA  . GLY C 1 11  ? 40.826  -31.920 28.021  1.00   32.55  ? 763  GLY C CA  1 
ATOM   2875 C C   . GLY C 1 11  ? 40.089  -31.033 28.976  1.00   36.76  ? 763  GLY C C   1 
ATOM   2876 O O   . GLY C 1 11  ? 39.050  -31.397 29.375  1.00   34.20  ? 763  GLY C O   1 
ATOM   2877 N N   . VAL C 1 12  ? 40.579  -29.841 29.295  1.00   34.28  ? 764  VAL C N   1 
ATOM   2878 C CA  . VAL C 1 12  ? 40.007  -29.070 30.302  1.00   36.23  ? 764  VAL C CA  1 
ATOM   2879 C C   . VAL C 1 12  ? 39.725  -27.633 29.786  1.00   38.41  ? 764  VAL C C   1 
ATOM   2880 O O   . VAL C 1 12  ? 40.583  -27.054 29.161  1.00   39.56  ? 764  VAL C O   1 
ATOM   2881 C CB  . VAL C 1 12  ? 40.853  -29.062 31.589  1.00   31.98  ? 764  VAL C CB  1 
ATOM   2882 C CG1 . VAL C 1 12  ? 40.167  -28.092 32.615  1.00   31.41  ? 764  VAL C CG1 1 
ATOM   2883 C CG2 . VAL C 1 12  ? 41.013  -30.504 32.157  1.00   43.73  ? 764  VAL C CG2 1 
ATOM   2884 N N   . VAL C 1 13  ? 38.529  -27.135 30.016  1.00   41.37  ? 765  VAL C N   1 
ATOM   2885 C CA  . VAL C 1 13  ? 38.098  -25.849 29.519  1.00   40.91  ? 765  VAL C CA  1 
ATOM   2886 C C   . VAL C 1 13  ? 37.152  -25.132 30.451  1.00   40.81  ? 765  VAL C C   1 
ATOM   2887 O O   . VAL C 1 13  ? 36.294  -25.743 31.020  1.00   41.08  ? 765  VAL C O   1 
ATOM   2888 C CB  . VAL C 1 13  ? 37.364  -26.041 28.195  1.00   36.33  ? 765  VAL C CB  1 
ATOM   2889 C CG1 . VAL C 1 13  ? 37.105  -24.765 27.573  1.00   36.36  ? 765  VAL C CG1 1 
ATOM   2890 C CG2 . VAL C 1 13  ? 38.167  -26.863 27.312  1.00   41.51  ? 765  VAL C CG2 1 
ATOM   2891 N N   . MET C 1 14  ? 37.271  -23.829 30.577  1.00   37.26  ? 766  MET C N   1 
ATOM   2892 C CA  . MET C 1 14  ? 36.295  -23.180 31.403  1.00   37.77  ? 766  MET C CA  1 
ATOM   2893 C C   . MET C 1 14  ? 35.082  -22.716 30.702  1.00   40.88  ? 766  MET C C   1 
ATOM   2894 O O   . MET C 1 14  ? 35.148  -22.080 29.721  1.00   34.90  ? 766  MET C O   1 
ATOM   2895 C CB  . MET C 1 14  ? 36.819  -22.145 32.379  1.00   44.32  ? 766  MET C CB  1 
ATOM   2896 C CG  . MET C 1 14  ? 37.743  -21.180 31.935  1.00   36.64  ? 766  MET C CG  1 
ATOM   2897 S SD  . MET C 1 14  ? 38.663  -20.460 33.327  1.00   57.70  ? 766  MET C SD  1 
ATOM   2898 C CE  . MET C 1 14  ? 40.080  -19.889 32.452  1.00   36.51  ? 766  MET C CE  1 
ATOM   2899 N N   . GLY C 1 15  ? 33.961  -23.107 31.266  1.00   44.17  ? 767  GLY C N   1 
ATOM   2900 C CA  . GLY C 1 15  ? 32.666  -22.683 30.849  1.00   41.61  ? 767  GLY C CA  1 
ATOM   2901 C C   . GLY C 1 15  ? 32.203  -21.623 31.797  1.00   43.07  ? 767  GLY C C   1 
ATOM   2902 O O   . GLY C 1 15  ? 32.731  -21.470 32.840  1.00   49.02  ? 767  GLY C O   1 
ATOM   2903 N N   . LEU C 1 16  ? 31.243  -20.850 31.391  1.00   42.59  ? 768  LEU C N   1 
ATOM   2904 C CA  . LEU C 1 16  ? 30.526  -19.943 32.283  1.00   38.05  ? 768  LEU C CA  1 
ATOM   2905 C C   . LEU C 1 16  ? 29.157  -20.460 32.446  1.00   39.24  ? 768  LEU C C   1 
ATOM   2906 O O   . LEU C 1 16  ? 28.438  -20.548 31.437  1.00   45.25  ? 768  LEU C O   1 
ATOM   2907 C CB  . LEU C 1 16  ? 30.393  -18.579 31.636  1.00   42.49  ? 768  LEU C CB  1 
ATOM   2908 C CG  . LEU C 1 16  ? 31.563  -17.648 31.454  1.00   32.53  ? 768  LEU C CG  1 
ATOM   2909 C CD1 . LEU C 1 16  ? 32.646  -17.889 32.457  1.00   33.31  ? 768  LEU C CD1 1 
ATOM   2910 C CD2 . LEU C 1 16  ? 32.138  -17.725 30.122  1.00   40.85  ? 768  LEU C CD2 1 
ATOM   2911 N N   . ALA C 1 17  ? 28.776  -20.735 33.676  1.00   38.85  ? 769  ALA C N   1 
ATOM   2912 C CA  . ALA C 1 17  ? 27.479  -21.266 34.067  1.00   46.97  ? 769  ALA C CA  1 
ATOM   2913 C C   . ALA C 1 17  ? 26.618  -20.170 34.649  1.00   48.67  ? 769  ALA C C   1 
ATOM   2914 O O   . ALA C 1 17  ? 27.113  -19.324 35.411  1.00   41.99  ? 769  ALA C O   1 
ATOM   2915 C CB  . ALA C 1 17  ? 27.645  -22.307 35.107  1.00   45.97  ? 769  ALA C CB  1 
ATOM   2916 N N   . TRP C 1 18  ? 25.346  -20.194 34.283  1.00   46.34  ? 770  TRP C N   1 
ATOM   2917 C CA  . TRP C 1 18  ? 24.293  -19.433 34.980  1.00   49.86  ? 770  TRP C CA  1 
ATOM   2918 C C   . TRP C 1 18  ? 23.821  -20.206 36.204  1.00   54.15  ? 770  TRP C C   1 
ATOM   2919 O O   . TRP C 1 18  ? 22.972  -21.095 36.073  1.00   47.13  ? 770  TRP C O   1 
ATOM   2920 C CB  . TRP C 1 18  ? 23.090  -19.201 34.032  1.00   56.84  ? 770  TRP C CB  1 
ATOM   2921 C CG  . TRP C 1 18  ? 22.000  -18.235 34.454  1.00   49.86  ? 770  TRP C CG  1 
ATOM   2922 C CD1 . TRP C 1 18  ? 21.948  -17.513 35.589  1.00   47.52  ? 770  TRP C CD1 1 
ATOM   2923 C CD2 . TRP C 1 18  ? 20.810  -17.887 33.700  1.00   47.97  ? 770  TRP C CD2 1 
ATOM   2924 N NE1 . TRP C 1 18  ? 20.783  -16.712 35.615  1.00   57.58  ? 770  TRP C NE1 1 
ATOM   2925 C CE2 . TRP C 1 18  ? 20.075  -16.939 34.468  1.00   60.34  ? 770  TRP C CE2 1 
ATOM   2926 C CE3 . TRP C 1 18  ? 20.290  -18.288 32.466  1.00   43.19  ? 770  TRP C CE3 1 
ATOM   2927 C CZ2 . TRP C 1 18  ? 18.846  -16.399 34.030  1.00   46.63  ? 770  TRP C CZ2 1 
ATOM   2928 C CZ3 . TRP C 1 18  ? 19.114  -17.748 32.034  1.00   58.87  ? 770  TRP C CZ3 1 
ATOM   2929 C CH2 . TRP C 1 18  ? 18.405  -16.794 32.807  1.00   62.10  ? 770  TRP C CH2 1 
ATOM   2930 N N   . THR C 1 19  ? 24.338  -19.854 37.391  1.00   57.18  ? 771  THR C N   1 
ATOM   2931 C CA  . THR C 1 19  ? 23.889  -20.474 38.681  1.00   58.08  ? 771  THR C CA  1 
ATOM   2932 C C   . THR C 1 19  ? 22.652  -19.796 39.264  1.00   59.40  ? 771  THR C C   1 
ATOM   2933 O O   . THR C 1 19  ? 22.334  -18.653 38.920  1.00   66.41  ? 771  THR C O   1 
ATOM   2934 C CB  . THR C 1 19  ? 24.965  -20.470 39.754  1.00   58.39  ? 771  THR C CB  1 
ATOM   2935 O OG1 . THR C 1 19  ? 25.146  -19.150 40.266  1.00   41.11  ? 771  THR C OG1 1 
ATOM   2936 C CG2 . THR C 1 19  ? 26.339  -21.040 39.200  1.00   48.01  ? 771  THR C CG2 1 
ATOM   2937 N N   . ALA C 1 20  ? 21.909  -20.507 40.107  1.00   60.80  ? 772  ALA C N   1 
ATOM   2938 C CA  . ALA C 1 20  ? 20.770  -19.899 40.826  1.00   61.08  ? 772  ALA C CA  1 
ATOM   2939 C C   . ALA C 1 20  ? 21.133  -18.680 41.711  1.00   61.67  ? 772  ALA C C   1 
ATOM   2940 O O   . ALA C 1 20  ? 20.269  -17.862 41.965  1.00   65.62  ? 772  ALA C O   1 
ATOM   2941 C CB  . ALA C 1 20  ? 20.036  -20.967 41.665  1.00   59.74  ? 772  ALA C CB  1 
ATOM   2942 N N   . MET C 1 21  ? 22.388  -18.541 42.153  1.00   62.42  ? 773  MET C N   1 
ATOM   2943 C CA  . MET C 1 21  ? 22.824  -17.332 42.894  1.00   70.91  ? 773  MET C CA  1 
ATOM   2944 C C   . MET C 1 21  ? 23.841  -16.442 42.120  1.00   70.49  ? 773  MET C C   1 
ATOM   2945 O O   . MET C 1 21  ? 24.574  -15.611 42.692  1.00   68.82  ? 773  MET C O   1 
ATOM   2946 C CB  . MET C 1 21  ? 23.374  -17.712 44.274  1.00   73.96  ? 773  MET C CB  1 
ATOM   2947 C CG  . MET C 1 21  ? 24.643  -18.595 44.269  1.00   82.71  ? 773  MET C CG  1 
ATOM   2948 S SD  . MET C 1 21  ? 25.109  -19.284 45.903  1.00   94.35  ? 773  MET C SD  1 
ATOM   2949 C CE  . MET C 1 21  ? 26.572  -20.233 45.426  1.00   95.24  ? 773  MET C CE  1 
ATOM   2950 N N   . GLY C 1 22  ? 23.873  -16.600 40.810  1.00   65.28  ? 774  GLY C N   1 
ATOM   2951 C CA  . GLY C 1 22  ? 24.567  -15.629 39.988  1.00   63.74  ? 774  GLY C CA  1 
ATOM   2952 C C   . GLY C 1 22  ? 25.318  -16.324 38.900  1.00   63.55  ? 774  GLY C C   1 
ATOM   2953 O O   . GLY C 1 22  ? 24.770  -17.178 38.188  1.00   66.23  ? 774  GLY C O   1 
ATOM   2954 N N   . GLY C 1 23  ? 26.586  -15.968 38.787  1.00   59.94  ? 775  GLY C N   1 
ATOM   2955 C CA  . GLY C 1 23  ? 27.450  -16.521 37.755  1.00   56.41  ? 775  GLY C CA  1 
ATOM   2956 C C   . GLY C 1 23  ? 28.513  -17.390 38.378  1.00   57.12  ? 775  GLY C C   1 
ATOM   2957 O O   . GLY C 1 23  ? 28.922  -17.141 39.523  1.00   59.18  ? 775  GLY C O   1 
ATOM   2958 N N   . SER C 1 24  ? 28.953  -18.407 37.635  1.00   50.83  ? 776  SER C N   1 
ATOM   2959 C CA  . SER C 1 24  ? 30.172  -19.130 37.948  1.00   56.44  ? 776  SER C CA  1 
ATOM   2960 C C   . SER C 1 24  ? 31.007  -19.638 36.762  1.00   54.73  ? 776  SER C C   1 
ATOM   2961 O O   . SER C 1 24  ? 30.493  -20.019 35.700  1.00   48.53  ? 776  SER C O   1 
ATOM   2962 C CB  . SER C 1 24  ? 29.833  -20.347 38.807  1.00   60.27  ? 776  SER C CB  1 
ATOM   2963 O OG  . SER C 1 24  ? 30.961  -20.696 39.573  1.00   55.20  ? 776  SER C OG  1 
ATOM   2964 N N   . THR C 1 25  ? 32.299  -19.716 37.000  1.00   51.70  ? 777  THR C N   1 
ATOM   2965 C CA  . THR C 1 25  ? 33.215  -20.223 36.018  1.00   55.02  ? 777  THR C CA  1 
ATOM   2966 C C   . THR C 1 25  ? 33.501  -21.667 36.391  1.00   52.71  ? 777  THR C C   1 
ATOM   2967 O O   . THR C 1 25  ? 34.061  -21.944 37.442  1.00   40.29  ? 777  THR C O   1 
ATOM   2968 C CB  . THR C 1 25  ? 34.447  -19.393 35.996  1.00   52.74  ? 777  THR C CB  1 
ATOM   2969 O OG1 . THR C 1 25  ? 34.063  -18.004 35.949  1.00   65.15  ? 777  THR C OG1 1 
ATOM   2970 C CG2 . THR C 1 25  ? 35.298  -19.717 34.818  1.00   60.96  ? 777  THR C CG2 1 
ATOM   2971 N N   . LEU C 1 26  ? 33.087  -22.584 35.521  1.00   53.78  ? 778  LEU C N   1 
ATOM   2972 C CA  . LEU C 1 26  ? 33.160  -24.009 35.795  1.00   51.84  ? 778  LEU C CA  1 
ATOM   2973 C C   . LEU C 1 26  ? 34.227  -24.636 34.929  1.00   51.84  ? 778  LEU C C   1 
ATOM   2974 O O   . LEU C 1 26  ? 34.434  -24.204 33.802  1.00   58.59  ? 778  LEU C O   1 
ATOM   2975 C CB  . LEU C 1 26  ? 31.757  -24.629 35.592  1.00   49.88  ? 778  LEU C CB  1 
ATOM   2976 C CG  . LEU C 1 26  ? 30.943  -24.680 36.920  1.00   63.85  ? 778  LEU C CG  1 
ATOM   2977 C CD1 . LEU C 1 26  ? 31.145  -23.449 37.878  1.00   55.99  ? 778  LEU C CD1 1 
ATOM   2978 C CD2 . LEU C 1 26  ? 29.440  -24.959 36.663  1.00   46.89  ? 778  LEU C CD2 1 
ATOM   2979 N N   . PHE C 1 27  ? 34.906  -25.663 35.440  1.00   43.04  ? 779  PHE C N   1 
ATOM   2980 C CA  . PHE C 1 27  ? 35.852  -26.421 34.646  1.00   43.99  ? 779  PHE C CA  1 
ATOM   2981 C C   . PHE C 1 27  ? 35.271  -27.714 34.090  1.00   43.95  ? 779  PHE C C   1 
ATOM   2982 O O   . PHE C 1 27  ? 34.946  -28.643 34.823  1.00   41.38  ? 779  PHE C O   1 
ATOM   2983 C CB  . PHE C 1 27  ? 37.134  -26.661 35.410  1.00   37.89  ? 779  PHE C CB  1 
ATOM   2984 C CG  . PHE C 1 27  ? 37.937  -25.364 35.599  1.00   46.26  ? 779  PHE C CG  1 
ATOM   2985 C CD1 . PHE C 1 27  ? 39.109  -25.140 34.887  1.00   49.70  ? 779  PHE C CD1 1 
ATOM   2986 C CD2 . PHE C 1 27  ? 37.465  -24.369 36.482  1.00   63.69  ? 779  PHE C CD2 1 
ATOM   2987 C CE1 . PHE C 1 27  ? 39.838  -23.946 35.059  1.00   56.41  ? 779  PHE C CE1 1 
ATOM   2988 C CE2 . PHE C 1 27  ? 38.155  -23.171 36.666  1.00   54.18  ? 779  PHE C CE2 1 
ATOM   2989 C CZ  . PHE C 1 27  ? 39.349  -22.955 35.947  1.00   53.69  ? 779  PHE C CZ  1 
ATOM   2990 N N   . VAL C 1 28  ? 35.168  -27.760 32.768  1.00   39.43  ? 780  VAL C N   1 
ATOM   2991 C CA  . VAL C 1 28  ? 34.794  -28.923 32.154  1.00   37.83  ? 780  VAL C CA  1 
ATOM   2992 C C   . VAL C 1 28  ? 36.124  -29.660 32.089  1.00   28.94  ? 780  VAL C C   1 
ATOM   2993 O O   . VAL C 1 28  ? 37.141  -29.099 31.692  1.00   39.33  ? 780  VAL C O   1 
ATOM   2994 C CB  . VAL C 1 28  ? 34.205  -28.669 30.753  1.00   39.88  ? 780  VAL C CB  1 
ATOM   2995 C CG1 . VAL C 1 28  ? 34.177  -29.925 30.013  1.00   29.98  ? 780  VAL C CG1 1 
ATOM   2996 C CG2 . VAL C 1 28  ? 32.828  -28.018 30.824  1.00   34.31  ? 780  VAL C CG2 1 
ATOM   2997 N N   . GLU C 1 29  ? 36.018  -30.964 32.219  1.00   33.50  ? 781  GLU C N   1 
ATOM   2998 C CA  . GLU C 1 29  ? 37.165  -31.893 32.152  1.00   33.81  ? 781  GLU C CA  1 
ATOM   2999 C C   . GLU C 1 29  ? 36.771  -33.158 31.509  1.00   25.46  ? 781  GLU C C   1 
ATOM   3000 O O   . GLU C 1 29  ? 35.594  -33.530 31.532  1.00   28.47  ? 781  GLU C O   1 
ATOM   3001 C CB  . GLU C 1 29  ? 37.612  -32.322 33.528  1.00   37.80  ? 781  GLU C CB  1 
ATOM   3002 C CG  . GLU C 1 29  ? 38.007  -31.330 34.466  1.00   33.01  ? 781  GLU C CG  1 
ATOM   3003 C CD  . GLU C 1 29  ? 38.277  -31.898 35.881  1.00   45.59  ? 781  GLU C CD  1 
ATOM   3004 O OE1 . GLU C 1 29  ? 37.397  -31.755 36.772  1.00   54.33  ? 781  GLU C OE1 1 
ATOM   3005 O OE2 . GLU C 1 29  ? 39.396  -32.412 36.108  1.00   36.50  ? 781  GLU C OE2 1 
ATOM   3006 N N   . THR C 1 30  ? 37.740  -33.793 30.847  1.00   32.89  ? 782  THR C N   1 
ATOM   3007 C CA  . THR C 1 30  ? 37.495  -35.072 30.157  1.00   36.64  ? 782  THR C CA  1 
ATOM   3008 C C   . THR C 1 30  ? 38.741  -35.902 30.384  1.00   38.01  ? 782  THR C C   1 
ATOM   3009 O O   . THR C 1 30  ? 39.796  -35.343 30.644  1.00   33.22  ? 782  THR C O   1 
ATOM   3010 C CB  . THR C 1 30  ? 37.419  -34.932 28.631  1.00   39.67  ? 782  THR C CB  1 
ATOM   3011 O OG1 . THR C 1 30  ? 38.416  -33.972 28.236  1.00   40.24  ? 782  THR C OG1 1 
ATOM   3012 C CG2 . THR C 1 30  ? 36.031  -34.556 28.264  1.00   28.35  ? 782  THR C CG2 1 
ATOM   3013 N N   . SER C 1 31  ? 38.632  -37.219 30.236  1.00   36.01  ? 783  SER C N   1 
ATOM   3014 C CA  . SER C 1 31  ? 39.847  -38.074 30.333  1.00   36.70  ? 783  SER C CA  1 
ATOM   3015 C C   . SER C 1 31  ? 39.728  -39.357 29.577  1.00   39.46  ? 783  SER C C   1 
ATOM   3016 O O   . SER C 1 31  ? 38.615  -39.894 29.398  1.00   33.83  ? 783  SER C O   1 
ATOM   3017 C CB  . SER C 1 31  ? 40.120  -38.454 31.808  1.00   41.42  ? 783  SER C CB  1 
ATOM   3018 O OG  . SER C 1 31  ? 41.142  -39.516 31.929  1.00   40.25  ? 783  SER C OG  1 
ATOM   3019 N N   . LEU C 1 32  ? 40.862  -39.980 29.240  1.00   40.69  ? 784  LEU C N   1 
ATOM   3020 C CA  . LEU C 1 32  ? 40.696  -41.441 28.918  1.00   35.31  ? 784  LEU C CA  1 
ATOM   3021 C C   . LEU C 1 32  ? 40.402  -42.228 30.193  1.00   36.51  ? 784  LEU C C   1 
ATOM   3022 O O   . LEU C 1 32  ? 40.789  -41.828 31.251  1.00   40.18  ? 784  LEU C O   1 
ATOM   3023 C CB  . LEU C 1 32  ? 41.951  -41.962 28.195  1.00   48.03  ? 784  LEU C CB  1 
ATOM   3024 C CG  . LEU C 1 32  ? 42.012  -42.308 26.721  1.00   52.91  ? 784  LEU C CG  1 
ATOM   3025 C CD1 . LEU C 1 32  ? 43.379  -42.875 26.468  1.00   56.91  ? 784  LEU C CD1 1 
ATOM   3026 C CD2 . LEU C 1 32  ? 40.861  -43.303 26.289  1.00   49.77  ? 784  LEU C CD2 1 
ATOM   3027 N N   . ARG C 1 33  ? 39.599  -43.309 30.107  1.00   39.25  ? 785  ARG C N   1 
ATOM   3028 C CA  . ARG C 1 33  ? 39.392  -44.184 31.180  1.00   37.72  ? 785  ARG C CA  1 
ATOM   3029 C C   . ARG C 1 33  ? 39.567  -45.681 30.792  1.00   45.97  ? 785  ARG C C   1 
ATOM   3030 O O   . ARG C 1 33  ? 39.277  -46.556 31.608  1.00   43.82  ? 785  ARG C O   1 
ATOM   3031 C CB  . ARG C 1 33  ? 37.966  -43.998 31.841  1.00   32.71  ? 785  ARG C CB  1 
ATOM   3032 C CG  . ARG C 1 33  ? 36.887  -44.135 30.861  1.00   41.98  ? 785  ARG C CG  1 
ATOM   3033 C CD  . ARG C 1 33  ? 35.559  -44.162 31.573  1.00   43.80  ? 785  ARG C CD  1 
ATOM   3034 N NE  . ARG C 1 33  ? 35.330  -45.442 32.168  1.00   62.33  ? 785  ARG C NE  1 
ATOM   3035 C CZ  . ARG C 1 33  ? 35.058  -46.516 31.441  1.00   66.25  ? 785  ARG C CZ  1 
ATOM   3036 N NH1 . ARG C 1 33  ? 34.970  -46.430 30.105  1.00   59.26  ? 785  ARG C NH1 1 
ATOM   3037 N NH2 . ARG C 1 33  ? 34.890  -47.669 32.052  1.00   45.12  ? 785  ARG C NH2 1 
ATOM   3038 N N   . ARG C 1 34  ? 40.017  -45.961 29.569  1.00   51.43  ? 786  ARG C N   1 
ATOM   3039 C CA  . ARG C 1 34  ? 40.405  -47.288 29.128  1.00   50.37  ? 786  ARG C CA  1 
ATOM   3040 C C   . ARG C 1 34  ? 41.447  -47.024 28.041  1.00   56.04  ? 786  ARG C C   1 
ATOM   3041 O O   . ARG C 1 34  ? 41.326  -46.074 27.285  1.00   54.76  ? 786  ARG C O   1 
ATOM   3042 C CB  . ARG C 1 34  ? 39.254  -48.076 28.489  1.00   49.59  ? 786  ARG C CB  1 
ATOM   3043 C CG  . ARG C 1 34  ? 38.411  -48.832 29.473  1.00   55.60  ? 786  ARG C CG  1 
ATOM   3044 C CD  . ARG C 1 34  ? 38.280  -50.278 29.061  1.00   61.95  ? 786  ARG C CD  1 
ATOM   3045 N NE  . ARG C 1 34  ? 37.143  -50.484 28.191  1.00   48.73  ? 786  ARG C NE  1 
ATOM   3046 C CZ  . ARG C 1 34  ? 36.943  -51.570 27.439  1.00   71.11  ? 786  ARG C CZ  1 
ATOM   3047 N NH1 . ARG C 1 34  ? 37.796  -52.598 27.455  1.00   73.06  ? 786  ARG C NH1 1 
ATOM   3048 N NH2 . ARG C 1 34  ? 35.856  -51.641 26.675  1.00   65.16  ? 786  ARG C NH2 1 
ATOM   3049 N N   . PRO C 1 35  ? 42.457  -47.882 27.940  1.00   56.30  ? 787  PRO C N   1 
ATOM   3050 C CA  . PRO C 1 35  ? 43.483  -47.603 26.937  1.00   56.51  ? 787  PRO C CA  1 
ATOM   3051 C C   . PRO C 1 35  ? 43.036  -47.998 25.518  1.00   53.62  ? 787  PRO C C   1 
ATOM   3052 O O   . PRO C 1 35  ? 43.617  -47.517 24.547  1.00   60.72  ? 787  PRO C O   1 
ATOM   3053 C CB  . PRO C 1 35  ? 44.654  -48.479 27.409  1.00   60.16  ? 787  PRO C CB  1 
ATOM   3054 C CG  . PRO C 1 35  ? 43.969  -49.686 28.066  1.00   61.56  ? 787  PRO C CG  1 
ATOM   3055 C CD  . PRO C 1 35  ? 42.604  -49.208 28.578  1.00   51.41  ? 787  PRO C CD  1 
ATOM   3056 N N   . GLN C 1 36  ? 42.044  -48.894 25.419  1.00   53.26  ? 788  GLN C N   1 
ATOM   3057 C CA  . GLN C 1 36  ? 41.679  -49.595 24.180  1.00   65.50  ? 788  GLN C CA  1 
ATOM   3058 C C   . GLN C 1 36  ? 40.326  -50.341 24.282  1.00   66.95  ? 788  GLN C C   1 
ATOM   3059 O O   . GLN C 1 36  ? 39.632  -50.477 23.267  1.00   72.29  ? 788  GLN C O   1 
ATOM   3060 C CB  . GLN C 1 36  ? 42.747  -50.611 23.753  1.00   65.92  ? 788  GLN C CB  1 
ATOM   3061 C CG  . GLN C 1 36  ? 43.091  -50.507 22.292  1.00   66.96  ? 788  GLN C CG  1 
ATOM   3062 C CD  . GLN C 1 36  ? 44.078  -49.402 22.069  1.00   71.52  ? 788  GLN C CD  1 
ATOM   3063 O OE1 . GLN C 1 36  ? 45.203  -49.480 22.573  1.00   53.65  ? 788  GLN C OE1 1 
ATOM   3064 N NE2 . GLN C 1 36  ? 43.675  -48.349 21.334  1.00   56.37  ? 788  GLN C NE2 1 
ATOM   3065 N N   . LYS C 1 44  ? 37.292  -50.458 15.839  1.00   70.29  ? 796  LYS C N   1 
ATOM   3066 C CA  . LYS C 1 44  ? 36.960  -50.279 17.236  1.00   68.76  ? 796  LYS C CA  1 
ATOM   3067 C C   . LYS C 1 44  ? 35.645  -49.607 17.421  1.00   64.61  ? 796  LYS C C   1 
ATOM   3068 O O   . LYS C 1 44  ? 34.965  -49.228 16.508  1.00   65.09  ? 796  LYS C O   1 
ATOM   3069 C CB  . LYS C 1 44  ? 38.011  -49.454 17.964  1.00   20.00  ? 796  LYS C CB  1 
ATOM   3070 C CG  . LYS C 1 44  ? 39.343  -50.164 18.191  1.00   20.00  ? 796  LYS C CG  1 
ATOM   3071 C CD  . LYS C 1 44  ? 40.333  -49.743 17.130  1.00   20.00  ? 796  LYS C CD  1 
ATOM   3072 C CE  . LYS C 1 44  ? 40.055  -50.427 15.829  1.00   20.00  ? 796  LYS C CE  1 
ATOM   3073 N NZ  . LYS C 1 44  ? 40.336  -49.618 14.598  1.00   20.00  ? 796  LYS C NZ  1 
ATOM   3074 N N   . ASP C 1 45  ? 35.314  -49.481 18.667  1.00   62.54  ? 797  ASP C N   1 
ATOM   3075 C CA  . ASP C 1 45  ? 34.201  -48.650 19.148  1.00   63.37  ? 797  ASP C CA  1 
ATOM   3076 C C   . ASP C 1 45  ? 34.790  -47.744 20.210  1.00   61.10  ? 797  ASP C C   1 
ATOM   3077 O O   . ASP C 1 45  ? 35.657  -48.180 20.941  1.00   63.77  ? 797  ASP C O   1 
ATOM   3078 N N   . GLY C 1 46  ? 34.363  -46.482 20.285  1.00   56.01  ? 798  GLY C N   1 
ATOM   3079 C CA  . GLY C 1 46  ? 34.696  -45.636 21.414  1.00   51.84  ? 798  GLY C CA  1 
ATOM   3080 C C   . GLY C 1 46  ? 33.457  -45.464 22.273  1.00   48.12  ? 798  GLY C C   1 
ATOM   3081 O O   . GLY C 1 46  ? 32.384  -45.860 21.891  1.00   51.54  ? 798  GLY C O   1 
ATOM   3082 N N   . SER C 1 47  ? 33.592  -44.802 23.399  1.00   49.57  ? 799  SER C N   1 
ATOM   3083 C CA  . SER C 1 47  ? 32.438  -44.670 24.293  1.00   37.71  ? 799  SER C CA  1 
ATOM   3084 C C   . SER C 1 47  ? 32.635  -43.465 25.081  1.00   34.98  ? 799  SER C C   1 
ATOM   3085 O O   . SER C 1 47  ? 33.747  -43.096 25.266  1.00   37.19  ? 799  SER C O   1 
ATOM   3086 C CB  . SER C 1 47  ? 32.312  -45.912 25.220  1.00   28.75  ? 799  SER C CB  1 
ATOM   3087 O OG  . SER C 1 47  ? 33.024  -45.876 26.500  1.00   38.93  ? 799  SER C OG  1 
ATOM   3088 N N   . LEU C 1 48  ? 31.566  -42.911 25.656  1.00   38.28  ? 800  LEU C N   1 
ATOM   3089 C CA  . LEU C 1 48  ? 31.696  -41.782 26.549  1.00   40.60  ? 800  LEU C CA  1 
ATOM   3090 C C   . LEU C 1 48  ? 30.888  -41.953 27.793  1.00   39.25  ? 800  LEU C C   1 
ATOM   3091 O O   . LEU C 1 48  ? 29.687  -42.094 27.724  1.00   37.49  ? 800  LEU C O   1 
ATOM   3092 C CB  . LEU C 1 48  ? 31.293  -40.450 25.864  1.00   48.46  ? 800  LEU C CB  1 
ATOM   3093 C CG  . LEU C 1 48  ? 31.408  -39.247 26.788  1.00   45.70  ? 800  LEU C CG  1 
ATOM   3094 C CD1 . LEU C 1 48  ? 32.874  -38.892 27.379  1.00   34.66  ? 800  LEU C CD1 1 
ATOM   3095 C CD2 . LEU C 1 48  ? 30.779  -38.064 26.191  1.00   54.77  ? 800  LEU C CD2 1 
ATOM   3096 N N   . GLU C 1 49  ? 31.558  -41.821 28.926  1.00   34.64  ? 801  GLU C N   1 
ATOM   3097 C CA  . GLU C 1 49  ? 30.925  -41.817 30.227  1.00   43.87  ? 801  GLU C CA  1 
ATOM   3098 C C   . GLU C 1 49  ? 30.877  -40.388 30.839  1.00   40.86  ? 801  GLU C C   1 
ATOM   3099 O O   . GLU C 1 49  ? 31.875  -39.642 30.844  1.00   44.66  ? 801  GLU C O   1 
ATOM   3100 C CB  . GLU C 1 49  ? 31.592  -42.873 31.177  1.00   40.32  ? 801  GLU C CB  1 
ATOM   3101 C CG  . GLU C 1 49  ? 31.214  -42.684 32.690  1.00   45.83  ? 801  GLU C CG  1 
ATOM   3102 C CD  . GLU C 1 49  ? 31.780  -43.672 33.705  1.00   48.16  ? 801  GLU C CD  1 
ATOM   3103 O OE1 . GLU C 1 49  ? 30.990  -44.224 34.495  1.00   66.86  ? 801  GLU C OE1 1 
ATOM   3104 O OE2 . GLU C 1 49  ? 33.007  -43.825 33.803  1.00   58.76  ? 801  GLU C OE2 1 
ATOM   3105 N N   . VAL C 1 50  ? 29.687  -40.003 31.314  1.00   39.99  ? 802  VAL C N   1 
ATOM   3106 C CA  . VAL C 1 50  ? 29.434  -38.651 31.706  1.00   38.41  ? 802  VAL C CA  1 
ATOM   3107 C C   . VAL C 1 50  ? 29.018  -38.664 33.217  1.00   37.32  ? 802  VAL C C   1 
ATOM   3108 O O   . VAL C 1 50  ? 28.101  -39.372 33.607  1.00   47.20  ? 802  VAL C O   1 
ATOM   3109 C CB  . VAL C 1 50  ? 28.364  -37.910 30.830  1.00   40.05  ? 802  VAL C CB  1 
ATOM   3110 C CG1 . VAL C 1 50  ? 28.127  -36.480 31.345  1.00   36.46  ? 802  VAL C CG1 1 
ATOM   3111 C CG2 . VAL C 1 50  ? 28.735  -37.783 29.352  1.00   30.81  ? 802  VAL C CG2 1 
ATOM   3112 N N   . THR C 1 51  ? 29.731  -37.945 34.035  1.00   37.28  ? 803  THR C N   1 
ATOM   3113 C CA  . THR C 1 51  ? 29.300  -37.527 35.360  1.00   40.14  ? 803  THR C CA  1 
ATOM   3114 C C   . THR C 1 51  ? 28.944  -36.042 35.457  1.00   41.91  ? 803  THR C C   1 
ATOM   3115 O O   . THR C 1 51  ? 29.223  -35.266 34.492  1.00   38.45  ? 803  THR C O   1 
ATOM   3116 C CB  . THR C 1 51  ? 30.278  -37.874 36.417  1.00   38.47  ? 803  THR C CB  1 
ATOM   3117 O OG1 . THR C 1 51  ? 31.597  -37.416 36.012  1.00   34.15  ? 803  THR C OG1 1 
ATOM   3118 C CG2 . THR C 1 51  ? 30.236  -39.420 36.539  1.00   39.67  ? 803  THR C CG2 1 
ATOM   3119 N N   . GLY C 1 52  ? 28.370  -35.695 36.604  1.00   35.01  ? 804  GLY C N   1 
ATOM   3120 C CA  . GLY C 1 52  ? 27.818  -34.398 36.887  1.00   44.60  ? 804  GLY C CA  1 
ATOM   3121 C C   . GLY C 1 52  ? 26.386  -34.403 37.372  1.00   44.12  ? 804  GLY C C   1 
ATOM   3122 O O   . GLY C 1 52  ? 25.838  -33.379 37.640  1.00   43.66  ? 804  GLY C O   1 
ATOM   3123 N N   . GLN C 1 53  ? 25.800  -35.573 37.527  1.00   48.01  ? 805  GLN C N   1 
ATOM   3124 C CA  . GLN C 1 53  ? 24.471  -35.703 38.120  1.00   49.19  ? 805  GLN C CA  1 
ATOM   3125 C C   . GLN C 1 53  ? 23.410  -34.991 37.359  1.00   51.84  ? 805  GLN C C   1 
ATOM   3126 O O   . GLN C 1 53  ? 22.580  -34.291 37.884  1.00   52.58  ? 805  GLN C O   1 
ATOM   3127 C CB  . GLN C 1 53  ? 24.485  -35.159 39.542  1.00   51.01  ? 805  GLN C CB  1 
ATOM   3128 C CG  . GLN C 1 53  ? 23.877  -36.048 40.505  1.00   48.63  ? 805  GLN C CG  1 
ATOM   3129 C CD  . GLN C 1 53  ? 24.859  -36.579 41.430  1.00   60.29  ? 805  GLN C CD  1 
ATOM   3130 O OE1 . GLN C 1 53  ? 25.224  -35.934 42.378  1.00   69.27  ? 805  GLN C OE1 1 
ATOM   3131 N NE2 . GLN C 1 53  ? 25.321  -37.754 41.166  1.00   56.00  ? 805  GLN C NE2 1 
ATOM   3132 N N   . LEU C 1 54  ? 23.519  -35.151 36.081  1.00   38.98  ? 806  LEU C N   1 
ATOM   3133 C CA  . LEU C 1 54  ? 22.652  -34.541 35.171  1.00   45.12  ? 806  LEU C CA  1 
ATOM   3134 C C   . LEU C 1 54  ? 21.379  -35.270 35.003  1.00   44.98  ? 806  LEU C C   1 
ATOM   3135 O O   . LEU C 1 54  ? 21.306  -36.440 35.098  1.00   50.50  ? 806  LEU C O   1 
ATOM   3136 C CB  . LEU C 1 54  ? 23.360  -34.580 33.828  1.00   46.02  ? 806  LEU C CB  1 
ATOM   3137 C CG  . LEU C 1 54  ? 24.855  -34.648 33.880  1.00   44.59  ? 806  LEU C CG  1 
ATOM   3138 C CD1 . LEU C 1 54  ? 25.390  -34.805 32.544  1.00   37.07  ? 806  LEU C CD1 1 
ATOM   3139 C CD2 . LEU C 1 54  ? 25.277  -33.378 34.424  1.00   46.10  ? 806  LEU C CD2 1 
ATOM   3140 N N   . GLY C 1 55  ? 20.358  -34.560 34.668  1.00   47.00  ? 807  GLY C N   1 
ATOM   3141 C CA  . GLY C 1 55  ? 19.210  -35.276 34.089  1.00   36.79  ? 807  GLY C CA  1 
ATOM   3142 C C   . GLY C 1 55  ? 19.302  -35.569 32.608  1.00   43.60  ? 807  GLY C C   1 
ATOM   3143 O O   . GLY C 1 55  ? 20.298  -35.310 31.911  1.00   43.71  ? 807  GLY C O   1 
ATOM   3144 N N   A GLU C 1 56  ? 18.177  -36.103 32.151  0.50   48.71  ? 808  GLU C N   1 
ATOM   3145 N N   B GLU C 1 56  ? 18.216  -36.108 32.100  0.50   49.27  ? 808  GLU C N   1 
ATOM   3146 C CA  A GLU C 1 56  ? 17.926  -36.615 30.819  0.50   47.66  ? 808  GLU C CA  1 
ATOM   3147 C CA  B GLU C 1 56  ? 18.100  -36.621 30.763  0.50   48.67  ? 808  GLU C CA  1 
ATOM   3148 C C   A GLU C 1 56  ? 18.289  -35.598 29.782  0.50   48.50  ? 808  GLU C C   1 
ATOM   3149 C C   B GLU C 1 56  ? 18.322  -35.555 29.761  0.50   49.54  ? 808  GLU C C   1 
ATOM   3150 O O   A GLU C 1 56  ? 18.921  -35.896 28.789  0.50   48.49  ? 808  GLU C O   1 
ATOM   3151 O O   B GLU C 1 56  ? 18.821  -35.795 28.729  0.50   51.47  ? 808  GLU C O   1 
ATOM   3152 C CB  A GLU C 1 56  ? 16.423  -36.866 30.742  0.50   48.83  ? 808  GLU C CB  1 
ATOM   3153 C CB  B GLU C 1 56  ? 16.754  -37.271 30.555  0.50   52.33  ? 808  GLU C CB  1 
ATOM   3154 C CG  A GLU C 1 56  ? 15.776  -37.024 32.135  0.50   45.52  ? 808  GLU C CG  1 
ATOM   3155 C CG  B GLU C 1 56  ? 16.829  -38.626 29.883  0.50   51.86  ? 808  GLU C CG  1 
ATOM   3156 C CD  A GLU C 1 56  ? 15.541  -35.712 32.910  0.50   40.86  ? 808  GLU C CD  1 
ATOM   3157 C CD  B GLU C 1 56  ? 17.687  -39.647 30.655  0.50   54.85  ? 808  GLU C CD  1 
ATOM   3158 O OE1 A GLU C 1 56  ? 15.085  -34.692 32.333  0.50   48.34  ? 808  GLU C OE1 1 
ATOM   3159 O OE1 B GLU C 1 56  ? 18.528  -40.354 30.030  0.50   54.01  ? 808  GLU C OE1 1 
ATOM   3160 O OE2 A GLU C 1 56  ? 15.788  -35.731 34.121  0.50   38.84  ? 808  GLU C OE2 1 
ATOM   3161 O OE2 B GLU C 1 56  ? 17.495  -39.739 31.887  0.50   52.41  ? 808  GLU C OE2 1 
ATOM   3162 N N   . VAL C 1 57  ? 17.905  -34.366 30.076  1.00   49.95  ? 809  VAL C N   1 
ATOM   3163 C CA  . VAL C 1 57  ? 18.078  -33.272 29.217  1.00   45.50  ? 809  VAL C CA  1 
ATOM   3164 C C   . VAL C 1 57  ? 19.546  -32.931 29.067  1.00   48.94  ? 809  VAL C C   1 
ATOM   3165 O O   . VAL C 1 57  ? 20.000  -32.785 27.908  1.00   55.56  ? 809  VAL C O   1 
ATOM   3166 C CB  . VAL C 1 57  ? 17.217  -32.103 29.674  1.00   51.15  ? 809  VAL C CB  1 
ATOM   3167 C CG1 . VAL C 1 57  ? 17.514  -30.848 28.885  1.00   43.92  ? 809  VAL C CG1 1 
ATOM   3168 C CG2 . VAL C 1 57  ? 15.758  -32.508 29.536  1.00   42.66  ? 809  VAL C CG2 1 
ATOM   3169 N N   . MET C 1 58  ? 20.302  -32.849 30.172  1.00   44.89  ? 810  MET C N   1 
ATOM   3170 C CA  . MET C 1 58  ? 21.753  -32.581 30.066  1.00   42.54  ? 810  MET C CA  1 
ATOM   3171 C C   . MET C 1 58  ? 22.599  -33.787 29.496  1.00   44.47  ? 810  MET C C   1 
ATOM   3172 O O   . MET C 1 58  ? 23.668  -33.599 28.852  1.00   40.97  ? 810  MET C O   1 
ATOM   3173 C CB  . MET C 1 58  ? 22.367  -32.111 31.386  1.00   46.03  ? 810  MET C CB  1 
ATOM   3174 C CG  . MET C 1 58  ? 22.409  -30.592 31.588  1.00   55.74  ? 810  MET C CG  1 
ATOM   3175 S SD  . MET C 1 58  ? 23.534  -29.842 30.392  1.00   59.11  ? 810  MET C SD  1 
ATOM   3176 C CE  . MET C 1 58  ? 25.187  -30.344 30.892  1.00   66.31  ? 810  MET C CE  1 
ATOM   3177 N N   . LYS C 1 59  ? 22.103  -34.981 29.742  1.00   42.82  ? 811  LYS C N   1 
ATOM   3178 C CA  . LYS C 1 59  ? 22.708  -36.182 29.238  1.00   43.77  ? 811  LYS C CA  1 
ATOM   3179 C C   . LYS C 1 59  ? 22.707  -36.140 27.734  1.00   40.18  ? 811  LYS C C   1 
ATOM   3180 O O   . LYS C 1 59  ? 23.659  -36.525 27.137  1.00   38.59  ? 811  LYS C O   1 
ATOM   3181 C CB  . LYS C 1 59  ? 21.943  -37.412 29.711  1.00   39.20  ? 811  LYS C CB  1 
ATOM   3182 C CG  . LYS C 1 59  ? 22.303  -37.883 31.063  1.00   50.64  ? 811  LYS C CG  1 
ATOM   3183 C CD  . LYS C 1 59  ? 21.287  -38.864 31.653  1.00   42.97  ? 811  LYS C CD  1 
ATOM   3184 C CE  . LYS C 1 59  ? 21.567  -39.224 33.097  1.00   54.61  ? 811  LYS C CE  1 
ATOM   3185 N NZ  . LYS C 1 59  ? 20.531  -40.008 33.759  1.00   51.36  ? 811  LYS C NZ  1 
ATOM   3186 N N   . GLU C 1 60  ? 21.631  -35.662 27.147  1.00   34.42  ? 812  GLU C N   1 
ATOM   3187 C CA  . GLU C 1 60  ? 21.529  -35.625 25.801  1.00   34.00  ? 812  GLU C CA  1 
ATOM   3188 C C   . GLU C 1 60  ? 22.452  -34.538 25.219  1.00   40.39  ? 812  GLU C C   1 
ATOM   3189 O O   . GLU C 1 60  ? 23.150  -34.745 24.198  1.00   36.99  ? 812  GLU C O   1 
ATOM   3190 C CB  . GLU C 1 60  ? 20.066  -35.387 25.409  1.00   38.41  ? 812  GLU C CB  1 
ATOM   3191 C CG  . GLU C 1 60  ? 19.820  -35.754 23.990  1.00   41.10  ? 812  GLU C CG  1 
ATOM   3192 C CD  . GLU C 1 60  ? 19.778  -37.253 23.839  1.00   55.29  ? 812  GLU C CD  1 
ATOM   3193 O OE1 . GLU C 1 60  ? 18.776  -37.873 24.262  1.00   51.03  ? 812  GLU C OE1 1 
ATOM   3194 O OE2 . GLU C 1 60  ? 20.740  -37.794 23.319  1.00   38.09  ? 812  GLU C OE2 1 
ATOM   3195 N N   . SER C 1 61  ? 22.447  -33.388 25.881  1.00   37.56  ? 813  SER C N   1 
ATOM   3196 C CA  . SER C 1 61  ? 23.335  -32.268 25.516  1.00   35.57  ? 813  SER C CA  1 
ATOM   3197 C C   . SER C 1 61  ? 24.798  -32.765 25.395  1.00   26.99  ? 813  SER C C   1 
ATOM   3198 O O   . SER C 1 61  ? 25.334  -32.638 24.319  1.00   26.65  ? 813  SER C O   1 
ATOM   3199 C CB  . SER C 1 61  ? 23.193  -31.136 26.474  1.00   34.17  ? 813  SER C CB  1 
ATOM   3200 O OG  . SER C 1 61  ? 24.079  -30.046 26.220  1.00   50.07  ? 813  SER C OG  1 
ATOM   3201 N N   . ALA C 1 62  ? 25.302  -33.424 26.369  1.00   35.80  ? 814  ALA C N   1 
ATOM   3202 C CA  . ALA C 1 62  ? 26.615  -34.105 26.217  1.00   36.32  ? 814  ALA C CA  1 
ATOM   3203 C C   . ALA C 1 62  ? 26.660  -34.985 24.988  1.00   29.21  ? 814  ALA C C   1 
ATOM   3204 O O   . ALA C 1 62  ? 27.640  -34.959 24.318  1.00   37.76  ? 814  ALA C O   1 
ATOM   3205 C CB  . ALA C 1 62  ? 26.984  -34.828 27.404  1.00   37.11  ? 814  ALA C CB  1 
ATOM   3206 N N   . ARG C 1 63  ? 25.584  -35.726 24.691  1.00   36.89  ? 815  ARG C N   1 
ATOM   3207 C CA  . ARG C 1 63  ? 25.517  -36.546 23.471  1.00   36.61  ? 815  ARG C CA  1 
ATOM   3208 C C   . ARG C 1 63  ? 25.659  -35.738 22.226  1.00   39.13  ? 815  ARG C C   1 
ATOM   3209 O O   . ARG C 1 63  ? 26.600  -35.988 21.455  1.00   38.61  ? 815  ARG C O   1 
ATOM   3210 C CB  . ARG C 1 63  ? 24.386  -37.593 23.484  1.00   35.43  ? 815  ARG C CB  1 
ATOM   3211 C CG  . ARG C 1 63  ? 24.768  -38.998 24.026  1.00   49.49  ? 815  ARG C CG  1 
ATOM   3212 C CD  . ARG C 1 63  ? 23.501  -39.830 24.399  1.00   56.24  ? 815  ARG C CD  1 
ATOM   3213 N NE  . ARG C 1 63  ? 22.730  -39.245 25.510  1.00   68.30  ? 815  ARG C NE  1 
ATOM   3214 C CZ  . ARG C 1 63  ? 21.473  -39.554 25.834  1.00   72.06  ? 815  ARG C CZ  1 
ATOM   3215 N NH1 . ARG C 1 63  ? 20.883  -38.958 26.855  1.00   74.53  ? 815  ARG C NH1 1 
ATOM   3216 N NH2 . ARG C 1 63  ? 20.795  -40.452 25.139  1.00   84.50  ? 815  ARG C NH2 1 
ATOM   3217 N N   . ILE C 1 64  ? 24.957  -34.643 22.148  1.00   34.81  ? 816  ILE C N   1 
ATOM   3218 C CA  . ILE C 1 64  ? 25.087  -33.789 21.021  1.00   36.05  ? 816  ILE C CA  1 
ATOM   3219 C C   . ILE C 1 64  ? 26.498  -33.305 20.860  1.00   25.29  ? 816  ILE C C   1 
ATOM   3220 O O   . ILE C 1 64  ? 27.023  -33.340 19.801  1.00   34.13  ? 816  ILE C O   1 
ATOM   3221 C CB  . ILE C 1 64  ? 24.256  -32.541 21.195  1.00   31.92  ? 816  ILE C CB  1 
ATOM   3222 C CG1 . ILE C 1 64  ? 22.803  -32.861 21.420  1.00   40.43  ? 816  ILE C CG1 1 
ATOM   3223 C CG2 . ILE C 1 64  ? 24.396  -31.672 20.038  1.00   41.17  ? 816  ILE C CG2 1 
ATOM   3224 C CD1 . ILE C 1 64  ? 21.992  -31.679 21.659  1.00   48.29  ? 816  ILE C CD1 1 
ATOM   3225 N N   . ALA C 1 65  ? 27.128  -32.879 21.919  1.00   28.96  ? 817  ALA C N   1 
ATOM   3226 C CA  . ALA C 1 65  ? 28.496  -32.434 21.834  1.00   35.70  ? 817  ALA C CA  1 
ATOM   3227 C C   . ALA C 1 65  ? 29.439  -33.558 21.429  1.00   34.46  ? 817  ALA C C   1 
ATOM   3228 O O   . ALA C 1 65  ? 30.339  -33.351 20.714  1.00   31.07  ? 817  ALA C O   1 
ATOM   3229 C CB  . ALA C 1 65  ? 28.908  -31.860 23.042  1.00   25.89  ? 817  ALA C CB  1 
ATOM   3230 N N   . TYR C 1 66  ? 29.211  -34.746 21.935  1.00   38.08  ? 818  TYR C N   1 
ATOM   3231 C CA  . TYR C 1 66  ? 30.022  -35.898 21.579  1.00   29.75  ? 818  TYR C CA  1 
ATOM   3232 C C   . TYR C 1 66  ? 29.925  -36.253 20.126  1.00   29.10  ? 818  TYR C C   1 
ATOM   3233 O O   . TYR C 1 66  ? 30.905  -36.462 19.513  1.00   27.63  ? 818  TYR C O   1 
ATOM   3234 C CB  . TYR C 1 66  ? 29.642  -37.092 22.455  1.00   36.17  ? 818  TYR C CB  1 
ATOM   3235 C CG  . TYR C 1 66  ? 30.425  -38.378 22.288  1.00   44.02  ? 818  TYR C CG  1 
ATOM   3236 C CD1 . TYR C 1 66  ? 29.789  -39.557 22.081  1.00   39.60  ? 818  TYR C CD1 1 
ATOM   3237 C CD2 . TYR C 1 66  ? 31.766  -38.414 22.425  1.00   41.78  ? 818  TYR C CD2 1 
ATOM   3238 C CE1 . TYR C 1 66  ? 30.458  -40.674 21.979  1.00   36.70  ? 818  TYR C CE1 1 
ATOM   3239 C CE2 . TYR C 1 66  ? 32.438  -39.548 22.314  1.00   46.32  ? 818  TYR C CE2 1 
ATOM   3240 C CZ  . TYR C 1 66  ? 31.785  -40.671 22.088  1.00   43.78  ? 818  TYR C CZ  1 
ATOM   3241 O OH  . TYR C 1 66  ? 32.439  -41.818 21.961  1.00   39.23  ? 818  TYR C OH  1 
ATOM   3242 N N   . THR C 1 67  ? 28.734  -36.280 19.569  1.00   31.51  ? 819  THR C N   1 
ATOM   3243 C CA  . THR C 1 67  ? 28.611  -36.515 18.194  1.00   36.62  ? 819  THR C CA  1 
ATOM   3244 C C   . THR C 1 67  ? 29.193  -35.431 17.346  1.00   31.81  ? 819  THR C C   1 
ATOM   3245 O O   . THR C 1 67  ? 29.750  -35.706 16.243  1.00   24.89  ? 819  THR C O   1 
ATOM   3246 C CB  . THR C 1 67  ? 27.107  -36.689 17.891  1.00   39.50  ? 819  THR C CB  1 
ATOM   3247 O OG1 . THR C 1 67  ? 26.608  -37.758 18.707  1.00   45.07  ? 819  THR C OG1 1 
ATOM   3248 C CG2 . THR C 1 67  ? 26.766  -36.875 16.405  1.00   40.29  ? 819  THR C CG2 1 
ATOM   3249 N N   . PHE C 1 68  ? 28.931  -34.177 17.710  1.00   33.34  ? 820  PHE C N   1 
ATOM   3250 C CA  . PHE C 1 68  ? 29.378  -33.130 16.845  1.00   33.06  ? 820  PHE C CA  1 
ATOM   3251 C C   . PHE C 1 68  ? 30.875  -33.169 16.828  1.00   27.12  ? 820  PHE C C   1 
ATOM   3252 O O   . PHE C 1 68  ? 31.426  -33.058 15.725  1.00   31.65  ? 820  PHE C O   1 
ATOM   3253 C CB  . PHE C 1 68  ? 28.861  -31.723 17.169  1.00   34.75  ? 820  PHE C CB  1 
ATOM   3254 C CG  . PHE C 1 68  ? 29.530  -30.685 16.375  1.00   33.66  ? 820  PHE C CG  1 
ATOM   3255 C CD1 . PHE C 1 68  ? 30.435  -29.887 16.963  1.00   32.93  ? 820  PHE C CD1 1 
ATOM   3256 C CD2 . PHE C 1 68  ? 29.185  -30.434 15.054  1.00   31.40  ? 820  PHE C CD2 1 
ATOM   3257 C CE1 . PHE C 1 68  ? 30.992  -28.866 16.143  1.00   18.11  ? 820  PHE C CE1 1 
ATOM   3258 C CE2 . PHE C 1 68  ? 29.816  -29.536 14.264  1.00   40.98  ? 820  PHE C CE2 1 
ATOM   3259 C CZ  . PHE C 1 68  ? 30.778  -28.760 14.810  1.00   19.36  ? 820  PHE C CZ  1 
ATOM   3260 N N   . ALA C 1 69  ? 31.473  -33.260 18.001  1.00   32.98  ? 821  ALA C N   1 
ATOM   3261 C CA  . ALA C 1 69  ? 32.970  -33.303 18.149  1.00   30.08  ? 821  ALA C CA  1 
ATOM   3262 C C   . ALA C 1 69  ? 33.637  -34.343 17.291  1.00   35.36  ? 821  ALA C C   1 
ATOM   3263 O O   . ALA C 1 69  ? 34.666  -34.083 16.677  1.00   38.26  ? 821  ALA C O   1 
ATOM   3264 C CB  . ALA C 1 69  ? 33.435  -33.541 19.652  1.00   20.86  ? 821  ALA C CB  1 
ATOM   3265 N N   . ARG C 1 70  ? 33.128  -35.568 17.369  1.00   42.04  ? 822  ARG C N   1 
ATOM   3266 C CA  . ARG C 1 70  ? 33.490  -36.609 16.373  1.00   40.10  ? 822  ARG C CA  1 
ATOM   3267 C C   . ARG C 1 70  ? 33.466  -36.169 14.878  1.00   33.58  ? 822  ARG C C   1 
ATOM   3268 O O   . ARG C 1 70  ? 34.404  -36.377 14.118  1.00   31.43  ? 822  ARG C O   1 
ATOM   3269 C CB  . ARG C 1 70  ? 32.584  -37.871 16.622  1.00   34.28  ? 822  ARG C CB  1 
ATOM   3270 C CG  . ARG C 1 70  ? 32.863  -38.631 17.976  1.00   45.13  ? 822  ARG C CG  1 
ATOM   3271 C CD  . ARG C 1 70  ? 31.814  -39.665 18.340  1.00   36.08  ? 822  ARG C CD  1 
ATOM   3272 N NE  . ARG C 1 70  ? 31.737  -40.775 17.398  1.00   39.50  ? 822  ARG C NE  1 
ATOM   3273 C CZ  . ARG C 1 70  ? 31.916  -42.057 17.751  1.00   35.19  ? 822  ARG C CZ  1 
ATOM   3274 N NH1 . ARG C 1 70  ? 32.333  -42.356 18.974  1.00   45.24  ? 822  ARG C NH1 1 
ATOM   3275 N NH2 . ARG C 1 70  ? 31.811  -43.009 16.854  1.00   41.49  ? 822  ARG C NH2 1 
ATOM   3276 N N   . ALA C 1 71  ? 32.345  -35.668 14.409  1.00   28.22  ? 823  ALA C N   1 
ATOM   3277 C CA  . ALA C 1 71  ? 32.115  -35.280 13.063  1.00   33.42  ? 823  ALA C CA  1 
ATOM   3278 C C   . ALA C 1 71  ? 33.031  -34.046 12.751  1.00   34.04  ? 823  ALA C C   1 
ATOM   3279 O O   . ALA C 1 71  ? 33.541  -33.980 11.692  1.00   38.81  ? 823  ALA C O   1 
ATOM   3280 C CB  . ALA C 1 71  ? 30.626  -34.927 12.916  1.00   29.52  ? 823  ALA C CB  1 
ATOM   3281 N N   . PHE C 1 72  ? 33.321  -33.239 13.740  1.00   31.32  ? 824  PHE C N   1 
ATOM   3282 C CA  . PHE C 1 72  ? 34.156  -31.965 13.517  1.00   30.80  ? 824  PHE C CA  1 
ATOM   3283 C C   . PHE C 1 72  ? 35.593  -32.470 13.259  1.00   22.99  ? 824  PHE C C   1 
ATOM   3284 O O   . PHE C 1 72  ? 36.102  -32.297 12.132  1.00   30.61  ? 824  PHE C O   1 
ATOM   3285 C CB  . PHE C 1 72  ? 34.168  -31.053 14.679  1.00   34.38  ? 824  PHE C CB  1 
ATOM   3286 C CG  . PHE C 1 72  ? 35.026  -29.816 14.419  1.00   24.38  ? 824  PHE C CG  1 
ATOM   3287 C CD1 . PHE C 1 72  ? 36.317  -29.815 14.792  1.00   32.64  ? 824  PHE C CD1 1 
ATOM   3288 C CD2 . PHE C 1 72  ? 34.493  -28.715 13.797  1.00   30.64  ? 824  PHE C CD2 1 
ATOM   3289 C CE1 . PHE C 1 72  ? 37.120  -28.731 14.482  1.00   25.62  ? 824  PHE C CE1 1 
ATOM   3290 C CE2 . PHE C 1 72  ? 35.302  -27.617 13.434  1.00   34.69  ? 824  PHE C CE2 1 
ATOM   3291 C CZ  . PHE C 1 72  ? 36.600  -27.648 13.754  1.00   36.17  ? 824  PHE C CZ  1 
ATOM   3292 N N   . LEU C 1 73  ? 36.069  -33.267 14.193  1.00   31.33  ? 825  LEU C N   1 
ATOM   3293 C CA  . LEU C 1 73  ? 37.485  -33.847 14.081  1.00   30.08  ? 825  LEU C CA  1 
ATOM   3294 C C   . LEU C 1 73  ? 37.791  -34.680 12.820  1.00   40.58  ? 825  LEU C C   1 
ATOM   3295 O O   . LEU C 1 73  ? 38.972  -34.792 12.454  1.00   40.33  ? 825  LEU C O   1 
ATOM   3296 C CB  . LEU C 1 73  ? 37.824  -34.620 15.297  1.00   28.41  ? 825  LEU C CB  1 
ATOM   3297 C CG  . LEU C 1 73  ? 39.182  -35.245 15.576  1.00   30.41  ? 825  LEU C CG  1 
ATOM   3298 C CD1 . LEU C 1 73  ? 40.165  -33.970 15.875  1.00   22.65  ? 825  LEU C CD1 1 
ATOM   3299 C CD2 . LEU C 1 73  ? 39.186  -36.199 16.711  1.00   29.59  ? 825  LEU C CD2 1 
ATOM   3300 N N   . MET C 1 74  ? 36.787  -35.363 12.278  1.00   37.05  ? 826  MET C N   1 
ATOM   3301 C CA  . MET C 1 74  ? 36.943  -36.265 11.190  1.00   43.12  ? 826  MET C CA  1 
ATOM   3302 C C   . MET C 1 74  ? 37.261  -35.549 9.881   1.00   49.40  ? 826  MET C C   1 
ATOM   3303 O O   . MET C 1 74  ? 37.913  -36.104 8.967   1.00   48.32  ? 826  MET C O   1 
ATOM   3304 C CB  . MET C 1 74  ? 35.668  -37.062 10.973  1.00   46.09  ? 826  MET C CB  1 
ATOM   3305 C CG  . MET C 1 74  ? 36.017  -38.393 10.294  1.00   62.94  ? 826  MET C CG  1 
ATOM   3306 S SD  . MET C 1 74  ? 34.741  -39.680 10.286  1.00   77.75  ? 826  MET C SD  1 
ATOM   3307 C CE  . MET C 1 74  ? 34.955  -40.416 11.884  1.00   50.28  ? 826  MET C CE  1 
ATOM   3308 N N   . GLN C 1 75  ? 36.782  -34.334 9.823   1.00   45.37  ? 827  GLN C N   1 
ATOM   3309 C CA  . GLN C 1 75  ? 37.067  -33.482 8.752   1.00   40.84  ? 827  GLN C CA  1 
ATOM   3310 C C   . GLN C 1 75  ? 38.238  -32.600 9.095   1.00   38.91  ? 827  GLN C C   1 
ATOM   3311 O O   . GLN C 1 75  ? 39.041  -32.365 8.296   1.00   39.64  ? 827  GLN C O   1 
ATOM   3312 C CB  . GLN C 1 75  ? 35.872  -32.678 8.404   1.00   44.04  ? 827  GLN C CB  1 
ATOM   3313 C CG  . GLN C 1 75  ? 36.246  -31.587 7.547   1.00   54.83  ? 827  GLN C CG  1 
ATOM   3314 C CD  . GLN C 1 75  ? 35.093  -30.863 7.026   1.00   59.18  ? 827  GLN C CD  1 
ATOM   3315 O OE1 . GLN C 1 75  ? 34.087  -31.451 6.698   1.00   72.07  ? 827  GLN C OE1 1 
ATOM   3316 N NE2 . GLN C 1 75  ? 35.222  -29.567 6.930   1.00   63.19  ? 827  GLN C NE2 1 
ATOM   3317 N N   . HIS C 1 76  ? 38.346  -32.101 10.291  1.00   31.91  ? 828  HIS C N   1 
ATOM   3318 C CA  . HIS C 1 76  ? 39.507  -31.301 10.624  1.00   30.47  ? 828  HIS C CA  1 
ATOM   3319 C C   . HIS C 1 76  ? 40.817  -32.074 10.655  1.00   37.82  ? 828  HIS C C   1 
ATOM   3320 O O   . HIS C 1 76  ? 41.840  -31.545 10.338  1.00   33.07  ? 828  HIS C O   1 
ATOM   3321 C CB  . HIS C 1 76  ? 39.308  -30.541 11.918  1.00   39.10  ? 828  HIS C CB  1 
ATOM   3322 C CG  . HIS C 1 76  ? 40.528  -29.841 12.392  1.00   30.62  ? 828  HIS C CG  1 
ATOM   3323 N ND1 . HIS C 1 76  ? 41.241  -30.267 13.470  1.00   45.63  ? 828  HIS C ND1 1 
ATOM   3324 C CD2 . HIS C 1 76  ? 41.176  -28.767 11.920  1.00   34.68  ? 828  HIS C CD2 1 
ATOM   3325 C CE1 . HIS C 1 76  ? 42.276  -29.482 13.649  1.00   39.92  ? 828  HIS C CE1 1 
ATOM   3326 N NE2 . HIS C 1 76  ? 42.256  -28.562 12.720  1.00   40.31  ? 828  HIS C NE2 1 
ATOM   3327 N N   . ALA C 1 77  ? 40.762  -33.299 11.148  1.00   40.05  ? 829  ALA C N   1 
ATOM   3328 C CA  . ALA C 1 77  ? 41.918  -34.191 11.225  1.00   41.06  ? 829  ALA C CA  1 
ATOM   3329 C C   . ALA C 1 77  ? 41.528  -35.627 10.944  1.00   36.45  ? 829  ALA C C   1 
ATOM   3330 O O   . ALA C 1 77  ? 41.398  -36.406 11.822  1.00   32.32  ? 829  ALA C O   1 
ATOM   3331 C CB  . ALA C 1 77  ? 42.564  -34.091 12.507  1.00   42.67  ? 829  ALA C CB  1 
ATOM   3332 N N   . PRO C 1 78  ? 41.404  -35.930 9.681   1.00   29.24  ? 830  PRO C N   1 
ATOM   3333 C CA  . PRO C 1 78  ? 40.938  -37.181 9.158   1.00   37.89  ? 830  PRO C CA  1 
ATOM   3334 C C   . PRO C 1 78  ? 41.811  -38.290 9.661   1.00   32.53  ? 830  PRO C C   1 
ATOM   3335 O O   . PRO C 1 78  ? 41.381  -39.385 9.769   1.00   34.34  ? 830  PRO C O   1 
ATOM   3336 C CB  . PRO C 1 78  ? 41.158  -36.999 7.689   1.00   42.98  ? 830  PRO C CB  1 
ATOM   3337 C CG  . PRO C 1 78  ? 41.439  -35.651 7.519   1.00   37.55  ? 830  PRO C CG  1 
ATOM   3338 C CD  . PRO C 1 78  ? 42.009  -35.128 8.650   1.00   30.23  ? 830  PRO C CD  1 
ATOM   3339 N N   . ALA C 1 79  ? 43.049  -37.972 9.907   1.00   33.49  ? 831  ALA C N   1 
ATOM   3340 C CA  . ALA C 1 79  ? 43.983  -38.892 10.470  1.00   45.52  ? 831  ALA C CA  1 
ATOM   3341 C C   . ALA C 1 79  ? 43.709  -39.307 11.912  1.00   48.99  ? 831  ALA C C   1 
ATOM   3342 O O   . ALA C 1 79  ? 44.072  -40.381 12.299  1.00   46.37  ? 831  ALA C O   1 
ATOM   3343 C CB  . ALA C 1 79  ? 45.339  -38.351 10.363  1.00   48.59  ? 831  ALA C CB  1 
ATOM   3344 N N   . ASN C 1 80  ? 43.135  -38.417 12.710  1.00   42.65  ? 832  ASN C N   1 
ATOM   3345 C CA  . ASN C 1 80  ? 42.961  -38.633 14.141  1.00   42.81  ? 832  ASN C CA  1 
ATOM   3346 C C   . ASN C 1 80  ? 41.680  -39.383 14.517  1.00   42.95  ? 832  ASN C C   1 
ATOM   3347 O O   . ASN C 1 80  ? 40.605  -38.893 14.450  1.00   39.02  ? 832  ASN C O   1 
ATOM   3348 C CB  . ASN C 1 80  ? 43.129  -37.293 14.844  1.00   45.58  ? 832  ASN C CB  1 
ATOM   3349 C CG  . ASN C 1 80  ? 43.115  -37.386 16.328  1.00   42.92  ? 832  ASN C CG  1 
ATOM   3350 O OD1 . ASN C 1 80  ? 42.700  -38.347 16.880  1.00   41.80  ? 832  ASN C OD1 1 
ATOM   3351 N ND2 . ASN C 1 80  ? 43.530  -36.355 16.969  1.00   35.25  ? 832  ASN C ND2 1 
ATOM   3352 N N   . ASP C 1 81  ? 41.888  -40.610 14.931  1.00   34.27  ? 833  ASP C N   1 
ATOM   3353 C CA  . ASP C 1 81  ? 40.846  -41.544 15.240  1.00   39.73  ? 833  ASP C CA  1 
ATOM   3354 C C   . ASP C 1 81  ? 40.412  -41.548 16.710  1.00   36.12  ? 833  ASP C C   1 
ATOM   3355 O O   . ASP C 1 81  ? 39.582  -42.323 17.087  1.00   39.12  ? 833  ASP C O   1 
ATOM   3356 C CB  . ASP C 1 81  ? 41.334  -42.926 14.868  1.00   45.05  ? 833  ASP C CB  1 
ATOM   3357 C CG  . ASP C 1 81  ? 42.293  -43.510 15.877  1.00   50.68  ? 833  ASP C CG  1 
ATOM   3358 O OD1 . ASP C 1 81  ? 43.367  -42.972 16.162  1.00   47.39  ? 833  ASP C OD1 1 
ATOM   3359 O OD2 . ASP C 1 81  ? 41.950  -44.558 16.393  1.00   64.45  ? 833  ASP C OD2 1 
ATOM   3360 N N   . TYR C 1 82  ? 40.964  -40.655 17.499  1.00   35.26  ? 834  TYR C N   1 
ATOM   3361 C CA  . TYR C 1 82  ? 40.848  -40.695 18.910  1.00   38.28  ? 834  TYR C CA  1 
ATOM   3362 C C   . TYR C 1 82  ? 39.446  -40.653 19.436  1.00   39.04  ? 834  TYR C C   1 
ATOM   3363 O O   . TYR C 1 82  ? 39.167  -41.320 20.339  1.00   39.91  ? 834  TYR C O   1 
ATOM   3364 C CB  . TYR C 1 82  ? 41.662  -39.555 19.482  1.00   38.79  ? 834  TYR C CB  1 
ATOM   3365 C CG  . TYR C 1 82  ? 41.773  -39.492 20.960  1.00   35.32  ? 834  TYR C CG  1 
ATOM   3366 C CD1 . TYR C 1 82  ? 42.902  -39.866 21.592  1.00   40.60  ? 834  TYR C CD1 1 
ATOM   3367 C CD2 . TYR C 1 82  ? 40.756  -39.029 21.716  1.00   28.73  ? 834  TYR C CD2 1 
ATOM   3368 C CE1 . TYR C 1 82  ? 42.997  -39.804 22.926  1.00   41.80  ? 834  TYR C CE1 1 
ATOM   3369 C CE2 . TYR C 1 82  ? 40.850  -38.967 23.014  1.00   33.46  ? 834  TYR C CE2 1 
ATOM   3370 C CZ  . TYR C 1 82  ? 41.960  -39.355 23.638  1.00   41.08  ? 834  TYR C CZ  1 
ATOM   3371 O OH  . TYR C 1 82  ? 42.024  -39.295 24.981  1.00   43.24  ? 834  TYR C OH  1 
ATOM   3372 N N   . LEU C 1 83  ? 38.589  -39.837 18.897  1.00   39.30  ? 835  LEU C N   1 
ATOM   3373 C CA  . LEU C 1 83  ? 37.218  -39.759 19.349  1.00   35.19  ? 835  LEU C CA  1 
ATOM   3374 C C   . LEU C 1 83  ? 36.359  -40.932 18.993  1.00   34.58  ? 835  LEU C C   1 
ATOM   3375 O O   . LEU C 1 83  ? 35.532  -41.314 19.715  1.00   41.02  ? 835  LEU C O   1 
ATOM   3376 C CB  . LEU C 1 83  ? 36.573  -38.479 18.887  1.00   41.10  ? 835  LEU C CB  1 
ATOM   3377 C CG  . LEU C 1 83  ? 37.047  -37.188 19.527  1.00   43.84  ? 835  LEU C CG  1 
ATOM   3378 C CD1 . LEU C 1 83  ? 36.211  -36.065 19.082  1.00   42.96  ? 835  LEU C CD1 1 
ATOM   3379 C CD2 . LEU C 1 83  ? 36.980  -37.298 20.974  1.00   58.15  ? 835  LEU C CD2 1 
ATOM   3380 N N   . VAL C 1 84  ? 36.562  -41.442 17.816  1.00   30.76  ? 836  VAL C N   1 
ATOM   3381 C CA  . VAL C 1 84  ? 35.855  -42.589 17.282  1.00   38.27  ? 836  VAL C CA  1 
ATOM   3382 C C   . VAL C 1 84  ? 36.123  -43.910 18.042  1.00   44.73  ? 836  VAL C C   1 
ATOM   3383 O O   . VAL C 1 84  ? 35.234  -44.843 18.117  1.00   41.68  ? 836  VAL C O   1 
ATOM   3384 C CB  . VAL C 1 84  ? 36.182  -42.758 15.784  1.00   34.92  ? 836  VAL C CB  1 
ATOM   3385 C CG1 . VAL C 1 84  ? 35.829  -44.173 15.284  1.00   40.86  ? 836  VAL C CG1 1 
ATOM   3386 C CG2 . VAL C 1 84  ? 35.443  -41.709 14.952  1.00   54.37  ? 836  VAL C CG2 1 
ATOM   3387 N N   . THR C 1 85  ? 37.333  -44.039 18.530  1.00   42.25  ? 837  THR C N   1 
ATOM   3388 C CA  . THR C 1 85  ? 37.763  -45.329 19.021  1.00   42.57  ? 837  THR C CA  1 
ATOM   3389 C C   . THR C 1 85  ? 37.846  -45.418 20.497  1.00   46.91  ? 837  THR C C   1 
ATOM   3390 O O   . THR C 1 85  ? 37.431  -46.441 21.030  1.00   51.25  ? 837  THR C O   1 
ATOM   3391 C CB  . THR C 1 85  ? 39.102  -45.751 18.435  1.00   46.51  ? 837  THR C CB  1 
ATOM   3392 O OG1 . THR C 1 85  ? 40.074  -44.778 18.784  1.00   42.33  ? 837  THR C OG1 1 
ATOM   3393 C CG2 . THR C 1 85  ? 38.986  -45.938 16.859  1.00   55.16  ? 837  THR C CG2 1 
ATOM   3394 N N   . SER C 1 86  ? 38.265  -44.310 21.145  1.00   45.62  ? 838  SER C N   1 
ATOM   3395 C CA  . SER C 1 86  ? 38.550  -44.248 22.539  1.00   35.98  ? 838  SER C CA  1 
ATOM   3396 C C   . SER C 1 86  ? 37.417  -44.117 23.485  1.00   42.79  ? 838  SER C C   1 
ATOM   3397 O O   . SER C 1 86  ? 36.375  -43.520 23.183  1.00   36.32  ? 838  SER C O   1 
ATOM   3398 C CB  . SER C 1 86  ? 39.535  -43.112 22.868  1.00   24.83  ? 838  SER C CB  1 
ATOM   3399 O OG  . SER C 1 86  ? 40.400  -43.223 21.814  1.00   36.77  ? 838  SER C OG  1 
ATOM   3400 N N   . HIS C 1 87  ? 37.660  -44.685 24.646  1.00   43.12  ? 839  HIS C N   1 
ATOM   3401 C CA  . HIS C 1 87  ? 36.674  -44.734 25.715  1.00   45.15  ? 839  HIS C CA  1 
ATOM   3402 C C   . HIS C 1 87  ? 36.983  -43.623 26.701  1.00   45.84  ? 839  HIS C C   1 
ATOM   3403 O O   . HIS C 1 87  ? 38.015  -43.674 27.325  1.00   52.80  ? 839  HIS C O   1 
ATOM   3404 C CB  . HIS C 1 87  ? 36.734  -46.082 26.399  1.00   42.14  ? 839  HIS C CB  1 
ATOM   3405 C CG  . HIS C 1 87  ? 36.386  -47.237 25.512  1.00   40.39  ? 839  HIS C CG  1 
ATOM   3406 N ND1 . HIS C 1 87  ? 35.092  -47.542 25.148  1.00   42.62  ? 839  HIS C ND1 1 
ATOM   3407 C CD2 . HIS C 1 87  ? 37.162  -48.229 25.009  1.00   41.91  ? 839  HIS C CD2 1 
ATOM   3408 C CE1 . HIS C 1 87  ? 35.093  -48.661 24.439  1.00   42.48  ? 839  HIS C CE1 1 
ATOM   3409 N NE2 . HIS C 1 87  ? 36.336  -49.088 24.329  1.00   42.26  ? 839  HIS C NE2 1 
ATOM   3410 N N   . ILE C 1 88  ? 36.095  -42.604 26.787  1.00   46.25  ? 840  ILE C N   1 
ATOM   3411 C CA  . ILE C 1 88  ? 36.368  -41.335 27.480  1.00   40.68  ? 840  ILE C CA  1 
ATOM   3412 C C   . ILE C 1 88  ? 35.339  -41.092 28.608  1.00   42.11  ? 840  ILE C C   1 
ATOM   3413 O O   . ILE C 1 88  ? 34.240  -41.639 28.607  1.00   41.99  ? 840  ILE C O   1 
ATOM   3414 C CB  . ILE C 1 88  ? 36.345  -40.187 26.419  1.00   46.68  ? 840  ILE C CB  1 
ATOM   3415 C CG1 . ILE C 1 88  ? 37.425  -40.435 25.362  1.00   37.88  ? 840  ILE C CG1 1 
ATOM   3416 C CG2 . ILE C 1 88  ? 36.613  -38.909 27.027  1.00   41.08  ? 840  ILE C CG2 1 
ATOM   3417 C CD1 . ILE C 1 88  ? 37.286  -39.464 24.098  1.00   47.95  ? 840  ILE C CD1 1 
ATOM   3418 N N   . HIS C 1 89  ? 35.729  -40.260 29.544  1.00   36.63  ? 841  HIS C N   1 
ATOM   3419 C CA  . HIS C 1 89  ? 34.904  -39.812 30.627  1.00   31.10  ? 841  HIS C CA  1 
ATOM   3420 C C   . HIS C 1 89  ? 34.864  -38.309 30.586  1.00   36.81  ? 841  HIS C C   1 
ATOM   3421 O O   . HIS C 1 89  ? 35.889  -37.684 30.540  1.00   28.78  ? 841  HIS C O   1 
ATOM   3422 C CB  . HIS C 1 89  ? 35.547  -40.219 31.917  1.00   29.93  ? 841  HIS C CB  1 
ATOM   3423 C CG  . HIS C 1 89  ? 34.685  -40.057 33.125  1.00   38.15  ? 841  HIS C CG  1 
ATOM   3424 N ND1 . HIS C 1 89  ? 34.189  -38.853 33.534  1.00   37.62  ? 841  HIS C ND1 1 
ATOM   3425 C CD2 . HIS C 1 89  ? 34.290  -40.947 34.053  1.00   42.86  ? 841  HIS C CD2 1 
ATOM   3426 C CE1 . HIS C 1 89  ? 33.508  -39.008 34.644  1.00   30.93  ? 841  HIS C CE1 1 
ATOM   3427 N NE2 . HIS C 1 89  ? 33.548  -40.273 34.975  1.00   46.48  ? 841  HIS C NE2 1 
ATOM   3428 N N   . LEU C 1 90  ? 33.668  -37.759 30.625  1.00   33.53  ? 842  LEU C N   1 
ATOM   3429 C CA  . LEU C 1 90  ? 33.498  -36.319 30.664  1.00   29.81  ? 842  LEU C CA  1 
ATOM   3430 C C   . LEU C 1 90  ? 32.923  -35.873 31.977  1.00   32.99  ? 842  LEU C C   1 
ATOM   3431 O O   . LEU C 1 90  ? 32.017  -36.451 32.467  1.00   29.68  ? 842  LEU C O   1 
ATOM   3432 C CB  . LEU C 1 90  ? 32.582  -35.824 29.548  1.00   28.34  ? 842  LEU C CB  1 
ATOM   3433 C CG  . LEU C 1 90  ? 31.993  -34.384 29.611  1.00   19.10  ? 842  LEU C CG  1 
ATOM   3434 C CD1 . LEU C 1 90  ? 32.952  -33.377 29.247  1.00   26.56  ? 842  LEU C CD1 1 
ATOM   3435 C CD2 . LEU C 1 90  ? 30.855  -34.293 28.727  1.00   22.51  ? 842  LEU C CD2 1 
ATOM   3436 N N   . HIS C 1 91  ? 33.473  -34.815 32.539  1.00   35.62  ? 843  HIS C N   1 
ATOM   3437 C CA  . HIS C 1 91  ? 32.844  -34.205 33.682  1.00   31.73  ? 843  HIS C CA  1 
ATOM   3438 C C   . HIS C 1 91  ? 32.306  -32.802 33.466  1.00   36.56  ? 843  HIS C C   1 
ATOM   3439 O O   . HIS C 1 91  ? 32.979  -31.929 33.084  1.00   37.39  ? 843  HIS C O   1 
ATOM   3440 C CB  . HIS C 1 91  ? 33.713  -34.203 34.907  1.00   34.08  ? 843  HIS C CB  1 
ATOM   3441 C CG  . HIS C 1 91  ? 32.941  -34.008 36.161  1.00   40.15  ? 843  HIS C CG  1 
ATOM   3442 N ND1 . HIS C 1 91  ? 33.221  -33.023 37.061  1.00   46.64  ? 843  HIS C ND1 1 
ATOM   3443 C CD2 . HIS C 1 91  ? 31.853  -34.637 36.626  1.00   36.01  ? 843  HIS C CD2 1 
ATOM   3444 C CE1 . HIS C 1 91  ? 32.353  -33.066 38.039  1.00   49.55  ? 843  HIS C CE1 1 
ATOM   3445 N NE2 . HIS C 1 91  ? 31.511  -34.032 37.794  1.00   31.31  ? 843  HIS C NE2 1 
ATOM   3446 N N   . VAL C 1 92  ? 31.064  -32.627 33.810  1.00   45.29  ? 844  VAL C N   1 
ATOM   3447 C CA  . VAL C 1 92  ? 30.337  -31.331 33.725  1.00   45.49  ? 844  VAL C CA  1 
ATOM   3448 C C   . VAL C 1 92  ? 30.074  -30.879 35.099  1.00   39.85  ? 844  VAL C C   1 
ATOM   3449 O O   . VAL C 1 92  ? 29.158  -31.355 35.679  1.00   35.02  ? 844  VAL C O   1 
ATOM   3450 C CB  . VAL C 1 92  ? 28.954  -31.552 32.961  1.00   35.53  ? 844  VAL C CB  1 
ATOM   3451 C CG1 . VAL C 1 92  ? 28.086  -30.284 32.875  1.00   54.12  ? 844  VAL C CG1 1 
ATOM   3452 C CG2 . VAL C 1 92  ? 29.269  -32.090 31.516  1.00   44.73  ? 844  VAL C CG2 1 
ATOM   3453 N N   . PRO C 1 93  ? 30.825  -29.895 35.610  1.00   44.51  ? 845  PRO C N   1 
ATOM   3454 C CA  . PRO C 1 93  ? 30.618  -29.514 36.981  1.00   51.11  ? 845  PRO C CA  1 
ATOM   3455 C C   . PRO C 1 93  ? 29.188  -29.064 37.164  1.00   49.32  ? 845  PRO C C   1 
ATOM   3456 O O   . PRO C 1 93  ? 28.511  -28.656 36.198  1.00   43.75  ? 845  PRO C O   1 
ATOM   3457 C CB  . PRO C 1 93  ? 31.618  -28.394 37.199  1.00   53.92  ? 845  PRO C CB  1 
ATOM   3458 C CG  . PRO C 1 93  ? 32.728  -28.730 36.296  1.00   48.32  ? 845  PRO C CG  1 
ATOM   3459 C CD  . PRO C 1 93  ? 32.080  -29.333 35.072  1.00   57.63  ? 845  PRO C CD  1 
ATOM   3460 N N   . GLU C 1 94  ? 28.721  -29.260 38.378  1.00   41.47  ? 846  GLU C N   1 
ATOM   3461 C CA  . GLU C 1 94  ? 27.376  -28.921 38.746  1.00   43.51  ? 846  GLU C CA  1 
ATOM   3462 C C   . GLU C 1 94  ? 27.430  -27.425 38.921  1.00   35.69  ? 846  GLU C C   1 
ATOM   3463 O O   . GLU C 1 94  ? 28.457  -26.884 39.252  1.00   43.28  ? 846  GLU C O   1 
ATOM   3464 C CB  . GLU C 1 94  ? 27.021  -29.586 40.043  1.00   51.62  ? 846  GLU C CB  1 
ATOM   3465 C CG  . GLU C 1 94  ? 27.247  -31.126 40.016  1.00   64.29  ? 846  GLU C CG  1 
ATOM   3466 C CD  . GLU C 1 94  ? 26.803  -31.778 41.329  1.00   64.05  ? 846  GLU C CD  1 
ATOM   3467 O OE1 . GLU C 1 94  ? 25.759  -31.319 41.850  1.00   65.04  ? 846  GLU C OE1 1 
ATOM   3468 O OE2 . GLU C 1 94  ? 27.494  -32.714 41.831  1.00   64.15  ? 846  GLU C OE2 1 
ATOM   3469 N N   . GLY C 1 95  ? 26.282  -26.804 38.775  1.00   44.79  ? 847  GLY C N   1 
ATOM   3470 C CA  . GLY C 1 95  ? 26.108  -25.391 38.960  1.00   44.01  ? 847  GLY C CA  1 
ATOM   3471 C C   . GLY C 1 95  ? 25.061  -24.689 38.131  1.00   48.45  ? 847  GLY C C   1 
ATOM   3472 O O   . GLY C 1 95  ? 24.407  -23.866 38.633  1.00   51.50  ? 847  GLY C O   1 
ATOM   3473 N N   . ALA C 1 96  ? 24.881  -25.033 36.889  1.00   43.75  ? 848  ALA C N   1 
ATOM   3474 C CA  . ALA C 1 96  ? 23.884  -24.455 36.040  1.00   47.34  ? 848  ALA C CA  1 
ATOM   3475 C C   . ALA C 1 96  ? 22.502  -24.998 36.353  1.00   55.29  ? 848  ALA C C   1 
ATOM   3476 O O   . ALA C 1 96  ? 22.322  -26.197 36.582  1.00   55.27  ? 848  ALA C O   1 
ATOM   3477 C CB  . ALA C 1 96  ? 24.277  -24.764 34.518  1.00   52.85  ? 848  ALA C CB  1 
ATOM   3478 N N   . THR C 1 97  ? 21.521  -24.102 36.368  1.00   57.35  ? 849  THR C N   1 
ATOM   3479 C CA  . THR C 1 97  ? 20.128  -24.481 36.322  1.00   55.03  ? 849  THR C CA  1 
ATOM   3480 C C   . THR C 1 97  ? 19.851  -25.376 35.108  1.00   58.73  ? 849  THR C C   1 
ATOM   3481 O O   . THR C 1 97  ? 20.642  -25.371 34.145  1.00   55.67  ? 849  THR C O   1 
ATOM   3482 C CB  . THR C 1 97  ? 19.278  -23.204 36.168  1.00   57.98  ? 849  THR C CB  1 
ATOM   3483 O OG1 . THR C 1 97  ? 19.624  -22.566 34.925  1.00   56.00  ? 849  THR C OG1 1 
ATOM   3484 C CG2 . THR C 1 97  ? 19.573  -22.208 37.275  1.00   58.74  ? 849  THR C CG2 1 
ATOM   3485 N N   . PRO C 1 98  ? 18.701  -26.112 35.103  1.00   57.65  ? 850  PRO C N   1 
ATOM   3486 C CA  . PRO C 1 98  ? 18.323  -26.974 33.931  1.00   58.56  ? 850  PRO C CA  1 
ATOM   3487 C C   . PRO C 1 98  ? 18.147  -26.241 32.597  1.00   61.00  ? 850  PRO C C   1 
ATOM   3488 O O   . PRO C 1 98  ? 18.073  -26.866 31.508  1.00   55.47  ? 850  PRO C O   1 
ATOM   3489 C CB  . PRO C 1 98  ? 16.971  -27.606 34.337  1.00   56.27  ? 850  PRO C CB  1 
ATOM   3490 C CG  . PRO C 1 98  ? 16.929  -27.506 35.905  1.00   63.85  ? 850  PRO C CG  1 
ATOM   3491 C CD  . PRO C 1 98  ? 17.836  -26.311 36.290  1.00   58.33  ? 850  PRO C CD  1 
ATOM   3492 N N   . LYS C 1 99  ? 18.057  -24.927 32.674  1.00   58.22  ? 851  LYS C N   1 
ATOM   3493 C CA  . LYS C 1 99  ? 17.846  -24.125 31.480  1.00   59.23  ? 851  LYS C CA  1 
ATOM   3494 C C   . LYS C 1 99  ? 19.198  -23.675 30.945  1.00   51.27  ? 851  LYS C C   1 
ATOM   3495 O O   . LYS C 1 99  ? 19.349  -23.448 29.744  1.00   51.05  ? 851  LYS C O   1 
ATOM   3496 C CB  . LYS C 1 99  ? 16.927  -22.932 31.805  1.00   63.24  ? 851  LYS C CB  1 
ATOM   3497 C CG  . LYS C 1 99  ? 17.265  -22.203 33.108  1.00   71.41  ? 851  LYS C CG  1 
ATOM   3498 C CD  . LYS C 1 99  ? 16.118  -21.323 33.625  1.00   82.49  ? 851  LYS C CD  1 
ATOM   3499 C CE  . LYS C 1 99  ? 16.605  -20.418 34.761  1.00   87.95  ? 851  LYS C CE  1 
ATOM   3500 N NZ  . LYS C 1 99  ? 15.544  -20.160 35.795  1.00   83.86  ? 851  LYS C NZ  1 
ATOM   3501 N N   . ASP C 1 100 ? 20.157  -23.494 31.840  1.00   47.71  ? 852  ASP C N   1 
ATOM   3502 C CA  . ASP C 1 100 ? 21.514  -23.131 31.446  1.00   47.60  ? 852  ASP C CA  1 
ATOM   3503 C C   . ASP C 1 100 ? 22.282  -24.387 31.054  1.00   45.49  ? 852  ASP C C   1 
ATOM   3504 O O   . ASP C 1 100 ? 23.322  -24.271 30.478  1.00   43.61  ? 852  ASP C O   1 
ATOM   3505 C CB  . ASP C 1 100 ? 22.283  -22.378 32.532  1.00   52.58  ? 852  ASP C CB  1 
ATOM   3506 C CG  . ASP C 1 100 ? 23.441  -21.500 31.940  1.00   44.44  ? 852  ASP C CG  1 
ATOM   3507 O OD1 . ASP C 1 100 ? 23.190  -20.709 31.041  1.00   46.04  ? 852  ASP C OD1 1 
ATOM   3508 O OD2 . ASP C 1 100 ? 24.611  -21.641 32.310  1.00   43.77  ? 852  ASP C OD2 1 
ATOM   3509 N N   . GLY C 1 101 ? 21.741  -25.570 31.332  1.00   40.88  ? 853  GLY C N   1 
ATOM   3510 C CA  . GLY C 1 101 ? 22.365  -26.859 30.910  1.00   42.06  ? 853  GLY C CA  1 
ATOM   3511 C C   . GLY C 1 101 ? 22.973  -26.955 29.492  1.00   36.41  ? 853  GLY C C   1 
ATOM   3512 O O   . GLY C 1 101 ? 24.190  -27.111 29.342  1.00   33.12  ? 853  GLY C O   1 
ATOM   3513 N N   . PRO C 1 102 ? 22.141  -26.837 28.431  1.00   35.25  ? 854  PRO C N   1 
ATOM   3514 C CA  . PRO C 1 102 ? 22.669  -26.862 27.141  1.00   34.50  ? 854  PRO C CA  1 
ATOM   3515 C C   . PRO C 1 102 ? 23.751  -25.863 26.797  1.00   34.82  ? 854  PRO C C   1 
ATOM   3516 O O   . PRO C 1 102 ? 24.448  -26.137 25.885  1.00   31.68  ? 854  PRO C O   1 
ATOM   3517 C CB  . PRO C 1 102 ? 21.453  -26.724 26.227  1.00   39.15  ? 854  PRO C CB  1 
ATOM   3518 C CG  . PRO C 1 102 ? 20.291  -26.896 27.145  1.00   37.83  ? 854  PRO C CG  1 
ATOM   3519 C CD  . PRO C 1 102 ? 20.688  -26.659 28.477  1.00   36.76  ? 854  PRO C CD  1 
ATOM   3520 N N   . SER C 1 103 ? 23.865  -24.748 27.522  1.00   34.21  ? 855  SER C N   1 
ATOM   3521 C CA  . SER C 1 103 ? 24.805  -23.673 27.172  1.00   35.05  ? 855  SER C CA  1 
ATOM   3522 C C   . SER C 1 103 ? 26.273  -24.099 27.367  1.00   35.78  ? 855  SER C C   1 
ATOM   3523 O O   . SER C 1 103 ? 27.171  -23.391 26.969  1.00   38.24  ? 855  SER C O   1 
ATOM   3524 C CB  . SER C 1 103 ? 24.507  -22.451 28.029  1.00   34.11  ? 855  SER C CB  1 
ATOM   3525 O OG  . SER C 1 103 ? 25.336  -22.419 29.227  1.00   40.39  ? 855  SER C OG  1 
ATOM   3526 N N   . ALA C 1 104 ? 26.486  -25.256 28.042  1.00   37.49  ? 856  ALA C N   1 
ATOM   3527 C CA  . ALA C 1 104 ? 27.783  -25.943 28.167  1.00   38.41  ? 856  ALA C CA  1 
ATOM   3528 C C   . ALA C 1 104 ? 28.327  -26.604 26.930  1.00   31.43  ? 856  ALA C C   1 
ATOM   3529 O O   . ALA C 1 104 ? 29.434  -27.137 26.939  1.00   35.71  ? 856  ALA C O   1 
ATOM   3530 C CB  . ALA C 1 104 ? 27.675  -27.015 29.293  1.00   33.76  ? 856  ALA C CB  1 
ATOM   3531 N N   . GLY C 1 105 ? 27.547  -26.613 25.891  1.00   28.86  ? 857  GLY C N   1 
ATOM   3532 C CA  . GLY C 1 105 ? 27.851  -27.401 24.751  1.00   32.08  ? 857  GLY C CA  1 
ATOM   3533 C C   . GLY C 1 105 ? 29.126  -27.092 24.039  1.00   30.19  ? 857  GLY C C   1 
ATOM   3534 O O   . GLY C 1 105 ? 29.885  -27.972 23.818  1.00   25.46  ? 857  GLY C O   1 
ATOM   3535 N N   . CYS C 1 106 ? 29.344  -25.829 23.689  1.00   28.19  ? 858  CYS C N   1 
ATOM   3536 C CA  . CYS C 1 106 ? 30.607  -25.409 23.091  1.00   31.52  ? 858  CYS C CA  1 
ATOM   3537 C C   . CYS C 1 106 ? 31.794  -25.836 23.949  1.00   28.19  ? 858  CYS C C   1 
ATOM   3538 O O   . CYS C 1 106 ? 32.807  -26.311 23.434  1.00   32.74  ? 858  CYS C O   1 
ATOM   3539 C CB  . CYS C 1 106 ? 30.624  -23.893 22.886  1.00   34.66  ? 858  CYS C CB  1 
ATOM   3540 S SG  . CYS C 1 106 ? 30.432  -22.931 24.405  1.00   36.94  ? 858  CYS C SG  1 
ATOM   3541 N N   . THR C 1 107 ? 31.661  -25.662 25.259  1.00   30.31  ? 859  THR C N   1 
ATOM   3542 C CA  . THR C 1 107 ? 32.710  -25.998 26.186  1.00   33.42  ? 859  THR C CA  1 
ATOM   3543 C C   . THR C 1 107 ? 33.029  -27.482 26.139  1.00   30.00  ? 859  THR C C   1 
ATOM   3544 O O   . THR C 1 107 ? 34.133  -27.845 26.125  1.00   31.33  ? 859  THR C O   1 
ATOM   3545 C CB  . THR C 1 107 ? 32.283  -25.611 27.588  1.00   37.76  ? 859  THR C CB  1 
ATOM   3546 O OG1 . THR C 1 107 ? 31.663  -24.351 27.524  1.00   38.23  ? 859  THR C OG1 1 
ATOM   3547 C CG2 . THR C 1 107 ? 33.437  -25.517 28.488  1.00   30.70  ? 859  THR C CG2 1 
ATOM   3548 N N   . ILE C 1 108 ? 32.016  -28.312 26.067  1.00   29.66  ? 860  ILE C N   1 
ATOM   3549 C CA  . ILE C 1 108 ? 32.151  -29.751 25.928  1.00   28.85  ? 860  ILE C CA  1 
ATOM   3550 C C   . ILE C 1 108 ? 32.814  -30.312 24.658  1.00   30.85  ? 860  ILE C C   1 
ATOM   3551 O O   . ILE C 1 108 ? 33.686  -31.076 24.741  1.00   32.28  ? 860  ILE C O   1 
ATOM   3552 C CB  . ILE C 1 108 ? 30.817  -30.408 26.101  1.00   19.71  ? 860  ILE C CB  1 
ATOM   3553 C CG1 . ILE C 1 108 ? 30.268  -30.102 27.467  1.00   28.75  ? 860  ILE C CG1 1 
ATOM   3554 C CG2 . ILE C 1 108 ? 30.956  -31.815 25.985  1.00   27.04  ? 860  ILE C CG2 1 
ATOM   3555 C CD1 . ILE C 1 108 ? 29.000  -30.689 27.727  1.00   27.12  ? 860  ILE C CD1 1 
ATOM   3556 N N   . VAL C 1 109 ? 32.409  -29.868 23.497  1.00   30.59  ? 861  VAL C N   1 
ATOM   3557 C CA  . VAL C 1 109 ? 33.081  -30.085 22.260  1.00   28.88  ? 861  VAL C CA  1 
ATOM   3558 C C   . VAL C 1 109 ? 34.530  -29.734 22.350  1.00   36.01  ? 861  VAL C C   1 
ATOM   3559 O O   . VAL C 1 109 ? 35.420  -30.542 21.982  1.00   23.58  ? 861  VAL C O   1 
ATOM   3560 C CB  . VAL C 1 109 ? 32.507  -29.239 21.078  1.00   22.02  ? 861  VAL C CB  1 
ATOM   3561 C CG1 . VAL C 1 109 ? 33.156  -29.444 19.833  1.00   17.69  ? 861  VAL C CG1 1 
ATOM   3562 C CG2 . VAL C 1 109 ? 31.014  -29.520 20.761  1.00   23.37  ? 861  VAL C CG2 1 
ATOM   3563 N N   . THR C 1 110 ? 34.762  -28.521 22.774  1.00   28.74  ? 862  THR C N   1 
ATOM   3564 C CA  . THR C 1 110 ? 36.142  -28.066 22.904  1.00   38.74  ? 862  THR C CA  1 
ATOM   3565 C C   . THR C 1 110 ? 37.030  -28.897 23.833  1.00   25.94  ? 862  THR C C   1 
ATOM   3566 O O   . THR C 1 110 ? 38.201  -29.141 23.511  1.00   41.67  ? 862  THR C O   1 
ATOM   3567 C CB  . THR C 1 110 ? 36.246  -26.639 23.472  1.00   22.51  ? 862  THR C CB  1 
ATOM   3568 O OG1 . THR C 1 110 ? 35.419  -25.716 22.798  1.00   40.58  ? 862  THR C OG1 1 
ATOM   3569 C CG2 . THR C 1 110 ? 37.715  -26.188 23.274  1.00   28.21  ? 862  THR C CG2 1 
ATOM   3570 N N   . ALA C 1 111 ? 36.568  -29.203 25.024  1.00   29.18  ? 863  ALA C N   1 
ATOM   3571 C CA  . ALA C 1 111 ? 37.160  -30.228 25.864  1.00   34.83  ? 863  ALA C CA  1 
ATOM   3572 C C   . ALA C 1 111 ? 37.470  -31.503 25.171  1.00   38.51  ? 863  ALA C C   1 
ATOM   3573 O O   . ALA C 1 111 ? 38.569  -31.962 25.354  1.00   34.55  ? 863  ALA C O   1 
ATOM   3574 C CB  . ALA C 1 111 ? 36.320  -30.536 27.102  1.00   30.24  ? 863  ALA C CB  1 
ATOM   3575 N N   . LEU C 1 112 ? 36.486  -32.066 24.448  1.00   32.82  ? 864  LEU C N   1 
ATOM   3576 C CA  . LEU C 1 112 ? 36.634  -33.346 23.760  1.00   33.06  ? 864  LEU C CA  1 
ATOM   3577 C C   . LEU C 1 112 ? 37.681  -33.221 22.648  1.00   38.96  ? 864  LEU C C   1 
ATOM   3578 O O   . LEU C 1 112 ? 38.609  -34.019 22.584  1.00   27.82  ? 864  LEU C O   1 
ATOM   3579 C CB  . LEU C 1 112 ? 35.290  -33.853 23.188  1.00   32.57  ? 864  LEU C CB  1 
ATOM   3580 C CG  . LEU C 1 112 ? 34.257  -34.388 24.147  1.00   31.55  ? 864  LEU C CG  1 
ATOM   3581 C CD1 . LEU C 1 112 ? 33.037  -34.666 23.335  1.00   36.60  ? 864  LEU C CD1 1 
ATOM   3582 C CD2 . LEU C 1 112 ? 34.725  -35.712 24.853  1.00   42.19  ? 864  LEU C CD2 1 
ATOM   3583 N N   . LEU C 1 113 ? 37.661  -32.122 21.865  1.00   35.76  ? 865  LEU C N   1 
ATOM   3584 C CA  . LEU C 1 113 ? 38.701  -31.905 20.856  1.00   36.55  ? 865  LEU C CA  1 
ATOM   3585 C C   . LEU C 1 113 ? 40.095  -31.635 21.407  1.00   37.55  ? 865  LEU C C   1 
ATOM   3586 O O   . LEU C 1 113 ? 41.165  -32.138 20.832  1.00   32.09  ? 865  LEU C O   1 
ATOM   3587 C CB  . LEU C 1 113 ? 38.239  -30.784 19.849  1.00   35.24  ? 865  LEU C CB  1 
ATOM   3588 C CG  . LEU C 1 113 ? 37.011  -31.023 18.932  1.00   32.54  ? 865  LEU C CG  1 
ATOM   3589 C CD1 . LEU C 1 113 ? 36.575  -29.606 18.320  1.00   27.38  ? 865  LEU C CD1 1 
ATOM   3590 C CD2 . LEU C 1 113 ? 37.219  -31.985 17.781  1.00   26.48  ? 865  LEU C CD2 1 
ATOM   3591 N N   . SER C 1 114 ? 40.176  -30.815 22.454  1.00   35.19  ? 866  SER C N   1 
ATOM   3592 C CA  . SER C 1 114 ? 41.488  -30.474 22.987  1.00   34.95  ? 866  SER C CA  1 
ATOM   3593 C C   . SER C 1 114 ? 42.163  -31.798 23.537  1.00   48.22  ? 866  SER C C   1 
ATOM   3594 O O   . SER C 1 114 ? 43.372  -31.991 23.414  1.00   40.83  ? 866  SER C O   1 
ATOM   3595 C CB  . SER C 1 114 ? 41.344  -29.542 24.165  1.00   37.19  ? 866  SER C CB  1 
ATOM   3596 O OG  . SER C 1 114 ? 42.234  -29.777 25.234  1.00   41.92  ? 866  SER C OG  1 
ATOM   3597 N N   . LEU C 1 115 ? 41.377  -32.643 24.201  1.00   40.54  ? 867  LEU C N   1 
ATOM   3598 C CA  . LEU C 1 115 ? 41.895  -33.951 24.645  1.00   44.88  ? 867  LEU C CA  1 
ATOM   3599 C C   . LEU C 1 115 ? 42.308  -34.834 23.455  1.00   43.88  ? 867  LEU C C   1 
ATOM   3600 O O   . LEU C 1 115 ? 43.324  -35.521 23.483  1.00   51.48  ? 867  LEU C O   1 
ATOM   3601 C CB  . LEU C 1 115 ? 40.867  -34.672 25.512  1.00   41.19  ? 867  LEU C CB  1 
ATOM   3602 C CG  . LEU C 1 115 ? 41.313  -36.092 25.963  1.00   39.89  ? 867  LEU C CG  1 
ATOM   3603 C CD1 . LEU C 1 115 ? 42.606  -35.991 26.906  1.00   45.67  ? 867  LEU C CD1 1 
ATOM   3604 C CD2 . LEU C 1 115 ? 40.249  -36.906 26.624  1.00   33.21  ? 867  LEU C CD2 1 
ATOM   3605 N N   . ALA C 1 116 ? 41.514  -34.858 22.418  1.00   48.27  ? 868  ALA C N   1 
ATOM   3606 C CA  . ALA C 1 116 ? 41.857  -35.705 21.286  1.00   46.36  ? 868  ALA C CA  1 
ATOM   3607 C C   . ALA C 1 116 ? 43.062  -35.252 20.443  1.00   44.17  ? 868  ALA C C   1 
ATOM   3608 O O   . ALA C 1 116 ? 43.720  -36.087 19.826  1.00   46.24  ? 868  ALA C O   1 
ATOM   3609 C CB  . ALA C 1 116 ? 40.637  -35.940 20.468  1.00   40.27  ? 868  ALA C CB  1 
ATOM   3610 N N   . MET C 1 117 ? 43.389  -33.955 20.467  1.00   36.56  ? 869  MET C N   1 
ATOM   3611 C CA  . MET C 1 117 ? 44.511  -33.384 19.763  1.00   47.75  ? 869  MET C CA  1 
ATOM   3612 C C   . MET C 1 117 ? 45.668  -33.207 20.713  1.00   47.72  ? 869  MET C C   1 
ATOM   3613 O O   . MET C 1 117 ? 46.665  -32.660 20.343  1.00   56.15  ? 869  MET C O   1 
ATOM   3614 C CB  . MET C 1 117 ? 44.139  -31.962 19.246  1.00   37.09  ? 869  MET C CB  1 
ATOM   3615 C CG  . MET C 1 117 ? 43.266  -32.038 18.096  1.00   38.65  ? 869  MET C CG  1 
ATOM   3616 S SD  . MET C 1 117 ? 42.686  -30.325 17.559  1.00   41.43  ? 869  MET C SD  1 
ATOM   3617 C CE  . MET C 1 117 ? 41.904  -29.640 18.983  1.00   36.64  ? 869  MET C CE  1 
ATOM   3618 N N   . GLY C 1 118 ? 45.492  -33.581 21.958  1.00   48.53  ? 870  GLY C N   1 
ATOM   3619 C CA  . GLY C 1 118 ? 46.536  -33.451 22.966  1.00   52.32  ? 870  GLY C CA  1 
ATOM   3620 C C   . GLY C 1 118 ? 46.972  -32.009 23.106  1.00   50.16  ? 870  GLY C C   1 
ATOM   3621 O O   . GLY C 1 118 ? 48.114  -31.718 23.177  1.00   50.50  ? 870  GLY C O   1 
ATOM   3622 N N   . ARG C 1 119 ? 46.027  -31.097 23.130  1.00   48.75  ? 871  ARG C N   1 
ATOM   3623 C CA  . ARG C 1 119 ? 46.362  -29.694 22.959  1.00   46.24  ? 871  ARG C CA  1 
ATOM   3624 C C   . ARG C 1 119 ? 45.496  -28.937 23.889  1.00   44.99  ? 871  ARG C C   1 
ATOM   3625 O O   . ARG C 1 119 ? 44.264  -29.074 23.829  1.00   50.72  ? 871  ARG C O   1 
ATOM   3626 C CB  . ARG C 1 119 ? 46.082  -29.238 21.531  1.00   49.41  ? 871  ARG C CB  1 
ATOM   3627 C CG  . ARG C 1 119 ? 47.224  -29.405 20.526  1.00   61.37  ? 871  ARG C CG  1 
ATOM   3628 C CD  . ARG C 1 119 ? 48.240  -28.248 20.630  1.00   67.00  ? 871  ARG C CD  1 
ATOM   3629 N NE  . ARG C 1 119 ? 48.897  -27.964 19.358  1.00   69.63  ? 871  ARG C NE  1 
ATOM   3630 C CZ  . ARG C 1 119 ? 48.539  -27.009 18.501  1.00   71.66  ? 871  ARG C CZ  1 
ATOM   3631 N NH1 . ARG C 1 119 ? 47.503  -26.182 18.762  1.00   75.02  ? 871  ARG C NH1 1 
ATOM   3632 N NH2 . ARG C 1 119 ? 49.219  -26.888 17.371  1.00   65.80  ? 871  ARG C NH2 1 
ATOM   3633 N N   . PRO C 1 120 ? 46.116  -28.129 24.761  1.00   47.15  ? 872  PRO C N   1 
ATOM   3634 C CA  . PRO C 1 120 ? 45.350  -27.417 25.733  1.00   49.72  ? 872  PRO C CA  1 
ATOM   3635 C C   . PRO C 1 120 ? 44.789  -26.169 25.042  1.00   45.89  ? 872  PRO C C   1 
ATOM   3636 O O   . PRO C 1 120 ? 45.298  -25.729 24.030  1.00   50.23  ? 872  PRO C O   1 
ATOM   3637 C CB  . PRO C 1 120 ? 46.398  -27.092 26.805  1.00   47.86  ? 872  PRO C CB  1 
ATOM   3638 C CG  . PRO C 1 120 ? 47.596  -26.759 25.999  1.00   49.88  ? 872  PRO C CG  1 
ATOM   3639 C CD  . PRO C 1 120 ? 47.509  -27.651 24.748  1.00   49.94  ? 872  PRO C CD  1 
ATOM   3640 N N   . VAL C 1 121 ? 43.745  -25.643 25.597  1.00   47.49  ? 873  VAL C N   1 
ATOM   3641 C CA  . VAL C 1 121 ? 43.095  -24.478 25.149  1.00   46.23  ? 873  VAL C CA  1 
ATOM   3642 C C   . VAL C 1 121 ? 43.833  -23.205 25.527  1.00   43.41  ? 873  VAL C C   1 
ATOM   3643 O O   . VAL C 1 121 ? 44.541  -23.152 26.479  1.00   43.64  ? 873  VAL C O   1 
ATOM   3644 C CB  . VAL C 1 121 ? 41.731  -24.473 25.754  1.00   46.40  ? 873  VAL C CB  1 
ATOM   3645 C CG1 . VAL C 1 121 ? 41.013  -23.280 25.401  1.00   44.90  ? 873  VAL C CG1 1 
ATOM   3646 C CG2 . VAL C 1 121 ? 41.003  -25.601 25.273  1.00   53.62  ? 873  VAL C CG2 1 
ATOM   3647 N N   . ARG C 1 122 ? 43.558  -22.142 24.812  1.00   49.26  ? 874  ARG C N   1 
ATOM   3648 C CA  . ARG C 1 122 ? 44.156  -20.858 25.065  1.00   51.74  ? 874  ARG C CA  1 
ATOM   3649 C C   . ARG C 1 122 ? 43.926  -20.469 26.518  1.00   52.67  ? 874  ARG C C   1 
ATOM   3650 O O   . ARG C 1 122 ? 42.960  -20.841 27.111  1.00   59.43  ? 874  ARG C O   1 
ATOM   3651 C CB  . ARG C 1 122 ? 43.488  -19.845 24.147  1.00   54.85  ? 874  ARG C CB  1 
ATOM   3652 C CG  . ARG C 1 122 ? 43.612  -18.398 24.546  1.00   53.79  ? 874  ARG C CG  1 
ATOM   3653 C CD  . ARG C 1 122 ? 43.278  -17.475 23.403  1.00   49.93  ? 874  ARG C CD  1 
ATOM   3654 N NE  . ARG C 1 122 ? 43.089  -16.124 23.876  1.00   65.53  ? 874  ARG C NE  1 
ATOM   3655 C CZ  . ARG C 1 122 ? 42.787  -15.068 23.131  1.00   63.89  ? 874  ARG C CZ  1 
ATOM   3656 N NH1 . ARG C 1 122 ? 42.660  -15.159 21.838  1.00   51.75  ? 874  ARG C NH1 1 
ATOM   3657 N NH2 . ARG C 1 122 ? 42.641  -13.898 23.705  1.00   61.15  ? 874  ARG C NH2 1 
ATOM   3658 N N   . GLN C 1 123 ? 44.884  -19.820 27.130  1.00   56.40  ? 875  GLN C N   1 
ATOM   3659 C CA  . GLN C 1 123 ? 44.780  -19.457 28.520  1.00   51.27  ? 875  GLN C CA  1 
ATOM   3660 C C   . GLN C 1 123 ? 43.873  -18.320 28.756  1.00   43.80  ? 875  GLN C C   1 
ATOM   3661 O O   . GLN C 1 123 ? 43.793  -17.457 27.966  1.00   50.12  ? 875  GLN C O   1 
ATOM   3662 C CB  . GLN C 1 123 ? 46.120  -19.070 29.040  1.00   59.82  ? 875  GLN C CB  1 
ATOM   3663 C CG  . GLN C 1 123 ? 47.165  -19.961 28.583  1.00   63.61  ? 875  GLN C CG  1 
ATOM   3664 C CD  . GLN C 1 123 ? 47.524  -20.953 29.602  1.00   72.19  ? 875  GLN C CD  1 
ATOM   3665 O OE1 . GLN C 1 123 ? 48.629  -20.937 30.098  1.00   68.97  ? 875  GLN C OE1 1 
ATOM   3666 N NE2 . GLN C 1 123 ? 46.605  -21.835 29.922  1.00   57.52  ? 875  GLN C NE2 1 
ATOM   3667 N N   . ASN C 1 124 ? 43.218  -18.334 29.890  1.00   45.74  ? 876  ASN C N   1 
ATOM   3668 C CA  . ASN C 1 124 ? 42.227  -17.346 30.271  1.00   51.11  ? 876  ASN C CA  1 
ATOM   3669 C C   . ASN C 1 124 ? 40.973  -17.269 29.356  1.00   50.40  ? 876  ASN C C   1 
ATOM   3670 O O   . ASN C 1 124 ? 40.183  -16.292 29.427  1.00   37.37  ? 876  ASN C O   1 
ATOM   3671 C CB  . ASN C 1 124 ? 42.925  -15.987 30.464  1.00   50.75  ? 876  ASN C CB  1 
ATOM   3672 C CG  . ASN C 1 124 ? 43.957  -15.999 31.612  1.00   63.61  ? 876  ASN C CG  1 
ATOM   3673 O OD1 . ASN C 1 124 ? 43.906  -16.857 32.510  1.00   57.98  ? 876  ASN C OD1 1 
ATOM   3674 N ND2 . ASN C 1 124 ? 44.874  -15.016 31.605  1.00   69.08  ? 876  ASN C ND2 1 
ATOM   3675 N N   . LEU C 1 125 ? 40.759  -18.307 28.529  1.00   48.24  ? 877  LEU C N   1 
ATOM   3676 C CA  . LEU C 1 125 ? 39.614  -18.322 27.583  1.00   39.39  ? 877  LEU C CA  1 
ATOM   3677 C C   . LEU C 1 125 ? 38.442  -18.966 28.292  1.00   39.74  ? 877  LEU C C   1 
ATOM   3678 O O   . LEU C 1 125 ? 38.624  -20.013 28.855  1.00   43.43  ? 877  LEU C O   1 
ATOM   3679 C CB  . LEU C 1 125 ? 39.979  -19.152 26.303  1.00   40.12  ? 877  LEU C CB  1 
ATOM   3680 C CG  . LEU C 1 125 ? 38.915  -19.187 25.178  1.00   45.71  ? 877  LEU C CG  1 
ATOM   3681 C CD1 . LEU C 1 125 ? 38.266  -17.809 24.941  1.00   34.49  ? 877  LEU C CD1 1 
ATOM   3682 C CD2 . LEU C 1 125 ? 39.451  -19.646 23.810  1.00   33.84  ? 877  LEU C CD2 1 
ATOM   3683 N N   . ALA C 1 126 ? 37.264  -18.386 28.220  1.00   35.31  ? 878  ALA C N   1 
ATOM   3684 C CA  . ALA C 1 126 ? 36.039  -19.024 28.675  1.00   38.67  ? 878  ALA C CA  1 
ATOM   3685 C C   . ALA C 1 126 ? 34.886  -18.856 27.671  1.00   35.37  ? 878  ALA C C   1 
ATOM   3686 O O   . ALA C 1 126 ? 34.920  -18.014 26.841  1.00   40.27  ? 878  ALA C O   1 
ATOM   3687 C CB  . ALA C 1 126 ? 35.654  -18.557 29.984  1.00   40.87  ? 878  ALA C CB  1 
ATOM   3688 N N   . MET C 1 127 ? 33.879  -19.683 27.731  1.00   34.90  ? 879  MET C N   1 
ATOM   3689 C CA  . MET C 1 127 ? 32.896  -19.647 26.717  1.00   24.81  ? 879  MET C CA  1 
ATOM   3690 C C   . MET C 1 127 ? 31.577  -20.232 27.184  1.00   35.55  ? 879  MET C C   1 
ATOM   3691 O O   . MET C 1 127 ? 31.548  -20.948 28.123  1.00   35.22  ? 879  MET C O   1 
ATOM   3692 C CB  . MET C 1 127 ? 33.445  -20.436 25.552  1.00   27.36  ? 879  MET C CB  1 
ATOM   3693 C CG  . MET C 1 127 ? 33.509  -21.970 25.796  1.00   25.18  ? 879  MET C CG  1 
ATOM   3694 S SD  . MET C 1 127 ? 34.196  -23.010 24.548  1.00   32.88  ? 879  MET C SD  1 
ATOM   3695 C CE  . MET C 1 127 ? 35.694  -22.277 24.141  1.00   23.72  ? 879  MET C CE  1 
ATOM   3696 N N   . THR C 1 128 ? 30.501  -19.891 26.506  1.00   29.12  ? 880  THR C N   1 
ATOM   3697 C CA  . THR C 1 128 ? 29.187  -20.433 26.730  1.00   23.52  ? 880  THR C CA  1 
ATOM   3698 C C   . THR C 1 128 ? 28.477  -20.492 25.398  1.00   27.50  ? 880  THR C C   1 
ATOM   3699 O O   . THR C 1 128 ? 28.719  -19.692 24.569  1.00   36.83  ? 880  THR C O   1 
ATOM   3700 C CB  . THR C 1 128 ? 28.385  -19.605 27.720  1.00   32.14  ? 880  THR C CB  1 
ATOM   3701 O OG1 . THR C 1 128 ? 27.152  -20.234 28.007  1.00   27.62  ? 880  THR C OG1 1 
ATOM   3702 C CG2 . THR C 1 128 ? 28.105  -18.286 27.182  1.00   28.28  ? 880  THR C CG2 1 
ATOM   3703 N N   . GLY C 1 129 ? 27.567  -21.419 25.225  1.00   30.38  ? 881  GLY C N   1 
ATOM   3704 C CA  . GLY C 1 129 ? 26.909  -21.609 23.969  1.00   26.60  ? 881  GLY C CA  1 
ATOM   3705 C C   . GLY C 1 129 ? 26.440  -23.000 23.616  1.00   31.93  ? 881  GLY C C   1 
ATOM   3706 O O   . GLY C 1 129 ? 27.184  -23.938 23.636  1.00   27.39  ? 881  GLY C O   1 
ATOM   3707 N N   . GLU C 1 130 ? 25.158  -23.096 23.323  1.00   32.85  ? 882  GLU C N   1 
ATOM   3708 C CA  . GLU C 1 130 ? 24.514  -24.319 22.904  1.00   35.58  ? 882  GLU C CA  1 
ATOM   3709 C C   . GLU C 1 130 ? 24.997  -24.693 21.539  1.00   42.84  ? 882  GLU C C   1 
ATOM   3710 O O   . GLU C 1 130 ? 25.296  -23.853 20.764  1.00   36.61  ? 882  GLU C O   1 
ATOM   3711 C CB  . GLU C 1 130 ? 22.999  -24.152 22.894  1.00   39.23  ? 882  GLU C CB  1 
ATOM   3712 C CG  . GLU C 1 130 ? 22.185  -25.394 22.705  1.00   37.23  ? 882  GLU C CG  1 
ATOM   3713 C CD  . GLU C 1 130 ? 20.689  -25.184 22.745  1.00   46.79  ? 882  GLU C CD  1 
ATOM   3714 O OE1 . GLU C 1 130 ? 20.199  -24.117 22.961  1.00   36.56  ? 882  GLU C OE1 1 
ATOM   3715 O OE2 . GLU C 1 130 ? 19.973  -26.123 22.576  1.00   42.24  ? 882  GLU C OE2 1 
ATOM   3716 N N   . VAL C 1 131 ? 25.059  -25.973 21.250  1.00   35.46  ? 883  VAL C N   1 
ATOM   3717 C CA  . VAL C 1 131 ? 25.513  -26.396 19.922  1.00   29.97  ? 883  VAL C CA  1 
ATOM   3718 C C   . VAL C 1 131 ? 24.582  -27.354 19.216  1.00   36.53  ? 883  VAL C C   1 
ATOM   3719 O O   . VAL C 1 131 ? 24.279  -28.408 19.739  1.00   41.22  ? 883  VAL C O   1 
ATOM   3720 C CB  . VAL C 1 131 ? 27.013  -26.994 19.977  1.00   35.85  ? 883  VAL C CB  1 
ATOM   3721 C CG1 . VAL C 1 131 ? 27.729  -27.123 18.574  1.00   31.00  ? 883  VAL C CG1 1 
ATOM   3722 C CG2 . VAL C 1 131 ? 27.911  -26.099 20.750  1.00   31.70  ? 883  VAL C CG2 1 
ATOM   3723 N N   . SER C 1 132 ? 24.203  -26.982 18.000  1.00   39.62  ? 884  SER C N   1 
ATOM   3724 C CA  . SER C 1 132 ? 23.457  -27.833 17.145  1.00   41.70  ? 884  SER C CA  1 
ATOM   3725 C C   . SER C 1 132 ? 24.401  -28.953 16.629  1.00   41.03  ? 884  SER C C   1 
ATOM   3726 O O   . SER C 1 132 ? 25.632  -28.884 16.774  1.00   39.79  ? 884  SER C O   1 
ATOM   3727 C CB  . SER C 1 132 ? 22.881  -27.043 15.981  1.00   29.01  ? 884  SER C CB  1 
ATOM   3728 O OG  . SER C 1 132 ? 23.827  -26.945 14.918  1.00   30.03  ? 884  SER C OG  1 
ATOM   3729 N N   . LEU C 1 133 ? 23.806  -29.965 16.020  1.00   43.25  ? 885  LEU C N   1 
ATOM   3730 C CA  . LEU C 1 133 ? 24.551  -31.083 15.358  1.00   37.32  ? 885  LEU C CA  1 
ATOM   3731 C C   . LEU C 1 133 ? 25.222  -30.663 14.105  1.00   37.96  ? 885  LEU C C   1 
ATOM   3732 O O   . LEU C 1 133 ? 26.032  -31.394 13.611  1.00   45.35  ? 885  LEU C O   1 
ATOM   3733 C CB  . LEU C 1 133 ? 23.583  -32.186 14.963  1.00   36.83  ? 885  LEU C CB  1 
ATOM   3734 C CG  . LEU C 1 133 ? 22.809  -32.977 15.965  1.00   36.15  ? 885  LEU C CG  1 
ATOM   3735 C CD1 . LEU C 1 133 ? 21.842  -33.825 15.242  1.00   42.16  ? 885  LEU C CD1 1 
ATOM   3736 C CD2 . LEU C 1 133 ? 23.809  -33.831 16.791  1.00   41.24  ? 885  LEU C CD2 1 
ATOM   3737 N N   . THR C 1 134 ? 24.865  -29.524 13.529  1.00   37.16  ? 886  THR C N   1 
ATOM   3738 C CA  . THR C 1 134 ? 25.664  -28.999 12.410  1.00   45.18  ? 886  THR C CA  1 
ATOM   3739 C C   . THR C 1 134 ? 26.700  -28.016 12.914  1.00   36.66  ? 886  THR C C   1 
ATOM   3740 O O   . THR C 1 134 ? 27.494  -27.432 12.156  1.00   47.30  ? 886  THR C O   1 
ATOM   3741 C CB  . THR C 1 134 ? 24.752  -28.323 11.441  1.00   39.24  ? 886  THR C CB  1 
ATOM   3742 O OG1 . THR C 1 134 ? 23.858  -27.444 12.170  1.00   60.21  ? 886  THR C OG1 1 
ATOM   3743 C CG2 . THR C 1 134 ? 23.908  -29.396 10.737  1.00   49.67  ? 886  THR C CG2 1 
ATOM   3744 N N   . GLY C 1 135 ? 26.692  -27.749 14.203  1.00   38.18  ? 887  GLY C N   1 
ATOM   3745 C CA  . GLY C 1 135 ? 27.778  -26.963 14.729  1.00   34.69  ? 887  GLY C CA  1 
ATOM   3746 C C   . GLY C 1 135 ? 27.407  -25.522 14.870  1.00   38.13  ? 887  GLY C C   1 
ATOM   3747 O O   . GLY C 1 135 ? 28.293  -24.682 15.194  1.00   35.41  ? 887  GLY C O   1 
ATOM   3748 N N   . LYS C 1 136 ? 26.120  -25.230 14.590  1.00   38.62  ? 888  LYS C N   1 
ATOM   3749 C CA  . LYS C 1 136 ? 25.553  -23.921 14.913  1.00   39.93  ? 888  LYS C CA  1 
ATOM   3750 C C   . LYS C 1 136 ? 25.533  -23.534 16.411  1.00   33.29  ? 888  LYS C C   1 
ATOM   3751 O O   . LYS C 1 136 ? 25.061  -24.281 17.329  1.00   30.03  ? 888  LYS C O   1 
ATOM   3752 C CB  . LYS C 1 136 ? 24.204  -23.756 14.196  1.00   35.05  ? 888  LYS C CB  1 
ATOM   3753 C CG  . LYS C 1 136 ? 23.562  -22.410 14.264  1.00   40.89  ? 888  LYS C CG  1 
ATOM   3754 C CD  . LYS C 1 136 ? 22.123  -22.532 13.595  1.00   43.15  ? 888  LYS C CD  1 
ATOM   3755 C CE  . LYS C 1 136 ? 21.336  -21.172 13.716  1.00   39.17  ? 888  LYS C CE  1 
ATOM   3756 N NZ  . LYS C 1 136 ? 22.055  -20.003 12.909  1.00   43.41  ? 888  LYS C NZ  1 
ATOM   3757 N N   . ILE C 1 137 ? 26.010  -22.287 16.681  1.00   31.34  ? 889  ILE C N   1 
ATOM   3758 C CA  . ILE C 1 137 ? 26.001  -21.756 18.038  1.00   25.22  ? 889  ILE C CA  1 
ATOM   3759 C C   . ILE C 1 137 ? 24.787  -20.960 18.325  1.00   32.15  ? 889  ILE C C   1 
ATOM   3760 O O   . ILE C 1 137 ? 24.629  -19.859 17.789  1.00   38.71  ? 889  ILE C O   1 
ATOM   3761 C CB  . ILE C 1 137 ? 27.323  -20.942 18.376  1.00   28.13  ? 889  ILE C CB  1 
ATOM   3762 C CG1 . ILE C 1 137 ? 28.546  -21.772 17.968  1.00   23.74  ? 889  ILE C CG1 1 
ATOM   3763 C CG2 . ILE C 1 137 ? 27.491  -20.506 19.771  1.00   28.06  ? 889  ILE C CG2 1 
ATOM   3764 C CD1 . ILE C 1 137 ? 28.682  -23.145 18.546  1.00   27.81  ? 889  ILE C CD1 1 
ATOM   3765 N N   . LEU C 1 138 ? 24.016  -21.431 19.288  1.00   33.95  ? 890  LEU C N   1 
ATOM   3766 C CA  . LEU C 1 138 ? 22.740  -20.827 19.605  1.00   33.60  ? 890  LEU C CA  1 
ATOM   3767 C C   . LEU C 1 138 ? 22.896  -19.949 20.857  1.00   39.72  ? 890  LEU C C   1 
ATOM   3768 O O   . LEU C 1 138 ? 23.776  -20.201 21.691  1.00   43.16  ? 890  LEU C O   1 
ATOM   3769 C CB  . LEU C 1 138 ? 21.762  -21.954 19.856  1.00   34.72  ? 890  LEU C CB  1 
ATOM   3770 C CG  . LEU C 1 138 ? 21.291  -22.778 18.678  1.00   29.02  ? 890  LEU C CG  1 
ATOM   3771 C CD1 . LEU C 1 138 ? 22.070  -22.751 17.406  1.00   29.99  ? 890  LEU C CD1 1 
ATOM   3772 C CD2 . LEU C 1 138 ? 20.646  -24.171 19.083  1.00   32.01  ? 890  LEU C CD2 1 
ATOM   3773 N N   . PRO C 1 139 ? 22.081  -18.853 20.950  1.00   39.40  ? 891  PRO C N   1 
ATOM   3774 C CA  . PRO C 1 139 ? 22.015  -17.944 22.050  1.00   39.13  ? 891  PRO C CA  1 
ATOM   3775 C C   . PRO C 1 139 ? 21.605  -18.553 23.391  1.00   43.19  ? 891  PRO C C   1 
ATOM   3776 O O   . PRO C 1 139 ? 20.686  -19.382 23.523  1.00   42.12  ? 891  PRO C O   1 
ATOM   3777 C CB  . PRO C 1 139 ? 20.938  -16.905 21.594  1.00   42.96  ? 891  PRO C CB  1 
ATOM   3778 C CG  . PRO C 1 139 ? 19.996  -17.713 20.752  1.00   41.30  ? 891  PRO C CG  1 
ATOM   3779 C CD  . PRO C 1 139 ? 20.911  -18.728 20.053  1.00   39.90  ? 891  PRO C CD  1 
ATOM   3780 N N   . VAL C 1 140 ? 22.229  -18.054 24.425  1.00   38.98  ? 892  VAL C N   1 
ATOM   3781 C CA  . VAL C 1 140 ? 21.938  -18.539 25.774  1.00   39.93  ? 892  VAL C CA  1 
ATOM   3782 C C   . VAL C 1 140 ? 21.449  -17.457 26.721  1.00   39.07  ? 892  VAL C C   1 
ATOM   3783 O O   . VAL C 1 140 ? 21.444  -16.260 26.385  1.00   43.53  ? 892  VAL C O   1 
ATOM   3784 C CB  . VAL C 1 140 ? 23.183  -19.242 26.356  1.00   46.87  ? 892  VAL C CB  1 
ATOM   3785 C CG1 . VAL C 1 140 ? 23.628  -20.497 25.432  1.00   30.02  ? 892  VAL C CG1 1 
ATOM   3786 C CG2 . VAL C 1 140 ? 24.323  -18.201 26.517  1.00   49.37  ? 892  VAL C CG2 1 
ATOM   3787 N N   . GLY C 1 141 ? 21.060  -17.887 27.916  1.00   45.36  ? 893  GLY C N   1 
ATOM   3788 C CA  . GLY C 1 141 ? 20.868  -17.001 29.044  1.00   43.82  ? 893  GLY C CA  1 
ATOM   3789 C C   . GLY C 1 141 ? 22.055  -16.585 29.906  1.00   42.12  ? 893  GLY C C   1 
ATOM   3790 O O   . GLY C 1 141 ? 23.179  -17.015 29.726  1.00   43.10  ? 893  GLY C O   1 
ATOM   3791 N N   . GLY C 1 142 ? 21.771  -15.727 30.879  1.00   38.75  ? 894  GLY C N   1 
ATOM   3792 C CA  . GLY C 1 142 ? 22.723  -15.352 31.922  1.00   42.02  ? 894  GLY C CA  1 
ATOM   3793 C C   . GLY C 1 142 ? 23.913  -14.511 31.506  1.00   36.31  ? 894  GLY C C   1 
ATOM   3794 O O   . GLY C 1 142 ? 24.981  -14.612 32.115  1.00   47.98  ? 894  GLY C O   1 
ATOM   3795 N N   . ILE C 1 143 ? 23.806  -13.742 30.440  1.00   41.34  ? 895  ILE C N   1 
ATOM   3796 C CA  . ILE C 1 143 ? 25.038  -13.061 29.951  1.00   38.88  ? 895  ILE C CA  1 
ATOM   3797 C C   . ILE C 1 143 ? 25.717  -12.160 31.016  1.00   42.11  ? 895  ILE C C   1 
ATOM   3798 O O   . ILE C 1 143 ? 26.956  -12.237 31.217  1.00   39.94  ? 895  ILE C O   1 
ATOM   3799 C CB  . ILE C 1 143 ? 24.794  -12.295 28.647  1.00   36.47  ? 895  ILE C CB  1 
ATOM   3800 C CG1 . ILE C 1 143 ? 24.251  -13.245 27.531  1.00   52.28  ? 895  ILE C CG1 1 
ATOM   3801 C CG2 . ILE C 1 143 ? 26.051  -11.674 28.108  1.00   44.87  ? 895  ILE C CG2 1 
ATOM   3802 C CD1 . ILE C 1 143 ? 25.111  -14.568 27.189  1.00   32.02  ? 895  ILE C CD1 1 
ATOM   3803 N N   . LYS C 1 144 ? 24.918  -11.269 31.625  1.00   43.50  ? 896  LYS C N   1 
ATOM   3804 C CA  . LYS C 1 144 ? 25.301  -10.503 32.834  1.00   48.36  ? 896  LYS C CA  1 
ATOM   3805 C C   . LYS C 1 144 ? 26.084  -11.427 33.802  1.00   45.58  ? 896  LYS C C   1 
ATOM   3806 O O   . LYS C 1 144 ? 27.288  -11.318 33.966  1.00   40.01  ? 896  LYS C O   1 
ATOM   3807 C CB  . LYS C 1 144 ? 24.024  -9.891  33.539  1.00   48.04  ? 896  LYS C CB  1 
ATOM   3808 C CG  . LYS C 1 144 ? 24.285  -9.196  34.919  1.00   52.01  ? 896  LYS C CG  1 
ATOM   3809 C CD  . LYS C 1 144 ? 23.139  -8.233  35.369  1.00   56.39  ? 896  LYS C CD  1 
ATOM   3810 C CE  . LYS C 1 144 ? 23.647  -7.180  36.397  1.00   61.87  ? 896  LYS C CE  1 
ATOM   3811 N NZ  . LYS C 1 144 ? 23.159  -7.357  37.827  1.00   59.92  ? 896  LYS C NZ  1 
ATOM   3812 N N   . GLU C 1 145 ? 25.382  -12.392 34.343  1.00   42.84  ? 897  GLU C N   1 
ATOM   3813 C CA  . GLU C 1 145 ? 25.911  -13.252 35.365  1.00   46.85  ? 897  GLU C CA  1 
ATOM   3814 C C   . GLU C 1 145 ? 27.190  -13.976 34.913  1.00   45.47  ? 897  GLU C C   1 
ATOM   3815 O O   . GLU C 1 145 ? 28.283  -13.917 35.588  1.00   53.87  ? 897  GLU C O   1 
ATOM   3816 C CB  . GLU C 1 145 ? 24.788  -14.260 35.775  1.00   40.01  ? 897  GLU C CB  1 
ATOM   3817 C CG  . GLU C 1 145 ? 23.673  -13.654 36.600  1.00   55.54  ? 897  GLU C CG  1 
ATOM   3818 C CD  . GLU C 1 145 ? 22.561  -13.058 35.739  1.00   47.61  ? 897  GLU C CD  1 
ATOM   3819 O OE1 . GLU C 1 145 ? 21.531  -12.677 36.311  1.00   49.09  ? 897  GLU C OE1 1 
ATOM   3820 O OE2 . GLU C 1 145 ? 22.684  -13.035 34.490  1.00   49.60  ? 897  GLU C OE2 1 
ATOM   3821 N N   . LYS C 1 146 ? 27.118  -14.587 33.727  1.00   39.65  ? 898  LYS C N   1 
ATOM   3822 C CA  . LYS C 1 146 ? 28.290  -15.297 33.261  1.00   44.78  ? 898  LYS C CA  1 
ATOM   3823 C C   . LYS C 1 146 ? 29.511  -14.340 33.114  1.00   35.72  ? 898  LYS C C   1 
ATOM   3824 O O   . LYS C 1 146 ? 30.676  -14.790 33.190  1.00   42.93  ? 898  LYS C O   1 
ATOM   3825 C CB  . LYS C 1 146 ? 27.952  -16.005 31.939  1.00   44.39  ? 898  LYS C CB  1 
ATOM   3826 C CG  . LYS C 1 146 ? 26.971  -17.214 32.092  1.00   32.74  ? 898  LYS C CG  1 
ATOM   3827 C CD  . LYS C 1 146 ? 26.685  -17.764 30.733  1.00   34.03  ? 898  LYS C CD  1 
ATOM   3828 C CE  . LYS C 1 146 ? 25.533  -18.880 30.844  1.00   28.84  ? 898  LYS C CE  1 
ATOM   3829 N NZ  . LYS C 1 146 ? 25.191  -19.144 29.562  1.00   25.65  ? 898  LYS C NZ  1 
ATOM   3830 N N   . THR C 1 147 ? 29.260  -13.083 32.774  1.00   39.07  ? 899  THR C N   1 
ATOM   3831 C CA  . THR C 1 147 ? 30.382  -12.160 32.336  1.00   42.38  ? 899  THR C CA  1 
ATOM   3832 C C   . THR C 1 147 ? 31.055  -11.596 33.592  1.00   44.20  ? 899  THR C C   1 
ATOM   3833 O O   . THR C 1 147 ? 32.303  -11.356 33.647  1.00   37.62  ? 899  THR C O   1 
ATOM   3834 C CB  . THR C 1 147 ? 29.871  -10.942 31.490  1.00   36.64  ? 899  THR C CB  1 
ATOM   3835 O OG1 . THR C 1 147 ? 29.136  -11.378 30.316  1.00   39.24  ? 899  THR C OG1 1 
ATOM   3836 C CG2 . THR C 1 147 ? 31.019  -10.070 30.951  1.00   35.83  ? 899  THR C CG2 1 
ATOM   3837 N N   . ILE C 1 148 ? 30.211  -11.343 34.606  1.00   45.40  ? 900  ILE C N   1 
ATOM   3838 C CA  . ILE C 1 148 ? 30.757  -10.946 35.936  1.00   49.14  ? 900  ILE C CA  1 
ATOM   3839 C C   . ILE C 1 148 ? 31.619  -12.117 36.423  1.00   50.79  ? 900  ILE C C   1 
ATOM   3840 O O   . ILE C 1 148 ? 32.762  -11.904 36.781  1.00   49.68  ? 900  ILE C O   1 
ATOM   3841 C CB  . ILE C 1 148 ? 29.649  -10.560 36.943  1.00   45.20  ? 900  ILE C CB  1 
ATOM   3842 C CG1 . ILE C 1 148 ? 28.828  -9.383  36.387  1.00   53.20  ? 900  ILE C CG1 1 
ATOM   3843 C CG2 . ILE C 1 148 ? 30.272  -10.198 38.334  1.00   46.91  ? 900  ILE C CG2 1 
ATOM   3844 C CD1 . ILE C 1 148 ? 27.656  -8.958  37.315  1.00   38.42  ? 900  ILE C CD1 1 
ATOM   3845 N N   . ALA C 1 149 ? 31.108  -13.357 36.335  1.00   45.84  ? 901  ALA C N   1 
ATOM   3846 C CA  . ALA C 1 149 ? 31.866  -14.537 36.853  1.00   46.48  ? 901  ALA C CA  1 
ATOM   3847 C C   . ALA C 1 149 ? 33.208  -14.767 36.124  1.00   39.29  ? 901  ALA C C   1 
ATOM   3848 O O   . ALA C 1 149 ? 34.254  -15.076 36.716  1.00   44.35  ? 901  ALA C O   1 
ATOM   3849 C CB  . ALA C 1 149 ? 30.953  -15.833 36.860  1.00   43.37  ? 901  ALA C CB  1 
ATOM   3850 N N   . ALA C 1 150 ? 33.201  -14.569 34.804  1.00   42.99  ? 902  ALA C N   1 
ATOM   3851 C CA  . ALA C 1 150 ? 34.390  -14.462 34.028  1.00   42.79  ? 902  ALA C CA  1 
ATOM   3852 C C   . ALA C 1 150 ? 35.395  -13.473 34.599  1.00   47.92  ? 902  ALA C C   1 
ATOM   3853 O O   . ALA C 1 150 ? 36.563  -13.776 34.770  1.00   50.15  ? 902  ALA C O   1 
ATOM   3854 C CB  . ALA C 1 150 ? 34.015  -13.995 32.544  1.00   36.95  ? 902  ALA C CB  1 
ATOM   3855 N N   . LYS C 1 151 ? 34.958  -12.230 34.737  1.00   56.27  ? 903  LYS C N   1 
ATOM   3856 C CA  . LYS C 1 151 ? 35.850  -11.184 35.226  1.00   58.55  ? 903  LYS C CA  1 
ATOM   3857 C C   . LYS C 1 151 ? 36.307  -11.621 36.652  1.00   54.42  ? 903  LYS C C   1 
ATOM   3858 O O   . LYS C 1 151 ? 37.478  -11.643 36.949  1.00   48.61  ? 903  LYS C O   1 
ATOM   3859 C CB  . LYS C 1 151 ? 35.137  -9.813  35.163  1.00   58.52  ? 903  LYS C CB  1 
ATOM   3860 C CG  . LYS C 1 151 ? 36.113  -8.620  35.103  1.00   70.15  ? 903  LYS C CG  1 
ATOM   3861 C CD  . LYS C 1 151 ? 35.559  -7.431  34.300  1.00   70.71  ? 903  LYS C CD  1 
ATOM   3862 C CE  . LYS C 1 151 ? 36.585  -6.291  34.202  1.00   70.96  ? 903  LYS C CE  1 
ATOM   3863 N NZ  . LYS C 1 151 ? 37.774  -6.663  33.318  1.00   54.11  ? 903  LYS C NZ  1 
ATOM   3864 N N   . ARG C 1 152 ? 35.383  -12.124 37.462  1.00   51.15  ? 904  ARG C N   1 
ATOM   3865 C CA  . ARG C 1 152 ? 35.746  -12.652 38.768  1.00   54.99  ? 904  ARG C CA  1 
ATOM   3866 C C   . ARG C 1 152 ? 36.931  -13.597 38.752  1.00   57.01  ? 904  ARG C C   1 
ATOM   3867 O O   . ARG C 1 152 ? 37.649  -13.665 39.731  1.00   53.69  ? 904  ARG C O   1 
ATOM   3868 C CB  . ARG C 1 152 ? 34.592  -13.423 39.405  1.00   55.31  ? 904  ARG C CB  1 
ATOM   3869 C CG  . ARG C 1 152 ? 34.781  -13.649 40.908  1.00   57.43  ? 904  ARG C CG  1 
ATOM   3870 C CD  . ARG C 1 152 ? 33.484  -13.795 41.580  1.00   61.15  ? 904  ARG C CD  1 
ATOM   3871 N NE  . ARG C 1 152 ? 32.855  -15.038 41.153  1.00   63.56  ? 904  ARG C NE  1 
ATOM   3872 C CZ  . ARG C 1 152 ? 31.713  -15.166 40.454  1.00   66.62  ? 904  ARG C CZ  1 
ATOM   3873 N NH1 . ARG C 1 152 ? 30.977  -14.121 40.053  1.00   66.31  ? 904  ARG C NH1 1 
ATOM   3874 N NH2 . ARG C 1 152 ? 31.288  -16.385 40.150  1.00   61.76  ? 904  ARG C NH2 1 
ATOM   3875 N N   . ALA C 1 153 ? 37.118  -14.333 37.656  1.00   48.14  ? 905  ALA C N   1 
ATOM   3876 C CA  . ALA C 1 153 ? 38.066  -15.436 37.667  1.00   47.22  ? 905  ALA C CA  1 
ATOM   3877 C C   . ALA C 1 153 ? 39.292  -15.091 36.938  1.00   43.58  ? 905  ALA C C   1 
ATOM   3878 O O   . ALA C 1 153 ? 40.073  -15.944 36.700  1.00   48.24  ? 905  ALA C O   1 
ATOM   3879 C CB  . ALA C 1 153 ? 37.465  -16.662 37.027  1.00   44.20  ? 905  ALA C CB  1 
ATOM   3880 N N   . GLY C 1 154 ? 39.433  -13.841 36.543  1.00   52.78  ? 906  GLY C N   1 
ATOM   3881 C CA  . GLY C 1 154 ? 40.585  -13.430 35.791  1.00   50.27  ? 906  GLY C CA  1 
ATOM   3882 C C   . GLY C 1 154 ? 40.524  -13.906 34.356  1.00   48.54  ? 906  GLY C C   1 
ATOM   3883 O O   . GLY C 1 154 ? 41.557  -14.159 33.741  1.00   44.26  ? 906  GLY C O   1 
ATOM   3884 N N   . VAL C 1 155 ? 39.320  -14.044 33.816  1.00   48.36  ? 907  VAL C N   1 
ATOM   3885 C CA  . VAL C 1 155 ? 39.164  -14.343 32.396  1.00   47.20  ? 907  VAL C CA  1 
ATOM   3886 C C   . VAL C 1 155 ? 39.337  -13.059 31.544  1.00   48.36  ? 907  VAL C C   1 
ATOM   3887 O O   . VAL C 1 155 ? 38.550  -12.161 31.638  1.00   49.85  ? 907  VAL C O   1 
ATOM   3888 C CB  . VAL C 1 155 ? 37.770  -14.941 32.051  1.00   41.47  ? 907  VAL C CB  1 
ATOM   3889 C CG1 . VAL C 1 155 ? 37.590  -15.023 30.541  1.00   49.35  ? 907  VAL C CG1 1 
ATOM   3890 C CG2 . VAL C 1 155 ? 37.593  -16.296 32.625  1.00   35.50  ? 907  VAL C CG2 1 
ATOM   3891 N N   . THR C 1 156 ? 40.281  -13.090 30.610  1.00   51.24  ? 908  THR C N   1 
ATOM   3892 C CA  . THR C 1 156 ? 40.601  -12.013 29.729  1.00   53.09  ? 908  THR C CA  1 
ATOM   3893 C C   . THR C 1 156 ? 39.962  -12.113 28.314  1.00   53.62  ? 908  THR C C   1 
ATOM   3894 O O   . THR C 1 156 ? 39.989  -11.160 27.551  1.00   53.70  ? 908  THR C O   1 
ATOM   3895 C CB  . THR C 1 156 ? 42.132  -11.934 29.550  1.00   54.37  ? 908  THR C CB  1 
ATOM   3896 O OG1 . THR C 1 156 ? 42.455  -10.745 28.841  1.00   64.34  ? 908  THR C OG1 1 
ATOM   3897 C CG2 . THR C 1 156 ? 42.671  -13.151 28.739  1.00   50.90  ? 908  THR C CG2 1 
ATOM   3898 N N   . CYS C 1 157 ? 39.384  -13.256 27.967  1.00   52.07  ? 909  CYS C N   1 
ATOM   3899 C CA  . CYS C 1 157 ? 38.872  -13.499 26.635  1.00   47.70  ? 909  CYS C CA  1 
ATOM   3900 C C   . CYS C 1 157 ? 37.625  -14.369 26.736  1.00   44.57  ? 909  CYS C C   1 
ATOM   3901 O O   . CYS C 1 157 ? 37.669  -15.471 27.247  1.00   49.57  ? 909  CYS C O   1 
ATOM   3902 C CB  . CYS C 1 157 ? 39.908  -14.190 25.732  1.00   51.12  ? 909  CYS C CB  1 
ATOM   3903 S SG  . CYS C 1 157 ? 39.260  -14.456 23.998  1.00   47.16  ? 909  CYS C SG  1 
ATOM   3904 N N   . ILE C 1 158 ? 36.500  -13.839 26.315  1.00   43.57  ? 910  ILE C N   1 
ATOM   3905 C CA  . ILE C 1 158 ? 35.301  -14.649 26.256  1.00   41.26  ? 910  ILE C CA  1 
ATOM   3906 C C   . ILE C 1 158 ? 34.700  -14.796 24.854  1.00   41.92  ? 910  ILE C C   1 
ATOM   3907 O O   . ILE C 1 158 ? 34.759  -13.903 23.993  1.00   46.76  ? 910  ILE C O   1 
ATOM   3908 C CB  . ILE C 1 158 ? 34.274  -14.239 27.280  1.00   30.71  ? 910  ILE C CB  1 
ATOM   3909 C CG1 . ILE C 1 158 ? 33.453  -13.040 26.898  1.00   39.21  ? 910  ILE C CG1 1 
ATOM   3910 C CG2 . ILE C 1 158 ? 34.872  -14.024 28.615  1.00   41.79  ? 910  ILE C CG2 1 
ATOM   3911 C CD1 . ILE C 1 158 ? 32.224  -13.017 27.768  1.00   34.71  ? 910  ILE C CD1 1 
ATOM   3912 N N   . VAL C 1 159 ? 34.109  -15.956 24.649  1.00   35.51  ? 911  VAL C N   1 
ATOM   3913 C CA  . VAL C 1 159 ? 33.451  -16.343 23.450  1.00   31.38  ? 911  VAL C CA  1 
ATOM   3914 C C   . VAL C 1 159 ? 31.985  -16.486 23.741  1.00   37.83  ? 911  VAL C C   1 
ATOM   3915 O O   . VAL C 1 159 ? 31.643  -17.203 24.649  1.00   36.83  ? 911  VAL C O   1 
ATOM   3916 C CB  . VAL C 1 159 ? 33.982  -17.683 22.925  1.00   38.52  ? 911  VAL C CB  1 
ATOM   3917 C CG1 . VAL C 1 159 ? 33.297  -18.072 21.526  1.00   29.43  ? 911  VAL C CG1 1 
ATOM   3918 C CG2 . VAL C 1 159 ? 35.378  -17.521 22.737  1.00   36.71  ? 911  VAL C CG2 1 
ATOM   3919 N N   . LEU C 1 160 ? 31.163  -15.691 23.046  1.00   39.32  ? 912  LEU C N   1 
ATOM   3920 C CA  . LEU C 1 160 ? 29.669  -15.716 23.096  1.00   26.48  ? 912  LEU C CA  1 
ATOM   3921 C C   . LEU C 1 160 ? 28.998  -15.900 21.817  1.00   29.64  ? 912  LEU C C   1 
ATOM   3922 O O   . LEU C 1 160 ? 29.533  -15.487 20.770  1.00   29.05  ? 912  LEU C O   1 
ATOM   3923 C CB  . LEU C 1 160 ? 29.134  -14.327 23.651  1.00   35.33  ? 912  LEU C CB  1 
ATOM   3924 C CG  . LEU C 1 160 ? 29.548  -14.121 25.112  1.00   50.21  ? 912  LEU C CG  1 
ATOM   3925 C CD1 . LEU C 1 160 ? 29.080  -12.736 25.682  1.00   33.29  ? 912  LEU C CD1 1 
ATOM   3926 C CD2 . LEU C 1 160 ? 29.002  -15.347 25.910  1.00   38.36  ? 912  LEU C CD2 1 
ATOM   3927 N N   . PRO C 1 161 ? 27.726  -16.356 21.854  1.00   27.51  ? 913  PRO C N   1 
ATOM   3928 C CA  . PRO C 1 161 ? 26.934  -16.503 20.657  1.00   29.59  ? 913  PRO C CA  1 
ATOM   3929 C C   . PRO C 1 161 ? 26.480  -15.130 20.075  1.00   31.66  ? 913  PRO C C   1 
ATOM   3930 O O   . PRO C 1 161 ? 26.212  -14.221 20.882  1.00   31.44  ? 913  PRO C O   1 
ATOM   3931 C CB  . PRO C 1 161 ? 25.747  -17.337 21.150  1.00   35.90  ? 913  PRO C CB  1 
ATOM   3932 C CG  . PRO C 1 161 ? 26.181  -17.969 22.401  1.00   28.03  ? 913  PRO C CG  1 
ATOM   3933 C CD  . PRO C 1 161 ? 27.013  -16.824 23.015  1.00   34.04  ? 913  PRO C CD  1 
ATOM   3934 N N   . ALA C 1 162 ? 26.427  -15.031 18.763  1.00   27.28  ? 914  ALA C N   1 
ATOM   3935 C CA  . ALA C 1 162 ? 26.221  -13.800 17.993  1.00   39.77  ? 914  ALA C CA  1 
ATOM   3936 C C   . ALA C 1 162 ? 24.909  -13.223 18.311  1.00   34.56  ? 914  ALA C C   1 
ATOM   3937 O O   . ALA C 1 162 ? 24.795  -12.019 18.411  1.00   38.33  ? 914  ALA C O   1 
ATOM   3938 C CB  . ALA C 1 162 ? 26.375  -14.048 16.487  1.00   44.11  ? 914  ALA C CB  1 
ATOM   3939 N N   . GLU C 1 163 ? 23.898  -14.052 18.622  1.00   38.55  ? 915  GLU C N   1 
ATOM   3940 C CA  . GLU C 1 163 ? 22.572  -13.509 19.013  1.00   41.01  ? 915  GLU C CA  1 
ATOM   3941 C C   . GLU C 1 163 ? 22.520  -13.043 20.470  1.00   40.90  ? 915  GLU C C   1 
ATOM   3942 O O   . GLU C 1 163 ? 21.518  -12.576 20.942  1.00   49.04  ? 915  GLU C O   1 
ATOM   3943 C CB  . GLU C 1 163 ? 21.440  -14.490 18.605  1.00   43.17  ? 915  GLU C CB  1 
ATOM   3944 C CG  . GLU C 1 163 ? 21.455  -14.537 17.079  1.00   43.29  ? 915  GLU C CG  1 
ATOM   3945 C CD  . GLU C 1 163 ? 20.449  -15.491 16.412  1.00   68.40  ? 915  GLU C CD  1 
ATOM   3946 O OE1 . GLU C 1 163 ? 20.040  -16.480 17.058  1.00   66.44  ? 915  GLU C OE1 1 
ATOM   3947 O OE2 . GLU C 1 163 ? 20.103  -15.246 15.205  1.00   66.24  ? 915  GLU C OE2 1 
ATOM   3948 N N   . ASN C 1 164 ? 23.646  -13.057 21.165  1.00   35.35  ? 916  ASN C N   1 
ATOM   3949 C CA  . ASN C 1 164 ? 23.717  -12.503 22.470  1.00   28.89  ? 916  ASN C CA  1 
ATOM   3950 C C   . ASN C 1 164 ? 24.514  -11.125 22.440  1.00   34.87  ? 916  ASN C C   1 
ATOM   3951 O O   . ASN C 1 164 ? 24.916  -10.617 23.490  1.00   32.04  ? 916  ASN C O   1 
ATOM   3952 C CB  . ASN C 1 164 ? 24.383  -13.410 23.467  1.00   33.40  ? 916  ASN C CB  1 
ATOM   3953 C CG  . ASN C 1 164 ? 23.506  -14.593 23.841  1.00   33.83  ? 916  ASN C CG  1 
ATOM   3954 O OD1 . ASN C 1 164 ? 23.888  -15.764 23.738  1.00   32.77  ? 916  ASN C OD1 1 
ATOM   3955 N ND2 . ASN C 1 164 ? 22.366  -14.278 24.281  1.00   28.25  ? 916  ASN C ND2 1 
ATOM   3956 N N   . LYS C 1 165 ? 24.756  -10.669 21.242  1.00   37.49  ? 917  LYS C N   1 
ATOM   3957 C CA  . LYS C 1 165 ? 25.502  -9.470  20.960  1.00   43.78  ? 917  LYS C CA  1 
ATOM   3958 C C   . LYS C 1 165 ? 24.840  -8.358  21.743  1.00   43.86  ? 917  LYS C C   1 
ATOM   3959 O O   . LYS C 1 165 ? 25.496  -7.649  22.494  1.00   41.54  ? 917  LYS C O   1 
ATOM   3960 C CB  . LYS C 1 165 ? 25.480  -9.155  19.499  1.00   42.35  ? 917  LYS C CB  1 
ATOM   3961 C CG  . LYS C 1 165 ? 26.859  -8.808  18.863  1.00   44.53  ? 917  LYS C CG  1 
ATOM   3962 C CD  . LYS C 1 165 ? 26.712  -8.451  17.354  1.00   50.27  ? 917  LYS C CD  1 
ATOM   3963 C CE  . LYS C 1 165 ? 27.933  -8.942  16.602  1.00   58.94  ? 917  LYS C CE  1 
ATOM   3964 N NZ  . LYS C 1 165 ? 27.958  -8.574  15.171  1.00   56.07  ? 917  LYS C NZ  1 
ATOM   3965 N N   . LYS C 1 166 ? 23.526  -8.230  21.632  1.00   44.75  ? 918  LYS C N   1 
ATOM   3966 C CA  . LYS C 1 166 ? 22.919  -7.185  22.447  1.00   46.70  ? 918  LYS C CA  1 
ATOM   3967 C C   . LYS C 1 166 ? 22.741  -7.379  23.948  1.00   42.40  ? 918  LYS C C   1 
ATOM   3968 O O   . LYS C 1 166 ? 22.570  -6.375  24.678  1.00   44.64  ? 918  LYS C O   1 
ATOM   3969 C CB  . LYS C 1 166 ? 21.714  -6.590  21.790  1.00   47.33  ? 918  LYS C CB  1 
ATOM   3970 C CG  . LYS C 1 166 ? 22.184  -5.669  20.661  1.00   45.95  ? 918  LYS C CG  1 
ATOM   3971 C CD  . LYS C 1 166 ? 21.006  -4.850  20.079  1.00   53.58  ? 918  LYS C CD  1 
ATOM   3972 C CE  . LYS C 1 166 ? 20.221  -5.681  19.089  1.00   54.26  ? 918  LYS C CE  1 
ATOM   3973 N NZ  . LYS C 1 166 ? 20.233  -7.119  19.400  1.00   57.42  ? 918  LYS C NZ  1 
ATOM   3974 N N   . ASP C 1 167 ? 22.821  -8.634  24.437  1.00   42.06  ? 919  ASP C N   1 
ATOM   3975 C CA  . ASP C 1 167 ? 22.826  -8.881  25.865  1.00   36.84  ? 919  ASP C CA  1 
ATOM   3976 C C   . ASP C 1 167 ? 24.152  -8.364  26.439  1.00   32.87  ? 919  ASP C C   1 
ATOM   3977 O O   . ASP C 1 167 ? 24.205  -7.915  27.587  1.00   36.41  ? 919  ASP C O   1 
ATOM   3978 C CB  . ASP C 1 167 ? 22.601  -10.386 26.176  1.00   42.48  ? 919  ASP C CB  1 
ATOM   3979 C CG  . ASP C 1 167 ? 21.258  -10.917 25.625  1.00   31.55  ? 919  ASP C CG  1 
ATOM   3980 O OD1 . ASP C 1 167 ? 20.381  -11.251 26.425  1.00   53.98  ? 919  ASP C OD1 1 
ATOM   3981 O OD2 . ASP C 1 167 ? 21.119  -11.079 24.369  1.00   53.64  ? 919  ASP C OD2 1 
ATOM   3982 N N   . PHE C 1 168 ? 25.211  -8.533  25.681  1.00   35.12  ? 920  PHE C N   1 
ATOM   3983 C CA  . PHE C 1 168 ? 26.518  -8.097  26.076  1.00   28.67  ? 920  PHE C CA  1 
ATOM   3984 C C   . PHE C 1 168 ? 26.700  -6.617  26.064  1.00   40.07  ? 920  PHE C C   1 
ATOM   3985 O O   . PHE C 1 168 ? 27.326  -6.066  26.903  1.00   44.59  ? 920  PHE C O   1 
ATOM   3986 C CB  . PHE C 1 168 ? 27.592  -8.715  25.211  1.00   31.48  ? 920  PHE C CB  1 
ATOM   3987 C CG  . PHE C 1 168 ? 28.972  -8.474  25.691  1.00   34.32  ? 920  PHE C CG  1 
ATOM   3988 C CD1 . PHE C 1 168 ? 29.491  -9.183  26.708  1.00   46.75  ? 920  PHE C CD1 1 
ATOM   3989 C CD2 . PHE C 1 168 ? 29.754  -7.525  25.112  1.00   50.90  ? 920  PHE C CD2 1 
ATOM   3990 C CE1 . PHE C 1 168 ? 30.734  -8.950  27.125  1.00   30.59  ? 920  PHE C CE1 1 
ATOM   3991 C CE2 . PHE C 1 168 ? 30.992  -7.306  25.518  1.00   35.10  ? 920  PHE C CE2 1 
ATOM   3992 C CZ  . PHE C 1 168 ? 31.481  -8.021  26.524  1.00   45.74  ? 920  PHE C CZ  1 
ATOM   3993 N N   . TYR C 1 169 ? 26.246  -5.978  24.997  1.00   38.25  ? 921  TYR C N   1 
ATOM   3994 C CA  . TYR C 1 169 ? 26.388  -4.533  24.902  1.00   42.53  ? 921  TYR C CA  1 
ATOM   3995 C C   . TYR C 1 169 ? 25.576  -3.811  25.978  1.00   41.01  ? 921  TYR C C   1 
ATOM   3996 O O   . TYR C 1 169 ? 26.019  -2.802  26.527  1.00   51.40  ? 921  TYR C O   1 
ATOM   3997 C CB  . TYR C 1 169 ? 26.118  -4.026  23.483  1.00   32.34  ? 921  TYR C CB  1 
ATOM   3998 C CG  . TYR C 1 169 ? 27.218  -4.422  22.514  1.00   45.06  ? 921  TYR C CG  1 
ATOM   3999 C CD1 . TYR C 1 169 ? 28.559  -4.230  22.840  1.00   39.62  ? 921  TYR C CD1 1 
ATOM   4000 C CD2 . TYR C 1 169 ? 26.920  -4.989  21.283  1.00   34.21  ? 921  TYR C CD2 1 
ATOM   4001 C CE1 . TYR C 1 169 ? 29.574  -4.595  21.964  1.00   46.07  ? 921  TYR C CE1 1 
ATOM   4002 C CE2 . TYR C 1 169 ? 27.924  -5.353  20.401  1.00   36.87  ? 921  TYR C CE2 1 
ATOM   4003 C CZ  . TYR C 1 169 ? 29.247  -5.153  20.746  1.00   54.06  ? 921  TYR C CZ  1 
ATOM   4004 O OH  . TYR C 1 169 ? 30.244  -5.514  19.869  1.00   59.08  ? 921  TYR C OH  1 
ATOM   4005 N N   . ASP C 1 170 ? 24.389  -4.332  26.273  1.00   50.01  ? 922  ASP C N   1 
ATOM   4006 C CA  . ASP C 1 170 ? 23.521  -3.712  27.252  1.00   51.78  ? 922  ASP C CA  1 
ATOM   4007 C C   . ASP C 1 170 ? 24.146  -3.599  28.616  1.00   49.95  ? 922  ASP C C   1 
ATOM   4008 O O   . ASP C 1 170 ? 23.682  -2.856  29.398  1.00   50.54  ? 922  ASP C O   1 
ATOM   4009 C CB  . ASP C 1 170 ? 22.182  -4.428  27.402  1.00   53.86  ? 922  ASP C CB  1 
ATOM   4010 C CG  . ASP C 1 170 ? 21.040  -3.744  26.634  1.00   59.32  ? 922  ASP C CG  1 
ATOM   4011 O OD1 . ASP C 1 170 ? 21.029  -3.730  25.405  1.00   66.39  ? 922  ASP C OD1 1 
ATOM   4012 O OD2 . ASP C 1 170 ? 20.129  -3.216  27.266  1.00   61.28  ? 922  ASP C OD2 1 
ATOM   4013 N N   . LEU C 1 171 ? 25.141  -4.388  28.929  1.00   41.64  ? 923  LEU C N   1 
ATOM   4014 C CA  . LEU C 1 171 ? 25.772  -4.378  30.248  1.00   47.53  ? 923  LEU C CA  1 
ATOM   4015 C C   . LEU C 1 171 ? 26.554  -3.077  30.506  1.00   52.41  ? 923  LEU C C   1 
ATOM   4016 O O   . LEU C 1 171 ? 27.049  -2.433  29.560  1.00   49.17  ? 923  LEU C O   1 
ATOM   4017 C CB  . LEU C 1 171 ? 26.734  -5.574  30.447  1.00   38.60  ? 923  LEU C CB  1 
ATOM   4018 C CG  . LEU C 1 171 ? 26.165  -6.931  30.069  1.00   44.07  ? 923  LEU C CG  1 
ATOM   4019 C CD1 . LEU C 1 171 ? 27.312  -7.991  30.067  1.00   34.07  ? 923  LEU C CD1 1 
ATOM   4020 C CD2 . LEU C 1 171 ? 24.955  -7.262  30.899  1.00   35.82  ? 923  LEU C CD2 1 
ATOM   4021 N N   . ALA C 1 172 ? 26.637  -2.707  31.792  1.00   50.28  ? 924  ALA C N   1 
ATOM   4022 C CA  . ALA C 1 172 ? 27.463  -1.577  32.246  1.00   49.91  ? 924  ALA C CA  1 
ATOM   4023 C C   . ALA C 1 172 ? 28.886  -1.715  31.751  1.00   45.39  ? 924  ALA C C   1 
ATOM   4024 O O   . ALA C 1 172 ? 29.460  -2.801  31.773  1.00   42.81  ? 924  ALA C O   1 
ATOM   4025 C CB  . ALA C 1 172 ? 27.437  -1.443  33.805  1.00   52.95  ? 924  ALA C CB  1 
ATOM   4026 N N   . ALA C 1 173 ? 29.489  -0.600  31.331  1.00   43.72  ? 925  ALA C N   1 
ATOM   4027 C CA  . ALA C 1 173 ? 30.825  -0.678  30.784  1.00   49.54  ? 925  ALA C CA  1 
ATOM   4028 C C   . ALA C 1 173 ? 31.802  -1.292  31.745  1.00   49.39  ? 925  ALA C C   1 
ATOM   4029 O O   . ALA C 1 173 ? 32.761  -1.963  31.299  1.00   57.04  ? 925  ALA C O   1 
ATOM   4030 C CB  . ALA C 1 173 ? 31.341  0.703   30.267  1.00   36.32  ? 925  ALA C CB  1 
ATOM   4031 N N   . PHE C 1 174 ? 31.583  -1.069  33.040  1.00   51.17  ? 926  PHE C N   1 
ATOM   4032 C CA  . PHE C 1 174 ? 32.539  -1.470  34.057  1.00   54.62  ? 926  PHE C CA  1 
ATOM   4033 C C   . PHE C 1 174 ? 32.641  -2.981  34.213  1.00   54.39  ? 926  PHE C C   1 
ATOM   4034 O O   . PHE C 1 174 ? 33.705  -3.461  34.616  1.00   46.47  ? 926  PHE C O   1 
ATOM   4035 C CB  . PHE C 1 174 ? 32.212  -0.811  35.423  1.00   63.69  ? 926  PHE C CB  1 
ATOM   4036 C CG  . PHE C 1 174 ? 32.318  -1.747  36.610  1.00   64.69  ? 926  PHE C CG  1 
ATOM   4037 C CD1 . PHE C 1 174 ? 33.561  -2.019  37.196  1.00   72.39  ? 926  PHE C CD1 1 
ATOM   4038 C CD2 . PHE C 1 174 ? 31.185  -2.344  37.141  1.00   74.75  ? 926  PHE C CD2 1 
ATOM   4039 C CE1 . PHE C 1 174 ? 33.686  -2.883  38.291  1.00   78.85  ? 926  PHE C CE1 1 
ATOM   4040 C CE2 . PHE C 1 174 ? 31.291  -3.213  38.241  1.00   85.97  ? 926  PHE C CE2 1 
ATOM   4041 C CZ  . PHE C 1 174 ? 32.555  -3.483  38.818  1.00   83.23  ? 926  PHE C CZ  1 
ATOM   4042 N N   . ILE C 1 175 ? 31.525  -3.701  33.968  1.00   54.39  ? 927  ILE C N   1 
ATOM   4043 C CA  . ILE C 1 175 ? 31.504  -5.201  33.917  1.00   51.52  ? 927  ILE C CA  1 
ATOM   4044 C C   . ILE C 1 175 ? 32.387  -5.721  32.771  1.00   58.29  ? 927  ILE C C   1 
ATOM   4045 O O   . ILE C 1 175 ? 33.155  -6.679  32.913  1.00   65.51  ? 927  ILE C O   1 
ATOM   4046 C CB  . ILE C 1 175 ? 30.044  -5.721  33.701  1.00   52.30  ? 927  ILE C CB  1 
ATOM   4047 C CG1 . ILE C 1 175 ? 29.163  -5.353  34.881  1.00   43.85  ? 927  ILE C CG1 1 
ATOM   4048 C CG2 . ILE C 1 175 ? 30.019  -7.258  33.448  1.00   60.97  ? 927  ILE C CG2 1 
ATOM   4049 C CD1 . ILE C 1 175 ? 27.604  -5.571  34.727  1.00   45.79  ? 927  ILE C CD1 1 
ATOM   4050 N N   . THR C 1 176 ? 32.372  -4.990  31.675  1.00   58.37  ? 928  THR C N   1 
ATOM   4051 C CA  . THR C 1 176 ? 32.638  -5.527  30.365  1.00   58.12  ? 928  THR C CA  1 
ATOM   4052 C C   . THR C 1 176 ? 34.061  -5.253  29.877  1.00   58.44  ? 928  THR C C   1 
ATOM   4053 O O   . THR C 1 176 ? 34.555  -5.879  28.923  1.00   53.93  ? 928  THR C O   1 
ATOM   4054 C CB  . THR C 1 176 ? 31.552  -4.913  29.394  1.00   58.66  ? 928  THR C CB  1 
ATOM   4055 O OG1 . THR C 1 176 ? 30.772  -5.964  28.797  1.00   50.68  ? 928  THR C OG1 1 
ATOM   4056 C CG2 . THR C 1 176 ? 32.161  -3.986  28.386  1.00   56.54  ? 928  THR C CG2 1 
ATOM   4057 N N   . GLU C 1 177 ? 34.764  -4.347  30.533  1.00   63.94  ? 929  GLU C N   1 
ATOM   4058 C CA  . GLU C 1 177 ? 36.034  -3.889  29.944  1.00   64.70  ? 929  GLU C CA  1 
ATOM   4059 C C   . GLU C 1 177 ? 37.226  -4.549  30.579  1.00   56.92  ? 929  GLU C C   1 
ATOM   4060 O O   . GLU C 1 177 ? 37.114  -5.073  31.662  1.00   61.48  ? 929  GLU C O   1 
ATOM   4061 C CB  . GLU C 1 177 ? 36.138  -2.352  29.900  1.00   70.67  ? 929  GLU C CB  1 
ATOM   4062 C CG  . GLU C 1 177 ? 35.613  -1.716  28.556  1.00   73.65  ? 929  GLU C CG  1 
ATOM   4063 C CD  . GLU C 1 177 ? 36.078  -2.469  27.285  1.00   78.39  ? 929  GLU C CD  1 
ATOM   4064 O OE1 . GLU C 1 177 ? 37.174  -3.073  27.296  1.00   68.38  ? 929  GLU C OE1 1 
ATOM   4065 O OE2 . GLU C 1 177 ? 35.329  -2.460  26.277  1.00   80.04  ? 929  GLU C OE2 1 
ATOM   4066 N N   . GLY C 1 178 ? 38.348  -4.546  29.867  1.00   60.20  ? 930  GLY C N   1 
ATOM   4067 C CA  . GLY C 1 178 ? 39.385  -5.573  30.021  1.00   63.33  ? 930  GLY C CA  1 
ATOM   4068 C C   . GLY C 1 178 ? 38.971  -6.914  29.348  1.00   60.89  ? 930  GLY C C   1 
ATOM   4069 O O   . GLY C 1 178 ? 39.703  -7.899  29.415  1.00   63.82  ? 930  GLY C O   1 
ATOM   4070 N N   . LEU C 1 179 ? 37.776  -7.002  28.767  1.00   57.50  ? 931  LEU C N   1 
ATOM   4071 C CA  . LEU C 1 179 ? 37.329  -8.292  28.174  1.00   54.57  ? 931  LEU C CA  1 
ATOM   4072 C C   . LEU C 1 179 ? 37.425  -8.218  26.683  1.00   52.91  ? 931  LEU C C   1 
ATOM   4073 O O   . LEU C 1 179 ? 36.881  -7.312  26.105  1.00   55.01  ? 931  LEU C O   1 
ATOM   4074 C CB  . LEU C 1 179 ? 35.921  -8.634  28.576  1.00   54.49  ? 931  LEU C CB  1 
ATOM   4075 C CG  . LEU C 1 179 ? 35.723  -8.740  30.084  1.00   61.28  ? 931  LEU C CG  1 
ATOM   4076 C CD1 . LEU C 1 179 ? 34.519  -9.585  30.389  1.00   58.62  ? 931  LEU C CD1 1 
ATOM   4077 C CD2 . LEU C 1 179 ? 36.973  -9.293  30.837  1.00   70.89  ? 931  LEU C CD2 1 
ATOM   4078 N N   . GLU C 1 180 ? 38.169  -9.150  26.087  1.00   48.19  ? 932  GLU C N   1 
ATOM   4079 C CA  . GLU C 1 180 ? 38.194  -9.399  24.645  1.00   56.39  ? 932  GLU C CA  1 
ATOM   4080 C C   . GLU C 1 180 ? 37.004  -10.352 24.350  1.00   48.02  ? 932  GLU C C   1 
ATOM   4081 O O   . GLU C 1 180 ? 36.972  -11.443 24.862  1.00   51.08  ? 932  GLU C O   1 
ATOM   4082 C CB  . GLU C 1 180 ? 39.548  -10.047 24.269  1.00   54.33  ? 932  GLU C CB  1 
ATOM   4083 C CG  . GLU C 1 180 ? 39.940  -10.081 22.767  1.00   63.76  ? 932  GLU C CG  1 
ATOM   4084 C CD  . GLU C 1 180 ? 41.188  -10.931 22.470  1.00   64.16  ? 932  GLU C CD  1 
ATOM   4085 O OE1 . GLU C 1 180 ? 42.293  -10.563 22.928  1.00   74.36  ? 932  GLU C OE1 1 
ATOM   4086 O OE2 . GLU C 1 180 ? 41.076  -11.961 21.756  1.00   69.85  ? 932  GLU C OE2 1 
ATOM   4087 N N   . VAL C 1 181 ? 36.016  -9.888  23.586  1.00   46.81  ? 933  VAL C N   1 
ATOM   4088 C CA  . VAL C 1 181 ? 34.814  -10.678 23.253  1.00   44.40  ? 933  VAL C CA  1 
ATOM   4089 C C   . VAL C 1 181 ? 34.832  -11.088 21.773  1.00   45.18  ? 933  VAL C C   1 
ATOM   4090 O O   . VAL C 1 181 ? 35.199  -10.315 20.898  1.00   43.38  ? 933  VAL C O   1 
ATOM   4091 C CB  . VAL C 1 181 ? 33.481  -9.896  23.588  1.00   43.18  ? 933  VAL C CB  1 
ATOM   4092 C CG1 . VAL C 1 181 ? 32.286  -10.851 23.750  1.00   38.59  ? 933  VAL C CG1 1 
ATOM   4093 C CG2 . VAL C 1 181 ? 33.654  -9.047  24.840  1.00   60.23  ? 933  VAL C CG2 1 
ATOM   4094 N N   . HIS C 1 182 ? 34.416  -12.316 21.495  1.00   42.39  ? 934  HIS C N   1 
ATOM   4095 C CA  . HIS C 1 182 ? 34.249  -12.799 20.148  1.00   36.74  ? 934  HIS C CA  1 
ATOM   4096 C C   . HIS C 1 182 ? 32.795  -13.317 20.127  1.00   35.89  ? 934  HIS C C   1 
ATOM   4097 O O   . HIS C 1 182 ? 32.388  -14.000 21.065  1.00   35.76  ? 934  HIS C O   1 
ATOM   4098 C CB  . HIS C 1 182 ? 35.178  -13.963 19.879  1.00   48.54  ? 934  HIS C CB  1 
ATOM   4099 C CG  . HIS C 1 182 ? 36.609  -13.597 19.906  1.00   37.85  ? 934  HIS C CG  1 
ATOM   4100 N ND1 . HIS C 1 182 ? 37.343  -13.628 21.064  1.00   39.10  ? 934  HIS C ND1 1 
ATOM   4101 C CD2 . HIS C 1 182 ? 37.426  -13.102 18.946  1.00   41.56  ? 934  HIS C CD2 1 
ATOM   4102 C CE1 . HIS C 1 182 ? 38.569  -13.210 20.798  1.00   34.65  ? 934  HIS C CE1 1 
ATOM   4103 N NE2 . HIS C 1 182 ? 38.641  -12.888 19.522  1.00   48.82  ? 934  HIS C NE2 1 
ATOM   4104 N N   . PHE C 1 183 ? 32.031  -12.808 19.172  1.00   36.64  ? 935  PHE C N   1 
ATOM   4105 C CA  . PHE C 1 183 ? 30.694  -13.241 18.808  1.00   34.47  ? 935  PHE C CA  1 
ATOM   4106 C C   . PHE C 1 183 ? 30.697  -14.215 17.715  1.00   30.30  ? 935  PHE C C   1 
ATOM   4107 O O   . PHE C 1 183 ? 31.158  -13.992 16.626  1.00   38.02  ? 935  PHE C O   1 
ATOM   4108 C CB  . PHE C 1 183 ? 29.720  -12.064 18.549  1.00   39.29  ? 935  PHE C CB  1 
ATOM   4109 C CG  . PHE C 1 183 ? 29.540  -11.189 19.740  1.00   31.35  ? 935  PHE C CG  1 
ATOM   4110 C CD1 . PHE C 1 183 ? 28.782  -11.578 20.829  1.00   25.74  ? 935  PHE C CD1 1 
ATOM   4111 C CD2 . PHE C 1 183 ? 30.238  -9.962  19.825  1.00   47.86  ? 935  PHE C CD2 1 
ATOM   4112 C CE1 . PHE C 1 183 ? 28.686  -10.863 21.940  1.00   30.36  ? 935  PHE C CE1 1 
ATOM   4113 C CE2 . PHE C 1 183 ? 30.100  -9.150  20.951  1.00   36.51  ? 935  PHE C CE2 1 
ATOM   4114 C CZ  . PHE C 1 183 ? 29.326  -9.569  22.005  1.00   30.16  ? 935  PHE C CZ  1 
ATOM   4115 N N   . VAL C 1 184 ? 30.181  -15.410 17.976  1.00   37.96  ? 936  VAL C N   1 
ATOM   4116 C CA  . VAL C 1 184 ? 30.380  -16.509 16.990  1.00   29.27  ? 936  VAL C CA  1 
ATOM   4117 C C   . VAL C 1 184 ? 29.031  -17.105 16.550  1.00   36.05  ? 936  VAL C C   1 
ATOM   4118 O O   . VAL C 1 184 ? 28.088  -17.144 17.375  1.00   32.02  ? 936  VAL C O   1 
ATOM   4119 C CB  . VAL C 1 184 ? 31.228  -17.625 17.647  1.00   38.70  ? 936  VAL C CB  1 
ATOM   4120 C CG1 . VAL C 1 184 ? 32.553  -17.045 18.124  1.00   36.54  ? 936  VAL C CG1 1 
ATOM   4121 C CG2 . VAL C 1 184 ? 30.585  -18.210 18.918  1.00   25.80  ? 936  VAL C CG2 1 
ATOM   4122 N N   . GLU C 1 185 ? 28.985  -17.544 15.302  1.00   33.66  ? 937  GLU C N   1 
ATOM   4123 C CA  . GLU C 1 185 ? 27.809  -18.273 14.719  1.00   33.92  ? 937  GLU C CA  1 
ATOM   4124 C C   . GLU C 1 185 ? 28.015  -19.806 14.571  1.00   29.49  ? 937  GLU C C   1 
ATOM   4125 O O   . GLU C 1 185 ? 27.033  -20.545 14.608  1.00   29.30  ? 937  GLU C O   1 
ATOM   4126 C CB  . GLU C 1 185 ? 27.396  -17.606 13.426  1.00   36.17  ? 937  GLU C CB  1 
ATOM   4127 C CG  . GLU C 1 185 ? 27.033  -16.063 13.598  1.00   36.34  ? 937  GLU C CG  1 
ATOM   4128 C CD  . GLU C 1 185 ? 25.963  -15.555 12.587  1.00   61.66  ? 937  GLU C CD  1 
ATOM   4129 O OE1 . GLU C 1 185 ? 24.808  -15.039 12.953  1.00   45.94  ? 937  GLU C OE1 1 
ATOM   4130 O OE2 . GLU C 1 185 ? 26.298  -15.724 11.391  1.00   56.26  ? 937  GLU C OE2 1 
ATOM   4131 N N   A HIS C 1 186 ? 29.249  -20.277 14.403  0.50   35.92  ? 938  HIS C N   1 
ATOM   4132 N N   B HIS C 1 186 ? 29.268  -20.255 14.489  0.50   33.72  ? 938  HIS C N   1 
ATOM   4133 C CA  A HIS C 1 186 ? 29.484  -21.744 14.214  0.50   35.55  ? 938  HIS C CA  1 
ATOM   4134 C CA  B HIS C 1 186 ? 29.562  -21.689 14.197  0.50   31.82  ? 938  HIS C CA  1 
ATOM   4135 C C   A HIS C 1 186 ? 30.628  -22.233 15.092  0.50   38.44  ? 938  HIS C C   1 
ATOM   4136 C C   B HIS C 1 186 ? 30.688  -22.232 15.053  0.50   37.03  ? 938  HIS C C   1 
ATOM   4137 O O   A HIS C 1 186 ? 31.526  -21.447 15.484  0.50   32.90  ? 938  HIS C O   1 
ATOM   4138 O O   B HIS C 1 186 ? 31.633  -21.472 15.399  0.50   30.90  ? 938  HIS C O   1 
ATOM   4139 C CB  A HIS C 1 186 ? 29.791  -22.111 12.738  0.50   36.96  ? 938  HIS C CB  1 
ATOM   4140 C CB  B HIS C 1 186 ? 29.884  -21.879 12.701  0.50   31.39  ? 938  HIS C CB  1 
ATOM   4141 C CG  A HIS C 1 186 ? 29.790  -23.607 12.454  0.50   45.37  ? 938  HIS C CG  1 
ATOM   4142 C CG  B HIS C 1 186 ? 28.669  -21.762 11.860  0.50   28.88  ? 938  HIS C CG  1 
ATOM   4143 N ND1 A HIS C 1 186 ? 30.883  -24.429 12.713  0.50   29.34  ? 938  HIS C ND1 1 
ATOM   4144 N ND1 B HIS C 1 186 ? 28.425  -20.671 11.067  0.50   26.27  ? 938  HIS C ND1 1 
ATOM   4145 C CD2 A HIS C 1 186 ? 28.836  -24.413 11.910  0.50   21.77  ? 938  HIS C CD2 1 
ATOM   4146 C CD2 B HIS C 1 186 ? 27.517  -22.468 11.887  0.50   21.04  ? 938  HIS C CD2 1 
ATOM   4147 C CE1 A HIS C 1 186 ? 30.583  -25.671 12.408  0.50   35.06  ? 938  HIS C CE1 1 
ATOM   4148 C CE1 B HIS C 1 186 ? 27.199  -20.733 10.588  0.50   28.62  ? 938  HIS C CE1 1 
ATOM   4149 N NE2 A HIS C 1 186 ? 29.372  -25.679 11.857  0.50   46.01  ? 938  HIS C NE2 1 
ATOM   4150 N NE2 B HIS C 1 186 ? 26.622  -21.816 11.069  0.50   31.26  ? 938  HIS C NE2 1 
ATOM   4151 N N   . TYR C 1 187 ? 30.642  -23.510 15.393  1.00   32.56  ? 939  TYR C N   1 
ATOM   4152 C CA  . TYR C 1 187 ? 31.665  -23.983 16.268  1.00   33.13  ? 939  TYR C CA  1 
ATOM   4153 C C   . TYR C 1 187 ? 33.024  -23.676 15.737  1.00   24.78  ? 939  TYR C C   1 
ATOM   4154 O O   . TYR C 1 187 ? 33.856  -23.430 16.478  1.00   29.85  ? 939  TYR C O   1 
ATOM   4155 C CB  . TYR C 1 187 ? 31.602  -25.440 16.641  1.00   31.24  ? 939  TYR C CB  1 
ATOM   4156 C CG  . TYR C 1 187 ? 32.720  -25.743 17.552  1.00   32.88  ? 939  TYR C CG  1 
ATOM   4157 C CD1 . TYR C 1 187 ? 32.700  -25.347 18.845  1.00   34.29  ? 939  TYR C CD1 1 
ATOM   4158 C CD2 . TYR C 1 187 ? 33.833  -26.365 17.103  1.00   35.64  ? 939  TYR C CD2 1 
ATOM   4159 C CE1 . TYR C 1 187 ? 33.721  -25.574 19.657  1.00   38.28  ? 939  TYR C CE1 1 
ATOM   4160 C CE2 . TYR C 1 187 ? 34.850  -26.622 17.924  1.00   37.42  ? 939  TYR C CE2 1 
ATOM   4161 C CZ  . TYR C 1 187 ? 34.795  -26.223 19.207  1.00   26.85  ? 939  TYR C CZ  1 
ATOM   4162 O OH  . TYR C 1 187 ? 35.812  -26.440 20.035  1.00   35.71  ? 939  TYR C OH  1 
ATOM   4163 N N   . ARG C 1 188 ? 33.235  -23.703 14.453  1.00   28.01  ? 940  ARG C N   1 
ATOM   4164 C CA  . ARG C 1 188 ? 34.534  -23.553 13.880  1.00   26.30  ? 940  ARG C CA  1 
ATOM   4165 C C   . ARG C 1 188 ? 35.204  -22.271 14.294  1.00   37.40  ? 940  ARG C C   1 
ATOM   4166 O O   . ARG C 1 188 ? 36.360  -22.218 14.429  1.00   23.71  ? 940  ARG C O   1 
ATOM   4167 C CB  . ARG C 1 188 ? 34.438  -23.607 12.379  1.00   28.17  ? 940  ARG C CB  1 
ATOM   4168 C CG  . ARG C 1 188 ? 35.731  -23.446 11.662  1.00   34.17  ? 940  ARG C CG  1 
ATOM   4169 C CD  . ARG C 1 188 ? 36.577  -24.626 11.726  1.00   29.38  ? 940  ARG C CD  1 
ATOM   4170 N NE  . ARG C 1 188 ? 37.970  -24.286 11.790  1.00   45.43  ? 940  ARG C NE  1 
ATOM   4171 C CZ  . ARG C 1 188 ? 38.937  -25.138 11.537  1.00   37.44  ? 940  ARG C CZ  1 
ATOM   4172 N NH1 . ARG C 1 188 ? 38.667  -26.349 11.161  1.00   51.37  ? 940  ARG C NH1 1 
ATOM   4173 N NH2 . ARG C 1 188 ? 40.161  -24.790 11.629  1.00   32.28  ? 940  ARG C NH2 1 
ATOM   4174 N N   . GLU C 1 189 ? 34.414  -21.221 14.491  1.00   30.48  ? 941  GLU C N   1 
ATOM   4175 C CA  . GLU C 1 189 ? 34.955  -19.943 14.946  1.00   34.58  ? 941  GLU C CA  1 
ATOM   4176 C C   . GLU C 1 189 ? 35.548  -20.067 16.348  1.00   37.24  ? 941  GLU C C   1 
ATOM   4177 O O   . GLU C 1 189 ? 36.562  -19.446 16.667  1.00   31.62  ? 941  GLU C O   1 
ATOM   4178 C CB  . GLU C 1 189 ? 33.870  -18.864 14.928  1.00   24.49  ? 941  GLU C CB  1 
ATOM   4179 C CG  . GLU C 1 189 ? 33.260  -18.621 13.557  1.00   31.51  ? 941  GLU C CG  1 
ATOM   4180 C CD  . GLU C 1 189 ? 32.187  -17.551 13.579  1.00   32.49  ? 941  GLU C CD  1 
ATOM   4181 O OE1 . GLU C 1 189 ? 31.600  -17.273 12.511  1.00   38.62  ? 941  GLU C OE1 1 
ATOM   4182 O OE2 . GLU C 1 189 ? 31.929  -16.986 14.663  1.00   53.87  ? 941  GLU C OE2 1 
ATOM   4183 N N   . ILE C 1 190 ? 34.900  -20.879 17.175  1.00   33.50  ? 942  ILE C N   1 
ATOM   4184 C CA  . ILE C 1 190 ? 35.346  -21.149 18.531  1.00   33.08  ? 942  ILE C CA  1 
ATOM   4185 C C   . ILE C 1 190 ? 36.554  -22.049 18.413  1.00   35.22  ? 942  ILE C C   1 
ATOM   4186 O O   . ILE C 1 190 ? 37.537  -21.823 19.090  1.00   35.28  ? 942  ILE C O   1 
ATOM   4187 C CB  . ILE C 1 190 ? 34.274  -21.762 19.412  1.00   32.04  ? 942  ILE C CB  1 
ATOM   4188 C CG1 . ILE C 1 190 ? 33.058  -20.806 19.486  1.00   35.38  ? 942  ILE C CG1 1 
ATOM   4189 C CG2 . ILE C 1 190 ? 34.887  -22.126 20.742  1.00   32.73  ? 942  ILE C CG2 1 
ATOM   4190 C CD1 . ILE C 1 190 ? 31.954  -21.140 20.430  1.00   29.68  ? 942  ILE C CD1 1 
ATOM   4191 N N   . PHE C 1 191 ? 36.510  -23.060 17.572  1.00   33.55  ? 943  PHE C N   1 
ATOM   4192 C CA  . PHE C 1 191 ? 37.769  -23.843 17.350  1.00   30.81  ? 943  PHE C CA  1 
ATOM   4193 C C   . PHE C 1 191 ? 39.051  -22.955 17.030  1.00   40.31  ? 943  PHE C C   1 
ATOM   4194 O O   . PHE C 1 191 ? 40.153  -23.159 17.592  1.00   36.49  ? 943  PHE C O   1 
ATOM   4195 C CB  . PHE C 1 191 ? 37.570  -24.863 16.301  1.00   40.28  ? 943  PHE C CB  1 
ATOM   4196 C CG  . PHE C 1 191 ? 38.764  -25.771 16.108  1.00   40.88  ? 943  PHE C CG  1 
ATOM   4197 C CD1 . PHE C 1 191 ? 39.728  -25.451 15.186  1.00   35.65  ? 943  PHE C CD1 1 
ATOM   4198 C CD2 . PHE C 1 191 ? 38.851  -26.986 16.799  1.00   32.78  ? 943  PHE C CD2 1 
ATOM   4199 C CE1 . PHE C 1 191 ? 40.864  -26.285 15.000  1.00   39.21  ? 943  PHE C CE1 1 
ATOM   4200 C CE2 . PHE C 1 191 ? 39.952  -27.813 16.624  1.00   34.10  ? 943  PHE C CE2 1 
ATOM   4201 C CZ  . PHE C 1 191 ? 40.945  -27.477 15.726  1.00   45.92  ? 943  PHE C CZ  1 
ATOM   4202 N N   . ASP C 1 192 ? 38.896  -21.986 16.146  1.00   37.68  ? 944  ASP C N   1 
ATOM   4203 C CA  . ASP C 1 192 ? 40.058  -21.178 15.730  1.00   43.48  ? 944  ASP C CA  1 
ATOM   4204 C C   . ASP C 1 192 ? 40.603  -20.243 16.816  1.00   39.67  ? 944  ASP C C   1 
ATOM   4205 O O   . ASP C 1 192 ? 41.809  -19.963 16.833  1.00   50.68  ? 944  ASP C O   1 
ATOM   4206 C CB  . ASP C 1 192 ? 39.754  -20.434 14.421  1.00   43.81  ? 944  ASP C CB  1 
ATOM   4207 C CG  . ASP C 1 192 ? 39.776  -21.328 13.217  1.00   47.86  ? 944  ASP C CG  1 
ATOM   4208 O OD1 . ASP C 1 192 ? 40.561  -22.307 13.125  1.00   43.70  ? 944  ASP C OD1 1 
ATOM   4209 O OD2 . ASP C 1 192 ? 38.990  -21.034 12.298  1.00   30.99  ? 944  ASP C OD2 1 
ATOM   4210 N N   . ILE C 1 193 ? 39.747  -19.709 17.671  1.00   39.41  ? 945  ILE C N   1 
ATOM   4211 C CA  . ILE C 1 193 ? 40.169  -18.968 18.865  1.00   42.87  ? 945  ILE C CA  1 
ATOM   4212 C C   . ILE C 1 193 ? 40.757  -19.874 19.907  1.00   40.26  ? 945  ILE C C   1 
ATOM   4213 O O   . ILE C 1 193 ? 41.693  -19.470 20.574  1.00   40.00  ? 945  ILE C O   1 
ATOM   4214 C CB  . ILE C 1 193 ? 38.968  -18.159 19.500  1.00   39.87  ? 945  ILE C CB  1 
ATOM   4215 C CG1 . ILE C 1 193 ? 38.363  -17.209 18.511  1.00   39.63  ? 945  ILE C CG1 1 
ATOM   4216 C CG2 . ILE C 1 193 ? 39.346  -17.509 20.800  1.00   47.20  ? 945  ILE C CG2 1 
ATOM   4217 C CD1 . ILE C 1 193 ? 36.846  -16.815 18.784  1.00   30.16  ? 945  ILE C CD1 1 
ATOM   4218 N N   . ALA C 1 194 ? 40.171  -21.076 20.160  1.00   40.42  ? 946  ALA C N   1 
ATOM   4219 C CA  . ALA C 1 194 ? 40.656  -21.899 21.236  1.00   38.90  ? 946  ALA C CA  1 
ATOM   4220 C C   . ALA C 1 194 ? 42.021  -22.436 20.947  1.00   39.45  ? 946  ALA C C   1 
ATOM   4221 O O   . ALA C 1 194 ? 42.845  -22.474 21.865  1.00   42.24  ? 946  ALA C O   1 
ATOM   4222 C CB  . ALA C 1 194 ? 39.662  -23.080 21.641  1.00   40.99  ? 946  ALA C CB  1 
ATOM   4223 N N   . PHE C 1 195 ? 42.266  -22.718 19.665  1.00   44.81  ? 947  PHE C N   1 
ATOM   4224 C CA  . PHE C 1 195 ? 43.412  -23.473 19.161  1.00   42.19  ? 947  PHE C CA  1 
ATOM   4225 C C   . PHE C 1 195 ? 44.082  -22.732 17.981  1.00   42.66  ? 947  PHE C C   1 
ATOM   4226 O O   . PHE C 1 195 ? 44.130  -23.241 16.864  1.00   47.21  ? 947  PHE C O   1 
ATOM   4227 C CB  . PHE C 1 195 ? 42.892  -24.844 18.693  1.00   44.12  ? 947  PHE C CB  1 
ATOM   4228 C CG  . PHE C 1 195 ? 42.146  -25.617 19.758  1.00   37.29  ? 947  PHE C CG  1 
ATOM   4229 C CD1 . PHE C 1 195 ? 42.813  -26.130 20.872  1.00   43.60  ? 947  PHE C CD1 1 
ATOM   4230 C CD2 . PHE C 1 195 ? 40.839  -25.935 19.578  1.00   32.36  ? 947  PHE C CD2 1 
ATOM   4231 C CE1 . PHE C 1 195 ? 42.131  -26.893 21.839  1.00   45.62  ? 947  PHE C CE1 1 
ATOM   4232 C CE2 . PHE C 1 195 ? 40.153  -26.718 20.506  1.00   39.76  ? 947  PHE C CE2 1 
ATOM   4233 C CZ  . PHE C 1 195 ? 40.806  -27.223 21.645  1.00   42.31  ? 947  PHE C CZ  1 
ATOM   4234 N N   . PRO C 1 196 ? 44.625  -21.512 18.228  1.00   43.50  ? 948  PRO C N   1 
ATOM   4235 C CA  . PRO C 1 196 ? 45.096  -20.663 17.143  1.00   49.75  ? 948  PRO C CA  1 
ATOM   4236 C C   . PRO C 1 196 ? 46.046  -21.381 16.203  1.00   50.39  ? 948  PRO C C   1 
ATOM   4237 O O   . PRO C 1 196 ? 45.978  -21.205 14.997  1.00   47.31  ? 948  PRO C O   1 
ATOM   4238 C CB  . PRO C 1 196 ? 45.801  -19.481 17.851  1.00   49.62  ? 948  PRO C CB  1 
ATOM   4239 C CG  . PRO C 1 196 ? 45.345  -19.493 19.221  1.00   51.57  ? 948  PRO C CG  1 
ATOM   4240 C CD  . PRO C 1 196 ? 44.843  -20.921 19.547  1.00   46.09  ? 948  PRO C CD  1 
ATOM   4241 N N   . ASP C 1 197 ? 46.896  -22.234 16.742  1.00   59.95  ? 949  ASP C N   1 
ATOM   4242 C CA  . ASP C 1 197 ? 47.964  -22.832 15.928  1.00   62.09  ? 949  ASP C CA  1 
ATOM   4243 C C   . ASP C 1 197 ? 47.503  -24.004 15.111  1.00   66.57  ? 949  ASP C C   1 
ATOM   4244 O O   . ASP C 1 197 ? 48.221  -24.527 14.251  1.00   71.74  ? 949  ASP C O   1 
ATOM   4245 C CB  . ASP C 1 197 ? 49.149  -23.174 16.837  1.00   65.99  ? 949  ASP C CB  1 
ATOM   4246 C CG  . ASP C 1 197 ? 49.502  -22.015 17.758  1.00   49.70  ? 949  ASP C CG  1 
ATOM   4247 O OD1 . ASP C 1 197 ? 49.659  -20.876 17.241  1.00   63.51  ? 949  ASP C OD1 1 
ATOM   4248 O OD2 . ASP C 1 197 ? 49.565  -22.227 18.996  1.00   54.66  ? 949  ASP C OD2 1 
ATOM   4249 N N   . GLU C 1 198 ? 46.268  -24.397 15.328  1.00   66.77  ? 950  GLU C N   1 
ATOM   4250 C CA  . GLU C 1 198 ? 45.715  -25.451 14.538  1.00   60.84  ? 950  GLU C CA  1 
ATOM   4251 C C   . GLU C 1 198 ? 45.423  -24.941 13.137  1.00   56.98  ? 950  GLU C C   1 
ATOM   4252 O O   . GLU C 1 198 ? 45.223  -23.755 12.904  1.00   58.95  ? 950  GLU C O   1 
ATOM   4253 C CB  . GLU C 1 198 ? 44.451  -25.982 15.175  1.00   56.79  ? 950  GLU C CB  1 
ATOM   4254 C CG  . GLU C 1 198 ? 44.680  -26.941 16.293  1.00   60.29  ? 950  GLU C CG  1 
ATOM   4255 C CD  . GLU C 1 198 ? 45.262  -28.252 15.858  1.00   49.03  ? 950  GLU C CD  1 
ATOM   4256 O OE1 . GLU C 1 198 ? 45.008  -28.709 14.691  1.00   55.70  ? 950  GLU C OE1 1 
ATOM   4257 O OE2 . GLU C 1 198 ? 46.020  -28.782 16.681  1.00   59.96  ? 950  GLU C OE2 1 
ATOM   4258 N N   . GLN C 1 199 ? 45.370  -25.892 12.230  1.00   50.49  ? 951  GLN C N   1 
ATOM   4259 C CA  . GLN C 1 199 ? 45.320  -25.619 10.823  1.00   55.53  ? 951  GLN C CA  1 
ATOM   4260 C C   . GLN C 1 199 ? 43.985  -24.973 10.458  1.00   55.74  ? 951  GLN C C   1 
ATOM   4261 O O   . GLN C 1 199 ? 42.973  -25.250 11.097  1.00   57.60  ? 951  GLN C O   1 
ATOM   4262 C CB  . GLN C 1 199 ? 45.491  -26.946 10.125  1.00   54.94  ? 951  GLN C CB  1 
ATOM   4263 C CG  . GLN C 1 199 ? 46.226  -26.932 8.858   1.00   66.09  ? 951  GLN C CG  1 
ATOM   4264 C CD  . GLN C 1 199 ? 46.669  -28.313 8.539   1.00   67.03  ? 951  GLN C CD  1 
ATOM   4265 O OE1 . GLN C 1 199 ? 45.940  -29.066 7.880   1.00   55.71  ? 951  GLN C OE1 1 
ATOM   4266 N NE2 . GLN C 1 199 ? 47.847  -28.700 9.070   1.00   60.88  ? 951  GLN C NE2 1 
ATOM   4267 N N   . ALA C 1 200 ? 43.979  -24.133 9.421   1.00   59.40  ? 952  ALA C N   1 
ATOM   4268 C CA  . ALA C 1 200 ? 42.816  -23.339 9.032   1.00   55.08  ? 952  ALA C CA  1 
ATOM   4269 C C   . ALA C 1 200 ? 41.729  -24.123 8.355   1.00   62.46  ? 952  ALA C C   1 
ATOM   4270 O O   . ALA C 1 200 ? 41.979  -25.175 7.822   1.00   56.22  ? 952  ALA C O   1 
ATOM   4271 C CB  . ALA C 1 200 ? 43.236  -22.192 8.094   1.00   56.40  ? 952  ALA C CB  1 
ATOM   4272 N N   . GLU C 1 201 ? 40.529  -23.538 8.361   1.00   65.41  ? 953  GLU C N   1 
ATOM   4273 C CA  . GLU C 1 201 ? 39.448  -23.803 7.403   1.00   69.10  ? 953  GLU C CA  1 
ATOM   4274 C C   . GLU C 1 201 ? 38.370  -24.528 8.140   1.00   60.99  ? 953  GLU C C   1 
ATOM   4275 O O   . GLU C 1 201 ? 37.414  -24.974 7.538   1.00   63.65  ? 953  GLU C O   1 
ATOM   4276 C CB  . GLU C 1 201 ? 39.903  -24.575 6.114   1.00   71.79  ? 953  GLU C CB  1 
ATOM   4277 C CG  . GLU C 1 201 ? 38.896  -24.565 4.958   1.00   73.67  ? 953  GLU C CG  1 
ATOM   4278 C CD  . GLU C 1 201 ? 38.798  -25.913 4.241   1.00   81.75  ? 953  GLU C CD  1 
ATOM   4279 O OE1 . GLU C 1 201 ? 37.654  -26.388 4.044   1.00   66.86  ? 953  GLU C OE1 1 
ATOM   4280 O OE2 . GLU C 1 201 ? 39.861  -26.505 3.894   1.00   77.16  ? 953  GLU C OE2 1 
ATOM   4281 N N   . THR D 1 8   ? 47.987  -52.741 57.624  1.00   64.19  ? 760  THR D N   1 
ATOM   4282 C CA  . THR D 1 8   ? 47.953  -51.853 56.405  1.00   64.03  ? 760  THR D CA  1 
ATOM   4283 C C   . THR D 1 8   ? 48.208  -52.641 55.117  1.00   57.68  ? 760  THR D C   1 
ATOM   4284 O O   . THR D 1 8   ? 49.270  -52.505 54.556  1.00   50.88  ? 760  THR D O   1 
ATOM   4285 C CB  . THR D 1 8   ? 49.063  -50.697 56.495  1.00   68.67  ? 760  THR D CB  1 
ATOM   4286 O OG1 . THR D 1 8   ? 49.306  -50.318 57.857  1.00   59.42  ? 760  THR D OG1 1 
ATOM   4287 C CG2 . THR D 1 8   ? 48.623  -49.462 55.667  1.00   65.77  ? 760  THR D CG2 1 
ATOM   4288 N N   . PRO D 1 9   ? 47.257  -53.493 54.666  1.00   57.15  ? 761  PRO D N   1 
ATOM   4289 C CA  . PRO D 1 9   ? 47.458  -54.336 53.469  1.00   63.10  ? 761  PRO D CA  1 
ATOM   4290 C C   . PRO D 1 9   ? 47.059  -53.604 52.160  1.00   60.27  ? 761  PRO D C   1 
ATOM   4291 O O   . PRO D 1 9   ? 46.554  -52.509 52.236  1.00   61.06  ? 761  PRO D O   1 
ATOM   4292 C CB  . PRO D 1 9   ? 46.483  -55.506 53.716  1.00   67.54  ? 761  PRO D CB  1 
ATOM   4293 C CG  . PRO D 1 9   ? 45.289  -54.832 54.383  1.00   58.78  ? 761  PRO D CG  1 
ATOM   4294 C CD  . PRO D 1 9   ? 45.886  -53.643 55.196  1.00   61.43  ? 761  PRO D CD  1 
ATOM   4295 N N   . PRO D 1 10  ? 47.249  -54.225 50.982  1.00   57.93  ? 762  PRO D N   1 
ATOM   4296 C CA  . PRO D 1 10  ? 46.815  -53.645 49.690  1.00   55.07  ? 762  PRO D CA  1 
ATOM   4297 C C   . PRO D 1 10  ? 45.304  -53.440 49.563  1.00   56.10  ? 762  PRO D C   1 
ATOM   4298 O O   . PRO D 1 10  ? 44.497  -54.314 50.008  1.00   50.66  ? 762  PRO D O   1 
ATOM   4299 C CB  . PRO D 1 10  ? 47.253  -54.700 48.673  1.00   53.99  ? 762  PRO D CB  1 
ATOM   4300 C CG  . PRO D 1 10  ? 48.421  -55.378 49.366  1.00   63.22  ? 762  PRO D CG  1 
ATOM   4301 C CD  . PRO D 1 10  ? 47.949  -55.507 50.775  1.00   55.04  ? 762  PRO D CD  1 
ATOM   4302 N N   . GLY D 1 11  ? 44.931  -52.300 48.954  1.00   53.29  ? 763  GLY D N   1 
ATOM   4303 C CA  . GLY D 1 11  ? 43.519  -51.803 48.903  1.00   49.04  ? 763  GLY D CA  1 
ATOM   4304 C C   . GLY D 1 11  ? 42.953  -51.063 50.135  1.00   51.65  ? 763  GLY D C   1 
ATOM   4305 O O   . GLY D 1 11  ? 41.754  -50.815 50.195  1.00   55.19  ? 763  GLY D O   1 
ATOM   4306 N N   . VAL D 1 12  ? 43.804  -50.696 51.085  1.00   49.71  ? 764  VAL D N   1 
ATOM   4307 C CA  . VAL D 1 12  ? 43.365  -50.214 52.411  1.00   48.57  ? 764  VAL D CA  1 
ATOM   4308 C C   . VAL D 1 12  ? 44.150  -48.919 52.755  1.00   45.30  ? 764  VAL D C   1 
ATOM   4309 O O   . VAL D 1 12  ? 45.401  -48.886 52.792  1.00   34.18  ? 764  VAL D O   1 
ATOM   4310 C CB  . VAL D 1 12  ? 43.573  -51.332 53.521  1.00   53.04  ? 764  VAL D CB  1 
ATOM   4311 C CG1 . VAL D 1 12  ? 43.215  -50.836 54.935  1.00   53.23  ? 764  VAL D CG1 1 
ATOM   4312 C CG2 . VAL D 1 12  ? 42.776  -52.677 53.162  1.00   51.92  ? 764  VAL D CG2 1 
ATOM   4313 N N   . VAL D 1 13  ? 43.395  -47.851 52.991  1.00   43.48  ? 765  VAL D N   1 
ATOM   4314 C CA  . VAL D 1 13  ? 43.947  -46.554 53.244  1.00   46.23  ? 765  VAL D CA  1 
ATOM   4315 C C   . VAL D 1 13  ? 43.068  -45.788 54.213  1.00   50.45  ? 765  VAL D C   1 
ATOM   4316 O O   . VAL D 1 13  ? 41.799  -45.903 54.216  1.00   49.71  ? 765  VAL D O   1 
ATOM   4317 C CB  . VAL D 1 13  ? 44.117  -45.720 51.910  1.00   48.06  ? 765  VAL D CB  1 
ATOM   4318 C CG1 . VAL D 1 13  ? 44.438  -44.256 52.228  1.00   45.66  ? 765  VAL D CG1 1 
ATOM   4319 C CG2 . VAL D 1 13  ? 45.214  -46.267 51.037  1.00   46.22  ? 765  VAL D CG2 1 
ATOM   4320 N N   . MET D 1 14  ? 43.739  -44.946 54.998  1.00   50.29  ? 766  MET D N   1 
ATOM   4321 C CA  . MET D 1 14  ? 43.069  -44.255 56.056  1.00   52.94  ? 766  MET D CA  1 
ATOM   4322 C C   . MET D 1 14  ? 42.602  -42.848 55.704  1.00   53.91  ? 766  MET D C   1 
ATOM   4323 O O   . MET D 1 14  ? 43.410  -41.889 55.495  1.00   49.29  ? 766  MET D O   1 
ATOM   4324 C CB  . MET D 1 14  ? 43.933  -44.179 57.316  1.00   48.95  ? 766  MET D CB  1 
ATOM   4325 C CG  . MET D 1 14  ? 43.160  -43.705 58.531  1.00   51.98  ? 766  MET D CG  1 
ATOM   4326 S SD  . MET D 1 14  ? 44.058  -43.341 60.095  1.00   57.33  ? 766  MET D SD  1 
ATOM   4327 C CE  . MET D 1 14  ? 45.398  -42.156 59.738  1.00   56.17  ? 766  MET D CE  1 
ATOM   4328 N N   . GLY D 1 15  ? 41.284  -42.720 55.778  1.00   51.88  ? 767  GLY D N   1 
ATOM   4329 C CA  . GLY D 1 15  ? 40.627  -41.472 55.559  1.00   51.11  ? 767  GLY D CA  1 
ATOM   4330 C C   . GLY D 1 15  ? 40.018  -40.888 56.783  1.00   50.91  ? 767  GLY D C   1 
ATOM   4331 O O   . GLY D 1 15  ? 39.614  -41.604 57.716  1.00   61.83  ? 767  GLY D O   1 
ATOM   4332 N N   . LEU D 1 16  ? 39.892  -39.575 56.732  1.00   49.35  ? 768  LEU D N   1 
ATOM   4333 C CA  . LEU D 1 16  ? 39.459  -38.746 57.838  1.00   47.04  ? 768  LEU D CA  1 
ATOM   4334 C C   . LEU D 1 16  ? 38.077  -38.301 57.495  1.00   49.13  ? 768  LEU D C   1 
ATOM   4335 O O   . LEU D 1 16  ? 37.843  -37.950 56.331  1.00   56.48  ? 768  LEU D O   1 
ATOM   4336 C CB  . LEU D 1 16  ? 40.409  -37.532 57.959  1.00   48.20  ? 768  LEU D CB  1 
ATOM   4337 C CG  . LEU D 1 16  ? 41.575  -37.506 58.957  1.00   49.67  ? 768  LEU D CG  1 
ATOM   4338 C CD1 . LEU D 1 16  ? 42.040  -38.983 59.455  1.00   40.77  ? 768  LEU D CD1 1 
ATOM   4339 C CD2 . LEU D 1 16  ? 42.826  -36.639 58.549  1.00   46.72  ? 768  LEU D CD2 1 
ATOM   4340 N N   . ALA D 1 17  ? 37.149  -38.329 58.450  1.00   49.33  ? 769  ALA D N   1 
ATOM   4341 C CA  . ALA D 1 17  ? 35.736  -37.978 58.161  1.00   51.76  ? 769  ALA D CA  1 
ATOM   4342 C C   . ALA D 1 17  ? 35.163  -36.959 59.108  1.00   51.63  ? 769  ALA D C   1 
ATOM   4343 O O   . ALA D 1 17  ? 35.519  -36.862 60.264  1.00   51.45  ? 769  ALA D O   1 
ATOM   4344 C CB  . ALA D 1 17  ? 34.840  -39.217 58.187  1.00   49.33  ? 769  ALA D CB  1 
ATOM   4345 N N   . TRP D 1 18  ? 34.159  -36.276 58.608  1.00   52.21  ? 770  TRP D N   1 
ATOM   4346 C CA  . TRP D 1 18  ? 33.502  -35.267 59.353  1.00   46.87  ? 770  TRP D CA  1 
ATOM   4347 C C   . TRP D 1 18  ? 32.136  -35.886 59.573  1.00   50.39  ? 770  TRP D C   1 
ATOM   4348 O O   . TRP D 1 18  ? 31.478  -36.197 58.615  1.00   50.92  ? 770  TRP D O   1 
ATOM   4349 C CB  . TRP D 1 18  ? 33.543  -33.984 58.529  1.00   48.18  ? 770  TRP D CB  1 
ATOM   4350 C CG  . TRP D 1 18  ? 32.926  -32.783 59.120  1.00   52.99  ? 770  TRP D CG  1 
ATOM   4351 C CD1 . TRP D 1 18  ? 32.526  -32.588 60.400  1.00   57.92  ? 770  TRP D CD1 1 
ATOM   4352 C CD2 . TRP D 1 18  ? 32.614  -31.591 58.412  1.00   55.00  ? 770  TRP D CD2 1 
ATOM   4353 N NE1 . TRP D 1 18  ? 31.988  -31.328 60.533  1.00   60.58  ? 770  TRP D NE1 1 
ATOM   4354 C CE2 . TRP D 1 18  ? 32.031  -30.710 59.312  1.00   49.29  ? 770  TRP D CE2 1 
ATOM   4355 C CE3 . TRP D 1 18  ? 32.742  -31.193 57.067  1.00   56.49  ? 770  TRP D CE3 1 
ATOM   4356 C CZ2 . TRP D 1 18  ? 31.602  -29.456 58.937  1.00   49.50  ? 770  TRP D CZ2 1 
ATOM   4357 C CZ3 . TRP D 1 18  ? 32.324  -29.928 56.718  1.00   57.51  ? 770  TRP D CZ3 1 
ATOM   4358 C CH2 . TRP D 1 18  ? 31.761  -29.085 57.664  1.00   48.74  ? 770  TRP D CH2 1 
ATOM   4359 N N   . THR D 1 19  ? 31.760  -36.091 60.838  1.00   42.46  ? 771  THR D N   1 
ATOM   4360 C CA  . THR D 1 19  ? 30.520  -36.744 61.214  1.00   54.20  ? 771  THR D CA  1 
ATOM   4361 C C   . THR D 1 19  ? 29.558  -35.698 61.734  1.00   58.29  ? 771  THR D C   1 
ATOM   4362 O O   . THR D 1 19  ? 29.856  -34.476 61.781  1.00   51.39  ? 771  THR D O   1 
ATOM   4363 C CB  . THR D 1 19  ? 30.763  -37.879 62.217  1.00   56.80  ? 771  THR D CB  1 
ATOM   4364 O OG1 . THR D 1 19  ? 31.140  -37.348 63.499  1.00   67.21  ? 771  THR D OG1 1 
ATOM   4365 C CG2 . THR D 1 19  ? 31.862  -38.764 61.684  1.00   52.80  ? 771  THR D CG2 1 
ATOM   4366 N N   . ALA D 1 20  ? 28.363  -36.166 62.010  1.00   61.57  ? 772  ALA D N   1 
ATOM   4367 C CA  . ALA D 1 20  ? 27.331  -35.323 62.578  1.00   65.64  ? 772  ALA D CA  1 
ATOM   4368 C C   . ALA D 1 20  ? 27.802  -34.571 63.826  1.00   67.05  ? 772  ALA D C   1 
ATOM   4369 O O   . ALA D 1 20  ? 27.535  -33.364 63.995  1.00   71.07  ? 772  ALA D O   1 
ATOM   4370 C CB  . ALA D 1 20  ? 26.106  -36.174 62.902  1.00   62.38  ? 772  ALA D CB  1 
ATOM   4371 N N   . MET D 1 21  ? 28.507  -35.277 64.694  1.00   67.44  ? 773  MET D N   1 
ATOM   4372 C CA  . MET D 1 21  ? 28.856  -34.734 66.007  1.00   70.34  ? 773  MET D CA  1 
ATOM   4373 C C   . MET D 1 21  ? 30.337  -34.423 66.209  1.00   70.23  ? 773  MET D C   1 
ATOM   4374 O O   . MET D 1 21  ? 30.697  -33.848 67.242  1.00   67.67  ? 773  MET D O   1 
ATOM   4375 C CB  . MET D 1 21  ? 28.399  -35.700 67.081  1.00   70.94  ? 773  MET D CB  1 
ATOM   4376 C CG  . MET D 1 21  ? 28.890  -37.143 66.895  1.00   82.13  ? 773  MET D CG  1 
ATOM   4377 S SD  . MET D 1 21  ? 27.645  -38.266 67.574  1.00   94.28  ? 773  MET D SD  1 
ATOM   4378 C CE  . MET D 1 21  ? 26.268  -37.993 66.442  1.00   86.87  ? 773  MET D CE  1 
ATOM   4379 N N   . GLY D 1 22  ? 31.184  -34.792 65.245  1.00   67.42  ? 774  GLY D N   1 
ATOM   4380 C CA  . GLY D 1 22  ? 32.614  -34.543 65.351  1.00   64.47  ? 774  GLY D CA  1 
ATOM   4381 C C   . GLY D 1 22  ? 33.450  -35.184 64.234  1.00   64.55  ? 774  GLY D C   1 
ATOM   4382 O O   . GLY D 1 22  ? 32.945  -35.570 63.182  1.00   58.37  ? 774  GLY D O   1 
ATOM   4383 N N   . GLY D 1 23  ? 34.741  -35.302 64.484  1.00   56.48  ? 775  GLY D N   1 
ATOM   4384 C CA  . GLY D 1 23  ? 35.643  -36.024 63.608  1.00   52.58  ? 775  GLY D CA  1 
ATOM   4385 C C   . GLY D 1 23  ? 35.722  -37.531 63.750  1.00   54.08  ? 775  GLY D C   1 
ATOM   4386 O O   . GLY D 1 23  ? 35.435  -38.102 64.803  1.00   54.31  ? 775  GLY D O   1 
ATOM   4387 N N   . SER D 1 24  ? 36.176  -38.199 62.698  1.00   59.19  ? 776  SER D N   1 
ATOM   4388 C CA  . SER D 1 24  ? 36.310  -39.633 62.765  1.00   57.25  ? 776  SER D CA  1 
ATOM   4389 C C   . SER D 1 24  ? 37.392  -40.183 61.844  1.00   62.04  ? 776  SER D C   1 
ATOM   4390 O O   . SER D 1 24  ? 37.660  -39.630 60.784  1.00   63.58  ? 776  SER D O   1 
ATOM   4391 C CB  . SER D 1 24  ? 34.986  -40.255 62.415  1.00   58.91  ? 776  SER D CB  1 
ATOM   4392 O OG  . SER D 1 24  ? 35.113  -41.640 62.418  1.00   61.66  ? 776  SER D OG  1 
ATOM   4393 N N   . THR D 1 25  ? 38.043  -41.264 62.267  1.00   53.55  ? 777  THR D N   1 
ATOM   4394 C CA  . THR D 1 25  ? 39.033  -41.902 61.435  1.00   58.72  ? 777  THR D CA  1 
ATOM   4395 C C   . THR D 1 25  ? 38.410  -43.152 60.838  1.00   57.18  ? 777  THR D C   1 
ATOM   4396 O O   . THR D 1 25  ? 37.684  -43.863 61.523  1.00   57.91  ? 777  THR D O   1 
ATOM   4397 C CB  . THR D 1 25  ? 40.306  -42.240 62.252  1.00   61.92  ? 777  THR D CB  1 
ATOM   4398 O OG1 . THR D 1 25  ? 41.232  -41.148 62.157  1.00   67.08  ? 777  THR D OG1 1 
ATOM   4399 C CG2 . THR D 1 25  ? 40.950  -43.445 61.718  1.00   64.00  ? 777  THR D CG2 1 
ATOM   4400 N N   . LEU D 1 26  ? 38.638  -43.382 59.545  1.00   56.41  ? 778  LEU D N   1 
ATOM   4401 C CA  . LEU D 1 26  ? 38.079  -44.524 58.869  1.00   61.52  ? 778  LEU D CA  1 
ATOM   4402 C C   . LEU D 1 26  ? 38.912  -45.019 57.668  1.00   60.65  ? 778  LEU D C   1 
ATOM   4403 O O   . LEU D 1 26  ? 39.720  -44.285 57.069  1.00   58.40  ? 778  LEU D O   1 
ATOM   4404 C CB  . LEU D 1 26  ? 36.586  -44.290 58.521  1.00   62.66  ? 778  LEU D CB  1 
ATOM   4405 C CG  . LEU D 1 26  ? 36.068  -42.914 58.051  1.00   74.57  ? 778  LEU D CG  1 
ATOM   4406 C CD1 . LEU D 1 26  ? 36.180  -42.751 56.532  1.00   68.98  ? 778  LEU D CD1 1 
ATOM   4407 C CD2 . LEU D 1 26  ? 34.592  -42.656 58.504  1.00   76.48  ? 778  LEU D CD2 1 
ATOM   4408 N N   . PHE D 1 27  ? 38.669  -46.283 57.333  1.00   61.08  ? 779  PHE D N   1 
ATOM   4409 C CA  . PHE D 1 27  ? 39.473  -47.051 56.417  1.00   59.13  ? 779  PHE D CA  1 
ATOM   4410 C C   . PHE D 1 27  ? 38.664  -47.376 55.187  1.00   55.07  ? 779  PHE D C   1 
ATOM   4411 O O   . PHE D 1 27  ? 37.717  -48.181 55.225  1.00   56.15  ? 779  PHE D O   1 
ATOM   4412 C CB  . PHE D 1 27  ? 39.919  -48.373 57.092  1.00   58.66  ? 779  PHE D CB  1 
ATOM   4413 C CG  . PHE D 1 27  ? 41.009  -48.204 58.120  1.00   63.38  ? 779  PHE D CG  1 
ATOM   4414 C CD1 . PHE D 1 27  ? 42.349  -48.290 57.759  1.00   55.21  ? 779  PHE D CD1 1 
ATOM   4415 C CD2 . PHE D 1 27  ? 40.698  -47.959 59.472  1.00   50.50  ? 779  PHE D CD2 1 
ATOM   4416 C CE1 . PHE D 1 27  ? 43.331  -48.148 58.710  1.00   55.44  ? 779  PHE D CE1 1 
ATOM   4417 C CE2 . PHE D 1 27  ? 41.678  -47.787 60.385  1.00   53.17  ? 779  PHE D CE2 1 
ATOM   4418 C CZ  . PHE D 1 27  ? 42.984  -47.899 60.037  1.00   44.96  ? 779  PHE D CZ  1 
ATOM   4419 N N   . VAL D 1 28  ? 39.023  -46.765 54.079  1.00   51.00  ? 780  VAL D N   1 
ATOM   4420 C CA  . VAL D 1 28  ? 38.484  -47.207 52.807  1.00   49.94  ? 780  VAL D CA  1 
ATOM   4421 C C   . VAL D 1 28  ? 39.245  -48.501 52.421  1.00   50.66  ? 780  VAL D C   1 
ATOM   4422 O O   . VAL D 1 28  ? 40.455  -48.592 52.605  1.00   48.48  ? 780  VAL D O   1 
ATOM   4423 C CB  . VAL D 1 28  ? 38.526  -45.997 51.712  1.00   55.12  ? 780  VAL D CB  1 
ATOM   4424 C CG1 . VAL D 1 28  ? 37.928  -46.391 50.372  1.00   51.90  ? 780  VAL D CG1 1 
ATOM   4425 C CG2 . VAL D 1 28  ? 37.823  -44.759 52.249  1.00   48.35  ? 780  VAL D CG2 1 
ATOM   4426 N N   . GLU D 1 29  ? 38.518  -49.490 51.896  1.00   52.00  ? 781  GLU D N   1 
ATOM   4427 C CA  . GLU D 1 29  ? 39.074  -50.704 51.346  1.00   59.20  ? 781  GLU D CA  1 
ATOM   4428 C C   . GLU D 1 29  ? 38.527  -50.977 49.940  1.00   57.76  ? 781  GLU D C   1 
ATOM   4429 O O   . GLU D 1 29  ? 37.370  -50.739 49.668  1.00   62.69  ? 781  GLU D O   1 
ATOM   4430 C CB  . GLU D 1 29  ? 38.680  -51.927 52.190  1.00   63.45  ? 781  GLU D CB  1 
ATOM   4431 C CG  . GLU D 1 29  ? 38.765  -51.765 53.708  1.00   63.16  ? 781  GLU D CG  1 
ATOM   4432 C CD  . GLU D 1 29  ? 38.487  -53.069 54.416  1.00   74.23  ? 781  GLU D CD  1 
ATOM   4433 O OE1 . GLU D 1 29  ? 38.421  -53.041 55.671  1.00   67.95  ? 781  GLU D OE1 1 
ATOM   4434 O OE2 . GLU D 1 29  ? 38.326  -54.109 53.709  1.00   65.90  ? 781  GLU D OE2 1 
ATOM   4435 N N   . THR D 1 30  ? 39.372  -51.531 49.088  1.00   60.86  ? 782  THR D N   1 
ATOM   4436 C CA  . THR D 1 30  ? 38.981  -52.134 47.802  1.00   58.32  ? 782  THR D CA  1 
ATOM   4437 C C   . THR D 1 30  ? 39.492  -53.590 47.753  1.00   59.61  ? 782  THR D C   1 
ATOM   4438 O O   . THR D 1 30  ? 40.577  -53.876 48.227  1.00   58.27  ? 782  THR D O   1 
ATOM   4439 C CB  . THR D 1 30  ? 39.717  -51.478 46.667  1.00   58.10  ? 782  THR D CB  1 
ATOM   4440 O OG1 . THR D 1 30  ? 41.103  -51.599 46.995  1.00   61.11  ? 782  THR D OG1 1 
ATOM   4441 C CG2 . THR D 1 30  ? 39.339  -49.953 46.480  1.00   45.07  ? 782  THR D CG2 1 
ATOM   4442 N N   . SER D 1 31  ? 38.737  -54.495 47.142  1.00   60.75  ? 783  SER D N   1 
ATOM   4443 C CA  . SER D 1 31  ? 39.152  -55.920 47.045  1.00   62.83  ? 783  SER D CA  1 
ATOM   4444 C C   . SER D 1 31  ? 38.587  -56.521 45.768  1.00   62.54  ? 783  SER D C   1 
ATOM   4445 O O   . SER D 1 31  ? 37.802  -55.872 45.090  1.00   56.63  ? 783  SER D O   1 
ATOM   4446 C CB  . SER D 1 31  ? 38.652  -56.718 48.249  1.00   64.24  ? 783  SER D CB  1 
ATOM   4447 O OG  . SER D 1 31  ? 37.255  -56.542 48.461  1.00   58.18  ? 783  SER D OG  1 
ATOM   4448 N N   . LEU D 1 32  ? 38.985  -57.745 45.434  1.00   63.64  ? 784  LEU D N   1 
ATOM   4449 C CA  . LEU D 1 32  ? 38.427  -58.400 44.253  1.00   65.84  ? 784  LEU D CA  1 
ATOM   4450 C C   . LEU D 1 32  ? 37.159  -59.097 44.633  1.00   66.47  ? 784  LEU D C   1 
ATOM   4451 O O   . LEU D 1 32  ? 37.121  -59.873 45.588  1.00   69.78  ? 784  LEU D O   1 
ATOM   4452 C CB  . LEU D 1 32  ? 39.404  -59.372 43.599  1.00   65.45  ? 784  LEU D CB  1 
ATOM   4453 C CG  . LEU D 1 32  ? 40.313  -58.661 42.609  1.00   67.29  ? 784  LEU D CG  1 
ATOM   4454 C CD1 . LEU D 1 32  ? 41.351  -59.617 42.053  1.00   58.74  ? 784  LEU D CD1 1 
ATOM   4455 C CD2 . LEU D 1 32  ? 39.495  -58.017 41.462  1.00   74.98  ? 784  LEU D CD2 1 
ATOM   4456 N N   . ARG D 1 33  ? 36.113  -58.781 43.893  1.00   66.31  ? 785  ARG D N   1 
ATOM   4457 C CA  . ARG D 1 33  ? 34.822  -59.318 44.143  1.00   68.20  ? 785  ARG D CA  1 
ATOM   4458 C C   . ARG D 1 33  ? 34.425  -60.266 43.007  1.00   66.61  ? 785  ARG D C   1 
ATOM   4459 O O   . ARG D 1 33  ? 34.559  -61.476 43.136  1.00   64.33  ? 785  ARG D O   1 
ATOM   4460 C CB  . ARG D 1 33  ? 33.838  -58.164 44.312  1.00   68.67  ? 785  ARG D CB  1 
ATOM   4461 C CG  . ARG D 1 33  ? 33.325  -57.602 43.016  1.00   60.07  ? 785  ARG D CG  1 
ATOM   4462 C CD  . ARG D 1 33  ? 31.796  -57.415 43.031  1.00   65.88  ? 785  ARG D CD  1 
ATOM   4463 N NE  . ARG D 1 33  ? 31.137  -58.056 41.894  1.00   64.92  ? 785  ARG D NE  1 
ATOM   4464 C CZ  . ARG D 1 33  ? 31.200  -57.636 40.633  1.00   77.50  ? 785  ARG D CZ  1 
ATOM   4465 N NH1 . ARG D 1 33  ? 31.891  -56.532 40.314  1.00   88.85  ? 785  ARG D NH1 1 
ATOM   4466 N NH2 . ARG D 1 33  ? 30.563  -58.326 39.677  1.00   71.38  ? 785  ARG D NH2 1 
ATOM   4467 N N   . ASP D 1 45  ? 36.140  -54.868 29.813  1.00   61.28  ? 797  ASP D N   1 
ATOM   4468 C CA  . ASP D 1 45  ? 36.214  -53.790 30.794  1.00   58.06  ? 797  ASP D CA  1 
ATOM   4469 C C   . ASP D 1 45  ? 35.876  -54.217 32.223  1.00   60.95  ? 797  ASP D C   1 
ATOM   4470 O O   . ASP D 1 45  ? 34.924  -54.982 32.463  1.00   47.32  ? 797  ASP D O   1 
ATOM   4471 C CB  . ASP D 1 45  ? 35.331  -52.588 30.415  1.00   60.92  ? 797  ASP D CB  1 
ATOM   4472 C CG  . ASP D 1 45  ? 35.739  -51.264 31.181  1.00   59.87  ? 797  ASP D CG  1 
ATOM   4473 O OD1 . ASP D 1 45  ? 34.872  -50.375 31.363  1.00   49.39  ? 797  ASP D OD1 1 
ATOM   4474 O OD2 . ASP D 1 45  ? 36.913  -51.138 31.609  1.00   59.43  ? 797  ASP D OD2 1 
ATOM   4475 N N   . GLY D 1 46  ? 36.674  -53.702 33.167  1.00   56.82  ? 798  GLY D N   1 
ATOM   4476 C CA  . GLY D 1 46  ? 36.424  -53.887 34.611  1.00   54.64  ? 798  GLY D CA  1 
ATOM   4477 C C   . GLY D 1 46  ? 35.188  -53.152 35.100  1.00   53.14  ? 798  GLY D C   1 
ATOM   4478 O O   . GLY D 1 46  ? 34.470  -52.475 34.309  1.00   51.05  ? 798  GLY D O   1 
ATOM   4479 N N   . SER D 1 47  ? 34.911  -53.304 36.384  1.00   49.62  ? 799  SER D N   1 
ATOM   4480 C CA  . SER D 1 47  ? 33.822  -52.576 37.018  1.00   57.57  ? 799  SER D CA  1 
ATOM   4481 C C   . SER D 1 47  ? 34.115  -52.398 38.467  1.00   56.39  ? 799  SER D C   1 
ATOM   4482 O O   . SER D 1 47  ? 34.896  -53.167 39.043  1.00   63.97  ? 799  SER D O   1 
ATOM   4483 C CB  . SER D 1 47  ? 32.457  -53.284 36.833  1.00   61.37  ? 799  SER D CB  1 
ATOM   4484 O OG  . SER D 1 47  ? 32.208  -54.344 37.733  1.00   61.67  ? 799  SER D OG  1 
ATOM   4485 N N   . LEU D 1 48  ? 33.507  -51.367 39.049  1.00   58.68  ? 800  LEU D N   1 
ATOM   4486 C CA  . LEU D 1 48  ? 33.603  -51.083 40.477  1.00   59.09  ? 800  LEU D CA  1 
ATOM   4487 C C   . LEU D 1 48  ? 32.209  -50.962 41.077  1.00   61.13  ? 800  LEU D C   1 
ATOM   4488 O O   . LEU D 1 48  ? 31.437  -50.101 40.689  1.00   60.24  ? 800  LEU D O   1 
ATOM   4489 C CB  . LEU D 1 48  ? 34.365  -49.799 40.726  1.00   59.36  ? 800  LEU D CB  1 
ATOM   4490 C CG  . LEU D 1 48  ? 34.494  -49.323 42.171  1.00   60.49  ? 800  LEU D CG  1 
ATOM   4491 C CD1 . LEU D 1 48  ? 34.916  -50.483 43.094  1.00   48.86  ? 800  LEU D CD1 1 
ATOM   4492 C CD2 . LEU D 1 48  ? 35.479  -48.167 42.275  1.00   49.50  ? 800  LEU D CD2 1 
ATOM   4493 N N   . GLU D 1 49  ? 31.888  -51.832 42.025  1.00   62.97  ? 801  GLU D N   1 
ATOM   4494 C CA  . GLU D 1 49  ? 30.635  -51.704 42.768  1.00   62.87  ? 801  GLU D CA  1 
ATOM   4495 C C   . GLU D 1 49  ? 30.986  -51.020 44.082  1.00   60.75  ? 801  GLU D C   1 
ATOM   4496 O O   . GLU D 1 49  ? 32.031  -51.317 44.655  1.00   61.29  ? 801  GLU D O   1 
ATOM   4497 C CB  . GLU D 1 49  ? 30.009  -53.066 43.066  1.00   61.60  ? 801  GLU D CB  1 
ATOM   4498 C CG  . GLU D 1 49  ? 29.621  -53.895 41.876  1.00   63.63  ? 801  GLU D CG  1 
ATOM   4499 C CD  . GLU D 1 49  ? 28.522  -54.922 42.199  1.00   73.21  ? 801  GLU D CD  1 
ATOM   4500 O OE1 . GLU D 1 49  ? 28.613  -55.620 43.249  1.00   69.71  ? 801  GLU D OE1 1 
ATOM   4501 O OE2 . GLU D 1 49  ? 27.563  -55.011 41.395  1.00   67.47  ? 801  GLU D OE2 1 
ATOM   4502 N N   . VAL D 1 50  ? 30.104  -50.126 44.531  1.00   62.34  ? 802  VAL D N   1 
ATOM   4503 C CA  . VAL D 1 50  ? 30.267  -49.354 45.757  1.00   65.90  ? 802  VAL D CA  1 
ATOM   4504 C C   . VAL D 1 50  ? 29.255  -49.827 46.809  1.00   72.32  ? 802  VAL D C   1 
ATOM   4505 O O   . VAL D 1 50  ? 28.036  -49.886 46.533  1.00   77.32  ? 802  VAL D O   1 
ATOM   4506 C CB  . VAL D 1 50  ? 29.997  -47.841 45.500  1.00   65.18  ? 802  VAL D CB  1 
ATOM   4507 C CG1 . VAL D 1 50  ? 30.337  -46.993 46.728  1.00   61.41  ? 802  VAL D CG1 1 
ATOM   4508 C CG2 . VAL D 1 50  ? 30.716  -47.349 44.262  1.00   65.66  ? 802  VAL D CG2 1 
ATOM   4509 N N   . THR D 1 51  ? 29.760  -50.161 47.999  1.00   72.59  ? 803  THR D N   1 
ATOM   4510 C CA  . THR D 1 51  ? 28.937  -50.463 49.165  1.00   73.03  ? 803  THR D CA  1 
ATOM   4511 C C   . THR D 1 51  ? 29.337  -49.537 50.339  1.00   74.70  ? 803  THR D C   1 
ATOM   4512 O O   . THR D 1 51  ? 30.342  -48.785 50.254  1.00   69.13  ? 803  THR D O   1 
ATOM   4513 C CB  . THR D 1 51  ? 29.023  -51.964 49.586  1.00   74.63  ? 803  THR D CB  1 
ATOM   4514 O OG1 . THR D 1 51  ? 30.382  -52.421 49.550  1.00   77.98  ? 803  THR D OG1 1 
ATOM   4515 C CG2 . THR D 1 51  ? 28.159  -52.845 48.675  1.00   74.66  ? 803  THR D CG2 1 
ATOM   4516 N N   . GLY D 1 52  ? 28.554  -49.594 51.422  1.00   74.97  ? 804  GLY D N   1 
ATOM   4517 C CA  . GLY D 1 52  ? 28.627  -48.596 52.498  1.00   78.81  ? 804  GLY D CA  1 
ATOM   4518 C C   . GLY D 1 52  ? 27.735  -47.449 52.064  1.00   83.40  ? 804  GLY D C   1 
ATOM   4519 O O   . GLY D 1 52  ? 28.222  -46.473 51.479  1.00   82.79  ? 804  GLY D O   1 
ATOM   4520 N N   . GLN D 1 53  ? 26.433  -47.591 52.364  1.00   88.87  ? 805  GLN D N   1 
ATOM   4521 C CA  . GLN D 1 53  ? 25.309  -46.962 51.603  1.00   91.57  ? 805  GLN D CA  1 
ATOM   4522 C C   . GLN D 1 53  ? 25.474  -45.451 51.327  1.00   91.59  ? 805  GLN D C   1 
ATOM   4523 O O   . GLN D 1 53  ? 25.661  -44.647 52.257  1.00   93.91  ? 805  GLN D O   1 
ATOM   4524 C CB  . GLN D 1 53  ? 23.956  -47.267 52.290  1.00   90.54  ? 805  GLN D CB  1 
ATOM   4525 C CG  . GLN D 1 53  ? 22.694  -46.664 51.613  1.00   94.41  ? 805  GLN D CG  1 
ATOM   4526 C CD  . GLN D 1 53  ? 21.378  -47.186 52.212  1.00   96.04  ? 805  GLN D CD  1 
ATOM   4527 O OE1 . GLN D 1 53  ? 20.378  -46.453 52.288  1.00   97.02  ? 805  GLN D OE1 1 
ATOM   4528 N NE2 . GLN D 1 53  ? 21.377  -48.452 52.646  1.00   89.35  ? 805  GLN D NE2 1 
ATOM   4529 N N   . LEU D 1 54  ? 25.403  -45.074 50.048  1.00   89.00  ? 806  LEU D N   1 
ATOM   4530 C CA  . LEU D 1 54  ? 25.772  -43.714 49.656  1.00   87.17  ? 806  LEU D CA  1 
ATOM   4531 C C   . LEU D 1 54  ? 24.962  -43.121 48.497  1.00   83.73  ? 806  LEU D C   1 
ATOM   4532 O O   . LEU D 1 54  ? 24.673  -43.782 47.498  1.00   83.52  ? 806  LEU D O   1 
ATOM   4533 C CB  . LEU D 1 54  ? 27.274  -43.651 49.379  1.00   86.55  ? 806  LEU D CB  1 
ATOM   4534 C CG  . LEU D 1 54  ? 27.968  -44.833 48.681  1.00   84.28  ? 806  LEU D CG  1 
ATOM   4535 C CD1 . LEU D 1 54  ? 27.869  -44.758 47.153  1.00   78.43  ? 806  LEU D CD1 1 
ATOM   4536 C CD2 . LEU D 1 54  ? 29.429  -44.888 49.122  1.00   82.22  ? 806  LEU D CD2 1 
ATOM   4537 N N   . GLY D 1 55  ? 24.600  -41.856 48.659  1.00   80.71  ? 807  GLY D N   1 
ATOM   4538 C CA  . GLY D 1 55  ? 23.773  -41.164 47.694  1.00   78.99  ? 807  GLY D CA  1 
ATOM   4539 C C   . GLY D 1 55  ? 24.488  -41.035 46.371  1.00   78.66  ? 807  GLY D C   1 
ATOM   4540 O O   . GLY D 1 55  ? 25.627  -41.493 46.192  1.00   79.72  ? 807  GLY D O   1 
ATOM   4541 N N   . GLU D 1 56  ? 23.816  -40.411 45.427  1.00   77.46  ? 808  GLU D N   1 
ATOM   4542 C CA  . GLU D 1 56  ? 24.384  -40.290 44.104  1.00   73.35  ? 808  GLU D CA  1 
ATOM   4543 C C   . GLU D 1 56  ? 25.673  -39.471 44.183  1.00   73.23  ? 808  GLU D C   1 
ATOM   4544 O O   . GLU D 1 56  ? 26.684  -39.881 43.607  1.00   73.14  ? 808  GLU D O   1 
ATOM   4545 C CB  . GLU D 1 56  ? 23.356  -39.740 43.122  1.00   75.15  ? 808  GLU D CB  1 
ATOM   4546 C CG  . GLU D 1 56  ? 22.163  -40.706 42.883  1.00   67.22  ? 808  GLU D CG  1 
ATOM   4547 C CD  . GLU D 1 56  ? 22.579  -42.035 42.254  1.00   66.06  ? 808  GLU D CD  1 
ATOM   4548 O OE1 . GLU D 1 56  ? 23.446  -42.048 41.364  1.00   71.45  ? 808  GLU D OE1 1 
ATOM   4549 O OE2 . GLU D 1 56  ? 22.057  -43.079 42.671  1.00   65.65  ? 808  GLU D OE2 1 
ATOM   4550 N N   . VAL D 1 57  ? 25.663  -38.388 44.968  1.00   65.19  ? 809  VAL D N   1 
ATOM   4551 C CA  . VAL D 1 57  ? 26.883  -37.613 45.217  1.00   65.51  ? 809  VAL D CA  1 
ATOM   4552 C C   . VAL D 1 57  ? 28.123  -38.533 45.413  1.00   62.92  ? 809  VAL D C   1 
ATOM   4553 O O   . VAL D 1 57  ? 29.152  -38.349 44.767  1.00   55.48  ? 809  VAL D O   1 
ATOM   4554 C CB  . VAL D 1 57  ? 26.817  -36.742 46.470  1.00   59.30  ? 809  VAL D CB  1 
ATOM   4555 C CG1 . VAL D 1 57  ? 28.123  -36.047 46.627  1.00   62.38  ? 809  VAL D CG1 1 
ATOM   4556 C CG2 . VAL D 1 57  ? 25.635  -35.721 46.462  1.00   60.19  ? 809  VAL D CG2 1 
ATOM   4557 N N   . MET D 1 58  ? 28.015  -39.510 46.304  1.00   64.75  ? 810  MET D N   1 
ATOM   4558 C CA  . MET D 1 58  ? 29.149  -40.395 46.590  1.00   61.62  ? 810  MET D CA  1 
ATOM   4559 C C   . MET D 1 58  ? 29.446  -41.363 45.451  1.00   55.85  ? 810  MET D C   1 
ATOM   4560 O O   . MET D 1 58  ? 30.618  -41.626 45.192  1.00   64.08  ? 810  MET D O   1 
ATOM   4561 C CB  . MET D 1 58  ? 28.911  -41.190 47.854  1.00   60.31  ? 810  MET D CB  1 
ATOM   4562 C CG  . MET D 1 58  ? 30.168  -41.782 48.505  1.00   70.91  ? 810  MET D CG  1 
ATOM   4563 S SD  . MET D 1 58  ? 31.341  -40.549 49.151  1.00   67.62  ? 810  MET D SD  1 
ATOM   4564 C CE  . MET D 1 58  ? 32.178  -41.461 50.452  1.00   73.32  ? 810  MET D CE  1 
ATOM   4565 N N   . LYS D 1 59  ? 28.408  -41.923 44.829  1.00   56.60  ? 811  LYS D N   1 
ATOM   4566 C CA  . LYS D 1 59  ? 28.514  -42.728 43.583  1.00   58.30  ? 811  LYS D CA  1 
ATOM   4567 C C   . LYS D 1 59  ? 29.266  -41.990 42.492  1.00   54.68  ? 811  LYS D C   1 
ATOM   4568 O O   . LYS D 1 59  ? 30.148  -42.546 41.853  1.00   57.73  ? 811  LYS D O   1 
ATOM   4569 C CB  . LYS D 1 59  ? 27.139  -43.085 43.022  1.00   62.96  ? 811  LYS D CB  1 
ATOM   4570 C CG  . LYS D 1 59  ? 26.675  -44.515 43.298  1.00   72.28  ? 811  LYS D CG  1 
ATOM   4571 C CD  . LYS D 1 59  ? 25.151  -44.569 43.300  1.00   74.53  ? 811  LYS D CD  1 
ATOM   4572 C CE  . LYS D 1 59  ? 24.588  -45.898 43.870  1.00   78.47  ? 811  LYS D CE  1 
ATOM   4573 N NZ  . LYS D 1 59  ? 25.216  -47.152 43.331  1.00   73.57  ? 811  LYS D NZ  1 
ATOM   4574 N N   A GLU D 1 60  ? 28.958  -40.726 42.236  0.50   53.00  ? 812  GLU D N   1 
ATOM   4575 N N   B GLU D 1 60  ? 28.921  -40.723 42.302  0.50   51.39  ? 812  GLU D N   1 
ATOM   4576 C CA  A GLU D 1 60  ? 29.702  -40.068 41.156  0.50   49.94  ? 812  GLU D CA  1 
ATOM   4577 C CA  B GLU D 1 60  ? 29.582  -39.909 41.299  0.50   48.19  ? 812  GLU D CA  1 
ATOM   4578 C C   A GLU D 1 60  ? 31.123  -39.696 41.651  0.50   46.35  ? 812  GLU D C   1 
ATOM   4579 C C   B GLU D 1 60  ? 31.055  -39.725 41.676  0.50   45.11  ? 812  GLU D C   1 
ATOM   4580 O O   A GLU D 1 60  ? 32.087  -39.819 40.907  0.50   43.29  ? 812  GLU D O   1 
ATOM   4581 O O   B GLU D 1 60  ? 31.959  -39.977 40.882  0.50   40.76  ? 812  GLU D O   1 
ATOM   4582 C CB  A GLU D 1 60  ? 28.922  -38.907 40.526  0.50   47.66  ? 812  GLU D CB  1 
ATOM   4583 C CB  B GLU D 1 60  ? 28.898  -38.553 41.226  0.50   43.35  ? 812  GLU D CB  1 
ATOM   4584 C CG  A GLU D 1 60  ? 27.791  -39.398 39.599  0.50   44.79  ? 812  GLU D CG  1 
ATOM   4585 C CG  B GLU D 1 60  ? 29.776  -37.474 40.706  0.50   39.28  ? 812  GLU D CG  1 
ATOM   4586 C CD  A GLU D 1 60  ? 27.304  -38.326 38.679  0.50   40.55  ? 812  GLU D CD  1 
ATOM   4587 C CD  B GLU D 1 60  ? 29.185  -36.135 40.969  0.50   33.59  ? 812  GLU D CD  1 
ATOM   4588 O OE1 A GLU D 1 60  ? 27.951  -37.265 38.653  0.50   38.59  ? 812  GLU D OE1 1 
ATOM   4589 O OE1 B GLU D 1 60  ? 28.503  -35.580 40.080  0.50   31.02  ? 812  GLU D OE1 1 
ATOM   4590 O OE2 A GLU D 1 60  ? 26.250  -38.507 38.033  0.50   28.20  ? 812  GLU D OE2 1 
ATOM   4591 O OE2 B GLU D 1 60  ? 29.374  -35.682 42.084  0.50   33.37  ? 812  GLU D OE2 1 
ATOM   4592 N N   . SER D 1 61  ? 31.261  -39.307 42.906  1.00   46.22  ? 813  SER D N   1 
ATOM   4593 C CA  . SER D 1 61  ? 32.585  -39.052 43.448  1.00   44.81  ? 813  SER D CA  1 
ATOM   4594 C C   . SER D 1 61  ? 33.550  -40.248 43.220  1.00   49.07  ? 813  SER D C   1 
ATOM   4595 O O   . SER D 1 61  ? 34.699  -40.065 42.805  1.00   45.90  ? 813  SER D O   1 
ATOM   4596 C CB  . SER D 1 61  ? 32.463  -38.694 44.901  1.00   51.18  ? 813  SER D CB  1 
ATOM   4597 O OG  . SER D 1 61  ? 33.488  -37.821 45.290  1.00   60.66  ? 813  SER D OG  1 
ATOM   4598 N N   . ALA D 1 62  ? 33.040  -41.461 43.441  1.00   40.24  ? 814  ALA D N   1 
ATOM   4599 C CA  . ALA D 1 62  ? 33.808  -42.682 43.296  1.00   46.92  ? 814  ALA D CA  1 
ATOM   4600 C C   . ALA D 1 62  ? 34.164  -42.948 41.821  1.00   43.77  ? 814  ALA D C   1 
ATOM   4601 O O   . ALA D 1 62  ? 35.312  -43.186 41.527  1.00   48.84  ? 814  ALA D O   1 
ATOM   4602 C CB  . ALA D 1 62  ? 33.035  -43.901 43.887  1.00   44.56  ? 814  ALA D CB  1 
ATOM   4603 N N   A ARG D 1 63  ? 33.186  -42.901 40.915  0.50   41.72  ? 815  ARG D N   1 
ATOM   4604 N N   B ARG D 1 63  ? 33.159  -42.894 40.938  0.50   42.44  ? 815  ARG D N   1 
ATOM   4605 C CA  A ARG D 1 63  ? 33.451  -43.212 39.507  0.50   43.36  ? 815  ARG D CA  1 
ATOM   4606 C CA  B ARG D 1 63  ? 33.331  -43.115 39.493  0.50   43.47  ? 815  ARG D CA  1 
ATOM   4607 C C   A ARG D 1 63  ? 34.336  -42.167 38.844  0.50   37.48  ? 815  ARG D C   1 
ATOM   4608 C C   B ARG D 1 63  ? 34.384  -42.194 38.913  0.50   37.91  ? 815  ARG D C   1 
ATOM   4609 O O   A ARG D 1 63  ? 34.999  -42.461 37.861  0.50   44.84  ? 815  ARG D O   1 
ATOM   4610 O O   B ARG D 1 63  ? 35.196  -42.597 38.083  0.50   41.20  ? 815  ARG D O   1 
ATOM   4611 C CB  A ARG D 1 63  ? 32.165  -43.462 38.703  0.50   46.43  ? 815  ARG D CB  1 
ATOM   4612 C CB  B ARG D 1 63  ? 32.012  -42.915 38.735  0.50   47.65  ? 815  ARG D CB  1 
ATOM   4613 C CG  A ARG D 1 63  ? 31.387  -42.222 38.338  0.50   48.37  ? 815  ARG D CG  1 
ATOM   4614 C CG  B ARG D 1 63  ? 31.025  -44.071 38.822  0.50   48.25  ? 815  ARG D CG  1 
ATOM   4615 C CD  A ARG D 1 63  ? 30.368  -42.550 37.277  0.50   57.21  ? 815  ARG D CD  1 
ATOM   4616 C CD  B ARG D 1 63  ? 30.208  -44.194 37.537  0.50   54.30  ? 815  ARG D CD  1 
ATOM   4617 N NE  A ARG D 1 63  ? 29.001  -42.331 37.744  0.50   52.21  ? 815  ARG D NE  1 
ATOM   4618 N NE  B ARG D 1 63  ? 28.765  -44.151 37.781  0.50   66.06  ? 815  ARG D NE  1 
ATOM   4619 C CZ  A ARG D 1 63  ? 27.955  -42.400 36.947  0.50   40.55  ? 815  ARG D CZ  1 
ATOM   4620 C CZ  B ARG D 1 63  ? 28.179  -44.505 38.919  0.50   61.33  ? 815  ARG D CZ  1 
ATOM   4621 N NH1 A ARG D 1 63  ? 26.747  -42.203 37.422  0.50   42.95  ? 815  ARG D NH1 1 
ATOM   4622 N NH1 B ARG D 1 63  ? 26.873  -44.417 39.031  0.50   57.73  ? 815  ARG D NH1 1 
ATOM   4623 N NH2 A ARG D 1 63  ? 28.135  -42.652 35.657  0.50   37.83  ? 815  ARG D NH2 1 
ATOM   4624 N NH2 B ARG D 1 63  ? 28.893  -44.968 39.941  0.50   63.42  ? 815  ARG D NH2 1 
ATOM   4625 N N   . ILE D 1 64  ? 34.424  -40.987 39.450  1.00   32.90  ? 816  ILE D N   1 
ATOM   4626 C CA  . ILE D 1 64  ? 35.327  -39.951 38.989  1.00   31.47  ? 816  ILE D CA  1 
ATOM   4627 C C   . ILE D 1 64  ? 36.735  -40.258 39.464  1.00   30.51  ? 816  ILE D C   1 
ATOM   4628 O O   . ILE D 1 64  ? 37.687  -40.135 38.697  1.00   34.22  ? 816  ILE D O   1 
ATOM   4629 C CB  . ILE D 1 64  ? 34.858  -38.569 39.537  1.00   38.37  ? 816  ILE D CB  1 
ATOM   4630 C CG1 . ILE D 1 64  ? 33.629  -38.008 38.733  1.00   35.39  ? 816  ILE D CG1 1 
ATOM   4631 C CG2 . ILE D 1 64  ? 36.050  -37.450 39.574  1.00   33.77  ? 816  ILE D CG2 1 
ATOM   4632 C CD1 . ILE D 1 64  ? 32.729  -37.055 39.620  1.00   28.34  ? 816  ILE D CD1 1 
ATOM   4633 N N   . ALA D 1 65  ? 36.876  -40.555 40.730  1.00   33.31  ? 817  ALA D N   1 
ATOM   4634 C CA  . ALA D 1 65  ? 38.250  -40.990 41.269  1.00   28.26  ? 817  ALA D CA  1 
ATOM   4635 C C   . ALA D 1 65  ? 38.710  -42.344 40.672  1.00   30.52  ? 817  ALA D C   1 
ATOM   4636 O O   . ALA D 1 65  ? 39.893  -42.618 40.526  1.00   40.06  ? 817  ALA D O   1 
ATOM   4637 C CB  . ALA D 1 65  ? 38.178  -40.992 42.740  1.00   31.43  ? 817  ALA D CB  1 
ATOM   4638 N N   . TYR D 1 66  ? 37.775  -43.172 40.241  1.00   41.12  ? 818  TYR D N   1 
ATOM   4639 C CA  . TYR D 1 66  ? 38.068  -44.478 39.601  1.00   37.51  ? 818  TYR D CA  1 
ATOM   4640 C C   . TYR D 1 66  ? 38.568  -44.221 38.172  1.00   45.63  ? 818  TYR D C   1 
ATOM   4641 O O   . TYR D 1 66  ? 39.611  -44.699 37.763  1.00   41.72  ? 818  TYR D O   1 
ATOM   4642 C CB  . TYR D 1 66  ? 36.785  -45.234 39.553  1.00   36.76  ? 818  TYR D CB  1 
ATOM   4643 C CG  . TYR D 1 66  ? 36.738  -46.641 38.931  1.00   37.46  ? 818  TYR D CG  1 
ATOM   4644 C CD1 . TYR D 1 66  ? 35.626  -47.007 38.192  1.00   40.25  ? 818  TYR D CD1 1 
ATOM   4645 C CD2 . TYR D 1 66  ? 37.794  -47.537 39.000  1.00   52.81  ? 818  TYR D CD2 1 
ATOM   4646 C CE1 . TYR D 1 66  ? 35.505  -48.304 37.617  1.00   54.28  ? 818  TYR D CE1 1 
ATOM   4647 C CE2 . TYR D 1 66  ? 37.702  -48.835 38.391  1.00   40.28  ? 818  TYR D CE2 1 
ATOM   4648 C CZ  . TYR D 1 66  ? 36.539  -49.205 37.745  1.00   47.14  ? 818  TYR D CZ  1 
ATOM   4649 O OH  . TYR D 1 66  ? 36.415  -50.460 37.198  1.00   50.59  ? 818  TYR D OH  1 
ATOM   4650 N N   . THR D 1 67  ? 37.910  -43.325 37.465  1.00   43.07  ? 819  THR D N   1 
ATOM   4651 C CA  . THR D 1 67  ? 38.433  -42.982 36.142  1.00   40.35  ? 819  THR D CA  1 
ATOM   4652 C C   . THR D 1 67  ? 39.776  -42.430 36.268  1.00   36.23  ? 819  THR D C   1 
ATOM   4653 O O   . THR D 1 67  ? 40.613  -42.818 35.491  1.00   49.38  ? 819  THR D O   1 
ATOM   4654 C CB  . THR D 1 67  ? 37.566  -42.038 35.323  1.00   31.63  ? 819  THR D CB  1 
ATOM   4655 O OG1 . THR D 1 67  ? 36.477  -42.771 34.795  1.00   46.36  ? 819  THR D OG1 1 
ATOM   4656 C CG2 . THR D 1 67  ? 38.366  -41.525 34.112  1.00   38.21  ? 819  THR D CG2 1 
ATOM   4657 N N   . PHE D 1 68  ? 40.005  -41.529 37.230  1.00   41.78  ? 820  PHE D N   1 
ATOM   4658 C CA  . PHE D 1 68  ? 41.270  -40.836 37.284  1.00   39.78  ? 820  PHE D CA  1 
ATOM   4659 C C   . PHE D 1 68  ? 42.390  -41.842 37.701  1.00   44.58  ? 820  PHE D C   1 
ATOM   4660 O O   . PHE D 1 68  ? 43.528  -41.743 37.262  1.00   44.38  ? 820  PHE D O   1 
ATOM   4661 C CB  . PHE D 1 68  ? 41.256  -39.752 38.378  1.00   36.89  ? 820  PHE D CB  1 
ATOM   4662 C CG  . PHE D 1 68  ? 42.627  -39.265 38.704  1.00   41.03  ? 820  PHE D CG  1 
ATOM   4663 C CD1 . PHE D 1 68  ? 43.200  -39.487 39.944  1.00   38.46  ? 820  PHE D CD1 1 
ATOM   4664 C CD2 . PHE D 1 68  ? 43.423  -38.693 37.726  1.00   53.73  ? 820  PHE D CD2 1 
ATOM   4665 C CE1 . PHE D 1 68  ? 44.626  -39.084 40.200  1.00   33.18  ? 820  PHE D CE1 1 
ATOM   4666 C CE2 . PHE D 1 68  ? 44.783  -38.295 37.999  1.00   49.97  ? 820  PHE D CE2 1 
ATOM   4667 C CZ  . PHE D 1 68  ? 45.345  -38.497 39.283  1.00   45.59  ? 820  PHE D CZ  1 
ATOM   4668 N N   . ALA D 1 69  ? 42.070  -42.724 38.630  1.00   42.03  ? 821  ALA D N   1 
ATOM   4669 C CA  . ALA D 1 69  ? 43.003  -43.850 38.941  1.00   45.20  ? 821  ALA D CA  1 
ATOM   4670 C C   . ALA D 1 69  ? 43.225  -44.682 37.661  1.00   40.31  ? 821  ALA D C   1 
ATOM   4671 O O   . ALA D 1 69  ? 44.338  -45.047 37.340  1.00   38.79  ? 821  ALA D O   1 
ATOM   4672 C CB  . ALA D 1 69  ? 42.493  -44.750 40.086  1.00   36.04  ? 821  ALA D CB  1 
ATOM   4673 N N   . ARG D 1 70  ? 42.187  -44.970 36.897  1.00   38.97  ? 822  ARG D N   1 
ATOM   4674 C CA  . ARG D 1 70  ? 42.421  -45.639 35.643  1.00   40.85  ? 822  ARG D CA  1 
ATOM   4675 C C   . ARG D 1 70  ? 43.440  -44.842 34.781  1.00   50.68  ? 822  ARG D C   1 
ATOM   4676 O O   . ARG D 1 70  ? 44.398  -45.413 34.196  1.00   51.77  ? 822  ARG D O   1 
ATOM   4677 C CB  . ARG D 1 70  ? 41.090  -45.882 34.953  1.00   47.95  ? 822  ARG D CB  1 
ATOM   4678 C CG  . ARG D 1 70  ? 40.540  -47.238 35.281  1.00   39.35  ? 822  ARG D CG  1 
ATOM   4679 C CD  . ARG D 1 70  ? 39.088  -47.334 35.005  1.00   42.54  ? 822  ARG D CD  1 
ATOM   4680 N NE  . ARG D 1 70  ? 38.712  -48.661 34.593  1.00   53.68  ? 822  ARG D NE  1 
ATOM   4681 C CZ  . ARG D 1 70  ? 37.472  -49.070 34.498  1.00   65.73  ? 822  ARG D CZ  1 
ATOM   4682 N NH1 . ARG D 1 70  ? 36.485  -48.248 34.853  1.00   70.92  ? 822  ARG D NH1 1 
ATOM   4683 N NH2 . ARG D 1 70  ? 37.219  -50.310 34.102  1.00   59.77  ? 822  ARG D NH2 1 
ATOM   4684 N N   . ALA D 1 71  ? 43.304  -43.515 34.752  1.00   44.58  ? 823  ALA D N   1 
ATOM   4685 C CA  . ALA D 1 71  ? 44.155  -42.668 33.859  1.00   47.76  ? 823  ALA D CA  1 
ATOM   4686 C C   . ALA D 1 71  ? 45.579  -42.505 34.394  1.00   50.36  ? 823  ALA D C   1 
ATOM   4687 O O   . ALA D 1 71  ? 46.559  -42.524 33.633  1.00   44.58  ? 823  ALA D O   1 
ATOM   4688 C CB  . ALA D 1 71  ? 43.492  -41.259 33.654  1.00   41.01  ? 823  ALA D CB  1 
ATOM   4689 N N   . PHE D 1 72  ? 45.683  -42.331 35.698  1.00   45.20  ? 824  PHE D N   1 
ATOM   4690 C CA  . PHE D 1 72  ? 46.982  -42.224 36.329  1.00   49.35  ? 824  PHE D CA  1 
ATOM   4691 C C   . PHE D 1 72  ? 47.744  -43.529 36.057  1.00   49.01  ? 824  PHE D C   1 
ATOM   4692 O O   . PHE D 1 72  ? 48.872  -43.541 35.591  1.00   47.76  ? 824  PHE D O   1 
ATOM   4693 C CB  . PHE D 1 72  ? 46.818  -42.052 37.837  1.00   42.98  ? 824  PHE D CB  1 
ATOM   4694 C CG  . PHE D 1 72  ? 48.004  -41.519 38.479  1.00   53.78  ? 824  PHE D CG  1 
ATOM   4695 C CD1 . PHE D 1 72  ? 48.975  -42.381 39.011  1.00   52.75  ? 824  PHE D CD1 1 
ATOM   4696 C CD2 . PHE D 1 72  ? 48.201  -40.142 38.535  1.00   42.46  ? 824  PHE D CD2 1 
ATOM   4697 C CE1 . PHE D 1 72  ? 50.112  -41.867 39.612  1.00   52.02  ? 824  PHE D CE1 1 
ATOM   4698 C CE2 . PHE D 1 72  ? 49.363  -39.612 39.161  1.00   40.78  ? 824  PHE D CE2 1 
ATOM   4699 C CZ  . PHE D 1 72  ? 50.298  -40.477 39.682  1.00   44.67  ? 824  PHE D CZ  1 
ATOM   4700 N N   . LEU D 1 73  ? 47.058  -44.635 36.285  1.00   46.12  ? 825  LEU D N   1 
ATOM   4701 C CA  . LEU D 1 73  ? 47.733  -45.941 36.243  1.00   53.01  ? 825  LEU D CA  1 
ATOM   4702 C C   . LEU D 1 73  ? 48.087  -46.422 34.818  1.00   56.39  ? 825  LEU D C   1 
ATOM   4703 O O   . LEU D 1 73  ? 49.043  -47.223 34.604  1.00   43.93  ? 825  LEU D O   1 
ATOM   4704 C CB  . LEU D 1 73  ? 46.891  -46.975 36.963  1.00   43.97  ? 825  LEU D CB  1 
ATOM   4705 C CG  . LEU D 1 73  ? 47.661  -48.233 37.351  1.00   51.27  ? 825  LEU D CG  1 
ATOM   4706 C CD1 . LEU D 1 73  ? 48.803  -47.875 38.349  1.00   33.35  ? 825  LEU D CD1 1 
ATOM   4707 C CD2 . LEU D 1 73  ? 46.725  -49.252 37.980  1.00   45.95  ? 825  LEU D CD2 1 
ATOM   4708 N N   . MET D 1 74  ? 47.304  -45.959 33.836  1.00   56.17  ? 826  MET D N   1 
ATOM   4709 C CA  . MET D 1 74  ? 47.697  -46.034 32.424  1.00   50.53  ? 826  MET D CA  1 
ATOM   4710 C C   . MET D 1 74  ? 48.910  -45.132 32.080  1.00   54.06  ? 826  MET D C   1 
ATOM   4711 O O   . MET D 1 74  ? 49.763  -45.504 31.249  1.00   53.04  ? 826  MET D O   1 
ATOM   4712 C CB  . MET D 1 74  ? 46.534  -45.632 31.493  1.00   52.95  ? 826  MET D CB  1 
ATOM   4713 C CG  . MET D 1 74  ? 45.409  -46.671 31.247  1.00   54.87  ? 826  MET D CG  1 
ATOM   4714 S SD  . MET D 1 74  ? 44.068  -46.005 30.106  1.00   64.82  ? 826  MET D SD  1 
ATOM   4715 C CE  . MET D 1 74  ? 44.090  -44.296 30.637  1.00   56.42  ? 826  MET D CE  1 
ATOM   4716 N N   . GLN D 1 75  ? 49.013  -43.946 32.660  1.00   55.66  ? 827  GLN D N   1 
ATOM   4717 C CA  . GLN D 1 75  ? 50.253  -43.163 32.467  1.00   59.02  ? 827  GLN D CA  1 
ATOM   4718 C C   . GLN D 1 75  ? 51.448  -43.716 33.263  1.00   63.37  ? 827  GLN D C   1 
ATOM   4719 O O   . GLN D 1 75  ? 52.529  -43.888 32.693  1.00   62.34  ? 827  GLN D O   1 
ATOM   4720 C CB  . GLN D 1 75  ? 50.029  -41.683 32.781  1.00   64.64  ? 827  GLN D CB  1 
ATOM   4721 C CG  . GLN D 1 75  ? 50.730  -40.655 31.834  1.00   74.33  ? 827  GLN D CG  1 
ATOM   4722 C CD  . GLN D 1 75  ? 50.210  -40.668 30.364  1.00   72.15  ? 827  GLN D CD  1 
ATOM   4723 O OE1 . GLN D 1 75  ? 49.711  -39.666 29.858  1.00   67.83  ? 827  GLN D OE1 1 
ATOM   4724 N NE2 . GLN D 1 75  ? 50.359  -41.791 29.689  1.00   66.24  ? 827  GLN D NE2 1 
ATOM   4725 N N   . HIS D 1 76  ? 51.253  -43.947 34.570  1.00   61.70  ? 828  HIS D N   1 
ATOM   4726 C CA  . HIS D 1 76  ? 52.275  -44.530 35.467  1.00   56.36  ? 828  HIS D CA  1 
ATOM   4727 C C   . HIS D 1 76  ? 52.772  -45.942 35.048  1.00   57.55  ? 828  HIS D C   1 
ATOM   4728 O O   . HIS D 1 76  ? 53.963  -46.137 34.894  1.00   52.00  ? 828  HIS D O   1 
ATOM   4729 C CB  . HIS D 1 76  ? 51.748  -44.574 36.918  1.00   60.32  ? 828  HIS D CB  1 
ATOM   4730 C CG  . HIS D 1 76  ? 52.788  -44.948 37.953  1.00   50.38  ? 828  HIS D CG  1 
ATOM   4731 N ND1 . HIS D 1 76  ? 52.746  -46.140 38.650  1.00   52.84  ? 828  HIS D ND1 1 
ATOM   4732 C CD2 . HIS D 1 76  ? 53.894  -44.300 38.392  1.00   49.46  ? 828  HIS D CD2 1 
ATOM   4733 C CE1 . HIS D 1 76  ? 53.770  -46.207 39.478  1.00   50.37  ? 828  HIS D CE1 1 
ATOM   4734 N NE2 . HIS D 1 76  ? 54.475  -45.095 39.353  1.00   47.54  ? 828  HIS D NE2 1 
ATOM   4735 N N   . ALA D 1 77  ? 51.879  -46.909 34.858  1.00   46.57  ? 829  ALA D N   1 
ATOM   4736 C CA  . ALA D 1 77  ? 52.298  -48.253 34.637  1.00   49.84  ? 829  ALA D CA  1 
ATOM   4737 C C   . ALA D 1 77  ? 51.584  -48.814 33.449  1.00   45.89  ? 829  ALA D C   1 
ATOM   4738 O O   . ALA D 1 77  ? 50.550  -49.479 33.627  1.00   50.14  ? 829  ALA D O   1 
ATOM   4739 C CB  . ALA D 1 77  ? 52.024  -49.099 35.856  1.00   57.32  ? 829  ALA D CB  1 
ATOM   4740 N N   . PRO D 1 78  ? 52.073  -48.503 32.227  1.00   52.55  ? 830  PRO D N   1 
ATOM   4741 C CA  . PRO D 1 78  ? 51.286  -48.845 31.041  1.00   50.55  ? 830  PRO D CA  1 
ATOM   4742 C C   . PRO D 1 78  ? 50.906  -50.343 30.999  1.00   56.41  ? 830  PRO D C   1 
ATOM   4743 O O   . PRO D 1 78  ? 49.791  -50.684 30.613  1.00   51.14  ? 830  PRO D O   1 
ATOM   4744 C CB  . PRO D 1 78  ? 52.199  -48.477 29.891  1.00   58.30  ? 830  PRO D CB  1 
ATOM   4745 C CG  . PRO D 1 78  ? 53.111  -47.349 30.428  1.00   63.75  ? 830  PRO D CG  1 
ATOM   4746 C CD  . PRO D 1 78  ? 53.059  -47.423 31.960  1.00   59.22  ? 830  PRO D CD  1 
ATOM   4747 N N   . ALA D 1 79  ? 51.817  -51.227 31.425  1.00   55.24  ? 831  ALA D N   1 
ATOM   4748 C CA  . ALA D 1 79  ? 51.589  -52.651 31.215  1.00   55.49  ? 831  ALA D CA  1 
ATOM   4749 C C   . ALA D 1 79  ? 50.625  -53.226 32.242  1.00   60.99  ? 831  ALA D C   1 
ATOM   4750 O O   . ALA D 1 79  ? 50.143  -54.352 32.058  1.00   67.23  ? 831  ALA D O   1 
ATOM   4751 C CB  . ALA D 1 79  ? 52.891  -53.408 31.192  1.00   60.45  ? 831  ALA D CB  1 
ATOM   4752 N N   . ASN D 1 80  ? 50.276  -52.452 33.285  1.00   61.43  ? 832  ASN D N   1 
ATOM   4753 C CA  . ASN D 1 80  ? 49.393  -52.960 34.319  1.00   59.01  ? 832  ASN D CA  1 
ATOM   4754 C C   . ASN D 1 80  ? 47.876  -52.957 33.983  1.00   57.67  ? 832  ASN D C   1 
ATOM   4755 O O   . ASN D 1 80  ? 47.197  -51.976 34.274  1.00   54.05  ? 832  ASN D O   1 
ATOM   4756 C CB  . ASN D 1 80  ? 49.675  -52.228 35.650  1.00   59.31  ? 832  ASN D CB  1 
ATOM   4757 C CG  . ASN D 1 80  ? 48.881  -52.808 36.809  1.00   58.09  ? 832  ASN D CG  1 
ATOM   4758 O OD1 . ASN D 1 80  ? 47.801  -53.394 36.618  1.00   64.20  ? 832  ASN D OD1 1 
ATOM   4759 N ND2 . ASN D 1 80  ? 49.401  -52.647 38.028  1.00   52.51  ? 832  ASN D ND2 1 
ATOM   4760 N N   . ASP D 1 81  ? 47.336  -54.073 33.467  1.00   55.06  ? 833  ASP D N   1 
ATOM   4761 C CA  . ASP D 1 81  ? 45.881  -54.115 33.083  1.00   59.69  ? 833  ASP D CA  1 
ATOM   4762 C C   . ASP D 1 81  ? 44.817  -54.156 34.202  1.00   55.59  ? 833  ASP D C   1 
ATOM   4763 O O   . ASP D 1 81  ? 43.604  -54.323 33.942  1.00   57.06  ? 833  ASP D O   1 
ATOM   4764 C CB  . ASP D 1 81  ? 45.603  -55.249 32.068  1.00   64.09  ? 833  ASP D CB  1 
ATOM   4765 C CG  . ASP D 1 81  ? 45.875  -56.677 32.619  1.00   67.84  ? 833  ASP D CG  1 
ATOM   4766 O OD1 . ASP D 1 81  ? 46.191  -56.888 33.823  1.00   65.15  ? 833  ASP D OD1 1 
ATOM   4767 O OD2 . ASP D 1 81  ? 45.759  -57.620 31.802  1.00   55.88  ? 833  ASP D OD2 1 
ATOM   4768 N N   . TYR D 1 82  ? 45.234  -54.016 35.453  1.00   49.07  ? 834  TYR D N   1 
ATOM   4769 C CA  . TYR D 1 82  ? 44.345  -54.382 36.580  1.00   54.13  ? 834  TYR D CA  1 
ATOM   4770 C C   . TYR D 1 82  ? 43.037  -53.600 36.768  1.00   53.22  ? 834  TYR D C   1 
ATOM   4771 O O   . TYR D 1 82  ? 41.960  -54.187 36.934  1.00   47.64  ? 834  TYR D O   1 
ATOM   4772 C CB  . TYR D 1 82  ? 45.143  -54.230 37.868  1.00   57.50  ? 834  TYR D CB  1 
ATOM   4773 C CG  . TYR D 1 82  ? 44.578  -54.920 39.087  1.00   53.80  ? 834  TYR D CG  1 
ATOM   4774 C CD1 . TYR D 1 82  ? 45.272  -55.981 39.669  1.00   66.98  ? 834  TYR D CD1 1 
ATOM   4775 C CD2 . TYR D 1 82  ? 43.412  -54.482 39.707  1.00   62.01  ? 834  TYR D CD2 1 
ATOM   4776 C CE1 . TYR D 1 82  ? 44.803  -56.621 40.793  1.00   60.87  ? 834  TYR D CE1 1 
ATOM   4777 C CE2 . TYR D 1 82  ? 42.931  -55.094 40.843  1.00   52.82  ? 834  TYR D CE2 1 
ATOM   4778 C CZ  . TYR D 1 82  ? 43.639  -56.172 41.400  1.00   62.89  ? 834  TYR D CZ  1 
ATOM   4779 O OH  . TYR D 1 82  ? 43.178  -56.829 42.522  1.00   48.10  ? 834  TYR D OH  1 
ATOM   4780 N N   . LEU D 1 83  ? 43.152  -52.270 36.866  1.00   54.69  ? 835  LEU D N   1 
ATOM   4781 C CA  . LEU D 1 83  ? 41.985  -51.385 37.005  1.00   51.31  ? 835  LEU D CA  1 
ATOM   4782 C C   . LEU D 1 83  ? 41.101  -51.479 35.770  1.00   53.12  ? 835  LEU D C   1 
ATOM   4783 O O   . LEU D 1 83  ? 39.896  -51.323 35.864  1.00   52.06  ? 835  LEU D O   1 
ATOM   4784 C CB  . LEU D 1 83  ? 42.423  -49.917 37.221  1.00   54.85  ? 835  LEU D CB  1 
ATOM   4785 C CG  . LEU D 1 83  ? 43.169  -49.648 38.540  1.00   55.02  ? 835  LEU D CG  1 
ATOM   4786 C CD1 . LEU D 1 83  ? 44.482  -50.390 38.456  1.00   60.89  ? 835  LEU D CD1 1 
ATOM   4787 C CD2 . LEU D 1 83  ? 43.471  -48.141 38.944  1.00   59.54  ? 835  LEU D CD2 1 
ATOM   4788 N N   . VAL D 1 84  ? 41.690  -51.702 34.600  1.00   48.43  ? 836  VAL D N   1 
ATOM   4789 C CA  . VAL D 1 84  ? 40.908  -51.617 33.392  1.00   52.40  ? 836  VAL D CA  1 
ATOM   4790 C C   . VAL D 1 84  ? 40.119  -52.896 33.096  1.00   58.51  ? 836  VAL D C   1 
ATOM   4791 O O   . VAL D 1 84  ? 39.174  -52.830 32.275  1.00   58.69  ? 836  VAL D O   1 
ATOM   4792 C CB  . VAL D 1 84  ? 41.712  -51.136 32.122  1.00   56.36  ? 836  VAL D CB  1 
ATOM   4793 C CG1 . VAL D 1 84  ? 42.243  -49.700 32.323  1.00   63.19  ? 836  VAL D CG1 1 
ATOM   4794 C CG2 . VAL D 1 84  ? 42.841  -52.082 31.716  1.00   48.40  ? 836  VAL D CG2 1 
ATOM   4795 N N   . THR D 1 85  ? 40.512  -54.020 33.736  1.00   51.01  ? 837  THR D N   1 
ATOM   4796 C CA  . THR D 1 85  ? 39.884  -55.364 33.513  1.00   55.81  ? 837  THR D CA  1 
ATOM   4797 C C   . THR D 1 85  ? 39.371  -56.026 34.790  1.00   53.50  ? 837  THR D C   1 
ATOM   4798 O O   . THR D 1 85  ? 38.489  -56.880 34.728  1.00   62.06  ? 837  THR D O   1 
ATOM   4799 C CB  . THR D 1 85  ? 40.851  -56.380 32.862  1.00   55.27  ? 837  THR D CB  1 
ATOM   4800 O OG1 . THR D 1 85  ? 41.923  -56.686 33.781  1.00   57.07  ? 837  THR D OG1 1 
ATOM   4801 C CG2 . THR D 1 85  ? 41.421  -55.839 31.595  1.00   54.75  ? 837  THR D CG2 1 
ATOM   4802 N N   . SER D 1 86  ? 39.852  -55.624 35.970  1.00   57.22  ? 838  SER D N   1 
ATOM   4803 C CA  . SER D 1 86  ? 39.372  -56.285 37.175  1.00   54.97  ? 838  SER D CA  1 
ATOM   4804 C C   . SER D 1 86  ? 37.940  -55.922 37.564  1.00   61.57  ? 838  SER D C   1 
ATOM   4805 O O   . SER D 1 86  ? 37.455  -54.819 37.318  1.00   54.80  ? 838  SER D O   1 
ATOM   4806 C CB  . SER D 1 86  ? 40.297  -56.006 38.361  1.00   60.30  ? 838  SER D CB  1 
ATOM   4807 O OG  . SER D 1 86  ? 41.666  -56.144 37.980  1.00   61.08  ? 838  SER D OG  1 
ATOM   4808 N N   . HIS D 1 87  ? 37.280  -56.845 38.243  1.00   62.17  ? 839  HIS D N   1 
ATOM   4809 C CA  . HIS D 1 87  ? 36.019  -56.517 38.900  1.00   60.01  ? 839  HIS D CA  1 
ATOM   4810 C C   . HIS D 1 87  ? 36.264  -56.265 40.406  1.00   63.62  ? 839  HIS D C   1 
ATOM   4811 O O   . HIS D 1 87  ? 36.641  -57.187 41.153  1.00   66.01  ? 839  HIS D O   1 
ATOM   4812 C CB  . HIS D 1 87  ? 35.032  -57.637 38.602  1.00   62.58  ? 839  HIS D CB  1 
ATOM   4813 C CG  . HIS D 1 87  ? 34.617  -57.686 37.166  1.00   63.36  ? 839  HIS D CG  1 
ATOM   4814 N ND1 . HIS D 1 87  ? 33.516  -57.007 36.692  1.00   63.06  ? 839  HIS D ND1 1 
ATOM   4815 C CD2 . HIS D 1 87  ? 35.183  -58.280 36.088  1.00   71.31  ? 839  HIS D CD2 1 
ATOM   4816 C CE1 . HIS D 1 87  ? 33.392  -57.218 35.391  1.00   70.57  ? 839  HIS D CE1 1 
ATOM   4817 N NE2 . HIS D 1 87  ? 34.391  -57.990 35.001  1.00   75.94  ? 839  HIS D NE2 1 
ATOM   4818 N N   . ILE D 1 88  ? 36.072  -55.005 40.835  1.00   58.77  ? 840  ILE D N   1 
ATOM   4819 C CA  . ILE D 1 88  ? 36.441  -54.514 42.177  1.00   52.42  ? 840  ILE D CA  1 
ATOM   4820 C C   . ILE D 1 88  ? 35.211  -54.118 42.953  1.00   56.28  ? 840  ILE D C   1 
ATOM   4821 O O   . ILE D 1 88  ? 34.173  -53.741 42.380  1.00   49.57  ? 840  ILE D O   1 
ATOM   4822 C CB  . ILE D 1 88  ? 37.434  -53.307 42.082  1.00   50.90  ? 840  ILE D CB  1 
ATOM   4823 C CG1 . ILE D 1 88  ? 38.527  -53.647 41.077  1.00   52.96  ? 840  ILE D CG1 1 
ATOM   4824 C CG2 . ILE D 1 88  ? 38.054  -52.826 43.408  1.00   54.77  ? 840  ILE D CG2 1 
ATOM   4825 C CD1 . ILE D 1 88  ? 39.585  -52.721 41.085  1.00   37.08  ? 840  ILE D CD1 1 
ATOM   4826 N N   . HIS D 1 89  ? 35.367  -54.268 44.274  1.00   59.47  ? 841  HIS D N   1 
ATOM   4827 C CA  . HIS D 1 89  ? 34.471  -53.828 45.317  1.00   58.23  ? 841  HIS D CA  1 
ATOM   4828 C C   . HIS D 1 89  ? 35.179  -52.723 46.085  1.00   55.85  ? 841  HIS D C   1 
ATOM   4829 O O   . HIS D 1 89  ? 36.325  -52.903 46.512  1.00   54.29  ? 841  HIS D O   1 
ATOM   4830 C CB  . HIS D 1 89  ? 34.187  -55.012 46.285  1.00   64.75  ? 841  HIS D CB  1 
ATOM   4831 C CG  . HIS D 1 89  ? 33.110  -54.738 47.298  1.00   68.77  ? 841  HIS D CG  1 
ATOM   4832 N ND1 . HIS D 1 89  ? 33.238  -55.086 48.631  1.00   75.06  ? 841  HIS D ND1 1 
ATOM   4833 C CD2 . HIS D 1 89  ? 31.897  -54.140 47.182  1.00   69.57  ? 841  HIS D CD2 1 
ATOM   4834 C CE1 . HIS D 1 89  ? 32.153  -54.721 49.289  1.00   61.93  ? 841  HIS D CE1 1 
ATOM   4835 N NE2 . HIS D 1 89  ? 31.326  -54.138 48.435  1.00   78.42  ? 841  HIS D NE2 1 
ATOM   4836 N N   . LEU D 1 90  ? 34.521  -51.569 46.194  1.00   50.41  ? 842  LEU D N   1 
ATOM   4837 C CA  . LEU D 1 90  ? 34.993  -50.409 46.971  1.00   54.18  ? 842  LEU D CA  1 
ATOM   4838 C C   . LEU D 1 90  ? 34.005  -50.342 48.106  1.00   42.48  ? 842  LEU D C   1 
ATOM   4839 O O   . LEU D 1 90  ? 32.804  -50.298 47.854  1.00   53.41  ? 842  LEU D O   1 
ATOM   4840 C CB  . LEU D 1 90  ? 34.926  -49.059 46.196  1.00   50.09  ? 842  LEU D CB  1 
ATOM   4841 C CG  . LEU D 1 90  ? 35.125  -47.799 47.100  1.00   54.69  ? 842  LEU D CG  1 
ATOM   4842 C CD1 . LEU D 1 90  ? 36.536  -47.773 47.681  1.00   43.03  ? 842  LEU D CD1 1 
ATOM   4843 C CD2 . LEU D 1 90  ? 34.846  -46.454 46.397  1.00   54.87  ? 842  LEU D CD2 1 
ATOM   4844 N N   . HIS D 1 91  ? 34.485  -50.450 49.338  1.00   51.64  ? 843  HIS D N   1 
ATOM   4845 C CA  . HIS D 1 91  ? 33.646  -50.231 50.523  1.00   51.54  ? 843  HIS D CA  1 
ATOM   4846 C C   . HIS D 1 91  ? 34.142  -48.935 51.183  1.00   53.16  ? 843  HIS D C   1 
ATOM   4847 O O   . HIS D 1 91  ? 35.292  -48.867 51.543  1.00   55.39  ? 843  HIS D O   1 
ATOM   4848 C CB  . HIS D 1 91  ? 33.762  -51.411 51.489  1.00   57.00  ? 843  HIS D CB  1 
ATOM   4849 C CG  . HIS D 1 91  ? 33.057  -51.205 52.801  1.00   53.92  ? 843  HIS D CG  1 
ATOM   4850 N ND1 . HIS D 1 91  ? 33.733  -50.896 53.962  1.00   58.93  ? 843  HIS D ND1 1 
ATOM   4851 C CD2 . HIS D 1 91  ? 31.753  -51.331 53.149  1.00   59.61  ? 843  HIS D CD2 1 
ATOM   4852 C CE1 . HIS D 1 91  ? 32.871  -50.792 54.961  1.00   62.95  ? 843  HIS D CE1 1 
ATOM   4853 N NE2 . HIS D 1 91  ? 31.661  -51.052 54.494  1.00   67.09  ? 843  HIS D NE2 1 
ATOM   4854 N N   . VAL D 1 92  ? 33.275  -47.915 51.274  1.00   54.01  ? 844  VAL D N   1 
ATOM   4855 C CA  . VAL D 1 92  ? 33.547  -46.686 52.010  1.00   54.80  ? 844  VAL D CA  1 
ATOM   4856 C C   . VAL D 1 92  ? 32.617  -46.643 53.240  1.00   59.43  ? 844  VAL D C   1 
ATOM   4857 O O   . VAL D 1 92  ? 31.413  -46.401 53.081  1.00   61.29  ? 844  VAL D O   1 
ATOM   4858 C CB  . VAL D 1 92  ? 33.267  -45.352 51.183  1.00   47.43  ? 844  VAL D CB  1 
ATOM   4859 C CG1 . VAL D 1 92  ? 33.877  -44.168 51.882  1.00   56.49  ? 844  VAL D CG1 1 
ATOM   4860 C CG2 . VAL D 1 92  ? 33.729  -45.436 49.750  1.00   44.60  ? 844  VAL D CG2 1 
ATOM   4861 N N   . PRO D 1 93  ? 33.179  -46.797 54.456  1.00   58.29  ? 845  PRO D N   1 
ATOM   4862 C CA  . PRO D 1 93  ? 32.420  -46.900 55.695  1.00   58.60  ? 845  PRO D CA  1 
ATOM   4863 C C   . PRO D 1 93  ? 31.594  -45.658 55.948  1.00   57.47  ? 845  PRO D C   1 
ATOM   4864 O O   . PRO D 1 93  ? 32.123  -44.558 55.787  1.00   46.40  ? 845  PRO D O   1 
ATOM   4865 C CB  . PRO D 1 93  ? 33.506  -46.962 56.773  1.00   62.57  ? 845  PRO D CB  1 
ATOM   4866 C CG  . PRO D 1 93  ? 34.787  -47.004 56.059  1.00   58.67  ? 845  PRO D CG  1 
ATOM   4867 C CD  . PRO D 1 93  ? 34.575  -46.440 54.740  1.00   61.14  ? 845  PRO D CD  1 
ATOM   4868 N N   . GLU D 1 94  ? 30.325  -45.824 56.338  1.00   58.45  ? 846  GLU D N   1 
ATOM   4869 C CA  . GLU D 1 94  ? 29.480  -44.669 56.671  1.00   64.59  ? 846  GLU D CA  1 
ATOM   4870 C C   . GLU D 1 94  ? 30.126  -43.866 57.773  1.00   62.61  ? 846  GLU D C   1 
ATOM   4871 O O   . GLU D 1 94  ? 30.998  -44.349 58.500  1.00   65.47  ? 846  GLU D O   1 
ATOM   4872 C CB  . GLU D 1 94  ? 28.079  -45.086 57.105  1.00   66.15  ? 846  GLU D CB  1 
ATOM   4873 C CG  . GLU D 1 94  ? 27.260  -45.682 55.985  1.00   66.49  ? 846  GLU D CG  1 
ATOM   4874 C CD  . GLU D 1 94  ? 25.747  -45.710 56.278  1.00   76.01  ? 846  GLU D CD  1 
ATOM   4875 O OE1 . GLU D 1 94  ? 25.178  -46.824 56.214  1.00   77.41  ? 846  GLU D OE1 1 
ATOM   4876 O OE2 . GLU D 1 94  ? 25.127  -44.646 56.565  1.00   65.73  ? 846  GLU D OE2 1 
ATOM   4877 N N   . GLY D 1 95  ? 29.700  -42.624 57.874  1.00   61.92  ? 847  GLY D N   1 
ATOM   4878 C CA  . GLY D 1 95  ? 30.125  -41.794 58.944  1.00   55.91  ? 847  GLY D CA  1 
ATOM   4879 C C   . GLY D 1 95  ? 30.285  -40.380 58.471  1.00   57.95  ? 847  GLY D C   1 
ATOM   4880 O O   . GLY D 1 95  ? 30.015  -39.444 59.240  1.00   53.10  ? 847  GLY D O   1 
ATOM   4881 N N   . ALA D 1 96  ? 30.735  -40.181 57.229  1.00   49.17  ? 848  ALA D N   1 
ATOM   4882 C CA  . ALA D 1 96  ? 30.971  -38.793 56.810  1.00   48.37  ? 848  ALA D CA  1 
ATOM   4883 C C   . ALA D 1 96  ? 29.563  -38.180 56.589  1.00   45.43  ? 848  ALA D C   1 
ATOM   4884 O O   . ALA D 1 96  ? 28.664  -38.890 56.180  1.00   44.32  ? 848  ALA D O   1 
ATOM   4885 C CB  . ALA D 1 96  ? 31.807  -38.746 55.504  1.00   49.31  ? 848  ALA D CB  1 
ATOM   4886 N N   . THR D 1 97  ? 29.386  -36.879 56.751  1.00   52.54  ? 849  THR D N   1 
ATOM   4887 C CA  . THR D 1 97  ? 28.094  -36.262 56.423  1.00   49.92  ? 849  THR D CA  1 
ATOM   4888 C C   . THR D 1 97  ? 27.795  -36.380 54.915  1.00   56.32  ? 849  THR D C   1 
ATOM   4889 O O   . THR D 1 97  ? 28.666  -36.731 54.124  1.00   51.38  ? 849  THR D O   1 
ATOM   4890 C CB  . THR D 1 97  ? 27.993  -34.773 56.923  1.00   49.82  ? 849  THR D CB  1 
ATOM   4891 O OG1 . THR D 1 97  ? 28.851  -33.904 56.190  1.00   56.26  ? 849  THR D OG1 1 
ATOM   4892 C CG2 . THR D 1 97  ? 28.269  -34.638 58.461  1.00   53.78  ? 849  THR D CG2 1 
ATOM   4893 N N   . PRO D 1 98  ? 26.548  -36.087 54.495  1.00   60.49  ? 850  PRO D N   1 
ATOM   4894 C CA  . PRO D 1 98  ? 26.359  -35.953 53.032  1.00   59.31  ? 850  PRO D CA  1 
ATOM   4895 C C   . PRO D 1 98  ? 27.398  -35.047 52.423  1.00   53.04  ? 850  PRO D C   1 
ATOM   4896 O O   . PRO D 1 98  ? 28.145  -35.467 51.562  1.00   60.43  ? 850  PRO D O   1 
ATOM   4897 C CB  . PRO D 1 98  ? 24.941  -35.341 52.907  1.00   61.04  ? 850  PRO D CB  1 
ATOM   4898 C CG  . PRO D 1 98  ? 24.206  -35.878 54.105  1.00   59.22  ? 850  PRO D CG  1 
ATOM   4899 C CD  . PRO D 1 98  ? 25.277  -35.968 55.233  1.00   60.39  ? 850  PRO D CD  1 
ATOM   4900 N N   . LYS D 1 99  ? 27.442  -33.797 52.862  1.00   51.54  ? 851  LYS D N   1 
ATOM   4901 C CA  . LYS D 1 99  ? 28.354  -32.824 52.275  1.00   49.51  ? 851  LYS D CA  1 
ATOM   4902 C C   . LYS D 1 99  ? 29.883  -33.162 52.332  1.00   47.94  ? 851  LYS D C   1 
ATOM   4903 O O   . LYS D 1 99  ? 30.632  -32.760 51.419  1.00   43.05  ? 851  LYS D O   1 
ATOM   4904 C CB  . LYS D 1 99  ? 28.094  -31.436 52.864  1.00   53.96  ? 851  LYS D CB  1 
ATOM   4905 C CG  . LYS D 1 99  ? 28.841  -30.282 52.130  1.00   59.80  ? 851  LYS D CG  1 
ATOM   4906 C CD  . LYS D 1 99  ? 28.186  -29.832 50.783  1.00   67.53  ? 851  LYS D CD  1 
ATOM   4907 C CE  . LYS D 1 99  ? 29.192  -29.059 49.894  1.00   67.30  ? 851  LYS D CE  1 
ATOM   4908 N NZ  . LYS D 1 99  ? 28.807  -28.880 48.448  1.00   61.74  ? 851  LYS D NZ  1 
ATOM   4909 N N   . ASP D 1 100 ? 30.337  -33.859 53.379  1.00   48.86  ? 852  ASP D N   1 
ATOM   4910 C CA  . ASP D 1 100 ? 31.816  -34.199 53.554  1.00   44.13  ? 852  ASP D CA  1 
ATOM   4911 C C   . ASP D 1 100 ? 32.261  -35.266 52.604  1.00   44.49  ? 852  ASP D C   1 
ATOM   4912 O O   . ASP D 1 100 ? 33.402  -35.271 52.141  1.00   52.38  ? 852  ASP D O   1 
ATOM   4913 C CB  . ASP D 1 100 ? 32.126  -34.592 55.044  1.00   39.91  ? 852  ASP D CB  1 
ATOM   4914 C CG  . ASP D 1 100 ? 33.605  -34.967 55.287  1.00   50.49  ? 852  ASP D CG  1 
ATOM   4915 O OD1 . ASP D 1 100 ? 34.456  -34.093 55.179  1.00   45.56  ? 852  ASP D OD1 1 
ATOM   4916 O OD2 . ASP D 1 100 ? 33.893  -36.123 55.637  1.00   38.40  ? 852  ASP D OD2 1 
ATOM   4917 N N   . GLY D 1 101 ? 31.370  -36.203 52.259  1.00   52.30  ? 853  GLY D N   1 
ATOM   4918 C CA  . GLY D 1 101 ? 31.843  -37.489 51.778  1.00   43.44  ? 853  GLY D CA  1 
ATOM   4919 C C   . GLY D 1 101 ? 32.697  -37.531 50.515  1.00   51.06  ? 853  GLY D C   1 
ATOM   4920 O O   . GLY D 1 101 ? 33.526  -38.471 50.370  1.00   47.51  ? 853  GLY D O   1 
ATOM   4921 N N   . PRO D 1 102 ? 32.524  -36.547 49.592  1.00   47.00  ? 854  PRO D N   1 
ATOM   4922 C CA  . PRO D 1 102 ? 33.421  -36.414 48.412  1.00   43.37  ? 854  PRO D CA  1 
ATOM   4923 C C   . PRO D 1 102 ? 34.875  -36.073 48.765  1.00   42.97  ? 854  PRO D C   1 
ATOM   4924 O O   . PRO D 1 102 ? 35.804  -36.367 47.988  1.00   44.08  ? 854  PRO D O   1 
ATOM   4925 C CB  . PRO D 1 102 ? 32.782  -35.262 47.650  1.00   47.97  ? 854  PRO D CB  1 
ATOM   4926 C CG  . PRO D 1 102 ? 31.390  -35.458 47.942  1.00   36.37  ? 854  PRO D CG  1 
ATOM   4927 C CD  . PRO D 1 102 ? 31.378  -35.652 49.418  1.00   40.36  ? 854  PRO D CD  1 
ATOM   4928 N N   . SER D 1 103 ? 35.067  -35.551 49.960  1.00   44.94  ? 855  SER D N   1 
ATOM   4929 C CA  . SER D 1 103 ? 36.424  -35.425 50.572  1.00   42.06  ? 855  SER D CA  1 
ATOM   4930 C C   . SER D 1 103 ? 37.170  -36.794 50.684  1.00   39.28  ? 855  SER D C   1 
ATOM   4931 O O   . SER D 1 103 ? 38.372  -36.813 50.867  1.00   46.04  ? 855  SER D O   1 
ATOM   4932 C CB  . SER D 1 103 ? 36.337  -34.784 51.913  1.00   39.04  ? 855  SER D CB  1 
ATOM   4933 O OG  . SER D 1 103 ? 36.181  -35.713 52.955  1.00   50.55  ? 855  SER D OG  1 
ATOM   4934 N N   . ALA D 1 104 ? 36.441  -37.911 50.541  1.00   40.14  ? 856  ALA D N   1 
ATOM   4935 C CA  . ALA D 1 104 ? 37.062  -39.228 50.414  1.00   37.77  ? 856  ALA D CA  1 
ATOM   4936 C C   . ALA D 1 104 ? 37.725  -39.583 49.044  1.00   39.91  ? 856  ALA D C   1 
ATOM   4937 O O   . ALA D 1 104 ? 38.446  -40.624 48.908  1.00   36.22  ? 856  ALA D O   1 
ATOM   4938 C CB  . ALA D 1 104 ? 36.039  -40.239 50.714  1.00   33.81  ? 856  ALA D CB  1 
ATOM   4939 N N   . GLY D 1 105 ? 37.521  -38.739 48.030  1.00   34.83  ? 857  GLY D N   1 
ATOM   4940 C CA  . GLY D 1 105 ? 37.976  -39.040 46.646  1.00   32.18  ? 857  GLY D CA  1 
ATOM   4941 C C   . GLY D 1 105 ? 39.415  -39.564 46.536  1.00   35.23  ? 857  GLY D C   1 
ATOM   4942 O O   . GLY D 1 105 ? 39.701  -40.584 45.882  1.00   41.73  ? 857  GLY D O   1 
ATOM   4943 N N   . CYS D 1 106 ? 40.293  -38.874 47.230  1.00   37.08  ? 858  CYS D N   1 
ATOM   4944 C CA  . CYS D 1 106 ? 41.712  -39.064 47.066  1.00   40.40  ? 858  CYS D CA  1 
ATOM   4945 C C   . CYS D 1 106 ? 42.150  -40.378 47.803  1.00   39.00  ? 858  CYS D C   1 
ATOM   4946 O O   . CYS D 1 106 ? 43.123  -41.019 47.437  1.00   39.17  ? 858  CYS D O   1 
ATOM   4947 C CB  . CYS D 1 106 ? 42.392  -37.821 47.675  1.00   42.76  ? 858  CYS D CB  1 
ATOM   4948 S SG  . CYS D 1 106 ? 42.440  -37.709 49.434  1.00   50.62  ? 858  CYS D SG  1 
ATOM   4949 N N   . THR D 1 107 ? 41.409  -40.717 48.860  1.00   40.31  ? 859  THR D N   1 
ATOM   4950 C CA  . THR D 1 107 ? 41.559  -41.925 49.595  1.00   42.87  ? 859  THR D CA  1 
ATOM   4951 C C   . THR D 1 107 ? 41.112  -43.096 48.757  1.00   47.98  ? 859  THR D C   1 
ATOM   4952 O O   . THR D 1 107 ? 41.733  -44.166 48.843  1.00   38.09  ? 859  THR D O   1 
ATOM   4953 C CB  . THR D 1 107 ? 40.845  -41.862 51.049  1.00   38.89  ? 859  THR D CB  1 
ATOM   4954 O OG1 . THR D 1 107 ? 40.832  -40.500 51.496  1.00   42.58  ? 859  THR D OG1 1 
ATOM   4955 C CG2 . THR D 1 107 ? 41.646  -42.692 52.134  1.00   39.43  ? 859  THR D CG2 1 
ATOM   4956 N N   . ILE D 1 108 ? 40.070  -42.906 47.940  1.00   41.02  ? 860  ILE D N   1 
ATOM   4957 C CA  . ILE D 1 108 ? 39.632  -43.910 47.025  1.00   40.34  ? 860  ILE D CA  1 
ATOM   4958 C C   . ILE D 1 108 ? 40.671  -44.171 45.925  1.00   49.75  ? 860  ILE D C   1 
ATOM   4959 O O   . ILE D 1 108 ? 41.013  -45.344 45.636  1.00   44.23  ? 860  ILE D O   1 
ATOM   4960 C CB  . ILE D 1 108 ? 38.245  -43.540 46.441  1.00   44.38  ? 860  ILE D CB  1 
ATOM   4961 C CG1 . ILE D 1 108 ? 37.210  -43.531 47.572  1.00   44.10  ? 860  ILE D CG1 1 
ATOM   4962 C CG2 . ILE D 1 108 ? 37.857  -44.438 45.293  1.00   42.57  ? 860  ILE D CG2 1 
ATOM   4963 C CD1 . ILE D 1 108 ? 36.029  -42.640 47.333  1.00   37.38  ? 860  ILE D CD1 1 
ATOM   4964 N N   . VAL D 1 109 ? 41.181  -43.097 45.336  1.00   44.43  ? 861  VAL D N   1 
ATOM   4965 C CA  . VAL D 1 109 ? 42.218  -43.191 44.292  1.00   40.98  ? 861  VAL D CA  1 
ATOM   4966 C C   . VAL D 1 109 ? 43.311  -44.097 44.859  1.00   43.10  ? 861  VAL D C   1 
ATOM   4967 O O   . VAL D 1 109 ? 43.776  -45.024 44.152  1.00   43.20  ? 861  VAL D O   1 
ATOM   4968 C CB  . VAL D 1 109 ? 42.822  -41.816 43.871  1.00   39.85  ? 861  VAL D CB  1 
ATOM   4969 C CG1 . VAL D 1 109 ? 43.794  -41.971 42.745  1.00   41.50  ? 861  VAL D CG1 1 
ATOM   4970 C CG2 . VAL D 1 109 ? 41.705  -40.845 43.361  1.00   44.92  ? 861  VAL D CG2 1 
ATOM   4971 N N   . THR D 1 110 ? 43.566  -43.920 46.152  1.00   34.81  ? 862  THR D N   1 
ATOM   4972 C CA  . THR D 1 110 ? 44.723  -44.522 46.785  1.00   46.03  ? 862  THR D CA  1 
ATOM   4973 C C   . THR D 1 110 ? 44.385  -45.978 47.028  1.00   45.08  ? 862  THR D C   1 
ATOM   4974 O O   . THR D 1 110 ? 45.099  -46.822 46.544  1.00   44.21  ? 862  THR D O   1 
ATOM   4975 C CB  . THR D 1 110 ? 45.253  -43.756 47.977  1.00   46.29  ? 862  THR D CB  1 
ATOM   4976 O OG1 . THR D 1 110 ? 45.357  -42.339 47.653  1.00   34.53  ? 862  THR D OG1 1 
ATOM   4977 C CG2 . THR D 1 110 ? 46.624  -44.243 48.239  1.00   44.16  ? 862  THR D CG2 1 
ATOM   4978 N N   . ALA D 1 111 ? 43.258  -46.262 47.695  1.00   44.13  ? 863  ALA D N   1 
ATOM   4979 C CA  . ALA D 1 111 ? 42.769  -47.626 47.740  1.00   49.85  ? 863  ALA D CA  1 
ATOM   4980 C C   . ALA D 1 111 ? 43.060  -48.298 46.409  1.00   47.07  ? 863  ALA D C   1 
ATOM   4981 O O   . ALA D 1 111 ? 43.797  -49.261 46.357  1.00   50.21  ? 863  ALA D O   1 
ATOM   4982 C CB  . ALA D 1 111 ? 41.292  -47.685 48.027  1.00   45.66  ? 863  ALA D CB  1 
ATOM   4983 N N   . LEU D 1 112 ? 42.486  -47.772 45.339  1.00   47.69  ? 864  LEU D N   1 
ATOM   4984 C CA  . LEU D 1 112 ? 42.469  -48.445 44.039  1.00   45.62  ? 864  LEU D CA  1 
ATOM   4985 C C   . LEU D 1 112 ? 43.846  -48.634 43.557  1.00   40.37  ? 864  LEU D C   1 
ATOM   4986 O O   . LEU D 1 112 ? 44.177  -49.736 43.112  1.00   37.11  ? 864  LEU D O   1 
ATOM   4987 C CB  . LEU D 1 112 ? 41.748  -47.635 42.964  1.00   43.62  ? 864  LEU D CB  1 
ATOM   4988 C CG  . LEU D 1 112 ? 40.272  -47.391 43.192  1.00   38.79  ? 864  LEU D CG  1 
ATOM   4989 C CD1 . LEU D 1 112 ? 39.828  -46.396 42.204  1.00   41.20  ? 864  LEU D CD1 1 
ATOM   4990 C CD2 . LEU D 1 112 ? 39.435  -48.761 43.127  1.00   49.98  ? 864  LEU D CD2 1 
ATOM   4991 N N   . LEU D 1 113 ? 44.695  -47.593 43.690  1.00   40.76  ? 865  LEU D N   1 
ATOM   4992 C CA  . LEU D 1 113 ? 46.021  -47.751 43.125  1.00   39.33  ? 865  LEU D CA  1 
ATOM   4993 C C   . LEU D 1 113 ? 46.808  -48.823 43.910  1.00   38.96  ? 865  LEU D C   1 
ATOM   4994 O O   . LEU D 1 113 ? 47.546  -49.630 43.306  1.00   49.12  ? 865  LEU D O   1 
ATOM   4995 C CB  . LEU D 1 113 ? 46.759  -46.403 43.066  1.00   41.20  ? 865  LEU D CB  1 
ATOM   4996 C CG  . LEU D 1 113 ? 46.165  -45.311 42.120  1.00   33.34  ? 865  LEU D CG  1 
ATOM   4997 C CD1 . LEU D 1 113 ? 47.028  -44.061 42.154  1.00   36.75  ? 865  LEU D CD1 1 
ATOM   4998 C CD2 . LEU D 1 113 ? 46.218  -45.890 40.634  1.00   30.71  ? 865  LEU D CD2 1 
ATOM   4999 N N   . SER D 1 114 ? 46.617  -48.853 45.229  1.00   44.50  ? 866  SER D N   1 
ATOM   5000 C CA  . SER D 1 114 ? 47.322  -49.767 46.127  1.00   43.74  ? 866  SER D CA  1 
ATOM   5001 C C   . SER D 1 114 ? 46.979  -51.193 45.698  1.00   43.94  ? 866  SER D C   1 
ATOM   5002 O O   . SER D 1 114 ? 47.858  -51.941 45.354  1.00   45.23  ? 866  SER D O   1 
ATOM   5003 C CB  . SER D 1 114 ? 46.946  -49.522 47.587  1.00   51.87  ? 866  SER D CB  1 
ATOM   5004 O OG  . SER D 1 114 ? 47.198  -50.657 48.457  1.00   50.13  ? 866  SER D OG  1 
ATOM   5005 N N   . LEU D 1 115 ? 45.684  -51.522 45.690  1.00   43.25  ? 867  LEU D N   1 
ATOM   5006 C CA  . LEU D 1 115 ? 45.185  -52.822 45.268  1.00   40.10  ? 867  LEU D CA  1 
ATOM   5007 C C   . LEU D 1 115 ? 45.753  -53.218 43.939  1.00   47.30  ? 867  LEU D C   1 
ATOM   5008 O O   . LEU D 1 115 ? 46.289  -54.306 43.797  1.00   50.24  ? 867  LEU D O   1 
ATOM   5009 C CB  . LEU D 1 115 ? 43.651  -52.783 45.176  1.00   40.87  ? 867  LEU D CB  1 
ATOM   5010 C CG  . LEU D 1 115 ? 42.941  -54.078 44.829  1.00   46.41  ? 867  LEU D CG  1 
ATOM   5011 C CD1 . LEU D 1 115 ? 43.439  -55.280 45.651  1.00   69.27  ? 867  LEU D CD1 1 
ATOM   5012 C CD2 . LEU D 1 115 ? 41.424  -53.900 44.988  1.00   50.12  ? 867  LEU D CD2 1 
ATOM   5013 N N   . ALA D 1 116 ? 45.658  -52.300 42.967  1.00   53.86  ? 868  ALA D N   1 
ATOM   5014 C CA  . ALA D 1 116 ? 46.101  -52.509 41.572  1.00   48.73  ? 868  ALA D CA  1 
ATOM   5015 C C   . ALA D 1 116 ? 47.539  -52.908 41.466  1.00   49.73  ? 868  ALA D C   1 
ATOM   5016 O O   . ALA D 1 116 ? 47.881  -53.774 40.653  1.00   42.08  ? 868  ALA D O   1 
ATOM   5017 C CB  . ALA D 1 116 ? 45.914  -51.201 40.788  1.00   54.09  ? 868  ALA D CB  1 
ATOM   5018 N N   . MET D 1 117 ? 48.386  -52.159 42.204  1.00   55.03  ? 869  MET D N   1 
ATOM   5019 C CA  . MET D 1 117 ? 49.828  -52.400 42.291  1.00   50.93  ? 869  MET D CA  1 
ATOM   5020 C C   . MET D 1 117 ? 50.226  -53.577 43.277  1.00   54.57  ? 869  MET D C   1 
ATOM   5021 O O   . MET D 1 117 ? 51.388  -53.991 43.288  1.00   61.32  ? 869  MET D O   1 
ATOM   5022 C CB  . MET D 1 117 ? 50.581  -51.130 42.735  1.00   47.29  ? 869  MET D CB  1 
ATOM   5023 C CG  . MET D 1 117 ? 50.323  -49.929 41.960  1.00   50.95  ? 869  MET D CG  1 
ATOM   5024 S SD  . MET D 1 117 ? 51.511  -48.616 42.314  1.00   51.64  ? 869  MET D SD  1 
ATOM   5025 C CE  . MET D 1 117 ? 51.182  -48.071 43.938  1.00   29.31  ? 869  MET D CE  1 
ATOM   5026 N N   . GLY D 1 118 ? 49.279  -54.082 44.068  1.00   57.84  ? 870  GLY D N   1 
ATOM   5027 C CA  . GLY D 1 118 ? 49.506  -55.157 45.070  1.00   58.42  ? 870  GLY D CA  1 
ATOM   5028 C C   . GLY D 1 118 ? 50.369  -54.708 46.235  1.00   61.39  ? 870  GLY D C   1 
ATOM   5029 O O   . GLY D 1 118 ? 51.205  -55.490 46.747  1.00   51.91  ? 870  GLY D O   1 
ATOM   5030 N N   . ARG D 1 119 ? 50.155  -53.447 46.645  1.00   54.29  ? 871  ARG D N   1 
ATOM   5031 C CA  . ARG D 1 119 ? 51.152  -52.731 47.416  1.00   56.18  ? 871  ARG D CA  1 
ATOM   5032 C C   . ARG D 1 119 ? 50.515  -51.832 48.447  1.00   51.36  ? 871  ARG D C   1 
ATOM   5033 O O   . ARG D 1 119 ? 49.769  -50.918 48.096  1.00   62.24  ? 871  ARG D O   1 
ATOM   5034 C CB  . ARG D 1 119 ? 52.026  -51.940 46.499  1.00   54.87  ? 871  ARG D CB  1 
ATOM   5035 C CG  . ARG D 1 119 ? 53.267  -51.412 47.138  1.00   57.05  ? 871  ARG D CG  1 
ATOM   5036 C CD  . ARG D 1 119 ? 53.290  -49.942 46.926  1.00   58.48  ? 871  ARG D CD  1 
ATOM   5037 N NE  . ARG D 1 119 ? 54.598  -49.348 47.140  1.00   65.54  ? 871  ARG D NE  1 
ATOM   5038 C CZ  . ARG D 1 119 ? 55.051  -48.853 48.290  1.00   71.57  ? 871  ARG D CZ  1 
ATOM   5039 N NH1 . ARG D 1 119 ? 54.296  -48.834 49.418  1.00   68.88  ? 871  ARG D NH1 1 
ATOM   5040 N NH2 . ARG D 1 119 ? 56.282  -48.330 48.291  1.00   74.96  ? 871  ARG D NH2 1 
ATOM   5041 N N   . PRO D 1 120 ? 50.780  -52.099 49.724  1.00   44.94  ? 872  PRO D N   1 
ATOM   5042 C CA  . PRO D 1 120 ? 50.267  -51.293 50.787  1.00   39.64  ? 872  PRO D CA  1 
ATOM   5043 C C   . PRO D 1 120 ? 50.808  -49.894 50.820  1.00   43.72  ? 872  PRO D C   1 
ATOM   5044 O O   . PRO D 1 120 ? 51.929  -49.610 50.352  1.00   46.23  ? 872  PRO D O   1 
ATOM   5045 C CB  . PRO D 1 120 ? 50.694  -52.055 52.072  1.00   46.01  ? 872  PRO D CB  1 
ATOM   5046 C CG  . PRO D 1 120 ? 51.876  -52.779 51.639  1.00   39.31  ? 872  PRO D CG  1 
ATOM   5047 C CD  . PRO D 1 120 ? 51.611  -53.198 50.252  1.00   45.39  ? 872  PRO D CD  1 
ATOM   5048 N N   . VAL D 1 121 ? 49.970  -49.013 51.371  1.00   46.88  ? 873  VAL D N   1 
ATOM   5049 C CA  . VAL D 1 121 ? 50.405  -47.633 51.638  1.00   47.85  ? 873  VAL D CA  1 
ATOM   5050 C C   . VAL D 1 121 ? 51.258  -47.599 52.832  1.00   51.55  ? 873  VAL D C   1 
ATOM   5051 O O   . VAL D 1 121 ? 51.022  -48.283 53.800  1.00   56.16  ? 873  VAL D O   1 
ATOM   5052 C CB  . VAL D 1 121 ? 49.239  -46.695 51.988  1.00   52.08  ? 873  VAL D CB  1 
ATOM   5053 C CG1 . VAL D 1 121 ? 49.783  -45.205 52.228  1.00   49.08  ? 873  VAL D CG1 1 
ATOM   5054 C CG2 . VAL D 1 121 ? 48.147  -46.822 50.896  1.00   39.41  ? 873  VAL D CG2 1 
ATOM   5055 N N   . ARG D 1 122 ? 52.207  -46.706 52.814  1.00   52.88  ? 874  ARG D N   1 
ATOM   5056 C CA  . ARG D 1 122 ? 52.936  -46.416 54.020  1.00   45.58  ? 874  ARG D CA  1 
ATOM   5057 C C   . ARG D 1 122 ? 52.111  -46.306 55.292  1.00   52.25  ? 874  ARG D C   1 
ATOM   5058 O O   . ARG D 1 122 ? 50.957  -45.770 55.291  1.00   46.56  ? 874  ARG D O   1 
ATOM   5059 C CB  . ARG D 1 122 ? 53.815  -45.188 53.738  1.00   50.42  ? 874  ARG D CB  1 
ATOM   5060 C CG  . ARG D 1 122 ? 53.068  -43.885 53.564  1.00   55.09  ? 874  ARG D CG  1 
ATOM   5061 C CD  . ARG D 1 122 ? 53.942  -42.728 54.007  1.00   42.04  ? 874  ARG D CD  1 
ATOM   5062 N NE  . ARG D 1 122 ? 54.022  -42.582 55.419  1.00   43.38  ? 874  ARG D NE  1 
ATOM   5063 C CZ  . ARG D 1 122 ? 54.548  -41.526 56.035  1.00   39.45  ? 874  ARG D CZ  1 
ATOM   5064 N NH1 . ARG D 1 122 ? 55.014  -40.497 55.320  1.00   59.76  ? 874  ARG D NH1 1 
ATOM   5065 N NH2 . ARG D 1 122 ? 54.565  -41.480 57.345  1.00   43.30  ? 874  ARG D NH2 1 
ATOM   5066 N N   . GLN D 1 123 ? 52.659  -46.907 56.378  1.00   45.09  ? 875  GLN D N   1 
ATOM   5067 C CA  . GLN D 1 123 ? 52.086  -46.775 57.718  1.00   47.80  ? 875  GLN D CA  1 
ATOM   5068 C C   . GLN D 1 123 ? 52.009  -45.311 58.118  1.00   44.81  ? 875  GLN D C   1 
ATOM   5069 O O   . GLN D 1 123 ? 52.785  -44.470 57.613  1.00   54.22  ? 875  GLN D O   1 
ATOM   5070 C CB  . GLN D 1 123 ? 52.896  -47.597 58.827  1.00   50.89  ? 875  GLN D CB  1 
ATOM   5071 C CG  . GLN D 1 123 ? 52.497  -49.120 58.879  1.00   62.97  ? 875  GLN D CG  1 
ATOM   5072 C CD  . GLN D 1 123 ? 52.501  -49.748 60.303  1.00   77.55  ? 875  GLN D CD  1 
ATOM   5073 O OE1 . GLN D 1 123 ? 53.536  -50.273 60.764  1.00   72.19  ? 875  GLN D OE1 1 
ATOM   5074 N NE2 . GLN D 1 123 ? 51.333  -49.719 60.978  1.00   69.22  ? 875  GLN D NE2 1 
ATOM   5075 N N   . ASN D 1 124 ? 51.093  -45.054 59.043  1.00   46.86  ? 876  ASN D N   1 
ATOM   5076 C CA  . ASN D 1 124 ? 50.993  -43.821 59.761  1.00   56.19  ? 876  ASN D CA  1 
ATOM   5077 C C   . ASN D 1 124 ? 50.775  -42.722 58.744  1.00   57.96  ? 876  ASN D C   1 
ATOM   5078 O O   . ASN D 1 124 ? 51.662  -41.885 58.561  1.00   61.18  ? 876  ASN D O   1 
ATOM   5079 C CB  . ASN D 1 124 ? 52.288  -43.486 60.559  1.00   58.65  ? 876  ASN D CB  1 
ATOM   5080 C CG  . ASN D 1 124 ? 52.176  -42.140 61.267  1.00   56.72  ? 876  ASN D CG  1 
ATOM   5081 O OD1 . ASN D 1 124 ? 51.173  -41.875 61.945  1.00   61.52  ? 876  ASN D OD1 1 
ATOM   5082 N ND2 . ASN D 1 124 ? 53.179  -41.278 61.100  1.00   45.32  ? 876  ASN D ND2 1 
ATOM   5083 N N   . LEU D 1 125 ? 49.653  -42.804 58.025  1.00   52.18  ? 877  LEU D N   1 
ATOM   5084 C CA  . LEU D 1 125 ? 49.274  -41.780 57.083  1.00   46.81  ? 877  LEU D CA  1 
ATOM   5085 C C   . LEU D 1 125 ? 47.794  -41.733 56.981  1.00   37.91  ? 877  LEU D C   1 
ATOM   5086 O O   . LEU D 1 125 ? 47.189  -42.752 56.763  1.00   36.56  ? 877  LEU D O   1 
ATOM   5087 C CB  . LEU D 1 125 ? 49.814  -42.072 55.714  1.00   43.38  ? 877  LEU D CB  1 
ATOM   5088 C CG  . LEU D 1 125 ? 49.454  -41.039 54.614  1.00   46.13  ? 877  LEU D CG  1 
ATOM   5089 C CD1 . LEU D 1 125 ? 50.100  -39.646 54.980  1.00   40.70  ? 877  LEU D CD1 1 
ATOM   5090 C CD2 . LEU D 1 125 ? 49.856  -41.558 53.244  1.00   49.12  ? 877  LEU D CD2 1 
ATOM   5091 N N   . ALA D 1 126 ? 47.233  -40.536 57.111  1.00   41.07  ? 878  ALA D N   1 
ATOM   5092 C CA  . ALA D 1 126 ? 45.808  -40.285 56.895  1.00   39.40  ? 878  ALA D CA  1 
ATOM   5093 C C   . ALA D 1 126 ? 45.577  -39.167 55.841  1.00   42.79  ? 878  ALA D C   1 
ATOM   5094 O O   . ALA D 1 126 ? 46.455  -38.317 55.651  1.00   39.02  ? 878  ALA D O   1 
ATOM   5095 C CB  . ALA D 1 126 ? 45.086  -39.941 58.244  1.00   33.53  ? 878  ALA D CB  1 
ATOM   5096 N N   . MET D 1 127 ? 44.415  -39.153 55.175  1.00   40.52  ? 879  MET D N   1 
ATOM   5097 C CA  . MET D 1 127 ? 44.139  -38.158 54.077  1.00   46.15  ? 879  MET D CA  1 
ATOM   5098 C C   . MET D 1 127 ? 42.711  -37.778 53.897  1.00   50.16  ? 879  MET D C   1 
ATOM   5099 O O   . MET D 1 127 ? 41.800  -38.589 54.155  1.00   49.11  ? 879  MET D O   1 
ATOM   5100 C CB  . MET D 1 127 ? 44.730  -38.564 52.721  1.00   42.84  ? 879  MET D CB  1 
ATOM   5101 C CG  . MET D 1 127 ? 43.978  -39.628 51.974  1.00   39.42  ? 879  MET D CG  1 
ATOM   5102 S SD  . MET D 1 127 ? 44.840  -40.253 50.549  1.00   40.54  ? 879  MET D SD  1 
ATOM   5103 C CE  . MET D 1 127 ? 46.403  -41.123 51.117  1.00   42.53  ? 879  MET D CE  1 
ATOM   5104 N N   . THR D 1 128 ? 42.524  -36.519 53.472  1.00   46.65  ? 880  THR D N   1 
ATOM   5105 C CA  . THR D 1 128 ? 41.205  -35.998 53.104  1.00   43.57  ? 880  THR D CA  1 
ATOM   5106 C C   . THR D 1 128 ? 41.348  -35.069 51.936  1.00   47.18  ? 880  THR D C   1 
ATOM   5107 O O   . THR D 1 128 ? 42.239  -34.207 51.885  1.00   46.73  ? 880  THR D O   1 
ATOM   5108 C CB  . THR D 1 128 ? 40.563  -35.247 54.198  1.00   38.93  ? 880  THR D CB  1 
ATOM   5109 O OG1 . THR D 1 128 ? 39.150  -35.096 53.918  1.00   35.62  ? 880  THR D OG1 1 
ATOM   5110 C CG2 . THR D 1 128 ? 41.239  -33.900 54.374  1.00   42.72  ? 880  THR D CG2 1 
ATOM   5111 N N   . GLY D 1 129 ? 40.495  -35.262 50.958  1.00   43.93  ? 881  GLY D N   1 
ATOM   5112 C CA  . GLY D 1 129 ? 40.649  -34.462 49.776  1.00   47.25  ? 881  GLY D CA  1 
ATOM   5113 C C   . GLY D 1 129 ? 39.725  -34.833 48.665  1.00   44.02  ? 881  GLY D C   1 
ATOM   5114 O O   . GLY D 1 129 ? 39.643  -35.998 48.223  1.00   43.90  ? 881  GLY D O   1 
ATOM   5115 N N   . GLU D 1 130 ? 39.088  -33.795 48.145  1.00   46.41  ? 882  GLU D N   1 
ATOM   5116 C CA  . GLU D 1 130 ? 38.290  -33.929 46.926  1.00   45.56  ? 882  GLU D CA  1 
ATOM   5117 C C   . GLU D 1 130 ? 39.182  -34.019 45.706  1.00   35.53  ? 882  GLU D C   1 
ATOM   5118 O O   . GLU D 1 130 ? 40.101  -33.195 45.505  1.00   39.36  ? 882  GLU D O   1 
ATOM   5119 C CB  . GLU D 1 130 ? 37.333  -32.737 46.901  1.00   52.25  ? 882  GLU D CB  1 
ATOM   5120 C CG  . GLU D 1 130 ? 36.196  -32.822 45.961  1.00   54.45  ? 882  GLU D CG  1 
ATOM   5121 C CD  . GLU D 1 130 ? 34.979  -32.060 46.494  1.00   55.26  ? 882  GLU D CD  1 
ATOM   5122 O OE1 . GLU D 1 130 ? 34.797  -31.810 47.744  1.00   55.04  ? 882  GLU D OE1 1 
ATOM   5123 O OE2 . GLU D 1 130 ? 34.157  -31.769 45.648  1.00   52.26  ? 882  GLU D OE2 1 
ATOM   5124 N N   . VAL D 1 131 ? 38.951  -35.013 44.862  1.00   39.01  ? 883  VAL D N   1 
ATOM   5125 C CA  . VAL D 1 131 ? 39.667  -35.124 43.617  1.00   33.63  ? 883  VAL D CA  1 
ATOM   5126 C C   . VAL D 1 131 ? 38.839  -34.933 42.388  1.00   42.00  ? 883  VAL D C   1 
ATOM   5127 O O   . VAL D 1 131 ? 37.825  -35.597 42.227  1.00   44.61  ? 883  VAL D O   1 
ATOM   5128 C CB  . VAL D 1 131 ? 40.472  -36.470 43.504  1.00   36.72  ? 883  VAL D CB  1 
ATOM   5129 C CG1 . VAL D 1 131 ? 39.552  -37.662 43.661  1.00   30.80  ? 883  VAL D CG1 1 
ATOM   5130 C CG2 . VAL D 1 131 ? 41.244  -36.490 42.225  1.00   43.22  ? 883  VAL D CG2 1 
ATOM   5131 N N   . SER D 1 132 ? 39.368  -34.076 41.489  1.00   42.14  ? 884  SER D N   1 
ATOM   5132 C CA  . SER D 1 132 ? 38.863  -33.859 40.114  1.00   46.41  ? 884  SER D CA  1 
ATOM   5133 C C   . SER D 1 132 ? 39.207  -35.041 39.245  1.00   49.15  ? 884  SER D C   1 
ATOM   5134 O O   . SER D 1 132 ? 39.888  -36.007 39.690  1.00   45.88  ? 884  SER D O   1 
ATOM   5135 C CB  . SER D 1 132 ? 39.380  -32.528 39.517  1.00   46.20  ? 884  SER D CB  1 
ATOM   5136 O OG  . SER D 1 132 ? 40.512  -32.691 38.650  1.00   39.33  ? 884  SER D OG  1 
ATOM   5137 N N   . LEU D 1 133 ? 38.630  -34.993 38.061  1.00   36.70  ? 885  LEU D N   1 
ATOM   5138 C CA  . LEU D 1 133 ? 38.700  -36.023 37.035  1.00   43.67  ? 885  LEU D CA  1 
ATOM   5139 C C   . LEU D 1 133 ? 40.089  -36.102 36.491  1.00   45.65  ? 885  LEU D C   1 
ATOM   5140 O O   . LEU D 1 133 ? 40.577  -37.186 36.194  1.00   42.44  ? 885  LEU D O   1 
ATOM   5141 C CB  . LEU D 1 133 ? 37.784  -35.643 35.909  1.00   37.85  ? 885  LEU D CB  1 
ATOM   5142 C CG  . LEU D 1 133 ? 36.905  -36.580 35.126  1.00   46.92  ? 885  LEU D CG  1 
ATOM   5143 C CD1 . LEU D 1 133 ? 37.195  -36.299 33.595  1.00   31.40  ? 885  LEU D CD1 1 
ATOM   5144 C CD2 . LEU D 1 133 ? 37.024  -38.048 35.511  1.00   42.03  ? 885  LEU D CD2 1 
ATOM   5145 N N   . THR D 1 134 ? 40.711  -34.946 36.372  1.00   41.70  ? 886  THR D N   1 
ATOM   5146 C CA  . THR D 1 134 ? 42.122  -34.847 35.962  1.00   42.87  ? 886  THR D CA  1 
ATOM   5147 C C   . THR D 1 134 ? 43.118  -34.809 37.102  1.00   42.81  ? 886  THR D C   1 
ATOM   5148 O O   . THR D 1 134 ? 44.303  -34.479 36.898  1.00   43.72  ? 886  THR D O   1 
ATOM   5149 C CB  . THR D 1 134 ? 42.373  -33.579 35.094  1.00   44.19  ? 886  THR D CB  1 
ATOM   5150 O OG1 . THR D 1 134 ? 41.913  -32.406 35.758  1.00   44.28  ? 886  THR D OG1 1 
ATOM   5151 C CG2 . THR D 1 134 ? 41.683  -33.650 33.787  1.00   37.16  ? 886  THR D CG2 1 
ATOM   5152 N N   . GLY D 1 135 ? 42.659  -35.065 38.320  1.00   40.79  ? 887  GLY D N   1 
ATOM   5153 C CA  . GLY D 1 135 ? 43.579  -35.294 39.432  1.00   47.58  ? 887  GLY D CA  1 
ATOM   5154 C C   . GLY D 1 135 ? 43.878  -34.089 40.344  1.00   46.72  ? 887  GLY D C   1 
ATOM   5155 O O   . GLY D 1 135 ? 44.705  -34.200 41.217  1.00   48.49  ? 887  GLY D O   1 
ATOM   5156 N N   . LYS D 1 136 ? 43.202  -32.956 40.151  1.00   40.60  ? 888  LYS D N   1 
ATOM   5157 C CA  . LYS D 1 136 ? 43.259  -31.854 41.092  1.00   47.74  ? 888  LYS D CA  1 
ATOM   5158 C C   . LYS D 1 136 ? 42.569  -32.182 42.404  1.00   46.18  ? 888  LYS D C   1 
ATOM   5159 O O   . LYS D 1 136 ? 41.514  -32.815 42.455  1.00   47.92  ? 888  LYS D O   1 
ATOM   5160 C CB  . LYS D 1 136 ? 42.580  -30.611 40.464  1.00   51.75  ? 888  LYS D CB  1 
ATOM   5161 C CG  . LYS D 1 136 ? 43.469  -29.350 40.392  1.00   59.32  ? 888  LYS D CG  1 
ATOM   5162 C CD  . LYS D 1 136 ? 43.280  -28.433 41.634  1.00   61.99  ? 888  LYS D CD  1 
ATOM   5163 C CE  . LYS D 1 136 ? 44.604  -27.700 42.058  1.00   57.49  ? 888  LYS D CE  1 
ATOM   5164 N NZ  . LYS D 1 136 ? 45.001  -28.076 43.490  1.00   46.12  ? 888  LYS D NZ  1 
ATOM   5165 N N   . ILE D 1 137 ? 43.154  -31.645 43.466  1.00   39.85  ? 889  ILE D N   1 
ATOM   5166 C CA  . ILE D 1 137 ? 42.752  -31.823 44.748  1.00   40.73  ? 889  ILE D CA  1 
ATOM   5167 C C   . ILE D 1 137 ? 42.080  -30.535 45.216  1.00   42.86  ? 889  ILE D C   1 
ATOM   5168 O O   . ILE D 1 137 ? 42.670  -29.470 45.193  1.00   46.15  ? 889  ILE D O   1 
ATOM   5169 C CB  . ILE D 1 137 ? 43.958  -32.293 45.635  1.00   32.57  ? 889  ILE D CB  1 
ATOM   5170 C CG1 . ILE D 1 137 ? 44.423  -33.636 45.084  1.00   38.90  ? 889  ILE D CG1 1 
ATOM   5171 C CG2 . ILE D 1 137 ? 43.471  -32.441 47.046  1.00   34.73  ? 889  ILE D CG2 1 
ATOM   5172 C CD1 . ILE D 1 137 ? 45.801  -33.989 45.479  1.00   59.39  ? 889  ILE D CD1 1 
ATOM   5173 N N   . LEU D 1 138 ? 40.824  -30.625 45.608  1.00   39.74  ? 890  LEU D N   1 
ATOM   5174 C CA  . LEU D 1 138 ? 40.075  -29.384 45.987  1.00   42.76  ? 890  LEU D CA  1 
ATOM   5175 C C   . LEU D 1 138 ? 39.778  -29.270 47.473  1.00   42.90  ? 890  LEU D C   1 
ATOM   5176 O O   . LEU D 1 138 ? 39.603  -30.302 48.151  1.00   45.72  ? 890  LEU D O   1 
ATOM   5177 C CB  . LEU D 1 138 ? 38.752  -29.372 45.249  1.00   49.87  ? 890  LEU D CB  1 
ATOM   5178 C CG  . LEU D 1 138 ? 38.538  -28.844 43.806  1.00   46.12  ? 890  LEU D CG  1 
ATOM   5179 C CD1 . LEU D 1 138 ? 39.460  -29.405 42.718  1.00   51.48  ? 890  LEU D CD1 1 
ATOM   5180 C CD2 . LEU D 1 138 ? 37.002  -29.052 43.474  1.00   33.10  ? 890  LEU D CD2 1 
ATOM   5181 N N   . PRO D 1 139 ? 39.611  -28.022 47.990  1.00   46.37  ? 891  PRO D N   1 
ATOM   5182 C CA  . PRO D 1 139 ? 39.412  -27.816 49.420  1.00   46.59  ? 891  PRO D CA  1 
ATOM   5183 C C   . PRO D 1 139 ? 38.195  -28.470 50.016  1.00   48.35  ? 891  PRO D C   1 
ATOM   5184 O O   . PRO D 1 139 ? 37.230  -28.724 49.323  1.00   45.93  ? 891  PRO D O   1 
ATOM   5185 C CB  . PRO D 1 139 ? 39.270  -26.294 49.546  1.00   49.20  ? 891  PRO D CB  1 
ATOM   5186 C CG  . PRO D 1 139 ? 38.858  -25.850 48.149  1.00   42.71  ? 891  PRO D CG  1 
ATOM   5187 C CD  . PRO D 1 139 ? 39.531  -26.755 47.226  1.00   37.42  ? 891  PRO D CD  1 
ATOM   5188 N N   . VAL D 1 140 ? 38.248  -28.789 51.320  1.00   42.76  ? 892  VAL D N   1 
ATOM   5189 C CA  . VAL D 1 140 ? 37.140  -29.488 51.965  1.00   48.67  ? 892  VAL D CA  1 
ATOM   5190 C C   . VAL D 1 140 ? 36.815  -28.856 53.246  1.00   45.89  ? 892  VAL D C   1 
ATOM   5191 O O   . VAL D 1 140 ? 37.577  -28.004 53.717  1.00   51.98  ? 892  VAL D O   1 
ATOM   5192 C CB  . VAL D 1 140 ? 37.477  -30.993 52.203  1.00   51.05  ? 892  VAL D CB  1 
ATOM   5193 C CG1 . VAL D 1 140 ? 37.543  -31.676 50.889  1.00   49.59  ? 892  VAL D CG1 1 
ATOM   5194 C CG2 . VAL D 1 140 ? 38.832  -31.194 53.082  1.00   44.69  ? 892  VAL D CG2 1 
ATOM   5195 N N   . GLY D 1 141 ? 35.712  -29.305 53.841  1.00   48.06  ? 893  GLY D N   1 
ATOM   5196 C CA  . GLY D 1 141 ? 35.231  -28.832 55.122  1.00   44.23  ? 893  GLY D CA  1 
ATOM   5197 C C   . GLY D 1 141 ? 35.747  -29.643 56.342  1.00   50.33  ? 893  GLY D C   1 
ATOM   5198 O O   . GLY D 1 141 ? 36.359  -30.700 56.203  1.00   52.06  ? 893  GLY D O   1 
ATOM   5199 N N   . GLY D 1 142 ? 35.501  -29.132 57.541  1.00   55.70  ? 894  GLY D N   1 
ATOM   5200 C CA  . GLY D 1 142 ? 35.797  -29.849 58.777  1.00   58.02  ? 894  GLY D CA  1 
ATOM   5201 C C   . GLY D 1 142 ? 37.237  -30.220 59.000  1.00   56.90  ? 894  GLY D C   1 
ATOM   5202 O O   . GLY D 1 142 ? 37.568  -31.412 59.137  1.00   57.32  ? 894  GLY D O   1 
ATOM   5203 N N   . ILE D 1 143 ? 38.094  -29.199 59.042  1.00   48.55  ? 895  ILE D N   1 
ATOM   5204 C CA  . ILE D 1 143 ? 39.525  -29.423 59.060  1.00   47.56  ? 895  ILE D CA  1 
ATOM   5205 C C   . ILE D 1 143 ? 39.949  -29.600 60.499  1.00   49.99  ? 895  ILE D C   1 
ATOM   5206 O O   . ILE D 1 143 ? 40.881  -30.353 60.785  1.00   46.05  ? 895  ILE D O   1 
ATOM   5207 C CB  . ILE D 1 143 ? 40.269  -28.256 58.470  1.00   45.80  ? 895  ILE D CB  1 
ATOM   5208 C CG1 . ILE D 1 143 ? 39.972  -28.124 56.970  1.00   47.39  ? 895  ILE D CG1 1 
ATOM   5209 C CG2 . ILE D 1 143 ? 41.775  -28.402 58.703  1.00   48.77  ? 895  ILE D CG2 1 
ATOM   5210 C CD1 . ILE D 1 143 ? 40.404  -29.308 56.104  1.00   37.87  ? 895  ILE D CD1 1 
ATOM   5211 N N   . LYS D 1 144 ? 39.249  -28.896 61.380  1.00   43.57  ? 896  LYS D N   1 
ATOM   5212 C CA  . LYS D 1 144 ? 39.451  -28.927 62.794  1.00   50.05  ? 896  LYS D CA  1 
ATOM   5213 C C   . LYS D 1 144 ? 39.074  -30.311 63.265  1.00   48.11  ? 896  LYS D C   1 
ATOM   5214 O O   . LYS D 1 144 ? 39.876  -30.961 63.945  1.00   56.03  ? 896  LYS D O   1 
ATOM   5215 C CB  . LYS D 1 144 ? 38.613  -27.829 63.475  1.00   42.48  ? 896  LYS D CB  1 
ATOM   5216 C CG  . LYS D 1 144 ? 38.672  -27.838 65.038  1.00   58.75  ? 896  LYS D CG  1 
ATOM   5217 C CD  . LYS D 1 144 ? 38.143  -26.531 65.685  1.00   54.27  ? 896  LYS D CD  1 
ATOM   5218 C CE  . LYS D 1 144 ? 36.575  -26.536 65.804  1.00   63.85  ? 896  LYS D CE  1 
ATOM   5219 N NZ  . LYS D 1 144 ? 35.919  -25.519 66.733  1.00   48.68  ? 896  LYS D NZ  1 
ATOM   5220 N N   . GLU D 1 145 ? 37.931  -30.801 62.798  1.00   45.08  ? 897  GLU D N   1 
ATOM   5221 C CA  . GLU D 1 145 ? 37.381  -32.123 63.195  1.00   41.91  ? 897  GLU D CA  1 
ATOM   5222 C C   . GLU D 1 145 ? 38.340  -33.253 62.839  1.00   49.84  ? 897  GLU D C   1 
ATOM   5223 O O   . GLU D 1 145 ? 38.611  -34.201 63.657  1.00   49.85  ? 897  GLU D O   1 
ATOM   5224 C CB  . GLU D 1 145 ? 35.926  -32.350 62.649  1.00   49.32  ? 897  GLU D CB  1 
ATOM   5225 C CG  . GLU D 1 145 ? 34.768  -31.596 63.346  1.00   45.35  ? 897  GLU D CG  1 
ATOM   5226 C CD  . GLU D 1 145 ? 34.812  -30.068 63.107  1.00   55.90  ? 897  GLU D CD  1 
ATOM   5227 O OE1 . GLU D 1 145 ? 34.314  -29.284 63.961  1.00   60.17  ? 897  GLU D OE1 1 
ATOM   5228 O OE2 . GLU D 1 145 ? 35.421  -29.630 62.108  1.00   53.43  ? 897  GLU D OE2 1 
ATOM   5229 N N   . LYS D 1 146 ? 38.920  -33.131 61.656  1.00   45.17  ? 898  LYS D N   1 
ATOM   5230 C CA  . LYS D 1 146 ? 39.668  -34.197 61.091  1.00   44.67  ? 898  LYS D CA  1 
ATOM   5231 C C   . LYS D 1 146 ? 41.065  -34.242 61.648  1.00   44.18  ? 898  LYS D C   1 
ATOM   5232 O O   . LYS D 1 146 ? 41.665  -35.294 61.716  1.00   40.72  ? 898  LYS D O   1 
ATOM   5233 C CB  . LYS D 1 146 ? 39.682  -34.058 59.550  1.00   42.84  ? 898  LYS D CB  1 
ATOM   5234 C CG  . LYS D 1 146 ? 38.303  -34.233 58.939  1.00   41.42  ? 898  LYS D CG  1 
ATOM   5235 C CD  . LYS D 1 146 ? 38.318  -33.779 57.407  1.00   37.73  ? 898  LYS D CD  1 
ATOM   5236 C CE  . LYS D 1 146 ? 36.975  -34.076 56.661  1.00   33.39  ? 898  LYS D CE  1 
ATOM   5237 N NZ  . LYS D 1 146 ? 36.879  -33.677 55.189  1.00   29.79  ? 898  LYS D NZ  1 
ATOM   5238 N N   . THR D 1 147 ? 41.618  -33.077 61.943  1.00   46.53  ? 899  THR D N   1 
ATOM   5239 C CA  . THR D 1 147 ? 42.928  -32.987 62.434  1.00   42.27  ? 899  THR D CA  1 
ATOM   5240 C C   . THR D 1 147 ? 42.842  -33.568 63.843  1.00   49.97  ? 899  THR D C   1 
ATOM   5241 O O   . THR D 1 147 ? 43.566  -34.499 64.155  1.00   44.61  ? 899  THR D O   1 
ATOM   5242 C CB  . THR D 1 147 ? 43.396  -31.562 62.477  1.00   51.16  ? 899  THR D CB  1 
ATOM   5243 O OG1 . THR D 1 147 ? 43.265  -30.985 61.140  1.00   49.46  ? 899  THR D OG1 1 
ATOM   5244 C CG2 . THR D 1 147 ? 44.808  -31.542 62.906  1.00   43.65  ? 899  THR D CG2 1 
ATOM   5245 N N   . ILE D 1 148 ? 41.864  -33.086 64.624  1.00   45.51  ? 900  ILE D N   1 
ATOM   5246 C CA  . ILE D 1 148 ? 41.622  -33.506 65.999  1.00   43.70  ? 900  ILE D CA  1 
ATOM   5247 C C   . ILE D 1 148 ? 41.467  -34.958 66.040  1.00   44.80  ? 900  ILE D C   1 
ATOM   5248 O O   . ILE D 1 148 ? 42.002  -35.576 66.925  1.00   43.47  ? 900  ILE D O   1 
ATOM   5249 C CB  . ILE D 1 148 ? 40.447  -32.801 66.689  1.00   38.61  ? 900  ILE D CB  1 
ATOM   5250 C CG1 . ILE D 1 148 ? 40.912  -31.401 67.090  1.00   46.39  ? 900  ILE D CG1 1 
ATOM   5251 C CG2 . ILE D 1 148 ? 39.908  -33.649 67.837  1.00   42.95  ? 900  ILE D CG2 1 
ATOM   5252 C CD1 . ILE D 1 148 ? 39.850  -30.474 67.802  1.00   44.54  ? 900  ILE D CD1 1 
ATOM   5253 N N   . ALA D 1 149 ? 40.863  -35.503 65.006  1.00   49.60  ? 901  ALA D N   1 
ATOM   5254 C CA  . ALA D 1 149 ? 40.560  -36.908 64.942  1.00   39.66  ? 901  ALA D CA  1 
ATOM   5255 C C   . ALA D 1 149 ? 41.831  -37.718 64.578  1.00   46.08  ? 901  ALA D C   1 
ATOM   5256 O O   . ALA D 1 149 ? 42.109  -38.773 65.192  1.00   50.45  ? 901  ALA D O   1 
ATOM   5257 C CB  . ALA D 1 149 ? 39.477  -37.122 63.976  1.00   34.71  ? 901  ALA D CB  1 
ATOM   5258 N N   . ALA D 1 150 ? 42.641  -37.222 63.647  1.00   44.12  ? 902  ALA D N   1 
ATOM   5259 C CA  . ALA D 1 150 ? 43.882  -37.899 63.388  1.00   45.12  ? 902  ALA D CA  1 
ATOM   5260 C C   . ALA D 1 150 ? 44.776  -37.873 64.641  1.00   47.98  ? 902  ALA D C   1 
ATOM   5261 O O   . ALA D 1 150 ? 45.481  -38.827 64.935  1.00   45.82  ? 902  ALA D O   1 
ATOM   5262 C CB  . ALA D 1 150 ? 44.613  -37.296 62.175  1.00   46.66  ? 902  ALA D CB  1 
ATOM   5263 N N   . LYS D 1 151 ? 44.761  -36.758 65.339  1.00   45.85  ? 903  LYS D N   1 
ATOM   5264 C CA  . LYS D 1 151 ? 45.603  -36.563 66.503  1.00   50.66  ? 903  LYS D CA  1 
ATOM   5265 C C   . LYS D 1 151 ? 45.216  -37.474 67.707  1.00   58.57  ? 903  LYS D C   1 
ATOM   5266 O O   . LYS D 1 151 ? 46.094  -37.995 68.374  1.00   59.27  ? 903  LYS D O   1 
ATOM   5267 C CB  . LYS D 1 151 ? 45.566  -35.094 66.880  1.00   51.17  ? 903  LYS D CB  1 
ATOM   5268 C CG  . LYS D 1 151 ? 46.851  -34.655 67.483  1.00   52.40  ? 903  LYS D CG  1 
ATOM   5269 C CD  . LYS D 1 151 ? 46.682  -33.722 68.669  1.00   47.66  ? 903  LYS D CD  1 
ATOM   5270 C CE  . LYS D 1 151 ? 48.119  -33.291 69.218  1.00   39.67  ? 903  LYS D CE  1 
ATOM   5271 N NZ  . LYS D 1 151 ? 48.791  -33.031 67.958  1.00   42.66  ? 903  LYS D NZ  1 
ATOM   5272 N N   . ARG D 1 152 ? 43.916  -37.658 67.966  1.00   59.25  ? 904  ARG D N   1 
ATOM   5273 C CA  . ARG D 1 152 ? 43.422  -38.639 68.979  1.00   58.02  ? 904  ARG D CA  1 
ATOM   5274 C C   . ARG D 1 152 ? 43.843  -40.088 68.692  1.00   59.15  ? 904  ARG D C   1 
ATOM   5275 O O   . ARG D 1 152 ? 44.213  -40.793 69.639  1.00   60.91  ? 904  ARG D O   1 
ATOM   5276 C CB  . ARG D 1 152 ? 41.874  -38.572 69.137  1.00   50.29  ? 904  ARG D CB  1 
ATOM   5277 C CG  . ARG D 1 152 ? 41.377  -37.218 69.756  1.00   50.50  ? 904  ARG D CG  1 
ATOM   5278 C CD  . ARG D 1 152 ? 39.866  -36.989 69.615  1.00   61.66  ? 904  ARG D CD  1 
ATOM   5279 N NE  . ARG D 1 152 ? 39.098  -37.655 70.676  1.00   62.10  ? 904  ARG D NE  1 
ATOM   5280 C CZ  . ARG D 1 152 ? 38.501  -38.841 70.572  1.00   70.61  ? 904  ARG D CZ  1 
ATOM   5281 N NH1 . ARG D 1 152 ? 38.548  -39.517 69.430  1.00   73.93  ? 904  ARG D NH1 1 
ATOM   5282 N NH2 . ARG D 1 152 ? 37.840  -39.354 71.622  1.00   72.48  ? 904  ARG D NH2 1 
ATOM   5283 N N   . ALA D 1 153 ? 43.770  -40.509 67.423  1.00   52.77  ? 905  ALA D N   1 
ATOM   5284 C CA  . ALA D 1 153 ? 44.099  -41.876 66.941  1.00   51.96  ? 905  ALA D CA  1 
ATOM   5285 C C   . ALA D 1 153 ? 45.585  -42.216 66.831  1.00   56.06  ? 905  ALA D C   1 
ATOM   5286 O O   . ALA D 1 153 ? 45.950  -43.373 66.572  1.00   51.07  ? 905  ALA D O   1 
ATOM   5287 C CB  . ALA D 1 153 ? 43.514  -42.100 65.585  1.00   50.25  ? 905  ALA D CB  1 
ATOM   5288 N N   . GLY D 1 154 ? 46.420  -41.191 66.850  1.00   55.69  ? 906  GLY D N   1 
ATOM   5289 C CA  . GLY D 1 154 ? 47.848  -41.396 66.929  1.00   57.83  ? 906  GLY D CA  1 
ATOM   5290 C C   . GLY D 1 154 ? 48.612  -40.999 65.703  1.00   60.58  ? 906  GLY D C   1 
ATOM   5291 O O   . GLY D 1 154 ? 49.840  -41.117 65.667  1.00   55.16  ? 906  GLY D O   1 
ATOM   5292 N N   . VAL D 1 155 ? 47.894  -40.508 64.702  1.00   61.43  ? 907  VAL D N   1 
ATOM   5293 C CA  . VAL D 1 155 ? 48.471  -40.254 63.413  1.00   51.62  ? 907  VAL D CA  1 
ATOM   5294 C C   . VAL D 1 155 ? 49.261  -38.967 63.454  1.00   50.09  ? 907  VAL D C   1 
ATOM   5295 O O   . VAL D 1 155 ? 48.788  -37.956 63.928  1.00   54.66  ? 907  VAL D O   1 
ATOM   5296 C CB  . VAL D 1 155 ? 47.395  -40.197 62.340  1.00   55.54  ? 907  VAL D CB  1 
ATOM   5297 C CG1 . VAL D 1 155 ? 48.003  -40.435 61.026  1.00   56.16  ? 907  VAL D CG1 1 
ATOM   5298 C CG2 . VAL D 1 155 ? 46.344  -41.230 62.621  1.00   51.58  ? 907  VAL D CG2 1 
ATOM   5299 N N   . THR D 1 156 ? 50.496  -39.036 62.969  1.00   47.71  ? 908  THR D N   1 
ATOM   5300 C CA  . THR D 1 156 ? 51.394  -37.917 62.962  1.00   52.03  ? 908  THR D CA  1 
ATOM   5301 C C   . THR D 1 156 ? 51.684  -37.428 61.517  1.00   51.07  ? 908  THR D C   1 
ATOM   5302 O O   . THR D 1 156 ? 52.347  -36.401 61.351  1.00   57.83  ? 908  THR D O   1 
ATOM   5303 C CB  . THR D 1 156 ? 52.688  -38.265 63.738  1.00   58.28  ? 908  THR D CB  1 
ATOM   5304 O OG1 . THR D 1 156 ? 53.606  -37.148 63.665  1.00   63.81  ? 908  THR D OG1 1 
ATOM   5305 C CG2 . THR D 1 156 ? 53.315  -39.510 63.144  1.00   45.01  ? 908  THR D CG2 1 
ATOM   5306 N N   . CYS D 1 157 ? 51.160  -38.155 60.524  1.00   54.17  ? 909  CYS D N   1 
ATOM   5307 C CA  . CYS D 1 157 ? 51.204  -37.811 59.075  1.00   48.46  ? 909  CYS D CA  1 
ATOM   5308 C C   . CYS D 1 157 ? 49.838  -37.634 58.403  1.00   43.67  ? 909  CYS D C   1 
ATOM   5309 O O   . CYS D 1 157 ? 49.156  -38.619 58.040  1.00   43.03  ? 909  CYS D O   1 
ATOM   5310 C CB  . CYS D 1 157 ? 51.978  -38.840 58.296  1.00   51.73  ? 909  CYS D CB  1 
ATOM   5311 S SG  . CYS D 1 157 ? 52.631  -38.107 56.773  1.00   50.30  ? 909  CYS D SG  1 
ATOM   5312 N N   . ILE D 1 158 ? 49.395  -36.376 58.286  1.00   42.90  ? 910  ILE D N   1 
ATOM   5313 C CA  . ILE D 1 158 ? 48.170  -36.053 57.443  1.00   39.63  ? 910  ILE D CA  1 
ATOM   5314 C C   . ILE D 1 158 ? 48.399  -35.473 56.033  1.00   43.15  ? 910  ILE D C   1 
ATOM   5315 O O   . ILE D 1 158 ? 49.339  -34.681 55.789  1.00   40.73  ? 910  ILE D O   1 
ATOM   5316 C CB  . ILE D 1 158 ? 47.201  -35.192 58.219  1.00   38.81  ? 910  ILE D CB  1 
ATOM   5317 C CG1 . ILE D 1 158 ? 47.837  -33.879 58.699  1.00   43.50  ? 910  ILE D CG1 1 
ATOM   5318 C CG2 . ILE D 1 158 ? 46.777  -35.950 59.444  1.00   45.78  ? 910  ILE D CG2 1 
ATOM   5319 C CD1 . ILE D 1 158 ? 46.868  -32.904 59.311  1.00   48.57  ? 910  ILE D CD1 1 
ATOM   5320 N N   . VAL D 1 159 ? 47.533  -35.859 55.082  1.00   41.16  ? 911  VAL D N   1 
ATOM   5321 C CA  . VAL D 1 159 ? 47.499  -35.221 53.728  1.00   42.65  ? 911  VAL D CA  1 
ATOM   5322 C C   . VAL D 1 159 ? 46.215  -34.400 53.612  1.00   42.63  ? 911  VAL D C   1 
ATOM   5323 O O   . VAL D 1 159 ? 45.120  -34.955 53.836  1.00   49.64  ? 911  VAL D O   1 
ATOM   5324 C CB  . VAL D 1 159 ? 47.611  -36.289 52.591  1.00   41.13  ? 911  VAL D CB  1 
ATOM   5325 C CG1 . VAL D 1 159 ? 47.351  -35.718 51.128  1.00   37.99  ? 911  VAL D CG1 1 
ATOM   5326 C CG2 . VAL D 1 159 ? 48.980  -36.887 52.611  1.00   44.90  ? 911  VAL D CG2 1 
ATOM   5327 N N   . LEU D 1 160 ? 46.355  -33.087 53.378  1.00   46.71  ? 912  LEU D N   1 
ATOM   5328 C CA  . LEU D 1 160 ? 45.259  -32.164 53.263  1.00   44.84  ? 912  LEU D CA  1 
ATOM   5329 C C   . LEU D 1 160 ? 45.323  -31.333 51.937  1.00   46.22  ? 912  LEU D C   1 
ATOM   5330 O O   . LEU D 1 160 ? 46.378  -31.085 51.405  1.00   46.05  ? 912  LEU D O   1 
ATOM   5331 C CB  . LEU D 1 160 ? 45.190  -31.192 54.449  1.00   39.58  ? 912  LEU D CB  1 
ATOM   5332 C CG  . LEU D 1 160 ? 44.864  -31.531 55.926  1.00   43.11  ? 912  LEU D CG  1 
ATOM   5333 C CD1 . LEU D 1 160 ? 44.854  -30.293 56.755  1.00   32.11  ? 912  LEU D CD1 1 
ATOM   5334 C CD2 . LEU D 1 160 ? 43.561  -32.272 56.284  1.00   31.26  ? 912  LEU D CD2 1 
ATOM   5335 N N   . PRO D 1 161 ? 44.153  -30.864 51.425  1.00   47.40  ? 913  PRO D N   1 
ATOM   5336 C CA  . PRO D 1 161 ? 44.080  -29.872 50.331  1.00   43.87  ? 913  PRO D CA  1 
ATOM   5337 C C   . PRO D 1 161 ? 44.890  -28.614 50.571  1.00   36.22  ? 913  PRO D C   1 
ATOM   5338 O O   . PRO D 1 161 ? 44.896  -28.094 51.682  1.00   46.81  ? 913  PRO D O   1 
ATOM   5339 C CB  . PRO D 1 161 ? 42.609  -29.473 50.311  1.00   46.66  ? 913  PRO D CB  1 
ATOM   5340 C CG  . PRO D 1 161 ? 41.859  -30.795 50.604  1.00   39.06  ? 913  PRO D CG  1 
ATOM   5341 C CD  . PRO D 1 161 ? 42.815  -31.388 51.773  1.00   51.28  ? 913  PRO D CD  1 
ATOM   5342 N N   . ALA D 1 162 ? 45.677  -28.260 49.576  1.00   43.28  ? 914  ALA D N   1 
ATOM   5343 C CA  . ALA D 1 162 ? 46.443  -27.018 49.583  1.00   45.19  ? 914  ALA D CA  1 
ATOM   5344 C C   . ALA D 1 162 ? 45.584  -25.796 49.986  1.00   42.23  ? 914  ALA D C   1 
ATOM   5345 O O   . ALA D 1 162 ? 46.016  -24.944 50.730  1.00   50.75  ? 914  ALA D O   1 
ATOM   5346 C CB  . ALA D 1 162 ? 47.056  -26.838 48.198  1.00   46.49  ? 914  ALA D CB  1 
ATOM   5347 N N   . GLU D 1 163 ? 44.366  -25.709 49.514  1.00   51.29  ? 915  GLU D N   1 
ATOM   5348 C CA  . GLU D 1 163 ? 43.450  -24.563 49.897  1.00   52.49  ? 915  GLU D CA  1 
ATOM   5349 C C   . GLU D 1 163 ? 42.826  -24.559 51.358  1.00   54.74  ? 915  GLU D C   1 
ATOM   5350 O O   . GLU D 1 163 ? 42.366  -23.485 51.947  1.00   44.51  ? 915  GLU D O   1 
ATOM   5351 C CB  . GLU D 1 163 ? 42.389  -24.534 48.789  1.00   51.25  ? 915  GLU D CB  1 
ATOM   5352 C CG  . GLU D 1 163 ? 42.685  -23.522 47.728  1.00   54.60  ? 915  GLU D CG  1 
ATOM   5353 C CD  . GLU D 1 163 ? 41.880  -23.772 46.468  1.00   64.29  ? 915  GLU D CD  1 
ATOM   5354 O OE1 . GLU D 1 163 ? 40.673  -23.395 46.417  1.00   60.78  ? 915  GLU D OE1 1 
ATOM   5355 O OE2 . GLU D 1 163 ? 42.484  -24.368 45.542  1.00   50.72  ? 915  GLU D OE2 1 
ATOM   5356 N N   . ASN D 1 164 ? 42.856  -25.752 51.993  1.00   53.73  ? 916  ASN D N   1 
ATOM   5357 C CA  . ASN D 1 164 ? 42.688  -25.839 53.457  1.00   50.77  ? 916  ASN D CA  1 
ATOM   5358 C C   . ASN D 1 164 ? 43.972  -25.550 54.265  1.00   50.53  ? 916  ASN D C   1 
ATOM   5359 O O   . ASN D 1 164 ? 44.021  -25.824 55.447  1.00   46.78  ? 916  ASN D O   1 
ATOM   5360 C CB  . ASN D 1 164 ? 42.202  -27.217 53.820  1.00   46.96  ? 916  ASN D CB  1 
ATOM   5361 C CG  . ASN D 1 164 ? 40.899  -27.547 53.181  1.00   34.28  ? 916  ASN D CG  1 
ATOM   5362 O OD1 . ASN D 1 164 ? 40.817  -28.473 52.354  1.00   46.73  ? 916  ASN D OD1 1 
ATOM   5363 N ND2 . ASN D 1 164 ? 39.849  -26.834 53.573  1.00   44.56  ? 916  ASN D ND2 1 
ATOM   5364 N N   . LYS D 1 165 ? 45.014  -25.025 53.632  1.00   42.14  ? 917  LYS D N   1 
ATOM   5365 C CA  . LYS D 1 165 ? 46.209  -24.631 54.381  1.00   51.75  ? 917  LYS D CA  1 
ATOM   5366 C C   . LYS D 1 165 ? 45.827  -23.670 55.488  1.00   51.92  ? 917  LYS D C   1 
ATOM   5367 O O   . LYS D 1 165 ? 46.243  -23.833 56.658  1.00   51.72  ? 917  LYS D O   1 
ATOM   5368 C CB  . LYS D 1 165 ? 47.244  -23.955 53.488  1.00   50.92  ? 917  LYS D CB  1 
ATOM   5369 C CG  . LYS D 1 165 ? 48.638  -23.761 54.123  1.00   55.43  ? 917  LYS D CG  1 
ATOM   5370 C CD  . LYS D 1 165 ? 49.718  -23.583 53.072  1.00   58.15  ? 917  LYS D CD  1 
ATOM   5371 C CE  . LYS D 1 165 ? 51.051  -23.132 53.695  1.00   63.15  ? 917  LYS D CE  1 
ATOM   5372 N NZ  . LYS D 1 165 ? 52.147  -23.465 52.756  1.00   58.06  ? 917  LYS D NZ  1 
ATOM   5373 N N   . LYS D 1 166 ? 45.009  -22.689 55.116  1.00   54.36  ? 918  LYS D N   1 
ATOM   5374 C CA  . LYS D 1 166 ? 44.609  -21.585 56.012  1.00   59.48  ? 918  LYS D CA  1 
ATOM   5375 C C   . LYS D 1 166 ? 43.790  -22.091 57.185  1.00   54.96  ? 918  LYS D C   1 
ATOM   5376 O O   . LYS D 1 166 ? 43.968  -21.625 58.311  1.00   65.48  ? 918  LYS D O   1 
ATOM   5377 C CB  . LYS D 1 166 ? 43.771  -20.603 55.205  1.00   67.38  ? 918  LYS D CB  1 
ATOM   5378 C CG  . LYS D 1 166 ? 43.612  -19.190 55.748  1.00   72.41  ? 918  LYS D CG  1 
ATOM   5379 C CD  . LYS D 1 166 ? 43.235  -18.198 54.571  1.00   77.94  ? 918  LYS D CD  1 
ATOM   5380 C CE  . LYS D 1 166 ? 42.213  -18.772 53.510  1.00   80.82  ? 918  LYS D CE  1 
ATOM   5381 N NZ  . LYS D 1 166 ? 40.968  -19.434 54.075  1.00   76.54  ? 918  LYS D NZ  1 
ATOM   5382 N N   . ASP D 1 167 ? 42.899  -23.047 56.924  1.00   52.12  ? 919  ASP D N   1 
ATOM   5383 C CA  . ASP D 1 167 ? 42.060  -23.671 57.973  1.00   46.35  ? 919  ASP D CA  1 
ATOM   5384 C C   . ASP D 1 167 ? 42.916  -24.422 59.019  1.00   44.33  ? 919  ASP D C   1 
ATOM   5385 O O   . ASP D 1 167 ? 42.616  -24.435 60.235  1.00   48.82  ? 919  ASP D O   1 
ATOM   5386 C CB  . ASP D 1 167 ? 41.007  -24.587 57.350  1.00   49.83  ? 919  ASP D CB  1 
ATOM   5387 C CG  . ASP D 1 167 ? 40.001  -23.813 56.458  1.00   45.28  ? 919  ASP D CG  1 
ATOM   5388 O OD1 . ASP D 1 167 ? 39.249  -22.942 56.960  1.00   50.41  ? 919  ASP D OD1 1 
ATOM   5389 O OD2 . ASP D 1 167 ? 40.013  -24.074 55.268  1.00   41.07  ? 919  ASP D OD2 1 
ATOM   5390 N N   . PHE D 1 168 ? 44.019  -24.995 58.572  1.00   49.37  ? 920  PHE D N   1 
ATOM   5391 C CA  . PHE D 1 168 ? 44.883  -25.779 59.478  1.00   46.92  ? 920  PHE D CA  1 
ATOM   5392 C C   . PHE D 1 168 ? 45.627  -24.924 60.505  1.00   47.50  ? 920  PHE D C   1 
ATOM   5393 O O   . PHE D 1 168 ? 45.653  -25.264 61.656  1.00   56.91  ? 920  PHE D O   1 
ATOM   5394 C CB  . PHE D 1 168 ? 45.880  -26.582 58.653  1.00   55.16  ? 920  PHE D CB  1 
ATOM   5395 C CG  . PHE D 1 168 ? 46.645  -27.576 59.436  1.00   49.87  ? 920  PHE D CG  1 
ATOM   5396 C CD1 . PHE D 1 168 ? 46.102  -28.827 59.700  1.00   61.23  ? 920  PHE D CD1 1 
ATOM   5397 C CD2 . PHE D 1 168 ? 47.897  -27.274 59.942  1.00   62.75  ? 920  PHE D CD2 1 
ATOM   5398 C CE1 . PHE D 1 168 ? 46.820  -29.751 60.409  1.00   54.55  ? 920  PHE D CE1 1 
ATOM   5399 C CE2 . PHE D 1 168 ? 48.607  -28.208 60.663  1.00   47.72  ? 920  PHE D CE2 1 
ATOM   5400 C CZ  . PHE D 1 168 ? 48.072  -29.422 60.898  1.00   50.65  ? 920  PHE D CZ  1 
ATOM   5401 N N   . TYR D 1 169 ? 46.227  -23.827 60.062  1.00   57.08  ? 921  TYR D N   1 
ATOM   5402 C CA  . TYR D 1 169 ? 46.970  -22.911 60.921  1.00   58.12  ? 921  TYR D CA  1 
ATOM   5403 C C   . TYR D 1 169 ? 46.075  -21.967 61.745  1.00   57.00  ? 921  TYR D C   1 
ATOM   5404 O O   . TYR D 1 169 ? 46.513  -21.372 62.732  1.00   61.68  ? 921  TYR D O   1 
ATOM   5405 C CB  . TYR D 1 169 ? 48.077  -22.190 60.136  1.00   56.64  ? 921  TYR D CB  1 
ATOM   5406 C CG  . TYR D 1 169 ? 49.171  -23.181 59.713  1.00   62.98  ? 921  TYR D CG  1 
ATOM   5407 C CD1 . TYR D 1 169 ? 50.058  -23.735 60.652  1.00   64.15  ? 921  TYR D CD1 1 
ATOM   5408 C CD2 . TYR D 1 169 ? 49.275  -23.624 58.415  1.00   56.03  ? 921  TYR D CD2 1 
ATOM   5409 C CE1 . TYR D 1 169 ? 51.032  -24.683 60.273  1.00   69.48  ? 921  TYR D CE1 1 
ATOM   5410 C CE2 . TYR D 1 169 ? 50.243  -24.560 58.030  1.00   59.75  ? 921  TYR D CE2 1 
ATOM   5411 C CZ  . TYR D 1 169 ? 51.114  -25.099 58.963  1.00   72.97  ? 921  TYR D CZ  1 
ATOM   5412 O OH  . TYR D 1 169 ? 52.071  -26.038 58.575  1.00   72.61  ? 921  TYR D OH  1 
ATOM   5413 N N   . ASP D 1 170 ? 44.814  -21.868 61.389  1.00   55.79  ? 922  ASP D N   1 
ATOM   5414 C CA  . ASP D 1 170 ? 43.851  -21.332 62.335  1.00   58.01  ? 922  ASP D CA  1 
ATOM   5415 C C   . ASP D 1 170 ? 43.507  -22.241 63.547  1.00   54.36  ? 922  ASP D C   1 
ATOM   5416 O O   . ASP D 1 170 ? 42.863  -21.795 64.468  1.00   55.35  ? 922  ASP D O   1 
ATOM   5417 C CB  . ASP D 1 170 ? 42.593  -20.884 61.595  1.00   58.14  ? 922  ASP D CB  1 
ATOM   5418 C CG  . ASP D 1 170 ? 42.681  -19.436 61.133  1.00   70.19  ? 922  ASP D CG  1 
ATOM   5419 O OD1 . ASP D 1 170 ? 43.798  -18.836 61.163  1.00   65.32  ? 922  ASP D OD1 1 
ATOM   5420 O OD2 . ASP D 1 170 ? 41.616  -18.898 60.747  1.00   81.04  ? 922  ASP D OD2 1 
ATOM   5421 N N   . LEU D 1 171 ? 43.920  -23.506 63.564  1.00   57.90  ? 923  LEU D N   1 
ATOM   5422 C CA  . LEU D 1 171 ? 43.640  -24.350 64.747  1.00   54.17  ? 923  LEU D CA  1 
ATOM   5423 C C   . LEU D 1 171 ? 44.691  -24.051 65.795  1.00   55.29  ? 923  LEU D C   1 
ATOM   5424 O O   . LEU D 1 171 ? 45.785  -23.572 65.454  1.00   51.17  ? 923  LEU D O   1 
ATOM   5425 C CB  . LEU D 1 171 ? 43.647  -25.840 64.370  1.00   57.99  ? 923  LEU D CB  1 
ATOM   5426 C CG  . LEU D 1 171 ? 42.753  -26.272 63.211  1.00   51.70  ? 923  LEU D CG  1 
ATOM   5427 C CD1 . LEU D 1 171 ? 43.148  -27.662 62.641  1.00   55.03  ? 923  LEU D CD1 1 
ATOM   5428 C CD2 . LEU D 1 171 ? 41.266  -26.230 63.642  1.00   55.32  ? 923  LEU D CD2 1 
ATOM   5429 N N   . ALA D 1 172 ? 44.399  -24.367 67.047  1.00   59.39  ? 924  ALA D N   1 
ATOM   5430 C CA  . ALA D 1 172 ? 45.250  -23.967 68.162  1.00   63.69  ? 924  ALA D CA  1 
ATOM   5431 C C   . ALA D 1 172 ? 46.553  -24.736 68.200  1.00   61.83  ? 924  ALA D C   1 
ATOM   5432 O O   . ALA D 1 172 ? 46.605  -25.919 67.841  1.00   66.59  ? 924  ALA D O   1 
ATOM   5433 C CB  . ALA D 1 172 ? 44.515  -24.122 69.480  1.00   64.07  ? 924  ALA D CB  1 
ATOM   5434 N N   . ALA D 1 173 ? 47.610  -24.057 68.623  1.00   55.82  ? 925  ALA D N   1 
ATOM   5435 C CA  . ALA D 1 173 ? 48.925  -24.676 68.707  1.00   55.22  ? 925  ALA D CA  1 
ATOM   5436 C C   . ALA D 1 173 ? 48.884  -26.059 69.361  1.00   47.89  ? 925  ALA D C   1 
ATOM   5437 O O   . ALA D 1 173 ? 49.583  -26.996 68.915  1.00   51.95  ? 925  ALA D O   1 
ATOM   5438 C CB  . ALA D 1 173 ? 49.896  -23.724 69.423  1.00   57.96  ? 925  ALA D CB  1 
ATOM   5439 N N   . PHE D 1 174 ? 48.055  -26.227 70.392  1.00   50.82  ? 926  PHE D N   1 
ATOM   5440 C CA  . PHE D 1 174 ? 47.955  -27.539 71.061  1.00   52.63  ? 926  PHE D CA  1 
ATOM   5441 C C   . PHE D 1 174 ? 47.524  -28.656 70.149  1.00   48.55  ? 926  PHE D C   1 
ATOM   5442 O O   . PHE D 1 174 ? 47.791  -29.828 70.424  1.00   51.09  ? 926  PHE D O   1 
ATOM   5443 C CB  . PHE D 1 174 ? 47.001  -27.495 72.292  1.00   50.52  ? 926  PHE D CB  1 
ATOM   5444 C CG  . PHE D 1 174 ? 47.077  -28.725 73.143  1.00   50.77  ? 926  PHE D CG  1 
ATOM   5445 C CD1 . PHE D 1 174 ? 48.000  -28.831 74.196  1.00   34.18  ? 926  PHE D CD1 1 
ATOM   5446 C CD2 . PHE D 1 174 ? 46.226  -29.774 72.905  1.00   50.40  ? 926  PHE D CD2 1 
ATOM   5447 C CE1 . PHE D 1 174 ? 48.099  -29.987 74.952  1.00   43.74  ? 926  PHE D CE1 1 
ATOM   5448 C CE2 . PHE D 1 174 ? 46.301  -30.890 73.641  1.00   34.52  ? 926  PHE D CE2 1 
ATOM   5449 C CZ  . PHE D 1 174 ? 47.236  -31.034 74.676  1.00   43.07  ? 926  PHE D CZ  1 
ATOM   5450 N N   . ILE D 1 175 ? 46.800  -28.327 69.075  1.00   51.08  ? 927  ILE D N   1 
ATOM   5451 C CA  . ILE D 1 175 ? 46.345  -29.325 68.147  1.00   45.41  ? 927  ILE D CA  1 
ATOM   5452 C C   . ILE D 1 175 ? 47.437  -29.608 67.097  1.00   49.36  ? 927  ILE D C   1 
ATOM   5453 O O   . ILE D 1 175 ? 47.806  -30.777 66.843  1.00   49.39  ? 927  ILE D O   1 
ATOM   5454 C CB  . ILE D 1 175 ? 44.985  -28.962 67.484  1.00   53.41  ? 927  ILE D CB  1 
ATOM   5455 C CG1 . ILE D 1 175 ? 43.886  -28.798 68.562  1.00   51.27  ? 927  ILE D CG1 1 
ATOM   5456 C CG2 . ILE D 1 175 ? 44.633  -30.079 66.516  1.00   56.58  ? 927  ILE D CG2 1 
ATOM   5457 C CD1 . ILE D 1 175 ? 42.557  -28.114 68.106  1.00   55.54  ? 927  ILE D CD1 1 
ATOM   5458 N N   . THR D 1 176 ? 48.060  -28.556 66.595  1.00   43.42  ? 928  THR D N   1 
ATOM   5459 C CA  . THR D 1 176 ? 48.903  -28.623 65.414  1.00   52.37  ? 928  THR D CA  1 
ATOM   5460 C C   . THR D 1 176 ? 50.382  -28.992 65.638  1.00   50.50  ? 928  THR D C   1 
ATOM   5461 O O   . THR D 1 176 ? 50.966  -29.729 64.828  1.00   49.86  ? 928  THR D O   1 
ATOM   5462 C CB  . THR D 1 176 ? 48.824  -27.273 64.691  1.00   55.03  ? 928  THR D CB  1 
ATOM   5463 O OG1 . THR D 1 176 ? 49.131  -26.252 65.641  1.00   51.46  ? 928  THR D OG1 1 
ATOM   5464 C CG2 . THR D 1 176 ? 47.391  -27.056 64.148  1.00   55.54  ? 928  THR D CG2 1 
ATOM   5465 N N   . GLU D 1 177 ? 51.011  -28.487 66.696  1.00   57.48  ? 929  GLU D N   1 
ATOM   5466 C CA  . GLU D 1 177 ? 52.427  -28.828 66.925  1.00   57.52  ? 929  GLU D CA  1 
ATOM   5467 C C   . GLU D 1 177 ? 52.642  -30.328 67.014  1.00   52.43  ? 929  GLU D C   1 
ATOM   5468 O O   . GLU D 1 177 ? 51.888  -31.056 67.643  1.00   47.83  ? 929  GLU D O   1 
ATOM   5469 C CB  . GLU D 1 177 ? 52.996  -28.137 68.151  1.00   60.10  ? 929  GLU D CB  1 
ATOM   5470 C CG  . GLU D 1 177 ? 53.755  -26.820 67.802  1.00   68.85  ? 929  GLU D CG  1 
ATOM   5471 C CD  . GLU D 1 177 ? 53.473  -25.706 68.788  1.00   69.19  ? 929  GLU D CD  1 
ATOM   5472 O OE1 . GLU D 1 177 ? 53.783  -24.548 68.461  1.00   72.24  ? 929  GLU D OE1 1 
ATOM   5473 O OE2 . GLU D 1 177 ? 52.927  -25.983 69.877  1.00   86.93  ? 929  GLU D OE2 1 
ATOM   5474 N N   . GLY D 1 178 ? 53.650  -30.795 66.298  1.00   53.48  ? 930  GLY D N   1 
ATOM   5475 C CA  . GLY D 1 178 ? 54.005  -32.188 66.395  1.00   52.80  ? 930  GLY D CA  1 
ATOM   5476 C C   . GLY D 1 178 ? 53.481  -32.970 65.227  1.00   49.63  ? 930  GLY D C   1 
ATOM   5477 O O   . GLY D 1 178 ? 53.880  -34.094 65.067  1.00   48.11  ? 930  GLY D O   1 
ATOM   5478 N N   . LEU D 1 179 ? 52.516  -32.400 64.491  1.00   49.64  ? 931  LEU D N   1 
ATOM   5479 C CA  . LEU D 1 179 ? 51.925  -33.012 63.291  1.00   50.45  ? 931  LEU D CA  1 
ATOM   5480 C C   . LEU D 1 179 ? 52.774  -32.714 62.064  1.00   47.42  ? 931  LEU D C   1 
ATOM   5481 O O   . LEU D 1 179 ? 53.023  -31.539 61.773  1.00   45.39  ? 931  LEU D O   1 
ATOM   5482 C CB  . LEU D 1 179 ? 50.540  -32.389 63.016  1.00   52.20  ? 931  LEU D CB  1 
ATOM   5483 C CG  . LEU D 1 179 ? 49.278  -33.142 63.333  1.00   43.52  ? 931  LEU D CG  1 
ATOM   5484 C CD1 . LEU D 1 179 ? 48.142  -32.311 63.017  1.00   39.44  ? 931  LEU D CD1 1 
ATOM   5485 C CD2 . LEU D 1 179 ? 49.201  -34.430 62.535  1.00   56.97  ? 931  LEU D CD2 1 
ATOM   5486 N N   . GLU D 1 180 ? 53.149  -33.772 61.330  1.00   47.55  ? 932  GLU D N   1 
ATOM   5487 C CA  . GLU D 1 180 ? 53.664  -33.671 59.962  1.00   42.69  ? 932  GLU D CA  1 
ATOM   5488 C C   . GLU D 1 180 ? 52.415  -33.699 59.042  1.00   50.26  ? 932  GLU D C   1 
ATOM   5489 O O   . GLU D 1 180 ? 51.640  -34.691 59.016  1.00   45.75  ? 932  GLU D O   1 
ATOM   5490 C CB  . GLU D 1 180 ? 54.587  -34.865 59.643  1.00   50.71  ? 932  GLU D CB  1 
ATOM   5491 C CG  . GLU D 1 180 ? 55.020  -35.071 58.169  1.00   50.87  ? 932  GLU D CG  1 
ATOM   5492 C CD  . GLU D 1 180 ? 55.784  -36.421 57.856  1.00   57.45  ? 932  GLU D CD  1 
ATOM   5493 O OE1 . GLU D 1 180 ? 55.809  -37.366 58.666  1.00   64.70  ? 932  GLU D OE1 1 
ATOM   5494 O OE2 . GLU D 1 180 ? 56.364  -36.534 56.766  1.00   55.34  ? 932  GLU D OE2 1 
ATOM   5495 N N   . VAL D 1 181 ? 52.256  -32.599 58.313  1.00   44.43  ? 933  VAL D N   1 
ATOM   5496 C CA  . VAL D 1 181 ? 51.098  -32.307 57.474  1.00   53.87  ? 933  VAL D CA  1 
ATOM   5497 C C   . VAL D 1 181 ? 51.571  -32.004 56.056  1.00   53.44  ? 933  VAL D C   1 
ATOM   5498 O O   . VAL D 1 181 ? 52.488  -31.245 55.845  1.00   57.62  ? 933  VAL D O   1 
ATOM   5499 C CB  . VAL D 1 181 ? 50.261  -31.118 58.018  1.00   46.47  ? 933  VAL D CB  1 
ATOM   5500 C CG1 . VAL D 1 181 ? 51.148  -29.885 58.219  1.00   47.99  ? 933  VAL D CG1 1 
ATOM   5501 C CG2 . VAL D 1 181 ? 49.101  -30.873 57.136  1.00   56.78  ? 933  VAL D CG2 1 
ATOM   5502 N N   . HIS D 1 182 ? 50.962  -32.642 55.078  1.00   48.64  ? 934  HIS D N   1 
ATOM   5503 C CA  . HIS D 1 182 ? 51.328  -32.339 53.709  1.00   56.49  ? 934  HIS D CA  1 
ATOM   5504 C C   . HIS D 1 182 ? 50.145  -31.668 53.019  1.00   58.50  ? 934  HIS D C   1 
ATOM   5505 O O   . HIS D 1 182 ? 49.001  -32.157 53.136  1.00   59.11  ? 934  HIS D O   1 
ATOM   5506 C CB  . HIS D 1 182 ? 51.686  -33.589 52.936  1.00   56.45  ? 934  HIS D CB  1 
ATOM   5507 C CG  . HIS D 1 182 ? 52.949  -34.265 53.373  1.00   56.29  ? 934  HIS D CG  1 
ATOM   5508 N ND1 . HIS D 1 182 ? 53.016  -35.043 54.508  1.00   44.93  ? 934  HIS D ND1 1 
ATOM   5509 C CD2 . HIS D 1 182 ? 54.158  -34.372 52.768  1.00   51.01  ? 934  HIS D CD2 1 
ATOM   5510 C CE1 . HIS D 1 182 ? 54.228  -35.566 54.613  1.00   45.27  ? 934  HIS D CE1 1 
ATOM   5511 N NE2 . HIS D 1 182 ? 54.940  -35.171 53.568  1.00   63.90  ? 934  HIS D NE2 1 
ATOM   5512 N N   . PHE D 1 183 ? 50.440  -30.595 52.276  1.00   58.85  ? 935  PHE D N   1 
ATOM   5513 C CA  . PHE D 1 183 ? 49.416  -29.830 51.536  1.00   60.95  ? 935  PHE D CA  1 
ATOM   5514 C C   . PHE D 1 183 ? 49.587  -29.988 50.024  1.00   57.45  ? 935  PHE D C   1 
ATOM   5515 O O   . PHE D 1 183 ? 50.596  -29.570 49.503  1.00   55.61  ? 935  PHE D O   1 
ATOM   5516 C CB  . PHE D 1 183 ? 49.461  -28.351 51.932  1.00   58.55  ? 935  PHE D CB  1 
ATOM   5517 C CG  . PHE D 1 183 ? 49.210  -28.114 53.402  1.00   57.92  ? 935  PHE D CG  1 
ATOM   5518 C CD1 . PHE D 1 183 ? 47.901  -28.115 53.917  1.00   50.82  ? 935  PHE D CD1 1 
ATOM   5519 C CD2 . PHE D 1 183 ? 50.278  -27.940 54.276  1.00   61.74  ? 935  PHE D CD2 1 
ATOM   5520 C CE1 . PHE D 1 183 ? 47.667  -27.872 55.252  1.00   44.15  ? 935  PHE D CE1 1 
ATOM   5521 C CE2 . PHE D 1 183 ? 50.072  -27.723 55.634  1.00   50.79  ? 935  PHE D CE2 1 
ATOM   5522 C CZ  . PHE D 1 183 ? 48.761  -27.692 56.136  1.00   50.93  ? 935  PHE D CZ  1 
ATOM   5523 N N   . VAL D 1 184 ? 48.573  -30.588 49.367  1.00   50.48  ? 936  VAL D N   1 
ATOM   5524 C CA  . VAL D 1 184 ? 48.663  -31.093 48.037  1.00   45.13  ? 936  VAL D CA  1 
ATOM   5525 C C   . VAL D 1 184 ? 47.778  -30.318 47.091  1.00   42.15  ? 936  VAL D C   1 
ATOM   5526 O O   . VAL D 1 184 ? 46.613  -30.006 47.376  1.00   48.49  ? 936  VAL D O   1 
ATOM   5527 C CB  . VAL D 1 184 ? 48.387  -32.715 47.964  1.00   52.28  ? 936  VAL D CB  1 
ATOM   5528 C CG1 . VAL D 1 184 ? 49.422  -33.485 48.723  1.00   38.53  ? 936  VAL D CG1 1 
ATOM   5529 C CG2 . VAL D 1 184 ? 47.048  -33.127 48.528  1.00   40.55  ? 936  VAL D CG2 1 
ATOM   5530 N N   . GLU D 1 185 ? 48.326  -30.010 45.940  1.00   50.43  ? 937  GLU D N   1 
ATOM   5531 C CA  . GLU D 1 185 ? 47.568  -29.424 44.828  1.00   49.56  ? 937  GLU D CA  1 
ATOM   5532 C C   . GLU D 1 185 ? 46.988  -30.507 43.918  1.00   51.21  ? 937  GLU D C   1 
ATOM   5533 O O   . GLU D 1 185 ? 45.874  -30.345 43.389  1.00   50.82  ? 937  GLU D O   1 
ATOM   5534 C CB  . GLU D 1 185 ? 48.487  -28.481 44.025  1.00   53.61  ? 937  GLU D CB  1 
ATOM   5535 C CG  . GLU D 1 185 ? 48.808  -27.155 44.743  1.00   55.82  ? 937  GLU D CG  1 
ATOM   5536 C CD  . GLU D 1 185 ? 49.883  -26.317 44.023  1.00   66.05  ? 937  GLU D CD  1 
ATOM   5537 O OE1 . GLU D 1 185 ? 49.808  -25.070 44.114  1.00   77.30  ? 937  GLU D OE1 1 
ATOM   5538 O OE2 . GLU D 1 185 ? 50.801  -26.884 43.365  1.00   64.80  ? 937  GLU D OE2 1 
ATOM   5539 N N   . HIS D 1 186 ? 47.719  -31.613 43.752  1.00   48.05  ? 938  HIS D N   1 
ATOM   5540 C CA  . HIS D 1 186 ? 47.403  -32.602 42.741  1.00   46.55  ? 938  HIS D CA  1 
ATOM   5541 C C   . HIS D 1 186 ? 47.673  -34.013 43.276  1.00   45.17  ? 938  HIS D C   1 
ATOM   5542 O O   . HIS D 1 186 ? 48.640  -34.276 44.005  1.00   46.14  ? 938  HIS D O   1 
ATOM   5543 C CB  . HIS D 1 186 ? 48.252  -32.396 41.458  1.00   44.10  ? 938  HIS D CB  1 
ATOM   5544 C CG  . HIS D 1 186 ? 47.777  -33.167 40.301  1.00   41.32  ? 938  HIS D CG  1 
ATOM   5545 N ND1 . HIS D 1 186 ? 46.821  -32.668 39.438  1.00   51.83  ? 938  HIS D ND1 1 
ATOM   5546 C CD2 . HIS D 1 186 ? 48.074  -34.416 39.858  1.00   45.85  ? 938  HIS D CD2 1 
ATOM   5547 C CE1 . HIS D 1 186 ? 46.601  -33.550 38.477  1.00   50.50  ? 938  HIS D CE1 1 
ATOM   5548 N NE2 . HIS D 1 186 ? 47.316  -34.635 38.727  1.00   65.29  ? 938  HIS D NE2 1 
ATOM   5549 N N   . TYR D 1 187 ? 46.858  -34.952 42.840  1.00   45.56  ? 939  TYR D N   1 
ATOM   5550 C CA  . TYR D 1 187 ? 46.984  -36.311 43.350  1.00   47.86  ? 939  TYR D CA  1 
ATOM   5551 C C   . TYR D 1 187 ? 48.382  -36.943 43.123  1.00   51.68  ? 939  TYR D C   1 
ATOM   5552 O O   . TYR D 1 187 ? 48.738  -37.937 43.824  1.00   43.01  ? 939  TYR D O   1 
ATOM   5553 C CB  . TYR D 1 187 ? 45.882  -37.231 42.764  1.00   46.67  ? 939  TYR D CB  1 
ATOM   5554 C CG  . TYR D 1 187 ? 46.023  -38.567 43.424  1.00   43.89  ? 939  TYR D CG  1 
ATOM   5555 C CD1 . TYR D 1 187 ? 45.674  -38.725 44.775  1.00   45.74  ? 939  TYR D CD1 1 
ATOM   5556 C CD2 . TYR D 1 187 ? 46.735  -39.593 42.819  1.00   44.89  ? 939  TYR D CD2 1 
ATOM   5557 C CE1 . TYR D 1 187 ? 45.878  -39.968 45.437  1.00   41.00  ? 939  TYR D CE1 1 
ATOM   5558 C CE2 . TYR D 1 187 ? 46.992  -40.818 43.498  1.00   44.58  ? 939  TYR D CE2 1 
ATOM   5559 C CZ  . TYR D 1 187 ? 46.537  -40.990 44.785  1.00   48.27  ? 939  TYR D CZ  1 
ATOM   5560 O OH  . TYR D 1 187 ? 46.762  -42.200 45.419  1.00   47.08  ? 939  TYR D OH  1 
ATOM   5561 N N   . ARG D 1 188 ? 49.156  -36.391 42.163  1.00   51.92  ? 940  ARG D N   1 
ATOM   5562 C CA  . ARG D 1 188 ? 50.530  -36.870 41.845  1.00   55.93  ? 940  ARG D CA  1 
ATOM   5563 C C   . ARG D 1 188 ? 51.400  -36.809 43.097  1.00   58.74  ? 940  ARG D C   1 
ATOM   5564 O O   . ARG D 1 188 ? 52.157  -37.750 43.373  1.00   52.24  ? 940  ARG D O   1 
ATOM   5565 C CB  . ARG D 1 188 ? 51.187  -36.069 40.680  1.00   57.58  ? 940  ARG D CB  1 
ATOM   5566 C CG  . ARG D 1 188 ? 52.714  -35.891 40.733  1.00   71.11  ? 940  ARG D CG  1 
ATOM   5567 C CD  . ARG D 1 188 ? 53.531  -37.082 40.137  1.00   78.88  ? 940  ARG D CD  1 
ATOM   5568 N NE  . ARG D 1 188 ? 54.960  -37.021 40.494  1.00   80.13  ? 940  ARG D NE  1 
ATOM   5569 C CZ  . ARG D 1 188 ? 55.907  -37.859 40.062  1.00   83.38  ? 940  ARG D CZ  1 
ATOM   5570 N NH1 . ARG D 1 188 ? 55.599  -38.839 39.216  1.00   89.98  ? 940  ARG D NH1 1 
ATOM   5571 N NH2 . ARG D 1 188 ? 57.174  -37.729 40.488  1.00   79.86  ? 940  ARG D NH2 1 
ATOM   5572 N N   . GLU D 1 189 ? 51.273  -35.697 43.835  1.00   60.27  ? 941  GLU D N   1 
ATOM   5573 C CA  . GLU D 1 189 ? 51.948  -35.496 45.114  1.00   59.60  ? 941  GLU D CA  1 
ATOM   5574 C C   . GLU D 1 189 ? 51.575  -36.535 46.183  1.00   56.27  ? 941  GLU D C   1 
ATOM   5575 O O   . GLU D 1 189 ? 52.445  -37.072 46.853  1.00   54.30  ? 941  GLU D O   1 
ATOM   5576 C CB  . GLU D 1 189 ? 51.603  -34.123 45.652  1.00   59.97  ? 941  GLU D CB  1 
ATOM   5577 C CG  . GLU D 1 189 ? 52.210  -33.028 44.863  1.00   56.96  ? 941  GLU D CG  1 
ATOM   5578 C CD  . GLU D 1 189 ? 51.529  -31.694 45.120  1.00   67.12  ? 941  GLU D CD  1 
ATOM   5579 O OE1 . GLU D 1 189 ? 50.292  -31.596 44.969  1.00   76.56  ? 941  GLU D OE1 1 
ATOM   5580 O OE2 . GLU D 1 189 ? 52.217  -30.730 45.439  1.00   58.48  ? 941  GLU D OE2 1 
ATOM   5581 N N   . ILE D 1 190 ? 50.273  -36.801 46.315  1.00   54.64  ? 942  ILE D N   1 
ATOM   5582 C CA  . ILE D 1 190 ? 49.744  -37.761 47.302  1.00   54.62  ? 942  ILE D CA  1 
ATOM   5583 C C   . ILE D 1 190 ? 50.318  -39.111 47.006  1.00   52.73  ? 942  ILE D C   1 
ATOM   5584 O O   . ILE D 1 190 ? 50.700  -39.844 47.918  1.00   51.29  ? 942  ILE D O   1 
ATOM   5585 C CB  . ILE D 1 190 ? 48.199  -37.934 47.256  1.00   50.33  ? 942  ILE D CB  1 
ATOM   5586 C CG1 . ILE D 1 190 ? 47.504  -36.600 47.472  1.00   53.60  ? 942  ILE D CG1 1 
ATOM   5587 C CG2 . ILE D 1 190 ? 47.742  -38.883 48.325  1.00   47.06  ? 942  ILE D CG2 1 
ATOM   5588 C CD1 . ILE D 1 190 ? 45.976  -36.671 47.391  1.00   59.73  ? 942  ILE D CD1 1 
ATOM   5589 N N   . PHE D 1 191 ? 50.429  -39.416 45.718  1.00   43.20  ? 943  PHE D N   1 
ATOM   5590 C CA  . PHE D 1 191 ? 50.935  -40.707 45.277  1.00   41.56  ? 943  PHE D CA  1 
ATOM   5591 C C   . PHE D 1 191 ? 52.381  -40.928 45.814  1.00   46.41  ? 943  PHE D C   1 
ATOM   5592 O O   . PHE D 1 191 ? 52.802  -42.064 46.095  1.00   43.01  ? 943  PHE D O   1 
ATOM   5593 C CB  . PHE D 1 191 ? 50.982  -40.751 43.766  1.00   43.91  ? 943  PHE D CB  1 
ATOM   5594 C CG  . PHE D 1 191 ? 51.594  -42.005 43.226  1.00   40.80  ? 943  PHE D CG  1 
ATOM   5595 C CD1 . PHE D 1 191 ? 52.921  -42.039 42.869  1.00   49.88  ? 943  PHE D CD1 1 
ATOM   5596 C CD2 . PHE D 1 191 ? 50.818  -43.138 43.065  1.00   47.20  ? 943  PHE D CD2 1 
ATOM   5597 C CE1 . PHE D 1 191 ? 53.480  -43.197 42.399  1.00   60.08  ? 943  PHE D CE1 1 
ATOM   5598 C CE2 . PHE D 1 191 ? 51.360  -44.306 42.610  1.00   52.78  ? 943  PHE D CE2 1 
ATOM   5599 C CZ  . PHE D 1 191 ? 52.679  -44.354 42.265  1.00   47.61  ? 943  PHE D CZ  1 
ATOM   5600 N N   . ASP D 1 192 ? 53.138  -39.828 45.884  1.00   48.29  ? 944  ASP D N   1 
ATOM   5601 C CA  . ASP D 1 192 ? 54.561  -39.871 46.154  1.00   53.29  ? 944  ASP D CA  1 
ATOM   5602 C C   . ASP D 1 192 ? 54.845  -40.071 47.640  1.00   57.16  ? 944  ASP D C   1 
ATOM   5603 O O   . ASP D 1 192 ? 55.887  -40.657 48.018  1.00   63.45  ? 944  ASP D O   1 
ATOM   5604 C CB  . ASP D 1 192 ? 55.226  -38.594 45.599  1.00   50.14  ? 944  ASP D CB  1 
ATOM   5605 C CG  . ASP D 1 192 ? 55.567  -38.723 44.113  1.00   60.15  ? 944  ASP D CG  1 
ATOM   5606 O OD1 . ASP D 1 192 ? 55.288  -39.809 43.516  1.00   47.31  ? 944  ASP D OD1 1 
ATOM   5607 O OD2 . ASP D 1 192 ? 56.101  -37.736 43.545  1.00   56.26  ? 944  ASP D OD2 1 
ATOM   5608 N N   . ILE D 1 193 ? 53.879  -39.651 48.455  1.00   46.61  ? 945  ILE D N   1 
ATOM   5609 C CA  . ILE D 1 193 ? 53.958  -39.753 49.886  1.00   51.98  ? 945  ILE D CA  1 
ATOM   5610 C C   . ILE D 1 193 ? 53.323  -41.093 50.289  1.00   46.99  ? 945  ILE D C   1 
ATOM   5611 O O   . ILE D 1 193 ? 53.854  -41.820 51.117  1.00   52.17  ? 945  ILE D O   1 
ATOM   5612 C CB  . ILE D 1 193 ? 53.198  -38.606 50.598  1.00   36.48  ? 945  ILE D CB  1 
ATOM   5613 C CG1 . ILE D 1 193 ? 53.850  -37.259 50.340  1.00   59.19  ? 945  ILE D CG1 1 
ATOM   5614 C CG2 . ILE D 1 193 ? 53.126  -38.871 52.067  1.00   51.65  ? 945  ILE D CG2 1 
ATOM   5615 C CD1 . ILE D 1 193 ? 52.889  -36.141 50.514  1.00   45.57  ? 945  ILE D CD1 1 
ATOM   5616 N N   . ALA D 1 194 ? 52.163  -41.385 49.738  1.00   47.03  ? 946  ALA D N   1 
ATOM   5617 C CA  . ALA D 1 194 ? 51.523  -42.694 50.030  1.00   45.71  ? 946  ALA D CA  1 
ATOM   5618 C C   . ALA D 1 194 ? 52.311  -43.943 49.644  1.00   50.44  ? 946  ALA D C   1 
ATOM   5619 O O   . ALA D 1 194 ? 52.147  -44.988 50.301  1.00   43.63  ? 946  ALA D O   1 
ATOM   5620 C CB  . ALA D 1 194 ? 50.177  -42.768 49.418  1.00   48.54  ? 946  ALA D CB  1 
ATOM   5621 N N   . PHE D 1 195 ? 53.062  -43.872 48.529  1.00   50.37  ? 947  PHE D N   1 
ATOM   5622 C CA  . PHE D 1 195 ? 53.896  -44.961 48.071  1.00   53.92  ? 947  PHE D CA  1 
ATOM   5623 C C   . PHE D 1 195 ? 55.333  -44.459 47.773  1.00   58.83  ? 947  PHE D C   1 
ATOM   5624 O O   . PHE D 1 195 ? 55.670  -44.183 46.626  1.00   63.08  ? 947  PHE D O   1 
ATOM   5625 C CB  . PHE D 1 195 ? 53.326  -45.596 46.787  1.00   57.75  ? 947  PHE D CB  1 
ATOM   5626 C CG  . PHE D 1 195 ? 51.844  -45.935 46.845  1.00   49.57  ? 947  PHE D CG  1 
ATOM   5627 C CD1 . PHE D 1 195 ? 51.403  -47.066 47.486  1.00   43.50  ? 947  PHE D CD1 1 
ATOM   5628 C CD2 . PHE D 1 195 ? 50.905  -45.143 46.172  1.00   48.86  ? 947  PHE D CD2 1 
ATOM   5629 C CE1 . PHE D 1 195 ? 49.980  -47.373 47.535  1.00   44.28  ? 947  PHE D CE1 1 
ATOM   5630 C CE2 . PHE D 1 195 ? 49.534  -45.478 46.150  1.00   56.58  ? 947  PHE D CE2 1 
ATOM   5631 C CZ  . PHE D 1 195 ? 49.064  -46.581 46.822  1.00   52.79  ? 947  PHE D CZ  1 
ATOM   5632 N N   . PRO D 1 196 ? 56.180  -44.348 48.798  1.00   56.80  ? 948  PRO D N   1 
ATOM   5633 C CA  . PRO D 1 196 ? 57.557  -43.931 48.582  1.00   58.52  ? 948  PRO D CA  1 
ATOM   5634 C C   . PRO D 1 196 ? 58.445  -45.111 48.196  1.00   52.99  ? 948  PRO D C   1 
ATOM   5635 O O   . PRO D 1 196 ? 58.427  -45.488 47.039  1.00   62.58  ? 948  PRO D O   1 
ATOM   5636 C CB  . PRO D 1 196 ? 57.947  -43.380 49.949  1.00   56.46  ? 948  PRO D CB  1 
ATOM   5637 C CG  . PRO D 1 196 ? 57.234  -44.243 50.862  1.00   56.65  ? 948  PRO D CG  1 
ATOM   5638 C CD  . PRO D 1 196 ? 55.920  -44.602 50.221  1.00   53.86  ? 948  PRO D CD  1 
ATOM   5639 N N   . ASP E 1 6   ? 40.832  17.597  3.441   1.00   81.35  ? 758  ASP E N   1 
ATOM   5640 C CA  . ASP E 1 6   ? 39.420  17.452  3.950   1.00   83.43  ? 758  ASP E CA  1 
ATOM   5641 C C   . ASP E 1 6   ? 39.345  16.453  5.133   1.00   80.01  ? 758  ASP E C   1 
ATOM   5642 O O   . ASP E 1 6   ? 38.552  15.503  5.132   1.00   73.89  ? 758  ASP E O   1 
ATOM   5643 C CB  . ASP E 1 6   ? 38.477  17.061  2.792   1.00   84.56  ? 758  ASP E CB  1 
ATOM   5644 C CG  . ASP E 1 6   ? 37.039  16.853  3.240   1.00   84.65  ? 758  ASP E CG  1 
ATOM   5645 O OD1 . ASP E 1 6   ? 36.490  17.744  3.938   1.00   82.30  ? 758  ASP E OD1 1 
ATOM   5646 O OD2 . ASP E 1 6   ? 36.485  15.783  2.897   1.00   70.77  ? 758  ASP E OD2 1 
ATOM   5647 N N   . VAL E 1 7   ? 40.190  16.692  6.133   1.00   79.32  ? 759  VAL E N   1 
ATOM   5648 C CA  . VAL E 1 7   ? 40.240  15.884  7.355   1.00   77.08  ? 759  VAL E CA  1 
ATOM   5649 C C   . VAL E 1 7   ? 39.203  16.324  8.431   1.00   75.87  ? 759  VAL E C   1 
ATOM   5650 O O   . VAL E 1 7   ? 39.271  17.435  8.954   1.00   68.98  ? 759  VAL E O   1 
ATOM   5651 C CB  . VAL E 1 7   ? 41.682  15.885  7.968   1.00   76.12  ? 759  VAL E CB  1 
ATOM   5652 C CG1 . VAL E 1 7   ? 42.087  17.276  8.507   1.00   75.48  ? 759  VAL E CG1 1 
ATOM   5653 C CG2 . VAL E 1 7   ? 41.820  14.803  9.057   1.00   75.82  ? 759  VAL E CG2 1 
ATOM   5654 N N   . THR E 1 8   ? 38.279  15.423  8.788   1.00   73.42  ? 760  THR E N   1 
ATOM   5655 C CA  . THR E 1 8   ? 37.299  15.696  9.854   1.00   70.52  ? 760  THR E CA  1 
ATOM   5656 C C   . THR E 1 8   ? 37.974  16.085  11.213  1.00   70.67  ? 760  THR E C   1 
ATOM   5657 O O   . THR E 1 8   ? 38.694  15.287  11.814  1.00   75.69  ? 760  THR E O   1 
ATOM   5658 C CB  . THR E 1 8   ? 36.241  14.487  10.028  1.00   71.07  ? 760  THR E CB  1 
ATOM   5659 O OG1 . THR E 1 8   ? 36.878  13.276  10.490  1.00   68.03  ? 760  THR E OG1 1 
ATOM   5660 C CG2 . THR E 1 8   ? 35.511  14.179  8.722   1.00   70.76  ? 760  THR E CG2 1 
ATOM   5661 N N   . PRO E 1 9   ? 37.736  17.293  11.704  1.00   69.05  ? 761  PRO E N   1 
ATOM   5662 C CA  . PRO E 1 9   ? 38.202  17.688  13.025  1.00   67.97  ? 761  PRO E CA  1 
ATOM   5663 C C   . PRO E 1 9   ? 37.214  17.136  14.026  1.00   64.32  ? 761  PRO E C   1 
ATOM   5664 O O   . PRO E 1 9   ? 36.120  16.831  13.650  1.00   68.84  ? 761  PRO E O   1 
ATOM   5665 C CB  . PRO E 1 9   ? 37.987  19.163  13.001  1.00   64.39  ? 761  PRO E CB  1 
ATOM   5666 C CG  . PRO E 1 9   ? 36.785  19.288  12.326  1.00   65.94  ? 761  PRO E CG  1 
ATOM   5667 C CD  . PRO E 1 9   ? 36.826  18.316  11.198  1.00   67.84  ? 761  PRO E CD  1 
ATOM   5668 N N   . PRO E 1 10  ? 37.553  17.093  15.283  1.00   56.58  ? 762  PRO E N   1 
ATOM   5669 C CA  . PRO E 1 10  ? 36.688  16.517  16.275  1.00   48.66  ? 762  PRO E CA  1 
ATOM   5670 C C   . PRO E 1 10  ? 35.305  17.085  16.266  1.00   52.96  ? 762  PRO E C   1 
ATOM   5671 O O   . PRO E 1 10  ? 35.136  18.257  16.179  1.00   39.65  ? 762  PRO E O   1 
ATOM   5672 C CB  . PRO E 1 10  ? 37.351  16.977  17.527  1.00   54.24  ? 762  PRO E CB  1 
ATOM   5673 C CG  . PRO E 1 10  ? 38.787  17.036  17.162  1.00   52.49  ? 762  PRO E CG  1 
ATOM   5674 C CD  . PRO E 1 10  ? 38.931  16.995  15.713  1.00   57.70  ? 762  PRO E CD  1 
ATOM   5675 N N   . GLY E 1 11  ? 34.315  16.205  16.343  1.00   51.09  ? 763  GLY E N   1 
ATOM   5676 C CA  . GLY E 1 11  ? 32.909  16.663  16.369  1.00   48.65  ? 763  GLY E CA  1 
ATOM   5677 C C   . GLY E 1 11  ? 32.193  16.836  15.037  1.00   45.58  ? 763  GLY E C   1 
ATOM   5678 O O   . GLY E 1 11  ? 31.070  17.386  15.006  1.00   46.36  ? 763  GLY E O   1 
ATOM   5679 N N   . VAL E 1 12  ? 32.820  16.319  13.981  1.00   38.78  ? 764  VAL E N   1 
ATOM   5680 C CA  . VAL E 1 12  ? 32.292  16.304  12.610  1.00   44.99  ? 764  VAL E CA  1 
ATOM   5681 C C   . VAL E 1 12  ? 32.249  14.871  12.077  1.00   41.94  ? 764  VAL E C   1 
ATOM   5682 O O   . VAL E 1 12  ? 33.238  14.170  11.979  1.00   45.02  ? 764  VAL E O   1 
ATOM   5683 C CB  . VAL E 1 12  ? 33.161  17.233  11.674  1.00   51.26  ? 764  VAL E CB  1 
ATOM   5684 C CG1 . VAL E 1 12  ? 32.895  17.028  10.266  1.00   46.35  ? 764  VAL E CG1 1 
ATOM   5685 C CG2 . VAL E 1 12  ? 32.874  18.710  11.992  1.00   46.29  ? 764  VAL E CG2 1 
ATOM   5686 N N   . VAL E 1 13  ? 31.063  14.437  11.718  1.00   46.83  ? 765  VAL E N   1 
ATOM   5687 C CA  . VAL E 1 13  ? 30.892  13.100  11.154  1.00   36.21  ? 765  VAL E CA  1 
ATOM   5688 C C   . VAL E 1 13  ? 30.149  13.267  9.883   1.00   34.27  ? 765  VAL E C   1 
ATOM   5689 O O   . VAL E 1 13  ? 29.179  14.090  9.780   1.00   35.94  ? 765  VAL E O   1 
ATOM   5690 C CB  . VAL E 1 13  ? 30.132  12.091  12.087  1.00   40.22  ? 765  VAL E CB  1 
ATOM   5691 C CG1 . VAL E 1 13  ? 30.380  10.575  11.579  1.00   26.17  ? 765  VAL E CG1 1 
ATOM   5692 C CG2 . VAL E 1 13  ? 30.611  12.224  13.514  1.00   43.10  ? 765  VAL E CG2 1 
ATOM   5693 N N   . MET E 1 14  ? 30.522  12.453  8.908   1.00   34.77  ? 766  MET E N   1 
ATOM   5694 C CA  . MET E 1 14  ? 29.782  12.420  7.660   1.00   37.46  ? 766  MET E CA  1 
ATOM   5695 C C   . MET E 1 14  ? 28.560  11.440  7.786   1.00   41.01  ? 766  MET E C   1 
ATOM   5696 O O   . MET E 1 14  ? 28.732  10.260  8.071   1.00   44.61  ? 766  MET E O   1 
ATOM   5697 C CB  . MET E 1 14  ? 30.620  11.984  6.511   1.00   45.40  ? 766  MET E CB  1 
ATOM   5698 C CG  . MET E 1 14  ? 29.859  11.870  5.224   1.00   46.93  ? 766  MET E CG  1 
ATOM   5699 S SD  . MET E 1 14  ? 30.737  11.450  3.704   1.00   57.24  ? 766  MET E SD  1 
ATOM   5700 C CE  . MET E 1 14  ? 32.375  10.796  4.310   1.00   46.01  ? 766  MET E CE  1 
ATOM   5701 N N   . GLY E 1 15  ? 27.393  11.937  7.429   1.00   37.19  ? 767  GLY E N   1 
ATOM   5702 C CA  . GLY E 1 15  ? 26.181  11.192  7.421   1.00   36.98  ? 767  GLY E CA  1 
ATOM   5703 C C   . GLY E 1 15  ? 25.626  11.064  6.025   1.00   39.85  ? 767  GLY E C   1 
ATOM   5704 O O   . GLY E 1 15  ? 25.759  11.946  5.159   1.00   46.73  ? 767  GLY E O   1 
ATOM   5705 N N   . LEU E 1 16  ? 24.921  9.973   5.805   1.00   39.07  ? 768  LEU E N   1 
ATOM   5706 C CA  . LEU E 1 16  ? 24.328  9.761   4.551   1.00   38.39  ? 768  LEU E CA  1 
ATOM   5707 C C   . LEU E 1 16  ? 22.899  10.154  4.662   1.00   42.00  ? 768  LEU E C   1 
ATOM   5708 O O   . LEU E 1 16  ? 22.194  9.802   5.650   1.00   43.58  ? 768  LEU E O   1 
ATOM   5709 C CB  . LEU E 1 16  ? 24.468  8.308   4.140   1.00   37.27  ? 768  LEU E CB  1 
ATOM   5710 C CG  . LEU E 1 16  ? 25.765  7.690   3.579   1.00   32.67  ? 768  LEU E CG  1 
ATOM   5711 C CD1 . LEU E 1 16  ? 26.831  8.686   2.868   1.00   39.38  ? 768  LEU E CD1 1 
ATOM   5712 C CD2 . LEU E 1 16  ? 26.464  6.648   4.425   1.00   33.99  ? 768  LEU E CD2 1 
ATOM   5713 N N   . ALA E 1 17  ? 22.398  10.832  3.636   1.00   31.77  ? 769  ALA E N   1 
ATOM   5714 C CA  . ALA E 1 17  ? 21.025  11.258  3.713   1.00   37.17  ? 769  ALA E CA  1 
ATOM   5715 C C   . ALA E 1 17  ? 20.312  10.794  2.494   1.00   33.41  ? 769  ALA E C   1 
ATOM   5716 O O   . ALA E 1 17  ? 20.873  10.816  1.429   1.00   45.46  ? 769  ALA E O   1 
ATOM   5717 C CB  . ALA E 1 17  ? 20.971  12.800  3.833   1.00   36.61  ? 769  ALA E CB  1 
ATOM   5718 N N   . TRP E 1 18  ? 19.016  10.505  2.640   1.00   39.35  ? 770  TRP E N   1 
ATOM   5719 C CA  . TRP E 1 18  ? 18.118  10.135  1.542   1.00   38.85  ? 770  TRP E CA  1 
ATOM   5720 C C   . TRP E 1 18  ? 17.308  11.392  1.195   1.00   43.89  ? 770  TRP E C   1 
ATOM   5721 O O   . TRP E 1 18  ? 16.657  11.910  2.035   1.00   37.96  ? 770  TRP E O   1 
ATOM   5722 C CB  . TRP E 1 18  ? 17.182  9.011   2.018   1.00   45.70  ? 770  TRP E CB  1 
ATOM   5723 C CG  . TRP E 1 18  ? 16.205  8.434   1.064   1.00   39.26  ? 770  TRP E CG  1 
ATOM   5724 C CD1 . TRP E 1 18  ? 16.214  8.479   -0.312  1.00   54.33  ? 770  TRP E CD1 1 
ATOM   5725 C CD2 . TRP E 1 18  ? 15.027  7.678   1.419   1.00   48.59  ? 770  TRP E CD2 1 
ATOM   5726 N NE1 . TRP E 1 18  ? 15.098  7.771   -0.840  1.00   39.81  ? 770  TRP E NE1 1 
ATOM   5727 C CE2 . TRP E 1 18  ? 14.365  7.300   0.206   1.00   48.44  ? 770  TRP E CE2 1 
ATOM   5728 C CE3 . TRP E 1 18  ? 14.459  7.289   2.650   1.00   58.98  ? 770  TRP E CE3 1 
ATOM   5729 C CZ2 . TRP E 1 18  ? 13.214  6.537   0.198   1.00   56.50  ? 770  TRP E CZ2 1 
ATOM   5730 C CZ3 . TRP E 1 18  ? 13.299  6.533   2.637   1.00   54.27  ? 770  TRP E CZ3 1 
ATOM   5731 C CH2 . TRP E 1 18  ? 12.678  6.202   1.423   1.00   51.48  ? 770  TRP E CH2 1 
ATOM   5732 N N   . THR E 1 19  ? 17.482  11.968  0.021   1.00   47.41  ? 771  THR E N   1 
ATOM   5733 C CA  . THR E 1 19  ? 16.860  13.284  -0.271  1.00   55.50  ? 771  THR E CA  1 
ATOM   5734 C C   . THR E 1 19  ? 15.823  12.979  -1.344  1.00   56.00  ? 771  THR E C   1 
ATOM   5735 O O   . THR E 1 19  ? 15.965  11.996  -2.027  1.00   64.62  ? 771  THR E O   1 
ATOM   5736 C CB  . THR E 1 19  ? 17.891  14.215  -0.833  1.00   54.17  ? 771  THR E CB  1 
ATOM   5737 O OG1 . THR E 1 19  ? 18.135  13.821  -2.183  1.00   60.41  ? 771  THR E OG1 1 
ATOM   5738 C CG2 . THR E 1 19  ? 19.211  14.086  -0.030  1.00   50.00  ? 771  THR E CG2 1 
ATOM   5739 N N   . ALA E 1 20  ? 14.777  13.788  -1.494  1.00   65.85  ? 772  ALA E N   1 
ATOM   5740 C CA  . ALA E 1 20  ? 13.598  13.343  -2.307  1.00   66.79  ? 772  ALA E CA  1 
ATOM   5741 C C   . ALA E 1 20  ? 13.933  13.056  -3.798  1.00   68.61  ? 772  ALA E C   1 
ATOM   5742 O O   . ALA E 1 20  ? 13.218  12.266  -4.464  1.00   66.38  ? 772  ALA E O   1 
ATOM   5743 C CB  . ALA E 1 20  ? 12.447  14.340  -2.176  1.00   68.63  ? 772  ALA E CB  1 
ATOM   5744 N N   . MET E 1 21  ? 15.023  13.671  -4.285  1.00   66.59  ? 773  MET E N   1 
ATOM   5745 C CA  . MET E 1 21  ? 15.539  13.473  -5.641  1.00   70.12  ? 773  MET E CA  1 
ATOM   5746 C C   . MET E 1 21  ? 16.718  12.506  -5.738  1.00   70.16  ? 773  MET E C   1 
ATOM   5747 O O   . MET E 1 21  ? 17.088  12.101  -6.835  1.00   70.49  ? 773  MET E O   1 
ATOM   5748 C CB  . MET E 1 21  ? 15.965  14.812  -6.212  1.00   74.20  ? 773  MET E CB  1 
ATOM   5749 C CG  . MET E 1 21  ? 14.785  15.624  -6.746  1.00   79.35  ? 773  MET E CG  1 
ATOM   5750 S SD  . MET E 1 21  ? 15.191  17.358  -7.010  1.00   89.95  ? 773  MET E SD  1 
ATOM   5751 C CE  . MET E 1 21  ? 15.524  17.927  -5.318  1.00   85.31  ? 773  MET E CE  1 
ATOM   5752 N N   . GLY E 1 22  ? 17.330  12.167  -4.600  1.00   69.08  ? 774  GLY E N   1 
ATOM   5753 C CA  . GLY E 1 22  ? 18.328  11.090  -4.545  1.00   63.33  ? 774  GLY E CA  1 
ATOM   5754 C C   . GLY E 1 22  ? 18.959  10.862  -3.174  1.00   58.40  ? 774  GLY E C   1 
ATOM   5755 O O   . GLY E 1 22  ? 18.265  10.719  -2.168  1.00   53.96  ? 774  GLY E O   1 
ATOM   5756 N N   . GLY E 1 23  ? 20.287  10.813  -3.190  1.00   54.62  ? 775  GLY E N   1 
ATOM   5757 C CA  . GLY E 1 23  ? 21.137  10.503  -2.077  1.00   53.04  ? 775  GLY E CA  1 
ATOM   5758 C C   . GLY E 1 23  ? 22.098  11.661  -1.843  1.00   58.09  ? 775  GLY E C   1 
ATOM   5759 O O   . GLY E 1 23  ? 22.601  12.279  -2.771  1.00   58.56  ? 775  GLY E O   1 
ATOM   5760 N N   . SER E 1 24  ? 22.328  11.984  -0.587  1.00   51.23  ? 776  SER E N   1 
ATOM   5761 C CA  . SER E 1 24  ? 23.311  13.004  -0.260  1.00   55.34  ? 776  SER E CA  1 
ATOM   5762 C C   . SER E 1 24  ? 24.241  12.622  0.883   1.00   49.49  ? 776  SER E C   1 
ATOM   5763 O O   . SER E 1 24  ? 23.871  11.808  1.784   1.00   47.47  ? 776  SER E O   1 
ATOM   5764 C CB  . SER E 1 24  ? 22.590  14.269  0.142   1.00   56.08  ? 776  SER E CB  1 
ATOM   5765 O OG  . SER E 1 24  ? 23.520  15.122  0.760   1.00   68.32  ? 776  SER E OG  1 
ATOM   5766 N N   . THR E 1 25  ? 25.424  13.224  0.861   1.00   46.43  ? 777  THR E N   1 
ATOM   5767 C CA  . THR E 1 25  ? 26.391  13.147  1.978   1.00   48.53  ? 777  THR E CA  1 
ATOM   5768 C C   . THR E 1 25  ? 26.371  14.459  2.708   1.00   51.83  ? 777  THR E C   1 
ATOM   5769 O O   . THR E 1 25  ? 26.451  15.505  2.055   1.00   58.07  ? 777  THR E O   1 
ATOM   5770 C CB  . THR E 1 25  ? 27.780  12.892  1.462   1.00   55.70  ? 777  THR E CB  1 
ATOM   5771 O OG1 . THR E 1 25  ? 27.963  11.463  1.397   1.00   56.67  ? 777  THR E OG1 1 
ATOM   5772 C CG2 . THR E 1 25  ? 28.818  13.568  2.386   1.00   56.58  ? 777  THR E CG2 1 
ATOM   5773 N N   . LEU E 1 26  ? 26.215  14.420  4.044   1.00   55.86  ? 778  LEU E N   1 
ATOM   5774 C CA  . LEU E 1 26  ? 26.084  15.639  4.841   1.00   57.12  ? 778  LEU E CA  1 
ATOM   5775 C C   . LEU E 1 26  ? 26.898  15.565  6.119   1.00   59.19  ? 778  LEU E C   1 
ATOM   5776 O O   . LEU E 1 26  ? 26.869  14.559  6.875   1.00   63.69  ? 778  LEU E O   1 
ATOM   5777 C CB  . LEU E 1 26  ? 24.600  15.994  5.094   1.00   59.86  ? 778  LEU E CB  1 
ATOM   5778 C CG  . LEU E 1 26  ? 23.677  16.189  3.861   1.00   62.71  ? 778  LEU E CG  1 
ATOM   5779 C CD1 . LEU E 1 26  ? 22.180  16.027  4.289   1.00   77.56  ? 778  LEU E CD1 1 
ATOM   5780 C CD2 . LEU E 1 26  ? 23.854  17.521  3.045   1.00   61.11  ? 778  LEU E CD2 1 
ATOM   5781 N N   . PHE E 1 27  ? 27.689  16.607  6.336   1.00   57.78  ? 779  PHE E N   1 
ATOM   5782 C CA  . PHE E 1 27  ? 28.531  16.690  7.494   1.00   56.41  ? 779  PHE E CA  1 
ATOM   5783 C C   . PHE E 1 27  ? 27.677  17.140  8.703   1.00   54.68  ? 779  PHE E C   1 
ATOM   5784 O O   . PHE E 1 27  ? 27.099  18.234  8.700   1.00   56.55  ? 779  PHE E O   1 
ATOM   5785 C CB  . PHE E 1 27  ? 29.731  17.642  7.227   1.00   60.78  ? 779  PHE E CB  1 
ATOM   5786 C CG  . PHE E 1 27  ? 30.850  17.025  6.372   1.00   56.64  ? 779  PHE E CG  1 
ATOM   5787 C CD1 . PHE E 1 27  ? 31.916  16.383  6.974   1.00   60.88  ? 779  PHE E CD1 1 
ATOM   5788 C CD2 . PHE E 1 27  ? 30.842  17.105  4.981   1.00   49.97  ? 779  PHE E CD2 1 
ATOM   5789 C CE1 . PHE E 1 27  ? 32.943  15.799  6.219   1.00   49.21  ? 779  PHE E CE1 1 
ATOM   5790 C CE2 . PHE E 1 27  ? 31.865  16.542  4.219   1.00   48.38  ? 779  PHE E CE2 1 
ATOM   5791 C CZ  . PHE E 1 27  ? 32.916  15.877  4.829   1.00   43.60  ? 779  PHE E CZ  1 
ATOM   5792 N N   . VAL E 1 28  ? 27.530  16.249  9.694   1.00   50.87  ? 780  VAL E N   1 
ATOM   5793 C CA  . VAL E 1 28  ? 26.947  16.618  10.968  1.00   45.72  ? 780  VAL E CA  1 
ATOM   5794 C C   . VAL E 1 28  ? 28.002  17.283  11.765  1.00   43.70  ? 780  VAL E C   1 
ATOM   5795 O O   . VAL E 1 28  ? 29.098  16.852  11.765  1.00   46.10  ? 780  VAL E O   1 
ATOM   5796 C CB  . VAL E 1 28  ? 26.385  15.413  11.724  1.00   40.89  ? 780  VAL E CB  1 
ATOM   5797 C CG1 . VAL E 1 28  ? 25.709  15.848  13.033  1.00   41.60  ? 780  VAL E CG1 1 
ATOM   5798 C CG2 . VAL E 1 28  ? 25.321  14.725  10.777  1.00   30.13  ? 780  VAL E CG2 1 
ATOM   5799 N N   . GLU E 1 29  ? 27.647  18.338  12.499  1.00   52.81  ? 781  GLU E N   1 
ATOM   5800 C CA  . GLU E 1 29  ? 28.651  19.194  13.176  1.00   54.92  ? 781  GLU E CA  1 
ATOM   5801 C C   . GLU E 1 29  ? 28.310  19.605  14.601  1.00   51.73  ? 781  GLU E C   1 
ATOM   5802 O O   . GLU E 1 29  ? 27.297  20.322  14.836  1.00   51.78  ? 781  GLU E O   1 
ATOM   5803 C CB  . GLU E 1 29  ? 28.822  20.487  12.377  1.00   60.78  ? 781  GLU E CB  1 
ATOM   5804 C CG  . GLU E 1 29  ? 30.225  20.757  11.903  1.00   67.37  ? 781  GLU E CG  1 
ATOM   5805 C CD  . GLU E 1 29  ? 30.381  22.170  11.345  1.00   68.39  ? 781  GLU E CD  1 
ATOM   5806 O OE1 . GLU E 1 29  ? 29.503  22.563  10.541  1.00   55.71  ? 781  GLU E OE1 1 
ATOM   5807 O OE2 . GLU E 1 29  ? 31.387  22.857  11.716  1.00   61.95  ? 781  GLU E OE2 1 
ATOM   5808 N N   . THR E 1 30  ? 29.123  19.134  15.539  1.00   49.41  ? 782  THR E N   1 
ATOM   5809 C CA  . THR E 1 30  ? 29.028  19.593  16.917  1.00   50.03  ? 782  THR E CA  1 
ATOM   5810 C C   . THR E 1 30  ? 30.146  20.600  17.295  1.00   48.58  ? 782  THR E C   1 
ATOM   5811 O O   . THR E 1 30  ? 31.306  20.371  17.020  1.00   47.51  ? 782  THR E O   1 
ATOM   5812 C CB  . THR E 1 30  ? 28.941  18.441  17.953  1.00   45.35  ? 782  THR E CB  1 
ATOM   5813 O OG1 . THR E 1 30  ? 30.099  17.611  17.886  1.00   57.00  ? 782  THR E OG1 1 
ATOM   5814 C CG2 . THR E 1 30  ? 27.665  17.591  17.727  1.00   48.69  ? 782  THR E CG2 1 
ATOM   5815 N N   . SER E 1 31  ? 29.755  21.721  17.904  1.00   53.38  ? 783  SER E N   1 
ATOM   5816 C CA  . SER E 1 31  ? 30.705  22.704  18.456  1.00   55.47  ? 783  SER E CA  1 
ATOM   5817 C C   . SER E 1 31  ? 30.248  23.210  19.809  1.00   59.01  ? 783  SER E C   1 
ATOM   5818 O O   . SER E 1 31  ? 29.059  23.180  20.124  1.00   60.91  ? 783  SER E O   1 
ATOM   5819 C CB  . SER E 1 31  ? 30.936  23.874  17.481  1.00   59.83  ? 783  SER E CB  1 
ATOM   5820 O OG  . SER E 1 31  ? 29.802  24.738  17.335  1.00   47.56  ? 783  SER E OG  1 
ATOM   5821 N N   . LEU E 1 32  ? 31.221  23.579  20.642  1.00   62.36  ? 784  LEU E N   1 
ATOM   5822 C CA  . LEU E 1 32  ? 30.979  24.468  21.761  1.00   67.35  ? 784  LEU E CA  1 
ATOM   5823 C C   . LEU E 1 32  ? 30.283  25.746  21.256  1.00   67.99  ? 784  LEU E C   1 
ATOM   5824 O O   . LEU E 1 32  ? 30.582  26.254  20.181  1.00   69.47  ? 784  LEU E O   1 
ATOM   5825 C CB  . LEU E 1 32  ? 32.309  24.852  22.428  1.00   67.13  ? 784  LEU E CB  1 
ATOM   5826 C CG  . LEU E 1 32  ? 32.394  24.793  23.949  1.00   68.41  ? 784  LEU E CG  1 
ATOM   5827 C CD1 . LEU E 1 32  ? 31.587  23.611  24.503  1.00   61.73  ? 784  LEU E CD1 1 
ATOM   5828 C CD2 . LEU E 1 32  ? 33.867  24.697  24.400  1.00   60.05  ? 784  LEU E CD2 1 
ATOM   5829 N N   . ARG E 1 33  ? 29.356  26.259  22.037  1.00   67.46  ? 785  ARG E N   1 
ATOM   5830 C CA  . ARG E 1 33  ? 28.711  27.497  21.695  1.00   74.45  ? 785  ARG E CA  1 
ATOM   5831 C C   . ARG E 1 33  ? 28.872  28.544  22.814  1.00   76.14  ? 785  ARG E C   1 
ATOM   5832 O O   . ARG E 1 33  ? 28.860  28.210  23.987  1.00   79.83  ? 785  ARG E O   1 
ATOM   5833 C CB  . ARG E 1 33  ? 27.252  27.195  21.344  1.00   75.74  ? 785  ARG E CB  1 
ATOM   5834 C CG  . ARG E 1 33  ? 26.401  28.382  20.909  1.00   82.70  ? 785  ARG E CG  1 
ATOM   5835 C CD  . ARG E 1 33  ? 25.383  28.777  22.023  1.00   90.01  ? 785  ARG E CD  1 
ATOM   5836 N NE  . ARG E 1 33  ? 24.525  27.655  22.412  1.00   90.88  ? 785  ARG E NE  1 
ATOM   5837 C CZ  . ARG E 1 33  ? 23.929  27.502  23.599  1.00   97.01  ? 785  ARG E CZ  1 
ATOM   5838 N NH1 . ARG E 1 33  ? 24.082  28.404  24.574  1.00   98.27  ? 785  ARG E NH1 1 
ATOM   5839 N NH2 . ARG E 1 33  ? 23.178  26.418  23.816  1.00   94.24  ? 785  ARG E NH2 1 
ATOM   5840 N N   . ARG E 1 34  ? 29.086  29.800  22.423  1.00   79.03  ? 786  ARG E N   1 
ATOM   5841 C CA  . ARG E 1 34  ? 29.101  30.963  23.339  1.00   79.47  ? 786  ARG E CA  1 
ATOM   5842 C C   . ARG E 1 34  ? 30.116  30.840  24.480  1.00   80.14  ? 786  ARG E C   1 
ATOM   5843 O O   . ARG E 1 34  ? 30.557  31.836  25.046  1.00   71.31  ? 786  ARG E O   1 
ATOM   5844 C CB  . ARG E 1 34  ? 27.684  31.255  23.878  1.00   79.00  ? 786  ARG E CB  1 
ATOM   5845 C CG  . ARG E 1 34  ? 27.204  30.322  25.011  1.00   77.98  ? 786  ARG E CG  1 
ATOM   5846 C CD  . ARG E 1 34  ? 26.278  31.026  25.967  1.00   80.71  ? 786  ARG E CD  1 
ATOM   5847 N NE  . ARG E 1 34  ? 26.980  32.152  26.584  1.00   82.74  ? 786  ARG E NE  1 
ATOM   5848 C CZ  . ARG E 1 34  ? 26.436  33.030  27.416  1.00   80.52  ? 786  ARG E CZ  1 
ATOM   5849 N NH1 . ARG E 1 34  ? 25.157  32.939  27.776  1.00   82.05  ? 786  ARG E NH1 1 
ATOM   5850 N NH2 . ARG E 1 34  ? 27.186  34.007  27.895  1.00   83.46  ? 786  ARG E NH2 1 
ATOM   5851 N N   . ASP E 1 45  ? 24.873  21.769  34.512  1.00   62.57  ? 797  ASP E N   1 
ATOM   5852 C CA  . ASP E 1 45  ? 23.844  21.500  33.526  1.00   68.47  ? 797  ASP E CA  1 
ATOM   5853 C C   . ASP E 1 45  ? 24.165  22.076  32.160  1.00   70.73  ? 797  ASP E C   1 
ATOM   5854 O O   . ASP E 1 45  ? 24.088  23.253  31.976  1.00   73.52  ? 797  ASP E O   1 
ATOM   5855 C CB  . ASP E 1 45  ? 22.520  22.068  33.996  1.00   69.36  ? 797  ASP E CB  1 
ATOM   5856 C CG  . ASP E 1 45  ? 22.418  23.621  33.846  1.00   79.82  ? 797  ASP E CG  1 
ATOM   5857 O OD1 . ASP E 1 45  ? 22.565  24.354  34.860  1.00   81.96  ? 797  ASP E OD1 1 
ATOM   5858 O OD2 . ASP E 1 45  ? 22.104  24.118  32.733  1.00   67.98  ? 797  ASP E OD2 1 
ATOM   5859 N N   . GLY E 1 46  ? 24.490  21.260  31.178  1.00   66.93  ? 798  GLY E N   1 
ATOM   5860 C CA  . GLY E 1 46  ? 24.770  21.779  29.858  1.00   61.69  ? 798  GLY E CA  1 
ATOM   5861 C C   . GLY E 1 46  ? 23.501  21.995  29.099  1.00   59.49  ? 798  GLY E C   1 
ATOM   5862 O O   . GLY E 1 46  ? 22.486  22.068  29.721  1.00   59.49  ? 798  GLY E O   1 
ATOM   5863 N N   . SER E 1 47  ? 23.550  22.072  27.777  1.00   52.47  ? 799  SER E N   1 
ATOM   5864 C CA  . SER E 1 47  ? 22.380  22.330  26.944  1.00   50.70  ? 799  SER E CA  1 
ATOM   5865 C C   . SER E 1 47  ? 22.658  21.986  25.489  1.00   51.01  ? 799  SER E C   1 
ATOM   5866 O O   . SER E 1 47  ? 23.799  22.068  25.034  1.00   59.22  ? 799  SER E O   1 
ATOM   5867 C CB  . SER E 1 47  ? 21.948  23.793  27.066  1.00   46.05  ? 799  SER E CB  1 
ATOM   5868 O OG  . SER E 1 47  ? 22.944  24.662  26.555  1.00   49.95  ? 799  SER E OG  1 
ATOM   5869 N N   . LEU E 1 48  ? 21.685  21.663  24.689  1.00   42.03  ? 800  LEU E N   1 
ATOM   5870 C CA  . LEU E 1 48  ? 22.015  21.431  23.312  1.00   53.87  ? 800  LEU E CA  1 
ATOM   5871 C C   . LEU E 1 48  ? 21.134  22.217  22.428  1.00   53.51  ? 800  LEU E C   1 
ATOM   5872 O O   . LEU E 1 48  ? 19.972  21.977  22.413  1.00   57.99  ? 800  LEU E O   1 
ATOM   5873 C CB  . LEU E 1 48  ? 21.813  19.977  22.963  1.00   56.19  ? 800  LEU E CB  1 
ATOM   5874 C CG  . LEU E 1 48  ? 21.924  19.600  21.494  1.00   59.59  ? 800  LEU E CG  1 
ATOM   5875 C CD1 . LEU E 1 48  ? 23.302  19.703  21.008  1.00   43.21  ? 800  LEU E CD1 1 
ATOM   5876 C CD2 . LEU E 1 48  ? 21.469  18.242  21.284  1.00   51.79  ? 800  LEU E CD2 1 
ATOM   5877 N N   . GLU E 1 49  ? 21.655  23.155  21.673  1.00   55.68  ? 801  GLU E N   1 
ATOM   5878 C CA  . GLU E 1 49  ? 20.773  23.796  20.676  1.00   57.16  ? 801  GLU E CA  1 
ATOM   5879 C C   . GLU E 1 49  ? 21.086  23.226  19.270  1.00   54.42  ? 801  GLU E C   1 
ATOM   5880 O O   . GLU E 1 49  ? 22.235  23.085  18.854  1.00   51.63  ? 801  GLU E O   1 
ATOM   5881 C CB  . GLU E 1 49  ? 20.844  25.341  20.732  1.00   59.59  ? 801  GLU E CB  1 
ATOM   5882 C CG  . GLU E 1 49  ? 21.945  25.952  19.859  1.00   65.09  ? 801  GLU E CG  1 
ATOM   5883 C CD  . GLU E 1 49  ? 22.215  27.459  20.096  1.00   77.23  ? 801  GLU E CD  1 
ATOM   5884 O OE1 . GLU E 1 49  ? 21.915  27.997  21.205  1.00   76.01  ? 801  GLU E OE1 1 
ATOM   5885 O OE2 . GLU E 1 49  ? 22.777  28.084  19.143  1.00   70.12  ? 801  GLU E OE2 1 
ATOM   5886 N N   . VAL E 1 50  ? 20.030  22.911  18.549  1.00   53.48  ? 802  VAL E N   1 
ATOM   5887 C CA  . VAL E 1 50  ? 20.135  22.262  17.268  1.00   52.00  ? 802  VAL E CA  1 
ATOM   5888 C C   . VAL E 1 50  ? 19.731  23.243  16.207  1.00   56.49  ? 802  VAL E C   1 
ATOM   5889 O O   . VAL E 1 50  ? 18.753  23.996  16.396  1.00   57.01  ? 802  VAL E O   1 
ATOM   5890 C CB  . VAL E 1 50  ? 19.091  21.094  17.165  1.00   53.41  ? 802  VAL E CB  1 
ATOM   5891 C CG1 . VAL E 1 50  ? 19.311  20.341  15.904  1.00   48.36  ? 802  VAL E CG1 1 
ATOM   5892 C CG2 . VAL E 1 50  ? 19.128  20.179  18.357  1.00   51.78  ? 802  VAL E CG2 1 
ATOM   5893 N N   . THR E 1 51  ? 20.448  23.225  15.072  1.00   60.21  ? 803  THR E N   1 
ATOM   5894 C CA  . THR E 1 51  ? 19.977  23.889  13.842  1.00   56.25  ? 803  THR E CA  1 
ATOM   5895 C C   . THR E 1 51  ? 20.051  22.981  12.592  1.00   58.66  ? 803  THR E C   1 
ATOM   5896 O O   . THR E 1 51  ? 20.667  21.894  12.590  1.00   53.86  ? 803  THR E O   1 
ATOM   5897 C CB  . THR E 1 51  ? 20.750  25.191  13.569  1.00   51.68  ? 803  THR E CB  1 
ATOM   5898 O OG1 . THR E 1 51  ? 22.125  24.909  13.329  1.00   55.32  ? 803  THR E OG1 1 
ATOM   5899 C CG2 . THR E 1 51  ? 20.615  26.157  14.784  1.00   56.85  ? 803  THR E CG2 1 
ATOM   5900 N N   . GLY E 1 52  ? 19.514  23.475  11.493  1.00   65.21  ? 804  GLY E N   1 
ATOM   5901 C CA  . GLY E 1 52  ? 19.452  22.695  10.284  1.00   67.98  ? 804  GLY E CA  1 
ATOM   5902 C C   . GLY E 1 52  ? 18.095  22.099  10.219  1.00   73.74  ? 804  GLY E C   1 
ATOM   5903 O O   . GLY E 1 52  ? 17.886  20.985  9.796   1.00   72.91  ? 804  GLY E O   1 
ATOM   5904 N N   . GLN E 1 53  ? 17.136  22.957  10.555  1.00   82.46  ? 805  GLN E N   1 
ATOM   5905 C CA  . GLN E 1 53  ? 15.818  22.640  11.080  1.00   83.70  ? 805  GLN E CA  1 
ATOM   5906 C C   . GLN E 1 53  ? 14.938  21.681  10.293  1.00   83.93  ? 805  GLN E C   1 
ATOM   5907 O O   . GLN E 1 53  ? 14.857  21.712  9.065   1.00   83.62  ? 805  GLN E O   1 
ATOM   5908 C CB  . GLN E 1 53  ? 15.041  23.935  11.346  1.00   83.93  ? 805  GLN E CB  1 
ATOM   5909 C CG  . GLN E 1 53  ? 13.832  23.759  12.251  1.00   82.42  ? 805  GLN E CG  1 
ATOM   5910 C CD  . GLN E 1 53  ? 13.915  24.606  13.505  1.00   83.11  ? 805  GLN E CD  1 
ATOM   5911 O OE1 . GLN E 1 53  ? 13.060  25.456  13.752  1.00   80.29  ? 805  GLN E OE1 1 
ATOM   5912 N NE2 . GLN E 1 53  ? 14.949  24.376  14.307  1.00   75.27  ? 805  GLN E NE2 1 
ATOM   5913 N N   . LEU E 1 54  ? 14.290  20.819  11.071  1.00   79.09  ? 806  LEU E N   1 
ATOM   5914 C CA  . LEU E 1 54  ? 13.475  19.747  10.604  1.00   76.84  ? 806  LEU E CA  1 
ATOM   5915 C C   . LEU E 1 54  ? 12.345  19.579  11.551  1.00   69.72  ? 806  LEU E C   1 
ATOM   5916 O O   . LEU E 1 54  ? 12.333  20.093  12.642  1.00   69.07  ? 806  LEU E O   1 
ATOM   5917 C CB  . LEU E 1 54  ? 14.236  18.446  10.472  1.00   81.13  ? 806  LEU E CB  1 
ATOM   5918 C CG  . LEU E 1 54  ? 14.217  17.757  9.113   1.00   82.74  ? 806  LEU E CG  1 
ATOM   5919 C CD1 . LEU E 1 54  ? 15.366  18.340  8.279   1.00   79.95  ? 806  LEU E CD1 1 
ATOM   5920 C CD2 . LEU E 1 54  ? 14.315  16.253  9.231   1.00   72.82  ? 806  LEU E CD2 1 
ATOM   5921 N N   . GLY E 1 55  ? 11.385  18.845  11.089  1.00   62.68  ? 807  GLY E N   1 
ATOM   5922 C CA  . GLY E 1 55  ? 10.153  18.596  11.832  1.00   59.77  ? 807  GLY E CA  1 
ATOM   5923 C C   . GLY E 1 55  ? 10.357  17.989  13.200  1.00   50.40  ? 807  GLY E C   1 
ATOM   5924 O O   . GLY E 1 55  ? 11.498  17.742  13.644  1.00   53.83  ? 807  GLY E O   1 
ATOM   5925 N N   . GLU E 1 56  ? 9.251   17.744  13.885  1.00   52.60  ? 808  GLU E N   1 
ATOM   5926 C CA  . GLU E 1 56  ? 9.316   17.262  15.276  1.00   53.41  ? 808  GLU E CA  1 
ATOM   5927 C C   . GLU E 1 56  ? 10.141  15.956  15.408  1.00   57.20  ? 808  GLU E C   1 
ATOM   5928 O O   . GLU E 1 56  ? 10.834  15.728  16.417  1.00   52.75  ? 808  GLU E O   1 
ATOM   5929 C CB  . GLU E 1 56  ? 7.928   16.952  15.798  1.00   57.03  ? 808  GLU E CB  1 
ATOM   5930 C CG  . GLU E 1 56  ? 6.948   18.112  15.884  1.00   62.09  ? 808  GLU E CG  1 
ATOM   5931 C CD  . GLU E 1 56  ? 5.614   17.643  16.453  1.00   69.34  ? 808  GLU E CD  1 
ATOM   5932 O OE1 . GLU E 1 56  ? 5.566   16.488  16.978  1.00   62.26  ? 808  GLU E OE1 1 
ATOM   5933 O OE2 . GLU E 1 56  ? 4.622   18.419  16.392  1.00   65.87  ? 808  GLU E OE2 1 
ATOM   5934 N N   . VAL E 1 57  ? 10.064  15.122  14.377  1.00   55.11  ? 809  VAL E N   1 
ATOM   5935 C CA  . VAL E 1 57  ? 10.710  13.817  14.399  1.00   57.35  ? 809  VAL E CA  1 
ATOM   5936 C C   . VAL E 1 57  ? 12.227  13.877  14.321  1.00   54.12  ? 809  VAL E C   1 
ATOM   5937 O O   . VAL E 1 57  ? 12.901  13.324  15.164  1.00   47.02  ? 809  VAL E O   1 
ATOM   5938 C CB  . VAL E 1 57  ? 10.104  12.902  13.321  1.00   56.05  ? 809  VAL E CB  1 
ATOM   5939 C CG1 . VAL E 1 57  ? 11.010  11.756  12.965  1.00   46.87  ? 809  VAL E CG1 1 
ATOM   5940 C CG2 . VAL E 1 57  ? 8.766   12.357  13.864  1.00   52.58  ? 809  VAL E CG2 1 
ATOM   5941 N N   . MET E 1 58  ? 12.755  14.592  13.353  1.00   52.16  ? 810  MET E N   1 
ATOM   5942 C CA  . MET E 1 58  ? 14.167  14.823  13.304  1.00   50.09  ? 810  MET E CA  1 
ATOM   5943 C C   . MET E 1 58  ? 14.697  15.579  14.549  1.00   47.79  ? 810  MET E C   1 
ATOM   5944 O O   . MET E 1 58  ? 15.802  15.314  14.987  1.00   41.84  ? 810  MET E O   1 
ATOM   5945 C CB  . MET E 1 58  ? 14.559  15.498  11.974  1.00   50.61  ? 810  MET E CB  1 
ATOM   5946 C CG  . MET E 1 58  ? 15.924  16.215  11.990  1.00   65.88  ? 810  MET E CG  1 
ATOM   5947 S SD  . MET E 1 58  ? 17.304  15.097  11.705  1.00   68.10  ? 810  MET E SD  1 
ATOM   5948 C CE  . MET E 1 58  ? 17.650  15.245  9.974   1.00   52.82  ? 810  MET E CE  1 
ATOM   5949 N N   . LYS E 1 59  ? 13.915  16.502  15.108  1.00   42.15  ? 811  LYS E N   1 
ATOM   5950 C CA  . LYS E 1 59  ? 14.240  17.100  16.364  1.00   50.78  ? 811  LYS E CA  1 
ATOM   5951 C C   . LYS E 1 59  ? 14.368  16.105  17.551  1.00   45.18  ? 811  LYS E C   1 
ATOM   5952 O O   . LYS E 1 59  ? 15.294  16.166  18.311  1.00   33.50  ? 811  LYS E O   1 
ATOM   5953 C CB  . LYS E 1 59  ? 13.176  18.163  16.718  1.00   56.94  ? 811  LYS E CB  1 
ATOM   5954 C CG  . LYS E 1 59  ? 13.484  18.897  18.024  1.00   61.57  ? 811  LYS E CG  1 
ATOM   5955 C CD  . LYS E 1 59  ? 12.564  20.121  18.287  1.00   75.06  ? 811  LYS E CD  1 
ATOM   5956 C CE  . LYS E 1 59  ? 12.847  20.787  19.669  1.00   78.60  ? 811  LYS E CE  1 
ATOM   5957 N NZ  . LYS E 1 59  ? 12.760  22.309  19.646  1.00   71.52  ? 811  LYS E NZ  1 
ATOM   5958 N N   . GLU E 1 60  ? 13.359  15.281  17.773  1.00   37.25  ? 812  GLU E N   1 
ATOM   5959 C CA  . GLU E 1 60  ? 13.444  14.224  18.782  1.00   44.44  ? 812  GLU E CA  1 
ATOM   5960 C C   . GLU E 1 60  ? 14.570  13.257  18.535  1.00   40.46  ? 812  GLU E C   1 
ATOM   5961 O O   . GLU E 1 60  ? 15.216  12.833  19.520  1.00   36.99  ? 812  GLU E O   1 
ATOM   5962 C CB  . GLU E 1 60  ? 12.117  13.468  18.908  1.00   52.92  ? 812  GLU E CB  1 
ATOM   5963 C CG  . GLU E 1 60  ? 11.103  14.340  19.591  1.00   54.26  ? 812  GLU E CG  1 
ATOM   5964 C CD  . GLU E 1 60  ? 11.614  14.907  20.938  1.00   70.69  ? 812  GLU E CD  1 
ATOM   5965 O OE1 . GLU E 1 60  ? 12.359  14.168  21.692  1.00   45.53  ? 812  GLU E OE1 1 
ATOM   5966 O OE2 . GLU E 1 60  ? 11.256  16.103  21.192  1.00   62.57  ? 812  GLU E OE2 1 
ATOM   5967 N N   . SER E 1 61  ? 14.887  13.007  17.248  1.00   39.43  ? 813  SER E N   1 
ATOM   5968 C CA  . SER E 1 61  ? 16.014  12.127  16.945  1.00   37.91  ? 813  SER E CA  1 
ATOM   5969 C C   . SER E 1 61  ? 17.282  12.758  17.500  1.00   46.21  ? 813  SER E C   1 
ATOM   5970 O O   . SER E 1 61  ? 18.113  12.095  18.075  1.00   37.61  ? 813  SER E O   1 
ATOM   5971 C CB  . SER E 1 61  ? 16.158  11.921  15.441  1.00   39.11  ? 813  SER E CB  1 
ATOM   5972 O OG  . SER E 1 61  ? 17.158  10.905  15.255  1.00   38.27  ? 813  SER E OG  1 
ATOM   5973 N N   . ALA E 1 62  ? 17.419  14.082  17.317  1.00   46.24  ? 814  ALA E N   1 
ATOM   5974 C CA  . ALA E 1 62  ? 18.492  14.801  17.939  1.00   42.38  ? 814  ALA E CA  1 
ATOM   5975 C C   . ALA E 1 62  ? 18.525  14.637  19.482  1.00   44.17  ? 814  ALA E C   1 
ATOM   5976 O O   . ALA E 1 62  ? 19.554  14.296  20.040  1.00   43.48  ? 814  ALA E O   1 
ATOM   5977 C CB  . ALA E 1 62  ? 18.428  16.346  17.479  1.00   39.71  ? 814  ALA E CB  1 
ATOM   5978 N N   . ARG E 1 63  ? 17.424  14.952  20.164  1.00   38.82  ? 815  ARG E N   1 
ATOM   5979 C CA  . ARG E 1 63  ? 17.260  14.740  21.579  1.00   35.30  ? 815  ARG E CA  1 
ATOM   5980 C C   . ARG E 1 63  ? 17.604  13.287  22.001  1.00   36.50  ? 815  ARG E C   1 
ATOM   5981 O O   . ARG E 1 63  ? 18.196  13.138  22.995  1.00   33.70  ? 815  ARG E O   1 
ATOM   5982 C CB  . ARG E 1 63  ? 15.860  15.095  22.086  1.00   38.71  ? 815  ARG E CB  1 
ATOM   5983 C CG  . ARG E 1 63  ? 15.551  16.667  22.249  1.00   52.13  ? 815  ARG E CG  1 
ATOM   5984 C CD  . ARG E 1 63  ? 14.107  16.900  22.843  1.00   51.55  ? 815  ARG E CD  1 
ATOM   5985 N NE  . ARG E 1 63  ? 13.972  17.805  24.002  1.00   66.38  ? 815  ARG E NE  1 
ATOM   5986 C CZ  . ARG E 1 63  ? 12.866  18.529  24.314  1.00   68.86  ? 815  ARG E CZ  1 
ATOM   5987 N NH1 . ARG E 1 63  ? 12.851  19.288  25.405  1.00   65.25  ? 815  ARG E NH1 1 
ATOM   5988 N NH2 . ARG E 1 63  ? 11.761  18.525  23.549  1.00   70.65  ? 815  ARG E NH2 1 
ATOM   5989 N N   . ILE E 1 64  ? 17.234  12.282  21.210  1.00   36.02  ? 816  ILE E N   1 
ATOM   5990 C CA  . ILE E 1 64  ? 17.488  10.931  21.563  1.00   40.55  ? 816  ILE E CA  1 
ATOM   5991 C C   . ILE E 1 64  ? 18.969  10.714  21.556  1.00   34.70  ? 816  ILE E C   1 
ATOM   5992 O O   . ILE E 1 64  ? 19.506  10.243  22.540  1.00   30.38  ? 816  ILE E O   1 
ATOM   5993 C CB  . ILE E 1 64  ? 16.849  9.952   20.591  1.00   44.78  ? 816  ILE E CB  1 
ATOM   5994 C CG1 . ILE E 1 64  ? 15.372  9.888   20.843  1.00   33.91  ? 816  ILE E CG1 1 
ATOM   5995 C CG2 . ILE E 1 64  ? 17.448  8.636   20.829  1.00   41.72  ? 816  ILE E CG2 1 
ATOM   5996 C CD1 . ILE E 1 64  ? 14.572  8.853   19.901  1.00   27.66  ? 816  ILE E CD1 1 
ATOM   5997 N N   . ALA E 1 65  ? 19.631  11.250  20.528  1.00   36.12  ? 817  ALA E N   1 
ATOM   5998 C CA  . ALA E 1 65  ? 21.036  11.095  20.465  1.00   34.40  ? 817  ALA E CA  1 
ATOM   5999 C C   . ALA E 1 65  ? 21.870  11.763  21.520  1.00   39.75  ? 817  ALA E C   1 
ATOM   6000 O O   . ALA E 1 65  ? 22.805  11.131  22.037  1.00   38.63  ? 817  ALA E O   1 
ATOM   6001 C CB  . ALA E 1 65  ? 21.516  11.332  18.995  1.00   33.91  ? 817  ALA E CB  1 
ATOM   6002 N N   . TYR E 1 66  ? 21.563  13.032  21.849  1.00   37.16  ? 818  TYR E N   1 
ATOM   6003 C CA  . TYR E 1 66  ? 22.073  13.702  22.968  1.00   40.07  ? 818  TYR E CA  1 
ATOM   6004 C C   . TYR E 1 66  ? 21.876  13.039  24.360  1.00   38.69  ? 818  TYR E C   1 
ATOM   6005 O O   . TYR E 1 66  ? 22.767  12.991  25.115  1.00   38.25  ? 818  TYR E O   1 
ATOM   6006 C CB  . TYR E 1 66  ? 21.436  15.082  23.016  1.00   44.17  ? 818  TYR E CB  1 
ATOM   6007 C CG  . TYR E 1 66  ? 22.011  16.003  24.043  1.00   49.21  ? 818  TYR E CG  1 
ATOM   6008 C CD1 . TYR E 1 66  ? 21.180  16.711  24.894  1.00   54.55  ? 818  TYR E CD1 1 
ATOM   6009 C CD2 . TYR E 1 66  ? 23.393  16.257  24.101  1.00   45.25  ? 818  TYR E CD2 1 
ATOM   6010 C CE1 . TYR E 1 66  ? 21.695  17.659  25.791  1.00   46.89  ? 818  TYR E CE1 1 
ATOM   6011 C CE2 . TYR E 1 66  ? 23.910  17.154  25.033  1.00   56.99  ? 818  TYR E CE2 1 
ATOM   6012 C CZ  . TYR E 1 66  ? 23.057  17.848  25.878  1.00   58.18  ? 818  TYR E CZ  1 
ATOM   6013 O OH  . TYR E 1 66  ? 23.543  18.751  26.801  1.00   53.65  ? 818  TYR E OH  1 
ATOM   6014 N N   . THR E 1 67  ? 20.699  12.510  24.643  1.00   44.04  ? 819  THR E N   1 
ATOM   6015 C CA  . THR E 1 67  ? 20.473  11.771  25.840  1.00   42.79  ? 819  THR E CA  1 
ATOM   6016 C C   . THR E 1 67  ? 21.276  10.457  25.864  1.00   41.93  ? 819  THR E C   1 
ATOM   6017 O O   . THR E 1 67  ? 21.879  10.108  26.860  1.00   34.31  ? 819  THR E O   1 
ATOM   6018 C CB  . THR E 1 67  ? 18.980  11.532  26.043  1.00   37.48  ? 819  THR E CB  1 
ATOM   6019 O OG1 . THR E 1 67  ? 18.381  12.796  26.393  1.00   47.06  ? 819  THR E OG1 1 
ATOM   6020 C CG2 . THR E 1 67  ? 18.795  10.601  27.275  1.00   39.04  ? 819  THR E CG2 1 
ATOM   6021 N N   . PHE E 1 68  ? 21.347  9.786   24.741  1.00   35.13  ? 820  PHE E N   1 
ATOM   6022 C CA  . PHE E 1 68  ? 22.050  8.435   24.750  1.00   38.28  ? 820  PHE E CA  1 
ATOM   6023 C C   . PHE E 1 68  ? 23.551  8.656   24.816  1.00   35.32  ? 820  PHE E C   1 
ATOM   6024 O O   . PHE E 1 68  ? 24.287  7.944   25.464  1.00   32.68  ? 820  PHE E O   1 
ATOM   6025 C CB  . PHE E 1 68  ? 21.663  7.641   23.540  1.00   38.93  ? 820  PHE E CB  1 
ATOM   6026 C CG  . PHE E 1 68  ? 22.524  6.479   23.337  1.00   31.47  ? 820  PHE E CG  1 
ATOM   6027 C CD1 . PHE E 1 68  ? 23.549  6.538   22.442  1.00   31.72  ? 820  PHE E CD1 1 
ATOM   6028 C CD2 . PHE E 1 68  ? 22.362  5.374   24.149  1.00   36.76  ? 820  PHE E CD2 1 
ATOM   6029 C CE1 . PHE E 1 68  ? 24.399  5.391   22.303  1.00   35.44  ? 820  PHE E CE1 1 
ATOM   6030 C CE2 . PHE E 1 68  ? 23.211  4.331   24.073  1.00   34.26  ? 820  PHE E CE2 1 
ATOM   6031 C CZ  . PHE E 1 68  ? 24.210  4.328   23.140  1.00   36.17  ? 820  PHE E CZ  1 
ATOM   6032 N N   . ALA E 1 69  ? 24.003  9.717   24.223  1.00   36.01  ? 821  ALA E N   1 
ATOM   6033 C CA  . ALA E 1 69  ? 25.465  9.999   24.248  1.00   34.59  ? 821  ALA E CA  1 
ATOM   6034 C C   . ALA E 1 69  ? 26.000  10.485  25.575  1.00   39.02  ? 821  ALA E C   1 
ATOM   6035 O O   . ALA E 1 69  ? 27.126  10.126  25.986  1.00   42.50  ? 821  ALA E O   1 
ATOM   6036 C CB  . ALA E 1 69  ? 25.807  10.989  23.144  1.00   35.61  ? 821  ALA E CB  1 
ATOM   6037 N N   . ARG E 1 70  ? 25.174  11.184  26.341  1.00   34.41  ? 822  ARG E N   1 
ATOM   6038 C CA  . ARG E 1 70  ? 25.520  11.474  27.696  1.00   38.80  ? 822  ARG E CA  1 
ATOM   6039 C C   . ARG E 1 70  ? 25.511  10.182  28.567  1.00   32.68  ? 822  ARG E C   1 
ATOM   6040 O O   . ARG E 1 70  ? 26.416  10.010  29.309  1.00   38.78  ? 822  ARG E O   1 
ATOM   6041 C CB  . ARG E 1 70  ? 24.564  12.518  28.300  1.00   42.02  ? 822  ARG E CB  1 
ATOM   6042 C CG  . ARG E 1 70  ? 24.602  13.895  27.638  1.00   45.84  ? 822  ARG E CG  1 
ATOM   6043 C CD  . ARG E 1 70  ? 23.215  14.387  27.356  1.00   49.40  ? 822  ARG E CD  1 
ATOM   6044 N NE  . ARG E 1 70  ? 22.776  15.382  28.252  1.00   60.07  ? 822  ARG E NE  1 
ATOM   6045 C CZ  . ARG E 1 70  ? 21.498  15.621  28.504  1.00   59.67  ? 822  ARG E CZ  1 
ATOM   6046 N NH1 . ARG E 1 70  ? 20.558  14.871  27.963  1.00   49.62  ? 822  ARG E NH1 1 
ATOM   6047 N NH2 . ARG E 1 70  ? 21.175  16.603  29.322  1.00   56.17  ? 822  ARG E NH2 1 
ATOM   6048 N N   . ALA E 1 71  ? 24.512  9.285   28.429  1.00   37.64  ? 823  ALA E N   1 
ATOM   6049 C CA  . ALA E 1 71  ? 24.503  8.047   29.174  1.00   36.09  ? 823  ALA E CA  1 
ATOM   6050 C C   . ALA E 1 71  ? 25.704  7.169   28.845  1.00   37.25  ? 823  ALA E C   1 
ATOM   6051 O O   . ALA E 1 71  ? 26.334  6.522   29.737  1.00   40.20  ? 823  ALA E O   1 
ATOM   6052 C CB  . ALA E 1 71  ? 23.200  7.228   28.964  1.00   34.38  ? 823  ALA E CB  1 
ATOM   6053 N N   . PHE E 1 72  ? 25.938  7.064   27.559  1.00   38.62  ? 824  PHE E N   1 
ATOM   6054 C CA  . PHE E 1 72  ? 26.988  6.213   26.992  1.00   30.56  ? 824  PHE E CA  1 
ATOM   6055 C C   . PHE E 1 72  ? 28.388  6.733   27.415  1.00   39.82  ? 824  PHE E C   1 
ATOM   6056 O O   . PHE E 1 72  ? 29.236  5.999   27.817  1.00   40.73  ? 824  PHE E O   1 
ATOM   6057 C CB  . PHE E 1 72  ? 26.802  6.141   25.473  1.00   25.66  ? 824  PHE E CB  1 
ATOM   6058 C CG  . PHE E 1 72  ? 27.860  5.310   24.790  1.00   43.72  ? 824  PHE E CG  1 
ATOM   6059 C CD1 . PHE E 1 72  ? 29.102  5.818   24.580  1.00   31.77  ? 824  PHE E CD1 1 
ATOM   6060 C CD2 . PHE E 1 72  ? 27.620  3.992   24.427  1.00   37.17  ? 824  PHE E CD2 1 
ATOM   6061 C CE1 . PHE E 1 72  ? 30.119  5.070   24.042  1.00   38.48  ? 824  PHE E CE1 1 
ATOM   6062 C CE2 . PHE E 1 72  ? 28.612  3.248   23.826  1.00   41.67  ? 824  PHE E CE2 1 
ATOM   6063 C CZ  . PHE E 1 72  ? 29.868  3.813   23.615  1.00   33.10  ? 824  PHE E CZ  1 
ATOM   6064 N N   . LEU E 1 73  ? 28.597  8.029   27.390  1.00   41.44  ? 825  LEU E N   1 
ATOM   6065 C CA  . LEU E 1 73  ? 29.844  8.561   27.884  1.00   44.97  ? 825  LEU E CA  1 
ATOM   6066 C C   . LEU E 1 73  ? 30.009  8.413   29.417  1.00   40.52  ? 825  LEU E C   1 
ATOM   6067 O O   . LEU E 1 73  ? 31.100  8.123   29.944  1.00   46.23  ? 825  LEU E O   1 
ATOM   6068 C CB  . LEU E 1 73  ? 29.985  10.016  27.369  1.00   39.81  ? 825  LEU E CB  1 
ATOM   6069 C CG  . LEU E 1 73  ? 31.404  10.542  27.580  1.00   52.57  ? 825  LEU E CG  1 
ATOM   6070 C CD1 . LEU E 1 73  ? 32.388  9.691   26.753  1.00   35.16  ? 825  LEU E CD1 1 
ATOM   6071 C CD2 . LEU E 1 73  ? 31.503  12.027  27.205  1.00   32.60  ? 825  LEU E CD2 1 
ATOM   6072 N N   . MET E 1 74  ? 28.913  8.508   30.145  1.00   39.27  ? 826  MET E N   1 
ATOM   6073 C CA  . MET E 1 74  ? 28.965  8.324   31.545  1.00   42.07  ? 826  MET E CA  1 
ATOM   6074 C C   . MET E 1 74  ? 29.414  6.913   31.853  1.00   48.26  ? 826  MET E C   1 
ATOM   6075 O O   . MET E 1 74  ? 30.239  6.682   32.762  1.00   44.45  ? 826  MET E O   1 
ATOM   6076 C CB  . MET E 1 74  ? 27.594  8.585   32.172  1.00   39.39  ? 826  MET E CB  1 
ATOM   6077 C CG  . MET E 1 74  ? 27.453  8.209   33.642  1.00   44.87  ? 826  MET E CG  1 
ATOM   6078 S SD  . MET E 1 74  ? 25.910  8.711   34.470  1.00   53.58  ? 826  MET E SD  1 
ATOM   6079 C CE  . MET E 1 74  ? 26.206  10.463  34.160  1.00   59.59  ? 826  MET E CE  1 
ATOM   6080 N N   . GLN E 1 75  ? 28.873  5.987   31.082  1.00   46.24  ? 827  GLN E N   1 
ATOM   6081 C CA  . GLN E 1 75  ? 29.167  4.585   31.230  1.00   47.37  ? 827  GLN E CA  1 
ATOM   6082 C C   . GLN E 1 75  ? 30.562  4.173   30.884  1.00   51.17  ? 827  GLN E C   1 
ATOM   6083 O O   . GLN E 1 75  ? 31.160  3.383   31.606  1.00   56.19  ? 827  GLN E O   1 
ATOM   6084 C CB  . GLN E 1 75  ? 28.185  3.762   30.394  1.00   51.22  ? 827  GLN E CB  1 
ATOM   6085 C CG  . GLN E 1 75  ? 26.891  3.479   31.075  1.00   56.36  ? 827  GLN E CG  1 
ATOM   6086 C CD  . GLN E 1 75  ? 27.015  2.543   32.295  1.00   63.90  ? 827  GLN E CD  1 
ATOM   6087 O OE1 . GLN E 1 75  ? 26.032  2.344   33.028  1.00   51.64  ? 827  GLN E OE1 1 
ATOM   6088 N NE2 . GLN E 1 75  ? 28.197  1.956   32.505  1.00   62.31  ? 827  GLN E NE2 1 
ATOM   6089 N N   A HIS E 1 76  ? 31.099  4.694   29.790  0.50   50.47  ? 828  HIS E N   1 
ATOM   6090 N N   B HIS E 1 76  ? 31.064  4.715   29.779  0.50   51.29  ? 828  HIS E N   1 
ATOM   6091 C CA  A HIS E 1 76  ? 32.412  4.279   29.336  0.50   50.38  ? 828  HIS E CA  1 
ATOM   6092 C CA  B HIS E 1 76  ? 32.354  4.361   29.215  0.50   51.55  ? 828  HIS E CA  1 
ATOM   6093 C C   A HIS E 1 76  ? 33.514  5.212   29.793  0.50   51.18  ? 828  HIS E C   1 
ATOM   6094 C C   B HIS E 1 76  ? 33.462  5.197   29.823  0.50   51.29  ? 828  HIS E C   1 
ATOM   6095 O O   A HIS E 1 76  ? 34.650  4.779   29.918  0.50   53.10  ? 828  HIS E O   1 
ATOM   6096 O O   B HIS E 1 76  ? 34.533  4.684   30.101  0.50   51.10  ? 828  HIS E O   1 
ATOM   6097 C CB  A HIS E 1 76  ? 32.454  4.085   27.812  0.50   47.97  ? 828  HIS E CB  1 
ATOM   6098 C CB  B HIS E 1 76  ? 32.322  4.520   27.680  0.50   50.02  ? 828  HIS E CB  1 
ATOM   6099 C CG  A HIS E 1 76  ? 31.458  3.088   27.319  0.50   44.38  ? 828  HIS E CG  1 
ATOM   6100 C CG  B HIS E 1 76  ? 33.670  4.692   27.040  0.50   53.36  ? 828  HIS E CG  1 
ATOM   6101 N ND1 A HIS E 1 76  ? 30.191  3.452   26.933  0.50   39.47  ? 828  HIS E ND1 1 
ATOM   6102 N ND1 B HIS E 1 76  ? 34.295  3.685   26.334  0.50   47.74  ? 828  HIS E ND1 1 
ATOM   6103 C CD2 A HIS E 1 76  ? 31.515  1.740   27.192  0.50   46.49  ? 828  HIS E CD2 1 
ATOM   6104 C CD2 B HIS E 1 76  ? 34.494  5.765   26.968  0.50   48.84  ? 828  HIS E CD2 1 
ATOM   6105 C CE1 A HIS E 1 76  ? 29.519  2.373   26.556  0.50   41.07  ? 828  HIS E CE1 1 
ATOM   6106 C CE1 B HIS E 1 76  ? 35.442  4.129   25.858  0.50   43.61  ? 828  HIS E CE1 1 
ATOM   6107 N NE2 A HIS E 1 76  ? 30.291  1.323   26.717  0.50   35.44  ? 828  HIS E NE2 1 
ATOM   6108 N NE2 B HIS E 1 76  ? 35.593  5.385   26.235  0.50   52.38  ? 828  HIS E NE2 1 
ATOM   6109 N N   . ALA E 1 77  ? 33.201  6.479   30.028  1.00   52.53  ? 829  ALA E N   1 
ATOM   6110 C CA  . ALA E 1 77  ? 34.202  7.404   30.606  1.00   51.77  ? 829  ALA E CA  1 
ATOM   6111 C C   . ALA E 1 77  ? 33.631  8.159   31.788  1.00   51.42  ? 829  ALA E C   1 
ATOM   6112 O O   . ALA E 1 77  ? 33.272  9.345   31.667  1.00   56.57  ? 829  ALA E O   1 
ATOM   6113 C CB  . ALA E 1 77  ? 34.787  8.387   29.509  1.00   43.85  ? 829  ALA E CB  1 
ATOM   6114 N N   . PRO E 1 78  ? 33.541  7.490   32.949  1.00   49.98  ? 830  PRO E N   1 
ATOM   6115 C CA  . PRO E 1 78  ? 33.104  8.096   34.180  1.00   53.34  ? 830  PRO E CA  1 
ATOM   6116 C C   . PRO E 1 78  ? 33.617  9.488   34.465  1.00   54.28  ? 830  PRO E C   1 
ATOM   6117 O O   . PRO E 1 78  ? 32.888  10.258  35.043  1.00   50.80  ? 830  PRO E O   1 
ATOM   6118 C CB  . PRO E 1 78  ? 33.678  7.154   35.232  1.00   59.37  ? 830  PRO E CB  1 
ATOM   6119 C CG  . PRO E 1 78  ? 33.610  5.878   34.605  1.00   58.43  ? 830  PRO E CG  1 
ATOM   6120 C CD  . PRO E 1 78  ? 34.051  6.141   33.207  1.00   51.48  ? 830  PRO E CD  1 
ATOM   6121 N N   . ALA E 1 79  ? 34.852  9.815   34.051  1.00   60.92  ? 831  ALA E N   1 
ATOM   6122 C CA  . ALA E 1 79  ? 35.503  11.007  34.535  1.00   59.70  ? 831  ALA E CA  1 
ATOM   6123 C C   . ALA E 1 79  ? 35.191  12.203  33.723  1.00   58.73  ? 831  ALA E C   1 
ATOM   6124 O O   . ALA E 1 79  ? 35.477  13.357  34.154  1.00   56.49  ? 831  ALA E O   1 
ATOM   6125 C CB  . ALA E 1 79  ? 37.025  10.821  34.585  1.00   63.14  ? 831  ALA E CB  1 
ATOM   6126 N N   . ASN E 1 80  ? 34.689  11.967  32.521  1.00   58.65  ? 832  ASN E N   1 
ATOM   6127 C CA  . ASN E 1 80  ? 34.568  13.046  31.581  1.00   52.20  ? 832  ASN E CA  1 
ATOM   6128 C C   . ASN E 1 80  ? 33.188  13.646  31.651  1.00   51.77  ? 832  ASN E C   1 
ATOM   6129 O O   . ASN E 1 80  ? 32.208  12.992  31.275  1.00   52.50  ? 832  ASN E O   1 
ATOM   6130 C CB  . ASN E 1 80  ? 34.916  12.575  30.139  1.00   56.89  ? 832  ASN E CB  1 
ATOM   6131 C CG  . ASN E 1 80  ? 34.833  13.700  29.130  1.00   44.47  ? 832  ASN E CG  1 
ATOM   6132 O OD1 . ASN E 1 80  ? 34.267  14.752  29.447  1.00   63.44  ? 832  ASN E OD1 1 
ATOM   6133 N ND2 . ASN E 1 80  ? 35.339  13.492  27.867  1.00   46.58  ? 832  ASN E ND2 1 
ATOM   6134 N N   . ASP E 1 81  ? 33.102  14.919  32.027  1.00   48.19  ? 833  ASP E N   1 
ATOM   6135 C CA  . ASP E 1 81  ? 31.802  15.548  32.285  1.00   48.49  ? 833  ASP E CA  1 
ATOM   6136 C C   . ASP E 1 81  ? 31.290  16.531  31.179  1.00   47.04  ? 833  ASP E C   1 
ATOM   6137 O O   . ASP E 1 81  ? 30.242  17.221  31.334  1.00   48.84  ? 833  ASP E O   1 
ATOM   6138 C CB  . ASP E 1 81  ? 31.827  16.191  33.672  1.00   49.81  ? 833  ASP E CB  1 
ATOM   6139 C CG  . ASP E 1 81  ? 32.771  17.397  33.768  1.00   52.31  ? 833  ASP E CG  1 
ATOM   6140 O OD1 . ASP E 1 81  ? 32.757  18.151  34.795  1.00   60.43  ? 833  ASP E OD1 1 
ATOM   6141 O OD2 . ASP E 1 81  ? 33.539  17.587  32.819  1.00   52.79  ? 833  ASP E OD2 1 
ATOM   6142 N N   . TYR E 1 82  ? 31.969  16.517  30.030  1.00   46.20  ? 834  TYR E N   1 
ATOM   6143 C CA  . TYR E 1 82  ? 31.822  17.444  28.943  1.00   48.03  ? 834  TYR E CA  1 
ATOM   6144 C C   . TYR E 1 82  ? 30.429  17.524  28.375  1.00   48.15  ? 834  TYR E C   1 
ATOM   6145 O O   . TYR E 1 82  ? 29.859  18.622  28.099  1.00   47.16  ? 834  TYR E O   1 
ATOM   6146 C CB  . TYR E 1 82  ? 32.789  17.042  27.803  1.00   54.32  ? 834  TYR E CB  1 
ATOM   6147 C CG  . TYR E 1 82  ? 32.895  18.051  26.671  1.00   57.00  ? 834  TYR E CG  1 
ATOM   6148 C CD1 . TYR E 1 82  ? 33.825  19.081  26.692  1.00   62.72  ? 834  TYR E CD1 1 
ATOM   6149 C CD2 . TYR E 1 82  ? 32.044  17.982  25.590  1.00   61.09  ? 834  TYR E CD2 1 
ATOM   6150 C CE1 . TYR E 1 82  ? 33.888  20.015  25.650  1.00   59.55  ? 834  TYR E CE1 1 
ATOM   6151 C CE2 . TYR E 1 82  ? 32.092  18.891  24.572  1.00   52.16  ? 834  TYR E CE2 1 
ATOM   6152 C CZ  . TYR E 1 82  ? 33.011  19.900  24.593  1.00   59.42  ? 834  TYR E CZ  1 
ATOM   6153 O OH  . TYR E 1 82  ? 33.001  20.756  23.538  1.00   40.28  ? 834  TYR E OH  1 
ATOM   6154 N N   . LEU E 1 83  ? 29.866  16.350  28.151  1.00   44.46  ? 835  LEU E N   1 
ATOM   6155 C CA  . LEU E 1 83  ? 28.534  16.275  27.620  1.00   45.33  ? 835  LEU E CA  1 
ATOM   6156 C C   . LEU E 1 83  ? 27.483  16.743  28.636  1.00   41.40  ? 835  LEU E C   1 
ATOM   6157 O O   . LEU E 1 83  ? 26.387  17.181  28.281  1.00   42.53  ? 835  LEU E O   1 
ATOM   6158 C CB  . LEU E 1 83  ? 28.313  14.830  27.153  1.00   43.86  ? 835  LEU E CB  1 
ATOM   6159 C CG  . LEU E 1 83  ? 28.450  14.713  25.629  1.00   40.20  ? 835  LEU E CG  1 
ATOM   6160 C CD1 . LEU E 1 83  ? 29.302  15.674  24.853  1.00   41.66  ? 835  LEU E CD1 1 
ATOM   6161 C CD2 . LEU E 1 83  ? 28.757  13.237  25.191  1.00   45.83  ? 835  LEU E CD2 1 
ATOM   6162 N N   . VAL E 1 84  ? 27.817  16.608  29.893  1.00   49.83  ? 836  VAL E N   1 
ATOM   6163 C CA  . VAL E 1 84  ? 26.958  17.079  30.959  1.00   52.00  ? 836  VAL E CA  1 
ATOM   6164 C C   . VAL E 1 84  ? 27.202  18.524  31.362  1.00   54.58  ? 836  VAL E C   1 
ATOM   6165 O O   . VAL E 1 84  ? 26.334  19.135  31.951  1.00   54.74  ? 836  VAL E O   1 
ATOM   6166 C CB  . VAL E 1 84  ? 27.120  16.199  32.125  1.00   48.72  ? 836  VAL E CB  1 
ATOM   6167 C CG1 . VAL E 1 84  ? 26.878  16.961  33.420  1.00   46.30  ? 836  VAL E CG1 1 
ATOM   6168 C CG2 . VAL E 1 84  ? 26.163  15.003  31.922  1.00   49.18  ? 836  VAL E CG2 1 
ATOM   6169 N N   . THR E 1 85  ? 28.350  19.074  31.003  1.00   57.14  ? 837  THR E N   1 
ATOM   6170 C CA  . THR E 1 85  ? 28.640  20.492  31.332  1.00   63.02  ? 837  THR E CA  1 
ATOM   6171 C C   . THR E 1 85  ? 28.499  21.499  30.188  1.00   63.98  ? 837  THR E C   1 
ATOM   6172 O O   . THR E 1 85  ? 28.069  22.643  30.414  1.00   68.10  ? 837  THR E O   1 
ATOM   6173 C CB  . THR E 1 85  ? 30.030  20.606  31.979  1.00   60.02  ? 837  THR E CB  1 
ATOM   6174 O OG1 . THR E 1 85  ? 31.004  19.871  31.211  1.00   51.01  ? 837  THR E OG1 1 
ATOM   6175 C CG2 . THR E 1 85  ? 29.964  19.999  33.350  1.00   63.33  ? 837  THR E CG2 1 
ATOM   6176 N N   . SER E 1 86  ? 28.844  21.109  28.958  1.00   59.68  ? 838  SER E N   1 
ATOM   6177 C CA  . SER E 1 86  ? 28.996  22.107  27.896  1.00   50.67  ? 838  SER E CA  1 
ATOM   6178 C C   . SER E 1 86  ? 27.686  22.506  27.261  1.00   51.97  ? 838  SER E C   1 
ATOM   6179 O O   . SER E 1 86  ? 26.773  21.737  27.199  1.00   46.54  ? 838  SER E O   1 
ATOM   6180 C CB  . SER E 1 86  ? 29.963  21.628  26.842  1.00   50.75  ? 838  SER E CB  1 
ATOM   6181 O OG  . SER E 1 86  ? 30.968  20.833  27.426  1.00   46.33  ? 838  SER E OG  1 
ATOM   6182 N N   . HIS E 1 87  ? 27.597  23.754  26.845  1.00   49.29  ? 839  HIS E N   1 
ATOM   6183 C CA  . HIS E 1 87  ? 26.508  24.244  26.030  1.00   53.12  ? 839  HIS E CA  1 
ATOM   6184 C C   . HIS E 1 87  ? 26.934  24.005  24.574  1.00   54.73  ? 839  HIS E C   1 
ATOM   6185 O O   . HIS E 1 87  ? 27.993  24.499  24.111  1.00   56.36  ? 839  HIS E O   1 
ATOM   6186 C CB  . HIS E 1 87  ? 26.203  25.713  26.351  1.00   55.71  ? 839  HIS E CB  1 
ATOM   6187 C CG  . HIS E 1 87  ? 25.677  25.925  27.737  1.00   63.19  ? 839  HIS E CG  1 
ATOM   6188 N ND1 . HIS E 1 87  ? 24.348  25.738  28.072  1.00   62.60  ? 839  HIS E ND1 1 
ATOM   6189 C CD2 . HIS E 1 87  ? 26.308  26.266  28.884  1.00   65.64  ? 839  HIS E CD2 1 
ATOM   6190 C CE1 . HIS E 1 87  ? 24.179  25.991  29.356  1.00   67.17  ? 839  HIS E CE1 1 
ATOM   6191 N NE2 . HIS E 1 87  ? 25.353  26.305  29.874  1.00   74.84  ? 839  HIS E NE2 1 
ATOM   6192 N N   . ILE E 1 88  ? 26.157  23.160  23.883  1.00   46.91  ? 840  ILE E N   1 
ATOM   6193 C CA  . ILE E 1 88  ? 26.503  22.670  22.502  1.00   43.49  ? 840  ILE E CA  1 
ATOM   6194 C C   . ILE E 1 88  ? 25.499  23.011  21.367  1.00   39.78  ? 840  ILE E C   1 
ATOM   6195 O O   . ILE E 1 88  ? 24.311  22.897  21.524  1.00   48.39  ? 840  ILE E O   1 
ATOM   6196 C CB  . ILE E 1 88  ? 26.805  21.074  22.532  1.00   46.30  ? 840  ILE E CB  1 
ATOM   6197 C CG1 . ILE E 1 88  ? 27.831  20.773  23.635  1.00   48.99  ? 840  ILE E CG1 1 
ATOM   6198 C CG2 . ILE E 1 88  ? 27.176  20.585  21.120  1.00   46.08  ? 840  ILE E CG2 1 
ATOM   6199 C CD1 . ILE E 1 88  ? 28.258  19.291  23.885  1.00   54.53  ? 840  ILE E CD1 1 
ATOM   6200 N N   . HIS E 1 89  ? 26.044  23.419  20.218  1.00   47.17  ? 841  HIS E N   1 
ATOM   6201 C CA  . HIS E 1 89  ? 25.351  23.556  18.953  1.00   47.22  ? 841  HIS E CA  1 
ATOM   6202 C C   . HIS E 1 89  ? 25.517  22.304  18.065  1.00   44.22  ? 841  HIS E C   1 
ATOM   6203 O O   . HIS E 1 89  ? 26.594  21.984  17.653  1.00   39.42  ? 841  HIS E O   1 
ATOM   6204 C CB  . HIS E 1 89  ? 25.934  24.718  18.156  1.00   36.52  ? 841  HIS E CB  1 
ATOM   6205 C CG  . HIS E 1 89  ? 25.169  25.079  16.933  1.00   52.95  ? 841  HIS E CG  1 
ATOM   6206 N ND1 . HIS E 1 89  ? 25.791  25.342  15.735  1.00   57.41  ? 841  HIS E ND1 1 
ATOM   6207 C CD2 . HIS E 1 89  ? 23.837  25.227  16.704  1.00   43.97  ? 841  HIS E CD2 1 
ATOM   6208 C CE1 . HIS E 1 89  ? 24.881  25.602  14.809  1.00   60.25  ? 841  HIS E CE1 1 
ATOM   6209 N NE2 . HIS E 1 89  ? 23.685  25.518  15.367  1.00   60.15  ? 841  HIS E NE2 1 
ATOM   6210 N N   . LEU E 1 90  ? 24.411  21.643  17.776  1.00   49.18  ? 842  LEU E N   1 
ATOM   6211 C CA  . LEU E 1 90  ? 24.379  20.602  16.732  1.00   50.88  ? 842  LEU E CA  1 
ATOM   6212 C C   . LEU E 1 90  ? 23.866  21.216  15.463  1.00   44.98  ? 842  LEU E C   1 
ATOM   6213 O O   . LEU E 1 90  ? 22.770  21.769  15.434  1.00   52.39  ? 842  LEU E O   1 
ATOM   6214 C CB  . LEU E 1 90  ? 23.453  19.434  17.153  1.00   42.89  ? 842  LEU E CB  1 
ATOM   6215 C CG  . LEU E 1 90  ? 23.116  18.510  15.969  1.00   47.23  ? 842  LEU E CG  1 
ATOM   6216 C CD1 . LEU E 1 90  ? 24.389  17.929  15.506  1.00   42.41  ? 842  LEU E CD1 1 
ATOM   6217 C CD2 . LEU E 1 90  ? 22.110  17.405  16.311  1.00   38.06  ? 842  LEU E CD2 1 
ATOM   6218 N N   . HIS E 1 91  ? 24.670  21.163  14.409  1.00   46.25  ? 843  HIS E N   1 
ATOM   6219 C CA  . HIS E 1 91  ? 24.198  21.437  13.070  1.00   50.35  ? 843  HIS E CA  1 
ATOM   6220 C C   . HIS E 1 91  ? 24.032  20.153  12.289  1.00   48.07  ? 843  HIS E C   1 
ATOM   6221 O O   . HIS E 1 91  ? 25.003  19.399  12.168  1.00   48.33  ? 843  HIS E O   1 
ATOM   6222 C CB  . HIS E 1 91  ? 25.175  22.277  12.261  1.00   43.82  ? 843  HIS E CB  1 
ATOM   6223 C CG  . HIS E 1 91  ? 24.545  22.860  11.066  1.00   53.77  ? 843  HIS E CG  1 
ATOM   6224 N ND1 . HIS E 1 91  ? 24.964  22.574  9.778   1.00   44.84  ? 843  HIS E ND1 1 
ATOM   6225 C CD2 . HIS E 1 91  ? 23.436  23.627  10.948  1.00   43.63  ? 843  HIS E CD2 1 
ATOM   6226 C CE1 . HIS E 1 91  ? 24.207  23.239  8.928   1.00   50.74  ? 843  HIS E CE1 1 
ATOM   6227 N NE2 . HIS E 1 91  ? 23.253  23.859  9.606   1.00   50.81  ? 843  HIS E NE2 1 
ATOM   6228 N N   . VAL E 1 92  ? 22.821  19.950  11.764  1.00   47.60  ? 844  VAL E N   1 
ATOM   6229 C CA  . VAL E 1 92  ? 22.462  18.830  10.892  1.00   51.08  ? 844  VAL E CA  1 
ATOM   6230 C C   . VAL E 1 92  ? 21.878  19.488  9.639   1.00   54.11  ? 844  VAL E C   1 
ATOM   6231 O O   . VAL E 1 92  ? 20.687  19.917  9.653   1.00   53.26  ? 844  VAL E O   1 
ATOM   6232 C CB  . VAL E 1 92  ? 21.344  17.871  11.406  1.00   51.26  ? 844  VAL E CB  1 
ATOM   6233 C CG1 . VAL E 1 92  ? 20.930  16.826  10.237  1.00   34.56  ? 844  VAL E CG1 1 
ATOM   6234 C CG2 . VAL E 1 92  ? 21.729  17.147  12.619  1.00   52.79  ? 844  VAL E CG2 1 
ATOM   6235 N N   . PRO E 1 93  ? 22.690  19.576  8.586   1.00   50.97  ? 845  PRO E N   1 
ATOM   6236 C CA  . PRO E 1 93  ? 22.336  20.112  7.295   1.00   60.09  ? 845  PRO E CA  1 
ATOM   6237 C C   . PRO E 1 93  ? 21.011  19.608  6.720   1.00   62.07  ? 845  PRO E C   1 
ATOM   6238 O O   . PRO E 1 93  ? 20.641  18.438  6.892   1.00   63.10  ? 845  PRO E O   1 
ATOM   6239 C CB  . PRO E 1 93  ? 23.501  19.689  6.425   1.00   55.21  ? 845  PRO E CB  1 
ATOM   6240 C CG  . PRO E 1 93  ? 24.619  19.660  7.321   1.00   57.56  ? 845  PRO E CG  1 
ATOM   6241 C CD  . PRO E 1 93  ? 24.127  19.261  8.648   1.00   56.38  ? 845  PRO E CD  1 
ATOM   6242 N N   . GLU E 1 94  ? 20.311  20.509  6.024   1.00   66.35  ? 846  GLU E N   1 
ATOM   6243 C CA  . GLU E 1 94  ? 19.009  20.200  5.411   1.00   59.87  ? 846  GLU E CA  1 
ATOM   6244 C C   . GLU E 1 94  ? 19.136  19.271  4.202   1.00   60.44  ? 846  GLU E C   1 
ATOM   6245 O O   . GLU E 1 94  ? 20.242  19.089  3.628   1.00   45.25  ? 846  GLU E O   1 
ATOM   6246 C CB  . GLU E 1 94  ? 18.256  21.468  4.973   1.00   67.84  ? 846  GLU E CB  1 
ATOM   6247 C CG  . GLU E 1 94  ? 19.129  22.634  4.465   1.00   73.15  ? 846  GLU E CG  1 
ATOM   6248 C CD  . GLU E 1 94  ? 19.299  23.731  5.520   1.00   76.10  ? 846  GLU E CD  1 
ATOM   6249 O OE1 . GLU E 1 94  ? 20.442  24.010  5.958   1.00   80.73  ? 846  GLU E OE1 1 
ATOM   6250 O OE2 . GLU E 1 94  ? 18.276  24.311  5.934   1.00   86.51  ? 846  GLU E OE2 1 
ATOM   6251 N N   . GLY E 1 95  ? 17.983  18.703  3.837   1.00   57.16  ? 847  GLY E N   1 
ATOM   6252 C CA  . GLY E 1 95  ? 17.840  17.936  2.599   1.00   60.82  ? 847  GLY E CA  1 
ATOM   6253 C C   . GLY E 1 95  ? 17.085  16.647  2.800   1.00   61.29  ? 847  GLY E C   1 
ATOM   6254 O O   . GLY E 1 95  ? 16.296  16.255  1.962   1.00   61.34  ? 847  GLY E O   1 
ATOM   6255 N N   . ALA E 1 96  ? 17.339  15.982  3.922   1.00   64.96  ? 848  ALA E N   1 
ATOM   6256 C CA  . ALA E 1 96  ? 16.710  14.706  4.178   1.00   65.89  ? 848  ALA E CA  1 
ATOM   6257 C C   . ALA E 1 96  ? 15.188  14.927  4.178   1.00   69.99  ? 848  ALA E C   1 
ATOM   6258 O O   . ALA E 1 96  ? 14.691  15.961  4.648   1.00   73.67  ? 848  ALA E O   1 
ATOM   6259 C CB  . ALA E 1 96  ? 17.217  14.094  5.508   1.00   68.55  ? 848  ALA E CB  1 
ATOM   6260 N N   . THR E 1 97  ? 14.468  13.976  3.597   1.00   67.05  ? 849  THR E N   1 
ATOM   6261 C CA  . THR E 1 97  ? 13.023  13.968  3.597   1.00   63.66  ? 849  THR E CA  1 
ATOM   6262 C C   . THR E 1 97  ? 12.519  13.786  5.019   1.00   63.95  ? 849  THR E C   1 
ATOM   6263 O O   . THR E 1 97  ? 13.292  13.480  5.915   1.00   50.05  ? 849  THR E O   1 
ATOM   6264 C CB  . THR E 1 97  ? 12.514  12.756  2.829   1.00   65.12  ? 849  THR E CB  1 
ATOM   6265 O OG1 . THR E 1 97  ? 13.308  11.623  3.211   1.00   68.66  ? 849  THR E OG1 1 
ATOM   6266 C CG2 . THR E 1 97  ? 12.628  12.948  1.336   1.00   60.62  ? 849  THR E CG2 1 
ATOM   6267 N N   . PRO E 1 98  ? 11.213  13.969  5.238   1.00   64.69  ? 850  PRO E N   1 
ATOM   6268 C CA  . PRO E 1 98  ? 10.632  13.541  6.537   1.00   66.32  ? 850  PRO E CA  1 
ATOM   6269 C C   . PRO E 1 98  ? 10.772  12.053  6.864   1.00   66.89  ? 850  PRO E C   1 
ATOM   6270 O O   . PRO E 1 98  ? 11.146  11.710  7.991   1.00   72.95  ? 850  PRO E O   1 
ATOM   6271 C CB  . PRO E 1 98  ? 9.156   13.902  6.389   1.00   61.93  ? 850  PRO E CB  1 
ATOM   6272 C CG  . PRO E 1 98  ? 9.240   15.263  5.533   1.00   61.53  ? 850  PRO E CG  1 
ATOM   6273 C CD  . PRO E 1 98  ? 10.362  14.951  4.531   1.00   64.83  ? 850  PRO E CD  1 
ATOM   6274 N N   . LYS E 1 99  ? 10.462  11.198  5.899   1.00   66.35  ? 851  LYS E N   1 
ATOM   6275 C CA  . LYS E 1 99  ? 10.449  9.752   6.106   1.00   68.02  ? 851  LYS E CA  1 
ATOM   6276 C C   . LYS E 1 99  ? 11.810  9.230   6.624   1.00   65.42  ? 851  LYS E C   1 
ATOM   6277 O O   . LYS E 1 99  ? 11.869  8.406   7.557   1.00   69.38  ? 851  LYS E O   1 
ATOM   6278 C CB  . LYS E 1 99  ? 10.007  9.039   4.817   1.00   71.42  ? 851  LYS E CB  1 
ATOM   6279 C CG  . LYS E 1 99  ? 9.531   7.574   5.041   1.00   76.35  ? 851  LYS E CG  1 
ATOM   6280 C CD  . LYS E 1 99  ? 8.426   7.100   4.051   1.00   74.27  ? 851  LYS E CD  1 
ATOM   6281 C CE  . LYS E 1 99  ? 8.999   6.262   2.893   1.00   69.96  ? 851  LYS E CE  1 
ATOM   6282 N NZ  . LYS E 1 99  ? 9.736   7.070   1.855   1.00   65.80  ? 851  LYS E NZ  1 
ATOM   6283 N N   . ASP E 1 100 ? 12.877  9.871   6.181   1.00   57.39  ? 852  ASP E N   1 
ATOM   6284 C CA  . ASP E 1 100 ? 14.253  9.585   6.562   1.00   56.86  ? 852  ASP E CA  1 
ATOM   6285 C C   . ASP E 1 100 ? 14.693  10.374  7.771   1.00   51.14  ? 852  ASP E C   1 
ATOM   6286 O O   . ASP E 1 100 ? 15.841  10.450  8.050   1.00   41.93  ? 852  ASP E O   1 
ATOM   6287 C CB  . ASP E 1 100 ? 15.186  9.924   5.404   1.00   55.58  ? 852  ASP E CB  1 
ATOM   6288 C CG  . ASP E 1 100 ? 16.628  9.450   5.606   1.00   62.26  ? 852  ASP E CG  1 
ATOM   6289 O OD1 . ASP E 1 100 ? 17.568  10.191  5.259   1.00   37.35  ? 852  ASP E OD1 1 
ATOM   6290 O OD2 . ASP E 1 100 ? 16.794  8.313   6.040   1.00   43.75  ? 852  ASP E OD2 1 
ATOM   6291 N N   . GLY E 1 101 ? 13.767  10.978  8.481   1.00   54.19  ? 853  GLY E N   1 
ATOM   6292 C CA  . GLY E 1 101 ? 14.127  11.824  9.586   1.00   52.91  ? 853  GLY E CA  1 
ATOM   6293 C C   . GLY E 1 101 ? 14.915  11.299  10.761  1.00   53.42  ? 853  GLY E C   1 
ATOM   6294 O O   . GLY E 1 101 ? 15.794  11.968  11.198  1.00   59.00  ? 853  GLY E O   1 
ATOM   6295 N N   . PRO E 1 102 ? 14.642  10.116  11.261  1.00   49.48  ? 854  PRO E N   1 
ATOM   6296 C CA  . PRO E 1 102 ? 15.344  9.578   12.413  1.00   42.07  ? 854  PRO E CA  1 
ATOM   6297 C C   . PRO E 1 102 ? 16.626  8.822   12.068  1.00   39.38  ? 854  PRO E C   1 
ATOM   6298 O O   . PRO E 1 102 ? 17.317  8.397   12.951  1.00   41.75  ? 854  PRO E O   1 
ATOM   6299 C CB  . PRO E 1 102 ? 14.335  8.598   12.969  1.00   44.39  ? 854  PRO E CB  1 
ATOM   6300 C CG  . PRO E 1 102 ? 13.290  8.466   11.966  1.00   48.50  ? 854  PRO E CG  1 
ATOM   6301 C CD  . PRO E 1 102 ? 13.692  9.140   10.730  1.00   45.97  ? 854  PRO E CD  1 
ATOM   6302 N N   . SER E 1 103 ? 16.966  8.792   10.788  1.00   36.05  ? 855  SER E N   1 
ATOM   6303 C CA  . SER E 1 103 ? 18.126  8.055   10.244  1.00   38.82  ? 855  SER E CA  1 
ATOM   6304 C C   . SER E 1 103 ? 19.543  8.647   10.584  1.00   42.17  ? 855  SER E C   1 
ATOM   6305 O O   . SER E 1 103 ? 20.589  7.951   10.702  1.00   30.87  ? 855  SER E O   1 
ATOM   6306 C CB  . SER E 1 103 ? 17.866  7.976   8.738   1.00   31.53  ? 855  SER E CB  1 
ATOM   6307 O OG  . SER E 1 103 ? 19.063  7.657   8.008   1.00   54.93  ? 855  SER E OG  1 
ATOM   6308 N N   . ALA E 1 104 ? 19.561  9.912   10.938  1.00   35.72  ? 856  ALA E N   1 
ATOM   6309 C CA  . ALA E 1 104 ? 20.838  10.568  11.370  1.00   37.13  ? 856  ALA E CA  1 
ATOM   6310 C C   . ALA E 1 104 ? 21.224  10.414  12.863  1.00   34.75  ? 856  ALA E C   1 
ATOM   6311 O O   . ALA E 1 104 ? 22.197  10.940  13.385  1.00   41.59  ? 856  ALA E O   1 
ATOM   6312 C CB  . ALA E 1 104 ? 20.685  12.126  10.899  1.00   35.63  ? 856  ALA E CB  1 
ATOM   6313 N N   . GLY E 1 105 ? 20.465  9.604   13.567  1.00   25.09  ? 857  GLY E N   1 
ATOM   6314 C CA  . GLY E 1 105 ? 20.645  9.305   14.909  1.00   22.43  ? 857  GLY E CA  1 
ATOM   6315 C C   . GLY E 1 105 ? 22.058  8.934   15.337  1.00   26.52  ? 857  GLY E C   1 
ATOM   6316 O O   . GLY E 1 105 ? 22.641  9.602   16.224  1.00   32.25  ? 857  GLY E O   1 
ATOM   6317 N N   . CYS E 1 106 ? 22.670  7.945   14.672  1.00   35.79  ? 858  CYS E N   1 
ATOM   6318 C CA  . CYS E 1 106 ? 23.983  7.435   15.103  1.00   36.28  ? 858  CYS E CA  1 
ATOM   6319 C C   . CYS E 1 106 ? 25.180  8.326   14.778  1.00   32.77  ? 858  CYS E C   1 
ATOM   6320 O O   . CYS E 1 106 ? 26.213  8.371   15.569  1.00   29.84  ? 858  CYS E O   1 
ATOM   6321 C CB  . CYS E 1 106 ? 24.215  6.011   14.533  1.00   33.24  ? 858  CYS E CB  1 
ATOM   6322 S SG  . CYS E 1 106 ? 24.169  5.802   12.797  1.00   39.54  ? 858  CYS E SG  1 
ATOM   6323 N N   . THR E 1 107 ? 24.993  9.026   13.696  1.00   41.31  ? 859  THR E N   1 
ATOM   6324 C CA  . THR E 1 107 ? 25.841  10.112  13.191  1.00   44.01  ? 859  THR E CA  1 
ATOM   6325 C C   . THR E 1 107 ? 25.906  11.272  14.223  1.00   42.91  ? 859  THR E C   1 
ATOM   6326 O O   . THR E 1 107 ? 26.993  11.751  14.512  1.00   30.28  ? 859  THR E O   1 
ATOM   6327 C CB  . THR E 1 107 ? 25.322  10.681  11.879  1.00   48.71  ? 859  THR E CB  1 
ATOM   6328 O OG1 . THR E 1 107 ? 24.801  9.651   11.009  1.00   40.14  ? 859  THR E OG1 1 
ATOM   6329 C CG2 . THR E 1 107 ? 26.430  11.615  11.097  1.00   42.41  ? 859  THR E CG2 1 
ATOM   6330 N N   . ILE E 1 108 ? 24.758  11.728  14.730  1.00   44.38  ? 860  ILE E N   1 
ATOM   6331 C CA  . ILE E 1 108 ? 24.730  12.764  15.788  1.00   41.77  ? 860  ILE E CA  1 
ATOM   6332 C C   . ILE E 1 108 ? 25.449  12.276  17.041  1.00   40.72  ? 860  ILE E C   1 
ATOM   6333 O O   . ILE E 1 108 ? 26.209  12.980  17.648  1.00   31.66  ? 860  ILE E O   1 
ATOM   6334 C CB  . ILE E 1 108 ? 23.283  13.212  16.104  1.00   34.27  ? 860  ILE E CB  1 
ATOM   6335 C CG1 . ILE E 1 108 ? 22.647  13.861  14.844  1.00   37.25  ? 860  ILE E CG1 1 
ATOM   6336 C CG2 . ILE E 1 108 ? 23.201  14.166  17.417  1.00   39.68  ? 860  ILE E CG2 1 
ATOM   6337 C CD1 . ILE E 1 108 ? 21.157  13.716  14.853  1.00   46.20  ? 860  ILE E CD1 1 
ATOM   6338 N N   . VAL E 1 109 ? 25.242  11.023  17.439  1.00   31.90  ? 861  VAL E N   1 
ATOM   6339 C CA  . VAL E 1 109 ? 25.696  10.587  18.636  1.00   28.59  ? 861  VAL E CA  1 
ATOM   6340 C C   . VAL E 1 109 ? 27.206  10.619  18.495  1.00   19.92  ? 861  VAL E C   1 
ATOM   6341 O O   . VAL E 1 109 ? 27.898  10.807  19.514  1.00   27.37  ? 861  VAL E O   1 
ATOM   6342 C CB  . VAL E 1 109 ? 25.320  9.059   18.923  1.00   31.89  ? 861  VAL E CB  1 
ATOM   6343 C CG1 . VAL E 1 109 ? 26.142  8.535   20.048  1.00   30.73  ? 861  VAL E CG1 1 
ATOM   6344 C CG2 . VAL E 1 109 ? 23.828  8.938   19.294  1.00   28.64  ? 861  VAL E CG2 1 
ATOM   6345 N N   . THR E 1 110 ? 27.605  10.287  17.283  1.00   25.14  ? 862  THR E N   1 
ATOM   6346 C CA  . THR E 1 110 ? 29.038  9.980   17.060  1.00   38.43  ? 862  THR E CA  1 
ATOM   6347 C C   . THR E 1 110 ? 29.778  11.365  17.093  1.00   40.77  ? 862  THR E C   1 
ATOM   6348 O O   . THR E 1 110 ? 30.907  11.477  17.566  1.00   34.69  ? 862  THR E O   1 
ATOM   6349 C CB  . THR E 1 110 ? 29.278  9.298   15.718  1.00   42.15  ? 862  THR E CB  1 
ATOM   6350 O OG1 . THR E 1 110 ? 28.521  8.082   15.635  1.00   40.14  ? 862  THR E OG1 1 
ATOM   6351 C CG2 . THR E 1 110 ? 30.702  8.948   15.582  1.00   37.59  ? 862  THR E CG2 1 
ATOM   6352 N N   . ALA E 1 111 ? 29.092  12.386  16.626  1.00   37.22  ? 863  ALA E N   1 
ATOM   6353 C CA  . ALA E 1 111 ? 29.677  13.800  16.646  1.00   36.09  ? 863  ALA E CA  1 
ATOM   6354 C C   . ALA E 1 111 ? 29.816  14.341  18.079  1.00   38.46  ? 863  ALA E C   1 
ATOM   6355 O O   . ALA E 1 111 ? 30.910  14.842  18.435  1.00   39.95  ? 863  ALA E O   1 
ATOM   6356 C CB  . ALA E 1 111 ? 28.863  14.735  15.671  1.00   36.70  ? 863  ALA E CB  1 
ATOM   6357 N N   . LEU E 1 112 ? 28.827  14.042  18.950  1.00   37.70  ? 864  LEU E N   1 
ATOM   6358 C CA  . LEU E 1 112 ? 28.804  14.471  20.293  1.00   43.47  ? 864  LEU E CA  1 
ATOM   6359 C C   . LEU E 1 112 ? 29.948  13.842  21.054  1.00   44.70  ? 864  LEU E C   1 
ATOM   6360 O O   . LEU E 1 112 ? 30.544  14.479  21.880  1.00   48.97  ? 864  LEU E O   1 
ATOM   6361 C CB  . LEU E 1 112 ? 27.433  14.133  20.967  1.00   33.20  ? 864  LEU E CB  1 
ATOM   6362 C CG  . LEU E 1 112 ? 26.236  14.936  20.394  1.00   44.67  ? 864  LEU E CG  1 
ATOM   6363 C CD1 . LEU E 1 112 ? 24.955  14.392  20.927  1.00   33.77  ? 864  LEU E CD1 1 
ATOM   6364 C CD2 . LEU E 1 112 ? 26.230  16.403  20.710  1.00   35.85  ? 864  LEU E CD2 1 
ATOM   6365 N N   . LEU E 1 113 ? 30.259  12.604  20.716  1.00   46.79  ? 865  LEU E N   1 
ATOM   6366 C CA  . LEU E 1 113 ? 31.270  11.820  21.413  1.00   44.95  ? 865  LEU E CA  1 
ATOM   6367 C C   . LEU E 1 113 ? 32.686  12.177  20.986  1.00   45.46  ? 865  LEU E C   1 
ATOM   6368 O O   . LEU E 1 113 ? 33.545  12.380  21.879  1.00   48.83  ? 865  LEU E O   1 
ATOM   6369 C CB  . LEU E 1 113 ? 30.976  10.330  21.289  1.00   45.84  ? 865  LEU E CB  1 
ATOM   6370 C CG  . LEU E 1 113 ? 29.695  9.896   22.025  1.00   37.49  ? 865  LEU E CG  1 
ATOM   6371 C CD1 . LEU E 1 113 ? 29.499  8.361   21.944  1.00   43.79  ? 865  LEU E CD1 1 
ATOM   6372 C CD2 . LEU E 1 113 ? 29.694  10.349  23.477  1.00   43.48  ? 865  LEU E CD2 1 
ATOM   6373 N N   . SER E 1 114 ? 32.870  12.304  19.661  1.00   47.31  ? 866  SER E N   1 
ATOM   6374 C CA  . SER E 1 114 ? 34.042  12.895  19.002  1.00   48.41  ? 866  SER E CA  1 
ATOM   6375 C C   . SER E 1 114 ? 34.465  14.141  19.768  1.00   50.24  ? 866  SER E C   1 
ATOM   6376 O O   . SER E 1 114 ? 35.562  14.186  20.320  1.00   49.77  ? 866  SER E O   1 
ATOM   6377 C CB  . SER E 1 114 ? 33.708  13.225  17.507  1.00   49.41  ? 866  SER E CB  1 
ATOM   6378 O OG  . SER E 1 114 ? 34.783  13.776  16.761  1.00   40.46  ? 866  SER E OG  1 
ATOM   6379 N N   . LEU E 1 115 ? 33.538  15.088  19.844  1.00   39.11  ? 867  LEU E N   1 
ATOM   6380 C CA  . LEU E 1 115 ? 33.714  16.368  20.424  1.00   47.42  ? 867  LEU E CA  1 
ATOM   6381 C C   . LEU E 1 115 ? 34.007  16.227  21.878  1.00   43.16  ? 867  LEU E C   1 
ATOM   6382 O O   . LEU E 1 115 ? 34.855  16.958  22.361  1.00   58.18  ? 867  LEU E O   1 
ATOM   6383 C CB  . LEU E 1 115 ? 32.447  17.264  20.238  1.00   44.84  ? 867  LEU E CB  1 
ATOM   6384 C CG  . LEU E 1 115 ? 32.549  18.803  20.104  1.00   52.86  ? 867  LEU E CG  1 
ATOM   6385 C CD1 . LEU E 1 115 ? 31.341  19.533  20.609  1.00   34.16  ? 867  LEU E CD1 1 
ATOM   6386 C CD2 . LEU E 1 115 ? 33.773  19.431  20.710  1.00   61.42  ? 867  LEU E CD2 1 
ATOM   6387 N N   . ALA E 1 116 ? 33.389  15.279  22.594  1.00   40.18  ? 868  ALA E N   1 
ATOM   6388 C CA  . ALA E 1 116 ? 33.578  15.140  24.060  1.00   41.91  ? 868  ALA E CA  1 
ATOM   6389 C C   . ALA E 1 116 ? 34.904  14.543  24.458  1.00   39.51  ? 868  ALA E C   1 
ATOM   6390 O O   . ALA E 1 116 ? 35.385  14.830  25.555  1.00   40.80  ? 868  ALA E O   1 
ATOM   6391 C CB  . ALA E 1 116 ? 32.499  14.235  24.702  1.00   39.25  ? 868  ALA E CB  1 
ATOM   6392 N N   . MET E 1 117 ? 35.409  13.651  23.616  1.00   44.49  ? 869  MET E N   1 
ATOM   6393 C CA  . MET E 1 117 ? 36.722  13.046  23.744  1.00   50.49  ? 869  MET E CA  1 
ATOM   6394 C C   . MET E 1 117 ? 37.775  13.875  22.990  1.00   49.30  ? 869  MET E C   1 
ATOM   6395 O O   . MET E 1 117 ? 38.946  13.557  23.072  1.00   49.45  ? 869  MET E O   1 
ATOM   6396 C CB  . MET E 1 117 ? 36.744  11.602  23.203  1.00   45.28  ? 869  MET E CB  1 
ATOM   6397 C CG  . MET E 1 117 ? 35.667  10.695  23.725  1.00   50.45  ? 869  MET E CG  1 
ATOM   6398 S SD  . MET E 1 117 ? 35.602  9.073   22.925  1.00   53.27  ? 869  MET E SD  1 
ATOM   6399 C CE  . MET E 1 117 ? 35.617  9.472   21.226  1.00   38.00  ? 869  MET E CE  1 
ATOM   6400 N N   . GLY E 1 118 ? 37.370  14.975  22.343  1.00   56.09  ? 870  GLY E N   1 
ATOM   6401 C CA  . GLY E 1 118 ? 38.290  15.804  21.535  1.00   55.75  ? 870  GLY E CA  1 
ATOM   6402 C C   . GLY E 1 118 ? 39.067  14.930  20.560  1.00   60.43  ? 870  GLY E C   1 
ATOM   6403 O O   . GLY E 1 118 ? 40.295  15.082  20.349  1.00   51.11  ? 870  GLY E O   1 
ATOM   6404 N N   . ARG E 1 119 ? 38.332  14.008  19.948  1.00   56.01  ? 871  ARG E N   1 
ATOM   6405 C CA  . ARG E 1 119 ? 38.908  12.908  19.195  1.00   59.43  ? 871  ARG E CA  1 
ATOM   6406 C C   . ARG E 1 119 ? 38.252  12.891  17.851  1.00   56.57  ? 871  ARG E C   1 
ATOM   6407 O O   . ARG E 1 119 ? 37.045  12.732  17.764  1.00   62.20  ? 871  ARG E O   1 
ATOM   6408 C CB  . ARG E 1 119 ? 38.581  11.603  19.912  1.00   61.87  ? 871  ARG E CB  1 
ATOM   6409 C CG  . ARG E 1 119 ? 39.745  10.843  20.426  1.00   70.97  ? 871  ARG E CG  1 
ATOM   6410 C CD  . ARG E 1 119 ? 39.952  9.596   19.619  1.00   68.89  ? 871  ARG E CD  1 
ATOM   6411 N NE  . ARG E 1 119 ? 40.312  8.460   20.465  1.00   71.39  ? 871  ARG E NE  1 
ATOM   6412 C CZ  . ARG E 1 119 ? 40.431  7.215   20.014  1.00   74.61  ? 871  ARG E CZ  1 
ATOM   6413 N NH1 . ARG E 1 119 ? 40.259  6.940   18.712  1.00   64.01  ? 871  ARG E NH1 1 
ATOM   6414 N NH2 . ARG E 1 119 ? 40.730  6.241   20.859  1.00   75.70  ? 871  ARG E NH2 1 
ATOM   6415 N N   . PRO E 1 120 ? 39.019  13.057  16.773  1.00   59.88  ? 872  PRO E N   1 
ATOM   6416 C CA  . PRO E 1 120 ? 38.305  13.064  15.522  1.00   52.98  ? 872  PRO E CA  1 
ATOM   6417 C C   . PRO E 1 120 ? 37.846  11.684  15.120  1.00   50.79  ? 872  PRO E C   1 
ATOM   6418 O O   . PRO E 1 120 ? 38.480  10.693  15.493  1.00   47.42  ? 872  PRO E O   1 
ATOM   6419 C CB  . PRO E 1 120 ? 39.350  13.590  14.520  1.00   59.63  ? 872  PRO E CB  1 
ATOM   6420 C CG  . PRO E 1 120 ? 40.616  13.217  15.099  1.00   59.80  ? 872  PRO E CG  1 
ATOM   6421 C CD  . PRO E 1 120 ? 40.436  13.384  16.585  1.00   60.12  ? 872  PRO E CD  1 
ATOM   6422 N N   . VAL E 1 121 ? 36.769  11.630  14.332  1.00   53.49  ? 873  VAL E N   1 
ATOM   6423 C CA  . VAL E 1 121 ? 36.301  10.368  13.742  1.00   52.75  ? 873  VAL E CA  1 
ATOM   6424 C C   . VAL E 1 121 ? 37.269  9.967   12.685  1.00   56.22  ? 873  VAL E C   1 
ATOM   6425 O O   . VAL E 1 121 ? 37.905  10.812  12.031  1.00   49.80  ? 873  VAL E O   1 
ATOM   6426 C CB  . VAL E 1 121 ? 34.856  10.443  13.203  1.00   58.77  ? 873  VAL E CB  1 
ATOM   6427 C CG1 . VAL E 1 121 ? 34.550  9.284   12.246  1.00   56.57  ? 873  VAL E CG1 1 
ATOM   6428 C CG2 . VAL E 1 121 ? 33.835  10.434  14.406  1.00   41.35  ? 873  VAL E CG2 1 
ATOM   6429 N N   . ARG E 1 122 ? 37.465  8.668   12.556  1.00   56.74  ? 874  ARG E N   1 
ATOM   6430 C CA  . ARG E 1 122 ? 38.351  8.194   11.512  1.00   55.67  ? 874  ARG E CA  1 
ATOM   6431 C C   . ARG E 1 122 ? 38.003  8.766   10.111  1.00   58.58  ? 874  ARG E C   1 
ATOM   6432 O O   . ARG E 1 122 ? 36.858  9.144   9.792   1.00   64.25  ? 874  ARG E O   1 
ATOM   6433 C CB  . ARG E 1 122 ? 38.433  6.663   11.535  1.00   54.99  ? 874  ARG E CB  1 
ATOM   6434 C CG  . ARG E 1 122 ? 37.228  5.985   10.980  1.00   57.42  ? 874  ARG E CG  1 
ATOM   6435 C CD  . ARG E 1 122 ? 37.558  5.247   9.678   1.00   57.87  ? 874  ARG E CD  1 
ATOM   6436 N NE  . ARG E 1 122 ? 37.794  3.842   9.943   1.00   44.31  ? 874  ARG E NE  1 
ATOM   6437 C CZ  . ARG E 1 122 ? 37.962  2.881   9.033   1.00   44.52  ? 874  ARG E CZ  1 
ATOM   6438 N NH1 . ARG E 1 122 ? 37.991  3.123   7.743   1.00   52.20  ? 874  ARG E NH1 1 
ATOM   6439 N NH2 . ARG E 1 122 ? 38.168  1.631   9.441   1.00   57.92  ? 874  ARG E NH2 1 
ATOM   6440 N N   . GLN E 1 123 ? 39.007  8.773   9.271   1.00   59.09  ? 875  GLN E N   1 
ATOM   6441 C CA  . GLN E 1 123 ? 38.916  9.239   7.926   1.00   57.66  ? 875  GLN E CA  1 
ATOM   6442 C C   . GLN E 1 123 ? 38.207  8.225   7.110   1.00   56.74  ? 875  GLN E C   1 
ATOM   6443 O O   . GLN E 1 123 ? 38.202  7.077   7.469   1.00   56.59  ? 875  GLN E O   1 
ATOM   6444 C CB  . GLN E 1 123 ? 40.319  9.403   7.386   1.00   55.81  ? 875  GLN E CB  1 
ATOM   6445 C CG  . GLN E 1 123 ? 40.875  10.799  7.484   1.00   67.26  ? 875  GLN E CG  1 
ATOM   6446 C CD  . GLN E 1 123 ? 39.821  11.846  7.358   1.00   71.99  ? 875  GLN E CD  1 
ATOM   6447 O OE1 . GLN E 1 123 ? 39.072  11.872  6.391   1.00   65.23  ? 875  GLN E OE1 1 
ATOM   6448 N NE2 . GLN E 1 123 ? 39.730  12.706  8.359   1.00   60.54  ? 875  GLN E NE2 1 
ATOM   6449 N N   . ASN E 1 124 ? 37.632  8.648   5.998   1.00   50.62  ? 876  ASN E N   1 
ATOM   6450 C CA  . ASN E 1 124 ? 37.022  7.710   5.105   1.00   58.18  ? 876  ASN E CA  1 
ATOM   6451 C C   . ASN E 1 124 ? 35.914  6.891   5.698   1.00   59.44  ? 876  ASN E C   1 
ATOM   6452 O O   . ASN E 1 124 ? 36.049  5.710   5.727   1.00   67.30  ? 876  ASN E O   1 
ATOM   6453 C CB  . ASN E 1 124 ? 38.103  6.739   4.667   1.00   59.19  ? 876  ASN E CB  1 
ATOM   6454 C CG  . ASN E 1 124 ? 37.604  5.675   3.743   1.00   47.68  ? 876  ASN E CG  1 
ATOM   6455 O OD1 . ASN E 1 124 ? 36.726  5.889   2.951   1.00   64.56  ? 876  ASN E OD1 1 
ATOM   6456 N ND2 . ASN E 1 124 ? 38.206  4.531   3.813   1.00   56.45  ? 876  ASN E ND2 1 
ATOM   6457 N N   . LEU E 1 125 ? 34.898  7.512   6.266   1.00   48.22  ? 877  LEU E N   1 
ATOM   6458 C CA  . LEU E 1 125 ? 33.834  6.787   6.872   1.00   41.90  ? 877  LEU E CA  1 
ATOM   6459 C C   . LEU E 1 125 ? 32.565  7.526   6.837   1.00   39.32  ? 877  LEU E C   1 
ATOM   6460 O O   . LEU E 1 125 ? 32.530  8.609   7.243   1.00   40.50  ? 877  LEU E O   1 
ATOM   6461 C CB  . LEU E 1 125 ? 34.149  6.587   8.333   1.00   44.82  ? 877  LEU E CB  1 
ATOM   6462 C CG  . LEU E 1 125 ? 33.121  5.893   9.216   1.00   43.25  ? 877  LEU E CG  1 
ATOM   6463 C CD1 . LEU E 1 125 ? 33.495  4.495   9.432   1.00   53.52  ? 877  LEU E CD1 1 
ATOM   6464 C CD2 . LEU E 1 125 ? 33.031  6.534   10.511  1.00   48.63  ? 877  LEU E CD2 1 
ATOM   6465 N N   . ALA E 1 126 ? 31.501  6.895   6.416   1.00   36.23  ? 878  ALA E N   1 
ATOM   6466 C CA  . ALA E 1 126 ? 30.185  7.435   6.564   1.00   38.24  ? 878  ALA E CA  1 
ATOM   6467 C C   . ALA E 1 126 ? 29.233  6.418   7.275   1.00   36.86  ? 878  ALA E C   1 
ATOM   6468 O O   . ALA E 1 126 ? 29.440  5.167   7.216   1.00   38.86  ? 878  ALA E O   1 
ATOM   6469 C CB  . ALA E 1 126 ? 29.705  7.954   5.250   1.00   26.20  ? 878  ALA E CB  1 
ATOM   6470 N N   . MET E 1 127 ? 28.254  6.940   7.992   1.00   35.32  ? 879  MET E N   1 
ATOM   6471 C CA  . MET E 1 127 ? 27.201  6.114   8.613   1.00   33.80  ? 879  MET E CA  1 
ATOM   6472 C C   . MET E 1 127 ? 25.739  6.602   8.423   1.00   39.00  ? 879  MET E C   1 
ATOM   6473 O O   . MET E 1 127 ? 25.454  7.652   7.822   1.00   32.89  ? 879  MET E O   1 
ATOM   6474 C CB  . MET E 1 127 ? 27.497  5.941   10.094  1.00   33.36  ? 879  MET E CB  1 
ATOM   6475 C CG  . MET E 1 127 ? 27.625  7.284   10.825  1.00   25.85  ? 879  MET E CG  1 
ATOM   6476 S SD  . MET E 1 127 ? 27.781  7.102   12.508  1.00   33.58  ? 879  MET E SD  1 
ATOM   6477 C CE  . MET E 1 127 ? 29.517  6.687   12.427  1.00   31.63  ? 879  MET E CE  1 
ATOM   6478 N N   . THR E 1 128 ? 24.812  5.720   8.735   1.00   36.19  ? 880  THR E N   1 
ATOM   6479 C CA  . THR E 1 128 ? 23.389  5.989   8.817   1.00   33.84  ? 880  THR E CA  1 
ATOM   6480 C C   . THR E 1 128 ? 22.751  4.974   9.725   1.00   35.03  ? 880  THR E C   1 
ATOM   6481 O O   . THR E 1 128 ? 23.224  3.913   9.828   1.00   34.40  ? 880  THR E O   1 
ATOM   6482 C CB  . THR E 1 128 ? 22.659  5.989   7.460   1.00   39.21  ? 880  THR E CB  1 
ATOM   6483 O OG1 . THR E 1 128 ? 21.386  6.603   7.594   1.00   21.23  ? 880  THR E OG1 1 
ATOM   6484 C CG2 . THR E 1 128 ? 22.503  4.602   6.909   1.00   22.95  ? 880  THR E CG2 1 
ATOM   6485 N N   . GLY E 1 129 ? 21.689  5.358   10.386  1.00   29.45  ? 881  GLY E N   1 
ATOM   6486 C CA  . GLY E 1 129 ? 20.904  4.517   11.237  1.00   31.85  ? 881  GLY E CA  1 
ATOM   6487 C C   . GLY E 1 129 ? 20.274  5.225   12.411  1.00   31.89  ? 881  GLY E C   1 
ATOM   6488 O O   . GLY E 1 129 ? 20.871  5.996   13.063  1.00   31.57  ? 881  GLY E O   1 
ATOM   6489 N N   . GLU E 1 130 ? 19.019  4.880   12.676  1.00   30.96  ? 882  GLU E N   1 
ATOM   6490 C CA  . GLU E 1 130 ? 18.338  5.301   13.896  1.00   30.43  ? 882  GLU E CA  1 
ATOM   6491 C C   . GLU E 1 130 ? 18.877  4.598   15.147  1.00   37.17  ? 882  GLU E C   1 
ATOM   6492 O O   . GLU E 1 130 ? 19.156  3.399   15.126  1.00   30.77  ? 882  GLU E O   1 
ATOM   6493 C CB  . GLU E 1 130 ? 16.834  5.063   13.757  1.00   33.97  ? 882  GLU E CB  1 
ATOM   6494 C CG  . GLU E 1 130 ? 16.021  5.337   15.006  1.00   28.32  ? 882  GLU E CG  1 
ATOM   6495 C CD  . GLU E 1 130 ? 14.542  5.150   14.749  1.00   20.16  ? 882  GLU E CD  1 
ATOM   6496 O OE1 . GLU E 1 130 ? 14.192  4.811   13.602  1.00   30.69  ? 882  GLU E OE1 1 
ATOM   6497 O OE2 . GLU E 1 130 ? 13.730  5.341   15.681  1.00   35.39  ? 882  GLU E OE2 1 
ATOM   6498 N N   . VAL E 1 131 ? 19.021  5.364   16.225  1.00   32.76  ? 883  VAL E N   1 
ATOM   6499 C CA  . VAL E 1 131 ? 19.431  4.864   17.500  1.00   28.22  ? 883  VAL E CA  1 
ATOM   6500 C C   . VAL E 1 131 ? 18.312  5.005   18.459  1.00   34.71  ? 883  VAL E C   1 
ATOM   6501 O O   . VAL E 1 131 ? 17.696  5.998   18.576  1.00   32.83  ? 883  VAL E O   1 
ATOM   6502 C CB  . VAL E 1 131 ? 20.535  5.658   18.134  1.00   31.40  ? 883  VAL E CB  1 
ATOM   6503 C CG1 . VAL E 1 131 ? 21.271  4.843   19.119  1.00   37.09  ? 883  VAL E CG1 1 
ATOM   6504 C CG2 . VAL E 1 131 ? 21.463  6.111   17.171  1.00   34.93  ? 883  VAL E CG2 1 
ATOM   6505 N N   . SER E 1 132 ? 18.053  3.961   19.147  1.00   31.67  ? 884  SER E N   1 
ATOM   6506 C CA  . SER E 1 132 ? 17.138  3.989   20.355  1.00   31.13  ? 884  SER E CA  1 
ATOM   6507 C C   . SER E 1 132 ? 17.878  4.373   21.663  1.00   33.74  ? 884  SER E C   1 
ATOM   6508 O O   . SER E 1 132 ? 19.159  4.599   21.731  1.00   31.61  ? 884  SER E O   1 
ATOM   6509 C CB  . SER E 1 132 ? 16.377  2.660   20.452  1.00   27.88  ? 884  SER E CB  1 
ATOM   6510 O OG  . SER E 1 132 ? 17.222  1.734   21.118  1.00   37.75  ? 884  SER E OG  1 
ATOM   6511 N N   . LEU E 1 133 ? 17.113  4.619   22.715  1.00   32.78  ? 885  LEU E N   1 
ATOM   6512 C CA  . LEU E 1 133 ? 17.728  4.849   24.029  1.00   31.15  ? 885  LEU E CA  1 
ATOM   6513 C C   . LEU E 1 133 ? 18.472  3.658   24.561  1.00   32.49  ? 885  LEU E C   1 
ATOM   6514 O O   . LEU E 1 133 ? 19.369  3.847   25.309  1.00   28.47  ? 885  LEU E O   1 
ATOM   6515 C CB  . LEU E 1 133 ? 16.693  5.313   25.104  1.00   31.33  ? 885  LEU E CB  1 
ATOM   6516 C CG  . LEU E 1 133 ? 16.105  6.664   24.751  1.00   37.35  ? 885  LEU E CG  1 
ATOM   6517 C CD1 . LEU E 1 133 ? 14.893  6.940   25.545  1.00   36.77  ? 885  LEU E CD1 1 
ATOM   6518 C CD2 . LEU E 1 133 ? 17.103  7.805   24.934  1.00   42.64  ? 885  LEU E CD2 1 
ATOM   6519 N N   . THR E 1 134 ? 18.101  2.430   24.244  1.00   38.72  ? 886  THR E N   1 
ATOM   6520 C CA  . THR E 1 134 ? 18.904  1.328   24.750  1.00   36.66  ? 886  THR E CA  1 
ATOM   6521 C C   . THR E 1 134 ? 20.124  1.079   23.865  1.00   36.38  ? 886  THR E C   1 
ATOM   6522 O O   . THR E 1 134 ? 20.829  0.045   24.029  1.00   41.09  ? 886  THR E O   1 
ATOM   6523 C CB  . THR E 1 134 ? 17.988  0.045   24.931  1.00   44.12  ? 886  THR E CB  1 
ATOM   6524 O OG1 . THR E 1 134 ? 17.473  -0.384  23.693  1.00   35.45  ? 886  THR E OG1 1 
ATOM   6525 C CG2 . THR E 1 134 ? 16.796  0.325   25.853  1.00   35.83  ? 886  THR E CG2 1 
ATOM   6526 N N   . GLY E 1 135 ? 20.357  1.964   22.863  1.00   36.32  ? 887  GLY E N   1 
ATOM   6527 C CA  . GLY E 1 135 ? 21.514  1.787   21.997  1.00   39.80  ? 887  GLY E CA  1 
ATOM   6528 C C   . GLY E 1 135 ? 21.335  0.913   20.812  1.00   28.50  ? 887  GLY E C   1 
ATOM   6529 O O   . GLY E 1 135 ? 22.231  0.755   20.046  1.00   39.47  ? 887  GLY E O   1 
ATOM   6530 N N   . LYS E 1 136 ? 20.121  0.326   20.566  1.00   35.82  ? 888  LYS E N   1 
ATOM   6531 C CA  . LYS E 1 136 ? 19.886  -0.359  19.313  1.00   35.00  ? 888  LYS E CA  1 
ATOM   6532 C C   . LYS E 1 136 ? 19.987  0.587   18.077  1.00   41.01  ? 888  LYS E C   1 
ATOM   6533 O O   . LYS E 1 136 ? 19.413  1.721   18.011  1.00   37.01  ? 888  LYS E O   1 
ATOM   6534 C CB  . LYS E 1 136 ? 18.529  -1.140  19.338  1.00   34.75  ? 888  LYS E CB  1 
ATOM   6535 C CG  . LYS E 1 136 ? 18.413  -2.163  20.423  1.00   47.54  ? 888  LYS E CG  1 
ATOM   6536 C CD  . LYS E 1 136 ? 16.962  -2.262  20.971  1.00   52.99  ? 888  LYS E CD  1 
ATOM   6537 C CE  . LYS E 1 136 ? 16.807  -3.451  21.983  1.00   44.91  ? 888  LYS E CE  1 
ATOM   6538 N NZ  . LYS E 1 136 ? 17.290  -3.126  23.344  1.00   39.44  ? 888  LYS E NZ  1 
ATOM   6539 N N   . ILE E 1 137 ? 20.740  0.133   17.094  1.00   31.52  ? 889  ILE E N   1 
ATOM   6540 C CA  . ILE E 1 137 ? 20.611  0.631   15.784  1.00   32.22  ? 889  ILE E CA  1 
ATOM   6541 C C   . ILE E 1 137 ? 19.497  0.075   14.930  1.00   30.26  ? 889  ILE E C   1 
ATOM   6542 O O   . ILE E 1 137 ? 19.422  -1.163  14.654  1.00   32.64  ? 889  ILE E O   1 
ATOM   6543 C CB  . ILE E 1 137 ? 21.985  0.472   15.024  1.00   38.43  ? 889  ILE E CB  1 
ATOM   6544 C CG1 . ILE E 1 137 ? 23.180  1.051   15.883  1.00   34.39  ? 889  ILE E CG1 1 
ATOM   6545 C CG2 . ILE E 1 137 ? 21.898  1.081   13.589  1.00   25.02  ? 889  ILE E CG2 1 
ATOM   6546 C CD1 . ILE E 1 137 ? 23.023  2.662   16.415  1.00   33.86  ? 889  ILE E CD1 1 
ATOM   6547 N N   . LEU E 1 138 ? 18.631  0.931   14.423  1.00   29.68  ? 890  LEU E N   1 
ATOM   6548 C CA  . LEU E 1 138 ? 17.436  0.490   13.724  1.00   34.95  ? 890  LEU E CA  1 
ATOM   6549 C C   . LEU E 1 138 ? 17.684  0.742   12.282  1.00   35.13  ? 890  LEU E C   1 
ATOM   6550 O O   . LEU E 1 138 ? 18.480  1.650   11.977  1.00   33.46  ? 890  LEU E O   1 
ATOM   6551 C CB  . LEU E 1 138 ? 16.241  1.285   14.185  1.00   36.74  ? 890  LEU E CB  1 
ATOM   6552 C CG  . LEU E 1 138 ? 15.516  0.753   15.449  1.00   35.13  ? 890  LEU E CG  1 
ATOM   6553 C CD1 . LEU E 1 138 ? 16.386  -0.276  16.301  1.00   34.08  ? 890  LEU E CD1 1 
ATOM   6554 C CD2 . LEU E 1 138 ? 14.897  1.885   16.239  1.00   38.22  ? 890  LEU E CD2 1 
ATOM   6555 N N   . PRO E 1 139 ? 17.065  -0.057  11.414  1.00   23.54  ? 891  PRO E N   1 
ATOM   6556 C CA  . PRO E 1 139 ? 17.067  0.083   9.960   1.00   27.86  ? 891  PRO E CA  1 
ATOM   6557 C C   . PRO E 1 139 ? 16.448  1.329   9.430   1.00   36.60  ? 891  PRO E C   1 
ATOM   6558 O O   . PRO E 1 139 ? 15.499  1.854   10.031  1.00   38.28  ? 891  PRO E O   1 
ATOM   6559 C CB  . PRO E 1 139 ? 16.339  -1.183  9.461   1.00   31.15  ? 891  PRO E CB  1 
ATOM   6560 C CG  . PRO E 1 139 ? 15.482  -1.602  10.639  1.00   29.45  ? 891  PRO E CG  1 
ATOM   6561 C CD  . PRO E 1 139 ? 16.252  -1.262  11.821  1.00   27.12  ? 891  PRO E CD  1 
ATOM   6562 N N   . VAL E 1 140 ? 16.995  1.803   8.305   1.00   25.62  ? 892  VAL E N   1 
ATOM   6563 C CA  . VAL E 1 140 ? 16.490  3.021   7.655   1.00   35.08  ? 892  VAL E CA  1 
ATOM   6564 C C   . VAL E 1 140 ? 16.245  2.696   6.261   1.00   33.27  ? 892  VAL E C   1 
ATOM   6565 O O   . VAL E 1 140 ? 16.770  1.685   5.772   1.00   34.42  ? 892  VAL E O   1 
ATOM   6566 C CB  . VAL E 1 140 ? 17.538  4.121   7.720   1.00   36.61  ? 892  VAL E CB  1 
ATOM   6567 C CG1 . VAL E 1 140 ? 17.920  4.365   9.168   1.00   41.68  ? 892  VAL E CG1 1 
ATOM   6568 C CG2 . VAL E 1 140 ? 18.687  3.716   6.900   1.00   29.34  ? 892  VAL E CG2 1 
ATOM   6569 N N   . GLY E 1 141 ? 15.478  3.553   5.581   1.00   33.28  ? 893  GLY E N   1 
ATOM   6570 C CA  . GLY E 1 141 ? 15.280  3.490   4.156   1.00   37.60  ? 893  GLY E CA  1 
ATOM   6571 C C   . GLY E 1 141 ? 16.358  4.169   3.325   1.00   32.67  ? 893  GLY E C   1 
ATOM   6572 O O   . GLY E 1 141 ? 17.281  4.785   3.846   1.00   32.61  ? 893  GLY E O   1 
ATOM   6573 N N   . GLY E 1 142 ? 16.227  4.078   2.020   1.00   37.84  ? 894  GLY E N   1 
ATOM   6574 C CA  . GLY E 1 142 ? 17.096  4.811   1.098   1.00   40.15  ? 894  GLY E CA  1 
ATOM   6575 C C   . GLY E 1 142 ? 18.501  4.274   0.944   1.00   40.31  ? 894  GLY E C   1 
ATOM   6576 O O   . GLY E 1 142 ? 19.419  5.057   0.681   1.00   37.24  ? 894  GLY E O   1 
ATOM   6577 N N   . ILE E 1 143 ? 18.676  2.952   1.007   1.00   35.41  ? 895  ILE E N   1 
ATOM   6578 C CA  . ILE E 1 143 ? 20.002  2.348   1.187   1.00   38.17  ? 895  ILE E CA  1 
ATOM   6579 C C   . ILE E 1 143 ? 20.855  2.427   -0.126  1.00   36.94  ? 895  ILE E C   1 
ATOM   6580 O O   . ILE E 1 143 ? 22.091  2.557   -0.121  1.00   34.82  ? 895  ILE E O   1 
ATOM   6581 C CB  . ILE E 1 143 ? 19.813  0.836   1.642   1.00   38.62  ? 895  ILE E CB  1 
ATOM   6582 C CG1 . ILE E 1 143 ? 19.284  0.770   3.113   1.00   38.45  ? 895  ILE E CG1 1 
ATOM   6583 C CG2 . ILE E 1 143 ? 21.108  0.036   1.568   1.00   29.61  ? 895  ILE E CG2 1 
ATOM   6584 C CD1 . ILE E 1 143 ? 20.205  1.286   4.297   1.00   29.28  ? 895  ILE E CD1 1 
ATOM   6585 N N   . LYS E 1 144 ? 20.187  2.305   -1.249  1.00   35.43  ? 896  LYS E N   1 
ATOM   6586 C CA  . LYS E 1 144 ? 20.776  2.501   -2.574  1.00   39.29  ? 896  LYS E CA  1 
ATOM   6587 C C   . LYS E 1 144 ? 21.311  3.865   -2.722  1.00   38.80  ? 896  LYS E C   1 
ATOM   6588 O O   . LYS E 1 144 ? 22.489  3.999   -2.896  1.00   41.34  ? 896  LYS E O   1 
ATOM   6589 C CB  . LYS E 1 144 ? 19.730  2.224   -3.656  1.00   40.42  ? 896  LYS E CB  1 
ATOM   6590 C CG  . LYS E 1 144 ? 20.214  2.370   -5.076  1.00   36.11  ? 896  LYS E CG  1 
ATOM   6591 C CD  . LYS E 1 144 ? 19.401  1.560   -6.112  1.00   48.25  ? 896  LYS E CD  1 
ATOM   6592 C CE  . LYS E 1 144 ? 20.075  1.696   -7.543  1.00   40.57  ? 896  LYS E CE  1 
ATOM   6593 N NZ  . LYS E 1 144 ? 19.070  1.571   -8.585  1.00   51.83  ? 896  LYS E NZ  1 
ATOM   6594 N N   . GLU E 1 145 ? 20.433  4.851   -2.564  1.00   38.69  ? 897  GLU E N   1 
ATOM   6595 C CA  . GLU E 1 145 ? 20.742  6.284   -2.688  1.00   41.65  ? 897  GLU E CA  1 
ATOM   6596 C C   . GLU E 1 145 ? 21.803  6.695   -1.760  1.00   38.32  ? 897  GLU E C   1 
ATOM   6597 O O   . GLU E 1 145 ? 22.693  7.410   -2.153  1.00   39.21  ? 897  GLU E O   1 
ATOM   6598 C CB  . GLU E 1 145 ? 19.501  7.111   -2.382  1.00   40.71  ? 897  GLU E CB  1 
ATOM   6599 C CG  . GLU E 1 145 ? 18.367  6.985   -3.429  1.00   43.89  ? 897  GLU E CG  1 
ATOM   6600 C CD  . GLU E 1 145 ? 17.447  5.739   -3.214  1.00   63.59  ? 897  GLU E CD  1 
ATOM   6601 O OE1 . GLU E 1 145 ? 17.741  4.829   -2.346  1.00   51.44  ? 897  GLU E OE1 1 
ATOM   6602 O OE2 . GLU E 1 145 ? 16.423  5.671   -3.956  1.00   50.20  ? 897  GLU E OE2 1 
ATOM   6603 N N   . LYS E 1 146 ? 21.766  6.195   -0.504  1.00   44.95  ? 898  LYS E N   1 
ATOM   6604 C CA  . LYS E 1 146 ? 22.872  6.435   0.424   1.00   38.95  ? 898  LYS E CA  1 
ATOM   6605 C C   . LYS E 1 146 ? 24.145  5.751   0.056   1.00   39.98  ? 898  LYS E C   1 
ATOM   6606 O O   . LYS E 1 146 ? 25.297  6.276   0.266   1.00   36.11  ? 898  LYS E O   1 
ATOM   6607 C CB  . LYS E 1 146 ? 22.470  6.015   1.852   1.00   38.69  ? 898  LYS E CB  1 
ATOM   6608 C CG  . LYS E 1 146 ? 21.243  6.781   2.342   1.00   32.64  ? 898  LYS E CG  1 
ATOM   6609 C CD  . LYS E 1 146 ? 20.879  6.481   3.836   1.00   26.14  ? 898  LYS E CD  1 
ATOM   6610 C CE  . LYS E 1 146 ? 19.563  6.994   4.200   1.00   29.02  ? 898  LYS E CE  1 
ATOM   6611 N NZ  . LYS E 1 146 ? 19.115  6.682   5.525   1.00   29.58  ? 898  LYS E NZ  1 
ATOM   6612 N N   . THR E 1 147 ? 24.018  4.539   -0.460  1.00   34.24  ? 899  THR E N   1 
ATOM   6613 C CA  . THR E 1 147 ? 25.291  3.791   -0.751  1.00   35.46  ? 899  THR E CA  1 
ATOM   6614 C C   . THR E 1 147 ? 26.063  4.542   -1.894  1.00   41.17  ? 899  THR E C   1 
ATOM   6615 O O   . THR E 1 147 ? 27.293  4.715   -1.848  1.00   34.49  ? 899  THR E O   1 
ATOM   6616 C CB  . THR E 1 147 ? 25.030  2.351   -1.152  1.00   35.73  ? 899  THR E CB  1 
ATOM   6617 O OG1 . THR E 1 147 ? 24.244  1.771   -0.109  1.00   36.76  ? 899  THR E OG1 1 
ATOM   6618 C CG2 . THR E 1 147 ? 26.371  1.548   -1.237  1.00   31.84  ? 899  THR E CG2 1 
ATOM   6619 N N   . ILE E 1 148 ? 25.286  4.977   -2.875  1.00   35.61  ? 900  ILE E N   1 
ATOM   6620 C CA  . ILE E 1 148 ? 25.714  5.679   -4.068  1.00   42.63  ? 900  ILE E CA  1 
ATOM   6621 C C   . ILE E 1 148 ? 26.329  7.002   -3.622  1.00   37.58  ? 900  ILE E C   1 
ATOM   6622 O O   . ILE E 1 148 ? 27.362  7.390   -4.165  1.00   42.00  ? 900  ILE E O   1 
ATOM   6623 C CB  . ILE E 1 148 ? 24.494  5.902   -5.020  1.00   43.74  ? 900  ILE E CB  1 
ATOM   6624 C CG1 . ILE E 1 148 ? 24.139  4.639   -5.831  1.00   37.95  ? 900  ILE E CG1 1 
ATOM   6625 C CG2 . ILE E 1 148 ? 24.688  7.032   -6.028  1.00   41.49  ? 900  ILE E CG2 1 
ATOM   6626 C CD1 . ILE E 1 148 ? 22.768  4.819   -6.490  1.00   33.91  ? 900  ILE E CD1 1 
ATOM   6627 N N   . ALA E 1 149 ? 25.715  7.683   -2.643  1.00   46.33  ? 901  ALA E N   1 
ATOM   6628 C CA  . ALA E 1 149 ? 26.263  8.955   -2.025  1.00   41.86  ? 901  ALA E CA  1 
ATOM   6629 C C   . ALA E 1 149 ? 27.601  8.756   -1.436  1.00   41.65  ? 901  ALA E C   1 
ATOM   6630 O O   . ALA E 1 149 ? 28.598  9.527   -1.705  1.00   37.20  ? 901  ALA E O   1 
ATOM   6631 C CB  . ALA E 1 149 ? 25.343  9.487   -0.954  1.00   39.47  ? 901  ALA E CB  1 
ATOM   6632 N N   . ALA E 1 150 ? 27.718  7.704   -0.644  1.00   33.96  ? 902  ALA E N   1 
ATOM   6633 C CA  . ALA E 1 150 ? 29.050  7.395   -0.085  1.00   41.20  ? 902  ALA E CA  1 
ATOM   6634 C C   . ALA E 1 150 ? 30.069  7.335   -1.204  1.00   44.86  ? 902  ALA E C   1 
ATOM   6635 O O   . ALA E 1 150 ? 31.162  7.898   -1.134  1.00   47.70  ? 902  ALA E O   1 
ATOM   6636 C CB  . ALA E 1 150 ? 29.036  6.098   0.682   1.00   41.31  ? 902  ALA E CB  1 
ATOM   6637 N N   . LYS E 1 151 ? 29.681  6.632   -2.247  1.00   46.58  ? 903  LYS E N   1 
ATOM   6638 C CA  . LYS E 1 151 ? 30.568  6.327   -3.342  1.00   47.97  ? 903  LYS E CA  1 
ATOM   6639 C C   . LYS E 1 151 ? 30.894  7.580   -4.160  1.00   41.55  ? 903  LYS E C   1 
ATOM   6640 O O   . LYS E 1 151 ? 31.967  7.759   -4.509  1.00   42.27  ? 903  LYS E O   1 
ATOM   6641 C CB  . LYS E 1 151 ? 29.973  5.219   -4.181  1.00   44.26  ? 903  LYS E CB  1 
ATOM   6642 C CG  . LYS E 1 151 ? 30.974  4.175   -4.544  1.00   57.52  ? 903  LYS E CG  1 
ATOM   6643 C CD  . LYS E 1 151 ? 30.310  2.869   -4.753  1.00   57.75  ? 903  LYS E CD  1 
ATOM   6644 C CE  . LYS E 1 151 ? 31.215  1.916   -5.506  1.00   69.33  ? 903  LYS E CE  1 
ATOM   6645 N NZ  . LYS E 1 151 ? 32.113  1.210   -4.568  1.00   66.92  ? 903  LYS E NZ  1 
ATOM   6646 N N   . ARG E 1 152 ? 29.986  8.507   -4.326  1.00   38.07  ? 904  ARG E N   1 
ATOM   6647 C CA  . ARG E 1 152 ? 30.251  9.673   -5.064  1.00   42.09  ? 904  ARG E CA  1 
ATOM   6648 C C   . ARG E 1 152 ? 31.201  10.563  -4.265  1.00   47.88  ? 904  ARG E C   1 
ATOM   6649 O O   . ARG E 1 152 ? 31.884  11.389  -4.872  1.00   48.71  ? 904  ARG E O   1 
ATOM   6650 C CB  . ARG E 1 152 ? 28.946  10.449  -5.289  1.00   42.56  ? 904  ARG E CB  1 
ATOM   6651 C CG  . ARG E 1 152 ? 28.084  10.025  -6.480  1.00   36.07  ? 904  ARG E CG  1 
ATOM   6652 C CD  . ARG E 1 152 ? 27.084  11.064  -6.883  1.00   34.91  ? 904  ARG E CD  1 
ATOM   6653 N NE  . ARG E 1 152 ? 27.700  12.007  -7.829  1.00   49.38  ? 904  ARG E NE  1 
ATOM   6654 C CZ  . ARG E 1 152 ? 27.334  13.269  -8.041  1.00   61.51  ? 904  ARG E CZ  1 
ATOM   6655 N NH1 . ARG E 1 152 ? 26.349  13.841  -7.360  1.00   72.21  ? 904  ARG E NH1 1 
ATOM   6656 N NH2 . ARG E 1 152 ? 27.967  13.980  -8.953  1.00   52.81  ? 904  ARG E NH2 1 
ATOM   6657 N N   . ALA E 1 153 ? 31.207  10.417  -2.919  1.00   43.40  ? 905  ALA E N   1 
ATOM   6658 C CA  . ALA E 1 153 ? 32.005  11.200  -2.029  1.00   46.58  ? 905  ALA E CA  1 
ATOM   6659 C C   . ALA E 1 153 ? 33.342  10.608  -1.717  1.00   49.08  ? 905  ALA E C   1 
ATOM   6660 O O   . ALA E 1 153 ? 34.053  11.201  -0.925  1.00   55.44  ? 905  ALA E O   1 
ATOM   6661 C CB  . ALA E 1 153 ? 31.255  11.425  -0.667  1.00   48.94  ? 905  ALA E CB  1 
ATOM   6662 N N   . GLY E 1 154 ? 33.664  9.417   -2.208  1.00   43.12  ? 906  GLY E N   1 
ATOM   6663 C CA  . GLY E 1 154 ? 34.987  8.806   -1.986  1.00   39.36  ? 906  GLY E CA  1 
ATOM   6664 C C   . GLY E 1 154 ? 35.123  7.799   -0.880  1.00   49.62  ? 906  GLY E C   1 
ATOM   6665 O O   . GLY E 1 154 ? 36.234  7.426   -0.528  1.00   53.46  ? 906  GLY E O   1 
ATOM   6666 N N   . VAL E 1 155 ? 33.996  7.375   -0.303  1.00   45.31  ? 907  VAL E N   1 
ATOM   6667 C CA  . VAL E 1 155 ? 34.023  6.692   0.953   1.00   45.86  ? 907  VAL E CA  1 
ATOM   6668 C C   . VAL E 1 155 ? 34.094  5.265   0.554   1.00   43.41  ? 907  VAL E C   1 
ATOM   6669 O O   . VAL E 1 155 ? 33.435  4.901   -0.448  1.00   42.24  ? 907  VAL E O   1 
ATOM   6670 C CB  . VAL E 1 155 ? 32.713  6.870   1.748   1.00   46.01  ? 907  VAL E CB  1 
ATOM   6671 C CG1 . VAL E 1 155 ? 32.966  6.488   3.224   1.00   41.18  ? 907  VAL E CG1 1 
ATOM   6672 C CG2 . VAL E 1 155 ? 32.158  8.322   1.580   1.00   52.99  ? 907  VAL E CG2 1 
ATOM   6673 N N   . THR E 1 156 ? 34.956  4.525   1.234   1.00   44.22  ? 908  THR E N   1 
ATOM   6674 C CA  . THR E 1 156 ? 35.105  3.094   0.981   1.00   49.48  ? 908  THR E CA  1 
ATOM   6675 C C   . THR E 1 156 ? 34.917  2.291   2.255   1.00   48.12  ? 908  THR E C   1 
ATOM   6676 O O   . THR E 1 156 ? 35.165  1.043   2.284   1.00   57.87  ? 908  THR E O   1 
ATOM   6677 C CB  . THR E 1 156 ? 36.511  2.766   0.412   1.00   49.99  ? 908  THR E CB  1 
ATOM   6678 O OG1 . THR E 1 156 ? 37.481  3.313   1.298   1.00   50.14  ? 908  THR E OG1 1 
ATOM   6679 C CG2 . THR E 1 156 ? 36.723  3.348   -1.047  1.00   53.46  ? 908  THR E CG2 1 
ATOM   6680 N N   . CYS E 1 157 ? 34.484  2.967   3.310   1.00   50.44  ? 909  CYS E N   1 
ATOM   6681 C CA  . CYS E 1 157 ? 34.048  2.291   4.502   1.00   52.43  ? 909  CYS E CA  1 
ATOM   6682 C C   . CYS E 1 157 ? 32.752  2.919   5.082   1.00   48.93  ? 909  CYS E C   1 
ATOM   6683 O O   . CYS E 1 157 ? 32.764  4.069   5.478   1.00   48.76  ? 909  CYS E O   1 
ATOM   6684 C CB  . CYS E 1 157 ? 35.153  2.347   5.503   1.00   58.96  ? 909  CYS E CB  1 
ATOM   6685 S SG  . CYS E 1 157 ? 34.658  1.571   7.014   1.00   62.25  ? 909  CYS E SG  1 
ATOM   6686 N N   . ILE E 1 158 ? 31.645  2.173   5.066   1.00   49.17  ? 910  ILE E N   1 
ATOM   6687 C CA  . ILE E 1 158 ? 30.326  2.659   5.533   1.00   49.68  ? 910  ILE E CA  1 
ATOM   6688 C C   . ILE E 1 158 ? 29.626  1.759   6.587   1.00   45.58  ? 910  ILE E C   1 
ATOM   6689 O O   . ILE E 1 158 ? 29.795  0.514   6.646   1.00   37.56  ? 910  ILE E O   1 
ATOM   6690 C CB  . ILE E 1 158 ? 29.390  3.112   4.381   1.00   43.39  ? 910  ILE E CB  1 
ATOM   6691 C CG1 . ILE E 1 158 ? 28.281  2.156   4.070   1.00   51.07  ? 910  ILE E CG1 1 
ATOM   6692 C CG2 . ILE E 1 158 ? 30.134  3.232   3.039   1.00   54.86  ? 910  ILE E CG2 1 
ATOM   6693 C CD1 . ILE E 1 158 ? 28.741  1.114   3.237   1.00   37.70  ? 910  ILE E CD1 1 
ATOM   6694 N N   . VAL E 1 159 ? 28.893  2.423   7.482   1.00   43.30  ? 911  VAL E N   1 
ATOM   6695 C CA  . VAL E 1 159 ? 28.319  1.749   8.657   1.00   32.71  ? 911  VAL E CA  1 
ATOM   6696 C C   . VAL E 1 159 ? 26.819  1.746   8.478   1.00   34.53  ? 911  VAL E C   1 
ATOM   6697 O O   . VAL E 1 159 ? 26.228  2.778   8.379   1.00   34.85  ? 911  VAL E O   1 
ATOM   6698 C CB  . VAL E 1 159 ? 28.725  2.359   9.937   1.00   35.35  ? 911  VAL E CB  1 
ATOM   6699 C CG1 . VAL E 1 159 ? 27.881  1.818   11.175  1.00   34.70  ? 911  VAL E CG1 1 
ATOM   6700 C CG2 . VAL E 1 159 ? 30.339  2.238   10.211  1.00   32.76  ? 911  VAL E CG2 1 
ATOM   6701 N N   . LEU E 1 160 ? 26.221  0.557   8.456   1.00   35.39  ? 912  LEU E N   1 
ATOM   6702 C CA  . LEU E 1 160 ? 24.781  0.401   8.268   1.00   33.56  ? 912  LEU E CA  1 
ATOM   6703 C C   . LEU E 1 160 ? 24.131  -0.490  9.341   1.00   38.46  ? 912  LEU E C   1 
ATOM   6704 O O   . LEU E 1 160 ? 24.843  -1.285  9.998   1.00   31.34  ? 912  LEU E O   1 
ATOM   6705 C CB  . LEU E 1 160 ? 24.424  -0.085  6.833   1.00   34.50  ? 912  LEU E CB  1 
ATOM   6706 C CG  . LEU E 1 160 ? 24.996  0.499   5.549   1.00   39.91  ? 912  LEU E CG  1 
ATOM   6707 C CD1 . LEU E 1 160 ? 24.650  -0.245  4.319   1.00   29.75  ? 912  LEU E CD1 1 
ATOM   6708 C CD2 . LEU E 1 160 ? 24.684  1.996   5.269   1.00   17.37  ? 912  LEU E CD2 1 
ATOM   6709 N N   . PRO E 1 161 ? 22.829  -0.265  9.613   1.00   35.89  ? 913  PRO E N   1 
ATOM   6710 C CA  . PRO E 1 161 ? 22.091  -1.122  10.503  1.00   39.68  ? 913  PRO E CA  1 
ATOM   6711 C C   . PRO E 1 161 ? 22.168  -2.544  9.976   1.00   38.34  ? 913  PRO E C   1 
ATOM   6712 O O   . PRO E 1 161 ? 22.055  -2.798  8.742   1.00   37.01  ? 913  PRO E O   1 
ATOM   6713 C CB  . PRO E 1 161 ? 20.668  -0.600  10.419  1.00   38.28  ? 913  PRO E CB  1 
ATOM   6714 C CG  . PRO E 1 161 ? 20.818  0.824   9.858   1.00   27.37  ? 913  PRO E CG  1 
ATOM   6715 C CD  . PRO E 1 161 ? 21.940  0.685   8.925   1.00   35.87  ? 913  PRO E CD  1 
ATOM   6716 N N   . ALA E 1 162 ? 22.269  -3.450  10.933  1.00   38.93  ? 914  ALA E N   1 
ATOM   6717 C CA  . ALA E 1 162 ? 22.073  -4.901  10.669  1.00   42.55  ? 914  ALA E CA  1 
ATOM   6718 C C   . ALA E 1 162 ? 20.849  -5.286  9.840   1.00   42.69  ? 914  ALA E C   1 
ATOM   6719 O O   . ALA E 1 162 ? 21.008  -6.002  8.911   1.00   38.90  ? 914  ALA E O   1 
ATOM   6720 C CB  . ALA E 1 162 ? 22.111  -5.704  11.982  1.00   50.70  ? 914  ALA E CB  1 
ATOM   6721 N N   . GLU E 1 163 ? 19.649  -4.771  10.121  1.00   41.38  ? 915  GLU E N   1 
ATOM   6722 C CA  . GLU E 1 163 ? 18.455  -5.151  9.354   1.00   41.61  ? 915  GLU E CA  1 
ATOM   6723 C C   . GLU E 1 163 ? 18.346  -4.569  7.923   1.00   41.52  ? 915  GLU E C   1 
ATOM   6724 O O   . GLU E 1 163 ? 17.429  -4.812  7.128   1.00   34.59  ? 915  GLU E O   1 
ATOM   6725 C CB  . GLU E 1 163 ? 17.215  -4.867  10.218  1.00   48.43  ? 915  GLU E CB  1 
ATOM   6726 C CG  . GLU E 1 163 ? 17.206  -5.847  11.414  1.00   40.66  ? 915  GLU E CG  1 
ATOM   6727 C CD  . GLU E 1 163 ? 16.203  -5.479  12.483  1.00   53.43  ? 915  GLU E CD  1 
ATOM   6728 O OE1 . GLU E 1 163 ? 14.975  -5.579  12.195  1.00   46.60  ? 915  GLU E OE1 1 
ATOM   6729 O OE2 . GLU E 1 163 ? 16.630  -5.047  13.576  1.00   58.19  ? 915  GLU E OE2 1 
ATOM   6730 N N   . ASN E 1 164 ? 19.335  -3.799  7.575   1.00   44.93  ? 916  ASN E N   1 
ATOM   6731 C CA  . ASN E 1 164 ? 19.411  -3.302  6.243   1.00   38.97  ? 916  ASN E CA  1 
ATOM   6732 C C   . ASN E 1 164 ? 20.406  -4.208  5.439   1.00   33.89  ? 916  ASN E C   1 
ATOM   6733 O O   . ASN E 1 164 ? 20.701  -3.926  4.273   1.00   36.83  ? 916  ASN E O   1 
ATOM   6734 C CB  . ASN E 1 164 ? 19.866  -1.833  6.269   1.00   40.06  ? 916  ASN E CB  1 
ATOM   6735 C CG  . ASN E 1 164 ? 18.766  -0.840  6.567   1.00   35.16  ? 916  ASN E CG  1 
ATOM   6736 O OD1 . ASN E 1 164 ? 18.979  -0.056  7.455   1.00   42.65  ? 916  ASN E OD1 1 
ATOM   6737 N ND2 . ASN E 1 164 ? 17.612  -0.801  5.800   1.00   29.98  ? 916  ASN E ND2 1 
ATOM   6738 N N   . LYS E 1 165 ? 20.920  -5.293  6.036   1.00   39.89  ? 917  LYS E N   1 
ATOM   6739 C CA  . LYS E 1 165 ? 21.780  -6.216  5.281   1.00   43.48  ? 917  LYS E CA  1 
ATOM   6740 C C   . LYS E 1 165 ? 21.141  -6.620  3.976   1.00   48.49  ? 917  LYS E C   1 
ATOM   6741 O O   . LYS E 1 165 ? 21.767  -6.555  2.901   1.00   52.84  ? 917  LYS E O   1 
ATOM   6742 C CB  . LYS E 1 165 ? 22.046  -7.471  6.097   1.00   44.50  ? 917  LYS E CB  1 
ATOM   6743 C CG  . LYS E 1 165 ? 23.375  -8.144  5.910   1.00   54.56  ? 917  LYS E CG  1 
ATOM   6744 C CD  . LYS E 1 165 ? 23.460  -9.277  7.007   1.00   53.26  ? 917  LYS E CD  1 
ATOM   6745 C CE  . LYS E 1 165 ? 24.899  -9.692  7.319   1.00   60.32  ? 917  LYS E CE  1 
ATOM   6746 N NZ  . LYS E 1 165 ? 25.425  -10.473 6.160   1.00   47.50  ? 917  LYS E NZ  1 
ATOM   6747 N N   . LYS E 1 166 ? 19.902  -7.100  4.079   1.00   48.06  ? 918  LYS E N   1 
ATOM   6748 C CA  . LYS E 1 166 ? 19.109  -7.525  2.910   1.00   48.27  ? 918  LYS E CA  1 
ATOM   6749 C C   . LYS E 1 166 ? 19.228  -6.441  1.855   1.00   49.42  ? 918  LYS E C   1 
ATOM   6750 O O   . LYS E 1 166 ? 19.573  -6.705  0.702   1.00   48.54  ? 918  LYS E O   1 
ATOM   6751 C CB  . LYS E 1 166 ? 17.638  -7.744  3.364   1.00   50.58  ? 918  LYS E CB  1 
ATOM   6752 C CG  . LYS E 1 166 ? 16.531  -7.885  2.276   1.00   64.20  ? 918  LYS E CG  1 
ATOM   6753 C CD  . LYS E 1 166 ? 16.688  -9.107  1.341   1.00   70.99  ? 918  LYS E CD  1 
ATOM   6754 C CE  . LYS E 1 166 ? 16.209  -10.436 1.950   1.00   72.82  ? 918  LYS E CE  1 
ATOM   6755 N NZ  . LYS E 1 166 ? 16.614  -11.556 1.044   1.00   65.96  ? 918  LYS E NZ  1 
ATOM   6756 N N   . ASP E 1 167 ? 18.923  -5.202  2.261   1.00   47.49  ? 919  ASP E N   1 
ATOM   6757 C CA  . ASP E 1 167 ? 18.745  -4.098  1.361   1.00   37.66  ? 919  ASP E CA  1 
ATOM   6758 C C   . ASP E 1 167 ? 20.031  -3.847  0.573   1.00   35.26  ? 919  ASP E C   1 
ATOM   6759 O O   . ASP E 1 167 ? 20.053  -3.682  -0.669  1.00   34.97  ? 919  ASP E O   1 
ATOM   6760 C CB  . ASP E 1 167 ? 18.387  -2.837  2.173   1.00   44.04  ? 919  ASP E CB  1 
ATOM   6761 C CG  . ASP E 1 167 ? 17.020  -2.946  2.856   1.00   49.05  ? 919  ASP E CG  1 
ATOM   6762 O OD1 . ASP E 1 167 ? 16.031  -3.188  2.153   1.00   47.64  ? 919  ASP E OD1 1 
ATOM   6763 O OD2 . ASP E 1 167 ? 16.951  -2.839  4.093   1.00   41.32  ? 919  ASP E OD2 1 
ATOM   6764 N N   . PHE E 1 168 ? 21.123  -3.952  1.303   1.00   42.80  ? 920  PHE E N   1 
ATOM   6765 C CA  . PHE E 1 168 ? 22.418  -3.770  0.749   1.00   45.97  ? 920  PHE E CA  1 
ATOM   6766 C C   . PHE E 1 168 ? 22.819  -4.793  -0.263  1.00   48.99  ? 920  PHE E C   1 
ATOM   6767 O O   . PHE E 1 168 ? 23.368  -4.466  -1.317  1.00   47.69  ? 920  PHE E O   1 
ATOM   6768 C CB  . PHE E 1 168 ? 23.430  -3.777  1.888   1.00   35.74  ? 920  PHE E CB  1 
ATOM   6769 C CG  . PHE E 1 168 ? 24.777  -3.405  1.436   1.00   41.50  ? 920  PHE E CG  1 
ATOM   6770 C CD1 . PHE E 1 168 ? 25.047  -2.106  1.101   1.00   40.71  ? 920  PHE E CD1 1 
ATOM   6771 C CD2 . PHE E 1 168 ? 25.798  -4.355  1.334   1.00   44.72  ? 920  PHE E CD2 1 
ATOM   6772 C CE1 . PHE E 1 168 ? 26.327  -1.722  0.684   1.00   57.51  ? 920  PHE E CE1 1 
ATOM   6773 C CE2 . PHE E 1 168 ? 27.054  -3.985  0.939   1.00   44.98  ? 920  PHE E CE2 1 
ATOM   6774 C CZ  . PHE E 1 168 ? 27.325  -2.670  0.598   1.00   49.18  ? 920  PHE E CZ  1 
ATOM   6775 N N   . TYR E 1 169 ? 22.613  -6.062  0.064   1.00   45.46  ? 921  TYR E N   1 
ATOM   6776 C CA  . TYR E 1 169 ? 22.968  -7.101  -0.873  1.00   41.19  ? 921  TYR E CA  1 
ATOM   6777 C C   . TYR E 1 169 ? 22.003  -7.311  -2.065  1.00   41.81  ? 921  TYR E C   1 
ATOM   6778 O O   . TYR E 1 169 ? 22.382  -7.883  -3.033  1.00   43.76  ? 921  TYR E O   1 
ATOM   6779 C CB  . TYR E 1 169 ? 23.307  -8.387  -0.171  1.00   41.90  ? 921  TYR E CB  1 
ATOM   6780 C CG  . TYR E 1 169 ? 24.590  -8.248  0.627   1.00   49.22  ? 921  TYR E CG  1 
ATOM   6781 C CD1 . TYR E 1 169 ? 25.753  -7.951  0.004   1.00   44.12  ? 921  TYR E CD1 1 
ATOM   6782 C CD2 . TYR E 1 169 ? 24.614  -8.376  2.005   1.00   41.10  ? 921  TYR E CD2 1 
ATOM   6783 C CE1 . TYR E 1 169 ? 26.977  -7.850  0.713   1.00   37.68  ? 921  TYR E CE1 1 
ATOM   6784 C CE2 . TYR E 1 169 ? 25.807  -8.241  2.717   1.00   42.21  ? 921  TYR E CE2 1 
ATOM   6785 C CZ  . TYR E 1 169 ? 26.982  -7.944  2.070   1.00   46.03  ? 921  TYR E CZ  1 
ATOM   6786 O OH  . TYR E 1 169 ? 28.194  -7.801  2.783   1.00   44.79  ? 921  TYR E OH  1 
ATOM   6787 N N   . ASP E 1 170 ? 20.821  -6.745  -2.014  1.00   42.32  ? 922  ASP E N   1 
ATOM   6788 C CA  . ASP E 1 170 ? 19.983  -6.632  -3.155  1.00   44.50  ? 922  ASP E CA  1 
ATOM   6789 C C   . ASP E 1 170 ? 20.478  -5.619  -4.196  1.00   48.21  ? 922  ASP E C   1 
ATOM   6790 O O   . ASP E 1 170 ? 19.802  -5.437  -5.248  1.00   40.66  ? 922  ASP E O   1 
ATOM   6791 C CB  . ASP E 1 170 ? 18.582  -6.161  -2.680  1.00   47.50  ? 922  ASP E CB  1 
ATOM   6792 C CG  . ASP E 1 170 ? 17.716  -7.315  -2.220  1.00   48.41  ? 922  ASP E CG  1 
ATOM   6793 O OD1 . ASP E 1 170 ? 18.192  -8.488  -2.319  1.00   47.11  ? 922  ASP E OD1 1 
ATOM   6794 O OD2 . ASP E 1 170 ? 16.603  -7.026  -1.691  1.00   47.29  ? 922  ASP E OD2 1 
ATOM   6795 N N   . LEU E 1 171 ? 21.568  -4.902  -3.882  1.00   43.29  ? 923  LEU E N   1 
ATOM   6796 C CA  . LEU E 1 171 ? 22.138  -3.894  -4.827  1.00   43.41  ? 923  LEU E CA  1 
ATOM   6797 C C   . LEU E 1 171 ? 22.983  -4.651  -5.821  1.00   45.27  ? 923  LEU E C   1 
ATOM   6798 O O   . LEU E 1 171 ? 23.515  -5.709  -5.461  1.00   48.15  ? 923  LEU E O   1 
ATOM   6799 C CB  . LEU E 1 171 ? 23.067  -2.938  -4.091  1.00   40.33  ? 923  LEU E CB  1 
ATOM   6800 C CG  . LEU E 1 171 ? 22.440  -2.177  -2.897  1.00   50.82  ? 923  LEU E CG  1 
ATOM   6801 C CD1 . LEU E 1 171 ? 23.374  -1.073  -2.323  1.00   45.21  ? 923  LEU E CD1 1 
ATOM   6802 C CD2 . LEU E 1 171 ? 21.132  -1.612  -3.263  1.00   29.25  ? 923  LEU E CD2 1 
ATOM   6803 N N   . ALA E 1 172 ? 23.193  -4.036  -6.987  1.00   44.96  ? 924  ALA E N   1 
ATOM   6804 C CA  . ALA E 1 172 ? 24.107  -4.519  -8.009  1.00   43.25  ? 924  ALA E CA  1 
ATOM   6805 C C   . ALA E 1 172 ? 25.447  -4.615  -7.417  1.00   45.62  ? 924  ALA E C   1 
ATOM   6806 O O   . ALA E 1 172 ? 25.912  -3.741  -6.587  1.00   38.98  ? 924  ALA E O   1 
ATOM   6807 C CB  . ALA E 1 172 ? 24.099  -3.619  -9.255  1.00   43.83  ? 924  ALA E CB  1 
ATOM   6808 N N   . ALA E 1 173 ? 26.078  -5.691  -7.823  1.00   39.61  ? 925  ALA E N   1 
ATOM   6809 C CA  . ALA E 1 173 ? 27.403  -6.005  -7.351  1.00   43.68  ? 925  ALA E CA  1 
ATOM   6810 C C   . ALA E 1 173 ? 28.392  -4.872  -7.707  1.00   44.93  ? 925  ALA E C   1 
ATOM   6811 O O   . ALA E 1 173 ? 29.422  -4.684  -7.049  1.00   43.76  ? 925  ALA E O   1 
ATOM   6812 C CB  . ALA E 1 173 ? 27.847  -7.366  -7.940  1.00   51.86  ? 925  ALA E CB  1 
ATOM   6813 N N   . PHE E 1 174 ? 28.111  -4.152  -8.789  1.00   48.76  ? 926  PHE E N   1 
ATOM   6814 C CA  . PHE E 1 174 ? 28.926  -3.010  -9.177  1.00   46.33  ? 926  PHE E CA  1 
ATOM   6815 C C   . PHE E 1 174 ? 28.981  -1.929  -8.088  1.00   48.48  ? 926  PHE E C   1 
ATOM   6816 O O   . PHE E 1 174 ? 30.045  -1.371  -7.825  1.00   39.75  ? 926  PHE E O   1 
ATOM   6817 C CB  . PHE E 1 174 ? 28.424  -2.428  -10.517 1.00   42.75  ? 926  PHE E CB  1 
ATOM   6818 C CG  . PHE E 1 174 ? 29.405  -1.541  -11.196 1.00   43.99  ? 926  PHE E CG  1 
ATOM   6819 C CD1 . PHE E 1 174 ? 30.579  -2.063  -11.683 1.00   41.67  ? 926  PHE E CD1 1 
ATOM   6820 C CD2 . PHE E 1 174 ? 29.158  -0.177  -11.346 1.00   38.82  ? 926  PHE E CD2 1 
ATOM   6821 C CE1 . PHE E 1 174 ? 31.499  -1.255  -12.324 1.00   43.52  ? 926  PHE E CE1 1 
ATOM   6822 C CE2 . PHE E 1 174 ? 30.116  0.657   -11.900 1.00   43.80  ? 926  PHE E CE2 1 
ATOM   6823 C CZ  . PHE E 1 174 ? 31.252  0.134   -12.447 1.00   42.64  ? 926  PHE E CZ  1 
ATOM   6824 N N   . ILE E 1 175 ? 27.834  -1.617  -7.489  1.00   50.91  ? 927  ILE E N   1 
ATOM   6825 C CA  . ILE E 1 175 ? 27.742  -0.631  -6.395  1.00   51.39  ? 927  ILE E CA  1 
ATOM   6826 C C   . ILE E 1 175 ? 28.452  -1.147  -5.169  1.00   54.90  ? 927  ILE E C   1 
ATOM   6827 O O   . ILE E 1 175 ? 29.315  -0.460  -4.539  1.00   56.75  ? 927  ILE E O   1 
ATOM   6828 C CB  . ILE E 1 175 ? 26.260  -0.321  -6.049  1.00   55.83  ? 927  ILE E CB  1 
ATOM   6829 C CG1 . ILE E 1 175 ? 25.554  0.276   -7.254  1.00   51.66  ? 927  ILE E CG1 1 
ATOM   6830 C CG2 . ILE E 1 175 ? 26.166  0.608   -4.800  1.00   55.17  ? 927  ILE E CG2 1 
ATOM   6831 C CD1 . ILE E 1 175 ? 24.055  0.285   -7.170  1.00   54.69  ? 927  ILE E CD1 1 
ATOM   6832 N N   . THR E 1 176 ? 28.146  -2.391  -4.847  1.00   52.16  ? 928  THR E N   1 
ATOM   6833 C CA  . THR E 1 176 ? 28.594  -3.009  -3.600  1.00   55.08  ? 928  THR E CA  1 
ATOM   6834 C C   . THR E 1 176 ? 30.067  -3.308  -3.616  1.00   52.44  ? 928  THR E C   1 
ATOM   6835 O O   . THR E 1 176 ? 30.719  -3.177  -2.626  1.00   45.30  ? 928  THR E O   1 
ATOM   6836 C CB  . THR E 1 176 ? 27.826  -4.334  -3.400  1.00   58.62  ? 928  THR E CB  1 
ATOM   6837 O OG1 . THR E 1 176 ? 26.631  -4.067  -2.638  1.00   57.98  ? 928  THR E OG1 1 
ATOM   6838 C CG2 . THR E 1 176 ? 28.701  -5.336  -2.742  1.00   67.12  ? 928  THR E CG2 1 
ATOM   6839 N N   . GLU E 1 177 ? 30.587  -3.699  -4.775  1.00   58.21  ? 929  GLU E N   1 
ATOM   6840 C CA  . GLU E 1 177 ? 31.974  -4.181  -4.935  1.00   57.70  ? 929  GLU E CA  1 
ATOM   6841 C C   . GLU E 1 177 ? 32.995  -3.166  -4.440  1.00   57.33  ? 929  GLU E C   1 
ATOM   6842 O O   . GLU E 1 177 ? 32.885  -1.992  -4.789  1.00   60.76  ? 929  GLU E O   1 
ATOM   6843 C CB  . GLU E 1 177 ? 32.204  -4.457  -6.446  1.00   60.53  ? 929  GLU E CB  1 
ATOM   6844 C CG  . GLU E 1 177 ? 33.668  -4.573  -6.900  1.00   62.38  ? 929  GLU E CG  1 
ATOM   6845 C CD  . GLU E 1 177 ? 33.855  -4.284  -8.377  1.00   66.97  ? 929  GLU E CD  1 
ATOM   6846 O OE1 . GLU E 1 177 ? 32.892  -4.545  -9.172  1.00   51.26  ? 929  GLU E OE1 1 
ATOM   6847 O OE2 . GLU E 1 177 ? 34.977  -3.795  -8.737  1.00   62.41  ? 929  GLU E OE2 1 
ATOM   6848 N N   . GLY E 1 178 ? 33.964  -3.598  -3.628  1.00   59.56  ? 930  GLY E N   1 
ATOM   6849 C CA  . GLY E 1 178 ? 34.984  -2.663  -3.019  1.00   64.29  ? 930  GLY E CA  1 
ATOM   6850 C C   . GLY E 1 178 ? 34.707  -1.821  -1.758  1.00   63.51  ? 930  GLY E C   1 
ATOM   6851 O O   . GLY E 1 178 ? 35.647  -1.371  -1.059  1.00   64.85  ? 930  GLY E O   1 
ATOM   6852 N N   . LEU E 1 179 ? 33.430  -1.596  -1.453  1.00   61.31  ? 931  LEU E N   1 
ATOM   6853 C CA  . LEU E 1 179 ? 33.020  -0.890  -0.244  1.00   55.94  ? 931  LEU E CA  1 
ATOM   6854 C C   . LEU E 1 179 ? 33.235  -1.777  0.933   1.00   52.96  ? 931  LEU E C   1 
ATOM   6855 O O   . LEU E 1 179 ? 32.704  -2.887  0.976   1.00   54.24  ? 931  LEU E O   1 
ATOM   6856 C CB  . LEU E 1 179 ? 31.525  -0.576  -0.290  1.00   55.79  ? 931  LEU E CB  1 
ATOM   6857 C CG  . LEU E 1 179 ? 31.105  0.818   -0.680  1.00   64.24  ? 931  LEU E CG  1 
ATOM   6858 C CD1 . LEU E 1 179 ? 29.552  0.888   -0.874  1.00   45.76  ? 931  LEU E CD1 1 
ATOM   6859 C CD2 . LEU E 1 179 ? 31.592  1.673   0.429   1.00   60.95  ? 931  LEU E CD2 1 
ATOM   6860 N N   . GLU E 1 180 ? 34.040  -1.334  1.876   1.00   57.71  ? 932  GLU E N   1 
ATOM   6861 C CA  . GLU E 1 180 ? 34.051  -1.990  3.169   1.00   60.99  ? 932  GLU E CA  1 
ATOM   6862 C C   . GLU E 1 180 ? 32.739  -1.564  3.837   1.00   58.70  ? 932  GLU E C   1 
ATOM   6863 O O   . GLU E 1 180 ? 32.424  -0.386  3.810   1.00   54.62  ? 932  GLU E O   1 
ATOM   6864 C CB  . GLU E 1 180 ? 35.239  -1.524  4.017   1.00   65.49  ? 932  GLU E CB  1 
ATOM   6865 C CG  . GLU E 1 180 ? 35.645  -2.543  5.071   1.00   67.12  ? 932  GLU E CG  1 
ATOM   6866 C CD  . GLU E 1 180 ? 36.273  -1.950  6.318   1.00   65.34  ? 932  GLU E CD  1 
ATOM   6867 O OE1 . GLU E 1 180 ? 37.471  -2.221  6.550   1.00   80.66  ? 932  GLU E OE1 1 
ATOM   6868 O OE2 . GLU E 1 180 ? 35.583  -1.256  7.100   1.00   75.97  ? 932  GLU E OE2 1 
ATOM   6869 N N   . VAL E 1 181 ? 32.006  -2.520  4.427   1.00   53.98  ? 933  VAL E N   1 
ATOM   6870 C CA  . VAL E 1 181 ? 30.691  -2.321  5.003   1.00   44.20  ? 933  VAL E CA  1 
ATOM   6871 C C   . VAL E 1 181 ? 30.701  -2.888  6.392   1.00   46.55  ? 933  VAL E C   1 
ATOM   6872 O O   . VAL E 1 181 ? 31.159  -4.016  6.551   1.00   49.42  ? 933  VAL E O   1 
ATOM   6873 C CB  . VAL E 1 181 ? 29.544  -3.209  4.290   1.00   40.01  ? 933  VAL E CB  1 
ATOM   6874 C CG1 . VAL E 1 181 ? 28.252  -2.493  4.250   1.00   47.13  ? 933  VAL E CG1 1 
ATOM   6875 C CG2 . VAL E 1 181 ? 29.939  -3.716  2.979   1.00   50.52  ? 933  VAL E CG2 1 
ATOM   6876 N N   . HIS E 1 182 ? 30.155  -2.175  7.394   1.00   43.89  ? 934  HIS E N   1 
ATOM   6877 C CA  . HIS E 1 182 ? 29.925  -2.784  8.735   1.00   47.40  ? 934  HIS E CA  1 
ATOM   6878 C C   . HIS E 1 182 ? 28.469  -2.748  9.068   1.00   49.38  ? 934  HIS E C   1 
ATOM   6879 O O   . HIS E 1 182 ? 27.883  -1.667  9.156   1.00   48.13  ? 934  HIS E O   1 
ATOM   6880 C CB  . HIS E 1 182 ? 30.708  -2.081  9.849   1.00   42.95  ? 934  HIS E CB  1 
ATOM   6881 C CG  . HIS E 1 182 ? 32.189  -2.068  9.625   1.00   59.33  ? 934  HIS E CG  1 
ATOM   6882 N ND1 . HIS E 1 182 ? 33.050  -2.952  10.241  1.00   46.05  ? 934  HIS E ND1 1 
ATOM   6883 C CD2 . HIS E 1 182 ? 32.952  -1.290  8.834   1.00   50.54  ? 934  HIS E CD2 1 
ATOM   6884 C CE1 . HIS E 1 182 ? 34.278  -2.728  9.814   1.00   52.20  ? 934  HIS E CE1 1 
ATOM   6885 N NE2 . HIS E 1 182 ? 34.244  -1.710  8.976   1.00   52.85  ? 934  HIS E NE2 1 
ATOM   6886 N N   . PHE E 1 183 ? 27.911  -3.936  9.308   1.00   46.85  ? 935  PHE E N   1 
ATOM   6887 C CA  . PHE E 1 183 ? 26.562  -4.112  9.826   1.00   45.63  ? 935  PHE E CA  1 
ATOM   6888 C C   . PHE E 1 183 ? 26.452  -4.174  11.347  1.00   45.59  ? 935  PHE E C   1 
ATOM   6889 O O   . PHE E 1 183 ? 27.080  -5.041  12.059  1.00   42.65  ? 935  PHE E O   1 
ATOM   6890 C CB  . PHE E 1 183 ? 25.894  -5.303  9.126   1.00   42.73  ? 935  PHE E CB  1 
ATOM   6891 C CG  . PHE E 1 183 ? 25.894  -5.175  7.575   1.00   44.88  ? 935  PHE E CG  1 
ATOM   6892 C CD1 . PHE E 1 183 ? 24.969  -4.369  6.900   1.00   31.07  ? 935  PHE E CD1 1 
ATOM   6893 C CD2 . PHE E 1 183 ? 26.857  -5.802  6.804   1.00   51.84  ? 935  PHE E CD2 1 
ATOM   6894 C CE1 . PHE E 1 183 ? 24.992  -4.240  5.584   1.00   33.12  ? 935  PHE E CE1 1 
ATOM   6895 C CE2 . PHE E 1 183 ? 26.852  -5.656  5.425   1.00   41.86  ? 935  PHE E CE2 1 
ATOM   6896 C CZ  . PHE E 1 183 ? 25.906  -4.908  4.825   1.00   35.74  ? 935  PHE E CZ  1 
ATOM   6897 N N   . VAL E 1 184 ? 25.655  -3.245  11.890  1.00   37.25  ? 936  VAL E N   1 
ATOM   6898 C CA  . VAL E 1 184 ? 25.648  -3.052  13.346  1.00   35.23  ? 936  VAL E CA  1 
ATOM   6899 C C   . VAL E 1 184 ? 24.326  -3.197  13.938  1.00   38.35  ? 936  VAL E C   1 
ATOM   6900 O O   . VAL E 1 184 ? 23.348  -2.834  13.312  1.00   41.42  ? 936  VAL E O   1 
ATOM   6901 C CB  . VAL E 1 184 ? 26.191  -1.624  13.764  1.00   36.20  ? 936  VAL E CB  1 
ATOM   6902 C CG1 . VAL E 1 184 ? 27.684  -1.628  13.640  1.00   42.68  ? 936  VAL E CG1 1 
ATOM   6903 C CG2 . VAL E 1 184 ? 25.568  -0.374  12.907  1.00   37.36  ? 936  VAL E CG2 1 
ATOM   6904 N N   . GLU E 1 185 ? 24.323  -3.664  15.189  1.00   43.35  ? 937  GLU E N   1 
ATOM   6905 C CA  . GLU E 1 185 ? 23.123  -3.855  16.011  1.00   42.97  ? 937  GLU E CA  1 
ATOM   6906 C C   . GLU E 1 185 ? 23.064  -2.897  17.154  1.00   37.79  ? 937  GLU E C   1 
ATOM   6907 O O   . GLU E 1 185 ? 21.985  -2.581  17.591  1.00   37.61  ? 937  GLU E O   1 
ATOM   6908 C CB  . GLU E 1 185 ? 23.112  -5.264  16.640  1.00   37.09  ? 937  GLU E CB  1 
ATOM   6909 C CG  . GLU E 1 185 ? 22.834  -6.307  15.702  1.00   49.38  ? 937  GLU E CG  1 
ATOM   6910 C CD  . GLU E 1 185 ? 22.842  -7.689  16.331  1.00   43.86  ? 937  GLU E CD  1 
ATOM   6911 O OE1 . GLU E 1 185 ? 22.161  -7.854  17.348  1.00   43.50  ? 937  GLU E OE1 1 
ATOM   6912 O OE2 . GLU E 1 185 ? 23.486  -8.562  15.789  1.00   54.18  ? 937  GLU E OE2 1 
ATOM   6913 N N   . HIS E 1 186 ? 24.218  -2.518  17.720  1.00   38.96  ? 938  HIS E N   1 
ATOM   6914 C CA  . HIS E 1 186 ? 24.273  -1.728  18.896  1.00   37.10  ? 938  HIS E CA  1 
ATOM   6915 C C   . HIS E 1 186 ? 25.251  -0.585  18.635  1.00   30.93  ? 938  HIS E C   1 
ATOM   6916 O O   . HIS E 1 186 ? 26.082  -0.700  17.773  1.00   36.04  ? 938  HIS E O   1 
ATOM   6917 C CB  . HIS E 1 186 ? 24.684  -2.512  20.186  1.00   38.14  ? 938  HIS E CB  1 
ATOM   6918 C CG  . HIS E 1 186 ? 24.660  -1.706  21.439  1.00   44.71  ? 938  HIS E CG  1 
ATOM   6919 N ND1 . HIS E 1 186 ? 25.722  -0.907  21.822  1.00   42.63  ? 938  HIS E ND1 1 
ATOM   6920 C CD2 . HIS E 1 186 ? 23.736  -1.620  22.441  1.00   43.97  ? 938  HIS E CD2 1 
ATOM   6921 C CE1 . HIS E 1 186 ? 25.442  -0.346  22.983  1.00   46.78  ? 938  HIS E CE1 1 
ATOM   6922 N NE2 . HIS E 1 186 ? 24.249  -0.763  23.378  1.00   53.65  ? 938  HIS E NE2 1 
ATOM   6923 N N   . TYR E 1 187 ? 25.045  0.548   19.301  1.00   35.11  ? 939  TYR E N   1 
ATOM   6924 C CA  . TYR E 1 187 ? 25.898  1.730   19.038  1.00   31.65  ? 939  TYR E CA  1 
ATOM   6925 C C   . TYR E 1 187 ? 27.392  1.471   19.383  1.00   41.11  ? 939  TYR E C   1 
ATOM   6926 O O   . TYR E 1 187 ? 28.317  1.900   18.683  1.00   39.05  ? 939  TYR E O   1 
ATOM   6927 C CB  . TYR E 1 187 ? 25.375  2.993   19.770  1.00   32.15  ? 939  TYR E CB  1 
ATOM   6928 C CG  . TYR E 1 187 ? 26.331  4.131   19.450  1.00   33.38  ? 939  TYR E CG  1 
ATOM   6929 C CD1 . TYR E 1 187 ? 26.303  4.714   18.186  1.00   35.98  ? 939  TYR E CD1 1 
ATOM   6930 C CD2 . TYR E 1 187 ? 27.415  4.423   20.281  1.00   40.11  ? 939  TYR E CD2 1 
ATOM   6931 C CE1 . TYR E 1 187 ? 27.261  5.706   17.839  1.00   33.25  ? 939  TYR E CE1 1 
ATOM   6932 C CE2 . TYR E 1 187 ? 28.367  5.400   19.945  1.00   42.10  ? 939  TYR E CE2 1 
ATOM   6933 C CZ  . TYR E 1 187 ? 28.316  6.002   18.741  1.00   26.85  ? 939  TYR E CZ  1 
ATOM   6934 O OH  . TYR E 1 187 ? 29.309  6.902   18.290  1.00   33.85  ? 939  TYR E OH  1 
ATOM   6935 N N   . ARG E 1 188 ? 27.624  0.649   20.373  1.00   41.67  ? 940  ARG E N   1 
ATOM   6936 C CA  . ARG E 1 188 ? 28.951  0.352   20.832  1.00   45.95  ? 940  ARG E CA  1 
ATOM   6937 C C   . ARG E 1 188 ? 29.782  -0.176  19.676  1.00   38.20  ? 940  ARG E C   1 
ATOM   6938 O O   . ARG E 1 188 ? 30.936  0.065   19.601  1.00   40.53  ? 940  ARG E O   1 
ATOM   6939 C CB  . ARG E 1 188 ? 28.875  -0.653  21.958  1.00   45.69  ? 940  ARG E CB  1 
ATOM   6940 C CG  . ARG E 1 188 ? 30.147  -1.230  22.341  1.00   53.73  ? 940  ARG E CG  1 
ATOM   6941 C CD  . ARG E 1 188 ? 30.713  -0.469  23.449  1.00   64.55  ? 940  ARG E CD  1 
ATOM   6942 N NE  . ARG E 1 188 ? 32.156  -0.448  23.437  1.00   64.16  ? 940  ARG E NE  1 
ATOM   6943 C CZ  . ARG E 1 188 ? 32.907  -1.206  24.220  1.00   78.09  ? 940  ARG E CZ  1 
ATOM   6944 N NH1 . ARG E 1 188 ? 32.340  -2.056  25.057  1.00   76.26  ? 940  ARG E NH1 1 
ATOM   6945 N NH2 . ARG E 1 188 ? 34.220  -1.121  24.163  1.00   67.01  ? 940  ARG E NH2 1 
ATOM   6946 N N   . GLU E 1 189 ? 29.162  -0.913  18.788  1.00   41.79  ? 941  GLU E N   1 
ATOM   6947 C CA  . GLU E 1 189 ? 29.824  -1.394  17.612  1.00   40.29  ? 941  GLU E CA  1 
ATOM   6948 C C   . GLU E 1 189 ? 30.283  -0.233  16.717  1.00   41.77  ? 941  GLU E C   1 
ATOM   6949 O O   . GLU E 1 189 ? 31.331  -0.257  16.163  1.00   39.51  ? 941  GLU E O   1 
ATOM   6950 C CB  . GLU E 1 189 ? 28.917  -2.328  16.834  1.00   37.45  ? 941  GLU E CB  1 
ATOM   6951 C CG  . GLU E 1 189 ? 28.803  -3.725  17.325  1.00   38.05  ? 941  GLU E CG  1 
ATOM   6952 C CD  . GLU E 1 189 ? 27.719  -4.516  16.626  1.00   39.62  ? 941  GLU E CD  1 
ATOM   6953 O OE1 . GLU E 1 189 ? 26.564  -4.232  16.802  1.00   45.68  ? 941  GLU E OE1 1 
ATOM   6954 O OE2 . GLU E 1 189 ? 27.996  -5.442  15.900  1.00   43.07  ? 941  GLU E OE2 1 
ATOM   6955 N N   . ILE E 1 190 ? 29.457  0.771   16.578  1.00   39.07  ? 942  ILE E N   1 
ATOM   6956 C CA  . ILE E 1 190 ? 29.784  1.941   15.825  1.00   37.02  ? 942  ILE E CA  1 
ATOM   6957 C C   . ILE E 1 190 ? 30.989  2.638   16.510  1.00   33.73  ? 942  ILE E C   1 
ATOM   6958 O O   . ILE E 1 190 ? 31.915  3.044   15.821  1.00   41.94  ? 942  ILE E O   1 
ATOM   6959 C CB  . ILE E 1 190 ? 28.608  2.928   15.683  1.00   40.52  ? 942  ILE E CB  1 
ATOM   6960 C CG1 . ILE E 1 190 ? 27.469  2.316   14.889  1.00   40.12  ? 942  ILE E CG1 1 
ATOM   6961 C CG2 . ILE E 1 190 ? 29.165  4.428   15.118  1.00   32.64  ? 942  ILE E CG2 1 
ATOM   6962 C CD1 . ILE E 1 190 ? 26.093  3.218   14.928  1.00   47.73  ? 942  ILE E CD1 1 
ATOM   6963 N N   . PHE E 1 191 ? 30.965  2.788   17.826  1.00   36.18  ? 943  PHE E N   1 
ATOM   6964 C CA  . PHE E 1 191 ? 32.071  3.439   18.608  1.00   33.27  ? 943  PHE E CA  1 
ATOM   6965 C C   . PHE E 1 191 ? 33.385  2.722   18.277  1.00   43.42  ? 943  PHE E C   1 
ATOM   6966 O O   . PHE E 1 191 ? 34.361  3.322   17.858  1.00   45.77  ? 943  PHE E O   1 
ATOM   6967 C CB  . PHE E 1 191 ? 31.790  3.324   20.100  1.00   40.11  ? 943  PHE E CB  1 
ATOM   6968 C CG  . PHE E 1 191 ? 32.689  4.127   20.964  1.00   41.89  ? 943  PHE E CG  1 
ATOM   6969 C CD1 . PHE E 1 191 ? 33.767  3.517   21.636  1.00   46.15  ? 943  PHE E CD1 1 
ATOM   6970 C CD2 . PHE E 1 191 ? 32.527  5.508   21.070  1.00   46.40  ? 943  PHE E CD2 1 
ATOM   6971 C CE1 . PHE E 1 191 ? 34.583  4.271   22.450  1.00   52.82  ? 943  PHE E CE1 1 
ATOM   6972 C CE2 . PHE E 1 191 ? 33.343  6.272   21.916  1.00   50.51  ? 943  PHE E CE2 1 
ATOM   6973 C CZ  . PHE E 1 191 ? 34.369  5.657   22.597  1.00   48.25  ? 943  PHE E CZ  1 
ATOM   6974 N N   . ASP E 1 192 ? 33.391  1.402   18.408  1.00   36.07  ? 944  ASP E N   1 
ATOM   6975 C CA  . ASP E 1 192 ? 34.664  0.701   18.228  1.00   45.40  ? 944  ASP E CA  1 
ATOM   6976 C C   . ASP E 1 192 ? 35.199  0.926   16.791  1.00   46.52  ? 944  ASP E C   1 
ATOM   6977 O O   . ASP E 1 192 ? 36.384  0.964   16.596  1.00   57.32  ? 944  ASP E O   1 
ATOM   6978 C CB  . ASP E 1 192 ? 34.587  -0.795  18.591  1.00   39.46  ? 944  ASP E CB  1 
ATOM   6979 C CG  . ASP E 1 192 ? 34.220  -1.057  20.005  1.00   47.46  ? 944  ASP E CG  1 
ATOM   6980 O OD1 . ASP E 1 192 ? 34.462  -0.193  20.886  1.00   43.58  ? 944  ASP E OD1 1 
ATOM   6981 O OD2 . ASP E 1 192 ? 33.681  -2.181  20.264  1.00   42.37  ? 944  ASP E OD2 1 
ATOM   6982 N N   . ILE E 1 193 ? 34.329  1.151   15.813  1.00   43.55  ? 945  ILE E N   1 
ATOM   6983 C CA  . ILE E 1 193 ? 34.729  1.310   14.460  1.00   48.88  ? 945  ILE E CA  1 
ATOM   6984 C C   . ILE E 1 193 ? 35.267  2.702   14.222  1.00   50.78  ? 945  ILE E C   1 
ATOM   6985 O O   . ILE E 1 193 ? 36.367  2.843   13.676  1.00   42.98  ? 945  ILE E O   1 
ATOM   6986 C CB  . ILE E 1 193 ? 33.554  0.987   13.468  1.00   47.10  ? 945  ILE E CB  1 
ATOM   6987 C CG1 . ILE E 1 193 ? 33.264  -0.510  13.483  1.00   46.60  ? 945  ILE E CG1 1 
ATOM   6988 C CG2 . ILE E 1 193 ? 33.841  1.400   12.057  1.00   38.59  ? 945  ILE E CG2 1 
ATOM   6989 C CD1 . ILE E 1 193 ? 32.146  -0.905  12.561  1.00   34.38  ? 945  ILE E CD1 1 
ATOM   6990 N N   . ALA E 1 194 ? 34.514  3.692   14.684  1.00   48.73  ? 946  ALA E N   1 
ATOM   6991 C CA  . ALA E 1 194 ? 34.819  5.112   14.501  1.00   47.38  ? 946  ALA E CA  1 
ATOM   6992 C C   . ALA E 1 194 ? 35.966  5.654   15.320  1.00   50.34  ? 946  ALA E C   1 
ATOM   6993 O O   . ALA E 1 194 ? 36.465  6.710   14.963  1.00   42.22  ? 946  ALA E O   1 
ATOM   6994 C CB  . ALA E 1 194 ? 33.591  5.951   14.846  1.00   54.07  ? 946  ALA E CB  1 
ATOM   6995 N N   . PHE E 1 195 ? 36.235  5.036   16.478  1.00   45.68  ? 947  PHE E N   1 
ATOM   6996 C CA  . PHE E 1 195 ? 37.334  5.343   17.338  1.00   47.99  ? 947  PHE E CA  1 
ATOM   6997 C C   . PHE E 1 195 ? 38.139  4.067   17.651  1.00   46.86  ? 947  PHE E C   1 
ATOM   6998 O O   . PHE E 1 195 ? 38.061  3.516   18.758  1.00   55.35  ? 947  PHE E O   1 
ATOM   6999 C CB  . PHE E 1 195 ? 36.807  5.965   18.632  1.00   52.67  ? 947  PHE E CB  1 
ATOM   7000 C CG  . PHE E 1 195 ? 35.882  7.142   18.408  1.00   52.02  ? 947  PHE E CG  1 
ATOM   7001 C CD1 . PHE E 1 195 ? 36.326  8.271   17.760  1.00   53.60  ? 947  PHE E CD1 1 
ATOM   7002 C CD2 . PHE E 1 195 ? 34.572  7.105   18.853  1.00   47.78  ? 947  PHE E CD2 1 
ATOM   7003 C CE1 . PHE E 1 195 ? 35.477  9.348   17.541  1.00   45.06  ? 947  PHE E CE1 1 
ATOM   7004 C CE2 . PHE E 1 195 ? 33.719  8.185   18.619  1.00   63.29  ? 947  PHE E CE2 1 
ATOM   7005 C CZ  . PHE E 1 195 ? 34.190  9.309   17.964  1.00   40.28  ? 947  PHE E CZ  1 
ATOM   7006 N N   . PRO E 1 196 ? 38.903  3.566   16.674  1.00   50.30  ? 948  PRO E N   1 
ATOM   7007 C CA  . PRO E 1 196 ? 39.684  2.333   16.924  1.00   48.72  ? 948  PRO E CA  1 
ATOM   7008 C C   . PRO E 1 196 ? 40.766  2.457   18.030  1.00   53.52  ? 948  PRO E C   1 
ATOM   7009 O O   . PRO E 1 196 ? 41.984  2.547   17.745  1.00   57.41  ? 948  PRO E O   1 
ATOM   7010 C CB  . PRO E 1 196 ? 40.248  1.977   15.535  1.00   56.63  ? 948  PRO E CB  1 
ATOM   7011 C CG  . PRO E 1 196 ? 40.139  3.272   14.696  1.00   57.97  ? 948  PRO E CG  1 
ATOM   7012 C CD  . PRO E 1 196 ? 39.140  4.171   15.363  1.00   45.98  ? 948  PRO E CD  1 
ATOM   7013 N N   . VAL F 1 7   ? -4.423  -40.223 4.019   1.00   81.47  ? 759  VAL F N   1 
ATOM   7014 C CA  . VAL F 1 7   ? -4.630  -39.690 5.410   1.00   84.01  ? 759  VAL F CA  1 
ATOM   7015 C C   . VAL F 1 7   ? -3.442  -40.068 6.302   1.00   84.61  ? 759  VAL F C   1 
ATOM   7016 O O   . VAL F 1 7   ? -2.516  -40.759 5.859   1.00   87.53  ? 759  VAL F O   1 
ATOM   7017 C CB  . VAL F 1 7   ? -5.964  -40.187 6.040   1.00   83.24  ? 759  VAL F CB  1 
ATOM   7018 C CG1 . VAL F 1 7   ? -7.127  -39.238 5.674   1.00   83.04  ? 759  VAL F CG1 1 
ATOM   7019 C CG2 . VAL F 1 7   ? -6.249  -41.645 5.635   1.00   84.85  ? 759  VAL F CG2 1 
ATOM   7020 N N   . THR F 1 8   ? -3.466  -39.595 7.549   1.00   81.84  ? 760  THR F N   1 
ATOM   7021 C CA  . THR F 1 8   ? -2.392  -39.837 8.514   1.00   79.97  ? 760  THR F CA  1 
ATOM   7022 C C   . THR F 1 8   ? -3.023  -40.354 9.834   1.00   77.20  ? 760  THR F C   1 
ATOM   7023 O O   . THR F 1 8   ? -3.806  -39.615 10.455  1.00   77.23  ? 760  THR F O   1 
ATOM   7024 C CB  . THR F 1 8   ? -1.509  -38.523 8.756   1.00   78.16  ? 760  THR F CB  1 
ATOM   7025 O OG1 . THR F 1 8   ? -2.173  -37.604 9.648   1.00   80.90  ? 760  THR F OG1 1 
ATOM   7026 C CG2 . THR F 1 8   ? -1.188  -37.795 7.440   1.00   74.21  ? 760  THR F CG2 1 
ATOM   7027 N N   . PRO F 1 9   ? -2.743  -41.627 10.240  1.00   70.11  ? 761  PRO F N   1 
ATOM   7028 C CA  . PRO F 1 9   ? -3.164  -42.039 11.605  1.00   67.86  ? 761  PRO F CA  1 
ATOM   7029 C C   . PRO F 1 9   ? -2.249  -41.419 12.698  1.00   67.53  ? 761  PRO F C   1 
ATOM   7030 O O   . PRO F 1 9   ? -1.259  -40.767 12.363  1.00   68.27  ? 761  PRO F O   1 
ATOM   7031 C CB  . PRO F 1 9   ? -3.044  -43.579 11.564  1.00   65.80  ? 761  PRO F CB  1 
ATOM   7032 C CG  . PRO F 1 9   ? -2.110  -43.858 10.461  1.00   66.83  ? 761  PRO F CG  1 
ATOM   7033 C CD  . PRO F 1 9   ? -2.325  -42.791 9.435   1.00   66.18  ? 761  PRO F CD  1 
ATOM   7034 N N   . PRO F 1 10  ? -2.563  -41.625 14.001  1.00   66.24  ? 762  PRO F N   1 
ATOM   7035 C CA  . PRO F 1 10  ? -1.667  -41.111 15.040  1.00   62.95  ? 762  PRO F CA  1 
ATOM   7036 C C   . PRO F 1 10  ? -0.245  -41.611 14.885  1.00   58.75  ? 762  PRO F C   1 
ATOM   7037 O O   . PRO F 1 10  ? -0.021  -42.798 14.752  1.00   61.75  ? 762  PRO F O   1 
ATOM   7038 C CB  . PRO F 1 10  ? -2.240  -41.678 16.338  1.00   62.13  ? 762  PRO F CB  1 
ATOM   7039 C CG  . PRO F 1 10  ? -3.694  -41.986 16.008  1.00   63.59  ? 762  PRO F CG  1 
ATOM   7040 C CD  . PRO F 1 10  ? -3.662  -42.429 14.574  1.00   67.79  ? 762  PRO F CD  1 
ATOM   7041 N N   . GLY F 1 11  ? 0.706   -40.688 14.887  1.00   55.73  ? 763  GLY F N   1 
ATOM   7042 C CA  . GLY F 1 11  ? 2.121   -41.037 14.876  1.00   52.38  ? 763  GLY F CA  1 
ATOM   7043 C C   . GLY F 1 11  ? 2.779   -41.063 13.536  1.00   45.29  ? 763  GLY F C   1 
ATOM   7044 O O   . GLY F 1 11  ? 3.892   -41.628 13.360  1.00   45.27  ? 763  GLY F O   1 
ATOM   7045 N N   . VAL F 1 12  ? 2.096   -40.539 12.545  1.00   43.35  ? 764  VAL F N   1 
ATOM   7046 C CA  . VAL F 1 12  ? 2.649   -40.626 11.193  1.00   44.54  ? 764  VAL F CA  1 
ATOM   7047 C C   . VAL F 1 12  ? 2.708   -39.220 10.595  1.00   47.74  ? 764  VAL F C   1 
ATOM   7048 O O   . VAL F 1 12  ? 1.674   -38.553 10.440  1.00   48.94  ? 764  VAL F O   1 
ATOM   7049 C CB  . VAL F 1 12  ? 1.825   -41.574 10.303  1.00   47.97  ? 764  VAL F CB  1 
ATOM   7050 C CG1 . VAL F 1 12  ? 2.447   -41.681 8.976   1.00   47.12  ? 764  VAL F CG1 1 
ATOM   7051 C CG2 . VAL F 1 12  ? 1.741   -42.978 10.960  1.00   50.33  ? 764  VAL F CG2 1 
ATOM   7052 N N   . VAL F 1 13  ? 3.916   -38.767 10.234  1.00   52.35  ? 765  VAL F N   1 
ATOM   7053 C CA  . VAL F 1 13  ? 4.101   -37.368 9.749   1.00   49.68  ? 765  VAL F CA  1 
ATOM   7054 C C   . VAL F 1 13  ? 4.907   -37.322 8.479   1.00   51.56  ? 765  VAL F C   1 
ATOM   7055 O O   . VAL F 1 13  ? 5.880   -38.074 8.276   1.00   47.57  ? 765  VAL F O   1 
ATOM   7056 C CB  . VAL F 1 13  ? 4.771   -36.397 10.830  1.00   48.22  ? 765  VAL F CB  1 
ATOM   7057 C CG1 . VAL F 1 13  ? 4.405   -34.882 10.547  1.00   41.59  ? 765  VAL F CG1 1 
ATOM   7058 C CG2 . VAL F 1 13  ? 4.352   -36.760 12.221  1.00   50.55  ? 765  VAL F CG2 1 
ATOM   7059 N N   . MET F 1 14  ? 4.492   -36.426 7.589   1.00   53.19  ? 766  MET F N   1 
ATOM   7060 C CA  . MET F 1 14  ? 5.190   -36.218 6.304   1.00   57.19  ? 766  MET F CA  1 
ATOM   7061 C C   . MET F 1 14  ? 6.435   -35.288 6.412   1.00   58.22  ? 766  MET F C   1 
ATOM   7062 O O   . MET F 1 14  ? 6.315   -34.043 6.512   1.00   48.92  ? 766  MET F O   1 
ATOM   7063 C CB  . MET F 1 14  ? 4.244   -35.604 5.321   1.00   56.22  ? 766  MET F CB  1 
ATOM   7064 C CG  . MET F 1 14  ? 4.660   -35.771 3.907   1.00   64.74  ? 766  MET F CG  1 
ATOM   7065 S SD  . MET F 1 14  ? 3.356   -35.208 2.834   1.00   69.73  ? 766  MET F SD  1 
ATOM   7066 C CE  . MET F 1 14  ? 3.426   -36.543 1.617   1.00   78.94  ? 766  MET F CE  1 
ATOM   7067 N N   . GLY F 1 15  ? 7.608   -35.906 6.304   1.00   56.86  ? 767  GLY F N   1 
ATOM   7068 C CA  . GLY F 1 15  ? 8.862   -35.187 6.217   1.00   56.61  ? 767  GLY F CA  1 
ATOM   7069 C C   . GLY F 1 15  ? 9.337   -34.969 4.790   1.00   54.91  ? 767  GLY F C   1 
ATOM   7070 O O   . GLY F 1 15  ? 8.919   -35.637 3.840   1.00   55.92  ? 767  GLY F O   1 
ATOM   7071 N N   . LEU F 1 16  ? 10.196  -33.978 4.643   1.00   49.58  ? 768  LEU F N   1 
ATOM   7072 C CA  . LEU F 1 16  ? 10.681  -33.563 3.362   1.00   52.92  ? 768  LEU F CA  1 
ATOM   7073 C C   . LEU F 1 16  ? 12.172  -33.836 3.497   1.00   54.20  ? 768  LEU F C   1 
ATOM   7074 O O   . LEU F 1 16  ? 12.835  -33.257 4.365   1.00   54.42  ? 768  LEU F O   1 
ATOM   7075 C CB  . LEU F 1 16  ? 10.395  -32.070 3.129   1.00   45.69  ? 768  LEU F CB  1 
ATOM   7076 C CG  . LEU F 1 16  ? 9.187   -31.494 2.415   1.00   49.04  ? 768  LEU F CG  1 
ATOM   7077 C CD1 . LEU F 1 16  ? 8.282   -32.562 1.728   1.00   41.32  ? 768  LEU F CD1 1 
ATOM   7078 C CD2 . LEU F 1 16  ? 8.447   -30.548 3.344   1.00   27.26  ? 768  LEU F CD2 1 
ATOM   7079 N N   . ALA F 1 17  ? 12.687  -34.761 2.695   1.00   54.77  ? 769  ALA F N   1 
ATOM   7080 C CA  . ALA F 1 17  ? 14.093  -35.193 2.807   1.00   53.49  ? 769  ALA F CA  1 
ATOM   7081 C C   . ALA F 1 17  ? 14.771  -34.642 1.613   1.00   57.55  ? 769  ALA F C   1 
ATOM   7082 O O   . ALA F 1 17  ? 14.147  -34.589 0.560   1.00   56.77  ? 769  ALA F O   1 
ATOM   7083 C CB  . ALA F 1 17  ? 14.241  -36.722 2.817   1.00   51.85  ? 769  ALA F CB  1 
ATOM   7084 N N   . TRP F 1 18  ? 16.034  -34.203 1.784   1.00   57.31  ? 770  TRP F N   1 
ATOM   7085 C CA  . TRP F 1 18  ? 16.874  -33.759 0.681   1.00   58.04  ? 770  TRP F CA  1 
ATOM   7086 C C   . TRP F 1 18  ? 17.762  -34.941 0.300   1.00   62.05  ? 770  TRP F C   1 
ATOM   7087 O O   . TRP F 1 18  ? 18.652  -35.283 1.067   1.00   59.32  ? 770  TRP F O   1 
ATOM   7088 C CB  . TRP F 1 18  ? 17.700  -32.549 1.105   1.00   60.45  ? 770  TRP F CB  1 
ATOM   7089 C CG  . TRP F 1 18  ? 18.751  -32.070 0.145   1.00   56.57  ? 770  TRP F CG  1 
ATOM   7090 C CD1 . TRP F 1 18  ? 18.758  -32.205 -1.207  1.00   62.17  ? 770  TRP F CD1 1 
ATOM   7091 C CD2 . TRP F 1 18  ? 19.934  -31.328 0.485   1.00   57.90  ? 770  TRP F CD2 1 
ATOM   7092 N NE1 . TRP F 1 18  ? 19.891  -31.614 -1.741  1.00   63.67  ? 770  TRP F NE1 1 
ATOM   7093 C CE2 . TRP F 1 18  ? 20.617  -31.052 -0.722  1.00   60.00  ? 770  TRP F CE2 1 
ATOM   7094 C CE3 . TRP F 1 18  ? 20.484  -30.867 1.704   1.00   58.26  ? 770  TRP F CE3 1 
ATOM   7095 C CZ2 . TRP F 1 18  ? 21.825  -30.334 -0.757  1.00   58.66  ? 770  TRP F CZ2 1 
ATOM   7096 C CZ3 . TRP F 1 18  ? 21.661  -30.142 1.671   1.00   48.07  ? 770  TRP F CZ3 1 
ATOM   7097 C CH2 . TRP F 1 18  ? 22.333  -29.902 0.441   1.00   64.14  ? 770  TRP F CH2 1 
ATOM   7098 N N   . THR F 1 19  ? 17.491  -35.559 -0.864  1.00   65.09  ? 771  THR F N   1 
ATOM   7099 C CA  . THR F 1 19  ? 18.186  -36.777 -1.348  1.00   66.09  ? 771  THR F CA  1 
ATOM   7100 C C   . THR F 1 19  ? 19.327  -36.445 -2.361  1.00   69.83  ? 771  THR F C   1 
ATOM   7101 O O   . THR F 1 19  ? 19.618  -35.259 -2.635  1.00   64.92  ? 771  THR F O   1 
ATOM   7102 C CB  . THR F 1 19  ? 17.196  -37.743 -2.056  1.00   67.01  ? 771  THR F CB  1 
ATOM   7103 O OG1 . THR F 1 19  ? 16.650  -37.072 -3.191  1.00   56.47  ? 771  THR F OG1 1 
ATOM   7104 C CG2 . THR F 1 19  ? 16.073  -38.178 -1.138  1.00   63.13  ? 771  THR F CG2 1 
ATOM   7105 N N   . ALA F 1 20  ? 19.946  -37.493 -2.927  1.00   69.77  ? 772  ALA F N   1 
ATOM   7106 C CA  . ALA F 1 20  ? 21.252  -37.385 -3.635  1.00   70.19  ? 772  ALA F CA  1 
ATOM   7107 C C   . ALA F 1 20  ? 21.170  -36.788 -5.038  1.00   73.79  ? 772  ALA F C   1 
ATOM   7108 O O   . ALA F 1 20  ? 22.201  -36.353 -5.608  1.00   72.34  ? 772  ALA F O   1 
ATOM   7109 C CB  . ALA F 1 20  ? 21.924  -38.775 -3.722  1.00   61.70  ? 772  ALA F CB  1 
ATOM   7110 N N   . MET F 1 21  ? 19.955  -36.756 -5.562  1.00   77.88  ? 773  MET F N   1 
ATOM   7111 C CA  . MET F 1 21  ? 19.692  -36.224 -6.873  1.00   80.72  ? 773  MET F CA  1 
ATOM   7112 C C   . MET F 1 21  ? 18.441  -35.424 -6.830  1.00   79.67  ? 773  MET F C   1 
ATOM   7113 O O   . MET F 1 21  ? 17.784  -35.247 -7.830  1.00   76.91  ? 773  MET F O   1 
ATOM   7114 C CB  . MET F 1 21  ? 19.442  -37.354 -7.817  1.00   84.46  ? 773  MET F CB  1 
ATOM   7115 C CG  . MET F 1 21  ? 18.257  -38.159 -7.388  1.00   90.90  ? 773  MET F CG  1 
ATOM   7116 S SD  . MET F 1 21  ? 18.217  -38.256 -5.625  0.0000 105.25 ? 773  MET F SD  1 
ATOM   7117 C CE  . MET F 1 21  ? 17.871  -39.991 -5.358  0.0000 100.06 ? 773  MET F CE  1 
ATOM   7118 N N   . GLY F 1 22  ? 18.091  -34.951 -5.658  1.00   76.67  ? 774  GLY F N   1 
ATOM   7119 C CA  . GLY F 1 22  ? 16.920  -34.127 -5.537  1.00   76.55  ? 774  GLY F CA  1 
ATOM   7120 C C   . GLY F 1 22  ? 16.366  -34.232 -4.154  1.00   74.26  ? 774  GLY F C   1 
ATOM   7121 O O   . GLY F 1 22  ? 17.081  -34.029 -3.206  1.00   73.98  ? 774  GLY F O   1 
ATOM   7122 N N   . GLY F 1 23  ? 15.095  -34.571 -4.051  1.00   63.51  ? 775  GLY F N   1 
ATOM   7123 C CA  . GLY F 1 23  ? 14.436  -34.559 -2.786  1.00   60.98  ? 775  GLY F CA  1 
ATOM   7124 C C   . GLY F 1 23  ? 13.199  -35.383 -2.818  1.00   56.38  ? 775  GLY F C   1 
ATOM   7125 O O   . GLY F 1 23  ? 12.694  -35.674 -3.862  1.00   55.27  ? 775  GLY F O   1 
ATOM   7126 N N   . SER F 1 24  ? 12.725  -35.732 -1.644  1.00   57.78  ? 776  SER F N   1 
ATOM   7127 C CA  . SER F 1 24  ? 11.699  -36.754 -1.457  1.00   59.33  ? 776  SER F CA  1 
ATOM   7128 C C   . SER F 1 24  ? 10.754  -36.483 -0.311  1.00   61.46  ? 776  SER F C   1 
ATOM   7129 O O   . SER F 1 24  ? 11.031  -35.677 0.578   1.00   62.88  ? 776  SER F O   1 
ATOM   7130 C CB  . SER F 1 24  ? 12.377  -38.106 -1.226  1.00   60.31  ? 776  SER F CB  1 
ATOM   7131 O OG  . SER F 1 24  ? 12.824  -38.647 -2.455  1.00   53.18  ? 776  SER F OG  1 
ATOM   7132 N N   . THR F 1 25  ? 9.649   -37.204 -0.316  1.00   65.21  ? 777  THR F N   1 
ATOM   7133 C CA  . THR F 1 25  ? 8.554   -36.958 0.607   1.00   69.18  ? 777  THR F CA  1 
ATOM   7134 C C   . THR F 1 25  ? 8.220   -38.221 1.364   1.00   73.64  ? 777  THR F C   1 
ATOM   7135 O O   . THR F 1 25  ? 7.389   -39.041 0.924   1.00   78.79  ? 777  THR F O   1 
ATOM   7136 C CB  . THR F 1 25  ? 7.305   -36.519 -0.115  1.00   69.09  ? 777  THR F CB  1 
ATOM   7137 O OG1 . THR F 1 25  ? 7.637   -35.474 -1.034  1.00   81.77  ? 777  THR F OG1 1 
ATOM   7138 C CG2 . THR F 1 25  ? 6.239   -36.035 0.910   1.00   63.31  ? 777  THR F CG2 1 
ATOM   7139 N N   . LEU F 1 26  ? 8.848   -38.342 2.528   1.00   74.77  ? 778  LEU F N   1 
ATOM   7140 C CA  . LEU F 1 26  ? 8.906   -39.592 3.248   1.00   69.52  ? 778  LEU F CA  1 
ATOM   7141 C C   . LEU F 1 26  ? 8.034   -39.550 4.486   1.00   68.64  ? 778  LEU F C   1 
ATOM   7142 O O   . LEU F 1 26  ? 7.809   -38.499 5.100   1.00   66.70  ? 778  LEU F O   1 
ATOM   7143 C CB  . LEU F 1 26  ? 10.372  -39.946 3.585   1.00   70.40  ? 778  LEU F CB  1 
ATOM   7144 C CG  . LEU F 1 26  ? 11.269  -39.059 4.466   1.00   66.55  ? 778  LEU F CG  1 
ATOM   7145 C CD1 . LEU F 1 26  ? 10.786  -38.953 5.919   1.00   61.21  ? 778  LEU F CD1 1 
ATOM   7146 C CD2 . LEU F 1 26  ? 12.654  -39.620 4.445   1.00   65.81  ? 778  LEU F CD2 1 
ATOM   7147 N N   . PHE F 1 27  ? 7.509   -40.700 4.850   1.00   63.97  ? 779  PHE F N   1 
ATOM   7148 C CA  . PHE F 1 27  ? 6.681   -40.759 6.036   1.00   64.03  ? 779  PHE F CA  1 
ATOM   7149 C C   . PHE F 1 27  ? 7.471   -41.198 7.241   1.00   62.11  ? 779  PHE F C   1 
ATOM   7150 O O   . PHE F 1 27  ? 8.131   -42.255 7.245   1.00   54.30  ? 779  PHE F O   1 
ATOM   7151 C CB  . PHE F 1 27  ? 5.490   -41.673 5.826   1.00   64.53  ? 779  PHE F CB  1 
ATOM   7152 C CG  . PHE F 1 27  ? 4.403   -41.053 5.018   1.00   62.97  ? 779  PHE F CG  1 
ATOM   7153 C CD1 . PHE F 1 27  ? 3.535   -40.164 5.607   1.00   68.41  ? 779  PHE F CD1 1 
ATOM   7154 C CD2 . PHE F 1 27  ? 4.251   -41.355 3.674   1.00   70.82  ? 779  PHE F CD2 1 
ATOM   7155 C CE1 . PHE F 1 27  ? 2.525   -39.600 4.896   1.00   67.72  ? 779  PHE F CE1 1 
ATOM   7156 C CE2 . PHE F 1 27  ? 3.243   -40.771 2.936   1.00   68.12  ? 779  PHE F CE2 1 
ATOM   7157 C CZ  . PHE F 1 27  ? 2.384   -39.888 3.545   1.00   68.43  ? 779  PHE F CZ  1 
ATOM   7158 N N   . VAL F 1 28  ? 7.393   -40.381 8.282   1.00   52.96  ? 780  VAL F N   1 
ATOM   7159 C CA  . VAL F 1 28  ? 8.007   -40.754 9.519   1.00   47.83  ? 780  VAL F CA  1 
ATOM   7160 C C   . VAL F 1 28  ? 6.975   -41.413 10.388  1.00   46.37  ? 780  VAL F C   1 
ATOM   7161 O O   . VAL F 1 28  ? 5.914   -40.882 10.558  1.00   46.12  ? 780  VAL F O   1 
ATOM   7162 C CB  . VAL F 1 28  ? 8.664   -39.504 10.174  1.00   45.96  ? 780  VAL F CB  1 
ATOM   7163 C CG1 . VAL F 1 28  ? 8.980   -39.749 11.581  1.00   36.81  ? 780  VAL F CG1 1 
ATOM   7164 C CG2 . VAL F 1 28  ? 9.943   -39.224 9.422   1.00   35.65  ? 780  VAL F CG2 1 
ATOM   7165 N N   . GLU F 1 29  ? 7.303   -42.562 10.971  1.00   50.05  ? 781  GLU F N   1 
ATOM   7166 C CA  . GLU F 1 29  ? 6.294   -43.422 11.544  1.00   54.28  ? 781  GLU F CA  1 
ATOM   7167 C C   . GLU F 1 29  ? 6.661   -43.911 12.954  1.00   52.77  ? 781  GLU F C   1 
ATOM   7168 O O   . GLU F 1 29  ? 7.802   -44.277 13.231  1.00   60.99  ? 781  GLU F O   1 
ATOM   7169 C CB  . GLU F 1 29  ? 6.057   -44.603 10.568  1.00   56.02  ? 781  GLU F CB  1 
ATOM   7170 C CG  . GLU F 1 29  ? 5.221   -44.223 9.327   1.00   58.18  ? 781  GLU F CG  1 
ATOM   7171 C CD  . GLU F 1 29  ? 4.561   -45.463 8.603   1.00   61.90  ? 781  GLU F CD  1 
ATOM   7172 O OE1 . GLU F 1 29  ? 3.959   -45.276 7.503   1.00   55.01  ? 781  GLU F OE1 1 
ATOM   7173 O OE2 . GLU F 1 29  ? 4.678   -46.612 9.112   1.00   66.96  ? 781  GLU F OE2 1 
ATOM   7174 N N   . THR F 1 30  ? 5.708   -43.890 13.880  1.00   58.92  ? 782  THR F N   1 
ATOM   7175 C CA  . THR F 1 30  ? 5.959   -44.428 15.207  1.00   54.29  ? 782  THR F CA  1 
ATOM   7176 C C   . THR F 1 30  ? 4.793   -45.280 15.696  1.00   57.49  ? 782  THR F C   1 
ATOM   7177 O O   . THR F 1 30  ? 3.628   -44.918 15.558  1.00   57.52  ? 782  THR F O   1 
ATOM   7178 C CB  . THR F 1 30  ? 6.288   -43.314 16.286  1.00   57.45  ? 782  THR F CB  1 
ATOM   7179 O OG1 . THR F 1 30  ? 5.181   -42.402 16.397  1.00   49.40  ? 782  THR F OG1 1 
ATOM   7180 C CG2 . THR F 1 30  ? 7.564   -42.544 15.953  1.00   49.63  ? 782  THR F CG2 1 
ATOM   7181 N N   . SER F 1 31  ? 5.093   -46.422 16.282  1.00   61.28  ? 783  SER F N   1 
ATOM   7182 C CA  . SER F 1 31  ? 4.022   -47.242 16.881  1.00   65.13  ? 783  SER F CA  1 
ATOM   7183 C C   . SER F 1 31  ? 4.469   -47.631 18.253  1.00   66.44  ? 783  SER F C   1 
ATOM   7184 O O   . SER F 1 31  ? 5.668   -47.533 18.548  1.00   65.36  ? 783  SER F O   1 
ATOM   7185 C CB  . SER F 1 31  ? 3.759   -48.473 16.027  1.00   66.87  ? 783  SER F CB  1 
ATOM   7186 O OG  . SER F 1 31  ? 4.992   -48.950 15.502  1.00   68.49  ? 783  SER F OG  1 
ATOM   7187 N N   . LEU F 1 32  ? 3.516   -48.049 19.087  1.00   67.67  ? 784  LEU F N   1 
ATOM   7188 C CA  . LEU F 1 32  ? 3.813   -48.542 20.428  1.00   71.86  ? 784  LEU F CA  1 
ATOM   7189 C C   . LEU F 1 32  ? 4.436   -49.913 20.264  1.00   73.35  ? 784  LEU F C   1 
ATOM   7190 O O   . LEU F 1 32  ? 4.158   -50.596 19.275  1.00   79.20  ? 784  LEU F O   1 
ATOM   7191 C CB  . LEU F 1 32  ? 2.536   -48.618 21.305  1.00   72.59  ? 784  LEU F CB  1 
ATOM   7192 C CG  . LEU F 1 32  ? 2.605   -49.164 22.759  1.00   72.52  ? 784  LEU F CG  1 
ATOM   7193 C CD1 . LEU F 1 32  ? 3.752   -48.550 23.530  1.00   65.35  ? 784  LEU F CD1 1 
ATOM   7194 C CD2 . LEU F 1 32  ? 1.263   -48.999 23.589  1.00   59.13  ? 784  LEU F CD2 1 
ATOM   7195 N N   . ARG F 1 33  ? 5.292   -50.295 21.210  1.00   74.32  ? 785  ARG F N   1 
ATOM   7196 C CA  . ARG F 1 33  ? 5.912   -51.621 21.230  1.00   74.15  ? 785  ARG F CA  1 
ATOM   7197 C C   . ARG F 1 33  ? 6.524   -51.926 22.606  1.00   74.60  ? 785  ARG F C   1 
ATOM   7198 O O   . ARG F 1 33  ? 6.009   -52.735 23.397  1.00   72.28  ? 785  ARG F O   1 
ATOM   7199 C CB  . ARG F 1 33  ? 6.985   -51.678 20.152  1.00   75.03  ? 785  ARG F CB  1 
ATOM   7200 C CG  . ARG F 1 33  ? 7.654   -53.018 20.002  1.00   77.22  ? 785  ARG F CG  1 
ATOM   7201 C CD  . ARG F 1 33  ? 8.892   -52.883 19.092  1.00   78.72  ? 785  ARG F CD  1 
ATOM   7202 N NE  . ARG F 1 33  ? 10.026  -52.284 19.797  1.00   65.38  ? 785  ARG F NE  1 
ATOM   7203 C CZ  . ARG F 1 33  ? 10.739  -52.885 20.745  1.00   73.56  ? 785  ARG F CZ  1 
ATOM   7204 N NH1 . ARG F 1 33  ? 10.451  -54.123 21.144  1.00   65.67  ? 785  ARG F NH1 1 
ATOM   7205 N NH2 . ARG F 1 33  ? 11.755  -52.239 21.308  1.00   76.17  ? 785  ARG F NH2 1 
ATOM   7206 N N   . ASP F 1 45  ? 9.683   -46.905 33.700  1.00   63.32  ? 797  ASP F N   1 
ATOM   7207 C CA  . ASP F 1 45  ? 10.439  -46.409 32.546  1.00   67.43  ? 797  ASP F CA  1 
ATOM   7208 C C   . ASP F 1 45  ? 9.949   -46.939 31.193  1.00   71.04  ? 797  ASP F C   1 
ATOM   7209 O O   . ASP F 1 45  ? 9.127   -47.861 31.181  1.00   72.53  ? 797  ASP F O   1 
ATOM   7210 C CB  . ASP F 1 45  ? 11.900  -46.771 32.719  1.00   68.97  ? 797  ASP F CB  1 
ATOM   7211 C CG  . ASP F 1 45  ? 12.475  -46.241 34.005  1.00   72.84  ? 797  ASP F CG  1 
ATOM   7212 O OD1 . ASP F 1 45  ? 11.705  -45.629 34.810  1.00   63.01  ? 797  ASP F OD1 1 
ATOM   7213 O OD2 . ASP F 1 45  ? 13.700  -46.446 34.204  1.00   75.76  ? 797  ASP F OD2 1 
ATOM   7214 N N   . GLY F 1 46  ? 10.446  -46.343 30.083  1.00   68.64  ? 798  GLY F N   1 
ATOM   7215 C CA  . GLY F 1 46  ? 10.137  -46.770 28.676  1.00   64.21  ? 798  GLY F CA  1 
ATOM   7216 C C   . GLY F 1 46  ? 11.335  -46.604 27.753  1.00   63.85  ? 798  GLY F C   1 
ATOM   7217 O O   . GLY F 1 46  ? 12.405  -46.301 28.276  1.00   67.45  ? 798  GLY F O   1 
ATOM   7218 N N   . SER F 1 47  ? 11.183  -46.760 26.410  1.00   58.86  ? 799  SER F N   1 
ATOM   7219 C CA  . SER F 1 47  ? 12.335  -46.615 25.466  1.00   54.11  ? 799  SER F CA  1 
ATOM   7220 C C   . SER F 1 47  ? 12.084  -46.261 24.025  1.00   52.76  ? 799  SER F C   1 
ATOM   7221 O O   . SER F 1 47  ? 11.022  -46.474 23.494  1.00   56.56  ? 799  SER F O   1 
ATOM   7222 C CB  . SER F 1 47  ? 13.106  -47.944 25.431  1.00   59.53  ? 799  SER F CB  1 
ATOM   7223 O OG  . SER F 1 47  ? 12.216  -49.022 25.118  1.00   47.24  ? 799  SER F OG  1 
ATOM   7224 N N   . LEU F 1 48  ? 13.115  -45.774 23.341  1.00   57.90  ? 800  LEU F N   1 
ATOM   7225 C CA  . LEU F 1 48  ? 13.044  -45.612 21.882  1.00   58.99  ? 800  LEU F CA  1 
ATOM   7226 C C   . LEU F 1 48  ? 13.946  -46.571 21.154  1.00   56.69  ? 800  LEU F C   1 
ATOM   7227 O O   . LEU F 1 48  ? 14.988  -46.987 21.671  1.00   63.16  ? 800  LEU F O   1 
ATOM   7228 C CB  . LEU F 1 48  ? 13.380  -44.183 21.411  1.00   57.14  ? 800  LEU F CB  1 
ATOM   7229 C CG  . LEU F 1 48  ? 13.006  -43.872 19.966  1.00   58.64  ? 800  LEU F CG  1 
ATOM   7230 C CD1 . LEU F 1 48  ? 11.521  -43.784 19.807  1.00   50.88  ? 800  LEU F CD1 1 
ATOM   7231 C CD2 . LEU F 1 48  ? 13.662  -42.604 19.543  1.00   53.66  ? 800  LEU F CD2 1 
ATOM   7232 N N   . GLU F 1 49  ? 13.538  -46.936 19.943  1.00   57.65  ? 801  GLU F N   1 
ATOM   7233 C CA  . GLU F 1 49  ? 14.392  -47.787 19.096  1.00   60.13  ? 801  GLU F CA  1 
ATOM   7234 C C   . GLU F 1 49  ? 14.138  -47.412 17.649  1.00   51.92  ? 801  GLU F C   1 
ATOM   7235 O O   . GLU F 1 49  ? 12.985  -47.395 17.185  1.00   53.78  ? 801  GLU F O   1 
ATOM   7236 C CB  . GLU F 1 49  ? 14.068  -49.276 19.338  1.00   59.23  ? 801  GLU F CB  1 
ATOM   7237 C CG  . GLU F 1 49  ? 15.265  -50.211 19.468  1.00   70.07  ? 801  GLU F CG  1 
ATOM   7238 C CD  . GLU F 1 49  ? 15.880  -50.290 20.890  1.00   74.55  ? 801  GLU F CD  1 
ATOM   7239 O OE1 . GLU F 1 49  ? 15.284  -49.775 21.860  1.00   84.88  ? 801  GLU F OE1 1 
ATOM   7240 O OE2 . GLU F 1 49  ? 16.983  -50.870 21.039  1.00   79.11  ? 801  GLU F OE2 1 
ATOM   7241 N N   . VAL F 1 50  ? 15.199  -47.120 16.919  1.00   57.66  ? 802  VAL F N   1 
ATOM   7242 C CA  . VAL F 1 50  ? 15.024  -46.522 15.596  1.00   58.02  ? 802  VAL F CA  1 
ATOM   7243 C C   . VAL F 1 50  ? 15.547  -47.360 14.420  1.00   56.20  ? 802  VAL F C   1 
ATOM   7244 O O   . VAL F 1 50  ? 16.684  -47.780 14.423  1.00   56.87  ? 802  VAL F O   1 
ATOM   7245 C CB  . VAL F 1 50  ? 15.691  -45.168 15.515  1.00   56.28  ? 802  VAL F CB  1 
ATOM   7246 C CG1 . VAL F 1 50  ? 15.292  -44.525 14.175  1.00   52.52  ? 802  VAL F CG1 1 
ATOM   7247 C CG2 . VAL F 1 50  ? 15.259  -44.286 16.662  1.00   62.25  ? 802  VAL F CG2 1 
ATOM   7248 N N   . THR F 1 51  ? 14.720  -47.549 13.401  1.00   68.35  ? 803  THR F N   1 
ATOM   7249 C CA  . THR F 1 51  ? 15.142  -48.240 12.164  1.00   69.90  ? 803  THR F CA  1 
ATOM   7250 C C   . THR F 1 51  ? 15.284  -47.219 11.028  1.00   73.35  ? 803  THR F C   1 
ATOM   7251 O O   . THR F 1 51  ? 14.901  -46.051 11.177  1.00   72.42  ? 803  THR F O   1 
ATOM   7252 C CB  . THR F 1 51  ? 14.171  -49.378 11.810  1.00   69.10  ? 803  THR F CB  1 
ATOM   7253 O OG1 . THR F 1 51  ? 12.852  -49.051 12.274  1.00   64.56  ? 803  THR F OG1 1 
ATOM   7254 C CG2 . THR F 1 51  ? 14.618  -50.673 12.471  1.00   68.23  ? 803  THR F CG2 1 
ATOM   7255 N N   . GLY F 1 52  ? 15.839  -47.655 9.902   1.00   80.11  ? 804  GLY F N   1 
ATOM   7256 C CA  . GLY F 1 52  ? 16.310  -46.743 8.836   1.00   82.66  ? 804  GLY F CA  1 
ATOM   7257 C C   . GLY F 1 52  ? 17.825  -46.827 8.612   1.00   86.08  ? 804  GLY F C   1 
ATOM   7258 O O   . GLY F 1 52  ? 18.319  -46.477 7.519   1.00   90.23  ? 804  GLY F O   1 
ATOM   7259 N N   . GLN F 1 53  ? 18.543  -47.272 9.655   1.00   85.57  ? 805  GLN F N   1 
ATOM   7260 C CA  . GLN F 1 53  ? 20.004  -47.577 9.653   1.00   85.50  ? 805  GLN F CA  1 
ATOM   7261 C C   . GLN F 1 53  ? 20.925  -46.407 9.199   1.00   81.46  ? 805  GLN F C   1 
ATOM   7262 O O   . GLN F 1 53  ? 21.742  -46.504 8.267   1.00   79.41  ? 805  GLN F O   1 
ATOM   7263 C CB  . GLN F 1 53  ? 20.284  -48.918 8.930   1.00   87.60  ? 805  GLN F CB  1 
ATOM   7264 C CG  . GLN F 1 53  ? 21.174  -49.900 9.768   1.00   91.02  ? 805  GLN F CG  1 
ATOM   7265 C CD  . GLN F 1 53  ? 20.624  -51.330 9.917   1.00   93.20  ? 805  GLN F CD  1 
ATOM   7266 O OE1 . GLN F 1 53  ? 21.316  -52.204 10.450  1.00   91.39  ? 805  GLN F OE1 1 
ATOM   7267 N NE2 . GLN F 1 53  ? 19.386  -51.569 9.464   1.00   89.22  ? 805  GLN F NE2 1 
ATOM   7268 N N   . LEU F 1 54  ? 20.812  -45.313 9.946   1.00   76.39  ? 806  LEU F N   1 
ATOM   7269 C CA  . LEU F 1 54  ? 21.379  -44.050 9.544   1.00   69.31  ? 806  LEU F CA  1 
ATOM   7270 C C   . LEU F 1 54  ? 22.713  -43.817 10.267  1.00   62.80  ? 806  LEU F C   1 
ATOM   7271 O O   . LEU F 1 54  ? 23.163  -44.589 11.174  1.00   61.71  ? 806  LEU F O   1 
ATOM   7272 C CB  . LEU F 1 54  ? 20.356  -42.928 9.805   1.00   70.72  ? 806  LEU F CB  1 
ATOM   7273 C CG  . LEU F 1 54  ? 18.861  -43.095 9.368   1.00   69.67  ? 806  LEU F CG  1 
ATOM   7274 C CD1 . LEU F 1 54  ? 18.711  -43.547 7.911   1.00   64.05  ? 806  LEU F CD1 1 
ATOM   7275 C CD2 . LEU F 1 54  ? 17.989  -44.017 10.296  1.00   63.10  ? 806  LEU F CD2 1 
ATOM   7276 N N   . GLY F 1 55  ? 23.372  -42.758 9.867   1.00   58.12  ? 807  GLY F N   1 
ATOM   7277 C CA  . GLY F 1 55  ? 24.638  -42.404 10.523  1.00   58.09  ? 807  GLY F CA  1 
ATOM   7278 C C   . GLY F 1 55  ? 24.467  -41.948 11.958  1.00   52.77  ? 807  GLY F C   1 
ATOM   7279 O O   . GLY F 1 55  ? 23.370  -41.928 12.465  1.00   51.34  ? 807  GLY F O   1 
ATOM   7280 N N   . GLU F 1 56  ? 25.565  -41.570 12.609  1.00   47.46  ? 808  GLU F N   1 
ATOM   7281 C CA  . GLU F 1 56  ? 25.511  -41.070 13.969  1.00   47.43  ? 808  GLU F CA  1 
ATOM   7282 C C   . GLU F 1 56  ? 24.615  -39.821 14.045  1.00   40.53  ? 808  GLU F C   1 
ATOM   7283 O O   . GLU F 1 56  ? 23.909  -39.661 15.034  1.00   42.25  ? 808  GLU F O   1 
ATOM   7284 C CB  . GLU F 1 56  ? 26.902  -40.754 14.497  1.00   49.76  ? 808  GLU F CB  1 
ATOM   7285 C CG  . GLU F 1 56  ? 27.843  -41.961 14.599  1.00   51.86  ? 808  GLU F CG  1 
ATOM   7286 C CD  . GLU F 1 56  ? 29.218  -41.518 15.067  1.00   53.82  ? 808  GLU F CD  1 
ATOM   7287 O OE1 . GLU F 1 56  ? 30.189  -42.066 14.557  1.00   50.44  ? 808  GLU F OE1 1 
ATOM   7288 O OE2 . GLU F 1 56  ? 29.342  -40.621 15.945  1.00   63.44  ? 808  GLU F OE2 1 
ATOM   7289 N N   . VAL F 1 57  ? 24.642  -38.969 13.019  1.00   48.38  ? 809  VAL F N   1 
ATOM   7290 C CA  . VAL F 1 57  ? 24.015  -37.681 13.132  1.00   44.80  ? 809  VAL F CA  1 
ATOM   7291 C C   . VAL F 1 57  ? 22.503  -37.852 13.150  1.00   47.49  ? 809  VAL F C   1 
ATOM   7292 O O   . VAL F 1 57  ? 21.810  -37.333 14.036  1.00   47.81  ? 809  VAL F O   1 
ATOM   7293 C CB  . VAL F 1 57  ? 24.410  -36.662 12.066  1.00   41.15  ? 809  VAL F CB  1 
ATOM   7294 C CG1 . VAL F 1 57  ? 23.450  -35.500 12.202  1.00   40.12  ? 809  VAL F CG1 1 
ATOM   7295 C CG2 . VAL F 1 57  ? 25.815  -36.121 12.344  1.00   46.49  ? 809  VAL F CG2 1 
ATOM   7296 N N   . MET F 1 58  ? 21.994  -38.570 12.182  1.00   51.19  ? 810  MET F N   1 
ATOM   7297 C CA  . MET F 1 58  ? 20.579  -38.896 12.179  1.00   55.78  ? 810  MET F CA  1 
ATOM   7298 C C   . MET F 1 58  ? 20.146  -39.552 13.469  1.00   51.29  ? 810  MET F C   1 
ATOM   7299 O O   . MET F 1 58  ? 19.138  -39.175 14.023  1.00   46.65  ? 810  MET F O   1 
ATOM   7300 C CB  . MET F 1 58  ? 20.222  -39.807 11.033  1.00   58.41  ? 810  MET F CB  1 
ATOM   7301 C CG  . MET F 1 58  ? 19.311  -39.132 9.973   1.00   72.75  ? 810  MET F CG  1 
ATOM   7302 S SD  . MET F 1 58  ? 17.559  -38.889 10.466  1.00   69.92  ? 810  MET F SD  1 
ATOM   7303 C CE  . MET F 1 58  ? 16.786  -39.018 8.835   1.00   61.36  ? 810  MET F CE  1 
ATOM   7304 N N   . LYS F 1 59  ? 20.882  -40.581 13.892  1.00   50.03  ? 811  LYS F N   1 
ATOM   7305 C CA  . LYS F 1 59  ? 20.610  -41.265 15.139  1.00   45.53  ? 811  LYS F CA  1 
ATOM   7306 C C   . LYS F 1 59  ? 20.564  -40.287 16.336  1.00   47.00  ? 811  LYS F C   1 
ATOM   7307 O O   . LYS F 1 59  ? 19.725  -40.447 17.219  1.00   42.92  ? 811  LYS F O   1 
ATOM   7308 C CB  . LYS F 1 59  ? 21.693  -42.312 15.475  1.00   52.08  ? 811  LYS F CB  1 
ATOM   7309 C CG  . LYS F 1 59  ? 21.699  -43.666 14.681  1.00   64.32  ? 811  LYS F CG  1 
ATOM   7310 C CD  . LYS F 1 59  ? 22.947  -44.616 14.968  1.00   68.50  ? 811  LYS F CD  1 
ATOM   7311 C CE  . LYS F 1 59  ? 22.865  -45.417 16.332  1.00   75.03  ? 811  LYS F CE  1 
ATOM   7312 N NZ  . LYS F 1 59  ? 23.195  -44.608 17.586  1.00   66.61  ? 811  LYS F NZ  1 
ATOM   7313 N N   . GLU F 1 60  ? 21.524  -39.366 16.444  1.00   37.38  ? 812  GLU F N   1 
ATOM   7314 C CA  . GLU F 1 60  ? 21.487  -38.446 17.576  1.00   38.76  ? 812  GLU F CA  1 
ATOM   7315 C C   . GLU F 1 60  ? 20.361  -37.463 17.340  1.00   37.32  ? 812  GLU F C   1 
ATOM   7316 O O   . GLU F 1 60  ? 19.762  -36.956 18.298  1.00   51.54  ? 812  GLU F O   1 
ATOM   7317 C CB  . GLU F 1 60  ? 22.849  -37.708 17.737  1.00   41.30  ? 812  GLU F CB  1 
ATOM   7318 C CG  . GLU F 1 60  ? 22.942  -36.616 18.898  1.00   37.70  ? 812  GLU F CG  1 
ATOM   7319 C CD  . GLU F 1 60  ? 22.582  -37.109 20.269  1.00   37.85  ? 812  GLU F CD  1 
ATOM   7320 O OE1 . GLU F 1 60  ? 21.981  -36.327 21.102  1.00   51.66  ? 812  GLU F OE1 1 
ATOM   7321 O OE2 . GLU F 1 60  ? 22.933  -38.287 20.638  1.00   42.66  ? 812  GLU F OE2 1 
ATOM   7322 N N   . SER F 1 61  ? 20.002  -37.165 16.085  1.00   34.51  ? 813  SER F N   1 
ATOM   7323 C CA  . SER F 1 61  ? 18.811  -36.288 15.908  1.00   37.54  ? 813  SER F CA  1 
ATOM   7324 C C   . SER F 1 61  ? 17.489  -36.908 16.378  1.00   46.78  ? 813  SER F C   1 
ATOM   7325 O O   . SER F 1 61  ? 16.585  -36.182 16.897  1.00   37.51  ? 813  SER F O   1 
ATOM   7326 C CB  . SER F 1 61  ? 18.663  -35.777 14.498  1.00   43.29  ? 813  SER F CB  1 
ATOM   7327 O OG  . SER F 1 61  ? 17.532  -34.920 14.443  1.00   34.55  ? 813  SER F OG  1 
ATOM   7328 N N   . ALA F 1 62  ? 17.359  -38.238 16.223  1.00   42.20  ? 814  ALA F N   1 
ATOM   7329 C CA  . ALA F 1 62  ? 16.256  -38.980 16.872  1.00   39.07  ? 814  ALA F CA  1 
ATOM   7330 C C   . ALA F 1 62  ? 16.203  -38.857 18.382  1.00   39.79  ? 814  ALA F C   1 
ATOM   7331 O O   . ALA F 1 62  ? 15.119  -38.665 19.016  1.00   44.81  ? 814  ALA F O   1 
ATOM   7332 C CB  . ALA F 1 62  ? 16.353  -40.490 16.481  1.00   40.20  ? 814  ALA F CB  1 
ATOM   7333 N N   A ARG F 1 63  ? 17.357  -38.968 19.005  0.50   41.43  ? 815  ARG F N   1 
ATOM   7334 N N   B ARG F 1 63  ? 17.369  -38.976 18.994  0.50   40.98  ? 815  ARG F N   1 
ATOM   7335 C CA  A ARG F 1 63  ? 17.428  -38.871 20.440  0.50   43.09  ? 815  ARG F CA  1 
ATOM   7336 C CA  B ARG F 1 63  ? 17.501  -38.887 20.433  0.50   41.85  ? 815  ARG F CA  1 
ATOM   7337 C C   A ARG F 1 63  ? 17.061  -37.499 21.024  0.50   46.29  ? 815  ARG F C   1 
ATOM   7338 C C   B ARG F 1 63  ? 17.111  -37.513 21.036  0.50   45.90  ? 815  ARG F C   1 
ATOM   7339 O O   A ARG F 1 63  ? 16.439  -37.408 22.085  0.50   46.41  ? 815  ARG F O   1 
ATOM   7340 O O   B ARG F 1 63  ? 16.525  -37.440 22.123  0.50   46.04  ? 815  ARG F O   1 
ATOM   7341 C CB  A ARG F 1 63  ? 18.795  -39.339 20.912  0.50   42.83  ? 815  ARG F CB  1 
ATOM   7342 C CB  B ARG F 1 63  ? 18.916  -39.327 20.854  0.50   40.81  ? 815  ARG F CB  1 
ATOM   7343 C CG  A ARG F 1 63  ? 18.807  -40.835 21.226  0.50   44.68  ? 815  ARG F CG  1 
ATOM   7344 C CG  B ARG F 1 63  ? 19.172  -40.864 20.730  0.50   40.69  ? 815  ARG F CG  1 
ATOM   7345 C CD  A ARG F 1 63  ? 20.224  -41.366 21.451  0.50   48.00  ? 815  ARG F CD  1 
ATOM   7346 C CD  B ARG F 1 63  ? 20.626  -41.351 21.141  0.50   34.88  ? 815  ARG F CD  1 
ATOM   7347 N NE  A ARG F 1 63  ? 21.044  -41.189 20.257  0.50   52.81  ? 815  ARG F NE  1 
ATOM   7348 N NE  B ARG F 1 63  ? 20.709  -41.980 22.460  0.50   35.08  ? 815  ARG F NE  1 
ATOM   7349 C CZ  A ARG F 1 63  ? 22.094  -41.948 19.955  0.50   49.12  ? 815  ARG F CZ  1 
ATOM   7350 C CZ  B ARG F 1 63  ? 21.713  -42.771 22.903  0.50   36.43  ? 815  ARG F CZ  1 
ATOM   7351 N NH1 A ARG F 1 63  ? 22.771  -41.679 18.854  0.50   38.39  ? 815  ARG F NH1 1 
ATOM   7352 N NH1 B ARG F 1 63  ? 21.672  -43.283 24.113  0.50   29.53  ? 815  ARG F NH1 1 
ATOM   7353 N NH2 A ARG F 1 63  ? 22.455  -42.973 20.752  0.50   21.40  ? 815  ARG F NH2 1 
ATOM   7354 N NH2 B ARG F 1 63  ? 22.746  -43.068 22.162  0.50   31.19  ? 815  ARG F NH2 1 
ATOM   7355 N N   . ILE F 1 64  ? 17.460  -36.446 20.331  1.00   44.80  ? 816  ILE F N   1 
ATOM   7356 C CA  . ILE F 1 64  ? 17.067  -35.081 20.671  1.00   38.43  ? 816  ILE F CA  1 
ATOM   7357 C C   . ILE F 1 64  ? 15.583  -34.962 20.612  1.00   37.03  ? 816  ILE F C   1 
ATOM   7358 O O   . ILE F 1 64  ? 14.926  -34.577 21.555  1.00   35.66  ? 816  ILE F O   1 
ATOM   7359 C CB  . ILE F 1 64  ? 17.687  -34.122 19.631  1.00   36.55  ? 816  ILE F CB  1 
ATOM   7360 C CG1 . ILE F 1 64  ? 19.152  -34.025 19.880  1.00   27.90  ? 816  ILE F CG1 1 
ATOM   7361 C CG2 . ILE F 1 64  ? 17.259  -32.629 19.826  1.00   37.55  ? 816  ILE F CG2 1 
ATOM   7362 C CD1 . ILE F 1 64  ? 19.836  -33.540 18.745  1.00   23.97  ? 816  ILE F CD1 1 
ATOM   7363 N N   . ALA F 1 65  ? 15.036  -35.403 19.518  1.00   38.17  ? 817  ALA F N   1 
ATOM   7364 C CA  . ALA F 1 65  ? 13.643  -35.269 19.357  1.00   41.57  ? 817  ALA F CA  1 
ATOM   7365 C C   . ALA F 1 65  ? 12.903  -35.995 20.402  1.00   45.98  ? 817  ALA F C   1 
ATOM   7366 O O   . ALA F 1 65  ? 11.974  -35.450 21.017  1.00   46.29  ? 817  ALA F O   1 
ATOM   7367 C CB  . ALA F 1 65  ? 13.234  -35.640 17.883  1.00   35.72  ? 817  ALA F CB  1 
ATOM   7368 N N   . TYR F 1 66  ? 13.350  -37.213 20.681  1.00   48.92  ? 818  TYR F N   1 
ATOM   7369 C CA  . TYR F 1 66  ? 12.852  -38.010 21.785  1.00   53.03  ? 818  TYR F CA  1 
ATOM   7370 C C   . TYR F 1 66  ? 12.945  -37.289 23.134  1.00   53.24  ? 818  TYR F C   1 
ATOM   7371 O O   . TYR F 1 66  ? 11.976  -37.170 23.906  1.00   52.07  ? 818  TYR F O   1 
ATOM   7372 C CB  . TYR F 1 66  ? 13.647  -39.350 21.837  1.00   52.96  ? 818  TYR F CB  1 
ATOM   7373 C CG  . TYR F 1 66  ? 13.182  -40.342 22.871  1.00   51.63  ? 818  TYR F CG  1 
ATOM   7374 C CD1 . TYR F 1 66  ? 14.104  -40.989 23.709  1.00   58.48  ? 818  TYR F CD1 1 
ATOM   7375 C CD2 . TYR F 1 66  ? 11.845  -40.686 22.986  1.00   53.31  ? 818  TYR F CD2 1 
ATOM   7376 C CE1 . TYR F 1 66  ? 13.685  -41.943 24.666  1.00   55.11  ? 818  TYR F CE1 1 
ATOM   7377 C CE2 . TYR F 1 66  ? 11.416  -41.661 23.947  1.00   63.29  ? 818  TYR F CE2 1 
ATOM   7378 C CZ  . TYR F 1 66  ? 12.355  -42.297 24.767  1.00   61.02  ? 818  TYR F CZ  1 
ATOM   7379 O OH  . TYR F 1 66  ? 11.988  -43.253 25.729  1.00   45.63  ? 818  TYR F OH  1 
ATOM   7380 N N   . THR F 1 67  ? 14.134  -36.824 23.436  1.00   52.37  ? 819  THR F N   1 
ATOM   7381 C CA  . THR F 1 67  ? 14.334  -36.155 24.670  1.00   49.90  ? 819  THR F CA  1 
ATOM   7382 C C   . THR F 1 67  ? 13.502  -34.890 24.758  1.00   44.30  ? 819  THR F C   1 
ATOM   7383 O O   . THR F 1 67  ? 12.890  -34.634 25.769  1.00   48.44  ? 819  THR F O   1 
ATOM   7384 C CB  . THR F 1 67  ? 15.775  -35.863 24.873  1.00   45.66  ? 819  THR F CB  1 
ATOM   7385 O OG1 . THR F 1 67  ? 16.470  -37.106 24.920  1.00   51.83  ? 819  THR F OG1 1 
ATOM   7386 C CG2 . THR F 1 67  ? 15.993  -35.073 26.193  1.00   50.58  ? 819  THR F CG2 1 
ATOM   7387 N N   . PHE F 1 68  ? 13.464  -34.136 23.678  1.00   49.69  ? 820  PHE F N   1 
ATOM   7388 C CA  . PHE F 1 68  ? 12.672  -32.926 23.698  1.00   46.45  ? 820  PHE F CA  1 
ATOM   7389 C C   . PHE F 1 68  ? 11.142  -33.170 23.650  1.00   49.03  ? 820  PHE F C   1 
ATOM   7390 O O   . PHE F 1 68  ? 10.350  -32.432 24.313  1.00   36.70  ? 820  PHE F O   1 
ATOM   7391 C CB  . PHE F 1 68  ? 13.135  -32.022 22.597  1.00   48.34  ? 820  PHE F CB  1 
ATOM   7392 C CG  . PHE F 1 68  ? 12.233  -30.862 22.376  1.00   42.10  ? 820  PHE F CG  1 
ATOM   7393 C CD1 . PHE F 1 68  ? 11.235  -30.935 21.443  1.00   37.26  ? 820  PHE F CD1 1 
ATOM   7394 C CD2 . PHE F 1 68  ? 12.369  -29.716 23.125  1.00   41.09  ? 820  PHE F CD2 1 
ATOM   7395 C CE1 . PHE F 1 68  ? 10.364  -29.866 21.254  1.00   51.19  ? 820  PHE F CE1 1 
ATOM   7396 C CE2 . PHE F 1 68  ? 11.487  -28.656 22.958  1.00   37.63  ? 820  PHE F CE2 1 
ATOM   7397 C CZ  . PHE F 1 68  ? 10.522  -28.701 22.035  1.00   44.30  ? 820  PHE F CZ  1 
ATOM   7398 N N   . ALA F 1 69  ? 10.684  -34.173 22.884  1.00   39.68  ? 821  ALA F N   1 
ATOM   7399 C CA  . ALA F 1 69  ? 9.216   -34.465 22.943  1.00   40.25  ? 821  ALA F CA  1 
ATOM   7400 C C   . ALA F 1 69  ? 8.756   -34.907 24.309  1.00   43.66  ? 821  ALA F C   1 
ATOM   7401 O O   . ALA F 1 69  ? 7.624   -34.597 24.693  1.00   38.03  ? 821  ALA F O   1 
ATOM   7402 C CB  . ALA F 1 69  ? 8.737   -35.401 21.883  1.00   37.23  ? 821  ALA F CB  1 
ATOM   7403 N N   . ARG F 1 70  ? 9.622   -35.570 25.089  1.00   41.14  ? 822  ARG F N   1 
ATOM   7404 C CA  . ARG F 1 70  ? 9.214   -35.949 26.386  1.00   43.45  ? 822  ARG F CA  1 
ATOM   7405 C C   . ARG F 1 70  ? 9.167   -34.766 27.326  1.00   42.21  ? 822  ARG F C   1 
ATOM   7406 O O   . ARG F 1 70  ? 8.278   -34.691 28.179  1.00   40.36  ? 822  ARG F O   1 
ATOM   7407 C CB  . ARG F 1 70  ? 10.169  -36.940 27.001  1.00   41.14  ? 822  ARG F CB  1 
ATOM   7408 C CG  . ARG F 1 70  ? 10.177  -38.207 26.335  1.00   53.83  ? 822  ARG F CG  1 
ATOM   7409 C CD  . ARG F 1 70  ? 11.487  -38.896 26.562  1.00   66.66  ? 822  ARG F CD  1 
ATOM   7410 N NE  . ARG F 1 70  ? 11.470  -39.764 27.723  1.00   68.16  ? 822  ARG F NE  1 
ATOM   7411 C CZ  . ARG F 1 70  ? 12.532  -40.461 28.098  1.00   73.33  ? 822  ARG F CZ  1 
ATOM   7412 N NH1 . ARG F 1 70  ? 13.649  -40.364 27.387  1.00   70.73  ? 822  ARG F NH1 1 
ATOM   7413 N NH2 . ARG F 1 70  ? 12.486  -41.243 29.169  1.00   68.24  ? 822  ARG F NH2 1 
ATOM   7414 N N   . ALA F 1 71  ? 10.232  -33.955 27.304  1.00   42.64  ? 823  ALA F N   1 
ATOM   7415 C CA  . ALA F 1 71  ? 10.242  -32.713 28.065  1.00   43.29  ? 823  ALA F CA  1 
ATOM   7416 C C   . ALA F 1 71  ? 9.001   -31.897 27.687  1.00   32.99  ? 823  ALA F C   1 
ATOM   7417 O O   . ALA F 1 71  ? 8.344   -31.351 28.555  1.00   43.35  ? 823  ALA F O   1 
ATOM   7418 C CB  . ALA F 1 71  ? 11.523  -31.835 27.756  1.00   41.55  ? 823  ALA F CB  1 
ATOM   7419 N N   . PHE F 1 72  ? 8.776   -31.728 26.419  1.00   38.84  ? 824  PHE F N   1 
ATOM   7420 C CA  . PHE F 1 72  ? 7.690   -30.878 25.904  1.00   41.57  ? 824  PHE F CA  1 
ATOM   7421 C C   . PHE F 1 72  ? 6.289   -31.292 26.293  1.00   50.87  ? 824  PHE F C   1 
ATOM   7422 O O   . PHE F 1 72  ? 5.406   -30.456 26.605  1.00   53.34  ? 824  PHE F O   1 
ATOM   7423 C CB  . PHE F 1 72  ? 7.780   -30.812 24.430  1.00   44.73  ? 824  PHE F CB  1 
ATOM   7424 C CG  . PHE F 1 72  ? 6.737   -29.928 23.794  1.00   38.35  ? 824  PHE F CG  1 
ATOM   7425 C CD1 . PHE F 1 72  ? 5.543   -30.425 23.380  1.00   44.29  ? 824  PHE F CD1 1 
ATOM   7426 C CD2 . PHE F 1 72  ? 6.998   -28.565 23.620  1.00   42.83  ? 824  PHE F CD2 1 
ATOM   7427 C CE1 . PHE F 1 72  ? 4.589   -29.577 22.796  1.00   43.58  ? 824  PHE F CE1 1 
ATOM   7428 C CE2 . PHE F 1 72  ? 6.099   -27.736 23.022  1.00   39.21  ? 824  PHE F CE2 1 
ATOM   7429 C CZ  . PHE F 1 72  ? 4.881   -28.260 22.572  1.00   40.68  ? 824  PHE F CZ  1 
ATOM   7430 N N   . LEU F 1 73  ? 6.091   -32.591 26.261  1.00   52.36  ? 825  LEU F N   1 
ATOM   7431 C CA  . LEU F 1 73  ? 4.839   -33.195 26.639  1.00   48.64  ? 825  LEU F CA  1 
ATOM   7432 C C   . LEU F 1 73  ? 4.663   -33.127 28.124  1.00   43.33  ? 825  LEU F C   1 
ATOM   7433 O O   . LEU F 1 73  ? 3.564   -33.003 28.609  1.00   46.83  ? 825  LEU F O   1 
ATOM   7434 C CB  . LEU F 1 73  ? 4.809   -34.643 26.113  1.00   45.90  ? 825  LEU F CB  1 
ATOM   7435 C CG  . LEU F 1 73  ? 3.572   -35.438 26.478  1.00   40.96  ? 825  LEU F CG  1 
ATOM   7436 C CD1 . LEU F 1 73  ? 2.303   -34.933 25.684  1.00   53.44  ? 825  LEU F CD1 1 
ATOM   7437 C CD2 . LEU F 1 73  ? 3.817   -36.978 26.361  1.00   53.67  ? 825  LEU F CD2 1 
ATOM   7438 N N   . MET F 1 74  ? 5.733   -33.173 28.883  1.00   44.91  ? 826  MET F N   1 
ATOM   7439 C CA  . MET F 1 74  ? 5.602   -32.899 30.292  1.00   47.34  ? 826  MET F CA  1 
ATOM   7440 C C   . MET F 1 74  ? 4.967   -31.520 30.555  1.00   55.38  ? 826  MET F C   1 
ATOM   7441 O O   . MET F 1 74  ? 3.981   -31.364 31.328  1.00   49.99  ? 826  MET F O   1 
ATOM   7442 C CB  . MET F 1 74  ? 6.983   -32.942 30.956  1.00   54.81  ? 826  MET F CB  1 
ATOM   7443 C CG  . MET F 1 74  ? 6.959   -32.673 32.444  1.00   55.63  ? 826  MET F CG  1 
ATOM   7444 S SD  . MET F 1 74  ? 8.014   -33.783 33.384  1.00   55.75  ? 826  MET F SD  1 
ATOM   7445 C CE  . MET F 1 74  ? 7.185   -35.242 32.860  1.00   49.55  ? 826  MET F CE  1 
ATOM   7446 N N   . GLN F 1 75  ? 5.546   -30.514 29.898  1.00   55.02  ? 827  GLN F N   1 
ATOM   7447 C CA  . GLN F 1 75  ? 5.240   -29.136 30.196  1.00   51.03  ? 827  GLN F CA  1 
ATOM   7448 C C   . GLN F 1 75  ? 3.807   -28.821 29.852  1.00   53.09  ? 827  GLN F C   1 
ATOM   7449 O O   . GLN F 1 75  ? 3.155   -28.080 30.587  1.00   52.87  ? 827  GLN F O   1 
ATOM   7450 C CB  . GLN F 1 75  ? 6.162   -28.170 29.421  1.00   50.07  ? 827  GLN F CB  1 
ATOM   7451 C CG  . GLN F 1 75  ? 6.477   -26.908 30.220  1.00   60.37  ? 827  GLN F CG  1 
ATOM   7452 C CD  . GLN F 1 75  ? 7.319   -27.126 31.463  1.00   49.76  ? 827  GLN F CD  1 
ATOM   7453 O OE1 . GLN F 1 75  ? 7.904   -28.193 31.677  1.00   63.45  ? 827  GLN F OE1 1 
ATOM   7454 N NE2 . GLN F 1 75  ? 7.418   -26.093 32.283  1.00   56.57  ? 827  GLN F NE2 1 
ATOM   7455 N N   . HIS F 1 76  ? 3.334   -29.389 28.739  1.00   51.67  ? 828  HIS F N   1 
ATOM   7456 C CA  A HIS F 1 76  ? 2.028   -29.047 28.218  0.50   50.06  ? 828  HIS F CA  1 
ATOM   7457 C CA  B HIS F 1 76  ? 2.026   -29.100 28.130  0.50   52.20  ? 828  HIS F CA  1 
ATOM   7458 C C   . HIS F 1 76  ? 0.965   -30.102 28.583  1.00   54.01  ? 828  HIS F C   1 
ATOM   7459 O O   . HIS F 1 76  ? -0.228  -29.794 28.633  1.00   52.88  ? 828  HIS F O   1 
ATOM   7460 C CB  A HIS F 1 76  ? 2.128   -28.766 26.698  0.50   47.91  ? 828  HIS F CB  1 
ATOM   7461 C CB  B HIS F 1 76  ? 2.165   -29.138 26.581  0.50   51.57  ? 828  HIS F CB  1 
ATOM   7462 C CG  A HIS F 1 76  ? 3.021   -27.607 26.378  0.50   41.27  ? 828  HIS F CG  1 
ATOM   7463 C CG  B HIS F 1 76  ? 0.868   -29.151 25.811  0.50   51.17  ? 828  HIS F CG  1 
ATOM   7464 N ND1 A HIS F 1 76  ? 2.603   -26.301 26.495  0.50   46.86  ? 828  HIS F ND1 1 
ATOM   7465 N ND1 B HIS F 1 76  ? 0.151   -28.005 25.536  0.50   48.87  ? 828  HIS F ND1 1 
ATOM   7466 C CD2 A HIS F 1 76  ? 4.335   -27.549 26.054  0.50   35.81  ? 828  HIS F CD2 1 
ATOM   7467 C CD2 B HIS F 1 76  ? 0.211   -30.160 25.182  0.50   52.54  ? 828  HIS F CD2 1 
ATOM   7468 C CE1 A HIS F 1 76  ? 3.609   -25.489 26.224  0.50   50.12  ? 828  HIS F CE1 1 
ATOM   7469 C CE1 B HIS F 1 76  ? -0.908  -28.310 24.809  0.50   50.47  ? 828  HIS F CE1 1 
ATOM   7470 N NE2 A HIS F 1 76  ? 4.669   -26.221 25.936  0.50   43.91  ? 828  HIS F NE2 1 
ATOM   7471 N NE2 B HIS F 1 76  ? -0.893  -29.612 24.577  0.50   42.88  ? 828  HIS F NE2 1 
ATOM   7472 N N   . ALA F 1 77  ? 1.315   -31.356 28.709  1.00   48.13  ? 829  ALA F N   1 
ATOM   7473 C CA  . ALA F 1 77  ? 0.351   -32.336 29.176  1.00   50.74  ? 829  ALA F CA  1 
ATOM   7474 C C   . ALA F 1 77  ? 0.895   -33.326 30.196  1.00   52.57  ? 829  ALA F C   1 
ATOM   7475 O O   . ALA F 1 77  ? 1.119   -34.466 29.904  1.00   53.73  ? 829  ALA F O   1 
ATOM   7476 C CB  . ALA F 1 77  ? -0.222  -33.032 28.052  1.00   48.03  ? 829  ALA F CB  1 
ATOM   7477 N N   . PRO F 1 78  ? 1.065   -32.859 31.406  1.00   51.38  ? 830  PRO F N   1 
ATOM   7478 C CA  . PRO F 1 78  ? 1.721   -33.568 32.498  1.00   57.58  ? 830  PRO F CA  1 
ATOM   7479 C C   . PRO F 1 78  ? 1.135   -34.892 32.967  1.00   58.33  ? 830  PRO F C   1 
ATOM   7480 O O   . PRO F 1 78  ? 1.850   -35.761 33.363  1.00   54.33  ? 830  PRO F O   1 
ATOM   7481 C CB  . PRO F 1 78  ? 1.651   -32.568 33.613  1.00   59.08  ? 830  PRO F CB  1 
ATOM   7482 C CG  . PRO F 1 78  ? 0.454   -31.769 33.297  1.00   60.03  ? 830  PRO F CG  1 
ATOM   7483 C CD  . PRO F 1 78  ? 0.131   -31.849 31.888  1.00   54.73  ? 830  PRO F CD  1 
ATOM   7484 N N   . ALA F 1 79  ? -0.156  -35.014 32.958  1.00   55.53  ? 831  ALA F N   1 
ATOM   7485 C CA  . ALA F 1 79  ? -0.820  -36.233 33.346  1.00   57.50  ? 831  ALA F CA  1 
ATOM   7486 C C   . ALA F 1 79  ? -0.762  -37.302 32.260  1.00   58.27  ? 831  ALA F C   1 
ATOM   7487 O O   . ALA F 1 79  ? -1.280  -38.402 32.474  1.00   57.14  ? 831  ALA F O   1 
ATOM   7488 C CB  . ALA F 1 79  ? -2.233  -35.931 33.710  1.00   52.23  ? 831  ALA F CB  1 
ATOM   7489 N N   . ASN F 1 80  ? -0.194  -36.965 31.088  1.00   62.21  ? 832  ASN F N   1 
ATOM   7490 C CA  . ASN F 1 80  ? 0.157   -37.968 30.049  1.00   60.86  ? 832  ASN F CA  1 
ATOM   7491 C C   . ASN F 1 80  ? 1.555   -38.589 30.275  1.00   64.60  ? 832  ASN F C   1 
ATOM   7492 O O   . ASN F 1 80  ? 2.575   -37.875 30.179  1.00   64.32  ? 832  ASN F O   1 
ATOM   7493 C CB  . ASN F 1 80  ? 0.118   -37.342 28.646  1.00   54.63  ? 832  ASN F CB  1 
ATOM   7494 C CG  . ASN F 1 80  ? 0.122   -38.384 27.545  1.00   57.19  ? 832  ASN F CG  1 
ATOM   7495 O OD1 . ASN F 1 80  ? 0.668   -39.497 27.709  1.00   47.61  ? 832  ASN F OD1 1 
ATOM   7496 N ND2 . ASN F 1 80  ? -0.466  -38.031 26.388  1.00   50.19  ? 832  ASN F ND2 1 
ATOM   7497 N N   . ASP F 1 81  ? 1.617   -39.887 30.523  1.00   64.25  ? 833  ASP F N   1 
ATOM   7498 C CA  . ASP F 1 81  ? 2.889   -40.543 30.727  1.00   59.35  ? 833  ASP F CA  1 
ATOM   7499 C C   . ASP F 1 81  ? 3.395   -41.459 29.621  1.00   57.07  ? 833  ASP F C   1 
ATOM   7500 O O   . ASP F 1 81  ? 4.329   -42.206 29.805  1.00   53.89  ? 833  ASP F O   1 
ATOM   7501 C CB  . ASP F 1 81  ? 2.940   -41.218 32.085  1.00   58.71  ? 833  ASP F CB  1 
ATOM   7502 C CG  . ASP F 1 81  ? 2.102   -42.445 32.160  1.00   65.96  ? 833  ASP F CG  1 
ATOM   7503 O OD1 . ASP F 1 81  ? 1.215   -42.631 31.314  1.00   62.88  ? 833  ASP F OD1 1 
ATOM   7504 O OD2 . ASP F 1 81  ? 2.353   -43.217 33.095  1.00   64.73  ? 833  ASP F OD2 1 
ATOM   7505 N N   . TYR F 1 82  ? 2.778   -41.354 28.474  1.00   54.15  ? 834  TYR F N   1 
ATOM   7506 C CA  . TYR F 1 82  ? 2.968   -42.228 27.335  1.00   58.32  ? 834  TYR F CA  1 
ATOM   7507 C C   . TYR F 1 82  ? 4.371   -42.240 26.838  1.00   56.30  ? 834  TYR F C   1 
ATOM   7508 O O   . TYR F 1 82  ? 4.917   -43.280 26.551  1.00   52.28  ? 834  TYR F O   1 
ATOM   7509 C CB  . TYR F 1 82  ? 2.095   -41.777 26.176  1.00   59.08  ? 834  TYR F CB  1 
ATOM   7510 C CG  . TYR F 1 82  ? 2.090   -42.746 25.034  1.00   61.19  ? 834  TYR F CG  1 
ATOM   7511 C CD1 . TYR F 1 82  ? 1.147   -43.772 24.961  1.00   59.55  ? 834  TYR F CD1 1 
ATOM   7512 C CD2 . TYR F 1 82  ? 3.015   -42.633 24.008  1.00   66.92  ? 834  TYR F CD2 1 
ATOM   7513 C CE1 . TYR F 1 82  ? 1.150   -44.667 23.900  1.00   59.19  ? 834  TYR F CE1 1 
ATOM   7514 C CE2 . TYR F 1 82  ? 3.018   -43.504 22.954  1.00   62.13  ? 834  TYR F CE2 1 
ATOM   7515 C CZ  . TYR F 1 82  ? 2.083   -44.515 22.893  1.00   59.66  ? 834  TYR F CZ  1 
ATOM   7516 O OH  . TYR F 1 82  ? 2.120   -45.363 21.827  1.00   69.49  ? 834  TYR F OH  1 
ATOM   7517 N N   . LEU F 1 83  ? 4.931   -41.043 26.687  1.00   53.71  ? 835  LEU F N   1 
ATOM   7518 C CA  . LEU F 1 83  ? 6.255   -40.905 26.129  1.00   55.88  ? 835  LEU F CA  1 
ATOM   7519 C C   . LEU F 1 83  ? 7.282   -41.291 27.159  1.00   49.84  ? 835  LEU F C   1 
ATOM   7520 O O   . LEU F 1 83  ? 8.398   -41.736 26.845  1.00   51.36  ? 835  LEU F O   1 
ATOM   7521 C CB  . LEU F 1 83  ? 6.432   -39.470 25.609  1.00   53.96  ? 835  LEU F CB  1 
ATOM   7522 C CG  . LEU F 1 83  ? 6.499   -39.336 24.088  1.00   49.53  ? 835  LEU F CG  1 
ATOM   7523 C CD1 . LEU F 1 83  ? 5.891   -40.435 23.265  1.00   44.60  ? 835  LEU F CD1 1 
ATOM   7524 C CD2 . LEU F 1 83  ? 6.002   -37.910 23.639  1.00   41.87  ? 835  LEU F CD2 1 
ATOM   7525 N N   . VAL F 1 84  ? 6.929   -41.140 28.409  1.00   52.36  ? 836  VAL F N   1 
ATOM   7526 C CA  . VAL F 1 84  ? 7.872   -41.524 29.440  1.00   55.08  ? 836  VAL F CA  1 
ATOM   7527 C C   . VAL F 1 84  ? 7.870   -43.034 29.766  1.00   58.40  ? 836  VAL F C   1 
ATOM   7528 O O   . VAL F 1 84  ? 8.864   -43.550 30.298  1.00   56.77  ? 836  VAL F O   1 
ATOM   7529 C CB  . VAL F 1 84  ? 7.608   -40.811 30.747  1.00   59.08  ? 836  VAL F CB  1 
ATOM   7530 C CG1 . VAL F 1 84  ? 8.661   -41.259 31.731  1.00   55.66  ? 836  VAL F CG1 1 
ATOM   7531 C CG2 . VAL F 1 84  ? 7.635   -39.252 30.584  1.00   55.97  ? 836  VAL F CG2 1 
ATOM   7532 N N   . THR F 1 85  ? 6.751   -43.707 29.503  1.00   52.26  ? 837  THR F N   1 
ATOM   7533 C CA  . THR F 1 85  ? 6.619   -45.149 29.793  1.00   58.45  ? 837  THR F CA  1 
ATOM   7534 C C   . THR F 1 85  ? 6.627   -46.092 28.578  1.00   62.23  ? 837  THR F C   1 
ATOM   7535 O O   . THR F 1 85  ? 7.098   -47.229 28.674  1.00   65.21  ? 837  THR F O   1 
ATOM   7536 C CB  . THR F 1 85  ? 5.305   -45.415 30.560  1.00   60.70  ? 837  THR F CB  1 
ATOM   7537 O OG1 . THR F 1 85  ? 4.206   -44.883 29.808  1.00   45.86  ? 837  THR F OG1 1 
ATOM   7538 C CG2 . THR F 1 85  ? 5.303   -44.722 31.868  1.00   51.31  ? 837  THR F CG2 1 
ATOM   7539 N N   . SER F 1 86  ? 6.081   -45.655 27.445  1.00   61.37  ? 838  SER F N   1 
ATOM   7540 C CA  . SER F 1 86  ? 5.867   -46.554 26.336  1.00   59.82  ? 838  SER F CA  1 
ATOM   7541 C C   . SER F 1 86  ? 7.143   -46.936 25.579  1.00   58.99  ? 838  SER F C   1 
ATOM   7542 O O   . SER F 1 86  ? 8.039   -46.131 25.419  1.00   62.46  ? 838  SER F O   1 
ATOM   7543 C CB  . SER F 1 86  ? 4.873   -45.949 25.382  1.00   58.94  ? 838  SER F CB  1 
ATOM   7544 O OG  . SER F 1 86  ? 3.678   -45.818 26.061  1.00   53.23  ? 838  SER F OG  1 
ATOM   7545 N N   . HIS F 1 87  ? 7.213   -48.172 25.117  1.00   57.30  ? 839  HIS F N   1 
ATOM   7546 C CA  . HIS F 1 87  ? 8.407   -48.620 24.400  1.00   59.67  ? 839  HIS F CA  1 
ATOM   7547 C C   . HIS F 1 87  ? 8.076   -48.301 22.951  1.00   54.56  ? 839  HIS F C   1 
ATOM   7548 O O   . HIS F 1 87  ? 6.961   -48.588 22.521  1.00   56.05  ? 839  HIS F O   1 
ATOM   7549 C CB  . HIS F 1 87  ? 8.678   -50.101 24.650  1.00   57.46  ? 839  HIS F CB  1 
ATOM   7550 C CG  . HIS F 1 87  ? 9.254   -50.405 26.001  1.00   63.05  ? 839  HIS F CG  1 
ATOM   7551 N ND1 . HIS F 1 87  ? 10.588  -50.209 26.311  1.00   53.54  ? 839  HIS F ND1 1 
ATOM   7552 C CD2 . HIS F 1 87  ? 8.678   -50.918 27.121  1.00   49.92  ? 839  HIS F CD2 1 
ATOM   7553 C CE1 . HIS F 1 87  ? 10.802  -50.557 27.566  1.00   61.42  ? 839  HIS F CE1 1 
ATOM   7554 N NE2 . HIS F 1 87  ? 9.664   -51.007 28.073  1.00   67.80  ? 839  HIS F NE2 1 
ATOM   7555 N N   . ILE F 1 88  ? 8.982   -47.649 22.212  1.00   54.67  ? 840  ILE F N   1 
ATOM   7556 C CA  . ILE F 1 88  ? 8.575   -47.053 20.911  1.00   53.50  ? 840  ILE F CA  1 
ATOM   7557 C C   . ILE F 1 88  ? 9.453   -47.426 19.781  1.00   50.58  ? 840  ILE F C   1 
ATOM   7558 O O   . ILE F 1 88  ? 10.672  -47.514 19.933  1.00   67.18  ? 840  ILE F O   1 
ATOM   7559 C CB  . ILE F 1 88  ? 8.385   -45.486 20.961  1.00   49.38  ? 840  ILE F CB  1 
ATOM   7560 C CG1 . ILE F 1 88  ? 7.298   -45.180 21.962  1.00   46.67  ? 840  ILE F CG1 1 
ATOM   7561 C CG2 . ILE F 1 88  ? 7.983   -44.941 19.582  1.00   45.82  ? 840  ILE F CG2 1 
ATOM   7562 C CD1 . ILE F 1 88  ? 6.718   -43.746 21.901  1.00   46.14  ? 840  ILE F CD1 1 
ATOM   7563 N N   . HIS F 1 89  ? 8.810   -47.620 18.635  1.00   56.46  ? 841  HIS F N   1 
ATOM   7564 C CA  . HIS F 1 89  ? 9.458   -47.784 17.363  1.00   55.60  ? 841  HIS F CA  1 
ATOM   7565 C C   . HIS F 1 89  ? 9.420   -46.498 16.511  1.00   54.25  ? 841  HIS F C   1 
ATOM   7566 O O   . HIS F 1 89  ? 8.398   -45.975 16.198  1.00   53.89  ? 841  HIS F O   1 
ATOM   7567 C CB  . HIS F 1 89  ? 8.800   -48.948 16.593  1.00   60.03  ? 841  HIS F CB  1 
ATOM   7568 C CG  . HIS F 1 89  ? 9.502   -49.288 15.321  1.00   62.17  ? 841  HIS F CG  1 
ATOM   7569 N ND1 . HIS F 1 89  ? 8.865   -49.308 14.097  1.00   61.23  ? 841  HIS F ND1 1 
ATOM   7570 C CD2 . HIS F 1 89  ? 10.807  -49.562 15.072  1.00   56.64  ? 841  HIS F CD2 1 
ATOM   7571 C CE1 . HIS F 1 89  ? 9.748   -49.573 13.149  1.00   73.21  ? 841  HIS F CE1 1 
ATOM   7572 N NE2 . HIS F 1 89  ? 10.933  -49.739 13.717  1.00   66.70  ? 841  HIS F NE2 1 
ATOM   7573 N N   . LEU F 1 90  ? 10.579  -46.040 16.099  1.00   50.17  ? 842  LEU F N   1 
ATOM   7574 C CA  . LEU F 1 90  ? 10.656  -44.931 15.210  1.00   52.89  ? 842  LEU F CA  1 
ATOM   7575 C C   . LEU F 1 90  ? 11.153  -45.475 13.928  1.00   51.06  ? 842  LEU F C   1 
ATOM   7576 O O   . LEU F 1 90  ? 12.261  -46.010 13.849  1.00   51.45  ? 842  LEU F O   1 
ATOM   7577 C CB  . LEU F 1 90  ? 11.616  -43.864 15.738  1.00   50.66  ? 842  LEU F CB  1 
ATOM   7578 C CG  . LEU F 1 90  ? 11.594  -42.454 15.146  1.00   56.73  ? 842  LEU F CG  1 
ATOM   7579 C CD1 . LEU F 1 90  ? 12.964  -41.785 15.187  1.00   47.68  ? 842  LEU F CD1 1 
ATOM   7580 C CD2 . LEU F 1 90  ? 11.172  -42.487 13.822  1.00   41.05  ? 842  LEU F CD2 1 
ATOM   7581 N N   . HIS F 1 91  ? 10.339  -45.331 12.910  1.00   48.79  ? 843  HIS F N   1 
ATOM   7582 C CA  . HIS F 1 91  ? 10.862  -45.563 11.579  1.00   56.10  ? 843  HIS F CA  1 
ATOM   7583 C C   . HIS F 1 91  ? 11.072  -44.299 10.709  1.00   55.86  ? 843  HIS F C   1 
ATOM   7584 O O   . HIS F 1 91  ? 10.118  -43.613 10.316  1.00   55.22  ? 843  HIS F O   1 
ATOM   7585 C CB  . HIS F 1 91  ? 9.989   -46.581 10.870  1.00   54.88  ? 843  HIS F CB  1 
ATOM   7586 C CG  . HIS F 1 91  ? 10.579  -47.013 9.580   1.00   62.91  ? 843  HIS F CG  1 
ATOM   7587 N ND1 . HIS F 1 91  ? 11.699  -47.815 9.509   1.00   63.69  ? 843  HIS F ND1 1 
ATOM   7588 C CD2 . HIS F 1 91  ? 10.267  -46.673 8.314   1.00   60.49  ? 843  HIS F CD2 1 
ATOM   7589 C CE1 . HIS F 1 91  ? 12.021  -47.989 8.242   1.00   69.59  ? 843  HIS F CE1 1 
ATOM   7590 N NE2 . HIS F 1 91  ? 11.168  -47.307 7.496   1.00   69.15  ? 843  HIS F NE2 1 
ATOM   7591 N N   . VAL F 1 92  ? 12.344  -44.014 10.395  1.00   58.12  ? 844  VAL F N   1 
ATOM   7592 C CA  . VAL F 1 92  ? 12.711  -42.944 9.491   1.00   58.12  ? 844  VAL F CA  1 
ATOM   7593 C C   . VAL F 1 92  ? 13.150  -43.548 8.134   1.00   60.52  ? 844  VAL F C   1 
ATOM   7594 O O   . VAL F 1 92  ? 14.195  -44.183 8.028   1.00   61.47  ? 844  VAL F O   1 
ATOM   7595 C CB  . VAL F 1 92  ? 13.868  -42.072 10.039  1.00   56.97  ? 844  VAL F CB  1 
ATOM   7596 C CG1 . VAL F 1 92  ? 14.315  -41.108 8.963   1.00   41.49  ? 844  VAL F CG1 1 
ATOM   7597 C CG2 . VAL F 1 92  ? 13.439  -41.329 11.287  1.00   57.48  ? 844  VAL F CG2 1 
ATOM   7598 N N   . PRO F 1 93  ? 12.343  -43.371 7.099   1.00   62.54  ? 845  PRO F N   1 
ATOM   7599 C CA  . PRO F 1 93  ? 12.724  -43.963 5.839   1.00   62.49  ? 845  PRO F CA  1 
ATOM   7600 C C   . PRO F 1 93  ? 14.009  -43.424 5.249   1.00   67.11  ? 845  PRO F C   1 
ATOM   7601 O O   . PRO F 1 93  ? 14.316  -42.212 5.370   1.00   67.06  ? 845  PRO F O   1 
ATOM   7602 C CB  . PRO F 1 93  ? 11.548  -43.614 4.942   1.00   65.82  ? 845  PRO F CB  1 
ATOM   7603 C CG  . PRO F 1 93  ? 10.406  -43.551 5.855   1.00   58.24  ? 845  PRO F CG  1 
ATOM   7604 C CD  . PRO F 1 93  ? 10.921  -43.001 7.119   1.00   59.74  ? 845  PRO F CD  1 
ATOM   7605 N N   . GLU F 1 94  ? 14.754  -44.330 4.618   1.00   66.46  ? 846  GLU F N   1 
ATOM   7606 C CA  . GLU F 1 94  ? 16.013  -43.981 3.995   1.00   67.21  ? 846  GLU F CA  1 
ATOM   7607 C C   . GLU F 1 94  ? 15.770  -43.071 2.802   1.00   67.83  ? 846  GLU F C   1 
ATOM   7608 O O   . GLU F 1 94  ? 14.677  -43.039 2.214   1.00   66.24  ? 846  GLU F O   1 
ATOM   7609 C CB  . GLU F 1 94  ? 16.796  -45.238 3.580   1.00   71.24  ? 846  GLU F CB  1 
ATOM   7610 C CG  . GLU F 1 94  ? 18.306  -45.174 3.859   1.00   65.47  ? 846  GLU F CG  1 
ATOM   7611 C CD  . GLU F 1 94  ? 18.946  -46.569 3.853   1.00   74.00  ? 846  GLU F CD  1 
ATOM   7612 O OE1 . GLU F 1 94  ? 18.939  -47.244 4.901   1.00   78.70  ? 846  GLU F OE1 1 
ATOM   7613 O OE2 . GLU F 1 94  ? 19.466  -46.985 2.796   1.00   72.37  ? 846  GLU F OE2 1 
ATOM   7614 N N   . GLY F 1 95  ? 16.797  -42.301 2.484   1.00   70.04  ? 847  GLY F N   1 
ATOM   7615 C CA  . GLY F 1 95  ? 16.750  -41.343 1.390   1.00   70.50  ? 847  GLY F CA  1 
ATOM   7616 C C   . GLY F 1 95  ? 17.616  -40.115 1.631   1.00   71.05  ? 847  GLY F C   1 
ATOM   7617 O O   . GLY F 1 95  ? 18.297  -39.632 0.720   1.00   71.83  ? 847  GLY F O   1 
ATOM   7618 N N   . ALA F 1 96  ? 17.571  -39.595 2.855   1.00   68.85  ? 848  ALA F N   1 
ATOM   7619 C CA  . ALA F 1 96  ? 18.172  -38.325 3.139   1.00   68.32  ? 848  ALA F CA  1 
ATOM   7620 C C   . ALA F 1 96  ? 19.689  -38.446 3.010   1.00   71.17  ? 848  ALA F C   1 
ATOM   7621 O O   . ALA F 1 96  ? 20.258  -39.459 3.377   1.00   71.10  ? 848  ALA F O   1 
ATOM   7622 C CB  . ALA F 1 96  ? 17.770  -37.880 4.536   1.00   70.11  ? 848  ALA F CB  1 
ATOM   7623 N N   . THR F 1 97  ? 20.340  -37.421 2.464   1.00   69.84  ? 849  THR F N   1 
ATOM   7624 C CA  . THR F 1 97  ? 21.804  -37.391 2.444   1.00   69.86  ? 849  THR F CA  1 
ATOM   7625 C C   . THR F 1 97  ? 22.375  -37.311 3.869   1.00   70.21  ? 849  THR F C   1 
ATOM   7626 O O   . THR F 1 97  ? 21.776  -36.705 4.785   1.00   62.49  ? 849  THR F O   1 
ATOM   7627 C CB  . THR F 1 97  ? 22.415  -36.202 1.618   1.00   70.18  ? 849  THR F CB  1 
ATOM   7628 O OG1 . THR F 1 97  ? 22.460  -35.011 2.419   1.00   65.21  ? 849  THR F OG1 1 
ATOM   7629 C CG2 . THR F 1 97  ? 21.638  -35.944 0.307   1.00   73.18  ? 849  THR F CG2 1 
ATOM   7630 N N   . PRO F 1 98  ? 23.554  -37.892 4.059   1.00   71.16  ? 850  PRO F N   1 
ATOM   7631 C CA  . PRO F 1 98  ? 24.168  -37.838 5.386   1.00   75.57  ? 850  PRO F CA  1 
ATOM   7632 C C   . PRO F 1 98  ? 24.086  -36.432 5.990   1.00   75.30  ? 850  PRO F C   1 
ATOM   7633 O O   . PRO F 1 98  ? 23.778  -36.281 7.157   1.00   79.11  ? 850  PRO F O   1 
ATOM   7634 C CB  . PRO F 1 98  ? 25.634  -38.192 5.126   1.00   75.59  ? 850  PRO F CB  1 
ATOM   7635 C CG  . PRO F 1 98  ? 25.657  -38.884 3.789   1.00   75.98  ? 850  PRO F CG  1 
ATOM   7636 C CD  . PRO F 1 98  ? 24.434  -38.470 3.026   1.00   72.39  ? 850  PRO F CD  1 
ATOM   7637 N N   . LYS F 1 99  ? 24.344  -35.416 5.178   1.00   74.03  ? 851  LYS F N   1 
ATOM   7638 C CA  . LYS F 1 99  ? 24.391  -34.069 5.681   1.00   73.40  ? 851  LYS F CA  1 
ATOM   7639 C C   . LYS F 1 99  ? 23.089  -33.305 5.477   1.00   70.37  ? 851  LYS F C   1 
ATOM   7640 O O   . LYS F 1 99  ? 23.076  -32.099 5.588   1.00   71.63  ? 851  LYS F O   1 
ATOM   7641 C CB  . LYS F 1 99  ? 25.582  -33.340 5.054   1.00   76.38  ? 851  LYS F CB  1 
ATOM   7642 C CG  . LYS F 1 99  ? 26.966  -33.667 5.738   1.00   74.15  ? 851  LYS F CG  1 
ATOM   7643 C CD  . LYS F 1 99  ? 27.028  -33.136 7.196   1.00   61.42  ? 851  LYS F CD  1 
ATOM   7644 C CE  . LYS F 1 99  ? 28.240  -32.230 7.500   1.00   71.57  ? 851  LYS F CE  1 
ATOM   7645 N NZ  . LYS F 1 99  ? 27.883  -30.777 7.374   1.00   67.82  ? 851  LYS F NZ  1 
ATOM   7646 N N   . ASP F 1 100 ? 22.000  -34.000 5.159   1.00   63.86  ? 852  ASP F N   1 
ATOM   7647 C CA  . ASP F 1 100 ? 20.642  -33.518 5.531   1.00   61.49  ? 852  ASP F CA  1 
ATOM   7648 C C   . ASP F 1 100 ? 20.154  -34.177 6.795   1.00   56.26  ? 852  ASP F C   1 
ATOM   7649 O O   . ASP F 1 100 ? 19.050  -33.907 7.245   1.00   54.05  ? 852  ASP F O   1 
ATOM   7650 C CB  . ASP F 1 100 ? 19.628  -33.887 4.456   1.00   61.26  ? 852  ASP F CB  1 
ATOM   7651 C CG  . ASP F 1 100 ? 18.276  -33.200 4.632   1.00   63.10  ? 852  ASP F CG  1 
ATOM   7652 O OD1 . ASP F 1 100 ? 17.212  -33.906 4.693   1.00   63.63  ? 852  ASP F OD1 1 
ATOM   7653 O OD2 . ASP F 1 100 ? 18.295  -31.950 4.683   1.00   40.42  ? 852  ASP F OD2 1 
ATOM   7654 N N   . GLY F 1 101 ? 20.929  -35.112 7.332   1.00   56.80  ? 853  GLY F N   1 
ATOM   7655 C CA  . GLY F 1 101 ? 20.478  -35.912 8.459   1.00   58.30  ? 853  GLY F CA  1 
ATOM   7656 C C   . GLY F 1 101 ? 19.565  -35.253 9.505   1.00   56.18  ? 853  GLY F C   1 
ATOM   7657 O O   . GLY F 1 101 ? 18.415  -35.676 9.708   1.00   57.02  ? 853  GLY F O   1 
ATOM   7658 N N   . PRO F 1 102 ? 20.057  -34.218 10.180  1.00   46.86  ? 854  PRO F N   1 
ATOM   7659 C CA  . PRO F 1 102 ? 19.355  -33.749 11.350  1.00   42.63  ? 854  PRO F CA  1 
ATOM   7660 C C   . PRO F 1 102 ? 18.007  -33.014 11.040  1.00   37.96  ? 854  PRO F C   1 
ATOM   7661 O O   . PRO F 1 102 ? 17.306  -32.731 11.970  1.00   37.86  ? 854  PRO F O   1 
ATOM   7662 C CB  . PRO F 1 102 ? 20.363  -32.815 12.000  1.00   39.72  ? 854  PRO F CB  1 
ATOM   7663 C CG  . PRO F 1 102 ? 21.591  -32.916 11.184  1.00   40.03  ? 854  PRO F CG  1 
ATOM   7664 C CD  . PRO F 1 102 ? 21.143  -33.291 9.838   1.00   47.47  ? 854  PRO F CD  1 
ATOM   7665 N N   . SER F 1 103 ? 17.637  -32.784 9.794   1.00   42.70  ? 855  SER F N   1 
ATOM   7666 C CA  . SER F 1 103 ? 16.454  -31.891 9.494   1.00   45.26  ? 855  SER F CA  1 
ATOM   7667 C C   . SER F 1 103 ? 15.134  -32.576 9.627   1.00   39.40  ? 855  SER F C   1 
ATOM   7668 O O   . SER F 1 103 ? 14.129  -31.943 9.446   1.00   42.48  ? 855  SER F O   1 
ATOM   7669 C CB  . SER F 1 103 ? 16.516  -31.263 8.120   1.00   39.80  ? 855  SER F CB  1 
ATOM   7670 O OG  . SER F 1 103 ? 17.399  -31.956 7.341   1.00   39.43  ? 855  SER F OG  1 
ATOM   7671 N N   . ALA F 1 104 ? 15.173  -33.867 9.984   1.00   41.89  ? 856  ALA F N   1 
ATOM   7672 C CA  . ALA F 1 104 ? 13.993  -34.665 10.273  1.00   48.35  ? 856  ALA F CA  1 
ATOM   7673 C C   . ALA F 1 104 ? 13.638  -34.511 11.761  1.00   39.89  ? 856  ALA F C   1 
ATOM   7674 O O   . ALA F 1 104 ? 12.691  -35.059 12.279  1.00   41.12  ? 856  ALA F O   1 
ATOM   7675 C CB  . ALA F 1 104 ? 14.228  -36.138 9.820   1.00   42.06  ? 856  ALA F CB  1 
ATOM   7676 N N   . GLY F 1 105 ? 14.322  -33.627 12.439  1.00   43.91  ? 857  GLY F N   1 
ATOM   7677 C CA  . GLY F 1 105 ? 14.009  -33.405 13.833  1.00   38.37  ? 857  GLY F CA  1 
ATOM   7678 C C   . GLY F 1 105 ? 12.651  -32.892 14.203  1.00   30.64  ? 857  GLY F C   1 
ATOM   7679 O O   . GLY F 1 105 ? 12.036  -33.420 15.020  1.00   43.46  ? 857  GLY F O   1 
ATOM   7680 N N   . CYS F 1 106 ? 12.191  -31.840 13.534  1.00   44.47  ? 858  CYS F N   1 
ATOM   7681 C CA  . CYS F 1 106 ? 10.833  -31.338 13.752  1.00   37.21  ? 858  CYS F CA  1 
ATOM   7682 C C   . CYS F 1 106 ? 9.771   -32.404 13.471  1.00   37.87  ? 858  CYS F C   1 
ATOM   7683 O O   . CYS F 1 106 ? 8.752   -32.481 14.157  1.00   41.67  ? 858  CYS F O   1 
ATOM   7684 C CB  . CYS F 1 106 ? 10.576  -30.100 12.889  1.00   36.32  ? 858  CYS F CB  1 
ATOM   7685 S SG  . CYS F 1 106 ? 10.740  -30.382 11.111  1.00   48.47  ? 858  CYS F SG  1 
ATOM   7686 N N   . THR F 1 107 ? 10.028  -33.220 12.455  1.00   40.18  ? 859  THR F N   1 
ATOM   7687 C CA  . THR F 1 107 ? 9.099   -34.197 11.962  1.00   46.00  ? 859  THR F CA  1 
ATOM   7688 C C   . THR F 1 107 ? 8.897   -35.283 12.967  1.00   34.01  ? 859  THR F C   1 
ATOM   7689 O O   . THR F 1 107 ? 7.824   -35.615 13.274  1.00   50.22  ? 859  THR F O   1 
ATOM   7690 C CB  . THR F 1 107 ? 9.659   -34.834 10.712  1.00   45.03  ? 859  THR F CB  1 
ATOM   7691 O OG1 . THR F 1 107 ? 9.998   -33.841 9.776   1.00   41.76  ? 859  THR F OG1 1 
ATOM   7692 C CG2 . THR F 1 107 ? 8.680   -35.739 10.089  1.00   37.68  ? 859  THR F CG2 1 
ATOM   7693 N N   . ILE F 1 108 ? 9.966   -35.767 13.522  1.00   42.51  ? 860  ILE F N   1 
ATOM   7694 C CA  . ILE F 1 108 ? 9.999   -36.754 14.604  1.00   41.25  ? 860  ILE F CA  1 
ATOM   7695 C C   . ILE F 1 108 ? 9.419   -36.283 15.937  1.00   43.88  ? 860  ILE F C   1 
ATOM   7696 O O   . ILE F 1 108 ? 8.703   -36.979 16.632  1.00   43.60  ? 860  ILE F O   1 
ATOM   7697 C CB  . ILE F 1 108 ? 11.487  -37.218 14.839  1.00   34.76  ? 860  ILE F CB  1 
ATOM   7698 C CG1 . ILE F 1 108 ? 12.118  -37.721 13.515  1.00   44.79  ? 860  ILE F CG1 1 
ATOM   7699 C CG2 . ILE F 1 108 ? 11.559  -38.274 15.796  1.00   40.27  ? 860  ILE F CG2 1 
ATOM   7700 C CD1 . ILE F 1 108 ? 13.704  -37.811 13.522  1.00   45.36  ? 860  ILE F CD1 1 
ATOM   7701 N N   . VAL F 1 109 ? 9.747   -35.080 16.366  1.00   47.67  ? 861  VAL F N   1 
ATOM   7702 C CA  . VAL F 1 109 ? 9.116   -34.604 17.584  1.00   45.87  ? 861  VAL F CA  1 
ATOM   7703 C C   . VAL F 1 109 ? 7.622   -34.817 17.448  1.00   41.91  ? 861  VAL F C   1 
ATOM   7704 O O   . VAL F 1 109 ? 6.953   -35.319 18.341  1.00   44.52  ? 861  VAL F O   1 
ATOM   7705 C CB  . VAL F 1 109 ? 9.434   -33.088 17.874  1.00   38.23  ? 861  VAL F CB  1 
ATOM   7706 C CG1 . VAL F 1 109 ? 8.646   -32.546 19.163  1.00   35.73  ? 861  VAL F CG1 1 
ATOM   7707 C CG2 . VAL F 1 109 ? 10.870  -32.985 18.142  1.00   40.28  ? 861  VAL F CG2 1 
ATOM   7708 N N   . THR F 1 110 ? 7.116   -34.310 16.353  1.00   48.93  ? 862  THR F N   1 
ATOM   7709 C CA  . THR F 1 110 ? 5.702   -34.372 16.056  1.00   50.41  ? 862  THR F CA  1 
ATOM   7710 C C   . THR F 1 110 ? 5.140   -35.816 15.979  1.00   50.67  ? 862  THR F C   1 
ATOM   7711 O O   . THR F 1 110 ? 4.004   -36.027 16.344  1.00   45.21  ? 862  THR F O   1 
ATOM   7712 C CB  . THR F 1 110 ? 5.467   -33.697 14.748  1.00   50.24  ? 862  THR F CB  1 
ATOM   7713 O OG1 . THR F 1 110 ? 6.288   -32.533 14.698  1.00   45.95  ? 862  THR F OG1 1 
ATOM   7714 C CG2 . THR F 1 110 ? 4.071   -33.257 14.611  1.00   48.71  ? 862  THR F CG2 1 
ATOM   7715 N N   . ALA F 1 111 ? 5.911   -36.769 15.463  1.00   44.11  ? 863  ALA F N   1 
ATOM   7716 C CA  . ALA F 1 111 ? 5.414   -38.143 15.358  1.00   51.88  ? 863  ALA F CA  1 
ATOM   7717 C C   . ALA F 1 111 ? 5.261   -38.742 16.727  1.00   48.88  ? 863  ALA F C   1 
ATOM   7718 O O   . ALA F 1 111 ? 4.294   -39.373 16.970  1.00   56.60  ? 863  ALA F O   1 
ATOM   7719 C CB  . ALA F 1 111 ? 6.275   -39.011 14.483  1.00   42.64  ? 863  ALA F CB  1 
ATOM   7720 N N   . LEU F 1 112 ? 6.188   -38.510 17.634  1.00   48.28  ? 864  LEU F N   1 
ATOM   7721 C CA  . LEU F 1 112 ? 6.057   -39.004 18.997  1.00   43.47  ? 864  LEU F CA  1 
ATOM   7722 C C   . LEU F 1 112 ? 4.892   -38.354 19.725  1.00   53.37  ? 864  LEU F C   1 
ATOM   7723 O O   . LEU F 1 112 ? 4.160   -39.071 20.423  1.00   46.24  ? 864  LEU F O   1 
ATOM   7724 C CB  . LEU F 1 112 ? 7.349   -38.812 19.758  1.00   50.68  ? 864  LEU F CB  1 
ATOM   7725 C CG  . LEU F 1 112 ? 8.542   -39.581 19.182  1.00   48.71  ? 864  LEU F CG  1 
ATOM   7726 C CD1 . LEU F 1 112 ? 9.826   -38.973 19.698  1.00   39.29  ? 864  LEU F CD1 1 
ATOM   7727 C CD2 . LEU F 1 112 ? 8.412   -41.023 19.616  1.00   51.80  ? 864  LEU F CD2 1 
ATOM   7728 N N   . LEU F 1 113 ? 4.696   -37.031 19.543  1.00   42.45  ? 865  LEU F N   1 
ATOM   7729 C CA  . LEU F 1 113 ? 3.588   -36.380 20.203  1.00   48.75  ? 865  LEU F CA  1 
ATOM   7730 C C   . LEU F 1 113 ? 2.228   -36.801 19.633  1.00   44.73  ? 865  LEU F C   1 
ATOM   7731 O O   . LEU F 1 113 ? 1.352   -37.035 20.395  1.00   48.62  ? 865  LEU F O   1 
ATOM   7732 C CB  . LEU F 1 113 ? 3.718   -34.884 20.135  1.00   43.78  ? 865  LEU F CB  1 
ATOM   7733 C CG  . LEU F 1 113 ? 4.838   -34.161 20.888  1.00   40.73  ? 865  LEU F CG  1 
ATOM   7734 C CD1 . LEU F 1 113 ? 4.697   -32.702 20.363  1.00   27.83  ? 865  LEU F CD1 1 
ATOM   7735 C CD2 . LEU F 1 113 ? 4.762   -34.174 22.374  1.00   36.69  ? 865  LEU F CD2 1 
ATOM   7736 N N   . SER F 1 114 ? 2.093   -36.866 18.302  1.00   50.77  ? 866  SER F N   1 
ATOM   7737 C CA  . SER F 1 114 ? 0.960   -37.474 17.631  1.00   54.58  ? 866  SER F CA  1 
ATOM   7738 C C   . SER F 1 114 ? 0.617   -38.841 18.184  1.00   56.62  ? 866  SER F C   1 
ATOM   7739 O O   . SER F 1 114 ? -0.516  -39.099 18.524  1.00   53.04  ? 866  SER F O   1 
ATOM   7740 C CB  . SER F 1 114 ? 1.188   -37.580 16.128  1.00   59.14  ? 866  SER F CB  1 
ATOM   7741 O OG  . SER F 1 114 ? 0.047   -38.098 15.431  1.00   65.10  ? 866  SER F OG  1 
ATOM   7742 N N   . LEU F 1 115 ? 1.604   -39.706 18.271  1.00   53.85  ? 867  LEU F N   1 
ATOM   7743 C CA  . LEU F 1 115 ? 1.400   -41.012 18.859  1.00   54.08  ? 867  LEU F CA  1 
ATOM   7744 C C   . LEU F 1 115 ? 1.068   -40.840 20.335  1.00   49.53  ? 867  LEU F C   1 
ATOM   7745 O O   . LEU F 1 115 ? 0.046   -41.289 20.765  1.00   44.80  ? 867  LEU F O   1 
ATOM   7746 C CB  . LEU F 1 115 ? 2.666   -41.887 18.674  1.00   50.71  ? 867  LEU F CB  1 
ATOM   7747 C CG  . LEU F 1 115 ? 2.700   -43.301 19.269  1.00   57.99  ? 867  LEU F CG  1 
ATOM   7748 C CD1 . LEU F 1 115 ? 1.892   -44.331 18.470  1.00   45.02  ? 867  LEU F CD1 1 
ATOM   7749 C CD2 . LEU F 1 115 ? 4.114   -43.743 19.316  1.00   60.23  ? 867  LEU F CD2 1 
ATOM   7750 N N   . ALA F 1 116 ? 1.883   -40.144 21.119  1.00   49.16  ? 868  ALA F N   1 
ATOM   7751 C CA  . ALA F 1 116 ? 1.549   -39.995 22.556  1.00   49.30  ? 868  ALA F CA  1 
ATOM   7752 C C   . ALA F 1 116 ? 0.143   -39.518 22.861  1.00   50.53  ? 868  ALA F C   1 
ATOM   7753 O O   . ALA F 1 116 ? -0.386  -39.826 23.903  1.00   53.34  ? 868  ALA F O   1 
ATOM   7754 C CB  . ALA F 1 116 ? 2.520   -39.032 23.213  1.00   47.42  ? 868  ALA F CB  1 
ATOM   7755 N N   . MET F 1 117 ? -0.434  -38.707 21.984  1.00   57.20  ? 869  MET F N   1 
ATOM   7756 C CA  . MET F 1 117 ? -1.720  -38.069 22.270  1.00   54.92  ? 869  MET F CA  1 
ATOM   7757 C C   . MET F 1 117 ? -2.872  -38.764 21.553  1.00   58.19  ? 869  MET F C   1 
ATOM   7758 O O   . MET F 1 117 ? -3.990  -38.335 21.687  1.00   55.58  ? 869  MET F O   1 
ATOM   7759 C CB  . MET F 1 117 ? -1.720  -36.628 21.789  1.00   57.52  ? 869  MET F CB  1 
ATOM   7760 C CG  . MET F 1 117 ? -0.685  -35.782 22.457  1.00   61.43  ? 869  MET F CG  1 
ATOM   7761 S SD  . MET F 1 117 ? -0.754  -34.019 22.041  1.00   59.82  ? 869  MET F SD  1 
ATOM   7762 C CE  . MET F 1 117 ? -0.515  -33.875 20.275  1.00   36.88  ? 869  MET F CE  1 
ATOM   7763 N N   . GLY F 1 118 ? -2.585  -39.837 20.816  1.00   63.67  ? 870  GLY F N   1 
ATOM   7764 C CA  . GLY F 1 118 ? -3.577  -40.538 20.020  1.00   67.41  ? 870  GLY F CA  1 
ATOM   7765 C C   . GLY F 1 118 ? -4.353  -39.568 19.145  1.00   69.78  ? 870  GLY F C   1 
ATOM   7766 O O   . GLY F 1 118 ? -5.575  -39.675 19.007  1.00   67.12  ? 870  GLY F O   1 
ATOM   7767 N N   . ARG F 1 119 ? -3.639  -38.616 18.546  1.00   70.28  ? 871  ARG F N   1 
ATOM   7768 C CA  . ARG F 1 119 ? -4.276  -37.526 17.823  1.00   67.12  ? 871  ARG F CA  1 
ATOM   7769 C C   . ARG F 1 119 ? -3.469  -37.387 16.552  1.00   64.66  ? 871  ARG F C   1 
ATOM   7770 O O   . ARG F 1 119 ? -2.284  -37.011 16.623  1.00   69.66  ? 871  ARG F O   1 
ATOM   7771 C CB  . ARG F 1 119 ? -4.221  -36.256 18.702  1.00   63.40  ? 871  ARG F CB  1 
ATOM   7772 C CG  . ARG F 1 119 ? -4.777  -34.954 18.118  1.00   64.29  ? 871  ARG F CG  1 
ATOM   7773 C CD  . ARG F 1 119 ? -4.385  -33.790 19.048  1.00   72.32  ? 871  ARG F CD  1 
ATOM   7774 N NE  . ARG F 1 119 ? -5.069  -32.479 18.931  1.00   82.20  ? 871  ARG F NE  1 
ATOM   7775 C CZ  . ARG F 1 119 ? -5.520  -31.865 17.826  1.00   78.80  ? 871  ARG F CZ  1 
ATOM   7776 N NH1 . ARG F 1 119 ? -5.448  -32.406 16.613  1.00   79.38  ? 871  ARG F NH1 1 
ATOM   7777 N NH2 . ARG F 1 119 ? -6.080  -30.663 17.958  1.00   72.94  ? 871  ARG F NH2 1 
ATOM   7778 N N   . PRO F 1 120 ? -4.063  -37.720 15.390  1.00   60.24  ? 872  PRO F N   1 
ATOM   7779 C CA  . PRO F 1 120 ? -3.301  -37.651 14.167  1.00   60.33  ? 872  PRO F CA  1 
ATOM   7780 C C   . PRO F 1 120 ? -2.987  -36.223 13.792  1.00   58.51  ? 872  PRO F C   1 
ATOM   7781 O O   . PRO F 1 120 ? -3.625  -35.302 14.257  1.00   64.89  ? 872  PRO F O   1 
ATOM   7782 C CB  . PRO F 1 120 ? -4.256  -38.235 13.133  1.00   62.30  ? 872  PRO F CB  1 
ATOM   7783 C CG  . PRO F 1 120 ? -5.576  -37.887 13.652  1.00   58.38  ? 872  PRO F CG  1 
ATOM   7784 C CD  . PRO F 1 120 ? -5.480  -37.977 15.116  1.00   59.32  ? 872  PRO F CD  1 
ATOM   7785 N N   . VAL F 1 121 ? -2.018  -36.053 12.929  1.00   63.00  ? 873  VAL F N   1 
ATOM   7786 C CA  . VAL F 1 121 ? -1.649  -34.749 12.465  1.00   59.55  ? 873  VAL F CA  1 
ATOM   7787 C C   . VAL F 1 121 ? -2.522  -34.323 11.336  1.00   64.93  ? 873  VAL F C   1 
ATOM   7788 O O   . VAL F 1 121 ? -2.920  -35.123 10.541  1.00   63.63  ? 873  VAL F O   1 
ATOM   7789 C CB  . VAL F 1 121 ? -0.211  -34.726 11.977  1.00   64.76  ? 873  VAL F CB  1 
ATOM   7790 C CG1 . VAL F 1 121 ? 0.185   -33.340 11.666  1.00   45.13  ? 873  VAL F CG1 1 
ATOM   7791 C CG2 . VAL F 1 121 ? 0.689   -35.304 13.009  1.00   57.26  ? 873  VAL F CG2 1 
ATOM   7792 N N   . ARG F 1 122 ? -2.706  -33.033 11.203  1.00   62.53  ? 874  ARG F N   1 
ATOM   7793 C CA  . ARG F 1 122 ? -3.565  -32.517 10.183  1.00   64.69  ? 874  ARG F CA  1 
ATOM   7794 C C   . ARG F 1 122 ? -3.119  -32.930 8.813   1.00   68.24  ? 874  ARG F C   1 
ATOM   7795 O O   . ARG F 1 122 ? -2.005  -33.272 8.599   1.00   67.55  ? 874  ARG F O   1 
ATOM   7796 C CB  . ARG F 1 122 ? -3.651  -31.008 10.276  1.00   63.47  ? 874  ARG F CB  1 
ATOM   7797 C CG  . ARG F 1 122 ? -2.411  -30.264 9.982   1.00   51.28  ? 874  ARG F CG  1 
ATOM   7798 C CD  . ARG F 1 122 ? -2.725  -28.828 9.673   1.00   45.83  ? 874  ARG F CD  1 
ATOM   7799 N NE  . ARG F 1 122 ? -2.925  -28.645 8.263   1.00   49.70  ? 874  ARG F NE  1 
ATOM   7800 C CZ  . ARG F 1 122 ? -2.905  -27.480 7.656   1.00   48.71  ? 874  ARG F CZ  1 
ATOM   7801 N NH1 . ARG F 1 122 ? -2.709  -26.382 8.331   1.00   44.03  ? 874  ARG F NH1 1 
ATOM   7802 N NH2 . ARG F 1 122 ? -3.076  -27.423 6.365   1.00   59.12  ? 874  ARG F NH2 1 
ATOM   7803 N N   . GLN F 1 123 ? -4.048  -32.987 7.902   1.00   68.32  ? 875  GLN F N   1 
ATOM   7804 C CA  . GLN F 1 123 ? -3.759  -33.488 6.596   1.00   66.51  ? 875  GLN F CA  1 
ATOM   7805 C C   . GLN F 1 123 ? -3.110  -32.494 5.693   1.00   65.93  ? 875  GLN F C   1 
ATOM   7806 O O   . GLN F 1 123 ? -3.190  -31.306 5.887   1.00   57.62  ? 875  GLN F O   1 
ATOM   7807 C CB  . GLN F 1 123 ? -5.013  -34.066 5.968   1.00   70.64  ? 875  GLN F CB  1 
ATOM   7808 C CG  . GLN F 1 123 ? -5.745  -35.044 6.866   1.00   68.72  ? 875  GLN F CG  1 
ATOM   7809 C CD  . GLN F 1 123 ? -4.977  -36.333 7.100   1.00   69.92  ? 875  GLN F CD  1 
ATOM   7810 O OE1 . GLN F 1 123 ? -5.263  -37.090 8.011   1.00   68.64  ? 875  GLN F OE1 1 
ATOM   7811 N NE2 . GLN F 1 123 ? -4.015  -36.580 6.271   1.00   67.08  ? 875  GLN F NE2 1 
ATOM   7812 N N   . ASN F 1 124 ? -2.456  -33.017 4.684   1.00   67.03  ? 876  ASN F N   1 
ATOM   7813 C CA  . ASN F 1 124 ? -1.789  -32.169 3.747   1.00   67.35  ? 876  ASN F CA  1 
ATOM   7814 C C   . ASN F 1 124 ? -0.879  -31.207 4.459   1.00   68.78  ? 876  ASN F C   1 
ATOM   7815 O O   . ASN F 1 124 ? -1.170  -30.034 4.535   1.00   61.66  ? 876  ASN F O   1 
ATOM   7816 C CB  . ASN F 1 124 ? -2.772  -31.469 2.829   1.00   63.06  ? 876  ASN F CB  1 
ATOM   7817 C CG  . ASN F 1 124 ? -3.352  -32.410 1.766   1.00   71.13  ? 876  ASN F CG  1 
ATOM   7818 O OD1 . ASN F 1 124 ? -2.950  -32.400 0.621   1.00   67.70  ? 876  ASN F OD1 1 
ATOM   7819 N ND2 . ASN F 1 124 ? -4.302  -33.211 2.162   1.00   67.29  ? 876  ASN F ND2 1 
ATOM   7820 N N   . LEU F 1 125 ? 0.144   -31.753 5.092   1.00   63.56  ? 877  LEU F N   1 
ATOM   7821 C CA  . LEU F 1 125 ? 1.152   -30.992 5.768   1.00   58.82  ? 877  LEU F CA  1 
ATOM   7822 C C   . LEU F 1 125 ? 2.523   -31.657 5.637   1.00   57.76  ? 877  LEU F C   1 
ATOM   7823 O O   . LEU F 1 125 ? 2.619   -32.836 5.765   1.00   55.37  ? 877  LEU F O   1 
ATOM   7824 C CB  . LEU F 1 125 ? 0.737   -30.851 7.198   1.00   61.09  ? 877  LEU F CB  1 
ATOM   7825 C CG  . LEU F 1 125 ? 1.735   -30.246 8.146   1.00   55.49  ? 877  LEU F CG  1 
ATOM   7826 C CD1 . LEU F 1 125 ? 2.623   -29.445 7.369   1.00   54.43  ? 877  LEU F CD1 1 
ATOM   7827 C CD2 . LEU F 1 125 ? 1.071   -29.411 9.149   1.00   55.44  ? 877  LEU F CD2 1 
ATOM   7828 N N   . ALA F 1 126 ? 3.580   -30.903 5.369   1.00   50.63  ? 878  ALA F N   1 
ATOM   7829 C CA  . ALA F 1 126 ? 4.932   -31.456 5.325   1.00   51.79  ? 878  ALA F CA  1 
ATOM   7830 C C   . ALA F 1 126 ? 5.881   -30.533 6.110   1.00   48.02  ? 878  ALA F C   1 
ATOM   7831 O O   . ALA F 1 126 ? 5.759   -29.331 6.080   1.00   43.43  ? 878  ALA F O   1 
ATOM   7832 C CB  . ALA F 1 126 ? 5.431   -31.650 3.826   1.00   42.80  ? 878  ALA F CB  1 
ATOM   7833 N N   . MET F 1 127 ? 6.858   -31.103 6.801   1.00   52.86  ? 879  MET F N   1 
ATOM   7834 C CA  . MET F 1 127 ? 7.839   -30.269 7.463   1.00   44.13  ? 879  MET F CA  1 
ATOM   7835 C C   . MET F 1 127 ? 9.277   -30.697 7.308   1.00   44.58  ? 879  MET F C   1 
ATOM   7836 O O   . MET F 1 127 ? 9.618   -31.818 6.872   1.00   44.75  ? 879  MET F O   1 
ATOM   7837 C CB  . MET F 1 127 ? 7.462   -30.121 8.919   1.00   42.58  ? 879  MET F CB  1 
ATOM   7838 C CG  . MET F 1 127 ? 7.124   -31.433 9.589   1.00   42.10  ? 879  MET F CG  1 
ATOM   7839 S SD  . MET F 1 127 ? 6.817   -31.184 11.315  1.00   41.83  ? 879  MET F SD  1 
ATOM   7840 C CE  . MET F 1 127 ? 5.104   -30.499 11.295  1.00   43.34  ? 879  MET F CE  1 
ATOM   7841 N N   . THR F 1 128 ? 10.147  -29.764 7.639   1.00   43.78  ? 880  THR F N   1 
ATOM   7842 C CA  . THR F 1 128 ? 11.565  -29.988 7.751   1.00   36.53  ? 880  THR F CA  1 
ATOM   7843 C C   . THR F 1 128 ? 12.141  -29.006 8.764   1.00   38.05  ? 880  THR F C   1 
ATOM   7844 O O   . THR F 1 128 ? 11.556  -27.985 8.978   1.00   40.25  ? 880  THR F O   1 
ATOM   7845 C CB  . THR F 1 128 ? 12.227  -29.835 6.441   1.00   37.88  ? 880  THR F CB  1 
ATOM   7846 O OG1 . THR F 1 128 ? 13.568  -30.242 6.563   1.00   39.46  ? 880  THR F OG1 1 
ATOM   7847 C CG2 . THR F 1 128 ? 12.196  -28.460 6.015   1.00   40.78  ? 880  THR F CG2 1 
ATOM   7848 N N   . GLY F 1 129 ? 13.249  -29.343 9.405   1.00   32.23  ? 881  GLY F N   1 
ATOM   7849 C CA  . GLY F 1 129 ? 13.741  -28.564 10.503  1.00   36.80  ? 881  GLY F CA  1 
ATOM   7850 C C   . GLY F 1 129 ? 14.492  -29.248 11.623  1.00   36.47  ? 881  GLY F C   1 
ATOM   7851 O O   . GLY F 1 129 ? 13.987  -30.108 12.259  1.00   40.21  ? 881  GLY F O   1 
ATOM   7852 N N   . GLU F 1 130 ? 15.714  -28.807 11.872  1.00   36.67  ? 882  GLU F N   1 
ATOM   7853 C CA  . GLU F 1 130 ? 16.474  -29.296 13.010  1.00   42.78  ? 882  GLU F CA  1 
ATOM   7854 C C   . GLU F 1 130 ? 15.884  -28.681 14.229  1.00   41.60  ? 882  GLU F C   1 
ATOM   7855 O O   . GLU F 1 130 ? 15.535  -27.564 14.245  1.00   37.12  ? 882  GLU F O   1 
ATOM   7856 C CB  . GLU F 1 130 ? 17.975  -28.978 12.920  1.00   40.91  ? 882  GLU F CB  1 
ATOM   7857 C CG  . GLU F 1 130 ? 18.865  -29.667 13.989  1.00   52.79  ? 882  GLU F CG  1 
ATOM   7858 C CD  . GLU F 1 130 ? 20.334  -29.240 14.002  1.00   45.33  ? 882  GLU F CD  1 
ATOM   7859 O OE1 . GLU F 1 130 ? 20.780  -28.630 13.054  1.00   56.34  ? 882  GLU F OE1 1 
ATOM   7860 O OE2 . GLU F 1 130 ? 21.031  -29.512 14.959  1.00   43.75  ? 882  GLU F OE2 1 
ATOM   7861 N N   . VAL F 1 131 ? 15.739  -29.466 15.247  1.00   40.95  ? 883  VAL F N   1 
ATOM   7862 C CA  . VAL F 1 131 ? 15.177  -28.992 16.527  1.00   40.75  ? 883  VAL F CA  1 
ATOM   7863 C C   . VAL F 1 131 ? 16.232  -29.030 17.611  1.00   46.36  ? 883  VAL F C   1 
ATOM   7864 O O   . VAL F 1 131 ? 16.863  -30.051 17.712  1.00   40.72  ? 883  VAL F O   1 
ATOM   7865 C CB  . VAL F 1 131 ? 13.961  -29.877 16.963  1.00   40.31  ? 883  VAL F CB  1 
ATOM   7866 C CG1 . VAL F 1 131 ? 14.443  -31.328 17.390  1.00   33.14  ? 883  VAL F CG1 1 
ATOM   7867 C CG2 . VAL F 1 131 ? 13.157  -29.168 18.041  1.00   28.05  ? 883  VAL F CG2 1 
ATOM   7868 N N   . SER F 1 132 ? 16.481  -27.939 18.370  1.00   39.88  ? 884  SER F N   1 
ATOM   7869 C CA  . SER F 1 132 ? 17.434  -27.967 19.582  1.00   33.19  ? 884  SER F CA  1 
ATOM   7870 C C   . SER F 1 132 ? 16.714  -28.499 20.772  1.00   34.57  ? 884  SER F C   1 
ATOM   7871 O O   . SER F 1 132 ? 15.510  -28.549 20.738  1.00   39.81  ? 884  SER F O   1 
ATOM   7872 C CB  . SER F 1 132 ? 17.896  -26.553 19.943  1.00   42.77  ? 884  SER F CB  1 
ATOM   7873 O OG  . SER F 1 132 ? 16.758  -25.858 20.455  1.00   41.81  ? 884  SER F OG  1 
ATOM   7874 N N   . LEU F 1 133 ? 17.446  -28.886 21.822  1.00   38.55  ? 885  LEU F N   1 
ATOM   7875 C CA  . LEU F 1 133 ? 16.895  -29.361 23.128  1.00   34.53  ? 885  LEU F CA  1 
ATOM   7876 C C   . LEU F 1 133 ? 16.206  -28.259 23.828  1.00   36.47  ? 885  LEU F C   1 
ATOM   7877 O O   . LEU F 1 133 ? 15.368  -28.496 24.647  1.00   38.74  ? 885  LEU F O   1 
ATOM   7878 C CB  . LEU F 1 133 ? 17.973  -29.977 24.057  1.00   34.82  ? 885  LEU F CB  1 
ATOM   7879 C CG  . LEU F 1 133 ? 18.551  -31.342 23.640  1.00   40.10  ? 885  LEU F CG  1 
ATOM   7880 C CD1 . LEU F 1 133 ? 19.828  -31.651 24.419  1.00   33.01  ? 885  LEU F CD1 1 
ATOM   7881 C CD2 . LEU F 1 133 ? 17.457  -32.418 23.862  1.00   44.88  ? 885  LEU F CD2 1 
ATOM   7882 N N   . THR F 1 134 ? 16.444  -27.028 23.419  1.00   42.86  ? 886  THR F N   1 
ATOM   7883 C CA  . THR F 1 134 ? 15.635  -25.934 23.877  1.00   43.58  ? 886  THR F CA  1 
ATOM   7884 C C   . THR F 1 134 ? 14.437  -25.611 22.952  1.00   48.95  ? 886  THR F C   1 
ATOM   7885 O O   . THR F 1 134 ? 13.691  -24.704 23.232  1.00   48.11  ? 886  THR F O   1 
ATOM   7886 C CB  . THR F 1 134 ? 16.563  -24.722 24.171  1.00   45.94  ? 886  THR F CB  1 
ATOM   7887 O OG1 . THR F 1 134 ? 17.448  -24.489 23.053  1.00   49.29  ? 886  THR F OG1 1 
ATOM   7888 C CG2 . THR F 1 134 ? 17.460  -25.044 25.383  1.00   44.61  ? 886  THR F CG2 1 
ATOM   7889 N N   . GLY F 1 135 ? 14.213  -26.397 21.904  1.00   47.48  ? 887  GLY F N   1 
ATOM   7890 C CA  . GLY F 1 135 ? 13.063  -26.177 20.950  1.00   43.11  ? 887  GLY F CA  1 
ATOM   7891 C C   . GLY F 1 135 ? 13.252  -25.150 19.879  1.00   36.05  ? 887  GLY F C   1 
ATOM   7892 O O   . GLY F 1 135 ? 12.359  -24.883 19.134  1.00   34.02  ? 887  GLY F O   1 
ATOM   7893 N N   . LYS F 1 136 ? 14.445  -24.547 19.772  1.00   35.10  ? 888  LYS F N   1 
ATOM   7894 C CA  . LYS F 1 136 ? 14.722  -23.694 18.688  1.00   33.01  ? 888  LYS F CA  1 
ATOM   7895 C C   . LYS F 1 136 ? 14.694  -24.510 17.421  1.00   36.42  ? 888  LYS F C   1 
ATOM   7896 O O   . LYS F 1 136 ? 15.344  -25.620 17.354  1.00   34.92  ? 888  LYS F O   1 
ATOM   7897 C CB  . LYS F 1 136 ? 16.128  -23.055 18.795  1.00   34.49  ? 888  LYS F CB  1 
ATOM   7898 C CG  . LYS F 1 136 ? 16.198  -21.594 18.308  1.00   49.24  ? 888  LYS F CG  1 
ATOM   7899 C CD  . LYS F 1 136 ? 17.679  -21.011 18.292  1.00   40.06  ? 888  LYS F CD  1 
ATOM   7900 C CE  . LYS F 1 136 ? 17.998  -20.189 17.129  1.00   49.14  ? 888  LYS F CE  1 
ATOM   7901 N NZ  . LYS F 1 136 ? 17.164  -19.005 16.983  1.00   42.20  ? 888  LYS F NZ  1 
ATOM   7902 N N   . ILE F 1 137 ? 13.959  -23.995 16.450  1.00   33.77  ? 889  ILE F N   1 
ATOM   7903 C CA  . ILE F 1 137 ? 14.043  -24.462 15.039  1.00   34.59  ? 889  ILE F CA  1 
ATOM   7904 C C   . ILE F 1 137 ? 15.121  -23.858 14.224  1.00   33.99  ? 889  ILE F C   1 
ATOM   7905 O O   . ILE F 1 137 ? 15.134  -22.670 13.965  1.00   37.20  ? 889  ILE F O   1 
ATOM   7906 C CB  . ILE F 1 137 ? 12.702  -24.327 14.263  1.00   33.07  ? 889  ILE F CB  1 
ATOM   7907 C CG1 . ILE F 1 137 ? 11.561  -24.941 15.020  1.00   31.10  ? 889  ILE F CG1 1 
ATOM   7908 C CG2 . ILE F 1 137 ? 12.718  -24.981 12.768  1.00   28.61  ? 889  ILE F CG2 1 
ATOM   7909 C CD1 . ILE F 1 137 ? 11.856  -26.336 15.627  1.00   39.85  ? 889  ILE F CD1 1 
ATOM   7910 N N   . LEU F 1 138 ? 16.065  -24.696 13.791  1.00   30.93  ? 890  LEU F N   1 
ATOM   7911 C CA  . LEU F 1 138 ? 17.232  -24.297 13.038  1.00   33.17  ? 890  LEU F CA  1 
ATOM   7912 C C   . LEU F 1 138 ? 16.971  -24.553 11.527  1.00   33.62  ? 890  LEU F C   1 
ATOM   7913 O O   . LEU F 1 138 ? 16.198  -25.444 11.188  1.00   40.87  ? 890  LEU F O   1 
ATOM   7914 C CB  . LEU F 1 138 ? 18.452  -25.136 13.540  1.00   43.52  ? 890  LEU F CB  1 
ATOM   7915 C CG  . LEU F 1 138 ? 19.050  -24.897 14.946  1.00   40.41  ? 890  LEU F CG  1 
ATOM   7916 C CD1 . LEU F 1 138 ? 18.394  -23.615 15.544  1.00   29.63  ? 890  LEU F CD1 1 
ATOM   7917 C CD2 . LEU F 1 138 ? 18.793  -26.048 15.878  1.00   51.14  ? 890  LEU F CD2 1 
ATOM   7918 N N   . PRO F 1 139 ? 17.594  -23.784 10.638  1.00   30.94  ? 891  PRO F N   1 
ATOM   7919 C CA  . PRO F 1 139 ? 17.526  -23.846 9.205   1.00   29.24  ? 891  PRO F CA  1 
ATOM   7920 C C   . PRO F 1 139 ? 18.318  -25.016 8.643   1.00   40.26  ? 891  PRO F C   1 
ATOM   7921 O O   . PRO F 1 139 ? 19.363  -25.395 9.216   1.00   32.36  ? 891  PRO F O   1 
ATOM   7922 C CB  . PRO F 1 139 ? 18.179  -22.566 8.800   1.00   38.98  ? 891  PRO F CB  1 
ATOM   7923 C CG  . PRO F 1 139 ? 19.148  -22.359 9.935   1.00   27.76  ? 891  PRO F CG  1 
ATOM   7924 C CD  . PRO F 1 139 ? 18.524  -22.697 11.072  1.00   31.23  ? 891  PRO F CD  1 
ATOM   7925 N N   . VAL F 1 140 ? 17.784  -25.558 7.553   1.00   36.16  ? 892  VAL F N   1 
ATOM   7926 C CA  . VAL F 1 140 ? 18.266  -26.731 6.844   1.00   39.42  ? 892  VAL F CA  1 
ATOM   7927 C C   . VAL F 1 140 ? 18.563  -26.309 5.442   1.00   37.51  ? 892  VAL F C   1 
ATOM   7928 O O   . VAL F 1 140 ? 18.220  -25.192 4.994   1.00   45.65  ? 892  VAL F O   1 
ATOM   7929 C CB  . VAL F 1 140 ? 17.152  -27.826 6.893   1.00   45.89  ? 892  VAL F CB  1 
ATOM   7930 C CG1 . VAL F 1 140 ? 16.695  -28.010 8.317   1.00   29.95  ? 892  VAL F CG1 1 
ATOM   7931 C CG2 . VAL F 1 140 ? 15.969  -27.418 6.062   1.00   38.52  ? 892  VAL F CG2 1 
ATOM   7932 N N   . GLY F 1 141 ? 19.165  -27.192 4.709   1.00   34.73  ? 893  GLY F N   1 
ATOM   7933 C CA  . GLY F 1 141 ? 19.421  -27.005 3.308   1.00   42.31  ? 893  GLY F CA  1 
ATOM   7934 C C   . GLY F 1 141 ? 18.389  -27.720 2.413   1.00   40.35  ? 893  GLY F C   1 
ATOM   7935 O O   . GLY F 1 141 ? 17.423  -28.392 2.899   1.00   37.95  ? 893  GLY F O   1 
ATOM   7936 N N   . GLY F 1 142 ? 18.643  -27.645 1.119   1.00   49.95  ? 894  GLY F N   1 
ATOM   7937 C CA  . GLY F 1 142 ? 17.790  -28.307 0.144   1.00   45.26  ? 894  GLY F CA  1 
ATOM   7938 C C   . GLY F 1 142 ? 16.388  -27.798 0.074   1.00   42.02  ? 894  GLY F C   1 
ATOM   7939 O O   . GLY F 1 142 ? 15.475  -28.558 -0.051  1.00   47.05  ? 894  GLY F O   1 
ATOM   7940 N N   . ILE F 1 143 ? 16.222  -26.496 0.157   1.00   37.04  ? 895  ILE F N   1 
ATOM   7941 C CA  . ILE F 1 143 ? 14.928  -25.924 0.289   1.00   37.72  ? 895  ILE F CA  1 
ATOM   7942 C C   . ILE F 1 143 ? 14.145  -26.163 -1.021  1.00   46.97  ? 895  ILE F C   1 
ATOM   7943 O O   . ILE F 1 143 ? 13.109  -26.796 -0.991  1.00   48.44  ? 895  ILE F O   1 
ATOM   7944 C CB  . ILE F 1 143 ? 15.014  -24.428 0.592   1.00   36.13  ? 895  ILE F CB  1 
ATOM   7945 C CG1 . ILE F 1 143 ? 15.700  -24.156 1.988   1.00   42.02  ? 895  ILE F CG1 1 
ATOM   7946 C CG2 . ILE F 1 143 ? 13.582  -23.822 0.539   1.00   30.29  ? 895  ILE F CG2 1 
ATOM   7947 C CD1 . ILE F 1 143 ? 15.276  -24.812 3.156   1.00   29.60  ? 895  ILE F CD1 1 
ATOM   7948 N N   . LYS F 1 144 ? 14.636  -25.622 -2.129  1.00   48.25  ? 896  LYS F N   1 
ATOM   7949 C CA  . LYS F 1 144 ? 14.099  -25.885 -3.469  1.00   48.46  ? 896  LYS F CA  1 
ATOM   7950 C C   . LYS F 1 144 ? 13.665  -27.327 -3.623  1.00   44.82  ? 896  LYS F C   1 
ATOM   7951 O O   . LYS F 1 144 ? 12.490  -27.599 -3.811  1.00   54.22  ? 896  LYS F O   1 
ATOM   7952 C CB  . LYS F 1 144 ? 15.134  -25.543 -4.566  1.00   45.46  ? 896  LYS F CB  1 
ATOM   7953 C CG  . LYS F 1 144 ? 14.647  -25.839 -6.020  1.00   53.19  ? 896  LYS F CG  1 
ATOM   7954 C CD  . LYS F 1 144 ? 15.634  -25.244 -7.113  1.00   46.74  ? 896  LYS F CD  1 
ATOM   7955 C CE  . LYS F 1 144 ? 15.290  -25.737 -8.543  1.00   63.21  ? 896  LYS F CE  1 
ATOM   7956 N NZ  . LYS F 1 144 ? 16.395  -25.514 -9.588  1.00   49.87  ? 896  LYS F NZ  1 
ATOM   7957 N N   . GLU F 1 145 ? 14.594  -28.256 -3.499  1.00   47.42  ? 897  GLU F N   1 
ATOM   7958 C CA  . GLU F 1 145 ? 14.250  -29.667 -3.638  1.00   45.46  ? 897  GLU F CA  1 
ATOM   7959 C C   . GLU F 1 145 ? 13.155  -30.131 -2.720  1.00   50.13  ? 897  GLU F C   1 
ATOM   7960 O O   . GLU F 1 145 ? 12.252  -30.888 -3.118  1.00   55.47  ? 897  GLU F O   1 
ATOM   7961 C CB  . GLU F 1 145 ? 15.492  -30.523 -3.431  1.00   50.08  ? 897  GLU F CB  1 
ATOM   7962 C CG  . GLU F 1 145 ? 16.547  -30.337 -4.555  1.00   56.33  ? 897  GLU F CG  1 
ATOM   7963 C CD  . GLU F 1 145 ? 17.485  -29.173 -4.307  1.00   53.37  ? 897  GLU F CD  1 
ATOM   7964 O OE1 . GLU F 1 145 ? 18.308  -28.887 -5.180  1.00   66.92  ? 897  GLU F OE1 1 
ATOM   7965 O OE2 . GLU F 1 145 ? 17.410  -28.565 -3.224  1.00   55.28  ? 897  GLU F OE2 1 
ATOM   7966 N N   . LYS F 1 146 ? 13.202  -29.693 -1.472  1.00   49.00  ? 898  LYS F N   1 
ATOM   7967 C CA  . LYS F 1 146 ? 12.128  -30.012 -0.551  1.00   46.71  ? 898  LYS F CA  1 
ATOM   7968 C C   . LYS F 1 146 ? 10.769  -29.381 -0.953  1.00   51.30  ? 898  LYS F C   1 
ATOM   7969 O O   . LYS F 1 146 ? 9.685   -29.998 -0.753  1.00   45.37  ? 898  LYS F O   1 
ATOM   7970 C CB  . LYS F 1 146 ? 12.563  -29.692 0.917   1.00   44.58  ? 898  LYS F CB  1 
ATOM   7971 C CG  . LYS F 1 146 ? 13.624  -30.669 1.429   1.00   42.65  ? 898  LYS F CG  1 
ATOM   7972 C CD  . LYS F 1 146 ? 13.996  -30.448 2.906   1.00   41.24  ? 898  LYS F CD  1 
ATOM   7973 C CE  . LYS F 1 146 ? 15.436  -30.777 3.187   1.00   49.71  ? 898  LYS F CE  1 
ATOM   7974 N NZ  . LYS F 1 146 ? 16.037  -30.041 4.377   1.00   39.72  ? 898  LYS F NZ  1 
ATOM   7975 N N   . THR F 1 147 ? 10.816  -28.172 -1.520  1.00   48.53  ? 899  THR F N   1 
ATOM   7976 C CA  . THR F 1 147 ? 9.614   -27.461 -1.817  1.00   47.61  ? 899  THR F CA  1 
ATOM   7977 C C   . THR F 1 147 ? 8.970   -28.127 -3.051  1.00   51.39  ? 899  THR F C   1 
ATOM   7978 O O   . THR F 1 147 ? 7.746   -28.157 -3.143  1.00   46.89  ? 899  THR F O   1 
ATOM   7979 C CB  . THR F 1 147 ? 9.862   -25.969 -2.003  1.00   50.61  ? 899  THR F CB  1 
ATOM   7980 O OG1 . THR F 1 147 ? 10.393  -25.419 -0.772  1.00   48.36  ? 899  THR F OG1 1 
ATOM   7981 C CG2 . THR F 1 147 ? 8.518   -25.264 -2.291  1.00   35.74  ? 899  THR F CG2 1 
ATOM   7982 N N   . ILE F 1 148 ? 9.805   -28.704 -3.922  1.00   46.83  ? 900  ILE F N   1 
ATOM   7983 C CA  . ILE F 1 148 ? 9.368   -29.442 -5.121  1.00   52.38  ? 900  ILE F CA  1 
ATOM   7984 C C   . ILE F 1 148 ? 8.767   -30.809 -4.784  1.00   52.82  ? 900  ILE F C   1 
ATOM   7985 O O   . ILE F 1 148 ? 7.709   -31.164 -5.320  1.00   50.99  ? 900  ILE F O   1 
ATOM   7986 C CB  . ILE F 1 148 ? 10.535  -29.630 -6.070  1.00   47.86  ? 900  ILE F CB  1 
ATOM   7987 C CG1 . ILE F 1 148 ? 10.891  -28.257 -6.603  1.00   42.95  ? 900  ILE F CG1 1 
ATOM   7988 C CG2 . ILE F 1 148 ? 10.202  -30.607 -7.150  1.00   63.39  ? 900  ILE F CG2 1 
ATOM   7989 C CD1 . ILE F 1 148 ? 11.967  -28.162 -7.756  1.00   40.78  ? 900  ILE F CD1 1 
ATOM   7990 N N   . ALA F 1 149 ? 9.434   -31.578 -3.920  1.00   51.78  ? 901  ALA F N   1 
ATOM   7991 C CA  . ALA F 1 149 ? 8.886   -32.843 -3.425  1.00   56.33  ? 901  ALA F CA  1 
ATOM   7992 C C   . ALA F 1 149 ? 7.516   -32.662 -2.739  1.00   59.54  ? 901  ALA F C   1 
ATOM   7993 O O   . ALA F 1 149 ? 6.571   -33.434 -2.993  1.00   63.85  ? 901  ALA F O   1 
ATOM   7994 C CB  . ALA F 1 149 ? 9.919   -33.621 -2.527  1.00   50.48  ? 901  ALA F CB  1 
ATOM   7995 N N   . ALA F 1 150 ? 7.366   -31.628 -1.927  1.00   55.47  ? 902  ALA F N   1 
ATOM   7996 C CA  . ALA F 1 150 ? 6.037   -31.254 -1.423  1.00   56.57  ? 902  ALA F CA  1 
ATOM   7997 C C   . ALA F 1 150 ? 5.007   -31.187 -2.560  1.00   54.91  ? 902  ALA F C   1 
ATOM   7998 O O   . ALA F 1 150 ? 3.952   -31.795 -2.466  1.00   57.14  ? 902  ALA F O   1 
ATOM   7999 C CB  . ALA F 1 150 ? 6.075   -29.895 -0.752  1.00   53.88  ? 902  ALA F CB  1 
ATOM   8000 N N   . LYS F 1 151 ? 5.287   -30.367 -3.572  1.00   53.95  ? 903  LYS F N   1 
ATOM   8001 C CA  . LYS F 1 151 ? 4.336   -30.128 -4.691  1.00   53.64  ? 903  LYS F CA  1 
ATOM   8002 C C   . LYS F 1 151 ? 4.004   -31.447 -5.386  1.00   56.86  ? 903  LYS F C   1 
ATOM   8003 O O   . LYS F 1 151 ? 2.860   -31.719 -5.714  1.00   65.31  ? 903  LYS F O   1 
ATOM   8004 C CB  . LYS F 1 151 ? 4.899   -29.110 -5.689  1.00   56.73  ? 903  LYS F CB  1 
ATOM   8005 C CG  . LYS F 1 151 ? 4.819   -27.594 -5.296  1.00   44.00  ? 903  LYS F CG  1 
ATOM   8006 C CD  . LYS F 1 151 ? 3.413   -27.053 -5.248  1.00   65.82  ? 903  LYS F CD  1 
ATOM   8007 C CE  . LYS F 1 151 ? 3.346   -25.495 -5.352  1.00   58.95  ? 903  LYS F CE  1 
ATOM   8008 N NZ  . LYS F 1 151 ? 3.572   -25.040 -6.727  1.00   42.98  ? 903  LYS F NZ  1 
ATOM   8009 N N   . ARG F 1 152 ? 5.011   -32.284 -5.561  1.00   55.60  ? 904  ARG F N   1 
ATOM   8010 C CA  . ARG F 1 152 ? 4.839   -33.618 -6.108  1.00   60.05  ? 904  ARG F CA  1 
ATOM   8011 C C   . ARG F 1 152 ? 3.749   -34.432 -5.388  1.00   57.94  ? 904  ARG F C   1 
ATOM   8012 O O   . ARG F 1 152 ? 2.874   -35.045 -6.006  1.00   53.27  ? 904  ARG F O   1 
ATOM   8013 C CB  . ARG F 1 152 ? 6.177   -34.358 -6.043  1.00   63.08  ? 904  ARG F CB  1 
ATOM   8014 C CG  . ARG F 1 152 ? 6.487   -35.156 -7.220  1.00   65.50  ? 904  ARG F CG  1 
ATOM   8015 C CD  . ARG F 1 152 ? 7.929   -34.963 -7.690  1.00   64.62  ? 904  ARG F CD  1 
ATOM   8016 N NE  . ARG F 1 152 ? 8.070   -35.677 -8.946  1.00   70.86  ? 904  ARG F NE  1 
ATOM   8017 C CZ  . ARG F 1 152 ? 7.954   -37.004 -9.086  1.00   76.75  ? 904  ARG F CZ  1 
ATOM   8018 N NH1 . ARG F 1 152 ? 7.700   -37.805 -8.046  1.00   82.80  ? 904  ARG F NH1 1 
ATOM   8019 N NH2 . ARG F 1 152 ? 8.071   -37.549 -10.284 1.00   67.54  ? 904  ARG F NH2 1 
ATOM   8020 N N   . ALA F 1 153 ? 3.762   -34.383 -4.090  1.00   50.72  ? 905  ALA F N   1 
ATOM   8021 C CA  . ALA F 1 153 ? 2.847   -35.130 -3.297  1.00   50.11  ? 905  ALA F CA  1 
ATOM   8022 C C   . ALA F 1 153 ? 1.625   -34.327 -2.960  1.00   48.19  ? 905  ALA F C   1 
ATOM   8023 O O   . ALA F 1 153 ? 0.938   -34.626 -2.055  1.00   54.28  ? 905  ALA F O   1 
ATOM   8024 C CB  . ALA F 1 153 ? 3.518   -35.582 -2.086  1.00   54.43  ? 905  ALA F CB  1 
ATOM   8025 N N   . GLY F 1 154 ? 1.385   -33.257 -3.660  1.00   54.29  ? 906  GLY F N   1 
ATOM   8026 C CA  . GLY F 1 154 ? 0.192   -32.515 -3.408  1.00   58.13  ? 906  GLY F CA  1 
ATOM   8027 C C   . GLY F 1 154 ? -0.041  -31.960 -2.043  1.00   60.13  ? 906  GLY F C   1 
ATOM   8028 O O   . GLY F 1 154 ? -1.144  -31.917 -1.578  1.00   60.06  ? 906  GLY F O   1 
ATOM   8029 N N   . VAL F 1 155 ? 1.013   -31.487 -1.414  1.00   58.90  ? 907  VAL F N   1 
ATOM   8030 C CA  . VAL F 1 155 ? 0.889   -30.847 -0.135  1.00   52.66  ? 907  VAL F CA  1 
ATOM   8031 C C   . VAL F 1 155 ? 0.720   -29.375 -0.350  1.00   50.93  ? 907  VAL F C   1 
ATOM   8032 O O   . VAL F 1 155 ? 1.245   -28.801 -1.243  1.00   56.26  ? 907  VAL F O   1 
ATOM   8033 C CB  . VAL F 1 155 ? 2.033   -31.178 0.725   1.00   59.32  ? 907  VAL F CB  1 
ATOM   8034 C CG1 . VAL F 1 155 ? 3.150   -31.621 -0.124  1.00   62.52  ? 907  VAL F CG1 1 
ATOM   8035 C CG2 . VAL F 1 155 ? 2.410   -30.018 1.551   1.00   51.24  ? 907  VAL F CG2 1 
ATOM   8036 N N   . THR F 1 156 ? -0.094  -28.805 0.488   1.00   49.23  ? 908  THR F N   1 
ATOM   8037 C CA  . THR F 1 156 ? -0.462  -27.445 0.327   1.00   58.69  ? 908  THR F CA  1 
ATOM   8038 C C   . THR F 1 156 ? 0.119   -26.532 1.360   1.00   53.52  ? 908  THR F C   1 
ATOM   8039 O O   . THR F 1 156 ? 0.341   -25.391 1.086   1.00   59.25  ? 908  THR F O   1 
ATOM   8040 C CB  . THR F 1 156 ? -1.954  -27.331 0.517   1.00   58.76  ? 908  THR F CB  1 
ATOM   8041 O OG1 . THR F 1 156 ? -2.498  -28.627 0.757   1.00   60.22  ? 908  THR F OG1 1 
ATOM   8042 C CG2 . THR F 1 156 ? -2.556  -26.752 -0.695  1.00   59.20  ? 908  THR F CG2 1 
ATOM   8043 N N   . CYS F 1 157 ? 0.326   -27.062 2.552   1.00   52.98  ? 909  CYS F N   1 
ATOM   8044 C CA  . CYS F 1 157 ? 0.831   -26.348 3.700   1.00   54.77  ? 909  CYS F CA  1 
ATOM   8045 C C   . CYS F 1 157 ? 2.180   -26.926 4.071   1.00   51.91  ? 909  CYS F C   1 
ATOM   8046 O O   . CYS F 1 157 ? 2.311   -28.086 4.312   1.00   46.33  ? 909  CYS F O   1 
ATOM   8047 C CB  . CYS F 1 157 ? -0.137  -26.534 4.842   1.00   53.26  ? 909  CYS F CB  1 
ATOM   8048 S SG  . CYS F 1 157 ? 0.130   -25.672 6.348   1.00   61.29  ? 909  CYS F SG  1 
ATOM   8049 N N   . ILE F 1 158 ? 3.171   -26.062 4.129   1.00   52.24  ? 910  ILE F N   1 
ATOM   8050 C CA  . ILE F 1 158 ? 4.526   -26.414 4.417   1.00   47.84  ? 910  ILE F CA  1 
ATOM   8051 C C   . ILE F 1 158 ? 5.134   -25.636 5.610   1.00   51.04  ? 910  ILE F C   1 
ATOM   8052 O O   . ILE F 1 158 ? 5.007   -24.463 5.725   1.00   49.64  ? 910  ILE F O   1 
ATOM   8053 C CB  . ILE F 1 158 ? 5.296   -26.231 3.165   1.00   48.47  ? 910  ILE F CB  1 
ATOM   8054 C CG1 . ILE F 1 158 ? 6.635   -26.815 3.284   1.00   51.58  ? 910  ILE F CG1 1 
ATOM   8055 C CG2 . ILE F 1 158 ? 5.518   -24.844 2.874   1.00   40.76  ? 910  ILE F CG2 1 
ATOM   8056 C CD1 . ILE F 1 158 ? 7.359   -26.557 2.115   1.00   53.41  ? 910  ILE F CD1 1 
ATOM   8057 N N   . VAL F 1 159 ? 5.782   -26.331 6.502   1.00   49.18  ? 911  VAL F N   1 
ATOM   8058 C CA  . VAL F 1 159 ? 6.356   -25.744 7.704   1.00   49.87  ? 911  VAL F CA  1 
ATOM   8059 C C   . VAL F 1 159 ? 7.900   -25.757 7.508   1.00   48.73  ? 911  VAL F C   1 
ATOM   8060 O O   . VAL F 1 159 ? 8.500   -26.840 7.341   1.00   40.54  ? 911  VAL F O   1 
ATOM   8061 C CB  . VAL F 1 159 ? 5.920   -26.524 8.928   1.00   49.16  ? 911  VAL F CB  1 
ATOM   8062 C CG1 . VAL F 1 159 ? 6.848   -26.306 10.157  1.00   39.00  ? 911  VAL F CG1 1 
ATOM   8063 C CG2 . VAL F 1 159 ? 4.441   -26.220 9.273   1.00   49.62  ? 911  VAL F CG2 1 
ATOM   8064 N N   . LEU F 1 160 ? 8.480   -24.547 7.412   1.00   46.95  ? 912  LEU F N   1 
ATOM   8065 C CA  . LEU F 1 160 ? 9.925   -24.323 7.263   1.00   42.69  ? 912  LEU F CA  1 
ATOM   8066 C C   . LEU F 1 160 ? 10.575  -23.526 8.449   1.00   44.12  ? 912  LEU F C   1 
ATOM   8067 O O   . LEU F 1 160 ? 9.921   -22.807 9.150   1.00   48.36  ? 912  LEU F O   1 
ATOM   8068 C CB  . LEU F 1 160 ? 10.227  -23.621 5.947   1.00   43.17  ? 912  LEU F CB  1 
ATOM   8069 C CG  . LEU F 1 160 ? 9.771   -24.146 4.586   1.00   43.01  ? 912  LEU F CG  1 
ATOM   8070 C CD1 . LEU F 1 160 ? 10.089  -23.156 3.523   1.00   39.58  ? 912  LEU F CD1 1 
ATOM   8071 C CD2 . LEU F 1 160 ? 10.368  -25.476 4.248   1.00   38.43  ? 912  LEU F CD2 1 
ATOM   8072 N N   . PRO F 1 161 ? 11.876  -23.705 8.692   1.00   44.75  ? 913  PRO F N   1 
ATOM   8073 C CA  . PRO F 1 161 ? 12.575  -22.810 9.588   1.00   42.91  ? 913  PRO F CA  1 
ATOM   8074 C C   . PRO F 1 161 ? 12.531  -21.358 9.070   1.00   42.92  ? 913  PRO F C   1 
ATOM   8075 O O   . PRO F 1 161 ? 12.562  -21.112 7.842   1.00   43.02  ? 913  PRO F O   1 
ATOM   8076 C CB  . PRO F 1 161 ? 14.033  -23.307 9.560   1.00   42.28  ? 913  PRO F CB  1 
ATOM   8077 C CG  . PRO F 1 161 ? 13.988  -24.674 9.125   1.00   32.64  ? 913  PRO F CG  1 
ATOM   8078 C CD  . PRO F 1 161 ? 12.785  -24.717 8.123   1.00   42.57  ? 913  PRO F CD  1 
ATOM   8079 N N   . ALA F 1 162 ? 12.388  -20.438 10.029  1.00   41.93  ? 914  ALA F N   1 
ATOM   8080 C CA  . ALA F 1 162 ? 12.300  -18.993 9.796   1.00   39.92  ? 914  ALA F CA  1 
ATOM   8081 C C   . ALA F 1 162 ? 13.592  -18.487 9.145   1.00   41.59  ? 914  ALA F C   1 
ATOM   8082 O O   . ALA F 1 162 ? 13.524  -17.651 8.279   1.00   46.19  ? 914  ALA F O   1 
ATOM   8083 C CB  . ALA F 1 162 ? 11.897  -18.221 11.129  1.00   42.20  ? 914  ALA F CB  1 
ATOM   8084 N N   . GLU F 1 163 ? 14.715  -19.103 9.449   1.00   46.55  ? 915  GLU F N   1 
ATOM   8085 C CA  . GLU F 1 163 ? 15.989  -18.765 8.843   1.00   44.59  ? 915  GLU F CA  1 
ATOM   8086 C C   . GLU F 1 163 ? 16.139  -19.255 7.388   1.00   48.71  ? 915  GLU F C   1 
ATOM   8087 O O   . GLU F 1 163 ? 17.086  -18.943 6.731   1.00   39.82  ? 915  GLU F O   1 
ATOM   8088 C CB  . GLU F 1 163 ? 17.171  -19.165 9.734   1.00   48.10  ? 915  GLU F CB  1 
ATOM   8089 C CG  . GLU F 1 163 ? 17.439  -18.253 10.943  1.00   54.88  ? 915  GLU F CG  1 
ATOM   8090 C CD  . GLU F 1 163 ? 18.678  -18.638 11.751  1.00   56.86  ? 915  GLU F CD  1 
ATOM   8091 O OE1 . GLU F 1 163 ? 19.788  -18.606 11.249  1.00   61.29  ? 915  GLU F OE1 1 
ATOM   8092 O OE2 . GLU F 1 163 ? 18.551  -18.987 12.909  1.00   62.93  ? 915  GLU F OE2 1 
ATOM   8093 N N   . ASN F 1 164 ? 15.206  -20.068 6.920   1.00   45.47  ? 916  ASN F N   1 
ATOM   8094 C CA  . ASN F 1 164 ? 15.179  -20.531 5.540   1.00   45.28  ? 916  ASN F CA  1 
ATOM   8095 C C   . ASN F 1 164 ? 14.217  -19.673 4.707   1.00   51.25  ? 916  ASN F C   1 
ATOM   8096 O O   . ASN F 1 164 ? 13.802  -20.037 3.655   1.00   54.31  ? 916  ASN F O   1 
ATOM   8097 C CB  . ASN F 1 164 ? 14.795  -21.983 5.448   1.00   45.90  ? 916  ASN F CB  1 
ATOM   8098 C CG  . ASN F 1 164 ? 15.924  -22.907 5.707   1.00   27.90  ? 916  ASN F CG  1 
ATOM   8099 O OD1 . ASN F 1 164 ? 15.835  -23.765 6.498   1.00   36.35  ? 916  ASN F OD1 1 
ATOM   8100 N ND2 . ASN F 1 164 ? 16.947  -22.758 5.000   1.00   37.38  ? 916  ASN F ND2 1 
ATOM   8101 N N   . LYS F 1 165 ? 13.804  -18.552 5.233   1.00   47.00  ? 917  LYS F N   1 
ATOM   8102 C CA  . LYS F 1 165 ? 12.904  -17.729 4.507   1.00   49.12  ? 917  LYS F CA  1 
ATOM   8103 C C   . LYS F 1 165 ? 13.509  -17.197 3.225   1.00   56.11  ? 917  LYS F C   1 
ATOM   8104 O O   . LYS F 1 165 ? 12.902  -17.308 2.228   1.00   49.08  ? 917  LYS F O   1 
ATOM   8105 C CB  . LYS F 1 165 ? 12.385  -16.642 5.426   1.00   47.47  ? 917  LYS F CB  1 
ATOM   8106 C CG  . LYS F 1 165 ? 11.475  -15.661 4.821   1.00   49.81  ? 917  LYS F CG  1 
ATOM   8107 C CD  . LYS F 1 165 ? 10.952  -14.725 5.861   1.00   56.34  ? 917  LYS F CD  1 
ATOM   8108 C CE  . LYS F 1 165 ? 10.619  -15.462 7.163   1.00   64.60  ? 917  LYS F CE  1 
ATOM   8109 N NZ  . LYS F 1 165 ? 9.870   -14.721 8.252   1.00   50.24  ? 917  LYS F NZ  1 
ATOM   8110 N N   . LYS F 1 166 ? 14.723  -16.679 3.224   1.00   54.37  ? 918  LYS F N   1 
ATOM   8111 C CA  . LYS F 1 166 ? 15.370  -16.240 1.985   1.00   54.73  ? 918  LYS F CA  1 
ATOM   8112 C C   . LYS F 1 166 ? 15.463  -17.383 0.952   1.00   50.42  ? 918  LYS F C   1 
ATOM   8113 O O   . LYS F 1 166 ? 15.258  -17.167 -0.219  1.00   43.22  ? 918  LYS F O   1 
ATOM   8114 C CB  . LYS F 1 166 ? 16.775  -15.634 2.271   1.00   59.56  ? 918  LYS F CB  1 
ATOM   8115 C CG  . LYS F 1 166 ? 17.687  -15.419 1.040   1.00   64.82  ? 918  LYS F CG  1 
ATOM   8116 C CD  . LYS F 1 166 ? 18.810  -14.310 1.273   1.00   64.52  ? 918  LYS F CD  1 
ATOM   8117 C CE  . LYS F 1 166 ? 19.952  -14.383 0.278   1.00   61.06  ? 918  LYS F CE  1 
ATOM   8118 N NZ  . LYS F 1 166 ? 19.588  -14.483 -1.212  1.00   46.13  ? 918  LYS F NZ  1 
ATOM   8119 N N   . ASP F 1 167 ? 15.824  -18.592 1.372   1.00   44.40  ? 919  ASP F N   1 
ATOM   8120 C CA  . ASP F 1 167 ? 15.897  -19.726 0.464   1.00   43.95  ? 919  ASP F CA  1 
ATOM   8121 C C   . ASP F 1 167 ? 14.552  -19.968 -0.211  1.00   44.80  ? 919  ASP F C   1 
ATOM   8122 O O   . ASP F 1 167 ? 14.485  -20.352 -1.384  1.00   47.23  ? 919  ASP F O   1 
ATOM   8123 C CB  . ASP F 1 167 ? 16.292  -20.973 1.256   1.00   49.52  ? 919  ASP F CB  1 
ATOM   8124 C CG  . ASP F 1 167 ? 17.653  -20.796 2.010   1.00   47.13  ? 919  ASP F CG  1 
ATOM   8125 O OD1 . ASP F 1 167 ? 18.706  -20.817 1.350   1.00   51.15  ? 919  ASP F OD1 1 
ATOM   8126 O OD2 . ASP F 1 167 ? 17.664  -20.650 3.248   1.00   42.95  ? 919  ASP F OD2 1 
ATOM   8127 N N   . PHE F 1 168 ? 13.467  -19.779 0.524   1.00   41.67  ? 920  PHE F N   1 
ATOM   8128 C CA  . PHE F 1 168 ? 12.169  -20.172 0.007   1.00   48.97  ? 920  PHE F CA  1 
ATOM   8129 C C   . PHE F 1 168 ? 11.748  -19.180 -1.073  1.00   52.56  ? 920  PHE F C   1 
ATOM   8130 O O   . PHE F 1 168 ? 11.374  -19.572 -2.179  1.00   45.01  ? 920  PHE F O   1 
ATOM   8131 C CB  . PHE F 1 168 ? 11.131  -20.255 1.123   1.00   47.00  ? 920  PHE F CB  1 
ATOM   8132 C CG  . PHE F 1 168 ? 9.808   -20.858 0.686   1.00   50.59  ? 920  PHE F CG  1 
ATOM   8133 C CD1 . PHE F 1 168 ? 9.708   -22.195 0.341   1.00   47.61  ? 920  PHE F CD1 1 
ATOM   8134 C CD2 . PHE F 1 168 ? 8.690   -20.084 0.590   1.00   39.74  ? 920  PHE F CD2 1 
ATOM   8135 C CE1 . PHE F 1 168 ? 8.513   -22.730 -0.067  1.00   53.50  ? 920  PHE F CE1 1 
ATOM   8136 C CE2 . PHE F 1 168 ? 7.480   -20.620 0.175   1.00   44.91  ? 920  PHE F CE2 1 
ATOM   8137 C CZ  . PHE F 1 168 ? 7.381   -21.914 -0.134  1.00   43.15  ? 920  PHE F CZ  1 
ATOM   8138 N N   . TYR F 1 169 ? 11.844  -17.892 -0.759  1.00   48.44  ? 921  TYR F N   1 
ATOM   8139 C CA  . TYR F 1 169 ? 11.413  -16.859 -1.682  1.00   51.41  ? 921  TYR F CA  1 
ATOM   8140 C C   . TYR F 1 169 ? 12.436  -16.527 -2.722  1.00   53.40  ? 921  TYR F C   1 
ATOM   8141 O O   . TYR F 1 169 ? 12.178  -15.706 -3.623  1.00   55.39  ? 921  TYR F O   1 
ATOM   8142 C CB  . TYR F 1 169 ? 11.052  -15.606 -0.895  1.00   53.36  ? 921  TYR F CB  1 
ATOM   8143 C CG  . TYR F 1 169 ? 9.750   -15.761 -0.209  1.00   51.78  ? 921  TYR F CG  1 
ATOM   8144 C CD1 . TYR F 1 169 ? 8.565   -15.889 -0.931  1.00   44.85  ? 921  TYR F CD1 1 
ATOM   8145 C CD2 . TYR F 1 169 ? 9.686   -15.772 1.172   1.00   54.51  ? 921  TYR F CD2 1 
ATOM   8146 C CE1 . TYR F 1 169 ? 7.325   -16.018 -0.236  1.00   39.13  ? 921  TYR F CE1 1 
ATOM   8147 C CE2 . TYR F 1 169 ? 8.473   -15.899 1.849   1.00   47.37  ? 921  TYR F CE2 1 
ATOM   8148 C CZ  . TYR F 1 169 ? 7.304   -16.046 1.132   1.00   44.97  ? 921  TYR F CZ  1 
ATOM   8149 O OH  . TYR F 1 169 ? 6.117   -16.158 1.854   1.00   49.33  ? 921  TYR F OH  1 
ATOM   8150 N N   . ASP F 1 170 ? 13.607  -17.142 -2.608  1.00   49.90  ? 922  ASP F N   1 
ATOM   8151 C CA  . ASP F 1 170 ? 14.563  -17.141 -3.684  1.00   57.65  ? 922  ASP F CA  1 
ATOM   8152 C C   . ASP F 1 170 ? 14.207  -18.137 -4.806  1.00   55.22  ? 922  ASP F C   1 
ATOM   8153 O O   . ASP F 1 170 ? 14.840  -18.100 -5.825  1.00   61.90  ? 922  ASP F O   1 
ATOM   8154 C CB  . ASP F 1 170 ? 16.009  -17.404 -3.189  1.00   57.37  ? 922  ASP F CB  1 
ATOM   8155 C CG  . ASP F 1 170 ? 16.668  -16.161 -2.545  1.00   63.10  ? 922  ASP F CG  1 
ATOM   8156 O OD1 . ASP F 1 170 ? 16.119  -15.045 -2.649  1.00   59.71  ? 922  ASP F OD1 1 
ATOM   8157 O OD2 . ASP F 1 170 ? 17.740  -16.318 -1.905  1.00   66.04  ? 922  ASP F OD2 1 
ATOM   8158 N N   . LEU F 1 171 ? 13.204  -19.004 -4.631  1.00   56.37  ? 923  LEU F N   1 
ATOM   8159 C CA  . LEU F 1 171 ? 12.875  -20.005 -5.649  1.00   56.30  ? 923  LEU F CA  1 
ATOM   8160 C C   . LEU F 1 171 ? 11.989  -19.365 -6.700  1.00   49.43  ? 923  LEU F C   1 
ATOM   8161 O O   . LEU F 1 171 ? 11.284  -18.367 -6.425  1.00   54.68  ? 923  LEU F O   1 
ATOM   8162 C CB  . LEU F 1 171 ? 12.136  -21.193 -5.004  1.00   55.43  ? 923  LEU F CB  1 
ATOM   8163 C CG  . LEU F 1 171 ? 12.873  -22.062 -3.969  1.00   43.51  ? 923  LEU F CG  1 
ATOM   8164 C CD1 . LEU F 1 171 ? 11.901  -23.028 -3.352  1.00   49.05  ? 923  LEU F CD1 1 
ATOM   8165 C CD2 . LEU F 1 171 ? 14.036  -22.779 -4.613  1.00   53.91  ? 923  LEU F CD2 1 
ATOM   8166 N N   . ALA F 1 172 ? 11.989  -19.928 -7.901  1.00   59.28  ? 924  ALA F N   1 
ATOM   8167 C CA  . ALA F 1 172 ? 11.019  -19.472 -8.937  1.00   56.81  ? 924  ALA F CA  1 
ATOM   8168 C C   . ALA F 1 172 ? 9.598   -19.210 -8.388  1.00   57.51  ? 924  ALA F C   1 
ATOM   8169 O O   . ALA F 1 172 ? 9.020   -20.004 -7.646  1.00   53.40  ? 924  ALA F O   1 
ATOM   8170 C CB  . ALA F 1 172 ? 10.967  -20.454 -10.114 1.00   58.95  ? 924  ALA F CB  1 
ATOM   8171 N N   . ALA F 1 173 ? 9.029   -18.071 -8.758  1.00   60.62  ? 925  ALA F N   1 
ATOM   8172 C CA  . ALA F 1 173 ? 7.682   -17.728 -8.332  1.00   59.36  ? 925  ALA F CA  1 
ATOM   8173 C C   . ALA F 1 173 ? 6.689   -18.865 -8.695  1.00   61.45  ? 925  ALA F C   1 
ATOM   8174 O O   . ALA F 1 173 ? 5.724   -19.112 -7.977  1.00   68.06  ? 925  ALA F O   1 
ATOM   8175 C CB  . ALA F 1 173 ? 7.241   -16.371 -8.953  1.00   57.64  ? 925  ALA F CB  1 
ATOM   8176 N N   . PHE F 1 174 ? 6.948   -19.548 -9.814  1.00   66.91  ? 926  PHE F N   1 
ATOM   8177 C CA  . PHE F 1 174 ? 6.104   -20.644 -10.265 1.00   65.35  ? 926  PHE F CA  1 
ATOM   8178 C C   . PHE F 1 174 ? 6.026   -21.720 -9.215  1.00   61.28  ? 926  PHE F C   1 
ATOM   8179 O O   . PHE F 1 174 ? 4.963   -22.267 -8.947  1.00   58.74  ? 926  PHE F O   1 
ATOM   8180 C CB  . PHE F 1 174 ? 6.652   -21.246 -11.547 1.00   69.91  ? 926  PHE F CB  1 
ATOM   8181 C CG  . PHE F 1 174 ? 5.745   -22.280 -12.161 1.00   71.93  ? 926  PHE F CG  1 
ATOM   8182 C CD1 . PHE F 1 174 ? 4.526   -21.909 -12.682 1.00   73.62  ? 926  PHE F CD1 1 
ATOM   8183 C CD2 . PHE F 1 174 ? 6.113   -23.630 -12.192 1.00   68.23  ? 926  PHE F CD2 1 
ATOM   8184 C CE1 . PHE F 1 174 ? 3.683   -22.866 -13.265 1.00   78.62  ? 926  PHE F CE1 1 
ATOM   8185 C CE2 . PHE F 1 174 ? 5.281   -24.596 -12.769 1.00   71.42  ? 926  PHE F CE2 1 
ATOM   8186 C CZ  . PHE F 1 174 ? 4.070   -24.213 -13.309 1.00   73.68  ? 926  PHE F CZ  1 
ATOM   8187 N N   . ILE F 1 175 ? 7.161   -21.998 -8.598  1.00   61.72  ? 927  ILE F N   1 
ATOM   8188 C CA  . ILE F 1 175 ? 7.215   -23.022 -7.582  1.00   60.04  ? 927  ILE F CA  1 
ATOM   8189 C C   . ILE F 1 175 ? 6.425   -22.549 -6.393  1.00   58.06  ? 927  ILE F C   1 
ATOM   8190 O O   . ILE F 1 175 ? 5.498   -23.190 -5.960  1.00   60.01  ? 927  ILE F O   1 
ATOM   8191 C CB  . ILE F 1 175 ? 8.641   -23.376 -7.192  1.00   60.95  ? 927  ILE F CB  1 
ATOM   8192 C CG1 . ILE F 1 175 ? 9.409   -23.874 -8.403  1.00   57.54  ? 927  ILE F CG1 1 
ATOM   8193 C CG2 . ILE F 1 175 ? 8.639   -24.445 -6.080  1.00   52.92  ? 927  ILE F CG2 1 
ATOM   8194 C CD1 . ILE F 1 175 ? 10.875  -24.109 -8.170  1.00   53.59  ? 927  ILE F CD1 1 
ATOM   8195 N N   . THR F 1 176 ? 6.733   -21.371 -5.910  1.00   62.55  ? 928  THR F N   1 
ATOM   8196 C CA  . THR F 1 176 ? 6.235   -20.993 -4.612  1.00   60.71  ? 928  THR F CA  1 
ATOM   8197 C C   . THR F 1 176 ? 4.749   -20.568 -4.626  1.00   64.86  ? 928  THR F C   1 
ATOM   8198 O O   . THR F 1 176 ? 4.060   -20.688 -3.614  1.00   59.41  ? 928  THR F O   1 
ATOM   8199 C CB  . THR F 1 176 ? 7.078   -19.889 -4.040  1.00   62.91  ? 928  THR F CB  1 
ATOM   8200 O OG1 . THR F 1 176 ? 8.372   -20.414 -3.652  1.00   60.29  ? 928  THR F OG1 1 
ATOM   8201 C CG2 . THR F 1 176 ? 6.367   -19.290 -2.849  1.00   64.24  ? 928  THR F CG2 1 
ATOM   8202 N N   . GLU F 1 177 ? 4.255   -20.097 -5.768  1.00   63.33  ? 929  GLU F N   1 
ATOM   8203 C CA  . GLU F 1 177 ? 2.883   -19.578 -5.834  1.00   66.29  ? 929  GLU F CA  1 
ATOM   8204 C C   . GLU F 1 177 ? 1.839   -20.658 -5.467  1.00   61.71  ? 929  GLU F C   1 
ATOM   8205 O O   . GLU F 1 177 ? 1.960   -21.813 -5.871  1.00   62.51  ? 929  GLU F O   1 
ATOM   8206 C CB  . GLU F 1 177 ? 2.592   -18.939 -7.209  1.00   71.72  ? 929  GLU F CB  1 
ATOM   8207 C CG  . GLU F 1 177 ? 1.466   -17.889 -7.182  1.00   75.93  ? 929  GLU F CG  1 
ATOM   8208 C CD  . GLU F 1 177 ? 0.113   -18.430 -7.653  1.00   83.37  ? 929  GLU F CD  1 
ATOM   8209 O OE1 . GLU F 1 177 ? -0.910  -18.308 -6.893  1.00   67.14  ? 929  GLU F OE1 1 
ATOM   8210 O OE2 . GLU F 1 177 ? 0.092   -18.967 -8.801  1.00   76.66  ? 929  GLU F OE2 1 
ATOM   8211 N N   . GLY F 1 178 ? 0.853   -20.250 -4.661  1.00   56.83  ? 930  GLY F N   1 
ATOM   8212 C CA  . GLY F 1 178 ? -0.164  -21.120 -4.134  1.00   60.39  ? 930  GLY F CA  1 
ATOM   8213 C C   . GLY F 1 178 ? 0.189   -22.014 -2.959  1.00   62.08  ? 930  GLY F C   1 
ATOM   8214 O O   . GLY F 1 178 ? -0.678  -22.700 -2.423  1.00   64.88  ? 930  GLY F O   1 
ATOM   8215 N N   . LEU F 1 179 ? 1.451   -22.018 -2.540  1.00   59.37  ? 931  LEU F N   1 
ATOM   8216 C CA  . LEU F 1 179 ? 1.851   -22.763 -1.351  1.00   59.96  ? 931  LEU F CA  1 
ATOM   8217 C C   . LEU F 1 179 ? 1.638   -21.941 -0.072  1.00   61.03  ? 931  LEU F C   1 
ATOM   8218 O O   . LEU F 1 179 ? 2.221   -20.858 0.106   1.00   64.64  ? 931  LEU F O   1 
ATOM   8219 C CB  . LEU F 1 179 ? 3.322   -23.174 -1.478  1.00   59.04  ? 931  LEU F CB  1 
ATOM   8220 C CG  . LEU F 1 179 ? 3.818   -24.556 -1.141  1.00   57.06  ? 931  LEU F CG  1 
ATOM   8221 C CD1 . LEU F 1 179 ? 3.059   -25.720 -1.838  1.00   55.94  ? 931  LEU F CD1 1 
ATOM   8222 C CD2 . LEU F 1 179 ? 5.259   -24.581 -1.538  1.00   54.99  ? 931  LEU F CD2 1 
ATOM   8223 N N   . GLU F 1 180 ? 0.800   -22.463 0.822   1.00   57.32  ? 932  GLU F N   1 
ATOM   8224 C CA  . GLU F 1 180 ? 0.705   -21.950 2.172   1.00   57.09  ? 932  GLU F CA  1 
ATOM   8225 C C   . GLU F 1 180 ? 1.973   -22.303 2.942   1.00   59.04  ? 932  GLU F C   1 
ATOM   8226 O O   . GLU F 1 180 ? 2.313   -23.493 3.035   1.00   55.89  ? 932  GLU F O   1 
ATOM   8227 C CB  . GLU F 1 180 ? -0.463  -22.604 2.907   1.00   56.10  ? 932  GLU F CB  1 
ATOM   8228 C CG  . GLU F 1 180 ? -0.960  -21.800 4.119   1.00   60.33  ? 932  GLU F CG  1 
ATOM   8229 C CD  . GLU F 1 180 ? -2.193  -22.427 4.763   1.00   67.80  ? 932  GLU F CD  1 
ATOM   8230 O OE1 . GLU F 1 180 ? -3.218  -22.588 4.061   1.00   65.49  ? 932  GLU F OE1 1 
ATOM   8231 O OE2 . GLU F 1 180 ? -2.143  -22.718 5.976   1.00   60.16  ? 932  GLU F OE2 1 
ATOM   8232 N N   . VAL F 1 181 ? 2.654   -21.282 3.486   1.00   58.49  ? 933  VAL F N   1 
ATOM   8233 C CA  . VAL F 1 181 ? 3.971   -21.439 4.129   1.00   54.24  ? 933  VAL F CA  1 
ATOM   8234 C C   . VAL F 1 181 ? 3.910   -20.954 5.555   1.00   51.55  ? 933  VAL F C   1 
ATOM   8235 O O   . VAL F 1 181 ? 3.297   -19.940 5.841   1.00   49.95  ? 933  VAL F O   1 
ATOM   8236 C CB  . VAL F 1 181 ? 5.124   -20.624 3.430   1.00   52.02  ? 933  VAL F CB  1 
ATOM   8237 C CG1 . VAL F 1 181 ? 6.382   -21.479 3.298   1.00   49.07  ? 933  VAL F CG1 1 
ATOM   8238 C CG2 . VAL F 1 181 ? 4.722   -20.113 2.076   1.00   59.87  ? 933  VAL F CG2 1 
ATOM   8239 N N   . HIS F 1 182 ? 4.566   -21.693 6.442   1.00   50.35  ? 934  HIS F N   1 
ATOM   8240 C CA  . HIS F 1 182 ? 4.790   -21.259 7.809   1.00   46.71  ? 934  HIS F CA  1 
ATOM   8241 C C   . HIS F 1 182 ? 6.262   -21.316 8.230   1.00   50.09  ? 934  HIS F C   1 
ATOM   8242 O O   . HIS F 1 182 ? 6.908   -22.406 8.294   1.00   48.79  ? 934  HIS F O   1 
ATOM   8243 C CB  . HIS F 1 182 ? 3.922   -22.045 8.784   1.00   45.57  ? 934  HIS F CB  1 
ATOM   8244 C CG  . HIS F 1 182 ? 2.488   -21.671 8.692   1.00   57.27  ? 934  HIS F CG  1 
ATOM   8245 N ND1 . HIS F 1 182 ? 1.497   -22.581 8.432   1.00   56.07  ? 934  HIS F ND1 1 
ATOM   8246 C CD2 . HIS F 1 182 ? 1.894   -20.457 8.705   1.00   61.65  ? 934  HIS F CD2 1 
ATOM   8247 C CE1 . HIS F 1 182 ? 0.340   -21.957 8.353   1.00   69.18  ? 934  HIS F CE1 1 
ATOM   8248 N NE2 . HIS F 1 182 ? 0.557   -20.664 8.498   1.00   61.35  ? 934  HIS F NE2 1 
ATOM   8249 N N   . PHE F 1 183 ? 6.771   -20.131 8.545   1.00   43.90  ? 935  PHE F N   1 
ATOM   8250 C CA  . PHE F 1 183 ? 8.155   -19.979 8.969   1.00   46.31  ? 935  PHE F CA  1 
ATOM   8251 C C   . PHE F 1 183 ? 8.165   -19.889 10.438  1.00   40.35  ? 935  PHE F C   1 
ATOM   8252 O O   . PHE F 1 183 ? 7.632   -18.935 10.999  1.00   46.92  ? 935  PHE F O   1 
ATOM   8253 C CB  . PHE F 1 183 ? 8.701   -18.707 8.356   1.00   42.90  ? 935  PHE F CB  1 
ATOM   8254 C CG  . PHE F 1 183 ? 8.717   -18.736 6.864   1.00   39.32  ? 935  PHE F CG  1 
ATOM   8255 C CD1 . PHE F 1 183 ? 9.677   -19.423 6.206   1.00   41.65  ? 935  PHE F CD1 1 
ATOM   8256 C CD2 . PHE F 1 183 ? 7.744   -18.067 6.109   1.00   47.02  ? 935  PHE F CD2 1 
ATOM   8257 C CE1 . PHE F 1 183 ? 9.710   -19.450 4.840   1.00   38.16  ? 935  PHE F CE1 1 
ATOM   8258 C CE2 . PHE F 1 183 ? 7.799   -18.094 4.781   1.00   46.47  ? 935  PHE F CE2 1 
ATOM   8259 C CZ  . PHE F 1 183 ? 8.780   -18.822 4.149   1.00   40.01  ? 935  PHE F CZ  1 
ATOM   8260 N N   . VAL F 1 184 ? 8.839   -20.832 11.092  1.00   45.67  ? 936  VAL F N   1 
ATOM   8261 C CA  . VAL F 1 184 ? 8.728   -21.029 12.556  1.00   39.11  ? 936  VAL F CA  1 
ATOM   8262 C C   . VAL F 1 184 ? 10.077  -20.936 13.248  1.00   37.60  ? 936  VAL F C   1 
ATOM   8263 O O   . VAL F 1 184 ? 11.112  -21.265 12.643  1.00   46.60  ? 936  VAL F O   1 
ATOM   8264 C CB  . VAL F 1 184 ? 8.169   -22.426 12.836  1.00   39.96  ? 936  VAL F CB  1 
ATOM   8265 C CG1 . VAL F 1 184 ? 6.725   -22.402 12.345  1.00   40.86  ? 936  VAL F CG1 1 
ATOM   8266 C CG2 . VAL F 1 184 ? 9.044   -23.506 12.082  1.00   30.93  ? 936  VAL F CG2 1 
ATOM   8267 N N   . GLU F 1 185 ? 10.099  -20.511 14.504  1.00   46.84  ? 937  GLU F N   1 
ATOM   8268 C CA  . GLU F 1 185 ? 11.358  -20.372 15.247  1.00   38.81  ? 937  GLU F CA  1 
ATOM   8269 C C   . GLU F 1 185 ? 11.445  -21.307 16.420  1.00   41.48  ? 937  GLU F C   1 
ATOM   8270 O O   . GLU F 1 185 ? 12.517  -21.566 16.917  1.00   38.46  ? 937  GLU F O   1 
ATOM   8271 C CB  . GLU F 1 185 ? 11.530  -18.901 15.751  1.00   48.05  ? 937  GLU F CB  1 
ATOM   8272 C CG  . GLU F 1 185 ? 11.630  -17.847 14.687  1.00   58.11  ? 937  GLU F CG  1 
ATOM   8273 C CD  . GLU F 1 185 ? 11.813  -16.410 15.241  1.00   72.53  ? 937  GLU F CD  1 
ATOM   8274 O OE1 . GLU F 1 185 ? 12.837  -15.775 14.907  1.00   64.45  ? 937  GLU F OE1 1 
ATOM   8275 O OE2 . GLU F 1 185 ? 10.944  -15.925 16.011  1.00   56.00  ? 937  GLU F OE2 1 
ATOM   8276 N N   . HIS F 1 186 ? 10.315  -21.839 16.865  1.00   40.67  ? 938  HIS F N   1 
ATOM   8277 C CA  . HIS F 1 186 ? 10.296  -22.628 18.033  1.00   40.41  ? 938  HIS F CA  1 
ATOM   8278 C C   . HIS F 1 186 ? 9.354   -23.791 17.828  1.00   42.18  ? 938  HIS F C   1 
ATOM   8279 O O   . HIS F 1 186 ? 8.279   -23.597 17.267  1.00   37.23  ? 938  HIS F O   1 
ATOM   8280 C CB  . HIS F 1 186 ? 9.793   -21.830 19.237  1.00   44.02  ? 938  HIS F CB  1 
ATOM   8281 C CG  . HIS F 1 186 ? 10.015  -22.556 20.529  1.00   44.40  ? 938  HIS F CG  1 
ATOM   8282 N ND1 . HIS F 1 186 ? 11.101  -22.306 21.361  1.00   52.63  ? 938  HIS F ND1 1 
ATOM   8283 C CD2 . HIS F 1 186 ? 9.357   -23.598 21.084  1.00   34.04  ? 938  HIS F CD2 1 
ATOM   8284 C CE1 . HIS F 1 186 ? 11.049  -23.125 22.398  1.00   52.18  ? 938  HIS F CE1 1 
ATOM   8285 N NE2 . HIS F 1 186 ? 10.001  -23.929 22.251  1.00   44.15  ? 938  HIS F NE2 1 
ATOM   8286 N N   . TYR F 1 187 ? 9.682   -24.985 18.339  1.00   35.25  ? 939  TYR F N   1 
ATOM   8287 C CA  . TYR F 1 187 ? 8.761   -26.106 18.088  1.00   33.54  ? 939  TYR F CA  1 
ATOM   8288 C C   . TYR F 1 187 ? 7.293   -25.795 18.428  1.00   41.16  ? 939  TYR F C   1 
ATOM   8289 O O   . TYR F 1 187 ? 6.401   -26.348 17.851  1.00   41.37  ? 939  TYR F O   1 
ATOM   8290 C CB  . TYR F 1 187 ? 9.162   -27.382 18.899  1.00   31.37  ? 939  TYR F CB  1 
ATOM   8291 C CG  . TYR F 1 187 ? 8.245   -28.496 18.504  1.00   37.87  ? 939  TYR F CG  1 
ATOM   8292 C CD1 . TYR F 1 187 ? 8.341   -29.062 17.214  1.00   44.26  ? 939  TYR F CD1 1 
ATOM   8293 C CD2 . TYR F 1 187 ? 7.207   -28.881 19.326  1.00   32.25  ? 939  TYR F CD2 1 
ATOM   8294 C CE1 . TYR F 1 187 ? 7.460   -30.072 16.805  1.00   48.70  ? 939  TYR F CE1 1 
ATOM   8295 C CE2 . TYR F 1 187 ? 6.295   -29.879 18.898  1.00   48.18  ? 939  TYR F CE2 1 
ATOM   8296 C CZ  . TYR F 1 187 ? 6.452   -30.454 17.637  1.00   40.96  ? 939  TYR F CZ  1 
ATOM   8297 O OH  . TYR F 1 187 ? 5.587   -31.393 17.173  1.00   42.45  ? 939  TYR F OH  1 
ATOM   8298 N N   . ARG F 1 188 ? 7.043   -25.014 19.443  1.00   44.00  ? 940  ARG F N   1 
ATOM   8299 C CA  . ARG F 1 188 ? 5.656   -24.775 19.879  1.00   43.19  ? 940  ARG F CA  1 
ATOM   8300 C C   . ARG F 1 188 ? 4.813   -24.076 18.839  1.00   47.57  ? 940  ARG F C   1 
ATOM   8301 O O   . ARG F 1 188 ? 3.608   -24.327 18.772  1.00   48.93  ? 940  ARG F O   1 
ATOM   8302 C CB  . ARG F 1 188 ? 5.630   -24.107 21.261  1.00   50.63  ? 940  ARG F CB  1 
ATOM   8303 C CG  . ARG F 1 188 ? 4.830   -22.854 21.330  1.00   48.86  ? 940  ARG F CG  1 
ATOM   8304 C CD  . ARG F 1 188 ? 4.054   -22.788 22.555  1.00   63.42  ? 940  ARG F CD  1 
ATOM   8305 N NE  . ARG F 1 188 ? 2.700   -23.276 22.344  1.00   69.06  ? 940  ARG F NE  1 
ATOM   8306 C CZ  . ARG F 1 188 ? 2.296   -24.540 22.459  1.00   64.88  ? 940  ARG F CZ  1 
ATOM   8307 N NH1 . ARG F 1 188 ? 3.137   -25.520 22.782  1.00   64.18  ? 940  ARG F NH1 1 
ATOM   8308 N NH2 . ARG F 1 188 ? 1.003   -24.827 22.272  1.00   74.64  ? 940  ARG F NH2 1 
ATOM   8309 N N   . GLU F 1 189 ? 5.425   -23.279 17.955  1.00   43.89  ? 941  GLU F N   1 
ATOM   8310 C CA  . GLU F 1 189 ? 4.745   -22.821 16.751  1.00   46.19  ? 941  GLU F CA  1 
ATOM   8311 C C   . GLU F 1 189 ? 4.384   -23.978 15.863  1.00   48.91  ? 941  GLU F C   1 
ATOM   8312 O O   . GLU F 1 189 ? 3.295   -23.982 15.319  1.00   46.02  ? 941  GLU F O   1 
ATOM   8313 C CB  . GLU F 1 189 ? 5.590   -21.834 15.969  1.00   48.00  ? 941  GLU F CB  1 
ATOM   8314 C CG  . GLU F 1 189 ? 5.851   -20.527 16.805  1.00   43.02  ? 941  GLU F CG  1 
ATOM   8315 C CD  . GLU F 1 189 ? 6.958   -19.718 16.208  1.00   40.41  ? 941  GLU F CD  1 
ATOM   8316 O OE1 . GLU F 1 189 ? 8.093   -19.785 16.722  1.00   60.40  ? 941  GLU F OE1 1 
ATOM   8317 O OE2 . GLU F 1 189 ? 6.724   -19.065 15.186  1.00   66.77  ? 941  GLU F OE2 1 
ATOM   8318 N N   . ILE F 1 190 ? 5.278   -24.972 15.726  1.00   44.83  ? 942  ILE F N   1 
ATOM   8319 C CA  . ILE F 1 190 ? 4.959   -26.090 14.877  1.00   50.88  ? 942  ILE F CA  1 
ATOM   8320 C C   . ILE F 1 190 ? 3.758   -26.876 15.454  1.00   47.38  ? 942  ILE F C   1 
ATOM   8321 O O   . ILE F 1 190 ? 2.845   -27.290 14.745  1.00   47.48  ? 942  ILE F O   1 
ATOM   8322 C CB  . ILE F 1 190 ? 6.212   -27.050 14.683  1.00   44.95  ? 942  ILE F CB  1 
ATOM   8323 C CG1 . ILE F 1 190 ? 7.306   -26.410 13.834  1.00   43.67  ? 942  ILE F CG1 1 
ATOM   8324 C CG2 . ILE F 1 190 ? 5.780   -28.276 14.078  1.00   42.66  ? 942  ILE F CG2 1 
ATOM   8325 C CD1 . ILE F 1 190 ? 8.551   -27.350 13.632  1.00   35.83  ? 942  ILE F CD1 1 
ATOM   8326 N N   . PHE F 1 191 ? 3.799   -27.108 16.751  1.00   54.24  ? 943  PHE F N   1 
ATOM   8327 C CA  . PHE F 1 191 ? 2.744   -27.803 17.488  1.00   49.41  ? 943  PHE F CA  1 
ATOM   8328 C C   . PHE F 1 191 ? 1.354   -27.199 17.272  1.00   56.24  ? 943  PHE F C   1 
ATOM   8329 O O   . PHE F 1 191 ? 0.366   -27.949 17.136  1.00   51.66  ? 943  PHE F O   1 
ATOM   8330 C CB  . PHE F 1 191 ? 3.115   -27.757 18.962  1.00   50.22  ? 943  PHE F CB  1 
ATOM   8331 C CG  . PHE F 1 191 ? 2.361   -28.657 19.810  1.00   44.88  ? 943  PHE F CG  1 
ATOM   8332 C CD1 . PHE F 1 191 ? 1.533   -28.165 20.791  1.00   46.43  ? 943  PHE F CD1 1 
ATOM   8333 C CD2 . PHE F 1 191 ? 2.542   -30.032 19.723  1.00   53.90  ? 943  PHE F CD2 1 
ATOM   8334 C CE1 . PHE F 1 191 ? 0.875   -29.005 21.613  1.00   46.58  ? 943  PHE F CE1 1 
ATOM   8335 C CE2 . PHE F 1 191 ? 1.848   -30.880 20.575  1.00   50.02  ? 943  PHE F CE2 1 
ATOM   8336 C CZ  . PHE F 1 191 ? 1.031   -30.377 21.491  1.00   48.10  ? 943  PHE F CZ  1 
ATOM   8337 N N   . ASP F 1 192 ? 1.272   -25.869 17.244  1.00   56.34  ? 944  ASP F N   1 
ATOM   8338 C CA  . ASP F 1 192 ? -0.040  -25.170 17.184  1.00   58.71  ? 944  ASP F CA  1 
ATOM   8339 C C   . ASP F 1 192 ? -0.595  -25.321 15.782  1.00   59.29  ? 944  ASP F C   1 
ATOM   8340 O O   . ASP F 1 192 ? -1.802  -25.452 15.608  1.00   68.93  ? 944  ASP F O   1 
ATOM   8341 C CB  . ASP F 1 192 ? 0.062   -23.667 17.596  1.00   56.84  ? 944  ASP F CB  1 
ATOM   8342 C CG  . ASP F 1 192 ? 0.238   -23.466 19.088  1.00   63.63  ? 944  ASP F CG  1 
ATOM   8343 O OD1 . ASP F 1 192 ? -0.192  -24.356 19.836  1.00   63.28  ? 944  ASP F OD1 1 
ATOM   8344 O OD2 . ASP F 1 192 ? 0.808   -22.425 19.533  1.00   59.37  ? 944  ASP F OD2 1 
ATOM   8345 N N   . ILE F 1 193 ? 0.281   -25.371 14.785  1.00   56.87  ? 945  ILE F N   1 
ATOM   8346 C CA  . ILE F 1 193 ? -0.123  -25.633 13.405  1.00   54.47  ? 945  ILE F CA  1 
ATOM   8347 C C   . ILE F 1 193 ? -0.533  -27.068 13.172  1.00   56.35  ? 945  ILE F C   1 
ATOM   8348 O O   . ILE F 1 193 ? -1.513  -27.336 12.498  1.00   55.81  ? 945  ILE F O   1 
ATOM   8349 C CB  . ILE F 1 193 ? 1.017   -25.356 12.416  1.00   50.20  ? 945  ILE F CB  1 
ATOM   8350 C CG1 . ILE F 1 193 ? 1.261   -23.851 12.266  1.00   50.29  ? 945  ILE F CG1 1 
ATOM   8351 C CG2 . ILE F 1 193 ? 0.709   -25.967 11.074  1.00   44.90  ? 945  ILE F CG2 1 
ATOM   8352 C CD1 . ILE F 1 193 ? 2.717   -23.498 11.962  1.00   49.16  ? 945  ILE F CD1 1 
ATOM   8353 N N   . ALA F 1 194 ? 0.248   -27.984 13.721  1.00   57.44  ? 946  ALA F N   1 
ATOM   8354 C CA  . ALA F 1 194 ? 0.114   -29.404 13.407  1.00   58.49  ? 946  ALA F CA  1 
ATOM   8355 C C   . ALA F 1 194 ? -1.112  -30.016 14.069  1.00   55.34  ? 946  ALA F C   1 
ATOM   8356 O O   . ALA F 1 194 ? -1.727  -30.929 13.525  1.00   60.49  ? 946  ALA F O   1 
ATOM   8357 C CB  . ALA F 1 194 ? 1.417   -30.166 13.828  1.00   46.38  ? 946  ALA F CB  1 
ATOM   8358 N N   . PHE F 1 195 ? -1.449  -29.504 15.247  1.00   59.57  ? 947  PHE F N   1 
ATOM   8359 C CA  . PHE F 1 195 ? -2.540  -29.983 16.068  1.00   59.27  ? 947  PHE F CA  1 
ATOM   8360 C C   . PHE F 1 195 ? -3.446  -28.810 16.461  1.00   61.10  ? 947  PHE F C   1 
ATOM   8361 O O   . PHE F 1 195 ? -3.615  -28.494 17.665  1.00   55.00  ? 947  PHE F O   1 
ATOM   8362 C CB  . PHE F 1 195 ? -1.984  -30.645 17.323  1.00   57.66  ? 947  PHE F CB  1 
ATOM   8363 C CG  . PHE F 1 195 ? -1.003  -31.771 17.034  1.00   62.89  ? 947  PHE F CG  1 
ATOM   8364 C CD1 . PHE F 1 195 ? -1.426  -32.932 16.434  1.00   59.71  ? 947  PHE F CD1 1 
ATOM   8365 C CD2 . PHE F 1 195 ? 0.342   -31.645 17.364  1.00   46.13  ? 947  PHE F CD2 1 
ATOM   8366 C CE1 . PHE F 1 195 ? -0.539  -33.952 16.147  1.00   57.75  ? 947  PHE F CE1 1 
ATOM   8367 C CE2 . PHE F 1 195 ? 1.226   -32.674 17.126  1.00   52.44  ? 947  PHE F CE2 1 
ATOM   8368 C CZ  . PHE F 1 195 ? 0.796   -33.825 16.520  1.00   57.76  ? 947  PHE F CZ  1 
ATOM   8369 N N   . PRO F 1 196 ? -4.089  -28.196 15.466  1.00   59.70  ? 948  PRO F N   1 
ATOM   8370 C CA  . PRO F 1 196 ? -4.900  -26.988 15.679  1.00   63.12  ? 948  PRO F CA  1 
ATOM   8371 C C   . PRO F 1 196 ? -6.098  -27.173 16.617  1.00   61.25  ? 948  PRO F C   1 
ATOM   8372 O O   . PRO F 1 196 ? -6.604  -26.154 17.116  1.00   64.02  ? 948  PRO F O   1 
ATOM   8373 C CB  . PRO F 1 196 ? -5.422  -26.651 14.266  1.00   61.40  ? 948  PRO F CB  1 
ATOM   8374 C CG  . PRO F 1 196 ? -4.982  -27.753 13.391  1.00   57.46  ? 948  PRO F CG  1 
ATOM   8375 C CD  . PRO F 1 196 ? -4.448  -28.855 14.203  1.00   63.21  ? 948  PRO F CD  1 
HETATM 8376 O O   . HOH G 2 .   ? -12.439 -0.192  38.214  1.00   55.65  ? 2001 HOH A O   1 
HETATM 8377 O O   . HOH G 2 .   ? -11.926 -0.024  29.766  1.00   44.51  ? 2002 HOH A O   1 
HETATM 8378 O O   . HOH G 2 .   ? -7.242  -1.908  29.981  1.00   39.42  ? 2003 HOH A O   1 
HETATM 8379 O O   . HOH G 2 .   ? -9.725  9.254   31.929  1.00   55.53  ? 2004 HOH A O   1 
HETATM 8380 O O   . HOH G 2 .   ? -4.572  -1.617  29.814  1.00   41.11  ? 2005 HOH A O   1 
HETATM 8381 O O   . HOH G 2 .   ? 7.293   -2.413  30.164  1.00   36.44  ? 2006 HOH A O   1 
HETATM 8382 O O   . HOH G 2 .   ? 13.818  -8.703  39.292  1.00   54.34  ? 2007 HOH A O   1 
HETATM 8383 O O   . HOH G 2 .   ? 7.443   -9.780  41.509  1.00   49.05  ? 2008 HOH A O   1 
HETATM 8384 O O   . HOH G 2 .   ? 7.595   -4.937  42.914  1.00   66.43  ? 2009 HOH A O   1 
HETATM 8385 O O   . HOH G 2 .   ? -0.023  1.587   38.696  1.00   48.49  ? 2010 HOH A O   1 
HETATM 8386 O O   . HOH G 2 .   ? -1.637  24.182  16.267  1.00   58.68  ? 2011 HOH A O   1 
HETATM 8387 O O   . HOH G 2 .   ? 5.134   23.105  22.464  1.00   50.92  ? 2012 HOH A O   1 
HETATM 8388 O O   . HOH G 2 .   ? 3.133   24.200  23.710  1.00   59.46  ? 2013 HOH A O   1 
HETATM 8389 O O   . HOH G 2 .   ? 0.725   20.005  29.701  1.00   32.95  ? 2014 HOH A O   1 
HETATM 8390 O O   . HOH G 2 .   ? 5.349   19.071  25.575  1.00   55.03  ? 2015 HOH A O   1 
HETATM 8391 O O   . HOH G 2 .   ? 7.823   17.574  32.527  1.00   45.73  ? 2016 HOH A O   1 
HETATM 8392 O O   . HOH G 2 .   ? 13.056  6.676   35.740  1.00   48.49  ? 2017 HOH A O   1 
HETATM 8393 O O   . HOH G 2 .   ? 16.046  7.149   33.583  1.00   39.90  ? 2018 HOH A O   1 
HETATM 8394 O O   . HOH G 2 .   ? 17.060  15.978  25.394  1.00   67.14  ? 2019 HOH A O   1 
HETATM 8395 O O   . HOH G 2 .   ? 12.206  17.621  30.808  1.00   58.23  ? 2020 HOH A O   1 
HETATM 8396 O O   . HOH G 2 .   ? -10.066 6.967   11.880  1.00   51.28  ? 2021 HOH A O   1 
HETATM 8397 O O   . HOH G 2 .   ? -10.234 11.747  11.753  1.00   40.17  ? 2022 HOH A O   1 
HETATM 8398 O O   . HOH G 2 .   ? -3.729  15.292  17.224  1.00   47.71  ? 2023 HOH A O   1 
HETATM 8399 O O   . HOH G 2 .   ? -10.877 18.148  16.912  1.00   61.62  ? 2024 HOH A O   1 
HETATM 8400 O O   . HOH G 2 .   ? -9.879  14.682  27.318  1.00   51.86  ? 2025 HOH A O   1 
HETATM 8401 O O   . HOH G 2 .   ? -0.416  17.498  23.713  1.00   39.38  ? 2026 HOH A O   1 
HETATM 8402 O O   . HOH G 2 .   ? -8.235  20.810  22.802  1.00   58.94  ? 2027 HOH A O   1 
HETATM 8403 O O   . HOH G 2 .   ? 8.239   6.177   36.736  1.00   34.72  ? 2028 HOH A O   1 
HETATM 8404 O O   . HOH G 2 .   ? 6.358   7.209   42.231  1.00   56.68  ? 2029 HOH A O   1 
HETATM 8405 O O   . HOH G 2 .   ? 10.834  3.368   38.166  1.00   54.44  ? 2030 HOH A O   1 
HETATM 8406 O O   . HOH G 2 .   ? 12.535  3.522   34.647  1.00   40.88  ? 2031 HOH A O   1 
HETATM 8407 O O   . HOH G 2 .   ? 13.835  -4.436  29.578  1.00   34.55  ? 2032 HOH A O   1 
HETATM 8408 O O   . HOH G 2 .   ? 8.533   -0.558  32.277  1.00   37.37  ? 2033 HOH A O   1 
HETATM 8409 O O   . HOH G 2 .   ? 8.574   3.131   32.192  1.00   44.49  ? 2034 HOH A O   1 
HETATM 8410 O O   . HOH G 2 .   ? 4.965   -1.042  30.119  1.00   31.82  ? 2035 HOH A O   1 
HETATM 8411 O O   . HOH G 2 .   ? -7.598  -5.352  34.487  1.00   49.22  ? 2036 HOH A O   1 
HETATM 8412 O O   . HOH G 2 .   ? -10.392 -7.932  35.634  1.00   48.56  ? 2037 HOH A O   1 
HETATM 8413 O O   . HOH G 2 .   ? 14.617  -2.172  25.002  1.00   54.24  ? 2038 HOH A O   1 
HETATM 8414 O O   . HOH G 2 .   ? 14.065  4.423   22.740  1.00   32.79  ? 2039 HOH A O   1 
HETATM 8415 O O   . HOH G 2 .   ? 10.139  3.466   23.835  1.00   37.03  ? 2040 HOH A O   1 
HETATM 8416 O O   . HOH G 2 .   ? 12.186  3.271   13.267  1.00   31.44  ? 2041 HOH A O   1 
HETATM 8417 O O   . HOH G 2 .   ? 6.060   1.190   12.542  1.00   30.91  ? 2042 HOH A O   1 
HETATM 8418 O O   . HOH G 2 .   ? 10.055  -6.824  17.947  1.00   47.09  ? 2043 HOH A O   1 
HETATM 8419 O O   . HOH G 2 .   ? 16.308  -9.626  26.076  1.00   58.40  ? 2044 HOH A O   1 
HETATM 8420 O O   . HOH G 2 .   ? 9.926   3.769   34.615  1.00   32.98  ? 2045 HOH A O   1 
HETATM 8421 O O   . HOH G 2 .   ? 13.478  -11.452 29.110  1.00   51.13  ? 2046 HOH A O   1 
HETATM 8422 O O   . HOH G 2 .   ? 4.671   5.972   43.305  1.00   52.59  ? 2047 HOH A O   1 
HETATM 8423 O O   . HOH G 2 .   ? 10.683  -20.051 34.077  1.00   76.65  ? 2048 HOH A O   1 
HETATM 8424 O O   . HOH G 2 .   ? 12.358  -13.359 31.241  1.00   54.67  ? 2049 HOH A O   1 
HETATM 8425 O O   . HOH G 2 .   ? 9.666   -21.155 36.608  1.00   63.39  ? 2050 HOH A O   1 
HETATM 8426 O O   . HOH G 2 .   ? -9.372  -10.821 34.997  1.00   60.80  ? 2051 HOH A O   1 
HETATM 8427 O O   . HOH G 2 .   ? -7.110  -15.549 27.497  1.00   52.40  ? 2052 HOH A O   1 
HETATM 8428 O O   . HOH G 2 .   ? 17.415  -9.355  15.174  1.00   56.74  ? 2053 HOH A O   1 
HETATM 8429 O O   . HOH G 2 .   ? 12.275  -14.414 20.114  1.00   44.77  ? 2054 HOH A O   1 
HETATM 8430 O O   . HOH G 2 .   ? 15.434  -15.348 28.817  1.00   51.15  ? 2055 HOH A O   1 
HETATM 8431 O O   . HOH G 2 .   ? 5.226   -22.394 25.568  1.00   58.58  ? 2056 HOH A O   1 
HETATM 8432 O O   . HOH G 2 .   ? 2.277   -17.547 18.466  1.00   52.15  ? 2057 HOH A O   1 
HETATM 8433 O O   . HOH G 2 .   ? 15.377  -19.535 30.840  1.00   54.80  ? 2058 HOH A O   1 
HETATM 8434 O O   . HOH G 2 .   ? 7.453   -24.487 28.105  1.00   55.71  ? 2059 HOH A O   1 
HETATM 8435 O O   . HOH G 2 .   ? -0.972  -9.141  15.289  1.00   51.01  ? 2060 HOH A O   1 
HETATM 8436 O O   . HOH G 2 .   ? -7.977  -11.319 19.960  1.00   59.30  ? 2061 HOH A O   1 
HETATM 8437 O O   . HOH G 2 .   ? 0.003   -16.879 19.689  1.00   58.11  ? 2062 HOH A O   1 
HETATM 8438 O O   . HOH G 2 .   ? 0.682   -13.532 17.562  1.00   57.60  ? 2063 HOH A O   1 
HETATM 8439 O O   . HOH G 2 .   ? 6.461   -11.794 13.680  1.00   46.89  ? 2064 HOH A O   1 
HETATM 8440 O O   . HOH G 2 .   ? -2.853  4.346   10.655  1.00   45.48  ? 2065 HOH A O   1 
HETATM 8441 O O   . HOH G 2 .   ? 3.304   1.420   13.495  1.00   36.90  ? 2066 HOH A O   1 
HETATM 8442 O O   . HOH G 2 .   ? 3.830   -8.610  12.690  1.00   60.65  ? 2067 HOH A O   1 
HETATM 8443 O O   . HOH G 2 .   ? -2.196  -6.797  15.360  1.00   43.58  ? 2068 HOH A O   1 
HETATM 8444 O O   . HOH G 2 .   ? -2.883  -5.017  13.318  1.00   61.17  ? 2069 HOH A O   1 
HETATM 8445 O O   . HOH G 2 .   ? -8.436  -6.597  20.517  1.00   56.23  ? 2070 HOH A O   1 
HETATM 8446 O O   . HOH G 2 .   ? -14.780 -3.580  21.758  1.00   55.47  ? 2071 HOH A O   1 
HETATM 8447 O O   . HOH G 2 .   ? -9.749  -2.205  12.766  1.00   52.03  ? 2072 HOH A O   1 
HETATM 8448 O O   . HOH G 2 .   ? -10.331 7.489   15.857  1.00   53.63  ? 2073 HOH A O   1 
HETATM 8449 O O   . HOH G 2 .   ? -5.489  -1.654  6.179   1.00   49.27  ? 2074 HOH A O   1 
HETATM 8450 O O   . HOH H 2 .   ? -13.207 21.785  66.859  1.00   46.62  ? 2001 HOH B O   1 
HETATM 8451 O O   . HOH H 2 .   ? -3.319  29.909  56.329  1.00   68.44  ? 2002 HOH B O   1 
HETATM 8452 O O   . HOH H 2 .   ? 1.749   32.752  46.217  1.00   65.92  ? 2003 HOH B O   1 
HETATM 8453 O O   . HOH H 2 .   ? 0.409   33.997  50.810  1.00   49.95  ? 2004 HOH B O   1 
HETATM 8454 O O   . HOH H 2 .   ? 0.459   29.881  32.633  1.00   61.94  ? 2005 HOH B O   1 
HETATM 8455 O O   . HOH H 2 .   ? 3.530   31.503  45.189  1.00   66.67  ? 2006 HOH B O   1 
HETATM 8456 O O   . HOH H 2 .   ? 9.722   32.114  46.902  1.00   60.42  ? 2007 HOH B O   1 
HETATM 8457 O O   . HOH H 2 .   ? 10.331  30.968  43.797  1.00   67.15  ? 2008 HOH B O   1 
HETATM 8458 O O   . HOH H 2 .   ? 14.079  20.037  51.772  1.00   64.00  ? 2009 HOH B O   1 
HETATM 8459 O O   . HOH H 2 .   ? 5.355   10.574  40.964  1.00   40.39  ? 2010 HOH B O   1 
HETATM 8460 O O   . HOH H 2 .   ? 1.302   19.830  37.672  1.00   45.36  ? 2011 HOH B O   1 
HETATM 8461 O O   . HOH H 2 .   ? -2.272  27.469  40.579  1.00   47.36  ? 2012 HOH B O   1 
HETATM 8462 O O   . HOH H 2 .   ? -18.940 14.758  34.133  1.00   56.78  ? 2013 HOH B O   1 
HETATM 8463 O O   . HOH H 2 .   ? -21.430 20.584  43.581  1.00   50.76  ? 2014 HOH B O   1 
HETATM 8464 O O   . HOH H 2 .   ? -5.660  33.911  38.876  1.00   51.15  ? 2015 HOH B O   1 
HETATM 8465 O O   . HOH H 2 .   ? 6.036   5.510   57.921  1.00   77.33  ? 2016 HOH B O   1 
HETATM 8466 O O   . HOH H 2 .   ? 4.984   5.443   50.072  1.00   45.25  ? 2017 HOH B O   1 
HETATM 8467 O O   . HOH H 2 .   ? 1.640   7.424   51.825  1.00   47.63  ? 2018 HOH B O   1 
HETATM 8468 O O   . HOH H 2 .   ? 1.067   5.985   54.604  1.00   46.15  ? 2019 HOH B O   1 
HETATM 8469 O O   . HOH H 2 .   ? -20.758 14.502  54.963  1.00   53.72  ? 2020 HOH B O   1 
HETATM 8470 O O   . HOH H 2 .   ? -17.045 17.215  60.059  1.00   69.51  ? 2021 HOH B O   1 
HETATM 8471 O O   . HOH H 2 .   ? 3.613   6.494   45.433  1.00   53.09  ? 2022 HOH B O   1 
HETATM 8472 O O   . HOH H 2 .   ? 1.018   3.616   46.800  1.00   48.78  ? 2023 HOH B O   1 
HETATM 8473 O O   . HOH H 2 .   ? -7.122  14.058  36.147  1.00   42.89  ? 2024 HOH B O   1 
HETATM 8474 O O   . HOH H 2 .   ? -16.552 13.429  33.744  1.00   59.80  ? 2025 HOH B O   1 
HETATM 8475 O O   . HOH H 2 .   ? -1.064  2.306   48.308  1.00   37.91  ? 2026 HOH B O   1 
HETATM 8476 O O   . HOH H 2 .   ? -2.162  1.422   58.435  1.00   45.30  ? 2027 HOH B O   1 
HETATM 8477 O O   . HOH H 2 .   ? -3.459  0.667   61.498  1.00   39.99  ? 2028 HOH B O   1 
HETATM 8478 O O   . HOH H 2 .   ? -1.201  1.246   62.255  1.00   56.66  ? 2029 HOH B O   1 
HETATM 8479 O O   . HOH H 2 .   ? -4.190  14.437  67.760  1.00   52.29  ? 2030 HOH B O   1 
HETATM 8480 O O   . HOH H 2 .   ? -14.292 13.626  34.191  1.00   60.90  ? 2031 HOH B O   1 
HETATM 8481 O O   . HOH H 2 .   ? -8.405  1.728   48.883  1.00   42.06  ? 2032 HOH B O   1 
HETATM 8482 O O   . HOH H 2 .   ? -5.279  -3.062  52.945  1.00   46.13  ? 2033 HOH B O   1 
HETATM 8483 O O   . HOH H 2 .   ? -5.371  -1.327  62.096  1.00   41.11  ? 2034 HOH B O   1 
HETATM 8484 O O   . HOH H 2 .   ? -16.517 2.110   64.175  1.00   58.66  ? 2035 HOH B O   1 
HETATM 8485 O O   . HOH H 2 .   ? -22.168 14.641  62.318  1.00   59.75  ? 2036 HOH B O   1 
HETATM 8486 O O   . HOH H 2 .   ? -11.732 0.180   43.113  1.00   56.08  ? 2037 HOH B O   1 
HETATM 8487 O O   . HOH H 2 .   ? -19.317 16.524  42.813  1.00   56.84  ? 2038 HOH B O   1 
HETATM 8488 O O   . HOH H 2 .   ? -21.816 14.208  43.585  1.00   54.97  ? 2039 HOH B O   1 
HETATM 8489 O O   . HOH H 2 .   ? -21.956 11.336  44.646  1.00   54.92  ? 2040 HOH B O   1 
HETATM 8490 O O   . HOH H 2 .   ? -17.485 22.819  52.965  1.00   60.70  ? 2041 HOH B O   1 
HETATM 8491 O O   . HOH H 2 .   ? -22.226 17.671  48.013  1.00   67.15  ? 2042 HOH B O   1 
HETATM 8492 O O   . HOH I 2 .   ? 40.467  -22.301 43.168  1.00   50.10  ? 2001 HOH C O   1 
HETATM 8493 O O   . HOH I 2 .   ? 42.861  -20.914 31.688  1.00   51.94  ? 2002 HOH C O   1 
HETATM 8494 O O   . HOH I 2 .   ? 51.158  -23.857 36.485  1.00   68.20  ? 2003 HOH C O   1 
HETATM 8495 O O   . HOH I 2 .   ? 42.914  -26.686 27.997  1.00   41.88  ? 2004 HOH C O   1 
HETATM 8496 O O   . HOH I 2 .   ? 27.943  -22.418 29.707  1.00   37.39  ? 2005 HOH C O   1 
HETATM 8497 O O   . HOH I 2 .   ? 27.332  -13.305 38.787  1.00   49.36  ? 2006 HOH C O   1 
HETATM 8498 O O   . HOH I 2 .   ? 42.953  -35.384 30.526  1.00   47.16  ? 2007 HOH C O   1 
HETATM 8499 O O   . HOH I 2 .   ? 43.511  -38.341 29.168  1.00   50.88  ? 2008 HOH C O   1 
HETATM 8500 O O   . HOH I 2 .   ? 33.484  -49.197 34.354  1.00   45.99  ? 2009 HOH C O   1 
HETATM 8501 O O   . HOH I 2 .   ? 41.280  -48.367 20.109  1.00   53.13  ? 2010 HOH C O   1 
HETATM 8502 O O   . HOH I 2 .   ? 34.221  -52.448 15.153  1.00   51.20  ? 2011 HOH C O   1 
HETATM 8503 O O   . HOH I 2 .   ? 33.743  -44.460 28.185  1.00   31.45  ? 2012 HOH C O   1 
HETATM 8504 O O   . HOH I 2 .   ? 27.721  -41.901 31.314  1.00   44.12  ? 2013 HOH C O   1 
HETATM 8505 O O   . HOH I 2 .   ? 22.425  -29.134 23.851  1.00   52.58  ? 2014 HOH C O   1 
HETATM 8506 O O   . HOH I 2 .   ? 34.899  -41.603 22.202  1.00   30.66  ? 2015 HOH C O   1 
HETATM 8507 O O   . HOH I 2 .   ? 36.195  -38.498 14.345  1.00   42.93  ? 2016 HOH C O   1 
HETATM 8508 O O   . HOH I 2 .   ? 35.280  -29.835 10.672  1.00   32.67  ? 2017 HOH C O   1 
HETATM 8509 O O   . HOH I 2 .   ? 33.521  -27.230 5.728   1.00   42.91  ? 2018 HOH C O   1 
HETATM 8510 O O   . HOH I 2 .   ? 45.143  -35.390 10.395  1.00   38.71  ? 2019 HOH C O   1 
HETATM 8511 O O   . HOH I 2 .   ? 38.670  -39.199 16.213  1.00   33.56  ? 2020 HOH C O   1 
HETATM 8512 O O   . HOH I 2 .   ? 21.171  -20.430 29.179  1.00   40.07  ? 2021 HOH C O   1 
HETATM 8513 O O   . HOH I 2 .   ? 25.966  -27.573 31.898  1.00   54.58  ? 2022 HOH C O   1 
HETATM 8514 O O   . HOH I 2 .   ? 30.049  -23.390 29.520  1.00   34.77  ? 2023 HOH C O   1 
HETATM 8515 O O   . HOH I 2 .   ? 45.194  -36.804 24.849  1.00   54.84  ? 2024 HOH C O   1 
HETATM 8516 O O   . HOH I 2 .   ? 48.991  -34.820 20.425  1.00   63.18  ? 2025 HOH C O   1 
HETATM 8517 O O   . HOH I 2 .   ? 49.356  -34.145 24.931  1.00   60.77  ? 2026 HOH C O   1 
HETATM 8518 O O   . HOH I 2 .   ? 46.859  -23.606 19.156  1.00   47.96  ? 2027 HOH C O   1 
HETATM 8519 O O   . HOH I 2 .   ? 25.151  -40.173 30.371  1.00   39.66  ? 2028 HOH C O   1 
HETATM 8520 O O   . HOH I 2 .   ? 39.399  -22.595 28.990  1.00   43.97  ? 2029 HOH C O   1 
HETATM 8521 O O   A HOH I 2 .   ? 21.259  -28.632 20.056  0.50   22.84  ? 2030 HOH C O   1 
HETATM 8522 O O   B HOH I 2 .   ? 20.646  -28.581 21.785  0.50   18.31  ? 2030 HOH C O   1 
HETATM 8523 O O   A HOH I 2 .   ? 20.704  -22.299 24.526  0.0000 35.83  ? 2031 HOH C O   1 
HETATM 8524 O O   B HOH I 2 .   ? 19.491  -21.360 24.353  0.50   38.27  ? 2031 HOH C O   1 
HETATM 8525 O O   . HOH I 2 .   ? 24.260  -27.697 23.201  1.00   40.69  ? 2032 HOH C O   1 
HETATM 8526 O O   . HOH I 2 .   ? 32.998  -30.041 10.614  1.00   42.14  ? 2034 HOH C O   1 
HETATM 8527 O O   . HOH I 2 .   ? 25.568  -25.394 10.154  1.00   45.95  ? 2035 HOH C O   1 
HETATM 8528 O O   . HOH I 2 .   ? 23.375  -21.475 10.295  1.00   47.83  ? 2036 HOH C O   1 
HETATM 8529 O O   . HOH I 2 .   ? 18.566  -21.059 21.981  1.00   49.72  ? 2038 HOH C O   1 
HETATM 8530 O O   . HOH I 2 .   ? 22.886  -4.684  38.919  1.00   53.27  ? 2039 HOH C O   1 
HETATM 8531 O O   . HOH I 2 .   ? 43.845  -13.661 34.743  1.00   61.17  ? 2040 HOH C O   1 
HETATM 8532 O O   . HOH I 2 .   ? 41.399  -8.839  27.202  1.00   47.62  ? 2041 HOH C O   1 
HETATM 8533 O O   . HOH I 2 .   ? 23.857  -16.688 17.996  1.00   38.93  ? 2042 HOH C O   1 
HETATM 8534 O O   . HOH I 2 .   ? 20.964  -19.060 15.882  1.00   80.78  ? 2043 HOH C O   1 
HETATM 8535 O O   . HOH I 2 .   ? 30.589  -9.070  15.678  1.00   56.08  ? 2044 HOH C O   1 
HETATM 8536 O O   . HOH I 2 .   ? 20.842  -12.627 29.374  1.00   41.32  ? 2045 HOH C O   1 
HETATM 8537 O O   . HOH I 2 .   ? 32.031  -6.501  18.690  1.00   58.03  ? 2046 HOH C O   1 
HETATM 8538 O O   . HOH I 2 .   ? 34.324  -6.647  16.233  1.00   47.07  ? 2047 HOH C O   1 
HETATM 8539 O O   . HOH I 2 .   ? 26.347  0.408   29.703  1.00   56.78  ? 2048 HOH C O   1 
HETATM 8540 O O   . HOH I 2 .   ? 24.979  -4.350  33.606  1.00   36.63  ? 2049 HOH C O   1 
HETATM 8541 O O   . HOH I 2 .   ? 37.957  -2.733  24.529  1.00   67.50  ? 2050 HOH C O   1 
HETATM 8542 O O   . HOH I 2 .   ? 42.595  -13.092 19.828  1.00   52.76  ? 2051 HOH C O   1 
HETATM 8543 O O   . HOH I 2 .   ? 34.106  -8.152  19.152  1.00   40.32  ? 2052 HOH C O   1 
HETATM 8544 O O   . HOH I 2 .   ? 36.323  -7.603  21.890  1.00   54.65  ? 2053 HOH C O   1 
HETATM 8545 O O   . HOH I 2 .   ? 33.385  -10.834 17.550  1.00   35.93  ? 2054 HOH C O   1 
HETATM 8546 O O   . HOH I 2 .   ? 29.011  -12.352 14.605  1.00   50.91  ? 2055 HOH C O   1 
HETATM 8547 O O   . HOH I 2 .   ? 30.192  -25.354 8.756   1.00   52.68  ? 2056 HOH C O   1 
HETATM 8548 O O   . HOH I 2 .   ? 37.196  -28.447 9.603   1.00   39.33  ? 2057 HOH C O   1 
HETATM 8549 O O   . HOH I 2 .   ? 37.666  -17.565 15.004  1.00   39.42  ? 2058 HOH C O   1 
HETATM 8550 O O   . HOH I 2 .   ? 37.153  -19.213 12.235  1.00   44.71  ? 2059 HOH C O   1 
HETATM 8551 O O   . HOH I 2 .   ? 43.170  -17.538 15.872  1.00   52.26  ? 2060 HOH C O   1 
HETATM 8552 O O   . HOH I 2 .   ? 44.122  -20.104 14.142  1.00   62.84  ? 2061 HOH C O   1 
HETATM 8553 O O   . HOH I 2 .   ? 45.603  -28.924 12.235  1.00   38.77  ? 2062 HOH C O   1 
HETATM 8554 O O   . HOH I 2 .   ? 44.764  -31.251 14.541  1.00   46.43  ? 2063 HOH C O   1 
HETATM 8555 O O   . HOH I 2 .   ? 47.462  -31.105 16.982  1.00   60.91  ? 2064 HOH C O   1 
HETATM 8556 O O   . HOH I 2 .   ? 35.158  -24.212 7.759   1.00   45.44  ? 2065 HOH C O   1 
HETATM 8557 O O   . HOH J 2 .   ? 51.485  -54.124 54.627  1.00   46.25  ? 2001 HOH D O   1 
HETATM 8558 O O   . HOH J 2 .   ? 43.142  -55.972 50.672  1.00   70.15  ? 2002 HOH D O   1 
HETATM 8559 O O   . HOH J 2 .   ? 46.555  -45.275 54.921  1.00   40.28  ? 2003 HOH D O   1 
HETATM 8560 O O   . HOH J 2 .   ? 37.900  -37.352 54.028  1.00   34.58  ? 2004 HOH D O   1 
HETATM 8561 O O   . HOH J 2 .   ? 35.650  -33.295 67.117  1.00   47.82  ? 2005 HOH D O   1 
HETATM 8562 O O   . HOH J 2 .   ? 37.893  -40.021 65.898  1.00   48.62  ? 2006 HOH D O   1 
HETATM 8563 O O   . HOH J 2 .   ? 37.046  -53.414 49.856  1.00   59.53  ? 2007 HOH D O   1 
HETATM 8564 O O   . HOH J 2 .   ? 35.375  -61.572 40.312  1.00   74.17  ? 2008 HOH D O   1 
HETATM 8565 O O   . HOH J 2 .   ? 29.844  -56.264 45.017  1.00   56.94  ? 2009 HOH D O   1 
HETATM 8566 O O   . HOH J 2 .   ? 22.146  -49.569 55.508  1.00   60.08  ? 2010 HOH D O   1 
HETATM 8567 O O   . HOH J 2 .   ? 27.503  -48.777 43.464  1.00   60.63  ? 2011 HOH D O   1 
HETATM 8568 O O   . HOH J 2 .   ? 46.078  -41.545 30.791  1.00   49.22  ? 2012 HOH D O   1 
HETATM 8569 O O   . HOH J 2 .   ? 48.011  -37.671 30.580  1.00   56.41  ? 2013 HOH D O   1 
HETATM 8570 O O   . HOH J 2 .   ? 52.951  -41.067 34.450  1.00   58.47  ? 2014 HOH D O   1 
HETATM 8571 O O   . HOH J 2 .   ? 55.907  -44.577 34.774  1.00   49.26  ? 2015 HOH D O   1 
HETATM 8572 O O   . HOH J 2 .   ? 53.982  -50.533 33.002  1.00   55.69  ? 2016 HOH D O   1 
HETATM 8573 O O   . HOH J 2 .   ? 44.397  -51.177 34.833  1.00   46.54  ? 2017 HOH D O   1 
HETATM 8574 O O   . HOH J 2 .   ? 29.307  -48.539 56.886  1.00   47.06  ? 2018 HOH D O   1 
HETATM 8575 O O   . HOH J 2 .   ? 28.270  -41.401 56.278  1.00   63.60  ? 2019 HOH D O   1 
HETATM 8576 O O   . HOH J 2 .   ? 28.681  -26.989 46.804  1.00   61.77  ? 2020 HOH D O   1 
HETATM 8577 O O   . HOH J 2 .   ? 36.136  -36.390 45.178  1.00   37.44  ? 2021 HOH D O   1 
HETATM 8578 O O   . HOH J 2 .   ? 37.555  -62.815 40.900  1.00   60.33  ? 2022 HOH D O   1 
HETATM 8579 O O   . HOH J 2 .   ? 55.947  -45.028 57.595  1.00   63.92  ? 2023 HOH D O   1 
HETATM 8580 O O   . HOH J 2 .   ? 48.036  -44.086 59.483  1.00   72.01  ? 2024 HOH D O   1 
HETATM 8581 O O   . HOH J 2 .   ? 46.197  -35.522 34.886  1.00   59.83  ? 2025 HOH D O   1 
HETATM 8582 O O   . HOH J 2 .   ? 34.994  -27.521 50.518  1.00   61.47  ? 2026 HOH D O   1 
HETATM 8583 O O   . HOH J 2 .   ? 35.481  -27.991 47.437  1.00   52.31  ? 2027 HOH D O   1 
HETATM 8584 O O   . HOH J 2 .   ? 33.991  -31.161 53.215  1.00   40.91  ? 2028 HOH D O   1 
HETATM 8585 O O   . HOH J 2 .   ? 34.446  -26.642 58.147  1.00   59.39  ? 2029 HOH D O   1 
HETATM 8586 O O   . HOH J 2 .   ? 38.035  -26.281 60.643  1.00   43.35  ? 2030 HOH D O   1 
HETATM 8587 O O   . HOH J 2 .   ? 36.829  -27.223 68.496  1.00   55.22  ? 2031 HOH D O   1 
HETATM 8588 O O   . HOH J 2 .   ? 44.149  -27.776 47.203  1.00   43.52  ? 2032 HOH D O   1 
HETATM 8589 O O   . HOH J 2 .   ? 38.728  -22.214 59.112  1.00   55.24  ? 2033 HOH D O   1 
HETATM 8590 O O   . HOH J 2 .   ? 37.918  -22.583 53.168  1.00   65.16  ? 2034 HOH D O   1 
HETATM 8591 O O   . HOH J 2 .   ? 39.606  -24.244 60.800  1.00   49.26  ? 2035 HOH D O   1 
HETATM 8592 O O   . HOH J 2 .   ? 46.723  -18.464 63.460  1.00   55.81  ? 2036 HOH D O   1 
HETATM 8593 O O   . HOH J 2 .   ? 49.683  -22.092 64.067  1.00   58.10  ? 2037 HOH D O   1 
HETATM 8594 O O   . HOH J 2 .   ? 48.934  -19.901 63.516  1.00   63.72  ? 2038 HOH D O   1 
HETATM 8595 O O   . HOH J 2 .   ? 46.951  -23.789 72.033  1.00   30.00  ? 2039 HOH D O   1 
HETATM 8596 O O   . HOH J 2 .   ? 56.943  -32.345 56.395  1.00   82.59  ? 2040 HOH D O   1 
HETATM 8597 O O   . HOH J 2 .   ? 52.033  -29.416 61.992  1.00   42.95  ? 2041 HOH D O   1 
HETATM 8598 O O   . HOH J 2 .   ? 58.333  -34.660 56.556  1.00   60.50  ? 2042 HOH D O   1 
HETATM 8599 O O   . HOH K 2 .   ? 35.667  18.867  6.329   1.00   51.80  ? 2001 HOH E O   1 
HETATM 8600 O O   . HOH K 2 .   ? 33.426  19.810  15.386  1.00   44.17  ? 2002 HOH E O   1 
HETATM 8601 O O   . HOH K 2 .   ? 21.268  9.034   7.529   1.00   32.01  ? 2003 HOH E O   1 
HETATM 8602 O O   . HOH K 2 .   ? 27.678  16.731  0.464   1.00   63.76  ? 2004 HOH E O   1 
HETATM 8603 O O   . HOH K 2 .   ? 28.724  27.634  16.230  1.00   49.22  ? 2005 HOH E O   1 
HETATM 8604 O O   . HOH K 2 .   ? 19.812  26.941  24.950  1.00   54.95  ? 2006 HOH E O   1 
HETATM 8605 O O   . HOH K 2 .   ? 23.735  35.075  28.841  1.00   63.27  ? 2007 HOH E O   1 
HETATM 8606 O O   . HOH K 2 .   ? 29.694  30.879  20.516  1.00   60.90  ? 2008 HOH E O   1 
HETATM 8607 O O   . HOH K 2 .   ? 24.671  25.783  34.320  1.00   62.82  ? 2009 HOH E O   1 
HETATM 8608 O O   . HOH K 2 .   ? 21.428  31.179  21.623  1.00   56.10  ? 2010 HOH E O   1 
HETATM 8609 O O   . HOH K 2 .   ? 19.319  29.175  23.002  1.00   75.44  ? 2011 HOH E O   1 
HETATM 8610 O O   . HOH K 2 .   ? 17.415  23.893  19.275  1.00   58.14  ? 2012 HOH E O   1 
HETATM 8611 O O   . HOH K 2 .   ? 18.029  25.759  12.113  1.00   70.66  ? 2013 HOH E O   1 
HETATM 8612 O O   . HOH K 2 .   ? 14.309  25.200  16.953  1.00   55.44  ? 2014 HOH E O   1 
HETATM 8613 O O   . HOH K 2 .   ? 11.013  15.783  10.957  1.00   38.84  ? 2015 HOH E O   1 
HETATM 8614 O O   . HOH K 2 .   ? 5.237   14.089  15.870  1.00   40.83  ? 2016 HOH E O   1 
HETATM 8615 O O   . HOH K 2 .   ? 17.668  8.410   15.928  1.00   46.29  ? 2017 HOH E O   1 
HETATM 8616 O O   . HOH K 2 .   ? 28.179  12.081  30.379  1.00   54.87  ? 2018 HOH E O   1 
HETATM 8617 O O   . HOH K 2 .   ? 37.797  4.967   24.271  1.00   71.23  ? 2019 HOH E O   1 
HETATM 8618 O O   . HOH K 2 .   ? 37.241  5.011   31.861  1.00   58.73  ? 2020 HOH E O   1 
HETATM 8619 O O   . HOH K 2 .   ? 36.727  8.155   32.969  1.00   57.82  ? 2021 HOH E O   1 
HETATM 8620 O O   . HOH K 2 .   ? 37.865  15.453  28.171  1.00   58.85  ? 2022 HOH E O   1 
HETATM 8621 O O   . HOH K 2 .   ? 33.328  22.636  28.897  1.00   52.13  ? 2023 HOH E O   1 
HETATM 8622 O O   . HOH K 2 .   ? 26.559  27.905  32.391  1.00   55.69  ? 2024 HOH E O   1 
HETATM 8623 O O   . HOH K 2 .   ? 17.257  12.193  8.840   1.00   59.72  ? 2025 HOH E O   1 
HETATM 8624 O O   . HOH K 2 .   ? 23.126  10.669  9.051   1.00   36.25  ? 2026 HOH E O   1 
HETATM 8625 O O   . HOH K 2 .   ? 43.390  6.774   21.807  1.00   53.39  ? 2027 HOH E O   1 
HETATM 8626 O O   . HOH K 2 .   ? 42.905  9.801   19.021  1.00   52.58  ? 2028 HOH E O   1 
HETATM 8627 O O   . HOH K 2 .   ? 36.434  13.819  13.834  1.00   52.48  ? 2029 HOH E O   1 
HETATM 8628 O O   . HOH K 2 .   ? 37.252  10.902  5.466   1.00   44.68  ? 2030 HOH E O   1 
HETATM 8629 O O   . HOH K 2 .   ? 41.594  7.859   9.697   1.00   58.09  ? 2031 HOH E O   1 
HETATM 8630 O O   . HOH K 2 .   ? 26.580  26.148  35.768  1.00   53.10  ? 2032 HOH E O   1 
HETATM 8631 O O   . HOH K 2 .   ? 38.702  9.529   2.801   1.00   55.41  ? 2033 HOH E O   1 
HETATM 8632 O O   . HOH K 2 .   ? 32.881  10.504  9.225   1.00   45.80  ? 2034 HOH E O   1 
HETATM 8633 O O   . HOH K 2 .   ? 14.907  4.608   11.155  1.00   33.59  ? 2035 HOH E O   1 
HETATM 8634 O O   . HOH K 2 .   ? 15.045  5.529   18.710  1.00   43.72  ? 2036 HOH E O   1 
HETATM 8635 O O   . HOH K 2 .   ? 20.975  5.471   27.580  1.00   57.35  ? 2037 HOH E O   1 
HETATM 8636 O O   . HOH K 2 .   ? 38.240  2.251   30.747  1.00   68.30  ? 2038 HOH E O   1 
HETATM 8637 O O   . HOH K 2 .   ? 13.598  0.809   11.981  1.00   37.20  ? 2039 HOH E O   1 
HETATM 8638 O O   . HOH K 2 .   ? 14.787  5.842   6.608   1.00   44.48  ? 2040 HOH E O   1 
HETATM 8639 O O   . HOH K 2 .   ? 14.215  2.720   0.980   1.00   41.53  ? 2041 HOH E O   1 
HETATM 8640 O O   . HOH K 2 .   ? 16.305  0.875   1.440   1.00   46.24  ? 2042 HOH E O   1 
HETATM 8641 O O   . HOH K 2 .   ? 17.535  1.081   -1.084  1.00   41.87  ? 2043 HOH E O   1 
HETATM 8642 O O   . HOH K 2 .   ? 15.900  3.221   -2.543  1.00   60.72  ? 2044 HOH E O   1 
HETATM 8643 O O   . HOH K 2 .   ? 31.141  13.795  -6.729  1.00   30.00  ? 2045 HOH E O   1 
HETATM 8644 O O   . HOH K 2 .   ? 19.269  -3.173  12.486  1.00   33.65  ? 2046 HOH E O   1 
HETATM 8645 O O   . HOH K 2 .   ? 14.505  -3.405  5.064   1.00   56.49  ? 2047 HOH E O   1 
HETATM 8646 O O   . HOH K 2 .   ? 11.771  -3.923  4.713   1.00   64.43  ? 2048 HOH E O   1 
HETATM 8647 O O   . HOH K 2 .   ? 21.227  -1.577  -7.647  1.00   37.90  ? 2049 HOH E O   1 
HETATM 8648 O O   . HOH K 2 .   ? 26.612  -5.238  -11.205 1.00   59.17  ? 2050 HOH E O   1 
HETATM 8649 O O   . HOH K 2 .   ? 36.794  0.254   -2.810  1.00   54.92  ? 2051 HOH E O   1 
HETATM 8650 O O   . HOH K 2 .   ? 31.367  -4.961  0.488   1.00   47.97  ? 2052 HOH E O   1 
HETATM 8651 O O   . HOH K 2 .   ? 38.820  -3.581  9.051   1.00   58.17  ? 2053 HOH E O   1 
HETATM 8652 O O   . HOH K 2 .   ? 36.535  -4.665  7.650   1.00   56.92  ? 2054 HOH E O   1 
HETATM 8653 O O   . HOH K 2 .   ? 32.729  -4.744  12.442  1.00   64.55  ? 2055 HOH E O   1 
HETATM 8654 O O   . HOH K 2 .   ? 19.632  -3.617  16.473  1.00   39.93  ? 2056 HOH E O   1 
HETATM 8655 O O   . HOH K 2 .   ? 19.989  -8.299  16.537  1.00   52.70  ? 2057 HOH E O   1 
HETATM 8656 O O   . HOH K 2 .   ? 38.107  1.407   12.685  1.00   48.21  ? 2058 HOH E O   1 
HETATM 8657 O O   . HOH K 2 .   ? 43.538  0.555   18.024  1.00   55.95  ? 2059 HOH E O   1 
HETATM 8658 O O   . HOH L 2 .   ? 1.001   -44.519 13.347  1.00   57.51  ? 2001 HOH F O   1 
HETATM 8659 O O   . HOH L 2 .   ? 20.718  -31.086 -4.415  1.00   70.03  ? 2002 HOH F O   1 
HETATM 8660 O O   . HOH L 2 .   ? 21.997  -33.935 -2.861  1.00   45.81  ? 2003 HOH F O   1 
HETATM 8661 O O   . HOH L 2 .   ? 24.937  -35.685 -5.086  1.00   48.70  ? 2004 HOH F O   1 
HETATM 8662 O O   . HOH L 2 .   ? 2.572   -46.877 10.700  1.00   64.42  ? 2005 HOH F O   1 
HETATM 8663 O O   . HOH L 2 .   ? 5.231   -50.973 17.141  1.00   58.47  ? 2006 HOH F O   1 
HETATM 8664 O O   . HOH L 2 .   ? 2.139   -53.037 19.687  1.00   74.55  ? 2007 HOH F O   1 
HETATM 8665 O O   . HOH L 2 .   ? 7.373   -55.558 23.397  1.00   59.63  ? 2008 HOH F O   1 
HETATM 8666 O O   . HOH L 2 .   ? 5.328   -54.975 24.260  1.00   63.79  ? 2009 HOH F O   1 
HETATM 8667 O O   . HOH L 2 .   ? 15.739  -45.428 24.273  1.00   53.48  ? 2010 HOH F O   1 
HETATM 8668 O O   . HOH L 2 .   ? 19.707  -50.455 18.931  1.00   47.67  ? 2011 HOH F O   1 
HETATM 8669 O O   . HOH L 2 .   ? 13.665  -46.554 9.288   1.00   70.52  ? 2012 HOH F O   1 
HETATM 8670 O O   . HOH L 2 .   ? 27.694  -42.102 10.593  1.00   64.75  ? 2013 HOH F O   1 
HETATM 8671 O O   . HOH L 2 .   ? 17.448  -43.041 23.446  1.00   45.96  ? 2014 HOH F O   1 
HETATM 8672 O O   . HOH L 2 .   ? 10.147  -29.486 30.804  1.00   47.54  ? 2015 HOH F O   1 
HETATM 8673 O O   . HOH L 2 .   ? -1.439  -25.779 26.799  1.00   57.20  ? 2016 HOH F O   1 
HETATM 8674 O O   . HOH L 2 .   ? -2.851  -28.081 29.762  1.00   49.78  ? 2017 HOH F O   1 
HETATM 8675 O O   . HOH L 2 .   ? 0.494   -25.200 28.010  1.00   54.36  ? 2018 HOH F O   1 
HETATM 8676 O O   . HOH L 2 .   ? -1.962  -33.578 31.034  1.00   50.13  ? 2019 HOH F O   1 
HETATM 8677 O O   . HOH L 2 .   ? 4.223   -35.915 30.004  1.00   53.00  ? 2020 HOH F O   1 
HETATM 8678 O O   . HOH L 2 .   ? -2.437  -35.388 25.924  1.00   36.40  ? 2021 HOH F O   1 
HETATM 8679 O O   . HOH L 2 .   ? 3.284   -44.501 34.772  1.00   62.54  ? 2022 HOH F O   1 
HETATM 8680 O O   . HOH L 2 .   ? 19.941  -49.342 5.192   1.00   55.59  ? 2023 HOH F O   1 
HETATM 8681 O O   . HOH L 2 .   ? 28.755  -31.024 4.607   1.00   52.11  ? 2024 HOH F O   1 
HETATM 8682 O O   . HOH L 2 .   ? 28.647  -29.092 9.823   1.00   57.19  ? 2025 HOH F O   1 
HETATM 8683 O O   . HOH L 2 .   ? 15.614  -35.837 6.063   1.00   47.44  ? 2026 HOH F O   1 
HETATM 8684 O O   . HOH L 2 .   ? -2.195  -42.436 24.272  1.00   59.01  ? 2027 HOH F O   1 
HETATM 8685 O O   . HOH L 2 .   ? 6.692   -56.937 26.175  1.00   68.20  ? 2028 HOH F O   1 
HETATM 8686 O O   . HOH L 2 .   ? -5.136  -24.831 7.857   1.00   56.61  ? 2029 HOH F O   1 
HETATM 8687 O O   . HOH L 2 .   ? 2.110   -34.608 7.987   1.00   53.38  ? 2030 HOH F O   1 
HETATM 8688 O O   . HOH L 2 .   ? 19.881  -29.612 17.810  1.00   37.56  ? 2031 HOH F O   1 
HETATM 8689 O O   . HOH L 2 .   ? 16.289  -19.941 14.687  1.00   57.17  ? 2032 HOH F O   1 
HETATM 8690 O O   . HOH L 2 .   ? 15.048  -20.733 11.923  1.00   41.26  ? 2033 HOH F O   1 
HETATM 8691 O O   . HOH L 2 .   ? 20.950  -25.686 -0.078  1.00   47.59  ? 2034 HOH F O   1 
HETATM 8692 O O   . HOH L 2 .   ? 19.732  -26.101 -5.257  1.00   62.97  ? 2035 HOH F O   1 
HETATM 8693 O O   . HOH L 2 .   ? 0.626   -24.109 -7.808  1.00   55.21  ? 2036 HOH F O   1 
HETATM 8694 O O   . HOH L 2 .   ? 19.856  -19.987 6.691   1.00   45.67  ? 2037 HOH F O   1 
HETATM 8695 O O   . HOH L 2 .   ? 16.205  -16.221 5.971   1.00   53.71  ? 2038 HOH F O   1 
HETATM 8696 O O   . HOH L 2 .   ? 17.770  -14.891 8.724   1.00   55.92  ? 2039 HOH F O   1 
HETATM 8697 O O   . HOH L 2 .   ? 13.806  -21.797 -8.835  1.00   54.25  ? 2040 HOH F O   1 
HETATM 8698 O O   . HOH L 2 .   ? 4.369   -18.766 -1.007  1.00   55.38  ? 2041 HOH F O   1 
HETATM 8699 O O   . HOH L 2 .   ? -3.353  -22.415 7.834   1.00   47.44  ? 2042 HOH F O   1 
HETATM 8700 O O   . HOH L 2 .   ? 9.161   -16.264 11.573  1.00   67.25  ? 2043 HOH F O   1 
HETATM 8701 O O   . HOH L 2 .   ? 5.078   -17.927 8.589   1.00   46.11  ? 2044 HOH F O   1 
HETATM 8702 O O   . HOH L 2 .   ? 12.304  -19.907 19.862  1.00   50.01  ? 2045 HOH F O   1 
HETATM 8703 O O   . HOH L 2 .   ? 1.518   -20.263 22.433  1.00   65.62  ? 2046 HOH F O   1 
HETATM 8704 O O   . HOH L 2 .   ? 2.018   -21.840 15.171  1.00   47.73  ? 2047 HOH F O   1 
HETATM 8705 O O   . HOH L 2 .   ? -8.257  -27.397 18.895  1.00   64.38  ? 2048 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   753 ?   ?   ?   A . n 
A 1 2   GLU 2   754 ?   ?   ?   A . n 
A 1 3   ARG 3   755 ?   ?   ?   A . n 
A 1 4   MET 4   756 756 MET MET A . n 
A 1 5   TYR 5   757 757 TYR TYR A . n 
A 1 6   ASP 6   758 758 ASP ASP A . n 
A 1 7   VAL 7   759 759 VAL VAL A . n 
A 1 8   THR 8   760 760 THR THR A . n 
A 1 9   PRO 9   761 761 PRO PRO A . n 
A 1 10  PRO 10  762 762 PRO PRO A . n 
A 1 11  GLY 11  763 763 GLY GLY A . n 
A 1 12  VAL 12  764 764 VAL VAL A . n 
A 1 13  VAL 13  765 765 VAL VAL A . n 
A 1 14  MET 14  766 766 MET MET A . n 
A 1 15  GLY 15  767 767 GLY GLY A . n 
A 1 16  LEU 16  768 768 LEU LEU A . n 
A 1 17  ALA 17  769 769 ALA ALA A . n 
A 1 18  TRP 18  770 770 TRP TRP A . n 
A 1 19  THR 19  771 771 THR THR A . n 
A 1 20  ALA 20  772 772 ALA ALA A . n 
A 1 21  MET 21  773 773 MET MET A . n 
A 1 22  GLY 22  774 774 GLY GLY A . n 
A 1 23  GLY 23  775 775 GLY GLY A . n 
A 1 24  SER 24  776 776 SER SER A . n 
A 1 25  THR 25  777 777 THR THR A . n 
A 1 26  LEU 26  778 778 LEU LEU A . n 
A 1 27  PHE 27  779 779 PHE PHE A . n 
A 1 28  VAL 28  780 780 VAL VAL A . n 
A 1 29  GLU 29  781 781 GLU GLU A . n 
A 1 30  THR 30  782 782 THR THR A . n 
A 1 31  SER 31  783 783 SER SER A . n 
A 1 32  LEU 32  784 784 LEU LEU A . n 
A 1 33  ARG 33  785 785 ARG ARG A . n 
A 1 34  ARG 34  786 786 ARG ARG A . n 
A 1 35  PRO 35  787 787 PRO PRO A . n 
A 1 36  GLN 36  788 788 GLN GLN A . n 
A 1 37  ASP 37  789 ?   ?   ?   A . n 
A 1 38  LYS 38  790 ?   ?   ?   A . n 
A 1 39  ASP 39  791 ?   ?   ?   A . n 
A 1 40  ALA 40  792 ?   ?   ?   A . n 
A 1 41  LYS 41  793 ?   ?   ?   A . n 
A 1 42  GLY 42  794 ?   ?   ?   A . n 
A 1 43  ASP 43  795 ?   ?   ?   A . n 
A 1 44  LYS 44  796 ?   ?   ?   A . n 
A 1 45  ASP 45  797 797 ASP ASP A . n 
A 1 46  GLY 46  798 798 GLY GLY A . n 
A 1 47  SER 47  799 799 SER SER A . n 
A 1 48  LEU 48  800 800 LEU LEU A . n 
A 1 49  GLU 49  801 801 GLU GLU A . n 
A 1 50  VAL 50  802 802 VAL VAL A . n 
A 1 51  THR 51  803 803 THR THR A . n 
A 1 52  GLY 52  804 804 GLY GLY A . n 
A 1 53  GLN 53  805 805 GLN GLN A . n 
A 1 54  LEU 54  806 806 LEU LEU A . n 
A 1 55  GLY 55  807 807 GLY GLY A . n 
A 1 56  GLU 56  808 808 GLU GLU A . n 
A 1 57  VAL 57  809 809 VAL VAL A . n 
A 1 58  MET 58  810 810 MET MET A . n 
A 1 59  LYS 59  811 811 LYS LYS A . n 
A 1 60  GLU 60  812 812 GLU GLU A . n 
A 1 61  SER 61  813 813 SER SER A . n 
A 1 62  ALA 62  814 814 ALA ALA A . n 
A 1 63  ARG 63  815 815 ARG ARG A . n 
A 1 64  ILE 64  816 816 ILE ILE A . n 
A 1 65  ALA 65  817 817 ALA ALA A . n 
A 1 66  TYR 66  818 818 TYR TYR A . n 
A 1 67  THR 67  819 819 THR THR A . n 
A 1 68  PHE 68  820 820 PHE PHE A . n 
A 1 69  ALA 69  821 821 ALA ALA A . n 
A 1 70  ARG 70  822 822 ARG ARG A . n 
A 1 71  ALA 71  823 823 ALA ALA A . n 
A 1 72  PHE 72  824 824 PHE PHE A . n 
A 1 73  LEU 73  825 825 LEU LEU A . n 
A 1 74  MET 74  826 826 MET MET A . n 
A 1 75  GLN 75  827 827 GLN GLN A . n 
A 1 76  HIS 76  828 828 HIS HIS A . n 
A 1 77  ALA 77  829 829 ALA ALA A . n 
A 1 78  PRO 78  830 830 PRO PRO A . n 
A 1 79  ALA 79  831 831 ALA ALA A . n 
A 1 80  ASN 80  832 832 ASN ASN A . n 
A 1 81  ASP 81  833 833 ASP ASP A . n 
A 1 82  TYR 82  834 834 TYR TYR A . n 
A 1 83  LEU 83  835 835 LEU LEU A . n 
A 1 84  VAL 84  836 836 VAL VAL A . n 
A 1 85  THR 85  837 837 THR THR A . n 
A 1 86  SER 86  838 838 SER SER A . n 
A 1 87  HIS 87  839 839 HIS HIS A . n 
A 1 88  ILE 88  840 840 ILE ILE A . n 
A 1 89  HIS 89  841 841 HIS HIS A . n 
A 1 90  LEU 90  842 842 LEU LEU A . n 
A 1 91  HIS 91  843 843 HIS HIS A . n 
A 1 92  VAL 92  844 844 VAL VAL A . n 
A 1 93  PRO 93  845 845 PRO PRO A . n 
A 1 94  GLU 94  846 846 GLU GLU A . n 
A 1 95  GLY 95  847 847 GLY GLY A . n 
A 1 96  ALA 96  848 848 ALA ALA A . n 
A 1 97  THR 97  849 849 THR THR A . n 
A 1 98  PRO 98  850 850 PRO PRO A . n 
A 1 99  LYS 99  851 851 LYS LYS A . n 
A 1 100 ASP 100 852 852 ASP ASP A . n 
A 1 101 GLY 101 853 853 GLY GLY A . n 
A 1 102 PRO 102 854 854 PRO PRO A . n 
A 1 103 SER 103 855 855 SER SER A . n 
A 1 104 ALA 104 856 856 ALA ALA A . n 
A 1 105 GLY 105 857 857 GLY GLY A . n 
A 1 106 CYS 106 858 858 CYS CYS A . n 
A 1 107 THR 107 859 859 THR THR A . n 
A 1 108 ILE 108 860 860 ILE ILE A . n 
A 1 109 VAL 109 861 861 VAL VAL A . n 
A 1 110 THR 110 862 862 THR THR A . n 
A 1 111 ALA 111 863 863 ALA ALA A . n 
A 1 112 LEU 112 864 864 LEU LEU A . n 
A 1 113 LEU 113 865 865 LEU LEU A . n 
A 1 114 SER 114 866 866 SER SER A . n 
A 1 115 LEU 115 867 867 LEU LEU A . n 
A 1 116 ALA 116 868 868 ALA ALA A . n 
A 1 117 MET 117 869 869 MET MET A . n 
A 1 118 GLY 118 870 870 GLY GLY A . n 
A 1 119 ARG 119 871 871 ARG ARG A . n 
A 1 120 PRO 120 872 872 PRO PRO A . n 
A 1 121 VAL 121 873 873 VAL VAL A . n 
A 1 122 ARG 122 874 874 ARG ARG A . n 
A 1 123 GLN 123 875 875 GLN GLN A . n 
A 1 124 ASN 124 876 876 ASN ASN A . n 
A 1 125 LEU 125 877 877 LEU LEU A . n 
A 1 126 ALA 126 878 878 ALA ALA A . n 
A 1 127 MET 127 879 879 MET MET A . n 
A 1 128 THR 128 880 880 THR THR A . n 
A 1 129 GLY 129 881 881 GLY GLY A . n 
A 1 130 GLU 130 882 882 GLU GLU A . n 
A 1 131 VAL 131 883 883 VAL VAL A . n 
A 1 132 SER 132 884 884 SER SER A . n 
A 1 133 LEU 133 885 885 LEU LEU A . n 
A 1 134 THR 134 886 886 THR THR A . n 
A 1 135 GLY 135 887 887 GLY GLY A . n 
A 1 136 LYS 136 888 888 LYS LYS A . n 
A 1 137 ILE 137 889 889 ILE ILE A . n 
A 1 138 LEU 138 890 890 LEU LEU A . n 
A 1 139 PRO 139 891 891 PRO PRO A . n 
A 1 140 VAL 140 892 892 VAL VAL A . n 
A 1 141 GLY 141 893 893 GLY GLY A . n 
A 1 142 GLY 142 894 894 GLY GLY A . n 
A 1 143 ILE 143 895 895 ILE ILE A . n 
A 1 144 LYS 144 896 896 LYS LYS A . n 
A 1 145 GLU 145 897 897 GLU GLU A . n 
A 1 146 LYS 146 898 898 LYS LYS A . n 
A 1 147 THR 147 899 899 THR THR A . n 
A 1 148 ILE 148 900 900 ILE ILE A . n 
A 1 149 ALA 149 901 901 ALA ALA A . n 
A 1 150 ALA 150 902 902 ALA ALA A . n 
A 1 151 LYS 151 903 903 LYS LYS A . n 
A 1 152 ARG 152 904 904 ARG ARG A . n 
A 1 153 ALA 153 905 905 ALA ALA A . n 
A 1 154 GLY 154 906 906 GLY GLY A . n 
A 1 155 VAL 155 907 907 VAL VAL A . n 
A 1 156 THR 156 908 908 THR THR A . n 
A 1 157 CYS 157 909 909 CYS CYS A . n 
A 1 158 ILE 158 910 910 ILE ILE A . n 
A 1 159 VAL 159 911 911 VAL VAL A . n 
A 1 160 LEU 160 912 912 LEU LEU A . n 
A 1 161 PRO 161 913 913 PRO PRO A . n 
A 1 162 ALA 162 914 914 ALA ALA A . n 
A 1 163 GLU 163 915 915 GLU GLU A . n 
A 1 164 ASN 164 916 916 ASN ASN A . n 
A 1 165 LYS 165 917 917 LYS LYS A . n 
A 1 166 LYS 166 918 918 LYS LYS A . n 
A 1 167 ASP 167 919 919 ASP ASP A . n 
A 1 168 PHE 168 920 920 PHE PHE A . n 
A 1 169 TYR 169 921 921 TYR TYR A . n 
A 1 170 ASP 170 922 922 ASP ASP A . n 
A 1 171 LEU 171 923 923 LEU LEU A . n 
A 1 172 ALA 172 924 924 ALA ALA A . n 
A 1 173 ALA 173 925 925 ALA ALA A . n 
A 1 174 PHE 174 926 926 PHE PHE A . n 
A 1 175 ILE 175 927 927 ILE ILE A . n 
A 1 176 THR 176 928 928 THR THR A . n 
A 1 177 GLU 177 929 929 GLU GLU A . n 
A 1 178 GLY 178 930 930 GLY GLY A . n 
A 1 179 LEU 179 931 931 LEU LEU A . n 
A 1 180 GLU 180 932 932 GLU GLU A . n 
A 1 181 VAL 181 933 933 VAL VAL A . n 
A 1 182 HIS 182 934 934 HIS HIS A . n 
A 1 183 PHE 183 935 935 PHE PHE A . n 
A 1 184 VAL 184 936 936 VAL VAL A . n 
A 1 185 GLU 185 937 937 GLU GLU A . n 
A 1 186 HIS 186 938 938 HIS HIS A . n 
A 1 187 TYR 187 939 939 TYR TYR A . n 
A 1 188 ARG 188 940 940 ARG ARG A . n 
A 1 189 GLU 189 941 941 GLU GLU A . n 
A 1 190 ILE 190 942 942 ILE ILE A . n 
A 1 191 PHE 191 943 943 PHE PHE A . n 
A 1 192 ASP 192 944 944 ASP ASP A . n 
A 1 193 ILE 193 945 945 ILE ILE A . n 
A 1 194 ALA 194 946 946 ALA ALA A . n 
A 1 195 PHE 195 947 947 PHE PHE A . n 
A 1 196 PRO 196 948 948 PRO PRO A . n 
A 1 197 ASP 197 949 949 ASP ASP A . n 
A 1 198 GLU 198 950 950 GLU GLU A . n 
A 1 199 GLN 199 951 951 GLN GLN A . n 
A 1 200 ALA 200 952 952 ALA ALA A . n 
A 1 201 GLU 201 953 953 GLU GLU A . n 
A 1 202 ALA 202 954 ?   ?   ?   A . n 
A 1 203 LEU 203 955 ?   ?   ?   A . n 
A 1 204 ALA 204 956 ?   ?   ?   A . n 
A 1 205 VAL 205 957 ?   ?   ?   A . n 
A 1 206 GLU 206 958 ?   ?   ?   A . n 
A 1 207 ARG 207 959 ?   ?   ?   A . n 
B 1 1   VAL 1   753 ?   ?   ?   B . n 
B 1 2   GLU 2   754 ?   ?   ?   B . n 
B 1 3   ARG 3   755 ?   ?   ?   B . n 
B 1 4   MET 4   756 756 MET MET B . n 
B 1 5   TYR 5   757 757 TYR TYR B . n 
B 1 6   ASP 6   758 758 ASP ASP B . n 
B 1 7   VAL 7   759 759 VAL VAL B . n 
B 1 8   THR 8   760 760 THR THR B . n 
B 1 9   PRO 9   761 761 PRO PRO B . n 
B 1 10  PRO 10  762 762 PRO PRO B . n 
B 1 11  GLY 11  763 763 GLY GLY B . n 
B 1 12  VAL 12  764 764 VAL VAL B . n 
B 1 13  VAL 13  765 765 VAL VAL B . n 
B 1 14  MET 14  766 766 MET MET B . n 
B 1 15  GLY 15  767 767 GLY GLY B . n 
B 1 16  LEU 16  768 768 LEU LEU B . n 
B 1 17  ALA 17  769 769 ALA ALA B . n 
B 1 18  TRP 18  770 770 TRP TRP B . n 
B 1 19  THR 19  771 771 THR THR B . n 
B 1 20  ALA 20  772 772 ALA ALA B . n 
B 1 21  MET 21  773 773 MET MET B . n 
B 1 22  GLY 22  774 774 GLY GLY B . n 
B 1 23  GLY 23  775 775 GLY GLY B . n 
B 1 24  SER 24  776 776 SER SER B . n 
B 1 25  THR 25  777 777 THR THR B . n 
B 1 26  LEU 26  778 778 LEU LEU B . n 
B 1 27  PHE 27  779 779 PHE PHE B . n 
B 1 28  VAL 28  780 780 VAL VAL B . n 
B 1 29  GLU 29  781 781 GLU GLU B . n 
B 1 30  THR 30  782 782 THR THR B . n 
B 1 31  SER 31  783 783 SER SER B . n 
B 1 32  LEU 32  784 784 LEU LEU B . n 
B 1 33  ARG 33  785 ?   ?   ?   B . n 
B 1 34  ARG 34  786 ?   ?   ?   B . n 
B 1 35  PRO 35  787 ?   ?   ?   B . n 
B 1 36  GLN 36  788 ?   ?   ?   B . n 
B 1 37  ASP 37  789 ?   ?   ?   B . n 
B 1 38  LYS 38  790 ?   ?   ?   B . n 
B 1 39  ASP 39  791 ?   ?   ?   B . n 
B 1 40  ALA 40  792 ?   ?   ?   B . n 
B 1 41  LYS 41  793 ?   ?   ?   B . n 
B 1 42  GLY 42  794 ?   ?   ?   B . n 
B 1 43  ASP 43  795 ?   ?   ?   B . n 
B 1 44  LYS 44  796 ?   ?   ?   B . n 
B 1 45  ASP 45  797 ?   ?   ?   B . n 
B 1 46  GLY 46  798 798 GLY GLY B . n 
B 1 47  SER 47  799 799 SER SER B . n 
B 1 48  LEU 48  800 800 LEU LEU B . n 
B 1 49  GLU 49  801 801 GLU GLU B . n 
B 1 50  VAL 50  802 802 VAL VAL B . n 
B 1 51  THR 51  803 803 THR THR B . n 
B 1 52  GLY 52  804 804 GLY GLY B . n 
B 1 53  GLN 53  805 805 GLN GLN B . n 
B 1 54  LEU 54  806 806 LEU LEU B . n 
B 1 55  GLY 55  807 807 GLY GLY B . n 
B 1 56  GLU 56  808 808 GLU GLU B . n 
B 1 57  VAL 57  809 809 VAL VAL B . n 
B 1 58  MET 58  810 810 MET MET B . n 
B 1 59  LYS 59  811 811 LYS LYS B . n 
B 1 60  GLU 60  812 812 GLU GLU B . n 
B 1 61  SER 61  813 813 SER SER B . n 
B 1 62  ALA 62  814 814 ALA ALA B . n 
B 1 63  ARG 63  815 815 ARG ARG B . n 
B 1 64  ILE 64  816 816 ILE ILE B . n 
B 1 65  ALA 65  817 817 ALA ALA B . n 
B 1 66  TYR 66  818 818 TYR TYR B . n 
B 1 67  THR 67  819 819 THR THR B . n 
B 1 68  PHE 68  820 820 PHE PHE B . n 
B 1 69  ALA 69  821 821 ALA ALA B . n 
B 1 70  ARG 70  822 822 ARG ARG B . n 
B 1 71  ALA 71  823 823 ALA ALA B . n 
B 1 72  PHE 72  824 824 PHE PHE B . n 
B 1 73  LEU 73  825 825 LEU LEU B . n 
B 1 74  MET 74  826 826 MET MET B . n 
B 1 75  GLN 75  827 827 GLN GLN B . n 
B 1 76  HIS 76  828 828 HIS HIS B . n 
B 1 77  ALA 77  829 829 ALA ALA B . n 
B 1 78  PRO 78  830 830 PRO PRO B . n 
B 1 79  ALA 79  831 831 ALA ALA B . n 
B 1 80  ASN 80  832 832 ASN ASN B . n 
B 1 81  ASP 81  833 833 ASP ASP B . n 
B 1 82  TYR 82  834 834 TYR TYR B . n 
B 1 83  LEU 83  835 835 LEU LEU B . n 
B 1 84  VAL 84  836 836 VAL VAL B . n 
B 1 85  THR 85  837 837 THR THR B . n 
B 1 86  SER 86  838 838 SER SER B . n 
B 1 87  HIS 87  839 839 HIS HIS B . n 
B 1 88  ILE 88  840 840 ILE ILE B . n 
B 1 89  HIS 89  841 841 HIS HIS B . n 
B 1 90  LEU 90  842 842 LEU LEU B . n 
B 1 91  HIS 91  843 843 HIS HIS B . n 
B 1 92  VAL 92  844 844 VAL VAL B . n 
B 1 93  PRO 93  845 845 PRO PRO B . n 
B 1 94  GLU 94  846 846 GLU GLU B . n 
B 1 95  GLY 95  847 847 GLY GLY B . n 
B 1 96  ALA 96  848 848 ALA ALA B . n 
B 1 97  THR 97  849 849 THR THR B . n 
B 1 98  PRO 98  850 850 PRO PRO B . n 
B 1 99  LYS 99  851 851 LYS LYS B . n 
B 1 100 ASP 100 852 852 ASP ASP B . n 
B 1 101 GLY 101 853 853 GLY GLY B . n 
B 1 102 PRO 102 854 854 PRO PRO B . n 
B 1 103 SER 103 855 855 SER SER B . n 
B 1 104 ALA 104 856 856 ALA ALA B . n 
B 1 105 GLY 105 857 857 GLY GLY B . n 
B 1 106 CYS 106 858 858 CYS CYS B . n 
B 1 107 THR 107 859 859 THR THR B . n 
B 1 108 ILE 108 860 860 ILE ILE B . n 
B 1 109 VAL 109 861 861 VAL VAL B . n 
B 1 110 THR 110 862 862 THR THR B . n 
B 1 111 ALA 111 863 863 ALA ALA B . n 
B 1 112 LEU 112 864 864 LEU LEU B . n 
B 1 113 LEU 113 865 865 LEU LEU B . n 
B 1 114 SER 114 866 866 SER SER B . n 
B 1 115 LEU 115 867 867 LEU LEU B . n 
B 1 116 ALA 116 868 868 ALA ALA B . n 
B 1 117 MET 117 869 869 MET MET B . n 
B 1 118 GLY 118 870 870 GLY GLY B . n 
B 1 119 ARG 119 871 871 ARG ARG B . n 
B 1 120 PRO 120 872 872 PRO PRO B . n 
B 1 121 VAL 121 873 873 VAL VAL B . n 
B 1 122 ARG 122 874 874 ARG ARG B . n 
B 1 123 GLN 123 875 875 GLN GLN B . n 
B 1 124 ASN 124 876 876 ASN ASN B . n 
B 1 125 LEU 125 877 877 LEU LEU B . n 
B 1 126 ALA 126 878 878 ALA ALA B . n 
B 1 127 MET 127 879 879 MET MET B . n 
B 1 128 THR 128 880 880 THR THR B . n 
B 1 129 GLY 129 881 881 GLY GLY B . n 
B 1 130 GLU 130 882 882 GLU GLU B . n 
B 1 131 VAL 131 883 883 VAL VAL B . n 
B 1 132 SER 132 884 884 SER SER B . n 
B 1 133 LEU 133 885 885 LEU LEU B . n 
B 1 134 THR 134 886 886 THR THR B . n 
B 1 135 GLY 135 887 887 GLY GLY B . n 
B 1 136 LYS 136 888 888 LYS LYS B . n 
B 1 137 ILE 137 889 889 ILE ILE B . n 
B 1 138 LEU 138 890 890 LEU LEU B . n 
B 1 139 PRO 139 891 891 PRO PRO B . n 
B 1 140 VAL 140 892 892 VAL VAL B . n 
B 1 141 GLY 141 893 893 GLY GLY B . n 
B 1 142 GLY 142 894 894 GLY GLY B . n 
B 1 143 ILE 143 895 895 ILE ILE B . n 
B 1 144 LYS 144 896 896 LYS LYS B . n 
B 1 145 GLU 145 897 897 GLU GLU B . n 
B 1 146 LYS 146 898 898 LYS LYS B . n 
B 1 147 THR 147 899 899 THR THR B . n 
B 1 148 ILE 148 900 900 ILE ILE B . n 
B 1 149 ALA 149 901 901 ALA ALA B . n 
B 1 150 ALA 150 902 902 ALA ALA B . n 
B 1 151 LYS 151 903 903 LYS LYS B . n 
B 1 152 ARG 152 904 904 ARG ARG B . n 
B 1 153 ALA 153 905 905 ALA ALA B . n 
B 1 154 GLY 154 906 906 GLY GLY B . n 
B 1 155 VAL 155 907 907 VAL VAL B . n 
B 1 156 THR 156 908 908 THR THR B . n 
B 1 157 CYS 157 909 909 CYS CYS B . n 
B 1 158 ILE 158 910 910 ILE ILE B . n 
B 1 159 VAL 159 911 911 VAL VAL B . n 
B 1 160 LEU 160 912 912 LEU LEU B . n 
B 1 161 PRO 161 913 913 PRO PRO B . n 
B 1 162 ALA 162 914 914 ALA ALA B . n 
B 1 163 GLU 163 915 915 GLU GLU B . n 
B 1 164 ASN 164 916 916 ASN ASN B . n 
B 1 165 LYS 165 917 917 LYS LYS B . n 
B 1 166 LYS 166 918 918 LYS LYS B . n 
B 1 167 ASP 167 919 919 ASP ASP B . n 
B 1 168 PHE 168 920 920 PHE PHE B . n 
B 1 169 TYR 169 921 921 TYR TYR B . n 
B 1 170 ASP 170 922 922 ASP ASP B . n 
B 1 171 LEU 171 923 923 LEU LEU B . n 
B 1 172 ALA 172 924 924 ALA ALA B . n 
B 1 173 ALA 173 925 925 ALA ALA B . n 
B 1 174 PHE 174 926 926 PHE PHE B . n 
B 1 175 ILE 175 927 927 ILE ILE B . n 
B 1 176 THR 176 928 928 THR THR B . n 
B 1 177 GLU 177 929 929 GLU GLU B . n 
B 1 178 GLY 178 930 930 GLY GLY B . n 
B 1 179 LEU 179 931 931 LEU LEU B . n 
B 1 180 GLU 180 932 932 GLU GLU B . n 
B 1 181 VAL 181 933 933 VAL VAL B . n 
B 1 182 HIS 182 934 934 HIS HIS B . n 
B 1 183 PHE 183 935 935 PHE PHE B . n 
B 1 184 VAL 184 936 936 VAL VAL B . n 
B 1 185 GLU 185 937 937 GLU GLU B . n 
B 1 186 HIS 186 938 938 HIS HIS B . n 
B 1 187 TYR 187 939 939 TYR TYR B . n 
B 1 188 ARG 188 940 940 ARG ARG B . n 
B 1 189 GLU 189 941 941 GLU GLU B . n 
B 1 190 ILE 190 942 942 ILE ILE B . n 
B 1 191 PHE 191 943 943 PHE PHE B . n 
B 1 192 ASP 192 944 944 ASP ASP B . n 
B 1 193 ILE 193 945 945 ILE ILE B . n 
B 1 194 ALA 194 946 946 ALA ALA B . n 
B 1 195 PHE 195 947 947 PHE PHE B . n 
B 1 196 PRO 196 948 948 PRO PRO B . n 
B 1 197 ASP 197 949 ?   ?   ?   B . n 
B 1 198 GLU 198 950 ?   ?   ?   B . n 
B 1 199 GLN 199 951 ?   ?   ?   B . n 
B 1 200 ALA 200 952 ?   ?   ?   B . n 
B 1 201 GLU 201 953 ?   ?   ?   B . n 
B 1 202 ALA 202 954 ?   ?   ?   B . n 
B 1 203 LEU 203 955 ?   ?   ?   B . n 
B 1 204 ALA 204 956 ?   ?   ?   B . n 
B 1 205 VAL 205 957 ?   ?   ?   B . n 
B 1 206 GLU 206 958 ?   ?   ?   B . n 
B 1 207 ARG 207 959 ?   ?   ?   B . n 
C 1 1   VAL 1   753 ?   ?   ?   C . n 
C 1 2   GLU 2   754 ?   ?   ?   C . n 
C 1 3   ARG 3   755 755 ARG ARG C . n 
C 1 4   MET 4   756 756 MET MET C . n 
C 1 5   TYR 5   757 757 TYR TYR C . n 
C 1 6   ASP 6   758 758 ASP ASP C . n 
C 1 7   VAL 7   759 759 VAL VAL C . n 
C 1 8   THR 8   760 760 THR THR C . n 
C 1 9   PRO 9   761 761 PRO PRO C . n 
C 1 10  PRO 10  762 762 PRO PRO C . n 
C 1 11  GLY 11  763 763 GLY GLY C . n 
C 1 12  VAL 12  764 764 VAL VAL C . n 
C 1 13  VAL 13  765 765 VAL VAL C . n 
C 1 14  MET 14  766 766 MET MET C . n 
C 1 15  GLY 15  767 767 GLY GLY C . n 
C 1 16  LEU 16  768 768 LEU LEU C . n 
C 1 17  ALA 17  769 769 ALA ALA C . n 
C 1 18  TRP 18  770 770 TRP TRP C . n 
C 1 19  THR 19  771 771 THR THR C . n 
C 1 20  ALA 20  772 772 ALA ALA C . n 
C 1 21  MET 21  773 773 MET MET C . n 
C 1 22  GLY 22  774 774 GLY GLY C . n 
C 1 23  GLY 23  775 775 GLY GLY C . n 
C 1 24  SER 24  776 776 SER SER C . n 
C 1 25  THR 25  777 777 THR THR C . n 
C 1 26  LEU 26  778 778 LEU LEU C . n 
C 1 27  PHE 27  779 779 PHE PHE C . n 
C 1 28  VAL 28  780 780 VAL VAL C . n 
C 1 29  GLU 29  781 781 GLU GLU C . n 
C 1 30  THR 30  782 782 THR THR C . n 
C 1 31  SER 31  783 783 SER SER C . n 
C 1 32  LEU 32  784 784 LEU LEU C . n 
C 1 33  ARG 33  785 785 ARG ARG C . n 
C 1 34  ARG 34  786 786 ARG ARG C . n 
C 1 35  PRO 35  787 787 PRO PRO C . n 
C 1 36  GLN 36  788 788 GLN GLN C . n 
C 1 37  ASP 37  789 ?   ?   ?   C . n 
C 1 38  LYS 38  790 ?   ?   ?   C . n 
C 1 39  ASP 39  791 ?   ?   ?   C . n 
C 1 40  ALA 40  792 ?   ?   ?   C . n 
C 1 41  LYS 41  793 ?   ?   ?   C . n 
C 1 42  GLY 42  794 ?   ?   ?   C . n 
C 1 43  ASP 43  795 ?   ?   ?   C . n 
C 1 44  LYS 44  796 796 LYS LYS C . n 
C 1 45  ASP 45  797 797 ASP ASP C . n 
C 1 46  GLY 46  798 798 GLY GLY C . n 
C 1 47  SER 47  799 799 SER SER C . n 
C 1 48  LEU 48  800 800 LEU LEU C . n 
C 1 49  GLU 49  801 801 GLU GLU C . n 
C 1 50  VAL 50  802 802 VAL VAL C . n 
C 1 51  THR 51  803 803 THR THR C . n 
C 1 52  GLY 52  804 804 GLY GLY C . n 
C 1 53  GLN 53  805 805 GLN GLN C . n 
C 1 54  LEU 54  806 806 LEU LEU C . n 
C 1 55  GLY 55  807 807 GLY GLY C . n 
C 1 56  GLU 56  808 808 GLU GLU C . n 
C 1 57  VAL 57  809 809 VAL VAL C . n 
C 1 58  MET 58  810 810 MET MET C . n 
C 1 59  LYS 59  811 811 LYS LYS C . n 
C 1 60  GLU 60  812 812 GLU GLU C . n 
C 1 61  SER 61  813 813 SER SER C . n 
C 1 62  ALA 62  814 814 ALA ALA C . n 
C 1 63  ARG 63  815 815 ARG ARG C . n 
C 1 64  ILE 64  816 816 ILE ILE C . n 
C 1 65  ALA 65  817 817 ALA ALA C . n 
C 1 66  TYR 66  818 818 TYR TYR C . n 
C 1 67  THR 67  819 819 THR THR C . n 
C 1 68  PHE 68  820 820 PHE PHE C . n 
C 1 69  ALA 69  821 821 ALA ALA C . n 
C 1 70  ARG 70  822 822 ARG ARG C . n 
C 1 71  ALA 71  823 823 ALA ALA C . n 
C 1 72  PHE 72  824 824 PHE PHE C . n 
C 1 73  LEU 73  825 825 LEU LEU C . n 
C 1 74  MET 74  826 826 MET MET C . n 
C 1 75  GLN 75  827 827 GLN GLN C . n 
C 1 76  HIS 76  828 828 HIS HIS C . n 
C 1 77  ALA 77  829 829 ALA ALA C . n 
C 1 78  PRO 78  830 830 PRO PRO C . n 
C 1 79  ALA 79  831 831 ALA ALA C . n 
C 1 80  ASN 80  832 832 ASN ASN C . n 
C 1 81  ASP 81  833 833 ASP ASP C . n 
C 1 82  TYR 82  834 834 TYR TYR C . n 
C 1 83  LEU 83  835 835 LEU LEU C . n 
C 1 84  VAL 84  836 836 VAL VAL C . n 
C 1 85  THR 85  837 837 THR THR C . n 
C 1 86  SER 86  838 838 SER SER C . n 
C 1 87  HIS 87  839 839 HIS HIS C . n 
C 1 88  ILE 88  840 840 ILE ILE C . n 
C 1 89  HIS 89  841 841 HIS HIS C . n 
C 1 90  LEU 90  842 842 LEU LEU C . n 
C 1 91  HIS 91  843 843 HIS HIS C . n 
C 1 92  VAL 92  844 844 VAL VAL C . n 
C 1 93  PRO 93  845 845 PRO PRO C . n 
C 1 94  GLU 94  846 846 GLU GLU C . n 
C 1 95  GLY 95  847 847 GLY GLY C . n 
C 1 96  ALA 96  848 848 ALA ALA C . n 
C 1 97  THR 97  849 849 THR THR C . n 
C 1 98  PRO 98  850 850 PRO PRO C . n 
C 1 99  LYS 99  851 851 LYS LYS C . n 
C 1 100 ASP 100 852 852 ASP ASP C . n 
C 1 101 GLY 101 853 853 GLY GLY C . n 
C 1 102 PRO 102 854 854 PRO PRO C . n 
C 1 103 SER 103 855 855 SER SER C . n 
C 1 104 ALA 104 856 856 ALA ALA C . n 
C 1 105 GLY 105 857 857 GLY GLY C . n 
C 1 106 CYS 106 858 858 CYS CYS C . n 
C 1 107 THR 107 859 859 THR THR C . n 
C 1 108 ILE 108 860 860 ILE ILE C . n 
C 1 109 VAL 109 861 861 VAL VAL C . n 
C 1 110 THR 110 862 862 THR THR C . n 
C 1 111 ALA 111 863 863 ALA ALA C . n 
C 1 112 LEU 112 864 864 LEU LEU C . n 
C 1 113 LEU 113 865 865 LEU LEU C . n 
C 1 114 SER 114 866 866 SER SER C . n 
C 1 115 LEU 115 867 867 LEU LEU C . n 
C 1 116 ALA 116 868 868 ALA ALA C . n 
C 1 117 MET 117 869 869 MET MET C . n 
C 1 118 GLY 118 870 870 GLY GLY C . n 
C 1 119 ARG 119 871 871 ARG ARG C . n 
C 1 120 PRO 120 872 872 PRO PRO C . n 
C 1 121 VAL 121 873 873 VAL VAL C . n 
C 1 122 ARG 122 874 874 ARG ARG C . n 
C 1 123 GLN 123 875 875 GLN GLN C . n 
C 1 124 ASN 124 876 876 ASN ASN C . n 
C 1 125 LEU 125 877 877 LEU LEU C . n 
C 1 126 ALA 126 878 878 ALA ALA C . n 
C 1 127 MET 127 879 879 MET MET C . n 
C 1 128 THR 128 880 880 THR THR C . n 
C 1 129 GLY 129 881 881 GLY GLY C . n 
C 1 130 GLU 130 882 882 GLU GLU C . n 
C 1 131 VAL 131 883 883 VAL VAL C . n 
C 1 132 SER 132 884 884 SER SER C . n 
C 1 133 LEU 133 885 885 LEU LEU C . n 
C 1 134 THR 134 886 886 THR THR C . n 
C 1 135 GLY 135 887 887 GLY GLY C . n 
C 1 136 LYS 136 888 888 LYS LYS C . n 
C 1 137 ILE 137 889 889 ILE ILE C . n 
C 1 138 LEU 138 890 890 LEU LEU C . n 
C 1 139 PRO 139 891 891 PRO PRO C . n 
C 1 140 VAL 140 892 892 VAL VAL C . n 
C 1 141 GLY 141 893 893 GLY GLY C . n 
C 1 142 GLY 142 894 894 GLY GLY C . n 
C 1 143 ILE 143 895 895 ILE ILE C . n 
C 1 144 LYS 144 896 896 LYS LYS C . n 
C 1 145 GLU 145 897 897 GLU GLU C . n 
C 1 146 LYS 146 898 898 LYS LYS C . n 
C 1 147 THR 147 899 899 THR THR C . n 
C 1 148 ILE 148 900 900 ILE ILE C . n 
C 1 149 ALA 149 901 901 ALA ALA C . n 
C 1 150 ALA 150 902 902 ALA ALA C . n 
C 1 151 LYS 151 903 903 LYS LYS C . n 
C 1 152 ARG 152 904 904 ARG ARG C . n 
C 1 153 ALA 153 905 905 ALA ALA C . n 
C 1 154 GLY 154 906 906 GLY GLY C . n 
C 1 155 VAL 155 907 907 VAL VAL C . n 
C 1 156 THR 156 908 908 THR THR C . n 
C 1 157 CYS 157 909 909 CYS CYS C . n 
C 1 158 ILE 158 910 910 ILE ILE C . n 
C 1 159 VAL 159 911 911 VAL VAL C . n 
C 1 160 LEU 160 912 912 LEU LEU C . n 
C 1 161 PRO 161 913 913 PRO PRO C . n 
C 1 162 ALA 162 914 914 ALA ALA C . n 
C 1 163 GLU 163 915 915 GLU GLU C . n 
C 1 164 ASN 164 916 916 ASN ASN C . n 
C 1 165 LYS 165 917 917 LYS LYS C . n 
C 1 166 LYS 166 918 918 LYS LYS C . n 
C 1 167 ASP 167 919 919 ASP ASP C . n 
C 1 168 PHE 168 920 920 PHE PHE C . n 
C 1 169 TYR 169 921 921 TYR TYR C . n 
C 1 170 ASP 170 922 922 ASP ASP C . n 
C 1 171 LEU 171 923 923 LEU LEU C . n 
C 1 172 ALA 172 924 924 ALA ALA C . n 
C 1 173 ALA 173 925 925 ALA ALA C . n 
C 1 174 PHE 174 926 926 PHE PHE C . n 
C 1 175 ILE 175 927 927 ILE ILE C . n 
C 1 176 THR 176 928 928 THR THR C . n 
C 1 177 GLU 177 929 929 GLU GLU C . n 
C 1 178 GLY 178 930 930 GLY GLY C . n 
C 1 179 LEU 179 931 931 LEU LEU C . n 
C 1 180 GLU 180 932 932 GLU GLU C . n 
C 1 181 VAL 181 933 933 VAL VAL C . n 
C 1 182 HIS 182 934 934 HIS HIS C . n 
C 1 183 PHE 183 935 935 PHE PHE C . n 
C 1 184 VAL 184 936 936 VAL VAL C . n 
C 1 185 GLU 185 937 937 GLU GLU C . n 
C 1 186 HIS 186 938 938 HIS HIS C . n 
C 1 187 TYR 187 939 939 TYR TYR C . n 
C 1 188 ARG 188 940 940 ARG ARG C . n 
C 1 189 GLU 189 941 941 GLU GLU C . n 
C 1 190 ILE 190 942 942 ILE ILE C . n 
C 1 191 PHE 191 943 943 PHE PHE C . n 
C 1 192 ASP 192 944 944 ASP ASP C . n 
C 1 193 ILE 193 945 945 ILE ILE C . n 
C 1 194 ALA 194 946 946 ALA ALA C . n 
C 1 195 PHE 195 947 947 PHE PHE C . n 
C 1 196 PRO 196 948 948 PRO PRO C . n 
C 1 197 ASP 197 949 949 ASP ASP C . n 
C 1 198 GLU 198 950 950 GLU GLU C . n 
C 1 199 GLN 199 951 951 GLN GLN C . n 
C 1 200 ALA 200 952 952 ALA ALA C . n 
C 1 201 GLU 201 953 953 GLU GLU C . n 
C 1 202 ALA 202 954 ?   ?   ?   C . n 
C 1 203 LEU 203 955 ?   ?   ?   C . n 
C 1 204 ALA 204 956 ?   ?   ?   C . n 
C 1 205 VAL 205 957 ?   ?   ?   C . n 
C 1 206 GLU 206 958 ?   ?   ?   C . n 
C 1 207 ARG 207 959 ?   ?   ?   C . n 
D 1 1   VAL 1   753 ?   ?   ?   D . n 
D 1 2   GLU 2   754 ?   ?   ?   D . n 
D 1 3   ARG 3   755 ?   ?   ?   D . n 
D 1 4   MET 4   756 ?   ?   ?   D . n 
D 1 5   TYR 5   757 ?   ?   ?   D . n 
D 1 6   ASP 6   758 ?   ?   ?   D . n 
D 1 7   VAL 7   759 ?   ?   ?   D . n 
D 1 8   THR 8   760 760 THR THR D . n 
D 1 9   PRO 9   761 761 PRO PRO D . n 
D 1 10  PRO 10  762 762 PRO PRO D . n 
D 1 11  GLY 11  763 763 GLY GLY D . n 
D 1 12  VAL 12  764 764 VAL VAL D . n 
D 1 13  VAL 13  765 765 VAL VAL D . n 
D 1 14  MET 14  766 766 MET MET D . n 
D 1 15  GLY 15  767 767 GLY GLY D . n 
D 1 16  LEU 16  768 768 LEU LEU D . n 
D 1 17  ALA 17  769 769 ALA ALA D . n 
D 1 18  TRP 18  770 770 TRP TRP D . n 
D 1 19  THR 19  771 771 THR THR D . n 
D 1 20  ALA 20  772 772 ALA ALA D . n 
D 1 21  MET 21  773 773 MET MET D . n 
D 1 22  GLY 22  774 774 GLY GLY D . n 
D 1 23  GLY 23  775 775 GLY GLY D . n 
D 1 24  SER 24  776 776 SER SER D . n 
D 1 25  THR 25  777 777 THR THR D . n 
D 1 26  LEU 26  778 778 LEU LEU D . n 
D 1 27  PHE 27  779 779 PHE PHE D . n 
D 1 28  VAL 28  780 780 VAL VAL D . n 
D 1 29  GLU 29  781 781 GLU GLU D . n 
D 1 30  THR 30  782 782 THR THR D . n 
D 1 31  SER 31  783 783 SER SER D . n 
D 1 32  LEU 32  784 784 LEU LEU D . n 
D 1 33  ARG 33  785 785 ARG ARG D . n 
D 1 34  ARG 34  786 ?   ?   ?   D . n 
D 1 35  PRO 35  787 ?   ?   ?   D . n 
D 1 36  GLN 36  788 ?   ?   ?   D . n 
D 1 37  ASP 37  789 ?   ?   ?   D . n 
D 1 38  LYS 38  790 ?   ?   ?   D . n 
D 1 39  ASP 39  791 ?   ?   ?   D . n 
D 1 40  ALA 40  792 ?   ?   ?   D . n 
D 1 41  LYS 41  793 ?   ?   ?   D . n 
D 1 42  GLY 42  794 ?   ?   ?   D . n 
D 1 43  ASP 43  795 ?   ?   ?   D . n 
D 1 44  LYS 44  796 ?   ?   ?   D . n 
D 1 45  ASP 45  797 797 ASP ASP D . n 
D 1 46  GLY 46  798 798 GLY GLY D . n 
D 1 47  SER 47  799 799 SER SER D . n 
D 1 48  LEU 48  800 800 LEU LEU D . n 
D 1 49  GLU 49  801 801 GLU GLU D . n 
D 1 50  VAL 50  802 802 VAL VAL D . n 
D 1 51  THR 51  803 803 THR THR D . n 
D 1 52  GLY 52  804 804 GLY GLY D . n 
D 1 53  GLN 53  805 805 GLN GLN D . n 
D 1 54  LEU 54  806 806 LEU LEU D . n 
D 1 55  GLY 55  807 807 GLY GLY D . n 
D 1 56  GLU 56  808 808 GLU GLU D . n 
D 1 57  VAL 57  809 809 VAL VAL D . n 
D 1 58  MET 58  810 810 MET MET D . n 
D 1 59  LYS 59  811 811 LYS LYS D . n 
D 1 60  GLU 60  812 812 GLU GLU D . n 
D 1 61  SER 61  813 813 SER SER D . n 
D 1 62  ALA 62  814 814 ALA ALA D . n 
D 1 63  ARG 63  815 815 ARG ARG D . n 
D 1 64  ILE 64  816 816 ILE ILE D . n 
D 1 65  ALA 65  817 817 ALA ALA D . n 
D 1 66  TYR 66  818 818 TYR TYR D . n 
D 1 67  THR 67  819 819 THR THR D . n 
D 1 68  PHE 68  820 820 PHE PHE D . n 
D 1 69  ALA 69  821 821 ALA ALA D . n 
D 1 70  ARG 70  822 822 ARG ARG D . n 
D 1 71  ALA 71  823 823 ALA ALA D . n 
D 1 72  PHE 72  824 824 PHE PHE D . n 
D 1 73  LEU 73  825 825 LEU LEU D . n 
D 1 74  MET 74  826 826 MET MET D . n 
D 1 75  GLN 75  827 827 GLN GLN D . n 
D 1 76  HIS 76  828 828 HIS HIS D . n 
D 1 77  ALA 77  829 829 ALA ALA D . n 
D 1 78  PRO 78  830 830 PRO PRO D . n 
D 1 79  ALA 79  831 831 ALA ALA D . n 
D 1 80  ASN 80  832 832 ASN ASN D . n 
D 1 81  ASP 81  833 833 ASP ASP D . n 
D 1 82  TYR 82  834 834 TYR TYR D . n 
D 1 83  LEU 83  835 835 LEU LEU D . n 
D 1 84  VAL 84  836 836 VAL VAL D . n 
D 1 85  THR 85  837 837 THR THR D . n 
D 1 86  SER 86  838 838 SER SER D . n 
D 1 87  HIS 87  839 839 HIS HIS D . n 
D 1 88  ILE 88  840 840 ILE ILE D . n 
D 1 89  HIS 89  841 841 HIS HIS D . n 
D 1 90  LEU 90  842 842 LEU LEU D . n 
D 1 91  HIS 91  843 843 HIS HIS D . n 
D 1 92  VAL 92  844 844 VAL VAL D . n 
D 1 93  PRO 93  845 845 PRO PRO D . n 
D 1 94  GLU 94  846 846 GLU GLU D . n 
D 1 95  GLY 95  847 847 GLY GLY D . n 
D 1 96  ALA 96  848 848 ALA ALA D . n 
D 1 97  THR 97  849 849 THR THR D . n 
D 1 98  PRO 98  850 850 PRO PRO D . n 
D 1 99  LYS 99  851 851 LYS LYS D . n 
D 1 100 ASP 100 852 852 ASP ASP D . n 
D 1 101 GLY 101 853 853 GLY GLY D . n 
D 1 102 PRO 102 854 854 PRO PRO D . n 
D 1 103 SER 103 855 855 SER SER D . n 
D 1 104 ALA 104 856 856 ALA ALA D . n 
D 1 105 GLY 105 857 857 GLY GLY D . n 
D 1 106 CYS 106 858 858 CYS CYS D . n 
D 1 107 THR 107 859 859 THR THR D . n 
D 1 108 ILE 108 860 860 ILE ILE D . n 
D 1 109 VAL 109 861 861 VAL VAL D . n 
D 1 110 THR 110 862 862 THR THR D . n 
D 1 111 ALA 111 863 863 ALA ALA D . n 
D 1 112 LEU 112 864 864 LEU LEU D . n 
D 1 113 LEU 113 865 865 LEU LEU D . n 
D 1 114 SER 114 866 866 SER SER D . n 
D 1 115 LEU 115 867 867 LEU LEU D . n 
D 1 116 ALA 116 868 868 ALA ALA D . n 
D 1 117 MET 117 869 869 MET MET D . n 
D 1 118 GLY 118 870 870 GLY GLY D . n 
D 1 119 ARG 119 871 871 ARG ARG D . n 
D 1 120 PRO 120 872 872 PRO PRO D . n 
D 1 121 VAL 121 873 873 VAL VAL D . n 
D 1 122 ARG 122 874 874 ARG ARG D . n 
D 1 123 GLN 123 875 875 GLN GLN D . n 
D 1 124 ASN 124 876 876 ASN ASN D . n 
D 1 125 LEU 125 877 877 LEU LEU D . n 
D 1 126 ALA 126 878 878 ALA ALA D . n 
D 1 127 MET 127 879 879 MET MET D . n 
D 1 128 THR 128 880 880 THR THR D . n 
D 1 129 GLY 129 881 881 GLY GLY D . n 
D 1 130 GLU 130 882 882 GLU GLU D . n 
D 1 131 VAL 131 883 883 VAL VAL D . n 
D 1 132 SER 132 884 884 SER SER D . n 
D 1 133 LEU 133 885 885 LEU LEU D . n 
D 1 134 THR 134 886 886 THR THR D . n 
D 1 135 GLY 135 887 887 GLY GLY D . n 
D 1 136 LYS 136 888 888 LYS LYS D . n 
D 1 137 ILE 137 889 889 ILE ILE D . n 
D 1 138 LEU 138 890 890 LEU LEU D . n 
D 1 139 PRO 139 891 891 PRO PRO D . n 
D 1 140 VAL 140 892 892 VAL VAL D . n 
D 1 141 GLY 141 893 893 GLY GLY D . n 
D 1 142 GLY 142 894 894 GLY GLY D . n 
D 1 143 ILE 143 895 895 ILE ILE D . n 
D 1 144 LYS 144 896 896 LYS LYS D . n 
D 1 145 GLU 145 897 897 GLU GLU D . n 
D 1 146 LYS 146 898 898 LYS LYS D . n 
D 1 147 THR 147 899 899 THR THR D . n 
D 1 148 ILE 148 900 900 ILE ILE D . n 
D 1 149 ALA 149 901 901 ALA ALA D . n 
D 1 150 ALA 150 902 902 ALA ALA D . n 
D 1 151 LYS 151 903 903 LYS LYS D . n 
D 1 152 ARG 152 904 904 ARG ARG D . n 
D 1 153 ALA 153 905 905 ALA ALA D . n 
D 1 154 GLY 154 906 906 GLY GLY D . n 
D 1 155 VAL 155 907 907 VAL VAL D . n 
D 1 156 THR 156 908 908 THR THR D . n 
D 1 157 CYS 157 909 909 CYS CYS D . n 
D 1 158 ILE 158 910 910 ILE ILE D . n 
D 1 159 VAL 159 911 911 VAL VAL D . n 
D 1 160 LEU 160 912 912 LEU LEU D . n 
D 1 161 PRO 161 913 913 PRO PRO D . n 
D 1 162 ALA 162 914 914 ALA ALA D . n 
D 1 163 GLU 163 915 915 GLU GLU D . n 
D 1 164 ASN 164 916 916 ASN ASN D . n 
D 1 165 LYS 165 917 917 LYS LYS D . n 
D 1 166 LYS 166 918 918 LYS LYS D . n 
D 1 167 ASP 167 919 919 ASP ASP D . n 
D 1 168 PHE 168 920 920 PHE PHE D . n 
D 1 169 TYR 169 921 921 TYR TYR D . n 
D 1 170 ASP 170 922 922 ASP ASP D . n 
D 1 171 LEU 171 923 923 LEU LEU D . n 
D 1 172 ALA 172 924 924 ALA ALA D . n 
D 1 173 ALA 173 925 925 ALA ALA D . n 
D 1 174 PHE 174 926 926 PHE PHE D . n 
D 1 175 ILE 175 927 927 ILE ILE D . n 
D 1 176 THR 176 928 928 THR THR D . n 
D 1 177 GLU 177 929 929 GLU GLU D . n 
D 1 178 GLY 178 930 930 GLY GLY D . n 
D 1 179 LEU 179 931 931 LEU LEU D . n 
D 1 180 GLU 180 932 932 GLU GLU D . n 
D 1 181 VAL 181 933 933 VAL VAL D . n 
D 1 182 HIS 182 934 934 HIS HIS D . n 
D 1 183 PHE 183 935 935 PHE PHE D . n 
D 1 184 VAL 184 936 936 VAL VAL D . n 
D 1 185 GLU 185 937 937 GLU GLU D . n 
D 1 186 HIS 186 938 938 HIS HIS D . n 
D 1 187 TYR 187 939 939 TYR TYR D . n 
D 1 188 ARG 188 940 940 ARG ARG D . n 
D 1 189 GLU 189 941 941 GLU GLU D . n 
D 1 190 ILE 190 942 942 ILE ILE D . n 
D 1 191 PHE 191 943 943 PHE PHE D . n 
D 1 192 ASP 192 944 944 ASP ASP D . n 
D 1 193 ILE 193 945 945 ILE ILE D . n 
D 1 194 ALA 194 946 946 ALA ALA D . n 
D 1 195 PHE 195 947 947 PHE PHE D . n 
D 1 196 PRO 196 948 948 PRO PRO D . n 
D 1 197 ASP 197 949 ?   ?   ?   D . n 
D 1 198 GLU 198 950 ?   ?   ?   D . n 
D 1 199 GLN 199 951 ?   ?   ?   D . n 
D 1 200 ALA 200 952 ?   ?   ?   D . n 
D 1 201 GLU 201 953 ?   ?   ?   D . n 
D 1 202 ALA 202 954 ?   ?   ?   D . n 
D 1 203 LEU 203 955 ?   ?   ?   D . n 
D 1 204 ALA 204 956 ?   ?   ?   D . n 
D 1 205 VAL 205 957 ?   ?   ?   D . n 
D 1 206 GLU 206 958 ?   ?   ?   D . n 
D 1 207 ARG 207 959 ?   ?   ?   D . n 
E 1 1   VAL 1   753 ?   ?   ?   E . n 
E 1 2   GLU 2   754 ?   ?   ?   E . n 
E 1 3   ARG 3   755 ?   ?   ?   E . n 
E 1 4   MET 4   756 ?   ?   ?   E . n 
E 1 5   TYR 5   757 ?   ?   ?   E . n 
E 1 6   ASP 6   758 758 ASP ASP E . n 
E 1 7   VAL 7   759 759 VAL VAL E . n 
E 1 8   THR 8   760 760 THR THR E . n 
E 1 9   PRO 9   761 761 PRO PRO E . n 
E 1 10  PRO 10  762 762 PRO PRO E . n 
E 1 11  GLY 11  763 763 GLY GLY E . n 
E 1 12  VAL 12  764 764 VAL VAL E . n 
E 1 13  VAL 13  765 765 VAL VAL E . n 
E 1 14  MET 14  766 766 MET MET E . n 
E 1 15  GLY 15  767 767 GLY GLY E . n 
E 1 16  LEU 16  768 768 LEU LEU E . n 
E 1 17  ALA 17  769 769 ALA ALA E . n 
E 1 18  TRP 18  770 770 TRP TRP E . n 
E 1 19  THR 19  771 771 THR THR E . n 
E 1 20  ALA 20  772 772 ALA ALA E . n 
E 1 21  MET 21  773 773 MET MET E . n 
E 1 22  GLY 22  774 774 GLY GLY E . n 
E 1 23  GLY 23  775 775 GLY GLY E . n 
E 1 24  SER 24  776 776 SER SER E . n 
E 1 25  THR 25  777 777 THR THR E . n 
E 1 26  LEU 26  778 778 LEU LEU E . n 
E 1 27  PHE 27  779 779 PHE PHE E . n 
E 1 28  VAL 28  780 780 VAL VAL E . n 
E 1 29  GLU 29  781 781 GLU GLU E . n 
E 1 30  THR 30  782 782 THR THR E . n 
E 1 31  SER 31  783 783 SER SER E . n 
E 1 32  LEU 32  784 784 LEU LEU E . n 
E 1 33  ARG 33  785 785 ARG ARG E . n 
E 1 34  ARG 34  786 786 ARG ARG E . n 
E 1 35  PRO 35  787 ?   ?   ?   E . n 
E 1 36  GLN 36  788 ?   ?   ?   E . n 
E 1 37  ASP 37  789 ?   ?   ?   E . n 
E 1 38  LYS 38  790 ?   ?   ?   E . n 
E 1 39  ASP 39  791 ?   ?   ?   E . n 
E 1 40  ALA 40  792 ?   ?   ?   E . n 
E 1 41  LYS 41  793 ?   ?   ?   E . n 
E 1 42  GLY 42  794 ?   ?   ?   E . n 
E 1 43  ASP 43  795 ?   ?   ?   E . n 
E 1 44  LYS 44  796 ?   ?   ?   E . n 
E 1 45  ASP 45  797 797 ASP ASP E . n 
E 1 46  GLY 46  798 798 GLY GLY E . n 
E 1 47  SER 47  799 799 SER SER E . n 
E 1 48  LEU 48  800 800 LEU LEU E . n 
E 1 49  GLU 49  801 801 GLU GLU E . n 
E 1 50  VAL 50  802 802 VAL VAL E . n 
E 1 51  THR 51  803 803 THR THR E . n 
E 1 52  GLY 52  804 804 GLY GLY E . n 
E 1 53  GLN 53  805 805 GLN GLN E . n 
E 1 54  LEU 54  806 806 LEU LEU E . n 
E 1 55  GLY 55  807 807 GLY GLY E . n 
E 1 56  GLU 56  808 808 GLU GLU E . n 
E 1 57  VAL 57  809 809 VAL VAL E . n 
E 1 58  MET 58  810 810 MET MET E . n 
E 1 59  LYS 59  811 811 LYS LYS E . n 
E 1 60  GLU 60  812 812 GLU GLU E . n 
E 1 61  SER 61  813 813 SER SER E . n 
E 1 62  ALA 62  814 814 ALA ALA E . n 
E 1 63  ARG 63  815 815 ARG ARG E . n 
E 1 64  ILE 64  816 816 ILE ILE E . n 
E 1 65  ALA 65  817 817 ALA ALA E . n 
E 1 66  TYR 66  818 818 TYR TYR E . n 
E 1 67  THR 67  819 819 THR THR E . n 
E 1 68  PHE 68  820 820 PHE PHE E . n 
E 1 69  ALA 69  821 821 ALA ALA E . n 
E 1 70  ARG 70  822 822 ARG ARG E . n 
E 1 71  ALA 71  823 823 ALA ALA E . n 
E 1 72  PHE 72  824 824 PHE PHE E . n 
E 1 73  LEU 73  825 825 LEU LEU E . n 
E 1 74  MET 74  826 826 MET MET E . n 
E 1 75  GLN 75  827 827 GLN GLN E . n 
E 1 76  HIS 76  828 828 HIS HIS E . n 
E 1 77  ALA 77  829 829 ALA ALA E . n 
E 1 78  PRO 78  830 830 PRO PRO E . n 
E 1 79  ALA 79  831 831 ALA ALA E . n 
E 1 80  ASN 80  832 832 ASN ASN E . n 
E 1 81  ASP 81  833 833 ASP ASP E . n 
E 1 82  TYR 82  834 834 TYR TYR E . n 
E 1 83  LEU 83  835 835 LEU LEU E . n 
E 1 84  VAL 84  836 836 VAL VAL E . n 
E 1 85  THR 85  837 837 THR THR E . n 
E 1 86  SER 86  838 838 SER SER E . n 
E 1 87  HIS 87  839 839 HIS HIS E . n 
E 1 88  ILE 88  840 840 ILE ILE E . n 
E 1 89  HIS 89  841 841 HIS HIS E . n 
E 1 90  LEU 90  842 842 LEU LEU E . n 
E 1 91  HIS 91  843 843 HIS HIS E . n 
E 1 92  VAL 92  844 844 VAL VAL E . n 
E 1 93  PRO 93  845 845 PRO PRO E . n 
E 1 94  GLU 94  846 846 GLU GLU E . n 
E 1 95  GLY 95  847 847 GLY GLY E . n 
E 1 96  ALA 96  848 848 ALA ALA E . n 
E 1 97  THR 97  849 849 THR THR E . n 
E 1 98  PRO 98  850 850 PRO PRO E . n 
E 1 99  LYS 99  851 851 LYS LYS E . n 
E 1 100 ASP 100 852 852 ASP ASP E . n 
E 1 101 GLY 101 853 853 GLY GLY E . n 
E 1 102 PRO 102 854 854 PRO PRO E . n 
E 1 103 SER 103 855 855 SER SER E . n 
E 1 104 ALA 104 856 856 ALA ALA E . n 
E 1 105 GLY 105 857 857 GLY GLY E . n 
E 1 106 CYS 106 858 858 CYS CYS E . n 
E 1 107 THR 107 859 859 THR THR E . n 
E 1 108 ILE 108 860 860 ILE ILE E . n 
E 1 109 VAL 109 861 861 VAL VAL E . n 
E 1 110 THR 110 862 862 THR THR E . n 
E 1 111 ALA 111 863 863 ALA ALA E . n 
E 1 112 LEU 112 864 864 LEU LEU E . n 
E 1 113 LEU 113 865 865 LEU LEU E . n 
E 1 114 SER 114 866 866 SER SER E . n 
E 1 115 LEU 115 867 867 LEU LEU E . n 
E 1 116 ALA 116 868 868 ALA ALA E . n 
E 1 117 MET 117 869 869 MET MET E . n 
E 1 118 GLY 118 870 870 GLY GLY E . n 
E 1 119 ARG 119 871 871 ARG ARG E . n 
E 1 120 PRO 120 872 872 PRO PRO E . n 
E 1 121 VAL 121 873 873 VAL VAL E . n 
E 1 122 ARG 122 874 874 ARG ARG E . n 
E 1 123 GLN 123 875 875 GLN GLN E . n 
E 1 124 ASN 124 876 876 ASN ASN E . n 
E 1 125 LEU 125 877 877 LEU LEU E . n 
E 1 126 ALA 126 878 878 ALA ALA E . n 
E 1 127 MET 127 879 879 MET MET E . n 
E 1 128 THR 128 880 880 THR THR E . n 
E 1 129 GLY 129 881 881 GLY GLY E . n 
E 1 130 GLU 130 882 882 GLU GLU E . n 
E 1 131 VAL 131 883 883 VAL VAL E . n 
E 1 132 SER 132 884 884 SER SER E . n 
E 1 133 LEU 133 885 885 LEU LEU E . n 
E 1 134 THR 134 886 886 THR THR E . n 
E 1 135 GLY 135 887 887 GLY GLY E . n 
E 1 136 LYS 136 888 888 LYS LYS E . n 
E 1 137 ILE 137 889 889 ILE ILE E . n 
E 1 138 LEU 138 890 890 LEU LEU E . n 
E 1 139 PRO 139 891 891 PRO PRO E . n 
E 1 140 VAL 140 892 892 VAL VAL E . n 
E 1 141 GLY 141 893 893 GLY GLY E . n 
E 1 142 GLY 142 894 894 GLY GLY E . n 
E 1 143 ILE 143 895 895 ILE ILE E . n 
E 1 144 LYS 144 896 896 LYS LYS E . n 
E 1 145 GLU 145 897 897 GLU GLU E . n 
E 1 146 LYS 146 898 898 LYS LYS E . n 
E 1 147 THR 147 899 899 THR THR E . n 
E 1 148 ILE 148 900 900 ILE ILE E . n 
E 1 149 ALA 149 901 901 ALA ALA E . n 
E 1 150 ALA 150 902 902 ALA ALA E . n 
E 1 151 LYS 151 903 903 LYS LYS E . n 
E 1 152 ARG 152 904 904 ARG ARG E . n 
E 1 153 ALA 153 905 905 ALA ALA E . n 
E 1 154 GLY 154 906 906 GLY GLY E . n 
E 1 155 VAL 155 907 907 VAL VAL E . n 
E 1 156 THR 156 908 908 THR THR E . n 
E 1 157 CYS 157 909 909 CYS CYS E . n 
E 1 158 ILE 158 910 910 ILE ILE E . n 
E 1 159 VAL 159 911 911 VAL VAL E . n 
E 1 160 LEU 160 912 912 LEU LEU E . n 
E 1 161 PRO 161 913 913 PRO PRO E . n 
E 1 162 ALA 162 914 914 ALA ALA E . n 
E 1 163 GLU 163 915 915 GLU GLU E . n 
E 1 164 ASN 164 916 916 ASN ASN E . n 
E 1 165 LYS 165 917 917 LYS LYS E . n 
E 1 166 LYS 166 918 918 LYS LYS E . n 
E 1 167 ASP 167 919 919 ASP ASP E . n 
E 1 168 PHE 168 920 920 PHE PHE E . n 
E 1 169 TYR 169 921 921 TYR TYR E . n 
E 1 170 ASP 170 922 922 ASP ASP E . n 
E 1 171 LEU 171 923 923 LEU LEU E . n 
E 1 172 ALA 172 924 924 ALA ALA E . n 
E 1 173 ALA 173 925 925 ALA ALA E . n 
E 1 174 PHE 174 926 926 PHE PHE E . n 
E 1 175 ILE 175 927 927 ILE ILE E . n 
E 1 176 THR 176 928 928 THR THR E . n 
E 1 177 GLU 177 929 929 GLU GLU E . n 
E 1 178 GLY 178 930 930 GLY GLY E . n 
E 1 179 LEU 179 931 931 LEU LEU E . n 
E 1 180 GLU 180 932 932 GLU GLU E . n 
E 1 181 VAL 181 933 933 VAL VAL E . n 
E 1 182 HIS 182 934 934 HIS HIS E . n 
E 1 183 PHE 183 935 935 PHE PHE E . n 
E 1 184 VAL 184 936 936 VAL VAL E . n 
E 1 185 GLU 185 937 937 GLU GLU E . n 
E 1 186 HIS 186 938 938 HIS HIS E . n 
E 1 187 TYR 187 939 939 TYR TYR E . n 
E 1 188 ARG 188 940 940 ARG ARG E . n 
E 1 189 GLU 189 941 941 GLU GLU E . n 
E 1 190 ILE 190 942 942 ILE ILE E . n 
E 1 191 PHE 191 943 943 PHE PHE E . n 
E 1 192 ASP 192 944 944 ASP ASP E . n 
E 1 193 ILE 193 945 945 ILE ILE E . n 
E 1 194 ALA 194 946 946 ALA ALA E . n 
E 1 195 PHE 195 947 947 PHE PHE E . n 
E 1 196 PRO 196 948 948 PRO PRO E . n 
E 1 197 ASP 197 949 ?   ?   ?   E . n 
E 1 198 GLU 198 950 ?   ?   ?   E . n 
E 1 199 GLN 199 951 ?   ?   ?   E . n 
E 1 200 ALA 200 952 ?   ?   ?   E . n 
E 1 201 GLU 201 953 ?   ?   ?   E . n 
E 1 202 ALA 202 954 ?   ?   ?   E . n 
E 1 203 LEU 203 955 ?   ?   ?   E . n 
E 1 204 ALA 204 956 ?   ?   ?   E . n 
E 1 205 VAL 205 957 ?   ?   ?   E . n 
E 1 206 GLU 206 958 ?   ?   ?   E . n 
E 1 207 ARG 207 959 ?   ?   ?   E . n 
F 1 1   VAL 1   753 ?   ?   ?   F . n 
F 1 2   GLU 2   754 ?   ?   ?   F . n 
F 1 3   ARG 3   755 ?   ?   ?   F . n 
F 1 4   MET 4   756 ?   ?   ?   F . n 
F 1 5   TYR 5   757 ?   ?   ?   F . n 
F 1 6   ASP 6   758 ?   ?   ?   F . n 
F 1 7   VAL 7   759 759 VAL VAL F . n 
F 1 8   THR 8   760 760 THR THR F . n 
F 1 9   PRO 9   761 761 PRO PRO F . n 
F 1 10  PRO 10  762 762 PRO PRO F . n 
F 1 11  GLY 11  763 763 GLY GLY F . n 
F 1 12  VAL 12  764 764 VAL VAL F . n 
F 1 13  VAL 13  765 765 VAL VAL F . n 
F 1 14  MET 14  766 766 MET MET F . n 
F 1 15  GLY 15  767 767 GLY GLY F . n 
F 1 16  LEU 16  768 768 LEU LEU F . n 
F 1 17  ALA 17  769 769 ALA ALA F . n 
F 1 18  TRP 18  770 770 TRP TRP F . n 
F 1 19  THR 19  771 771 THR THR F . n 
F 1 20  ALA 20  772 772 ALA ALA F . n 
F 1 21  MET 21  773 773 MET MET F . n 
F 1 22  GLY 22  774 774 GLY GLY F . n 
F 1 23  GLY 23  775 775 GLY GLY F . n 
F 1 24  SER 24  776 776 SER SER F . n 
F 1 25  THR 25  777 777 THR THR F . n 
F 1 26  LEU 26  778 778 LEU LEU F . n 
F 1 27  PHE 27  779 779 PHE PHE F . n 
F 1 28  VAL 28  780 780 VAL VAL F . n 
F 1 29  GLU 29  781 781 GLU GLU F . n 
F 1 30  THR 30  782 782 THR THR F . n 
F 1 31  SER 31  783 783 SER SER F . n 
F 1 32  LEU 32  784 784 LEU LEU F . n 
F 1 33  ARG 33  785 785 ARG ARG F . n 
F 1 34  ARG 34  786 ?   ?   ?   F . n 
F 1 35  PRO 35  787 ?   ?   ?   F . n 
F 1 36  GLN 36  788 ?   ?   ?   F . n 
F 1 37  ASP 37  789 ?   ?   ?   F . n 
F 1 38  LYS 38  790 ?   ?   ?   F . n 
F 1 39  ASP 39  791 ?   ?   ?   F . n 
F 1 40  ALA 40  792 ?   ?   ?   F . n 
F 1 41  LYS 41  793 ?   ?   ?   F . n 
F 1 42  GLY 42  794 ?   ?   ?   F . n 
F 1 43  ASP 43  795 ?   ?   ?   F . n 
F 1 44  LYS 44  796 ?   ?   ?   F . n 
F 1 45  ASP 45  797 797 ASP ASP F . n 
F 1 46  GLY 46  798 798 GLY GLY F . n 
F 1 47  SER 47  799 799 SER SER F . n 
F 1 48  LEU 48  800 800 LEU LEU F . n 
F 1 49  GLU 49  801 801 GLU GLU F . n 
F 1 50  VAL 50  802 802 VAL VAL F . n 
F 1 51  THR 51  803 803 THR THR F . n 
F 1 52  GLY 52  804 804 GLY GLY F . n 
F 1 53  GLN 53  805 805 GLN GLN F . n 
F 1 54  LEU 54  806 806 LEU LEU F . n 
F 1 55  GLY 55  807 807 GLY GLY F . n 
F 1 56  GLU 56  808 808 GLU GLU F . n 
F 1 57  VAL 57  809 809 VAL VAL F . n 
F 1 58  MET 58  810 810 MET MET F . n 
F 1 59  LYS 59  811 811 LYS LYS F . n 
F 1 60  GLU 60  812 812 GLU GLU F . n 
F 1 61  SER 61  813 813 SER SER F . n 
F 1 62  ALA 62  814 814 ALA ALA F . n 
F 1 63  ARG 63  815 815 ARG ARG F . n 
F 1 64  ILE 64  816 816 ILE ILE F . n 
F 1 65  ALA 65  817 817 ALA ALA F . n 
F 1 66  TYR 66  818 818 TYR TYR F . n 
F 1 67  THR 67  819 819 THR THR F . n 
F 1 68  PHE 68  820 820 PHE PHE F . n 
F 1 69  ALA 69  821 821 ALA ALA F . n 
F 1 70  ARG 70  822 822 ARG ARG F . n 
F 1 71  ALA 71  823 823 ALA ALA F . n 
F 1 72  PHE 72  824 824 PHE PHE F . n 
F 1 73  LEU 73  825 825 LEU LEU F . n 
F 1 74  MET 74  826 826 MET MET F . n 
F 1 75  GLN 75  827 827 GLN GLN F . n 
F 1 76  HIS 76  828 828 HIS HIS F . n 
F 1 77  ALA 77  829 829 ALA ALA F . n 
F 1 78  PRO 78  830 830 PRO PRO F . n 
F 1 79  ALA 79  831 831 ALA ALA F . n 
F 1 80  ASN 80  832 832 ASN ASN F . n 
F 1 81  ASP 81  833 833 ASP ASP F . n 
F 1 82  TYR 82  834 834 TYR TYR F . n 
F 1 83  LEU 83  835 835 LEU LEU F . n 
F 1 84  VAL 84  836 836 VAL VAL F . n 
F 1 85  THR 85  837 837 THR THR F . n 
F 1 86  SER 86  838 838 SER SER F . n 
F 1 87  HIS 87  839 839 HIS HIS F . n 
F 1 88  ILE 88  840 840 ILE ILE F . n 
F 1 89  HIS 89  841 841 HIS HIS F . n 
F 1 90  LEU 90  842 842 LEU LEU F . n 
F 1 91  HIS 91  843 843 HIS HIS F . n 
F 1 92  VAL 92  844 844 VAL VAL F . n 
F 1 93  PRO 93  845 845 PRO PRO F . n 
F 1 94  GLU 94  846 846 GLU GLU F . n 
F 1 95  GLY 95  847 847 GLY GLY F . n 
F 1 96  ALA 96  848 848 ALA ALA F . n 
F 1 97  THR 97  849 849 THR THR F . n 
F 1 98  PRO 98  850 850 PRO PRO F . n 
F 1 99  LYS 99  851 851 LYS LYS F . n 
F 1 100 ASP 100 852 852 ASP ASP F . n 
F 1 101 GLY 101 853 853 GLY GLY F . n 
F 1 102 PRO 102 854 854 PRO PRO F . n 
F 1 103 SER 103 855 855 SER SER F . n 
F 1 104 ALA 104 856 856 ALA ALA F . n 
F 1 105 GLY 105 857 857 GLY GLY F . n 
F 1 106 CYS 106 858 858 CYS CYS F . n 
F 1 107 THR 107 859 859 THR THR F . n 
F 1 108 ILE 108 860 860 ILE ILE F . n 
F 1 109 VAL 109 861 861 VAL VAL F . n 
F 1 110 THR 110 862 862 THR THR F . n 
F 1 111 ALA 111 863 863 ALA ALA F . n 
F 1 112 LEU 112 864 864 LEU LEU F . n 
F 1 113 LEU 113 865 865 LEU LEU F . n 
F 1 114 SER 114 866 866 SER SER F . n 
F 1 115 LEU 115 867 867 LEU LEU F . n 
F 1 116 ALA 116 868 868 ALA ALA F . n 
F 1 117 MET 117 869 869 MET MET F . n 
F 1 118 GLY 118 870 870 GLY GLY F . n 
F 1 119 ARG 119 871 871 ARG ARG F . n 
F 1 120 PRO 120 872 872 PRO PRO F . n 
F 1 121 VAL 121 873 873 VAL VAL F . n 
F 1 122 ARG 122 874 874 ARG ARG F . n 
F 1 123 GLN 123 875 875 GLN GLN F . n 
F 1 124 ASN 124 876 876 ASN ASN F . n 
F 1 125 LEU 125 877 877 LEU LEU F . n 
F 1 126 ALA 126 878 878 ALA ALA F . n 
F 1 127 MET 127 879 879 MET MET F . n 
F 1 128 THR 128 880 880 THR THR F . n 
F 1 129 GLY 129 881 881 GLY GLY F . n 
F 1 130 GLU 130 882 882 GLU GLU F . n 
F 1 131 VAL 131 883 883 VAL VAL F . n 
F 1 132 SER 132 884 884 SER SER F . n 
F 1 133 LEU 133 885 885 LEU LEU F . n 
F 1 134 THR 134 886 886 THR THR F . n 
F 1 135 GLY 135 887 887 GLY GLY F . n 
F 1 136 LYS 136 888 888 LYS LYS F . n 
F 1 137 ILE 137 889 889 ILE ILE F . n 
F 1 138 LEU 138 890 890 LEU LEU F . n 
F 1 139 PRO 139 891 891 PRO PRO F . n 
F 1 140 VAL 140 892 892 VAL VAL F . n 
F 1 141 GLY 141 893 893 GLY GLY F . n 
F 1 142 GLY 142 894 894 GLY GLY F . n 
F 1 143 ILE 143 895 895 ILE ILE F . n 
F 1 144 LYS 144 896 896 LYS LYS F . n 
F 1 145 GLU 145 897 897 GLU GLU F . n 
F 1 146 LYS 146 898 898 LYS LYS F . n 
F 1 147 THR 147 899 899 THR THR F . n 
F 1 148 ILE 148 900 900 ILE ILE F . n 
F 1 149 ALA 149 901 901 ALA ALA F . n 
F 1 150 ALA 150 902 902 ALA ALA F . n 
F 1 151 LYS 151 903 903 LYS LYS F . n 
F 1 152 ARG 152 904 904 ARG ARG F . n 
F 1 153 ALA 153 905 905 ALA ALA F . n 
F 1 154 GLY 154 906 906 GLY GLY F . n 
F 1 155 VAL 155 907 907 VAL VAL F . n 
F 1 156 THR 156 908 908 THR THR F . n 
F 1 157 CYS 157 909 909 CYS CYS F . n 
F 1 158 ILE 158 910 910 ILE ILE F . n 
F 1 159 VAL 159 911 911 VAL VAL F . n 
F 1 160 LEU 160 912 912 LEU LEU F . n 
F 1 161 PRO 161 913 913 PRO PRO F . n 
F 1 162 ALA 162 914 914 ALA ALA F . n 
F 1 163 GLU 163 915 915 GLU GLU F . n 
F 1 164 ASN 164 916 916 ASN ASN F . n 
F 1 165 LYS 165 917 917 LYS LYS F . n 
F 1 166 LYS 166 918 918 LYS LYS F . n 
F 1 167 ASP 167 919 919 ASP ASP F . n 
F 1 168 PHE 168 920 920 PHE PHE F . n 
F 1 169 TYR 169 921 921 TYR TYR F . n 
F 1 170 ASP 170 922 922 ASP ASP F . n 
F 1 171 LEU 171 923 923 LEU LEU F . n 
F 1 172 ALA 172 924 924 ALA ALA F . n 
F 1 173 ALA 173 925 925 ALA ALA F . n 
F 1 174 PHE 174 926 926 PHE PHE F . n 
F 1 175 ILE 175 927 927 ILE ILE F . n 
F 1 176 THR 176 928 928 THR THR F . n 
F 1 177 GLU 177 929 929 GLU GLU F . n 
F 1 178 GLY 178 930 930 GLY GLY F . n 
F 1 179 LEU 179 931 931 LEU LEU F . n 
F 1 180 GLU 180 932 932 GLU GLU F . n 
F 1 181 VAL 181 933 933 VAL VAL F . n 
F 1 182 HIS 182 934 934 HIS HIS F . n 
F 1 183 PHE 183 935 935 PHE PHE F . n 
F 1 184 VAL 184 936 936 VAL VAL F . n 
F 1 185 GLU 185 937 937 GLU GLU F . n 
F 1 186 HIS 186 938 938 HIS HIS F . n 
F 1 187 TYR 187 939 939 TYR TYR F . n 
F 1 188 ARG 188 940 940 ARG ARG F . n 
F 1 189 GLU 189 941 941 GLU GLU F . n 
F 1 190 ILE 190 942 942 ILE ILE F . n 
F 1 191 PHE 191 943 943 PHE PHE F . n 
F 1 192 ASP 192 944 944 ASP ASP F . n 
F 1 193 ILE 193 945 945 ILE ILE F . n 
F 1 194 ALA 194 946 946 ALA ALA F . n 
F 1 195 PHE 195 947 947 PHE PHE F . n 
F 1 196 PRO 196 948 948 PRO PRO F . n 
F 1 197 ASP 197 949 ?   ?   ?   F . n 
F 1 198 GLU 198 950 ?   ?   ?   F . n 
F 1 199 GLN 199 951 ?   ?   ?   F . n 
F 1 200 ALA 200 952 ?   ?   ?   F . n 
F 1 201 GLU 201 953 ?   ?   ?   F . n 
F 1 202 ALA 202 954 ?   ?   ?   F . n 
F 1 203 LEU 203 955 ?   ?   ?   F . n 
F 1 204 ALA 204 956 ?   ?   ?   F . n 
F 1 205 VAL 205 957 ?   ?   ?   F . n 
F 1 206 GLU 206 958 ?   ?   ?   F . n 
F 1 207 ARG 207 959 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 2 HOH 1  2001 2001 HOH HOH A . 
G 2 HOH 2  2002 2002 HOH HOH A . 
G 2 HOH 3  2003 2003 HOH HOH A . 
G 2 HOH 4  2004 2004 HOH HOH A . 
G 2 HOH 5  2005 2005 HOH HOH A . 
G 2 HOH 6  2006 2006 HOH HOH A . 
G 2 HOH 7  2007 2007 HOH HOH A . 
G 2 HOH 8  2008 2008 HOH HOH A . 
G 2 HOH 9  2009 2009 HOH HOH A . 
G 2 HOH 10 2010 2010 HOH HOH A . 
G 2 HOH 11 2011 2011 HOH HOH A . 
G 2 HOH 12 2012 2012 HOH HOH A . 
G 2 HOH 13 2013 2013 HOH HOH A . 
G 2 HOH 14 2014 2014 HOH HOH A . 
G 2 HOH 15 2015 2015 HOH HOH A . 
G 2 HOH 16 2016 2016 HOH HOH A . 
G 2 HOH 17 2017 2017 HOH HOH A . 
G 2 HOH 18 2018 2018 HOH HOH A . 
G 2 HOH 19 2019 2019 HOH HOH A . 
G 2 HOH 20 2020 2020 HOH HOH A . 
G 2 HOH 21 2021 2021 HOH HOH A . 
G 2 HOH 22 2022 2022 HOH HOH A . 
G 2 HOH 23 2023 2023 HOH HOH A . 
G 2 HOH 24 2024 2024 HOH HOH A . 
G 2 HOH 25 2025 2025 HOH HOH A . 
G 2 HOH 26 2026 2026 HOH HOH A . 
G 2 HOH 27 2027 2027 HOH HOH A . 
G 2 HOH 28 2028 2028 HOH HOH A . 
G 2 HOH 29 2029 2029 HOH HOH A . 
G 2 HOH 30 2030 2030 HOH HOH A . 
G 2 HOH 31 2031 2031 HOH HOH A . 
G 2 HOH 32 2032 2032 HOH HOH A . 
G 2 HOH 33 2033 2033 HOH HOH A . 
G 2 HOH 34 2034 2034 HOH HOH A . 
G 2 HOH 35 2035 2035 HOH HOH A . 
G 2 HOH 36 2036 2036 HOH HOH A . 
G 2 HOH 37 2037 2037 HOH HOH A . 
G 2 HOH 38 2038 2038 HOH HOH A . 
G 2 HOH 39 2039 2039 HOH HOH A . 
G 2 HOH 40 2040 2040 HOH HOH A . 
G 2 HOH 41 2041 2041 HOH HOH A . 
G 2 HOH 42 2042 2042 HOH HOH A . 
G 2 HOH 43 2043 2043 HOH HOH A . 
G 2 HOH 44 2044 2044 HOH HOH A . 
G 2 HOH 45 2045 2045 HOH HOH A . 
G 2 HOH 46 2046 2046 HOH HOH A . 
G 2 HOH 47 2047 2047 HOH HOH A . 
G 2 HOH 48 2048 2048 HOH HOH A . 
G 2 HOH 49 2049 2049 HOH HOH A . 
G 2 HOH 50 2050 2050 HOH HOH A . 
G 2 HOH 51 2051 2051 HOH HOH A . 
G 2 HOH 52 2052 2052 HOH HOH A . 
G 2 HOH 53 2053 2053 HOH HOH A . 
G 2 HOH 54 2054 2054 HOH HOH A . 
G 2 HOH 55 2055 2055 HOH HOH A . 
G 2 HOH 56 2056 2056 HOH HOH A . 
G 2 HOH 57 2057 2057 HOH HOH A . 
G 2 HOH 58 2058 2058 HOH HOH A . 
G 2 HOH 59 2059 2059 HOH HOH A . 
G 2 HOH 60 2060 2060 HOH HOH A . 
G 2 HOH 61 2061 2061 HOH HOH A . 
G 2 HOH 62 2062 2062 HOH HOH A . 
G 2 HOH 63 2063 2063 HOH HOH A . 
G 2 HOH 64 2064 2064 HOH HOH A . 
G 2 HOH 65 2065 2065 HOH HOH A . 
G 2 HOH 66 2066 2066 HOH HOH A . 
G 2 HOH 67 2067 2067 HOH HOH A . 
G 2 HOH 68 2068 2068 HOH HOH A . 
G 2 HOH 69 2069 2069 HOH HOH A . 
G 2 HOH 70 2070 2070 HOH HOH A . 
G 2 HOH 71 2071 2071 HOH HOH A . 
G 2 HOH 72 2072 2072 HOH HOH A . 
G 2 HOH 73 2073 2073 HOH HOH A . 
G 2 HOH 74 2074 2074 HOH HOH A . 
H 2 HOH 1  2001 2001 HOH HOH B . 
H 2 HOH 2  2002 2002 HOH HOH B . 
H 2 HOH 3  2003 2003 HOH HOH B . 
H 2 HOH 4  2004 2004 HOH HOH B . 
H 2 HOH 5  2005 2005 HOH HOH B . 
H 2 HOH 6  2006 2006 HOH HOH B . 
H 2 HOH 7  2007 2007 HOH HOH B . 
H 2 HOH 8  2008 2008 HOH HOH B . 
H 2 HOH 9  2009 2009 HOH HOH B . 
H 2 HOH 10 2010 2010 HOH HOH B . 
H 2 HOH 11 2011 2011 HOH HOH B . 
H 2 HOH 12 2012 2012 HOH HOH B . 
H 2 HOH 13 2013 2013 HOH HOH B . 
H 2 HOH 14 2014 2014 HOH HOH B . 
H 2 HOH 15 2015 2015 HOH HOH B . 
H 2 HOH 16 2016 2016 HOH HOH B . 
H 2 HOH 17 2017 2017 HOH HOH B . 
H 2 HOH 18 2018 2018 HOH HOH B . 
H 2 HOH 19 2019 2019 HOH HOH B . 
H 2 HOH 20 2020 2020 HOH HOH B . 
H 2 HOH 21 2021 2021 HOH HOH B . 
H 2 HOH 22 2022 2022 HOH HOH B . 
H 2 HOH 23 2023 2023 HOH HOH B . 
H 2 HOH 24 2024 2024 HOH HOH B . 
H 2 HOH 25 2025 2025 HOH HOH B . 
H 2 HOH 26 2026 2026 HOH HOH B . 
H 2 HOH 27 2027 2027 HOH HOH B . 
H 2 HOH 28 2028 2028 HOH HOH B . 
H 2 HOH 29 2029 2029 HOH HOH B . 
H 2 HOH 30 2030 2030 HOH HOH B . 
H 2 HOH 31 2031 2031 HOH HOH B . 
H 2 HOH 32 2032 2032 HOH HOH B . 
H 2 HOH 33 2033 2033 HOH HOH B . 
H 2 HOH 34 2034 2034 HOH HOH B . 
H 2 HOH 35 2035 2035 HOH HOH B . 
H 2 HOH 36 2036 2036 HOH HOH B . 
H 2 HOH 37 2037 2037 HOH HOH B . 
H 2 HOH 38 2038 2038 HOH HOH B . 
H 2 HOH 39 2039 2039 HOH HOH B . 
H 2 HOH 40 2040 2040 HOH HOH B . 
H 2 HOH 41 2041 2041 HOH HOH B . 
H 2 HOH 42 2042 2042 HOH HOH B . 
I 2 HOH 1  2001 2001 HOH HOH C . 
I 2 HOH 2  2002 2002 HOH HOH C . 
I 2 HOH 3  2003 2003 HOH HOH C . 
I 2 HOH 4  2004 2004 HOH HOH C . 
I 2 HOH 5  2005 2005 HOH HOH C . 
I 2 HOH 6  2006 2006 HOH HOH C . 
I 2 HOH 7  2007 2007 HOH HOH C . 
I 2 HOH 8  2008 2008 HOH HOH C . 
I 2 HOH 9  2009 2009 HOH HOH C . 
I 2 HOH 10 2010 2010 HOH HOH C . 
I 2 HOH 11 2011 2011 HOH HOH C . 
I 2 HOH 12 2012 2012 HOH HOH C . 
I 2 HOH 13 2013 2013 HOH HOH C . 
I 2 HOH 14 2014 2014 HOH HOH C . 
I 2 HOH 15 2015 2015 HOH HOH C . 
I 2 HOH 16 2016 2016 HOH HOH C . 
I 2 HOH 17 2017 2017 HOH HOH C . 
I 2 HOH 18 2018 2018 HOH HOH C . 
I 2 HOH 19 2019 2019 HOH HOH C . 
I 2 HOH 20 2020 2020 HOH HOH C . 
I 2 HOH 21 2021 2021 HOH HOH C . 
I 2 HOH 22 2022 2022 HOH HOH C . 
I 2 HOH 23 2023 2023 HOH HOH C . 
I 2 HOH 24 2024 2024 HOH HOH C . 
I 2 HOH 25 2025 2025 HOH HOH C . 
I 2 HOH 26 2026 2026 HOH HOH C . 
I 2 HOH 27 2027 2027 HOH HOH C . 
I 2 HOH 28 2028 2028 HOH HOH C . 
I 2 HOH 29 2029 2029 HOH HOH C . 
I 2 HOH 30 2030 2030 HOH HOH C . 
I 2 HOH 31 2031 2031 HOH HOH C . 
I 2 HOH 32 2032 2032 HOH HOH C . 
I 2 HOH 33 2034 2034 HOH HOH C . 
I 2 HOH 34 2035 2035 HOH HOH C . 
I 2 HOH 35 2036 2036 HOH HOH C . 
I 2 HOH 36 2038 2038 HOH HOH C . 
I 2 HOH 37 2039 2039 HOH HOH C . 
I 2 HOH 38 2040 2040 HOH HOH C . 
I 2 HOH 39 2041 2041 HOH HOH C . 
I 2 HOH 40 2042 2042 HOH HOH C . 
I 2 HOH 41 2043 2043 HOH HOH C . 
I 2 HOH 42 2044 2044 HOH HOH C . 
I 2 HOH 43 2045 2045 HOH HOH C . 
I 2 HOH 44 2046 2046 HOH HOH C . 
I 2 HOH 45 2047 2047 HOH HOH C . 
I 2 HOH 46 2048 2048 HOH HOH C . 
I 2 HOH 47 2049 2049 HOH HOH C . 
I 2 HOH 48 2050 2050 HOH HOH C . 
I 2 HOH 49 2051 2051 HOH HOH C . 
I 2 HOH 50 2052 2052 HOH HOH C . 
I 2 HOH 51 2053 2053 HOH HOH C . 
I 2 HOH 52 2054 2054 HOH HOH C . 
I 2 HOH 53 2055 2055 HOH HOH C . 
I 2 HOH 54 2056 2056 HOH HOH C . 
I 2 HOH 55 2057 2057 HOH HOH C . 
I 2 HOH 56 2058 2058 HOH HOH C . 
I 2 HOH 57 2059 2059 HOH HOH C . 
I 2 HOH 58 2060 2060 HOH HOH C . 
I 2 HOH 59 2061 2061 HOH HOH C . 
I 2 HOH 60 2062 2062 HOH HOH C . 
I 2 HOH 61 2063 2063 HOH HOH C . 
I 2 HOH 62 2064 2064 HOH HOH C . 
I 2 HOH 63 2065 2065 HOH HOH C . 
J 2 HOH 1  2001 2001 HOH HOH D . 
J 2 HOH 2  2002 2002 HOH HOH D . 
J 2 HOH 3  2003 2003 HOH HOH D . 
J 2 HOH 4  2004 2004 HOH HOH D . 
J 2 HOH 5  2005 2005 HOH HOH D . 
J 2 HOH 6  2006 2006 HOH HOH D . 
J 2 HOH 7  2007 2007 HOH HOH D . 
J 2 HOH 8  2008 2008 HOH HOH D . 
J 2 HOH 9  2009 2009 HOH HOH D . 
J 2 HOH 10 2010 2010 HOH HOH D . 
J 2 HOH 11 2011 2011 HOH HOH D . 
J 2 HOH 12 2012 2012 HOH HOH D . 
J 2 HOH 13 2013 2013 HOH HOH D . 
J 2 HOH 14 2014 2014 HOH HOH D . 
J 2 HOH 15 2015 2015 HOH HOH D . 
J 2 HOH 16 2016 2016 HOH HOH D . 
J 2 HOH 17 2017 2017 HOH HOH D . 
J 2 HOH 18 2018 2018 HOH HOH D . 
J 2 HOH 19 2019 2019 HOH HOH D . 
J 2 HOH 20 2020 2020 HOH HOH D . 
J 2 HOH 21 2021 2021 HOH HOH D . 
J 2 HOH 22 2022 2022 HOH HOH D . 
J 2 HOH 23 2023 2023 HOH HOH D . 
J 2 HOH 24 2024 2024 HOH HOH D . 
J 2 HOH 25 2025 2025 HOH HOH D . 
J 2 HOH 26 2026 2026 HOH HOH D . 
J 2 HOH 27 2027 2027 HOH HOH D . 
J 2 HOH 28 2028 2028 HOH HOH D . 
J 2 HOH 29 2029 2029 HOH HOH D . 
J 2 HOH 30 2030 2030 HOH HOH D . 
J 2 HOH 31 2031 2031 HOH HOH D . 
J 2 HOH 32 2032 2032 HOH HOH D . 
J 2 HOH 33 2033 2033 HOH HOH D . 
J 2 HOH 34 2034 2034 HOH HOH D . 
J 2 HOH 35 2035 2035 HOH HOH D . 
J 2 HOH 36 2036 2036 HOH HOH D . 
J 2 HOH 37 2037 2037 HOH HOH D . 
J 2 HOH 38 2038 2038 HOH HOH D . 
J 2 HOH 39 2039 2039 HOH HOH D . 
J 2 HOH 40 2040 2040 HOH HOH D . 
J 2 HOH 41 2041 2041 HOH HOH D . 
J 2 HOH 42 2042 2042 HOH HOH D . 
K 2 HOH 1  2001 2001 HOH HOH E . 
K 2 HOH 2  2002 2002 HOH HOH E . 
K 2 HOH 3  2003 2003 HOH HOH E . 
K 2 HOH 4  2004 2004 HOH HOH E . 
K 2 HOH 5  2005 2005 HOH HOH E . 
K 2 HOH 6  2006 2006 HOH HOH E . 
K 2 HOH 7  2007 2007 HOH HOH E . 
K 2 HOH 8  2008 2008 HOH HOH E . 
K 2 HOH 9  2009 2009 HOH HOH E . 
K 2 HOH 10 2010 2010 HOH HOH E . 
K 2 HOH 11 2011 2011 HOH HOH E . 
K 2 HOH 12 2012 2012 HOH HOH E . 
K 2 HOH 13 2013 2013 HOH HOH E . 
K 2 HOH 14 2014 2014 HOH HOH E . 
K 2 HOH 15 2015 2015 HOH HOH E . 
K 2 HOH 16 2016 2016 HOH HOH E . 
K 2 HOH 17 2017 2017 HOH HOH E . 
K 2 HOH 18 2018 2018 HOH HOH E . 
K 2 HOH 19 2019 2019 HOH HOH E . 
K 2 HOH 20 2020 2020 HOH HOH E . 
K 2 HOH 21 2021 2021 HOH HOH E . 
K 2 HOH 22 2022 2022 HOH HOH E . 
K 2 HOH 23 2023 2023 HOH HOH E . 
K 2 HOH 24 2024 2024 HOH HOH E . 
K 2 HOH 25 2025 2025 HOH HOH E . 
K 2 HOH 26 2026 2026 HOH HOH E . 
K 2 HOH 27 2027 2027 HOH HOH E . 
K 2 HOH 28 2028 2028 HOH HOH E . 
K 2 HOH 29 2029 2029 HOH HOH E . 
K 2 HOH 30 2030 2030 HOH HOH E . 
K 2 HOH 31 2031 2031 HOH HOH E . 
K 2 HOH 32 2032 2032 HOH HOH E . 
K 2 HOH 33 2033 2033 HOH HOH E . 
K 2 HOH 34 2034 2034 HOH HOH E . 
K 2 HOH 35 2035 2035 HOH HOH E . 
K 2 HOH 36 2036 2036 HOH HOH E . 
K 2 HOH 37 2037 2037 HOH HOH E . 
K 2 HOH 38 2038 2038 HOH HOH E . 
K 2 HOH 39 2039 2039 HOH HOH E . 
K 2 HOH 40 2040 2040 HOH HOH E . 
K 2 HOH 41 2041 2041 HOH HOH E . 
K 2 HOH 42 2042 2042 HOH HOH E . 
K 2 HOH 43 2043 2043 HOH HOH E . 
K 2 HOH 44 2044 2044 HOH HOH E . 
K 2 HOH 45 2045 2045 HOH HOH E . 
K 2 HOH 46 2046 2046 HOH HOH E . 
K 2 HOH 47 2047 2047 HOH HOH E . 
K 2 HOH 48 2048 2048 HOH HOH E . 
K 2 HOH 49 2049 2049 HOH HOH E . 
K 2 HOH 50 2050 2050 HOH HOH E . 
K 2 HOH 51 2051 2051 HOH HOH E . 
K 2 HOH 52 2052 2052 HOH HOH E . 
K 2 HOH 53 2053 2053 HOH HOH E . 
K 2 HOH 54 2054 2054 HOH HOH E . 
K 2 HOH 55 2055 2055 HOH HOH E . 
K 2 HOH 56 2056 2056 HOH HOH E . 
K 2 HOH 57 2057 2057 HOH HOH E . 
K 2 HOH 58 2058 2058 HOH HOH E . 
K 2 HOH 59 2059 2059 HOH HOH E . 
L 2 HOH 1  2001 2001 HOH HOH F . 
L 2 HOH 2  2002 2002 HOH HOH F . 
L 2 HOH 3  2003 2003 HOH HOH F . 
L 2 HOH 4  2004 2004 HOH HOH F . 
L 2 HOH 5  2005 2005 HOH HOH F . 
L 2 HOH 6  2006 2006 HOH HOH F . 
L 2 HOH 7  2007 2007 HOH HOH F . 
L 2 HOH 8  2008 2008 HOH HOH F . 
L 2 HOH 9  2009 2009 HOH HOH F . 
L 2 HOH 10 2010 2010 HOH HOH F . 
L 2 HOH 11 2011 2011 HOH HOH F . 
L 2 HOH 12 2012 2012 HOH HOH F . 
L 2 HOH 13 2013 2013 HOH HOH F . 
L 2 HOH 14 2014 2014 HOH HOH F . 
L 2 HOH 15 2015 2015 HOH HOH F . 
L 2 HOH 16 2016 2016 HOH HOH F . 
L 2 HOH 17 2017 2017 HOH HOH F . 
L 2 HOH 18 2018 2018 HOH HOH F . 
L 2 HOH 19 2019 2019 HOH HOH F . 
L 2 HOH 20 2020 2020 HOH HOH F . 
L 2 HOH 21 2021 2021 HOH HOH F . 
L 2 HOH 22 2022 2022 HOH HOH F . 
L 2 HOH 23 2023 2023 HOH HOH F . 
L 2 HOH 24 2024 2024 HOH HOH F . 
L 2 HOH 25 2025 2025 HOH HOH F . 
L 2 HOH 26 2026 2026 HOH HOH F . 
L 2 HOH 27 2027 2027 HOH HOH F . 
L 2 HOH 28 2028 2028 HOH HOH F . 
L 2 HOH 29 2029 2029 HOH HOH F . 
L 2 HOH 30 2030 2030 HOH HOH F . 
L 2 HOH 31 2031 2031 HOH HOH F . 
L 2 HOH 32 2032 2032 HOH HOH F . 
L 2 HOH 33 2033 2033 HOH HOH F . 
L 2 HOH 34 2034 2034 HOH HOH F . 
L 2 HOH 35 2035 2035 HOH HOH F . 
L 2 HOH 36 2036 2036 HOH HOH F . 
L 2 HOH 37 2037 2037 HOH HOH F . 
L 2 HOH 38 2038 2038 HOH HOH F . 
L 2 HOH 39 2039 2039 HOH HOH F . 
L 2 HOH 40 2040 2040 HOH HOH F . 
L 2 HOH 41 2041 2041 HOH HOH F . 
L 2 HOH 42 2042 2042 HOH HOH F . 
L 2 HOH 43 2043 2043 HOH HOH F . 
L 2 HOH 44 2044 2044 HOH HOH F . 
L 2 HOH 45 2045 2045 HOH HOH F . 
L 2 HOH 46 2046 2046 HOH HOH F . 
L 2 HOH 47 2047 2047 HOH HOH F . 
L 2 HOH 48 2048 2048 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA trimeric 3 
2 software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H,K 
2 1 C,D,F,I,J,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3050  ? 
1 MORE         -15.9 ? 
1 'SSA (A^2)'  23770 ? 
2 'ABSA (A^2)' 3030  ? 
2 MORE         -16.6 ? 
2 'SSA (A^2)'  23340 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-05-19 
2 'Structure model' 1 1 2011-05-07 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0109 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   THR 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    803 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    804 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -139.73 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 C ASP 797  ? CB  ? C ASP 45 CB  
2 1 Y 1 C ASP 797  ? CG  ? C ASP 45 CG  
3 1 Y 1 C ASP 797  ? OD1 ? C ASP 45 OD1 
4 1 Y 1 C ASP 797  ? OD2 ? C ASP 45 OD2 
5 1 Y 0 F MET 773  ? SD  ? F MET 21 SD  
6 1 Y 0 F MET 773  ? CE  ? F MET 21 CE  
7 1 N 0 C HOH 2031 ? O   A I HOH ?  O   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A VAL 753 ? A VAL 1   
2   1 Y 1 A GLU 754 ? A GLU 2   
3   1 Y 1 A ARG 755 ? A ARG 3   
4   1 Y 1 A ASP 789 ? A ASP 37  
5   1 Y 1 A LYS 790 ? A LYS 38  
6   1 Y 1 A ASP 791 ? A ASP 39  
7   1 Y 1 A ALA 792 ? A ALA 40  
8   1 Y 1 A LYS 793 ? A LYS 41  
9   1 Y 1 A GLY 794 ? A GLY 42  
10  1 Y 1 A ASP 795 ? A ASP 43  
11  1 Y 1 A LYS 796 ? A LYS 44  
12  1 Y 1 A ALA 954 ? A ALA 202 
13  1 Y 1 A LEU 955 ? A LEU 203 
14  1 Y 1 A ALA 956 ? A ALA 204 
15  1 Y 1 A VAL 957 ? A VAL 205 
16  1 Y 1 A GLU 958 ? A GLU 206 
17  1 Y 1 A ARG 959 ? A ARG 207 
18  1 Y 1 B VAL 753 ? B VAL 1   
19  1 Y 1 B GLU 754 ? B GLU 2   
20  1 Y 1 B ARG 755 ? B ARG 3   
21  1 Y 1 B ARG 785 ? B ARG 33  
22  1 Y 1 B ARG 786 ? B ARG 34  
23  1 Y 1 B PRO 787 ? B PRO 35  
24  1 Y 1 B GLN 788 ? B GLN 36  
25  1 Y 1 B ASP 789 ? B ASP 37  
26  1 Y 1 B LYS 790 ? B LYS 38  
27  1 Y 1 B ASP 791 ? B ASP 39  
28  1 Y 1 B ALA 792 ? B ALA 40  
29  1 Y 1 B LYS 793 ? B LYS 41  
30  1 Y 1 B GLY 794 ? B GLY 42  
31  1 Y 1 B ASP 795 ? B ASP 43  
32  1 Y 1 B LYS 796 ? B LYS 44  
33  1 Y 1 B ASP 797 ? B ASP 45  
34  1 Y 0 B GLY 804 ? B GLY 52  
35  1 Y 0 B GLN 805 ? B GLN 53  
36  1 Y 0 B LEU 806 ? B LEU 54  
37  1 Y 1 B ASP 949 ? B ASP 197 
38  1 Y 1 B GLU 950 ? B GLU 198 
39  1 Y 1 B GLN 951 ? B GLN 199 
40  1 Y 1 B ALA 952 ? B ALA 200 
41  1 Y 1 B GLU 953 ? B GLU 201 
42  1 Y 1 B ALA 954 ? B ALA 202 
43  1 Y 1 B LEU 955 ? B LEU 203 
44  1 Y 1 B ALA 956 ? B ALA 204 
45  1 Y 1 B VAL 957 ? B VAL 205 
46  1 Y 1 B GLU 958 ? B GLU 206 
47  1 Y 1 B ARG 959 ? B ARG 207 
48  1 Y 1 C VAL 753 ? C VAL 1   
49  1 Y 1 C GLU 754 ? C GLU 2   
50  1 Y 1 C ASP 789 ? C ASP 37  
51  1 Y 1 C LYS 790 ? C LYS 38  
52  1 Y 1 C ASP 791 ? C ASP 39  
53  1 Y 1 C ALA 792 ? C ALA 40  
54  1 Y 1 C LYS 793 ? C LYS 41  
55  1 Y 1 C GLY 794 ? C GLY 42  
56  1 Y 1 C ASP 795 ? C ASP 43  
57  1 Y 1 C ALA 954 ? C ALA 202 
58  1 Y 1 C LEU 955 ? C LEU 203 
59  1 Y 1 C ALA 956 ? C ALA 204 
60  1 Y 1 C VAL 957 ? C VAL 205 
61  1 Y 1 C GLU 958 ? C GLU 206 
62  1 Y 1 C ARG 959 ? C ARG 207 
63  1 Y 1 D VAL 753 ? D VAL 1   
64  1 Y 1 D GLU 754 ? D GLU 2   
65  1 Y 1 D ARG 755 ? D ARG 3   
66  1 Y 1 D MET 756 ? D MET 4   
67  1 Y 1 D TYR 757 ? D TYR 5   
68  1 Y 1 D ASP 758 ? D ASP 6   
69  1 Y 1 D VAL 759 ? D VAL 7   
70  1 Y 1 D ARG 786 ? D ARG 34  
71  1 Y 1 D PRO 787 ? D PRO 35  
72  1 Y 1 D GLN 788 ? D GLN 36  
73  1 Y 1 D ASP 789 ? D ASP 37  
74  1 Y 1 D LYS 790 ? D LYS 38  
75  1 Y 1 D ASP 791 ? D ASP 39  
76  1 Y 1 D ALA 792 ? D ALA 40  
77  1 Y 1 D LYS 793 ? D LYS 41  
78  1 Y 1 D GLY 794 ? D GLY 42  
79  1 Y 1 D ASP 795 ? D ASP 43  
80  1 Y 1 D LYS 796 ? D LYS 44  
81  1 Y 1 D ASP 949 ? D ASP 197 
82  1 Y 1 D GLU 950 ? D GLU 198 
83  1 Y 1 D GLN 951 ? D GLN 199 
84  1 Y 1 D ALA 952 ? D ALA 200 
85  1 Y 1 D GLU 953 ? D GLU 201 
86  1 Y 1 D ALA 954 ? D ALA 202 
87  1 Y 1 D LEU 955 ? D LEU 203 
88  1 Y 1 D ALA 956 ? D ALA 204 
89  1 Y 1 D VAL 957 ? D VAL 205 
90  1 Y 1 D GLU 958 ? D GLU 206 
91  1 Y 1 D ARG 959 ? D ARG 207 
92  1 Y 1 E VAL 753 ? E VAL 1   
93  1 Y 1 E GLU 754 ? E GLU 2   
94  1 Y 1 E ARG 755 ? E ARG 3   
95  1 Y 1 E MET 756 ? E MET 4   
96  1 Y 1 E TYR 757 ? E TYR 5   
97  1 Y 1 E PRO 787 ? E PRO 35  
98  1 Y 1 E GLN 788 ? E GLN 36  
99  1 Y 1 E ASP 789 ? E ASP 37  
100 1 Y 1 E LYS 790 ? E LYS 38  
101 1 Y 1 E ASP 791 ? E ASP 39  
102 1 Y 1 E ALA 792 ? E ALA 40  
103 1 Y 1 E LYS 793 ? E LYS 41  
104 1 Y 1 E GLY 794 ? E GLY 42  
105 1 Y 1 E ASP 795 ? E ASP 43  
106 1 Y 1 E LYS 796 ? E LYS 44  
107 1 Y 1 E ASP 949 ? E ASP 197 
108 1 Y 1 E GLU 950 ? E GLU 198 
109 1 Y 1 E GLN 951 ? E GLN 199 
110 1 Y 1 E ALA 952 ? E ALA 200 
111 1 Y 1 E GLU 953 ? E GLU 201 
112 1 Y 1 E ALA 954 ? E ALA 202 
113 1 Y 1 E LEU 955 ? E LEU 203 
114 1 Y 1 E ALA 956 ? E ALA 204 
115 1 Y 1 E VAL 957 ? E VAL 205 
116 1 Y 1 E GLU 958 ? E GLU 206 
117 1 Y 1 E ARG 959 ? E ARG 207 
118 1 Y 1 F VAL 753 ? F VAL 1   
119 1 Y 1 F GLU 754 ? F GLU 2   
120 1 Y 1 F ARG 755 ? F ARG 3   
121 1 Y 1 F MET 756 ? F MET 4   
122 1 Y 1 F TYR 757 ? F TYR 5   
123 1 Y 1 F ASP 758 ? F ASP 6   
124 1 Y 1 F ARG 786 ? F ARG 34  
125 1 Y 1 F PRO 787 ? F PRO 35  
126 1 Y 1 F GLN 788 ? F GLN 36  
127 1 Y 1 F ASP 789 ? F ASP 37  
128 1 Y 1 F LYS 790 ? F LYS 38  
129 1 Y 1 F ASP 791 ? F ASP 39  
130 1 Y 1 F ALA 792 ? F ALA 40  
131 1 Y 1 F LYS 793 ? F LYS 41  
132 1 Y 1 F GLY 794 ? F GLY 42  
133 1 Y 1 F ASP 795 ? F ASP 43  
134 1 Y 1 F LYS 796 ? F LYS 44  
135 1 Y 1 F ASP 949 ? F ASP 197 
136 1 Y 1 F GLU 950 ? F GLU 198 
137 1 Y 1 F GLN 951 ? F GLN 199 
138 1 Y 1 F ALA 952 ? F ALA 200 
139 1 Y 1 F GLU 953 ? F GLU 201 
140 1 Y 1 F ALA 954 ? F ALA 202 
141 1 Y 1 F LEU 955 ? F LEU 203 
142 1 Y 1 F ALA 956 ? F ALA 204 
143 1 Y 1 F VAL 957 ? F VAL 205 
144 1 Y 1 F GLU 958 ? F GLU 206 
145 1 Y 1 F ARG 959 ? F ARG 207 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_reflns_twin.domain_id 
_pdbx_reflns_twin.crystal_id 
_pdbx_reflns_twin.diffrn_id 
_pdbx_reflns_twin.type 
_pdbx_reflns_twin.operator 
_pdbx_reflns_twin.fraction 
1 1 1 ? 'H, K, L' 0.321 
2 1 1 ? -h,-k,l   0.679 
#