data_2X4X
# 
_entry.id   2X4X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2X4X         
PDBE  EBI-42622    
WWPDB D_1290042622 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2D9E unspecified 'SOLUTION STRUCTURE OF THE BROMODOMAIN OF PEREGRIN'                            
PDB 2X35 unspecified 'MOLECULAR BASIS OF HISTONE H3K36ME3 RECOGNITION BY THE PWWP DOMAIN OF BRPF1.' 
PDB 2X4Y unspecified 'MOLECULAR BASIS OF HISTONE H3K36ME3 RECOGNITION BY THE PWWP DOMAIN OF BRPF1.' 
PDB 2X4W unspecified 'MOLECULAR BASIS OF HISTONE H3K36ME3 RECOGNITION BY THE PWWP DOMAIN OF BRPF1.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2X4X 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vezzoli, A.'     1 
'Bonadies, N.'    2 
'Allen, M.D.'     3 
'Freund, S.M.V.'  4 
'Santiveri, C.M.' 5 
'Kvinlaug, B.'    6 
'Huntly, B.J.P.'  7 
'Gottgens, B.'    8 
'Bycroft, M.'     9 
# 
_citation.id                        primary 
_citation.title                     'Molecular Basis of Histone H3K36Me3 Recognition by the Pwwp Domain of Brpf1.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                617 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20400950 
_citation.pdbx_database_id_DOI      10.1038/NSMB.1797 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vezzoli, A.'     1 
primary 'Bonadies, N.'    2 
primary 'Allen, M.D.'     3 
primary 'Freund, S.M.V.'  4 
primary 'Santiveri, C.M.' 5 
primary 'Kvinlaug, B.'    6 
primary 'Huntly, B.J.P.'  7 
primary 'Gottgens, B.'    8 
primary 'Bycroft, M.'     9 
# 
_cell.entry_id           2X4X 
_cell.length_a           38.437 
_cell.length_b           102.941 
_cell.length_c           88.654 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.33 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2X4X 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man PEREGRIN       15249.579 4   ? ? 'BRPF1 PWWP DOMAIN, RESIDUES 1076-1205' ?                               
2 polymer     syn 'HISTONE H3.2' 2330.777  4   ? ? 'RESIDUES 23-43'                        'TRIMETHYLATION AT POSITION 36' 
3 non-polymer syn 'SULFATE ION'  96.063    1   ? ? ?                                       ?                               
4 water       nat water          18.015    574 ? ? ?                                       ?                               
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BROMODOMAIN AND PHD FINGER-CONTAINING PROTEIN 1, PROTEIN BR140' 
2 'HUMAN H3 HISTONE, H3/M, H3/O'                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GGSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRT
WQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE
;
;GGSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRT
WQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE
;
A,C,E,G ? 
2 'polypeptide(L)' no yes 'TKAARKSAPATGGV(M3L)KPHRYR' TKAARKSAPATGGVKKPHRYR B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   SER n 
1 4   GLU n 
1 5   ASP n 
1 6   GLU n 
1 7   ASP n 
1 8   SER n 
1 9   PRO n 
1 10  LEU n 
1 11  ASP n 
1 12  ALA n 
1 13  LEU n 
1 14  ASP n 
1 15  LEU n 
1 16  VAL n 
1 17  TRP n 
1 18  ALA n 
1 19  LYS n 
1 20  CYS n 
1 21  ARG n 
1 22  GLY n 
1 23  TYR n 
1 24  PRO n 
1 25  SER n 
1 26  TYR n 
1 27  PRO n 
1 28  ALA n 
1 29  LEU n 
1 30  ILE n 
1 31  ILE n 
1 32  ASP n 
1 33  PRO n 
1 34  LYS n 
1 35  MET n 
1 36  PRO n 
1 37  ARG n 
1 38  GLU n 
1 39  GLY n 
1 40  MET n 
1 41  PHE n 
1 42  HIS n 
1 43  HIS n 
1 44  GLY n 
1 45  VAL n 
1 46  PRO n 
1 47  ILE n 
1 48  PRO n 
1 49  VAL n 
1 50  PRO n 
1 51  PRO n 
1 52  LEU n 
1 53  GLU n 
1 54  VAL n 
1 55  LEU n 
1 56  LYS n 
1 57  LEU n 
1 58  GLY n 
1 59  GLU n 
1 60  GLN n 
1 61  MET n 
1 62  THR n 
1 63  GLN n 
1 64  GLU n 
1 65  ALA n 
1 66  ARG n 
1 67  GLU n 
1 68  HIS n 
1 69  LEU n 
1 70  TYR n 
1 71  LEU n 
1 72  VAL n 
1 73  LEU n 
1 74  PHE n 
1 75  PHE n 
1 76  ASP n 
1 77  ASN n 
1 78  LYS n 
1 79  ARG n 
1 80  THR n 
1 81  TRP n 
1 82  GLN n 
1 83  TRP n 
1 84  LEU n 
1 85  PRO n 
1 86  ARG n 
1 87  THR n 
1 88  LYS n 
1 89  LEU n 
1 90  VAL n 
1 91  PRO n 
1 92  LEU n 
1 93  GLY n 
1 94  VAL n 
1 95  ASN n 
1 96  GLN n 
1 97  ASP n 
1 98  LEU n 
1 99  ASP n 
1 100 LYS n 
1 101 GLU n 
1 102 LYS n 
1 103 MET n 
1 104 LEU n 
1 105 GLU n 
1 106 GLY n 
1 107 ARG n 
1 108 LYS n 
1 109 SER n 
1 110 ASN n 
1 111 ILE n 
1 112 ARG n 
1 113 LYS n 
1 114 SER n 
1 115 VAL n 
1 116 GLN n 
1 117 ILE n 
1 118 ALA n 
1 119 TYR n 
1 120 HIS n 
1 121 ARG n 
1 122 ALA n 
1 123 LEU n 
1 124 GLN n 
1 125 HIS n 
1 126 ARG n 
1 127 SER n 
1 128 LYS n 
1 129 VAL n 
1 130 GLN n 
1 131 GLY n 
1 132 GLU n 
2 1   THR n 
2 2   LYS n 
2 3   ALA n 
2 4   ALA n 
2 5   ARG n 
2 6   LYS n 
2 7   SER n 
2 8   ALA n 
2 9   PRO n 
2 10  ALA n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  VAL n 
2 15  M3L n 
2 16  LYS n 
2 17  PRO n 
2 18  HIS n 
2 19  ARG n 
2 20  TYR n 
2 21  ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              C41 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PRSETA 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP BRPF1_HUMAN 1 ? ? P55201 ? 
2 UNP H32_HUMAN   2 ? ? Q71DI3 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2X4X A 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
2 2 2X4X B 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
3 1 2X4X C 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
4 2 2X4X D 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
5 1 2X4X E 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
6 2 2X4X F 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
7 1 2X4X G 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
8 2 2X4X H 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2X4X GLY A 1 ? UNP P55201 ? ? 'expression tag' 1074 1 
1 2X4X GLY A 2 ? UNP P55201 ? ? 'expression tag' 1075 2 
3 2X4X GLY C 1 ? UNP P55201 ? ? 'expression tag' 1074 3 
3 2X4X GLY C 2 ? UNP P55201 ? ? 'expression tag' 1075 4 
5 2X4X GLY E 1 ? UNP P55201 ? ? 'expression tag' 1074 5 
5 2X4X GLY E 2 ? UNP P55201 ? ? 'expression tag' 1075 6 
7 2X4X GLY G 1 ? UNP P55201 ? ? 'expression tag' 1074 7 
7 2X4X GLY G 2 ? UNP P55201 ? ? 'expression tag' 1075 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'     ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2X4X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.87 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% PEG3350, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5) 0.01M NACL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9334 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.9334 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2X4X 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             44.32 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   57772 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.00 
_reflns.B_iso_Wilson_estimate        27.90 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.95 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.36 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.80 
_reflns_shell.pdbx_redundancy        2.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2X4X 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     57745 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.31 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.998 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    94.43 
_refine.ls_R_factor_obs                          0.1991 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1969 
_refine.ls_R_factor_R_free                       0.2391 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5393 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.99 
_refine.aniso_B[1][1]                            4.3873 
_refine.aniso_B[2][2]                            -3.8323 
_refine.aniso_B[3][3]                            -0.5550 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            6.8587 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.347 
_refine.solvent_model_param_bsol                 49.734 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'DISORDERED REGIONS WERE MODELED STEREOCHEMICALLY' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 25.54 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4439 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             574 
_refine_hist.number_atoms_total               5018 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        34.998 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 4573 'X-RAY DIFFRACTION' ? 
f_angle_d          1.259  ? ? 6197 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.575 ? ? 1783 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.094  ? ? 653  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 792  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.8500 1.8710  3326 0.2737 91.00 0.2823 . . 147 . . 
'X-RAY DIFFRACTION' . 1.8710 1.8930  3322 0.2619 92.00 0.3221 . . 168 . . 
'X-RAY DIFFRACTION' . 1.8930 1.9161  3355 0.2587 92.00 0.2848 . . 192 . . 
'X-RAY DIFFRACTION' . 1.9161 1.9404  3281 0.2509 92.00 0.2982 . . 189 . . 
'X-RAY DIFFRACTION' . 1.9404 1.9659  3298 0.2447 93.00 0.3046 . . 196 . . 
'X-RAY DIFFRACTION' . 1.9659 1.9928  3329 0.2469 93.00 0.2960 . . 194 . . 
'X-RAY DIFFRACTION' . 1.9928 2.0213  3464 0.2446 93.00 0.3099 . . 161 . . 
'X-RAY DIFFRACTION' . 2.0213 2.0515  3330 0.2302 93.00 0.2571 . . 157 . . 
'X-RAY DIFFRACTION' . 2.0515 2.0835  3311 0.2340 93.00 0.2683 . . 164 . . 
'X-RAY DIFFRACTION' . 2.0835 2.1177  3464 0.2253 94.00 0.2800 . . 197 . . 
'X-RAY DIFFRACTION' . 2.1177 2.1542  3338 0.2084 93.00 0.2477 . . 181 . . 
'X-RAY DIFFRACTION' . 2.1542 2.1934  3382 0.2019 94.00 0.2562 . . 170 . . 
'X-RAY DIFFRACTION' . 2.1934 2.2355  3476 0.1970 94.00 0.3060 . . 160 . . 
'X-RAY DIFFRACTION' . 2.2355 2.2812  3399 0.1925 94.00 0.2382 . . 189 . . 
'X-RAY DIFFRACTION' . 2.2812 2.3307  3363 0.1836 94.00 0.2567 . . 172 . . 
'X-RAY DIFFRACTION' . 2.3307 2.3850  3483 0.1994 94.00 0.2319 . . 173 . . 
'X-RAY DIFFRACTION' . 2.3850 2.4446  3381 0.2110 95.00 0.2813 . . 159 . . 
'X-RAY DIFFRACTION' . 2.4446 2.5107  3412 0.2101 95.00 0.2726 . . 180 . . 
'X-RAY DIFFRACTION' . 2.5107 2.5845  3443 0.2166 95.00 0.2610 . . 209 . . 
'X-RAY DIFFRACTION' . 2.5845 2.6679  3396 0.2117 96.00 0.2829 . . 176 . . 
'X-RAY DIFFRACTION' . 2.6679 2.7632  3515 0.1988 95.00 0.2844 . . 170 . . 
'X-RAY DIFFRACTION' . 2.7632 2.8738  3397 0.1951 95.00 0.2403 . . 192 . . 
'X-RAY DIFFRACTION' . 2.8738 3.0045  3475 0.2043 96.00 0.2441 . . 173 . . 
'X-RAY DIFFRACTION' . 3.0045 3.1628  3527 0.2057 97.00 0.2510 . . 185 . . 
'X-RAY DIFFRACTION' . 3.1628 3.3609  3483 0.1867 97.00 0.2175 . . 181 . . 
'X-RAY DIFFRACTION' . 3.3609 3.6201  3495 0.1735 97.00 0.2316 . . 179 . . 
'X-RAY DIFFRACTION' . 3.6201 3.9840  3528 0.1703 97.00 0.2224 . . 184 . . 
'X-RAY DIFFRACTION' . 3.9840 4.5594  3472 0.1590 97.00 0.1884 . . 233 . . 
'X-RAY DIFFRACTION' . 4.5594 5.7402  3545 0.1714 98.00 0.1856 . . 175 . . 
'X-RAY DIFFRACTION' . 5.7402 35.0039 3411 0.1873 95.00 0.1924 . . 187 . . 
# 
_struct.entry_id                  2X4X 
_struct.title                     'Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.' 
_struct.pdbx_descriptor           'PEREGRIN, HISTONE H3.2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2X4X 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'TRANSCRIPTION, METAL-BINDING, ZINC-FINGER, CHROMATIN REGULATOR, TRANSCRIPTION REGULATION, NUCLEOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 51  ? ARG A 66  ? PRO A 1124 ARG A 1139 1 ? 16 
HELX_P HELX_P2  2  ASN A 95  ? LEU A 104 ? ASN A 1168 LEU A 1177 1 ? 10 
HELX_P HELX_P3  3  LYS A 108 ? GLN A 130 ? LYS A 1181 GLN A 1203 1 ? 23 
HELX_P HELX_P4  4  PRO C 51  ? ARG C 66  ? PRO C 1124 ARG C 1139 1 ? 16 
HELX_P HELX_P5  5  ASN C 95  ? LEU C 104 ? ASN C 1168 LEU C 1177 1 ? 10 
HELX_P HELX_P6  6  LYS C 108 ? GLY C 131 ? LYS C 1181 GLY C 1204 1 ? 24 
HELX_P HELX_P7  7  PRO E 51  ? ARG E 66  ? PRO E 1124 ARG E 1139 1 ? 16 
HELX_P HELX_P8  8  PRO E 85  ? THR E 87  ? PRO E 1158 THR E 1160 5 ? 3  
HELX_P HELX_P9  9  ASN E 95  ? LEU E 104 ? ASN E 1168 LEU E 1177 1 ? 10 
HELX_P HELX_P10 10 LYS E 108 ? GLY E 131 ? LYS E 1181 GLY E 1204 1 ? 24 
HELX_P HELX_P11 11 PRO G 51  ? ARG G 66  ? PRO G 1124 ARG G 1139 1 ? 16 
HELX_P HELX_P12 12 ASN G 95  ? LEU G 104 ? ASN G 1168 LEU G 1177 1 ? 10 
HELX_P HELX_P13 13 LYS G 108 ? GLN G 130 ? LYS G 1181 GLN G 1203 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B VAL 14 C ? ? ? 1_555 B M3L 15 N ? ? B VAL 35 B M3L 36 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? B M3L 15 C ? ? ? 1_555 B LYS 16 N ? ? B M3L 36 B LYS 37 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3 covale ? ? D VAL 14 C ? ? ? 1_555 D M3L 15 N ? ? D VAL 35 D M3L 36 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale4 covale ? ? D M3L 15 C ? ? ? 1_555 D LYS 16 N ? ? D M3L 36 D LYS 37 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale5 covale ? ? F VAL 14 C ? ? ? 1_555 F M3L 15 N ? ? F VAL 35 F M3L 36 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale6 covale ? ? F M3L 15 C ? ? ? 1_555 F LYS 16 N ? ? F M3L 36 F LYS 37 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7 covale ? ? H VAL 14 C ? ? ? 1_555 H M3L 15 N ? ? H VAL 35 H M3L 36 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale8 covale ? ? H M3L 15 C ? ? ? 1_555 H LYS 16 N ? ? H M3L 36 H LYS 37 1_555 ? ? ? ? ? ? ? 1.325 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
CA ? 5 ? 
CB ? 2 ? 
EA ? 5 ? 
EB ? 2 ? 
GA ? 5 ? 
GB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CB 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EA 4 5 ? anti-parallel 
EB 1 2 ? anti-parallel 
GA 1 2 ? anti-parallel 
GA 2 3 ? anti-parallel 
GA 3 4 ? anti-parallel 
GA 4 5 ? anti-parallel 
GB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TRP A 81 ? PRO A 85 ? TRP A 1154 PRO A 1158 
AA 2 LEU A 69 ? PHE A 74 ? LEU A 1142 PHE A 1147 
AA 3 TYR A 26 ? ILE A 31 ? TYR A 1099 ILE A 1104 
AA 4 LEU A 15 ? ALA A 18 ? LEU A 1088 ALA A 1091 
AA 5 LEU A 89 ? PRO A 91 ? LEU A 1162 PRO A 1164 
AB 1 MET A 40 ? HIS A 42 ? MET A 1113 HIS A 1115 
AB 2 VAL A 45 ? ILE A 47 ? VAL A 1118 ILE A 1120 
CA 1 TRP C 81 ? PRO C 85 ? TRP C 1154 PRO C 1158 
CA 2 LEU C 69 ? PHE C 74 ? LEU C 1142 PHE C 1147 
CA 3 TYR C 26 ? ILE C 31 ? TYR C 1099 ILE C 1104 
CA 4 LEU C 15 ? ALA C 18 ? LEU C 1088 ALA C 1091 
CA 5 LEU C 89 ? PRO C 91 ? LEU C 1162 PRO C 1164 
CB 1 MET C 40 ? HIS C 42 ? MET C 1113 HIS C 1115 
CB 2 VAL C 45 ? ILE C 47 ? VAL C 1118 ILE C 1120 
EA 1 TRP E 81 ? LEU E 84 ? TRP E 1154 LEU E 1157 
EA 2 TYR E 70 ? PHE E 74 ? TYR E 1143 PHE E 1147 
EA 3 TYR E 26 ? ILE E 31 ? TYR E 1099 ILE E 1104 
EA 4 LEU E 15 ? ALA E 18 ? LEU E 1088 ALA E 1091 
EA 5 LEU E 89 ? PRO E 91 ? LEU E 1162 PRO E 1164 
EB 1 MET E 40 ? HIS E 42 ? MET E 1113 HIS E 1115 
EB 2 VAL E 45 ? ILE E 47 ? VAL E 1118 ILE E 1120 
GA 1 TRP G 81 ? PRO G 85 ? TRP G 1154 PRO G 1158 
GA 2 LEU G 69 ? PHE G 74 ? LEU G 1142 PHE G 1147 
GA 3 TYR G 26 ? ILE G 31 ? TYR G 1099 ILE G 1104 
GA 4 LEU G 15 ? ALA G 18 ? LEU G 1088 ALA G 1091 
GA 5 LEU G 89 ? PRO G 91 ? LEU G 1162 PRO G 1164 
GB 1 PHE G 41 ? HIS G 42 ? PHE G 1114 HIS G 1115 
GB 2 VAL G 45 ? PRO G 46 ? VAL G 1118 PRO G 1119 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 84 ? N LEU A 1157 O TYR A 70 ? O TYR A 1143 
AA 2 3 N LEU A 73 ? N LEU A 1146 O LEU A 29 ? O LEU A 1102 
AA 3 4 N ALA A 28 ? N ALA A 1101 O VAL A 16 ? O VAL A 1089 
AA 4 5 N TRP A 17 ? N TRP A 1090 O VAL A 90 ? O VAL A 1163 
AB 1 2 N HIS A 42 ? N HIS A 1115 O VAL A 45 ? O VAL A 1118 
CA 1 2 N LEU C 84 ? N LEU C 1157 O TYR C 70 ? O TYR C 1143 
CA 2 3 N LEU C 73 ? N LEU C 1146 O LEU C 29 ? O LEU C 1102 
CA 3 4 N ALA C 28 ? N ALA C 1101 O VAL C 16 ? O VAL C 1089 
CA 4 5 N TRP C 17 ? N TRP C 1090 O VAL C 90 ? O VAL C 1163 
CB 1 2 N HIS C 42 ? N HIS C 1115 O VAL C 45 ? O VAL C 1118 
EA 1 2 N LEU E 84 ? N LEU E 1157 O TYR E 70 ? O TYR E 1143 
EA 2 3 N LEU E 73 ? N LEU E 1146 O LEU E 29 ? O LEU E 1102 
EA 3 4 N ALA E 28 ? N ALA E 1101 O VAL E 16 ? O VAL E 1089 
EA 4 5 N TRP E 17 ? N TRP E 1090 O VAL E 90 ? O VAL E 1163 
EB 1 2 N HIS E 42 ? N HIS E 1115 O VAL E 45 ? O VAL E 1118 
GA 1 2 N LEU G 84 ? N LEU G 1157 O TYR G 70 ? O TYR G 1143 
GA 2 3 N LEU G 73 ? N LEU G 1146 O LEU G 29 ? O LEU G 1102 
GA 3 4 N ALA G 28 ? N ALA G 1101 O VAL G 16 ? O VAL G 1089 
GA 4 5 N TRP G 17 ? N TRP G 1090 O VAL G 90 ? O VAL G 1163 
GB 1 2 N HIS G 42 ? N HIS G 1115 O VAL G 45 ? O VAL G 1118 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 A 2206' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 ARG A 37 ? ARG A 1110 . ? 1_555 ? 
2 AC1 6 LEU A 52 ? LEU A 1125 . ? 1_555 ? 
3 AC1 6 HOH J .  ? HOH A 2147 . ? 1_555 ? 
4 AC1 6 HOH J .  ? HOH A 2148 . ? 1_555 ? 
5 AC1 6 HOH J .  ? HOH A 2149 . ? 1_555 ? 
6 AC1 6 HOH J .  ? HOH A 2150 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2X4X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2X4X 
_atom_sites.fract_transf_matrix[1][1]   0.026017 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004742 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009714 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011466 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 7   ? 15.911 -34.900 44.094  1.00 47.46 ? 1080 ASP A N   1 
ATOM   2    C CA  . ASP A 1 7   ? 16.518 -35.568 45.253  1.00 54.46 ? 1080 ASP A CA  1 
ATOM   3    C C   . ASP A 1 7   ? 16.618 -34.738 46.558  1.00 54.67 ? 1080 ASP A C   1 
ATOM   4    O O   . ASP A 1 7   ? 15.723 -34.796 47.407  1.00 54.60 ? 1080 ASP A O   1 
ATOM   5    C CB  . ASP A 1 7   ? 17.883 -36.180 44.893  1.00 57.42 ? 1080 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 7   ? 18.668 -35.337 43.895  1.00 63.12 ? 1080 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 7   ? 19.792 -34.910 44.249  1.00 68.09 ? 1080 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 7   ? 18.175 -35.106 42.761  1.00 57.34 ? 1080 ASP A OD2 1 
ATOM   9    N N   . SER A 1 8   ? 17.710 -33.991 46.716  1.00 53.31 ? 1081 SER A N   1 
ATOM   10   C CA  . SER A 1 8   ? 18.036 -33.294 47.972  1.00 52.42 ? 1081 SER A CA  1 
ATOM   11   C C   . SER A 1 8   ? 17.206 -32.025 48.245  1.00 48.32 ? 1081 SER A C   1 
ATOM   12   O O   . SER A 1 8   ? 16.767 -31.353 47.308  1.00 41.91 ? 1081 SER A O   1 
ATOM   13   C CB  . SER A 1 8   ? 19.510 -32.894 47.955  1.00 52.20 ? 1081 SER A CB  1 
ATOM   14   O OG  . SER A 1 8   ? 19.707 -31.835 47.023  1.00 59.49 ? 1081 SER A OG  1 
ATOM   15   N N   . PRO A 1 9   ? 17.015 -31.680 49.537  1.00 49.54 ? 1082 PRO A N   1 
ATOM   16   C CA  . PRO A 1 9   ? 16.300 -30.449 49.899  1.00 46.06 ? 1082 PRO A CA  1 
ATOM   17   C C   . PRO A 1 9   ? 17.035 -29.186 49.433  1.00 44.58 ? 1082 PRO A C   1 
ATOM   18   O O   . PRO A 1 9   ? 18.268 -29.133 49.395  1.00 43.60 ? 1082 PRO A O   1 
ATOM   19   C CB  . PRO A 1 9   ? 16.244 -30.509 51.433  1.00 47.12 ? 1082 PRO A CB  1 
ATOM   20   C CG  . PRO A 1 9   ? 16.392 -31.959 51.759  1.00 45.99 ? 1082 PRO A CG  1 
ATOM   21   C CD  . PRO A 1 9   ? 17.343 -32.490 50.726  1.00 49.32 ? 1082 PRO A CD  1 
ATOM   22   N N   . LEU A 1 10  ? 16.239 -28.185 49.077  1.00 38.88 ? 1083 LEU A N   1 
ATOM   23   C CA  . LEU A 1 10  ? 16.701 -26.908 48.547  1.00 37.10 ? 1083 LEU A CA  1 
ATOM   24   C C   . LEU A 1 10  ? 16.491 -25.819 49.604  1.00 32.59 ? 1083 LEU A C   1 
ATOM   25   O O   . LEU A 1 10  ? 15.770 -26.028 50.578  1.00 34.55 ? 1083 LEU A O   1 
ATOM   26   C CB  . LEU A 1 10  ? 15.880 -26.572 47.304  1.00 33.60 ? 1083 LEU A CB  1 
ATOM   27   C CG  . LEU A 1 10  ? 16.251 -27.195 45.951  1.00 37.38 ? 1083 LEU A CG  1 
ATOM   28   C CD1 . LEU A 1 10  ? 17.099 -28.442 46.060  1.00 42.60 ? 1083 LEU A CD1 1 
ATOM   29   C CD2 . LEU A 1 10  ? 14.988 -27.433 45.145  1.00 30.56 ? 1083 LEU A CD2 1 
ATOM   30   N N   . ASP A 1 11  ? 17.116 -24.657 49.415  1.00 29.69 ? 1084 ASP A N   1 
ATOM   31   C CA  . ASP A 1 11  ? 17.065 -23.593 50.414  1.00 31.37 ? 1084 ASP A CA  1 
ATOM   32   C C   . ASP A 1 11  ? 16.297 -22.361 49.968  1.00 28.36 ? 1084 ASP A C   1 
ATOM   33   O O   . ASP A 1 11  ? 16.196 -22.071 48.773  1.00 23.64 ? 1084 ASP A O   1 
ATOM   34   C CB  . ASP A 1 11  ? 18.480 -23.178 50.808  1.00 32.47 ? 1084 ASP A CB  1 
ATOM   35   C CG  . ASP A 1 11  ? 19.283 -24.337 51.378  1.00 36.65 ? 1084 ASP A CG  1 
ATOM   36   O OD1 . ASP A 1 11  ? 20.509 -24.391 51.141  1.00 41.46 ? 1084 ASP A OD1 1 
ATOM   37   O OD2 . ASP A 1 11  ? 18.676 -25.194 52.051  1.00 38.06 ? 1084 ASP A OD2 1 
ATOM   38   N N   . ALA A 1 12  ? 15.775 -21.621 50.942  1.00 26.31 ? 1085 ALA A N   1 
ATOM   39   C CA  . ALA A 1 12  ? 15.149 -20.357 50.653  1.00 25.99 ? 1085 ALA A CA  1 
ATOM   40   C C   . ALA A 1 12  ? 16.158 -19.486 49.935  1.00 25.48 ? 1085 ALA A C   1 
ATOM   41   O O   . ALA A 1 12  ? 17.361 -19.518 50.231  1.00 22.83 ? 1085 ALA A O   1 
ATOM   42   C CB  . ALA A 1 12  ? 14.650 -19.658 51.951  1.00 28.32 ? 1085 ALA A CB  1 
ATOM   43   N N   . LEU A 1 13  ? 15.642 -18.736 48.972  1.00 24.80 ? 1086 LEU A N   1 
ATOM   44   C CA  . LEU A 1 13  ? 16.433 -17.848 48.120  1.00 25.01 ? 1086 LEU A CA  1 
ATOM   45   C C   . LEU A 1 13  ? 17.339 -18.511 47.066  1.00 24.70 ? 1086 LEU A C   1 
ATOM   46   O O   . LEU A 1 13  ? 18.087 -17.805 46.389  1.00 24.67 ? 1086 LEU A O   1 
ATOM   47   C CB  . LEU A 1 13  ? 17.205 -16.818 48.953  1.00 26.95 ? 1086 LEU A CB  1 
ATOM   48   C CG  . LEU A 1 13  ? 16.377 -16.166 50.053  1.00 27.97 ? 1086 LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 13  ? 17.219 -15.141 50.783  1.00 32.20 ? 1086 LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 13  ? 15.088 -15.516 49.474  1.00 29.26 ? 1086 LEU A CD2 1 
ATOM   51   N N   . ASP A 1 14  ? 17.245 -19.835 46.889  1.00 24.70 ? 1087 ASP A N   1 
ATOM   52   C CA  . ASP A 1 14  ? 17.840 -20.499 45.711  1.00 27.20 ? 1087 ASP A CA  1 
ATOM   53   C C   . ASP A 1 14  ? 17.062 -20.123 44.440  1.00 21.97 ? 1087 ASP A C   1 
ATOM   54   O O   . ASP A 1 14  ? 15.832 -20.061 44.450  1.00 21.72 ? 1087 ASP A O   1 
ATOM   55   C CB  . ASP A 1 14  ? 17.754 -22.040 45.818  1.00 24.45 ? 1087 ASP A CB  1 
ATOM   56   C CG  . ASP A 1 14  ? 18.742 -22.654 46.810  1.00 28.87 ? 1087 ASP A CG  1 
ATOM   57   O OD1 . ASP A 1 14  ? 19.620 -21.956 47.349  1.00 26.65 ? 1087 ASP A OD1 1 
ATOM   58   O OD2 . ASP A 1 14  ? 18.631 -23.880 47.044  1.00 29.85 ? 1087 ASP A OD2 1 
ATOM   59   N N   . LEU A 1 15  ? 17.758 -19.932 43.332  1.00 22.74 ? 1088 LEU A N   1 
ATOM   60   C CA  . LEU A 1 15  ? 17.082 -19.814 42.036  1.00 21.05 ? 1088 LEU A CA  1 
ATOM   61   C C   . LEU A 1 15  ? 16.738 -21.211 41.490  1.00 21.04 ? 1088 LEU A C   1 
ATOM   62   O O   . LEU A 1 15  ? 17.557 -22.113 41.564  1.00 19.50 ? 1088 LEU A O   1 
ATOM   63   C CB  . LEU A 1 15  ? 18.003 -19.126 41.040  1.00 20.75 ? 1088 LEU A CB  1 
ATOM   64   C CG  . LEU A 1 15  ? 18.346 -17.665 41.353  1.00 23.65 ? 1088 LEU A CG  1 
ATOM   65   C CD1 . LEU A 1 15  ? 19.461 -17.163 40.440  1.00 29.53 ? 1088 LEU A CD1 1 
ATOM   66   C CD2 . LEU A 1 15  ? 17.091 -16.822 41.237  1.00 24.31 ? 1088 LEU A CD2 1 
ATOM   67   N N   . VAL A 1 16  ? 15.542 -21.379 40.920  1.00 19.39 ? 1089 VAL A N   1 
ATOM   68   C CA  . VAL A 1 16  ? 15.156 -22.680 40.389  1.00 20.41 ? 1089 VAL A CA  1 
ATOM   69   C C   . VAL A 1 16  ? 14.379 -22.588 39.090  1.00 20.70 ? 1089 VAL A C   1 
ATOM   70   O O   . VAL A 1 16  ? 13.735 -21.579 38.806  1.00 19.81 ? 1089 VAL A O   1 
ATOM   71   C CB  . VAL A 1 16  ? 14.223 -23.468 41.397  1.00 21.78 ? 1089 VAL A CB  1 
ATOM   72   C CG1 . VAL A 1 16  ? 15.004 -23.894 42.627  1.00 22.66 ? 1089 VAL A CG1 1 
ATOM   73   C CG2 . VAL A 1 16  ? 12.989 -22.620 41.793  1.00 20.32 ? 1089 VAL A CG2 1 
ATOM   74   N N   . TRP A 1 17  ? 14.421 -23.673 38.327  1.00 21.44 ? 1090 TRP A N   1 
ATOM   75   C CA  . TRP A 1 17  ? 13.429 -23.908 37.282  1.00 21.84 ? 1090 TRP A CA  1 
ATOM   76   C C   . TRP A 1 17  ? 12.233 -24.502 37.984  1.00 23.38 ? 1090 TRP A C   1 
ATOM   77   O O   . TRP A 1 17  ? 12.371 -25.499 38.687  1.00 26.60 ? 1090 TRP A O   1 
ATOM   78   C CB  . TRP A 1 17  ? 13.968 -24.894 36.234  1.00 21.51 ? 1090 TRP A CB  1 
ATOM   79   C CG  . TRP A 1 17  ? 15.068 -24.319 35.422  1.00 24.13 ? 1090 TRP A CG  1 
ATOM   80   C CD1 . TRP A 1 17  ? 16.406 -24.469 35.619  1.00 23.11 ? 1090 TRP A CD1 1 
ATOM   81   C CD2 . TRP A 1 17  ? 14.920 -23.470 34.298  1.00 20.24 ? 1090 TRP A CD2 1 
ATOM   82   N NE1 . TRP A 1 17  ? 17.099 -23.774 34.688  1.00 23.59 ? 1090 TRP A NE1 1 
ATOM   83   C CE2 . TRP A 1 17  ? 16.209 -23.138 33.860  1.00 25.04 ? 1090 TRP A CE2 1 
ATOM   84   C CE3 . TRP A 1 17  ? 13.818 -22.937 33.632  1.00 23.88 ? 1090 TRP A CE3 1 
ATOM   85   C CZ2 . TRP A 1 17  ? 16.437 -22.320 32.760  1.00 23.56 ? 1090 TRP A CZ2 1 
ATOM   86   C CZ3 . TRP A 1 17  ? 14.049 -22.110 32.536  1.00 22.48 ? 1090 TRP A CZ3 1 
ATOM   87   C CH2 . TRP A 1 17  ? 15.344 -21.814 32.118  1.00 25.89 ? 1090 TRP A CH2 1 
ATOM   88   N N   . ALA A 1 18  ? 11.064 -23.897 37.823  1.00 22.44 ? 1091 ALA A N   1 
ATOM   89   C CA  . ALA A 1 18  ? 9.868  -24.362 38.518  1.00 22.63 ? 1091 ALA A CA  1 
ATOM   90   C C   . ALA A 1 18  ? 8.819  -24.792 37.495  1.00 24.76 ? 1091 ALA A C   1 
ATOM   91   O O   . ALA A 1 18  ? 8.415  -24.006 36.632  1.00 21.71 ? 1091 ALA A O   1 
ATOM   92   C CB  . ALA A 1 18  ? 9.323  -23.262 39.428  1.00 21.22 ? 1091 ALA A CB  1 
ATOM   93   N N   . LYS A 1 19  ? 8.365  -26.038 37.592  1.00 24.76 ? 1092 LYS A N   1 
ATOM   94   C CA  . LYS A 1 19  ? 7.480  -26.589 36.569  1.00 23.64 ? 1092 LYS A CA  1 
ATOM   95   C C   . LYS A 1 19  ? 6.022  -26.655 37.037  1.00 28.58 ? 1092 LYS A C   1 
ATOM   96   O O   . LYS A 1 19  ? 5.686  -27.372 37.991  1.00 25.16 ? 1092 LYS A O   1 
ATOM   97   C CB  . LYS A 1 19  ? 7.967  -27.987 36.136  1.00 30.86 ? 1092 LYS A CB  1 
ATOM   98   C CG  . LYS A 1 19  ? 7.062  -28.700 35.102  1.00 31.13 ? 1092 LYS A CG  1 
ATOM   99   C CD  . LYS A 1 19  ? 6.965  -27.926 33.784  1.00 30.55 ? 1092 LYS A CD  1 
ATOM   100  C CE  . LYS A 1 19  ? 6.347  -28.774 32.654  1.00 31.41 ? 1092 LYS A CE  1 
ATOM   101  N NZ  . LYS A 1 19  ? 4.858  -28.702 32.656  1.00 32.10 ? 1092 LYS A NZ  1 
ATOM   102  N N   . CYS A 1 20  ? 5.168  -25.913 36.350  1.00 27.05 ? 1093 CYS A N   1 
ATOM   103  C CA  . CYS A 1 20  ? 3.723  -25.975 36.562  1.00 30.07 ? 1093 CYS A CA  1 
ATOM   104  C C   . CYS A 1 20  ? 3.072  -26.730 35.414  1.00 35.67 ? 1093 CYS A C   1 
ATOM   105  O O   . CYS A 1 20  ? 3.599  -26.769 34.292  1.00 33.99 ? 1093 CYS A O   1 
ATOM   106  C CB  . CYS A 1 20  ? 3.140  -24.579 36.598  1.00 33.24 ? 1093 CYS A CB  1 
ATOM   107  S SG  . CYS A 1 20  ? 3.383  -23.748 38.148  1.00 43.48 ? 1093 CYS A SG  1 
ATOM   108  N N   . ARG A 1 21  ? 1.911  -27.312 35.684  1.00 36.78 ? 1094 ARG A N   1 
ATOM   109  C CA  . ARG A 1 21  ? 1.205  -28.084 34.673  1.00 40.35 ? 1094 ARG A CA  1 
ATOM   110  C C   . ARG A 1 21  ? 0.916  -27.240 33.429  1.00 34.92 ? 1094 ARG A C   1 
ATOM   111  O O   . ARG A 1 21  ? 0.402  -26.132 33.530  1.00 35.04 ? 1094 ARG A O   1 
ATOM   112  C CB  . ARG A 1 21  ? -0.102 -28.639 35.252  1.00 43.14 ? 1094 ARG A CB  1 
ATOM   113  C CG  . ARG A 1 21  ? -0.958 -29.357 34.233  1.00 47.20 ? 1094 ARG A CG  1 
ATOM   114  C CD  . ARG A 1 21  ? -2.400 -29.478 34.716  1.00 55.78 ? 1094 ARG A CD  1 
ATOM   115  N NE  . ARG A 1 21  ? -2.473 -29.983 36.091  1.00 67.95 ? 1094 ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 21  ? -2.284 -31.252 36.449  1.00 64.97 ? 1094 ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 21  ? -2.372 -31.596 37.729  1.00 66.86 ? 1094 ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 21  ? -1.999 -32.177 35.538  1.00 63.99 ? 1094 ARG A NH2 1 
ATOM   119  N N   . GLY A 1 22  ? 1.258  -27.761 32.257  1.00 38.55 ? 1095 GLY A N   1 
ATOM   120  C CA  . GLY A 1 22  ? 0.928  -27.077 31.020  1.00 38.30 ? 1095 GLY A CA  1 
ATOM   121  C C   . GLY A 1 22  ? 1.908  -25.987 30.593  1.00 39.56 ? 1095 GLY A C   1 
ATOM   122  O O   . GLY A 1 22  ? 2.008  -25.680 29.401  1.00 37.47 ? 1095 GLY A O   1 
ATOM   123  N N   . TYR A 1 23  ? 2.605  -25.384 31.552  1.00 34.04 ? 1096 TYR A N   1 
ATOM   124  C CA  . TYR A 1 23  ? 3.638  -24.397 31.227  1.00 32.60 ? 1096 TYR A CA  1 
ATOM   125  C C   . TYR A 1 23  ? 5.015  -25.068 31.142  1.00 29.63 ? 1096 TYR A C   1 
ATOM   126  O O   . TYR A 1 23  ? 5.250  -26.092 31.777  1.00 30.04 ? 1096 TYR A O   1 
ATOM   127  C CB  . TYR A 1 23  ? 3.698  -23.288 32.284  1.00 30.05 ? 1096 TYR A CB  1 
ATOM   128  C CG  . TYR A 1 23  ? 2.504  -22.356 32.430  1.00 33.14 ? 1096 TYR A CG  1 
ATOM   129  C CD1 . TYR A 1 23  ? 2.176  -21.415 31.449  1.00 37.86 ? 1096 TYR A CD1 1 
ATOM   130  C CD2 . TYR A 1 23  ? 1.749  -22.362 33.601  1.00 34.38 ? 1096 TYR A CD2 1 
ATOM   131  C CE1 . TYR A 1 23  ? 1.090  -20.525 31.635  1.00 33.43 ? 1096 TYR A CE1 1 
ATOM   132  C CE2 . TYR A 1 23  ? 0.680  -21.491 33.785  1.00 35.49 ? 1096 TYR A CE2 1 
ATOM   133  C CZ  . TYR A 1 23  ? 0.358  -20.579 32.802  1.00 38.39 ? 1096 TYR A CZ  1 
ATOM   134  O OH  . TYR A 1 23  ? -0.717 -19.731 33.017  1.00 42.83 ? 1096 TYR A OH  1 
ATOM   135  N N   . PRO A 1 24  ? 5.952  -24.488 30.378  1.00 30.60 ? 1097 PRO A N   1 
ATOM   136  C CA  . PRO A 1 24  ? 7.307  -25.067 30.441  1.00 32.93 ? 1097 PRO A CA  1 
ATOM   137  C C   . PRO A 1 24  ? 7.959  -24.671 31.761  1.00 24.43 ? 1097 PRO A C   1 
ATOM   138  O O   . PRO A 1 24  ? 7.440  -23.779 32.430  1.00 26.77 ? 1097 PRO A O   1 
ATOM   139  C CB  . PRO A 1 24  ? 8.060  -24.367 29.294  1.00 31.71 ? 1097 PRO A CB  1 
ATOM   140  C CG  . PRO A 1 24  ? 7.149  -23.324 28.763  1.00 35.55 ? 1097 PRO A CG  1 
ATOM   141  C CD  . PRO A 1 24  ? 5.915  -23.232 29.621  1.00 31.24 ? 1097 PRO A CD  1 
ATOM   142  N N   . SER A 1 25  ? 9.072  -25.296 32.113  1.00 25.07 ? 1098 SER A N   1 
ATOM   143  C CA  . SER A 1 25  ? 9.810  -24.909 33.304  1.00 26.71 ? 1098 SER A CA  1 
ATOM   144  C C   . SER A 1 25  ? 10.137 -23.411 33.237  1.00 24.48 ? 1098 SER A C   1 
ATOM   145  O O   . SER A 1 25  ? 10.521 -22.893 32.178  1.00 23.17 ? 1098 SER A O   1 
ATOM   146  C CB  . SER A 1 25  ? 11.102 -25.698 33.397  1.00 25.38 ? 1098 SER A CB  1 
ATOM   147  O OG  . SER A 1 25  ? 10.852 -27.094 33.514  1.00 29.05 ? 1098 SER A OG  1 
ATOM   148  N N   . TYR A 1 26  ? 9.993  -22.724 34.368  1.00 22.67 ? 1099 TYR A N   1 
ATOM   149  C CA  . TYR A 1 26  ? 10.054 -21.255 34.375  1.00 21.26 ? 1099 TYR A CA  1 
ATOM   150  C C   . TYR A 1 26  ? 10.905 -20.765 35.559  1.00 22.12 ? 1099 TYR A C   1 
ATOM   151  O O   . TYR A 1 26  ? 10.710 -21.248 36.673  1.00 22.98 ? 1099 TYR A O   1 
ATOM   152  C CB  . TYR A 1 26  ? 8.635  -20.708 34.480  1.00 21.86 ? 1099 TYR A CB  1 
ATOM   153  C CG  . TYR A 1 26  ? 8.446  -19.290 33.958  1.00 22.27 ? 1099 TYR A CG  1 
ATOM   154  C CD1 . TYR A 1 26  ? 8.739  -18.184 34.749  1.00 22.62 ? 1099 TYR A CD1 1 
ATOM   155  C CD2 . TYR A 1 26  ? 7.969  -19.065 32.664  1.00 23.49 ? 1099 TYR A CD2 1 
ATOM   156  C CE1 . TYR A 1 26  ? 8.556  -16.891 34.282  1.00 24.89 ? 1099 TYR A CE1 1 
ATOM   157  C CE2 . TYR A 1 26  ? 7.781  -17.791 32.186  1.00 24.36 ? 1099 TYR A CE2 1 
ATOM   158  C CZ  . TYR A 1 26  ? 8.077  -16.703 32.989  1.00 27.73 ? 1099 TYR A CZ  1 
ATOM   159  O OH  . TYR A 1 26  ? 7.893  -15.421 32.496  1.00 28.25 ? 1099 TYR A OH  1 
ATOM   160  N N   . PRO A 1 27  ? 11.846 -19.821 35.323  1.00 21.06 ? 1100 PRO A N   1 
ATOM   161  C CA  . PRO A 1 27  ? 12.718 -19.301 36.385  1.00 21.20 ? 1100 PRO A CA  1 
ATOM   162  C C   . PRO A 1 27  ? 11.936 -18.732 37.585  1.00 20.35 ? 1100 PRO A C   1 
ATOM   163  O O   . PRO A 1 27  ? 10.937 -18.012 37.432  1.00 20.49 ? 1100 PRO A O   1 
ATOM   164  C CB  . PRO A 1 27  ? 13.489 -18.166 35.690  1.00 20.27 ? 1100 PRO A CB  1 
ATOM   165  C CG  . PRO A 1 27  ? 13.589 -18.623 34.231  1.00 23.87 ? 1100 PRO A CG  1 
ATOM   166  C CD  . PRO A 1 27  ? 12.201 -19.253 33.996  1.00 21.29 ? 1100 PRO A CD  1 
ATOM   167  N N   . ALA A 1 28  ? 12.419 -19.049 38.774  1.00 22.03 ? 1101 ALA A N   1 
ATOM   168  C CA  . ALA A 1 28  ? 11.765 -18.612 40.004  1.00 20.52 ? 1101 ALA A CA  1 
ATOM   169  C C   . ALA A 1 28  ? 12.750 -18.591 41.158  1.00 19.42 ? 1101 ALA A C   1 
ATOM   170  O O   . ALA A 1 28  ? 13.866 -19.071 41.037  1.00 18.66 ? 1101 ALA A O   1 
ATOM   171  C CB  . ALA A 1 28  ? 10.533 -19.510 40.360  1.00 18.74 ? 1101 ALA A CB  1 
ATOM   172  N N   . LEU A 1 29  ? 12.315 -17.980 42.262  1.00 22.14 ? 1102 LEU A N   1 
ATOM   173  C CA  . LEU A 1 29  ? 13.115 -17.843 43.462  1.00 20.20 ? 1102 LEU A CA  1 
ATOM   174  C C   . LEU A 1 29  ? 12.342 -18.523 44.569  1.00 21.05 ? 1102 LEU A C   1 
ATOM   175  O O   . LEU A 1 29  ? 11.130 -18.278 44.721  1.00 21.70 ? 1102 LEU A O   1 
ATOM   176  C CB  . LEU A 1 29  ? 13.233 -16.345 43.776  1.00 22.92 ? 1102 LEU A CB  1 
ATOM   177  C CG  . LEU A 1 29  ? 14.047 -15.908 44.986  1.00 24.89 ? 1102 LEU A CG  1 
ATOM   178  C CD1 . LEU A 1 29  ? 15.498 -16.266 44.789  1.00 25.54 ? 1102 LEU A CD1 1 
ATOM   179  C CD2 . LEU A 1 29  ? 13.874 -14.366 45.202  1.00 24.93 ? 1102 LEU A CD2 1 
ATOM   180  N N   . ILE A 1 30  ? 13.004 -19.392 45.321  1.00 19.71 ? 1103 ILE A N   1 
ATOM   181  C CA  . ILE A 1 30  ? 12.338 -20.047 46.444  1.00 20.06 ? 1103 ILE A CA  1 
ATOM   182  C C   . ILE A 1 30  ? 12.264 -19.011 47.572  1.00 23.25 ? 1103 ILE A C   1 
ATOM   183  O O   . ILE A 1 30  ? 13.261 -18.342 47.869  1.00 22.58 ? 1103 ILE A O   1 
ATOM   184  C CB  . ILE A 1 30  ? 13.108 -21.230 46.958  1.00 20.96 ? 1103 ILE A CB  1 
ATOM   185  C CG1 . ILE A 1 30  ? 13.224 -22.314 45.893  1.00 21.43 ? 1103 ILE A CG1 1 
ATOM   186  C CG2 . ILE A 1 30  ? 12.430 -21.794 48.239  1.00 20.22 ? 1103 ILE A CG2 1 
ATOM   187  C CD1 . ILE A 1 30  ? 13.889 -23.591 46.410  1.00 24.11 ? 1103 ILE A CD1 1 
ATOM   188  N N   . ILE A 1 31  ? 11.099 -18.891 48.188  1.00 21.65 ? 1104 ILE A N   1 
ATOM   189  C CA  . ILE A 1 31  ? 10.857 -17.871 49.221  1.00 22.94 ? 1104 ILE A CA  1 
ATOM   190  C C   . ILE A 1 31  ? 10.541 -18.588 50.520  1.00 25.82 ? 1104 ILE A C   1 
ATOM   191  O O   . ILE A 1 31  ? 9.790  -19.562 50.515  1.00 26.84 ? 1104 ILE A O   1 
ATOM   192  C CB  . ILE A 1 31  ? 9.685  -16.952 48.822  1.00 26.42 ? 1104 ILE A CB  1 
ATOM   193  C CG1 . ILE A 1 31  ? 10.039 -16.164 47.556  1.00 23.20 ? 1104 ILE A CG1 1 
ATOM   194  C CG2 . ILE A 1 31  ? 9.278  -15.979 49.962  1.00 26.22 ? 1104 ILE A CG2 1 
ATOM   195  C CD1 . ILE A 1 31  ? 11.228 -15.230 47.704  1.00 27.08 ? 1104 ILE A CD1 1 
ATOM   196  N N   . ASP A 1 32  ? 11.123 -18.121 51.629  1.00 27.68 ? 1105 ASP A N   1 
ATOM   197  C CA  . ASP A 1 32  ? 10.833 -18.692 52.958  1.00 29.43 ? 1105 ASP A CA  1 
ATOM   198  C C   . ASP A 1 32  ? 9.469  -18.196 53.460  1.00 28.19 ? 1105 ASP A C   1 
ATOM   199  O O   . ASP A 1 32  ? 9.298  -17.006 53.712  1.00 27.44 ? 1105 ASP A O   1 
ATOM   200  C CB  . ASP A 1 32  ? 11.948 -18.321 53.947  1.00 29.20 ? 1105 ASP A CB  1 
ATOM   201  C CG  . ASP A 1 32  ? 11.676 -18.838 55.375  1.00 36.86 ? 1105 ASP A CG  1 
ATOM   202  O OD1 . ASP A 1 32  ? 10.620 -19.472 55.610  1.00 33.93 ? 1105 ASP A OD1 1 
ATOM   203  O OD2 . ASP A 1 32  ? 12.540 -18.623 56.257  1.00 38.44 ? 1105 ASP A OD2 1 
ATOM   204  N N   . PRO A 1 33  ? 8.487  -19.106 53.587  1.00 28.12 ? 1106 PRO A N   1 
ATOM   205  C CA  . PRO A 1 33  ? 7.122  -18.730 53.989  1.00 28.77 ? 1106 PRO A CA  1 
ATOM   206  C C   . PRO A 1 33  ? 7.110  -18.043 55.356  1.00 31.58 ? 1106 PRO A C   1 
ATOM   207  O O   . PRO A 1 33  ? 6.222  -17.238 55.640  1.00 34.56 ? 1106 PRO A O   1 
ATOM   208  C CB  . PRO A 1 33  ? 6.394  -20.074 54.104  1.00 31.29 ? 1106 PRO A CB  1 
ATOM   209  C CG  . PRO A 1 33  ? 7.206  -21.028 53.293  1.00 34.23 ? 1106 PRO A CG  1 
ATOM   210  C CD  . PRO A 1 33  ? 8.633  -20.556 53.392  1.00 29.94 ? 1106 PRO A CD  1 
ATOM   211  N N   . LYS A 1 34  ? 8.082  -18.366 56.201  1.00 32.07 ? 1107 LYS A N   1 
ATOM   212  C CA  . LYS A 1 34  ? 8.122  -17.778 57.537  1.00 33.67 ? 1107 LYS A CA  1 
ATOM   213  C C   . LYS A 1 34  ? 9.015  -16.549 57.605  1.00 36.82 ? 1107 LYS A C   1 
ATOM   214  O O   . LYS A 1 34  ? 9.408  -16.126 58.693  1.00 31.66 ? 1107 LYS A O   1 
ATOM   215  C CB  . LYS A 1 34  ? 8.596  -18.812 58.559  1.00 36.39 ? 1107 LYS A CB  1 
ATOM   216  C CG  . LYS A 1 34  ? 7.666  -19.984 58.705  1.00 38.04 ? 1107 LYS A CG  1 
ATOM   217  C CD  . LYS A 1 34  ? 8.212  -20.999 59.717  1.00 45.74 ? 1107 LYS A CD  1 
ATOM   218  C CE  . LYS A 1 34  ? 7.251  -22.183 59.923  1.00 54.25 ? 1107 LYS A CE  1 
ATOM   219  N NZ  . LYS A 1 34  ? 7.950  -23.454 60.353  1.00 52.22 ? 1107 LYS A NZ  1 
ATOM   220  N N   . MET A 1 35  ? 9.363  -15.982 56.451  1.00 34.56 ? 1108 MET A N   1 
ATOM   221  C CA  . MET A 1 35  ? 10.205 -14.796 56.467  1.00 31.94 ? 1108 MET A CA  1 
ATOM   222  C C   . MET A 1 35  ? 9.523  -13.690 57.270  1.00 34.54 ? 1108 MET A C   1 
ATOM   223  O O   . MET A 1 35  ? 8.302  -13.677 57.400  1.00 33.94 ? 1108 MET A O   1 
ATOM   224  C CB  . MET A 1 35  ? 10.561 -14.316 55.050  1.00 34.86 ? 1108 MET A CB  1 
ATOM   225  C CG  . MET A 1 35  ? 9.380  -13.885 54.187  1.00 30.63 ? 1108 MET A CG  1 
ATOM   226  S SD  . MET A 1 35  ? 9.992  -13.203 52.617  1.00 34.25 ? 1108 MET A SD  1 
ATOM   227  C CE  . MET A 1 35  ? 10.862 -11.742 53.180  1.00 32.20 ? 1108 MET A CE  1 
ATOM   228  N N   . PRO A 1 36  ? 10.317 -12.768 57.830  1.00 36.05 ? 1109 PRO A N   1 
ATOM   229  C CA  . PRO A 1 36  ? 9.726  -11.689 58.635  1.00 38.46 ? 1109 PRO A CA  1 
ATOM   230  C C   . PRO A 1 36  ? 8.662  -10.927 57.843  1.00 35.64 ? 1109 PRO A C   1 
ATOM   231  O O   . PRO A 1 36  ? 8.883  -10.535 56.696  1.00 35.27 ? 1109 PRO A O   1 
ATOM   232  C CB  . PRO A 1 36  ? 10.921 -10.788 58.950  1.00 41.66 ? 1109 PRO A CB  1 
ATOM   233  C CG  . PRO A 1 36  ? 12.103 -11.721 58.936  1.00 42.19 ? 1109 PRO A CG  1 
ATOM   234  C CD  . PRO A 1 36  ? 11.789 -12.753 57.858  1.00 36.73 ? 1109 PRO A CD  1 
ATOM   235  N N   . ARG A 1 37  ? 7.504  -10.736 58.465  1.00 41.29 ? 1110 ARG A N   1 
ATOM   236  C CA  . ARG A 1 37  ? 6.385  -10.075 57.818  1.00 38.51 ? 1110 ARG A CA  1 
ATOM   237  C C   . ARG A 1 37  ? 6.712  -8.620  57.553  1.00 38.36 ? 1110 ARG A C   1 
ATOM   238  O O   . ARG A 1 37  ? 6.014  -7.947  56.786  1.00 37.69 ? 1110 ARG A O   1 
ATOM   239  C CB  . ARG A 1 37  ? 5.137  -10.171 58.692  1.00 40.95 ? 1110 ARG A CB  1 
ATOM   240  C CG  . ARG A 1 37  ? 4.753  -11.596 59.049  1.00 40.75 ? 1110 ARG A CG  1 
ATOM   241  C CD  . ARG A 1 37  ? 4.498  -12.403 57.783  1.00 37.81 ? 1110 ARG A CD  1 
ATOM   242  N NE  . ARG A 1 37  ? 3.459  -11.793 56.955  1.00 34.93 ? 1110 ARG A NE  1 
ATOM   243  C CZ  . ARG A 1 37  ? 3.194  -12.165 55.711  1.00 38.85 ? 1110 ARG A CZ  1 
ATOM   244  N NH1 . ARG A 1 37  ? 2.238  -11.560 55.016  1.00 35.55 ? 1110 ARG A NH1 1 
ATOM   245  N NH2 . ARG A 1 37  ? 3.907  -13.140 55.155  1.00 33.38 ? 1110 ARG A NH2 1 
ATOM   246  N N   . GLU A 1 38  ? 7.770  -8.131  58.191  1.00 38.08 ? 1111 GLU A N   1 
ATOM   247  C CA  . GLU A 1 38  ? 8.194  -6.756  57.982  1.00 42.36 ? 1111 GLU A CA  1 
ATOM   248  C C   . GLU A 1 38  ? 9.133  -6.668  56.777  1.00 45.53 ? 1111 GLU A C   1 
ATOM   249  O O   . GLU A 1 38  ? 9.499  -5.575  56.339  1.00 47.83 ? 1111 GLU A O   1 
ATOM   250  C CB  . GLU A 1 38  ? 8.841  -6.156  59.249  1.00 43.79 ? 1111 GLU A CB  1 
ATOM   251  C CG  . GLU A 1 38  ? 10.017 -6.952  59.830  1.00 48.98 ? 1111 GLU A CG  1 
ATOM   252  C CD  . GLU A 1 38  ? 9.608  -7.940  60.936  1.00 49.21 ? 1111 GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 38  ? 10.424 -8.148  61.869  1.00 51.88 ? 1111 GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 38  ? 8.487  -8.504  60.877  1.00 47.54 ? 1111 GLU A OE2 1 
ATOM   255  N N   . GLY A 1 39  ? 9.498  -7.826  56.231  1.00 40.40 ? 1112 GLY A N   1 
ATOM   256  C CA  . GLY A 1 39  ? 10.436 -7.869  55.126  1.00 36.87 ? 1112 GLY A CA  1 
ATOM   257  C C   . GLY A 1 39  ? 11.858 -8.106  55.590  1.00 42.79 ? 1112 GLY A C   1 
ATOM   258  O O   . GLY A 1 39  ? 12.168 -8.049  56.789  1.00 39.55 ? 1112 GLY A O   1 
ATOM   259  N N   . MET A 1 40  ? 12.728 -8.392  54.629  1.00 38.60 ? 1113 MET A N   1 
ATOM   260  C CA  . MET A 1 40  ? 14.146 -8.526  54.905  1.00 41.67 ? 1113 MET A CA  1 
ATOM   261  C C   . MET A 1 40  ? 14.943 -8.226  53.654  1.00 40.09 ? 1113 MET A C   1 
ATOM   262  O O   . MET A 1 40  ? 14.402 -8.153  52.551  1.00 38.09 ? 1113 MET A O   1 
ATOM   263  C CB  . MET A 1 40  ? 14.491 -9.916  55.438  1.00 39.05 ? 1113 MET A CB  1 
ATOM   264  C CG  . MET A 1 40  ? 14.083 -11.051 54.543  1.00 43.18 ? 1113 MET A CG  1 
ATOM   265  S SD  . MET A 1 40  ? 15.459 -11.742 53.588  1.00 57.81 ? 1113 MET A SD  1 
ATOM   266  C CE  . MET A 1 40  ? 14.701 -13.267 53.044  1.00 44.74 ? 1113 MET A CE  1 
ATOM   267  N N   . PHE A 1 41  ? 16.238 -8.046  53.847  1.00 39.12 ? 1114 PHE A N   1 
ATOM   268  C CA  . PHE A 1 41  ? 17.142 -7.786  52.761  1.00 40.48 ? 1114 PHE A CA  1 
ATOM   269  C C   . PHE A 1 41  ? 18.081 -8.960  52.694  1.00 41.34 ? 1114 PHE A C   1 
ATOM   270  O O   . PHE A 1 41  ? 18.583 -9.426  53.719  1.00 45.97 ? 1114 PHE A O   1 
ATOM   271  C CB  . PHE A 1 41  ? 17.919 -6.488  53.028  1.00 43.60 ? 1114 PHE A CB  1 
ATOM   272  C CG  . PHE A 1 41  ? 17.071 -5.248  52.932  1.00 42.65 ? 1114 PHE A CG  1 
ATOM   273  C CD1 . PHE A 1 41  ? 16.461 -4.717  54.059  1.00 47.56 ? 1114 PHE A CD1 1 
ATOM   274  C CD2 . PHE A 1 41  ? 16.871 -4.624  51.712  1.00 43.49 ? 1114 PHE A CD2 1 
ATOM   275  C CE1 . PHE A 1 41  ? 15.669 -3.584  53.970  1.00 47.50 ? 1114 PHE A CE1 1 
ATOM   276  C CE2 . PHE A 1 41  ? 16.084 -3.484  51.614  1.00 46.48 ? 1114 PHE A CE2 1 
ATOM   277  C CZ  . PHE A 1 41  ? 15.483 -2.960  52.745  1.00 46.33 ? 1114 PHE A CZ  1 
ATOM   278  N N   . HIS A 1 42  ? 18.300 -9.467  51.492  1.00 40.63 ? 1115 HIS A N   1 
ATOM   279  C CA  . HIS A 1 42  ? 19.261 -10.535 51.303  1.00 40.98 ? 1115 HIS A CA  1 
ATOM   280  C C   . HIS A 1 42  ? 20.465 -9.926  50.609  1.00 40.37 ? 1115 HIS A C   1 
ATOM   281  O O   . HIS A 1 42  ? 20.418 -9.635  49.415  1.00 41.33 ? 1115 HIS A O   1 
ATOM   282  C CB  . HIS A 1 42  ? 18.651 -11.664 50.477  1.00 37.42 ? 1115 HIS A CB  1 
ATOM   283  C CG  . HIS A 1 42  ? 19.553 -12.842 50.300  1.00 39.16 ? 1115 HIS A CG  1 
ATOM   284  N ND1 . HIS A 1 42  ? 20.025 -13.583 51.364  1.00 40.26 ? 1115 HIS A ND1 1 
ATOM   285  C CD2 . HIS A 1 42  ? 20.027 -13.444 49.182  1.00 40.82 ? 1115 HIS A CD2 1 
ATOM   286  C CE1 . HIS A 1 42  ? 20.776 -14.574 50.909  1.00 39.14 ? 1115 HIS A CE1 1 
ATOM   287  N NE2 . HIS A 1 42  ? 20.792 -14.514 49.588  1.00 39.04 ? 1115 HIS A NE2 1 
ATOM   288  N N   . HIS A 1 43  ? 21.534 -9.701  51.369  1.00 45.11 ? 1116 HIS A N   1 
ATOM   289  C CA  . HIS A 1 43  ? 22.706 -8.996  50.851  1.00 43.52 ? 1116 HIS A CA  1 
ATOM   290  C C   . HIS A 1 43  ? 22.304 -7.715  50.128  1.00 44.16 ? 1116 HIS A C   1 
ATOM   291  O O   . HIS A 1 43  ? 22.719 -7.462  48.993  1.00 44.01 ? 1116 HIS A O   1 
ATOM   292  C CB  . HIS A 1 43  ? 23.510 -9.903  49.934  1.00 45.21 ? 1116 HIS A CB  1 
ATOM   293  C CG  . HIS A 1 43  ? 24.022 -11.131 50.615  1.00 46.31 ? 1116 HIS A CG  1 
ATOM   294  N ND1 . HIS A 1 43  ? 25.165 -11.133 51.386  1.00 51.36 ? 1116 HIS A ND1 1 
ATOM   295  C CD2 . HIS A 1 43  ? 23.541 -12.397 50.653  1.00 46.53 ? 1116 HIS A CD2 1 
ATOM   296  C CE1 . HIS A 1 43  ? 25.370 -12.349 51.863  1.00 51.99 ? 1116 HIS A CE1 1 
ATOM   297  N NE2 . HIS A 1 43  ? 24.400 -13.135 51.432  1.00 46.51 ? 1116 HIS A NE2 1 
ATOM   298  N N   . GLY A 1 44  ? 21.471 -6.920  50.793  1.00 43.92 ? 1117 GLY A N   1 
ATOM   299  C CA  . GLY A 1 44  ? 21.024 -5.649  50.249  1.00 46.98 ? 1117 GLY A CA  1 
ATOM   300  C C   . GLY A 1 44  ? 19.793 -5.714  49.359  1.00 43.88 ? 1117 GLY A C   1 
ATOM   301  O O   . GLY A 1 44  ? 19.201 -4.688  49.040  1.00 43.45 ? 1117 GLY A O   1 
ATOM   302  N N   . VAL A 1 45  ? 19.391 -6.913  48.959  1.00 42.22 ? 1118 VAL A N   1 
ATOM   303  C CA  . VAL A 1 45  ? 18.291 -7.035  48.010  1.00 39.00 ? 1118 VAL A CA  1 
ATOM   304  C C   . VAL A 1 45  ? 16.983 -7.327  48.753  1.00 39.07 ? 1118 VAL A C   1 
ATOM   305  O O   . VAL A 1 45  ? 16.886 -8.307  49.506  1.00 38.13 ? 1118 VAL A O   1 
ATOM   306  C CB  . VAL A 1 45  ? 18.604 -8.113  46.943  1.00 40.32 ? 1118 VAL A CB  1 
ATOM   307  C CG1 . VAL A 1 45  ? 17.478 -8.231  45.927  1.00 38.57 ? 1118 VAL A CG1 1 
ATOM   308  C CG2 . VAL A 1 45  ? 19.922 -7.797  46.236  1.00 40.85 ? 1118 VAL A CG2 1 
ATOM   309  N N   . PRO A 1 46  ? 15.970 -6.476  48.548  1.00 38.39 ? 1119 PRO A N   1 
ATOM   310  C CA  . PRO A 1 46  ? 14.717 -6.643  49.285  1.00 38.45 ? 1119 PRO A CA  1 
ATOM   311  C C   . PRO A 1 46  ? 13.944 -7.822  48.720  1.00 32.92 ? 1119 PRO A C   1 
ATOM   312  O O   . PRO A 1 46  ? 13.763 -7.904  47.505  1.00 36.89 ? 1119 PRO A O   1 
ATOM   313  C CB  . PRO A 1 46  ? 13.953 -5.338  49.006  1.00 38.72 ? 1119 PRO A CB  1 
ATOM   314  C CG  . PRO A 1 46  ? 14.798 -4.549  48.018  1.00 39.44 ? 1119 PRO A CG  1 
ATOM   315  C CD  . PRO A 1 46  ? 15.854 -5.463  47.482  1.00 37.25 ? 1119 PRO A CD  1 
ATOM   316  N N   . ILE A 1 47  ? 13.508 -8.725  49.588  1.00 31.79 ? 1120 ILE A N   1 
ATOM   317  C CA  . ILE A 1 47  ? 12.794 -9.925  49.161  1.00 31.18 ? 1120 ILE A CA  1 
ATOM   318  C C   . ILE A 1 47  ? 11.304 -9.744  49.394  1.00 31.19 ? 1120 ILE A C   1 
ATOM   319  O O   . ILE A 1 47  ? 10.885 -9.479  50.522  1.00 32.91 ? 1120 ILE A O   1 
ATOM   320  C CB  . ILE A 1 47  ? 13.259 -11.115 49.973  1.00 31.33 ? 1120 ILE A CB  1 
ATOM   321  C CG1 . ILE A 1 47  ? 14.770 -11.266 49.818  1.00 29.52 ? 1120 ILE A CG1 1 
ATOM   322  C CG2 . ILE A 1 47  ? 12.521 -12.391 49.547  1.00 27.30 ? 1120 ILE A CG2 1 
ATOM   323  C CD1 . ILE A 1 47  ? 15.216 -11.476 48.396  1.00 32.45 ? 1120 ILE A CD1 1 
ATOM   324  N N   . PRO A 1 48  ? 10.486 -9.908  48.343  1.00 26.92 ? 1121 PRO A N   1 
ATOM   325  C CA  . PRO A 1 48  ? 9.052  -9.663  48.524  1.00 29.41 ? 1121 PRO A CA  1 
ATOM   326  C C   . PRO A 1 48  ? 8.441  -10.586 49.581  1.00 31.76 ? 1121 PRO A C   1 
ATOM   327  O O   . PRO A 1 48  ? 8.792  -11.786 49.639  1.00 28.29 ? 1121 PRO A O   1 
ATOM   328  C CB  . PRO A 1 48  ? 8.463  -9.957  47.134  1.00 29.75 ? 1121 PRO A CB  1 
ATOM   329  C CG  . PRO A 1 48  ? 9.559  -9.743  46.212  1.00 32.47 ? 1121 PRO A CG  1 
ATOM   330  C CD  . PRO A 1 48  ? 10.824 -10.154 46.936  1.00 29.80 ? 1121 PRO A CD  1 
ATOM   331  N N   . VAL A 1 49  ? 7.536  -10.039 50.393  1.00 27.79 ? 1122 VAL A N   1 
ATOM   332  C CA  . VAL A 1 49  ? 6.847  -10.814 51.411  1.00 28.02 ? 1122 VAL A CA  1 
ATOM   333  C C   . VAL A 1 49  ? 5.581  -11.488 50.872  1.00 27.74 ? 1122 VAL A C   1 
ATOM   334  O O   . VAL A 1 49  ? 4.755  -10.855 50.233  1.00 31.10 ? 1122 VAL A O   1 
ATOM   335  C CB  . VAL A 1 49  ? 6.457  -9.903  52.632  1.00 28.65 ? 1122 VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 49  ? 5.697  -10.705 53.676  1.00 32.52 ? 1122 VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 49  ? 7.706  -9.260  53.234  1.00 28.26 ? 1122 VAL A CG2 1 
ATOM   338  N N   . PRO A 1 50  ? 5.417  -12.781 51.150  1.00 26.27 ? 1123 PRO A N   1 
ATOM   339  C CA  . PRO A 1 50  ? 4.236  -13.498 50.656  1.00 29.57 ? 1123 PRO A CA  1 
ATOM   340  C C   . PRO A 1 50  ? 2.965  -12.961 51.284  1.00 29.76 ? 1123 PRO A C   1 
ATOM   341  O O   . PRO A 1 50  ? 2.927  -12.870 52.508  1.00 31.66 ? 1123 PRO A O   1 
ATOM   342  C CB  . PRO A 1 50  ? 4.447  -14.923 51.171  1.00 24.51 ? 1123 PRO A CB  1 
ATOM   343  C CG  . PRO A 1 50  ? 5.889  -15.009 51.534  1.00 29.38 ? 1123 PRO A CG  1 
ATOM   344  C CD  . PRO A 1 50  ? 6.338  -13.648 51.898  1.00 29.33 ? 1123 PRO A CD  1 
ATOM   345  N N   . PRO A 1 51  ? 1.942  -12.654 50.467  1.00 32.80 ? 1124 PRO A N   1 
ATOM   346  C CA  . PRO A 1 51  ? 0.597  -12.287 50.936  1.00 35.33 ? 1124 PRO A CA  1 
ATOM   347  C C   . PRO A 1 51  ? 0.081  -13.318 51.938  1.00 36.07 ? 1124 PRO A C   1 
ATOM   348  O O   . PRO A 1 51  ? 0.391  -14.508 51.814  1.00 32.18 ? 1124 PRO A O   1 
ATOM   349  C CB  . PRO A 1 51  ? -0.258 -12.358 49.659  1.00 32.04 ? 1124 PRO A CB  1 
ATOM   350  C CG  . PRO A 1 51  ? 0.723  -12.192 48.525  1.00 36.97 ? 1124 PRO A CG  1 
ATOM   351  C CD  . PRO A 1 51  ? 2.025  -12.757 48.995  1.00 33.20 ? 1124 PRO A CD  1 
ATOM   352  N N   . LEU A 1 52  ? -0.699 -12.884 52.924  1.00 33.42 ? 1125 LEU A N   1 
ATOM   353  C CA  . LEU A 1 52  ? -1.325 -13.833 53.829  1.00 33.34 ? 1125 LEU A CA  1 
ATOM   354  C C   . LEU A 1 52  ? -2.128 -14.882 53.056  1.00 32.43 ? 1125 LEU A C   1 
ATOM   355  O O   . LEU A 1 52  ? -2.138 -16.069 53.406  1.00 32.58 ? 1125 LEU A O   1 
ATOM   356  C CB  . LEU A 1 52  ? -2.238 -13.084 54.803  1.00 34.64 ? 1125 LEU A CB  1 
ATOM   357  C CG  . LEU A 1 52  ? -1.491 -12.260 55.848  1.00 41.71 ? 1125 LEU A CG  1 
ATOM   358  C CD1 . LEU A 1 52  ? -2.467 -11.485 56.719  1.00 42.73 ? 1125 LEU A CD1 1 
ATOM   359  C CD2 . LEU A 1 52  ? -0.606 -13.155 56.705  1.00 40.52 ? 1125 LEU A CD2 1 
ATOM   360  N N   . GLU A 1 53  ? -2.802 -14.444 51.998  1.00 29.69 ? 1126 GLU A N   1 
ATOM   361  C CA  . GLU A 1 53  ? -3.633 -15.338 51.206  1.00 33.27 ? 1126 GLU A CA  1 
ATOM   362  C C   . GLU A 1 53  ? -2.814 -16.462 50.540  1.00 34.56 ? 1126 GLU A C   1 
ATOM   363  O O   . GLU A 1 53  ? -3.250 -17.600 50.446  1.00 31.71 ? 1126 GLU A O   1 
ATOM   364  C CB  . GLU A 1 53  ? -4.385 -14.534 50.152  1.00 34.66 ? 1126 GLU A CB  1 
ATOM   365  C CG  . GLU A 1 53  ? -5.152 -15.379 49.152  1.00 46.30 ? 1126 GLU A CG  1 
ATOM   366  C CD  . GLU A 1 53  ? -6.556 -14.837 48.887  1.00 57.13 ? 1126 GLU A CD  1 
ATOM   367  O OE1 . GLU A 1 53  ? -7.507 -15.354 49.521  1.00 60.73 ? 1126 GLU A OE1 1 
ATOM   368  O OE2 . GLU A 1 53  ? -6.704 -13.895 48.065  1.00 57.32 ? 1126 GLU A OE2 1 
ATOM   369  N N   . VAL A 1 54  ? -1.635 -16.115 50.051  1.00 31.88 ? 1127 VAL A N   1 
ATOM   370  C CA  . VAL A 1 54  ? -0.720 -17.109 49.489  1.00 28.65 ? 1127 VAL A CA  1 
ATOM   371  C C   . VAL A 1 54  ? -0.318 -18.138 50.562  1.00 30.00 ? 1127 VAL A C   1 
ATOM   372  O O   . VAL A 1 54  ? -0.293 -19.337 50.303  1.00 29.14 ? 1127 VAL A O   1 
ATOM   373  C CB  . VAL A 1 54  ? 0.495  -16.398 48.856  1.00 27.65 ? 1127 VAL A CB  1 
ATOM   374  C CG1 . VAL A 1 54  ? 1.635  -17.396 48.511  1.00 26.24 ? 1127 VAL A CG1 1 
ATOM   375  C CG2 . VAL A 1 54  ? 0.048  -15.600 47.625  1.00 30.36 ? 1127 VAL A CG2 1 
ATOM   376  N N   . LEU A 1 55  ? -0.029 -17.670 51.775  1.00 29.95 ? 1128 LEU A N   1 
ATOM   377  C CA  . LEU A 1 55  ? 0.324  -18.568 52.869  1.00 30.59 ? 1128 LEU A CA  1 
ATOM   378  C C   . LEU A 1 55  ? -0.796 -19.558 53.186  1.00 33.15 ? 1128 LEU A C   1 
ATOM   379  O O   . LEU A 1 55  ? -0.556 -20.744 53.442  1.00 32.03 ? 1128 LEU A O   1 
ATOM   380  C CB  . LEU A 1 55  ? 0.681  -17.762 54.123  1.00 30.41 ? 1128 LEU A CB  1 
ATOM   381  C CG  . LEU A 1 55  ? 1.922  -16.902 53.904  1.00 31.06 ? 1128 LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 55  ? 2.435  -16.369 55.237  1.00 33.81 ? 1128 LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 55  ? 2.959  -17.776 53.246  1.00 31.51 ? 1128 LEU A CD2 1 
ATOM   384  N N   . LYS A 1 56  ? -2.027 -19.067 53.149  1.00 32.00 ? 1129 LYS A N   1 
ATOM   385  C CA  . LYS A 1 56  ? -3.173 -19.884 53.485  1.00 32.88 ? 1129 LYS A CA  1 
ATOM   386  C C   . LYS A 1 56  ? -3.362 -20.956 52.428  1.00 32.99 ? 1129 LYS A C   1 
ATOM   387  O O   . LYS A 1 56  ? -3.723 -22.099 52.731  1.00 34.43 ? 1129 LYS A O   1 
ATOM   388  C CB  . LYS A 1 56  ? -4.422 -19.009 53.586  1.00 36.23 ? 1129 LYS A CB  1 
ATOM   389  C CG  . LYS A 1 56  ? -5.629 -19.723 54.143  1.00 43.85 ? 1129 LYS A CG  1 
ATOM   390  C CD  . LYS A 1 56  ? -6.908 -18.922 53.888  1.00 48.57 ? 1129 LYS A CD  1 
ATOM   391  C CE  . LYS A 1 56  ? -8.122 -19.615 54.507  1.00 56.63 ? 1129 LYS A CE  1 
ATOM   392  N NZ  . LYS A 1 56  ? -9.406 -19.090 53.951  1.00 65.92 ? 1129 LYS A NZ  1 
ATOM   393  N N   . LEU A 1 57  ? -3.094 -20.577 51.183  1.00 33.97 ? 1130 LEU A N   1 
ATOM   394  C CA  . LEU A 1 57  ? -3.157 -21.484 50.047  1.00 34.60 ? 1130 LEU A CA  1 
ATOM   395  C C   . LEU A 1 57  ? -2.156 -22.621 50.213  1.00 31.69 ? 1130 LEU A C   1 
ATOM   396  O O   . LEU A 1 57  ? -2.459 -23.784 49.925  1.00 31.96 ? 1130 LEU A O   1 
ATOM   397  C CB  . LEU A 1 57  ? -2.813 -20.710 48.778  1.00 33.60 ? 1130 LEU A CB  1 
ATOM   398  C CG  . LEU A 1 57  ? -3.500 -21.078 47.463  1.00 39.41 ? 1130 LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 57  ? -2.577 -20.713 46.326  1.00 37.03 ? 1130 LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 57  ? -3.896 -22.525 47.370  1.00 35.89 ? 1130 LEU A CD2 1 
ATOM   401  N N   . GLY A 1 58  ? -0.953 -22.278 50.664  1.00 30.09 ? 1131 GLY A N   1 
ATOM   402  C CA  . GLY A 1 58  ? 0.099  -23.265 50.849  1.00 29.97 ? 1131 GLY A CA  1 
ATOM   403  C C   . GLY A 1 58  ? -0.271 -24.317 51.886  1.00 31.31 ? 1131 GLY A C   1 
ATOM   404  O O   . GLY A 1 58  ? -0.131 -25.509 51.649  1.00 30.12 ? 1131 GLY A O   1 
ATOM   405  N N   . GLU A 1 59  ? -0.759 -23.869 53.037  1.00 32.97 ? 1132 GLU A N   1 
ATOM   406  C CA  . GLU A 1 59  ? -1.227 -24.789 54.069  1.00 33.86 ? 1132 GLU A CA  1 
ATOM   407  C C   . GLU A 1 59  ? -2.313 -25.730 53.532  1.00 34.99 ? 1132 GLU A C   1 
ATOM   408  O O   . GLU A 1 59  ? -2.321 -26.930 53.800  1.00 32.85 ? 1132 GLU A O   1 
ATOM   409  C CB  . GLU A 1 59  ? -1.743 -23.988 55.262  1.00 38.59 ? 1132 GLU A CB  1 
ATOM   410  C CG  . GLU A 1 59  ? -2.468 -24.806 56.298  1.00 43.66 ? 1132 GLU A CG  1 
ATOM   411  C CD  . GLU A 1 59  ? -2.876 -23.960 57.493  1.00 56.53 ? 1132 GLU A CD  1 
ATOM   412  O OE1 . GLU A 1 59  ? -3.863 -24.330 58.176  1.00 59.67 ? 1132 GLU A OE1 1 
ATOM   413  O OE2 . GLU A 1 59  ? -2.212 -22.918 57.739  1.00 55.29 ? 1132 GLU A OE2 1 
ATOM   414  N N   . GLN A 1 60  ? -3.227 -25.187 52.751  1.00 31.97 ? 1133 GLN A N   1 
ATOM   415  C CA  . GLN A 1 60  ? -4.291 -25.999 52.192  1.00 35.80 ? 1133 GLN A CA  1 
ATOM   416  C C   . GLN A 1 60  ? -3.773 -26.995 51.154  1.00 34.42 ? 1133 GLN A C   1 
ATOM   417  O O   . GLN A 1 60  ? -4.153 -28.170 51.174  1.00 32.93 ? 1133 GLN A O   1 
ATOM   418  C CB  . GLN A 1 60  ? -5.377 -25.078 51.648  1.00 39.99 ? 1133 GLN A CB  1 
ATOM   419  C CG  . GLN A 1 60  ? -6.154 -25.576 50.476  1.00 42.45 ? 1133 GLN A CG  1 
ATOM   420  C CD  . GLN A 1 60  ? -6.789 -24.410 49.729  1.00 49.83 ? 1133 GLN A CD  1 
ATOM   421  O OE1 . GLN A 1 60  ? -6.970 -23.321 50.298  1.00 51.91 ? 1133 GLN A OE1 1 
ATOM   422  N NE2 . GLN A 1 60  ? -7.106 -24.618 48.451  1.00 50.17 ? 1133 GLN A NE2 1 
ATOM   423  N N   . MET A 1 61  ? -2.883 -26.541 50.266  1.00 32.89 ? 1134 MET A N   1 
ATOM   424  C CA  . MET A 1 61  ? -2.288 -27.412 49.246  1.00 32.90 ? 1134 MET A CA  1 
ATOM   425  C C   . MET A 1 61  ? -1.382 -28.489 49.848  1.00 31.97 ? 1134 MET A C   1 
ATOM   426  O O   . MET A 1 61  ? -1.374 -29.625 49.383  1.00 30.10 ? 1134 MET A O   1 
ATOM   427  C CB  . MET A 1 61  ? -1.504 -26.592 48.197  1.00 29.96 ? 1134 MET A CB  1 
ATOM   428  C CG  . MET A 1 61  ? -2.337 -25.631 47.361  1.00 33.24 ? 1134 MET A CG  1 
ATOM   429  S SD  . MET A 1 61  ? -1.315 -24.652 46.202  1.00 31.32 ? 1134 MET A SD  1 
ATOM   430  C CE  . MET A 1 61  ? -0.697 -25.927 45.126  1.00 29.82 ? 1134 MET A CE  1 
ATOM   431  N N   . THR A 1 62  ? -0.616 -28.124 50.872  1.00 32.82 ? 1135 THR A N   1 
ATOM   432  C CA  . THR A 1 62  ? 0.260  -29.076 51.550  1.00 31.06 ? 1135 THR A CA  1 
ATOM   433  C C   . THR A 1 62  ? -0.560 -30.218 52.123  1.00 35.67 ? 1135 THR A C   1 
ATOM   434  O O   . THR A 1 62  ? -0.209 -31.380 51.963  1.00 33.88 ? 1135 THR A O   1 
ATOM   435  C CB  . THR A 1 62  ? 1.059  -28.416 52.683  1.00 32.41 ? 1135 THR A CB  1 
ATOM   436  O OG1 . THR A 1 62  ? 1.930  -27.410 52.135  1.00 31.01 ? 1135 THR A OG1 1 
ATOM   437  C CG2 . THR A 1 62  ? 1.897  -29.469 53.417  1.00 31.59 ? 1135 THR A CG2 1 
ATOM   438  N N   . GLN A 1 63  ? -1.668 -29.875 52.767  1.00 38.21 ? 1136 GLN A N   1 
ATOM   439  C CA  . GLN A 1 63  ? -2.551 -30.881 53.354  1.00 39.76 ? 1136 GLN A CA  1 
ATOM   440  C C   . GLN A 1 63  ? -3.216 -31.766 52.294  1.00 40.57 ? 1136 GLN A C   1 
ATOM   441  O O   . GLN A 1 63  ? -3.218 -33.004 52.424  1.00 41.53 ? 1136 GLN A O   1 
ATOM   442  C CB  . GLN A 1 63  ? -3.594 -30.208 54.255  1.00 40.61 ? 1136 GLN A CB  1 
ATOM   443  C CG  . GLN A 1 63  ? -3.173 -30.047 55.726  1.00 45.96 ? 1136 GLN A CG  1 
ATOM   444  C CD  . GLN A 1 63  ? -1.669 -29.841 55.925  1.00 46.03 ? 1136 GLN A CD  1 
ATOM   445  O OE1 . GLN A 1 63  ? -1.145 -28.717 55.784  1.00 44.95 ? 1136 GLN A OE1 1 
ATOM   446  N NE2 . GLN A 1 63  ? -0.968 -30.927 56.284  1.00 37.74 ? 1136 GLN A NE2 1 
ATOM   447  N N   . GLU A 1 64  ? -3.763 -31.160 51.241  1.00 37.09 ? 1137 GLU A N   1 
ATOM   448  C CA  . GLU A 1 64  ? -4.389 -31.959 50.181  1.00 38.55 ? 1137 GLU A CA  1 
ATOM   449  C C   . GLU A 1 64  ? -3.398 -32.878 49.478  1.00 41.45 ? 1137 GLU A C   1 
ATOM   450  O O   . GLU A 1 64  ? -3.760 -33.984 49.060  1.00 41.75 ? 1137 GLU A O   1 
ATOM   451  C CB  . GLU A 1 64  ? -5.234 -31.131 49.179  1.00 40.26 ? 1137 GLU A CB  1 
ATOM   452  C CG  . GLU A 1 64  ? -4.638 -29.819 48.670  1.00 44.72 ? 1137 GLU A CG  1 
ATOM   453  C CD  . GLU A 1 64  ? -5.684 -28.669 48.566  1.00 48.79 ? 1137 GLU A CD  1 
ATOM   454  O OE1 . GLU A 1 64  ? -5.321 -27.541 48.124  1.00 45.49 ? 1137 GLU A OE1 1 
ATOM   455  O OE2 . GLU A 1 64  ? -6.865 -28.887 48.948  1.00 51.61 ? 1137 GLU A OE2 1 
ATOM   456  N N   . ALA A 1 65  ? -2.142 -32.445 49.381  1.00 37.73 ? 1138 ALA A N   1 
ATOM   457  C CA  . ALA A 1 65  ? -1.125 -33.251 48.712  1.00 37.10 ? 1138 ALA A CA  1 
ATOM   458  C C   . ALA A 1 65  ? -0.351 -34.199 49.642  1.00 34.32 ? 1138 ALA A C   1 
ATOM   459  O O   . ALA A 1 65  ? 0.285  -35.135 49.166  1.00 36.73 ? 1138 ALA A O   1 
ATOM   460  C CB  . ALA A 1 65  ? -0.133 -32.338 47.941  1.00 37.36 ? 1138 ALA A CB  1 
ATOM   461  N N   . ARG A 1 66  ? -0.381 -33.948 50.947  1.00 35.60 ? 1139 ARG A N   1 
ATOM   462  C CA  . ARG A 1 66  ? 0.555  -34.624 51.865  1.00 35.70 ? 1139 ARG A CA  1 
ATOM   463  C C   . ARG A 1 66  ? 1.966  -34.714 51.283  1.00 35.44 ? 1139 ARG A C   1 
ATOM   464  O O   . ARG A 1 66  ? 2.572  -35.798 51.202  1.00 29.51 ? 1139 ARG A O   1 
ATOM   465  C CB  . ARG A 1 66  ? 0.055  -36.012 52.275  1.00 33.83 ? 1139 ARG A CB  1 
ATOM   466  C CG  . ARG A 1 66  ? -0.727 -35.954 53.554  1.00 38.25 ? 1139 ARG A CG  1 
ATOM   467  C CD  . ARG A 1 66  ? -2.150 -35.595 53.265  1.00 38.27 ? 1139 ARG A CD  1 
ATOM   468  N NE  . ARG A 1 66  ? -2.985 -36.785 53.304  1.00 42.09 ? 1139 ARG A NE  1 
ATOM   469  C CZ  . ARG A 1 66  ? -4.032 -36.976 52.515  1.00 41.61 ? 1139 ARG A CZ  1 
ATOM   470  N NH1 . ARG A 1 66  ? -4.353 -36.066 51.603  1.00 34.33 ? 1139 ARG A NH1 1 
ATOM   471  N NH2 . ARG A 1 66  ? -4.724 -38.095 52.618  1.00 34.88 ? 1139 ARG A NH2 1 
ATOM   472  N N   . GLU A 1 67  ? 2.477  -33.570 50.846  1.00 28.58 ? 1140 GLU A N   1 
ATOM   473  C CA  . GLU A 1 67  ? 3.874  -33.498 50.462  1.00 29.39 ? 1140 GLU A CA  1 
ATOM   474  C C   . GLU A 1 67  ? 4.380  -32.098 50.704  1.00 26.19 ? 1140 GLU A C   1 
ATOM   475  O O   . GLU A 1 67  ? 3.606  -31.124 50.722  1.00 25.66 ? 1140 GLU A O   1 
ATOM   476  C CB  . GLU A 1 67  ? 4.146  -33.999 49.026  1.00 36.07 ? 1140 GLU A CB  1 
ATOM   477  C CG  . GLU A 1 67  ? 3.382  -33.320 47.917  1.00 38.56 ? 1140 GLU A CG  1 
ATOM   478  C CD  . GLU A 1 67  ? 3.716  -33.888 46.522  1.00 39.18 ? 1140 GLU A CD  1 
ATOM   479  O OE1 . GLU A 1 67  ? 2.800  -33.911 45.683  1.00 39.53 ? 1140 GLU A OE1 1 
ATOM   480  O OE2 . GLU A 1 67  ? 4.873  -34.316 46.271  1.00 39.04 ? 1140 GLU A OE2 1 
ATOM   481  N N   . HIS A 1 68  ? 5.676  -32.007 50.955  1.00 25.23 ? 1141 HIS A N   1 
ATOM   482  C CA  . HIS A 1 68  ? 6.254  -30.738 51.325  1.00 25.22 ? 1141 HIS A CA  1 
ATOM   483  C C   . HIS A 1 68  ? 6.239  -29.869 50.079  1.00 25.88 ? 1141 HIS A C   1 
ATOM   484  O O   . HIS A 1 68  ? 6.622  -30.317 48.991  1.00 26.66 ? 1141 HIS A O   1 
ATOM   485  C CB  . HIS A 1 68  ? 7.675  -30.942 51.827  1.00 29.36 ? 1141 HIS A CB  1 
ATOM   486  C CG  . HIS A 1 68  ? 8.341  -29.677 52.251  1.00 32.04 ? 1141 HIS A CG  1 
ATOM   487  N ND1 . HIS A 1 68  ? 8.030  -29.032 53.428  1.00 31.92 ? 1141 HIS A ND1 1 
ATOM   488  C CD2 . HIS A 1 68  ? 9.305  -28.936 51.657  1.00 30.32 ? 1141 HIS A CD2 1 
ATOM   489  C CE1 . HIS A 1 68  ? 8.766  -27.940 53.537  1.00 35.46 ? 1141 HIS A CE1 1 
ATOM   490  N NE2 . HIS A 1 68  ? 9.545  -27.857 52.473  1.00 34.49 ? 1141 HIS A NE2 1 
ATOM   491  N N   . LEU A 1 69  ? 5.773  -28.636 50.219  1.00 29.15 ? 1142 LEU A N   1 
ATOM   492  C CA  . LEU A 1 69  ? 5.704  -27.750 49.061  1.00 24.95 ? 1142 LEU A CA  1 
ATOM   493  C C   . LEU A 1 69  ? 6.556  -26.530 49.319  1.00 25.13 ? 1142 LEU A C   1 
ATOM   494  O O   . LEU A 1 69  ? 6.525  -25.984 50.405  1.00 25.70 ? 1142 LEU A O   1 
ATOM   495  C CB  . LEU A 1 69  ? 4.256  -27.315 48.794  1.00 27.54 ? 1142 LEU A CB  1 
ATOM   496  C CG  . LEU A 1 69  ? 3.258  -28.451 48.541  1.00 26.36 ? 1142 LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 69  ? 1.827  -27.954 48.457  1.00 29.87 ? 1142 LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 69  ? 3.653  -29.184 47.282  1.00 25.29 ? 1142 LEU A CD2 1 
ATOM   499  N N   . TYR A 1 70  ? 7.325  -26.122 48.313  1.00 21.89 ? 1143 TYR A N   1 
ATOM   500  C CA  . TYR A 1 70  ? 8.177  -24.950 48.417  1.00 22.74 ? 1143 TYR A CA  1 
ATOM   501  C C   . TYR A 1 70  ? 7.371  -23.802 47.877  1.00 25.25 ? 1143 TYR A C   1 
ATOM   502  O O   . TYR A 1 70  ? 6.608  -23.976 46.928  1.00 25.28 ? 1143 TYR A O   1 
ATOM   503  C CB  . TYR A 1 70  ? 9.410  -25.123 47.534  1.00 26.14 ? 1143 TYR A CB  1 
ATOM   504  C CG  . TYR A 1 70  ? 10.386 -26.160 48.025  1.00 22.97 ? 1143 TYR A CG  1 
ATOM   505  C CD1 . TYR A 1 70  ? 11.460 -25.786 48.818  1.00 27.13 ? 1143 TYR A CD1 1 
ATOM   506  C CD2 . TYR A 1 70  ? 10.230 -27.522 47.707  1.00 24.94 ? 1143 TYR A CD2 1 
ATOM   507  C CE1 . TYR A 1 70  ? 12.376 -26.717 49.267  1.00 27.17 ? 1143 TYR A CE1 1 
ATOM   508  C CE2 . TYR A 1 70  ? 11.146 -28.465 48.159  1.00 25.45 ? 1143 TYR A CE2 1 
ATOM   509  C CZ  . TYR A 1 70  ? 12.211 -28.047 48.937  1.00 28.21 ? 1143 TYR A CZ  1 
ATOM   510  O OH  . TYR A 1 70  ? 13.127 -28.939 49.401  1.00 29.91 ? 1143 TYR A OH  1 
ATOM   511  N N   . LEU A 1 71  ? 7.529  -22.632 48.481  1.00 23.59 ? 1144 LEU A N   1 
ATOM   512  C CA  . LEU A 1 71  ? 6.915  -21.446 47.932  1.00 22.58 ? 1144 LEU A CA  1 
ATOM   513  C C   . LEU A 1 71  ? 7.876  -20.798 46.942  1.00 21.06 ? 1144 LEU A C   1 
ATOM   514  O O   . LEU A 1 71  ? 9.039  -20.515 47.269  1.00 19.01 ? 1144 LEU A O   1 
ATOM   515  C CB  . LEU A 1 71  ? 6.585  -20.474 49.038  1.00 23.58 ? 1144 LEU A CB  1 
ATOM   516  C CG  . LEU A 1 71  ? 6.044  -19.118 48.563  1.00 24.00 ? 1144 LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 71  ? 4.782  -19.338 47.732  1.00 21.11 ? 1144 LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 71  ? 5.773  -18.247 49.766  1.00 26.56 ? 1144 LEU A CD2 1 
ATOM   519  N N   . VAL A 1 72  ? 7.415  -20.597 45.716  1.00 19.28 ? 1145 VAL A N   1 
ATOM   520  C CA  . VAL A 1 72  ? 8.283  -19.982 44.697  1.00 17.82 ? 1145 VAL A CA  1 
ATOM   521  C C   . VAL A 1 72  ? 7.652  -18.690 44.157  1.00 21.06 ? 1145 VAL A C   1 
ATOM   522  O O   . VAL A 1 72  ? 6.419  -18.545 44.092  1.00 22.56 ? 1145 VAL A O   1 
ATOM   523  C CB  . VAL A 1 72  ? 8.643  -20.910 43.511  1.00 22.58 ? 1145 VAL A CB  1 
ATOM   524  C CG1 . VAL A 1 72  ? 9.287  -22.219 44.013  1.00 20.97 ? 1145 VAL A CG1 1 
ATOM   525  C CG2 . VAL A 1 72  ? 7.431  -21.167 42.620  1.00 18.89 ? 1145 VAL A CG2 1 
ATOM   526  N N   . LEU A 1 73  ? 8.512  -17.752 43.805  1.00 20.88 ? 1146 LEU A N   1 
ATOM   527  C CA  . LEU A 1 73  ? 8.080  -16.493 43.214  1.00 20.24 ? 1146 LEU A CA  1 
ATOM   528  C C   . LEU A 1 73  ? 8.679  -16.447 41.818  1.00 19.14 ? 1146 LEU A C   1 
ATOM   529  O O   . LEU A 1 73  ? 9.888  -16.417 41.662  1.00 21.20 ? 1146 LEU A O   1 
ATOM   530  C CB  . LEU A 1 73  ? 8.610  -15.318 44.035  1.00 21.69 ? 1146 LEU A CB  1 
ATOM   531  C CG  . LEU A 1 73  ? 8.276  -13.943 43.433  1.00 20.90 ? 1146 LEU A CG  1 
ATOM   532  C CD1 . LEU A 1 73  ? 6.769  -13.627 43.523  1.00 23.76 ? 1146 LEU A CD1 1 
ATOM   533  C CD2 . LEU A 1 73  ? 9.057  -12.856 44.182  1.00 23.82 ? 1146 LEU A CD2 1 
ATOM   534  N N   . PHE A 1 74  ? 7.837  -16.458 40.791  1.00 19.62 ? 1147 PHE A N   1 
ATOM   535  C CA  . PHE A 1 74  ? 8.366  -16.528 39.445  1.00 19.18 ? 1147 PHE A CA  1 
ATOM   536  C C   . PHE A 1 74  ? 8.986  -15.182 39.043  1.00 21.82 ? 1147 PHE A C   1 
ATOM   537  O O   . PHE A 1 74  ? 8.602  -14.135 39.562  1.00 26.07 ? 1147 PHE A O   1 
ATOM   538  C CB  . PHE A 1 74  ? 7.267  -16.887 38.441  1.00 20.67 ? 1147 PHE A CB  1 
ATOM   539  C CG  . PHE A 1 74  ? 6.758  -18.289 38.575  1.00 22.63 ? 1147 PHE A CG  1 
ATOM   540  C CD1 . PHE A 1 74  ? 7.494  -19.354 38.068  1.00 23.16 ? 1147 PHE A CD1 1 
ATOM   541  C CD2 . PHE A 1 74  ? 5.545  -18.539 39.190  1.00 25.33 ? 1147 PHE A CD2 1 
ATOM   542  C CE1 . PHE A 1 74  ? 7.033  -20.667 38.187  1.00 23.49 ? 1147 PHE A CE1 1 
ATOM   543  C CE2 . PHE A 1 74  ? 5.062  -19.849 39.313  1.00 26.57 ? 1147 PHE A CE2 1 
ATOM   544  C CZ  . PHE A 1 74  ? 5.814  -20.919 38.816  1.00 24.81 ? 1147 PHE A CZ  1 
ATOM   545  N N   . PHE A 1 75  ? 9.939  -15.235 38.129  1.00 19.81 ? 1148 PHE A N   1 
ATOM   546  C CA  . PHE A 1 75  ? 10.495 -14.021 37.533  1.00 25.03 ? 1148 PHE A CA  1 
ATOM   547  C C   . PHE A 1 75  ? 9.696  -13.577 36.314  1.00 26.71 ? 1148 PHE A C   1 
ATOM   548  O O   . PHE A 1 75  ? 10.247 -12.974 35.400  1.00 27.03 ? 1148 PHE A O   1 
ATOM   549  C CB  . PHE A 1 75  ? 11.954 -14.240 37.159  1.00 24.15 ? 1148 PHE A CB  1 
ATOM   550  C CG  . PHE A 1 75  ? 12.889 -14.195 38.344  1.00 25.71 ? 1148 PHE A CG  1 
ATOM   551  C CD1 . PHE A 1 75  ? 13.332 -12.973 38.843  1.00 24.48 ? 1148 PHE A CD1 1 
ATOM   552  C CD2 . PHE A 1 75  ? 13.341 -15.369 38.946  1.00 24.84 ? 1148 PHE A CD2 1 
ATOM   553  C CE1 . PHE A 1 75  ? 14.191 -12.913 39.942  1.00 26.14 ? 1148 PHE A CE1 1 
ATOM   554  C CE2 . PHE A 1 75  ? 14.205 -15.328 40.040  1.00 23.34 ? 1148 PHE A CE2 1 
ATOM   555  C CZ  . PHE A 1 75  ? 14.623 -14.095 40.550  1.00 25.68 ? 1148 PHE A CZ  1 
ATOM   556  N N   . ASP A 1 76  ? 8.394  -13.850 36.304  1.00 25.90 ? 1149 ASP A N   1 
ATOM   557  C CA  . ASP A 1 76  ? 7.564  -13.360 35.212  1.00 28.68 ? 1149 ASP A CA  1 
ATOM   558  C C   . ASP A 1 76  ? 7.278  -11.878 35.420  1.00 30.63 ? 1149 ASP A C   1 
ATOM   559  O O   . ASP A 1 76  ? 7.754  -11.275 36.392  1.00 27.34 ? 1149 ASP A O   1 
ATOM   560  C CB  . ASP A 1 76  ? 6.253  -14.143 35.095  1.00 28.22 ? 1149 ASP A CB  1 
ATOM   561  C CG  . ASP A 1 76  ? 5.505  -14.237 36.407  1.00 28.74 ? 1149 ASP A CG  1 
ATOM   562  O OD1 . ASP A 1 76  ? 6.104  -13.924 37.462  1.00 31.23 ? 1149 ASP A OD1 1 
ATOM   563  O OD2 . ASP A 1 76  ? 4.327  -14.651 36.393  1.00 29.27 ? 1149 ASP A OD2 1 
ATOM   564  N N   . ASN A 1 77  ? 6.473  -11.314 34.526  1.00 34.32 ? 1150 ASN A N   1 
ATOM   565  C CA  . ASN A 1 77  ? 6.168  -9.879  34.535  1.00 34.99 ? 1150 ASN A CA  1 
ATOM   566  C C   . ASN A 1 77  ? 5.476  -9.448  35.806  1.00 35.79 ? 1150 ASN A C   1 
ATOM   567  O O   . ASN A 1 77  ? 5.833  -8.429  36.405  1.00 38.65 ? 1150 ASN A O   1 
ATOM   568  C CB  . ASN A 1 77  ? 5.276  -9.510  33.344  1.00 37.18 ? 1150 ASN A CB  1 
ATOM   569  C CG  . ASN A 1 77  ? 6.004  -9.570  32.020  1.00 41.08 ? 1150 ASN A CG  1 
ATOM   570  O OD1 . ASN A 1 77  ? 7.225  -9.454  31.966  1.00 45.35 ? 1150 ASN A OD1 1 
ATOM   571  N ND2 . ASN A 1 77  ? 5.251  -9.749  30.936  1.00 41.06 ? 1150 ASN A ND2 1 
ATOM   572  N N   . LYS A 1 78  ? 4.479  -10.222 36.230  1.00 35.64 ? 1151 LYS A N   1 
ATOM   573  C CA  . LYS A 1 78  ? 3.686  -9.840  37.389  1.00 35.46 ? 1151 LYS A CA  1 
ATOM   574  C C   . LYS A 1 78  ? 4.256  -10.352 38.709  1.00 33.90 ? 1151 LYS A C   1 
ATOM   575  O O   . LYS A 1 78  ? 3.767  -9.971  39.780  1.00 32.02 ? 1151 LYS A O   1 
ATOM   576  C CB  . LYS A 1 78  ? 2.239  -10.288 37.216  1.00 39.16 ? 1151 LYS A CB  1 
ATOM   577  C CG  . LYS A 1 78  ? 1.583  -9.699  35.974  1.00 42.70 ? 1151 LYS A CG  1 
ATOM   578  C CD  . LYS A 1 78  ? 0.226  -10.337 35.745  1.00 47.22 ? 1151 LYS A CD  1 
ATOM   579  C CE  . LYS A 1 78  ? 0.325  -11.865 35.763  1.00 47.12 ? 1151 LYS A CE  1 
ATOM   580  N NZ  . LYS A 1 78  ? -0.958 -12.504 36.192  1.00 47.21 ? 1151 LYS A NZ  1 
ATOM   581  N N   . ARG A 1 79  ? 5.296  -11.186 38.619  1.00 30.47 ? 1152 ARG A N   1 
ATOM   582  C CA  . ARG A 1 79  ? 5.934  -11.790 39.788  1.00 28.38 ? 1152 ARG A CA  1 
ATOM   583  C C   . ARG A 1 79  ? 4.863  -12.527 40.559  1.00 25.67 ? 1152 ARG A C   1 
ATOM   584  O O   . ARG A 1 79  ? 4.457  -12.103 41.645  1.00 26.38 ? 1152 ARG A O   1 
ATOM   585  C CB  . ARG A 1 79  ? 6.624  -10.740 40.686  1.00 30.82 ? 1152 ARG A CB  1 
ATOM   586  C CG  . ARG A 1 79  ? 7.707  -9.910  40.002  1.00 35.47 ? 1152 ARG A CG  1 
ATOM   587  C CD  . ARG A 1 79  ? 8.883  -10.751 39.477  1.00 30.19 ? 1152 ARG A CD  1 
ATOM   588  N NE  . ARG A 1 79  ? 9.715  -11.370 40.514  1.00 28.31 ? 1152 ARG A NE  1 
ATOM   589  C CZ  . ARG A 1 79  ? 10.637 -10.722 41.231  1.00 35.83 ? 1152 ARG A CZ  1 
ATOM   590  N NH1 . ARG A 1 79  ? 10.819 -9.412  41.067  1.00 39.58 ? 1152 ARG A NH1 1 
ATOM   591  N NH2 . ARG A 1 79  ? 11.370 -11.369 42.129  1.00 29.74 ? 1152 ARG A NH2 1 
ATOM   592  N N   . THR A 1 80  ? 4.401  -13.641 39.988  1.00 26.58 ? 1153 THR A N   1 
ATOM   593  C CA  . THR A 1 80  ? 3.320  -14.438 40.582  1.00 28.98 ? 1153 THR A CA  1 
ATOM   594  C C   . THR A 1 80  ? 3.884  -15.554 41.474  1.00 25.49 ? 1153 THR A C   1 
ATOM   595  O O   . THR A 1 80  ? 5.051  -15.895 41.348  1.00 24.31 ? 1153 THR A O   1 
ATOM   596  C CB  . THR A 1 80  ? 2.477  -15.082 39.497  1.00 28.09 ? 1153 THR A CB  1 
ATOM   597  O OG1 . THR A 1 80  ? 3.339  -15.806 38.614  1.00 28.33 ? 1153 THR A OG1 1 
ATOM   598  C CG2 . THR A 1 80  ? 1.751  -14.014 38.690  1.00 33.11 ? 1153 THR A CG2 1 
ATOM   599  N N   . TRP A 1 81  ? 3.050  -16.114 42.350  1.00 25.27 ? 1154 TRP A N   1 
ATOM   600  C CA  . TRP A 1 81  ? 3.465  -17.108 43.360  1.00 25.10 ? 1154 TRP A CA  1 
ATOM   601  C C   . TRP A 1 81  ? 2.947  -18.492 43.007  1.00 25.83 ? 1154 TRP A C   1 
ATOM   602  O O   . TRP A 1 81  ? 1.906  -18.603 42.369  1.00 27.19 ? 1154 TRP A O   1 
ATOM   603  C CB  . TRP A 1 81  ? 2.870  -16.749 44.730  1.00 23.85 ? 1154 TRP A CB  1 
ATOM   604  C CG  . TRP A 1 81  ? 3.294  -15.395 45.282  1.00 27.40 ? 1154 TRP A CG  1 
ATOM   605  C CD1 . TRP A 1 81  ? 2.637  -14.188 45.141  1.00 26.87 ? 1154 TRP A CD1 1 
ATOM   606  C CD2 . TRP A 1 81  ? 4.451  -15.130 46.084  1.00 25.13 ? 1154 TRP A CD2 1 
ATOM   607  N NE1 . TRP A 1 81  ? 3.333  -13.196 45.806  1.00 26.83 ? 1154 TRP A NE1 1 
ATOM   608  C CE2 . TRP A 1 81  ? 4.438  -13.751 46.399  1.00 26.32 ? 1154 TRP A CE2 1 
ATOM   609  C CE3 . TRP A 1 81  ? 5.491  -15.932 46.584  1.00 23.03 ? 1154 TRP A CE3 1 
ATOM   610  C CZ2 . TRP A 1 81  ? 5.435  -13.157 47.168  1.00 28.01 ? 1154 TRP A CZ2 1 
ATOM   611  C CZ3 . TRP A 1 81  ? 6.479  -15.340 47.344  1.00 24.61 ? 1154 TRP A CZ3 1 
ATOM   612  C CH2 . TRP A 1 81  ? 6.447  -13.957 47.631  1.00 23.95 ? 1154 TRP A CH2 1 
ATOM   613  N N   . GLN A 1 82  ? 3.663  -19.544 43.414  1.00 23.99 ? 1155 GLN A N   1 
ATOM   614  C CA  . GLN A 1 82  ? 3.074  -20.899 43.437  1.00 23.99 ? 1155 GLN A CA  1 
ATOM   615  C C   . GLN A 1 82  ? 3.775  -21.751 44.467  1.00 25.21 ? 1155 GLN A C   1 
ATOM   616  O O   . GLN A 1 82  ? 4.915  -21.442 44.877  1.00 23.22 ? 1155 GLN A O   1 
ATOM   617  C CB  . GLN A 1 82  ? 3.140  -21.608 42.087  1.00 28.53 ? 1155 GLN A CB  1 
ATOM   618  C CG  . GLN A 1 82  ? 1.834  -21.655 41.303  1.00 38.92 ? 1155 GLN A CG  1 
ATOM   619  C CD  . GLN A 1 82  ? 0.705  -22.354 42.050  1.00 36.36 ? 1155 GLN A CD  1 
ATOM   620  O OE1 . GLN A 1 82  ? 0.925  -23.013 43.060  1.00 35.24 ? 1155 GLN A OE1 1 
ATOM   621  N NE2 . GLN A 1 82  ? -0.516 -22.197 41.551  1.00 39.85 ? 1155 GLN A NE2 1 
ATOM   622  N N   . TRP A 1 83  ? 3.083  -22.817 44.875  1.00 22.52 ? 1156 TRP A N   1 
ATOM   623  C CA  . TRP A 1 83  ? 3.622  -23.840 45.782  1.00 22.43 ? 1156 TRP A CA  1 
ATOM   624  C C   . TRP A 1 83  ? 3.849  -25.125 44.969  1.00 25.91 ? 1156 TRP A C   1 
ATOM   625  O O   . TRP A 1 83  ? 2.937  -25.603 44.281  1.00 23.01 ? 1156 TRP A O   1 
ATOM   626  C CB  . TRP A 1 83  ? 2.608  -24.128 46.888  1.00 25.81 ? 1156 TRP A CB  1 
ATOM   627  C CG  . TRP A 1 83  ? 2.337  -22.962 47.837  1.00 24.57 ? 1156 TRP A CG  1 
ATOM   628  C CD1 . TRP A 1 83  ? 1.379  -21.983 47.705  1.00 26.01 ? 1156 TRP A CD1 1 
ATOM   629  C CD2 . TRP A 1 83  ? 3.029  -22.685 49.063  1.00 26.73 ? 1156 TRP A CD2 1 
ATOM   630  N NE1 . TRP A 1 83  ? 1.446  -21.107 48.776  1.00 25.81 ? 1156 TRP A NE1 1 
ATOM   631  C CE2 . TRP A 1 83  ? 2.447  -21.519 49.623  1.00 27.21 ? 1156 TRP A CE2 1 
ATOM   632  C CE3 . TRP A 1 83  ? 4.090  -23.312 49.741  1.00 26.82 ? 1156 TRP A CE3 1 
ATOM   633  C CZ2 . TRP A 1 83  ? 2.889  -20.964 50.825  1.00 27.62 ? 1156 TRP A CZ2 1 
ATOM   634  C CZ3 . TRP A 1 83  ? 4.526  -22.768 50.944  1.00 28.95 ? 1156 TRP A CZ3 1 
ATOM   635  C CH2 . TRP A 1 83  ? 3.930  -21.593 51.467  1.00 30.54 ? 1156 TRP A CH2 1 
ATOM   636  N N   . LEU A 1 84  ? 5.062  -25.666 45.030  1.00 21.63 ? 1157 LEU A N   1 
ATOM   637  C CA  . LEU A 1 84  ? 5.452  -26.821 44.219  1.00 21.51 ? 1157 LEU A CA  1 
ATOM   638  C C   . LEU A 1 84  ? 6.287  -27.768 45.037  1.00 25.95 ? 1157 LEU A C   1 
ATOM   639  O O   . LEU A 1 84  ? 7.149  -27.320 45.806  1.00 22.79 ? 1157 LEU A O   1 
ATOM   640  C CB  . LEU A 1 84  ? 6.323  -26.371 43.039  1.00 21.96 ? 1157 LEU A CB  1 
ATOM   641  C CG  . LEU A 1 84  ? 5.631  -25.477 42.007  1.00 23.70 ? 1157 LEU A CG  1 
ATOM   642  C CD1 . LEU A 1 84  ? 6.650  -24.957 40.935  1.00 25.32 ? 1157 LEU A CD1 1 
ATOM   643  C CD2 . LEU A 1 84  ? 4.462  -26.194 41.336  1.00 25.54 ? 1157 LEU A CD2 1 
ATOM   644  N N   . PRO A 1 85  ? 6.082  -29.087 44.826  1.00 25.88 ? 1158 PRO A N   1 
ATOM   645  C CA  . PRO A 1 85  ? 6.917  -30.114 45.458  1.00 25.34 ? 1158 PRO A CA  1 
ATOM   646  C C   . PRO A 1 85  ? 8.342  -30.144 44.900  1.00 24.40 ? 1158 PRO A C   1 
ATOM   647  O O   . PRO A 1 85  ? 8.600  -29.671 43.807  1.00 23.14 ? 1158 PRO A O   1 
ATOM   648  C CB  . PRO A 1 85  ? 6.237  -31.431 45.069  1.00 29.00 ? 1158 PRO A CB  1 
ATOM   649  C CG  . PRO A 1 85  ? 5.332  -31.121 43.903  1.00 28.06 ? 1158 PRO A CG  1 
ATOM   650  C CD  . PRO A 1 85  ? 5.148  -29.624 43.818  1.00 24.16 ? 1158 PRO A CD  1 
ATOM   651  N N   . ARG A 1 86  ? 9.258  -30.745 45.642  1.00 23.49 ? 1159 ARG A N   1 
ATOM   652  C CA  . ARG A 1 86  ? 10.626 -30.962 45.147  1.00 25.72 ? 1159 ARG A CA  1 
ATOM   653  C C   . ARG A 1 86  ? 10.711 -31.507 43.714  1.00 27.56 ? 1159 ARG A C   1 
ATOM   654  O O   . ARG A 1 86  ? 11.596 -31.129 42.950  1.00 27.41 ? 1159 ARG A O   1 
ATOM   655  C CB  . ARG A 1 86  ? 11.374 -31.913 46.085  1.00 28.49 ? 1159 ARG A CB  1 
ATOM   656  C CG  . ARG A 1 86  ? 12.819 -32.145 45.681  1.00 26.81 ? 1159 ARG A CG  1 
ATOM   657  C CD  . ARG A 1 86  ? 13.595 -30.870 45.799  1.00 29.30 ? 1159 ARG A CD  1 
ATOM   658  N NE  . ARG A 1 86  ? 15.005 -31.016 45.423  1.00 32.36 ? 1159 ARG A NE  1 
ATOM   659  C CZ  . ARG A 1 86  ? 15.464 -31.034 44.172  1.00 33.92 ? 1159 ARG A CZ  1 
ATOM   660  N NH1 . ARG A 1 86  ? 16.765 -31.175 43.948  1.00 41.80 ? 1159 ARG A NH1 1 
ATOM   661  N NH2 . ARG A 1 86  ? 14.634 -30.924 43.137  1.00 31.85 ? 1159 ARG A NH2 1 
ATOM   662  N N   . THR A 1 87  ? 9.816  -32.417 43.339  1.00 26.94 ? 1160 THR A N   1 
ATOM   663  C CA  . THR A 1 87  ? 9.916  -33.055 42.026  1.00 31.42 ? 1160 THR A CA  1 
ATOM   664  C C   . THR A 1 87  ? 9.671  -32.096 40.866  1.00 29.85 ? 1160 THR A C   1 
ATOM   665  O O   . THR A 1 87  ? 9.939  -32.439 39.709  1.00 27.87 ? 1160 THR A O   1 
ATOM   666  C CB  . THR A 1 87  ? 8.903  -34.189 41.878  1.00 32.11 ? 1160 THR A CB  1 
ATOM   667  O OG1 . THR A 1 87  ? 7.612  -33.695 42.259  1.00 30.49 ? 1160 THR A OG1 1 
ATOM   668  C CG2 . THR A 1 87  ? 9.298  -35.360 42.772  1.00 30.38 ? 1160 THR A CG2 1 
ATOM   669  N N   . LYS A 1 88  ? 9.161  -30.906 41.163  1.00 25.17 ? 1161 LYS A N   1 
ATOM   670  C CA  . LYS A 1 88  ? 8.872  -29.941 40.109  1.00 25.13 ? 1161 LYS A CA  1 
ATOM   671  C C   . LYS A 1 88  ? 9.916  -28.819 40.064  1.00 24.79 ? 1161 LYS A C   1 
ATOM   672  O O   . LYS A 1 88  ? 9.744  -27.841 39.360  1.00 26.21 ? 1161 LYS A O   1 
ATOM   673  C CB  . LYS A 1 88  ? 7.466  -29.343 40.280  1.00 27.09 ? 1161 LYS A CB  1 
ATOM   674  C CG  . LYS A 1 88  ? 6.335  -30.383 40.257  1.00 29.69 ? 1161 LYS A CG  1 
ATOM   675  C CD  . LYS A 1 88  ? 6.265  -31.091 38.926  1.00 32.31 ? 1161 LYS A CD  1 
ATOM   676  C CE  . LYS A 1 88  ? 5.248  -32.232 38.984  1.00 37.57 ? 1161 LYS A CE  1 
ATOM   677  N NZ  . LYS A 1 88  ? 5.240  -32.992 37.716  1.00 38.49 ? 1161 LYS A NZ  1 
ATOM   678  N N   . LEU A 1 89  ? 11.001 -28.974 40.810  1.00 25.55 ? 1162 LEU A N   1 
ATOM   679  C CA  . LEU A 1 89  ? 11.998 -27.915 40.926  1.00 25.24 ? 1162 LEU A CA  1 
ATOM   680  C C   . LEU A 1 89  ? 13.349 -28.473 40.517  1.00 26.50 ? 1162 LEU A C   1 
ATOM   681  O O   . LEU A 1 89  ? 13.648 -29.633 40.790  1.00 25.21 ? 1162 LEU A O   1 
ATOM   682  C CB  . LEU A 1 89  ? 12.064 -27.411 42.385  1.00 22.38 ? 1162 LEU A CB  1 
ATOM   683  C CG  . LEU A 1 89  ? 10.788 -26.782 42.944  1.00 25.90 ? 1162 LEU A CG  1 
ATOM   684  C CD1 . LEU A 1 89  ? 11.017 -26.318 44.395  1.00 27.93 ? 1162 LEU A CD1 1 
ATOM   685  C CD2 . LEU A 1 89  ? 10.338 -25.615 42.092  1.00 24.63 ? 1162 LEU A CD2 1 
ATOM   686  N N   . VAL A 1 90  ? 14.147 -27.646 39.854  1.00 24.22 ? 1163 VAL A N   1 
ATOM   687  C CA  . VAL A 1 90  ? 15.515 -27.980 39.475  1.00 25.62 ? 1163 VAL A CA  1 
ATOM   688  C C   . VAL A 1 90  ? 16.352 -26.701 39.662  1.00 24.13 ? 1163 VAL A C   1 
ATOM   689  O O   . VAL A 1 90  ? 15.988 -25.649 39.172  1.00 25.76 ? 1163 VAL A O   1 
ATOM   690  C CB  . VAL A 1 90  ? 15.608 -28.464 37.984  1.00 27.04 ? 1163 VAL A CB  1 
ATOM   691  C CG1 . VAL A 1 90  ? 17.065 -28.537 37.533  1.00 29.80 ? 1163 VAL A CG1 1 
ATOM   692  C CG2 . VAL A 1 90  ? 14.897 -29.830 37.775  1.00 30.65 ? 1163 VAL A CG2 1 
ATOM   693  N N   . PRO A 1 91  ? 17.487 -26.798 40.357  1.00 26.41 ? 1164 PRO A N   1 
ATOM   694  C CA  . PRO A 1 91  ? 18.368 -25.638 40.548  1.00 26.76 ? 1164 PRO A CA  1 
ATOM   695  C C   . PRO A 1 91  ? 18.747 -24.938 39.235  1.00 26.40 ? 1164 PRO A C   1 
ATOM   696  O O   . PRO A 1 91  ? 19.095 -25.611 38.274  1.00 25.79 ? 1164 PRO A O   1 
ATOM   697  C CB  . PRO A 1 91  ? 19.610 -26.252 41.203  1.00 26.24 ? 1164 PRO A CB  1 
ATOM   698  C CG  . PRO A 1 91  ? 19.112 -27.427 41.900  1.00 30.41 ? 1164 PRO A CG  1 
ATOM   699  C CD  . PRO A 1 91  ? 18.010 -27.995 41.032  1.00 29.13 ? 1164 PRO A CD  1 
ATOM   700  N N   . LEU A 1 92  ? 18.673 -23.605 39.229  1.00 23.62 ? 1165 LEU A N   1 
ATOM   701  C CA  . LEU A 1 92  ? 18.867 -22.775 38.034  1.00 23.29 ? 1165 LEU A CA  1 
ATOM   702  C C   . LEU A 1 92  ? 20.186 -22.042 38.154  1.00 27.43 ? 1165 LEU A C   1 
ATOM   703  O O   . LEU A 1 92  ? 20.569 -21.608 39.247  1.00 25.97 ? 1165 LEU A O   1 
ATOM   704  C CB  . LEU A 1 92  ? 17.718 -21.764 37.876  1.00 20.80 ? 1165 LEU A CB  1 
ATOM   705  C CG  . LEU A 1 92  ? 17.745 -20.775 36.682  1.00 23.73 ? 1165 LEU A CG  1 
ATOM   706  C CD1 . LEU A 1 92  ? 16.329 -20.421 36.233  1.00 21.15 ? 1165 LEU A CD1 1 
ATOM   707  C CD2 . LEU A 1 92  ? 18.539 -19.485 36.971  1.00 23.82 ? 1165 LEU A CD2 1 
ATOM   708  N N   . GLY A 1 93  ? 20.892 -21.927 37.035  1.00 24.64 ? 1166 GLY A N   1 
ATOM   709  C CA  . GLY A 1 93  ? 22.104 -21.139 36.976  1.00 28.34 ? 1166 GLY A CA  1 
ATOM   710  C C   . GLY A 1 93  ? 23.303 -21.876 37.540  1.00 31.45 ? 1166 GLY A C   1 
ATOM   711  O O   . GLY A 1 93  ? 24.325 -21.261 37.836  1.00 32.64 ? 1166 GLY A O   1 
ATOM   712  N N   . VAL A 1 94  ? 23.180 -23.188 37.697  1.00 29.12 ? 1167 VAL A N   1 
ATOM   713  C CA  . VAL A 1 94  ? 24.280 -24.025 38.191  1.00 29.32 ? 1167 VAL A CA  1 
ATOM   714  C C   . VAL A 1 94  ? 24.991 -24.717 37.028  1.00 31.15 ? 1167 VAL A C   1 
ATOM   715  O O   . VAL A 1 94  ? 26.212 -24.833 37.010  1.00 33.12 ? 1167 VAL A O   1 
ATOM   716  C CB  . VAL A 1 94  ? 23.760 -25.148 39.128  1.00 33.62 ? 1167 VAL A CB  1 
ATOM   717  C CG1 . VAL A 1 94  ? 24.933 -25.937 39.700  1.00 35.26 ? 1167 VAL A CG1 1 
ATOM   718  C CG2 . VAL A 1 94  ? 22.925 -24.564 40.247  1.00 33.28 ? 1167 VAL A CG2 1 
ATOM   719  N N   . ASN A 1 95  ? 24.214 -25.183 36.062  1.00 29.53 ? 1168 ASN A N   1 
ATOM   720  C CA  . ASN A 1 95  ? 24.783 -25.820 34.873  1.00 30.78 ? 1168 ASN A CA  1 
ATOM   721  C C   . ASN A 1 95  ? 24.239 -25.180 33.622  1.00 30.63 ? 1168 ASN A C   1 
ATOM   722  O O   . ASN A 1 95  ? 23.024 -25.244 33.369  1.00 27.07 ? 1168 ASN A O   1 
ATOM   723  C CB  . ASN A 1 95  ? 24.506 -27.326 34.838  1.00 30.77 ? 1168 ASN A CB  1 
ATOM   724  C CG  . ASN A 1 95  ? 25.167 -28.008 33.623  1.00 36.62 ? 1168 ASN A CG  1 
ATOM   725  O OD1 . ASN A 1 95  ? 24.638 -27.973 32.510  1.00 31.53 ? 1168 ASN A OD1 1 
ATOM   726  N ND2 . ASN A 1 95  ? 26.348 -28.603 33.838  1.00 40.80 ? 1168 ASN A ND2 1 
ATOM   727  N N   . GLN A 1 96  ? 25.127 -24.547 32.849  1.00 29.29 ? 1169 GLN A N   1 
ATOM   728  C CA  . GLN A 1 96  ? 24.704 -23.783 31.673  1.00 29.17 ? 1169 GLN A CA  1 
ATOM   729  C C   . GLN A 1 96  ? 23.985 -24.637 30.628  1.00 29.38 ? 1169 GLN A C   1 
ATOM   730  O O   . GLN A 1 96  ? 23.007 -24.200 30.001  1.00 28.50 ? 1169 GLN A O   1 
ATOM   731  C CB  . GLN A 1 96  ? 25.884 -23.044 31.043  1.00 36.92 ? 1169 GLN A CB  1 
ATOM   732  C CG  . GLN A 1 96  ? 26.051 -21.622 31.572  1.00 47.78 ? 1169 GLN A CG  1 
ATOM   733  C CD  . GLN A 1 96  ? 26.779 -20.693 30.599  1.00 52.34 ? 1169 GLN A CD  1 
ATOM   734  O OE1 . GLN A 1 96  ? 26.325 -20.457 29.472  1.00 53.93 ? 1169 GLN A OE1 1 
ATOM   735  N NE2 . GLN A 1 96  ? 27.904 -20.141 31.045  1.00 57.74 ? 1169 GLN A NE2 1 
ATOM   736  N N   . ASP A 1 97  ? 24.461 -25.856 30.434  1.00 29.15 ? 1170 ASP A N   1 
ATOM   737  C CA  . ASP A 1 97  ? 23.817 -26.745 29.461  1.00 29.17 ? 1170 ASP A CA  1 
ATOM   738  C C   . ASP A 1 97  ? 22.430 -27.198 29.897  1.00 28.12 ? 1170 ASP A C   1 
ATOM   739  O O   . ASP A 1 97  ? 21.483 -27.215 29.103  1.00 25.47 ? 1170 ASP A O   1 
ATOM   740  C CB  . ASP A 1 97  ? 24.756 -27.895 29.125  1.00 27.85 ? 1170 ASP A CB  1 
ATOM   741  C CG  . ASP A 1 97  ? 25.959 -27.396 28.324  1.00 32.16 ? 1170 ASP A CG  1 
ATOM   742  O OD1 . ASP A 1 97  ? 27.109 -27.473 28.808  1.00 33.72 ? 1170 ASP A OD1 1 
ATOM   743  O OD2 . ASP A 1 97  ? 25.708 -26.854 27.238  1.00 33.59 ? 1170 ASP A OD2 1 
ATOM   744  N N   . LEU A 1 98  ? 22.302 -27.508 31.180  1.00 27.69 ? 1171 LEU A N   1 
ATOM   745  C CA  . LEU A 1 98  ? 20.988 -27.769 31.751  1.00 29.30 ? 1171 LEU A CA  1 
ATOM   746  C C   . LEU A 1 98  ? 20.063 -26.567 31.549  1.00 25.09 ? 1171 LEU A C   1 
ATOM   747  O O   . LEU A 1 98  ? 18.943 -26.722 31.050  1.00 23.80 ? 1171 LEU A O   1 
ATOM   748  C CB  . LEU A 1 98  ? 21.118 -28.133 33.237  1.00 29.14 ? 1171 LEU A CB  1 
ATOM   749  C CG  . LEU A 1 98  ? 19.830 -28.363 34.050  1.00 30.95 ? 1171 LEU A CG  1 
ATOM   750  C CD1 . LEU A 1 98  ? 18.886 -29.293 33.354  1.00 33.73 ? 1171 LEU A CD1 1 
ATOM   751  C CD2 . LEU A 1 98  ? 20.196 -28.947 35.397  1.00 32.98 ? 1171 LEU A CD2 1 
ATOM   752  N N   . ASP A 1 99  ? 20.529 -25.367 31.911  1.00 22.84 ? 1172 ASP A N   1 
ATOM   753  C CA  . ASP A 1 99  ? 19.711 -24.178 31.704  1.00 23.45 ? 1172 ASP A CA  1 
ATOM   754  C C   . ASP A 1 99  ? 19.318 -24.055 30.234  1.00 26.84 ? 1172 ASP A C   1 
ATOM   755  O O   . ASP A 1 99  ? 18.167 -23.760 29.910  1.00 25.37 ? 1172 ASP A O   1 
ATOM   756  C CB  . ASP A 1 99  ? 20.437 -22.905 32.151  1.00 25.59 ? 1172 ASP A CB  1 
ATOM   757  C CG  . ASP A 1 99  ? 20.642 -22.848 33.673  1.00 26.10 ? 1172 ASP A CG  1 
ATOM   758  O OD1 . ASP A 1 99  ? 21.463 -22.030 34.117  1.00 27.51 ? 1172 ASP A OD1 1 
ATOM   759  O OD2 . ASP A 1 99  ? 20.011 -23.653 34.397  1.00 25.98 ? 1172 ASP A OD2 1 
ATOM   760  N N   . LYS A 1 100 ? 20.282 -24.261 29.336  1.00 26.80 ? 1173 LYS A N   1 
ATOM   761  C CA  . LYS A 1 100 ? 19.983 -24.102 27.912  1.00 27.95 ? 1173 LYS A CA  1 
ATOM   762  C C   . LYS A 1 100 ? 18.961 -25.128 27.450  1.00 27.74 ? 1173 LYS A C   1 
ATOM   763  O O   . LYS A 1 100 ? 18.085 -24.815 26.625  1.00 27.88 ? 1173 LYS A O   1 
ATOM   764  C CB  . LYS A 1 100 ? 21.258 -24.169 27.064  1.00 31.78 ? 1173 LYS A CB  1 
ATOM   765  C CG  . LYS A 1 100 ? 22.140 -22.928 27.219  1.00 30.25 ? 1173 LYS A CG  1 
ATOM   766  C CD  . LYS A 1 100 ? 23.536 -23.160 26.664  1.00 35.66 ? 1173 LYS A CD  1 
ATOM   767  C CE  . LYS A 1 100 ? 24.367 -21.891 26.718  1.00 37.28 ? 1173 LYS A CE  1 
ATOM   768  N NZ  . LYS A 1 100 ? 25.361 -21.855 25.593  1.00 43.56 ? 1173 LYS A NZ  1 
ATOM   769  N N   . GLU A 1 101 ? 19.066 -26.350 27.971  1.00 26.37 ? 1174 GLU A N   1 
ATOM   770  C CA  . GLU A 1 101 ? 18.054 -27.360 27.664  1.00 26.75 ? 1174 GLU A CA  1 
ATOM   771  C C   . GLU A 1 101 ? 16.685 -26.916 28.153  1.00 27.25 ? 1174 GLU A C   1 
ATOM   772  O O   . GLU A 1 101 ? 15.689 -26.957 27.417  1.00 28.98 ? 1174 GLU A O   1 
ATOM   773  C CB  . GLU A 1 101 ? 18.412 -28.698 28.312  1.00 27.96 ? 1174 GLU A CB  1 
ATOM   774  C CG  . GLU A 1 101 ? 17.257 -29.654 28.277  1.00 30.34 ? 1174 GLU A CG  1 
ATOM   775  C CD  . GLU A 1 101 ? 17.596 -31.008 28.859  1.00 33.87 ? 1174 GLU A CD  1 
ATOM   776  O OE1 . GLU A 1 101 ? 16.789 -31.935 28.644  1.00 36.15 ? 1174 GLU A OE1 1 
ATOM   777  O OE2 . GLU A 1 101 ? 18.651 -31.141 29.528  1.00 34.29 ? 1174 GLU A OE2 1 
ATOM   778  N N   . LYS A 1 102 ? 16.622 -26.499 29.413  1.00 23.87 ? 1175 LYS A N   1 
ATOM   779  C CA  . LYS A 1 102 ? 15.377 -25.943 29.958  1.00 29.47 ? 1175 LYS A CA  1 
ATOM   780  C C   . LYS A 1 102 ? 14.763 -24.851 29.100  1.00 26.05 ? 1175 LYS A C   1 
ATOM   781  O O   . LYS A 1 102 ? 13.553 -24.844 28.883  1.00 27.28 ? 1175 LYS A O   1 
ATOM   782  C CB  . LYS A 1 102 ? 15.580 -25.392 31.380  1.00 27.47 ? 1175 LYS A CB  1 
ATOM   783  C CG  . LYS A 1 102 ? 15.980 -26.446 32.382  1.00 29.40 ? 1175 LYS A CG  1 
ATOM   784  C CD  . LYS A 1 102 ? 14.946 -27.561 32.472  1.00 36.71 ? 1175 LYS A CD  1 
ATOM   785  C CE  . LYS A 1 102 ? 15.412 -28.642 33.448  1.00 37.46 ? 1175 LYS A CE  1 
ATOM   786  N NZ  . LYS A 1 102 ? 14.434 -29.764 33.589  1.00 42.91 ? 1175 LYS A NZ  1 
ATOM   787  N N   . MET A 1 103 ? 15.578 -23.920 28.615  1.00 24.13 ? 1176 MET A N   1 
ATOM   788  C CA  . MET A 1 103 ? 15.026 -22.793 27.894  1.00 29.37 ? 1176 MET A CA  1 
ATOM   789  C C   . MET A 1 103 ? 14.352 -23.186 26.589  1.00 31.02 ? 1176 MET A C   1 
ATOM   790  O O   . MET A 1 103 ? 13.551 -22.415 26.064  1.00 27.47 ? 1176 MET A O   1 
ATOM   791  C CB  . MET A 1 103 ? 16.059 -21.688 27.676  1.00 31.81 ? 1176 MET A CB  1 
ATOM   792  C CG  . MET A 1 103 ? 16.038 -20.691 28.832  1.00 34.95 ? 1176 MET A CG  1 
ATOM   793  S SD  . MET A 1 103 ? 17.318 -19.474 28.721  1.00 44.56 ? 1176 MET A SD  1 
ATOM   794  C CE  . MET A 1 103 ? 18.801 -20.458 28.946  1.00 34.17 ? 1176 MET A CE  1 
ATOM   795  N N   . LEU A 1 104 ? 14.635 -24.398 26.110  1.00 32.88 ? 1177 LEU A N   1 
ATOM   796  C CA  . LEU A 1 104 ? 14.036 -24.906 24.867  1.00 31.65 ? 1177 LEU A CA  1 
ATOM   797  C C   . LEU A 1 104 ? 12.734 -25.683 25.040  1.00 34.07 ? 1177 LEU A C   1 
ATOM   798  O O   . LEU A 1 104 ? 12.169 -26.164 24.056  1.00 32.11 ? 1177 LEU A O   1 
ATOM   799  C CB  . LEU A 1 104 ? 15.033 -25.780 24.107  1.00 30.05 ? 1177 LEU A CB  1 
ATOM   800  C CG  . LEU A 1 104 ? 16.326 -25.104 23.676  1.00 31.11 ? 1177 LEU A CG  1 
ATOM   801  C CD1 . LEU A 1 104 ? 17.233 -26.139 23.082  1.00 32.25 ? 1177 LEU A CD1 1 
ATOM   802  C CD2 . LEU A 1 104 ? 16.027 -24.008 22.685  1.00 38.24 ? 1177 LEU A CD2 1 
ATOM   803  N N   . GLU A 1 105 ? 12.251 -25.806 26.274  1.00 31.14 ? 1178 GLU A N   1 
ATOM   804  C CA  . GLU A 1 105 ? 11.039 -26.586 26.543  1.00 31.67 ? 1178 GLU A CA  1 
ATOM   805  C C   . GLU A 1 105 ? 9.787  -26.015 25.891  1.00 34.55 ? 1178 GLU A C   1 
ATOM   806  O O   . GLU A 1 105 ? 8.916  -26.767 25.469  1.00 35.14 ? 1178 GLU A O   1 
ATOM   807  C CB  . GLU A 1 105 ? 10.775 -26.679 28.056  1.00 36.00 ? 1178 GLU A CB  1 
ATOM   808  C CG  . GLU A 1 105 ? 11.460 -27.818 28.761  1.00 36.65 ? 1178 GLU A CG  1 
ATOM   809  C CD  . GLU A 1 105 ? 11.104 -27.876 30.248  1.00 32.66 ? 1178 GLU A CD  1 
ATOM   810  O OE1 . GLU A 1 105 ? 12.006 -28.118 31.062  1.00 37.08 ? 1178 GLU A OE1 1 
ATOM   811  O OE2 . GLU A 1 105 ? 9.934  -27.674 30.601  1.00 35.19 ? 1178 GLU A OE2 1 
ATOM   812  N N   . GLY A 1 106 ? 9.681  -24.689 25.847  1.00 31.12 ? 1179 GLY A N   1 
ATOM   813  C CA  . GLY A 1 106 ? 8.465  -24.032 25.386  1.00 35.69 ? 1179 GLY A CA  1 
ATOM   814  C C   . GLY A 1 106 ? 8.116  -24.440 23.962  1.00 38.28 ? 1179 GLY A C   1 
ATOM   815  O O   . GLY A 1 106 ? 8.992  -24.488 23.093  1.00 35.37 ? 1179 GLY A O   1 
ATOM   816  N N   . ARG A 1 107 ? 6.837  -24.724 23.718  1.00 37.80 ? 1180 ARG A N   1 
ATOM   817  C CA  . ARG A 1 107 ? 6.395  -25.263 22.423  1.00 42.11 ? 1180 ARG A CA  1 
ATOM   818  C C   . ARG A 1 107 ? 6.348  -24.173 21.347  1.00 43.15 ? 1180 ARG A C   1 
ATOM   819  O O   . ARG A 1 107 ? 6.652  -24.422 20.180  1.00 46.99 ? 1180 ARG A O   1 
ATOM   820  C CB  . ARG A 1 107 ? 5.004  -25.918 22.558  1.00 42.84 ? 1180 ARG A CB  1 
ATOM   821  C CG  . ARG A 1 107 ? 3.923  -24.937 23.051  1.00 50.08 ? 1180 ARG A CG  1 
ATOM   822  C CD  . ARG A 1 107 ? 2.523  -25.573 23.125  1.00 59.28 ? 1180 ARG A CD  1 
ATOM   823  N NE  . ARG A 1 107 ? 1.463  -24.565 23.239  1.00 57.97 ? 1180 ARG A NE  1 
ATOM   824  C CZ  . ARG A 1 107 ? 1.104  -23.979 24.380  1.00 61.33 ? 1180 ARG A CZ  1 
ATOM   825  N NH1 . ARG A 1 107 ? 0.131  -23.069 24.397  1.00 61.00 ? 1180 ARG A NH1 1 
ATOM   826  N NH2 . ARG A 1 107 ? 1.724  -24.300 25.509  1.00 59.29 ? 1180 ARG A NH2 1 
ATOM   827  N N   . LYS A 1 108 ? 5.949  -22.972 21.749  1.00 40.78 ? 1181 LYS A N   1 
ATOM   828  C CA  . LYS A 1 108 ? 5.874  -21.832 20.845  1.00 45.03 ? 1181 LYS A CA  1 
ATOM   829  C C   . LYS A 1 108 ? 6.992  -20.830 21.118  1.00 43.13 ? 1181 LYS A C   1 
ATOM   830  O O   . LYS A 1 108 ? 7.541  -20.768 22.219  1.00 38.09 ? 1181 LYS A O   1 
ATOM   831  C CB  . LYS A 1 108 ? 4.514  -21.133 20.945  1.00 45.02 ? 1181 LYS A CB  1 
ATOM   832  C CG  . LYS A 1 108 ? 3.329  -21.940 20.406  1.00 46.50 ? 1181 LYS A CG  1 
ATOM   833  C CD  . LYS A 1 108 ? 2.074  -21.058 20.278  1.00 57.57 ? 1181 LYS A CD  1 
ATOM   834  C CE  . LYS A 1 108 ? 1.606  -20.513 21.642  1.00 61.32 ? 1181 LYS A CE  1 
ATOM   835  N NZ  . LYS A 1 108 ? 0.212  -19.938 21.641  1.00 58.16 ? 1181 LYS A NZ  1 
ATOM   836  N N   . SER A 1 109 ? 7.320  -20.054 20.091  1.00 42.41 ? 1182 SER A N   1 
ATOM   837  C CA  . SER A 1 109 ? 8.385  -19.071 20.158  1.00 39.04 ? 1182 SER A CA  1 
ATOM   838  C C   . SER A 1 109 ? 8.150  -18.065 21.270  1.00 39.61 ? 1182 SER A C   1 
ATOM   839  O O   . SER A 1 109 ? 9.082  -17.671 21.967  1.00 38.96 ? 1182 SER A O   1 
ATOM   840  C CB  . SER A 1 109 ? 8.508  -18.355 18.814  1.00 41.94 ? 1182 SER A CB  1 
ATOM   841  O OG  . SER A 1 109 ? 9.636  -17.494 18.799  1.00 47.74 ? 1182 SER A OG  1 
ATOM   842  N N   . ASN A 1 110 ? 6.898  -17.661 21.439  1.00 41.56 ? 1183 ASN A N   1 
ATOM   843  C CA  . ASN A 1 110 ? 6.565  -16.596 22.376  1.00 42.46 ? 1183 ASN A CA  1 
ATOM   844  C C   . ASN A 1 110 ? 6.702  -17.004 23.844  1.00 37.56 ? 1183 ASN A C   1 
ATOM   845  O O   . ASN A 1 110 ? 7.044  -16.179 24.714  1.00 33.00 ? 1183 ASN A O   1 
ATOM   846  C CB  . ASN A 1 110 ? 5.160  -16.052 22.089  1.00 45.54 ? 1183 ASN A CB  1 
ATOM   847  C CG  . ASN A 1 110 ? 4.077  -17.119 22.213  1.00 50.05 ? 1183 ASN A CG  1 
ATOM   848  O OD1 . ASN A 1 110 ? 4.355  -18.320 22.143  1.00 49.48 ? 1183 ASN A OD1 1 
ATOM   849  N ND2 . ASN A 1 110 ? 2.833  -16.681 22.398  1.00 54.64 ? 1183 ASN A ND2 1 
ATOM   850  N N   . ILE A 1 111 ? 6.435  -18.275 24.126  1.00 38.84 ? 1184 ILE A N   1 
ATOM   851  C CA  . ILE A 1 111 ? 6.578  -18.781 25.480  1.00 32.10 ? 1184 ILE A CA  1 
ATOM   852  C C   . ILE A 1 111 ? 8.055  -18.892 25.799  1.00 29.42 ? 1184 ILE A C   1 
ATOM   853  O O   . ILE A 1 111 ? 8.474  -18.584 26.916  1.00 29.15 ? 1184 ILE A O   1 
ATOM   854  C CB  . ILE A 1 111 ? 5.921  -20.171 25.648  1.00 36.86 ? 1184 ILE A CB  1 
ATOM   855  C CG1 . ILE A 1 111 ? 4.489  -20.140 25.095  1.00 45.64 ? 1184 ILE A CG1 1 
ATOM   856  C CG2 . ILE A 1 111 ? 5.917  -20.559 27.104  1.00 36.44 ? 1184 ILE A CG2 1 
ATOM   857  C CD1 . ILE A 1 111 ? 3.748  -21.496 25.106  1.00 48.42 ? 1184 ILE A CD1 1 
ATOM   858  N N   . ARG A 1 112 ? 8.844  -19.354 24.826  1.00 30.04 ? 1185 ARG A N   1 
ATOM   859  C CA  . ARG A 1 112 ? 10.283 -19.512 25.029  1.00 31.22 ? 1185 ARG A CA  1 
ATOM   860  C C   . ARG A 1 112 ? 10.948 -18.161 25.267  1.00 28.75 ? 1185 ARG A C   1 
ATOM   861  O O   . ARG A 1 112 ? 11.909 -18.077 26.037  1.00 28.72 ? 1185 ARG A O   1 
ATOM   862  C CB  . ARG A 1 112 ? 10.965 -20.255 23.868  1.00 33.59 ? 1185 ARG A CB  1 
ATOM   863  C CG  . ARG A 1 112 ? 10.492 -21.696 23.695  1.00 32.55 ? 1185 ARG A CG  1 
ATOM   864  C CD  . ARG A 1 112 ? 11.392 -22.473 22.744  1.00 37.07 ? 1185 ARG A CD  1 
ATOM   865  N NE  . ARG A 1 112 ? 11.474 -21.868 21.411  1.00 39.28 ? 1185 ARG A NE  1 
ATOM   866  C CZ  . ARG A 1 112 ? 10.674 -22.175 20.389  1.00 42.89 ? 1185 ARG A CZ  1 
ATOM   867  N NH1 . ARG A 1 112 ? 9.710  -23.082 20.537  1.00 36.60 ? 1185 ARG A NH1 1 
ATOM   868  N NH2 . ARG A 1 112 ? 10.841 -21.580 19.211  1.00 40.21 ? 1185 ARG A NH2 1 
ATOM   869  N N   . LYS A 1 113 ? 10.443 -17.117 24.618  1.00 28.93 ? 1186 LYS A N   1 
ATOM   870  C CA  . LYS A 1 113 ? 10.980 -15.756 24.830  1.00 30.67 ? 1186 LYS A CA  1 
ATOM   871  C C   . LYS A 1 113 ? 10.676 -15.234 26.241  1.00 29.19 ? 1186 LYS A C   1 
ATOM   872  O O   . LYS A 1 113 ? 11.549 -14.676 26.917  1.00 27.96 ? 1186 LYS A O   1 
ATOM   873  C CB  . LYS A 1 113 ? 10.483 -14.766 23.782  1.00 31.85 ? 1186 LYS A CB  1 
ATOM   874  C CG  . LYS A 1 113 ? 11.135 -13.388 23.940  1.00 35.35 ? 1186 LYS A CG  1 
ATOM   875  C CD  . LYS A 1 113 ? 10.911 -12.489 22.722  1.00 37.77 ? 1186 LYS A CD  1 
ATOM   876  C CE  . LYS A 1 113 ? 9.553  -11.789 22.776  1.00 37.67 ? 1186 LYS A CE  1 
ATOM   877  N NZ  . LYS A 1 113 ? 9.451  -10.745 23.834  1.00 35.53 ? 1186 LYS A NZ  1 
ATOM   878  N N   . SER A 1 114 ? 9.442  -15.416 26.689  1.00 26.88 ? 1187 SER A N   1 
ATOM   879  C CA  . SER A 1 114 ? 9.099  -15.101 28.081  1.00 29.54 ? 1187 SER A CA  1 
ATOM   880  C C   . SER A 1 114 ? 9.978  -15.860 29.079  1.00 26.36 ? 1187 SER A C   1 
ATOM   881  O O   . SER A 1 114 ? 10.391 -15.309 30.109  1.00 25.33 ? 1187 SER A O   1 
ATOM   882  C CB  . SER A 1 114 ? 7.629  -15.387 28.363  1.00 28.96 ? 1187 SER A CB  1 
ATOM   883  O OG  . SER A 1 114 ? 7.393  -15.380 29.766  1.00 36.82 ? 1187 SER A OG  1 
ATOM   884  N N   . VAL A 1 115 ? 10.288 -17.116 28.773  1.00 24.55 ? 1188 VAL A N   1 
ATOM   885  C CA  . VAL A 1 115 ? 11.158 -17.895 29.650  1.00 24.87 ? 1188 VAL A CA  1 
ATOM   886  C C   . VAL A 1 115 ? 12.565 -17.329 29.653  1.00 27.58 ? 1188 VAL A C   1 
ATOM   887  O O   . VAL A 1 115 ? 13.189 -17.221 30.715  1.00 22.10 ? 1188 VAL A O   1 
ATOM   888  C CB  . VAL A 1 115 ? 11.211 -19.374 29.257  1.00 24.21 ? 1188 VAL A CB  1 
ATOM   889  C CG1 . VAL A 1 115 ? 12.358 -20.062 29.966  1.00 22.55 ? 1188 VAL A CG1 1 
ATOM   890  C CG2 . VAL A 1 115 ? 9.873  -20.038 29.580  1.00 24.14 ? 1188 VAL A CG2 1 
ATOM   891  N N   . GLN A 1 116 ? 13.057 -16.970 28.461  1.00 26.85 ? 1189 GLN A N   1 
ATOM   892  C CA  . GLN A 1 116 ? 14.381 -16.379 28.308  1.00 27.68 ? 1189 GLN A CA  1 
ATOM   893  C C   . GLN A 1 116 ? 14.482 -15.062 29.075  1.00 22.92 ? 1189 GLN A C   1 
ATOM   894  O O   . GLN A 1 116 ? 15.465 -14.820 29.774  1.00 25.28 ? 1189 GLN A O   1 
ATOM   895  C CB  . GLN A 1 116 ? 14.716 -16.129 26.820  1.00 28.29 ? 1189 GLN A CB  1 
ATOM   896  C CG  . GLN A 1 116 ? 15.107 -17.364 26.033  1.00 35.25 ? 1189 GLN A CG  1 
ATOM   897  C CD  . GLN A 1 116 ? 15.380 -17.061 24.549  1.00 38.44 ? 1189 GLN A CD  1 
ATOM   898  O OE1 . GLN A 1 116 ? 15.733 -15.938 24.175  1.00 39.53 ? 1189 GLN A OE1 1 
ATOM   899  N NE2 . GLN A 1 116 ? 15.204 -18.062 23.711  1.00 43.36 ? 1189 GLN A NE2 1 
ATOM   900  N N   . ILE A 1 117 ? 13.484 -14.207 28.932  1.00 24.04 ? 1190 ILE A N   1 
ATOM   901  C CA  . ILE A 1 117 ? 13.501 -12.925 29.636  1.00 24.76 ? 1190 ILE A CA  1 
ATOM   902  C C   . ILE A 1 117 ? 13.556 -13.188 31.149  1.00 28.88 ? 1190 ILE A C   1 
ATOM   903  O O   . ILE A 1 117 ? 14.310 -12.543 31.897  1.00 28.24 ? 1190 ILE A O   1 
ATOM   904  C CB  . ILE A 1 117 ? 12.282 -12.088 29.289  1.00 25.26 ? 1190 ILE A CB  1 
ATOM   905  C CG1 . ILE A 1 117 ? 12.430 -11.461 27.892  1.00 28.65 ? 1190 ILE A CG1 1 
ATOM   906  C CG2 . ILE A 1 117 ? 12.053 -10.988 30.331  1.00 25.69 ? 1190 ILE A CG2 1 
ATOM   907  C CD1 . ILE A 1 117 ? 11.137 -10.841 27.414  1.00 32.02 ? 1190 ILE A CD1 1 
ATOM   908  N N   . ALA A 1 118 ? 12.791 -14.177 31.591  1.00 24.10 ? 1191 ALA A N   1 
ATOM   909  C CA  . ALA A 1 118 ? 12.698 -14.439 33.012  1.00 24.67 ? 1191 ALA A CA  1 
ATOM   910  C C   . ALA A 1 118 ? 14.042 -14.969 33.498  1.00 20.78 ? 1191 ALA A C   1 
ATOM   911  O O   . ALA A 1 118 ? 14.474 -14.685 34.602  1.00 22.72 ? 1191 ALA A O   1 
ATOM   912  C CB  . ALA A 1 118 ? 11.561 -15.431 33.296  1.00 22.46 ? 1191 ALA A CB  1 
ATOM   913  N N   . TYR A 1 119 ? 14.713 -15.726 32.655  1.00 21.64 ? 1192 TYR A N   1 
ATOM   914  C CA  . TYR A 1 119 ? 15.992 -16.323 33.005  1.00 22.25 ? 1192 TYR A CA  1 
ATOM   915  C C   . TYR A 1 119 ? 17.074 -15.245 33.155  1.00 24.28 ? 1192 TYR A C   1 
ATOM   916  O O   . TYR A 1 119 ? 17.915 -15.284 34.064  1.00 22.13 ? 1192 TYR A O   1 
ATOM   917  C CB  . TYR A 1 119 ? 16.391 -17.331 31.926  1.00 25.85 ? 1192 TYR A CB  1 
ATOM   918  C CG  . TYR A 1 119 ? 17.766 -17.940 32.111  1.00 25.62 ? 1192 TYR A CG  1 
ATOM   919  C CD1 . TYR A 1 119 ? 17.968 -19.021 32.981  1.00 26.44 ? 1192 TYR A CD1 1 
ATOM   920  C CD2 . TYR A 1 119 ? 18.862 -17.442 31.427  1.00 28.68 ? 1192 TYR A CD2 1 
ATOM   921  C CE1 . TYR A 1 119 ? 19.222 -19.578 33.143  1.00 27.47 ? 1192 TYR A CE1 1 
ATOM   922  C CE2 . TYR A 1 119 ? 20.110 -17.988 31.579  1.00 28.42 ? 1192 TYR A CE2 1 
ATOM   923  C CZ  . TYR A 1 119 ? 20.289 -19.058 32.434  1.00 27.88 ? 1192 TYR A CZ  1 
ATOM   924  O OH  . TYR A 1 119 ? 21.532 -19.595 32.600  1.00 30.71 ? 1192 TYR A OH  1 
ATOM   925  N N   . HIS A 1 120 ? 17.092 -14.298 32.226  1.00 22.95 ? 1193 HIS A N   1 
ATOM   926  C CA  . HIS A 1 120 ? 18.003 -13.164 32.386  1.00 26.17 ? 1193 HIS A CA  1 
ATOM   927  C C   . HIS A 1 120 ? 17.680 -12.339 33.616  1.00 24.89 ? 1193 HIS A C   1 
ATOM   928  O O   . HIS A 1 120 ? 18.583 -11.851 34.282  1.00 25.27 ? 1193 HIS A O   1 
ATOM   929  C CB  . HIS A 1 120 ? 18.064 -12.340 31.104  1.00 24.45 ? 1193 HIS A CB  1 
ATOM   930  C CG  . HIS A 1 120 ? 18.595 -13.143 29.966  1.00 26.05 ? 1193 HIS A CG  1 
ATOM   931  N ND1 . HIS A 1 120 ? 19.824 -13.757 30.025  1.00 26.00 ? 1193 HIS A ND1 1 
ATOM   932  C CD2 . HIS A 1 120 ? 18.043 -13.506 28.787  1.00 28.72 ? 1193 HIS A CD2 1 
ATOM   933  C CE1 . HIS A 1 120 ? 20.023 -14.446 28.915  1.00 32.16 ? 1193 HIS A CE1 1 
ATOM   934  N NE2 . HIS A 1 120 ? 18.962 -14.298 28.142  1.00 28.85 ? 1193 HIS A NE2 1 
ATOM   935  N N   . ARG A 1 121 ? 16.402 -12.220 33.937  1.00 22.23 ? 1194 ARG A N   1 
ATOM   936  C CA  . ARG A 1 121 ? 16.019 -11.524 35.161  1.00 24.80 ? 1194 ARG A CA  1 
ATOM   937  C C   . ARG A 1 121 ? 16.522 -12.281 36.385  1.00 26.43 ? 1194 ARG A C   1 
ATOM   938  O O   . ARG A 1 121 ? 16.986 -11.650 37.327  1.00 25.51 ? 1194 ARG A O   1 
ATOM   939  C CB  . ARG A 1 121 ? 14.518 -11.313 35.254  1.00 23.70 ? 1194 ARG A CB  1 
ATOM   940  C CG  . ARG A 1 121 ? 13.944 -10.172 34.367  1.00 28.48 ? 1194 ARG A CG  1 
ATOM   941  C CD  . ARG A 1 121 ? 12.427 -10.312 34.381  1.00 34.65 ? 1194 ARG A CD  1 
ATOM   942  N NE  . ARG A 1 121 ? 11.720 -9.396  33.498  1.00 36.74 ? 1194 ARG A NE  1 
ATOM   943  C CZ  . ARG A 1 121 ? 10.485 -9.623  33.050  1.00 39.17 ? 1194 ARG A CZ  1 
ATOM   944  N NH1 . ARG A 1 121 ? 9.899  -8.749  32.242  1.00 33.97 ? 1194 ARG A NH1 1 
ATOM   945  N NH2 . ARG A 1 121 ? 9.843  -10.749 33.398  1.00 35.09 ? 1194 ARG A NH2 1 
ATOM   946  N N   . ALA A 1 122 ? 16.453 -13.625 36.364  1.00 22.94 ? 1195 ALA A N   1 
ATOM   947  C CA  . ALA A 1 122 ? 16.933 -14.430 37.485  1.00 23.15 ? 1195 ALA A CA  1 
ATOM   948  C C   . ALA A 1 122 ? 18.423 -14.209 37.701  1.00 24.13 ? 1195 ALA A C   1 
ATOM   949  O O   . ALA A 1 122 ? 18.892 -14.070 38.816  1.00 25.86 ? 1195 ALA A O   1 
ATOM   950  C CB  . ALA A 1 122 ? 16.687 -15.942 37.215  1.00 23.61 ? 1195 ALA A CB  1 
ATOM   951  N N   . LEU A 1 123 ? 19.178 -14.222 36.616  1.00 24.70 ? 1196 LEU A N   1 
ATOM   952  C CA  . LEU A 1 123 ? 20.626 -14.069 36.739  1.00 27.21 ? 1196 LEU A CA  1 
ATOM   953  C C   . LEU A 1 123 ? 21.004 -12.641 37.184  1.00 29.07 ? 1196 LEU A C   1 
ATOM   954  O O   . LEU A 1 123 ? 21.982 -12.454 37.901  1.00 31.69 ? 1196 LEU A O   1 
ATOM   955  C CB  . LEU A 1 123 ? 21.335 -14.446 35.438  1.00 23.71 ? 1196 LEU A CB  1 
ATOM   956  C CG  . LEU A 1 123 ? 21.268 -15.924 35.000  1.00 30.70 ? 1196 LEU A CG  1 
ATOM   957  C CD1 . LEU A 1 123 ? 22.451 -16.257 34.115  1.00 30.36 ? 1196 LEU A CD1 1 
ATOM   958  C CD2 . LEU A 1 123 ? 21.213 -16.870 36.188  1.00 31.10 ? 1196 LEU A CD2 1 
ATOM   959  N N   . GLN A 1 124 ? 20.239 -11.639 36.776  1.00 25.69 ? 1197 GLN A N   1 
ATOM   960  C CA  . GLN A 1 124 ? 20.498 -10.284 37.286  1.00 30.06 ? 1197 GLN A CA  1 
ATOM   961  C C   . GLN A 1 124 ? 20.266 -10.223 38.793  1.00 31.07 ? 1197 GLN A C   1 
ATOM   962  O O   . GLN A 1 124 ? 21.021 -9.575  39.516  1.00 31.28 ? 1197 GLN A O   1 
ATOM   963  C CB  . GLN A 1 124 ? 19.630 -9.244  36.593  1.00 28.08 ? 1197 GLN A CB  1 
ATOM   964  C CG  . GLN A 1 124 ? 19.986 -9.011  35.104  1.00 25.69 ? 1197 GLN A CG  1 
ATOM   965  C CD  . GLN A 1 124 ? 18.957 -8.134  34.461  1.00 28.79 ? 1197 GLN A CD  1 
ATOM   966  O OE1 . GLN A 1 124 ? 18.860 -6.949  34.793  1.00 31.67 ? 1197 GLN A OE1 1 
ATOM   967  N NE2 . GLN A 1 124 ? 18.142 -8.706  33.567  1.00 26.45 ? 1197 GLN A NE2 1 
ATOM   968  N N   . HIS A 1 125 ? 19.214 -10.879 39.267  1.00 28.72 ? 1198 HIS A N   1 
ATOM   969  C CA  . HIS A 1 125 ? 18.978 -10.966 40.710  1.00 30.13 ? 1198 HIS A CA  1 
ATOM   970  C C   . HIS A 1 125 ? 20.181 -11.594 41.410  1.00 30.95 ? 1198 HIS A C   1 
ATOM   971  O O   . HIS A 1 125 ? 20.645 -11.090 42.439  1.00 32.56 ? 1198 HIS A O   1 
ATOM   972  C CB  . HIS A 1 125 ? 17.730 -11.790 41.024  1.00 27.82 ? 1198 HIS A CB  1 
ATOM   973  C CG  . HIS A 1 125 ? 17.646 -12.222 42.454  1.00 30.57 ? 1198 HIS A CG  1 
ATOM   974  N ND1 . HIS A 1 125 ? 16.972 -11.501 43.413  1.00 31.19 ? 1198 HIS A ND1 1 
ATOM   975  C CD2 . HIS A 1 125 ? 18.163 -13.300 43.088  1.00 33.47 ? 1198 HIS A CD2 1 
ATOM   976  C CE1 . HIS A 1 125 ? 17.081 -12.112 44.579  1.00 31.94 ? 1198 HIS A CE1 1 
ATOM   977  N NE2 . HIS A 1 125 ? 17.793 -13.210 44.407  1.00 32.75 ? 1198 HIS A NE2 1 
ATOM   978  N N   . ARG A 1 126 ? 20.695 -12.681 40.849  1.00 27.16 ? 1199 ARG A N   1 
ATOM   979  C CA  . ARG A 1 126 ? 21.876 -13.306 41.404  1.00 32.73 ? 1199 ARG A CA  1 
ATOM   980  C C   . ARG A 1 126 ? 23.068 -12.356 41.458  1.00 33.56 ? 1199 ARG A C   1 
ATOM   981  O O   . ARG A 1 126 ? 23.806 -12.331 42.440  1.00 34.42 ? 1199 ARG A O   1 
ATOM   982  C CB  . ARG A 1 126 ? 22.280 -14.534 40.602  1.00 30.68 ? 1199 ARG A CB  1 
ATOM   983  C CG  . ARG A 1 126 ? 23.437 -15.258 41.236  1.00 36.83 ? 1199 ARG A CG  1 
ATOM   984  C CD  . ARG A 1 126 ? 23.747 -16.547 40.506  1.00 35.67 ? 1199 ARG A CD  1 
ATOM   985  N NE  . ARG A 1 126 ? 24.243 -16.277 39.162  1.00 36.61 ? 1199 ARG A NE  1 
ATOM   986  C CZ  . ARG A 1 126 ? 24.525 -17.217 38.275  1.00 36.60 ? 1199 ARG A CZ  1 
ATOM   987  N NH1 . ARG A 1 126 ? 24.966 -16.889 37.071  1.00 43.16 ? 1199 ARG A NH1 1 
ATOM   988  N NH2 . ARG A 1 126 ? 24.369 -18.490 38.599  1.00 37.38 ? 1199 ARG A NH2 1 
ATOM   989  N N   . SER A 1 127 ? 23.288 -11.603 40.388  1.00 34.26 ? 1200 SER A N   1 
ATOM   990  C CA  . SER A 1 127 ? 24.396 -10.657 40.380  1.00 37.70 ? 1200 SER A CA  1 
ATOM   991  C C   . SER A 1 127 ? 24.254 -9.630  41.506  1.00 39.41 ? 1200 SER A C   1 
ATOM   992  O O   . SER A 1 127 ? 25.224 -9.299  42.176  1.00 43.67 ? 1200 SER A O   1 
ATOM   993  C CB  . SER A 1 127 ? 24.479 -9.951  39.025  1.00 38.42 ? 1200 SER A CB  1 
ATOM   994  O OG  . SER A 1 127 ? 24.970 -10.843 38.062  1.00 41.43 ? 1200 SER A OG  1 
ATOM   995  N N   . LYS A 1 128 ? 23.045 -9.133  41.719  1.00 34.48 ? 1201 LYS A N   1 
ATOM   996  C CA  . LYS A 1 128 ? 22.818 -8.138  42.769  1.00 38.42 ? 1201 LYS A CA  1 
ATOM   997  C C   . LYS A 1 128 ? 23.141 -8.687  44.140  1.00 41.39 ? 1201 LYS A C   1 
ATOM   998  O O   . LYS A 1 128 ? 23.763 -8.007  44.961  1.00 40.20 ? 1201 LYS A O   1 
ATOM   999  C CB  . LYS A 1 128 ? 21.386 -7.614  42.746  1.00 38.53 ? 1201 LYS A CB  1 
ATOM   1000 C CG  . LYS A 1 128 ? 21.175 -6.555  41.703  1.00 41.58 ? 1201 LYS A CG  1 
ATOM   1001 C CD  . LYS A 1 128 ? 19.715 -6.393  41.358  1.00 42.87 ? 1201 LYS A CD  1 
ATOM   1002 C CE  . LYS A 1 128 ? 19.572 -5.751  39.983  1.00 45.75 ? 1201 LYS A CE  1 
ATOM   1003 N NZ  . LYS A 1 128 ? 18.179 -5.267  39.719  1.00 52.75 ? 1201 LYS A NZ  1 
ATOM   1004 N N   . VAL A 1 129 ? 22.707 -9.917  44.389  1.00 38.69 ? 1202 VAL A N   1 
ATOM   1005 C CA  . VAL A 1 129 ? 22.941 -10.555 45.674  1.00 40.25 ? 1202 VAL A CA  1 
ATOM   1006 C C   . VAL A 1 129 ? 24.428 -10.769 45.897  1.00 45.40 ? 1202 VAL A C   1 
ATOM   1007 O O   . VAL A 1 129 ? 24.911 -10.689 47.023  1.00 46.32 ? 1202 VAL A O   1 
ATOM   1008 C CB  . VAL A 1 129 ? 22.218 -11.924 45.767  1.00 43.15 ? 1202 VAL A CB  1 
ATOM   1009 C CG1 . VAL A 1 129 ? 22.868 -12.823 46.821  1.00 37.70 ? 1202 VAL A CG1 1 
ATOM   1010 C CG2 . VAL A 1 129 ? 20.748 -11.716 46.055  1.00 37.47 ? 1202 VAL A CG2 1 
ATOM   1011 N N   . GLN A 1 130 ? 25.159 -11.045 44.825  1.00 42.08 ? 1203 GLN A N   1 
ATOM   1012 C CA  . GLN A 1 130 ? 26.572 -11.363 44.977  1.00 50.50 ? 1203 GLN A CA  1 
ATOM   1013 C C   . GLN A 1 130 ? 27.483 -10.141 44.948  1.00 50.02 ? 1203 GLN A C   1 
ATOM   1014 O O   . GLN A 1 130 ? 28.704 -10.276 45.008  1.00 51.80 ? 1203 GLN A O   1 
ATOM   1015 C CB  . GLN A 1 130 ? 27.007 -12.379 43.927  1.00 50.68 ? 1203 GLN A CB  1 
ATOM   1016 C CG  . GLN A 1 130 ? 26.251 -13.672 44.029  1.00 50.32 ? 1203 GLN A CG  1 
ATOM   1017 C CD  . GLN A 1 130 ? 27.078 -14.846 43.574  1.00 58.71 ? 1203 GLN A CD  1 
ATOM   1018 O OE1 . GLN A 1 130 ? 26.545 -15.917 43.254  1.00 60.34 ? 1203 GLN A OE1 1 
ATOM   1019 N NE2 . GLN A 1 130 ? 28.396 -14.659 43.544  1.00 61.84 ? 1203 GLN A NE2 1 
ATOM   1020 N N   . GLY A 1 131 ? 26.888 -8.956  44.866  1.00 50.69 ? 1204 GLY A N   1 
ATOM   1021 C CA  . GLY A 1 131 ? 27.653 -7.720  44.857  1.00 52.06 ? 1204 GLY A CA  1 
ATOM   1022 C C   . GLY A 1 131 ? 28.351 -7.489  43.531  1.00 59.82 ? 1204 GLY A C   1 
ATOM   1023 O O   . GLY A 1 131 ? 29.542 -7.166  43.484  1.00 63.74 ? 1204 GLY A O   1 
ATOM   1024 N N   . GLU A 1 132 ? 27.601 -7.651  42.447  1.00 56.30 ? 1205 GLU A N   1 
ATOM   1025 C CA  . GLU A 1 132 ? 28.138 -7.495  41.101  1.00 57.35 ? 1205 GLU A CA  1 
ATOM   1026 C C   . GLU A 1 132 ? 27.207 -6.615  40.277  1.00 60.69 ? 1205 GLU A C   1 
ATOM   1027 O O   . GLU A 1 132 ? 26.968 -6.893  39.095  1.00 65.04 ? 1205 GLU A O   1 
ATOM   1028 C CB  . GLU A 1 132 ? 28.285 -8.857  40.419  1.00 54.94 ? 1205 GLU A CB  1 
ATOM   1029 C CG  . GLU A 1 132 ? 28.935 -9.936  41.278  1.00 58.10 ? 1205 GLU A CG  1 
ATOM   1030 C CD  . GLU A 1 132 ? 28.781 -11.327 40.672  1.00 61.30 ? 1205 GLU A CD  1 
ATOM   1031 O OE1 . GLU A 1 132 ? 29.271 -12.313 41.282  1.00 62.55 ? 1205 GLU A OE1 1 
ATOM   1032 O OE2 . GLU A 1 132 ? 28.165 -11.431 39.582  1.00 62.28 ? 1205 GLU A OE2 1 
ATOM   1033 O OXT . GLU A 1 132 ? 26.673 -5.618  40.772  1.00 63.21 ? 1205 GLU A OXT 1 
ATOM   1034 N N   . SER B 2 7   ? 12.148 -0.411  48.380  1.00 53.00 ? 28   SER B N   1 
ATOM   1035 C CA  . SER B 2 7   ? 11.722 -1.626  49.064  1.00 49.15 ? 28   SER B CA  1 
ATOM   1036 C C   . SER B 2 7   ? 11.494 -2.782  48.065  1.00 43.84 ? 28   SER B C   1 
ATOM   1037 O O   . SER B 2 7   ? 11.896 -2.691  46.911  1.00 44.43 ? 28   SER B O   1 
ATOM   1038 C CB  . SER B 2 7   ? 10.455 -1.353  49.873  1.00 47.21 ? 28   SER B CB  1 
ATOM   1039 O OG  . SER B 2 7   ? 9.369  -1.044  49.011  1.00 50.36 ? 28   SER B OG  1 
ATOM   1040 N N   . ALA B 2 8   ? 10.837 -3.853  48.512  1.00 44.55 ? 29   ALA B N   1 
ATOM   1041 C CA  . ALA B 2 8   ? 10.611 -5.033  47.666  1.00 41.92 ? 29   ALA B CA  1 
ATOM   1042 C C   . ALA B 2 8   ? 9.717  -4.766  46.457  1.00 39.37 ? 29   ALA B C   1 
ATOM   1043 O O   . ALA B 2 8   ? 8.723  -4.045  46.569  1.00 43.81 ? 29   ALA B O   1 
ATOM   1044 C CB  . ALA B 2 8   ? 10.021 -6.171  48.500  1.00 36.78 ? 29   ALA B CB  1 
ATOM   1045 N N   . PRO B 2 9   ? 10.059 -5.365  45.302  1.00 38.99 ? 30   PRO B N   1 
ATOM   1046 C CA  . PRO B 2 9   ? 9.216  -5.339  44.101  1.00 37.45 ? 30   PRO B CA  1 
ATOM   1047 C C   . PRO B 2 9   ? 7.798  -5.781  44.431  1.00 37.71 ? 30   PRO B C   1 
ATOM   1048 O O   . PRO B 2 9   ? 7.619  -6.586  45.342  1.00 35.46 ? 30   PRO B O   1 
ATOM   1049 C CB  . PRO B 2 9   ? 9.875  -6.384  43.192  1.00 39.05 ? 30   PRO B CB  1 
ATOM   1050 C CG  . PRO B 2 9   ? 11.299 -6.399  43.614  1.00 41.30 ? 30   PRO B CG  1 
ATOM   1051 C CD  . PRO B 2 9   ? 11.301 -6.132  45.090  1.00 37.96 ? 30   PRO B CD  1 
ATOM   1052 N N   . ALA B 2 10  ? 6.815  -5.238  43.716  1.00 38.47 ? 31   ALA B N   1 
ATOM   1053 C CA  . ALA B 2 10  ? 5.425  -5.635  43.871  1.00 35.98 ? 31   ALA B CA  1 
ATOM   1054 C C   . ALA B 2 10  ? 5.265  -7.076  43.383  1.00 34.03 ? 31   ALA B C   1 
ATOM   1055 O O   . ALA B 2 10  ? 6.025  -7.517  42.507  1.00 34.51 ? 31   ALA B O   1 
ATOM   1056 C CB  . ALA B 2 10  ? 4.511  -4.700  43.062  1.00 36.95 ? 31   ALA B CB  1 
ATOM   1057 N N   . THR B 2 11  ? 4.294  -7.804  43.940  1.00 31.60 ? 32   THR B N   1 
ATOM   1058 C CA  . THR B 2 11  ? 4.006  -9.162  43.462  1.00 32.51 ? 32   THR B CA  1 
ATOM   1059 C C   . THR B 2 11  ? 2.537  -9.294  43.025  1.00 35.92 ? 32   THR B C   1 
ATOM   1060 O O   . THR B 2 11  ? 1.706  -8.452  43.377  1.00 36.44 ? 32   THR B O   1 
ATOM   1061 C CB  . THR B 2 11  ? 4.413  -10.247 44.493  1.00 30.64 ? 32   THR B CB  1 
ATOM   1062 O OG1 . THR B 2 11  ? 3.589  -10.185 45.669  1.00 31.73 ? 32   THR B OG1 1 
ATOM   1063 C CG2 . THR B 2 11  ? 5.873  -10.099 44.863  1.00 32.22 ? 32   THR B CG2 1 
ATOM   1064 N N   . GLY B 2 12  ? 2.219  -10.338 42.261  1.00 32.27 ? 33   GLY B N   1 
ATOM   1065 C CA  . GLY B 2 12  ? 0.944  -10.398 41.568  1.00 29.91 ? 33   GLY B CA  1 
ATOM   1066 C C   . GLY B 2 12  ? -0.016 -11.547 41.847  1.00 36.01 ? 33   GLY B C   1 
ATOM   1067 O O   . GLY B 2 12  ? -0.740 -11.986 40.945  1.00 40.12 ? 33   GLY B O   1 
ATOM   1068 N N   . GLY B 2 13  ? -0.048 -12.027 43.083  1.00 32.26 ? 34   GLY B N   1 
ATOM   1069 C CA  . GLY B 2 13  ? -0.957 -13.093 43.436  1.00 34.41 ? 34   GLY B CA  1 
ATOM   1070 C C   . GLY B 2 13  ? -0.520 -14.456 42.936  1.00 33.15 ? 34   GLY B C   1 
ATOM   1071 O O   . GLY B 2 13  ? 0.572  -14.630 42.386  1.00 31.26 ? 34   GLY B O   1 
ATOM   1072 N N   . VAL B 2 14  ? -1.400 -15.436 43.103  1.00 29.94 ? 35   VAL B N   1 
ATOM   1073 C CA  . VAL B 2 14  ? -1.084 -16.800 42.716  1.00 31.40 ? 35   VAL B CA  1 
ATOM   1074 C C   . VAL B 2 14  ? -1.188 -16.994 41.209  1.00 30.84 ? 35   VAL B C   1 
ATOM   1075 O O   . VAL B 2 14  ? -2.168 -16.578 40.584  1.00 31.82 ? 35   VAL B O   1 
ATOM   1076 C CB  . VAL B 2 14  ? -2.006 -17.769 43.442  1.00 31.47 ? 35   VAL B CB  1 
ATOM   1077 C CG1 . VAL B 2 14  ? -1.712 -19.211 43.035  1.00 30.15 ? 35   VAL B CG1 1 
ATOM   1078 C CG2 . VAL B 2 14  ? -1.875 -17.555 44.959  1.00 31.61 ? 35   VAL B CG2 1 
HETATM 1079 N N   . M3L B 2 15  ? -0.165 -17.614 40.624  1.00 26.60 ? 36   M3L B N   1 
HETATM 1080 C CA  . M3L B 2 15  ? -0.144 -17.859 39.195  1.00 30.64 ? 36   M3L B CA  1 
HETATM 1081 C CB  . M3L B 2 15  ? 1.158  -18.506 38.719  1.00 30.93 ? 36   M3L B CB  1 
HETATM 1082 C CG  . M3L B 2 15  ? 1.462  -18.338 37.235  1.00 30.44 ? 36   M3L B CG  1 
HETATM 1083 C CD  . M3L B 2 15  ? 2.786  -18.888 36.719  1.00 27.57 ? 36   M3L B CD  1 
HETATM 1084 C CE  . M3L B 2 15  ? 2.996  -18.657 35.226  1.00 25.52 ? 36   M3L B CE  1 
HETATM 1085 N NZ  . M3L B 2 15  ? 4.281  -18.995 34.667  1.00 30.83 ? 36   M3L B NZ  1 
HETATM 1086 C C   . M3L B 2 15  ? -1.383 -18.597 38.686  1.00 33.06 ? 36   M3L B C   1 
HETATM 1087 O O   . M3L B 2 15  ? -1.739 -19.609 39.208  1.00 30.49 ? 36   M3L B O   1 
HETATM 1088 C CM1 . M3L B 2 15  ? 4.554  -20.390 35.001  1.00 24.67 ? 36   M3L B CM1 1 
HETATM 1089 C CM2 . M3L B 2 15  ? 5.301  -18.105 35.218  1.00 25.32 ? 36   M3L B CM2 1 
HETATM 1090 C CM3 . M3L B 2 15  ? 4.239  -18.835 33.214  1.00 25.97 ? 36   M3L B CM3 1 
ATOM   1091 N N   . LYS B 2 16  ? -2.009 -18.045 37.650  1.00 31.76 ? 37   LYS B N   1 
ATOM   1092 C CA  . LYS B 2 16  ? -3.180 -18.671 37.051  1.00 36.40 ? 37   LYS B CA  1 
ATOM   1093 C C   . LYS B 2 16  ? -2.789 -19.944 36.320  1.00 33.71 ? 37   LYS B C   1 
ATOM   1094 O O   . LYS B 2 16  ? -1.690 -20.053 35.792  1.00 35.09 ? 37   LYS B O   1 
ATOM   1095 C CB  . LYS B 2 16  ? -3.874 -17.731 36.067  1.00 40.08 ? 37   LYS B CB  1 
ATOM   1096 C CG  . LYS B 2 16  ? -4.537 -16.537 36.706  1.00 44.37 ? 37   LYS B CG  1 
ATOM   1097 C CD  . LYS B 2 16  ? -5.569 -15.945 35.757  1.00 51.83 ? 37   LYS B CD  1 
ATOM   1098 C CE  . LYS B 2 16  ? -6.318 -14.786 36.384  1.00 59.77 ? 37   LYS B CE  1 
ATOM   1099 N NZ  . LYS B 2 16  ? -7.369 -14.259 35.463  1.00 66.43 ? 37   LYS B NZ  1 
ATOM   1100 N N   . PRO B 2 17  ? -3.707 -20.905 36.271  1.00 34.24 ? 38   PRO B N   1 
ATOM   1101 C CA  . PRO B 2 17  ? -3.403 -22.176 35.612  1.00 36.41 ? 38   PRO B CA  1 
ATOM   1102 C C   . PRO B 2 17  ? -3.295 -22.004 34.099  1.00 38.38 ? 38   PRO B C   1 
ATOM   1103 O O   . PRO B 2 17  ? -3.980 -21.164 33.514  1.00 38.02 ? 38   PRO B O   1 
ATOM   1104 C CB  . PRO B 2 17  ? -4.605 -23.054 35.982  1.00 40.46 ? 38   PRO B CB  1 
ATOM   1105 C CG  . PRO B 2 17  ? -5.192 -22.398 37.250  1.00 38.61 ? 38   PRO B CG  1 
ATOM   1106 C CD  . PRO B 2 17  ? -4.999 -20.934 36.978  1.00 42.23 ? 38   PRO B CD  1 
ATOM   1107 N N   . HIS B 2 18  ? -2.417 -22.783 33.476  1.00 39.86 ? 39   HIS B N   1 
ATOM   1108 C CA  . HIS B 2 18  ? -2.257 -22.713 32.025  1.00 39.00 ? 39   HIS B CA  1 
ATOM   1109 C C   . HIS B 2 18  ? -3.562 -23.116 31.364  1.00 40.17 ? 39   HIS B C   1 
ATOM   1110 O O   . HIS B 2 18  ? -4.245 -24.004 31.861  1.00 39.95 ? 39   HIS B O   1 
ATOM   1111 C CB  . HIS B 2 18  ? -1.150 -23.651 31.555  1.00 40.43 ? 39   HIS B CB  1 
ATOM   1112 C CG  . HIS B 2 18  ? -1.071 -23.770 30.065  1.00 38.89 ? 39   HIS B CG  1 
ATOM   1113 N ND1 . HIS B 2 18  ? -1.725 -24.762 29.365  1.00 41.54 ? 39   HIS B ND1 1 
ATOM   1114 C CD2 . HIS B 2 18  ? -0.456 -22.995 29.139  1.00 40.51 ? 39   HIS B CD2 1 
ATOM   1115 C CE1 . HIS B 2 18  ? -1.484 -24.615 28.073  1.00 45.78 ? 39   HIS B CE1 1 
ATOM   1116 N NE2 . HIS B 2 18  ? -0.719 -23.548 27.909  1.00 44.05 ? 39   HIS B NE2 1 
ATOM   1117 N N   . ARG B 2 19  ? -3.922 -22.482 30.257  1.00 35.63 ? 40   ARG B N   1 
ATOM   1118 C CA  . ARG B 2 19  ? -5.166 -22.862 29.594  1.00 40.38 ? 40   ARG B CA  1 
ATOM   1119 C C   . ARG B 2 19  ? -4.922 -23.167 28.117  1.00 36.65 ? 40   ARG B C   1 
ATOM   1120 O O   . ARG B 2 19  ? -4.387 -22.342 27.386  1.00 33.99 ? 40   ARG B O   1 
ATOM   1121 C CB  . ARG B 2 19  ? -6.251 -21.791 29.770  1.00 44.00 ? 40   ARG B CB  1 
ATOM   1122 C CG  . ARG B 2 19  ? -6.268 -21.136 31.160  1.00 49.86 ? 40   ARG B CG  1 
ATOM   1123 C CD  . ARG B 2 19  ? -7.701 -20.885 31.650  1.00 55.98 ? 40   ARG B CD  1 
ATOM   1124 N NE  . ARG B 2 19  ? -7.759 -20.631 33.094  1.00 59.97 ? 40   ARG B NE  1 
ATOM   1125 C CZ  . ARG B 2 19  ? -8.806 -20.911 33.874  1.00 61.44 ? 40   ARG B CZ  1 
ATOM   1126 N NH1 . ARG B 2 19  ? -8.760 -20.639 35.178  1.00 59.95 ? 40   ARG B NH1 1 
ATOM   1127 N NH2 . ARG B 2 19  ? -9.901 -21.466 33.358  1.00 56.44 ? 40   ARG B NH2 1 
ATOM   1128 N N   . TYR B 2 20  ? -5.303 -24.367 27.693  1.00 39.39 ? 41   TYR B N   1 
ATOM   1129 C CA  . TYR B 2 20  ? -5.006 -24.822 26.338  1.00 41.04 ? 41   TYR B CA  1 
ATOM   1130 C C   . TYR B 2 20  ? -5.540 -23.852 25.286  1.00 39.72 ? 41   TYR B C   1 
ATOM   1131 O O   . TYR B 2 20  ? -6.706 -23.478 25.350  1.00 41.42 ? 41   TYR B O   1 
ATOM   1132 C CB  . TYR B 2 20  ? -5.594 -26.210 26.128  1.00 38.61 ? 41   TYR B CB  1 
ATOM   1133 C CG  . TYR B 2 20  ? -5.635 -26.667 24.687  1.00 38.07 ? 41   TYR B CG  1 
ATOM   1134 C CD1 . TYR B 2 20  ? -4.472 -26.766 23.931  1.00 38.97 ? 41   TYR B CD1 1 
ATOM   1135 C CD2 . TYR B 2 20  ? -6.840 -27.019 24.089  1.00 34.49 ? 41   TYR B CD2 1 
ATOM   1136 C CE1 . TYR B 2 20  ? -4.515 -27.195 22.606  1.00 35.20 ? 41   TYR B CE1 1 
ATOM   1137 C CE2 . TYR B 2 20  ? -6.892 -27.437 22.777  1.00 32.25 ? 41   TYR B CE2 1 
ATOM   1138 C CZ  . TYR B 2 20  ? -5.731 -27.525 22.046  1.00 32.20 ? 41   TYR B CZ  1 
ATOM   1139 O OH  . TYR B 2 20  ? -5.786 -27.972 20.745  1.00 27.07 ? 41   TYR B OH  1 
ATOM   1140 N N   . ASP C 1 7   ? 40.788 2.065   2.513   1.00 56.41 ? 1080 ASP C N   1 
ATOM   1141 C CA  . ASP C 1 7   ? 40.630 0.625   2.682   1.00 51.71 ? 1080 ASP C CA  1 
ATOM   1142 C C   . ASP C 1 7   ? 41.843 -0.159  2.188   1.00 52.28 ? 1080 ASP C C   1 
ATOM   1143 O O   . ASP C 1 7   ? 42.136 -0.208  0.987   1.00 51.30 ? 1080 ASP C O   1 
ATOM   1144 C CB  . ASP C 1 7   ? 39.362 0.126   2.000   1.00 47.47 ? 1080 ASP C CB  1 
ATOM   1145 C CG  . ASP C 1 7   ? 38.273 -0.196  2.984   1.00 50.10 ? 1080 ASP C CG  1 
ATOM   1146 O OD1 . ASP C 1 7   ? 37.201 -0.692  2.552   1.00 49.89 ? 1080 ASP C OD1 1 
ATOM   1147 O OD2 . ASP C 1 7   ? 38.493 0.039   4.196   1.00 57.03 ? 1080 ASP C OD2 1 
ATOM   1148 N N   . SER C 1 8   ? 42.544 -0.770  3.137   1.00 50.88 ? 1081 SER C N   1 
ATOM   1149 C CA  . SER C 1 8   ? 43.733 -1.557  2.845   1.00 48.77 ? 1081 SER C CA  1 
ATOM   1150 C C   . SER C 1 8   ? 43.457 -2.730  1.901   1.00 46.88 ? 1081 SER C C   1 
ATOM   1151 O O   . SER C 1 8   ? 42.364 -3.304  1.899   1.00 44.02 ? 1081 SER C O   1 
ATOM   1152 C CB  . SER C 1 8   ? 44.364 -2.067  4.146   1.00 55.31 ? 1081 SER C CB  1 
ATOM   1153 O OG  . SER C 1 8   ? 44.884 -0.984  4.907   1.00 60.72 ? 1081 SER C OG  1 
ATOM   1154 N N   . PRO C 1 9   ? 44.458 -3.065  1.077   1.00 44.38 ? 1082 PRO C N   1 
ATOM   1155 C CA  . PRO C 1 9   ? 44.513 -4.280  0.269   1.00 41.48 ? 1082 PRO C CA  1 
ATOM   1156 C C   . PRO C 1 9   ? 44.302 -5.508  1.163   1.00 39.07 ? 1082 PRO C C   1 
ATOM   1157 O O   . PRO C 1 9   ? 44.791 -5.536  2.297   1.00 40.13 ? 1082 PRO C O   1 
ATOM   1158 C CB  . PRO C 1 9   ? 45.949 -4.260  -0.264  1.00 40.98 ? 1082 PRO C CB  1 
ATOM   1159 C CG  . PRO C 1 9   ? 46.307 -2.840  -0.316  1.00 44.61 ? 1082 PRO C CG  1 
ATOM   1160 C CD  . PRO C 1 9   ? 45.652 -2.224  0.882   1.00 48.67 ? 1082 PRO C CD  1 
ATOM   1161 N N   . LEU C 1 10  ? 43.556 -6.483  0.658   1.00 35.39 ? 1083 LEU C N   1 
ATOM   1162 C CA  . LEU C 1 10  ? 43.304 -7.754  1.337   1.00 31.95 ? 1083 LEU C CA  1 
ATOM   1163 C C   . LEU C 1 10  ? 44.147 -8.833  0.645   1.00 30.35 ? 1083 LEU C C   1 
ATOM   1164 O O   . LEU C 1 10  ? 44.550 -8.656  -0.513  1.00 32.15 ? 1083 LEU C O   1 
ATOM   1165 C CB  . LEU C 1 10  ? 41.823 -8.113  1.171   1.00 29.32 ? 1083 LEU C CB  1 
ATOM   1166 C CG  . LEU C 1 10  ? 40.757 -7.682  2.185   1.00 37.98 ? 1083 LEU C CG  1 
ATOM   1167 C CD1 . LEU C 1 10  ? 41.282 -6.683  3.137   1.00 31.03 ? 1083 LEU C CD1 1 
ATOM   1168 C CD2 . LEU C 1 10  ? 39.466 -7.213  1.494   1.00 32.73 ? 1083 LEU C CD2 1 
ATOM   1169 N N   . ASP C 1 11  ? 44.398 -9.954  1.326   1.00 24.30 ? 1084 ASP C N   1 
ATOM   1170 C CA  . ASP C 1 11  ? 45.320 -10.982 0.816   1.00 29.12 ? 1084 ASP C CA  1 
ATOM   1171 C C   . ASP C 1 11  ? 44.592 -12.257 0.384   1.00 27.72 ? 1084 ASP C C   1 
ATOM   1172 O O   . ASP C 1 11  ? 43.531 -12.587 0.920   1.00 22.13 ? 1084 ASP C O   1 
ATOM   1173 C CB  . ASP C 1 11  ? 46.351 -11.346 1.897   1.00 30.39 ? 1084 ASP C CB  1 
ATOM   1174 C CG  . ASP C 1 11  ? 47.241 -10.177 2.270   1.00 34.51 ? 1084 ASP C CG  1 
ATOM   1175 O OD1 . ASP C 1 11  ? 47.666 -10.062 3.439   1.00 40.12 ? 1084 ASP C OD1 1 
ATOM   1176 O OD2 . ASP C 1 11  ? 47.502 -9.351  1.385   1.00 32.93 ? 1084 ASP C OD2 1 
ATOM   1177 N N   . ALA C 1 12  ? 45.176 -12.993 -0.554  1.00 25.85 ? 1085 ALA C N   1 
ATOM   1178 C CA  . ALA C 1 12  ? 44.628 -14.281 -0.906  1.00 24.27 ? 1085 ALA C CA  1 
ATOM   1179 C C   . ALA C 1 12  ? 44.570 -15.134 0.349   1.00 23.25 ? 1085 ALA C C   1 
ATOM   1180 O O   . ALA C 1 12  ? 45.462 -15.069 1.209   1.00 21.64 ? 1085 ALA C O   1 
ATOM   1181 C CB  . ALA C 1 12  ? 45.466 -14.980 -1.980  1.00 24.90 ? 1085 ALA C CB  1 
ATOM   1182 N N   . LEU C 1 13  ? 43.511 -15.934 0.423   1.00 20.74 ? 1086 LEU C N   1 
ATOM   1183 C CA  . LEU C 1 13  ? 43.188 -16.793 1.571   1.00 20.30 ? 1086 LEU C CA  1 
ATOM   1184 C C   . LEU C 1 13  ? 42.685 -16.079 2.839   1.00 21.63 ? 1086 LEU C C   1 
ATOM   1185 O O   . LEU C 1 13  ? 42.517 -16.721 3.881   1.00 24.03 ? 1086 LEU C O   1 
ATOM   1186 C CB  . LEU C 1 13  ? 44.319 -17.805 1.873   1.00 23.68 ? 1086 LEU C CB  1 
ATOM   1187 C CG  . LEU C 1 13  ? 44.923 -18.385 0.589   1.00 26.54 ? 1086 LEU C CG  1 
ATOM   1188 C CD1 . LEU C 1 13  ? 46.119 -19.269 0.893   1.00 32.78 ? 1086 LEU C CD1 1 
ATOM   1189 C CD2 . LEU C 1 13  ? 43.864 -19.145 -0.189  1.00 26.82 ? 1086 LEU C CD2 1 
ATOM   1190 N N   . ASP C 1 14  ? 42.385 -14.784 2.754   1.00 21.71 ? 1087 ASP C N   1 
ATOM   1191 C CA  . ASP C 1 14  ? 41.716 -14.079 3.868   1.00 22.34 ? 1087 ASP C CA  1 
ATOM   1192 C C   . ASP C 1 14  ? 40.234 -14.492 3.846   1.00 22.22 ? 1087 ASP C C   1 
ATOM   1193 O O   . ASP C 1 14  ? 39.663 -14.664 2.770   1.00 20.40 ? 1087 ASP C O   1 
ATOM   1194 C CB  . ASP C 1 14  ? 41.754 -12.549 3.677   1.00 21.12 ? 1087 ASP C CB  1 
ATOM   1195 C CG  . ASP C 1 14  ? 43.069 -11.904 4.124   1.00 30.15 ? 1087 ASP C CG  1 
ATOM   1196 O OD1 . ASP C 1 14  ? 43.929 -12.596 4.687   1.00 27.13 ? 1087 ASP C OD1 1 
ATOM   1197 O OD2 . ASP C 1 14  ? 43.228 -10.672 3.910   1.00 29.73 ? 1087 ASP C OD2 1 
ATOM   1198 N N   . LEU C 1 15  ? 39.620 -14.615 5.016   1.00 20.76 ? 1088 LEU C N   1 
ATOM   1199 C CA  . LEU C 1 15  ? 38.169 -14.816 5.104   1.00 19.93 ? 1088 LEU C CA  1 
ATOM   1200 C C   . LEU C 1 15  ? 37.499 -13.470 5.043   1.00 19.69 ? 1088 LEU C C   1 
ATOM   1201 O O   . LEU C 1 15  ? 37.932 -12.528 5.703   1.00 18.54 ? 1088 LEU C O   1 
ATOM   1202 C CB  . LEU C 1 15  ? 37.790 -15.480 6.429   1.00 20.01 ? 1088 LEU C CB  1 
ATOM   1203 C CG  . LEU C 1 15  ? 38.344 -16.871 6.710   1.00 20.57 ? 1088 LEU C CG  1 
ATOM   1204 C CD1 . LEU C 1 15  ? 37.912 -17.319 8.080   1.00 20.32 ? 1088 LEU C CD1 1 
ATOM   1205 C CD2 . LEU C 1 15  ? 37.848 -17.838 5.653   1.00 23.75 ? 1088 LEU C CD2 1 
ATOM   1206 N N   . VAL C 1 16  ? 36.403 -13.371 4.291   1.00 18.49 ? 1089 VAL C N   1 
ATOM   1207 C CA  . VAL C 1 16  ? 35.750 -12.094 4.131   1.00 16.16 ? 1089 VAL C CA  1 
ATOM   1208 C C   . VAL C 1 16  ? 34.231 -12.280 4.100   1.00 17.92 ? 1089 VAL C C   1 
ATOM   1209 O O   . VAL C 1 16  ? 33.743 -13.355 3.797   1.00 18.52 ? 1089 VAL C O   1 
ATOM   1210 C CB  . VAL C 1 16  ? 36.153 -11.402 2.788   1.00 20.86 ? 1089 VAL C CB  1 
ATOM   1211 C CG1 . VAL C 1 16  ? 37.616 -10.916 2.846   1.00 21.89 ? 1089 VAL C CG1 1 
ATOM   1212 C CG2 . VAL C 1 16  ? 35.923 -12.339 1.592   1.00 22.01 ? 1089 VAL C CG2 1 
ATOM   1213 N N   . TRP C 1 17  ? 33.517 -11.231 4.453   1.00 18.14 ? 1090 TRP C N   1 
ATOM   1214 C CA  . TRP C 1 17  ? 32.101 -11.100 4.152   1.00 19.56 ? 1090 TRP C CA  1 
ATOM   1215 C C   . TRP C 1 17  ? 32.091 -10.502 2.754   1.00 22.57 ? 1090 TRP C C   1 
ATOM   1216 O O   . TRP C 1 17  ? 32.735 -9.468  2.510   1.00 25.30 ? 1090 TRP C O   1 
ATOM   1217 C CB  . TRP C 1 17  ? 31.476 -10.098 5.145   1.00 20.56 ? 1090 TRP C CB  1 
ATOM   1218 C CG  . TRP C 1 17  ? 31.331 -10.636 6.511   1.00 18.57 ? 1090 TRP C CG  1 
ATOM   1219 C CD1 . TRP C 1 17  ? 32.138 -10.407 7.590   1.00 16.51 ? 1090 TRP C CD1 1 
ATOM   1220 C CD2 . TRP C 1 17  ? 30.306 -11.519 6.952   1.00 18.97 ? 1090 TRP C CD2 1 
ATOM   1221 N NE1 . TRP C 1 17  ? 31.685 -11.110 8.672   1.00 18.22 ? 1090 TRP C NE1 1 
ATOM   1222 C CE2 . TRP C 1 17  ? 30.554 -11.804 8.304   1.00 20.38 ? 1090 TRP C CE2 1 
ATOM   1223 C CE3 . TRP C 1 17  ? 29.213 -12.134 6.312   1.00 19.78 ? 1090 TRP C CE3 1 
ATOM   1224 C CZ2 . TRP C 1 17  ? 29.729 -12.649 9.053   1.00 21.55 ? 1090 TRP C CZ2 1 
ATOM   1225 C CZ3 . TRP C 1 17  ? 28.397 -12.979 7.059   1.00 16.87 ? 1090 TRP C CZ3 1 
ATOM   1226 C CH2 . TRP C 1 17  ? 28.656 -13.226 8.411   1.00 21.53 ? 1090 TRP C CH2 1 
ATOM   1227 N N   . ALA C 1 18  ? 31.374 -11.118 1.822   1.00 20.05 ? 1091 ALA C N   1 
ATOM   1228 C CA  . ALA C 1 18  ? 31.405 -10.675 0.439   1.00 18.66 ? 1091 ALA C CA  1 
ATOM   1229 C C   . ALA C 1 18  ? 29.995 -10.356 -0.021  1.00 23.78 ? 1091 ALA C C   1 
ATOM   1230 O O   . ALA C 1 18  ? 29.114 -11.201 0.084   1.00 21.37 ? 1091 ALA C O   1 
ATOM   1231 C CB  . ALA C 1 18  ? 32.016 -11.746 -0.467  1.00 20.77 ? 1091 ALA C CB  1 
ATOM   1232 N N   . LYS C 1 19  ? 29.798 -9.132  -0.525  1.00 22.79 ? 1092 LYS C N   1 
ATOM   1233 C CA  . LYS C 1 19  ? 28.463 -8.626  -0.822  1.00 24.12 ? 1092 LYS C CA  1 
ATOM   1234 C C   . LYS C 1 19  ? 28.163 -8.606  -2.305  1.00 27.21 ? 1092 LYS C C   1 
ATOM   1235 O O   . LYS C 1 19  ? 28.792 -7.861  -3.075  1.00 27.96 ? 1092 LYS C O   1 
ATOM   1236 C CB  . LYS C 1 19  ? 28.265 -7.218  -0.228  1.00 29.03 ? 1092 LYS C CB  1 
ATOM   1237 C CG  . LYS C 1 19  ? 26.852 -6.632  -0.473  1.00 29.69 ? 1092 LYS C CG  1 
ATOM   1238 C CD  . LYS C 1 19  ? 25.772 -7.399  0.324   1.00 29.93 ? 1092 LYS C CD  1 
ATOM   1239 C CE  . LYS C 1 19  ? 24.404 -6.706  0.209   1.00 33.00 ? 1092 LYS C CE  1 
ATOM   1240 N NZ  . LYS C 1 19  ? 23.877 -6.710  -1.187  1.00 31.35 ? 1092 LYS C NZ  1 
ATOM   1241 N N   . CYS C 1 20  ? 27.206 -9.439  -2.707  1.00 28.45 ? 1093 CYS C N   1 
ATOM   1242 C CA  . CYS C 1 20  ? 26.687 -9.464  -4.083  1.00 31.04 ? 1093 CYS C CA  1 
ATOM   1243 C C   . CYS C 1 20  ? 25.313 -8.782  -4.140  1.00 36.06 ? 1093 CYS C C   1 
ATOM   1244 O O   . CYS C 1 20  ? 24.574 -8.812  -3.164  1.00 33.43 ? 1093 CYS C O   1 
ATOM   1245 C CB  . CYS C 1 20  ? 26.492 -10.908 -4.552  1.00 33.06 ? 1093 CYS C CB  1 
ATOM   1246 S SG  . CYS C 1 20  ? 27.991 -11.699 -5.102  1.00 45.22 ? 1093 CYS C SG  1 
ATOM   1247 N N   . ARG C 1 21  ? 24.965 -8.206  -5.291  1.00 39.22 ? 1094 ARG C N   1 
ATOM   1248 C CA  . ARG C 1 21  ? 23.652 -7.571  -5.469  1.00 42.45 ? 1094 ARG C CA  1 
ATOM   1249 C C   . ARG C 1 21  ? 22.535 -8.556  -5.130  1.00 38.39 ? 1094 ARG C C   1 
ATOM   1250 O O   . ARG C 1 21  ? 22.559 -9.698  -5.583  1.00 39.22 ? 1094 ARG C O   1 
ATOM   1251 C CB  . ARG C 1 21  ? 23.490 -7.074  -6.918  1.00 48.29 ? 1094 ARG C CB  1 
ATOM   1252 C CG  . ARG C 1 21  ? 22.161 -6.358  -7.192  1.00 48.35 ? 1094 ARG C CG  1 
ATOM   1253 C CD  . ARG C 1 21  ? 22.319 -5.158  -8.149  1.00 54.31 ? 1094 ARG C CD  1 
ATOM   1254 N NE  . ARG C 1 21  ? 23.572 -4.417  -7.948  1.00 60.32 ? 1094 ARG C NE  1 
ATOM   1255 C CZ  . ARG C 1 21  ? 23.892 -3.744  -6.840  1.00 59.61 ? 1094 ARG C CZ  1 
ATOM   1256 N NH1 . ARG C 1 21  ? 25.061 -3.111  -6.759  1.00 58.42 ? 1094 ARG C NH1 1 
ATOM   1257 N NH2 . ARG C 1 21  ? 23.055 -3.717  -5.805  1.00 56.59 ? 1094 ARG C NH2 1 
ATOM   1258 N N   . GLY C 1 22  ? 21.571 -8.115  -4.324  1.00 42.58 ? 1095 GLY C N   1 
ATOM   1259 C CA  . GLY C 1 22  ? 20.419 -8.938  -3.979  1.00 40.95 ? 1095 GLY C CA  1 
ATOM   1260 C C   . GLY C 1 22  ? 20.617 -9.880  -2.799  1.00 43.05 ? 1095 GLY C C   1 
ATOM   1261 O O   . GLY C 1 22  ? 19.673 -10.155 -2.046  1.00 45.69 ? 1095 GLY C O   1 
ATOM   1262 N N   . TYR C 1 23  ? 21.838 -10.380 -2.629  1.00 35.50 ? 1096 TYR C N   1 
ATOM   1263 C CA  . TYR C 1 23  ? 22.156 -11.256 -1.499  1.00 31.55 ? 1096 TYR C CA  1 
ATOM   1264 C C   . TYR C 1 23  ? 22.671 -10.456 -0.300  1.00 29.66 ? 1096 TYR C C   1 
ATOM   1265 O O   . TYR C 1 23  ? 23.242 -9.387  -0.454  1.00 29.19 ? 1096 TYR C O   1 
ATOM   1266 C CB  . TYR C 1 23  ? 23.204 -12.296 -1.908  1.00 32.25 ? 1096 TYR C CB  1 
ATOM   1267 C CG  . TYR C 1 23  ? 22.748 -13.263 -2.978  1.00 33.80 ? 1096 TYR C CG  1 
ATOM   1268 C CD1 . TYR C 1 23  ? 21.742 -14.195 -2.729  1.00 35.90 ? 1096 TYR C CD1 1 
ATOM   1269 C CD2 . TYR C 1 23  ? 23.346 -13.269 -4.225  1.00 37.33 ? 1096 TYR C CD2 1 
ATOM   1270 C CE1 . TYR C 1 23  ? 21.338 -15.098 -3.713  1.00 34.94 ? 1096 TYR C CE1 1 
ATOM   1271 C CE2 . TYR C 1 23  ? 22.955 -14.168 -5.204  1.00 37.45 ? 1096 TYR C CE2 1 
ATOM   1272 C CZ  . TYR C 1 23  ? 21.946 -15.073 -4.942  1.00 40.67 ? 1096 TYR C CZ  1 
ATOM   1273 O OH  . TYR C 1 23  ? 21.560 -15.963 -5.931  1.00 45.10 ? 1096 TYR C OH  1 
ATOM   1274 N N   . PRO C 1 24  ? 22.459 -10.974 0.901   1.00 26.40 ? 1097 PRO C N   1 
ATOM   1275 C CA  . PRO C 1 24  ? 23.086 -10.383 2.075   1.00 29.13 ? 1097 PRO C CA  1 
ATOM   1276 C C   . PRO C 1 24  ? 24.564 -10.734 2.048   1.00 24.87 ? 1097 PRO C C   1 
ATOM   1277 O O   . PRO C 1 24  ? 24.931 -11.682 1.357   1.00 25.24 ? 1097 PRO C O   1 
ATOM   1278 C CB  . PRO C 1 24  ? 22.413 -11.099 3.249   1.00 30.01 ? 1097 PRO C CB  1 
ATOM   1279 C CG  . PRO C 1 24  ? 21.716 -12.269 2.672   1.00 32.06 ? 1097 PRO C CG  1 
ATOM   1280 C CD  . PRO C 1 24  ? 21.833 -12.273 1.184   1.00 32.03 ? 1097 PRO C CD  1 
ATOM   1281 N N   . SER C 1 25  ? 25.383 -9.977  2.777   1.00 24.28 ? 1098 SER C N   1 
ATOM   1282 C CA  . SER C 1 25  ? 26.807 -10.282 2.911   1.00 24.92 ? 1098 SER C CA  1 
ATOM   1283 C C   . SER C 1 25  ? 27.014 -11.763 3.213   1.00 20.58 ? 1098 SER C C   1 
ATOM   1284 O O   . SER C 1 25  ? 26.337 -12.313 4.089   1.00 23.34 ? 1098 SER C O   1 
ATOM   1285 C CB  . SER C 1 25  ? 27.367 -9.468  4.078   1.00 23.72 ? 1098 SER C CB  1 
ATOM   1286 O OG  . SER C 1 25  ? 27.320 -8.089  3.754   1.00 29.09 ? 1098 SER C OG  1 
ATOM   1287 N N   . TYR C 1 26  ? 27.962 -12.403 2.534   1.00 17.92 ? 1099 TYR C N   1 
ATOM   1288 C CA  . TYR C 1 26  ? 28.068 -13.866 2.639   1.00 20.88 ? 1099 TYR C CA  1 
ATOM   1289 C C   . TYR C 1 26  ? 29.512 -14.312 2.852   1.00 17.03 ? 1099 TYR C C   1 
ATOM   1290 O O   . TYR C 1 26  ? 30.388 -13.798 2.169   1.00 19.49 ? 1099 TYR C O   1 
ATOM   1291 C CB  . TYR C 1 26  ? 27.536 -14.496 1.359   1.00 21.76 ? 1099 TYR C CB  1 
ATOM   1292 C CG  . TYR C 1 26  ? 27.071 -15.926 1.543   1.00 20.27 ? 1099 TYR C CG  1 
ATOM   1293 C CD1 . TYR C 1 26  ? 27.974 -16.985 1.491   1.00 20.98 ? 1099 TYR C CD1 1 
ATOM   1294 C CD2 . TYR C 1 26  ? 25.721 -16.215 1.732   1.00 20.30 ? 1099 TYR C CD2 1 
ATOM   1295 C CE1 . TYR C 1 26  ? 27.554 -18.308 1.645   1.00 19.92 ? 1099 TYR C CE1 1 
ATOM   1296 C CE2 . TYR C 1 26  ? 25.290 -17.536 1.896   1.00 22.95 ? 1099 TYR C CE2 1 
ATOM   1297 C CZ  . TYR C 1 26  ? 26.195 -18.565 1.828   1.00 21.89 ? 1099 TYR C CZ  1 
ATOM   1298 O OH  . TYR C 1 26  ? 25.757 -19.870 1.983   1.00 23.05 ? 1099 TYR C OH  1 
ATOM   1299 N N   . PRO C 1 27  ? 29.758 -15.253 3.796   1.00 18.10 ? 1100 PRO C N   1 
ATOM   1300 C CA  . PRO C 1 27  ? 31.140 -15.702 4.077   1.00 18.28 ? 1100 PRO C CA  1 
ATOM   1301 C C   . PRO C 1 27  ? 31.852 -16.281 2.858   1.00 18.44 ? 1100 PRO C C   1 
ATOM   1302 O O   . PRO C 1 27  ? 31.280 -17.096 2.137   1.00 17.68 ? 1100 PRO C O   1 
ATOM   1303 C CB  . PRO C 1 27  ? 30.945 -16.821 5.095   1.00 16.33 ? 1100 PRO C CB  1 
ATOM   1304 C CG  . PRO C 1 27  ? 29.684 -16.370 5.906   1.00 18.76 ? 1100 PRO C CG  1 
ATOM   1305 C CD  . PRO C 1 27  ? 28.791 -15.791 4.781   1.00 19.37 ? 1100 PRO C CD  1 
ATOM   1306 N N   . ALA C 1 28  ? 33.112 -15.910 2.655   1.00 18.23 ? 1101 ALA C N   1 
ATOM   1307 C CA  . ALA C 1 28  ? 33.824 -16.349 1.456   1.00 15.44 ? 1101 ALA C CA  1 
ATOM   1308 C C   . ALA C 1 28  ? 35.327 -16.335 1.740   1.00 20.44 ? 1101 ALA C C   1 
ATOM   1309 O O   . ALA C 1 28  ? 35.763 -15.822 2.766   1.00 17.39 ? 1101 ALA C O   1 
ATOM   1310 C CB  . ALA C 1 28  ? 33.531 -15.413 0.285   1.00 18.10 ? 1101 ALA C CB  1 
ATOM   1311 N N   . LEU C 1 29  ? 36.091 -16.901 0.820   1.00 19.28 ? 1102 LEU C N   1 
ATOM   1312 C CA  . LEU C 1 29  ? 37.538 -16.991 0.934   1.00 18.52 ? 1102 LEU C CA  1 
ATOM   1313 C C   . LEU C 1 29  ? 38.113 -16.302 -0.291  1.00 22.18 ? 1102 LEU C C   1 
ATOM   1314 O O   . LEU C 1 29  ? 37.695 -16.594 -1.424  1.00 20.74 ? 1102 LEU C O   1 
ATOM   1315 C CB  . LEU C 1 29  ? 37.907 -18.476 0.925   1.00 19.67 ? 1102 LEU C CB  1 
ATOM   1316 C CG  . LEU C 1 29  ? 39.374 -18.906 0.956   1.00 24.16 ? 1102 LEU C CG  1 
ATOM   1317 C CD1 . LEU C 1 29  ? 39.934 -18.554 2.295   1.00 21.94 ? 1102 LEU C CD1 1 
ATOM   1318 C CD2 . LEU C 1 29  ? 39.467 -20.420 0.743   1.00 24.89 ? 1102 LEU C CD2 1 
ATOM   1319 N N   . ILE C 1 30  ? 39.067 -15.391 -0.099  1.00 19.67 ? 1103 ILE C N   1 
ATOM   1320 C CA  . ILE C 1 30  ? 39.718 -14.771 -1.248  1.00 18.31 ? 1103 ILE C CA  1 
ATOM   1321 C C   . ILE C 1 30  ? 40.700 -15.801 -1.826  1.00 24.38 ? 1103 ILE C C   1 
ATOM   1322 O O   . ILE C 1 30  ? 41.454 -16.434 -1.074  1.00 21.46 ? 1103 ILE C O   1 
ATOM   1323 C CB  . ILE C 1 30  ? 40.472 -13.497 -0.884  1.00 22.15 ? 1103 ILE C CB  1 
ATOM   1324 C CG1 . ILE C 1 30  ? 39.528 -12.494 -0.209  1.00 21.13 ? 1103 ILE C CG1 1 
ATOM   1325 C CG2 . ILE C 1 30  ? 41.133 -12.845 -2.162  1.00 20.78 ? 1103 ILE C CG2 1 
ATOM   1326 C CD1 . ILE C 1 30  ? 40.193 -11.201 0.182   1.00 24.11 ? 1103 ILE C CD1 1 
ATOM   1327 N N   . ILE C 1 31  ? 40.688 -15.946 -3.146  1.00 23.74 ? 1104 ILE C N   1 
ATOM   1328 C CA  . ILE C 1 31  ? 41.514 -16.930 -3.867  1.00 21.42 ? 1104 ILE C CA  1 
ATOM   1329 C C   . ILE C 1 31  ? 42.435 -16.218 -4.861  1.00 26.33 ? 1104 ILE C C   1 
ATOM   1330 O O   . ILE C 1 31  ? 42.022 -15.281 -5.546  1.00 23.63 ? 1104 ILE C O   1 
ATOM   1331 C CB  . ILE C 1 31  ? 40.607 -17.917 -4.640  1.00 23.18 ? 1104 ILE C CB  1 
ATOM   1332 C CG1 . ILE C 1 31  ? 39.787 -18.757 -3.644  1.00 22.50 ? 1104 ILE C CG1 1 
ATOM   1333 C CG2 . ILE C 1 31  ? 41.466 -18.844 -5.531  1.00 22.74 ? 1104 ILE C CG2 1 
ATOM   1334 C CD1 . ILE C 1 31  ? 40.599 -19.806 -2.885  1.00 22.51 ? 1104 ILE C CD1 1 
ATOM   1335 N N   . ASP C 1 32  ? 43.698 -16.635 -4.912  1.00 26.64 ? 1105 ASP C N   1 
ATOM   1336 C CA  . ASP C 1 32  ? 44.648 -16.065 -5.861  1.00 26.64 ? 1105 ASP C CA  1 
ATOM   1337 C C   . ASP C 1 32  ? 44.386 -16.609 -7.267  1.00 27.46 ? 1105 ASP C C   1 
ATOM   1338 O O   . ASP C 1 32  ? 44.555 -17.817 -7.519  1.00 27.54 ? 1105 ASP C O   1 
ATOM   1339 C CB  . ASP C 1 32  ? 46.073 -16.409 -5.415  1.00 29.15 ? 1105 ASP C CB  1 
ATOM   1340 C CG  . ASP C 1 32  ? 47.128 -15.855 -6.350  1.00 34.93 ? 1105 ASP C CG  1 
ATOM   1341 O OD1 . ASP C 1 32  ? 46.763 -15.283 -7.408  1.00 32.35 ? 1105 ASP C OD1 1 
ATOM   1342 O OD2 . ASP C 1 32  ? 48.330 -16.018 -6.015  1.00 36.12 ? 1105 ASP C OD2 1 
ATOM   1343 N N   . PRO C 1 33  ? 43.981 -15.726 -8.189  1.00 29.09 ? 1106 PRO C N   1 
ATOM   1344 C CA  . PRO C 1 33  ? 43.635 -16.128 -9.559  1.00 32.50 ? 1106 PRO C CA  1 
ATOM   1345 C C   . PRO C 1 33  ? 44.812 -16.770 -10.266 1.00 29.82 ? 1106 PRO C C   1 
ATOM   1346 O O   . PRO C 1 33  ? 44.618 -17.557 -11.195 1.00 33.98 ? 1106 PRO C O   1 
ATOM   1347 C CB  . PRO C 1 33  ? 43.293 -14.803 -10.239 1.00 31.43 ? 1106 PRO C CB  1 
ATOM   1348 C CG  . PRO C 1 33  ? 42.969 -13.885 -9.148  1.00 34.83 ? 1106 PRO C CG  1 
ATOM   1349 C CD  . PRO C 1 33  ? 43.856 -14.271 -8.002  1.00 26.31 ? 1106 PRO C CD  1 
ATOM   1350 N N   . LYS C 1 34  ? 46.012 -16.440 -9.814  1.00 30.19 ? 1107 LYS C N   1 
ATOM   1351 C CA  . LYS C 1 34  ? 47.225 -17.015 -10.379 1.00 34.16 ? 1107 LYS C CA  1 
ATOM   1352 C C   . LYS C 1 34  ? 47.825 -18.169 -9.563  1.00 34.20 ? 1107 LYS C C   1 
ATOM   1353 O O   . LYS C 1 34  ? 49.006 -18.474 -9.724  1.00 33.31 ? 1107 LYS C O   1 
ATOM   1354 C CB  . LYS C 1 34  ? 48.302 -15.934 -10.529 1.00 36.09 ? 1107 LYS C CB  1 
ATOM   1355 C CG  . LYS C 1 34  ? 47.829 -14.657 -11.198 1.00 37.75 ? 1107 LYS C CG  1 
ATOM   1356 C CD  . LYS C 1 34  ? 48.140 -14.620 -12.696 1.00 43.57 ? 1107 LYS C CD  1 
ATOM   1357 C CE  . LYS C 1 34  ? 47.549 -13.353 -13.327 1.00 53.92 ? 1107 LYS C CE  1 
ATOM   1358 N NZ  . LYS C 1 34  ? 47.928 -13.135 -14.756 1.00 56.85 ? 1107 LYS C NZ  1 
ATOM   1359 N N   . MET C 1 35  ? 47.048 -18.806 -8.687  1.00 29.78 ? 1108 MET C N   1 
ATOM   1360 C CA  . MET C 1 35  ? 47.582 -19.955 -7.958  1.00 32.81 ? 1108 MET C CA  1 
ATOM   1361 C C   . MET C 1 35  ? 47.921 -21.049 -8.953  1.00 33.17 ? 1108 MET C C   1 
ATOM   1362 O O   . MET C 1 35  ? 47.390 -21.059 -10.053 1.00 34.22 ? 1108 MET C O   1 
ATOM   1363 C CB  . MET C 1 35  ? 46.585 -20.492 -6.922  1.00 29.77 ? 1108 MET C CB  1 
ATOM   1364 C CG  . MET C 1 35  ? 45.343 -21.058 -7.509  1.00 29.41 ? 1108 MET C CG  1 
ATOM   1365 S SD  . MET C 1 35  ? 44.185 -21.478 -6.191  1.00 33.11 ? 1108 MET C SD  1 
ATOM   1366 C CE  . MET C 1 35  ? 44.902 -23.017 -5.626  1.00 31.92 ? 1108 MET C CE  1 
ATOM   1367 N N   . PRO C 1 36  ? 48.810 -21.973 -8.571  1.00 36.65 ? 1109 PRO C N   1 
ATOM   1368 C CA  . PRO C 1 36  ? 49.172 -23.081 -9.470  1.00 34.85 ? 1109 PRO C CA  1 
ATOM   1369 C C   . PRO C 1 36  ? 47.945 -23.835 -9.989  1.00 38.21 ? 1109 PRO C C   1 
ATOM   1370 O O   . PRO C 1 36  ? 47.018 -24.168 -9.228  1.00 34.16 ? 1109 PRO C O   1 
ATOM   1371 C CB  . PRO C 1 36  ? 50.015 -23.993 -8.575  1.00 39.58 ? 1109 PRO C CB  1 
ATOM   1372 C CG  . PRO C 1 36  ? 50.596 -23.065 -7.540  1.00 37.82 ? 1109 PRO C CG  1 
ATOM   1373 C CD  . PRO C 1 36  ? 49.539 -22.026 -7.289  1.00 32.60 ? 1109 PRO C CD  1 
ATOM   1374 N N   . ARG C 1 37  ? 47.935 -24.102 -11.290 1.00 33.05 ? 1110 ARG C N   1 
ATOM   1375 C CA  . ARG C 1 37  ? 46.813 -24.795 -11.903 1.00 35.35 ? 1110 ARG C CA  1 
ATOM   1376 C C   . ARG C 1 37  ? 46.688 -26.228 -11.391 1.00 35.83 ? 1110 ARG C C   1 
ATOM   1377 O O   . ARG C 1 37  ? 45.610 -26.813 -11.435 1.00 37.38 ? 1110 ARG C O   1 
ATOM   1378 C CB  . ARG C 1 37  ? 46.924 -24.788 -13.435 1.00 39.07 ? 1110 ARG C CB  1 
ATOM   1379 C CG  . ARG C 1 37  ? 46.990 -23.409 -14.055 1.00 40.87 ? 1110 ARG C CG  1 
ATOM   1380 C CD  . ARG C 1 37  ? 45.782 -22.570 -13.685 1.00 38.29 ? 1110 ARG C CD  1 
ATOM   1381 N NE  . ARG C 1 37  ? 44.535 -23.216 -14.069 1.00 38.43 ? 1110 ARG C NE  1 
ATOM   1382 C CZ  . ARG C 1 37  ? 43.338 -22.869 -13.609 1.00 38.66 ? 1110 ARG C CZ  1 
ATOM   1383 N NH1 . ARG C 1 37  ? 42.259 -23.514 -14.016 1.00 36.10 ? 1110 ARG C NH1 1 
ATOM   1384 N NH2 . ARG C 1 37  ? 43.223 -21.881 -12.728 1.00 37.07 ? 1110 ARG C NH2 1 
ATOM   1385 N N   . GLU C 1 38  ? 47.788 -26.793 -10.899 1.00 35.35 ? 1111 GLU C N   1 
ATOM   1386 C CA  . GLU C 1 38  ? 47.740 -28.138 -10.356 1.00 38.99 ? 1111 GLU C CA  1 
ATOM   1387 C C   . GLU C 1 38  ? 47.343 -28.087 -8.884  1.00 39.35 ? 1111 GLU C C   1 
ATOM   1388 O O   . GLU C 1 38  ? 47.362 -29.101 -8.197  1.00 39.27 ? 1111 GLU C O   1 
ATOM   1389 C CB  . GLU C 1 38  ? 49.065 -28.889 -10.550 1.00 44.08 ? 1111 GLU C CB  1 
ATOM   1390 C CG  . GLU C 1 38  ? 50.320 -28.030 -10.441 1.00 45.33 ? 1111 GLU C CG  1 
ATOM   1391 C CD  . GLU C 1 38  ? 50.540 -27.140 -11.669 1.00 46.96 ? 1111 GLU C CD  1 
ATOM   1392 O OE1 . GLU C 1 38  ? 50.754 -25.925 -11.488 1.00 40.50 ? 1111 GLU C OE1 1 
ATOM   1393 O OE2 . GLU C 1 38  ? 50.493 -27.650 -12.814 1.00 49.54 ? 1111 GLU C OE2 1 
ATOM   1394 N N   . GLY C 1 39  ? 46.978 -26.896 -8.416  1.00 35.85 ? 1112 GLY C N   1 
ATOM   1395 C CA  . GLY C 1 39  ? 46.476 -26.745 -7.058  1.00 36.25 ? 1112 GLY C CA  1 
ATOM   1396 C C   . GLY C 1 39  ? 47.602 -26.492 -6.082  1.00 39.41 ? 1112 GLY C C   1 
ATOM   1397 O O   . GLY C 1 39  ? 48.779 -26.466 -6.472  1.00 42.02 ? 1112 GLY C O   1 
ATOM   1398 N N   . MET C 1 40  ? 47.249 -26.274 -4.817  1.00 38.59 ? 1113 MET C N   1 
ATOM   1399 C CA  . MET C 1 40  ? 48.248 -26.089 -3.767  1.00 36.42 ? 1113 MET C CA  1 
ATOM   1400 C C   . MET C 1 40  ? 47.655 -26.280 -2.369  1.00 38.84 ? 1113 MET C C   1 
ATOM   1401 O O   . MET C 1 40  ? 46.428 -26.360 -2.198  1.00 34.72 ? 1113 MET C O   1 
ATOM   1402 C CB  . MET C 1 40  ? 48.936 -24.731 -3.870  1.00 36.50 ? 1113 MET C CB  1 
ATOM   1403 C CG  . MET C 1 40  ? 48.017 -23.612 -4.252  1.00 42.81 ? 1113 MET C CG  1 
ATOM   1404 S SD  . MET C 1 40  ? 48.288 -22.198 -3.193  1.00 55.33 ? 1113 MET C SD  1 
ATOM   1405 C CE  . MET C 1 40  ? 47.441 -22.798 -1.742  1.00 33.82 ? 1113 MET C CE  1 
ATOM   1406 N N   . PHE C 1 41  ? 48.545 -26.381 -1.384  1.00 38.64 ? 1114 PHE C N   1 
ATOM   1407 C CA  . PHE C 1 41  ? 48.153 -26.575 0.007   1.00 38.04 ? 1114 PHE C CA  1 
ATOM   1408 C C   . PHE C 1 41  ? 48.589 -25.364 0.795   1.00 38.91 ? 1114 PHE C C   1 
ATOM   1409 O O   . PHE C 1 41  ? 49.715 -24.879 0.648   1.00 44.73 ? 1114 PHE C O   1 
ATOM   1410 C CB  . PHE C 1 41  ? 48.818 -27.817 0.615   1.00 41.12 ? 1114 PHE C CB  1 
ATOM   1411 C CG  . PHE C 1 41  ? 48.413 -29.105 -0.032  1.00 40.38 ? 1114 PHE C CG  1 
ATOM   1412 C CD1 . PHE C 1 41  ? 49.163 -29.638 -1.077  1.00 41.58 ? 1114 PHE C CD1 1 
ATOM   1413 C CD2 . PHE C 1 41  ? 47.296 -29.793 0.403   1.00 39.74 ? 1114 PHE C CD2 1 
ATOM   1414 C CE1 . PHE C 1 41  ? 48.795 -30.825 -1.672  1.00 43.41 ? 1114 PHE C CE1 1 
ATOM   1415 C CE2 . PHE C 1 41  ? 46.916 -30.989 -0.195  1.00 40.81 ? 1114 PHE C CE2 1 
ATOM   1416 C CZ  . PHE C 1 41  ? 47.665 -31.504 -1.236  1.00 44.44 ? 1114 PHE C CZ  1 
ATOM   1417 N N   . HIS C 1 42  ? 47.695 -24.880 1.637   1.00 35.73 ? 1115 HIS C N   1 
ATOM   1418 C CA  . HIS C 1 42  ? 48.018 -23.779 2.514   1.00 37.93 ? 1115 HIS C CA  1 
ATOM   1419 C C   . HIS C 1 42  ? 48.095 -24.360 3.910   1.00 34.06 ? 1115 HIS C C   1 
ATOM   1420 O O   . HIS C 1 42  ? 47.078 -24.775 4.460   1.00 32.16 ? 1115 HIS C O   1 
ATOM   1421 C CB  . HIS C 1 42  ? 46.929 -22.723 2.433   1.00 31.65 ? 1115 HIS C CB  1 
ATOM   1422 C CG  . HIS C 1 42  ? 47.179 -21.528 3.294   1.00 33.49 ? 1115 HIS C CG  1 
ATOM   1423 N ND1 . HIS C 1 42  ? 48.302 -20.737 3.164   1.00 37.59 ? 1115 HIS C ND1 1 
ATOM   1424 C CD2 . HIS C 1 42  ? 46.427 -20.958 4.264   1.00 34.49 ? 1115 HIS C CD2 1 
ATOM   1425 C CE1 . HIS C 1 42  ? 48.242 -19.744 4.035   1.00 38.66 ? 1115 HIS C CE1 1 
ATOM   1426 N NE2 . HIS C 1 42  ? 47.112 -19.853 4.713   1.00 34.22 ? 1115 HIS C NE2 1 
ATOM   1427 N N   . HIS C 1 43  ? 49.304 -24.390 4.472   1.00 35.87 ? 1116 HIS C N   1 
ATOM   1428 C CA  . HIS C 1 43  ? 49.543 -25.013 5.781   1.00 37.43 ? 1116 HIS C CA  1 
ATOM   1429 C C   . HIS C 1 43  ? 48.894 -26.388 5.827   1.00 34.06 ? 1116 HIS C C   1 
ATOM   1430 O O   . HIS C 1 43  ? 48.230 -26.757 6.806   1.00 33.83 ? 1116 HIS C O   1 
ATOM   1431 C CB  . HIS C 1 43  ? 49.031 -24.140 6.936   1.00 36.05 ? 1116 HIS C CB  1 
ATOM   1432 C CG  . HIS C 1 43  ? 49.579 -22.744 6.940   1.00 37.83 ? 1116 HIS C CG  1 
ATOM   1433 N ND1 . HIS C 1 43  ? 49.157 -21.783 7.835   1.00 44.25 ? 1116 HIS C ND1 1 
ATOM   1434 C CD2 . HIS C 1 43  ? 50.499 -22.141 6.152   1.00 38.92 ? 1116 HIS C CD2 1 
ATOM   1435 C CE1 . HIS C 1 43  ? 49.807 -20.654 7.609   1.00 41.02 ? 1116 HIS C CE1 1 
ATOM   1436 N NE2 . HIS C 1 43  ? 50.622 -20.846 6.588   1.00 39.56 ? 1116 HIS C NE2 1 
ATOM   1437 N N   . GLY C 1 44  ? 49.072 -27.136 4.747   1.00 35.31 ? 1117 GLY C N   1 
ATOM   1438 C CA  . GLY C 1 44  ? 48.543 -28.481 4.656   1.00 36.26 ? 1117 GLY C CA  1 
ATOM   1439 C C   . GLY C 1 44  ? 47.098 -28.597 4.194   1.00 40.84 ? 1117 GLY C C   1 
ATOM   1440 O O   . GLY C 1 44  ? 46.627 -29.705 3.992   1.00 38.06 ? 1117 GLY C O   1 
ATOM   1441 N N   . VAL C 1 45  ? 46.392 -27.475 4.026   1.00 35.26 ? 1118 VAL C N   1 
ATOM   1442 C CA  . VAL C 1 45  ? 44.989 -27.501 3.580   1.00 33.30 ? 1118 VAL C CA  1 
ATOM   1443 C C   . VAL C 1 45  ? 44.886 -27.191 2.092   1.00 35.75 ? 1118 VAL C C   1 
ATOM   1444 O O   . VAL C 1 45  ? 45.358 -26.138 1.653   1.00 31.83 ? 1118 VAL C O   1 
ATOM   1445 C CB  . VAL C 1 45  ? 44.160 -26.418 4.293   1.00 32.46 ? 1118 VAL C CB  1 
ATOM   1446 C CG1 . VAL C 1 45  ? 42.678 -26.529 3.918   1.00 29.12 ? 1118 VAL C CG1 1 
ATOM   1447 C CG2 . VAL C 1 45  ? 44.373 -26.495 5.811   1.00 34.38 ? 1118 VAL C CG2 1 
ATOM   1448 N N   . PRO C 1 46  ? 44.240 -28.080 1.317   1.00 33.94 ? 1119 PRO C N   1 
ATOM   1449 C CA  . PRO C 1 46  ? 44.195 -27.928 -0.146  1.00 35.34 ? 1119 PRO C CA  1 
ATOM   1450 C C   . PRO C 1 46  ? 43.220 -26.838 -0.528  1.00 36.10 ? 1119 PRO C C   1 
ATOM   1451 O O   . PRO C 1 46  ? 42.087 -26.841 -0.043  1.00 33.63 ? 1119 PRO C O   1 
ATOM   1452 C CB  . PRO C 1 46  ? 43.635 -29.271 -0.640  1.00 37.83 ? 1119 PRO C CB  1 
ATOM   1453 C CG  . PRO C 1 46  ? 43.278 -30.059 0.591   1.00 40.53 ? 1119 PRO C CG  1 
ATOM   1454 C CD  . PRO C 1 46  ? 43.405 -29.194 1.792   1.00 36.38 ? 1119 PRO C CD  1 
ATOM   1455 N N   . ILE C 1 47  ? 43.647 -25.924 -1.386  1.00 30.58 ? 1120 ILE C N   1 
ATOM   1456 C CA  . ILE C 1 47  ? 42.805 -24.810 -1.796  1.00 30.41 ? 1120 ILE C CA  1 
ATOM   1457 C C   . ILE C 1 47  ? 42.280 -25.044 -3.217  1.00 29.16 ? 1120 ILE C C   1 
ATOM   1458 O O   . ILE C 1 47  ? 43.050 -25.355 -4.112  1.00 28.79 ? 1120 ILE C O   1 
ATOM   1459 C CB  . ILE C 1 47  ? 43.620 -23.517 -1.778  1.00 32.22 ? 1120 ILE C CB  1 
ATOM   1460 C CG1 . ILE C 1 47  ? 44.277 -23.310 -0.408  1.00 28.77 ? 1120 ILE C CG1 1 
ATOM   1461 C CG2 . ILE C 1 47  ? 42.750 -22.350 -2.145  1.00 28.89 ? 1120 ILE C CG2 1 
ATOM   1462 C CD1 . ILE C 1 47  ? 43.298 -23.343 0.769   1.00 28.71 ? 1120 ILE C CD1 1 
ATOM   1463 N N   . PRO C 1 48  ? 40.968 -24.900 -3.432  1.00 26.60 ? 1121 PRO C N   1 
ATOM   1464 C CA  . PRO C 1 48  ? 40.369 -25.147 -4.750  1.00 26.52 ? 1121 PRO C CA  1 
ATOM   1465 C C   . PRO C 1 48  ? 40.905 -24.209 -5.841  1.00 29.25 ? 1121 PRO C C   1 
ATOM   1466 O O   . PRO C 1 48  ? 41.180 -23.038 -5.586  1.00 26.93 ? 1121 PRO C O   1 
ATOM   1467 C CB  . PRO C 1 48  ? 38.879 -24.862 -4.520  1.00 28.43 ? 1121 PRO C CB  1 
ATOM   1468 C CG  . PRO C 1 48  ? 38.674 -24.998 -3.074  1.00 29.90 ? 1121 PRO C CG  1 
ATOM   1469 C CD  . PRO C 1 48  ? 39.959 -24.581 -2.416  1.00 30.71 ? 1121 PRO C CD  1 
ATOM   1470 N N   . VAL C 1 49  ? 41.035 -24.727 -7.060  1.00 30.74 ? 1122 VAL C N   1 
ATOM   1471 C CA  . VAL C 1 49  ? 41.565 -23.966 -8.183  1.00 28.14 ? 1122 VAL C CA  1 
ATOM   1472 C C   . VAL C 1 49  ? 40.419 -23.386 -9.020  1.00 27.59 ? 1122 VAL C C   1 
ATOM   1473 O O   . VAL C 1 49  ? 39.513 -24.109 -9.392  1.00 28.70 ? 1122 VAL C O   1 
ATOM   1474 C CB  . VAL C 1 49  ? 42.459 -24.883 -9.070  1.00 35.95 ? 1122 VAL C CB  1 
ATOM   1475 C CG1 . VAL C 1 49  ? 43.062 -24.093 -10.232 1.00 34.67 ? 1122 VAL C CG1 1 
ATOM   1476 C CG2 . VAL C 1 49  ? 43.549 -25.512 -8.234  1.00 32.27 ? 1122 VAL C CG2 1 
ATOM   1477 N N   . PRO C 1 50  ? 40.452 -22.073 -9.301  1.00 27.39 ? 1123 PRO C N   1 
ATOM   1478 C CA  . PRO C 1 50  ? 39.425 -21.409 -10.116 1.00 30.06 ? 1123 PRO C CA  1 
ATOM   1479 C C   . PRO C 1 50  ? 39.418 -21.973 -11.537 1.00 34.04 ? 1123 PRO C C   1 
ATOM   1480 O O   . PRO C 1 50  ? 40.481 -22.026 -12.143 1.00 36.22 ? 1123 PRO C O   1 
ATOM   1481 C CB  . PRO C 1 50  ? 39.912 -19.951 -10.203 1.00 29.68 ? 1123 PRO C CB  1 
ATOM   1482 C CG  . PRO C 1 50  ? 41.093 -19.835 -9.273  1.00 32.57 ? 1123 PRO C CG  1 
ATOM   1483 C CD  . PRO C 1 50  ? 41.621 -21.218 -9.057  1.00 28.41 ? 1123 PRO C CD  1 
ATOM   1484 N N   . PRO C 1 51  ? 38.248 -22.369 -12.054 1.00 33.66 ? 1124 PRO C N   1 
ATOM   1485 C CA  . PRO C 1 51  ? 38.102 -22.771 -13.454 1.00 36.83 ? 1124 PRO C CA  1 
ATOM   1486 C C   . PRO C 1 51  ? 38.643 -21.724 -14.415 1.00 41.54 ? 1124 PRO C C   1 
ATOM   1487 O O   . PRO C 1 51  ? 38.590 -20.511 -14.150 1.00 36.76 ? 1124 PRO C O   1 
ATOM   1488 C CB  . PRO C 1 51  ? 36.588 -22.857 -13.625 1.00 36.12 ? 1124 PRO C CB  1 
ATOM   1489 C CG  . PRO C 1 51  ? 36.099 -23.257 -12.284 1.00 41.29 ? 1124 PRO C CG  1 
ATOM   1490 C CD  . PRO C 1 51  ? 37.005 -22.577 -11.292 1.00 38.59 ? 1124 PRO C CD  1 
ATOM   1491 N N   . LEU C 1 52  ? 39.144 -22.196 -15.551 1.00 39.29 ? 1125 LEU C N   1 
ATOM   1492 C CA  . LEU C 1 52  ? 39.539 -21.310 -16.628 1.00 40.91 ? 1125 LEU C CA  1 
ATOM   1493 C C   . LEU C 1 52  ? 38.479 -20.265 -16.935 1.00 37.92 ? 1125 LEU C C   1 
ATOM   1494 O O   . LEU C 1 52  ? 38.796 -19.087 -17.100 1.00 41.04 ? 1125 LEU C O   1 
ATOM   1495 C CB  . LEU C 1 52  ? 39.844 -22.122 -17.889 1.00 41.93 ? 1125 LEU C CB  1 
ATOM   1496 C CG  . LEU C 1 52  ? 41.101 -22.983 -17.778 1.00 44.39 ? 1125 LEU C CG  1 
ATOM   1497 C CD1 . LEU C 1 52  ? 41.431 -23.638 -19.128 1.00 46.12 ? 1125 LEU C CD1 1 
ATOM   1498 C CD2 . LEU C 1 52  ? 42.267 -22.134 -17.280 1.00 42.81 ? 1125 LEU C CD2 1 
ATOM   1499 N N   . GLU C 1 53  ? 37.223 -20.684 -17.004 1.00 39.64 ? 1126 GLU C N   1 
ATOM   1500 C CA  . GLU C 1 53  ? 36.173 -19.762 -17.401 1.00 45.59 ? 1126 GLU C CA  1 
ATOM   1501 C C   . GLU C 1 53  ? 35.822 -18.742 -16.314 1.00 42.60 ? 1126 GLU C C   1 
ATOM   1502 O O   . GLU C 1 53  ? 35.239 -17.693 -16.605 1.00 44.22 ? 1126 GLU C O   1 
ATOM   1503 C CB  . GLU C 1 53  ? 34.931 -20.508 -17.871 1.00 53.44 ? 1126 GLU C CB  1 
ATOM   1504 C CG  . GLU C 1 53  ? 33.830 -19.572 -18.364 1.00 60.05 ? 1126 GLU C CG  1 
ATOM   1505 C CD  . GLU C 1 53  ? 33.365 -19.894 -19.782 1.00 66.47 ? 1126 GLU C CD  1 
ATOM   1506 O OE1 . GLU C 1 53  ? 34.232 -20.036 -20.676 1.00 65.91 ? 1126 GLU C OE1 1 
ATOM   1507 O OE2 . GLU C 1 53  ? 32.136 -19.988 -20.005 1.00 70.60 ? 1126 GLU C OE2 1 
ATOM   1508 N N   . VAL C 1 54  ? 36.182 -19.032 -15.068 1.00 39.47 ? 1127 VAL C N   1 
ATOM   1509 C CA  . VAL C 1 54  ? 36.031 -18.018 -14.015 1.00 35.40 ? 1127 VAL C CA  1 
ATOM   1510 C C   . VAL C 1 54  ? 37.111 -16.961 -14.203 1.00 35.95 ? 1127 VAL C C   1 
ATOM   1511 O O   . VAL C 1 54  ? 36.869 -15.756 -14.026 1.00 36.16 ? 1127 VAL C O   1 
ATOM   1512 C CB  . VAL C 1 54  ? 36.129 -18.627 -12.599 1.00 39.43 ? 1127 VAL C CB  1 
ATOM   1513 C CG1 . VAL C 1 54  ? 36.222 -17.505 -11.517 1.00 31.76 ? 1127 VAL C CG1 1 
ATOM   1514 C CG2 . VAL C 1 54  ? 34.948 -19.568 -12.336 1.00 35.23 ? 1127 VAL C CG2 1 
ATOM   1515 N N   . LEU C 1 55  ? 38.310 -17.408 -14.570 1.00 34.56 ? 1128 LEU C N   1 
ATOM   1516 C CA  . LEU C 1 55  ? 39.420 -16.477 -14.752 1.00 40.15 ? 1128 LEU C CA  1 
ATOM   1517 C C   . LEU C 1 55  ? 39.184 -15.538 -15.944 1.00 39.99 ? 1128 LEU C C   1 
ATOM   1518 O O   . LEU C 1 55  ? 39.572 -14.365 -15.911 1.00 38.60 ? 1128 LEU C O   1 
ATOM   1519 C CB  . LEU C 1 55  ? 40.739 -17.220 -14.907 1.00 40.24 ? 1128 LEU C CB  1 
ATOM   1520 C CG  . LEU C 1 55  ? 41.177 -18.034 -13.686 1.00 40.72 ? 1128 LEU C CG  1 
ATOM   1521 C CD1 . LEU C 1 55  ? 42.625 -18.438 -13.870 1.00 39.28 ? 1128 LEU C CD1 1 
ATOM   1522 C CD2 . LEU C 1 55  ? 41.016 -17.224 -12.418 1.00 36.00 ? 1128 LEU C CD2 1 
ATOM   1523 N N   . LYS C 1 56  ? 38.537 -16.061 -16.982 1.00 42.48 ? 1129 LYS C N   1 
ATOM   1524 C CA  . LYS C 1 56  ? 38.250 -15.268 -18.177 1.00 48.21 ? 1129 LYS C CA  1 
ATOM   1525 C C   . LYS C 1 56  ? 37.156 -14.254 -17.884 1.00 45.09 ? 1129 LYS C C   1 
ATOM   1526 O O   . LYS C 1 56  ? 37.216 -13.115 -18.323 1.00 46.53 ? 1129 LYS C O   1 
ATOM   1527 C CB  . LYS C 1 56  ? 37.851 -16.155 -19.354 1.00 48.64 ? 1129 LYS C CB  1 
ATOM   1528 C CG  . LYS C 1 56  ? 37.459 -15.371 -20.595 1.00 55.48 ? 1129 LYS C CG  1 
ATOM   1529 C CD  . LYS C 1 56  ? 36.907 -16.284 -21.685 1.00 57.69 ? 1129 LYS C CD  1 
ATOM   1530 C CE  . LYS C 1 56  ? 36.449 -15.482 -22.900 1.00 60.74 ? 1129 LYS C CE  1 
ATOM   1531 N NZ  . LYS C 1 56  ? 36.010 -16.361 -24.029 1.00 66.83 ? 1129 LYS C NZ  1 
ATOM   1532 N N   . LEU C 1 57  ? 36.162 -14.662 -17.116 1.00 43.61 ? 1130 LEU C N   1 
ATOM   1533 C CA  . LEU C 1 57  ? 35.130 -13.726 -16.696 1.00 41.56 ? 1130 LEU C CA  1 
ATOM   1534 C C   . LEU C 1 57  ? 35.728 -12.596 -15.860 1.00 42.52 ? 1130 LEU C C   1 
ATOM   1535 O O   . LEU C 1 57  ? 35.223 -11.464 -15.868 1.00 43.76 ? 1130 LEU C O   1 
ATOM   1536 C CB  . LEU C 1 57  ? 34.038 -14.471 -15.931 1.00 43.05 ? 1130 LEU C CB  1 
ATOM   1537 C CG  . LEU C 1 57  ? 32.825 -13.724 -15.369 1.00 45.21 ? 1130 LEU C CG  1 
ATOM   1538 C CD1 . LEU C 1 57  ? 33.086 -13.326 -13.929 1.00 44.95 ? 1130 LEU C CD1 1 
ATOM   1539 C CD2 . LEU C 1 57  ? 32.415 -12.519 -16.232 1.00 42.82 ? 1130 LEU C CD2 1 
ATOM   1540 N N   . GLY C 1 58  ? 36.813 -12.901 -15.148 1.00 36.49 ? 1131 GLY C N   1 
ATOM   1541 C CA  . GLY C 1 58  ? 37.471 -11.924 -14.299 1.00 37.85 ? 1131 GLY C CA  1 
ATOM   1542 C C   . GLY C 1 58  ? 38.173 -10.821 -15.077 1.00 37.29 ? 1131 GLY C C   1 
ATOM   1543 O O   . GLY C 1 58  ? 38.067 -9.642  -14.738 1.00 38.26 ? 1131 GLY C O   1 
ATOM   1544 N N   . GLU C 1 59  ? 38.911 -11.193 -16.115 1.00 41.51 ? 1132 GLU C N   1 
ATOM   1545 C CA  . GLU C 1 59  ? 39.548 -10.169 -16.944 1.00 45.06 ? 1132 GLU C CA  1 
ATOM   1546 C C   . GLU C 1 59  ? 38.498 -9.205  -17.516 1.00 41.57 ? 1132 GLU C C   1 
ATOM   1547 O O   . GLU C 1 59  ? 38.661 -7.987  -17.444 1.00 44.06 ? 1132 GLU C O   1 
ATOM   1548 C CB  . GLU C 1 59  ? 40.400 -10.786 -18.063 1.00 49.67 ? 1132 GLU C CB  1 
ATOM   1549 C CG  . GLU C 1 59  ? 39.676 -11.827 -18.920 1.00 52.58 ? 1132 GLU C CG  1 
ATOM   1550 C CD  . GLU C 1 59  ? 40.325 -12.036 -20.289 1.00 62.29 ? 1132 GLU C CD  1 
ATOM   1551 O OE1 . GLU C 1 59  ? 40.088 -13.108 -20.910 1.00 64.23 ? 1132 GLU C OE1 1 
ATOM   1552 O OE2 . GLU C 1 59  ? 41.064 -11.127 -20.747 1.00 64.73 ? 1132 GLU C OE2 1 
ATOM   1553 N N   . GLN C 1 60  ? 37.419 -9.759  -18.061 1.00 39.48 ? 1133 GLN C N   1 
ATOM   1554 C CA  . GLN C 1 60  ? 36.335 -8.958  -18.614 1.00 44.92 ? 1133 GLN C CA  1 
ATOM   1555 C C   . GLN C 1 60  ? 35.784 -7.976  -17.597 1.00 45.46 ? 1133 GLN C C   1 
ATOM   1556 O O   . GLN C 1 60  ? 35.718 -6.767  -17.839 1.00 43.23 ? 1133 GLN C O   1 
ATOM   1557 C CB  . GLN C 1 60  ? 35.196 -9.861  -19.073 1.00 46.71 ? 1133 GLN C CB  1 
ATOM   1558 C CG  . GLN C 1 60  ? 35.494 -10.678 -20.288 1.00 48.72 ? 1133 GLN C CG  1 
ATOM   1559 C CD  . GLN C 1 60  ? 34.489 -11.798 -20.473 1.00 55.65 ? 1133 GLN C CD  1 
ATOM   1560 O OE1 . GLN C 1 60  ? 33.443 -11.823 -19.817 1.00 56.51 ? 1133 GLN C OE1 1 
ATOM   1561 N NE2 . GLN C 1 60  ? 34.803 -12.737 -21.363 1.00 60.44 ? 1133 GLN C NE2 1 
ATOM   1562 N N   . MET C 1 61  ? 35.377 -8.496  -16.446 1.00 40.81 ? 1134 MET C N   1 
ATOM   1563 C CA  . MET C 1 61  ? 34.748 -7.650  -15.449 1.00 41.30 ? 1134 MET C CA  1 
ATOM   1564 C C   . MET C 1 61  ? 35.701 -6.565  -14.996 1.00 42.59 ? 1134 MET C C   1 
ATOM   1565 O O   . MET C 1 61  ? 35.289 -5.433  -14.745 1.00 40.74 ? 1134 MET C O   1 
ATOM   1566 C CB  . MET C 1 61  ? 34.281 -8.483  -14.252 1.00 41.44 ? 1134 MET C CB  1 
ATOM   1567 C CG  . MET C 1 61  ? 33.186 -9.491  -14.589 1.00 40.34 ? 1134 MET C CG  1 
ATOM   1568 S SD  . MET C 1 61  ? 32.707 -10.401 -13.101 1.00 37.67 ? 1134 MET C SD  1 
ATOM   1569 C CE  . MET C 1 61  ? 32.229 -9.071  -12.016 1.00 34.72 ? 1134 MET C CE  1 
ATOM   1570 N N   . THR C 1 62  ? 36.980 -6.918  -14.890 1.00 38.90 ? 1135 THR C N   1 
ATOM   1571 C CA  . THR C 1 62  ? 37.975 -5.970  -14.428 1.00 35.61 ? 1135 THR C CA  1 
ATOM   1572 C C   . THR C 1 62  ? 38.081 -4.847  -15.465 1.00 42.26 ? 1135 THR C C   1 
ATOM   1573 O O   . THR C 1 62  ? 38.031 -3.664  -15.131 1.00 38.96 ? 1135 THR C O   1 
ATOM   1574 C CB  . THR C 1 62  ? 39.336 -6.656  -14.270 1.00 40.04 ? 1135 THR C CB  1 
ATOM   1575 O OG1 . THR C 1 62  ? 39.230 -7.715  -13.307 1.00 38.14 ? 1135 THR C OG1 1 
ATOM   1576 C CG2 . THR C 1 62  ? 40.395 -5.676  -13.825 1.00 38.37 ? 1135 THR C CG2 1 
ATOM   1577 N N   . GLN C 1 63  ? 38.196 -5.249  -16.728 1.00 42.95 ? 1136 GLN C N   1 
ATOM   1578 C CA  . GLN C 1 63  ? 38.408 -4.322  -17.835 1.00 48.42 ? 1136 GLN C CA  1 
ATOM   1579 C C   . GLN C 1 63  ? 37.299 -3.274  -17.898 1.00 48.38 ? 1136 GLN C C   1 
ATOM   1580 O O   . GLN C 1 63  ? 37.568 -2.084  -18.062 1.00 49.56 ? 1136 GLN C O   1 
ATOM   1581 C CB  . GLN C 1 63  ? 38.520 -5.100  -19.149 1.00 49.94 ? 1136 GLN C CB  1 
ATOM   1582 C CG  . GLN C 1 63  ? 39.236 -4.351  -20.265 1.00 60.19 ? 1136 GLN C CG  1 
ATOM   1583 C CD  . GLN C 1 63  ? 39.898 -5.284  -21.288 1.00 68.03 ? 1136 GLN C CD  1 
ATOM   1584 O OE1 . GLN C 1 63  ? 40.616 -4.828  -22.188 1.00 68.74 ? 1136 GLN C OE1 1 
ATOM   1585 N NE2 . GLN C 1 63  ? 39.666 -6.593  -21.146 1.00 64.14 ? 1136 GLN C NE2 1 
ATOM   1586 N N   . GLU C 1 64  ? 36.056 -3.712  -17.721 1.00 48.31 ? 1137 GLU C N   1 
ATOM   1587 C CA  . GLU C 1 64  ? 34.912 -2.807  -17.828 1.00 50.91 ? 1137 GLU C CA  1 
ATOM   1588 C C   . GLU C 1 64  ? 34.608 -1.979  -16.571 1.00 50.62 ? 1137 GLU C C   1 
ATOM   1589 O O   . GLU C 1 64  ? 33.976 -0.927  -16.659 1.00 48.66 ? 1137 GLU C O   1 
ATOM   1590 C CB  . GLU C 1 64  ? 33.664 -3.566  -18.291 1.00 51.49 ? 1137 GLU C CB  1 
ATOM   1591 C CG  . GLU C 1 64  ? 33.132 -4.564  -17.301 1.00 52.30 ? 1137 GLU C CG  1 
ATOM   1592 C CD  . GLU C 1 64  ? 32.405 -5.714  -17.985 1.00 58.77 ? 1137 GLU C CD  1 
ATOM   1593 O OE1 . GLU C 1 64  ? 32.042 -6.697  -17.288 1.00 56.98 ? 1137 GLU C OE1 1 
ATOM   1594 O OE2 . GLU C 1 64  ? 32.212 -5.642  -19.223 1.00 59.50 ? 1137 GLU C OE2 1 
ATOM   1595 N N   . ALA C 1 65  ? 35.058 -2.438  -15.407 1.00 45.77 ? 1138 ALA C N   1 
ATOM   1596 C CA  . ALA C 1 65  ? 34.810 -1.697  -14.181 1.00 43.46 ? 1138 ALA C CA  1 
ATOM   1597 C C   . ALA C 1 65  ? 35.944 -0.736  -13.867 1.00 41.49 ? 1138 ALA C C   1 
ATOM   1598 O O   . ALA C 1 65  ? 35.771 0.210   -13.091 1.00 41.25 ? 1138 ALA C O   1 
ATOM   1599 C CB  . ALA C 1 65  ? 34.592 -2.657  -13.011 1.00 46.83 ? 1138 ALA C CB  1 
ATOM   1600 N N   . ARG C 1 66  ? 37.109 -0.983  -14.458 1.00 41.20 ? 1139 ARG C N   1 
ATOM   1601 C CA  . ARG C 1 66  ? 38.296 -0.184  -14.154 1.00 38.39 ? 1139 ARG C CA  1 
ATOM   1602 C C   . ARG C 1 66  ? 38.574 -0.083  -12.653 1.00 36.95 ? 1139 ARG C C   1 
ATOM   1603 O O   . ARG C 1 66  ? 38.896 0.986   -12.104 1.00 35.81 ? 1139 ARG C O   1 
ATOM   1604 C CB  . ARG C 1 66  ? 38.186 1.194   -14.798 1.00 41.55 ? 1139 ARG C CB  1 
ATOM   1605 C CG  . ARG C 1 66  ? 38.139 1.103   -16.307 1.00 44.40 ? 1139 ARG C CG  1 
ATOM   1606 C CD  . ARG C 1 66  ? 37.956 2.463   -16.931 1.00 45.07 ? 1139 ARG C CD  1 
ATOM   1607 N NE  . ARG C 1 66  ? 37.848 2.360   -18.379 1.00 45.26 ? 1139 ARG C NE  1 
ATOM   1608 C CZ  . ARG C 1 66  ? 37.627 3.400   -19.177 1.00 46.70 ? 1139 ARG C CZ  1 
ATOM   1609 N NH1 . ARG C 1 66  ? 37.554 3.234   -20.497 1.00 47.63 ? 1139 ARG C NH1 1 
ATOM   1610 N NH2 . ARG C 1 66  ? 37.484 4.609   -18.649 1.00 44.35 ? 1139 ARG C NH2 1 
ATOM   1611 N N   . GLU C 1 67  ? 38.442 -1.217  -11.977 1.00 35.53 ? 1140 GLU C N   1 
ATOM   1612 C CA  . GLU C 1 67  ? 38.833 -1.301  -10.576 1.00 35.08 ? 1140 GLU C CA  1 
ATOM   1613 C C   . GLU C 1 67  ? 39.311 -2.722  -10.311 1.00 29.44 ? 1140 GLU C C   1 
ATOM   1614 O O   . GLU C 1 67  ? 38.965 -3.646  -11.040 1.00 32.83 ? 1140 GLU C O   1 
ATOM   1615 C CB  . GLU C 1 67  ? 37.699 -0.883  -9.631  1.00 37.24 ? 1140 GLU C CB  1 
ATOM   1616 C CG  . GLU C 1 67  ? 36.309 -1.279  -10.089 1.00 42.09 ? 1140 GLU C CG  1 
ATOM   1617 C CD  . GLU C 1 67  ? 35.266 -1.220  -8.968  1.00 46.58 ? 1140 GLU C CD  1 
ATOM   1618 O OE1 . GLU C 1 67  ? 34.131 -1.692  -9.208  1.00 46.16 ? 1140 GLU C OE1 1 
ATOM   1619 O OE2 . GLU C 1 67  ? 35.574 -0.716  -7.859  1.00 44.25 ? 1140 GLU C OE2 1 
ATOM   1620 N N   . HIS C 1 68  ? 40.172 -2.863  -9.321  1.00 31.05 ? 1141 HIS C N   1 
ATOM   1621 C CA  . HIS C 1 68  ? 40.779 -4.149  -9.049  1.00 30.80 ? 1141 HIS C CA  1 
ATOM   1622 C C   . HIS C 1 68  ? 39.697 -5.052  -8.478  1.00 30.69 ? 1141 HIS C C   1 
ATOM   1623 O O   . HIS C 1 68  ? 38.972 -4.649  -7.565  1.00 30.83 ? 1141 HIS C O   1 
ATOM   1624 C CB  . HIS C 1 68  ? 41.930 -3.968  -8.053  1.00 35.45 ? 1141 HIS C CB  1 
ATOM   1625 C CG  . HIS C 1 68  ? 42.602 -5.250  -7.675  1.00 34.87 ? 1141 HIS C CG  1 
ATOM   1626 N ND1 . HIS C 1 68  ? 43.325 -6.002  -8.573  1.00 33.46 ? 1141 HIS C ND1 1 
ATOM   1627 C CD2 . HIS C 1 68  ? 42.645 -5.921  -6.499  1.00 34.49 ? 1141 HIS C CD2 1 
ATOM   1628 C CE1 . HIS C 1 68  ? 43.793 -7.079  -7.967  1.00 38.56 ? 1141 HIS C CE1 1 
ATOM   1629 N NE2 . HIS C 1 68  ? 43.399 -7.051  -6.706  1.00 37.84 ? 1141 HIS C NE2 1 
ATOM   1630 N N   . LEU C 1 69  ? 39.565 -6.253  -9.026  1.00 29.96 ? 1142 LEU C N   1 
ATOM   1631 C CA  . LEU C 1 69  ? 38.557 -7.187  -8.540  1.00 30.37 ? 1142 LEU C CA  1 
ATOM   1632 C C   . LEU C 1 69  ? 39.194 -8.371  -7.842  1.00 29.44 ? 1142 LEU C C   1 
ATOM   1633 O O   . LEU C 1 69  ? 40.135 -8.982  -8.376  1.00 28.89 ? 1142 LEU C O   1 
ATOM   1634 C CB  . LEU C 1 69  ? 37.685 -7.677  -9.705  1.00 31.81 ? 1142 LEU C CB  1 
ATOM   1635 C CG  . LEU C 1 69  ? 36.906 -6.545  -10.396 1.00 32.22 ? 1142 LEU C CG  1 
ATOM   1636 C CD1 . LEU C 1 69  ? 35.944 -7.073  -11.427 1.00 34.67 ? 1142 LEU C CD1 1 
ATOM   1637 C CD2 . LEU C 1 69  ? 36.191 -5.700  -9.357  1.00 33.17 ? 1142 LEU C CD2 1 
ATOM   1638 N N   . TYR C 1 70  ? 38.689 -8.700  -6.651  1.00 26.75 ? 1143 TYR C N   1 
ATOM   1639 C CA  . TYR C 1 70  ? 39.133 -9.908  -5.956  1.00 26.88 ? 1143 TYR C CA  1 
ATOM   1640 C C   . TYR C 1 70  ? 38.302 -11.097 -6.412  1.00 23.96 ? 1143 TYR C C   1 
ATOM   1641 O O   . TYR C 1 70  ? 37.098 -10.972 -6.656  1.00 26.67 ? 1143 TYR C O   1 
ATOM   1642 C CB  . TYR C 1 70  ? 38.991 -9.732  -4.443  1.00 23.37 ? 1143 TYR C CB  1 
ATOM   1643 C CG  . TYR C 1 70  ? 39.892 -8.677  -3.854  1.00 26.55 ? 1143 TYR C CG  1 
ATOM   1644 C CD1 . TYR C 1 70  ? 41.085 -9.026  -3.226  1.00 27.48 ? 1143 TYR C CD1 1 
ATOM   1645 C CD2 . TYR C 1 70  ? 39.557 -7.326  -3.923  1.00 24.88 ? 1143 TYR C CD2 1 
ATOM   1646 C CE1 . TYR C 1 70  ? 41.910 -8.052  -2.671  1.00 26.96 ? 1143 TYR C CE1 1 
ATOM   1647 C CE2 . TYR C 1 70  ? 40.392 -6.349  -3.393  1.00 27.72 ? 1143 TYR C CE2 1 
ATOM   1648 C CZ  . TYR C 1 70  ? 41.564 -6.727  -2.771  1.00 26.83 ? 1143 TYR C CZ  1 
ATOM   1649 O OH  . TYR C 1 70  ? 42.379 -5.759  -2.228  1.00 28.51 ? 1143 TYR C OH  1 
ATOM   1650 N N   . LEU C 1 71  ? 38.938 -12.247 -6.544  1.00 24.50 ? 1144 LEU C N   1 
ATOM   1651 C CA  . LEU C 1 71  ? 38.204 -13.477 -6.748  1.00 23.20 ? 1144 LEU C CA  1 
ATOM   1652 C C   . LEU C 1 71  ? 37.836 -14.074 -5.397  1.00 22.76 ? 1144 LEU C C   1 
ATOM   1653 O O   . LEU C 1 71  ? 38.719 -14.293 -4.550  1.00 22.21 ? 1144 LEU C O   1 
ATOM   1654 C CB  . LEU C 1 71  ? 39.056 -14.469 -7.536  1.00 24.44 ? 1144 LEU C CB  1 
ATOM   1655 C CG  . LEU C 1 71  ? 38.450 -15.857 -7.720  1.00 26.21 ? 1144 LEU C CG  1 
ATOM   1656 C CD1 . LEU C 1 71  ? 37.078 -15.779 -8.428  1.00 28.01 ? 1144 LEU C CD1 1 
ATOM   1657 C CD2 . LEU C 1 71  ? 39.409 -16.736 -8.503  1.00 26.09 ? 1144 LEU C CD2 1 
ATOM   1658 N N   . VAL C 1 72  ? 36.550 -14.346 -5.176  1.00 20.73 ? 1145 VAL C N   1 
ATOM   1659 C CA  . VAL C 1 72  ? 36.152 -15.019 -3.931  1.00 23.00 ? 1145 VAL C CA  1 
ATOM   1660 C C   . VAL C 1 72  ? 35.445 -16.351 -4.201  1.00 22.51 ? 1145 VAL C C   1 
ATOM   1661 O O   . VAL C 1 72  ? 34.806 -16.534 -5.249  1.00 25.24 ? 1145 VAL C O   1 
ATOM   1662 C CB  . VAL C 1 72  ? 35.253 -14.136 -3.029  1.00 23.91 ? 1145 VAL C CB  1 
ATOM   1663 C CG1 . VAL C 1 72  ? 35.948 -12.817 -2.692  1.00 22.84 ? 1145 VAL C CG1 1 
ATOM   1664 C CG2 . VAL C 1 72  ? 33.882 -13.908 -3.687  1.00 23.56 ? 1145 VAL C CG2 1 
ATOM   1665 N N   . LEU C 1 73  ? 35.584 -17.271 -3.255  1.00 21.74 ? 1146 LEU C N   1 
ATOM   1666 C CA  . LEU C 1 73  ? 34.920 -18.569 -3.247  1.00 20.37 ? 1146 LEU C CA  1 
ATOM   1667 C C   . LEU C 1 73  ? 34.003 -18.594 -2.024  1.00 21.32 ? 1146 LEU C C   1 
ATOM   1668 O O   . LEU C 1 73  ? 34.461 -18.527 -0.887  1.00 19.92 ? 1146 LEU C O   1 
ATOM   1669 C CB  . LEU C 1 73  ? 35.960 -19.687 -3.161  1.00 21.20 ? 1146 LEU C CB  1 
ATOM   1670 C CG  . LEU C 1 73  ? 35.398 -21.110 -3.064  1.00 22.31 ? 1146 LEU C CG  1 
ATOM   1671 C CD1 . LEU C 1 73  ? 34.571 -21.419 -4.322  1.00 23.16 ? 1146 LEU C CD1 1 
ATOM   1672 C CD2 . LEU C 1 73  ? 36.551 -22.048 -2.950  1.00 25.09 ? 1146 LEU C CD2 1 
ATOM   1673 N N   . PHE C 1 74  ? 32.696 -18.634 -2.248  1.00 20.25 ? 1147 PHE C N   1 
ATOM   1674 C CA  . PHE C 1 74  ? 31.760 -18.632 -1.127  1.00 19.98 ? 1147 PHE C CA  1 
ATOM   1675 C C   . PHE C 1 74  ? 31.774 -19.943 -0.349  1.00 21.47 ? 1147 PHE C C   1 
ATOM   1676 O O   . PHE C 1 74  ? 32.032 -21.012 -0.908  1.00 20.66 ? 1147 PHE C O   1 
ATOM   1677 C CB  . PHE C 1 74  ? 30.338 -18.345 -1.624  1.00 20.88 ? 1147 PHE C CB  1 
ATOM   1678 C CG  . PHE C 1 74  ? 30.167 -16.952 -2.134  1.00 23.88 ? 1147 PHE C CG  1 
ATOM   1679 C CD1 . PHE C 1 74  ? 30.028 -15.895 -1.254  1.00 20.85 ? 1147 PHE C CD1 1 
ATOM   1680 C CD2 . PHE C 1 74  ? 30.147 -16.694 -3.483  1.00 24.38 ? 1147 PHE C CD2 1 
ATOM   1681 C CE1 . PHE C 1 74  ? 29.887 -14.597 -1.718  1.00 22.67 ? 1147 PHE C CE1 1 
ATOM   1682 C CE2 . PHE C 1 74  ? 29.988 -15.390 -3.949  1.00 26.11 ? 1147 PHE C CE2 1 
ATOM   1683 C CZ  . PHE C 1 74  ? 29.862 -14.348 -3.066  1.00 22.55 ? 1147 PHE C CZ  1 
ATOM   1684 N N   . PHE C 1 75  ? 31.490 -19.862 0.947   1.00 17.52 ? 1148 PHE C N   1 
ATOM   1685 C CA  . PHE C 1 75  ? 31.279 -21.050 1.745   1.00 18.82 ? 1148 PHE C CA  1 
ATOM   1686 C C   . PHE C 1 75  ? 29.836 -21.560 1.646   1.00 18.39 ? 1148 PHE C C   1 
ATOM   1687 O O   . PHE C 1 75  ? 29.327 -22.154 2.580   1.00 21.22 ? 1148 PHE C O   1 
ATOM   1688 C CB  . PHE C 1 75  ? 31.666 -20.803 3.215   1.00 16.67 ? 1148 PHE C CB  1 
ATOM   1689 C CG  . PHE C 1 75  ? 33.163 -20.700 3.424   1.00 17.17 ? 1148 PHE C CG  1 
ATOM   1690 C CD1 . PHE C 1 75  ? 33.922 -21.834 3.563   1.00 19.52 ? 1148 PHE C CD1 1 
ATOM   1691 C CD2 . PHE C 1 75  ? 33.791 -19.455 3.461   1.00 19.00 ? 1148 PHE C CD2 1 
ATOM   1692 C CE1 . PHE C 1 75  ? 35.322 -21.743 3.774   1.00 19.99 ? 1148 PHE C CE1 1 
ATOM   1693 C CE2 . PHE C 1 75  ? 35.160 -19.349 3.672   1.00 16.89 ? 1148 PHE C CE2 1 
ATOM   1694 C CZ  . PHE C 1 75  ? 35.934 -20.505 3.802   1.00 19.29 ? 1148 PHE C CZ  1 
ATOM   1695 N N   . ASP C 1 76  ? 29.183 -21.325 0.515   1.00 19.73 ? 1149 ASP C N   1 
ATOM   1696 C CA  . ASP C 1 76  ? 27.859 -21.896 0.315   1.00 21.65 ? 1149 ASP C CA  1 
ATOM   1697 C C   . ASP C 1 76  ? 27.956 -23.402 -0.046  1.00 27.86 ? 1149 ASP C C   1 
ATOM   1698 O O   . ASP C 1 76  ? 29.058 -23.954 -0.197  1.00 26.39 ? 1149 ASP C O   1 
ATOM   1699 C CB  . ASP C 1 76  ? 27.076 -21.114 -0.751  1.00 22.48 ? 1149 ASP C CB  1 
ATOM   1700 C CG  . ASP C 1 76  ? 27.817 -21.017 -2.105  1.00 25.09 ? 1149 ASP C CG  1 
ATOM   1701 O OD1 . ASP C 1 76  ? 29.034 -21.309 -2.194  1.00 24.25 ? 1149 ASP C OD1 1 
ATOM   1702 O OD2 . ASP C 1 76  ? 27.175 -20.606 -3.085  1.00 27.14 ? 1149 ASP C OD2 1 
ATOM   1703 N N   . ASN C 1 77  ? 26.809 -24.063 -0.185  1.00 27.14 ? 1150 ASN C N   1 
ATOM   1704 C CA  . ASN C 1 77  ? 26.811 -25.512 -0.412  1.00 32.09 ? 1150 ASN C CA  1 
ATOM   1705 C C   . ASN C 1 77  ? 27.579 -25.912 -1.666  1.00 30.72 ? 1150 ASN C C   1 
ATOM   1706 O O   . ASN C 1 77  ? 28.364 -26.855 -1.644  1.00 37.40 ? 1150 ASN C O   1 
ATOM   1707 C CB  . ASN C 1 77  ? 25.389 -26.049 -0.505  1.00 33.28 ? 1150 ASN C CB  1 
ATOM   1708 C CG  . ASN C 1 77  ? 24.687 -26.043 0.816   1.00 38.34 ? 1150 ASN C CG  1 
ATOM   1709 O OD1 . ASN C 1 77  ? 25.313 -25.871 1.863   1.00 37.29 ? 1150 ASN C OD1 1 
ATOM   1710 N ND2 . ASN C 1 77  ? 23.371 -26.256 0.787   1.00 42.32 ? 1150 ASN C ND2 1 
ATOM   1711 N N   . LYS C 1 78  ? 27.352 -25.193 -2.756  1.00 31.63 ? 1151 LYS C N   1 
ATOM   1712 C CA  . LYS C 1 78  ? 28.013 -25.499 -4.027  1.00 33.54 ? 1151 LYS C CA  1 
ATOM   1713 C C   . LYS C 1 78  ? 29.446 -24.970 -4.135  1.00 32.80 ? 1151 LYS C C   1 
ATOM   1714 O O   . LYS C 1 78  ? 30.166 -25.319 -5.072  1.00 33.63 ? 1151 LYS C O   1 
ATOM   1715 C CB  . LYS C 1 78  ? 27.190 -24.941 -5.184  1.00 37.48 ? 1151 LYS C CB  1 
ATOM   1716 C CG  . LYS C 1 78  ? 25.743 -25.404 -5.178  1.00 43.45 ? 1151 LYS C CG  1 
ATOM   1717 C CD  . LYS C 1 78  ? 25.030 -24.938 -6.435  1.00 50.81 ? 1151 LYS C CD  1 
ATOM   1718 C CE  . LYS C 1 78  ? 23.673 -25.610 -6.579  1.00 55.32 ? 1151 LYS C CE  1 
ATOM   1719 N NZ  . LYS C 1 78  ? 22.676 -24.996 -5.664  1.00 57.42 ? 1151 LYS C NZ  1 
ATOM   1720 N N   . ARG C 1 79  ? 29.857 -24.113 -3.199  1.00 29.22 ? 1152 ARG C N   1 
ATOM   1721 C CA  . ARG C 1 79  ? 31.162 -23.442 -3.292  1.00 26.58 ? 1152 ARG C CA  1 
ATOM   1722 C C   . ARG C 1 79  ? 31.269 -22.700 -4.622  1.00 26.56 ? 1152 ARG C C   1 
ATOM   1723 O O   . ARG C 1 79  ? 32.010 -23.110 -5.538  1.00 26.86 ? 1152 ARG C O   1 
ATOM   1724 C CB  . ARG C 1 79  ? 32.323 -24.431 -3.146  1.00 28.43 ? 1152 ARG C CB  1 
ATOM   1725 C CG  . ARG C 1 79  ? 32.356 -25.209 -1.833  1.00 32.09 ? 1152 ARG C CG  1 
ATOM   1726 C CD  . ARG C 1 79  ? 32.384 -24.272 -0.620  1.00 29.63 ? 1152 ARG C CD  1 
ATOM   1727 N NE  . ARG C 1 79  ? 33.678 -23.634 -0.320  1.00 28.93 ? 1152 ARG C NE  1 
ATOM   1728 C CZ  . ARG C 1 79  ? 34.749 -24.265 0.164   1.00 31.65 ? 1152 ARG C CZ  1 
ATOM   1729 N NH1 . ARG C 1 79  ? 34.730 -25.583 0.348   1.00 31.94 ? 1152 ARG C NH1 1 
ATOM   1730 N NH2 . ARG C 1 79  ? 35.861 -23.583 0.445   1.00 24.45 ? 1152 ARG C NH2 1 
ATOM   1731 N N   . THR C 1 80  ? 30.512 -21.614 -4.738  1.00 25.76 ? 1153 THR C N   1 
ATOM   1732 C CA  . THR C 1 80  ? 30.495 -20.808 -5.952  1.00 26.99 ? 1153 THR C CA  1 
ATOM   1733 C C   . THR C 1 80  ? 31.470 -19.602 -5.923  1.00 28.95 ? 1153 THR C C   1 
ATOM   1734 O O   . THR C 1 80  ? 31.888 -19.162 -4.851  1.00 26.51 ? 1153 THR C O   1 
ATOM   1735 C CB  . THR C 1 80  ? 29.081 -20.314 -6.255  1.00 29.10 ? 1153 THR C CB  1 
ATOM   1736 O OG1 . THR C 1 80  ? 28.625 -19.496 -5.183  1.00 30.02 ? 1153 THR C OG1 1 
ATOM   1737 C CG2 . THR C 1 80  ? 28.115 -21.502 -6.419  1.00 32.64 ? 1153 THR C CG2 1 
ATOM   1738 N N   . TRP C 1 81  ? 31.785 -19.082 -7.107  1.00 27.18 ? 1154 TRP C N   1 
ATOM   1739 C CA  . TRP C 1 81  ? 32.805 -18.042 -7.349  1.00 25.52 ? 1154 TRP C CA  1 
ATOM   1740 C C   . TRP C 1 81  ? 32.189 -16.693 -7.719  1.00 29.49 ? 1154 TRP C C   1 
ATOM   1741 O O   . TRP C 1 81  ? 31.105 -16.641 -8.291  1.00 30.39 ? 1154 TRP C O   1 
ATOM   1742 C CB  . TRP C 1 81  ? 33.715 -18.466 -8.535  1.00 26.35 ? 1154 TRP C CB  1 
ATOM   1743 C CG  . TRP C 1 81  ? 34.425 -19.765 -8.359  1.00 26.52 ? 1154 TRP C CG  1 
ATOM   1744 C CD1 . TRP C 1 81  ? 33.976 -21.017 -8.715  1.00 28.89 ? 1154 TRP C CD1 1 
ATOM   1745 C CD2 . TRP C 1 81  ? 35.715 -19.955 -7.764  1.00 25.26 ? 1154 TRP C CD2 1 
ATOM   1746 N NE1 . TRP C 1 81  ? 34.912 -21.966 -8.369  1.00 31.29 ? 1154 TRP C NE1 1 
ATOM   1747 C CE2 . TRP C 1 81  ? 35.985 -21.338 -7.786  1.00 25.58 ? 1154 TRP C CE2 1 
ATOM   1748 C CE3 . TRP C 1 81  ? 36.665 -19.085 -7.211  1.00 24.18 ? 1154 TRP C CE3 1 
ATOM   1749 C CZ2 . TRP C 1 81  ? 37.170 -21.872 -7.291  1.00 27.78 ? 1154 TRP C CZ2 1 
ATOM   1750 C CZ3 . TRP C 1 81  ? 37.834 -19.612 -6.717  1.00 20.87 ? 1154 TRP C CZ3 1 
ATOM   1751 C CH2 . TRP C 1 81  ? 38.081 -20.996 -6.764  1.00 24.98 ? 1154 TRP C CH2 1 
ATOM   1752 N N   . GLN C 1 82  ? 32.877 -15.599 -7.395  1.00 24.83 ? 1155 GLN C N   1 
ATOM   1753 C CA  . GLN C 1 82  ? 32.498 -14.270 -7.897  1.00 27.97 ? 1155 GLN C CA  1 
ATOM   1754 C C   . GLN C 1 82  ? 33.677 -13.329 -7.797  1.00 29.05 ? 1155 GLN C C   1 
ATOM   1755 O O   . GLN C 1 82  ? 34.604 -13.561 -7.009  1.00 26.89 ? 1155 GLN C O   1 
ATOM   1756 C CB  . GLN C 1 82  ? 31.314 -13.674 -7.139  1.00 31.18 ? 1155 GLN C CB  1 
ATOM   1757 C CG  . GLN C 1 82  ? 29.985 -13.754 -7.887  1.00 41.13 ? 1155 GLN C CG  1 
ATOM   1758 C CD  . GLN C 1 82  ? 30.031 -13.101 -9.267  1.00 41.92 ? 1155 GLN C CD  1 
ATOM   1759 O OE1 . GLN C 1 82  ? 30.992 -12.418 -9.619  1.00 37.67 ? 1155 GLN C OE1 1 
ATOM   1760 N NE2 . GLN C 1 82  ? 28.979 -13.303 -10.045 1.00 42.44 ? 1155 GLN C NE2 1 
ATOM   1761 N N   . TRP C 1 83  ? 33.629 -12.270 -8.596  1.00 31.22 ? 1156 TRP C N   1 
ATOM   1762 C CA  . TRP C 1 83  ? 34.640 -11.230 -8.611  1.00 28.31 ? 1156 TRP C CA  1 
ATOM   1763 C C   . TRP C 1 83  ? 34.034 -9.967  -8.014  1.00 31.56 ? 1156 TRP C C   1 
ATOM   1764 O O   . TRP C 1 83  ? 32.980 -9.495  -8.457  1.00 32.19 ? 1156 TRP C O   1 
ATOM   1765 C CB  . TRP C 1 83  ? 35.109 -10.966 -10.063 1.00 28.15 ? 1156 TRP C CB  1 
ATOM   1766 C CG  . TRP C 1 83  ? 35.877 -12.128 -10.707 1.00 27.58 ? 1156 TRP C CG  1 
ATOM   1767 C CD1 . TRP C 1 83  ? 35.358 -13.166 -11.421 1.00 28.90 ? 1156 TRP C CD1 1 
ATOM   1768 C CD2 . TRP C 1 83  ? 37.294 -12.332 -10.682 1.00 25.32 ? 1156 TRP C CD2 1 
ATOM   1769 N NE1 . TRP C 1 83  ? 36.363 -14.011 -11.832 1.00 26.51 ? 1156 TRP C NE1 1 
ATOM   1770 C CE2 . TRP C 1 83  ? 37.560 -13.522 -11.387 1.00 27.99 ? 1156 TRP C CE2 1 
ATOM   1771 C CE3 . TRP C 1 83  ? 38.359 -11.630 -10.119 1.00 24.73 ? 1156 TRP C CE3 1 
ATOM   1772 C CZ2 . TRP C 1 83  ? 38.853 -14.018 -11.559 1.00 30.19 ? 1156 TRP C CZ2 1 
ATOM   1773 C CZ3 . TRP C 1 83  ? 39.633 -12.120 -10.283 1.00 30.13 ? 1156 TRP C CZ3 1 
ATOM   1774 C CH2 . TRP C 1 83  ? 39.872 -13.310 -10.996 1.00 26.45 ? 1156 TRP C CH2 1 
ATOM   1775 N N   . LEU C 1 84  ? 34.701 -9.408  -7.012  1.00 27.53 ? 1157 LEU C N   1 
ATOM   1776 C CA  . LEU C 1 84  ? 34.171 -8.255  -6.306  1.00 26.69 ? 1157 LEU C CA  1 
ATOM   1777 C C   . LEU C 1 84  ? 35.279 -7.283  -6.020  1.00 28.18 ? 1157 LEU C C   1 
ATOM   1778 O O   . LEU C 1 84  ? 36.407 -7.698  -5.762  1.00 27.74 ? 1157 LEU C O   1 
ATOM   1779 C CB  . LEU C 1 84  ? 33.583 -8.699  -4.969  1.00 22.30 ? 1157 LEU C CB  1 
ATOM   1780 C CG  . LEU C 1 84  ? 32.389 -9.653  -5.104  1.00 26.50 ? 1157 LEU C CG  1 
ATOM   1781 C CD1 . LEU C 1 84  ? 31.973 -10.176 -3.739  1.00 27.76 ? 1157 LEU C CD1 1 
ATOM   1782 C CD2 . LEU C 1 84  ? 31.230 -8.893  -5.736  1.00 26.69 ? 1157 LEU C CD2 1 
ATOM   1783 N N   . PRO C 1 85  ? 34.955 -5.983  -6.015  1.00 28.88 ? 1158 PRO C N   1 
ATOM   1784 C CA  . PRO C 1 85  ? 35.929 -4.950  -5.663  1.00 27.26 ? 1158 PRO C CA  1 
ATOM   1785 C C   . PRO C 1 85  ? 36.052 -4.851  -4.159  1.00 30.29 ? 1158 PRO C C   1 
ATOM   1786 O O   . PRO C 1 85  ? 35.210 -5.391  -3.415  1.00 28.18 ? 1158 PRO C O   1 
ATOM   1787 C CB  . PRO C 1 85  ? 35.279 -3.679  -6.207  1.00 31.44 ? 1158 PRO C CB  1 
ATOM   1788 C CG  . PRO C 1 85  ? 33.798 -3.979  -6.045  1.00 29.84 ? 1158 PRO C CG  1 
ATOM   1789 C CD  . PRO C 1 85  ? 33.690 -5.399  -6.505  1.00 30.17 ? 1158 PRO C CD  1 
ATOM   1790 N N   . ARG C 1 86  ? 37.101 -4.165  -3.713  1.00 27.37 ? 1159 ARG C N   1 
ATOM   1791 C CA  . ARG C 1 86  ? 37.390 -4.002  -2.303  1.00 29.28 ? 1159 ARG C CA  1 
ATOM   1792 C C   . ARG C 1 86  ? 36.210 -3.424  -1.475  1.00 28.70 ? 1159 ARG C C   1 
ATOM   1793 O O   . ARG C 1 86  ? 36.046 -3.752  -0.304  1.00 28.45 ? 1159 ARG C O   1 
ATOM   1794 C CB  . ARG C 1 86  ? 38.634 -3.123  -2.145  1.00 27.81 ? 1159 ARG C CB  1 
ATOM   1795 C CG  . ARG C 1 86  ? 38.943 -2.791  -0.706  1.00 32.90 ? 1159 ARG C CG  1 
ATOM   1796 C CD  . ARG C 1 86  ? 39.559 -4.008  -0.064  1.00 32.68 ? 1159 ARG C CD  1 
ATOM   1797 N NE  . ARG C 1 86  ? 39.833 -3.839  1.352   1.00 33.91 ? 1159 ARG C NE  1 
ATOM   1798 C CZ  . ARG C 1 86  ? 38.898 -3.871  2.293   1.00 35.14 ? 1159 ARG C CZ  1 
ATOM   1799 N NH1 . ARG C 1 86  ? 39.235 -3.714  3.563   1.00 35.91 ? 1159 ARG C NH1 1 
ATOM   1800 N NH2 . ARG C 1 86  ? 37.619 -4.039  1.948   1.00 31.39 ? 1159 ARG C NH2 1 
ATOM   1801 N N   . THR C 1 87  ? 35.396 -2.567  -2.093  1.00 29.83 ? 1160 THR C N   1 
ATOM   1802 C CA  . THR C 1 87  ? 34.255 -1.967  -1.414  1.00 30.30 ? 1160 THR C CA  1 
ATOM   1803 C C   . THR C 1 87  ? 33.154 -2.957  -1.048  1.00 30.57 ? 1160 THR C C   1 
ATOM   1804 O O   . THR C 1 87  ? 32.280 -2.631  -0.249  1.00 32.15 ? 1160 THR C O   1 
ATOM   1805 C CB  . THR C 1 87  ? 33.607 -0.813  -2.270  1.00 33.23 ? 1160 THR C CB  1 
ATOM   1806 O OG1 . THR C 1 87  ? 33.304 -1.298  -3.583  1.00 32.99 ? 1160 THR C OG1 1 
ATOM   1807 C CG2 . THR C 1 87  ? 34.553 0.376   -2.397  1.00 36.35 ? 1160 THR C CG2 1 
ATOM   1808 N N   . LYS C 1 88  ? 33.191 -4.150  -1.630  1.00 27.77 ? 1161 LYS C N   1 
ATOM   1809 C CA  . LYS C 1 88  ? 32.173 -5.171  -1.385  1.00 27.07 ? 1161 LYS C CA  1 
ATOM   1810 C C   . LYS C 1 88  ? 32.692 -6.240  -0.418  1.00 27.46 ? 1161 LYS C C   1 
ATOM   1811 O O   . LYS C 1 88  ? 31.989 -7.200  -0.104  1.00 26.13 ? 1161 LYS C O   1 
ATOM   1812 C CB  . LYS C 1 88  ? 31.739 -5.837  -2.702  1.00 28.74 ? 1161 LYS C CB  1 
ATOM   1813 C CG  . LYS C 1 88  ? 31.035 -4.906  -3.695  1.00 33.72 ? 1161 LYS C CG  1 
ATOM   1814 C CD  . LYS C 1 88  ? 29.839 -4.203  -3.061  1.00 34.05 ? 1161 LYS C CD  1 
ATOM   1815 C CE  . LYS C 1 88  ? 29.192 -3.240  -4.057  1.00 42.13 ? 1161 LYS C CE  1 
ATOM   1816 N NZ  . LYS C 1 88  ? 28.202 -2.347  -3.384  1.00 47.58 ? 1161 LYS C NZ  1 
ATOM   1817 N N   . LEU C 1 89  ? 33.922 -6.075  0.055   1.00 24.94 ? 1162 LEU C N   1 
ATOM   1818 C CA  . LEU C 1 89  ? 34.502 -7.032  0.991   1.00 25.02 ? 1162 LEU C CA  1 
ATOM   1819 C C   . LEU C 1 89  ? 34.777 -6.439  2.363   1.00 27.37 ? 1162 LEU C C   1 
ATOM   1820 O O   . LEU C 1 89  ? 35.203 -5.282  2.487   1.00 26.07 ? 1162 LEU C O   1 
ATOM   1821 C CB  . LEU C 1 89  ? 35.798 -7.618  0.415   1.00 22.14 ? 1162 LEU C CB  1 
ATOM   1822 C CG  . LEU C 1 89  ? 35.657 -8.145  -1.000  1.00 21.86 ? 1162 LEU C CG  1 
ATOM   1823 C CD1 . LEU C 1 89  ? 37.045 -8.529  -1.528  1.00 25.48 ? 1162 LEU C CD1 1 
ATOM   1824 C CD2 . LEU C 1 89  ? 34.702 -9.325  -1.081  1.00 24.37 ? 1162 LEU C CD2 1 
ATOM   1825 N N   . VAL C 1 90  ? 34.512 -7.228  3.398   1.00 22.22 ? 1163 VAL C N   1 
ATOM   1826 C CA  . VAL C 1 90  ? 34.866 -6.847  4.768   1.00 24.32 ? 1163 VAL C CA  1 
ATOM   1827 C C   . VAL C 1 90  ? 35.530 -8.061  5.432   1.00 22.84 ? 1163 VAL C C   1 
ATOM   1828 O O   . VAL C 1 90  ? 35.004 -9.154  5.378   1.00 21.24 ? 1163 VAL C O   1 
ATOM   1829 C CB  . VAL C 1 90  ? 33.592 -6.390  5.568   1.00 26.93 ? 1163 VAL C CB  1 
ATOM   1830 C CG1 . VAL C 1 90  ? 33.886 -6.260  7.029   1.00 28.79 ? 1163 VAL C CG1 1 
ATOM   1831 C CG2 . VAL C 1 90  ? 33.054 -5.033  5.023   1.00 27.17 ? 1163 VAL C CG2 1 
ATOM   1832 N N   . PRO C 1 91  ? 36.685 -7.872  6.085   1.00 23.95 ? 1164 PRO C N   1 
ATOM   1833 C CA  . PRO C 1 91  ? 37.291 -9.017  6.769   1.00 22.17 ? 1164 PRO C CA  1 
ATOM   1834 C C   . PRO C 1 91  ? 36.359 -9.695  7.767   1.00 20.33 ? 1164 PRO C C   1 
ATOM   1835 O O   . PRO C 1 91  ? 35.645 -9.050  8.546   1.00 23.88 ? 1164 PRO C O   1 
ATOM   1836 C CB  . PRO C 1 91  ? 38.501 -8.393  7.491   1.00 25.63 ? 1164 PRO C CB  1 
ATOM   1837 C CG  . PRO C 1 91  ? 38.876 -7.240  6.611   1.00 26.12 ? 1164 PRO C CG  1 
ATOM   1838 C CD  . PRO C 1 91  ? 37.541 -6.673  6.160   1.00 26.94 ? 1164 PRO C CD  1 
ATOM   1839 N N   . LEU C 1 92  ? 36.385 -11.021 7.713   1.00 20.06 ? 1165 LEU C N   1 
ATOM   1840 C CA  . LEU C 1 92  ? 35.523 -11.883 8.498   1.00 21.51 ? 1165 LEU C CA  1 
ATOM   1841 C C   . LEU C 1 92  ? 36.322 -12.586 9.580   1.00 21.41 ? 1165 LEU C C   1 
ATOM   1842 O O   . LEU C 1 92  ? 37.460 -13.022 9.342   1.00 22.09 ? 1165 LEU C O   1 
ATOM   1843 C CB  . LEU C 1 92  ? 34.842 -12.917 7.571   1.00 16.92 ? 1165 LEU C CB  1 
ATOM   1844 C CG  . LEU C 1 92  ? 33.872 -13.892 8.249   1.00 18.74 ? 1165 LEU C CG  1 
ATOM   1845 C CD1 . LEU C 1 92  ? 32.792 -14.376 7.253   1.00 19.12 ? 1165 LEU C CD1 1 
ATOM   1846 C CD2 . LEU C 1 92  ? 34.606 -15.073 8.873   1.00 19.33 ? 1165 LEU C CD2 1 
ATOM   1847 N N   . GLY C 1 93  ? 35.726 -12.687 10.765  1.00 19.73 ? 1166 GLY C N   1 
ATOM   1848 C CA  . GLY C 1 93  ? 36.291 -13.413 11.895  1.00 21.59 ? 1166 GLY C CA  1 
ATOM   1849 C C   . GLY C 1 93  ? 37.308 -12.602 12.694  1.00 23.97 ? 1166 GLY C C   1 
ATOM   1850 O O   . GLY C 1 93  ? 38.084 -13.148 13.471  1.00 25.92 ? 1166 GLY C O   1 
ATOM   1851 N N   . VAL C 1 94  ? 37.278 -11.291 12.509  1.00 25.19 ? 1167 VAL C N   1 
ATOM   1852 C CA  . VAL C 1 94  ? 38.270 -10.392 13.107  1.00 28.88 ? 1167 VAL C CA  1 
ATOM   1853 C C   . VAL C 1 94  ? 37.649 -9.575  14.234  1.00 30.43 ? 1167 VAL C C   1 
ATOM   1854 O O   . VAL C 1 94  ? 38.308 -9.224  15.217  1.00 29.36 ? 1167 VAL C O   1 
ATOM   1855 C CB  . VAL C 1 94  ? 38.918 -9.515  11.998  1.00 26.22 ? 1167 VAL C CB  1 
ATOM   1856 C CG1 . VAL C 1 94  ? 39.764 -8.408  12.574  1.00 38.35 ? 1167 VAL C CG1 1 
ATOM   1857 C CG2 . VAL C 1 94  ? 39.784 -10.410 11.117  1.00 30.11 ? 1167 VAL C CG2 1 
ATOM   1858 N N   . ASN C 1 95  ? 36.357 -9.315  14.101  1.00 24.08 ? 1168 ASN C N   1 
ATOM   1859 C CA  . ASN C 1 95  ? 35.619 -8.498  15.056  1.00 25.64 ? 1168 ASN C CA  1 
ATOM   1860 C C   . ASN C 1 95  ? 34.277 -9.201  15.270  1.00 25.23 ? 1168 ASN C C   1 
ATOM   1861 O O   . ASN C 1 95  ? 33.462 -9.279  14.346  1.00 24.48 ? 1168 ASN C O   1 
ATOM   1862 C CB  . ASN C 1 95  ? 35.455 -7.109  14.439  1.00 29.07 ? 1168 ASN C CB  1 
ATOM   1863 C CG  . ASN C 1 95  ? 34.600 -6.160  15.260  1.00 30.20 ? 1168 ASN C CG  1 
ATOM   1864 O OD1 . ASN C 1 95  ? 33.748 -6.558  16.062  1.00 28.18 ? 1168 ASN C OD1 1 
ATOM   1865 N ND2 . ASN C 1 95  ? 34.813 -4.863  15.025  1.00 36.82 ? 1168 ASN C ND2 1 
ATOM   1866 N N   . GLN C 1 96  ? 34.064 -9.712  16.480  1.00 25.53 ? 1169 GLN C N   1 
ATOM   1867 C CA  . GLN C 1 96  ? 32.917 -10.545 16.765  1.00 28.62 ? 1169 GLN C CA  1 
ATOM   1868 C C   . GLN C 1 96  ? 31.608 -9.789  16.630  1.00 25.29 ? 1169 GLN C C   1 
ATOM   1869 O O   . GLN C 1 96  ? 30.623 -10.321 16.116  1.00 23.09 ? 1169 GLN C O   1 
ATOM   1870 C CB  . GLN C 1 96  ? 33.030 -11.175 18.152  1.00 35.44 ? 1169 GLN C CB  1 
ATOM   1871 C CG  . GLN C 1 96  ? 33.768 -12.492 18.121  1.00 45.06 ? 1169 GLN C CG  1 
ATOM   1872 C CD  . GLN C 1 96  ? 33.528 -13.302 19.365  1.00 51.19 ? 1169 GLN C CD  1 
ATOM   1873 O OE1 . GLN C 1 96  ? 34.474 -13.776 19.998  1.00 60.30 ? 1169 GLN C OE1 1 
ATOM   1874 N NE2 . GLN C 1 96  ? 32.260 -13.461 19.737  1.00 49.58 ? 1169 GLN C NE2 1 
ATOM   1875 N N   . ASP C 1 97  ? 31.591 -8.539  17.086  1.00 25.34 ? 1170 ASP C N   1 
ATOM   1876 C CA  . ASP C 1 97  ? 30.363 -7.764  16.950  1.00 23.28 ? 1170 ASP C CA  1 
ATOM   1877 C C   . ASP C 1 97  ? 30.025 -7.383  15.498  1.00 20.62 ? 1170 ASP C C   1 
ATOM   1878 O O   . ASP C 1 97  ? 28.862 -7.436  15.093  1.00 21.79 ? 1170 ASP C O   1 
ATOM   1879 C CB  . ASP C 1 97  ? 30.327 -6.623  17.958  1.00 23.80 ? 1170 ASP C CB  1 
ATOM   1880 C CG  . ASP C 1 97  ? 30.245 -7.147  19.380  1.00 25.35 ? 1170 ASP C CG  1 
ATOM   1881 O OD1 . ASP C 1 97  ? 31.238 -7.017  20.102  1.00 33.56 ? 1170 ASP C OD1 1 
ATOM   1882 O OD2 . ASP C 1 97  ? 29.213 -7.755  19.754  1.00 33.96 ? 1170 ASP C OD2 1 
ATOM   1883 N N   . LEU C 1 98  ? 31.031 -7.090  14.684  1.00 21.59 ? 1171 LEU C N   1 
ATOM   1884 C CA  . LEU C 1 98  ? 30.804 -6.914  13.259  1.00 21.55 ? 1171 LEU C CA  1 
ATOM   1885 C C   . LEU C 1 98  ? 30.231 -8.191  12.608  1.00 21.54 ? 1171 LEU C C   1 
ATOM   1886 O O   . LEU C 1 98  ? 29.233 -8.127  11.871  1.00 19.30 ? 1171 LEU C O   1 
ATOM   1887 C CB  . LEU C 1 98  ? 32.100 -6.495  12.565  1.00 22.41 ? 1171 LEU C CB  1 
ATOM   1888 C CG  . LEU C 1 98  ? 32.030 -6.301  11.046  1.00 20.77 ? 1171 LEU C CG  1 
ATOM   1889 C CD1 . LEU C 1 98  ? 33.060 -5.283  10.601  1.00 29.69 ? 1171 LEU C CD1 1 
ATOM   1890 C CD2 . LEU C 1 98  ? 32.266 -7.664  10.313  1.00 24.23 ? 1171 LEU C CD2 1 
ATOM   1891 N N   . ASP C 1 99  ? 30.855 -9.337  12.890  1.00 20.26 ? 1172 ASP C N   1 
ATOM   1892 C CA  . ASP C 1 99  ? 30.365 -10.622 12.366  1.00 20.03 ? 1172 ASP C CA  1 
ATOM   1893 C C   . ASP C 1 99  ? 28.894 -10.841 12.790  1.00 22.65 ? 1172 ASP C C   1 
ATOM   1894 O O   . ASP C 1 99  ? 28.044 -11.250 11.987  1.00 20.37 ? 1172 ASP C O   1 
ATOM   1895 C CB  . ASP C 1 99  ? 31.233 -11.803 12.837  1.00 19.59 ? 1172 ASP C CB  1 
ATOM   1896 C CG  . ASP C 1 99  ? 32.640 -11.835 12.174  1.00 18.77 ? 1172 ASP C CG  1 
ATOM   1897 O OD1 . ASP C 1 99  ? 33.472 -12.595 12.693  1.00 25.26 ? 1172 ASP C OD1 1 
ATOM   1898 O OD2 . ASP C 1 99  ? 32.911 -11.116 11.186  1.00 20.12 ? 1172 ASP C OD2 1 
ATOM   1899 N N   . LYS C 1 100 ? 28.596 -10.577 14.064  1.00 20.61 ? 1173 LYS C N   1 
ATOM   1900 C CA  . LYS C 1 100 ? 27.240 -10.764 14.563  1.00 24.20 ? 1173 LYS C CA  1 
ATOM   1901 C C   . LYS C 1 100 ? 26.246 -9.838  13.864  1.00 21.19 ? 1173 LYS C C   1 
ATOM   1902 O O   . LYS C 1 100 ? 25.115 -10.245 13.543  1.00 22.37 ? 1173 LYS C O   1 
ATOM   1903 C CB  . LYS C 1 100 ? 27.190 -10.609 16.077  1.00 22.23 ? 1173 LYS C CB  1 
ATOM   1904 C CG  . LYS C 1 100 ? 27.605 -11.872 16.838  1.00 25.75 ? 1173 LYS C CG  1 
ATOM   1905 C CD  . LYS C 1 100 ? 27.734 -11.586 18.338  1.00 29.33 ? 1173 LYS C CD  1 
ATOM   1906 C CE  . LYS C 1 100 ? 28.266 -12.784 19.109  1.00 39.39 ? 1173 LYS C CE  1 
ATOM   1907 N NZ  . LYS C 1 100 ? 28.713 -12.380 20.477  1.00 43.23 ? 1173 LYS C NZ  1 
ATOM   1908 N N   . GLU C 1 101 ? 26.642 -8.598  13.616  1.00 21.49 ? 1174 GLU C N   1 
ATOM   1909 C CA  . GLU C 1 101 ? 25.790 -7.714  12.843  1.00 20.31 ? 1174 GLU C CA  1 
ATOM   1910 C C   . GLU C 1 101 ? 25.545 -8.270  11.418  1.00 26.77 ? 1174 GLU C C   1 
ATOM   1911 O O   . GLU C 1 101 ? 24.407 -8.310  10.932  1.00 22.61 ? 1174 GLU C O   1 
ATOM   1912 C CB  . GLU C 1 101 ? 26.383 -6.293  12.790  1.00 19.57 ? 1174 GLU C CB  1 
ATOM   1913 C CG  . GLU C 1 101 ? 25.637 -5.391  11.813  1.00 24.59 ? 1174 GLU C CG  1 
ATOM   1914 C CD  . GLU C 1 101 ? 26.279 -4.008  11.586  1.00 29.18 ? 1174 GLU C CD  1 
ATOM   1915 O OE1 . GLU C 1 101 ? 25.597 -3.157  10.971  1.00 28.40 ? 1174 GLU C OE1 1 
ATOM   1916 O OE2 . GLU C 1 101 ? 27.441 -3.771  12.014  1.00 26.67 ? 1174 GLU C OE2 1 
ATOM   1917 N N   . LYS C 1 102 ? 26.606 -8.704  10.743  1.00 20.41 ? 1175 LYS C N   1 
ATOM   1918 C CA  . LYS C 1 102 ? 26.476 -9.207  9.379   1.00 24.45 ? 1175 LYS C CA  1 
ATOM   1919 C C   . LYS C 1 102 ? 25.556 -10.417 9.325   1.00 23.15 ? 1175 LYS C C   1 
ATOM   1920 O O   . LYS C 1 102 ? 24.846 -10.616 8.341   1.00 25.40 ? 1175 LYS C O   1 
ATOM   1921 C CB  . LYS C 1 102 ? 27.835 -9.662  8.819   1.00 21.40 ? 1175 LYS C CB  1 
ATOM   1922 C CG  . LYS C 1 102 ? 28.869 -8.598  8.684   1.00 25.84 ? 1175 LYS C CG  1 
ATOM   1923 C CD  . LYS C 1 102 ? 28.421 -7.520  7.752   1.00 30.96 ? 1175 LYS C CD  1 
ATOM   1924 C CE  . LYS C 1 102 ? 29.584 -6.643  7.357   1.00 32.44 ? 1175 LYS C CE  1 
ATOM   1925 N NZ  . LYS C 1 102 ? 29.081 -5.434  6.680   1.00 35.08 ? 1175 LYS C NZ  1 
ATOM   1926 N N   . MET C 1 103 ? 25.643 -11.262 10.347  1.00 19.86 ? 1176 MET C N   1 
ATOM   1927 C CA  . MET C 1 103 ? 24.895 -12.504 10.376  1.00 23.22 ? 1176 MET C CA  1 
ATOM   1928 C C   . MET C 1 103 ? 23.394 -12.208 10.282  1.00 26.39 ? 1176 MET C C   1 
ATOM   1929 O O   . MET C 1 103 ? 22.630 -13.033 9.829   1.00 26.42 ? 1176 MET C O   1 
ATOM   1930 C CB  . MET C 1 103 ? 25.132 -13.207 11.698  1.00 22.71 ? 1176 MET C CB  1 
ATOM   1931 C CG  . MET C 1 103 ? 25.045 -14.673 11.614  1.00 31.05 ? 1176 MET C CG  1 
ATOM   1932 S SD  . MET C 1 103 ? 26.687 -15.296 11.171  1.00 32.36 ? 1176 MET C SD  1 
ATOM   1933 C CE  . MET C 1 103 ? 27.497 -15.037 12.747  1.00 28.45 ? 1176 MET C CE  1 
ATOM   1934 N N   . LEU C 1 104 ? 22.991 -11.028 10.733  1.00 23.13 ? 1177 LEU C N   1 
ATOM   1935 C CA  . LEU C 1 104 ? 21.583 -10.667 10.850  1.00 24.46 ? 1177 LEU C CA  1 
ATOM   1936 C C   . LEU C 1 104 ? 21.067 -9.934  9.630   1.00 27.86 ? 1177 LEU C C   1 
ATOM   1937 O O   . LEU C 1 104 ? 19.904 -9.523  9.614   1.00 31.45 ? 1177 LEU C O   1 
ATOM   1938 C CB  . LEU C 1 104 ? 21.349 -9.792  12.105  1.00 24.36 ? 1177 LEU C CB  1 
ATOM   1939 C CG  . LEU C 1 104 ? 21.581 -10.438 13.485  1.00 26.46 ? 1177 LEU C CG  1 
ATOM   1940 C CD1 . LEU C 1 104 ? 21.623 -9.395  14.602  1.00 25.73 ? 1177 LEU C CD1 1 
ATOM   1941 C CD2 . LEU C 1 104 ? 20.554 -11.558 13.836  1.00 27.14 ? 1177 LEU C CD2 1 
ATOM   1942 N N   . GLU C 1 105 ? 21.914 -9.757  8.613   1.00 26.07 ? 1178 GLU C N   1 
ATOM   1943 C CA  . GLU C 1 105 ? 21.550 -9.007  7.423   1.00 26.74 ? 1178 GLU C CA  1 
ATOM   1944 C C   . GLU C 1 105 ? 20.380 -9.623  6.637   1.00 29.32 ? 1178 GLU C C   1 
ATOM   1945 O O   . GLU C 1 105 ? 19.545 -8.901  6.095   1.00 26.80 ? 1178 GLU C O   1 
ATOM   1946 C CB  . GLU C 1 105 ? 22.763 -8.904  6.492   1.00 31.21 ? 1178 GLU C CB  1 
ATOM   1947 C CG  . GLU C 1 105 ? 22.830 -7.658  5.667   1.00 32.93 ? 1178 GLU C CG  1 
ATOM   1948 C CD  . GLU C 1 105 ? 24.112 -7.578  4.876   1.00 30.09 ? 1178 GLU C CD  1 
ATOM   1949 O OE1 . GLU C 1 105 ? 25.181 -7.381  5.485   1.00 34.49 ? 1178 GLU C OE1 1 
ATOM   1950 O OE2 . GLU C 1 105 ? 24.049 -7.703  3.647   1.00 34.12 ? 1178 GLU C OE2 1 
ATOM   1951 N N   . GLY C 1 106 ? 20.360 -10.947 6.546   1.00 25.50 ? 1179 GLY C N   1 
ATOM   1952 C CA  . GLY C 1 106 ? 19.375 -11.652 5.741   1.00 29.42 ? 1179 GLY C CA  1 
ATOM   1953 C C   . GLY C 1 106 ? 17.952 -11.271 6.132   1.00 30.41 ? 1179 GLY C C   1 
ATOM   1954 O O   . GLY C 1 106 ? 17.623 -11.160 7.318   1.00 26.88 ? 1179 GLY C O   1 
ATOM   1955 N N   . ARG C 1 107 ? 17.093 -11.061 5.143   1.00 33.13 ? 1180 ARG C N   1 
ATOM   1956 C CA  . ARG C 1 107 ? 15.742 -10.589 5.473   1.00 30.72 ? 1180 ARG C CA  1 
ATOM   1957 C C   . ARG C 1 107 ? 14.814 -11.690 5.932   1.00 33.84 ? 1180 ARG C C   1 
ATOM   1958 O O   . ARG C 1 107 ? 13.863 -11.427 6.673   1.00 36.96 ? 1180 ARG C O   1 
ATOM   1959 C CB  . ARG C 1 107 ? 15.121 -9.797  4.324   1.00 42.75 ? 1180 ARG C CB  1 
ATOM   1960 C CG  . ARG C 1 107 ? 15.625 -10.152 2.950   1.00 45.27 ? 1180 ARG C CG  1 
ATOM   1961 C CD  . ARG C 1 107 ? 15.198 -9.080  1.948   1.00 55.57 ? 1180 ARG C CD  1 
ATOM   1962 N NE  . ARG C 1 107 ? 15.780 -9.305  0.627   1.00 60.03 ? 1180 ARG C NE  1 
ATOM   1963 C CZ  . ARG C 1 107 ? 16.862 -8.677  0.167   1.00 61.47 ? 1180 ARG C CZ  1 
ATOM   1964 N NH1 . ARG C 1 107 ? 17.318 -8.950  -1.051  1.00 60.35 ? 1180 ARG C NH1 1 
ATOM   1965 N NH2 . ARG C 1 107 ? 17.486 -7.773  0.919   1.00 59.22 ? 1180 ARG C NH2 1 
ATOM   1966 N N   . LYS C 1 108 ? 15.097 -12.924 5.520   1.00 31.14 ? 1181 LYS C N   1 
ATOM   1967 C CA  . LYS C 1 108 ? 14.321 -14.084 5.953   1.00 34.50 ? 1181 LYS C CA  1 
ATOM   1968 C C   . LYS C 1 108 ? 15.169 -15.090 6.749   1.00 33.95 ? 1181 LYS C C   1 
ATOM   1969 O O   . LYS C 1 108 ? 16.393 -15.189 6.562   1.00 31.25 ? 1181 LYS C O   1 
ATOM   1970 C CB  . LYS C 1 108 ? 13.678 -14.779 4.743   1.00 35.01 ? 1181 LYS C CB  1 
ATOM   1971 C CG  . LYS C 1 108 ? 13.156 -13.815 3.677   1.00 39.65 ? 1181 LYS C CG  1 
ATOM   1972 C CD  . LYS C 1 108 ? 12.046 -12.916 4.203   1.00 40.05 ? 1181 LYS C CD  1 
ATOM   1973 C CE  . LYS C 1 108 ? 10.685 -13.617 4.218   1.00 40.60 ? 1181 LYS C CE  1 
ATOM   1974 N NZ  . LYS C 1 108 ? 9.592  -12.658 4.610   1.00 39.18 ? 1181 LYS C NZ  1 
ATOM   1975 N N   . SER C 1 109 ? 14.513 -15.831 7.630   1.00 32.33 ? 1182 SER C N   1 
ATOM   1976 C CA  . SER C 1 109 ? 15.177 -16.816 8.479   1.00 32.45 ? 1182 SER C CA  1 
ATOM   1977 C C   . SER C 1 109 ? 15.964 -17.888 7.696   1.00 34.29 ? 1182 SER C C   1 
ATOM   1978 O O   . SER C 1 109 ? 17.040 -18.297 8.141   1.00 29.47 ? 1182 SER C O   1 
ATOM   1979 C CB  . SER C 1 109 ? 14.185 -17.468 9.464   1.00 39.39 ? 1182 SER C CB  1 
ATOM   1980 O OG  . SER C 1 109 ? 13.408 -18.481 8.843   1.00 37.34 ? 1182 SER C OG  1 
ATOM   1981 N N   . ASN C 1 110 ? 15.458 -18.319 6.535   1.00 32.67 ? 1183 ASN C N   1 
ATOM   1982 C CA  . ASN C 1 110 ? 16.166 -19.320 5.724   1.00 30.81 ? 1183 ASN C CA  1 
ATOM   1983 C C   . ASN C 1 110 ? 17.447 -18.750 5.091   1.00 33.17 ? 1183 ASN C C   1 
ATOM   1984 O O   . ASN C 1 110 ? 18.473 -19.419 5.021   1.00 30.36 ? 1183 ASN C O   1 
ATOM   1985 C CB  . ASN C 1 110 ? 15.253 -19.945 4.655   1.00 36.32 ? 1183 ASN C CB  1 
ATOM   1986 C CG  . ASN C 1 110 ? 15.098 -19.072 3.429   1.00 42.49 ? 1183 ASN C CG  1 
ATOM   1987 O OD1 . ASN C 1 110 ? 14.607 -17.938 3.508   1.00 43.46 ? 1183 ASN C OD1 1 
ATOM   1988 N ND2 . ASN C 1 110 ? 15.517 -19.599 2.272   1.00 47.12 ? 1183 ASN C ND2 1 
ATOM   1989 N N   . ILE C 1 111 ? 17.383 -17.505 4.636   1.00 30.22 ? 1184 ILE C N   1 
ATOM   1990 C CA  . ILE C 1 111 ? 18.579 -16.831 4.156   1.00 30.20 ? 1184 ILE C CA  1 
ATOM   1991 C C   . ILE C 1 111 ? 19.588 -16.698 5.311   1.00 29.46 ? 1184 ILE C C   1 
ATOM   1992 O O   . ILE C 1 111 ? 20.776 -16.982 5.138   1.00 25.75 ? 1184 ILE C O   1 
ATOM   1993 C CB  . ILE C 1 111 ? 18.232 -15.452 3.583   1.00 34.23 ? 1184 ILE C CB  1 
ATOM   1994 C CG1 . ILE C 1 111 ? 17.522 -15.610 2.232   1.00 38.63 ? 1184 ILE C CG1 1 
ATOM   1995 C CG2 . ILE C 1 111 ? 19.486 -14.610 3.424   1.00 32.35 ? 1184 ILE C CG2 1 
ATOM   1996 C CD1 . ILE C 1 111 ? 16.008 -15.606 2.304   1.00 41.44 ? 1184 ILE C CD1 1 
ATOM   1997 N N   . ARG C 1 112 ? 19.115 -16.276 6.487   1.00 24.97 ? 1185 ARG C N   1 
ATOM   1998 C CA  . ARG C 1 112 ? 20.027 -16.086 7.605   1.00 27.16 ? 1185 ARG C CA  1 
ATOM   1999 C C   . ARG C 1 112 ? 20.631 -17.407 8.062   1.00 26.36 ? 1185 ARG C C   1 
ATOM   2000 O O   . ARG C 1 112 ? 21.788 -17.450 8.479   1.00 22.70 ? 1185 ARG C O   1 
ATOM   2001 C CB  . ARG C 1 112 ? 19.376 -15.364 8.783   1.00 25.70 ? 1185 ARG C CB  1 
ATOM   2002 C CG  . ARG C 1 112 ? 18.970 -13.922 8.498   1.00 25.74 ? 1185 ARG C CG  1 
ATOM   2003 C CD  . ARG C 1 112 ? 18.555 -13.229 9.780   1.00 26.83 ? 1185 ARG C CD  1 
ATOM   2004 N NE  . ARG C 1 112 ? 17.397 -13.853 10.440  1.00 30.57 ? 1185 ARG C NE  1 
ATOM   2005 C CZ  . ARG C 1 112 ? 16.124 -13.596 10.115  1.00 34.82 ? 1185 ARG C CZ  1 
ATOM   2006 N NH1 . ARG C 1 112 ? 15.848 -12.749 9.119   1.00 28.40 ? 1185 ARG C NH1 1 
ATOM   2007 N NH2 . ARG C 1 112 ? 15.125 -14.199 10.767  1.00 31.13 ? 1185 ARG C NH2 1 
ATOM   2008 N N   . LYS C 1 113 ? 19.860 -18.486 7.987   1.00 24.66 ? 1186 LYS C N   1 
ATOM   2009 C CA  . LYS C 1 113 ? 20.376 -19.796 8.365   1.00 27.06 ? 1186 LYS C CA  1 
ATOM   2010 C C   . LYS C 1 113 ? 21.525 -20.240 7.443   1.00 22.30 ? 1186 LYS C C   1 
ATOM   2011 O O   . LYS C 1 113 ? 22.561 -20.770 7.911   1.00 23.87 ? 1186 LYS C O   1 
ATOM   2012 C CB  . LYS C 1 113 ? 19.270 -20.869 8.391   1.00 25.56 ? 1186 LYS C CB  1 
ATOM   2013 C CG  . LYS C 1 113 ? 19.714 -22.122 9.147   1.00 32.79 ? 1186 LYS C CG  1 
ATOM   2014 C CD  . LYS C 1 113 ? 18.722 -23.306 9.062   1.00 33.37 ? 1186 LYS C CD  1 
ATOM   2015 C CE  . LYS C 1 113 ? 19.119 -24.247 7.912   1.00 31.67 ? 1186 LYS C CE  1 
ATOM   2016 N NZ  . LYS C 1 113 ? 18.480 -25.563 7.995   1.00 38.25 ? 1186 LYS C NZ  1 
ATOM   2017 N N   . SER C 1 114 ? 21.362 -20.039 6.146   1.00 21.65 ? 1187 SER C N   1 
ATOM   2018 C CA  . SER C 1 114 ? 22.422 -20.400 5.209   1.00 25.61 ? 1187 SER C CA  1 
ATOM   2019 C C   . SER C 1 114 ? 23.705 -19.585 5.463   1.00 22.52 ? 1187 SER C C   1 
ATOM   2020 O O   . SER C 1 114 ? 24.818 -20.099 5.368   1.00 21.04 ? 1187 SER C O   1 
ATOM   2021 C CB  . SER C 1 114 ? 21.949 -20.229 3.755   1.00 26.61 ? 1187 SER C CB  1 
ATOM   2022 O OG  . SER C 1 114 ? 23.030 -20.449 2.857   1.00 36.81 ? 1187 SER C OG  1 
ATOM   2023 N N   . VAL C 1 115 ? 23.527 -18.316 5.814   1.00 22.79 ? 1188 VAL C N   1 
ATOM   2024 C CA  . VAL C 1 115 ? 24.659 -17.467 6.147   1.00 22.81 ? 1188 VAL C CA  1 
ATOM   2025 C C   . VAL C 1 115 ? 25.372 -17.960 7.426   1.00 21.22 ? 1188 VAL C C   1 
ATOM   2026 O O   . VAL C 1 115 ? 26.609 -18.030 7.479   1.00 21.13 ? 1188 VAL C O   1 
ATOM   2027 C CB  . VAL C 1 115 ? 24.196 -16.011 6.286   1.00 21.61 ? 1188 VAL C CB  1 
ATOM   2028 C CG1 . VAL C 1 115 ? 25.239 -15.192 7.036   1.00 18.69 ? 1188 VAL C CG1 1 
ATOM   2029 C CG2 . VAL C 1 115 ? 23.861 -15.424 4.891   1.00 22.26 ? 1188 VAL C CG2 1 
ATOM   2030 N N   . GLN C 1 116 ? 24.601 -18.329 8.441   1.00 21.83 ? 1189 GLN C N   1 
ATOM   2031 C CA  . GLN C 1 116 ? 25.189 -18.833 9.688   1.00 21.48 ? 1189 GLN C CA  1 
ATOM   2032 C C   . GLN C 1 116 ? 25.976 -20.105 9.432   1.00 21.15 ? 1189 GLN C C   1 
ATOM   2033 O O   . GLN C 1 116 ? 27.070 -20.298 9.986   1.00 18.61 ? 1189 GLN C O   1 
ATOM   2034 C CB  . GLN C 1 116 ? 24.117 -19.136 10.749  1.00 20.97 ? 1189 GLN C CB  1 
ATOM   2035 C CG  . GLN C 1 116 ? 23.319 -17.955 11.218  1.00 27.98 ? 1189 GLN C CG  1 
ATOM   2036 C CD  . GLN C 1 116 ? 22.144 -18.355 12.113  1.00 29.71 ? 1189 GLN C CD  1 
ATOM   2037 O OE1 . GLN C 1 116 ? 22.171 -19.382 12.781  1.00 31.42 ? 1189 GLN C OE1 1 
ATOM   2038 N NE2 . GLN C 1 116 ? 21.102 -17.527 12.120  1.00 35.35 ? 1189 GLN C NE2 1 
ATOM   2039 N N   . ILE C 1 117 ? 25.396 -20.999 8.638   1.00 17.67 ? 1190 ILE C N   1 
ATOM   2040 C CA  . ILE C 1 117 ? 26.101 -22.245 8.301   1.00 16.69 ? 1190 ILE C CA  1 
ATOM   2041 C C   . ILE C 1 117 ? 27.410 -21.914 7.555   1.00 19.43 ? 1190 ILE C C   1 
ATOM   2042 O O   . ILE C 1 117 ? 28.470 -22.471 7.860   1.00 18.54 ? 1190 ILE C O   1 
ATOM   2043 C CB  . ILE C 1 117 ? 25.229 -23.138 7.443   1.00 19.40 ? 1190 ILE C CB  1 
ATOM   2044 C CG1 . ILE C 1 117 ? 24.090 -23.721 8.307   1.00 22.71 ? 1190 ILE C CG1 1 
ATOM   2045 C CG2 . ILE C 1 117 ? 26.043 -24.269 6.816   1.00 19.74 ? 1190 ILE C CG2 1 
ATOM   2046 C CD1 . ILE C 1 117 ? 22.955 -24.324 7.483   1.00 27.60 ? 1190 ILE C CD1 1 
ATOM   2047 N N   . ALA C 1 118 ? 27.333 -20.992 6.601   1.00 18.74 ? 1191 ALA C N   1 
ATOM   2048 C CA  . ALA C 1 118 ? 28.505 -20.591 5.828   1.00 20.79 ? 1191 ALA C CA  1 
ATOM   2049 C C   . ALA C 1 118 ? 29.570 -19.995 6.756   1.00 19.09 ? 1191 ALA C C   1 
ATOM   2050 O O   . ALA C 1 118 ? 30.781 -20.225 6.579   1.00 16.71 ? 1191 ALA C O   1 
ATOM   2051 C CB  . ALA C 1 118 ? 28.118 -19.561 4.749   1.00 20.22 ? 1191 ALA C CB  1 
ATOM   2052 N N   . TYR C 1 119 ? 29.109 -19.213 7.721   1.00 17.86 ? 1192 TYR C N   1 
ATOM   2053 C CA  . TYR C 1 119 ? 30.008 -18.619 8.702   1.00 18.99 ? 1192 TYR C CA  1 
ATOM   2054 C C   . TYR C 1 119 ? 30.738 -19.664 9.560   1.00 20.91 ? 1192 TYR C C   1 
ATOM   2055 O O   . TYR C 1 119 ? 31.968 -19.582 9.728   1.00 16.24 ? 1192 TYR C O   1 
ATOM   2056 C CB  . TYR C 1 119 ? 29.254 -17.633 9.576   1.00 18.74 ? 1192 TYR C CB  1 
ATOM   2057 C CG  . TYR C 1 119 ? 30.094 -16.958 10.646  1.00 18.03 ? 1192 TYR C CG  1 
ATOM   2058 C CD1 . TYR C 1 119 ? 30.850 -15.815 10.350  1.00 20.67 ? 1192 TYR C CD1 1 
ATOM   2059 C CD2 . TYR C 1 119 ? 30.078 -17.421 11.958  1.00 22.99 ? 1192 TYR C CD2 1 
ATOM   2060 C CE1 . TYR C 1 119 ? 31.605 -15.187 11.334  1.00 20.28 ? 1192 TYR C CE1 1 
ATOM   2061 C CE2 . TYR C 1 119 ? 30.824 -16.792 12.953  1.00 26.40 ? 1192 TYR C CE2 1 
ATOM   2062 C CZ  . TYR C 1 119 ? 31.582 -15.669 12.621  1.00 24.11 ? 1192 TYR C CZ  1 
ATOM   2063 O OH  . TYR C 1 119 ? 32.311 -15.041 13.612  1.00 24.77 ? 1192 TYR C OH  1 
ATOM   2064 N N   . HIS C 1 120 ? 30.003 -20.616 10.132  1.00 16.86 ? 1193 HIS C N   1 
ATOM   2065 C CA  . HIS C 1 120 ? 30.680 -21.677 10.853  1.00 19.07 ? 1193 HIS C CA  1 
ATOM   2066 C C   . HIS C 1 120 ? 31.602 -22.483 9.973   1.00 20.56 ? 1193 HIS C C   1 
ATOM   2067 O O   . HIS C 1 120 ? 32.674 -22.907 10.421  1.00 19.60 ? 1193 HIS C O   1 
ATOM   2068 C CB  . HIS C 1 120 ? 29.677 -22.557 11.599  1.00 19.29 ? 1193 HIS C CB  1 
ATOM   2069 C CG  . HIS C 1 120 ? 28.911 -21.777 12.597  1.00 22.22 ? 1193 HIS C CG  1 
ATOM   2070 N ND1 . HIS C 1 120 ? 29.542 -21.092 13.612  1.00 23.00 ? 1193 HIS C ND1 1 
ATOM   2071 C CD2 . HIS C 1 120 ? 27.599 -21.457 12.669  1.00 23.61 ? 1193 HIS C CD2 1 
ATOM   2072 C CE1 . HIS C 1 120 ? 28.633 -20.425 14.308  1.00 25.16 ? 1193 HIS C CE1 1 
ATOM   2073 N NE2 . HIS C 1 120 ? 27.449 -20.632 13.755  1.00 26.66 ? 1193 HIS C NE2 1 
ATOM   2074 N N   . ARG C 1 121 ? 31.243 -22.644 8.704   1.00 15.46 ? 1194 ARG C N   1 
ATOM   2075 C CA  . ARG C 1 121 ? 32.165 -23.338 7.795   1.00 19.84 ? 1194 ARG C CA  1 
ATOM   2076 C C   . ARG C 1 121 ? 33.447 -22.544 7.543   1.00 20.42 ? 1194 ARG C C   1 
ATOM   2077 O O   . ARG C 1 121 ? 34.532 -23.137 7.486   1.00 18.99 ? 1194 ARG C O   1 
ATOM   2078 C CB  . ARG C 1 121 ? 31.516 -23.670 6.455   1.00 21.02 ? 1194 ARG C CB  1 
ATOM   2079 C CG  . ARG C 1 121 ? 30.409 -24.712 6.511   1.00 24.40 ? 1194 ARG C CG  1 
ATOM   2080 C CD  . ARG C 1 121 ? 29.746 -24.682 5.116   1.00 28.47 ? 1194 ARG C CD  1 
ATOM   2081 N NE  . ARG C 1 121 ? 28.684 -25.651 4.936   1.00 31.31 ? 1194 ARG C NE  1 
ATOM   2082 C CZ  . ARG C 1 121 ? 27.742 -25.524 4.003   1.00 32.42 ? 1194 ARG C CZ  1 
ATOM   2083 N NH1 . ARG C 1 121 ? 26.794 -26.447 3.897   1.00 31.01 ? 1194 ARG C NH1 1 
ATOM   2084 N NH2 . ARG C 1 121 ? 27.735 -24.440 3.209   1.00 27.41 ? 1194 ARG C NH2 1 
ATOM   2085 N N   . ALA C 1 122 ? 33.309 -21.220 7.399   1.00 18.40 ? 1195 ALA C N   1 
ATOM   2086 C CA  . ALA C 1 122 ? 34.457 -20.352 7.248   1.00 19.31 ? 1195 ALA C CA  1 
ATOM   2087 C C   . ALA C 1 122 ? 35.397 -20.494 8.445   1.00 18.24 ? 1195 ALA C C   1 
ATOM   2088 O O   . ALA C 1 122 ? 36.612 -20.653 8.273   1.00 19.79 ? 1195 ALA C O   1 
ATOM   2089 C CB  . ALA C 1 122 ? 34.008 -18.876 7.062   1.00 18.47 ? 1195 ALA C CB  1 
ATOM   2090 N N   . LEU C 1 123 ? 34.840 -20.438 9.655   1.00 18.08 ? 1196 LEU C N   1 
ATOM   2091 C CA  . LEU C 1 123 ? 35.678 -20.529 10.842  1.00 20.58 ? 1196 LEU C CA  1 
ATOM   2092 C C   . LEU C 1 123 ? 36.330 -21.901 10.986  1.00 22.34 ? 1196 LEU C C   1 
ATOM   2093 O O   . LEU C 1 123 ? 37.442 -21.993 11.526  1.00 22.20 ? 1196 LEU C O   1 
ATOM   2094 C CB  . LEU C 1 123 ? 34.926 -20.149 12.126  1.00 20.62 ? 1196 LEU C CB  1 
ATOM   2095 C CG  . LEU C 1 123 ? 34.452 -18.685 12.296  1.00 21.84 ? 1196 LEU C CG  1 
ATOM   2096 C CD1 . LEU C 1 123 ? 34.101 -18.407 13.783  1.00 25.33 ? 1196 LEU C CD1 1 
ATOM   2097 C CD2 . LEU C 1 123 ? 35.466 -17.667 11.814  1.00 23.28 ? 1196 LEU C CD2 1 
ATOM   2098 N N   . GLN C 1 124 ? 35.653 -22.964 10.536  1.00 21.11 ? 1197 GLN C N   1 
ATOM   2099 C CA  . GLN C 1 124 ? 36.257 -24.292 10.568  1.00 22.36 ? 1197 GLN C CA  1 
ATOM   2100 C C   . GLN C 1 124 ? 37.447 -24.367 9.622   1.00 23.58 ? 1197 GLN C C   1 
ATOM   2101 O O   . GLN C 1 124 ? 38.458 -24.994 9.941   1.00 22.08 ? 1197 GLN C O   1 
ATOM   2102 C CB  . GLN C 1 124 ? 35.246 -25.379 10.215  1.00 20.06 ? 1197 GLN C CB  1 
ATOM   2103 C CG  . GLN C 1 124 ? 34.324 -25.696 11.389  1.00 22.19 ? 1197 GLN C CG  1 
ATOM   2104 C CD  . GLN C 1 124 ? 33.183 -26.546 10.945  1.00 25.02 ? 1197 GLN C CD  1 
ATOM   2105 O OE1 . GLN C 1 124 ? 33.328 -27.767 10.831  1.00 24.23 ? 1197 GLN C OE1 1 
ATOM   2106 N NE2 . GLN C 1 124 ? 32.029 -25.912 10.665  1.00 20.84 ? 1197 GLN C NE2 1 
ATOM   2107 N N   . HIS C 1 125 ? 37.324 -23.725 8.466   1.00 22.09 ? 1198 HIS C N   1 
ATOM   2108 C CA  . HIS C 1 125 ? 38.454 -23.643 7.536   1.00 22.93 ? 1198 HIS C CA  1 
ATOM   2109 C C   . HIS C 1 125 ? 39.643 -22.945 8.194   1.00 23.12 ? 1198 HIS C C   1 
ATOM   2110 O O   . HIS C 1 125 ? 40.789 -23.420 8.124   1.00 25.04 ? 1198 HIS C O   1 
ATOM   2111 C CB  . HIS C 1 125 ? 38.054 -22.895 6.269   1.00 20.55 ? 1198 HIS C CB  1 
ATOM   2112 C CG  . HIS C 1 125 ? 39.224 -22.454 5.449   1.00 24.53 ? 1198 HIS C CG  1 
ATOM   2113 N ND1 . HIS C 1 125 ? 39.744 -23.220 4.429   1.00 26.07 ? 1198 HIS C ND1 1 
ATOM   2114 C CD2 . HIS C 1 125 ? 39.981 -21.333 5.508   1.00 23.15 ? 1198 HIS C CD2 1 
ATOM   2115 C CE1 . HIS C 1 125 ? 40.779 -22.590 3.897   1.00 27.60 ? 1198 HIS C CE1 1 
ATOM   2116 N NE2 . HIS C 1 125 ? 40.944 -21.443 4.536   1.00 23.27 ? 1198 HIS C NE2 1 
ATOM   2117 N N   . ARG C 1 126 ? 39.362 -21.833 8.862   1.00 21.34 ? 1199 ARG C N   1 
ATOM   2118 C CA  . ARG C 1 126 ? 40.382 -21.128 9.616   1.00 26.33 ? 1199 ARG C CA  1 
ATOM   2119 C C   . ARG C 1 126 ? 41.045 -22.013 10.664  1.00 26.10 ? 1199 ARG C C   1 
ATOM   2120 O O   . ARG C 1 126 ? 42.267 -22.035 10.763  1.00 28.76 ? 1199 ARG C O   1 
ATOM   2121 C CB  . ARG C 1 126 ? 39.830 -19.871 10.279  1.00 25.22 ? 1199 ARG C CB  1 
ATOM   2122 C CG  . ARG C 1 126 ? 40.932 -19.026 10.933  1.00 32.60 ? 1199 ARG C CG  1 
ATOM   2123 C CD  . ARG C 1 126 ? 40.389 -17.721 11.495  1.00 32.73 ? 1199 ARG C CD  1 
ATOM   2124 N NE  . ARG C 1 126 ? 39.569 -17.936 12.690  1.00 29.08 ? 1199 ARG C NE  1 
ATOM   2125 C CZ  . ARG C 1 126 ? 38.936 -16.960 13.336  1.00 33.40 ? 1199 ARG C CZ  1 
ATOM   2126 N NH1 . ARG C 1 126 ? 38.214 -17.222 14.418  1.00 34.41 ? 1199 ARG C NH1 1 
ATOM   2127 N NH2 . ARG C 1 126 ? 39.037 -15.713 12.910  1.00 32.15 ? 1199 ARG C NH2 1 
ATOM   2128 N N   . SER C 1 127 ? 40.259 -22.751 11.441  1.00 24.83 ? 1200 SER C N   1 
ATOM   2129 C CA  . SER C 1 127 ? 40.849 -23.664 12.439  1.00 27.72 ? 1200 SER C CA  1 
ATOM   2130 C C   . SER C 1 127 ? 41.723 -24.770 11.822  1.00 30.30 ? 1200 SER C C   1 
ATOM   2131 O O   . SER C 1 127 ? 42.746 -25.163 12.402  1.00 30.39 ? 1200 SER C O   1 
ATOM   2132 C CB  A SER C 1 127 ? 39.752 -24.324 13.290  0.74 25.91 ? 1200 SER C CB  1 
ATOM   2133 C CB  B SER C 1 127 ? 39.774 -24.263 13.351  0.26 26.12 ? 1200 SER C CB  1 
ATOM   2134 O OG  A SER C 1 127 ? 39.104 -23.365 14.084  0.74 29.21 ? 1200 SER C OG  1 
ATOM   2135 O OG  B SER C 1 127 ? 39.000 -25.210 12.652  0.26 27.54 ? 1200 SER C OG  1 
ATOM   2136 N N   . LYS C 1 128 ? 41.332 -25.272 10.657  1.00 26.97 ? 1201 LYS C N   1 
ATOM   2137 C CA  . LYS C 1 128 ? 42.165 -26.245 9.942   1.00 30.68 ? 1201 LYS C CA  1 
ATOM   2138 C C   . LYS C 1 128 ? 43.516 -25.647 9.515   1.00 31.17 ? 1201 LYS C C   1 
ATOM   2139 O O   . LYS C 1 128 ? 44.565 -26.282 9.670   1.00 31.16 ? 1201 LYS C O   1 
ATOM   2140 C CB  . LYS C 1 128 ? 41.421 -26.798 8.725   1.00 30.44 ? 1201 LYS C CB  1 
ATOM   2141 C CG  . LYS C 1 128 ? 40.294 -27.712 9.124   1.00 34.35 ? 1201 LYS C CG  1 
ATOM   2142 C CD  . LYS C 1 128 ? 39.489 -28.279 7.946   1.00 39.23 ? 1201 LYS C CD  1 
ATOM   2143 C CE  . LYS C 1 128 ? 38.201 -28.951 8.484   1.00 45.01 ? 1201 LYS C CE  1 
ATOM   2144 N NZ  . LYS C 1 128 ? 37.282 -29.553 7.458   1.00 48.53 ? 1201 LYS C NZ  1 
ATOM   2145 N N   . VAL C 1 129 ? 43.482 -24.422 8.998   1.00 28.76 ? 1202 VAL C N   1 
ATOM   2146 C CA  . VAL C 1 129 ? 44.683 -23.760 8.517   1.00 30.91 ? 1202 VAL C CA  1 
ATOM   2147 C C   . VAL C 1 129 ? 45.586 -23.349 9.687   1.00 37.49 ? 1202 VAL C C   1 
ATOM   2148 O O   . VAL C 1 129 ? 46.818 -23.351 9.568   1.00 36.35 ? 1202 VAL C O   1 
ATOM   2149 C CB  . VAL C 1 129 ? 44.316 -22.553 7.652   1.00 32.07 ? 1202 VAL C CB  1 
ATOM   2150 C CG1 . VAL C 1 129 ? 45.478 -21.559 7.568   1.00 36.60 ? 1202 VAL C CG1 1 
ATOM   2151 C CG2 . VAL C 1 129 ? 43.852 -23.025 6.268   1.00 27.50 ? 1202 VAL C CG2 1 
ATOM   2152 N N   . GLN C 1 130 ? 44.979 -23.028 10.827  1.00 30.13 ? 1203 GLN C N   1 
ATOM   2153 C CA  . GLN C 1 130 ? 45.756 -22.608 11.991  1.00 36.15 ? 1203 GLN C CA  1 
ATOM   2154 C C   . GLN C 1 130 ? 46.216 -23.782 12.847  1.00 39.22 ? 1203 GLN C C   1 
ATOM   2155 O O   . GLN C 1 130 ? 47.010 -23.594 13.771  1.00 39.93 ? 1203 GLN C O   1 
ATOM   2156 C CB  . GLN C 1 130 ? 44.979 -21.601 12.833  1.00 35.41 ? 1203 GLN C CB  1 
ATOM   2157 C CG  . GLN C 1 130 ? 44.717 -20.305 12.089  1.00 33.90 ? 1203 GLN C CG  1 
ATOM   2158 C CD  . GLN C 1 130 ? 44.036 -19.255 12.939  1.00 42.76 ? 1203 GLN C CD  1 
ATOM   2159 O OE1 . GLN C 1 130 ? 43.545 -19.544 14.032  1.00 44.74 ? 1203 GLN C OE1 1 
ATOM   2160 N NE2 . GLN C 1 130 ? 43.990 -18.017 12.431  1.00 40.25 ? 1203 GLN C NE2 1 
ATOM   2161 N N   . GLY C 1 131 ? 45.702 -24.979 12.546  1.00 36.30 ? 1204 GLY C N   1 
ATOM   2162 C CA  . GLY C 1 131 ? 46.119 -26.208 13.207  1.00 38.30 ? 1204 GLY C CA  1 
ATOM   2163 C C   . GLY C 1 131 ? 45.651 -26.338 14.647  1.00 40.92 ? 1204 GLY C C   1 
ATOM   2164 O O   . GLY C 1 131 ? 44.477 -26.108 14.955  1.00 45.08 ? 1204 GLY C O   1 
ATOM   2165 N N   . SER D 2 7   ? 43.046 -33.793 -1.140  1.00 40.57 ? 28   SER D N   1 
ATOM   2166 C CA  . SER D 2 7   ? 42.520 -33.177 -2.362  1.00 50.04 ? 28   SER D CA  1 
ATOM   2167 C C   . SER D 2 7   ? 41.460 -32.100 -2.073  1.00 44.97 ? 28   SER D C   1 
ATOM   2168 O O   . SER D 2 7   ? 40.554 -32.305 -1.253  1.00 44.33 ? 28   SER D O   1 
ATOM   2169 C CB  . SER D 2 7   ? 41.928 -34.235 -3.293  1.00 51.45 ? 28   SER D CB  1 
ATOM   2170 O OG  . SER D 2 7   ? 40.651 -34.642 -2.833  1.00 56.07 ? 28   SER D OG  1 
ATOM   2171 N N   . ALA D 2 8   ? 41.573 -30.968 -2.768  1.00 40.23 ? 29   ALA D N   1 
ATOM   2172 C CA  . ALA D 2 8   ? 40.716 -29.812 -2.535  1.00 38.93 ? 29   ALA D CA  1 
ATOM   2173 C C   . ALA D 2 8   ? 39.248 -30.123 -2.809  1.00 41.93 ? 29   ALA D C   1 
ATOM   2174 O O   . ALA D 2 8   ? 38.940 -30.963 -3.650  1.00 40.90 ? 29   ALA D O   1 
ATOM   2175 C CB  . ALA D 2 8   ? 41.165 -28.644 -3.419  1.00 38.36 ? 29   ALA D CB  1 
ATOM   2176 N N   . PRO D 2 9   ? 38.342 -29.432 -2.098  1.00 39.14 ? 30   PRO D N   1 
ATOM   2177 C CA  . PRO D 2 9   ? 36.883 -29.507 -2.291  1.00 40.82 ? 30   PRO D CA  1 
ATOM   2178 C C   . PRO D 2 9   ? 36.448 -29.148 -3.713  1.00 40.16 ? 30   PRO D C   1 
ATOM   2179 O O   . PRO D 2 9   ? 37.075 -28.291 -4.347  1.00 37.74 ? 30   PRO D O   1 
ATOM   2180 C CB  . PRO D 2 9   ? 36.343 -28.448 -1.314  1.00 38.03 ? 30   PRO D CB  1 
ATOM   2181 C CG  . PRO D 2 9   ? 37.398 -28.339 -0.237  1.00 42.97 ? 30   PRO D CG  1 
ATOM   2182 C CD  . PRO D 2 9   ? 38.717 -28.649 -0.903  1.00 41.05 ? 30   PRO D CD  1 
ATOM   2183 N N   . ALA D 2 10  ? 35.378 -29.780 -4.189  1.00 38.53 ? 31   ALA D N   1 
ATOM   2184 C CA  . ALA D 2 10  ? 34.798 -29.458 -5.485  1.00 41.24 ? 31   ALA D CA  1 
ATOM   2185 C C   . ALA D 2 10  ? 34.198 -28.061 -5.454  1.00 34.83 ? 31   ALA D C   1 
ATOM   2186 O O   . ALA D 2 10  ? 33.764 -27.591 -4.397  1.00 37.87 ? 31   ALA D O   1 
ATOM   2187 C CB  . ALA D 2 10  ? 33.715 -30.483 -5.848  1.00 42.67 ? 31   ALA D CB  1 
ATOM   2188 N N   . THR D 2 11  ? 34.183 -27.374 -6.590  1.00 33.32 ? 32   THR D N   1 
ATOM   2189 C CA  . THR D 2 11  ? 33.532 -26.062 -6.617  1.00 35.31 ? 32   THR D CA  1 
ATOM   2190 C C   . THR D 2 11  ? 32.461 -26.016 -7.701  1.00 37.15 ? 32   THR D C   1 
ATOM   2191 O O   . THR D 2 11  ? 32.402 -26.889 -8.566  1.00 37.95 ? 32   THR D O   1 
ATOM   2192 C CB  . THR D 2 11  ? 34.547 -24.876 -6.746  1.00 28.81 ? 32   THR D CB  1 
ATOM   2193 O OG1 . THR D 2 11  ? 35.239 -24.935 -8.002  1.00 33.39 ? 32   THR D OG1 1 
ATOM   2194 C CG2 . THR D 2 11  ? 35.581 -24.925 -5.626  1.00 27.96 ? 32   THR D CG2 1 
ATOM   2195 N N   . GLY D 2 12  ? 31.602 -25.015 -7.621  1.00 29.87 ? 33   GLY D N   1 
ATOM   2196 C CA  . GLY D 2 12  ? 30.606 -24.773 -8.637  1.00 34.00 ? 33   GLY D CA  1 
ATOM   2197 C C   . GLY D 2 12  ? 31.225 -23.838 -9.656  1.00 34.94 ? 33   GLY D C   1 
ATOM   2198 O O   . GLY D 2 12  ? 32.454 -23.785 -9.831  1.00 42.21 ? 33   GLY D O   1 
ATOM   2199 N N   . GLY D 2 13  ? 30.385 -23.101 -10.349 1.00 37.98 ? 34   GLY D N   1 
ATOM   2200 C CA  . GLY D 2 13  ? 30.880 -22.126 -11.287 1.00 38.46 ? 34   GLY D CA  1 
ATOM   2201 C C   . GLY D 2 13  ? 30.557 -20.787 -10.683 1.00 34.05 ? 34   GLY D C   1 
ATOM   2202 O O   . GLY D 2 13  ? 30.421 -20.655 -9.451  1.00 34.73 ? 34   GLY D O   1 
ATOM   2203 N N   . VAL D 2 14  ? 30.417 -19.790 -11.542 1.00 34.08 ? 35   VAL D N   1 
ATOM   2204 C CA  . VAL D 2 14  ? 30.053 -18.455 -11.084 1.00 34.72 ? 35   VAL D CA  1 
ATOM   2205 C C   . VAL D 2 14  ? 28.702 -18.495 -10.392 1.00 37.69 ? 35   VAL D C   1 
ATOM   2206 O O   . VAL D 2 14  ? 27.763 -19.147 -10.867 1.00 37.82 ? 35   VAL D O   1 
ATOM   2207 C CB  . VAL D 2 14  ? 30.010 -17.463 -12.253 1.00 34.24 ? 35   VAL D CB  1 
ATOM   2208 C CG1 . VAL D 2 14  ? 29.486 -16.114 -11.798 1.00 37.80 ? 35   VAL D CG1 1 
ATOM   2209 C CG2 . VAL D 2 14  ? 31.401 -17.322 -12.845 1.00 38.90 ? 35   VAL D CG2 1 
HETATM 2210 N N   . M3L D 2 15  ? 28.602 -17.800 -9.262  1.00 34.26 ? 36   M3L D N   1 
HETATM 2211 C CA  . M3L D 2 15  ? 27.357 -17.770 -8.525  1.00 36.12 ? 36   M3L D CA  1 
HETATM 2212 C CB  . M3L D 2 15  ? 27.525 -17.153 -7.140  1.00 32.16 ? 36   M3L D CB  1 
HETATM 2213 C CG  . M3L D 2 15  ? 26.312 -17.171 -6.219  1.00 35.15 ? 36   M3L D CG  1 
HETATM 2214 C CD  . M3L D 2 15  ? 26.530 -16.670 -4.784  1.00 31.60 ? 36   M3L D CD  1 
HETATM 2215 C CE  . M3L D 2 15  ? 25.332 -16.757 -3.846  1.00 31.34 ? 36   M3L D CE  1 
HETATM 2216 N NZ  . M3L D 2 15  ? 25.524 -16.442 -2.434  1.00 30.54 ? 36   M3L D NZ  1 
HETATM 2217 C C   . M3L D 2 15  ? 26.289 -17.051 -9.346  1.00 39.39 ? 36   M3L D C   1 
HETATM 2218 O O   . M3L D 2 15  ? 26.490 -15.955 -9.759  1.00 41.92 ? 36   M3L D O   1 
HETATM 2219 C CM1 . M3L D 2 15  ? 25.929 -15.049 -2.279  1.00 28.90 ? 36   M3L D CM1 1 
HETATM 2220 C CM2 . M3L D 2 15  ? 26.536 -17.336 -1.889  1.00 25.83 ? 36   M3L D CM2 1 
HETATM 2221 C CM3 . M3L D 2 15  ? 24.275 -16.628 -1.745  1.00 29.03 ? 36   M3L D CM3 1 
ATOM   2222 N N   . LYS D 2 16  ? 25.157 -17.712 -9.550  1.00 37.57 ? 37   LYS D N   1 
ATOM   2223 C CA  . LYS D 2 16  ? 24.059 -17.115 -10.290 1.00 42.92 ? 37   LYS D CA  1 
ATOM   2224 C C   . LYS D 2 16  ? 23.590 -15.850 -9.598  1.00 44.35 ? 37   LYS D C   1 
ATOM   2225 O O   . LYS D 2 16  ? 23.659 -15.744 -8.378  1.00 42.19 ? 37   LYS D O   1 
ATOM   2226 C CB  . LYS D 2 16  ? 22.900 -18.109 -10.423 1.00 47.94 ? 37   LYS D CB  1 
ATOM   2227 C CG  . LYS D 2 16  ? 23.244 -19.350 -11.250 1.00 51.66 ? 37   LYS D CG  1 
ATOM   2228 C CD  . LYS D 2 16  ? 22.094 -20.352 -11.264 1.00 59.38 ? 37   LYS D CD  1 
ATOM   2229 C CE  . LYS D 2 16  ? 22.537 -21.713 -11.796 1.00 64.28 ? 37   LYS D CE  1 
ATOM   2230 N NZ  . LYS D 2 16  ? 21.569 -22.785 -11.418 1.00 63.59 ? 37   LYS D NZ  1 
ATOM   2231 N N   . PRO D 2 17  ? 23.113 -14.875 -10.378 1.00 46.47 ? 38   PRO D N   1 
ATOM   2232 C CA  . PRO D 2 17  ? 22.622 -13.618 -9.809  1.00 46.55 ? 38   PRO D CA  1 
ATOM   2233 C C   . PRO D 2 17  ? 21.339 -13.837 -9.006  1.00 45.90 ? 38   PRO D C   1 
ATOM   2234 O O   . PRO D 2 17  ? 20.626 -14.812 -9.245  1.00 45.41 ? 38   PRO D O   1 
ATOM   2235 C CB  . PRO D 2 17  ? 22.316 -12.764 -11.049 1.00 49.28 ? 38   PRO D CB  1 
ATOM   2236 C CG  . PRO D 2 17  ? 22.934 -13.492 -12.214 1.00 50.12 ? 38   PRO D CG  1 
ATOM   2237 C CD  . PRO D 2 17  ? 22.909 -14.938 -11.831 1.00 50.60 ? 38   PRO D CD  1 
ATOM   2238 N N   . HIS D 2 18  ? 21.058 -12.933 -8.072  1.00 48.94 ? 39   HIS D N   1 
ATOM   2239 C CA  . HIS D 2 18  ? 19.838 -12.975 -7.268  1.00 45.77 ? 39   HIS D CA  1 
ATOM   2240 C C   . HIS D 2 18  ? 18.683 -12.319 -8.022  1.00 50.08 ? 39   HIS D C   1 
ATOM   2241 O O   . HIS D 2 18  ? 18.089 -12.924 -8.915  1.00 54.90 ? 39   HIS D O   1 
ATOM   2242 C CB  . HIS D 2 18  ? 20.071 -12.248 -5.941  1.00 45.06 ? 39   HIS D CB  1 
ATOM   2243 C CG  . HIS D 2 18  ? 18.874 -12.212 -5.042  1.00 44.46 ? 39   HIS D CG  1 
ATOM   2244 N ND1 . HIS D 2 18  ? 17.934 -11.202 -5.088  1.00 51.33 ? 39   HIS D ND1 1 
ATOM   2245 C CD2 . HIS D 2 18  ? 18.472 -13.055 -4.059  1.00 47.71 ? 39   HIS D CD2 1 
ATOM   2246 C CE1 . HIS D 2 18  ? 17.008 -11.424 -4.171  1.00 51.52 ? 39   HIS D CE1 1 
ATOM   2247 N NE2 . HIS D 2 18  ? 17.308 -12.544 -3.537  1.00 51.51 ? 39   HIS D NE2 1 
ATOM   2248 N N   . ASP E 1 7   ? 18.971 6.127   38.353  1.00 48.81 ? 1080 ASP E N   1 
ATOM   2249 C CA  . ASP E 1 7   ? 19.548 6.830   39.507  1.00 51.92 ? 1080 ASP E CA  1 
ATOM   2250 C C   . ASP E 1 7   ? 20.540 7.985   39.204  1.00 55.47 ? 1080 ASP E C   1 
ATOM   2251 O O   . ASP E 1 7   ? 20.163 9.170   39.199  1.00 53.38 ? 1080 ASP E O   1 
ATOM   2252 C CB  . ASP E 1 7   ? 20.196 5.831   40.474  1.00 60.11 ? 1080 ASP E CB  1 
ATOM   2253 C CG  . ASP E 1 7   ? 20.997 4.748   39.756  1.00 62.33 ? 1080 ASP E CG  1 
ATOM   2254 O OD1 . ASP E 1 7   ? 22.251 4.770   39.842  1.00 61.84 ? 1080 ASP E OD1 1 
ATOM   2255 O OD2 . ASP E 1 7   ? 20.370 3.875   39.110  1.00 62.99 ? 1080 ASP E OD2 1 
ATOM   2256 N N   . SER E 1 8   ? 21.804 7.616   38.975  1.00 53.73 ? 1081 SER E N   1 
ATOM   2257 C CA  . SER E 1 8   ? 22.931 8.551   38.907  1.00 51.68 ? 1081 SER E CA  1 
ATOM   2258 C C   . SER E 1 8   ? 23.188 9.112   37.504  1.00 46.44 ? 1081 SER E C   1 
ATOM   2259 O O   . SER E 1 8   ? 23.110 8.378   36.520  1.00 42.66 ? 1081 SER E O   1 
ATOM   2260 C CB  . SER E 1 8   ? 24.205 7.849   39.397  1.00 51.73 ? 1081 SER E CB  1 
ATOM   2261 O OG  . SER E 1 8   ? 24.474 6.685   38.623  1.00 55.38 ? 1081 SER E OG  1 
ATOM   2262 N N   . PRO E 1 9   ? 23.546 10.408  37.425  1.00 47.00 ? 1082 PRO E N   1 
ATOM   2263 C CA  . PRO E 1 9   ? 23.901 11.113  36.185  1.00 43.64 ? 1082 PRO E CA  1 
ATOM   2264 C C   . PRO E 1 9   ? 24.890 10.349  35.298  1.00 42.53 ? 1082 PRO E C   1 
ATOM   2265 O O   . PRO E 1 9   ? 25.862 9.757   35.782  1.00 44.59 ? 1082 PRO E O   1 
ATOM   2266 C CB  . PRO E 1 9   ? 24.536 12.416  36.691  1.00 46.41 ? 1082 PRO E CB  1 
ATOM   2267 C CG  . PRO E 1 9   ? 23.899 12.646  38.004  1.00 45.29 ? 1082 PRO E CG  1 
ATOM   2268 C CD  . PRO E 1 9   ? 23.650 11.287  38.602  1.00 50.32 ? 1082 PRO E CD  1 
ATOM   2269 N N   . LEU E 1 10  ? 24.614 10.388  33.997  1.00 36.49 ? 1083 LEU E N   1 
ATOM   2270 C CA  . LEU E 1 10  ? 25.357 9.681   32.957  1.00 35.22 ? 1083 LEU E CA  1 
ATOM   2271 C C   . LEU E 1 10  ? 26.274 10.684  32.239  1.00 32.43 ? 1083 LEU E C   1 
ATOM   2272 O O   . LEU E 1 10  ? 26.025 11.888  32.311  1.00 30.56 ? 1083 LEU E O   1 
ATOM   2273 C CB  . LEU E 1 10  ? 24.344 9.143   31.955  1.00 28.07 ? 1083 LEU E CB  1 
ATOM   2274 C CG  . LEU E 1 10  ? 23.796 7.723   32.172  1.00 38.04 ? 1083 LEU E CG  1 
ATOM   2275 C CD1 . LEU E 1 10  ? 24.182 7.134   33.509  1.00 33.27 ? 1083 LEU E CD1 1 
ATOM   2276 C CD2 . LEU E 1 10  ? 22.306 7.688   31.952  1.00 30.92 ? 1083 LEU E CD2 1 
ATOM   2277 N N   . ASP E 1 11  ? 27.306 10.206  31.535  1.00 29.66 ? 1084 ASP E N   1 
ATOM   2278 C CA  . ASP E 1 11  ? 28.261 11.113  30.871  1.00 27.81 ? 1084 ASP E CA  1 
ATOM   2279 C C   . ASP E 1 11  ? 28.154 11.069  29.350  1.00 26.43 ? 1084 ASP E C   1 
ATOM   2280 O O   . ASP E 1 11  ? 27.815 10.043  28.790  1.00 23.61 ? 1084 ASP E O   1 
ATOM   2281 C CB  . ASP E 1 11  ? 29.699 10.767  31.256  1.00 32.54 ? 1084 ASP E CB  1 
ATOM   2282 C CG  . ASP E 1 11  ? 29.936 10.876  32.737  1.00 37.78 ? 1084 ASP E CG  1 
ATOM   2283 O OD1 . ASP E 1 11  ? 30.717 10.061  33.277  1.00 41.06 ? 1084 ASP E OD1 1 
ATOM   2284 O OD2 . ASP E 1 11  ? 29.310 11.763  33.362  1.00 35.85 ? 1084 ASP E OD2 1 
ATOM   2285 N N   . ALA E 1 12  ? 28.475 12.174  28.685  1.00 26.14 ? 1085 ALA E N   1 
ATOM   2286 C CA  . ALA E 1 12  ? 28.514 12.175  27.228  1.00 25.07 ? 1085 ALA E CA  1 
ATOM   2287 C C   . ALA E 1 12  ? 29.390 11.026  26.708  1.00 25.79 ? 1085 ALA E C   1 
ATOM   2288 O O   . ALA E 1 12  ? 30.408 10.682  27.315  1.00 24.39 ? 1085 ALA E O   1 
ATOM   2289 C CB  . ALA E 1 12  ? 28.990 13.561  26.689  1.00 26.10 ? 1085 ALA E CB  1 
ATOM   2290 N N   . LEU E 1 13  ? 28.957 10.435  25.597  1.00 23.20 ? 1086 LEU E N   1 
ATOM   2291 C CA  . LEU E 1 13  ? 29.612 9.298   24.932  1.00 24.78 ? 1086 LEU E CA  1 
ATOM   2292 C C   . LEU E 1 13  ? 29.442 7.970   25.676  1.00 23.30 ? 1086 LEU E C   1 
ATOM   2293 O O   . LEU E 1 13  ? 30.056 6.983   25.312  1.00 24.07 ? 1086 LEU E O   1 
ATOM   2294 C CB  . LEU E 1 13  ? 31.081 9.591   24.592  1.00 26.06 ? 1086 LEU E CB  1 
ATOM   2295 C CG  . LEU E 1 13  ? 31.226 10.961  23.912  1.00 28.53 ? 1086 LEU E CG  1 
ATOM   2296 C CD1 . LEU E 1 13  ? 32.686 11.323  23.643  1.00 32.36 ? 1086 LEU E CD1 1 
ATOM   2297 C CD2 . LEU E 1 13  ? 30.382 11.019  22.625  1.00 28.38 ? 1086 LEU E CD2 1 
ATOM   2298 N N   . ASP E 1 14  ? 28.597 7.953   26.702  1.00 22.45 ? 1087 ASP E N   1 
ATOM   2299 C CA  . ASP E 1 14  ? 28.174 6.681   27.308  1.00 25.50 ? 1087 ASP E CA  1 
ATOM   2300 C C   . ASP E 1 14  ? 27.249 5.958   26.319  1.00 22.85 ? 1087 ASP E C   1 
ATOM   2301 O O   . ASP E 1 14  ? 26.423 6.604   25.659  1.00 22.93 ? 1087 ASP E O   1 
ATOM   2302 C CB  . ASP E 1 14  ? 27.416 6.916   28.624  1.00 23.80 ? 1087 ASP E CB  1 
ATOM   2303 C CG  . ASP E 1 14  ? 28.349 7.154   29.828  1.00 29.60 ? 1087 ASP E CG  1 
ATOM   2304 O OD1 . ASP E 1 14  ? 29.585 7.077   29.683  1.00 29.46 ? 1087 ASP E OD1 1 
ATOM   2305 O OD2 . ASP E 1 14  ? 27.831 7.412   30.928  1.00 29.47 ? 1087 ASP E OD2 1 
ATOM   2306 N N   . LEU E 1 15  ? 27.412 4.645   26.209  1.00 22.16 ? 1088 LEU E N   1 
ATOM   2307 C CA  . LEU E 1 15  ? 26.436 3.783   25.544  1.00 22.52 ? 1088 LEU E CA  1 
ATOM   2308 C C   . LEU E 1 15  ? 25.285 3.492   26.476  1.00 19.58 ? 1088 LEU E C   1 
ATOM   2309 O O   . LEU E 1 15  ? 25.499 3.125   27.628  1.00 20.21 ? 1088 LEU E O   1 
ATOM   2310 C CB  . LEU E 1 15  ? 27.085 2.452   25.163  1.00 21.93 ? 1088 LEU E CB  1 
ATOM   2311 C CG  . LEU E 1 15  ? 28.191 2.548   24.109  1.00 22.38 ? 1088 LEU E CG  1 
ATOM   2312 C CD1 . LEU E 1 15  ? 28.905 1.227   23.944  1.00 22.55 ? 1088 LEU E CD1 1 
ATOM   2313 C CD2 . LEU E 1 15  ? 27.623 3.023   22.767  1.00 23.47 ? 1088 LEU E CD2 1 
ATOM   2314 N N   . VAL E 1 16  ? 24.054 3.607   25.977  1.00 18.65 ? 1089 VAL E N   1 
ATOM   2315 C CA  . VAL E 1 16  ? 22.916 3.369   26.829  1.00 19.11 ? 1089 VAL E CA  1 
ATOM   2316 C C   . VAL E 1 16  ? 21.825 2.641   26.065  1.00 20.65 ? 1089 VAL E C   1 
ATOM   2317 O O   . VAL E 1 16  ? 21.801 2.661   24.850  1.00 18.80 ? 1089 VAL E O   1 
ATOM   2318 C CB  . VAL E 1 16  ? 22.327 4.722   27.396  1.00 22.21 ? 1089 VAL E CB  1 
ATOM   2319 C CG1 . VAL E 1 16  ? 23.341 5.388   28.345  1.00 21.12 ? 1089 VAL E CG1 1 
ATOM   2320 C CG2 . VAL E 1 16  ? 21.933 5.661   26.264  1.00 19.14 ? 1089 VAL E CG2 1 
ATOM   2321 N N   . TRP E 1 17  ? 20.941 1.982   26.799  1.00 20.41 ? 1090 TRP E N   1 
ATOM   2322 C CA  . TRP E 1 17  ? 19.626 1.629   26.286  1.00 20.18 ? 1090 TRP E CA  1 
ATOM   2323 C C   . TRP E 1 17  ? 18.748 2.854   26.495  1.00 21.44 ? 1090 TRP E C   1 
ATOM   2324 O O   . TRP E 1 17  ? 18.682 3.403   27.608  1.00 23.89 ? 1090 TRP E O   1 
ATOM   2325 C CB  . TRP E 1 17  ? 19.064 0.463   27.097  1.00 22.83 ? 1090 TRP E CB  1 
ATOM   2326 C CG  . TRP E 1 17  ? 19.761 -0.795  26.857  1.00 21.27 ? 1090 TRP E CG  1 
ATOM   2327 C CD1 . TRP E 1 17  ? 20.747 -1.356  27.633  1.00 19.96 ? 1090 TRP E CD1 1 
ATOM   2328 C CD2 . TRP E 1 17  ? 19.566 -1.672  25.756  1.00 22.17 ? 1090 TRP E CD2 1 
ATOM   2329 N NE1 . TRP E 1 17  ? 21.175 -2.511  27.070  1.00 22.49 ? 1090 TRP E NE1 1 
ATOM   2330 C CE2 . TRP E 1 17  ? 20.467 -2.738  25.918  1.00 21.61 ? 1090 TRP E CE2 1 
ATOM   2331 C CE3 . TRP E 1 17  ? 18.717 -1.657  24.636  1.00 23.18 ? 1090 TRP E CE3 1 
ATOM   2332 C CZ2 . TRP E 1 17  ? 20.532 -3.797  25.029  1.00 20.41 ? 1090 TRP E CZ2 1 
ATOM   2333 C CZ3 . TRP E 1 17  ? 18.779 -2.723  23.746  1.00 20.11 ? 1090 TRP E CZ3 1 
ATOM   2334 C CH2 . TRP E 1 17  ? 19.684 -3.776  23.944  1.00 22.75 ? 1090 TRP E CH2 1 
ATOM   2335 N N   . ALA E 1 18  ? 18.052 3.279   25.449  1.00 20.06 ? 1091 ALA E N   1 
ATOM   2336 C CA  . ALA E 1 18  ? 17.262 4.496   25.511  1.00 20.64 ? 1091 ALA E CA  1 
ATOM   2337 C C   . ALA E 1 18  ? 15.826 4.160   25.116  1.00 23.38 ? 1091 ALA E C   1 
ATOM   2338 O O   . ALA E 1 18  ? 15.590 3.659   24.019  1.00 20.15 ? 1091 ALA E O   1 
ATOM   2339 C CB  . ALA E 1 18  ? 17.838 5.563   24.540  1.00 19.48 ? 1091 ALA E CB  1 
ATOM   2340 N N   . LYS E 1 19  ? 14.881 4.446   26.003  1.00 24.48 ? 1092 LYS E N   1 
ATOM   2341 C CA  . LYS E 1 19  ? 13.462 4.101   25.798  1.00 28.50 ? 1092 LYS E CA  1 
ATOM   2342 C C   . LYS E 1 19  ? 12.635 5.307   25.361  1.00 29.14 ? 1092 LYS E C   1 
ATOM   2343 O O   . LYS E 1 19  ? 12.497 6.270   26.116  1.00 28.03 ? 1092 LYS E O   1 
ATOM   2344 C CB  . LYS E 1 19  ? 12.852 3.539   27.090  1.00 29.05 ? 1092 LYS E CB  1 
ATOM   2345 C CG  . LYS E 1 19  ? 11.342 3.171   27.002  1.00 29.11 ? 1092 LYS E CG  1 
ATOM   2346 C CD  . LYS E 1 19  ? 11.114 1.863   26.252  1.00 27.60 ? 1092 LYS E CD  1 
ATOM   2347 C CE  . LYS E 1 19  ? 9.614  1.498   26.121  1.00 28.47 ? 1092 LYS E CE  1 
ATOM   2348 N NZ  . LYS E 1 19  ? 8.855  2.593   25.471  1.00 28.15 ? 1092 LYS E NZ  1 
ATOM   2349 N N   . CYS E 1 20  ? 12.073 5.278   24.156  1.00 26.06 ? 1093 CYS E N   1 
ATOM   2350 C CA  . CYS E 1 20  ? 11.159 6.361   23.809  1.00 31.72 ? 1093 CYS E CA  1 
ATOM   2351 C C   . CYS E 1 20  ? 9.755  5.846   23.579  1.00 34.65 ? 1093 CYS E C   1 
ATOM   2352 O O   . CYS E 1 20  ? 9.540  4.639   23.491  1.00 32.07 ? 1093 CYS E O   1 
ATOM   2353 C CB  . CYS E 1 20  ? 11.656 7.256   22.672  1.00 38.59 ? 1093 CYS E CB  1 
ATOM   2354 S SG  . CYS E 1 20  ? 12.018 6.462   21.152  1.00 46.83 ? 1093 CYS E SG  1 
ATOM   2355 N N   . ARG E 1 21  ? 8.799  6.765   23.525  1.00 36.48 ? 1094 ARG E N   1 
ATOM   2356 C CA  . ARG E 1 21  ? 7.391  6.381   23.472  1.00 41.14 ? 1094 ARG E CA  1 
ATOM   2357 C C   . ARG E 1 21  ? 7.119  5.648   22.176  1.00 33.96 ? 1094 ARG E C   1 
ATOM   2358 O O   . ARG E 1 21  ? 7.527  6.101   21.102  1.00 36.03 ? 1094 ARG E O   1 
ATOM   2359 C CB  . ARG E 1 21  ? 6.477  7.614   23.556  1.00 42.52 ? 1094 ARG E CB  1 
ATOM   2360 C CG  . ARG E 1 21  ? 6.856  8.608   24.646  1.00 52.66 ? 1094 ARG E CG  1 
ATOM   2361 C CD  . ARG E 1 21  ? 5.642  9.395   25.147  1.00 59.75 ? 1094 ARG E CD  1 
ATOM   2362 N NE  . ARG E 1 21  ? 4.741  8.544   25.929  1.00 62.46 ? 1094 ARG E NE  1 
ATOM   2363 C CZ  . ARG E 1 21  ? 5.008  8.092   27.156  1.00 64.50 ? 1094 ARG E CZ  1 
ATOM   2364 N NH1 . ARG E 1 21  ? 4.125  7.323   27.783  1.00 66.28 ? 1094 ARG E NH1 1 
ATOM   2365 N NH2 . ARG E 1 21  ? 6.154  8.404   27.761  1.00 57.35 ? 1094 ARG E NH2 1 
ATOM   2366 N N   . GLY E 1 22  ? 6.439  4.514   22.281  1.00 39.33 ? 1095 GLY E N   1 
ATOM   2367 C CA  . GLY E 1 22  ? 6.086  3.737   21.105  1.00 37.37 ? 1095 GLY E CA  1 
ATOM   2368 C C   . GLY E 1 22  ? 7.109  2.699   20.657  1.00 38.24 ? 1095 GLY E C   1 
ATOM   2369 O O   . GLY E 1 22  ? 6.842  1.943   19.714  1.00 35.72 ? 1095 GLY E O   1 
ATOM   2370 N N   . TYR E 1 23  ? 8.271  2.640   21.313  1.00 33.26 ? 1096 TYR E N   1 
ATOM   2371 C CA  . TYR E 1 23  ? 9.306  1.687   20.896  1.00 30.39 ? 1096 TYR E CA  1 
ATOM   2372 C C   . TYR E 1 23  ? 9.947  0.965   22.083  1.00 27.36 ? 1096 TYR E C   1 
ATOM   2373 O O   . TYR E 1 23  ? 9.980  1.496   23.193  1.00 31.00 ? 1096 TYR E O   1 
ATOM   2374 C CB  . TYR E 1 23  ? 10.413 2.417   20.126  1.00 29.49 ? 1096 TYR E CB  1 
ATOM   2375 C CG  . TYR E 1 23  ? 10.036 2.908   18.756  1.00 31.96 ? 1096 TYR E CG  1 
ATOM   2376 C CD1 . TYR E 1 23  ? 9.907  2.019   17.689  1.00 32.85 ? 1096 TYR E CD1 1 
ATOM   2377 C CD2 . TYR E 1 23  ? 9.836  4.259   18.519  1.00 33.99 ? 1096 TYR E CD2 1 
ATOM   2378 C CE1 . TYR E 1 23  ? 9.570  2.463   16.435  1.00 36.92 ? 1096 TYR E CE1 1 
ATOM   2379 C CE2 . TYR E 1 23  ? 9.506  4.722   17.256  1.00 37.91 ? 1096 TYR E CE2 1 
ATOM   2380 C CZ  . TYR E 1 23  ? 9.368  3.815   16.219  1.00 42.17 ? 1096 TYR E CZ  1 
ATOM   2381 O OH  . TYR E 1 23  ? 9.029  4.254   14.961  1.00 47.04 ? 1096 TYR E OH  1 
ATOM   2382 N N   . PRO E 1 24  ? 10.474 -0.243  21.859  1.00 26.50 ? 1097 PRO E N   1 
ATOM   2383 C CA  . PRO E 1 24  ? 11.227 -0.923  22.916  1.00 26.98 ? 1097 PRO E CA  1 
ATOM   2384 C C   . PRO E 1 24  ? 12.585 -0.222  23.118  1.00 23.75 ? 1097 PRO E C   1 
ATOM   2385 O O   . PRO E 1 24  ? 12.990 0.541   22.239  1.00 24.83 ? 1097 PRO E O   1 
ATOM   2386 C CB  . PRO E 1 24  ? 11.449 -2.315  22.327  1.00 25.77 ? 1097 PRO E CB  1 
ATOM   2387 C CG  . PRO E 1 24  ? 11.507 -2.038  20.834  1.00 28.19 ? 1097 PRO E CG  1 
ATOM   2388 C CD  . PRO E 1 24  ? 10.397 -1.059  20.633  1.00 30.27 ? 1097 PRO E CD  1 
ATOM   2389 N N   . SER E 1 25  ? 13.234 -0.453  24.263  1.00 23.68 ? 1098 SER E N   1 
ATOM   2390 C CA  . SER E 1 25  ? 14.557 0.107   24.531  1.00 23.71 ? 1098 SER E CA  1 
ATOM   2391 C C   . SER E 1 25  ? 15.485 -0.122  23.354  1.00 19.82 ? 1098 SER E C   1 
ATOM   2392 O O   . SER E 1 25  ? 15.552 -1.229  22.797  1.00 21.27 ? 1098 SER E O   1 
ATOM   2393 C CB  . SER E 1 25  ? 15.179 -0.557  25.753  1.00 25.35 ? 1098 SER E CB  1 
ATOM   2394 O OG  . SER E 1 25  ? 14.347 -0.377  26.890  1.00 30.38 ? 1098 SER E OG  1 
ATOM   2395 N N   . TYR E 1 26  ? 16.271 0.896   23.024  1.00 20.59 ? 1099 TYR E N   1 
ATOM   2396 C CA  . TYR E 1 26  ? 17.038 0.830   21.788  1.00 20.70 ? 1099 TYR E CA  1 
ATOM   2397 C C   . TYR E 1 26  ? 18.446 1.367   22.044  1.00 20.24 ? 1099 TYR E C   1 
ATOM   2398 O O   . TYR E 1 26  ? 18.577 2.408   22.682  1.00 19.68 ? 1099 TYR E O   1 
ATOM   2399 C CB  . TYR E 1 26  ? 16.340 1.696   20.746  1.00 20.14 ? 1099 TYR E CB  1 
ATOM   2400 C CG  . TYR E 1 26  ? 16.691 1.321   19.322  1.00 23.21 ? 1099 TYR E CG  1 
ATOM   2401 C CD1 . TYR E 1 26  ? 17.868 1.777   18.745  1.00 19.46 ? 1099 TYR E CD1 1 
ATOM   2402 C CD2 . TYR E 1 26  ? 15.841 0.514   18.553  1.00 21.25 ? 1099 TYR E CD2 1 
ATOM   2403 C CE1 . TYR E 1 26  ? 18.211 1.435   17.428  1.00 20.13 ? 1099 TYR E CE1 1 
ATOM   2404 C CE2 . TYR E 1 26  ? 16.171 0.188   17.223  1.00 23.52 ? 1099 TYR E CE2 1 
ATOM   2405 C CZ  . TYR E 1 26  ? 17.360 0.663   16.686  1.00 21.80 ? 1099 TYR E CZ  1 
ATOM   2406 O OH  . TYR E 1 26  ? 17.710 0.351   15.401  1.00 24.57 ? 1099 TYR E OH  1 
ATOM   2407 N N   . PRO E 1 27  ? 19.485 0.671   21.542  1.00 20.06 ? 1100 PRO E N   1 
ATOM   2408 C CA  . PRO E 1 27  ? 20.860 1.148   21.791  1.00 17.82 ? 1100 PRO E CA  1 
ATOM   2409 C C   . PRO E 1 27  ? 21.141 2.556   21.222  1.00 18.82 ? 1100 PRO E C   1 
ATOM   2410 O O   . PRO E 1 27  ? 20.752 2.883   20.098  1.00 18.04 ? 1100 PRO E O   1 
ATOM   2411 C CB  . PRO E 1 27  ? 21.722 0.098   21.062  1.00 15.95 ? 1100 PRO E CB  1 
ATOM   2412 C CG  . PRO E 1 27  ? 20.884 -1.168  21.098  1.00 18.60 ? 1100 PRO E CG  1 
ATOM   2413 C CD  . PRO E 1 27  ? 19.483 -0.639  20.845  1.00 18.20 ? 1100 PRO E CD  1 
ATOM   2414 N N   . ALA E 1 28  ? 21.866 3.368   21.993  1.00 17.30 ? 1101 ALA E N   1 
ATOM   2415 C CA  . ALA E 1 28  ? 22.160 4.724   21.616  1.00 16.69 ? 1101 ALA E CA  1 
ATOM   2416 C C   . ALA E 1 28  ? 23.428 5.213   22.301  1.00 18.56 ? 1101 ALA E C   1 
ATOM   2417 O O   . ALA E 1 28  ? 23.963 4.538   23.200  1.00 16.84 ? 1101 ALA E O   1 
ATOM   2418 C CB  . ALA E 1 28  ? 20.974 5.646   21.996  1.00 18.85 ? 1101 ALA E CB  1 
ATOM   2419 N N   . LEU E 1 29  ? 23.874 6.396   21.875  1.00 17.83 ? 1102 LEU E N   1 
ATOM   2420 C CA  . LEU E 1 29  ? 25.056 7.049   22.409  1.00 21.12 ? 1102 LEU E CA  1 
ATOM   2421 C C   . LEU E 1 29  ? 24.617 8.393   22.984  1.00 20.74 ? 1102 LEU E C   1 
ATOM   2422 O O   . LEU E 1 29  ? 23.916 9.152   22.320  1.00 21.42 ? 1102 LEU E O   1 
ATOM   2423 C CB  . LEU E 1 29  ? 26.049 7.291   21.246  1.00 20.30 ? 1102 LEU E CB  1 
ATOM   2424 C CG  . LEU E 1 29  ? 27.389 7.971   21.466  1.00 25.20 ? 1102 LEU E CG  1 
ATOM   2425 C CD1 . LEU E 1 29  ? 28.238 7.067   22.298  1.00 22.98 ? 1102 LEU E CD1 1 
ATOM   2426 C CD2 . LEU E 1 29  ? 28.050 8.197   20.094  1.00 24.90 ? 1102 LEU E CD2 1 
ATOM   2427 N N   . ILE E 1 30  ? 25.019 8.697   24.212  1.00 21.85 ? 1103 ILE E N   1 
ATOM   2428 C CA  . ILE E 1 30  ? 24.744 10.023  24.764  1.00 18.90 ? 1103 ILE E CA  1 
ATOM   2429 C C   . ILE E 1 30  ? 25.716 11.000  24.089  1.00 23.59 ? 1103 ILE E C   1 
ATOM   2430 O O   . ILE E 1 30  ? 26.914 10.703  23.956  1.00 21.94 ? 1103 ILE E O   1 
ATOM   2431 C CB  . ILE E 1 30  ? 24.893 10.066  26.295  1.00 18.53 ? 1103 ILE E CB  1 
ATOM   2432 C CG1 . ILE E 1 30  ? 24.049 8.967   26.950  1.00 20.79 ? 1103 ILE E CG1 1 
ATOM   2433 C CG2 . ILE E 1 30  ? 24.597 11.488  26.836  1.00 21.08 ? 1103 ILE E CG2 1 
ATOM   2434 C CD1 . ILE E 1 30  ? 23.958 9.024   28.484  1.00 21.52 ? 1103 ILE E CD1 1 
ATOM   2435 N N   . ILE E 1 31  ? 25.183 12.139  23.656  1.00 20.63 ? 1104 ILE E N   1 
ATOM   2436 C CA  . ILE E 1 31  ? 25.943 13.168  22.953  1.00 24.49 ? 1104 ILE E CA  1 
ATOM   2437 C C   . ILE E 1 31  ? 25.851 14.477  23.732  1.00 25.98 ? 1104 ILE E C   1 
ATOM   2438 O O   . ILE E 1 31  ? 24.798 14.828  24.245  1.00 25.85 ? 1104 ILE E O   1 
ATOM   2439 C CB  . ILE E 1 31  ? 25.389 13.410  21.530  1.00 23.88 ? 1104 ILE E CB  1 
ATOM   2440 C CG1 . ILE E 1 31  ? 25.437 12.110  20.705  1.00 24.98 ? 1104 ILE E CG1 1 
ATOM   2441 C CG2 . ILE E 1 31  ? 26.162 14.562  20.805  1.00 24.94 ? 1104 ILE E CG2 1 
ATOM   2442 C CD1 . ILE E 1 31  ? 26.800 11.773  20.185  1.00 25.83 ? 1104 ILE E CD1 1 
ATOM   2443 N N   . ASP E 1 32  ? 26.970 15.192  23.807  1.00 26.86 ? 1105 ASP E N   1 
ATOM   2444 C CA  . ASP E 1 32  ? 27.015 16.490  24.469  1.00 28.33 ? 1105 ASP E CA  1 
ATOM   2445 C C   . ASP E 1 32  ? 26.408 17.551  23.545  1.00 28.22 ? 1105 ASP E C   1 
ATOM   2446 O O   . ASP E 1 32  ? 26.959 17.832  22.487  1.00 30.51 ? 1105 ASP E O   1 
ATOM   2447 C CB  . ASP E 1 32  ? 28.471 16.833  24.797  1.00 30.03 ? 1105 ASP E CB  1 
ATOM   2448 C CG  . ASP E 1 32  ? 28.607 18.143  25.562  1.00 34.97 ? 1105 ASP E CG  1 
ATOM   2449 O OD1 . ASP E 1 32  ? 27.604 18.872  25.681  1.00 31.23 ? 1105 ASP E OD1 1 
ATOM   2450 O OD2 . ASP E 1 32  ? 29.710 18.422  26.064  1.00 38.38 ? 1105 ASP E OD2 1 
ATOM   2451 N N   . PRO E 1 33  ? 25.273 18.139  23.935  1.00 30.57 ? 1106 PRO E N   1 
ATOM   2452 C CA  . PRO E 1 33  ? 24.593 19.091  23.051  1.00 31.57 ? 1106 PRO E CA  1 
ATOM   2453 C C   . PRO E 1 33  ? 25.491 20.290  22.770  1.00 34.76 ? 1106 PRO E C   1 
ATOM   2454 O O   . PRO E 1 33  ? 25.265 21.012  21.812  1.00 32.13 ? 1106 PRO E O   1 
ATOM   2455 C CB  . PRO E 1 33  ? 23.381 19.548  23.859  1.00 32.74 ? 1106 PRO E CB  1 
ATOM   2456 C CG  . PRO E 1 33  ? 23.262 18.620  24.991  1.00 33.72 ? 1106 PRO E CG  1 
ATOM   2457 C CD  . PRO E 1 33  ? 24.596 17.994  25.238  1.00 29.80 ? 1106 PRO E CD  1 
ATOM   2458 N N   . LYS E 1 34  ? 26.517 20.481  23.587  1.00 32.34 ? 1107 LYS E N   1 
ATOM   2459 C CA  . LYS E 1 34  ? 27.393 21.625  23.373  1.00 36.75 ? 1107 LYS E CA  1 
ATOM   2460 C C   . LYS E 1 34  ? 28.770 21.272  22.835  1.00 36.63 ? 1107 LYS E C   1 
ATOM   2461 O O   . LYS E 1 34  ? 29.700 22.060  22.971  1.00 37.54 ? 1107 LYS E O   1 
ATOM   2462 C CB  . LYS E 1 34  ? 27.508 22.448  24.656  1.00 39.03 ? 1107 LYS E CB  1 
ATOM   2463 C CG  . LYS E 1 34  ? 26.273 23.293  24.905  1.00 42.55 ? 1107 LYS E CG  1 
ATOM   2464 C CD  . LYS E 1 34  ? 26.197 23.786  26.343  1.00 53.58 ? 1107 LYS E CD  1 
ATOM   2465 C CE  . LYS E 1 34  ? 25.064 24.796  26.508  1.00 55.66 ? 1107 LYS E CE  1 
ATOM   2466 N NZ  . LYS E 1 34  ? 24.600 24.924  27.933  1.00 61.59 ? 1107 LYS E NZ  1 
ATOM   2467 N N   . MET E 1 35  ? 28.901 20.096  22.220  1.00 33.52 ? 1108 MET E N   1 
ATOM   2468 C CA  . MET E 1 35  ? 30.151 19.719  21.567  1.00 33.66 ? 1108 MET E CA  1 
ATOM   2469 C C   . MET E 1 35  ? 30.464 20.740  20.461  1.00 35.89 ? 1108 MET E C   1 
ATOM   2470 O O   . MET E 1 35  ? 29.562 21.447  19.990  1.00 34.23 ? 1108 MET E O   1 
ATOM   2471 C CB  . MET E 1 35  ? 30.053 18.305  20.971  1.00 35.78 ? 1108 MET E CB  1 
ATOM   2472 C CG  . MET E 1 35  ? 28.980 18.160  19.890  1.00 32.69 ? 1108 MET E CG  1 
ATOM   2473 S SD  . MET E 1 35  ? 28.941 16.464  19.252  1.00 36.08 ? 1108 MET E SD  1 
ATOM   2474 C CE  . MET E 1 35  ? 30.444 16.444  18.269  1.00 34.19 ? 1108 MET E CE  1 
ATOM   2475 N N   . PRO E 1 36  ? 31.737 20.829  20.050  1.00 38.30 ? 1109 PRO E N   1 
ATOM   2476 C CA  . PRO E 1 36  ? 32.128 21.748  18.966  1.00 41.47 ? 1109 PRO E CA  1 
ATOM   2477 C C   . PRO E 1 36  ? 31.286 21.595  17.697  1.00 39.84 ? 1109 PRO E C   1 
ATOM   2478 O O   . PRO E 1 36  ? 31.101 20.483  17.199  1.00 39.85 ? 1109 PRO E O   1 
ATOM   2479 C CB  . PRO E 1 36  ? 33.581 21.365  18.697  1.00 38.73 ? 1109 PRO E CB  1 
ATOM   2480 C CG  . PRO E 1 36  ? 34.074 20.899  20.000  1.00 42.42 ? 1109 PRO E CG  1 
ATOM   2481 C CD  . PRO E 1 36  ? 32.905 20.140  20.624  1.00 39.93 ? 1109 PRO E CD  1 
ATOM   2482 N N   . ARG E 1 37  ? 30.773 22.711  17.185  1.00 37.11 ? 1110 ARG E N   1 
ATOM   2483 C CA  . ARG E 1 37  ? 29.889 22.702  16.023  1.00 37.35 ? 1110 ARG E CA  1 
ATOM   2484 C C   . ARG E 1 37  ? 30.605 22.214  14.769  1.00 41.69 ? 1110 ARG E C   1 
ATOM   2485 O O   . ARG E 1 37  ? 29.982 21.707  13.831  1.00 38.47 ? 1110 ARG E O   1 
ATOM   2486 C CB  . ARG E 1 37  ? 29.355 24.108  15.789  1.00 39.24 ? 1110 ARG E CB  1 
ATOM   2487 C CG  . ARG E 1 37  ? 28.626 24.656  16.988  1.00 39.14 ? 1110 ARG E CG  1 
ATOM   2488 C CD  . ARG E 1 37  ? 27.451 23.766  17.308  1.00 39.70 ? 1110 ARG E CD  1 
ATOM   2489 N NE  . ARG E 1 37  ? 26.601 23.494  16.150  1.00 36.24 ? 1110 ARG E NE  1 
ATOM   2490 C CZ  . ARG E 1 37  ? 25.668 22.544  16.128  1.00 43.17 ? 1110 ARG E CZ  1 
ATOM   2491 N NH1 . ARG E 1 37  ? 24.921 22.362  15.044  1.00 36.58 ? 1110 ARG E NH1 1 
ATOM   2492 N NH2 . ARG E 1 37  ? 25.483 21.764  17.202  1.00 37.07 ? 1110 ARG E NH2 1 
ATOM   2493 N N   . GLU E 1 38  ? 31.922 22.370  14.755  1.00 39.44 ? 1111 GLU E N   1 
ATOM   2494 C CA  . GLU E 1 38  ? 32.694 21.916  13.613  1.00 47.14 ? 1111 GLU E CA  1 
ATOM   2495 C C   . GLU E 1 38  ? 32.924 20.395  13.672  1.00 47.71 ? 1111 GLU E C   1 
ATOM   2496 O O   . GLU E 1 38  ? 33.292 19.778  12.675  1.00 48.26 ? 1111 GLU E O   1 
ATOM   2497 C CB  . GLU E 1 38  ? 34.013 22.703  13.487  1.00 46.20 ? 1111 GLU E CB  1 
ATOM   2498 C CG  . GLU E 1 38  ? 35.067 22.358  14.534  1.00 50.63 ? 1111 GLU E CG  1 
ATOM   2499 C CD  . GLU E 1 38  ? 35.079 23.298  15.737  1.00 55.76 ? 1111 GLU E CD  1 
ATOM   2500 O OE1 . GLU E 1 38  ? 36.071 23.228  16.503  1.00 60.31 ? 1111 GLU E OE1 1 
ATOM   2501 O OE2 . GLU E 1 38  ? 34.117 24.095  15.922  1.00 50.25 ? 1111 GLU E OE2 1 
ATOM   2502 N N   . GLY E 1 39  ? 32.688 19.795  14.835  1.00 40.77 ? 1112 GLY E N   1 
ATOM   2503 C CA  . GLY E 1 39  ? 32.805 18.353  14.972  1.00 44.46 ? 1112 GLY E CA  1 
ATOM   2504 C C   . GLY E 1 39  ? 33.896 17.941  15.938  1.00 44.09 ? 1112 GLY E C   1 
ATOM   2505 O O   . GLY E 1 39  ? 34.613 18.785  16.481  1.00 43.69 ? 1112 GLY E O   1 
ATOM   2506 N N   . MET E 1 40  ? 34.020 16.636  16.168  1.00 42.36 ? 1113 MET E N   1 
ATOM   2507 C CA  . MET E 1 40  ? 35.098 16.125  17.009  1.00 44.83 ? 1113 MET E CA  1 
ATOM   2508 C C   . MET E 1 40  ? 35.321 14.638  16.811  1.00 43.23 ? 1113 MET E C   1 
ATOM   2509 O O   . MET E 1 40  ? 34.480 13.928  16.252  1.00 40.15 ? 1113 MET E O   1 
ATOM   2510 C CB  . MET E 1 40  ? 34.831 16.400  18.491  1.00 45.38 ? 1113 MET E CB  1 
ATOM   2511 C CG  . MET E 1 40  ? 33.493 15.891  18.964  1.00 47.29 ? 1113 MET E CG  1 
ATOM   2512 S SD  . MET E 1 40  ? 33.499 15.426  20.697  1.00 59.09 ? 1113 MET E SD  1 
ATOM   2513 C CE  . MET E 1 40  ? 34.498 13.952  20.635  1.00 44.12 ? 1113 MET E CE  1 
ATOM   2514 N N   . PHE E 1 41  ? 36.483 14.186  17.258  1.00 44.67 ? 1114 PHE E N   1 
ATOM   2515 C CA  . PHE E 1 41  ? 36.824 12.781  17.216  1.00 45.33 ? 1114 PHE E CA  1 
ATOM   2516 C C   . PHE E 1 41  ? 36.989 12.352  18.656  1.00 43.43 ? 1114 PHE E C   1 
ATOM   2517 O O   . PHE E 1 41  ? 37.587 13.076  19.461  1.00 47.66 ? 1114 PHE E O   1 
ATOM   2518 C CB  . PHE E 1 41  ? 38.119 12.551  16.409  1.00 43.53 ? 1114 PHE E CB  1 
ATOM   2519 C CG  . PHE E 1 41  ? 37.991 12.908  14.957  1.00 46.93 ? 1114 PHE E CG  1 
ATOM   2520 C CD1 . PHE E 1 41  ? 38.126 14.226  14.539  1.00 49.54 ? 1114 PHE E CD1 1 
ATOM   2521 C CD2 . PHE E 1 41  ? 37.708 11.937  14.015  1.00 44.70 ? 1114 PHE E CD2 1 
ATOM   2522 C CE1 . PHE E 1 41  ? 37.990 14.561  13.201  1.00 51.02 ? 1114 PHE E CE1 1 
ATOM   2523 C CE2 . PHE E 1 41  ? 37.568 12.264  12.674  1.00 50.39 ? 1114 PHE E CE2 1 
ATOM   2524 C CZ  . PHE E 1 41  ? 37.708 13.576  12.266  1.00 52.40 ? 1114 PHE E CZ  1 
ATOM   2525 N N   . HIS E 1 42  ? 36.411 11.200  18.986  1.00 43.17 ? 1115 HIS E N   1 
ATOM   2526 C CA  . HIS E 1 42  ? 36.588 10.585  20.290  1.00 41.24 ? 1115 HIS E CA  1 
ATOM   2527 C C   . HIS E 1 42  ? 37.537 9.398   20.103  1.00 44.41 ? 1115 HIS E C   1 
ATOM   2528 O O   . HIS E 1 42  ? 37.139 8.349   19.600  1.00 41.92 ? 1115 HIS E O   1 
ATOM   2529 C CB  . HIS E 1 42  ? 35.233 10.135  20.860  1.00 35.45 ? 1115 HIS E CB  1 
ATOM   2530 C CG  . HIS E 1 42  ? 35.302 9.599   22.258  1.00 40.80 ? 1115 HIS E CG  1 
ATOM   2531 N ND1 . HIS E 1 42  ? 35.788 10.335  23.317  1.00 40.87 ? 1115 HIS E ND1 1 
ATOM   2532 C CD2 . HIS E 1 42  ? 34.925 8.402   22.774  1.00 36.88 ? 1115 HIS E CD2 1 
ATOM   2533 C CE1 . HIS E 1 42  ? 35.711 9.617   24.425  1.00 40.23 ? 1115 HIS E CE1 1 
ATOM   2534 N NE2 . HIS E 1 42  ? 35.193 8.440   24.123  1.00 44.93 ? 1115 HIS E NE2 1 
ATOM   2535 N N   . HIS E 1 43  ? 38.802 9.587   20.475  1.00 48.18 ? 1116 HIS E N   1 
ATOM   2536 C CA  . HIS E 1 43  ? 39.820 8.574   20.248  1.00 44.51 ? 1116 HIS E CA  1 
ATOM   2537 C C   . HIS E 1 43  ? 39.746 8.070   18.803  1.00 47.01 ? 1116 HIS E C   1 
ATOM   2538 O O   . HIS E 1 43  ? 39.701 6.859   18.551  1.00 50.50 ? 1116 HIS E O   1 
ATOM   2539 C CB  . HIS E 1 43  ? 39.651 7.427   21.241  1.00 50.95 ? 1116 HIS E CB  1 
ATOM   2540 C CG  . HIS E 1 43  ? 39.712 7.861   22.673  1.00 54.19 ? 1116 HIS E CG  1 
ATOM   2541 N ND1 . HIS E 1 43  ? 40.368 9.007   23.074  1.00 54.64 ? 1116 HIS E ND1 1 
ATOM   2542 C CD2 . HIS E 1 43  ? 39.230 7.289   23.803  1.00 54.34 ? 1116 HIS E CD2 1 
ATOM   2543 C CE1 . HIS E 1 43  ? 40.267 9.133   24.385  1.00 56.06 ? 1116 HIS E CE1 1 
ATOM   2544 N NE2 . HIS E 1 43  ? 39.582 8.104   24.852  1.00 58.33 ? 1116 HIS E NE2 1 
ATOM   2545 N N   . GLY E 1 44  ? 39.714 9.013   17.863  1.00 44.01 ? 1117 GLY E N   1 
ATOM   2546 C CA  . GLY E 1 44  ? 39.670 8.703   16.443  1.00 45.06 ? 1117 GLY E CA  1 
ATOM   2547 C C   . GLY E 1 44  ? 38.326 8.294   15.858  1.00 45.37 ? 1117 GLY E C   1 
ATOM   2548 O O   . GLY E 1 44  ? 38.244 7.933   14.678  1.00 49.04 ? 1117 GLY E O   1 
ATOM   2549 N N   . VAL E 1 45  ? 37.268 8.338   16.661  1.00 41.29 ? 1118 VAL E N   1 
ATOM   2550 C CA  . VAL E 1 45  ? 35.928 8.052   16.151  1.00 38.70 ? 1118 VAL E CA  1 
ATOM   2551 C C   . VAL E 1 45  ? 35.154 9.356   15.979  1.00 40.08 ? 1118 VAL E C   1 
ATOM   2552 O O   . VAL E 1 45  ? 34.976 10.106  16.946  1.00 37.04 ? 1118 VAL E O   1 
ATOM   2553 C CB  . VAL E 1 45  ? 35.137 7.147   17.111  1.00 37.69 ? 1118 VAL E CB  1 
ATOM   2554 C CG1 . VAL E 1 45  ? 33.735 6.904   16.576  1.00 31.73 ? 1118 VAL E CG1 1 
ATOM   2555 C CG2 . VAL E 1 45  ? 35.868 5.843   17.346  1.00 38.74 ? 1118 VAL E CG2 1 
ATOM   2556 N N   . PRO E 1 46  ? 34.678 9.623   14.753  1.00 41.13 ? 1119 PRO E N   1 
ATOM   2557 C CA  . PRO E 1 46  ? 33.969 10.875  14.458  1.00 40.08 ? 1119 PRO E CA  1 
ATOM   2558 C C   . PRO E 1 46  ? 32.625 10.867  15.171  1.00 37.21 ? 1119 PRO E C   1 
ATOM   2559 O O   . PRO E 1 46  ? 31.935 9.856   15.080  1.00 35.74 ? 1119 PRO E O   1 
ATOM   2560 C CB  . PRO E 1 46  ? 33.725 10.807  12.950  1.00 44.67 ? 1119 PRO E CB  1 
ATOM   2561 C CG  . PRO E 1 46  ? 34.342 9.508   12.473  1.00 44.04 ? 1119 PRO E CG  1 
ATOM   2562 C CD  . PRO E 1 46  ? 34.580 8.650   13.653  1.00 40.44 ? 1119 PRO E CD  1 
ATOM   2563 N N   . ILE E 1 47  ? 32.278 11.946  15.870  1.00 34.07 ? 1120 ILE E N   1 
ATOM   2564 C CA  . ILE E 1 47  ? 30.987 12.032  16.559  1.00 30.25 ? 1120 ILE E CA  1 
ATOM   2565 C C   . ILE E 1 47  ? 30.074 13.023  15.863  1.00 31.31 ? 1120 ILE E C   1 
ATOM   2566 O O   . ILE E 1 47  ? 30.435 14.191  15.699  1.00 33.57 ? 1120 ILE E O   1 
ATOM   2567 C CB  . ILE E 1 47  ? 31.146 12.480  18.015  1.00 32.77 ? 1120 ILE E CB  1 
ATOM   2568 C CG1 . ILE E 1 47  ? 32.183 11.615  18.728  1.00 32.24 ? 1120 ILE E CG1 1 
ATOM   2569 C CG2 . ILE E 1 47  ? 29.783 12.423  18.732  1.00 30.98 ? 1120 ILE E CG2 1 
ATOM   2570 C CD1 . ILE E 1 47  ? 31.836 10.145  18.718  1.00 31.98 ? 1120 ILE E CD1 1 
ATOM   2571 N N   . PRO E 1 48  ? 28.893 12.560  15.437  1.00 29.11 ? 1121 PRO E N   1 
ATOM   2572 C CA  . PRO E 1 48  ? 27.943 13.419  14.728  1.00 29.61 ? 1121 PRO E CA  1 
ATOM   2573 C C   . PRO E 1 48  ? 27.565 14.644  15.552  1.00 33.15 ? 1121 PRO E C   1 
ATOM   2574 O O   . PRO E 1 48  ? 27.393 14.558  16.770  1.00 29.38 ? 1121 PRO E O   1 
ATOM   2575 C CB  . PRO E 1 48  ? 26.731 12.505  14.534  1.00 32.87 ? 1121 PRO E CB  1 
ATOM   2576 C CG  . PRO E 1 48  ? 27.309 11.125  14.507  1.00 31.98 ? 1121 PRO E CG  1 
ATOM   2577 C CD  . PRO E 1 48  ? 28.461 11.148  15.460  1.00 32.18 ? 1121 PRO E CD  1 
ATOM   2578 N N   . VAL E 1 49  ? 27.461 15.782  14.881  1.00 31.99 ? 1122 VAL E N   1 
ATOM   2579 C CA  . VAL E 1 49  ? 27.063 17.023  15.516  1.00 29.76 ? 1122 VAL E CA  1 
ATOM   2580 C C   . VAL E 1 49  ? 25.558 17.165  15.445  1.00 27.66 ? 1122 VAL E C   1 
ATOM   2581 O O   . VAL E 1 49  ? 24.956 17.020  14.397  1.00 29.94 ? 1122 VAL E O   1 
ATOM   2582 C CB  . VAL E 1 49  ? 27.704 18.209  14.768  1.00 35.11 ? 1122 VAL E CB  1 
ATOM   2583 C CG1 . VAL E 1 49  ? 27.118 19.529  15.241  1.00 34.55 ? 1122 VAL E CG1 1 
ATOM   2584 C CG2 . VAL E 1 49  ? 29.219 18.167  14.941  1.00 34.91 ? 1122 VAL E CG2 1 
ATOM   2585 N N   . PRO E 1 50  ? 24.930 17.453  16.575  1.00 28.88 ? 1123 PRO E N   1 
ATOM   2586 C CA  . PRO E 1 50  ? 23.473 17.640  16.573  1.00 28.25 ? 1123 PRO E CA  1 
ATOM   2587 C C   . PRO E 1 50  ? 23.042 18.808  15.669  1.00 32.68 ? 1123 PRO E C   1 
ATOM   2588 O O   . PRO E 1 50  ? 23.563 19.902  15.844  1.00 34.38 ? 1123 PRO E O   1 
ATOM   2589 C CB  . PRO E 1 50  ? 23.164 17.982  18.035  1.00 29.00 ? 1123 PRO E CB  1 
ATOM   2590 C CG  . PRO E 1 50  ? 24.441 17.711  18.803  1.00 32.51 ? 1123 PRO E CG  1 
ATOM   2591 C CD  . PRO E 1 50  ? 25.562 17.768  17.858  1.00 31.09 ? 1123 PRO E CD  1 
ATOM   2592 N N   . PRO E 1 51  ? 22.113 18.583  14.722  1.00 31.14 ? 1124 PRO E N   1 
ATOM   2593 C CA  . PRO E 1 51  ? 21.541 19.685  13.930  1.00 36.56 ? 1124 PRO E CA  1 
ATOM   2594 C C   . PRO E 1 51  ? 21.043 20.820  14.820  1.00 38.24 ? 1124 PRO E C   1 
ATOM   2595 O O   . PRO E 1 51  ? 20.536 20.554  15.910  1.00 35.77 ? 1124 PRO E O   1 
ATOM   2596 C CB  . PRO E 1 51  ? 20.329 19.034  13.255  1.00 37.86 ? 1124 PRO E CB  1 
ATOM   2597 C CG  . PRO E 1 51  ? 20.640 17.600  13.201  1.00 38.56 ? 1124 PRO E CG  1 
ATOM   2598 C CD  . PRO E 1 51  ? 21.499 17.287  14.389  1.00 35.93 ? 1124 PRO E CD  1 
ATOM   2599 N N   . LEU E 1 52  ? 21.131 22.069  14.362  1.00 37.03 ? 1125 LEU E N   1 
ATOM   2600 C CA  . LEU E 1 52  ? 20.679 23.183  15.192  1.00 37.74 ? 1125 LEU E CA  1 
ATOM   2601 C C   . LEU E 1 52  ? 19.219 23.048  15.575  1.00 31.90 ? 1125 LEU E C   1 
ATOM   2602 O O   . LEU E 1 52  ? 18.820 23.443  16.659  1.00 36.78 ? 1125 LEU E O   1 
ATOM   2603 C CB  . LEU E 1 52  ? 20.925 24.528  14.492  1.00 40.55 ? 1125 LEU E CB  1 
ATOM   2604 C CG  . LEU E 1 52  ? 22.411 24.861  14.365  1.00 43.46 ? 1125 LEU E CG  1 
ATOM   2605 C CD1 . LEU E 1 52  ? 22.667 25.933  13.301  1.00 53.11 ? 1125 LEU E CD1 1 
ATOM   2606 C CD2 . LEU E 1 52  ? 22.993 25.261  15.713  1.00 42.73 ? 1125 LEU E CD2 1 
ATOM   2607 N N   . GLU E 1 53  ? 18.423 22.483  14.679  1.00 35.80 ? 1126 GLU E N   1 
ATOM   2608 C CA  . GLU E 1 53  ? 17.004 22.326  14.917  1.00 37.36 ? 1126 GLU E CA  1 
ATOM   2609 C C   . GLU E 1 53  ? 16.752 21.280  16.008  1.00 41.73 ? 1126 GLU E C   1 
ATOM   2610 O O   . GLU E 1 53  ? 15.777 21.386  16.764  1.00 40.51 ? 1126 GLU E O   1 
ATOM   2611 C CB  . GLU E 1 53  ? 16.307 21.942  13.618  1.00 42.30 ? 1126 GLU E CB  1 
ATOM   2612 C CG  . GLU E 1 53  ? 15.244 20.887  13.768  1.00 48.13 ? 1126 GLU E CG  1 
ATOM   2613 C CD  . GLU E 1 53  ? 15.355 19.814  12.689  1.00 58.16 ? 1126 GLU E CD  1 
ATOM   2614 O OE1 . GLU E 1 53  ? 14.976 18.643  12.955  1.00 58.14 ? 1126 GLU E OE1 1 
ATOM   2615 O OE2 . GLU E 1 53  ? 15.846 20.145  11.579  1.00 63.00 ? 1126 GLU E OE2 1 
ATOM   2616 N N   . VAL E 1 54  ? 17.639 20.287  16.104  1.00 36.08 ? 1127 VAL E N   1 
ATOM   2617 C CA  . VAL E 1 54  ? 17.529 19.278  17.160  1.00 33.86 ? 1127 VAL E CA  1 
ATOM   2618 C C   . VAL E 1 54  ? 17.850 19.923  18.518  1.00 33.48 ? 1127 VAL E C   1 
ATOM   2619 O O   . VAL E 1 54  ? 17.205 19.622  19.514  1.00 32.50 ? 1127 VAL E O   1 
ATOM   2620 C CB  . VAL E 1 54  ? 18.389 17.989  16.858  1.00 35.95 ? 1127 VAL E CB  1 
ATOM   2621 C CG1 . VAL E 1 54  ? 18.388 17.015  18.049  1.00 28.59 ? 1127 VAL E CG1 1 
ATOM   2622 C CG2 . VAL E 1 54  ? 17.864 17.268  15.604  1.00 36.98 ? 1127 VAL E CG2 1 
ATOM   2623 N N   . LEU E 1 55  ? 18.808 20.843  18.558  1.00 33.81 ? 1128 LEU E N   1 
ATOM   2624 C CA  . LEU E 1 55  ? 19.069 21.556  19.811  1.00 36.34 ? 1128 LEU E CA  1 
ATOM   2625 C C   . LEU E 1 55  ? 17.864 22.400  20.234  1.00 37.55 ? 1128 LEU E C   1 
ATOM   2626 O O   . LEU E 1 55  ? 17.523 22.450  21.409  1.00 33.90 ? 1128 LEU E O   1 
ATOM   2627 C CB  . LEU E 1 55  ? 20.320 22.420  19.718  1.00 34.64 ? 1128 LEU E CB  1 
ATOM   2628 C CG  . LEU E 1 55  ? 21.581 21.611  19.402  1.00 35.77 ? 1128 LEU E CG  1 
ATOM   2629 C CD1 . LEU E 1 55  ? 22.797 22.532  19.283  1.00 34.45 ? 1128 LEU E CD1 1 
ATOM   2630 C CD2 . LEU E 1 55  ? 21.808 20.542  20.463  1.00 33.12 ? 1128 LEU E CD2 1 
ATOM   2631 N N   . LYS E 1 56  ? 17.215 23.046  19.266  1.00 38.99 ? 1129 LYS E N   1 
ATOM   2632 C CA  . LYS E 1 56  ? 16.045 23.883  19.553  1.00 38.81 ? 1129 LYS E CA  1 
ATOM   2633 C C   . LYS E 1 56  ? 14.896 23.061  20.114  1.00 39.73 ? 1129 LYS E C   1 
ATOM   2634 O O   . LYS E 1 56  ? 14.218 23.480  21.055  1.00 36.92 ? 1129 LYS E O   1 
ATOM   2635 C CB  . LYS E 1 56  ? 15.579 24.615  18.289  1.00 42.70 ? 1129 LYS E CB  1 
ATOM   2636 C CG  . LYS E 1 56  ? 14.061 24.851  18.259  1.00 50.20 ? 1129 LYS E CG  1 
ATOM   2637 C CD  . LYS E 1 56  ? 13.493 24.997  16.826  1.00 52.88 ? 1129 LYS E CD  1 
ATOM   2638 C CE  . LYS E 1 56  ? 11.986 24.640  16.776  1.00 54.00 ? 1129 LYS E CE  1 
ATOM   2639 N NZ  . LYS E 1 56  ? 11.275 25.168  15.561  1.00 57.38 ? 1129 LYS E NZ  1 
ATOM   2640 N N   . LEU E 1 57  ? 14.676 21.879  19.537  1.00 39.42 ? 1130 LEU E N   1 
ATOM   2641 C CA  . LEU E 1 57  ? 13.649 20.974  20.032  1.00 38.21 ? 1130 LEU E CA  1 
ATOM   2642 C C   . LEU E 1 57  ? 13.935 20.597  21.480  1.00 36.58 ? 1130 LEU E C   1 
ATOM   2643 O O   . LEU E 1 57  ? 13.015 20.435  22.287  1.00 35.00 ? 1130 LEU E O   1 
ATOM   2644 C CB  . LEU E 1 57  ? 13.619 19.701  19.192  1.00 38.83 ? 1130 LEU E CB  1 
ATOM   2645 C CG  . LEU E 1 57  ? 12.288 18.982  19.018  1.00 42.46 ? 1130 LEU E CG  1 
ATOM   2646 C CD1 . LEU E 1 57  ? 12.548 17.489  18.898  1.00 46.26 ? 1130 LEU E CD1 1 
ATOM   2647 C CD2 . LEU E 1 57  ? 11.317 19.263  20.154  1.00 45.26 ? 1130 LEU E CD2 1 
ATOM   2648 N N   . GLY E 1 58  ? 15.216 20.444  21.800  1.00 35.05 ? 1131 GLY E N   1 
ATOM   2649 C CA  . GLY E 1 58  ? 15.627 20.024  23.130  1.00 33.96 ? 1131 GLY E CA  1 
ATOM   2650 C C   . GLY E 1 58  ? 15.337 21.072  24.196  1.00 34.56 ? 1131 GLY E C   1 
ATOM   2651 O O   . GLY E 1 58  ? 14.857 20.749  25.292  1.00 35.94 ? 1131 GLY E O   1 
ATOM   2652 N N   . GLU E 1 59  ? 15.657 22.325  23.891  1.00 35.35 ? 1132 GLU E N   1 
ATOM   2653 C CA  . GLU E 1 59  ? 15.355 23.423  24.806  1.00 36.46 ? 1132 GLU E CA  1 
ATOM   2654 C C   . GLU E 1 59  ? 13.849 23.461  25.027  1.00 36.01 ? 1132 GLU E C   1 
ATOM   2655 O O   . GLU E 1 59  ? 13.366 23.506  26.149  1.00 34.84 ? 1132 GLU E O   1 
ATOM   2656 C CB  . GLU E 1 59  ? 15.885 24.753  24.249  1.00 41.69 ? 1132 GLU E CB  1 
ATOM   2657 C CG  . GLU E 1 59  ? 17.416 24.805  24.257  1.00 41.92 ? 1132 GLU E CG  1 
ATOM   2658 C CD  . GLU E 1 59  ? 18.008 25.987  23.491  1.00 53.15 ? 1132 GLU E CD  1 
ATOM   2659 O OE1 . GLU E 1 59  ? 17.764 27.158  23.884  1.00 53.24 ? 1132 GLU E OE1 1 
ATOM   2660 O OE2 . GLU E 1 59  ? 18.744 25.737  22.503  1.00 52.51 ? 1132 GLU E OE2 1 
ATOM   2661 N N   . GLN E 1 60  ? 13.117 23.389  23.932  1.00 33.66 ? 1133 GLN E N   1 
ATOM   2662 C CA  . GLN E 1 60  ? 11.672 23.344  23.980  1.00 37.58 ? 1133 GLN E CA  1 
ATOM   2663 C C   . GLN E 1 60  ? 11.130 22.144  24.784  1.00 37.04 ? 1133 GLN E C   1 
ATOM   2664 O O   . GLN E 1 60  ? 10.242 22.308  25.606  1.00 38.24 ? 1133 GLN E O   1 
ATOM   2665 C CB  . GLN E 1 60  ? 11.151 23.380  22.548  1.00 39.12 ? 1133 GLN E CB  1 
ATOM   2666 C CG  . GLN E 1 60  ? 9.740  22.946  22.351  1.00 46.49 ? 1133 GLN E CG  1 
ATOM   2667 C CD  . GLN E 1 60  ? 9.392  22.915  20.876  1.00 54.19 ? 1133 GLN E CD  1 
ATOM   2668 O OE1 . GLN E 1 60  ? 8.556  22.116  20.433  1.00 56.73 ? 1133 GLN E OE1 1 
ATOM   2669 N NE2 . GLN E 1 60  ? 10.055 23.778  20.096  1.00 51.46 ? 1133 GLN E NE2 1 
ATOM   2670 N N   . MET E 1 61  ? 11.678 20.944  24.592  1.00 39.11 ? 1134 MET E N   1 
ATOM   2671 C CA  . MET E 1 61  ? 11.233 19.773  25.375  1.00 35.24 ? 1134 MET E CA  1 
ATOM   2672 C C   . MET E 1 61  ? 11.653 19.818  26.847  1.00 33.90 ? 1134 MET E C   1 
ATOM   2673 O O   . MET E 1 61  ? 10.957 19.319  27.728  1.00 32.13 ? 1134 MET E O   1 
ATOM   2674 C CB  . MET E 1 61  ? 11.752 18.476  24.747  1.00 32.46 ? 1134 MET E CB  1 
ATOM   2675 C CG  . MET E 1 61  ? 11.291 18.269  23.312  1.00 37.15 ? 1134 MET E CG  1 
ATOM   2676 S SD  . MET E 1 61  ? 11.977 16.763  22.581  1.00 35.68 ? 1134 MET E SD  1 
ATOM   2677 C CE  . MET E 1 61  ? 11.291 15.545  23.689  1.00 34.15 ? 1134 MET E CE  1 
ATOM   2678 N N   . THR E 1 62  ? 12.816 20.393  27.101  1.00 32.82 ? 1135 THR E N   1 
ATOM   2679 C CA  . THR E 1 62  ? 13.307 20.499  28.459  1.00 34.85 ? 1135 THR E CA  1 
ATOM   2680 C C   . THR E 1 62  ? 12.386 21.476  29.207  1.00 38.03 ? 1135 THR E C   1 
ATOM   2681 O O   . THR E 1 62  ? 11.962 21.204  30.328  1.00 35.51 ? 1135 THR E O   1 
ATOM   2682 C CB  . THR E 1 62  ? 14.760 21.023  28.470  1.00 31.98 ? 1135 THR E CB  1 
ATOM   2683 O OG1 . THR E 1 62  ? 15.620 20.047  27.862  1.00 34.16 ? 1135 THR E OG1 1 
ATOM   2684 C CG2 . THR E 1 62  ? 15.231 21.285  29.888  1.00 31.18 ? 1135 THR E CG2 1 
ATOM   2685 N N   . GLN E 1 63  ? 12.076 22.597  28.557  1.00 38.42 ? 1136 GLN E N   1 
ATOM   2686 C CA  . GLN E 1 63  ? 11.205 23.620  29.144  1.00 43.05 ? 1136 GLN E CA  1 
ATOM   2687 C C   . GLN E 1 63  ? 9.840  23.037  29.505  1.00 42.90 ? 1136 GLN E C   1 
ATOM   2688 O O   . GLN E 1 63  ? 9.368  23.228  30.627  1.00 42.41 ? 1136 GLN E O   1 
ATOM   2689 C CB  . GLN E 1 63  ? 11.061 24.823  28.206  1.00 46.22 ? 1136 GLN E CB  1 
ATOM   2690 C CG  . GLN E 1 63  ? 10.297 26.025  28.792  1.00 53.87 ? 1136 GLN E CG  1 
ATOM   2691 C CD  . GLN E 1 63  ? 10.309 27.265  27.875  1.00 61.52 ? 1136 GLN E CD  1 
ATOM   2692 O OE1 . GLN E 1 63  ? 10.523 27.159  26.660  1.00 59.70 ? 1136 GLN E OE1 1 
ATOM   2693 N NE2 . GLN E 1 63  ? 10.066 28.442  28.462  1.00 59.54 ? 1136 GLN E NE2 1 
ATOM   2694 N N   . GLU E 1 64  ? 9.215  22.311  28.578  1.00 39.45 ? 1137 GLU E N   1 
ATOM   2695 C CA  . GLU E 1 64  ? 7.889  21.763  28.859  1.00 43.16 ? 1137 GLU E CA  1 
ATOM   2696 C C   . GLU E 1 64  ? 7.876  20.633  29.880  1.00 42.54 ? 1137 GLU E C   1 
ATOM   2697 O O   . GLU E 1 64  ? 6.943  20.544  30.676  1.00 42.29 ? 1137 GLU E O   1 
ATOM   2698 C CB  . GLU E 1 64  ? 7.081  21.403  27.593  1.00 43.20 ? 1137 GLU E CB  1 
ATOM   2699 C CG  . GLU E 1 64  ? 7.866  20.812  26.445  1.00 49.50 ? 1137 GLU E CG  1 
ATOM   2700 C CD  . GLU E 1 64  ? 7.285  21.198  25.073  1.00 55.67 ? 1137 GLU E CD  1 
ATOM   2701 O OE1 . GLU E 1 64  ? 7.482  20.429  24.099  1.00 60.07 ? 1137 GLU E OE1 1 
ATOM   2702 O OE2 . GLU E 1 64  ? 6.643  22.274  24.967  1.00 58.47 ? 1137 GLU E OE2 1 
ATOM   2703 N N   . ALA E 1 65  ? 8.901  19.781  29.883  1.00 39.72 ? 1138 ALA E N   1 
ATOM   2704 C CA  . ALA E 1 65  ? 8.949  18.695  30.863  1.00 35.43 ? 1138 ALA E CA  1 
ATOM   2705 C C   . ALA E 1 65  ? 9.442  19.184  32.234  1.00 36.38 ? 1138 ALA E C   1 
ATOM   2706 O O   . ALA E 1 65  ? 9.161  18.561  33.257  1.00 33.93 ? 1138 ALA E O   1 
ATOM   2707 C CB  . ALA E 1 65  ? 9.822  17.552  30.364  1.00 37.06 ? 1138 ALA E CB  1 
ATOM   2708 N N   . ARG E 1 66  ? 10.181 20.289  32.249  1.00 36.94 ? 1139 ARG E N   1 
ATOM   2709 C CA  . ARG E 1 66  ? 10.848 20.717  33.479  1.00 35.90 ? 1139 ARG E CA  1 
ATOM   2710 C C   . ARG E 1 66  ? 11.687 19.581  34.035  1.00 34.58 ? 1139 ARG E C   1 
ATOM   2711 O O   . ARG E 1 66  ? 11.577 19.213  35.201  1.00 35.00 ? 1139 ARG E O   1 
ATOM   2712 C CB  . ARG E 1 66  ? 9.828  21.176  34.525  1.00 37.54 ? 1139 ARG E CB  1 
ATOM   2713 C CG  . ARG E 1 66  ? 9.915  22.646  34.783  1.00 42.03 ? 1139 ARG E CG  1 
ATOM   2714 C CD  . ARG E 1 66  ? 9.233  23.463  33.704  1.00 41.07 ? 1139 ARG E CD  1 
ATOM   2715 N NE  . ARG E 1 66  ? 7.957  23.968  34.191  1.00 43.74 ? 1139 ARG E NE  1 
ATOM   2716 C CZ  . ARG E 1 66  ? 6.787  23.657  33.657  1.00 44.42 ? 1139 ARG E CZ  1 
ATOM   2717 N NH1 . ARG E 1 66  ? 5.669  24.151  34.168  1.00 37.28 ? 1139 ARG E NH1 1 
ATOM   2718 N NH2 . ARG E 1 66  ? 6.744  22.854  32.612  1.00 41.51 ? 1139 ARG E NH2 1 
ATOM   2719 N N   . GLU E 1 67  ? 12.546 19.030  33.189  1.00 31.57 ? 1140 GLU E N   1 
ATOM   2720 C CA  . GLU E 1 67  ? 13.287 17.836  33.553  1.00 32.00 ? 1140 GLU E CA  1 
ATOM   2721 C C   . GLU E 1 67  ? 14.535 17.856  32.714  1.00 27.32 ? 1140 GLU E C   1 
ATOM   2722 O O   . GLU E 1 67  ? 14.499 18.279  31.548  1.00 29.28 ? 1140 GLU E O   1 
ATOM   2723 C CB  . GLU E 1 67  ? 12.439 16.598  33.235  1.00 34.20 ? 1140 GLU E CB  1 
ATOM   2724 C CG  . GLU E 1 67  ? 12.834 15.287  33.923  1.00 35.31 ? 1140 GLU E CG  1 
ATOM   2725 C CD  . GLU E 1 67  ? 11.785 14.184  33.696  1.00 40.30 ? 1140 GLU E CD  1 
ATOM   2726 O OE1 . GLU E 1 67  ? 10.967 14.307  32.753  1.00 40.93 ? 1140 GLU E OE1 1 
ATOM   2727 O OE2 . GLU E 1 67  ? 11.778 13.201  34.461  1.00 38.65 ? 1140 GLU E OE2 1 
ATOM   2728 N N   . HIS E 1 68  ? 15.652 17.449  33.301  1.00 26.11 ? 1141 HIS E N   1 
ATOM   2729 C CA  . HIS E 1 68  ? 16.899 17.392  32.547  1.00 28.48 ? 1141 HIS E CA  1 
ATOM   2730 C C   . HIS E 1 68  ? 16.815 16.273  31.499  1.00 24.49 ? 1141 HIS E C   1 
ATOM   2731 O O   . HIS E 1 68  ? 16.484 15.148  31.816  1.00 26.66 ? 1141 HIS E O   1 
ATOM   2732 C CB  . HIS E 1 68  ? 18.076 17.149  33.478  1.00 28.41 ? 1141 HIS E CB  1 
ATOM   2733 C CG  . HIS E 1 68  ? 19.388 17.084  32.770  1.00 27.92 ? 1141 HIS E CG  1 
ATOM   2734 N ND1 . HIS E 1 68  ? 20.066 18.208  32.359  1.00 30.68 ? 1141 HIS E ND1 1 
ATOM   2735 C CD2 . HIS E 1 68  ? 20.136 16.025  32.376  1.00 31.05 ? 1141 HIS E CD2 1 
ATOM   2736 C CE1 . HIS E 1 68  ? 21.174 17.847  31.733  1.00 34.98 ? 1141 HIS E CE1 1 
ATOM   2737 N NE2 . HIS E 1 68  ? 21.245 16.528  31.741  1.00 30.06 ? 1141 HIS E NE2 1 
ATOM   2738 N N   . LEU E 1 69  ? 17.096 16.608  30.256  1.00 26.80 ? 1142 LEU E N   1 
ATOM   2739 C CA  . LEU E 1 69  ? 17.007 15.645  29.170  1.00 28.90 ? 1142 LEU E CA  1 
ATOM   2740 C C   . LEU E 1 69  ? 18.391 15.464  28.558  1.00 24.62 ? 1142 LEU E C   1 
ATOM   2741 O O   . LEU E 1 69  ? 19.084 16.437  28.296  1.00 26.49 ? 1142 LEU E O   1 
ATOM   2742 C CB  . LEU E 1 69  ? 16.032 16.160  28.105  1.00 26.56 ? 1142 LEU E CB  1 
ATOM   2743 C CG  . LEU E 1 69  ? 14.604 16.435  28.586  1.00 29.12 ? 1142 LEU E CG  1 
ATOM   2744 C CD1 . LEU E 1 69  ? 13.789 16.877  27.385  1.00 30.10 ? 1142 LEU E CD1 1 
ATOM   2745 C CD2 . LEU E 1 69  ? 13.991 15.183  29.219  1.00 25.96 ? 1142 LEU E CD2 1 
ATOM   2746 N N   . TYR E 1 70  ? 18.784 14.203  28.353  1.00 26.16 ? 1143 TYR E N   1 
ATOM   2747 C CA  . TYR E 1 70  ? 20.039 13.838  27.712  1.00 25.18 ? 1143 TYR E CA  1 
ATOM   2748 C C   . TYR E 1 70  ? 19.748 13.772  26.238  1.00 23.62 ? 1143 TYR E C   1 
ATOM   2749 O O   . TYR E 1 70  ? 18.633 13.408  25.859  1.00 24.68 ? 1143 TYR E O   1 
ATOM   2750 C CB  . TYR E 1 70  ? 20.481 12.450  28.190  1.00 24.51 ? 1143 TYR E CB  1 
ATOM   2751 C CG  . TYR E 1 70  ? 20.952 12.431  29.623  1.00 24.06 ? 1143 TYR E CG  1 
ATOM   2752 C CD1 . TYR E 1 70  ? 22.292 12.617  29.937  1.00 21.83 ? 1143 TYR E CD1 1 
ATOM   2753 C CD2 . TYR E 1 70  ? 20.052 12.245  30.663  1.00 23.14 ? 1143 TYR E CD2 1 
ATOM   2754 C CE1 . TYR E 1 70  ? 22.718 12.591  31.251  1.00 25.31 ? 1143 TYR E CE1 1 
ATOM   2755 C CE2 . TYR E 1 70  ? 20.469 12.243  31.977  1.00 26.90 ? 1143 TYR E CE2 1 
ATOM   2756 C CZ  . TYR E 1 70  ? 21.799 12.416  32.264  1.00 27.66 ? 1143 TYR E CZ  1 
ATOM   2757 O OH  . TYR E 1 70  ? 22.194 12.397  33.584  1.00 30.46 ? 1143 TYR E OH  1 
ATOM   2758 N N   . LEU E 1 71  ? 20.719 14.170  25.415  1.00 21.79 ? 1144 LEU E N   1 
ATOM   2759 C CA  . LEU E 1 71  ? 20.569 14.100  23.976  1.00 21.53 ? 1144 LEU E CA  1 
ATOM   2760 C C   . LEU E 1 71  ? 21.109 12.737  23.621  1.00 22.78 ? 1144 LEU E C   1 
ATOM   2761 O O   . LEU E 1 71  ? 22.238 12.431  23.995  1.00 21.71 ? 1144 LEU E O   1 
ATOM   2762 C CB  . LEU E 1 71  ? 21.427 15.173  23.304  1.00 24.04 ? 1144 LEU E CB  1 
ATOM   2763 C CG  . LEU E 1 71  ? 21.497 15.109  21.769  1.00 24.06 ? 1144 LEU E CG  1 
ATOM   2764 C CD1 . LEU E 1 71  ? 20.082 15.016  21.225  1.00 23.90 ? 1144 LEU E CD1 1 
ATOM   2765 C CD2 . LEU E 1 71  ? 22.214 16.304  21.200  1.00 25.43 ? 1144 LEU E CD2 1 
ATOM   2766 N N   . VAL E 1 72  ? 20.324 11.905  22.940  1.00 19.37 ? 1145 VAL E N   1 
ATOM   2767 C CA  . VAL E 1 72  ? 20.869 10.630  22.481  1.00 20.94 ? 1145 VAL E CA  1 
ATOM   2768 C C   . VAL E 1 72  ? 20.814 10.464  20.965  1.00 22.12 ? 1145 VAL E C   1 
ATOM   2769 O O   . VAL E 1 72  ? 19.935 11.013  20.281  1.00 23.84 ? 1145 VAL E O   1 
ATOM   2770 C CB  . VAL E 1 72  ? 20.265 9.404   23.191  1.00 21.67 ? 1145 VAL E CB  1 
ATOM   2771 C CG1 . VAL E 1 72  ? 20.386 9.558   24.717  1.00 20.81 ? 1145 VAL E CG1 1 
ATOM   2772 C CG2 . VAL E 1 72  ? 18.802 9.149   22.748  1.00 18.30 ? 1145 VAL E CG2 1 
ATOM   2773 N N   . LEU E 1 73  ? 21.767 9.697   20.458  1.00 22.24 ? 1146 LEU E N   1 
ATOM   2774 C CA  . LEU E 1 73  ? 21.838 9.372   19.031  1.00 21.44 ? 1146 LEU E CA  1 
ATOM   2775 C C   . LEU E 1 73  ? 21.725 7.849   18.922  1.00 21.00 ? 1146 LEU E C   1 
ATOM   2776 O O   . LEU E 1 73  ? 22.563 7.129   19.433  1.00 20.30 ? 1146 LEU E O   1 
ATOM   2777 C CB  . LEU E 1 73  ? 23.169 9.842   18.460  1.00 21.63 ? 1146 LEU E CB  1 
ATOM   2778 C CG  . LEU E 1 73  ? 23.407 9.458   16.995  1.00 25.09 ? 1146 LEU E CG  1 
ATOM   2779 C CD1 . LEU E 1 73  ? 22.440 10.211  16.083  1.00 26.76 ? 1146 LEU E CD1 1 
ATOM   2780 C CD2 . LEU E 1 73  ? 24.837 9.765   16.627  1.00 28.42 ? 1146 LEU E CD2 1 
ATOM   2781 N N   . PHE E 1 74  ? 20.680 7.359   18.270  1.00 18.39 ? 1147 PHE E N   1 
ATOM   2782 C CA  . PHE E 1 74  ? 20.427 5.933   18.235  1.00 18.21 ? 1147 PHE E CA  1 
ATOM   2783 C C   . PHE E 1 74  ? 21.362 5.257   17.233  1.00 20.71 ? 1147 PHE E C   1 
ATOM   2784 O O   . PHE E 1 74  ? 21.821 5.895   16.268  1.00 21.67 ? 1147 PHE E O   1 
ATOM   2785 C CB  . PHE E 1 74  ? 18.979 5.656   17.832  1.00 21.73 ? 1147 PHE E CB  1 
ATOM   2786 C CG  . PHE E 1 74  ? 17.969 6.024   18.882  1.00 19.92 ? 1147 PHE E CG  1 
ATOM   2787 C CD1 . PHE E 1 74  ? 17.785 5.222   19.993  1.00 18.37 ? 1147 PHE E CD1 1 
ATOM   2788 C CD2 . PHE E 1 74  ? 17.171 7.140   18.728  1.00 26.38 ? 1147 PHE E CD2 1 
ATOM   2789 C CE1 . PHE E 1 74  ? 16.830 5.569   20.979  1.00 21.80 ? 1147 PHE E CE1 1 
ATOM   2790 C CE2 . PHE E 1 74  ? 16.237 7.493   19.694  1.00 27.07 ? 1147 PHE E CE2 1 
ATOM   2791 C CZ  . PHE E 1 74  ? 16.060 6.691   20.818  1.00 24.16 ? 1147 PHE E CZ  1 
ATOM   2792 N N   . PHE E 1 75  ? 21.645 3.975   17.465  1.00 16.63 ? 1148 PHE E N   1 
ATOM   2793 C CA  . PHE E 1 75  ? 22.413 3.192   16.499  1.00 21.51 ? 1148 PHE E CA  1 
ATOM   2794 C C   . PHE E 1 75  ? 21.494 2.602   15.438  1.00 21.28 ? 1148 PHE E C   1 
ATOM   2795 O O   . PHE E 1 75  ? 21.714 1.475   14.969  1.00 21.90 ? 1148 PHE E O   1 
ATOM   2796 C CB  . PHE E 1 75  ? 23.223 2.093   17.211  1.00 20.03 ? 1148 PHE E CB  1 
ATOM   2797 C CG  . PHE E 1 75  ? 24.458 2.627   17.929  1.00 20.64 ? 1148 PHE E CG  1 
ATOM   2798 C CD1 . PHE E 1 75  ? 25.636 2.866   17.230  1.00 24.56 ? 1148 PHE E CD1 1 
ATOM   2799 C CD2 . PHE E 1 75  ? 24.418 2.916   19.292  1.00 20.27 ? 1148 PHE E CD2 1 
ATOM   2800 C CE1 . PHE E 1 75  ? 26.774 3.363   17.872  1.00 24.50 ? 1148 PHE E CE1 1 
ATOM   2801 C CE2 . PHE E 1 75  ? 25.529 3.423   19.959  1.00 20.58 ? 1148 PHE E CE2 1 
ATOM   2802 C CZ  . PHE E 1 75  ? 26.733 3.647   19.246  1.00 21.43 ? 1148 PHE E CZ  1 
ATOM   2803 N N   . ASP E 1 76  ? 20.438 3.332   15.075  1.00 18.63 ? 1149 ASP E N   1 
ATOM   2804 C CA  . ASP E 1 76  ? 19.549 2.818   14.036  1.00 24.23 ? 1149 ASP E CA  1 
ATOM   2805 C C   . ASP E 1 76  ? 20.109 3.121   12.628  1.00 26.43 ? 1149 ASP E C   1 
ATOM   2806 O O   . ASP E 1 76  ? 21.120 3.774   12.499  1.00 22.80 ? 1149 ASP E O   1 
ATOM   2807 C CB  . ASP E 1 76  ? 18.117 3.334   14.194  1.00 22.74 ? 1149 ASP E CB  1 
ATOM   2808 C CG  . ASP E 1 76  ? 18.018 4.869   14.281  1.00 25.31 ? 1149 ASP E CG  1 
ATOM   2809 O OD1 . ASP E 1 76  ? 19.034 5.550   14.502  1.00 24.58 ? 1149 ASP E OD1 1 
ATOM   2810 O OD2 . ASP E 1 76  ? 16.890 5.393   14.141  1.00 28.62 ? 1149 ASP E OD2 1 
ATOM   2811 N N   . ASN E 1 77  ? 19.422 2.668   11.589  1.00 27.57 ? 1150 ASN E N   1 
ATOM   2812 C CA  . ASN E 1 77  ? 19.890 2.897   10.219  1.00 29.78 ? 1150 ASN E CA  1 
ATOM   2813 C C   . ASN E 1 77  ? 20.047 4.369   9.903   1.00 33.58 ? 1150 ASN E C   1 
ATOM   2814 O O   . ASN E 1 77  ? 21.102 4.781   9.445   1.00 31.36 ? 1150 ASN E O   1 
ATOM   2815 C CB  . ASN E 1 77  ? 18.960 2.224   9.189   1.00 34.77 ? 1150 ASN E CB  1 
ATOM   2816 C CG  . ASN E 1 77  ? 19.191 0.726   9.080   1.00 38.39 ? 1150 ASN E CG  1 
ATOM   2817 O OD1 . ASN E 1 77  ? 20.103 0.176   9.709   1.00 35.58 ? 1150 ASN E OD1 1 
ATOM   2818 N ND2 . ASN E 1 77  ? 18.365 0.053   8.274   1.00 34.74 ? 1150 ASN E ND2 1 
ATOM   2819 N N   . LYS E 1 78  ? 19.022 5.174   10.192  1.00 34.57 ? 1151 LYS E N   1 
ATOM   2820 C CA  . LYS E 1 78  ? 19.093 6.607   9.895   1.00 33.87 ? 1151 LYS E CA  1 
ATOM   2821 C C   . LYS E 1 78  ? 19.868 7.430   10.922  1.00 35.51 ? 1151 LYS E C   1 
ATOM   2822 O O   . LYS E 1 78  ? 20.200 8.583   10.666  1.00 32.98 ? 1151 LYS E O   1 
ATOM   2823 C CB  . LYS E 1 78  ? 17.693 7.176   9.706   1.00 36.85 ? 1151 LYS E CB  1 
ATOM   2824 C CG  . LYS E 1 78  ? 16.985 6.607   8.491   1.00 42.03 ? 1151 LYS E CG  1 
ATOM   2825 C CD  . LYS E 1 78  ? 15.561 7.115   8.424   1.00 48.80 ? 1151 LYS E CD  1 
ATOM   2826 C CE  . LYS E 1 78  ? 14.920 7.047   9.798   1.00 49.25 ? 1151 LYS E CE  1 
ATOM   2827 N NZ  . LYS E 1 78  ? 13.493 7.508   9.805   1.00 55.94 ? 1151 LYS E NZ  1 
ATOM   2828 N N   . ARG E 1 79  ? 20.179 6.831   12.072  1.00 30.77 ? 1152 ARG E N   1 
ATOM   2829 C CA  . ARG E 1 79  ? 20.948 7.526   13.102  1.00 28.44 ? 1152 ARG E CA  1 
ATOM   2830 C C   . ARG E 1 79  ? 20.160 8.743   13.551  1.00 28.02 ? 1152 ARG E C   1 
ATOM   2831 O O   . ARG E 1 79  ? 20.590 9.882   13.326  1.00 28.98 ? 1152 ARG E O   1 
ATOM   2832 C CB  . ARG E 1 79  ? 22.328 7.994   12.597  1.00 31.84 ? 1152 ARG E CB  1 
ATOM   2833 C CG  . ARG E 1 79  ? 23.429 6.921   12.427  1.00 37.01 ? 1152 ARG E CG  1 
ATOM   2834 C CD  . ARG E 1 79  ? 23.564 5.963   13.637  1.00 32.18 ? 1152 ARG E CD  1 
ATOM   2835 N NE  . ARG E 1 79  ? 24.433 6.402   14.748  1.00 27.99 ? 1152 ARG E NE  1 
ATOM   2836 C CZ  . ARG E 1 79  ? 25.767 6.469   14.700  1.00 37.62 ? 1152 ARG E CZ  1 
ATOM   2837 N NH1 . ARG E 1 79  ? 26.422 6.200   13.569  1.00 36.38 ? 1152 ARG E NH1 1 
ATOM   2838 N NH2 . ARG E 1 79  ? 26.455 6.835   15.780  1.00 34.05 ? 1152 ARG E NH2 1 
ATOM   2839 N N   . THR E 1 80  ? 19.022 8.483   14.188  1.00 28.21 ? 1153 THR E N   1 
ATOM   2840 C CA  . THR E 1 80  ? 18.113 9.513   14.666  1.00 29.65 ? 1153 THR E CA  1 
ATOM   2841 C C   . THR E 1 80  ? 18.394 9.937   16.107  1.00 28.21 ? 1153 THR E C   1 
ATOM   2842 O O   . THR E 1 80  ? 19.088 9.240   16.858  1.00 25.83 ? 1153 THR E O   1 
ATOM   2843 C CB  . THR E 1 80  ? 16.653 9.055   14.556  1.00 28.88 ? 1153 THR E CB  1 
ATOM   2844 O OG1 . THR E 1 80  ? 16.456 7.876   15.347  1.00 29.13 ? 1153 THR E OG1 1 
ATOM   2845 C CG2 . THR E 1 80  ? 16.333 8.717   13.109  1.00 35.83 ? 1153 THR E CG2 1 
ATOM   2846 N N   . TRP E 1 81  ? 17.814 11.074  16.462  1.00 27.13 ? 1154 TRP E N   1 
ATOM   2847 C CA  . TRP E 1 81  ? 18.092 11.781  17.704  1.00 29.96 ? 1154 TRP E CA  1 
ATOM   2848 C C   . TRP E 1 81  ? 16.871 11.773  18.586  1.00 29.30 ? 1154 TRP E C   1 
ATOM   2849 O O   . TRP E 1 81  ? 15.740 11.820  18.101  1.00 30.28 ? 1154 TRP E O   1 
ATOM   2850 C CB  . TRP E 1 81  ? 18.441 13.251  17.429  1.00 29.21 ? 1154 TRP E CB  1 
ATOM   2851 C CG  . TRP E 1 81  ? 19.648 13.516  16.565  1.00 29.57 ? 1154 TRP E CG  1 
ATOM   2852 C CD1 . TRP E 1 81  ? 19.658 13.727  15.212  1.00 32.12 ? 1154 TRP E CD1 1 
ATOM   2853 C CD2 . TRP E 1 81  ? 21.011 13.667  16.999  1.00 25.29 ? 1154 TRP E CD2 1 
ATOM   2854 N NE1 . TRP E 1 81  ? 20.935 13.964  14.779  1.00 28.46 ? 1154 TRP E NE1 1 
ATOM   2855 C CE2 . TRP E 1 81  ? 21.786 13.931  15.849  1.00 28.28 ? 1154 TRP E CE2 1 
ATOM   2856 C CE3 . TRP E 1 81  ? 21.649 13.582  18.242  1.00 23.88 ? 1154 TRP E CE3 1 
ATOM   2857 C CZ2 . TRP E 1 81  ? 23.165 14.123  15.908  1.00 29.62 ? 1154 TRP E CZ2 1 
ATOM   2858 C CZ3 . TRP E 1 81  ? 23.001 13.766  18.313  1.00 21.84 ? 1154 TRP E CZ3 1 
ATOM   2859 C CH2 . TRP E 1 81  ? 23.758 14.044  17.145  1.00 30.26 ? 1154 TRP E CH2 1 
ATOM   2860 N N   . GLN E 1 82  ? 17.098 11.760  19.893  1.00 26.59 ? 1155 GLN E N   1 
ATOM   2861 C CA  . GLN E 1 82  ? 16.010 11.991  20.837  1.00 25.22 ? 1155 GLN E CA  1 
ATOM   2862 C C   . GLN E 1 82  ? 16.544 12.655  22.096  1.00 27.57 ? 1155 GLN E C   1 
ATOM   2863 O O   . GLN E 1 82  ? 17.745 12.627  22.353  1.00 23.33 ? 1155 GLN E O   1 
ATOM   2864 C CB  . GLN E 1 82  ? 15.312 10.679  21.209  1.00 27.39 ? 1155 GLN E CB  1 
ATOM   2865 C CG  . GLN E 1 82  ? 13.958 10.458  20.544  1.00 34.24 ? 1155 GLN E CG  1 
ATOM   2866 C CD  . GLN E 1 82  ? 12.951 11.544  20.896  1.00 36.12 ? 1155 GLN E CD  1 
ATOM   2867 O OE1 . GLN E 1 82  ? 13.065 12.187  21.931  1.00 36.55 ? 1155 GLN E OE1 1 
ATOM   2868 N NE2 . GLN E 1 82  ? 11.952 11.736  20.042  1.00 36.18 ? 1155 GLN E NE2 1 
ATOM   2869 N N   . TRP E 1 83  ? 15.629 13.247  22.863  1.00 24.47 ? 1156 TRP E N   1 
ATOM   2870 C CA  . TRP E 1 83  ? 15.922 13.919  24.128  1.00 26.30 ? 1156 TRP E CA  1 
ATOM   2871 C C   . TRP E 1 83  ? 15.172 13.150  25.220  1.00 24.51 ? 1156 TRP E C   1 
ATOM   2872 O O   . TRP E 1 83  ? 13.940 13.078  25.200  1.00 30.10 ? 1156 TRP E O   1 
ATOM   2873 C CB  . TRP E 1 83  ? 15.413 15.371  24.069  1.00 26.01 ? 1156 TRP E CB  1 
ATOM   2874 C CG  . TRP E 1 83  ? 16.231 16.279  23.229  1.00 25.67 ? 1156 TRP E CG  1 
ATOM   2875 C CD1 . TRP E 1 83  ? 16.007 16.644  21.925  1.00 24.76 ? 1156 TRP E CD1 1 
ATOM   2876 C CD2 . TRP E 1 83  ? 17.429 16.925  23.630  1.00 24.04 ? 1156 TRP E CD2 1 
ATOM   2877 N NE1 . TRP E 1 83  ? 16.996 17.497  21.503  1.00 27.58 ? 1156 TRP E NE1 1 
ATOM   2878 C CE2 . TRP E 1 83  ? 17.887 17.676  22.532  1.00 28.33 ? 1156 TRP E CE2 1 
ATOM   2879 C CE3 . TRP E 1 83  ? 18.164 16.941  24.823  1.00 25.39 ? 1156 TRP E CE3 1 
ATOM   2880 C CZ2 . TRP E 1 83  ? 19.041 18.442  22.589  1.00 28.62 ? 1156 TRP E CZ2 1 
ATOM   2881 C CZ3 . TRP E 1 83  ? 19.316 17.713  24.879  1.00 27.07 ? 1156 TRP E CZ3 1 
ATOM   2882 C CH2 . TRP E 1 83  ? 19.735 18.459  23.773  1.00 30.08 ? 1156 TRP E CH2 1 
ATOM   2883 N N   . LEU E 1 84  ? 15.885 12.523  26.148  1.00 21.16 ? 1157 LEU E N   1 
ATOM   2884 C CA  . LEU E 1 84  ? 15.238 11.641  27.122  1.00 25.32 ? 1157 LEU E CA  1 
ATOM   2885 C C   . LEU E 1 84  ? 15.764 11.921  28.518  1.00 26.03 ? 1157 LEU E C   1 
ATOM   2886 O O   . LEU E 1 84  ? 16.947 12.209  28.674  1.00 25.24 ? 1157 LEU E O   1 
ATOM   2887 C CB  . LEU E 1 84  ? 15.509 10.164  26.777  1.00 25.91 ? 1157 LEU E CB  1 
ATOM   2888 C CG  . LEU E 1 84  ? 14.874 9.671   25.470  1.00 26.14 ? 1157 LEU E CG  1 
ATOM   2889 C CD1 . LEU E 1 84  ? 15.531 8.351   25.003  1.00 26.38 ? 1157 LEU E CD1 1 
ATOM   2890 C CD2 . LEU E 1 84  ? 13.351 9.508   25.643  1.00 26.55 ? 1157 LEU E CD2 1 
ATOM   2891 N N   . PRO E 1 85  ? 14.899 11.803  29.539  1.00 26.76 ? 1158 PRO E N   1 
ATOM   2892 C CA  . PRO E 1 85  ? 15.369 11.960  30.924  1.00 25.15 ? 1158 PRO E CA  1 
ATOM   2893 C C   . PRO E 1 85  ? 16.085 10.717  31.418  1.00 25.34 ? 1158 PRO E C   1 
ATOM   2894 O O   . PRO E 1 85  ? 16.022 9.632   30.798  1.00 25.43 ? 1158 PRO E O   1 
ATOM   2895 C CB  . PRO E 1 85  ? 14.073 12.117  31.727  1.00 30.11 ? 1158 PRO E CB  1 
ATOM   2896 C CG  . PRO E 1 85  ? 12.984 11.528  30.867  1.00 29.74 ? 1158 PRO E CG  1 
ATOM   2897 C CD  . PRO E 1 85  ? 13.482 11.397  29.456  1.00 26.32 ? 1158 PRO E CD  1 
ATOM   2898 N N   . ARG E 1 86  ? 16.763 10.880  32.548  1.00 25.53 ? 1159 ARG E N   1 
ATOM   2899 C CA  . ARG E 1 86  ? 17.467 9.800   33.227  1.00 26.49 ? 1159 ARG E CA  1 
ATOM   2900 C C   . ARG E 1 86  ? 16.650 8.521   33.381  1.00 26.96 ? 1159 ARG E C   1 
ATOM   2901 O O   . ARG E 1 86  ? 17.198 7.444   33.266  1.00 25.79 ? 1159 ARG E O   1 
ATOM   2902 C CB  . ARG E 1 86  ? 17.936 10.244  34.623  1.00 27.43 ? 1159 ARG E CB  1 
ATOM   2903 C CG  . ARG E 1 86  ? 18.781 9.183   35.340  1.00 31.21 ? 1159 ARG E CG  1 
ATOM   2904 C CD  . ARG E 1 86  ? 20.064 8.944   34.565  1.00 32.35 ? 1159 ARG E CD  1 
ATOM   2905 N NE  . ARG E 1 86  ? 20.922 7.927   35.162  1.00 35.69 ? 1159 ARG E NE  1 
ATOM   2906 C CZ  . ARG E 1 86  ? 20.717 6.626   35.024  1.00 34.06 ? 1159 ARG E CZ  1 
ATOM   2907 N NH1 . ARG E 1 86  ? 21.539 5.753   35.590  1.00 35.70 ? 1159 ARG E NH1 1 
ATOM   2908 N NH2 . ARG E 1 86  ? 19.672 6.213   34.316  1.00 31.73 ? 1159 ARG E NH2 1 
ATOM   2909 N N   . THR E 1 87  ? 15.353 8.639   33.663  1.00 25.81 ? 1160 THR E N   1 
ATOM   2910 C CA  . THR E 1 87  ? 14.540 7.458   33.925  1.00 28.48 ? 1160 THR E CA  1 
ATOM   2911 C C   . THR E 1 87  ? 14.325 6.592   32.677  1.00 27.52 ? 1160 THR E C   1 
ATOM   2912 O O   . THR E 1 87  ? 13.804 5.484   32.768  1.00 27.08 ? 1160 THR E O   1 
ATOM   2913 C CB  . THR E 1 87  ? 13.173 7.866   34.429  1.00 28.29 ? 1160 THR E CB  1 
ATOM   2914 O OG1 . THR E 1 87  ? 12.690 8.913   33.592  1.00 29.32 ? 1160 THR E OG1 1 
ATOM   2915 C CG2 . THR E 1 87  ? 13.266 8.395   35.882  1.00 32.05 ? 1160 THR E CG2 1 
ATOM   2916 N N   . LYS E 1 88  ? 14.690 7.116   31.512  1.00 26.03 ? 1161 LYS E N   1 
ATOM   2917 C CA  . LYS E 1 88  ? 14.479 6.399   30.251  1.00 24.90 ? 1161 LYS E CA  1 
ATOM   2918 C C   . LYS E 1 88  ? 15.772 5.795   29.711  1.00 26.11 ? 1161 LYS E C   1 
ATOM   2919 O O   . LYS E 1 88  ? 15.787 5.219   28.614  1.00 24.08 ? 1161 LYS E O   1 
ATOM   2920 C CB  . LYS E 1 88  ? 13.873 7.318   29.174  1.00 25.17 ? 1161 LYS E CB  1 
ATOM   2921 C CG  . LYS E 1 88  ? 12.461 7.822   29.485  1.00 28.74 ? 1161 LYS E CG  1 
ATOM   2922 C CD  . LYS E 1 88  ? 11.474 6.677   29.711  1.00 30.74 ? 1161 LYS E CD  1 
ATOM   2923 C CE  . LYS E 1 88  ? 10.207 7.211   30.386  1.00 37.97 ? 1161 LYS E CE  1 
ATOM   2924 N NZ  . LYS E 1 88  ? 9.238  6.132   30.787  1.00 43.92 ? 1161 LYS E NZ  1 
ATOM   2925 N N   . LEU E 1 89  ? 16.839 5.868   30.503  1.00 25.52 ? 1162 LEU E N   1 
ATOM   2926 C CA  . LEU E 1 89  ? 18.146 5.405   30.051  1.00 23.31 ? 1162 LEU E CA  1 
ATOM   2927 C C   . LEU E 1 89  ? 18.761 4.450   31.053  1.00 27.02 ? 1162 LEU E C   1 
ATOM   2928 O O   . LEU E 1 89  ? 18.607 4.625   32.277  1.00 25.51 ? 1162 LEU E O   1 
ATOM   2929 C CB  . LEU E 1 89  ? 19.093 6.597   29.895  1.00 22.48 ? 1162 LEU E CB  1 
ATOM   2930 C CG  . LEU E 1 89  ? 18.625 7.782   29.073  1.00 25.89 ? 1162 LEU E CG  1 
ATOM   2931 C CD1 . LEU E 1 89  ? 19.669 8.882   29.253  1.00 29.90 ? 1162 LEU E CD1 1 
ATOM   2932 C CD2 . LEU E 1 89  ? 18.472 7.408   27.603  1.00 23.46 ? 1162 LEU E CD2 1 
ATOM   2933 N N   . VAL E 1 90  ? 19.433 3.435   30.530  1.00 24.11 ? 1163 VAL E N   1 
ATOM   2934 C CA  . VAL E 1 90  ? 20.239 2.531   31.341  1.00 26.38 ? 1163 VAL E CA  1 
ATOM   2935 C C   . VAL E 1 90  ? 21.527 2.143   30.614  1.00 22.78 ? 1163 VAL E C   1 
ATOM   2936 O O   . VAL E 1 90  ? 21.532 1.915   29.401  1.00 22.43 ? 1163 VAL E O   1 
ATOM   2937 C CB  . VAL E 1 90  ? 19.432 1.287   31.867  1.00 32.87 ? 1163 VAL E CB  1 
ATOM   2938 C CG1 . VAL E 1 90  ? 17.909 1.581   31.935  1.00 33.13 ? 1163 VAL E CG1 1 
ATOM   2939 C CG2 . VAL E 1 90  ? 19.710 0.076   31.065  1.00 31.23 ? 1163 VAL E CG2 1 
ATOM   2940 N N   . PRO E 1 91  ? 22.642 2.119   31.353  1.00 24.30 ? 1164 PRO E N   1 
ATOM   2941 C CA  . PRO E 1 91  ? 23.953 1.836   30.778  1.00 24.88 ? 1164 PRO E CA  1 
ATOM   2942 C C   . PRO E 1 91  ? 23.943 0.529   29.996  1.00 22.25 ? 1164 PRO E C   1 
ATOM   2943 O O   . PRO E 1 91  ? 23.414 -0.483  30.479  1.00 24.76 ? 1164 PRO E O   1 
ATOM   2944 C CB  . PRO E 1 91  ? 24.855 1.710   32.019  1.00 26.57 ? 1164 PRO E CB  1 
ATOM   2945 C CG  . PRO E 1 91  ? 24.213 2.644   33.009  1.00 27.88 ? 1164 PRO E CG  1 
ATOM   2946 C CD  . PRO E 1 91  ? 22.729 2.426   32.797  1.00 26.51 ? 1164 PRO E CD  1 
ATOM   2947 N N   . LEU E 1 92  ? 24.545 0.565   28.810  1.00 20.76 ? 1165 LEU E N   1 
ATOM   2948 C CA  . LEU E 1 92  ? 24.605 -0.562  27.894  1.00 21.23 ? 1165 LEU E CA  1 
ATOM   2949 C C   . LEU E 1 92  ? 25.995 -1.161  27.865  1.00 24.85 ? 1165 LEU E C   1 
ATOM   2950 O O   . LEU E 1 92  ? 26.993 -0.426  27.953  1.00 21.95 ? 1165 LEU E O   1 
ATOM   2951 C CB  . LEU E 1 92  ? 24.209 -0.076  26.483  1.00 18.30 ? 1165 LEU E CB  1 
ATOM   2952 C CG  . LEU E 1 92  ? 24.115 -1.153  25.413  1.00 21.06 ? 1165 LEU E CG  1 
ATOM   2953 C CD1 . LEU E 1 92  ? 23.000 -0.822  24.403  1.00 21.26 ? 1165 LEU E CD1 1 
ATOM   2954 C CD2 . LEU E 1 92  ? 25.471 -1.304  24.704  1.00 17.94 ? 1165 LEU E CD2 1 
ATOM   2955 N N   . GLY E 1 93  ? 26.048 -2.490  27.734  1.00 23.47 ? 1166 GLY E N   1 
ATOM   2956 C CA  . GLY E 1 93  ? 27.279 -3.235  27.551  1.00 24.13 ? 1166 GLY E CA  1 
ATOM   2957 C C   . GLY E 1 93  ? 28.079 -3.462  28.824  1.00 27.81 ? 1166 GLY E C   1 
ATOM   2958 O O   . GLY E 1 93  ? 29.253 -3.833  28.758  1.00 28.85 ? 1166 GLY E O   1 
ATOM   2959 N N   . VAL E 1 94  ? 27.444 -3.230  29.965  1.00 27.99 ? 1167 VAL E N   1 
ATOM   2960 C CA  . VAL E 1 94  ? 28.079 -3.357  31.291  1.00 29.99 ? 1167 VAL E CA  1 
ATOM   2961 C C   . VAL E 1 94  ? 27.592 -4.596  32.059  1.00 32.76 ? 1167 VAL E C   1 
ATOM   2962 O O   . VAL E 1 94  ? 28.367 -5.220  32.778  1.00 31.20 ? 1167 VAL E O   1 
ATOM   2963 C CB  A VAL E 1 94  ? 27.784 -2.114  32.166  0.42 30.20 ? 1167 VAL E CB  1 
ATOM   2964 C CB  B VAL E 1 94  ? 27.910 -2.068  32.135  0.58 30.30 ? 1167 VAL E CB  1 
ATOM   2965 C CG1 A VAL E 1 94  ? 28.676 -2.101  33.401  0.42 30.43 ? 1167 VAL E CG1 1 
ATOM   2966 C CG1 B VAL E 1 94  ? 28.518 -0.867  31.392  0.58 31.25 ? 1167 VAL E CG1 1 
ATOM   2967 C CG2 A VAL E 1 94  ? 27.960 -0.835  31.360  0.42 30.47 ? 1167 VAL E CG2 1 
ATOM   2968 C CG2 B VAL E 1 94  ? 26.450 -1.822  32.459  0.58 29.16 ? 1167 VAL E CG2 1 
ATOM   2969 N N   . ASN E 1 95  ? 26.310 -4.931  31.892  1.00 25.62 ? 1168 ASN E N   1 
ATOM   2970 C CA  . ASN E 1 95  ? 25.675 -6.123  32.486  1.00 31.42 ? 1168 ASN E CA  1 
ATOM   2971 C C   . ASN E 1 95  ? 25.103 -7.011  31.376  1.00 28.61 ? 1168 ASN E C   1 
ATOM   2972 O O   . ASN E 1 95  ? 24.125 -6.653  30.703  1.00 27.25 ? 1168 ASN E O   1 
ATOM   2973 C CB  . ASN E 1 95  ? 24.583 -5.703  33.490  1.00 27.23 ? 1168 ASN E CB  1 
ATOM   2974 C CG  . ASN E 1 95  ? 23.925 -6.898  34.210  1.00 33.32 ? 1168 ASN E CG  1 
ATOM   2975 O OD1 . ASN E 1 95  ? 23.765 -7.988  33.649  1.00 28.38 ? 1168 ASN E OD1 1 
ATOM   2976 N ND2 . ASN E 1 95  ? 23.536 -6.675  35.461  1.00 38.33 ? 1168 ASN E ND2 1 
ATOM   2977 N N   . GLN E 1 96  ? 25.728 -8.163  31.175  1.00 24.41 ? 1169 GLN E N   1 
ATOM   2978 C CA  . GLN E 1 96  ? 25.411 -9.005  30.040  1.00 31.75 ? 1169 GLN E CA  1 
ATOM   2979 C C   . GLN E 1 96  ? 23.973 -9.518  30.095  1.00 28.63 ? 1169 GLN E C   1 
ATOM   2980 O O   . GLN E 1 96  ? 23.294 -9.585  29.077  1.00 25.22 ? 1169 GLN E O   1 
ATOM   2981 C CB  . GLN E 1 96  ? 26.410 -10.153 29.947  1.00 34.87 ? 1169 GLN E CB  1 
ATOM   2982 C CG  . GLN E 1 96  ? 26.007 -11.246 29.000  1.00 40.67 ? 1169 GLN E CG  1 
ATOM   2983 C CD  . GLN E 1 96  ? 27.164 -11.676 28.113  1.00 53.10 ? 1169 GLN E CD  1 
ATOM   2984 O OE1 . GLN E 1 96  ? 27.829 -10.835 27.495  1.00 55.56 ? 1169 GLN E OE1 1 
ATOM   2985 N NE2 . GLN E 1 96  ? 27.412 -12.989 28.044  1.00 57.76 ? 1169 GLN E NE2 1 
ATOM   2986 N N   . ASP E 1 97  ? 23.497 -9.860  31.285  1.00 27.15 ? 1170 ASP E N   1 
ATOM   2987 C CA  . ASP E 1 97  ? 22.111 -10.336 31.426  1.00 27.57 ? 1170 ASP E CA  1 
ATOM   2988 C C   . ASP E 1 97  ? 21.054 -9.272  31.237  1.00 26.75 ? 1170 ASP E C   1 
ATOM   2989 O O   . ASP E 1 97  ? 19.963 -9.537  30.698  1.00 25.40 ? 1170 ASP E O   1 
ATOM   2990 C CB  . ASP E 1 97  ? 21.934 -11.052 32.775  1.00 25.32 ? 1170 ASP E CB  1 
ATOM   2991 C CG  . ASP E 1 97  ? 22.752 -12.313 32.840  1.00 30.24 ? 1170 ASP E CG  1 
ATOM   2992 O OD1 . ASP E 1 97  ? 23.644 -12.401 33.712  1.00 35.90 ? 1170 ASP E OD1 1 
ATOM   2993 O OD2 . ASP E 1 97  ? 22.532 -13.190 31.979  1.00 29.77 ? 1170 ASP E OD2 1 
ATOM   2994 N N   . LEU E 1 98  ? 21.340 -8.068  31.720  1.00 25.07 ? 1171 LEU E N   1 
ATOM   2995 C CA  . LEU E 1 98  ? 20.482 -6.938  31.439  1.00 26.36 ? 1171 LEU E CA  1 
ATOM   2996 C C   . LEU E 1 98  ? 20.440 -6.684  29.920  1.00 23.66 ? 1171 LEU E C   1 
ATOM   2997 O O   . LEU E 1 98  ? 19.358 -6.491  29.358  1.00 24.41 ? 1171 LEU E O   1 
ATOM   2998 C CB  . LEU E 1 98  ? 20.967 -5.691  32.192  1.00 26.48 ? 1171 LEU E CB  1 
ATOM   2999 C CG  . LEU E 1 98  ? 20.265 -4.340  32.024  1.00 31.20 ? 1171 LEU E CG  1 
ATOM   3000 C CD1 . LEU E 1 98  ? 18.752 -4.436  32.109  1.00 34.27 ? 1171 LEU E CD1 1 
ATOM   3001 C CD2 . LEU E 1 98  ? 20.772 -3.369  33.080  1.00 29.71 ? 1171 LEU E CD2 1 
ATOM   3002 N N   . ASP E 1 99  ? 21.596 -6.688  29.262  1.00 21.66 ? 1172 ASP E N   1 
ATOM   3003 C CA  . ASP E 1 99  ? 21.604 -6.457  27.818  1.00 22.59 ? 1172 ASP E CA  1 
ATOM   3004 C C   . ASP E 1 99  ? 20.727 -7.517  27.119  1.00 27.54 ? 1172 ASP E C   1 
ATOM   3005 O O   . ASP E 1 99  ? 19.917 -7.187  26.247  1.00 24.19 ? 1172 ASP E O   1 
ATOM   3006 C CB  . ASP E 1 99  ? 23.016 -6.476  27.240  1.00 24.47 ? 1172 ASP E CB  1 
ATOM   3007 C CG  . ASP E 1 99  ? 23.834 -5.221  27.601  1.00 22.45 ? 1172 ASP E CG  1 
ATOM   3008 O OD1 . ASP E 1 99  ? 25.056 -5.248  27.367  1.00 26.09 ? 1172 ASP E OD1 1 
ATOM   3009 O OD2 . ASP E 1 99  ? 23.276 -4.255  28.141  1.00 23.63 ? 1172 ASP E OD2 1 
ATOM   3010 N N   . LYS E 1 100 ? 20.884 -8.780  27.520  1.00 22.55 ? 1173 LYS E N   1 
ATOM   3011 C CA  . LYS E 1 100 ? 20.102 -9.851  26.920  1.00 29.61 ? 1173 LYS E CA  1 
ATOM   3012 C C   . LYS E 1 100 ? 18.591 -9.734  27.152  1.00 25.28 ? 1173 LYS E C   1 
ATOM   3013 O O   . LYS E 1 100 ? 17.800 -10.018 26.250  1.00 27.60 ? 1173 LYS E O   1 
ATOM   3014 C CB  . LYS E 1 100 ? 20.650 -11.217 27.330  1.00 28.15 ? 1173 LYS E CB  1 
ATOM   3015 C CG  . LYS E 1 100 ? 21.989 -11.547 26.653  1.00 28.91 ? 1173 LYS E CG  1 
ATOM   3016 C CD  . LYS E 1 100 ? 22.703 -12.681 27.370  1.00 36.98 ? 1173 LYS E CD  1 
ATOM   3017 C CE  . LYS E 1 100 ? 23.933 -13.139 26.623  1.00 41.61 ? 1173 LYS E CE  1 
ATOM   3018 N NZ  . LYS E 1 100 ? 24.401 -14.459 27.135  1.00 50.18 ? 1173 LYS E NZ  1 
ATOM   3019 N N   . GLU E 1 101 ? 18.187 -9.308  28.346  1.00 23.42 ? 1174 GLU E N   1 
ATOM   3020 C CA  . GLU E 1 101 ? 16.786 -9.017  28.601  1.00 26.08 ? 1174 GLU E CA  1 
ATOM   3021 C C   . GLU E 1 101 ? 16.257 -7.885  27.705  1.00 27.70 ? 1174 GLU E C   1 
ATOM   3022 O O   . GLU E 1 101 ? 15.185 -8.011  27.088  1.00 25.70 ? 1174 GLU E O   1 
ATOM   3023 C CB  . GLU E 1 101 ? 16.559 -8.670  30.077  1.00 26.46 ? 1174 GLU E CB  1 
ATOM   3024 C CG  . GLU E 1 101 ? 15.156 -8.227  30.375  1.00 29.67 ? 1174 GLU E CG  1 
ATOM   3025 C CD  . GLU E 1 101 ? 14.951 -7.733  31.812  1.00 34.00 ? 1174 GLU E CD  1 
ATOM   3026 O OE1 . GLU E 1 101 ? 13.782 -7.525  32.194  1.00 35.49 ? 1174 GLU E OE1 1 
ATOM   3027 O OE2 . GLU E 1 101 ? 15.944 -7.562  32.551  1.00 31.23 ? 1174 GLU E OE2 1 
ATOM   3028 N N   . LYS E 1 102 ? 16.987 -6.771  27.645  1.00 23.83 ? 1175 LYS E N   1 
ATOM   3029 C CA  . LYS E 1 102 ? 16.562 -5.626  26.822  1.00 27.46 ? 1175 LYS E CA  1 
ATOM   3030 C C   . LYS E 1 102 ? 16.371 -6.029  25.358  1.00 25.45 ? 1175 LYS E C   1 
ATOM   3031 O O   . LYS E 1 102 ? 15.459 -5.556  24.675  1.00 28.84 ? 1175 LYS E O   1 
ATOM   3032 C CB  . LYS E 1 102 ? 17.614 -4.507  26.881  1.00 25.16 ? 1175 LYS E CB  1 
ATOM   3033 C CG  . LYS E 1 102 ? 17.792 -3.912  28.271  1.00 29.42 ? 1175 LYS E CG  1 
ATOM   3034 C CD  . LYS E 1 102 ? 16.633 -3.031  28.612  1.00 29.81 ? 1175 LYS E CD  1 
ATOM   3035 C CE  . LYS E 1 102 ? 16.849 -2.355  29.957  1.00 36.73 ? 1175 LYS E CE  1 
ATOM   3036 N NZ  . LYS E 1 102 ? 15.555 -1.866  30.465  1.00 32.01 ? 1175 LYS E NZ  1 
ATOM   3037 N N   . MET E 1 103 ? 17.235 -6.904  24.883  1.00 22.66 ? 1176 MET E N   1 
ATOM   3038 C CA  . MET E 1 103 ? 17.219 -7.249  23.470  1.00 28.14 ? 1176 MET E CA  1 
ATOM   3039 C C   . MET E 1 103 ? 15.945 -7.993  23.072  1.00 31.94 ? 1176 MET E C   1 
ATOM   3040 O O   . MET E 1 103 ? 15.599 -8.050  21.890  1.00 29.41 ? 1176 MET E O   1 
ATOM   3041 C CB  . MET E 1 103 ? 18.478 -8.019  23.081  1.00 25.69 ? 1176 MET E CB  1 
ATOM   3042 C CG  . MET E 1 103 ? 19.554 -7.025  22.508  1.00 28.96 ? 1176 MET E CG  1 
ATOM   3043 S SD  . MET E 1 103 ? 21.002 -7.826  21.947  1.00 45.72 ? 1176 MET E SD  1 
ATOM   3044 C CE  . MET E 1 103 ? 21.532 -8.746  23.403  1.00 31.49 ? 1176 MET E CE  1 
ATOM   3045 N N   . LEU E 1 104 ? 15.246 -8.536  24.068  1.00 29.70 ? 1177 LEU E N   1 
ATOM   3046 C CA  . LEU E 1 104 ? 14.004 -9.307  23.844  1.00 29.97 ? 1177 LEU E CA  1 
ATOM   3047 C C   . LEU E 1 104 ? 12.714 -8.530  24.079  1.00 31.86 ? 1177 LEU E C   1 
ATOM   3048 O O   . LEU E 1 104 ? 11.616 -9.102  24.038  1.00 35.95 ? 1177 LEU E O   1 
ATOM   3049 C CB  . LEU E 1 104 ? 14.007 -10.547 24.738  1.00 27.40 ? 1177 LEU E CB  1 
ATOM   3050 C CG  . LEU E 1 104 ? 15.125 -11.534 24.483  1.00 31.61 ? 1177 LEU E CG  1 
ATOM   3051 C CD1 . LEU E 1 104 ? 15.164 -12.565 25.579  1.00 34.60 ? 1177 LEU E CD1 1 
ATOM   3052 C CD2 . LEU E 1 104 ? 14.956 -12.207 23.118  1.00 35.13 ? 1177 LEU E CD2 1 
ATOM   3053 N N   . GLU E 1 105 ? 12.837 -7.232  24.330  1.00 30.50 ? 1178 GLU E N   1 
ATOM   3054 C CA  . GLU E 1 105 ? 11.704 -6.376  24.666  1.00 32.95 ? 1178 GLU E CA  1 
ATOM   3055 C C   . GLU E 1 105 ? 10.702 -6.134  23.529  1.00 34.79 ? 1178 GLU E C   1 
ATOM   3056 O O   . GLU E 1 105 ? 9.514  -5.919  23.785  1.00 35.18 ? 1178 GLU E O   1 
ATOM   3057 C CB  . GLU E 1 105 ? 12.244 -5.033  25.124  1.00 31.17 ? 1178 GLU E CB  1 
ATOM   3058 C CG  . GLU E 1 105 ? 11.357 -4.239  26.009  1.00 35.23 ? 1178 GLU E CG  1 
ATOM   3059 C CD  . GLU E 1 105 ? 11.954 -2.882  26.354  1.00 33.37 ? 1178 GLU E CD  1 
ATOM   3060 O OE1 . GLU E 1 105 ? 13.010 -2.825  27.024  1.00 34.51 ? 1178 GLU E OE1 1 
ATOM   3061 O OE2 . GLU E 1 105 ? 11.332 -1.868  25.995  1.00 37.34 ? 1178 GLU E OE2 1 
ATOM   3062 N N   . GLY E 1 106 ? 11.186 -6.115  22.288  1.00 31.76 ? 1179 GLY E N   1 
ATOM   3063 C CA  . GLY E 1 106 ? 10.336 -5.798  21.144  1.00 31.31 ? 1179 GLY E CA  1 
ATOM   3064 C C   . GLY E 1 106 ? 9.227  -6.838  20.983  1.00 32.44 ? 1179 GLY E C   1 
ATOM   3065 O O   . GLY E 1 106 ? 9.463  -8.011  21.182  1.00 32.07 ? 1179 GLY E O   1 
ATOM   3066 N N   . ARG E 1 107 ? 8.018  -6.408  20.644  1.00 34.18 ? 1180 ARG E N   1 
ATOM   3067 C CA  . ARG E 1 107 ? 6.910  -7.361  20.577  1.00 38.24 ? 1180 ARG E CA  1 
ATOM   3068 C C   . ARG E 1 107 ? 6.938  -8.232  19.321  1.00 36.40 ? 1180 ARG E C   1 
ATOM   3069 O O   . ARG E 1 107 ? 6.416  -9.339  19.323  1.00 38.64 ? 1180 ARG E O   1 
ATOM   3070 C CB  . ARG E 1 107 ? 5.561  -6.658  20.695  1.00 40.99 ? 1180 ARG E CB  1 
ATOM   3071 C CG  . ARG E 1 107 ? 4.469  -7.604  21.219  1.00 56.26 ? 1180 ARG E CG  1 
ATOM   3072 C CD  . ARG E 1 107 ? 3.182  -6.875  21.627  1.00 61.95 ? 1180 ARG E CD  1 
ATOM   3073 N NE  . ARG E 1 107 ? 2.268  -7.759  22.357  1.00 65.67 ? 1180 ARG E NE  1 
ATOM   3074 C CZ  . ARG E 1 107 ? 1.356  -8.539  21.781  1.00 67.00 ? 1180 ARG E CZ  1 
ATOM   3075 N NH1 . ARG E 1 107 ? 0.573  -9.306  22.529  1.00 71.41 ? 1180 ARG E NH1 1 
ATOM   3076 N NH2 . ARG E 1 107 ? 1.223  -8.558  20.461  1.00 65.72 ? 1180 ARG E NH2 1 
ATOM   3077 N N   . LYS E 1 108 ? 7.546  -7.731  18.255  1.00 30.86 ? 1181 LYS E N   1 
ATOM   3078 C CA  . LYS E 1 108 ? 7.631  -8.484  17.000  1.00 35.19 ? 1181 LYS E CA  1 
ATOM   3079 C C   . LYS E 1 108 ? 9.075  -8.708  16.534  1.00 37.31 ? 1181 LYS E C   1 
ATOM   3080 O O   . LYS E 1 108 ? 9.976  -7.922  16.845  1.00 34.38 ? 1181 LYS E O   1 
ATOM   3081 C CB  . LYS E 1 108 ? 6.827  -7.782  15.903  1.00 36.59 ? 1181 LYS E CB  1 
ATOM   3082 C CG  . LYS E 1 108 ? 5.316  -7.865  16.106  1.00 39.50 ? 1181 LYS E CG  1 
ATOM   3083 C CD  . LYS E 1 108 ? 4.571  -7.180  14.969  1.00 46.68 ? 1181 LYS E CD  1 
ATOM   3084 C CE  . LYS E 1 108 ? 3.182  -6.691  15.412  1.00 52.99 ? 1181 LYS E CE  1 
ATOM   3085 N NZ  . LYS E 1 108 ? 2.594  -5.697  14.445  1.00 52.04 ? 1181 LYS E NZ  1 
ATOM   3086 N N   . SER E 1 109 ? 9.271  -9.757  15.745  1.00 34.96 ? 1182 SER E N   1 
ATOM   3087 C CA  . SER E 1 109 ? 10.606 -10.194 15.361  1.00 33.87 ? 1182 SER E CA  1 
ATOM   3088 C C   . SER E 1 109 ? 11.394 -9.115  14.634  1.00 33.49 ? 1182 SER E C   1 
ATOM   3089 O O   . SER E 1 109 ? 12.618 -9.043  14.771  1.00 31.31 ? 1182 SER E O   1 
ATOM   3090 C CB  . SER E 1 109 ? 10.521 -11.438 14.483  1.00 37.58 ? 1182 SER E CB  1 
ATOM   3091 O OG  . SER E 1 109 ? 9.886  -11.116 13.258  1.00 37.98 ? 1182 SER E OG  1 
ATOM   3092 N N   . ASN E 1 110 ? 10.699 -8.275  13.867  1.00 30.41 ? 1183 ASN E N   1 
ATOM   3093 C CA  . ASN E 1 110 ? 11.381 -7.269  13.069  1.00 34.99 ? 1183 ASN E CA  1 
ATOM   3094 C C   . ASN E 1 110 ? 12.037 -6.164  13.906  1.00 33.58 ? 1183 ASN E C   1 
ATOM   3095 O O   . ASN E 1 110 ? 13.190 -5.793  13.650  1.00 27.37 ? 1183 ASN E O   1 
ATOM   3096 C CB  . ASN E 1 110 ? 10.467 -6.708  11.961  1.00 35.15 ? 1183 ASN E CB  1 
ATOM   3097 C CG  . ASN E 1 110 ? 9.616  -5.534  12.419  1.00 44.73 ? 1183 ASN E CG  1 
ATOM   3098 O OD1 . ASN E 1 110 ? 8.803  -5.641  13.349  1.00 42.77 ? 1183 ASN E OD1 1 
ATOM   3099 N ND2 . ASN E 1 110 ? 9.795  -4.396  11.750  1.00 48.53 ? 1183 ASN E ND2 1 
ATOM   3100 N N   . ILE E 1 111 ? 11.324 -5.634  14.897  1.00 28.54 ? 1184 ILE E N   1 
ATOM   3101 C CA  . ILE E 1 111 ? 11.939 -4.605  15.723  1.00 31.93 ? 1184 ILE E CA  1 
ATOM   3102 C C   . ILE E 1 111 ? 13.003 -5.251  16.612  1.00 25.11 ? 1184 ILE E C   1 
ATOM   3103 O O   . ILE E 1 111 ? 14.017 -4.621  16.890  1.00 24.74 ? 1184 ILE E O   1 
ATOM   3104 C CB  . ILE E 1 111 ? 10.898 -3.736  16.535  1.00 33.44 ? 1184 ILE E CB  1 
ATOM   3105 C CG1 . ILE E 1 111 ? 11.547 -2.476  17.147  1.00 34.72 ? 1184 ILE E CG1 1 
ATOM   3106 C CG2 . ILE E 1 111 ? 10.262 -4.538  17.635  1.00 32.27 ? 1184 ILE E CG2 1 
ATOM   3107 C CD1 . ILE E 1 111 ? 12.068 -1.441  16.132  1.00 36.02 ? 1184 ILE E CD1 1 
ATOM   3108 N N   . ARG E 1 112 ? 12.797 -6.490  17.058  1.00 24.17 ? 1185 ARG E N   1 
ATOM   3109 C CA  . ARG E 1 112 ? 13.857 -7.149  17.827  1.00 27.09 ? 1185 ARG E CA  1 
ATOM   3110 C C   . ARG E 1 112 ? 15.146 -7.306  16.998  1.00 27.03 ? 1185 ARG E C   1 
ATOM   3111 O O   . ARG E 1 112 ? 16.258 -7.175  17.533  1.00 21.99 ? 1185 ARG E O   1 
ATOM   3112 C CB  . ARG E 1 112 ? 13.420 -8.516  18.324  1.00 27.99 ? 1185 ARG E CB  1 
ATOM   3113 C CG  . ARG E 1 112 ? 12.622 -8.470  19.617  1.00 30.17 ? 1185 ARG E CG  1 
ATOM   3114 C CD  . ARG E 1 112 ? 12.114 -9.847  19.977  1.00 32.31 ? 1185 ARG E CD  1 
ATOM   3115 N NE  . ARG E 1 112 ? 10.683 -9.830  19.719  1.00 45.24 ? 1185 ARG E NE  1 
ATOM   3116 C CZ  . ARG E 1 112 ? 9.980  -10.791 19.144  1.00 36.47 ? 1185 ARG E CZ  1 
ATOM   3117 N NH1 . ARG E 1 112 ? 10.540 -11.922 18.731  1.00 36.73 ? 1185 ARG E NH1 1 
ATOM   3118 N NH2 . ARG E 1 112 ? 8.686  -10.585 18.971  1.00 45.25 ? 1185 ARG E NH2 1 
ATOM   3119 N N   . LYS E 1 113 ? 15.005 -7.598  15.705  1.00 23.21 ? 1186 LYS E N   1 
ATOM   3120 C CA  . LYS E 1 113 ? 16.189 -7.753  14.852  1.00 24.95 ? 1186 LYS E CA  1 
ATOM   3121 C C   . LYS E 1 113 ? 16.902 -6.419  14.678  1.00 21.55 ? 1186 LYS E C   1 
ATOM   3122 O O   . LYS E 1 113 ? 18.151 -6.361  14.658  1.00 22.26 ? 1186 LYS E O   1 
ATOM   3123 C CB  . LYS E 1 113 ? 15.846 -8.337  13.465  1.00 27.27 ? 1186 LYS E CB  1 
ATOM   3124 C CG  . LYS E 1 113 ? 17.055 -8.997  12.785  1.00 27.81 ? 1186 LYS E CG  1 
ATOM   3125 C CD  . LYS E 1 113 ? 16.780 -9.480  11.347  1.00 31.68 ? 1186 LYS E CD  1 
ATOM   3126 C CE  . LYS E 1 113 ? 16.747 -8.309  10.373  1.00 29.47 ? 1186 LYS E CE  1 
ATOM   3127 N NZ  . LYS E 1 113 ? 17.218 -8.691  9.001   1.00 33.62 ? 1186 LYS E NZ  1 
ATOM   3128 N N   . SER E 1 114 ? 16.117 -5.350  14.540  1.00 20.51 ? 1187 SER E N   1 
ATOM   3129 C CA  . SER E 1 114 ? 16.667 -4.007  14.435  1.00 22.94 ? 1187 SER E CA  1 
ATOM   3130 C C   . SER E 1 114 ? 17.430 -3.652  15.705  1.00 22.47 ? 1187 SER E C   1 
ATOM   3131 O O   . SER E 1 114 ? 18.509 -3.055  15.653  1.00 19.23 ? 1187 SER E O   1 
ATOM   3132 C CB  . SER E 1 114 ? 15.551 -2.998  14.213  1.00 27.07 ? 1187 SER E CB  1 
ATOM   3133 O OG  . SER E 1 114 ? 16.052 -1.669  14.244  1.00 33.24 ? 1187 SER E OG  1 
ATOM   3134 N N   . VAL E 1 115 ? 16.854 -4.028  16.842  1.00 21.57 ? 1188 VAL E N   1 
ATOM   3135 C CA  . VAL E 1 115 ? 17.484 -3.746  18.123  1.00 23.25 ? 1188 VAL E CA  1 
ATOM   3136 C C   . VAL E 1 115 ? 18.794 -4.520  18.244  1.00 19.78 ? 1188 VAL E C   1 
ATOM   3137 O O   . VAL E 1 115 ? 19.795 -3.966  18.679  1.00 18.24 ? 1188 VAL E O   1 
ATOM   3138 C CB  . VAL E 1 115 ? 16.529 -4.084  19.282  1.00 23.08 ? 1188 VAL E CB  1 
ATOM   3139 C CG1 . VAL E 1 115 ? 17.288 -4.126  20.581  1.00 19.67 ? 1188 VAL E CG1 1 
ATOM   3140 C CG2 . VAL E 1 115 ? 15.428 -3.042  19.333  1.00 21.78 ? 1188 VAL E CG2 1 
ATOM   3141 N N   . GLN E 1 116 ? 18.775 -5.794  17.869  1.00 19.58 ? 1189 GLN E N   1 
ATOM   3142 C CA  . GLN E 1 116 ? 19.984 -6.625  17.926  1.00 23.71 ? 1189 GLN E CA  1 
ATOM   3143 C C   . GLN E 1 116 ? 21.102 -6.091  17.040  1.00 22.04 ? 1189 GLN E C   1 
ATOM   3144 O O   . GLN E 1 116 ? 22.273 -6.037  17.446  1.00 18.95 ? 1189 GLN E O   1 
ATOM   3145 C CB  . GLN E 1 116 ? 19.710 -8.070  17.497  1.00 24.18 ? 1189 GLN E CB  1 
ATOM   3146 C CG  . GLN E 1 116 ? 18.853 -8.897  18.412  1.00 31.29 ? 1189 GLN E CG  1 
ATOM   3147 C CD  . GLN E 1 116 ? 18.572 -10.268 17.802  1.00 34.74 ? 1189 GLN E CD  1 
ATOM   3148 O OE1 . GLN E 1 116 ? 19.494 -10.995 17.416  1.00 40.50 ? 1189 GLN E OE1 1 
ATOM   3149 N NE2 . GLN E 1 116 ? 17.296 -10.608 17.688  1.00 41.85 ? 1189 GLN E NE2 1 
ATOM   3150 N N   . ILE E 1 117 ? 20.755 -5.719  15.813  1.00 19.67 ? 1190 ILE E N   1 
ATOM   3151 C CA  . ILE E 1 117 ? 21.732 -5.086  14.936  1.00 20.58 ? 1190 ILE E CA  1 
ATOM   3152 C C   . ILE E 1 117 ? 22.311 -3.821  15.601  1.00 22.73 ? 1190 ILE E C   1 
ATOM   3153 O O   . ILE E 1 117 ? 23.540 -3.599  15.601  1.00 20.91 ? 1190 ILE E O   1 
ATOM   3154 C CB  . ILE E 1 117 ? 21.101 -4.780  13.579  1.00 18.98 ? 1190 ILE E CB  1 
ATOM   3155 C CG1 . ILE E 1 117 ? 20.902 -6.119  12.830  1.00 20.91 ? 1190 ILE E CG1 1 
ATOM   3156 C CG2 . ILE E 1 117 ? 21.989 -3.843  12.770  1.00 22.33 ? 1190 ILE E CG2 1 
ATOM   3157 C CD1 . ILE E 1 117 ? 20.063 -6.026  11.530  1.00 24.60 ? 1190 ILE E CD1 1 
ATOM   3158 N N   . ALA E 1 118 ? 21.427 -3.005  16.178  1.00 20.55 ? 1191 ALA E N   1 
ATOM   3159 C CA  . ALA E 1 118 ? 21.858 -1.748  16.808  1.00 18.56 ? 1191 ALA E CA  1 
ATOM   3160 C C   . ALA E 1 118 ? 22.797 -2.020  17.989  1.00 19.97 ? 1191 ALA E C   1 
ATOM   3161 O O   . ALA E 1 118 ? 23.740 -1.277  18.228  1.00 19.62 ? 1191 ALA E O   1 
ATOM   3162 C CB  . ALA E 1 118 ? 20.627 -0.946  17.289  1.00 20.63 ? 1191 ALA E CB  1 
ATOM   3163 N N   . TYR E 1 119 ? 22.513 -3.079  18.735  1.00 19.14 ? 1192 TYR E N   1 
ATOM   3164 C CA  . TYR E 1 119 ? 23.369 -3.491  19.844  1.00 19.01 ? 1192 TYR E CA  1 
ATOM   3165 C C   . TYR E 1 119 ? 24.792 -3.852  19.369  1.00 20.82 ? 1192 TYR E C   1 
ATOM   3166 O O   . TYR E 1 119 ? 25.777 -3.417  19.986  1.00 19.63 ? 1192 TYR E O   1 
ATOM   3167 C CB  . TYR E 1 119 ? 22.752 -4.682  20.576  1.00 19.41 ? 1192 TYR E CB  1 
ATOM   3168 C CG  . TYR E 1 119 ? 23.587 -5.168  21.744  1.00 19.64 ? 1192 TYR E CG  1 
ATOM   3169 C CD1 . TYR E 1 119 ? 23.552 -4.513  22.951  1.00 22.64 ? 1192 TYR E CD1 1 
ATOM   3170 C CD2 . TYR E 1 119 ? 24.387 -6.292  21.627  1.00 24.57 ? 1192 TYR E CD2 1 
ATOM   3171 C CE1 . TYR E 1 119 ? 24.305 -4.953  24.028  1.00 23.94 ? 1192 TYR E CE1 1 
ATOM   3172 C CE2 . TYR E 1 119 ? 25.154 -6.749  22.691  1.00 26.43 ? 1192 TYR E CE2 1 
ATOM   3173 C CZ  . TYR E 1 119 ? 25.102 -6.074  23.886  1.00 27.62 ? 1192 TYR E CZ  1 
ATOM   3174 O OH  . TYR E 1 119 ? 25.848 -6.535  24.947  1.00 29.54 ? 1192 TYR E OH  1 
ATOM   3175 N N   . HIS E 1 120 ? 24.914 -4.671  18.314  1.00 18.92 ? 1193 HIS E N   1 
ATOM   3176 C CA  . HIS E 1 120 ? 26.252 -4.991  17.788  1.00 19.98 ? 1193 HIS E CA  1 
ATOM   3177 C C   . HIS E 1 120 ? 26.937 -3.766  17.221  1.00 19.70 ? 1193 HIS E C   1 
ATOM   3178 O O   . HIS E 1 120 ? 28.155 -3.629  17.338  1.00 22.02 ? 1193 HIS E O   1 
ATOM   3179 C CB  . HIS E 1 120 ? 26.233 -6.186  16.798  1.00 18.72 ? 1193 HIS E CB  1 
ATOM   3180 C CG  . HIS E 1 120 ? 25.672 -7.414  17.432  1.00 22.65 ? 1193 HIS E CG  1 
ATOM   3181 N ND1 . HIS E 1 120 ? 26.253 -7.990  18.537  1.00 23.45 ? 1193 HIS E ND1 1 
ATOM   3182 C CD2 . HIS E 1 120 ? 24.528 -8.102  17.201  1.00 23.39 ? 1193 HIS E CD2 1 
ATOM   3183 C CE1 . HIS E 1 120 ? 25.518 -9.018  18.935  1.00 26.21 ? 1193 HIS E CE1 1 
ATOM   3184 N NE2 . HIS E 1 120 ? 24.459 -9.100  18.145  1.00 24.42 ? 1193 HIS E NE2 1 
ATOM   3185 N N   . ARG E 1 121 ? 26.167 -2.853  16.639  1.00 18.00 ? 1194 ARG E N   1 
ATOM   3186 C CA  . ARG E 1 121 ? 26.758 -1.587  16.216  1.00 20.16 ? 1194 ARG E CA  1 
ATOM   3187 C C   . ARG E 1 121 ? 27.335 -0.807  17.403  1.00 21.16 ? 1194 ARG E C   1 
ATOM   3188 O O   . ARG E 1 121 ? 28.442 -0.249  17.322  1.00 19.56 ? 1194 ARG E O   1 
ATOM   3189 C CB  . ARG E 1 121 ? 25.754 -0.716  15.467  1.00 19.52 ? 1194 ARG E CB  1 
ATOM   3190 C CG  . ARG E 1 121 ? 25.453 -1.207  14.060  1.00 24.99 ? 1194 ARG E CG  1 
ATOM   3191 C CD  . ARG E 1 121 ? 24.270 -0.394  13.547  1.00 27.48 ? 1194 ARG E CD  1 
ATOM   3192 N NE  . ARG E 1 121 ? 23.870 -0.797  12.214  1.00 28.03 ? 1194 ARG E NE  1 
ATOM   3193 C CZ  . ARG E 1 121 ? 22.680 -0.526  11.687  1.00 30.70 ? 1194 ARG E CZ  1 
ATOM   3194 N NH1 . ARG E 1 121 ? 22.404 -0.944  10.460  1.00 29.01 ? 1194 ARG E NH1 1 
ATOM   3195 N NH2 . ARG E 1 121 ? 21.760 0.144   12.398  1.00 27.64 ? 1194 ARG E NH2 1 
ATOM   3196 N N   . ALA E 1 122 ? 26.575 -0.764  18.492  1.00 21.01 ? 1195 ALA E N   1 
ATOM   3197 C CA  . ALA E 1 122 ? 27.023 -0.085  19.714  1.00 21.18 ? 1195 ALA E CA  1 
ATOM   3198 C C   . ALA E 1 122 ? 28.352 -0.677  20.202  1.00 23.41 ? 1195 ALA E C   1 
ATOM   3199 O O   . ALA E 1 122 ? 29.270 0.068   20.551  1.00 19.71 ? 1195 ALA E O   1 
ATOM   3200 C CB  . ALA E 1 122 ? 25.961 -0.176  20.815  1.00 20.01 ? 1195 ALA E CB  1 
ATOM   3201 N N   . LEU E 1 123 ? 28.455 -2.014  20.224  1.00 19.38 ? 1196 LEU E N   1 
ATOM   3202 C CA  . LEU E 1 123 ? 29.680 -2.649  20.730  1.00 23.59 ? 1196 LEU E CA  1 
ATOM   3203 C C   . LEU E 1 123 ? 30.871 -2.503  19.767  1.00 26.69 ? 1196 LEU E C   1 
ATOM   3204 O O   . LEU E 1 123 ? 32.027 -2.498  20.198  1.00 23.44 ? 1196 LEU E O   1 
ATOM   3205 C CB  . LEU E 1 123 ? 29.437 -4.121  21.086  1.00 21.95 ? 1196 LEU E CB  1 
ATOM   3206 C CG  . LEU E 1 123 ? 28.441 -4.423  22.214  1.00 27.68 ? 1196 LEU E CG  1 
ATOM   3207 C CD1 . LEU E 1 123 ? 28.599 -5.868  22.690  1.00 28.41 ? 1196 LEU E CD1 1 
ATOM   3208 C CD2 . LEU E 1 123 ? 28.575 -3.470  23.379  1.00 28.47 ? 1196 LEU E CD2 1 
ATOM   3209 N N   . GLN E 1 124 ? 30.588 -2.366  18.473  1.00 20.81 ? 1197 GLN E N   1 
ATOM   3210 C CA  . GLN E 1 124 ? 31.612 -2.063  17.515  1.00 22.47 ? 1197 GLN E CA  1 
ATOM   3211 C C   . GLN E 1 124 ? 32.151 -0.659  17.737  1.00 25.27 ? 1197 GLN E C   1 
ATOM   3212 O O   . GLN E 1 124 ? 33.326 -0.379  17.512  1.00 23.82 ? 1197 GLN E O   1 
ATOM   3213 C CB  . GLN E 1 124 ? 31.054 -2.150  16.100  1.00 22.69 ? 1197 GLN E CB  1 
ATOM   3214 C CG  . GLN E 1 124 ? 31.009 -3.591  15.555  1.00 23.06 ? 1197 GLN E CG  1 
ATOM   3215 C CD  . GLN E 1 124 ? 30.323 -3.625  14.224  1.00 24.61 ? 1197 GLN E CD  1 
ATOM   3216 O OE1 . GLN E 1 124 ? 30.918 -3.300  13.195  1.00 23.93 ? 1197 GLN E OE1 1 
ATOM   3217 N NE2 . GLN E 1 124 ? 29.049 -3.992  14.232  1.00 23.58 ? 1197 GLN E NE2 1 
ATOM   3218 N N   . HIS E 1 125 ? 31.264 0.241   18.124  1.00 23.05 ? 1198 HIS E N   1 
ATOM   3219 C CA  . HIS E 1 125 ? 31.676 1.608   18.401  1.00 25.29 ? 1198 HIS E CA  1 
ATOM   3220 C C   . HIS E 1 125 ? 32.593 1.605   19.621  1.00 26.36 ? 1198 HIS E C   1 
ATOM   3221 O O   . HIS E 1 125 ? 33.646 2.238   19.607  1.00 30.01 ? 1198 HIS E O   1 
ATOM   3222 C CB  . HIS E 1 125 ? 30.462 2.504   18.641  1.00 26.73 ? 1198 HIS E CB  1 
ATOM   3223 C CG  . HIS E 1 125 ? 30.796 3.793   19.322  1.00 23.91 ? 1198 HIS E CG  1 
ATOM   3224 N ND1 . HIS E 1 125 ? 30.968 4.969   18.636  1.00 28.68 ? 1198 HIS E ND1 1 
ATOM   3225 C CD2 . HIS E 1 125 ? 30.990 4.083   20.633  1.00 24.89 ? 1198 HIS E CD2 1 
ATOM   3226 C CE1 . HIS E 1 125 ? 31.258 5.938   19.493  1.00 28.77 ? 1198 HIS E CE1 1 
ATOM   3227 N NE2 . HIS E 1 125 ? 31.283 5.426   20.708  1.00 25.16 ? 1198 HIS E NE2 1 
ATOM   3228 N N   . ARG E 1 126 ? 32.208 0.876   20.661  1.00 22.70 ? 1199 ARG E N   1 
ATOM   3229 C CA  . ARG E 1 126 ? 33.046 0.775   21.849  1.00 27.93 ? 1199 ARG E CA  1 
ATOM   3230 C C   . ARG E 1 126 ? 34.433 0.201   21.535  1.00 31.59 ? 1199 ARG E C   1 
ATOM   3231 O O   . ARG E 1 126 ? 35.438 0.612   22.113  1.00 32.63 ? 1199 ARG E O   1 
ATOM   3232 C CB  . ARG E 1 126 ? 32.396 -0.125  22.875  1.00 27.90 ? 1199 ARG E CB  1 
ATOM   3233 C CG  . ARG E 1 126 ? 33.392 -0.630  23.897  1.00 34.12 ? 1199 ARG E CG  1 
ATOM   3234 C CD  . ARG E 1 126 ? 33.061 -2.063  24.263  1.00 43.33 ? 1199 ARG E CD  1 
ATOM   3235 N NE  . ARG E 1 126 ? 32.109 -2.058  25.346  1.00 37.80 ? 1199 ARG E NE  1 
ATOM   3236 C CZ  . ARG E 1 126 ? 31.496 -3.128  25.844  1.00 36.93 ? 1199 ARG E CZ  1 
ATOM   3237 N NH1 . ARG E 1 126 ? 30.683 -2.957  26.857  1.00 33.41 ? 1199 ARG E NH1 1 
ATOM   3238 N NH2 . ARG E 1 126 ? 31.688 -4.346  25.355  1.00 36.82 ? 1199 ARG E NH2 1 
ATOM   3239 N N   . SER E 1 127 ? 34.473 -0.763  20.624  1.00 27.63 ? 1200 SER E N   1 
ATOM   3240 C CA  . SER E 1 127 ? 35.711 -1.433  20.259  1.00 33.13 ? 1200 SER E CA  1 
ATOM   3241 C C   . SER E 1 127 ? 36.640 -0.484  19.483  1.00 34.19 ? 1200 SER E C   1 
ATOM   3242 O O   . SER E 1 127 ? 37.869 -0.517  19.660  1.00 33.80 ? 1200 SER E O   1 
ATOM   3243 C CB  . SER E 1 127 ? 35.396 -2.693  19.440  1.00 29.79 ? 1200 SER E CB  1 
ATOM   3244 O OG  . SER E 1 127 ? 36.587 -3.371  19.067  1.00 41.45 ? 1200 SER E OG  1 
ATOM   3245 N N   . LYS E 1 128 ? 36.061 0.360   18.633  1.00 30.65 ? 1201 LYS E N   1 
ATOM   3246 C CA  . LYS E 1 128 ? 36.852 1.335   17.881  1.00 31.28 ? 1201 LYS E CA  1 
ATOM   3247 C C   . LYS E 1 128 ? 37.441 2.354   18.840  1.00 36.10 ? 1201 LYS E C   1 
ATOM   3248 O O   . LYS E 1 128 ? 38.576 2.805   18.663  1.00 35.86 ? 1201 LYS E O   1 
ATOM   3249 C CB  . LYS E 1 128 ? 36.019 2.038   16.812  1.00 31.89 ? 1201 LYS E CB  1 
ATOM   3250 C CG  . LYS E 1 128 ? 35.497 1.122   15.717  1.00 36.34 ? 1201 LYS E CG  1 
ATOM   3251 C CD  . LYS E 1 128 ? 34.920 1.946   14.562  1.00 39.04 ? 1201 LYS E CD  1 
ATOM   3252 C CE  . LYS E 1 128 ? 34.561 1.060   13.374  1.00 49.58 ? 1201 LYS E CE  1 
ATOM   3253 N NZ  . LYS E 1 128 ? 34.692 1.755   12.043  1.00 54.23 ? 1201 LYS E NZ  1 
ATOM   3254 N N   . VAL E 1 129 ? 36.672 2.700   19.869  1.00 32.35 ? 1202 VAL E N   1 
ATOM   3255 C CA  . VAL E 1 129 ? 37.129 3.636   20.891  1.00 33.80 ? 1202 VAL E CA  1 
ATOM   3256 C C   . VAL E 1 129 ? 38.236 3.024   21.764  1.00 38.24 ? 1202 VAL E C   1 
ATOM   3257 O O   . VAL E 1 129 ? 39.170 3.718   22.164  1.00 43.82 ? 1202 VAL E O   1 
ATOM   3258 C CB  . VAL E 1 129 ? 35.958 4.112   21.758  1.00 36.74 ? 1202 VAL E CB  1 
ATOM   3259 C CG1 . VAL E 1 129 ? 36.454 4.914   22.948  1.00 40.35 ? 1202 VAL E CG1 1 
ATOM   3260 C CG2 . VAL E 1 129 ? 34.997 4.916   20.904  1.00 30.44 ? 1202 VAL E CG2 1 
ATOM   3261 N N   . GLN E 1 130 ? 38.147 1.727   22.037  1.00 39.02 ? 1203 GLN E N   1 
ATOM   3262 C CA  . GLN E 1 130 ? 39.182 1.025   22.800  1.00 38.59 ? 1203 GLN E CA  1 
ATOM   3263 C C   . GLN E 1 130 ? 40.548 0.992   22.077  1.00 40.61 ? 1203 GLN E C   1 
ATOM   3264 O O   . GLN E 1 130 ? 41.594 1.073   22.717  1.00 39.03 ? 1203 GLN E O   1 
ATOM   3265 C CB  . GLN E 1 130 ? 38.723 -0.394  23.132  1.00 40.16 ? 1203 GLN E CB  1 
ATOM   3266 C CG  . GLN E 1 130 ? 39.854 -1.382  23.397  1.00 44.64 ? 1203 GLN E CG  1 
ATOM   3267 C CD  . GLN E 1 130 ? 39.350 -2.799  23.664  1.00 52.82 ? 1203 GLN E CD  1 
ATOM   3268 O OE1 . GLN E 1 130 ? 40.022 -3.595  24.330  1.00 58.93 ? 1203 GLN E OE1 1 
ATOM   3269 N NE2 . GLN E 1 130 ? 38.162 -3.122  23.144  1.00 47.64 ? 1203 GLN E NE2 1 
ATOM   3270 N N   . GLY E 1 131 ? 40.533 0.855   20.755  1.00 35.33 ? 1204 GLY E N   1 
ATOM   3271 C CA  . GLY E 1 131 ? 41.763 0.879   19.968  1.00 39.76 ? 1204 GLY E CA  1 
ATOM   3272 C C   . GLY E 1 131 ? 42.445 -0.466  19.710  1.00 41.92 ? 1204 GLY E C   1 
ATOM   3273 O O   . GLY E 1 131 ? 41.802 -1.517  19.710  1.00 39.45 ? 1204 GLY E O   1 
ATOM   3274 N N   . GLU E 1 132 ? 43.762 -0.428  19.504  1.00 42.65 ? 1205 GLU E N   1 
ATOM   3275 C CA  . GLU E 1 132 ? 44.528 -1.606  19.057  1.00 40.02 ? 1205 GLU E CA  1 
ATOM   3276 C C   . GLU E 1 132 ? 45.336 -2.308  20.162  1.00 41.12 ? 1205 GLU E C   1 
ATOM   3277 O O   . GLU E 1 132 ? 45.853 -3.428  19.975  1.00 36.49 ? 1205 GLU E O   1 
ATOM   3278 C CB  . GLU E 1 132 ? 45.470 -1.189  17.922  1.00 39.42 ? 1205 GLU E CB  1 
ATOM   3279 C CG  . GLU E 1 132 ? 44.776 -0.320  16.872  1.00 45.59 ? 1205 GLU E CG  1 
ATOM   3280 C CD  . GLU E 1 132 ? 45.666 0.038   15.690  1.00 49.82 ? 1205 GLU E CD  1 
ATOM   3281 O OE1 . GLU E 1 132 ? 45.368 1.062   15.026  1.00 51.49 ? 1205 GLU E OE1 1 
ATOM   3282 O OE2 . GLU E 1 132 ? 46.651 -0.700  15.427  1.00 50.05 ? 1205 GLU E OE2 1 
ATOM   3283 O OXT . GLU E 1 132 ? 45.518 -1.768  21.259  1.00 37.48 ? 1205 GLU E OXT 1 
ATOM   3284 N N   . SER F 2 7   ? 35.082 10.830  7.903   1.00 65.03 ? 28   SER F N   1 
ATOM   3285 C CA  . SER F 2 7   ? 34.677 11.501  9.136   1.00 57.90 ? 28   SER F CA  1 
ATOM   3286 C C   . SER F 2 7   ? 33.209 11.244  9.499   1.00 59.39 ? 28   SER F C   1 
ATOM   3287 O O   . SER F 2 7   ? 32.616 10.244  9.079   1.00 58.83 ? 28   SER F O   1 
ATOM   3288 C CB  . SER F 2 7   ? 34.968 13.006  9.066   1.00 61.04 ? 28   SER F CB  1 
ATOM   3289 O OG  . SER F 2 7   ? 34.613 13.552  7.801   1.00 65.12 ? 28   SER F OG  1 
ATOM   3290 N N   . ALA F 2 8   ? 32.633 12.164  10.271  1.00 53.63 ? 29   ALA F N   1 
ATOM   3291 C CA  . ALA F 2 8   ? 31.367 11.944  10.967  1.00 50.56 ? 29   ALA F CA  1 
ATOM   3292 C C   . ALA F 2 8   ? 30.189 11.487  10.104  1.00 50.42 ? 29   ALA F C   1 
ATOM   3293 O O   . ALA F 2 8   ? 29.862 12.111  9.097   1.00 52.72 ? 29   ALA F O   1 
ATOM   3294 C CB  . ALA F 2 8   ? 30.990 13.191  11.775  1.00 48.15 ? 29   ALA F CB  1 
ATOM   3295 N N   . PRO F 2 9   ? 29.530 10.399  10.530  1.00 49.83 ? 30   PRO F N   1 
ATOM   3296 C CA  . PRO F 2 9   ? 28.332 9.853   9.886   1.00 46.51 ? 30   PRO F CA  1 
ATOM   3297 C C   . PRO F 2 9   ? 27.202 10.885  9.821   1.00 49.77 ? 30   PRO F C   1 
ATOM   3298 O O   . PRO F 2 9   ? 27.036 11.656  10.771  1.00 47.88 ? 30   PRO F O   1 
ATOM   3299 C CB  . PRO F 2 9   ? 27.914 8.715   10.833  1.00 48.10 ? 30   PRO F CB  1 
ATOM   3300 C CG  . PRO F 2 9   ? 29.127 8.405   11.658  1.00 47.27 ? 30   PRO F CG  1 
ATOM   3301 C CD  . PRO F 2 9   ? 29.887 9.676   11.768  1.00 47.12 ? 30   PRO F CD  1 
ATOM   3302 N N   . ALA F 2 10  ? 26.429 10.887  8.734   1.00 47.95 ? 31   ALA F N   1 
ATOM   3303 C CA  . ALA F 2 10  ? 25.231 11.723  8.651   1.00 48.21 ? 31   ALA F CA  1 
ATOM   3304 C C   . ALA F 2 10  ? 24.164 11.233  9.639   1.00 43.81 ? 31   ALA F C   1 
ATOM   3305 O O   . ALA F 2 10  ? 24.149 10.052  10.015  1.00 44.08 ? 31   ALA F O   1 
ATOM   3306 C CB  . ALA F 2 10  ? 24.680 11.730  7.222   1.00 49.14 ? 31   ALA F CB  1 
ATOM   3307 N N   . THR F 2 11  ? 23.275 12.126  10.067  1.00 43.67 ? 32   THR F N   1 
ATOM   3308 C CA  . THR F 2 11  ? 22.219 11.728  11.009  1.00 39.62 ? 32   THR F CA  1 
ATOM   3309 C C   . THR F 2 11  ? 20.835 12.095  10.480  1.00 42.92 ? 32   THR F C   1 
ATOM   3310 O O   . THR F 2 11  ? 20.719 12.916  9.561   1.00 45.24 ? 32   THR F O   1 
ATOM   3311 C CB  . THR F 2 11  ? 22.446 12.324  12.394  1.00 35.10 ? 32   THR F CB  1 
ATOM   3312 O OG1 . THR F 2 11  ? 22.333 13.757  12.335  1.00 37.52 ? 32   THR F OG1 1 
ATOM   3313 C CG2 . THR F 2 11  ? 23.821 11.949  12.887  1.00 31.89 ? 32   THR F CG2 1 
ATOM   3314 N N   . GLY F 2 12  ? 19.795 11.494  11.055  1.00 36.67 ? 33   GLY F N   1 
ATOM   3315 C CA  . GLY F 2 12  ? 18.465 11.538  10.465  1.00 40.80 ? 33   GLY F CA  1 
ATOM   3316 C C   . GLY F 2 12  ? 17.374 12.283  11.212  1.00 45.59 ? 33   GLY F C   1 
ATOM   3317 O O   . GLY F 2 12  ? 16.209 11.863  11.194  1.00 49.16 ? 33   GLY F O   1 
ATOM   3318 N N   . GLY F 2 13  ? 17.732 13.394  11.853  1.00 40.75 ? 34   GLY F N   1 
ATOM   3319 C CA  . GLY F 2 13  ? 16.756 14.170  12.600  1.00 41.63 ? 34   GLY F CA  1 
ATOM   3320 C C   . GLY F 2 13  ? 16.146 13.446  13.792  1.00 43.48 ? 34   GLY F C   1 
ATOM   3321 O O   . GLY F 2 13  ? 16.555 12.334  14.155  1.00 37.01 ? 34   GLY F O   1 
ATOM   3322 N N   . VAL F 2 14  ? 15.153 14.095  14.394  1.00 42.40 ? 35   VAL F N   1 
ATOM   3323 C CA  . VAL F 2 14  ? 14.475 13.602  15.578  1.00 37.22 ? 35   VAL F CA  1 
ATOM   3324 C C   . VAL F 2 14  ? 13.572 12.427  15.267  1.00 43.54 ? 35   VAL F C   1 
ATOM   3325 O O   . VAL F 2 14  ? 12.775 12.464  14.330  1.00 45.93 ? 35   VAL F O   1 
ATOM   3326 C CB  . VAL F 2 14  ? 13.629 14.716  16.213  1.00 41.45 ? 35   VAL F CB  1 
ATOM   3327 C CG1 . VAL F 2 14  ? 13.113 14.279  17.584  1.00 41.93 ? 35   VAL F CG1 1 
ATOM   3328 C CG2 . VAL F 2 14  ? 14.453 15.981  16.330  1.00 38.47 ? 35   VAL F CG2 1 
HETATM 3329 N N   . M3L F 2 15  ? 13.699 11.375  16.065  1.00 36.87 ? 36   M3L F N   1 
HETATM 3330 C CA  . M3L F 2 15  ? 12.912 10.188  15.864  1.00 39.83 ? 36   M3L F CA  1 
HETATM 3331 C CB  . M3L F 2 15  ? 13.559 9.038   16.614  1.00 38.94 ? 36   M3L F CB  1 
HETATM 3332 C CG  . M3L F 2 15  ? 13.025 7.646   16.331  1.00 36.64 ? 36   M3L F CG  1 
HETATM 3333 C CD  . M3L F 2 15  ? 13.690 6.527   17.113  1.00 30.64 ? 36   M3L F CD  1 
HETATM 3334 C CE  . M3L F 2 15  ? 13.274 5.134   16.676  1.00 31.77 ? 36   M3L F CE  1 
HETATM 3335 N NZ  . M3L F 2 15  ? 13.965 4.015   17.271  1.00 32.13 ? 36   M3L F NZ  1 
HETATM 3336 C C   . M3L F 2 15  ? 11.426 10.338  16.209  1.00 41.47 ? 36   M3L F C   1 
HETATM 3337 O O   . M3L F 2 15  ? 11.101 10.768  17.267  1.00 42.89 ? 36   M3L F O   1 
HETATM 3338 C CM1 . M3L F 2 15  ? 13.824 4.125   18.720  1.00 28.23 ? 36   M3L F CM1 1 
HETATM 3339 C CM2 . M3L F 2 15  ? 15.376 4.048   16.897  1.00 25.75 ? 36   M3L F CM2 1 
HETATM 3340 C CM3 . M3L F 2 15  ? 13.367 2.791   16.777  1.00 30.24 ? 36   M3L F CM3 1 
ATOM   3341 N N   . LYS F 2 16  ? 10.558 9.933   15.290  1.00 44.36 ? 37   LYS F N   1 
ATOM   3342 C CA  . LYS F 2 16  ? 9.112  9.992   15.499  1.00 43.82 ? 37   LYS F CA  1 
ATOM   3343 C C   . LYS F 2 16  ? 8.533  8.594   15.696  1.00 49.65 ? 37   LYS F C   1 
ATOM   3344 O O   . LYS F 2 16  ? 9.164  7.608   15.332  1.00 47.00 ? 37   LYS F O   1 
ATOM   3345 C CB  . LYS F 2 16  ? 8.434  10.670  14.313  1.00 53.49 ? 37   LYS F CB  1 
ATOM   3346 C CG  . LYS F 2 16  ? 8.976  12.063  13.998  1.00 59.16 ? 37   LYS F CG  1 
ATOM   3347 C CD  . LYS F 2 16  ? 8.065  12.816  13.028  1.00 66.17 ? 37   LYS F CD  1 
ATOM   3348 C CE  . LYS F 2 16  ? 8.543  14.250  12.799  1.00 74.34 ? 37   LYS F CE  1 
ATOM   3349 N NZ  . LYS F 2 16  ? 7.621  15.025  11.902  1.00 75.53 ? 37   LYS F NZ  1 
ATOM   3350 N N   . PRO F 2 17  ? 7.324  8.503   16.285  1.00 49.75 ? 38   PRO F N   1 
ATOM   3351 C CA  . PRO F 2 17  ? 6.637  7.226   16.554  1.00 50.77 ? 38   PRO F CA  1 
ATOM   3352 C C   . PRO F 2 17  ? 6.334  6.435   15.279  1.00 51.97 ? 38   PRO F C   1 
ATOM   3353 O O   . PRO F 2 17  ? 6.184  7.064   14.223  1.00 53.61 ? 38   PRO F O   1 
ATOM   3354 C CB  . PRO F 2 17  ? 5.319  7.675   17.214  1.00 53.59 ? 38   PRO F CB  1 
ATOM   3355 C CG  . PRO F 2 17  ? 5.168  9.138   16.798  1.00 52.85 ? 38   PRO F CG  1 
ATOM   3356 C CD  . PRO F 2 17  ? 6.573  9.644   16.841  1.00 54.81 ? 38   PRO F CD  1 
ATOM   3357 N N   . PRO G 1 9   ? 40.682 -41.803 15.760  1.00 55.40 ? 1082 PRO G N   1 
ATOM   3358 C CA  . PRO G 1 9   ? 39.964 -43.042 16.076  1.00 55.80 ? 1082 PRO G CA  1 
ATOM   3359 C C   . PRO G 1 9   ? 38.845 -42.762 17.073  1.00 49.80 ? 1082 PRO G C   1 
ATOM   3360 O O   . PRO G 1 9   ? 38.879 -41.751 17.792  1.00 47.23 ? 1082 PRO G O   1 
ATOM   3361 C CB  . PRO G 1 9   ? 41.041 -43.926 16.734  1.00 56.60 ? 1082 PRO G CB  1 
ATOM   3362 C CG  . PRO G 1 9   ? 42.333 -43.088 16.744  1.00 56.25 ? 1082 PRO G CG  1 
ATOM   3363 C CD  . PRO G 1 9   ? 41.893 -41.661 16.583  1.00 56.26 ? 1082 PRO G CD  1 
ATOM   3364 N N   . LEU G 1 10  ? 37.850 -43.637 17.108  1.00 42.24 ? 1083 LEU G N   1 
ATOM   3365 C CA  . LEU G 1 10  ? 36.687 -43.371 17.930  1.00 39.29 ? 1083 LEU G CA  1 
ATOM   3366 C C   . LEU G 1 10  ? 36.625 -44.431 18.989  1.00 37.84 ? 1083 LEU G C   1 
ATOM   3367 O O   . LEU G 1 10  ? 36.537 -45.615 18.683  1.00 37.28 ? 1083 LEU G O   1 
ATOM   3368 C CB  . LEU G 1 10  ? 35.404 -43.373 17.098  1.00 37.72 ? 1083 LEU G CB  1 
ATOM   3369 C CG  . LEU G 1 10  ? 35.300 -42.317 15.994  1.00 44.08 ? 1083 LEU G CG  1 
ATOM   3370 C CD1 . LEU G 1 10  ? 33.951 -42.387 15.262  1.00 40.24 ? 1083 LEU G CD1 1 
ATOM   3371 C CD2 . LEU G 1 10  ? 35.503 -40.938 16.584  1.00 42.81 ? 1083 LEU G CD2 1 
ATOM   3372 N N   . ASP G 1 11  ? 36.678 -43.992 20.237  1.00 31.79 ? 1084 ASP G N   1 
ATOM   3373 C CA  . ASP G 1 11  ? 36.644 -44.889 21.383  1.00 35.77 ? 1084 ASP G CA  1 
ATOM   3374 C C   . ASP G 1 11  ? 35.257 -44.984 22.007  1.00 33.18 ? 1084 ASP G C   1 
ATOM   3375 O O   . ASP G 1 11  ? 34.450 -44.041 21.926  1.00 29.37 ? 1084 ASP G O   1 
ATOM   3376 C CB  . ASP G 1 11  ? 37.619 -44.388 22.451  1.00 36.53 ? 1084 ASP G CB  1 
ATOM   3377 C CG  . ASP G 1 11  ? 39.044 -44.377 21.973  1.00 42.72 ? 1084 ASP G CG  1 
ATOM   3378 O OD1 . ASP G 1 11  ? 39.818 -43.531 22.467  1.00 46.64 ? 1084 ASP G OD1 1 
ATOM   3379 O OD2 . ASP G 1 11  ? 39.390 -45.212 21.102  1.00 39.89 ? 1084 ASP G OD2 1 
ATOM   3380 N N   . ALA G 1 12  ? 34.991 -46.113 22.657  1.00 29.59 ? 1085 ALA G N   1 
ATOM   3381 C CA  . ALA G 1 12  ? 33.792 -46.237 23.474  1.00 29.47 ? 1085 ALA G CA  1 
ATOM   3382 C C   . ALA G 1 12  ? 33.680 -45.080 24.475  1.00 31.59 ? 1085 ALA G C   1 
ATOM   3383 O O   . ALA G 1 12  ? 34.668 -44.667 25.090  1.00 32.42 ? 1085 ALA G O   1 
ATOM   3384 C CB  . ALA G 1 12  ? 33.757 -47.591 24.185  1.00 34.30 ? 1085 ALA G CB  1 
ATOM   3385 N N   . LEU G 1 13  ? 32.462 -44.550 24.594  1.00 27.85 ? 1086 LEU G N   1 
ATOM   3386 C CA  . LEU G 1 13  ? 32.112 -43.451 25.498  1.00 28.76 ? 1086 LEU G CA  1 
ATOM   3387 C C   . LEU G 1 13  ? 32.468 -42.043 24.979  1.00 29.85 ? 1086 LEU G C   1 
ATOM   3388 O O   . LEU G 1 13  ? 32.285 -41.057 25.686  1.00 30.22 ? 1086 LEU G O   1 
ATOM   3389 C CB  . LEU G 1 13  ? 32.610 -43.706 26.934  1.00 31.36 ? 1086 LEU G CB  1 
ATOM   3390 C CG  . LEU G 1 13  ? 32.074 -45.019 27.543  1.00 31.32 ? 1086 LEU G CG  1 
ATOM   3391 C CD1 . LEU G 1 13  ? 32.512 -45.156 28.975  1.00 36.12 ? 1086 LEU G CD1 1 
ATOM   3392 C CD2 . LEU G 1 13  ? 30.547 -45.117 27.440  1.00 29.17 ? 1086 LEU G CD2 1 
ATOM   3393 N N   . ASP G 1 14  ? 32.945 -41.961 23.736  1.00 27.83 ? 1087 ASP G N   1 
ATOM   3394 C CA  . ASP G 1 14  ? 33.150 -40.675 23.050  1.00 29.03 ? 1087 ASP G CA  1 
ATOM   3395 C C   . ASP G 1 14  ? 31.792 -40.114 22.636  1.00 27.60 ? 1087 ASP G C   1 
ATOM   3396 O O   . ASP G 1 14  ? 30.908 -40.871 22.176  1.00 25.46 ? 1087 ASP G O   1 
ATOM   3397 C CB  . ASP G 1 14  ? 33.934 -40.865 21.731  1.00 26.00 ? 1087 ASP G CB  1 
ATOM   3398 C CG  . ASP G 1 14  ? 35.451 -40.966 21.913  1.00 33.22 ? 1087 ASP G CG  1 
ATOM   3399 O OD1 . ASP G 1 14  ? 35.978 -40.894 23.041  1.00 35.71 ? 1087 ASP G OD1 1 
ATOM   3400 O OD2 . ASP G 1 14  ? 36.124 -41.114 20.872  1.00 36.31 ? 1087 ASP G OD2 1 
ATOM   3401 N N   . LEU G 1 15  ? 31.642 -38.794 22.743  1.00 27.08 ? 1088 LEU G N   1 
ATOM   3402 C CA  . LEU G 1 15  ? 30.474 -38.116 22.195  1.00 26.03 ? 1088 LEU G CA  1 
ATOM   3403 C C   . LEU G 1 15  ? 30.654 -37.899 20.694  1.00 23.59 ? 1088 LEU G C   1 
ATOM   3404 O O   . LEU G 1 15  ? 31.723 -37.469 20.223  1.00 23.06 ? 1088 LEU G O   1 
ATOM   3405 C CB  . LEU G 1 15  ? 30.268 -36.757 22.872  1.00 23.25 ? 1088 LEU G CB  1 
ATOM   3406 C CG  . LEU G 1 15  ? 29.897 -36.778 24.356  1.00 24.10 ? 1088 LEU G CG  1 
ATOM   3407 C CD1 . LEU G 1 15  ? 29.834 -35.359 24.885  1.00 25.30 ? 1088 LEU G CD1 1 
ATOM   3408 C CD2 . LEU G 1 15  ? 28.552 -37.517 24.591  1.00 27.41 ? 1088 LEU G CD2 1 
ATOM   3409 N N   . VAL G 1 16  ? 29.605 -38.173 19.936  1.00 20.79 ? 1089 VAL G N   1 
ATOM   3410 C CA  . VAL G 1 16  ? 29.699 -37.978 18.496  1.00 20.58 ? 1089 VAL G CA  1 
ATOM   3411 C C   . VAL G 1 16  ? 28.423 -37.400 17.929  1.00 20.83 ? 1089 VAL G C   1 
ATOM   3412 O O   . VAL G 1 16  ? 27.371 -37.487 18.539  1.00 20.76 ? 1089 VAL G O   1 
ATOM   3413 C CB  . VAL G 1 16  ? 29.952 -39.322 17.727  1.00 19.59 ? 1089 VAL G CB  1 
ATOM   3414 C CG1 . VAL G 1 16  ? 31.341 -39.882 18.040  1.00 24.94 ? 1089 VAL G CG1 1 
ATOM   3415 C CG2 . VAL G 1 16  ? 28.831 -40.370 18.022  1.00 21.68 ? 1089 VAL G CG2 1 
ATOM   3416 N N   . TRP G 1 17  ? 28.545 -36.811 16.745  1.00 19.48 ? 1090 TRP G N   1 
ATOM   3417 C CA  . TRP G 1 17  ? 27.412 -36.516 15.880  1.00 19.50 ? 1090 TRP G CA  1 
ATOM   3418 C C   . TRP G 1 17  ? 27.230 -37.764 15.041  1.00 22.14 ? 1090 TRP G C   1 
ATOM   3419 O O   . TRP G 1 17  ? 28.179 -38.200 14.403  1.00 24.40 ? 1090 TRP G O   1 
ATOM   3420 C CB  . TRP G 1 17  ? 27.763 -35.358 14.944  1.00 20.62 ? 1090 TRP G CB  1 
ATOM   3421 C CG  . TRP G 1 17  ? 27.796 -34.023 15.672  1.00 20.29 ? 1090 TRP G CG  1 
ATOM   3422 C CD1 . TRP G 1 17  ? 28.899 -33.330 16.114  1.00 22.04 ? 1090 TRP G CD1 1 
ATOM   3423 C CD2 . TRP G 1 17  ? 26.666 -33.255 16.025  1.00 21.47 ? 1090 TRP G CD2 1 
ATOM   3424 N NE1 . TRP G 1 17  ? 28.505 -32.158 16.725  1.00 21.56 ? 1090 TRP G NE1 1 
ATOM   3425 C CE2 . TRP G 1 17  ? 27.132 -32.089 16.675  1.00 20.04 ? 1090 TRP G CE2 1 
ATOM   3426 C CE3 . TRP G 1 17  ? 25.285 -33.434 15.851  1.00 20.97 ? 1090 TRP G CE3 1 
ATOM   3427 C CZ2 . TRP G 1 17  ? 26.267 -31.111 17.162  1.00 20.42 ? 1090 TRP G CZ2 1 
ATOM   3428 C CZ3 . TRP G 1 17  ? 24.420 -32.437 16.323  1.00 20.60 ? 1090 TRP G CZ3 1 
ATOM   3429 C CH2 . TRP G 1 17  ? 24.922 -31.293 16.971  1.00 21.20 ? 1090 TRP G CH2 1 
ATOM   3430 N N   . ALA G 1 18  ? 26.034 -38.344 15.035  1.00 21.65 ? 1091 ALA G N   1 
ATOM   3431 C CA  . ALA G 1 18  ? 25.827 -39.612 14.342  1.00 20.53 ? 1091 ALA G CA  1 
ATOM   3432 C C   . ALA G 1 18  ? 24.781 -39.398 13.266  1.00 25.60 ? 1091 ALA G C   1 
ATOM   3433 O O   . ALA G 1 18  ? 23.686 -38.928 13.560  1.00 23.77 ? 1091 ALA G O   1 
ATOM   3434 C CB  . ALA G 1 18  ? 25.391 -40.689 15.335  1.00 18.26 ? 1091 ALA G CB  1 
ATOM   3435 N N   . LYS G 1 19  ? 25.108 -39.744 12.022  1.00 23.00 ? 1092 LYS G N   1 
ATOM   3436 C CA  . LYS G 1 19  ? 24.226 -39.434 10.902  1.00 28.75 ? 1092 LYS G CA  1 
ATOM   3437 C C   . LYS G 1 19  ? 23.545 -40.687 10.372  1.00 31.84 ? 1092 LYS G C   1 
ATOM   3438 O O   . LYS G 1 19  ? 24.204 -41.579 9.821   1.00 30.16 ? 1092 LYS G O   1 
ATOM   3439 C CB  . LYS G 1 19  ? 25.011 -38.745 9.768   1.00 28.36 ? 1092 LYS G CB  1 
ATOM   3440 C CG  . LYS G 1 19  ? 24.193 -38.448 8.494   1.00 29.84 ? 1092 LYS G CG  1 
ATOM   3441 C CD  . LYS G 1 19  ? 23.175 -37.326 8.729   1.00 30.77 ? 1092 LYS G CD  1 
ATOM   3442 C CE  . LYS G 1 19  ? 22.471 -36.923 7.437   1.00 32.43 ? 1092 LYS G CE  1 
ATOM   3443 N NZ  . LYS G 1 19  ? 21.520 -37.971 7.008   1.00 32.04 ? 1092 LYS G NZ  1 
ATOM   3444 N N   . CYS G 1 20  ? 22.230 -40.744 10.546  1.00 30.96 ? 1093 CYS G N   1 
ATOM   3445 C CA  . CYS G 1 20  ? 21.415 -41.839 10.036  1.00 34.27 ? 1093 CYS G CA  1 
ATOM   3446 C C   . CYS G 1 20  ? 20.722 -41.379 8.765   1.00 36.66 ? 1093 CYS G C   1 
ATOM   3447 O O   . CYS G 1 20  ? 20.419 -40.210 8.613   1.00 31.99 ? 1093 CYS G O   1 
ATOM   3448 C CB  . CYS G 1 20  ? 20.364 -42.250 11.067  1.00 38.96 ? 1093 CYS G CB  1 
ATOM   3449 S SG  . CYS G 1 20  ? 20.952 -43.406 12.319  1.00 47.08 ? 1093 CYS G SG  1 
ATOM   3450 N N   . ARG G 1 21  ? 20.466 -42.307 7.855   1.00 39.45 ? 1094 ARG G N   1 
ATOM   3451 C CA  . ARG G 1 21  ? 19.772 -41.976 6.612   1.00 43.36 ? 1094 ARG G CA  1 
ATOM   3452 C C   . ARG G 1 21  ? 18.460 -41.245 6.883   1.00 37.42 ? 1094 ARG G C   1 
ATOM   3453 O O   . ARG G 1 21  ? 17.627 -41.703 7.658   1.00 41.20 ? 1094 ARG G O   1 
ATOM   3454 C CB  . ARG G 1 21  ? 19.529 -43.252 5.796   1.00 45.11 ? 1094 ARG G CB  1 
ATOM   3455 C CG  . ARG G 1 21  ? 18.489 -43.152 4.691   1.00 52.70 ? 1094 ARG G CG  1 
ATOM   3456 C CD  . ARG G 1 21  ? 18.362 -44.512 4.008   1.00 62.01 ? 1094 ARG G CD  1 
ATOM   3457 N NE  . ARG G 1 21  ? 17.013 -44.790 3.519   1.00 72.89 ? 1094 ARG G NE  1 
ATOM   3458 C CZ  . ARG G 1 21  ? 16.521 -46.015 3.338   1.00 73.22 ? 1094 ARG G CZ  1 
ATOM   3459 N NH1 . ARG G 1 21  ? 15.284 -46.177 2.883   1.00 73.61 ? 1094 ARG G NH1 1 
ATOM   3460 N NH2 . ARG G 1 21  ? 17.265 -47.080 3.615   1.00 73.24 ? 1094 ARG G NH2 1 
ATOM   3461 N N   . GLY G 1 22  ? 18.290 -40.091 6.250   1.00 40.79 ? 1095 GLY G N   1 
ATOM   3462 C CA  . GLY G 1 22  ? 17.056 -39.334 6.394   1.00 43.95 ? 1095 GLY G CA  1 
ATOM   3463 C C   . GLY G 1 22  ? 16.969 -38.428 7.616   1.00 41.60 ? 1095 GLY G C   1 
ATOM   3464 O O   . GLY G 1 22  ? 16.134 -37.526 7.662   1.00 47.72 ? 1095 GLY G O   1 
ATOM   3465 N N   . TYR G 1 23  ? 17.798 -38.667 8.624   1.00 37.35 ? 1096 TYR G N   1 
ATOM   3466 C CA  . TYR G 1 23  ? 17.790 -37.781 9.794   1.00 34.33 ? 1096 TYR G CA  1 
ATOM   3467 C C   . TYR G 1 23  ? 18.979 -36.853 9.740   1.00 31.50 ? 1096 TYR G C   1 
ATOM   3468 O O   . TYR G 1 23  ? 20.004 -37.189 9.178   1.00 32.97 ? 1096 TYR G O   1 
ATOM   3469 C CB  . TYR G 1 23  ? 17.856 -38.562 11.102  1.00 31.44 ? 1096 TYR G CB  1 
ATOM   3470 C CG  . TYR G 1 23  ? 16.672 -39.446 11.394  1.00 39.71 ? 1096 TYR G CG  1 
ATOM   3471 C CD1 . TYR G 1 23  ? 15.439 -38.905 11.758  1.00 39.56 ? 1096 TYR G CD1 1 
ATOM   3472 C CD2 . TYR G 1 23  ? 16.800 -40.831 11.353  1.00 40.15 ? 1096 TYR G CD2 1 
ATOM   3473 C CE1 . TYR G 1 23  ? 14.356 -39.733 12.050  1.00 41.68 ? 1096 TYR G CE1 1 
ATOM   3474 C CE2 . TYR G 1 23  ? 15.727 -41.662 11.637  1.00 41.79 ? 1096 TYR G CE2 1 
ATOM   3475 C CZ  . TYR G 1 23  ? 14.515 -41.108 11.976  1.00 41.74 ? 1096 TYR G CZ  1 
ATOM   3476 O OH  . TYR G 1 23  ? 13.461 -41.946 12.251  1.00 47.42 ? 1096 TYR G OH  1 
ATOM   3477 N N   . PRO G 1 24  ? 18.851 -35.673 10.341  1.00 33.83 ? 1097 PRO G N   1 
ATOM   3478 C CA  . PRO G 1 24  ? 20.024 -34.806 10.399  1.00 27.92 ? 1097 PRO G CA  1 
ATOM   3479 C C   . PRO G 1 24  ? 20.997 -35.401 11.407  1.00 24.64 ? 1097 PRO G C   1 
ATOM   3480 O O   . PRO G 1 24  ? 20.608 -36.242 12.210  1.00 23.44 ? 1097 PRO G O   1 
ATOM   3481 C CB  . PRO G 1 24  ? 19.438 -33.512 10.952  1.00 29.11 ? 1097 PRO G CB  1 
ATOM   3482 C CG  . PRO G 1 24  ? 18.312 -33.999 11.836  1.00 30.12 ? 1097 PRO G CG  1 
ATOM   3483 C CD  . PRO G 1 24  ? 17.678 -35.050 10.973  1.00 34.85 ? 1097 PRO G CD  1 
ATOM   3484 N N   . SER G 1 25  ? 22.250 -34.972 11.373  1.00 26.45 ? 1098 SER G N   1 
ATOM   3485 C CA  . SER G 1 25  ? 23.223 -35.440 12.352  1.00 22.89 ? 1098 SER G CA  1 
ATOM   3486 C C   . SER G 1 25  ? 22.677 -35.296 13.751  1.00 20.68 ? 1098 SER G C   1 
ATOM   3487 O O   . SER G 1 25  ? 22.085 -34.264 14.083  1.00 21.56 ? 1098 SER G O   1 
ATOM   3488 C CB  . SER G 1 25  ? 24.510 -34.629 12.232  1.00 20.98 ? 1098 SER G CB  1 
ATOM   3489 O OG  . SER G 1 25  ? 25.027 -34.753 10.917  1.00 24.18 ? 1098 SER G OG  1 
ATOM   3490 N N   . TYR G 1 26  ? 22.907 -36.305 14.589  1.00 19.57 ? 1099 TYR G N   1 
ATOM   3491 C CA  . TYR G 1 26  ? 22.287 -36.302 15.924  1.00 21.02 ? 1099 TYR G CA  1 
ATOM   3492 C C   . TYR G 1 26  ? 23.293 -36.709 17.002  1.00 20.51 ? 1099 TYR G C   1 
ATOM   3493 O O   . TYR G 1 26  ? 24.022 -37.679 16.820  1.00 20.47 ? 1099 TYR G O   1 
ATOM   3494 C CB  . TYR G 1 26  ? 21.110 -37.285 15.948  1.00 23.49 ? 1099 TYR G CB  1 
ATOM   3495 C CG  . TYR G 1 26  ? 20.018 -36.920 16.936  1.00 20.65 ? 1099 TYR G CG  1 
ATOM   3496 C CD1 . TYR G 1 26  ? 20.118 -37.277 18.278  1.00 23.44 ? 1099 TYR G CD1 1 
ATOM   3497 C CD2 . TYR G 1 26  ? 18.879 -36.227 16.522  1.00 22.07 ? 1099 TYR G CD2 1 
ATOM   3498 C CE1 . TYR G 1 26  ? 19.103 -36.944 19.194  1.00 21.62 ? 1099 TYR G CE1 1 
ATOM   3499 C CE2 . TYR G 1 26  ? 17.858 -35.897 17.440  1.00 24.67 ? 1099 TYR G CE2 1 
ATOM   3500 C CZ  . TYR G 1 26  ? 17.982 -36.279 18.761  1.00 24.43 ? 1099 TYR G CZ  1 
ATOM   3501 O OH  . TYR G 1 26  ? 17.001 -35.958 19.680  1.00 25.52 ? 1099 TYR G OH  1 
ATOM   3502 N N   . PRO G 1 27  ? 23.313 -35.981 18.135  1.00 21.06 ? 1100 PRO G N   1 
ATOM   3503 C CA  . PRO G 1 27  ? 24.208 -36.275 19.269  1.00 18.08 ? 1100 PRO G CA  1 
ATOM   3504 C C   . PRO G 1 27  ? 23.987 -37.682 19.828  1.00 19.37 ? 1100 PRO G C   1 
ATOM   3505 O O   . PRO G 1 27  ? 22.852 -38.137 20.001  1.00 19.18 ? 1100 PRO G O   1 
ATOM   3506 C CB  . PRO G 1 27  ? 23.841 -35.188 20.300  1.00 19.75 ? 1100 PRO G CB  1 
ATOM   3507 C CG  . PRO G 1 27  ? 23.330 -34.030 19.430  1.00 23.38 ? 1100 PRO G CG  1 
ATOM   3508 C CD  . PRO G 1 27  ? 22.496 -34.772 18.385  1.00 21.30 ? 1100 PRO G CD  1 
ATOM   3509 N N   . ALA G 1 28  ? 25.079 -38.363 20.115  1.00 20.73 ? 1101 ALA G N   1 
ATOM   3510 C CA  . ALA G 1 28  ? 25.012 -39.729 20.572  1.00 20.34 ? 1101 ALA G CA  1 
ATOM   3511 C C   . ALA G 1 28  ? 26.260 -40.064 21.338  1.00 21.29 ? 1101 ALA G C   1 
ATOM   3512 O O   . ALA G 1 28  ? 27.215 -39.315 21.329  1.00 20.23 ? 1101 ALA G O   1 
ATOM   3513 C CB  . ALA G 1 28  ? 24.861 -40.693 19.374  1.00 20.05 ? 1101 ALA G CB  1 
ATOM   3514 N N   . LEU G 1 29  ? 26.253 -41.229 21.966  1.00 22.57 ? 1102 LEU G N   1 
ATOM   3515 C CA  . LEU G 1 29  ? 27.386 -41.703 22.744  1.00 20.93 ? 1102 LEU G CA  1 
ATOM   3516 C C   . LEU G 1 29  ? 27.774 -43.051 22.152  1.00 22.59 ? 1102 LEU G C   1 
ATOM   3517 O O   . LEU G 1 29  ? 26.898 -43.880 21.965  1.00 21.07 ? 1102 LEU G O   1 
ATOM   3518 C CB  . LEU G 1 29  ? 26.896 -41.929 24.170  1.00 25.89 ? 1102 LEU G CB  1 
ATOM   3519 C CG  . LEU G 1 29  ? 27.903 -42.389 25.231  1.00 28.45 ? 1102 LEU G CG  1 
ATOM   3520 C CD1 . LEU G 1 29  ? 29.064 -41.412 25.344  1.00 27.77 ? 1102 LEU G CD1 1 
ATOM   3521 C CD2 . LEU G 1 29  ? 27.208 -42.528 26.566  1.00 24.55 ? 1102 LEU G CD2 1 
ATOM   3522 N N   . ILE G 1 30  ? 29.061 -43.273 21.864  1.00 24.56 ? 1103 ILE G N   1 
ATOM   3523 C CA  . ILE G 1 30  ? 29.521 -44.582 21.416  1.00 21.71 ? 1103 ILE G CA  1 
ATOM   3524 C C   . ILE G 1 30  ? 29.496 -45.504 22.632  1.00 27.25 ? 1103 ILE G C   1 
ATOM   3525 O O   . ILE G 1 30  ? 29.920 -45.112 23.719  1.00 26.51 ? 1103 ILE G O   1 
ATOM   3526 C CB  . ILE G 1 30  ? 30.965 -44.536 20.864  1.00 27.25 ? 1103 ILE G CB  1 
ATOM   3527 C CG1 . ILE G 1 30  ? 31.048 -43.542 19.703  1.00 23.64 ? 1103 ILE G CG1 1 
ATOM   3528 C CG2 . ILE G 1 30  ? 31.422 -45.944 20.402  1.00 27.47 ? 1103 ILE G CG2 1 
ATOM   3529 C CD1 . ILE G 1 30  ? 32.337 -43.543 18.966  1.00 28.58 ? 1103 ILE G CD1 1 
ATOM   3530 N N   . ILE G 1 31  ? 29.020 -46.729 22.445  1.00 25.48 ? 1104 ILE G N   1 
ATOM   3531 C CA  . ILE G 1 31  ? 28.867 -47.678 23.548  1.00 26.74 ? 1104 ILE G CA  1 
ATOM   3532 C C   . ILE G 1 31  ? 29.625 -48.928 23.163  1.00 30.13 ? 1104 ILE G C   1 
ATOM   3533 O O   . ILE G 1 31  ? 29.592 -49.324 21.991  1.00 28.48 ? 1104 ILE G O   1 
ATOM   3534 C CB  . ILE G 1 31  ? 27.388 -48.015 23.774  1.00 25.32 ? 1104 ILE G CB  1 
ATOM   3535 C CG1 . ILE G 1 31  ? 26.634 -46.756 24.250  1.00 27.04 ? 1104 ILE G CG1 1 
ATOM   3536 C CG2 . ILE G 1 31  ? 27.220 -49.162 24.772  1.00 28.28 ? 1104 ILE G CG2 1 
ATOM   3537 C CD1 . ILE G 1 31  ? 26.935 -46.335 25.667  1.00 27.09 ? 1104 ILE G CD1 1 
ATOM   3538 N N   . ASP G 1 32  ? 30.349 -49.511 24.119  1.00 28.71 ? 1105 ASP G N   1 
ATOM   3539 C CA  . ASP G 1 32  ? 31.088 -50.766 23.869  1.00 31.65 ? 1105 ASP G CA  1 
ATOM   3540 C C   . ASP G 1 32  ? 30.124 -51.960 23.857  1.00 33.07 ? 1105 ASP G C   1 
ATOM   3541 O O   . ASP G 1 32  ? 29.526 -52.294 24.890  1.00 33.78 ? 1105 ASP G O   1 
ATOM   3542 C CB  . ASP G 1 32  ? 32.177 -50.970 24.929  1.00 33.47 ? 1105 ASP G CB  1 
ATOM   3543 C CG  . ASP G 1 32  ? 32.970 -52.278 24.733  1.00 39.69 ? 1105 ASP G CG  1 
ATOM   3544 O OD1 . ASP G 1 32  ? 32.716 -53.017 23.756  1.00 37.06 ? 1105 ASP G OD1 1 
ATOM   3545 O OD2 . ASP G 1 32  ? 33.867 -52.551 25.562  1.00 40.08 ? 1105 ASP G OD2 1 
ATOM   3546 N N   . PRO G 1 33  ? 29.968 -52.609 22.692  1.00 33.45 ? 1106 PRO G N   1 
ATOM   3547 C CA  . PRO G 1 33  ? 28.982 -53.689 22.567  1.00 31.85 ? 1106 PRO G CA  1 
ATOM   3548 C C   . PRO G 1 33  ? 29.335 -54.839 23.493  1.00 36.54 ? 1106 PRO G C   1 
ATOM   3549 O O   . PRO G 1 33  ? 28.462 -55.623 23.838  1.00 36.70 ? 1106 PRO G O   1 
ATOM   3550 C CB  . PRO G 1 33  ? 29.112 -54.147 21.113  1.00 37.12 ? 1106 PRO G CB  1 
ATOM   3551 C CG  . PRO G 1 33  ? 30.023 -53.163 20.434  1.00 37.23 ? 1106 PRO G CG  1 
ATOM   3552 C CD  . PRO G 1 33  ? 30.805 -52.460 21.488  1.00 36.86 ? 1106 PRO G CD  1 
ATOM   3553 N N   . LYS G 1 34  ? 30.602 -54.926 23.881  1.00 36.64 ? 1107 LYS G N   1 
ATOM   3554 C CA  . LYS G 1 34  ? 31.069 -55.989 24.760  1.00 40.12 ? 1107 LYS G CA  1 
ATOM   3555 C C   . LYS G 1 34  ? 31.245 -55.497 26.194  1.00 41.82 ? 1107 LYS G C   1 
ATOM   3556 O O   . LYS G 1 34  ? 31.999 -56.090 26.967  1.00 42.21 ? 1107 LYS G O   1 
ATOM   3557 C CB  . LYS G 1 34  ? 32.386 -56.579 24.253  1.00 41.36 ? 1107 LYS G CB  1 
ATOM   3558 C CG  . LYS G 1 34  ? 32.290 -57.300 22.900  1.00 49.37 ? 1107 LYS G CG  1 
ATOM   3559 C CD  . LYS G 1 34  ? 33.602 -58.008 22.547  1.00 58.36 ? 1107 LYS G CD  1 
ATOM   3560 C CE  . LYS G 1 34  ? 33.569 -58.630 21.138  1.00 66.78 ? 1107 LYS G CE  1 
ATOM   3561 N NZ  . LYS G 1 34  ? 34.770 -59.478 20.816  1.00 61.25 ? 1107 LYS G NZ  1 
ATOM   3562 N N   . MET G 1 35  ? 30.553 -54.419 26.559  1.00 36.72 ? 1108 MET G N   1 
ATOM   3563 C CA  . MET G 1 35  ? 30.567 -53.975 27.954  1.00 38.75 ? 1108 MET G CA  1 
ATOM   3564 C C   . MET G 1 35  ? 29.907 -55.033 28.842  1.00 40.30 ? 1108 MET G C   1 
ATOM   3565 O O   . MET G 1 35  ? 29.101 -55.835 28.366  1.00 39.63 ? 1108 MET G O   1 
ATOM   3566 C CB  . MET G 1 35  ? 29.859 -52.623 28.124  1.00 38.14 ? 1108 MET G CB  1 
ATOM   3567 C CG  . MET G 1 35  ? 28.365 -52.651 27.845  1.00 36.21 ? 1108 MET G CG  1 
ATOM   3568 S SD  . MET G 1 35  ? 27.614 -51.016 28.120  1.00 37.26 ? 1108 MET G SD  1 
ATOM   3569 C CE  . MET G 1 35  ? 27.635 -50.918 29.924  1.00 35.50 ? 1108 MET G CE  1 
ATOM   3570 N N   . PRO G 1 36  ? 30.259 -55.043 30.131  1.00 39.58 ? 1109 PRO G N   1 
ATOM   3571 C CA  . PRO G 1 36  ? 29.698 -56.007 31.088  1.00 40.59 ? 1109 PRO G CA  1 
ATOM   3572 C C   . PRO G 1 36  ? 28.163 -56.040 31.109  1.00 42.46 ? 1109 PRO G C   1 
ATOM   3573 O O   . PRO G 1 36  ? 27.502 -55.002 31.182  1.00 38.60 ? 1109 PRO G O   1 
ATOM   3574 C CB  . PRO G 1 36  ? 30.268 -55.534 32.418  1.00 44.79 ? 1109 PRO G CB  1 
ATOM   3575 C CG  . PRO G 1 36  ? 31.611 -54.963 32.040  1.00 44.72 ? 1109 PRO G CG  1 
ATOM   3576 C CD  . PRO G 1 36  ? 31.393 -54.289 30.699  1.00 42.35 ? 1109 PRO G CD  1 
ATOM   3577 N N   . ARG G 1 37  ? 27.604 -57.244 31.035  1.00 41.34 ? 1110 ARG G N   1 
ATOM   3578 C CA  . ARG G 1 37  ? 26.152 -57.414 30.997  1.00 46.28 ? 1110 ARG G CA  1 
ATOM   3579 C C   . ARG G 1 37  ? 25.524 -56.973 32.297  1.00 46.26 ? 1110 ARG G C   1 
ATOM   3580 O O   . ARG G 1 37  ? 24.336 -56.665 32.340  1.00 48.50 ? 1110 ARG G O   1 
ATOM   3581 C CB  . ARG G 1 37  ? 25.763 -58.865 30.698  1.00 46.30 ? 1110 ARG G CB  1 
ATOM   3582 C CG  . ARG G 1 37  ? 26.102 -59.296 29.290  1.00 45.09 ? 1110 ARG G CG  1 
ATOM   3583 C CD  . ARG G 1 37  ? 25.688 -58.244 28.272  1.00 43.19 ? 1110 ARG G CD  1 
ATOM   3584 N NE  . ARG G 1 37  ? 24.250 -58.231 28.012  1.00 37.40 ? 1110 ARG G NE  1 
ATOM   3585 C CZ  . ARG G 1 37  ? 23.663 -57.472 27.091  1.00 38.74 ? 1110 ARG G CZ  1 
ATOM   3586 N NH1 . ARG G 1 37  ? 22.351 -57.545 26.914  1.00 37.45 ? 1110 ARG G NH1 1 
ATOM   3587 N NH2 . ARG G 1 37  ? 24.392 -56.650 26.334  1.00 36.34 ? 1110 ARG G NH2 1 
ATOM   3588 N N   . GLU G 1 38  ? 26.329 -56.925 33.353  1.00 45.83 ? 1111 GLU G N   1 
ATOM   3589 C CA  . GLU G 1 38  ? 25.826 -56.494 34.647  1.00 51.64 ? 1111 GLU G CA  1 
ATOM   3590 C C   . GLU G 1 38  ? 25.804 -54.973 34.710  1.00 50.92 ? 1111 GLU G C   1 
ATOM   3591 O O   . GLU G 1 38  ? 25.176 -54.387 35.589  1.00 49.75 ? 1111 GLU G O   1 
ATOM   3592 C CB  . GLU G 1 38  ? 26.647 -57.083 35.811  1.00 55.18 ? 1111 GLU G CB  1 
ATOM   3593 C CG  . GLU G 1 38  ? 27.911 -56.297 36.188  1.00 54.85 ? 1111 GLU G CG  1 
ATOM   3594 C CD  . GLU G 1 38  ? 29.191 -56.988 35.740  1.00 60.35 ? 1111 GLU G CD  1 
ATOM   3595 O OE1 . GLU G 1 38  ? 30.277 -56.619 36.247  1.00 62.10 ? 1111 GLU G OE1 1 
ATOM   3596 O OE2 . GLU G 1 38  ? 29.109 -57.910 34.889  1.00 58.85 ? 1111 GLU G OE2 1 
ATOM   3597 N N   . GLY G 1 39  ? 26.485 -54.336 33.763  1.00 50.37 ? 1112 GLY G N   1 
ATOM   3598 C CA  . GLY G 1 39  ? 26.536 -52.886 33.714  1.00 47.34 ? 1112 GLY G CA  1 
ATOM   3599 C C   . GLY G 1 39  ? 27.914 -52.388 34.092  1.00 47.10 ? 1112 GLY G C   1 
ATOM   3600 O O   . GLY G 1 39  ? 28.810 -53.187 34.395  1.00 49.04 ? 1112 GLY G O   1 
ATOM   3601 N N   . MET G 1 40  ? 28.093 -51.073 34.059  1.00 46.64 ? 1113 MET G N   1 
ATOM   3602 C CA  . MET G 1 40  ? 29.366 -50.463 34.440  1.00 48.23 ? 1113 MET G CA  1 
ATOM   3603 C C   . MET G 1 40  ? 29.195 -48.981 34.749  1.00 49.78 ? 1113 MET G C   1 
ATOM   3604 O O   . MET G 1 40  ? 28.221 -48.345 34.332  1.00 49.46 ? 1113 MET G O   1 
ATOM   3605 C CB  . MET G 1 40  ? 30.411 -50.635 33.336  1.00 49.19 ? 1113 MET G CB  1 
ATOM   3606 C CG  . MET G 1 40  ? 30.119 -49.790 32.102  1.00 52.66 ? 1113 MET G CG  1 
ATOM   3607 S SD  . MET G 1 40  ? 31.598 -49.220 31.238  1.00 64.40 ? 1113 MET G SD  1 
ATOM   3608 C CE  . MET G 1 40  ? 32.313 -48.106 32.451  1.00 53.02 ? 1113 MET G CE  1 
ATOM   3609 N N   . PHE G 1 41  ? 30.161 -48.433 35.474  1.00 50.31 ? 1114 PHE G N   1 
ATOM   3610 C CA  . PHE G 1 41  ? 30.134 -47.028 35.842  1.00 53.19 ? 1114 PHE G CA  1 
ATOM   3611 C C   . PHE G 1 41  ? 31.300 -46.320 35.185  1.00 52.25 ? 1114 PHE G C   1 
ATOM   3612 O O   . PHE G 1 41  ? 32.412 -46.843 35.148  1.00 55.67 ? 1114 PHE G O   1 
ATOM   3613 C CB  . PHE G 1 41  ? 30.225 -46.870 37.360  1.00 52.31 ? 1114 PHE G CB  1 
ATOM   3614 C CG  . PHE G 1 41  ? 28.954 -47.194 38.077  1.00 53.02 ? 1114 PHE G CG  1 
ATOM   3615 C CD1 . PHE G 1 41  ? 28.723 -48.467 38.567  1.00 52.79 ? 1114 PHE G CD1 1 
ATOM   3616 C CD2 . PHE G 1 41  ? 27.985 -46.224 38.264  1.00 53.46 ? 1114 PHE G CD2 1 
ATOM   3617 C CE1 . PHE G 1 41  ? 27.548 -48.774 39.222  1.00 49.74 ? 1114 PHE G CE1 1 
ATOM   3618 C CE2 . PHE G 1 41  ? 26.802 -46.525 38.926  1.00 57.89 ? 1114 PHE G CE2 1 
ATOM   3619 C CZ  . PHE G 1 41  ? 26.589 -47.808 39.408  1.00 54.83 ? 1114 PHE G CZ  1 
ATOM   3620 N N   . HIS G 1 42  ? 31.045 -45.129 34.659  1.00 49.27 ? 1115 HIS G N   1 
ATOM   3621 C CA  . HIS G 1 42  ? 32.099 -44.331 34.056  1.00 52.79 ? 1115 HIS G CA  1 
ATOM   3622 C C   . HIS G 1 42  ? 32.265 -43.065 34.887  1.00 54.25 ? 1115 HIS G C   1 
ATOM   3623 O O   . HIS G 1 42  ? 31.437 -42.154 34.820  1.00 50.75 ? 1115 HIS G O   1 
ATOM   3624 C CB  . HIS G 1 42  ? 31.748 -44.002 32.599  1.00 48.91 ? 1115 HIS G CB  1 
ATOM   3625 C CG  . HIS G 1 42  ? 32.773 -43.163 31.894  1.00 51.63 ? 1115 HIS G CG  1 
ATOM   3626 N ND1 . HIS G 1 42  ? 34.109 -43.499 31.845  1.00 53.63 ? 1115 HIS G ND1 1 
ATOM   3627 C CD2 . HIS G 1 42  ? 32.650 -42.017 31.180  1.00 49.87 ? 1115 HIS G CD2 1 
ATOM   3628 C CE1 . HIS G 1 42  ? 34.768 -42.588 31.148  1.00 48.92 ? 1115 HIS G CE1 1 
ATOM   3629 N NE2 . HIS G 1 42  ? 33.904 -41.684 30.725  1.00 48.65 ? 1115 HIS G NE2 1 
ATOM   3630 N N   . HIS G 1 43  ? 33.332 -43.017 35.682  1.00 56.86 ? 1116 HIS G N   1 
ATOM   3631 C CA  . HIS G 1 43  ? 33.515 -41.929 36.636  1.00 55.58 ? 1116 HIS G CA  1 
ATOM   3632 C C   . HIS G 1 43  ? 32.204 -41.645 37.343  1.00 53.49 ? 1116 HIS G C   1 
ATOM   3633 O O   . HIS G 1 43  ? 31.781 -40.496 37.475  1.00 56.55 ? 1116 HIS G O   1 
ATOM   3634 C CB  . HIS G 1 43  ? 34.052 -40.685 35.936  1.00 53.64 ? 1116 HIS G CB  1 
ATOM   3635 C CG  . HIS G 1 43  ? 35.423 -40.876 35.375  1.00 56.77 ? 1116 HIS G CG  1 
ATOM   3636 N ND1 . HIS G 1 43  ? 36.557 -40.410 36.006  1.00 59.44 ? 1116 HIS G ND1 1 
ATOM   3637 C CD2 . HIS G 1 43  ? 35.848 -41.524 34.264  1.00 55.14 ? 1116 HIS G CD2 1 
ATOM   3638 C CE1 . HIS G 1 43  ? 37.620 -40.746 35.295  1.00 62.79 ? 1116 HIS G CE1 1 
ATOM   3639 N NE2 . HIS G 1 43  ? 37.217 -41.422 34.234  1.00 56.88 ? 1116 HIS G NE2 1 
ATOM   3640 N N   . GLY G 1 44  ? 31.554 -42.719 37.777  1.00 52.32 ? 1117 GLY G N   1 
ATOM   3641 C CA  . GLY G 1 44  ? 30.339 -42.612 38.551  1.00 55.38 ? 1117 GLY G CA  1 
ATOM   3642 C C   . GLY G 1 44  ? 29.071 -42.769 37.736  1.00 56.32 ? 1117 GLY G C   1 
ATOM   3643 O O   . GLY G 1 44  ? 28.070 -43.264 38.247  1.00 57.47 ? 1117 GLY G O   1 
ATOM   3644 N N   . VAL G 1 45  ? 29.106 -42.357 36.473  1.00 51.36 ? 1118 VAL G N   1 
ATOM   3645 C CA  . VAL G 1 45  ? 27.917 -42.396 35.623  1.00 51.34 ? 1118 VAL G CA  1 
ATOM   3646 C C   . VAL G 1 45  ? 27.584 -43.816 35.125  1.00 49.95 ? 1118 VAL G C   1 
ATOM   3647 O O   . VAL G 1 45  ? 28.438 -44.478 34.523  1.00 50.72 ? 1118 VAL G O   1 
ATOM   3648 C CB  . VAL G 1 45  ? 28.105 -41.438 34.423  1.00 50.19 ? 1118 VAL G CB  1 
ATOM   3649 C CG1 . VAL G 1 45  ? 26.821 -41.308 33.618  1.00 48.17 ? 1118 VAL G CG1 1 
ATOM   3650 C CG2 . VAL G 1 45  ? 28.564 -40.078 34.919  1.00 48.41 ? 1118 VAL G CG2 1 
ATOM   3651 N N   . PRO G 1 46  ? 26.341 -44.293 35.363  1.00 45.89 ? 1119 PRO G N   1 
ATOM   3652 C CA  . PRO G 1 46  ? 25.973 -45.634 34.888  1.00 50.59 ? 1119 PRO G CA  1 
ATOM   3653 C C   . PRO G 1 46  ? 25.678 -45.595 33.397  1.00 44.25 ? 1119 PRO G C   1 
ATOM   3654 O O   . PRO G 1 46  ? 24.968 -44.694 32.960  1.00 43.45 ? 1119 PRO G O   1 
ATOM   3655 C CB  . PRO G 1 46  ? 24.667 -45.942 35.637  1.00 48.20 ? 1119 PRO G CB  1 
ATOM   3656 C CG  . PRO G 1 46  ? 24.307 -44.680 36.394  1.00 49.10 ? 1119 PRO G CG  1 
ATOM   3657 C CD  . PRO G 1 46  ? 25.173 -43.575 35.889  1.00 48.29 ? 1119 PRO G CD  1 
ATOM   3658 N N   . ILE G 1 47  ? 26.193 -46.567 32.653  1.00 40.20 ? 1120 ILE G N   1 
ATOM   3659 C CA  . ILE G 1 47  ? 26.092 -46.599 31.192  1.00 36.89 ? 1120 ILE G CA  1 
ATOM   3660 C C   . ILE G 1 47  ? 25.094 -47.662 30.752  1.00 35.77 ? 1120 ILE G C   1 
ATOM   3661 O O   . ILE G 1 47  ? 25.249 -48.836 31.091  1.00 35.46 ? 1120 ILE G O   1 
ATOM   3662 C CB  . ILE G 1 47  ? 27.456 -46.952 30.598  1.00 36.72 ? 1120 ILE G CB  1 
ATOM   3663 C CG1 . ILE G 1 47  ? 28.520 -45.993 31.126  1.00 37.92 ? 1120 ILE G CG1 1 
ATOM   3664 C CG2 . ILE G 1 47  ? 27.407 -46.978 29.066  1.00 35.80 ? 1120 ILE G CG2 1 
ATOM   3665 C CD1 . ILE G 1 47  ? 28.261 -44.560 30.761  1.00 36.80 ? 1120 ILE G CD1 1 
ATOM   3666 N N   . PRO G 1 48  ? 24.067 -47.268 29.985  1.00 33.98 ? 1121 PRO G N   1 
ATOM   3667 C CA  . PRO G 1 48  ? 23.044 -48.227 29.566  1.00 32.02 ? 1121 PRO G CA  1 
ATOM   3668 C C   . PRO G 1 48  ? 23.648 -49.435 28.856  1.00 33.82 ? 1121 PRO G C   1 
ATOM   3669 O O   . PRO G 1 48  ? 24.553 -49.290 28.027  1.00 29.30 ? 1121 PRO G O   1 
ATOM   3670 C CB  . PRO G 1 48  ? 22.177 -47.419 28.605  1.00 31.07 ? 1121 PRO G CB  1 
ATOM   3671 C CG  . PRO G 1 48  ? 22.344 -46.012 29.048  1.00 34.74 ? 1121 PRO G CG  1 
ATOM   3672 C CD  . PRO G 1 48  ? 23.745 -45.894 29.571  1.00 35.15 ? 1121 PRO G CD  1 
ATOM   3673 N N   . VAL G 1 49  ? 23.154 -50.618 29.210  1.00 31.09 ? 1122 VAL G N   1 
ATOM   3674 C CA  . VAL G 1 49  ? 23.608 -51.871 28.625  1.00 29.49 ? 1122 VAL G CA  1 
ATOM   3675 C C   . VAL G 1 49  ? 22.779 -52.156 27.389  1.00 28.16 ? 1122 VAL G C   1 
ATOM   3676 O O   . VAL G 1 49  ? 21.545 -52.107 27.450  1.00 31.81 ? 1122 VAL G O   1 
ATOM   3677 C CB  . VAL G 1 49  ? 23.381 -53.037 29.619  1.00 33.51 ? 1122 VAL G CB  1 
ATOM   3678 C CG1 . VAL G 1 49  ? 23.612 -54.382 28.930  1.00 32.72 ? 1122 VAL G CG1 1 
ATOM   3679 C CG2 . VAL G 1 49  ? 24.278 -52.881 30.848  1.00 33.69 ? 1122 VAL G CG2 1 
ATOM   3680 N N   . PRO G 1 50  ? 23.440 -52.444 26.258  1.00 28.21 ? 1123 PRO G N   1 
ATOM   3681 C CA  . PRO G 1 50  ? 22.743 -52.780 25.010  1.00 30.73 ? 1123 PRO G CA  1 
ATOM   3682 C C   . PRO G 1 50  ? 21.885 -54.033 25.156  1.00 32.84 ? 1123 PRO G C   1 
ATOM   3683 O O   . PRO G 1 50  ? 22.382 -55.077 25.578  1.00 32.72 ? 1123 PRO G O   1 
ATOM   3684 C CB  . PRO G 1 50  ? 23.888 -53.093 24.023  1.00 28.84 ? 1123 PRO G CB  1 
ATOM   3685 C CG  . PRO G 1 50  ? 25.112 -52.526 24.621  1.00 32.81 ? 1123 PRO G CG  1 
ATOM   3686 C CD  . PRO G 1 50  ? 24.904 -52.449 26.110  1.00 31.42 ? 1123 PRO G CD  1 
ATOM   3687 N N   . PRO G 1 51  ? 20.611 -53.950 24.774  1.00 33.35 ? 1124 PRO G N   1 
ATOM   3688 C CA  . PRO G 1 51  ? 19.805 -55.180 24.737  1.00 34.98 ? 1124 PRO G CA  1 
ATOM   3689 C C   . PRO G 1 51  ? 20.340 -56.232 23.741  1.00 36.92 ? 1124 PRO G C   1 
ATOM   3690 O O   . PRO G 1 51  ? 20.872 -55.909 22.667  1.00 32.87 ? 1124 PRO G O   1 
ATOM   3691 C CB  . PRO G 1 51  ? 18.425 -54.676 24.286  1.00 35.13 ? 1124 PRO G CB  1 
ATOM   3692 C CG  . PRO G 1 51  ? 18.424 -53.182 24.618  1.00 35.99 ? 1124 PRO G CG  1 
ATOM   3693 C CD  . PRO G 1 51  ? 19.842 -52.754 24.387  1.00 30.80 ? 1124 PRO G CD  1 
ATOM   3694 N N   . LEU G 1 52  ? 20.185 -57.505 24.090  1.00 36.09 ? 1125 LEU G N   1 
ATOM   3695 C CA  . LEU G 1 52  ? 20.573 -58.583 23.189  1.00 34.47 ? 1125 LEU G CA  1 
ATOM   3696 C C   . LEU G 1 52  ? 20.116 -58.350 21.761  1.00 37.21 ? 1125 LEU G C   1 
ATOM   3697 O O   . LEU G 1 52  ? 20.865 -58.588 20.816  1.00 36.17 ? 1125 LEU G O   1 
ATOM   3698 C CB  . LEU G 1 52  ? 20.004 -59.918 23.686  1.00 35.40 ? 1125 LEU G CB  1 
ATOM   3699 C CG  . LEU G 1 52  ? 20.561 -60.319 25.043  1.00 40.77 ? 1125 LEU G CG  1 
ATOM   3700 C CD1 . LEU G 1 52  ? 19.972 -61.663 25.508  1.00 45.46 ? 1125 LEU G CD1 1 
ATOM   3701 C CD2 . LEU G 1 52  ? 22.058 -60.400 24.944  1.00 37.44 ? 1125 LEU G CD2 1 
ATOM   3702 N N   . GLU G 1 53  ? 18.882 -57.899 21.586  1.00 34.12 ? 1126 GLU G N   1 
ATOM   3703 C CA  . GLU G 1 53  ? 18.351 -57.766 20.237  1.00 37.91 ? 1126 GLU G CA  1 
ATOM   3704 C C   . GLU G 1 53  ? 19.098 -56.681 19.441  1.00 37.56 ? 1126 GLU G C   1 
ATOM   3705 O O   . GLU G 1 53  ? 19.221 -56.749 18.215  1.00 32.60 ? 1126 GLU G O   1 
ATOM   3706 C CB  . GLU G 1 53  ? 16.861 -57.466 20.309  1.00 45.40 ? 1126 GLU G CB  1 
ATOM   3707 C CG  . GLU G 1 53  ? 16.303 -56.768 19.096  1.00 50.23 ? 1126 GLU G CG  1 
ATOM   3708 C CD  . GLU G 1 53  ? 14.957 -56.126 19.385  1.00 57.52 ? 1126 GLU G CD  1 
ATOM   3709 O OE1 . GLU G 1 53  ? 14.754 -54.958 18.969  1.00 56.82 ? 1126 GLU G OE1 1 
ATOM   3710 O OE2 . GLU G 1 53  ? 14.113 -56.784 20.045  1.00 61.36 ? 1126 GLU G OE2 1 
ATOM   3711 N N   . VAL G 1 54  ? 19.589 -55.676 20.155  1.00 35.69 ? 1127 VAL G N   1 
ATOM   3712 C CA  . VAL G 1 54  ? 20.400 -54.634 19.534  1.00 36.65 ? 1127 VAL G CA  1 
ATOM   3713 C C   . VAL G 1 54  ? 21.740 -55.235 19.133  1.00 34.86 ? 1127 VAL G C   1 
ATOM   3714 O O   . VAL G 1 54  ? 22.262 -54.954 18.048  1.00 31.91 ? 1127 VAL G O   1 
ATOM   3715 C CB  . VAL G 1 54  ? 20.597 -53.433 20.496  1.00 31.95 ? 1127 VAL G CB  1 
ATOM   3716 C CG1 . VAL G 1 54  ? 21.596 -52.468 19.936  1.00 28.23 ? 1127 VAL G CG1 1 
ATOM   3717 C CG2 . VAL G 1 54  ? 19.252 -52.749 20.759  1.00 31.65 ? 1127 VAL G CG2 1 
ATOM   3718 N N   . LEU G 1 55  ? 22.301 -56.070 19.999  1.00 33.84 ? 1128 LEU G N   1 
ATOM   3719 C CA  . LEU G 1 55  ? 23.585 -56.689 19.675  1.00 35.20 ? 1128 LEU G CA  1 
ATOM   3720 C C   . LEU G 1 55  ? 23.447 -57.593 18.448  1.00 36.79 ? 1128 LEU G C   1 
ATOM   3721 O O   . LEU G 1 55  ? 24.324 -57.651 17.590  1.00 36.74 ? 1128 LEU G O   1 
ATOM   3722 C CB  . LEU G 1 55  ? 24.119 -57.495 20.853  1.00 35.84 ? 1128 LEU G CB  1 
ATOM   3723 C CG  . LEU G 1 55  ? 24.579 -56.693 22.065  1.00 37.45 ? 1128 LEU G CG  1 
ATOM   3724 C CD1 . LEU G 1 55  ? 25.147 -57.640 23.088  1.00 34.91 ? 1128 LEU G CD1 1 
ATOM   3725 C CD2 . LEU G 1 55  ? 25.601 -55.611 21.690  1.00 29.84 ? 1128 LEU G CD2 1 
ATOM   3726 N N   . LYS G 1 56  ? 22.327 -58.289 18.371  1.00 36.94 ? 1129 LYS G N   1 
ATOM   3727 C CA  . LYS G 1 56  ? 22.118 -59.263 17.319  1.00 39.10 ? 1129 LYS G CA  1 
ATOM   3728 C C   . LYS G 1 56  ? 21.989 -58.483 16.031  1.00 36.93 ? 1129 LYS G C   1 
ATOM   3729 O O   . LYS G 1 56  ? 22.452 -58.920 14.980  1.00 36.11 ? 1129 LYS G O   1 
ATOM   3730 C CB  . LYS G 1 56  ? 20.849 -60.061 17.618  1.00 42.49 ? 1129 LYS G CB  1 
ATOM   3731 C CG  . LYS G 1 56  ? 20.503 -61.160 16.645  1.00 44.30 ? 1129 LYS G CG  1 
ATOM   3732 C CD  . LYS G 1 56  ? 19.254 -61.882 17.137  1.00 48.47 ? 1129 LYS G CD  1 
ATOM   3733 C CE  . LYS G 1 56  ? 18.611 -62.684 16.026  1.00 56.91 ? 1129 LYS G CE  1 
ATOM   3734 N NZ  . LYS G 1 56  ? 17.541 -63.584 16.544  1.00 66.23 ? 1129 LYS G NZ  1 
ATOM   3735 N N   . LEU G 1 57  ? 21.382 -57.306 16.121  1.00 32.96 ? 1130 LEU G N   1 
ATOM   3736 C CA  . LEU G 1 57  ? 21.254 -56.444 14.960  1.00 34.84 ? 1130 LEU G CA  1 
ATOM   3737 C C   . LEU G 1 57  ? 22.641 -56.024 14.503  1.00 33.74 ? 1130 LEU G C   1 
ATOM   3738 O O   . LEU G 1 57  ? 22.892 -55.897 13.308  1.00 37.63 ? 1130 LEU G O   1 
ATOM   3739 C CB  . LEU G 1 57  ? 20.423 -55.195 15.267  1.00 32.18 ? 1130 LEU G CB  1 
ATOM   3740 C CG  . LEU G 1 57  ? 20.422 -54.201 14.095  1.00 33.08 ? 1130 LEU G CG  1 
ATOM   3741 C CD1 . LEU G 1 57  ? 19.700 -54.795 12.889  1.00 39.01 ? 1130 LEU G CD1 1 
ATOM   3742 C CD2 . LEU G 1 57  ? 19.836 -52.836 14.456  1.00 37.91 ? 1130 LEU G CD2 1 
ATOM   3743 N N   . GLY G 1 58  ? 23.534 -55.778 15.459  1.00 31.77 ? 1131 GLY G N   1 
ATOM   3744 C CA  . GLY G 1 58  ? 24.881 -55.341 15.124  1.00 32.12 ? 1131 GLY G CA  1 
ATOM   3745 C C   . GLY G 1 58  ? 25.622 -56.371 14.295  1.00 35.16 ? 1131 GLY G C   1 
ATOM   3746 O O   . GLY G 1 58  ? 26.317 -56.045 13.332  1.00 34.32 ? 1131 GLY G O   1 
ATOM   3747 N N   . GLU G 1 59  ? 25.488 -57.631 14.675  1.00 34.91 ? 1132 GLU G N   1 
ATOM   3748 C CA  . GLU G 1 59  ? 26.126 -58.677 13.885  1.00 36.83 ? 1132 GLU G CA  1 
ATOM   3749 C C   . GLU G 1 59  ? 25.556 -58.746 12.473  1.00 36.44 ? 1132 GLU G C   1 
ATOM   3750 O O   . GLU G 1 59  ? 26.308 -58.751 11.499  1.00 36.65 ? 1132 GLU G O   1 
ATOM   3751 C CB  . GLU G 1 59  ? 26.090 -60.007 14.617  1.00 39.70 ? 1132 GLU G CB  1 
ATOM   3752 C CG  . GLU G 1 59  ? 27.214 -60.082 15.655  1.00 45.69 ? 1132 GLU G CG  1 
ATOM   3753 C CD  . GLU G 1 59  ? 26.782 -60.676 16.987  1.00 54.57 ? 1132 GLU G CD  1 
ATOM   3754 O OE1 . GLU G 1 59  ? 26.437 -61.881 17.012  1.00 62.30 ? 1132 GLU G OE1 1 
ATOM   3755 O OE2 . GLU G 1 59  ? 26.807 -59.946 18.015  1.00 49.07 ? 1132 GLU G OE2 1 
ATOM   3756 N N   . GLN G 1 60  ? 24.236 -58.753 12.345  1.00 34.18 ? 1133 GLN G N   1 
ATOM   3757 C CA  . GLN G 1 60  ? 23.640 -58.781 11.010  1.00 35.44 ? 1133 GLN G CA  1 
ATOM   3758 C C   . GLN G 1 60  ? 24.128 -57.627 10.121  1.00 36.51 ? 1133 GLN G C   1 
ATOM   3759 O O   . GLN G 1 60  ? 24.592 -57.857 9.003   1.00 35.89 ? 1133 GLN G O   1 
ATOM   3760 C CB  A GLN G 1 60  ? 22.106 -58.791 11.078  0.46 36.77 ? 1133 GLN G CB  1 
ATOM   3761 C CB  B GLN G 1 60  ? 22.115 -58.772 11.112  0.54 36.82 ? 1133 GLN G CB  1 
ATOM   3762 C CG  A GLN G 1 60  ? 21.450 -57.412 11.031  0.46 38.57 ? 1133 GLN G CG  1 
ATOM   3763 C CG  B GLN G 1 60  ? 21.557 -59.954 11.886  0.54 36.64 ? 1133 GLN G CG  1 
ATOM   3764 C CD  A GLN G 1 60  ? 19.981 -57.469 10.653  0.46 39.99 ? 1133 GLN G CD  1 
ATOM   3765 C CD  B GLN G 1 60  ? 20.068 -59.827 12.176  0.54 38.03 ? 1133 GLN G CD  1 
ATOM   3766 O OE1 A GLN G 1 60  ? 19.524 -56.723 9.787   0.46 40.88 ? 1133 GLN G OE1 1 
ATOM   3767 O OE1 B GLN G 1 60  ? 19.543 -58.723 12.349  0.54 37.38 ? 1133 GLN G OE1 1 
ATOM   3768 N NE2 A GLN G 1 60  ? 19.235 -58.359 11.300  0.46 39.99 ? 1133 GLN G NE2 1 
ATOM   3769 N NE2 B GLN G 1 60  ? 19.383 -60.962 12.238  0.54 38.35 ? 1133 GLN G NE2 1 
ATOM   3770 N N   . MET G 1 61  ? 24.025 -56.394 10.616  1.00 33.57 ? 1134 MET G N   1 
ATOM   3771 C CA  . MET G 1 61  ? 24.415 -55.212 9.852   1.00 32.25 ? 1134 MET G CA  1 
ATOM   3772 C C   . MET G 1 61  ? 25.893 -55.223 9.511   1.00 31.70 ? 1134 MET G C   1 
ATOM   3773 O O   . MET G 1 61  ? 26.290 -54.766 8.443   1.00 33.55 ? 1134 MET G O   1 
ATOM   3774 C CB  . MET G 1 61  ? 24.080 -53.918 10.621  1.00 29.02 ? 1134 MET G CB  1 
ATOM   3775 C CG  . MET G 1 61  ? 22.577 -53.646 10.743  1.00 32.89 ? 1134 MET G CG  1 
ATOM   3776 S SD  . MET G 1 61  ? 22.203 -52.177 11.757  1.00 32.26 ? 1134 MET G SD  1 
ATOM   3777 C CE  . MET G 1 61  ? 22.831 -50.905 10.675  1.00 33.37 ? 1134 MET G CE  1 
ATOM   3778 N N   . THR G 1 62  ? 26.703 -55.705 10.443  1.00 31.14 ? 1135 THR G N   1 
ATOM   3779 C CA  . THR G 1 62  ? 28.141 -55.769 10.236  1.00 34.58 ? 1135 THR G CA  1 
ATOM   3780 C C   . THR G 1 62  ? 28.485 -56.712 9.075   1.00 37.55 ? 1135 THR G C   1 
ATOM   3781 O O   . THR G 1 62  ? 29.270 -56.363 8.196   1.00 35.94 ? 1135 THR G O   1 
ATOM   3782 C CB  . THR G 1 62  ? 28.855 -56.214 11.508  1.00 31.31 ? 1135 THR G CB  1 
ATOM   3783 O OG1 . THR G 1 62  ? 28.747 -55.170 12.481  1.00 34.41 ? 1135 THR G OG1 1 
ATOM   3784 C CG2 . THR G 1 62  ? 30.316 -56.467 11.230  1.00 33.52 ? 1135 THR G CG2 1 
ATOM   3785 N N   . GLN G 1 63  ? 27.870 -57.894 9.078   1.00 37.31 ? 1136 GLN G N   1 
ATOM   3786 C CA  . GLN G 1 63  ? 28.099 -58.874 8.023   1.00 38.47 ? 1136 GLN G CA  1 
ATOM   3787 C C   . GLN G 1 63  ? 27.614 -58.315 6.701   1.00 40.52 ? 1136 GLN G C   1 
ATOM   3788 O O   . GLN G 1 63  ? 28.266 -58.501 5.667   1.00 42.53 ? 1136 GLN G O   1 
ATOM   3789 C CB  . GLN G 1 63  ? 27.393 -60.203 8.339   1.00 41.43 ? 1136 GLN G CB  1 
ATOM   3790 C CG  . GLN G 1 63  ? 27.952 -60.910 9.581   1.00 44.08 ? 1136 GLN G CG  1 
ATOM   3791 C CD  . GLN G 1 63  ? 27.173 -62.167 9.994   1.00 53.30 ? 1136 GLN G CD  1 
ATOM   3792 O OE1 . GLN G 1 63  ? 27.301 -62.634 11.133  1.00 55.00 ? 1136 GLN G OE1 1 
ATOM   3793 N NE2 . GLN G 1 63  ? 26.371 -62.722 9.072   1.00 56.99 ? 1136 GLN G NE2 1 
ATOM   3794 N N   . GLU G 1 64  ? 26.488 -57.608 6.718   1.00 36.59 ? 1137 GLU G N   1 
ATOM   3795 C CA  . GLU G 1 64  ? 25.970 -57.086 5.458   1.00 39.95 ? 1137 GLU G CA  1 
ATOM   3796 C C   . GLU G 1 64  ? 26.780 -55.914 4.921   1.00 40.26 ? 1137 GLU G C   1 
ATOM   3797 O O   . GLU G 1 64  ? 26.904 -55.743 3.703   1.00 42.31 ? 1137 GLU G O   1 
ATOM   3798 C CB  . GLU G 1 64  ? 24.454 -56.801 5.480   1.00 42.05 ? 1137 GLU G CB  1 
ATOM   3799 C CG  . GLU G 1 64  ? 23.952 -55.803 6.488   1.00 45.36 ? 1137 GLU G CG  1 
ATOM   3800 C CD  . GLU G 1 64  ? 22.408 -55.710 6.518   1.00 50.03 ? 1137 GLU G CD  1 
ATOM   3801 O OE1 . GLU G 1 64  ? 21.825 -55.755 7.634   1.00 48.08 ? 1137 GLU G OE1 1 
ATOM   3802 O OE2 . GLU G 1 64  ? 21.785 -55.589 5.430   1.00 51.78 ? 1137 GLU G OE2 1 
ATOM   3803 N N   . ALA G 1 65  ? 27.354 -55.112 5.809   1.00 37.71 ? 1138 ALA G N   1 
ATOM   3804 C CA  . ALA G 1 65  ? 28.134 -53.979 5.334   1.00 38.37 ? 1138 ALA G CA  1 
ATOM   3805 C C   . ALA G 1 65  ? 29.582 -54.403 5.095   1.00 33.35 ? 1138 ALA G C   1 
ATOM   3806 O O   . ALA G 1 65  ? 30.314 -53.762 4.329   1.00 35.97 ? 1138 ALA G O   1 
ATOM   3807 C CB  . ALA G 1 65  ? 28.063 -52.806 6.327   1.00 34.27 ? 1138 ALA G CB  1 
ATOM   3808 N N   . ARG G 1 66  ? 29.978 -55.495 5.736   1.00 34.26 ? 1139 ARG G N   1 
ATOM   3809 C CA  . ARG G 1 66  ? 31.378 -55.886 5.748   1.00 35.70 ? 1139 ARG G CA  1 
ATOM   3810 C C   . ARG G 1 66  ? 32.232 -54.655 6.054   1.00 37.36 ? 1139 ARG G C   1 
ATOM   3811 O O   . ARG G 1 66  ? 33.198 -54.356 5.354   1.00 32.82 ? 1139 ARG G O   1 
ATOM   3812 C CB  . ARG G 1 66  ? 31.764 -56.536 4.412   1.00 34.77 ? 1139 ARG G CB  1 
ATOM   3813 C CG  . ARG G 1 66  ? 31.301 -57.993 4.337   1.00 39.99 ? 1139 ARG G CG  1 
ATOM   3814 C CD  . ARG G 1 66  ? 30.793 -58.387 2.962   1.00 39.39 ? 1139 ARG G CD  1 
ATOM   3815 N NE  . ARG G 1 66  ? 29.549 -57.714 2.618   1.00 39.84 ? 1139 ARG G NE  1 
ATOM   3816 C CZ  . ARG G 1 66  ? 28.692 -58.172 1.712   1.00 45.13 ? 1139 ARG G CZ  1 
ATOM   3817 N NH1 . ARG G 1 66  ? 27.577 -57.502 1.449   1.00 42.99 ? 1139 ARG G NH1 1 
ATOM   3818 N NH2 . ARG G 1 66  ? 28.945 -59.313 1.073   1.00 42.97 ? 1139 ARG G NH2 1 
ATOM   3819 N N   . GLU G 1 67  ? 31.827 -53.907 7.080   1.00 33.19 ? 1140 GLU G N   1 
ATOM   3820 C CA  . GLU G 1 67  ? 32.722 -52.914 7.680   1.00 33.98 ? 1140 GLU G CA  1 
ATOM   3821 C C   . GLU G 1 67  ? 32.494 -52.800 9.172   1.00 31.88 ? 1140 GLU G C   1 
ATOM   3822 O O   . GLU G 1 67  ? 31.436 -53.192 9.687   1.00 30.51 ? 1140 GLU G O   1 
ATOM   3823 C CB  . GLU G 1 67  ? 32.658 -51.536 7.007   1.00 37.74 ? 1140 GLU G CB  1 
ATOM   3824 C CG  . GLU G 1 67  ? 31.290 -51.010 6.679   1.00 39.27 ? 1140 GLU G CG  1 
ATOM   3825 C CD  . GLU G 1 67  ? 31.311 -49.534 6.250   1.00 45.24 ? 1140 GLU G CD  1 
ATOM   3826 O OE1 . GLU G 1 67  ? 30.326 -49.098 5.591   1.00 43.71 ? 1140 GLU G OE1 1 
ATOM   3827 O OE2 . GLU G 1 67  ? 32.301 -48.814 6.567   1.00 43.88 ? 1140 GLU G OE2 1 
ATOM   3828 N N   . HIS G 1 68  ? 33.500 -52.279 9.860   1.00 28.24 ? 1141 HIS G N   1 
ATOM   3829 C CA  . HIS G 1 68  ? 33.427 -52.175 11.298  1.00 28.34 ? 1141 HIS G CA  1 
ATOM   3830 C C   . HIS G 1 68  ? 32.364 -51.134 11.653  1.00 28.69 ? 1141 HIS G C   1 
ATOM   3831 O O   . HIS G 1 68  ? 32.386 -50.024 11.136  1.00 30.67 ? 1141 HIS G O   1 
ATOM   3832 C CB  . HIS G 1 68  ? 34.772 -51.746 11.871  1.00 30.97 ? 1141 HIS G CB  1 
ATOM   3833 C CG  . HIS G 1 68  ? 34.793 -51.716 13.365  1.00 31.78 ? 1141 HIS G CG  1 
ATOM   3834 N ND1 . HIS G 1 68  ? 34.763 -52.862 14.126  1.00 32.38 ? 1141 HIS G ND1 1 
ATOM   3835 C CD2 . HIS G 1 68  ? 34.817 -50.680 14.240  1.00 34.19 ? 1141 HIS G CD2 1 
ATOM   3836 C CE1 . HIS G 1 68  ? 34.779 -52.540 15.408  1.00 34.16 ? 1141 HIS G CE1 1 
ATOM   3837 N NE2 . HIS G 1 68  ? 34.796 -51.221 15.505  1.00 37.60 ? 1141 HIS G NE2 1 
ATOM   3838 N N   . LEU G 1 69  ? 31.434 -51.514 12.515  1.00 28.24 ? 1142 LEU G N   1 
ATOM   3839 C CA  . LEU G 1 69  ? 30.323 -50.645 12.896  1.00 29.34 ? 1142 LEU G CA  1 
ATOM   3840 C C   . LEU G 1 69  ? 30.404 -50.263 14.384  1.00 30.63 ? 1142 LEU G C   1 
ATOM   3841 O O   . LEU G 1 69  ? 30.723 -51.108 15.234  1.00 28.39 ? 1142 LEU G O   1 
ATOM   3842 C CB  . LEU G 1 69  ? 28.989 -51.334 12.605  1.00 29.08 ? 1142 LEU G CB  1 
ATOM   3843 C CG  . LEU G 1 69  ? 28.759 -51.748 11.147  1.00 30.05 ? 1142 LEU G CG  1 
ATOM   3844 C CD1 . LEU G 1 69  ? 27.345 -52.328 11.003  1.00 30.12 ? 1142 LEU G CD1 1 
ATOM   3845 C CD2 . LEU G 1 69  ? 28.927 -50.546 10.243  1.00 26.64 ? 1142 LEU G CD2 1 
ATOM   3846 N N   . TYR G 1 70  ? 30.113 -48.993 14.693  1.00 24.44 ? 1143 TYR G N   1 
ATOM   3847 C CA  . TYR G 1 70  ? 30.101 -48.517 16.074  1.00 22.42 ? 1143 TYR G CA  1 
ATOM   3848 C C   . TYR G 1 70  ? 28.672 -48.553 16.574  1.00 24.47 ? 1143 TYR G C   1 
ATOM   3849 O O   . TYR G 1 70  ? 27.749 -48.247 15.818  1.00 24.45 ? 1143 TYR G O   1 
ATOM   3850 C CB  . TYR G 1 70  ? 30.659 -47.081 16.149  1.00 25.22 ? 1143 TYR G CB  1 
ATOM   3851 C CG  . TYR G 1 70  ? 32.107 -47.021 15.734  1.00 27.71 ? 1143 TYR G CG  1 
ATOM   3852 C CD1 . TYR G 1 70  ? 33.126 -47.138 16.680  1.00 29.22 ? 1143 TYR G CD1 1 
ATOM   3853 C CD2 . TYR G 1 70  ? 32.459 -46.890 14.392  1.00 27.01 ? 1143 TYR G CD2 1 
ATOM   3854 C CE1 . TYR G 1 70  ? 34.459 -47.102 16.303  1.00 31.03 ? 1143 TYR G CE1 1 
ATOM   3855 C CE2 . TYR G 1 70  ? 33.801 -46.856 14.001  1.00 29.46 ? 1143 TYR G CE2 1 
ATOM   3856 C CZ  . TYR G 1 70  ? 34.791 -46.966 14.953  1.00 32.94 ? 1143 TYR G CZ  1 
ATOM   3857 O OH  . TYR G 1 70  ? 36.111 -46.935 14.564  1.00 34.78 ? 1143 TYR G OH  1 
ATOM   3858 N N   . LEU G 1 71  ? 28.488 -48.944 17.828  1.00 24.79 ? 1144 LEU G N   1 
ATOM   3859 C CA  . LEU G 1 71  ? 27.167 -48.931 18.437  1.00 24.37 ? 1144 LEU G CA  1 
ATOM   3860 C C   . LEU G 1 71  ? 26.990 -47.554 19.053  1.00 25.46 ? 1144 LEU G C   1 
ATOM   3861 O O   . LEU G 1 71  ? 27.835 -47.108 19.840  1.00 22.45 ? 1144 LEU G O   1 
ATOM   3862 C CB  . LEU G 1 71  ? 27.072 -49.972 19.539  1.00 23.95 ? 1144 LEU G CB  1 
ATOM   3863 C CG  . LEU G 1 71  ? 25.793 -49.854 20.390  1.00 23.30 ? 1144 LEU G CG  1 
ATOM   3864 C CD1 . LEU G 1 71  ? 24.579 -50.058 19.463  1.00 26.85 ? 1144 LEU G CD1 1 
ATOM   3865 C CD2 . LEU G 1 71  ? 25.817 -50.909 21.479  1.00 27.83 ? 1144 LEU G CD2 1 
ATOM   3866 N N   . VAL G 1 72  ? 25.927 -46.864 18.682  1.00 20.68 ? 1145 VAL G N   1 
ATOM   3867 C CA  . VAL G 1 72  ? 25.683 -45.560 19.308  1.00 21.92 ? 1145 VAL G CA  1 
ATOM   3868 C C   . VAL G 1 72  ? 24.353 -45.532 20.044  1.00 25.22 ? 1145 VAL G C   1 
ATOM   3869 O O   . VAL G 1 72  ? 23.397 -46.211 19.658  1.00 24.48 ? 1145 VAL G O   1 
ATOM   3870 C CB  . VAL G 1 72  ? 25.818 -44.387 18.344  1.00 21.24 ? 1145 VAL G CB  1 
ATOM   3871 C CG1 . VAL G 1 72  ? 27.160 -44.457 17.628  1.00 22.62 ? 1145 VAL G CG1 1 
ATOM   3872 C CG2 . VAL G 1 72  ? 24.681 -44.332 17.314  1.00 22.09 ? 1145 VAL G CG2 1 
ATOM   3873 N N   . LEU G 1 73  ? 24.311 -44.739 21.108  1.00 23.10 ? 1146 LEU G N   1 
ATOM   3874 C CA  . LEU G 1 73  ? 23.084 -44.520 21.878  1.00 24.21 ? 1146 LEU G CA  1 
ATOM   3875 C C   . LEU G 1 73  ? 22.753 -43.032 21.735  1.00 24.44 ? 1146 LEU G C   1 
ATOM   3876 O O   . LEU G 1 73  ? 23.535 -42.195 22.155  1.00 20.14 ? 1146 LEU G O   1 
ATOM   3877 C CB  . LEU G 1 73  ? 23.337 -44.837 23.344  1.00 21.62 ? 1146 LEU G CB  1 
ATOM   3878 C CG  . LEU G 1 73  ? 22.111 -44.601 24.227  1.00 24.90 ? 1146 LEU G CG  1 
ATOM   3879 C CD1 . LEU G 1 73  ? 20.936 -45.481 23.760  1.00 24.68 ? 1146 LEU G CD1 1 
ATOM   3880 C CD2 . LEU G 1 73  ? 22.441 -44.907 25.681  1.00 26.86 ? 1146 LEU G CD2 1 
ATOM   3881 N N   . PHE G 1 74  ? 21.630 -42.699 21.106  1.00 21.16 ? 1147 PHE G N   1 
ATOM   3882 C CA  . PHE G 1 74  ? 21.321 -41.295 20.877  1.00 20.09 ? 1147 PHE G CA  1 
ATOM   3883 C C   . PHE G 1 74  ? 20.894 -40.621 22.174  1.00 23.07 ? 1147 PHE G C   1 
ATOM   3884 O O   . PHE G 1 74  ? 20.421 -41.282 23.091  1.00 24.59 ? 1147 PHE G O   1 
ATOM   3885 C CB  . PHE G 1 74  ? 20.222 -41.136 19.830  1.00 19.66 ? 1147 PHE G CB  1 
ATOM   3886 C CG  . PHE G 1 74  ? 20.650 -41.552 18.432  1.00 24.69 ? 1147 PHE G CG  1 
ATOM   3887 C CD1 . PHE G 1 74  ? 21.388 -40.693 17.631  1.00 21.44 ? 1147 PHE G CD1 1 
ATOM   3888 C CD2 . PHE G 1 74  ? 20.304 -42.793 17.932  1.00 23.83 ? 1147 PHE G CD2 1 
ATOM   3889 C CE1 . PHE G 1 74  ? 21.790 -41.074 16.321  1.00 21.92 ? 1147 PHE G CE1 1 
ATOM   3890 C CE2 . PHE G 1 74  ? 20.688 -43.179 16.622  1.00 28.40 ? 1147 PHE G CE2 1 
ATOM   3891 C CZ  . PHE G 1 74  ? 21.436 -42.315 15.827  1.00 21.68 ? 1147 PHE G CZ  1 
ATOM   3892 N N   . PHE G 1 75  ? 21.072 -39.301 22.229  1.00 21.44 ? 1148 PHE G N   1 
ATOM   3893 C CA  . PHE G 1 75  ? 20.542 -38.519 23.340  1.00 21.95 ? 1148 PHE G CA  1 
ATOM   3894 C C   . PHE G 1 75  ? 19.151 -38.005 23.017  1.00 19.93 ? 1148 PHE G C   1 
ATOM   3895 O O   . PHE G 1 75  ? 18.779 -36.946 23.462  1.00 25.62 ? 1148 PHE G O   1 
ATOM   3896 C CB  . PHE G 1 75  ? 21.438 -37.317 23.639  1.00 21.89 ? 1148 PHE G CB  1 
ATOM   3897 C CG  . PHE G 1 75  ? 22.705 -37.680 24.351  1.00 21.54 ? 1148 PHE G CG  1 
ATOM   3898 C CD1 . PHE G 1 75  ? 22.704 -37.894 25.717  1.00 25.65 ? 1148 PHE G CD1 1 
ATOM   3899 C CD2 . PHE G 1 75  ? 23.878 -37.870 23.647  1.00 23.93 ? 1148 PHE G CD2 1 
ATOM   3900 C CE1 . PHE G 1 75  ? 23.864 -38.235 26.378  1.00 26.52 ? 1148 PHE G CE1 1 
ATOM   3901 C CE2 . PHE G 1 75  ? 25.047 -38.214 24.300  1.00 23.82 ? 1148 PHE G CE2 1 
ATOM   3902 C CZ  . PHE G 1 75  ? 25.033 -38.396 25.672  1.00 25.10 ? 1148 PHE G CZ  1 
ATOM   3903 N N   . ASP G 1 76  ? 18.384 -38.750 22.238  1.00 23.09 ? 1149 ASP G N   1 
ATOM   3904 C CA  . ASP G 1 76  ? 16.995 -38.381 22.027  1.00 24.36 ? 1149 ASP G CA  1 
ATOM   3905 C C   . ASP G 1 76  ? 16.189 -38.741 23.283  1.00 27.26 ? 1149 ASP G C   1 
ATOM   3906 O O   . ASP G 1 76  ? 16.736 -39.272 24.257  1.00 28.67 ? 1149 ASP G O   1 
ATOM   3907 C CB  . ASP G 1 76  ? 16.422 -39.017 20.736  1.00 24.48 ? 1149 ASP G CB  1 
ATOM   3908 C CG  . ASP G 1 76  ? 16.570 -40.559 20.691  1.00 28.26 ? 1149 ASP G CG  1 
ATOM   3909 O OD1 . ASP G 1 76  ? 17.354 -41.129 21.480  1.00 23.88 ? 1149 ASP G OD1 1 
ATOM   3910 O OD2 . ASP G 1 76  ? 15.876 -41.200 19.850  1.00 29.21 ? 1149 ASP G OD2 1 
ATOM   3911 N N   . ASN G 1 77  ? 14.902 -38.448 23.261  1.00 29.19 ? 1150 ASN G N   1 
ATOM   3912 C CA  . ASN G 1 77  ? 14.074 -38.569 24.467  1.00 30.90 ? 1150 ASN G CA  1 
ATOM   3913 C C   . ASN G 1 77  ? 14.038 -40.012 24.942  1.00 31.76 ? 1150 ASN G C   1 
ATOM   3914 O O   . ASN G 1 77  ? 14.151 -40.282 26.123  1.00 33.44 ? 1150 ASN G O   1 
ATOM   3915 C CB  . ASN G 1 77  ? 12.641 -38.115 24.170  1.00 32.36 ? 1150 ASN G CB  1 
ATOM   3916 C CG  . ASN G 1 77  ? 12.533 -36.624 23.944  1.00 38.61 ? 1150 ASN G CG  1 
ATOM   3917 O OD1 . ASN G 1 77  ? 13.313 -35.845 24.496  1.00 42.24 ? 1150 ASN G OD1 1 
ATOM   3918 N ND2 . ASN G 1 77  ? 11.547 -36.209 23.139  1.00 45.66 ? 1150 ASN G ND2 1 
ATOM   3919 N N   . LYS G 1 78  ? 13.917 -40.938 23.999  1.00 33.13 ? 1151 LYS G N   1 
ATOM   3920 C CA  . LYS G 1 78  ? 13.744 -42.349 24.334  1.00 33.27 ? 1151 LYS G CA  1 
ATOM   3921 C C   . LYS G 1 78  ? 15.052 -43.127 24.382  1.00 32.55 ? 1151 LYS G C   1 
ATOM   3922 O O   . LYS G 1 78  ? 15.073 -44.306 24.759  1.00 29.52 ? 1151 LYS G O   1 
ATOM   3923 C CB  . LYS G 1 78  ? 12.793 -42.976 23.329  1.00 36.69 ? 1151 LYS G CB  1 
ATOM   3924 C CG  . LYS G 1 78  ? 11.409 -42.353 23.354  1.00 41.81 ? 1151 LYS G CG  1 
ATOM   3925 C CD  . LYS G 1 78  ? 10.787 -42.325 21.961  1.00 48.72 ? 1151 LYS G CD  1 
ATOM   3926 C CE  . LYS G 1 78  ? 9.458  -41.569 21.948  1.00 54.03 ? 1151 LYS G CE  1 
ATOM   3927 N NZ  . LYS G 1 78  ? 9.088  -41.124 20.572  1.00 55.43 ? 1151 LYS G NZ  1 
ATOM   3928 N N   . ARG G 1 79  ? 16.140 -42.465 23.978  1.00 28.67 ? 1152 ARG G N   1 
ATOM   3929 C CA  . ARG G 1 79  ? 17.477 -43.050 24.010  1.00 25.97 ? 1152 ARG G CA  1 
ATOM   3930 C C   . ARG G 1 79  ? 17.513 -44.306 23.178  1.00 25.83 ? 1152 ARG G C   1 
ATOM   3931 O O   . ARG G 1 79  ? 17.594 -45.427 23.727  1.00 26.62 ? 1152 ARG G O   1 
ATOM   3932 C CB  . ARG G 1 79  ? 17.926 -43.366 25.439  1.00 28.83 ? 1152 ARG G CB  1 
ATOM   3933 C CG  . ARG G 1 79  ? 17.940 -42.156 26.374  1.00 30.46 ? 1152 ARG G CG  1 
ATOM   3934 C CD  . ARG G 1 79  ? 18.940 -41.065 25.945  1.00 30.27 ? 1152 ARG G CD  1 
ATOM   3935 N NE  . ARG G 1 79  ? 20.372 -41.338 26.148  1.00 26.81 ? 1152 ARG G NE  1 
ATOM   3936 C CZ  . ARG G 1 79  ? 20.982 -41.416 27.327  1.00 33.80 ? 1152 ARG G CZ  1 
ATOM   3937 N NH1 . ARG G 1 79  ? 20.288 -41.326 28.468  1.00 33.99 ? 1152 ARG G NH1 1 
ATOM   3938 N NH2 . ARG G 1 79  ? 22.287 -41.628 27.370  1.00 29.10 ? 1152 ARG G NH2 1 
ATOM   3939 N N   . THR G 1 80  ? 17.440 -44.113 21.861  1.00 24.61 ? 1153 THR G N   1 
ATOM   3940 C CA  . THR G 1 80  ? 17.456 -45.203 20.889  1.00 24.88 ? 1153 THR G CA  1 
ATOM   3941 C C   . THR G 1 80  ? 18.876 -45.567 20.427  1.00 28.40 ? 1153 THR G C   1 
ATOM   3942 O O   . THR G 1 80  ? 19.833 -44.809 20.629  1.00 25.77 ? 1153 THR G O   1 
ATOM   3943 C CB  . THR G 1 80  ? 16.584 -44.902 19.666  1.00 27.39 ? 1153 THR G CB  1 
ATOM   3944 O OG1 . THR G 1 80  ? 16.994 -43.666 19.072  1.00 27.61 ? 1153 THR G OG1 1 
ATOM   3945 C CG2 . THR G 1 80  ? 15.132 -44.792 20.047  1.00 31.21 ? 1153 THR G CG2 1 
ATOM   3946 N N   . TRP G 1 81  ? 18.986 -46.735 19.798  1.00 23.47 ? 1154 TRP G N   1 
ATOM   3947 C CA  . TRP G 1 81  ? 20.274 -47.341 19.440  1.00 25.98 ? 1154 TRP G CA  1 
ATOM   3948 C C   . TRP G 1 81  ? 20.426 -47.425 17.936  1.00 26.38 ? 1154 TRP G C   1 
ATOM   3949 O O   . TRP G 1 81  ? 19.459 -47.687 17.217  1.00 26.40 ? 1154 TRP G O   1 
ATOM   3950 C CB  . TRP G 1 81  ? 20.380 -48.778 19.980  1.00 25.47 ? 1154 TRP G CB  1 
ATOM   3951 C CG  . TRP G 1 81  ? 20.299 -48.975 21.482  1.00 26.68 ? 1154 TRP G CG  1 
ATOM   3952 C CD1 . TRP G 1 81  ? 19.172 -49.249 22.211  1.00 28.90 ? 1154 TRP G CD1 1 
ATOM   3953 C CD2 . TRP G 1 81  ? 21.390 -48.984 22.419  1.00 25.90 ? 1154 TRP G CD2 1 
ATOM   3954 N NE1 . TRP G 1 81  ? 19.491 -49.385 23.534  1.00 30.10 ? 1154 TRP G NE1 1 
ATOM   3955 C CE2 . TRP G 1 81  ? 20.843 -49.241 23.691  1.00 23.75 ? 1154 TRP G CE2 1 
ATOM   3956 C CE3 . TRP G 1 81  ? 22.768 -48.764 22.311  1.00 23.93 ? 1154 TRP G CE3 1 
ATOM   3957 C CZ2 . TRP G 1 81  ? 21.619 -49.287 24.838  1.00 26.59 ? 1154 TRP G CZ2 1 
ATOM   3958 C CZ3 . TRP G 1 81  ? 23.539 -48.820 23.448  1.00 24.46 ? 1154 TRP G CZ3 1 
ATOM   3959 C CH2 . TRP G 1 81  ? 22.965 -49.078 24.696  1.00 27.95 ? 1154 TRP G CH2 1 
ATOM   3960 N N   . GLN G 1 82  ? 21.646 -47.226 17.447  1.00 25.16 ? 1155 GLN G N   1 
ATOM   3961 C CA  . GLN G 1 82  ? 21.941 -47.550 16.049  1.00 24.85 ? 1155 GLN G CA  1 
ATOM   3962 C C   . GLN G 1 82  ? 23.369 -48.023 15.906  1.00 25.07 ? 1155 GLN G C   1 
ATOM   3963 O O   . GLN G 1 82  ? 24.205 -47.784 16.783  1.00 23.84 ? 1155 GLN G O   1 
ATOM   3964 C CB  . GLN G 1 82  ? 21.679 -46.362 15.125  1.00 28.76 ? 1155 GLN G CB  1 
ATOM   3965 C CG  . GLN G 1 82  ? 20.386 -46.454 14.322  1.00 38.37 ? 1155 GLN G CG  1 
ATOM   3966 C CD  . GLN G 1 82  ? 20.231 -47.768 13.537  1.00 37.18 ? 1155 GLN G CD  1 
ATOM   3967 O OE1 . GLN G 1 82  ? 21.190 -48.511 13.321  1.00 36.25 ? 1155 GLN G OE1 1 
ATOM   3968 N NE2 . GLN G 1 82  ? 19.004 -48.051 13.113  1.00 39.27 ? 1155 GLN G NE2 1 
ATOM   3969 N N   . TRP G 1 83  ? 23.636 -48.695 14.791  1.00 25.78 ? 1156 TRP G N   1 
ATOM   3970 C CA  . TRP G 1 83  ? 24.989 -49.117 14.416  1.00 23.34 ? 1156 TRP G CA  1 
ATOM   3971 C C   . TRP G 1 83  ? 25.397 -48.336 13.177  1.00 24.71 ? 1156 TRP G C   1 
ATOM   3972 O O   . TRP G 1 83  ? 24.643 -48.271 12.211  1.00 26.45 ? 1156 TRP G O   1 
ATOM   3973 C CB  . TRP G 1 83  ? 24.985 -50.618 14.072  1.00 25.96 ? 1156 TRP G CB  1 
ATOM   3974 C CG  . TRP G 1 83  ? 24.755 -51.510 15.230  1.00 26.73 ? 1156 TRP G CG  1 
ATOM   3975 C CD1 . TRP G 1 83  ? 23.550 -51.991 15.671  1.00 28.34 ? 1156 TRP G CD1 1 
ATOM   3976 C CD2 . TRP G 1 83  ? 25.752 -52.063 16.102  1.00 23.62 ? 1156 TRP G CD2 1 
ATOM   3977 N NE1 . TRP G 1 83  ? 23.742 -52.815 16.760  1.00 26.96 ? 1156 TRP G NE1 1 
ATOM   3978 C CE2 . TRP G 1 83  ? 25.082 -52.881 17.041  1.00 28.64 ? 1156 TRP G CE2 1 
ATOM   3979 C CE3 . TRP G 1 83  ? 27.147 -51.968 16.166  1.00 26.78 ? 1156 TRP G CE3 1 
ATOM   3980 C CZ2 . TRP G 1 83  ? 25.756 -53.564 18.055  1.00 29.26 ? 1156 TRP G CZ2 1 
ATOM   3981 C CZ3 . TRP G 1 83  ? 27.819 -52.662 17.171  1.00 26.10 ? 1156 TRP G CZ3 1 
ATOM   3982 C CH2 . TRP G 1 83  ? 27.121 -53.449 18.097  1.00 31.28 ? 1156 TRP G CH2 1 
ATOM   3983 N N   . LEU G 1 84  ? 26.574 -47.724 13.194  1.00 22.37 ? 1157 LEU G N   1 
ATOM   3984 C CA  . LEU G 1 84  ? 26.990 -46.907 12.066  1.00 22.99 ? 1157 LEU G CA  1 
ATOM   3985 C C   . LEU G 1 84  ? 28.485 -47.016 11.836  1.00 24.73 ? 1157 LEU G C   1 
ATOM   3986 O O   . LEU G 1 84  ? 29.251 -47.154 12.783  1.00 23.26 ? 1157 LEU G O   1 
ATOM   3987 C CB  . LEU G 1 84  ? 26.673 -45.436 12.371  1.00 27.03 ? 1157 LEU G CB  1 
ATOM   3988 C CG  . LEU G 1 84  ? 25.220 -45.023 12.507  1.00 24.32 ? 1157 LEU G CG  1 
ATOM   3989 C CD1 . LEU G 1 84  ? 25.132 -43.630 13.150  1.00 26.88 ? 1157 LEU G CD1 1 
ATOM   3990 C CD2 . LEU G 1 84  ? 24.554 -45.026 11.159  1.00 26.35 ? 1157 LEU G CD2 1 
ATOM   3991 N N   . PRO G 1 85  ? 28.917 -46.908 10.573  1.00 27.07 ? 1158 PRO G N   1 
ATOM   3992 C CA  . PRO G 1 85  ? 30.351 -46.926 10.276  1.00 25.05 ? 1158 PRO G CA  1 
ATOM   3993 C C   . PRO G 1 85  ? 31.024 -45.601 10.592  1.00 27.33 ? 1158 PRO G C   1 
ATOM   3994 O O   . PRO G 1 85  ? 30.384 -44.567 10.748  1.00 25.67 ? 1158 PRO G O   1 
ATOM   3995 C CB  . PRO G 1 85  ? 30.396 -47.106 8.756   1.00 28.19 ? 1158 PRO G CB  1 
ATOM   3996 C CG  . PRO G 1 85  ? 29.038 -46.691 8.245   1.00 29.73 ? 1158 PRO G CG  1 
ATOM   3997 C CD  . PRO G 1 85  ? 28.105 -46.491 9.418   1.00 29.33 ? 1158 PRO G CD  1 
ATOM   3998 N N   . ARG G 1 86  ? 32.342 -45.649 10.653  1.00 27.94 ? 1159 ARG G N   1 
ATOM   3999 C CA  . ARG G 1 86  ? 33.141 -44.483 10.948  1.00 29.31 ? 1159 ARG G CA  1 
ATOM   4000 C C   . ARG G 1 86  ? 32.788 -43.262 10.097  1.00 29.19 ? 1159 ARG G C   1 
ATOM   4001 O O   . ARG G 1 86  ? 32.819 -42.160 10.606  1.00 28.97 ? 1159 ARG G O   1 
ATOM   4002 C CB  . ARG G 1 86  ? 34.620 -44.824 10.794  1.00 33.14 ? 1159 ARG G CB  1 
ATOM   4003 C CG  . ARG G 1 86  ? 35.480 -44.136 11.834  1.00 39.81 ? 1159 ARG G CG  1 
ATOM   4004 C CD  . ARG G 1 86  ? 36.022 -42.881 11.280  1.00 43.74 ? 1159 ARG G CD  1 
ATOM   4005 N NE  . ARG G 1 86  ? 36.631 -42.007 12.275  1.00 47.36 ? 1159 ARG G NE  1 
ATOM   4006 C CZ  . ARG G 1 86  ? 36.091 -40.860 12.666  1.00 41.31 ? 1159 ARG G CZ  1 
ATOM   4007 N NH1 . ARG G 1 86  ? 36.726 -40.095 13.545  1.00 46.44 ? 1159 ARG G NH1 1 
ATOM   4008 N NH2 . ARG G 1 86  ? 34.916 -40.480 12.169  1.00 35.95 ? 1159 ARG G NH2 1 
ATOM   4009 N N   . THR G 1 87  ? 32.460 -43.453 8.812   1.00 26.71 ? 1160 THR G N   1 
ATOM   4010 C CA  . THR G 1 87  ? 32.143 -42.311 7.953   1.00 29.45 ? 1160 THR G CA  1 
ATOM   4011 C C   . THR G 1 87  ? 30.859 -41.570 8.338   1.00 29.62 ? 1160 THR G C   1 
ATOM   4012 O O   . THR G 1 87  ? 30.593 -40.492 7.812   1.00 31.50 ? 1160 THR G O   1 
ATOM   4013 C CB  . THR G 1 87  ? 31.976 -42.713 6.475   1.00 36.20 ? 1160 THR G CB  1 
ATOM   4014 O OG1 . THR G 1 87  ? 30.923 -43.678 6.364   1.00 36.44 ? 1160 THR G OG1 1 
ATOM   4015 C CG2 . THR G 1 87  ? 33.286 -43.280 5.893   1.00 33.51 ? 1160 THR G CG2 1 
ATOM   4016 N N   . LYS G 1 88  ? 30.059 -42.136 9.228   1.00 27.05 ? 1161 LYS G N   1 
ATOM   4017 C CA  . LYS G 1 88  ? 28.812 -41.467 9.635   1.00 26.68 ? 1161 LYS G CA  1 
ATOM   4018 C C   . LYS G 1 88  ? 28.930 -40.834 11.015  1.00 27.30 ? 1161 LYS G C   1 
ATOM   4019 O O   . LYS G 1 88  ? 27.929 -40.390 11.593  1.00 28.63 ? 1161 LYS G O   1 
ATOM   4020 C CB  . LYS G 1 88  ? 27.626 -42.435 9.620   1.00 28.38 ? 1161 LYS G CB  1 
ATOM   4021 C CG  . LYS G 1 88  ? 27.333 -43.032 8.234   1.00 30.54 ? 1161 LYS G CG  1 
ATOM   4022 C CD  . LYS G 1 88  ? 26.892 -41.982 7.225   1.00 31.83 ? 1161 LYS G CD  1 
ATOM   4023 C CE  . LYS G 1 88  ? 26.686 -42.638 5.846   1.00 35.30 ? 1161 LYS G CE  1 
ATOM   4024 N NZ  . LYS G 1 88  ? 26.031 -41.676 4.937   1.00 45.65 ? 1161 LYS G NZ  1 
ATOM   4025 N N   . LEU G 1 89  ? 30.149 -40.780 11.538  1.00 24.48 ? 1162 LEU G N   1 
ATOM   4026 C CA  . LEU G 1 89  ? 30.372 -40.246 12.875  1.00 25.32 ? 1162 LEU G CA  1 
ATOM   4027 C C   . LEU G 1 89  ? 31.439 -39.151 12.878  1.00 30.93 ? 1162 LEU G C   1 
ATOM   4028 O O   . LEU G 1 89  ? 32.465 -39.263 12.204  1.00 28.87 ? 1162 LEU G O   1 
ATOM   4029 C CB  . LEU G 1 89  ? 30.806 -41.342 13.837  1.00 25.11 ? 1162 LEU G CB  1 
ATOM   4030 C CG  . LEU G 1 89  ? 29.905 -42.576 13.873  1.00 26.00 ? 1162 LEU G CG  1 
ATOM   4031 C CD1 . LEU G 1 89  ? 30.652 -43.700 14.531  1.00 29.90 ? 1162 LEU G CD1 1 
ATOM   4032 C CD2 . LEU G 1 89  ? 28.624 -42.240 14.627  1.00 24.74 ? 1162 LEU G CD2 1 
ATOM   4033 N N   . VAL G 1 90  ? 31.181 -38.105 13.656  1.00 25.85 ? 1163 VAL G N   1 
ATOM   4034 C CA  . VAL G 1 90  ? 32.107 -36.995 13.836  1.00 24.91 ? 1163 VAL G CA  1 
ATOM   4035 C C   . VAL G 1 90  ? 32.156 -36.655 15.328  1.00 25.91 ? 1163 VAL G C   1 
ATOM   4036 O O   . VAL G 1 90  ? 31.126 -36.618 15.979  1.00 24.98 ? 1163 VAL G O   1 
ATOM   4037 C CB  . VAL G 1 90  ? 31.583 -35.766 13.053  1.00 29.33 ? 1163 VAL G CB  1 
ATOM   4038 C CG1 . VAL G 1 90  ? 32.351 -34.553 13.443  1.00 31.85 ? 1163 VAL G CG1 1 
ATOM   4039 C CG2 . VAL G 1 90  ? 31.679 -36.019 11.511  1.00 34.01 ? 1163 VAL G CG2 1 
ATOM   4040 N N   . PRO G 1 91  ? 33.347 -36.424 15.894  1.00 25.41 ? 1164 PRO G N   1 
ATOM   4041 C CA  . PRO G 1 91  ? 33.374 -36.067 17.318  1.00 24.64 ? 1164 PRO G CA  1 
ATOM   4042 C C   . PRO G 1 91  ? 32.608 -34.796 17.668  1.00 22.64 ? 1164 PRO G C   1 
ATOM   4043 O O   . PRO G 1 91  ? 32.622 -33.801 16.917  1.00 25.26 ? 1164 PRO G O   1 
ATOM   4044 C CB  . PRO G 1 91  ? 34.871 -35.886 17.603  1.00 26.28 ? 1164 PRO G CB  1 
ATOM   4045 C CG  . PRO G 1 91  ? 35.518 -36.785 16.651  1.00 27.03 ? 1164 PRO G CG  1 
ATOM   4046 C CD  . PRO G 1 91  ? 34.690 -36.752 15.389  1.00 30.43 ? 1164 PRO G CD  1 
ATOM   4047 N N   . LEU G 1 92  ? 31.918 -34.839 18.804  1.00 22.79 ? 1165 LEU G N   1 
ATOM   4048 C CA  . LEU G 1 92  ? 31.036 -33.767 19.218  1.00 23.86 ? 1165 LEU G CA  1 
ATOM   4049 C C   . LEU G 1 92  ? 31.624 -33.112 20.464  1.00 23.98 ? 1165 LEU G C   1 
ATOM   4050 O O   . LEU G 1 92  ? 32.198 -33.790 21.303  1.00 23.92 ? 1165 LEU G O   1 
ATOM   4051 C CB  . LEU G 1 92  ? 29.615 -34.350 19.479  1.00 23.39 ? 1165 LEU G CB  1 
ATOM   4052 C CG  . LEU G 1 92  ? 28.504 -33.432 20.036  1.00 23.04 ? 1165 LEU G CG  1 
ATOM   4053 C CD1 . LEU G 1 92  ? 27.098 -34.005 19.689  1.00 19.77 ? 1165 LEU G CD1 1 
ATOM   4054 C CD2 . LEU G 1 92  ? 28.585 -33.220 21.556  1.00 22.60 ? 1165 LEU G CD2 1 
ATOM   4055 N N   . GLY G 1 93  ? 31.493 -31.799 20.586  1.00 19.85 ? 1166 GLY G N   1 
ATOM   4056 C CA  . GLY G 1 93  ? 31.927 -31.099 21.788  1.00 24.84 ? 1166 GLY G CA  1 
ATOM   4057 C C   . GLY G 1 93  ? 33.411 -30.772 21.778  1.00 29.33 ? 1166 GLY G C   1 
ATOM   4058 O O   . GLY G 1 93  ? 33.980 -30.403 22.801  1.00 28.88 ? 1166 GLY G O   1 
ATOM   4059 N N   . VAL G 1 94  ? 34.033 -30.894 20.612  1.00 24.53 ? 1167 VAL G N   1 
ATOM   4060 C CA  . VAL G 1 94  ? 35.472 -30.645 20.459  1.00 27.99 ? 1167 VAL G CA  1 
ATOM   4061 C C   . VAL G 1 94  ? 35.728 -29.371 19.638  1.00 29.08 ? 1167 VAL G C   1 
ATOM   4062 O O   . VAL G 1 94  ? 36.614 -28.586 19.949  1.00 30.75 ? 1167 VAL G O   1 
ATOM   4063 C CB  . VAL G 1 94  ? 36.188 -31.807 19.756  1.00 27.81 ? 1167 VAL G CB  1 
ATOM   4064 C CG1 . VAL G 1 94  ? 37.691 -31.624 19.898  1.00 35.37 ? 1167 VAL G CG1 1 
ATOM   4065 C CG2 . VAL G 1 94  ? 35.781 -33.147 20.355  1.00 32.43 ? 1167 VAL G CG2 1 
ATOM   4066 N N   . ASN G 1 95  ? 34.935 -29.183 18.589  1.00 23.88 ? 1168 ASN G N   1 
ATOM   4067 C CA  . ASN G 1 95  ? 35.088 -28.038 17.702  1.00 25.88 ? 1168 ASN G CA  1 
ATOM   4068 C C   . ASN G 1 95  ? 33.776 -27.277 17.735  1.00 25.87 ? 1168 ASN G C   1 
ATOM   4069 O O   . ASN G 1 95  ? 32.747 -27.767 17.244  1.00 22.81 ? 1168 ASN G O   1 
ATOM   4070 C CB  . ASN G 1 95  ? 35.405 -28.544 16.299  1.00 26.25 ? 1168 ASN G CB  1 
ATOM   4071 C CG  . ASN G 1 95  ? 35.659 -27.422 15.312  1.00 29.66 ? 1168 ASN G CG  1 
ATOM   4072 O OD1 . ASN G 1 95  ? 35.005 -26.363 15.345  1.00 27.04 ? 1168 ASN G OD1 1 
ATOM   4073 N ND2 . ASN G 1 95  ? 36.593 -27.661 14.404  1.00 31.96 ? 1168 ASN G ND2 1 
ATOM   4074 N N   . GLN G 1 96  ? 33.786 -26.092 18.339  1.00 22.41 ? 1169 GLN G N   1 
ATOM   4075 C CA  . GLN G 1 96  ? 32.535 -25.408 18.560  1.00 27.22 ? 1169 GLN G CA  1 
ATOM   4076 C C   . GLN G 1 96  ? 31.849 -24.977 17.266  1.00 22.68 ? 1169 GLN G C   1 
ATOM   4077 O O   . GLN G 1 96  ? 30.618 -25.032 17.170  1.00 22.71 ? 1169 GLN G O   1 
ATOM   4078 C CB  . GLN G 1 96  ? 32.692 -24.233 19.535  1.00 32.16 ? 1169 GLN G CB  1 
ATOM   4079 C CG  . GLN G 1 96  ? 31.489 -24.111 20.451  1.00 34.88 ? 1169 GLN G CG  1 
ATOM   4080 C CD  . GLN G 1 96  ? 31.666 -23.063 21.527  1.00 43.01 ? 1169 GLN G CD  1 
ATOM   4081 O OE1 . GLN G 1 96  ? 32.671 -22.336 21.549  1.00 43.22 ? 1169 GLN G OE1 1 
ATOM   4082 N NE2 . GLN G 1 96  ? 30.688 -22.974 22.429  1.00 42.34 ? 1169 GLN G NE2 1 
ATOM   4083 N N   . ASP G 1 97  ? 32.629 -24.562 16.271  1.00 21.32 ? 1170 ASP G N   1 
ATOM   4084 C CA  . ASP G 1 97  ? 32.025 -24.156 15.002  1.00 21.96 ? 1170 ASP G CA  1 
ATOM   4085 C C   . ASP G 1 97  ? 31.400 -25.339 14.247  1.00 22.46 ? 1170 ASP G C   1 
ATOM   4086 O O   . ASP G 1 97  ? 30.321 -25.212 13.654  1.00 21.15 ? 1170 ASP G O   1 
ATOM   4087 C CB  . ASP G 1 97  ? 33.034 -23.374 14.155  1.00 22.46 ? 1170 ASP G CB  1 
ATOM   4088 C CG  . ASP G 1 97  ? 33.322 -22.006 14.742  1.00 26.31 ? 1170 ASP G CG  1 
ATOM   4089 O OD1 . ASP G 1 97  ? 34.464 -21.776 15.196  1.00 29.89 ? 1170 ASP G OD1 1 
ATOM   4090 O OD2 . ASP G 1 97  ? 32.402 -21.177 14.770  1.00 28.58 ? 1170 ASP G OD2 1 
ATOM   4091 N N   . LEU G 1 98  ? 32.059 -26.494 14.295  1.00 22.42 ? 1171 LEU G N   1 
ATOM   4092 C CA  . LEU G 1 98  ? 31.468 -27.717 13.767  1.00 22.11 ? 1171 LEU G CA  1 
ATOM   4093 C C   . LEU G 1 98  ? 30.158 -28.041 14.476  1.00 21.45 ? 1171 LEU G C   1 
ATOM   4094 O O   . LEU G 1 98  ? 29.128 -28.312 13.831  1.00 20.55 ? 1171 LEU G O   1 
ATOM   4095 C CB  . LEU G 1 98  ? 32.469 -28.886 13.852  1.00 22.67 ? 1171 LEU G CB  1 
ATOM   4096 C CG  . LEU G 1 98  ? 31.986 -30.223 13.296  1.00 21.88 ? 1171 LEU G CG  1 
ATOM   4097 C CD1 . LEU G 1 98  ? 33.158 -30.942 12.648  1.00 28.29 ? 1171 LEU G CD1 1 
ATOM   4098 C CD2 . LEU G 1 98  ? 31.310 -31.082 14.395  1.00 21.53 ? 1171 LEU G CD2 1 
ATOM   4099 N N   . ASP G 1 99  ? 30.164 -27.985 15.803  1.00 22.17 ? 1172 ASP G N   1 
ATOM   4100 C CA  . ASP G 1 99  ? 28.934 -28.300 16.535  1.00 21.98 ? 1172 ASP G CA  1 
ATOM   4101 C C   . ASP G 1 99  ? 27.854 -27.348 16.077  1.00 22.53 ? 1172 ASP G C   1 
ATOM   4102 O O   . ASP G 1 99  ? 26.735 -27.771 15.827  1.00 22.56 ? 1172 ASP G O   1 
ATOM   4103 C CB  . ASP G 1 99  ? 29.085 -28.157 18.056  1.00 21.01 ? 1172 ASP G CB  1 
ATOM   4104 C CG  . ASP G 1 99  ? 30.004 -29.193 18.678  1.00 24.32 ? 1172 ASP G CG  1 
ATOM   4105 O OD1 . ASP G 1 99  ? 30.446 -28.926 19.827  1.00 25.01 ? 1172 ASP G OD1 1 
ATOM   4106 O OD2 . ASP G 1 99  ? 30.274 -30.258 18.059  1.00 22.36 ? 1172 ASP G OD2 1 
ATOM   4107 N N   . LYS G 1 100 ? 28.173 -26.052 15.977  1.00 19.14 ? 1173 LYS G N   1 
ATOM   4108 C CA  . LYS G 1 100 ? 27.173 -25.092 15.566  1.00 22.87 ? 1173 LYS G CA  1 
ATOM   4109 C C   . LYS G 1 100 ? 26.671 -25.317 14.134  1.00 21.97 ? 1173 LYS G C   1 
ATOM   4110 O O   . LYS G 1 100 ? 25.463 -25.163 13.876  1.00 22.57 ? 1173 LYS G O   1 
ATOM   4111 C CB  . LYS G 1 100 ? 27.658 -23.646 15.817  1.00 23.97 ? 1173 LYS G CB  1 
ATOM   4112 C CG  . LYS G 1 100 ? 27.714 -23.332 17.329  1.00 25.16 ? 1173 LYS G CG  1 
ATOM   4113 C CD  . LYS G 1 100 ? 28.307 -21.957 17.641  1.00 31.62 ? 1173 LYS G CD  1 
ATOM   4114 C CE  . LYS G 1 100 ? 28.261 -21.670 19.153  1.00 35.97 ? 1173 LYS G CE  1 
ATOM   4115 N NZ  . LYS G 1 100 ? 28.487 -20.212 19.426  1.00 41.51 ? 1173 LYS G NZ  1 
ATOM   4116 N N   . GLU G 1 101 ? 27.556 -25.678 13.210  1.00 21.16 ? 1174 GLU G N   1 
ATOM   4117 C CA  . GLU G 1 101 ? 27.101 -26.029 11.857  1.00 19.25 ? 1174 GLU G CA  1 
ATOM   4118 C C   . GLU G 1 101 ? 26.143 -27.248 11.911  1.00 23.97 ? 1174 GLU G C   1 
ATOM   4119 O O   . GLU G 1 101 ? 25.067 -27.278 11.262  1.00 21.70 ? 1174 GLU G O   1 
ATOM   4120 C CB  . GLU G 1 101 ? 28.277 -26.346 10.931  1.00 18.52 ? 1174 GLU G CB  1 
ATOM   4121 C CG  . GLU G 1 101 ? 27.818 -26.956 9.622   1.00 22.12 ? 1174 GLU G CG  1 
ATOM   4122 C CD  . GLU G 1 101 ? 28.947 -27.346 8.685   1.00 29.61 ? 1174 GLU G CD  1 
ATOM   4123 O OE1 . GLU G 1 101 ? 28.651 -27.561 7.494   1.00 28.35 ? 1174 GLU G OE1 1 
ATOM   4124 O OE2 . GLU G 1 101 ? 30.117 -27.428 9.123   1.00 28.08 ? 1174 GLU G OE2 1 
ATOM   4125 N N   . LYS G 1 102 ? 26.534 -28.271 12.656  1.00 19.82 ? 1175 LYS G N   1 
ATOM   4126 C CA  . LYS G 1 102 ? 25.674 -29.459 12.751  1.00 23.00 ? 1175 LYS G CA  1 
ATOM   4127 C C   . LYS G 1 102 ? 24.290 -29.115 13.302  1.00 22.09 ? 1175 LYS G C   1 
ATOM   4128 O O   . LYS G 1 102 ? 23.280 -29.663 12.872  1.00 23.85 ? 1175 LYS G O   1 
ATOM   4129 C CB  . LYS G 1 102 ? 26.283 -30.531 13.655  1.00 22.30 ? 1175 LYS G CB  1 
ATOM   4130 C CG  . LYS G 1 102 ? 27.590 -31.119 13.150  1.00 23.98 ? 1175 LYS G CG  1 
ATOM   4131 C CD  . LYS G 1 102 ? 27.471 -31.768 11.803  1.00 27.72 ? 1175 LYS G CD  1 
ATOM   4132 C CE  . LYS G 1 102 ? 28.874 -32.253 11.364  1.00 32.88 ? 1175 LYS G CE  1 
ATOM   4133 N NZ  . LYS G 1 102 ? 28.863 -33.017 10.090  1.00 34.23 ? 1175 LYS G NZ  1 
ATOM   4134 N N   . MET G 1 103 ? 24.242 -28.217 14.268  1.00 20.66 ? 1176 MET G N   1 
ATOM   4135 C CA  . MET G 1 103 ? 22.963 -27.961 14.944  1.00 25.06 ? 1176 MET G CA  1 
ATOM   4136 C C   . MET G 1 103 ? 21.962 -27.329 13.948  1.00 26.84 ? 1176 MET G C   1 
ATOM   4137 O O   . MET G 1 103 ? 20.753 -27.376 14.168  1.00 29.37 ? 1176 MET G O   1 
ATOM   4138 C CB  . MET G 1 103 ? 23.165 -27.113 16.211  1.00 23.99 ? 1176 MET G CB  1 
ATOM   4139 C CG  . MET G 1 103 ? 23.226 -27.973 17.513  1.00 26.02 ? 1176 MET G CG  1 
ATOM   4140 S SD  . MET G 1 103 ? 23.567 -27.058 18.996  1.00 43.48 ? 1176 MET G SD  1 
ATOM   4141 C CE  . MET G 1 103 ? 25.001 -26.104 18.527  1.00 32.63 ? 1176 MET G CE  1 
ATOM   4142 N N   . LEU G 1 104 ? 22.475 -26.756 12.859  1.00 23.31 ? 1177 LEU G N   1 
ATOM   4143 C CA  . LEU G 1 104 ? 21.647 -26.091 11.850  1.00 23.58 ? 1177 LEU G CA  1 
ATOM   4144 C C   . LEU G 1 104 ? 21.234 -26.987 10.684  1.00 24.26 ? 1177 LEU G C   1 
ATOM   4145 O O   . LEU G 1 104 ? 20.581 -26.538 9.760   1.00 29.48 ? 1177 LEU G O   1 
ATOM   4146 C CB  . LEU G 1 104 ? 22.342 -24.808 11.331  1.00 23.91 ? 1177 LEU G CB  1 
ATOM   4147 C CG  . LEU G 1 104 ? 22.665 -23.712 12.353  1.00 27.80 ? 1177 LEU G CG  1 
ATOM   4148 C CD1 . LEU G 1 104 ? 23.477 -22.609 11.688  1.00 26.36 ? 1177 LEU G CD1 1 
ATOM   4149 C CD2 . LEU G 1 104 ? 21.392 -23.145 12.975  1.00 29.80 ? 1177 LEU G CD2 1 
ATOM   4150 N N   . GLU G 1 105 ? 21.542 -28.276 10.751  1.00 21.35 ? 1178 GLU G N   1 
ATOM   4151 C CA  . GLU G 1 105 ? 21.314 -29.153 9.624   1.00 29.83 ? 1178 GLU G CA  1 
ATOM   4152 C C   . GLU G 1 105 ? 19.830 -29.415 9.371   1.00 31.28 ? 1178 GLU G C   1 
ATOM   4153 O O   . GLU G 1 105 ? 19.430 -29.531 8.219   1.00 33.04 ? 1178 GLU G O   1 
ATOM   4154 C CB  . GLU G 1 105 ? 22.047 -30.475 9.857   1.00 27.18 ? 1178 GLU G CB  1 
ATOM   4155 C CG  . GLU G 1 105 ? 22.268 -31.346 8.664   1.00 33.31 ? 1178 GLU G CG  1 
ATOM   4156 C CD  . GLU G 1 105 ? 23.121 -32.563 9.033   1.00 32.51 ? 1178 GLU G CD  1 
ATOM   4157 O OE1 . GLU G 1 105 ? 24.247 -32.381 9.567   1.00 31.78 ? 1178 GLU G OE1 1 
ATOM   4158 O OE2 . GLU G 1 105 ? 22.670 -33.692 8.792   1.00 35.58 ? 1178 GLU G OE2 1 
ATOM   4159 N N   . GLY G 1 106 ? 19.030 -29.524 10.433  1.00 27.36 ? 1179 GLY G N   1 
ATOM   4160 C CA  . GLY G 1 106 ? 17.646 -29.956 10.285  1.00 33.52 ? 1179 GLY G CA  1 
ATOM   4161 C C   . GLY G 1 106 ? 16.818 -29.009 9.426   1.00 33.40 ? 1179 GLY G C   1 
ATOM   4162 O O   . GLY G 1 106 ? 16.996 -27.799 9.484   1.00 31.12 ? 1179 GLY G O   1 
ATOM   4163 N N   . ARG G 1 107 ? 15.890 -29.547 8.646   1.00 37.33 ? 1180 ARG G N   1 
ATOM   4164 C CA  . ARG G 1 107 ? 15.163 -28.707 7.698   1.00 40.41 ? 1180 ARG G CA  1 
ATOM   4165 C C   . ARG G 1 107 ? 13.963 -27.970 8.318   1.00 37.79 ? 1180 ARG G C   1 
ATOM   4166 O O   . ARG G 1 107 ? 13.510 -26.971 7.780   1.00 38.30 ? 1180 ARG G O   1 
ATOM   4167 C CB  . ARG G 1 107 ? 14.757 -29.510 6.462   1.00 42.66 ? 1180 ARG G CB  1 
ATOM   4168 C CG  . ARG G 1 107 ? 13.643 -30.501 6.689   1.00 45.28 ? 1180 ARG G CG  1 
ATOM   4169 C CD  . ARG G 1 107 ? 13.289 -31.213 5.379   1.00 53.59 ? 1180 ARG G CD  1 
ATOM   4170 N NE  . ARG G 1 107 ? 13.528 -30.345 4.219   1.00 57.81 ? 1180 ARG G NE  1 
ATOM   4171 C CZ  . ARG G 1 107 ? 12.939 -30.483 3.032   1.00 54.81 ? 1180 ARG G CZ  1 
ATOM   4172 N NH1 . ARG G 1 107 ? 13.233 -29.638 2.047   1.00 50.12 ? 1180 ARG G NH1 1 
ATOM   4173 N NH2 . ARG G 1 107 ? 12.057 -31.463 2.830   1.00 53.23 ? 1180 ARG G NH2 1 
ATOM   4174 N N   . LYS G 1 108 ? 13.474 -28.445 9.458   1.00 36.44 ? 1181 LYS G N   1 
ATOM   4175 C CA  . LYS G 1 108 ? 12.403 -27.750 10.174  1.00 36.38 ? 1181 LYS G CA  1 
ATOM   4176 C C   . LYS G 1 108 ? 12.811 -27.399 11.593  1.00 36.10 ? 1181 LYS G C   1 
ATOM   4177 O O   . LYS G 1 108 ? 13.595 -28.106 12.225  1.00 34.81 ? 1181 LYS G O   1 
ATOM   4178 C CB  . LYS G 1 108 ? 11.135 -28.611 10.228  1.00 38.50 ? 1181 LYS G CB  1 
ATOM   4179 C CG  . LYS G 1 108 ? 10.756 -29.246 8.908   1.00 38.55 ? 1181 LYS G CG  1 
ATOM   4180 C CD  . LYS G 1 108 ? 9.550  -30.159 9.085   1.00 46.78 ? 1181 LYS G CD  1 
ATOM   4181 C CE  . LYS G 1 108 ? 9.416  -31.150 7.935   1.00 49.35 ? 1181 LYS G CE  1 
ATOM   4182 N NZ  . LYS G 1 108 ? 8.199  -32.003 8.105   1.00 58.40 ? 1181 LYS G NZ  1 
ATOM   4183 N N   . SER G 1 109 ? 12.235 -26.323 12.100  1.00 32.71 ? 1182 SER G N   1 
ATOM   4184 C CA  . SER G 1 109 ? 12.544 -25.830 13.422  1.00 37.07 ? 1182 SER G CA  1 
ATOM   4185 C C   . SER G 1 109 ? 12.459 -26.913 14.524  1.00 34.13 ? 1182 SER G C   1 
ATOM   4186 O O   . SER G 1 109 ? 13.314 -26.976 15.400  1.00 33.69 ? 1182 SER G O   1 
ATOM   4187 C CB  . SER G 1 109 ? 11.602 -24.666 13.749  1.00 40.60 ? 1182 SER G CB  1 
ATOM   4188 O OG  . SER G 1 109 ? 12.033 -23.976 14.899  1.00 48.02 ? 1182 SER G OG  1 
ATOM   4189 N N   . ASN G 1 110 ? 11.430 -27.750 14.496  1.00 34.59 ? 1183 ASN G N   1 
ATOM   4190 C CA  . ASN G 1 110 ? 11.236 -28.712 15.580  1.00 37.14 ? 1183 ASN G CA  1 
ATOM   4191 C C   . ASN G 1 110 ? 12.302 -29.810 15.570  1.00 35.93 ? 1183 ASN G C   1 
ATOM   4192 O O   . ASN G 1 110 ? 12.771 -30.249 16.627  1.00 33.87 ? 1183 ASN G O   1 
ATOM   4193 C CB  . ASN G 1 110 ? 9.834  -29.336 15.517  1.00 39.55 ? 1183 ASN G CB  1 
ATOM   4194 C CG  . ASN G 1 110 ? 9.568  -30.014 14.193  1.00 38.16 ? 1183 ASN G CG  1 
ATOM   4195 O OD1 . ASN G 1 110 ? 9.814  -29.435 13.127  1.00 42.03 ? 1183 ASN G OD1 1 
ATOM   4196 N ND2 . ASN G 1 110 ? 9.071  -31.246 14.244  1.00 42.27 ? 1183 ASN G ND2 1 
ATOM   4197 N N   . ILE G 1 111 ? 12.669 -30.255 14.371  1.00 31.54 ? 1184 ILE G N   1 
ATOM   4198 C CA  . ILE G 1 111 ? 13.795 -31.164 14.205  1.00 33.19 ? 1184 ILE G CA  1 
ATOM   4199 C C   . ILE G 1 111 ? 15.045 -30.507 14.780  1.00 28.76 ? 1184 ILE G C   1 
ATOM   4200 O O   . ILE G 1 111 ? 15.780 -31.155 15.508  1.00 25.97 ? 1184 ILE G O   1 
ATOM   4201 C CB  . ILE G 1 111 ? 13.997 -31.559 12.726  1.00 34.76 ? 1184 ILE G CB  1 
ATOM   4202 C CG1 . ILE G 1 111 ? 12.789 -32.359 12.231  1.00 36.23 ? 1184 ILE G CG1 1 
ATOM   4203 C CG2 . ILE G 1 111 ? 15.235 -32.410 12.539  1.00 31.93 ? 1184 ILE G CG2 1 
ATOM   4204 C CD1 . ILE G 1 111 ? 12.607 -32.318 10.718  1.00 41.38 ? 1184 ILE G CD1 1 
ATOM   4205 N N   . ARG G 1 112 ? 15.293 -29.230 14.470  1.00 28.92 ? 1185 ARG G N   1 
ATOM   4206 C CA  . ARG G 1 112 ? 16.487 -28.583 15.014  1.00 29.03 ? 1185 ARG G CA  1 
ATOM   4207 C C   . ARG G 1 112 ? 16.394 -28.436 16.525  1.00 30.08 ? 1185 ARG G C   1 
ATOM   4208 O O   . ARG G 1 112 ? 17.392 -28.562 17.241  1.00 26.48 ? 1185 ARG G O   1 
ATOM   4209 C CB  . ARG G 1 112 ? 16.736 -27.218 14.371  1.00 27.07 ? 1185 ARG G CB  1 
ATOM   4210 C CG  . ARG G 1 112 ? 17.092 -27.317 12.878  1.00 25.94 ? 1185 ARG G CG  1 
ATOM   4211 C CD  . ARG G 1 112 ? 17.650 -25.995 12.343  1.00 28.95 ? 1185 ARG G CD  1 
ATOM   4212 N NE  . ARG G 1 112 ? 16.735 -24.863 12.456  1.00 32.24 ? 1185 ARG G NE  1 
ATOM   4213 C CZ  . ARG G 1 112 ? 15.748 -24.594 11.603  1.00 33.05 ? 1185 ARG G CZ  1 
ATOM   4214 N NH1 . ARG G 1 112 ? 14.986 -23.525 11.802  1.00 33.64 ? 1185 ARG G NH1 1 
ATOM   4215 N NH2 . ARG G 1 112 ? 15.520 -25.385 10.561  1.00 29.20 ? 1185 ARG G NH2 1 
ATOM   4216 N N   . LYS G 1 113 ? 15.199 -28.152 17.030  1.00 28.37 ? 1186 LYS G N   1 
ATOM   4217 C CA  . LYS G 1 113 ? 15.080 -27.986 18.478  1.00 28.99 ? 1186 LYS G CA  1 
ATOM   4218 C C   . LYS G 1 113 ? 15.442 -29.284 19.185  1.00 27.00 ? 1186 LYS G C   1 
ATOM   4219 O O   . LYS G 1 113 ? 16.171 -29.273 20.185  1.00 28.32 ? 1186 LYS G O   1 
ATOM   4220 C CB  . LYS G 1 113 ? 13.687 -27.473 18.902  1.00 32.76 ? 1186 LYS G CB  1 
ATOM   4221 C CG  . LYS G 1 113 ? 13.688 -26.816 20.303  1.00 34.91 ? 1186 LYS G CG  1 
ATOM   4222 C CD  . LYS G 1 113 ? 12.314 -26.235 20.715  1.00 37.58 ? 1186 LYS G CD  1 
ATOM   4223 C CE  . LYS G 1 113 ? 11.420 -27.345 21.253  1.00 35.72 ? 1186 LYS G CE  1 
ATOM   4224 N NZ  . LYS G 1 113 ? 10.106 -26.869 21.755  1.00 38.89 ? 1186 LYS G NZ  1 
ATOM   4225 N N   . SER G 1 114 ? 14.942 -30.400 18.665  1.00 24.30 ? 1187 SER G N   1 
ATOM   4226 C CA  . SER G 1 114 ? 15.238 -31.720 19.212  1.00 27.37 ? 1187 SER G CA  1 
ATOM   4227 C C   . SER G 1 114 ? 16.752 -31.989 19.208  1.00 26.03 ? 1187 SER G C   1 
ATOM   4228 O O   . SER G 1 114 ? 17.326 -32.465 20.194  1.00 22.96 ? 1187 SER G O   1 
ATOM   4229 C CB  . SER G 1 114 ? 14.464 -32.781 18.418  1.00 30.22 ? 1187 SER G CB  1 
ATOM   4230 O OG  . SER G 1 114 ? 14.687 -34.091 18.919  1.00 37.64 ? 1187 SER G OG  1 
ATOM   4231 N N   . VAL G 1 115 ? 17.404 -31.636 18.112  1.00 23.78 ? 1188 VAL G N   1 
ATOM   4232 C CA  . VAL G 1 115 ? 18.866 -31.769 18.029  1.00 23.30 ? 1188 VAL G CA  1 
ATOM   4233 C C   . VAL G 1 115 ? 19.562 -30.895 19.069  1.00 22.61 ? 1188 VAL G C   1 
ATOM   4234 O O   . VAL G 1 115 ? 20.472 -31.343 19.751  1.00 22.15 ? 1188 VAL G O   1 
ATOM   4235 C CB  . VAL G 1 115 ? 19.377 -31.386 16.634  1.00 23.54 ? 1188 VAL G CB  1 
ATOM   4236 C CG1 . VAL G 1 115 ? 20.895 -31.289 16.650  1.00 19.30 ? 1188 VAL G CG1 1 
ATOM   4237 C CG2 . VAL G 1 115 ? 18.897 -32.403 15.613  1.00 23.03 ? 1188 VAL G CG2 1 
ATOM   4238 N N   . GLN G 1 116 ? 19.151 -29.640 19.182  1.00 22.75 ? 1189 GLN G N   1 
ATOM   4239 C CA  . GLN G 1 116 ? 19.774 -28.761 20.178  1.00 27.52 ? 1189 GLN G CA  1 
ATOM   4240 C C   . GLN G 1 116 ? 19.606 -29.310 21.586  1.00 24.37 ? 1189 GLN G C   1 
ATOM   4241 O O   . GLN G 1 116 ? 20.550 -29.300 22.387  1.00 22.23 ? 1189 GLN G O   1 
ATOM   4242 C CB  . GLN G 1 116 ? 19.151 -27.368 20.161  1.00 26.00 ? 1189 GLN G CB  1 
ATOM   4243 C CG  . GLN G 1 116 ? 19.630 -26.467 19.064  1.00 33.11 ? 1189 GLN G CG  1 
ATOM   4244 C CD  . GLN G 1 116 ? 18.804 -25.194 19.032  1.00 36.56 ? 1189 GLN G CD  1 
ATOM   4245 O OE1 . GLN G 1 116 ? 18.917 -24.330 19.921  1.00 40.49 ? 1189 GLN G OE1 1 
ATOM   4246 N NE2 . GLN G 1 116 ? 17.948 -25.079 18.022  1.00 37.49 ? 1189 GLN G NE2 1 
ATOM   4247 N N   . ILE G 1 117 ? 18.389 -29.743 21.909  1.00 21.78 ? 1190 ILE G N   1 
ATOM   4248 C CA  . ILE G 1 117 ? 18.144 -30.323 23.233  1.00 21.76 ? 1190 ILE G CA  1 
ATOM   4249 C C   . ILE G 1 117 ? 19.055 -31.513 23.449  1.00 22.56 ? 1190 ILE G C   1 
ATOM   4250 O O   . ILE G 1 117 ? 19.733 -31.614 24.466  1.00 23.30 ? 1190 ILE G O   1 
ATOM   4251 C CB  . ILE G 1 117 ? 16.660 -30.741 23.394  1.00 23.61 ? 1190 ILE G CB  1 
ATOM   4252 C CG1 . ILE G 1 117 ? 15.791 -29.479 23.473  1.00 24.36 ? 1190 ILE G CG1 1 
ATOM   4253 C CG2 . ILE G 1 117 ? 16.475 -31.633 24.636  1.00 26.98 ? 1190 ILE G CG2 1 
ATOM   4254 C CD1 . ILE G 1 117 ? 14.291 -29.744 23.261  1.00 31.55 ? 1190 ILE G CD1 1 
ATOM   4255 N N   . ALA G 1 118 ? 19.138 -32.372 22.439  1.00 21.57 ? 1191 ALA G N   1 
ATOM   4256 C CA  . ALA G 1 118 ? 19.979 -33.548 22.548  1.00 23.30 ? 1191 ALA G CA  1 
ATOM   4257 C C   . ALA G 1 118 ? 21.430 -33.120 22.755  1.00 21.69 ? 1191 ALA G C   1 
ATOM   4258 O O   . ALA G 1 118 ? 22.191 -33.784 23.469  1.00 24.36 ? 1191 ALA G O   1 
ATOM   4259 C CB  . ALA G 1 118 ? 19.839 -34.423 21.291  1.00 22.78 ? 1191 ALA G CB  1 
ATOM   4260 N N   . TYR G 1 119 ? 21.821 -32.026 22.111  1.00 21.51 ? 1192 TYR G N   1 
ATOM   4261 C CA  . TYR G 1 119 ? 23.205 -31.567 22.200  1.00 22.60 ? 1192 TYR G CA  1 
ATOM   4262 C C   . TYR G 1 119 ? 23.515 -31.146 23.643  1.00 22.88 ? 1192 TYR G C   1 
ATOM   4263 O O   . TYR G 1 119 ? 24.562 -31.485 24.205  1.00 21.88 ? 1192 TYR G O   1 
ATOM   4264 C CB  . TYR G 1 119 ? 23.434 -30.406 21.202  1.00 23.61 ? 1192 TYR G CB  1 
ATOM   4265 C CG  . TYR G 1 119 ? 24.806 -29.740 21.269  1.00 25.50 ? 1192 TYR G CG  1 
ATOM   4266 C CD1 . TYR G 1 119 ? 25.937 -30.368 20.762  1.00 23.48 ? 1192 TYR G CD1 1 
ATOM   4267 C CD2 . TYR G 1 119 ? 24.951 -28.459 21.815  1.00 24.86 ? 1192 TYR G CD2 1 
ATOM   4268 C CE1 . TYR G 1 119 ? 27.198 -29.755 20.834  1.00 20.56 ? 1192 TYR G CE1 1 
ATOM   4269 C CE2 . TYR G 1 119 ? 26.197 -27.841 21.890  1.00 27.57 ? 1192 TYR G CE2 1 
ATOM   4270 C CZ  . TYR G 1 119 ? 27.307 -28.484 21.404  1.00 27.58 ? 1192 TYR G CZ  1 
ATOM   4271 O OH  . TYR G 1 119 ? 28.525 -27.850 21.476  1.00 29.80 ? 1192 TYR G OH  1 
ATOM   4272 N N   . HIS G 1 120 ? 22.608 -30.379 24.234  1.00 23.88 ? 1193 HIS G N   1 
ATOM   4273 C CA  . HIS G 1 120 ? 22.807 -29.906 25.593  1.00 24.18 ? 1193 HIS G CA  1 
ATOM   4274 C C   . HIS G 1 120 ? 22.774 -31.049 26.577  1.00 25.35 ? 1193 HIS G C   1 
ATOM   4275 O O   . HIS G 1 120 ? 23.509 -31.032 27.570  1.00 23.86 ? 1193 HIS G O   1 
ATOM   4276 C CB  . HIS G 1 120 ? 21.802 -28.805 25.950  1.00 25.53 ? 1193 HIS G CB  1 
ATOM   4277 C CG  . HIS G 1 120 ? 22.001 -27.563 25.131  1.00 27.78 ? 1193 HIS G CG  1 
ATOM   4278 N ND1 . HIS G 1 120 ? 23.213 -26.908 25.078  1.00 28.83 ? 1193 HIS G ND1 1 
ATOM   4279 C CD2 . HIS G 1 120 ? 21.164 -26.878 24.315  1.00 27.71 ? 1193 HIS G CD2 1 
ATOM   4280 C CE1 . HIS G 1 120 ? 23.120 -25.874 24.256  1.00 27.87 ? 1193 HIS G CE1 1 
ATOM   4281 N NE2 . HIS G 1 120 ? 21.885 -25.834 23.781  1.00 29.42 ? 1193 HIS G NE2 1 
ATOM   4282 N N   . ARG G 1 121 ? 21.940 -32.046 26.290  1.00 25.10 ? 1194 ARG G N   1 
ATOM   4283 C CA  . ARG G 1 121 ? 21.948 -33.289 27.081  1.00 26.41 ? 1194 ARG G CA  1 
ATOM   4284 C C   . ARG G 1 121 ? 23.301 -33.981 26.964  1.00 25.93 ? 1194 ARG G C   1 
ATOM   4285 O O   . ARG G 1 121 ? 23.865 -34.428 27.965  1.00 27.64 ? 1194 ARG G O   1 
ATOM   4286 C CB  . ARG G 1 121 ? 20.856 -34.241 26.620  1.00 26.70 ? 1194 ARG G CB  1 
ATOM   4287 C CG  . ARG G 1 121 ? 19.443 -33.851 27.027  1.00 31.57 ? 1194 ARG G CG  1 
ATOM   4288 C CD  . ARG G 1 121 ? 18.505 -34.899 26.445  1.00 34.19 ? 1194 ARG G CD  1 
ATOM   4289 N NE  . ARG G 1 121 ? 17.092 -34.613 26.666  1.00 39.13 ? 1194 ARG G NE  1 
ATOM   4290 C CZ  . ARG G 1 121 ? 16.131 -34.957 25.809  1.00 39.10 ? 1194 ARG G CZ  1 
ATOM   4291 N NH1 . ARG G 1 121 ? 14.870 -34.654 26.088  1.00 36.06 ? 1194 ARG G NH1 1 
ATOM   4292 N NH2 . ARG G 1 121 ? 16.441 -35.568 24.655  1.00 32.52 ? 1194 ARG G NH2 1 
ATOM   4293 N N   . ALA G 1 122 ? 23.823 -34.073 25.739  1.00 24.26 ? 1195 ALA G N   1 
ATOM   4294 C CA  . ALA G 1 122 ? 25.145 -34.647 25.519  1.00 24.68 ? 1195 ALA G CA  1 
ATOM   4295 C C   . ALA G 1 122 ? 26.208 -33.961 26.365  1.00 25.47 ? 1195 ALA G C   1 
ATOM   4296 O O   . ALA G 1 122 ? 27.006 -34.639 27.015  1.00 24.97 ? 1195 ALA G O   1 
ATOM   4297 C CB  . ALA G 1 122 ? 25.540 -34.569 24.010  1.00 23.53 ? 1195 ALA G CB  1 
ATOM   4298 N N   . LEU G 1 123 ? 26.234 -32.623 26.340  1.00 23.47 ? 1196 LEU G N   1 
ATOM   4299 C CA  . LEU G 1 123 ? 27.242 -31.868 27.107  1.00 27.42 ? 1196 LEU G CA  1 
ATOM   4300 C C   . LEU G 1 123 ? 27.083 -31.994 28.630  1.00 27.97 ? 1196 LEU G C   1 
ATOM   4301 O O   . LEU G 1 123 ? 28.046 -31.914 29.378  1.00 28.24 ? 1196 LEU G O   1 
ATOM   4302 C CB  . LEU G 1 123 ? 27.237 -30.398 26.696  1.00 24.29 ? 1196 LEU G CB  1 
ATOM   4303 C CG  . LEU G 1 123 ? 27.670 -30.183 25.226  1.00 27.11 ? 1196 LEU G CG  1 
ATOM   4304 C CD1 . LEU G 1 123 ? 27.940 -28.708 24.996  1.00 31.15 ? 1196 LEU G CD1 1 
ATOM   4305 C CD2 . LEU G 1 123 ? 28.910 -31.035 24.888  1.00 27.32 ? 1196 LEU G CD2 1 
ATOM   4306 N N   . GLN G 1 124 ? 25.859 -32.173 29.087  1.00 27.38 ? 1197 GLN G N   1 
ATOM   4307 C CA  . GLN G 1 124 ? 25.636 -32.428 30.509  1.00 29.98 ? 1197 GLN G CA  1 
ATOM   4308 C C   . GLN G 1 124 ? 26.204 -33.791 30.884  1.00 33.88 ? 1197 GLN G C   1 
ATOM   4309 O O   . GLN G 1 124 ? 26.794 -33.953 31.956  1.00 34.46 ? 1197 GLN G O   1 
ATOM   4310 C CB  . GLN G 1 124 ? 24.156 -32.384 30.819  1.00 25.30 ? 1197 GLN G CB  1 
ATOM   4311 C CG  . GLN G 1 124 ? 23.569 -30.995 30.748  1.00 27.52 ? 1197 GLN G CG  1 
ATOM   4312 C CD  . GLN G 1 124 ? 22.092 -31.032 30.940  1.00 32.48 ? 1197 GLN G CD  1 
ATOM   4313 O OE1 . GLN G 1 124 ? 21.602 -31.334 32.037  1.00 32.16 ? 1197 GLN G OE1 1 
ATOM   4314 N NE2 . GLN G 1 124 ? 21.350 -30.737 29.875  1.00 30.17 ? 1197 GLN G NE2 1 
ATOM   4315 N N   . HIS G 1 125 ? 26.029 -34.780 30.000  1.00 29.54 ? 1198 HIS G N   1 
ATOM   4316 C CA  . HIS G 1 125 ? 26.599 -36.099 30.250  1.00 32.30 ? 1198 HIS G CA  1 
ATOM   4317 C C   . HIS G 1 125 ? 28.090 -35.973 30.497  1.00 34.45 ? 1198 HIS G C   1 
ATOM   4318 O O   . HIS G 1 125 ? 28.622 -36.512 31.469  1.00 35.65 ? 1198 HIS G O   1 
ATOM   4319 C CB  . HIS G 1 125 ? 26.357 -37.060 29.072  1.00 32.35 ? 1198 HIS G CB  1 
ATOM   4320 C CG  . HIS G 1 125 ? 27.212 -38.290 29.121  1.00 31.63 ? 1198 HIS G CG  1 
ATOM   4321 N ND1 . HIS G 1 125 ? 26.830 -39.437 29.784  1.00 35.54 ? 1198 HIS G ND1 1 
ATOM   4322 C CD2 . HIS G 1 125 ? 28.445 -38.537 28.621  1.00 32.73 ? 1198 HIS G CD2 1 
ATOM   4323 C CE1 . HIS G 1 125 ? 27.783 -40.346 29.669  1.00 34.04 ? 1198 HIS G CE1 1 
ATOM   4324 N NE2 . HIS G 1 125 ? 28.775 -39.826 28.967  1.00 31.82 ? 1198 HIS G NE2 1 
ATOM   4325 N N   . ARG G 1 126 ? 28.762 -35.255 29.613  1.00 29.68 ? 1199 ARG G N   1 
ATOM   4326 C CA  . ARG G 1 126 ? 30.205 -35.102 29.716  1.00 35.17 ? 1199 ARG G CA  1 
ATOM   4327 C C   . ARG G 1 126 ? 30.613 -34.397 31.014  1.00 39.23 ? 1199 ARG G C   1 
ATOM   4328 O O   . ARG G 1 126 ? 31.638 -34.725 31.615  1.00 41.73 ? 1199 ARG G O   1 
ATOM   4329 C CB  . ARG G 1 126 ? 30.726 -34.266 28.557  1.00 29.99 ? 1199 ARG G CB  1 
ATOM   4330 C CG  . ARG G 1 126 ? 31.867 -33.361 28.998  1.00 44.20 ? 1199 ARG G CG  1 
ATOM   4331 C CD  . ARG G 1 126 ? 31.906 -32.063 28.195  1.00 46.14 ? 1199 ARG G CD  1 
ATOM   4332 N NE  . ARG G 1 126 ? 32.536 -32.327 26.925  1.00 35.79 ? 1199 ARG G NE  1 
ATOM   4333 C CZ  . ARG G 1 126 ? 32.739 -31.427 25.963  1.00 37.96 ? 1199 ARG G CZ  1 
ATOM   4334 N NH1 . ARG G 1 126 ? 33.336 -31.813 24.851  1.00 35.39 ? 1199 ARG G NH1 1 
ATOM   4335 N NH2 . ARG G 1 126 ? 32.346 -30.166 26.098  1.00 39.69 ? 1199 ARG G NH2 1 
ATOM   4336 N N   . SER G 1 127 ? 29.834 -33.396 31.410  1.00 36.09 ? 1200 SER G N   1 
ATOM   4337 C CA  . SER G 1 127 ? 30.126 -32.666 32.639  1.00 39.53 ? 1200 SER G CA  1 
ATOM   4338 C C   . SER G 1 127 ? 29.994 -33.576 33.865  1.00 42.33 ? 1200 SER G C   1 
ATOM   4339 O O   . SER G 1 127 ? 30.752 -33.449 34.824  1.00 45.72 ? 1200 SER G O   1 
ATOM   4340 C CB  . SER G 1 127 ? 29.244 -31.418 32.749  1.00 37.67 ? 1200 SER G CB  1 
ATOM   4341 O OG  . SER G 1 127 ? 29.744 -30.382 31.894  1.00 40.48 ? 1200 SER G OG  1 
ATOM   4342 N N   . LYS G 1 128 ? 29.055 -34.515 33.823  1.00 40.02 ? 1201 LYS G N   1 
ATOM   4343 C CA  . LYS G 1 128 ? 28.902 -35.478 34.920  1.00 43.30 ? 1201 LYS G CA  1 
ATOM   4344 C C   . LYS G 1 128 ? 30.103 -36.419 35.000  1.00 45.53 ? 1201 LYS G C   1 
ATOM   4345 O O   . LYS G 1 128 ? 30.544 -36.802 36.090  1.00 45.14 ? 1201 LYS G O   1 
ATOM   4346 C CB  . LYS G 1 128 ? 27.603 -36.271 34.776  1.00 39.58 ? 1201 LYS G CB  1 
ATOM   4347 C CG  . LYS G 1 128 ? 26.351 -35.459 35.040  1.00 44.14 ? 1201 LYS G CG  1 
ATOM   4348 C CD  . LYS G 1 128 ? 25.068 -36.284 34.883  1.00 45.76 ? 1201 LYS G CD  1 
ATOM   4349 C CE  . LYS G 1 128 ? 23.836 -35.363 34.877  1.00 51.27 ? 1201 LYS G CE  1 
ATOM   4350 N NZ  . LYS G 1 128 ? 22.526 -36.074 34.666  1.00 53.68 ? 1201 LYS G NZ  1 
ATOM   4351 N N   . VAL G 1 129 ? 30.625 -36.792 33.838  1.00 42.98 ? 1202 VAL G N   1 
ATOM   4352 C CA  . VAL G 1 129 ? 31.828 -37.604 33.759  1.00 46.77 ? 1202 VAL G CA  1 
ATOM   4353 C C   . VAL G 1 129 ? 33.031 -36.831 34.296  1.00 48.93 ? 1202 VAL G C   1 
ATOM   4354 O O   . VAL G 1 129 ? 33.927 -37.401 34.929  1.00 52.14 ? 1202 VAL G O   1 
ATOM   4355 C CB  . VAL G 1 129 ? 32.116 -38.000 32.310  1.00 46.44 ? 1202 VAL G CB  1 
ATOM   4356 C CG1 . VAL G 1 129 ? 33.550 -38.437 32.169  1.00 48.98 ? 1202 VAL G CG1 1 
ATOM   4357 C CG2 . VAL G 1 129 ? 31.152 -39.073 31.867  1.00 40.79 ? 1202 VAL G CG2 1 
ATOM   4358 N N   . GLN G 1 130 ? 33.048 -35.528 34.041  1.00 47.21 ? 1203 GLN G N   1 
ATOM   4359 C CA  . GLN G 1 130 ? 34.119 -34.669 34.554  1.00 55.01 ? 1203 GLN G CA  1 
ATOM   4360 C C   . GLN G 1 130 ? 33.696 -33.889 35.805  1.00 57.60 ? 1203 GLN G C   1 
ATOM   4361 O O   . GLN G 1 130 ? 33.362 -34.479 36.839  1.00 59.40 ? 1203 GLN G O   1 
ATOM   4362 C CB  . GLN G 1 130 ? 34.586 -33.708 33.469  1.00 52.24 ? 1203 GLN G CB  1 
ATOM   4363 C CG  . GLN G 1 130 ? 34.914 -34.418 32.186  1.00 50.85 ? 1203 GLN G CG  1 
ATOM   4364 C CD  . GLN G 1 130 ? 35.080 -33.466 31.027  1.00 55.94 ? 1203 GLN G CD  1 
ATOM   4365 O OE1 . GLN G 1 130 ? 35.615 -33.842 29.983  1.00 60.60 ? 1203 GLN G OE1 1 
ATOM   4366 N NE2 . GLN G 1 130 ? 34.622 -32.223 31.200  1.00 52.39 ? 1203 GLN G NE2 1 
ATOM   4367 N N   . SER H 2 7   ? 19.306 -47.158 38.286  1.00 57.55 ? 28   SER H N   1 
ATOM   4368 C CA  . SER H 2 7   ? 20.659 -47.428 37.813  1.00 52.07 ? 28   SER H CA  1 
ATOM   4369 C C   . SER H 2 7   ? 20.931 -46.594 36.567  1.00 49.15 ? 28   SER H C   1 
ATOM   4370 O O   . SER H 2 7   ? 20.859 -45.361 36.609  1.00 44.85 ? 28   SER H O   1 
ATOM   4371 C CB  . SER H 2 7   ? 20.860 -48.928 37.538  1.00 55.89 ? 28   SER H CB  1 
ATOM   4372 O OG  . SER H 2 7   ? 19.904 -49.438 36.618  1.00 55.72 ? 28   SER H OG  1 
ATOM   4373 N N   . ALA H 2 8   ? 21.241 -47.264 35.463  1.00 46.80 ? 29   ALA H N   1 
ATOM   4374 C CA  . ALA H 2 8   ? 21.452 -46.569 34.203  1.00 43.38 ? 29   ALA H CA  1 
ATOM   4375 C C   . ALA H 2 8   ? 20.095 -46.184 33.646  1.00 42.98 ? 29   ALA H C   1 
ATOM   4376 O O   . ALA H 2 8   ? 19.104 -46.828 33.943  1.00 42.48 ? 29   ALA H O   1 
ATOM   4377 C CB  . ALA H 2 8   ? 22.200 -47.476 33.219  1.00 42.94 ? 29   ALA H CB  1 
ATOM   4378 N N   . PRO H 2 9   ? 20.042 -45.134 32.819  1.00 43.79 ? 30   PRO H N   1 
ATOM   4379 C CA  . PRO H 2 9   ? 18.740 -44.748 32.256  1.00 40.59 ? 30   PRO H CA  1 
ATOM   4380 C C   . PRO H 2 9   ? 18.154 -45.848 31.383  1.00 41.51 ? 30   PRO H C   1 
ATOM   4381 O O   . PRO H 2 9   ? 18.895 -46.637 30.778  1.00 40.86 ? 30   PRO H O   1 
ATOM   4382 C CB  . PRO H 2 9   ? 19.073 -43.530 31.381  1.00 40.85 ? 30   PRO H CB  1 
ATOM   4383 C CG  . PRO H 2 9   ? 20.404 -43.047 31.855  1.00 44.38 ? 30   PRO H CG  1 
ATOM   4384 C CD  . PRO H 2 9   ? 21.132 -44.233 32.413  1.00 42.01 ? 30   PRO H CD  1 
ATOM   4385 N N   . ALA H 2 10  ? 16.828 -45.886 31.299  1.00 40.14 ? 31   ALA H N   1 
ATOM   4386 C CA  . ALA H 2 10  ? 16.164 -46.778 30.367  1.00 37.34 ? 31   ALA H CA  1 
ATOM   4387 C C   . ALA H 2 10  ? 16.476 -46.416 28.919  1.00 33.92 ? 31   ALA H C   1 
ATOM   4388 O O   . ALA H 2 10  ? 16.680 -45.244 28.575  1.00 34.03 ? 31   ALA H O   1 
ATOM   4389 C CB  . ALA H 2 10  ? 14.667 -46.755 30.590  1.00 37.74 ? 31   ALA H CB  1 
ATOM   4390 N N   . THR H 2 11  ? 16.504 -47.425 28.058  1.00 34.59 ? 32   THR H N   1 
ATOM   4391 C CA  . THR H 2 11  ? 16.722 -47.162 26.646  1.00 33.98 ? 32   THR H CA  1 
ATOM   4392 C C   . THR H 2 11  ? 15.581 -47.701 25.799  1.00 36.81 ? 32   THR H C   1 
ATOM   4393 O O   . THR H 2 11  ? 14.805 -48.577 26.223  1.00 36.59 ? 32   THR H O   1 
ATOM   4394 C CB  . THR H 2 11  ? 18.078 -47.672 26.166  1.00 29.88 ? 32   THR H CB  1 
ATOM   4395 O OG1 . THR H 2 11  ? 18.145 -49.095 26.320  1.00 34.34 ? 32   THR H OG1 1 
ATOM   4396 C CG2 . THR H 2 11  ? 19.185 -46.996 26.966  1.00 30.65 ? 32   THR H CG2 1 
ATOM   4397 N N   . GLY H 2 12  ? 15.444 -47.111 24.627  1.00 30.51 ? 33   GLY H N   1 
ATOM   4398 C CA  . GLY H 2 12  ? 14.454 -47.540 23.672  1.00 34.58 ? 33   GLY H CA  1 
ATOM   4399 C C   . GLY H 2 12  ? 15.091 -48.721 22.970  1.00 36.22 ? 33   GLY H C   1 
ATOM   4400 O O   . GLY H 2 12  ? 16.033 -49.360 23.477  1.00 39.67 ? 33   GLY H O   1 
ATOM   4401 N N   . GLY H 2 13  ? 14.567 -49.041 21.811  1.00 38.05 ? 34   GLY H N   1 
ATOM   4402 C CA  . GLY H 2 13  ? 15.150 -50.101 21.023  1.00 34.77 ? 34   GLY H CA  1 
ATOM   4403 C C   . GLY H 2 13  ? 15.905 -49.427 19.900  1.00 36.11 ? 34   GLY H C   1 
ATOM   4404 O O   . GLY H 2 13  ? 16.340 -48.273 20.021  1.00 31.53 ? 34   GLY H O   1 
ATOM   4405 N N   . VAL H 2 14  ? 16.051 -50.152 18.805  1.00 33.72 ? 35   VAL H N   1 
ATOM   4406 C CA  . VAL H 2 14  ? 16.727 -49.644 17.635  1.00 33.03 ? 35   VAL H CA  1 
ATOM   4407 C C   . VAL H 2 14  ? 15.914 -48.500 17.077  1.00 35.47 ? 35   VAL H C   1 
ATOM   4408 O O   . VAL H 2 14  ? 14.692 -48.577 17.029  1.00 39.09 ? 35   VAL H O   1 
ATOM   4409 C CB  . VAL H 2 14  ? 16.825 -50.734 16.577  1.00 34.82 ? 35   VAL H CB  1 
ATOM   4410 C CG1 . VAL H 2 14  ? 17.457 -50.173 15.319  1.00 33.62 ? 35   VAL H CG1 1 
ATOM   4411 C CG2 . VAL H 2 14  ? 17.623 -51.888 17.121  1.00 36.42 ? 35   VAL H CG2 1 
HETATM 4412 N N   . M3L H 2 15  ? 16.591 -47.431 16.671  1.00 30.16 ? 36   M3L H N   1 
HETATM 4413 C CA  . M3L H 2 15  ? 15.917 -46.268 16.158  1.00 32.08 ? 36   M3L H CA  1 
HETATM 4414 C CB  . M3L H 2 15  ? 16.861 -45.073 16.025  1.00 29.95 ? 36   M3L H CB  1 
HETATM 4415 C CG  . M3L H 2 15  ? 16.223 -43.753 15.659  1.00 33.47 ? 36   M3L H CG  1 
HETATM 4416 C CD  . M3L H 2 15  ? 17.098 -42.505 15.783  1.00 30.49 ? 36   M3L H CD  1 
HETATM 4417 C CE  . M3L H 2 15  ? 16.403 -41.187 15.498  1.00 32.54 ? 36   M3L H CE  1 
HETATM 4418 N NZ  . M3L H 2 15  ? 17.187 -39.971 15.628  1.00 31.60 ? 36   M3L H NZ  1 
HETATM 4419 C C   . M3L H 2 15  ? 15.263 -46.608 14.832  1.00 35.64 ? 36   M3L H C   1 
HETATM 4420 O O   . M3L H 2 15  ? 15.874 -47.166 13.983  1.00 34.73 ? 36   M3L H O   1 
HETATM 4421 C CM1 . M3L H 2 15  ? 18.361 -40.029 14.769  1.00 29.38 ? 36   M3L H CM1 1 
HETATM 4422 C CM2 . M3L H 2 15  ? 17.601 -39.813 17.014  1.00 26.65 ? 36   M3L H CM2 1 
HETATM 4423 C CM3 . M3L H 2 15  ? 16.328 -38.858 15.241  1.00 32.86 ? 36   M3L H CM3 1 
ATOM   4424 N N   . LYS H 2 16  ? 14.006 -46.213 14.693  1.00 40.97 ? 37   LYS H N   1 
ATOM   4425 C CA  . LYS H 2 16  ? 13.248 -46.477 13.477  1.00 42.78 ? 37   LYS H CA  1 
ATOM   4426 C C   . LYS H 2 16  ? 13.664 -45.612 12.289  1.00 45.08 ? 37   LYS H C   1 
ATOM   4427 O O   . LYS H 2 16  ? 14.032 -44.452 12.447  1.00 40.49 ? 37   LYS H O   1 
ATOM   4428 C CB  . LYS H 2 16  ? 11.751 -46.283 13.747  1.00 45.00 ? 37   LYS H CB  1 
ATOM   4429 C CG  . LYS H 2 16  ? 11.175 -47.269 14.762  1.00 58.32 ? 37   LYS H CG  1 
ATOM   4430 C CD  . LYS H 2 16  ? 9.661  -47.102 14.914  1.00 69.25 ? 37   LYS H CD  1 
ATOM   4431 C CE  . LYS H 2 16  ? 9.077  -48.092 15.928  1.00 76.90 ? 37   LYS H CE  1 
ATOM   4432 N NZ  . LYS H 2 16  ? 7.654  -47.782 16.274  1.00 78.14 ? 37   LYS H NZ  1 
ATOM   4433 N N   . PRO H 2 17  ? 13.584 -46.183 11.082  1.00 47.41 ? 38   PRO H N   1 
ATOM   4434 C CA  . PRO H 2 17  ? 13.818 -45.468 9.827   1.00 48.38 ? 38   PRO H CA  1 
ATOM   4435 C C   . PRO H 2 17  ? 13.034 -44.168 9.747   1.00 48.25 ? 38   PRO H C   1 
ATOM   4436 O O   . PRO H 2 17  ? 11.956 -44.053 10.323  1.00 48.16 ? 38   PRO H O   1 
ATOM   4437 C CB  . PRO H 2 17  ? 13.285 -46.444 8.773   1.00 47.92 ? 38   PRO H CB  1 
ATOM   4438 C CG  . PRO H 2 17  ? 13.477 -47.774 9.371   1.00 45.42 ? 38   PRO H CG  1 
ATOM   4439 C CD  . PRO H 2 17  ? 13.269 -47.606 10.852  1.00 49.30 ? 38   PRO H CD  1 
ATOM   4440 N N   . HIS H 2 18  ? 13.576 -43.199 9.017   1.00 53.04 ? 39   HIS H N   1 
ATOM   4441 C CA  . HIS H 2 18  ? 12.883 -41.940 8.801   1.00 50.32 ? 39   HIS H CA  1 
ATOM   4442 C C   . HIS H 2 18  ? 11.812 -42.061 7.709   1.00 55.79 ? 39   HIS H C   1 
ATOM   4443 O O   . HIS H 2 18  ? 10.740 -41.448 7.798   1.00 55.61 ? 39   HIS H O   1 
ATOM   4444 C CB  . HIS H 2 18  ? 13.878 -40.837 8.449   1.00 51.04 ? 39   HIS H CB  1 
ATOM   4445 C CG  . HIS H 2 18  ? 13.233 -39.515 8.184   1.00 51.87 ? 39   HIS H CG  1 
ATOM   4446 N ND1 . HIS H 2 18  ? 12.968 -39.060 6.911   1.00 55.45 ? 39   HIS H ND1 1 
ATOM   4447 C CD2 . HIS H 2 18  ? 12.785 -38.555 9.030   1.00 54.14 ? 39   HIS H CD2 1 
ATOM   4448 C CE1 . HIS H 2 18  ? 12.388 -37.873 6.983   1.00 58.12 ? 39   HIS H CE1 1 
ATOM   4449 N NE2 . HIS H 2 18  ? 12.262 -37.546 8.258   1.00 58.12 ? 39   HIS H NE2 1 
HETATM 4450 S S   . SO4 I 3 .   ? 1.112  -9.164  57.893  1.00 45.91 ? 2206 SO4 A S   1 
HETATM 4451 O O1  . SO4 I 3 .   ? -0.266 -9.327  58.307  1.00 40.67 ? 2206 SO4 A O1  1 
HETATM 4452 O O2  . SO4 I 3 .   ? 1.125  -9.214  56.430  1.00 44.96 ? 2206 SO4 A O2  1 
HETATM 4453 O O3  . SO4 I 3 .   ? 1.645  -7.891  58.400  1.00 42.13 ? 2206 SO4 A O3  1 
HETATM 4454 O O4  . SO4 I 3 .   ? 1.886  -10.252 58.477  1.00 46.49 ? 2206 SO4 A O4  1 
HETATM 4455 O O   . HOH J 4 .   ? -1.173 -13.013 60.760  1.00 42.64 ? 2001 HOH A O   1 
HETATM 4456 O O   . HOH J 4 .   ? -3.490 -9.220  62.138  1.00 45.31 ? 2002 HOH A O   1 
HETATM 4457 O O   . HOH J 4 .   ? 21.916 -28.936 40.588  1.00 43.83 ? 2003 HOH A O   1 
HETATM 4458 O O   . HOH J 4 .   ? 19.366 -20.448 25.936  1.00 42.86 ? 2004 HOH A O   1 
HETATM 4459 O O   . HOH J 4 .   ? 11.720 -30.305 25.854  1.00 39.77 ? 2005 HOH A O   1 
HETATM 4460 O O   . HOH J 4 .   ? 23.314 -15.580 45.243  1.00 46.65 ? 2006 HOH A O   1 
HETATM 4461 O O   . HOH J 4 .   ? 22.647 -27.043 43.177  1.00 47.27 ? 2007 HOH A O   1 
HETATM 4462 O O   . HOH J 4 .   ? 13.446 -33.808 49.130  1.00 44.06 ? 2008 HOH A O   1 
HETATM 4463 O O   . HOH J 4 .   ? 13.850 -24.604 51.998  1.00 32.12 ? 2009 HOH A O   1 
HETATM 4464 O O   . HOH J 4 .   ? 19.264 -18.460 24.686  1.00 45.80 ? 2010 HOH A O   1 
HETATM 4465 O O   . HOH J 4 .   ? 5.232  -22.634 56.874  1.00 46.48 ? 2011 HOH A O   1 
HETATM 4466 O O   . HOH J 4 .   ? 19.826 -19.831 49.327  1.00 32.01 ? 2012 HOH A O   1 
HETATM 4467 O O   . HOH J 4 .   ? 16.166 -22.693 53.686  1.00 41.14 ? 2013 HOH A O   1 
HETATM 4468 O O   . HOH J 4 .   ? 18.218 -18.869 52.602  1.00 38.88 ? 2014 HOH A O   1 
HETATM 4469 O O   . HOH J 4 .   ? 19.123 -15.270 46.070  1.00 32.97 ? 2015 HOH A O   1 
HETATM 4470 O O   . HOH J 4 .   ? 22.035 -22.576 48.441  1.00 48.07 ? 2016 HOH A O   1 
HETATM 4471 O O   . HOH J 4 .   ? 19.201 -25.017 44.565  1.00 35.80 ? 2017 HOH A O   1 
HETATM 4472 O O   . HOH J 4 .   ? 20.390 -25.356 48.242  1.00 40.59 ? 2018 HOH A O   1 
HETATM 4473 O O   . HOH J 4 .   ? 20.443 -20.119 43.443  1.00 27.75 ? 2019 HOH A O   1 
HETATM 4474 O O   . HOH J 4 .   ? 19.755 -22.934 42.900  1.00 29.93 ? 2020 HOH A O   1 
HETATM 4475 O O   . HOH J 4 .   ? 6.197  -23.656 35.001  1.00 26.99 ? 2021 HOH A O   1 
HETATM 4476 O O   . HOH J 4 .   ? 4.027  -28.875 29.707  1.00 42.15 ? 2022 HOH A O   1 
HETATM 4477 O O   . HOH J 4 .   ? 3.429  -28.723 38.666  1.00 32.81 ? 2023 HOH A O   1 
HETATM 4478 O O   . HOH J 4 .   ? 4.057  -30.811 34.637  1.00 39.81 ? 2024 HOH A O   1 
HETATM 4479 O O   . HOH J 4 .   ? -0.561 -24.698 35.260  1.00 40.83 ? 2025 HOH A O   1 
HETATM 4480 O O   . HOH J 4 .   ? 1.182  -27.040 38.733  1.00 38.67 ? 2026 HOH A O   1 
HETATM 4481 O O   . HOH J 4 .   ? 5.874  -27.257 28.239  1.00 45.04 ? 2027 HOH A O   1 
HETATM 4482 O O   . HOH J 4 .   ? 11.101 -23.501 29.619  1.00 25.15 ? 2028 HOH A O   1 
HETATM 4483 O O   . HOH J 4 .   ? 12.529 -28.416 34.606  1.00 44.20 ? 2029 HOH A O   1 
HETATM 4484 O O   . HOH J 4 .   ? 9.811  -22.348 50.317  1.00 24.48 ? 2030 HOH A O   1 
HETATM 4485 O O   . HOH J 4 .   ? 12.397 -15.698 51.755  1.00 29.74 ? 2031 HOH A O   1 
HETATM 4486 O O   . HOH J 4 .   ? 13.652 -15.518 56.100  1.00 37.88 ? 2032 HOH A O   1 
HETATM 4487 O O   . HOH J 4 .   ? 14.957 -18.863 55.748  1.00 44.44 ? 2033 HOH A O   1 
HETATM 4488 O O   . HOH J 4 .   ? 12.352 -21.958 54.159  1.00 36.04 ? 2034 HOH A O   1 
HETATM 4489 O O   . HOH J 4 .   ? 10.217 -21.808 56.729  1.00 42.81 ? 2035 HOH A O   1 
HETATM 4490 O O   . HOH J 4 .   ? 4.360  -16.257 58.075  1.00 39.80 ? 2036 HOH A O   1 
HETATM 4491 O O   . HOH J 4 .   ? 6.310  -14.432 56.037  1.00 32.56 ? 2037 HOH A O   1 
HETATM 4492 O O   . HOH J 4 .   ? 7.439  -11.589 61.213  1.00 40.68 ? 2038 HOH A O   1 
HETATM 4493 O O   . HOH J 4 .   ? 6.086  -8.227  62.145  1.00 43.26 ? 2039 HOH A O   1 
HETATM 4494 O O   . HOH J 4 .   ? 21.319 -7.417  53.708  1.00 47.70 ? 2040 HOH A O   1 
HETATM 4495 O O   . HOH J 4 .   ? 13.832 -7.977  44.839  1.00 30.84 ? 2041 HOH A O   1 
HETATM 4496 O O   . HOH J 4 .   ? 11.329 -7.178  52.069  1.00 37.43 ? 2042 HOH A O   1 
HETATM 4497 O O   . HOH J 4 .   ? 7.080  -7.176  50.251  1.00 31.10 ? 2043 HOH A O   1 
HETATM 4498 O O   . HOH J 4 .   ? 2.656  -8.993  51.004  1.00 40.55 ? 2044 HOH A O   1 
HETATM 4499 O O   . HOH J 4 .   ? -2.193 -16.853 56.170  1.00 32.26 ? 2045 HOH A O   1 
HETATM 4500 O O   . HOH J 4 .   ? -1.045 -10.141 53.304  1.00 43.17 ? 2046 HOH A O   1 
HETATM 4501 O O   . HOH J 4 .   ? -3.343 -11.931 51.601  1.00 42.07 ? 2047 HOH A O   1 
HETATM 4502 O O   . HOH J 4 .   ? 1.978  -21.567 54.684  1.00 34.79 ? 2048 HOH A O   1 
HETATM 4503 O O   . HOH J 4 .   ? -4.961 -22.454 55.262  1.00 44.07 ? 2049 HOH A O   1 
HETATM 4504 O O   . HOH J 4 .   ? 2.368  -24.119 53.620  1.00 38.09 ? 2050 HOH A O   1 
HETATM 4505 O O   . HOH J 4 .   ? -6.345 -29.089 51.903  1.00 44.89 ? 2051 HOH A O   1 
HETATM 4506 O O   . HOH J 4 .   ? -1.722 -29.740 46.630  1.00 37.60 ? 2052 HOH A O   1 
HETATM 4507 O O   . HOH J 4 .   ? 4.449  -27.505 52.562  1.00 31.46 ? 2053 HOH A O   1 
HETATM 4508 O O   . HOH J 4 .   ? -1.940 -30.441 59.627  1.00 42.97 ? 2054 HOH A O   1 
HETATM 4509 O O   . HOH J 4 .   ? -2.858 -33.355 55.635  1.00 42.36 ? 2055 HOH A O   1 
HETATM 4510 O O   . HOH J 4 .   ? -0.178 -36.023 46.422  1.00 43.76 ? 2056 HOH A O   1 
HETATM 4511 O O   . HOH J 4 .   ? 5.048  -36.688 51.082  1.00 38.06 ? 2057 HOH A O   1 
HETATM 4512 O O   . HOH J 4 .   ? 2.494  -38.553 51.770  1.00 32.34 ? 2058 HOH A O   1 
HETATM 4513 O O   . HOH J 4 .   ? 8.126  -34.164 46.368  1.00 34.84 ? 2059 HOH A O   1 
HETATM 4514 O O   . HOH J 4 .   ? 1.643  -32.009 44.627  1.00 44.02 ? 2060 HOH A O   1 
HETATM 4515 O O   . HOH J 4 .   ? 10.995 -25.565 52.618  1.00 35.05 ? 2061 HOH A O   1 
HETATM 4516 O O   . HOH J 4 .   ? 5.446  -29.030 54.699  1.00 32.02 ? 2062 HOH A O   1 
HETATM 4517 O O   . HOH J 4 .   ? 8.446  -31.993 48.107  1.00 28.84 ? 2063 HOH A O   1 
HETATM 4518 O O   . HOH J 4 .   ? 8.318  -24.125 52.247  1.00 35.88 ? 2064 HOH A O   1 
HETATM 4519 O O   . HOH J 4 .   ? 5.248  -25.000 53.381  1.00 38.18 ? 2065 HOH A O   1 
HETATM 4520 O O   . HOH J 4 .   ? 11.302 -14.176 41.512  1.00 23.14 ? 2066 HOH A O   1 
HETATM 4521 O O   . HOH J 4 .   ? 2.896  -15.233 34.343  1.00 41.98 ? 2067 HOH A O   1 
HETATM 4522 O O   . HOH J 4 .   ? 8.952  -8.477  36.959  1.00 38.35 ? 2068 HOH A O   1 
HETATM 4523 O O   . HOH J 4 .   ? 5.893  -12.787 31.535  1.00 33.95 ? 2069 HOH A O   1 
HETATM 4524 O O   . HOH J 4 .   ? 8.068  -11.489 29.138  1.00 36.02 ? 2070 HOH A O   1 
HETATM 4525 O O   . HOH J 4 .   ? 8.242  -8.225  29.760  1.00 42.92 ? 2071 HOH A O   1 
HETATM 4526 O O   . HOH J 4 .   ? 5.790  -6.436  38.601  1.00 44.34 ? 2072 HOH A O   1 
HETATM 4527 O O   . HOH J 4 .   ? 3.198  -12.432 33.974  1.00 41.70 ? 2073 HOH A O   1 
HETATM 4528 O O   . HOH J 4 .   ? 0.318  -15.453 34.720  1.00 43.85 ? 2074 HOH A O   1 
HETATM 4529 O O   . HOH J 4 .   ? 2.626  -7.588  39.819  1.00 40.36 ? 2075 HOH A O   1 
HETATM 4530 O O   . HOH J 4 .   ? 13.627 -8.683  41.088  1.00 43.03 ? 2076 HOH A O   1 
HETATM 4531 O O   . HOH J 4 .   ? 9.471  -7.351  39.305  1.00 34.90 ? 2077 HOH A O   1 
HETATM 4532 O O   . HOH J 4 .   ? 14.116 -9.962  43.117  1.00 42.61 ? 2078 HOH A O   1 
HETATM 4533 O O   . HOH J 4 .   ? 13.196 -9.452  38.647  1.00 39.79 ? 2079 HOH A O   1 
HETATM 4534 O O   . HOH J 4 .   ? 0.553  -25.680 41.180  1.00 40.72 ? 2080 HOH A O   1 
HETATM 4535 O O   . HOH J 4 .   ? 1.673  -27.807 43.451  1.00 28.31 ? 2081 HOH A O   1 
HETATM 4536 O O   . HOH J 4 .   ? 16.966 -31.252 40.981  1.00 36.94 ? 2082 HOH A O   1 
HETATM 4537 O O   . HOH J 4 .   ? 12.063 -32.043 37.934  1.00 41.75 ? 2083 HOH A O   1 
HETATM 4538 O O   . HOH J 4 .   ? 5.228  -34.990 43.060  1.00 40.68 ? 2084 HOH A O   1 
HETATM 4539 O O   . HOH J 4 .   ? 11.547 -27.930 36.846  1.00 30.04 ? 2085 HOH A O   1 
HETATM 4540 O O   . HOH J 4 .   ? 2.780  -30.708 36.924  1.00 43.93 ? 2086 HOH A O   1 
HETATM 4541 O O   . HOH J 4 .   ? 13.126 -32.310 40.119  1.00 38.92 ? 2087 HOH A O   1 
HETATM 4542 O O   . HOH J 4 .   ? 20.423 -28.233 38.364  1.00 38.30 ? 2088 HOH A O   1 
HETATM 4543 O O   . HOH J 4 .   ? 22.289 -20.066 40.812  1.00 37.06 ? 2089 HOH A O   1 
HETATM 4544 O O   . HOH J 4 .   ? 27.686 -24.476 33.769  1.00 44.43 ? 2090 HOH A O   1 
HETATM 4545 O O   . HOH J 4 .   ? 29.327 -26.573 27.785  1.00 35.87 ? 2091 HOH A O   1 
HETATM 4546 O O   . HOH J 4 .   ? 24.205 -21.528 34.237  1.00 36.54 ? 2092 HOH A O   1 
HETATM 4547 O O   . HOH J 4 .   ? 21.246 -25.023 36.387  1.00 26.50 ? 2093 HOH A O   1 
HETATM 4548 O O   . HOH J 4 .   ? 18.844 -22.667 25.013  1.00 32.89 ? 2094 HOH A O   1 
HETATM 4549 O O   . HOH J 4 .   ? 13.880 -29.141 27.088  1.00 35.37 ? 2095 HOH A O   1 
HETATM 4550 O O   . HOH J 4 .   ? 19.249 -32.838 31.622  1.00 44.44 ? 2096 HOH A O   1 
HETATM 4551 O O   . HOH J 4 .   ? 14.526 -31.990 27.602  1.00 35.34 ? 2097 HOH A O   1 
HETATM 4552 O O   . HOH J 4 .   ? 17.654 -34.786 29.990  1.00 43.93 ? 2098 HOH A O   1 
HETATM 4553 O O   . HOH J 4 .   ? 15.708 -31.551 34.811  1.00 45.33 ? 2099 HOH A O   1 
HETATM 4554 O O   . HOH J 4 .   ? 10.961 -22.540 27.175  1.00 29.20 ? 2100 HOH A O   1 
HETATM 4555 O O   . HOH J 4 .   ? 13.372 -29.783 29.929  1.00 40.29 ? 2101 HOH A O   1 
HETATM 4556 O O   . HOH J 4 .   ? 8.622  -26.248 19.146  1.00 46.73 ? 2102 HOH A O   1 
HETATM 4557 O O   . HOH J 4 .   ? 2.951  -23.595 27.631  1.00 41.10 ? 2103 HOH A O   1 
HETATM 4558 O O   . HOH J 4 .   ? 5.058  -25.193 26.226  1.00 43.24 ? 2104 HOH A O   1 
HETATM 4559 O O   . HOH J 4 .   ? 11.820 -17.389 21.346  1.00 36.25 ? 2105 HOH A O   1 
HETATM 4560 O O   . HOH J 4 .   ? 6.765  -21.444 17.537  1.00 47.06 ? 2106 HOH A O   1 
HETATM 4561 O O   . HOH J 4 .   ? 12.218 -22.425 51.454  1.00 33.02 ? 2107 HOH A O   1 
HETATM 4562 O O   . HOH J 4 .   ? 6.560  -13.241 24.870  1.00 40.88 ? 2108 HOH A O   1 
HETATM 4563 O O   . HOH J 4 .   ? 14.479 -21.690 55.272  1.00 46.07 ? 2109 HOH A O   1 
HETATM 4564 O O   . HOH J 4 .   ? 16.747 -16.637 54.059  1.00 44.53 ? 2110 HOH A O   1 
HETATM 4565 O O   . HOH J 4 .   ? 21.046 -15.736 44.223  1.00 33.79 ? 2111 HOH A O   1 
HETATM 4566 O O   . HOH J 4 .   ? 20.651 -27.420 45.152  1.00 45.55 ? 2112 HOH A O   1 
HETATM 4567 O O   . HOH J 4 .   ? 8.862  -23.263 17.876  1.00 45.39 ? 2113 HOH A O   1 
HETATM 4568 O O   . HOH J 4 .   ? 14.187 -20.557 21.490  1.00 42.66 ? 2114 HOH A O   1 
HETATM 4569 O O   . HOH J 4 .   ? 2.801  -29.657 41.341  1.00 31.71 ? 2115 HOH A O   1 
HETATM 4570 O O   . HOH J 4 .   ? 1.674  -22.003 37.665  1.00 36.43 ? 2116 HOH A O   1 
HETATM 4571 O O   . HOH J 4 .   ? 8.325  -11.857 26.466  1.00 42.93 ? 2117 HOH A O   1 
HETATM 4572 O O   . HOH J 4 .   ? 9.219  -12.838 31.184  1.00 31.43 ? 2118 HOH A O   1 
HETATM 4573 O O   . HOH J 4 .   ? 17.547 -20.770 23.726  1.00 40.36 ? 2119 HOH A O   1 
HETATM 4574 O O   . HOH J 4 .   ? 14.616 -20.328 24.122  1.00 38.80 ? 2120 HOH A O   1 
HETATM 4575 O O   . HOH J 4 .   ? 14.519 -15.987 53.519  1.00 40.09 ? 2121 HOH A O   1 
HETATM 4576 O O   . HOH J 4 .   ? 7.816  -22.792 56.573  1.00 41.11 ? 2122 HOH A O   1 
HETATM 4577 O O   . HOH J 4 .   ? 1.917  -14.894 58.451  1.00 39.91 ? 2123 HOH A O   1 
HETATM 4578 O O   . HOH J 4 .   ? 23.068 -20.475 30.031  1.00 41.12 ? 2124 HOH A O   1 
HETATM 4579 O O   . HOH J 4 .   ? 18.429 -14.412 25.166  1.00 37.27 ? 2125 HOH A O   1 
HETATM 4580 O O   . HOH J 4 .   ? 16.052 -9.310  38.200  1.00 32.15 ? 2126 HOH A O   1 
HETATM 4581 O O   . HOH J 4 .   ? 4.466  -6.669  51.103  1.00 45.73 ? 2127 HOH A O   1 
HETATM 4582 O O   . HOH J 4 .   ? -0.108 -8.685  50.661  1.00 46.42 ? 2128 HOH A O   1 
HETATM 4583 O O   . HOH J 4 .   ? -0.282 -16.334 57.870  1.00 37.32 ? 2129 HOH A O   1 
HETATM 4584 O O   . HOH J 4 .   ? 19.472 -5.535  36.726  1.00 42.15 ? 2130 HOH A O   1 
HETATM 4585 O O   . HOH J 4 .   ? 22.108 -7.419  38.063  1.00 32.73 ? 2131 HOH A O   1 
HETATM 4586 O O   . HOH J 4 .   ? 16.234 -8.789  42.523  1.00 43.30 ? 2132 HOH A O   1 
HETATM 4587 O O   . HOH J 4 .   ? 2.197  -25.800 55.720  1.00 43.41 ? 2133 HOH A O   1 
HETATM 4588 O O   . HOH J 4 .   ? 0.547  -29.737 44.949  1.00 34.32 ? 2134 HOH A O   1 
HETATM 4589 O O   . HOH J 4 .   ? 25.320 -19.021 35.262  1.00 45.56 ? 2135 HOH A O   1 
HETATM 4590 O O   . HOH J 4 .   ? 24.551 -13.785 37.781  1.00 36.64 ? 2136 HOH A O   1 
HETATM 4591 O O   . HOH J 4 .   ? -0.762 -33.729 44.838  1.00 44.93 ? 2137 HOH A O   1 
HETATM 4592 O O   . HOH J 4 .   ? 4.837  -38.374 49.050  1.00 35.99 ? 2138 HOH A O   1 
HETATM 4593 O O   . HOH J 4 .   ? 10.626 -35.540 46.174  1.00 42.64 ? 2139 HOH A O   1 
HETATM 4594 O O   . HOH J 4 .   ? 2.555  -32.152 41.853  1.00 37.53 ? 2140 HOH A O   1 
HETATM 4595 O O   . HOH J 4 .   ? 17.135 -7.853  39.870  1.00 38.22 ? 2141 HOH A O   1 
HETATM 4596 O O   . HOH J 4 .   ? 9.826  -7.681  27.932  1.00 44.02 ? 2142 HOH A O   1 
HETATM 4597 O O   . HOH J 4 .   ? 11.225 -5.346  39.650  1.00 46.19 ? 2143 HOH A O   1 
HETATM 4598 O O   . HOH J 4 .   ? 24.279 -6.220  39.030  1.00 47.17 ? 2144 HOH A O   1 
HETATM 4599 O O   . HOH J 4 .   ? -2.213 -25.924 41.733  1.00 46.50 ? 2145 HOH A O   1 
HETATM 4600 O O   . HOH J 4 .   ? 19.551 -31.008 38.454  1.00 45.86 ? 2146 HOH A O   1 
HETATM 4601 O O   . HOH J 4 .   ? 2.808  -6.789  59.874  1.00 44.74 ? 2147 HOH A O   1 
HETATM 4602 O O   . HOH J 4 .   ? 3.128  -7.728  54.878  1.00 42.03 ? 2148 HOH A O   1 
HETATM 4603 O O   . HOH J 4 .   ? 1.277  -12.709 60.041  1.00 37.94 ? 2149 HOH A O   1 
HETATM 4604 O O   . HOH J 4 .   ? -2.385 -10.494 59.904  1.00 41.11 ? 2150 HOH A O   1 
HETATM 4605 O O   . HOH K 4 .   ? 10.443 -3.927  51.080  1.00 47.18 ? 2001 HOH B O   1 
HETATM 4606 O O   . HOH K 4 .   ? 6.038  -6.895  47.588  1.00 39.66 ? 2002 HOH B O   1 
HETATM 4607 O O   . HOH K 4 .   ? 7.443  -6.391  40.389  1.00 35.24 ? 2003 HOH B O   1 
HETATM 4608 O O   . HOH K 4 .   ? 2.771  -6.383  46.128  1.00 38.92 ? 2004 HOH B O   1 
HETATM 4609 O O   . HOH K 4 .   ? 4.873  -9.307  47.908  1.00 32.88 ? 2005 HOH B O   1 
HETATM 4610 O O   . HOH K 4 .   ? -2.224 -13.756 39.600  1.00 40.51 ? 2006 HOH B O   1 
HETATM 4611 O O   . HOH K 4 .   ? 1.252  -11.365 45.243  1.00 35.91 ? 2007 HOH B O   1 
HETATM 4612 O O   . HOH K 4 .   ? -3.994 -14.518 44.041  1.00 41.41 ? 2008 HOH B O   1 
HETATM 4613 O O   . HOH K 4 .   ? -2.476 -20.226 29.675  1.00 43.38 ? 2009 HOH B O   1 
HETATM 4614 O O   . HOH L 4 .   ? 28.672 -3.422  0.575   1.00 45.54 ? 2001 HOH C O   1 
HETATM 4615 O O   . HOH L 4 .   ? 36.009 -3.626  8.816   1.00 37.46 ? 2002 HOH C O   1 
HETATM 4616 O O   . HOH L 4 .   ? 39.276 -5.575  9.880   1.00 45.76 ? 2003 HOH C O   1 
HETATM 4617 O O   . HOH L 4 .   ? 22.748 -14.665 14.261  1.00 30.06 ? 2004 HOH C O   1 
HETATM 4618 O O   . HOH L 4 .   ? 20.607 -5.467  8.146   1.00 34.87 ? 2005 HOH C O   1 
HETATM 4619 O O   . HOH L 4 .   ? 33.592 -2.568  8.043   1.00 42.46 ? 2006 HOH C O   1 
HETATM 4620 O O   . HOH L 4 .   ? 10.522 -16.973 6.993   1.00 44.66 ? 2007 HOH C O   1 
HETATM 4621 O O   . HOH L 4 .   ? 15.960 -22.715 5.305   1.00 46.39 ? 2008 HOH C O   1 
HETATM 4622 O O   . HOH L 4 .   ? 19.068 -19.399 1.385   1.00 44.87 ? 2009 HOH C O   1 
HETATM 4623 O O   . HOH L 4 .   ? 21.215 -16.132 0.089   1.00 43.84 ? 2010 HOH C O   1 
HETATM 4624 O O   . HOH L 4 .   ? 42.369 -0.971  -1.388  1.00 44.14 ? 2011 HOH C O   1 
HETATM 4625 O O   . HOH L 4 .   ? 44.877 -10.155 -2.834  1.00 33.99 ? 2012 HOH C O   1 
HETATM 4626 O O   . HOH L 4 .   ? 25.063 -19.888 17.775  1.00 43.06 ? 2013 HOH C O   1 
HETATM 4627 O O   . HOH L 4 .   ? 45.656 -14.708 3.862   1.00 31.30 ? 2014 HOH C O   1 
HETATM 4628 O O   . HOH L 4 .   ? 48.024 -15.698 0.833   1.00 38.72 ? 2015 HOH C O   1 
HETATM 4629 O O   . HOH L 4 .   ? 47.590 -11.857 -1.699  1.00 36.63 ? 2016 HOH C O   1 
HETATM 4630 O O   . HOH L 4 .   ? 42.744 -19.150 4.950   1.00 29.34 ? 2017 HOH C O   1 
HETATM 4631 O O   . HOH L 4 .   ? 41.312 -9.411  5.449   1.00 31.74 ? 2018 HOH C O   1 
HETATM 4632 O O   . HOH L 4 .   ? 45.937 -11.664 6.286   1.00 43.69 ? 2019 HOH C O   1 
HETATM 4633 O O   . HOH L 4 .   ? 45.273 -9.095  4.871   1.00 41.95 ? 2020 HOH C O   1 
HETATM 4634 O O   . HOH L 4 .   ? 43.525 -14.105 7.587   1.00 45.16 ? 2021 HOH C O   1 
HETATM 4635 O O   . HOH L 4 .   ? 41.143 -14.374 7.305   1.00 27.61 ? 2022 HOH C O   1 
HETATM 4636 O O   . HOH L 4 .   ? 30.698 -7.171  2.694   1.00 32.99 ? 2023 HOH C O   1 
HETATM 4637 O O   . HOH L 4 .   ? 26.603 -11.628 -1.028  1.00 24.23 ? 2024 HOH C O   1 
HETATM 4638 O O   . HOH L 4 .   ? 28.484 -6.592  -5.573  1.00 35.38 ? 2025 HOH C O   1 
HETATM 4639 O O   . HOH L 4 .   ? 20.916 -5.904  -0.562  1.00 47.99 ? 2026 HOH C O   1 
HETATM 4640 O O   . HOH L 4 .   ? 24.187 -16.714 15.084  1.00 40.72 ? 2027 HOH C O   1 
HETATM 4641 O O   . HOH L 4 .   ? 26.483 -4.613  -4.849  1.00 47.19 ? 2028 HOH C O   1 
HETATM 4642 O O   . HOH L 4 .   ? 21.531 -5.200  -2.916  1.00 46.41 ? 2029 HOH C O   1 
HETATM 4643 O O   . HOH L 4 .   ? 29.196 -6.519  4.377   1.00 38.74 ? 2030 HOH C O   1 
HETATM 4644 O O   . HOH L 4 .   ? 24.402 -11.883 5.925   1.00 21.83 ? 2031 HOH C O   1 
HETATM 4645 O O   . HOH L 4 .   ? 48.976 -19.246 -4.813  1.00 37.30 ? 2032 HOH C O   1 
HETATM 4646 O O   . HOH L 4 .   ? 47.950 -12.748 -8.252  1.00 45.46 ? 2033 HOH C O   1 
HETATM 4647 O O   . HOH L 4 .   ? 46.471 -12.747 -5.334  1.00 36.25 ? 2034 HOH C O   1 
HETATM 4648 O O   . HOH L 4 .   ? 44.703 -18.935 -3.696  1.00 29.09 ? 2035 HOH C O   1 
HETATM 4649 O O   . HOH L 4 .   ? 45.237 -20.385 -11.230 1.00 40.58 ? 2036 HOH C O   1 
HETATM 4650 O O   . HOH L 4 .   ? 43.723 -28.519 -9.956  1.00 42.91 ? 2037 HOH C O   1 
HETATM 4651 O O   . HOH L 4 .   ? 44.371 -24.727 -16.233 1.00 42.79 ? 2038 HOH C O   1 
HETATM 4652 O O   . HOH L 4 .   ? 50.226 -23.586 -12.792 1.00 45.64 ? 2039 HOH C O   1 
HETATM 4653 O O   . HOH L 4 .   ? 45.970 -29.363 -3.231  1.00 36.07 ? 2040 HOH C O   1 
HETATM 4654 O O   . HOH L 4 .   ? 46.588 -16.512 5.584   1.00 43.16 ? 2041 HOH C O   1 
HETATM 4655 O O   . HOH L 4 .   ? 50.192 -20.868 1.318   1.00 41.67 ? 2042 HOH C O   1 
HETATM 4656 O O   . HOH L 4 .   ? 51.022 -18.037 5.869   1.00 35.97 ? 2043 HOH C O   1 
HETATM 4657 O O   . HOH L 4 .   ? 51.854 -23.318 3.535   1.00 42.64 ? 2044 HOH C O   1 
HETATM 4658 O O   . HOH L 4 .   ? 51.544 -26.587 3.184   1.00 42.05 ? 2045 HOH C O   1 
HETATM 4659 O O   . HOH L 4 .   ? 39.727 -26.747 1.355   1.00 31.61 ? 2046 HOH C O   1 
HETATM 4660 O O   . HOH L 4 .   ? 44.608 -27.597 -4.631  1.00 34.89 ? 2047 HOH C O   1 
HETATM 4661 O O   . HOH L 4 .   ? 40.946 -27.700 -7.330  1.00 34.68 ? 2048 HOH C O   1 
HETATM 4662 O O   . HOH L 4 .   ? 39.254 -24.961 -16.156 1.00 45.12 ? 2049 HOH C O   1 
HETATM 4663 O O   . HOH L 4 .   ? 41.440 -13.346 -14.246 1.00 42.16 ? 2050 HOH C O   1 
HETATM 4664 O O   . HOH L 4 .   ? 32.753 -5.289  -13.709 1.00 41.66 ? 2051 HOH C O   1 
HETATM 4665 O O   . HOH L 4 .   ? 40.897 -7.597  -11.490 1.00 40.87 ? 2052 HOH C O   1 
HETATM 4666 O O   . HOH L 4 .   ? 42.184 -2.571  -21.640 1.00 47.09 ? 2053 HOH C O   1 
HETATM 4667 O O   . HOH L 4 .   ? 40.211 -1.279  -18.776 1.00 48.23 ? 2054 HOH C O   1 
HETATM 4668 O O   . HOH L 4 .   ? 36.899 -0.753  -5.417  1.00 39.33 ? 2055 HOH C O   1 
HETATM 4669 O O   . HOH L 4 .   ? 33.779 0.094   -6.162  1.00 47.17 ? 2056 HOH C O   1 
HETATM 4670 O O   . HOH L 4 .   ? 32.356 -3.060  -10.028 1.00 46.75 ? 2057 HOH C O   1 
HETATM 4671 O O   . HOH L 4 .   ? 38.797 -2.927  -5.715  1.00 29.06 ? 2058 HOH C O   1 
HETATM 4672 O O   . HOH L 4 .   ? 43.160 -5.967  -11.417 1.00 35.93 ? 2059 HOH C O   1 
HETATM 4673 O O   . HOH L 4 .   ? 41.004 -0.373  -8.395  1.00 34.16 ? 2060 HOH C O   1 
HETATM 4674 O O   . HOH L 4 .   ? 44.032 -9.507  -5.621  1.00 38.58 ? 2061 HOH C O   1 
HETATM 4675 O O   . HOH L 4 .   ? 42.268 -10.672 -7.845  1.00 33.34 ? 2062 HOH C O   1 
HETATM 4676 O O   . HOH L 4 .   ? 41.950 -3.304  -3.140  1.00 34.42 ? 2063 HOH C O   1 
HETATM 4677 O O   . HOH L 4 .   ? 41.611 -12.303 -5.574  1.00 28.32 ? 2064 HOH C O   1 
HETATM 4678 O O   . HOH L 4 .   ? 35.195 -20.829 0.463   1.00 20.95 ? 2065 HOH C O   1 
HETATM 4679 O O   . HOH L 4 .   ? 31.371 -24.842 2.699   1.00 37.89 ? 2066 HOH C O   1 
HETATM 4680 O O   . HOH L 4 .   ? 24.761 -20.245 -3.367  1.00 37.48 ? 2067 HOH C O   1 
HETATM 4681 O O   . HOH L 4 .   ? 30.318 -26.595 1.075   1.00 38.63 ? 2068 HOH C O   1 
HETATM 4682 O O   . HOH L 4 .   ? 29.844 -28.952 -3.165  1.00 46.50 ? 2069 HOH C O   1 
HETATM 4683 O O   . HOH L 4 .   ? 23.794 -26.577 4.169   1.00 41.34 ? 2070 HOH C O   1 
HETATM 4684 O O   . HOH L 4 .   ? 23.066 -24.046 3.900   1.00 40.55 ? 2071 HOH C O   1 
HETATM 4685 O O   . HOH L 4 .   ? 29.959 -27.802 -6.182  1.00 38.83 ? 2072 HOH C O   1 
HETATM 4686 O O   . HOH L 4 .   ? 25.138 -23.381 -2.913  1.00 35.82 ? 2073 HOH C O   1 
HETATM 4687 O O   . HOH L 4 .   ? 32.753 -27.748 0.199   1.00 32.61 ? 2074 HOH C O   1 
HETATM 4688 O O   . HOH L 4 .   ? 38.094 -24.831 2.063   1.00 36.94 ? 2075 HOH C O   1 
HETATM 4689 O O   . HOH L 4 .   ? 33.653 -25.407 3.621   1.00 36.09 ? 2076 HOH C O   1 
HETATM 4690 O O   . HOH L 4 .   ? 36.241 -26.140 2.945   1.00 44.05 ? 2077 HOH C O   1 
HETATM 4691 O O   . HOH L 4 .   ? 26.550 -13.210 -6.731  1.00 37.56 ? 2078 HOH C O   1 
HETATM 4692 O O   . HOH L 4 .   ? 31.460 -7.500  -9.111  1.00 37.58 ? 2079 HOH C O   1 
HETATM 4693 O O   . HOH L 4 .   ? 37.137 -3.552  5.159   1.00 36.36 ? 2080 HOH C O   1 
HETATM 4694 O O   . HOH L 4 .   ? 30.927 -4.297  1.511   1.00 40.13 ? 2081 HOH C O   1 
HETATM 4695 O O   . HOH L 4 .   ? 34.520 -2.661  2.461   1.00 35.46 ? 2082 HOH C O   1 
HETATM 4696 O O   . HOH L 4 .   ? 36.343 -6.578  9.713   1.00 31.25 ? 2083 HOH C O   1 
HETATM 4697 O O   . HOH L 4 .   ? 39.661 -14.376 10.181  1.00 28.29 ? 2084 HOH C O   1 
HETATM 4698 O O   . HOH L 4 .   ? 40.599 -9.979  16.327  1.00 44.92 ? 2085 HOH C O   1 
HETATM 4699 O O   . HOH L 4 .   ? 36.985 -11.919 16.654  1.00 32.67 ? 2086 HOH C O   1 
HETATM 4700 O O   . HOH L 4 .   ? 33.465 -5.066  18.234  1.00 33.32 ? 2087 HOH C O   1 
HETATM 4701 O O   . HOH L 4 .   ? 34.622 -2.292  15.871  1.00 30.62 ? 2088 HOH C O   1 
HETATM 4702 O O   . HOH L 4 .   ? 36.513 -9.633  18.528  1.00 43.50 ? 2089 HOH C O   1 
HETATM 4703 O O   . HOH L 4 .   ? 28.504 -9.448  21.504  1.00 41.87 ? 2090 HOH C O   1 
HETATM 4704 O O   . HOH L 4 .   ? 31.350 -7.922  22.394  1.00 45.34 ? 2091 HOH C O   1 
HETATM 4705 O O   . HOH L 4 .   ? 35.195 -9.630  11.332  1.00 22.46 ? 2092 HOH C O   1 
HETATM 4706 O O   . HOH L 4 .   ? 34.867 -12.802 15.138  1.00 33.02 ? 2093 HOH C O   1 
HETATM 4707 O O   . HOH L 4 .   ? 24.301 -12.413 15.214  1.00 24.34 ? 2094 HOH C O   1 
HETATM 4708 O O   . HOH L 4 .   ? 23.539 -3.655  9.447   1.00 31.92 ? 2095 HOH C O   1 
HETATM 4709 O O   . HOH L 4 .   ? 22.991 -6.303  9.331   1.00 30.22 ? 2096 HOH C O   1 
HETATM 4710 O O   . HOH L 4 .   ? 31.067 -3.176  7.452   1.00 41.28 ? 2097 HOH C O   1 
HETATM 4711 O O   . HOH L 4 .   ? 27.147 -4.037  7.872   1.00 39.63 ? 2098 HOH C O   1 
HETATM 4712 O O   . HOH L 4 .   ? 25.176 -6.235  7.896   1.00 38.10 ? 2099 HOH C O   1 
HETATM 4713 O O   . HOH L 4 .   ? 25.828 -5.166  3.444   1.00 41.71 ? 2100 HOH C O   1 
HETATM 4714 O O   . HOH L 4 .   ? 22.186 -12.971 7.082   1.00 23.22 ? 2101 HOH C O   1 
HETATM 4715 O O   . HOH L 4 .   ? 14.302 -9.739  8.591   1.00 40.56 ? 2102 HOH C O   1 
HETATM 4716 O O   . HOH L 4 .   ? 11.383 -14.938 8.585   1.00 45.88 ? 2103 HOH C O   1 
HETATM 4717 O O   . HOH L 4 .   ? 17.754 -18.242 10.799  1.00 37.25 ? 2104 HOH C O   1 
HETATM 4718 O O   . HOH L 4 .   ? 44.117 -12.335 -4.196  1.00 36.05 ? 2105 HOH C O   1 
HETATM 4719 O O   . HOH L 4 .   ? 18.428 -22.146 4.603   1.00 34.56 ? 2106 HOH C O   1 
HETATM 4720 O O   . HOH L 4 .   ? 48.365 -13.190 -3.622  1.00 40.82 ? 2107 HOH C O   1 
HETATM 4721 O O   . HOH L 4 .   ? 41.867 -18.510 7.496   1.00 31.79 ? 2108 HOH C O   1 
HETATM 4722 O O   . HOH L 4 .   ? 42.576 -6.999  6.636   1.00 44.13 ? 2109 HOH C O   1 
HETATM 4723 O O   . HOH L 4 .   ? 21.515 -17.491 2.143   1.00 39.56 ? 2110 HOH C O   1 
HETATM 4724 O O   . HOH L 4 .   ? 12.800 -13.013 9.574   1.00 41.26 ? 2111 HOH C O   1 
HETATM 4725 O O   . HOH L 4 .   ? 15.948 -16.351 12.757  1.00 46.39 ? 2112 HOH C O   1 
HETATM 4726 O O   . HOH L 4 .   ? 18.881 -14.969 12.543  1.00 36.51 ? 2113 HOH C O   1 
HETATM 4727 O O   . HOH L 4 .   ? 30.361 -5.638  -7.100  1.00 32.60 ? 2114 HOH C O   1 
HETATM 4728 O O   . HOH L 4 .   ? 20.316 -23.349 5.546   1.00 40.87 ? 2115 HOH C O   1 
HETATM 4729 O O   . HOH L 4 .   ? 25.189 -22.350 3.747   1.00 25.56 ? 2116 HOH C O   1 
HETATM 4730 O O   . HOH L 4 .   ? 18.620 -17.254 13.703  1.00 46.15 ? 2117 HOH C O   1 
HETATM 4731 O O   . HOH L 4 .   ? 19.103 -20.177 11.858  1.00 43.85 ? 2118 HOH C O   1 
HETATM 4732 O O   . HOH L 4 .   ? 21.405 -14.854 11.841  1.00 30.83 ? 2119 HOH C O   1 
HETATM 4733 O O   . HOH L 4 .   ? 47.008 -19.093 -2.746  1.00 38.01 ? 2120 HOH C O   1 
HETATM 4734 O O   . HOH L 4 .   ? 41.373 -28.297 -10.325 1.00 39.16 ? 2121 HOH C O   1 
HETATM 4735 O O   . HOH L 4 .   ? 43.350 -28.870 -6.670  1.00 36.13 ? 2122 HOH C O   1 
HETATM 4736 O O   . HOH L 4 .   ? 24.791 -20.827 14.951  1.00 32.33 ? 2123 HOH C O   1 
HETATM 4737 O O   . HOH L 4 .   ? 34.853 -25.505 6.499   1.00 29.13 ? 2124 HOH C O   1 
HETATM 4738 O O   . HOH L 4 .   ? 31.583 -27.472 4.081   1.00 46.87 ? 2125 HOH C O   1 
HETATM 4739 O O   . HOH L 4 .   ? 38.734 -20.637 13.552  1.00 32.06 ? 2126 HOH C O   1 
HETATM 4740 O O   . HOH L 4 .   ? 35.876 -28.977 11.013  1.00 33.64 ? 2127 HOH C O   1 
HETATM 4741 O O   . HOH L 4 .   ? 32.098 -29.428 9.254   1.00 38.60 ? 2128 HOH C O   1 
HETATM 4742 O O   . HOH L 4 .   ? 32.455 -5.356  -10.939 1.00 45.24 ? 2129 HOH C O   1 
HETATM 4743 O O   . HOH L 4 .   ? 41.729 -13.950 12.124  1.00 42.85 ? 2130 HOH C O   1 
HETATM 4744 O O   . HOH L 4 .   ? 36.229 -15.200 15.391  1.00 32.32 ? 2131 HOH C O   1 
HETATM 4745 O O   . HOH L 4 .   ? 30.431 -2.968  -8.006  1.00 43.87 ? 2132 HOH C O   1 
HETATM 4746 O O   . HOH L 4 .   ? 40.013 -28.407 12.838  1.00 39.14 ? 2133 HOH C O   1 
HETATM 4747 O O   . HOH L 4 .   ? 36.474 -24.115 14.159  1.00 31.12 ? 2134 HOH C O   1 
HETATM 4748 O O   . HOH L 4 .   ? 37.949 -26.998 11.702  1.00 26.90 ? 2135 HOH C O   1 
HETATM 4749 O O   . HOH L 4 .   ? 40.117 -23.423 16.726  1.00 44.71 ? 2136 HOH C O   1 
HETATM 4750 O O   . HOH L 4 .   ? 44.415 -10.637 -9.187  1.00 37.12 ? 2137 HOH C O   1 
HETATM 4751 O O   . HOH L 4 .   ? 36.971 -26.944 6.779   1.00 36.15 ? 2138 HOH C O   1 
HETATM 4752 O O   . HOH L 4 .   ? 47.409 -26.273 9.526   1.00 35.40 ? 2139 HOH C O   1 
HETATM 4753 O O   . HOH L 4 .   ? 44.230 -18.452 9.089   1.00 41.76 ? 2140 HOH C O   1 
HETATM 4754 O O   . HOH L 4 .   ? 41.612 -17.490 15.167  1.00 41.86 ? 2141 HOH C O   1 
HETATM 4755 O O   . HOH L 4 .   ? 41.273 -20.931 14.547  1.00 40.08 ? 2142 HOH C O   1 
HETATM 4756 O O   . HOH L 4 .   ? 23.299 -20.239 -5.840  1.00 44.45 ? 2143 HOH C O   1 
HETATM 4757 O O   . HOH L 4 .   ? 22.935 -27.849 6.402   1.00 38.90 ? 2144 HOH C O   1 
HETATM 4758 O O   . HOH L 4 .   ? 36.879 -28.947 2.955   1.00 42.66 ? 2145 HOH C O   1 
HETATM 4759 O O   . HOH M 4 .   ? 43.030 -31.165 -5.389  1.00 48.19 ? 2001 HOH D O   1 
HETATM 4760 O O   . HOH M 4 .   ? 38.250 -28.166 -6.504  1.00 36.72 ? 2002 HOH D O   1 
HETATM 4761 O O   . HOH M 4 .   ? 32.454 -28.707 -2.434  1.00 44.14 ? 2003 HOH D O   1 
HETATM 4762 O O   . HOH M 4 .   ? 35.191 -28.794 -9.181  1.00 42.78 ? 2004 HOH D O   1 
HETATM 4763 O O   . HOH M 4 .   ? 37.591 -25.955 -8.224  1.00 37.85 ? 2005 HOH D O   1 
HETATM 4764 O O   . HOH M 4 .   ? 28.329 -23.612 -9.526  1.00 43.25 ? 2006 HOH D O   1 
HETATM 4765 O O   . HOH M 4 .   ? 24.970 -20.244 -8.386  1.00 46.24 ? 2007 HOH D O   1 
HETATM 4766 O O   . HOH N 4 .   ? 21.168 -0.900  35.331  1.00 39.67 ? 2001 HOH E O   1 
HETATM 4767 O O   . HOH N 4 .   ? 25.124 -0.164  34.957  1.00 41.33 ? 2002 HOH E O   1 
HETATM 4768 O O   . HOH N 4 .   ? 18.335 -11.632 21.500  1.00 37.77 ? 2003 HOH E O   1 
HETATM 4769 O O   . HOH N 4 .   ? 18.615 -0.902  35.318  1.00 42.84 ? 2004 HOH E O   1 
HETATM 4770 O O   . HOH N 4 .   ? 27.407 1.558   34.628  1.00 42.44 ? 2005 HOH E O   1 
HETATM 4771 O O   . HOH N 4 .   ? 26.904 7.786   35.072  1.00 46.88 ? 2006 HOH E O   1 
HETATM 4772 O O   . HOH N 4 .   ? 26.835 8.132   37.515  1.00 47.45 ? 2007 HOH E O   1 
HETATM 4773 O O   . HOH N 4 .   ? 25.906 14.086  30.773  1.00 32.86 ? 2008 HOH E O   1 
HETATM 4774 O O   . HOH N 4 .   ? 24.253 -13.622 18.920  1.00 44.00 ? 2009 HOH E O   1 
HETATM 4775 O O   . HOH N 4 .   ? 32.589 12.298  28.274  1.00 40.34 ? 2010 HOH E O   1 
HETATM 4776 O O   . HOH N 4 .   ? 31.536 8.606   28.586  1.00 30.21 ? 2011 HOH E O   1 
HETATM 4777 O O   . HOH N 4 .   ? 29.623 14.340  30.279  1.00 39.15 ? 2012 HOH E O   1 
HETATM 4778 O O   . HOH N 4 .   ? 29.133 -0.109  12.410  1.00 44.24 ? 2013 HOH E O   1 
HETATM 4779 O O   . HOH N 4 .   ? 31.946 6.045   23.478  1.00 30.86 ? 2014 HOH E O   1 
HETATM 4780 O O   . HOH N 4 .   ? 29.603 7.169   33.441  1.00 46.93 ? 2015 HOH E O   1 
HETATM 4781 O O   . HOH N 4 .   ? 26.435 5.280   31.686  1.00 34.51 ? 2016 HOH E O   1 
HETATM 4782 O O   . HOH N 4 .   ? 27.290 3.287   29.819  1.00 31.51 ? 2017 HOH E O   1 
HETATM 4783 O O   . HOH N 4 .   ? 29.447 3.199   27.568  1.00 28.21 ? 2018 HOH E O   1 
HETATM 4784 O O   . HOH N 4 .   ? 24.248 1.878   36.656  1.00 44.25 ? 2019 HOH E O   1 
HETATM 4785 O O   . HOH N 4 .   ? 13.432 3.453   22.302  1.00 23.31 ? 2020 HOH E O   1 
HETATM 4786 O O   . HOH N 4 .   ? 10.336 7.930   26.569  1.00 32.97 ? 2021 HOH E O   1 
HETATM 4787 O O   . HOH N 4 .   ? 5.915  3.413   25.203  1.00 42.13 ? 2022 HOH E O   1 
HETATM 4788 O O   . HOH N 4 .   ? 9.502  9.602   24.297  1.00 37.88 ? 2023 HOH E O   1 
HETATM 4789 O O   . HOH N 4 .   ? 23.308 14.747  26.611  1.00 25.64 ? 2024 HOH E O   1 
HETATM 4790 O O   . HOH N 4 .   ? 29.410 14.623  22.375  1.00 30.01 ? 2025 HOH E O   1 
HETATM 4791 O O   . HOH N 4 .   ? 31.589 16.497  27.087  1.00 43.58 ? 2026 HOH E O   1 
HETATM 4792 O O   . HOH N 4 .   ? 26.847 20.035  28.103  1.00 43.17 ? 2027 HOH E O   1 
HETATM 4793 O O   . HOH N 4 .   ? 26.836 16.790  28.231  1.00 39.02 ? 2028 HOH E O   1 
HETATM 4794 O O   . HOH N 4 .   ? 30.333 20.769  27.312  1.00 45.97 ? 2029 HOH E O   1 
HETATM 4795 O O   . HOH N 4 .   ? 31.925 17.974  23.758  1.00 44.01 ? 2030 HOH E O   1 
HETATM 4796 O O   . HOH N 4 .   ? 29.098 24.334  21.408  1.00 45.36 ? 2031 HOH E O   1 
HETATM 4797 O O   . HOH N 4 .   ? 30.374 19.484  11.887  1.00 41.31 ? 2032 HOH E O   1 
HETATM 4798 O O   . HOH N 4 .   ? 26.846 21.104  19.390  1.00 36.63 ? 2033 HOH E O   1 
HETATM 4799 O O   . HOH N 4 .   ? 33.081 20.026  10.188  1.00 47.83 ? 2034 HOH E O   1 
HETATM 4800 O O   . HOH N 4 .   ? 40.981 4.391   19.211  1.00 41.86 ? 2035 HOH E O   1 
HETATM 4801 O O   . HOH N 4 .   ? 30.702 7.460   14.257  1.00 44.23 ? 2036 HOH E O   1 
HETATM 4802 O O   . HOH N 4 .   ? 32.192 15.172  13.856  1.00 37.50 ? 2037 HOH E O   1 
HETATM 4803 O O   . HOH N 4 .   ? 25.091 19.136  12.434  1.00 40.40 ? 2038 HOH E O   1 
HETATM 4804 O O   . HOH N 4 .   ? 24.621 15.272  12.569  1.00 36.84 ? 2039 HOH E O   1 
HETATM 4805 O O   . HOH N 4 .   ? 28.291 16.143  12.158  1.00 37.04 ? 2040 HOH E O   1 
HETATM 4806 O O   . HOH N 4 .   ? 19.293 25.670  17.979  1.00 43.94 ? 2041 HOH E O   1 
HETATM 4807 O O   . HOH N 4 .   ? 22.791 22.373  11.950  1.00 43.52 ? 2042 HOH E O   1 
HETATM 4808 O O   . HOH N 4 .   ? 19.218 22.121  23.300  1.00 38.58 ? 2043 HOH E O   1 
HETATM 4809 O O   . HOH N 4 .   ? 14.734 24.904  28.541  1.00 46.26 ? 2044 HOH E O   1 
HETATM 4810 O O   . HOH N 4 .   ? 18.309 21.345  25.918  1.00 38.92 ? 2045 HOH E O   1 
HETATM 4811 O O   . HOH N 4 .   ? 9.149  17.408  26.883  1.00 40.78 ? 2046 HOH E O   1 
HETATM 4812 O O   . HOH N 4 .   ? 17.755 19.275  29.134  1.00 33.96 ? 2047 HOH E O   1 
HETATM 4813 O O   . HOH N 4 .   ? 10.169 25.810  31.706  1.00 44.55 ? 2048 HOH E O   1 
HETATM 4814 O O   . HOH N 4 .   ? 7.837  17.778  24.730  1.00 45.31 ? 2049 HOH E O   1 
HETATM 4815 O O   . HOH N 4 .   ? 7.474  16.520  33.335  1.00 45.45 ? 2050 HOH E O   1 
HETATM 4816 O O   . HOH N 4 .   ? 10.741 19.901  37.816  1.00 32.55 ? 2051 HOH E O   1 
HETATM 4817 O O   . HOH N 4 .   ? 13.086 17.807  37.222  1.00 34.74 ? 2052 HOH E O   1 
HETATM 4818 O O   . HOH N 4 .   ? 9.919  13.791  30.458  1.00 40.83 ? 2053 HOH E O   1 
HETATM 4819 O O   . HOH N 4 .   ? 14.763 11.890  35.101  1.00 40.04 ? 2054 HOH E O   1 
HETATM 4820 O O   . HOH N 4 .   ? 18.607 20.514  31.355  1.00 32.53 ? 2055 HOH E O   1 
HETATM 4821 O O   . HOH N 4 .   ? 23.482 16.046  30.468  1.00 37.27 ? 2056 HOH E O   1 
HETATM 4822 O O   . HOH N 4 .   ? 16.636 13.512  33.829  1.00 30.98 ? 2057 HOH E O   1 
HETATM 4823 O O   . HOH N 4 .   ? 15.559 16.877  36.086  1.00 26.40 ? 2058 HOH E O   1 
HETATM 4824 O O   . HOH N 4 .   ? 21.654 17.174  27.650  1.00 34.20 ? 2059 HOH E O   1 
HETATM 4825 O O   . HOH N 4 .   ? 24.781 6.172   18.014  1.00 21.60 ? 2060 HOH E O   1 
HETATM 4826 O O   . HOH N 4 .   ? 23.762 3.318   11.253  1.00 36.20 ? 2061 HOH E O   1 
HETATM 4827 O O   . HOH N 4 .   ? 14.648 4.307   13.067  1.00 41.75 ? 2062 HOH E O   1 
HETATM 4828 O O   . HOH N 4 .   ? 19.950 -2.937  8.749   1.00 38.68 ? 2063 HOH E O   1 
HETATM 4829 O O   . HOH N 4 .   ? 17.228 0.594   12.054  1.00 33.86 ? 2064 HOH E O   1 
HETATM 4830 O O   . HOH N 4 .   ? 18.152 -2.550  11.150  1.00 35.52 ? 2065 HOH E O   1 
HETATM 4831 O O   . HOH N 4 .   ? 12.589 6.345   12.455  1.00 42.44 ? 2066 HOH E O   1 
HETATM 4832 O O   . HOH N 4 .   ? 20.496 9.354   7.990   1.00 45.54 ? 2067 HOH E O   1 
HETATM 4833 O O   . HOH N 4 .   ? 16.405 3.919   10.828  1.00 34.35 ? 2068 HOH E O   1 
HETATM 4834 O O   . HOH N 4 .   ? 27.374 2.874   13.956  1.00 42.29 ? 2069 HOH E O   1 
HETATM 4835 O O   . HOH N 4 .   ? 25.506 5.165   10.597  1.00 39.95 ? 2070 HOH E O   1 
HETATM 4836 O O   . HOH N 4 .   ? 9.776  13.740  20.719  1.00 44.69 ? 2071 HOH E O   1 
HETATM 4837 O O   . HOH N 4 .   ? 10.717 11.647  23.791  1.00 34.96 ? 2072 HOH E O   1 
HETATM 4838 O O   . HOH N 4 .   ? 11.525 12.866  26.305  1.00 31.96 ? 2073 HOH E O   1 
HETATM 4839 O O   . HOH N 4 .   ? 20.245 3.168   35.218  1.00 36.20 ? 2074 HOH E O   1 
HETATM 4840 O O   . HOH N 4 .   ? 13.544 4.570   35.699  1.00 45.09 ? 2075 HOH E O   1 
HETATM 4841 O O   . HOH N 4 .   ? 14.969 2.857   31.329  1.00 39.60 ? 2076 HOH E O   1 
HETATM 4842 O O   . HOH N 4 .   ? 16.213 2.367   29.000  1.00 34.96 ? 2077 HOH E O   1 
HETATM 4843 O O   . HOH N 4 .   ? 16.593 4.249   34.179  1.00 30.29 ? 2078 HOH E O   1 
HETATM 4844 O O   . HOH N 4 .   ? 24.398 -3.095  30.427  1.00 27.91 ? 2079 HOH E O   1 
HETATM 4845 O O   . HOH N 4 .   ? 23.232 -0.977  33.229  1.00 33.52 ? 2080 HOH E O   1 
HETATM 4846 O O   . HOH N 4 .   ? 29.640 -0.193  27.684  1.00 34.53 ? 2081 HOH E O   1 
HETATM 4847 O O   . HOH N 4 .   ? 30.925 -4.673  33.443  1.00 42.97 ? 2082 HOH E O   1 
HETATM 4848 O O   . HOH N 4 .   ? 27.929 -9.017  32.667  1.00 41.94 ? 2083 HOH E O   1 
HETATM 4849 O O   . HOH N 4 .   ? 23.616 -10.567 35.642  1.00 39.11 ? 2084 HOH E O   1 
HETATM 4850 O O   . HOH N 4 .   ? 27.252 -6.903  28.224  1.00 36.30 ? 2085 HOH E O   1 
HETATM 4851 O O   . HOH N 4 .   ? 18.865 -11.768 24.333  1.00 31.81 ? 2086 HOH E O   1 
HETATM 4852 O O   . HOH N 4 .   ? 13.266 -6.444  34.655  1.00 43.48 ? 2087 HOH E O   1 
HETATM 4853 O O   . HOH N 4 .   ? 12.510 -7.449  28.012  1.00 35.01 ? 2088 HOH E O   1 
HETATM 4854 O O   . HOH N 4 .   ? 11.784 -7.237  30.842  1.00 40.45 ? 2089 HOH E O   1 
HETATM 4855 O O   . HOH N 4 .   ? 15.395 0.095   29.134  1.00 32.77 ? 2090 HOH E O   1 
HETATM 4856 O O   . HOH N 4 .   ? 16.635 -1.512  33.716  1.00 42.53 ? 2091 HOH E O   1 
HETATM 4857 O O   . HOH N 4 .   ? 14.150 -4.199  31.122  1.00 40.48 ? 2092 HOH E O   1 
HETATM 4858 O O   . HOH N 4 .   ? 14.518 -3.779  22.895  1.00 24.99 ? 2093 HOH E O   1 
HETATM 4859 O O   . HOH N 4 .   ? 13.304 -5.000  28.695  1.00 36.90 ? 2094 HOH E O   1 
HETATM 4860 O O   . HOH N 4 .   ? 8.522  -1.882  25.402  1.00 37.26 ? 2095 HOH E O   1 
HETATM 4861 O O   . HOH N 4 .   ? 13.869 -5.694  21.214  1.00 25.19 ? 2096 HOH E O   1 
HETATM 4862 O O   . HOH N 4 .   ? 6.924  -11.898 15.537  1.00 39.69 ? 2097 HOH E O   1 
HETATM 4863 O O   . HOH N 4 .   ? 14.323 -11.119 15.647  1.00 32.96 ? 2098 HOH E O   1 
HETATM 4864 O O   . HOH N 4 .   ? 27.270 4.375   34.046  1.00 43.70 ? 2099 HOH E O   1 
HETATM 4865 O O   . HOH N 4 .   ? 25.689 14.553  28.149  1.00 36.14 ? 2100 HOH E O   1 
HETATM 4866 O O   . HOH N 4 .   ? 14.286 -5.383  10.943  1.00 32.85 ? 2101 HOH E O   1 
HETATM 4867 O O   . HOH N 4 .   ? 7.990  -8.627  12.410  1.00 38.04 ? 2102 HOH E O   1 
HETATM 4868 O O   . HOH N 4 .   ? 7.597  -3.650  15.219  1.00 41.82 ? 2103 HOH E O   1 
HETATM 4869 O O   . HOH N 4 .   ? 32.209 3.270   24.224  1.00 32.38 ? 2104 HOH E O   1 
HETATM 4870 O O   . HOH N 4 .   ? 31.007 1.963   26.555  1.00 42.09 ? 2105 HOH E O   1 
HETATM 4871 O O   . HOH N 4 .   ? 29.981 3.197   29.703  1.00 45.67 ? 2106 HOH E O   1 
HETATM 4872 O O   . HOH N 4 .   ? 10.691 10.680  27.636  1.00 32.98 ? 2107 HOH E O   1 
HETATM 4873 O O   . HOH N 4 .   ? 15.926 -1.344  11.138  1.00 44.08 ? 2108 HOH E O   1 
HETATM 4874 O O   . HOH N 4 .   ? 19.222 -1.548  13.413  1.00 27.98 ? 2109 HOH E O   1 
HETATM 4875 O O   . HOH N 4 .   ? 16.573 -10.108 20.082  1.00 38.20 ? 2110 HOH E O   1 
HETATM 4876 O O   . HOH N 4 .   ? 14.437 -12.175 19.132  1.00 40.67 ? 2111 HOH E O   1 
HETATM 4877 O O   . HOH N 4 .   ? 17.168 -12.595 15.373  1.00 46.38 ? 2112 HOH E O   1 
HETATM 4878 O O   . HOH N 4 .   ? 31.610 15.019  23.932  1.00 41.15 ? 2113 HOH E O   1 
HETATM 4879 O O   . HOH N 4 .   ? 27.730 18.773  11.153  1.00 39.09 ? 2114 HOH E O   1 
HETATM 4880 O O   . HOH N 4 .   ? 23.030 -11.564 17.555  1.00 28.19 ? 2115 HOH E O   1 
HETATM 4881 O O   . HOH N 4 .   ? 29.157 1.179   14.970  1.00 23.72 ? 2116 HOH E O   1 
HETATM 4882 O O   . HOH N 4 .   ? 33.260 -2.301  13.110  1.00 36.21 ? 2117 HOH E O   1 
HETATM 4883 O O   . HOH N 4 .   ? 30.044 5.546   16.190  1.00 39.57 ? 2118 HOH E O   1 
HETATM 4884 O O   . HOH N 4 .   ? 13.717 25.639  30.920  1.00 42.90 ? 2119 HOH E O   1 
HETATM 4885 O O   . HOH N 4 .   ? 10.111 14.787  27.483  1.00 40.05 ? 2120 HOH E O   1 
HETATM 4886 O O   . HOH N 4 .   ? 20.089 21.943  29.673  1.00 43.55 ? 2121 HOH E O   1 
HETATM 4887 O O   . HOH N 4 .   ? 36.465 1.391   24.544  1.00 42.64 ? 2122 HOH E O   1 
HETATM 4888 O O   . HOH N 4 .   ? 31.664 -0.555  29.393  1.00 39.85 ? 2123 HOH E O   1 
HETATM 4889 O O   . HOH N 4 .   ? 7.393  15.046  30.513  1.00 46.32 ? 2124 HOH E O   1 
HETATM 4890 O O   . HOH N 4 .   ? 11.101 16.139  38.317  1.00 44.51 ? 2125 HOH E O   1 
HETATM 4891 O O   . HOH N 4 .   ? 9.085  11.415  30.133  1.00 43.61 ? 2126 HOH E O   1 
HETATM 4892 O O   . HOH N 4 .   ? 37.655 -2.641  16.427  1.00 39.66 ? 2127 HOH E O   1 
HETATM 4893 O O   . HOH N 4 .   ? 16.627 -5.009  10.626  1.00 36.77 ? 2128 HOH E O   1 
HETATM 4894 O O   . HOH N 4 .   ? 45.222 -4.598  17.823  1.00 39.60 ? 2129 HOH E O   1 
HETATM 4895 O O   . HOH N 4 .   ? 46.372 -3.173  23.155  1.00 42.13 ? 2130 HOH E O   1 
HETATM 4896 O O   . HOH N 4 .   ? 44.456 0.293   22.819  1.00 43.16 ? 2131 HOH E O   1 
HETATM 4897 O O   . HOH O 4 .   ? 26.844 14.471  10.909  1.00 40.70 ? 2001 HOH F O   1 
HETATM 4898 O O   . HOH O 4 .   ? 22.878 14.736  9.216   1.00 48.05 ? 2002 HOH F O   1 
HETATM 4899 O O   . HOH O 4 .   ? 11.266 8.006   19.219  1.00 39.50 ? 2003 HOH F O   1 
HETATM 4900 O O   . HOH O 4 .   ? 10.525 6.146   14.033  1.00 42.30 ? 2004 HOH F O   1 
HETATM 4901 O O   . HOH P 4 .   ? 35.612 -33.376 12.435  1.00 37.70 ? 2001 HOH G O   1 
HETATM 4902 O O   . HOH P 4 .   ? 21.683 -23.479 16.724  1.00 34.88 ? 2002 HOH G O   1 
HETATM 4903 O O   . HOH P 4 .   ? 34.277 -33.376 10.140  1.00 42.46 ? 2003 HOH G O   1 
HETATM 4904 O O   . HOH P 4 .   ? 38.868 -41.182 20.232  1.00 44.50 ? 2004 HOH G O   1 
HETATM 4905 O O   . HOH P 4 .   ? 35.669 -48.041 19.462  1.00 39.43 ? 2005 HOH G O   1 
HETATM 4906 O O   . HOH P 4 .   ? 38.480 -45.641 15.699  1.00 47.02 ? 2006 HOH G O   1 
HETATM 4907 O O   . HOH P 4 .   ? 26.151 -23.758 20.666  1.00 40.22 ? 2007 HOH G O   1 
HETATM 4908 O O   . HOH P 4 .   ? 37.008 -48.131 22.262  1.00 39.96 ? 2008 HOH G O   1 
HETATM 4909 O O   . HOH P 4 .   ? 36.328 -46.150 26.507  1.00 43.06 ? 2009 HOH G O   1 
HETATM 4910 O O   . HOH P 4 .   ? 31.565 -39.924 28.052  1.00 41.02 ? 2010 HOH G O   1 
HETATM 4911 O O   . HOH P 4 .   ? 27.183 -32.049 36.071  1.00 46.59 ? 2011 HOH G O   1 
HETATM 4912 O O   . HOH P 4 .   ? 29.703 -59.874 12.839  1.00 45.08 ? 2012 HOH G O   1 
HETATM 4913 O O   . HOH P 4 .   ? 35.964 -42.100 25.243  1.00 36.76 ? 2013 HOH G O   1 
HETATM 4914 O O   . HOH P 4 .   ? 35.809 -39.352 19.200  1.00 38.44 ? 2014 HOH G O   1 
HETATM 4915 O O   . HOH P 4 .   ? 35.822 -38.156 24.337  1.00 40.56 ? 2015 HOH G O   1 
HETATM 4916 O O   . HOH P 4 .   ? 20.331 -39.446 32.840  1.00 40.44 ? 2016 HOH G O   1 
HETATM 4917 O O   . HOH P 4 .   ? 33.593 -37.175 24.077  1.00 33.61 ? 2017 HOH G O   1 
HETATM 4918 O O   . HOH P 4 .   ? 34.371 -37.155 20.810  1.00 28.43 ? 2018 HOH G O   1 
HETATM 4919 O O   . HOH P 4 .   ? 28.122 -37.288 11.458  1.00 32.39 ? 2019 HOH G O   1 
HETATM 4920 O O   . HOH P 4 .   ? 23.716 -43.477 8.077   1.00 38.20 ? 2020 HOH G O   1 
HETATM 4921 O O   . HOH P 4 .   ? 22.756 -39.580 5.030   1.00 43.50 ? 2021 HOH G O   1 
HETATM 4922 O O   . HOH P 4 .   ? 21.128 -45.295 8.811   1.00 42.33 ? 2022 HOH G O   1 
HETATM 4923 O O   . HOH P 4 .   ? 20.963 -39.058 12.482  1.00 27.05 ? 2023 HOH G O   1 
HETATM 4924 O O   . HOH P 4 .   ? 27.475 -35.119 10.582  1.00 35.35 ? 2024 HOH G O   1 
HETATM 4925 O O   . HOH P 4 .   ? 26.789 -36.016 7.997   1.00 47.67 ? 2025 HOH G O   1 
HETATM 4926 O O   . HOH P 4 .   ? 21.463 -31.807 13.038  1.00 23.22 ? 2026 HOH G O   1 
HETATM 4927 O O   . HOH P 4 .   ? 30.988 -49.264 19.410  1.00 28.15 ? 2027 HOH G O   1 
HETATM 4928 O O   . HOH P 4 .   ? 30.062 -48.780 26.818  1.00 34.31 ? 2028 HOH G O   1 
HETATM 4929 O O   . HOH P 4 .   ? 34.163 -51.021 21.916  1.00 41.99 ? 2029 HOH G O   1 
HETATM 4930 O O   . HOH P 4 .   ? 35.678 -50.518 26.286  1.00 44.37 ? 2030 HOH G O   1 
HETATM 4931 O O   . HOH P 4 .   ? 27.205 -56.126 26.272  1.00 40.86 ? 2031 HOH G O   1 
HETATM 4932 O O   . HOH P 4 .   ? 29.282 -59.662 31.031  1.00 43.60 ? 2032 HOH G O   1 
HETATM 4933 O O   . HOH P 4 .   ? 25.184 -49.952 33.651  1.00 36.31 ? 2033 HOH G O   1 
HETATM 4934 O O   . HOH P 4 .   ? 21.357 -50.838 31.577  1.00 34.07 ? 2034 HOH G O   1 
HETATM 4935 O O   . HOH P 4 .   ? 17.969 -58.140 25.945  1.00 41.27 ? 2035 HOH G O   1 
HETATM 4936 O O   . HOH P 4 .   ? 22.249 -60.678 20.963  1.00 41.24 ? 2036 HOH G O   1 
HETATM 4937 O O   . HOH P 4 .   ? 14.193 -52.517 19.099  1.00 44.68 ? 2037 HOH G O   1 
HETATM 4938 O O   . HOH P 4 .   ? 16.560 -57.788 23.439  1.00 43.78 ? 2038 HOH G O   1 
HETATM 4939 O O   . HOH P 4 .   ? 26.909 -57.071 18.029  1.00 38.90 ? 2039 HOH G O   1 
HETATM 4940 O O   . HOH P 4 .   ? 28.609 -56.141 16.146  1.00 39.01 ? 2040 HOH G O   1 
HETATM 4941 O O   . HOH P 4 .   ? 24.020 -60.965 19.114  1.00 46.22 ? 2041 HOH G O   1 
HETATM 4942 O O   . HOH P 4 .   ? 19.152 -60.040 8.827   1.00 46.00 ? 2042 HOH G O   1 
HETATM 4943 O O   . HOH P 4 .   ? 24.761 -52.729 7.382   1.00 38.12 ? 2043 HOH G O   1 
HETATM 4944 O O   . HOH P 4 .   ? 31.028 -54.253 13.668  1.00 31.43 ? 2044 HOH G O   1 
HETATM 4945 O O   . HOH P 4 .   ? 29.859 -61.090 6.382   1.00 46.88 ? 2045 HOH G O   1 
HETATM 4946 O O   . HOH P 4 .   ? 21.995 -52.674 7.135   1.00 46.94 ? 2046 HOH G O   1 
HETATM 4947 O O   . HOH P 4 .   ? 35.695 -53.000 5.752   1.00 36.89 ? 2047 HOH G O   1 
HETATM 4948 O O   . HOH P 4 .   ? 27.400 -49.224 6.067   1.00 41.22 ? 2048 HOH G O   1 
HETATM 4949 O O   . HOH P 4 .   ? 34.105 -47.514 7.715   1.00 41.55 ? 2049 HOH G O   1 
HETATM 4950 O O   . HOH P 4 .   ? 33.512 -55.446 13.295  1.00 38.07 ? 2050 HOH G O   1 
HETATM 4951 O O   . HOH P 4 .   ? 33.893 -48.219 10.121  1.00 30.24 ? 2051 HOH G O   1 
HETATM 4952 O O   . HOH P 4 .   ? 35.080 -50.412 18.271  1.00 39.86 ? 2052 HOH G O   1 
HETATM 4953 O O   . HOH P 4 .   ? 31.791 -51.403 17.950  1.00 37.76 ? 2053 HOH G O   1 
HETATM 4954 O O   . HOH P 4 .   ? 30.953 -54.212 16.520  1.00 37.15 ? 2054 HOH G O   1 
HETATM 4955 O O   . HOH P 4 .   ? 36.515 -47.825 11.995  1.00 37.14 ? 2055 HOH G O   1 
HETATM 4956 O O   . HOH P 4 .   ? 23.182 -41.278 24.714  1.00 24.39 ? 2056 HOH G O   1 
HETATM 4957 O O   . HOH P 4 .   ? 16.568 -38.980 27.774  1.00 36.56 ? 2057 HOH G O   1 
HETATM 4958 O O   . HOH P 4 .   ? 13.295 -33.148 22.527  1.00 35.26 ? 2058 HOH G O   1 
HETATM 4959 O O   . HOH P 4 .   ? 13.966 -36.557 21.145  1.00 31.96 ? 2059 HOH G O   1 
HETATM 4960 O O   . HOH P 4 .   ? 14.024 -42.402 28.124  1.00 44.98 ? 2060 HOH G O   1 
HETATM 4961 O O   . HOH P 4 .   ? 13.207 -45.178 26.501  1.00 35.84 ? 2061 HOH G O   1 
HETATM 4962 O O   . HOH P 4 .   ? 12.764 -40.020 21.221  1.00 39.59 ? 2062 HOH G O   1 
HETATM 4963 O O   . HOH P 4 .   ? 17.763 -40.542 29.395  1.00 32.67 ? 2063 HOH G O   1 
HETATM 4964 O O   . HOH P 4 .   ? 21.092 -38.018 28.884  1.00 38.84 ? 2064 HOH G O   1 
HETATM 4965 O O   . HOH P 4 .   ? 23.859 -41.434 29.456  1.00 44.88 ? 2065 HOH G O   1 
HETATM 4966 O O   . HOH P 4 .   ? 21.870 -47.324 10.078  1.00 43.73 ? 2066 HOH G O   1 
HETATM 4967 O O   . HOH P 4 .   ? 18.439 -44.224 12.576  1.00 39.67 ? 2067 HOH G O   1 
HETATM 4968 O O   . HOH P 4 .   ? 24.573 -48.251 9.352   1.00 33.62 ? 2068 HOH G O   1 
HETATM 4969 O O   . HOH P 4 .   ? 35.526 -37.448 12.096  1.00 39.55 ? 2069 HOH G O   1 
HETATM 4970 O O   . HOH P 4 .   ? 29.234 -37.998 9.069   1.00 40.30 ? 2070 HOH G O   1 
HETATM 4971 O O   . HOH P 4 .   ? 31.150 -45.925 4.970   1.00 43.95 ? 2071 HOH G O   1 
HETATM 4972 O O   . HOH P 4 .   ? 23.138 -41.923 5.500   1.00 45.49 ? 2072 HOH G O   1 
HETATM 4973 O O   . HOH P 4 .   ? 33.142 -38.928 9.573   1.00 34.54 ? 2073 HOH G O   1 
HETATM 4974 O O   . HOH P 4 .   ? 34.855 -33.121 15.366  1.00 33.81 ? 2074 HOH G O   1 
HETATM 4975 O O   . HOH P 4 .   ? 35.984 -29.350 24.380  1.00 40.00 ? 2075 HOH G O   1 
HETATM 4976 O O   . HOH P 4 .   ? 37.731 -28.514 22.338  1.00 45.76 ? 2076 HOH G O   1 
HETATM 4977 O O   . HOH P 4 .   ? 38.605 -29.792 14.849  1.00 41.17 ? 2077 HOH G O   1 
HETATM 4978 O O   . HOH P 4 .   ? 36.081 -25.119 19.555  1.00 34.51 ? 2078 HOH G O   1 
HETATM 4979 O O   . HOH P 4 .   ? 32.930 -31.151 17.914  1.00 24.24 ? 2079 HOH G O   1 
HETATM 4980 O O   . HOH P 4 .   ? 24.009 -23.313 15.559  1.00 27.85 ? 2080 HOH G O   1 
HETATM 4981 O O   . HOH P 4 .   ? 24.493 -27.580 8.607   1.00 31.48 ? 2081 HOH G O   1 
HETATM 4982 O O   . HOH P 4 .   ? 26.365 -28.034 6.475   1.00 29.43 ? 2082 HOH G O   1 
HETATM 4983 O O   . HOH P 4 .   ? 32.630 -27.655 7.502   1.00 39.43 ? 2083 HOH G O   1 
HETATM 4984 O O   . HOH P 4 .   ? 29.970 -28.620 5.528   1.00 40.29 ? 2084 HOH G O   1 
HETATM 4985 O O   . HOH P 4 .   ? 31.801 -32.956 9.435   1.00 41.56 ? 2085 HOH G O   1 
HETATM 4986 O O   . HOH P 4 .   ? 28.186 -30.967 8.374   1.00 38.44 ? 2086 HOH G O   1 
HETATM 4987 O O   . HOH P 4 .   ? 19.454 -29.781 13.341  1.00 25.48 ? 2087 HOH G O   1 
HETATM 4988 O O   . HOH P 4 .   ? 25.791 -30.336 8.939   1.00 33.10 ? 2088 HOH G O   1 
HETATM 4989 O O   . HOH P 4 .   ? 20.678 -33.571 7.079   1.00 39.71 ? 2089 HOH G O   1 
HETATM 4990 O O   . HOH P 4 .   ? 15.936 -32.535 8.687   1.00 37.00 ? 2090 HOH G O   1 
HETATM 4991 O O   . HOH P 4 .   ? 15.217 -24.955 6.410   1.00 46.14 ? 2091 HOH G O   1 
HETATM 4992 O O   . HOH P 4 .   ? 10.652 -24.797 10.609  1.00 39.27 ? 2092 HOH G O   1 
HETATM 4993 O O   . HOH P 4 .   ? 9.999  -25.294 17.128  1.00 43.88 ? 2093 HOH G O   1 
HETATM 4994 O O   . HOH P 4 .   ? 11.007 -30.337 18.855  1.00 40.99 ? 2094 HOH G O   1 
HETATM 4995 O O   . HOH P 4 .   ? 36.106 -50.600 23.141  1.00 40.73 ? 2095 HOH G O   1 
HETATM 4996 O O   . HOH P 4 .   ? 32.390 -37.293 27.243  1.00 44.62 ? 2096 HOH G O   1 
HETATM 4997 O O   . HOH P 4 .   ? 15.391 -33.826 15.525  1.00 37.69 ? 2097 HOH G O   1 
HETATM 4998 O O   . HOH P 4 .   ? 17.525 -23.588 14.812  1.00 34.26 ? 2098 HOH G O   1 
HETATM 4999 O O   . HOH P 4 .   ? 13.306 -24.054 9.430   1.00 43.08 ? 2099 HOH G O   1 
HETATM 5000 O O   . HOH P 4 .   ? 25.285 -46.048 7.861   1.00 34.09 ? 2100 HOH G O   1 
HETATM 5001 O O   . HOH P 4 .   ? 27.685 -38.168 7.051   1.00 42.07 ? 2101 HOH G O   1 
HETATM 5002 O O   . HOH P 4 .   ? 15.737 -34.154 21.859  1.00 28.27 ? 2102 HOH G O   1 
HETATM 5003 O O   . HOH P 4 .   ? 19.705 -25.253 15.807  1.00 35.71 ? 2103 HOH G O   1 
HETATM 5004 O O   . HOH P 4 .   ? 32.225 -49.074 28.239  1.00 44.27 ? 2104 HOH G O   1 
HETATM 5005 O O   . HOH P 4 .   ? 28.165 -24.856 21.346  1.00 42.05 ? 2105 HOH G O   1 
HETATM 5006 O O   . HOH P 4 .   ? 20.053 -23.667 22.733  1.00 40.65 ? 2106 HOH G O   1 
HETATM 5007 O O   . HOH P 4 .   ? 22.191 -35.860 29.884  1.00 31.58 ? 2107 HOH G O   1 
HETATM 5008 O O   . HOH P 4 .   ? 19.910 -53.031 31.123  1.00 44.47 ? 2108 HOH G O   1 
HETATM 5009 O O   . HOH P 4 .   ? 25.631 -32.266 34.024  1.00 38.81 ? 2109 HOH G O   1 
HETATM 5010 O O   . HOH P 4 .   ? 28.566 -57.412 20.079  1.00 45.96 ? 2110 HOH G O   1 
HETATM 5011 O O   . HOH P 4 .   ? 29.750 -58.204 14.832  1.00 42.58 ? 2111 HOH G O   1 
HETATM 5012 O O   . HOH P 4 .   ? 24.083 -39.070 31.685  1.00 44.43 ? 2112 HOH G O   1 
HETATM 5013 O O   . HOH P 4 .   ? 25.596 -50.179 7.930   1.00 35.93 ? 2113 HOH G O   1 
HETATM 5014 O O   . HOH P 4 .   ? 30.871 -28.432 27.839  1.00 37.17 ? 2114 HOH G O   1 
HETATM 5015 O O   . HOH P 4 .   ? 26.612 -46.528 5.574   1.00 42.74 ? 2115 HOH G O   1 
HETATM 5016 O O   . HOH P 4 .   ? 27.417 -29.062 31.325  1.00 39.07 ? 2116 HOH G O   1 
HETATM 5017 O O   . HOH P 4 .   ? 32.904 -53.839 18.247  1.00 41.76 ? 2117 HOH G O   1 
HETATM 5018 O O   . HOH P 4 .   ? 23.468 -36.403 32.181  1.00 41.20 ? 2118 HOH G O   1 
HETATM 5019 O O   . HOH P 4 .   ? 34.936 -37.068 29.222  1.00 49.44 ? 2119 HOH G O   1 
HETATM 5020 O O   . HOH P 4 .   ? 12.030 -30.655 21.182  1.00 42.92 ? 2120 HOH G O   1 
HETATM 5021 O O   . HOH P 4 .   ? 20.046 -49.286 9.093   1.00 44.19 ? 2121 HOH G O   1 
HETATM 5022 O O   . HOH Q 4 .   ? 19.125 -49.378 30.566  1.00 40.29 ? 2001 HOH H O   1 
HETATM 5023 O O   . HOH Q 4 .   ? 16.021 -42.783 29.623  1.00 35.67 ? 2002 HOH H O   1 
HETATM 5024 O O   . HOH Q 4 .   ? 14.965 -43.281 32.283  1.00 45.29 ? 2003 HOH H O   1 
HETATM 5025 O O   . HOH Q 4 .   ? 19.583 -50.009 28.079  1.00 35.65 ? 2004 HOH H O   1 
HETATM 5026 O O   . HOH Q 4 .   ? 15.598 -50.032 29.206  1.00 36.45 ? 2005 HOH H O   1 
HETATM 5027 O O   . HOH Q 4 .   ? 12.446 -49.948 25.305  1.00 44.05 ? 2006 HOH H O   1 
HETATM 5028 O O   . HOH Q 4 .   ? 12.889 -48.054 19.195  1.00 39.58 ? 2007 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1074 ?    ?   ?   A . n 
A 1 2   GLY 2   1075 ?    ?   ?   A . n 
A 1 3   SER 3   1076 ?    ?   ?   A . n 
A 1 4   GLU 4   1077 ?    ?   ?   A . n 
A 1 5   ASP 5   1078 ?    ?   ?   A . n 
A 1 6   GLU 6   1079 ?    ?   ?   A . n 
A 1 7   ASP 7   1080 1080 ASP ASP A . n 
A 1 8   SER 8   1081 1081 SER SER A . n 
A 1 9   PRO 9   1082 1082 PRO PRO A . n 
A 1 10  LEU 10  1083 1083 LEU LEU A . n 
A 1 11  ASP 11  1084 1084 ASP ASP A . n 
A 1 12  ALA 12  1085 1085 ALA ALA A . n 
A 1 13  LEU 13  1086 1086 LEU LEU A . n 
A 1 14  ASP 14  1087 1087 ASP ASP A . n 
A 1 15  LEU 15  1088 1088 LEU LEU A . n 
A 1 16  VAL 16  1089 1089 VAL VAL A . n 
A 1 17  TRP 17  1090 1090 TRP TRP A . n 
A 1 18  ALA 18  1091 1091 ALA ALA A . n 
A 1 19  LYS 19  1092 1092 LYS LYS A . n 
A 1 20  CYS 20  1093 1093 CYS CYS A . n 
A 1 21  ARG 21  1094 1094 ARG ARG A . n 
A 1 22  GLY 22  1095 1095 GLY GLY A . n 
A 1 23  TYR 23  1096 1096 TYR TYR A . n 
A 1 24  PRO 24  1097 1097 PRO PRO A . n 
A 1 25  SER 25  1098 1098 SER SER A . n 
A 1 26  TYR 26  1099 1099 TYR TYR A . n 
A 1 27  PRO 27  1100 1100 PRO PRO A . n 
A 1 28  ALA 28  1101 1101 ALA ALA A . n 
A 1 29  LEU 29  1102 1102 LEU LEU A . n 
A 1 30  ILE 30  1103 1103 ILE ILE A . n 
A 1 31  ILE 31  1104 1104 ILE ILE A . n 
A 1 32  ASP 32  1105 1105 ASP ASP A . n 
A 1 33  PRO 33  1106 1106 PRO PRO A . n 
A 1 34  LYS 34  1107 1107 LYS LYS A . n 
A 1 35  MET 35  1108 1108 MET MET A . n 
A 1 36  PRO 36  1109 1109 PRO PRO A . n 
A 1 37  ARG 37  1110 1110 ARG ARG A . n 
A 1 38  GLU 38  1111 1111 GLU GLU A . n 
A 1 39  GLY 39  1112 1112 GLY GLY A . n 
A 1 40  MET 40  1113 1113 MET MET A . n 
A 1 41  PHE 41  1114 1114 PHE PHE A . n 
A 1 42  HIS 42  1115 1115 HIS HIS A . n 
A 1 43  HIS 43  1116 1116 HIS HIS A . n 
A 1 44  GLY 44  1117 1117 GLY GLY A . n 
A 1 45  VAL 45  1118 1118 VAL VAL A . n 
A 1 46  PRO 46  1119 1119 PRO PRO A . n 
A 1 47  ILE 47  1120 1120 ILE ILE A . n 
A 1 48  PRO 48  1121 1121 PRO PRO A . n 
A 1 49  VAL 49  1122 1122 VAL VAL A . n 
A 1 50  PRO 50  1123 1123 PRO PRO A . n 
A 1 51  PRO 51  1124 1124 PRO PRO A . n 
A 1 52  LEU 52  1125 1125 LEU LEU A . n 
A 1 53  GLU 53  1126 1126 GLU GLU A . n 
A 1 54  VAL 54  1127 1127 VAL VAL A . n 
A 1 55  LEU 55  1128 1128 LEU LEU A . n 
A 1 56  LYS 56  1129 1129 LYS LYS A . n 
A 1 57  LEU 57  1130 1130 LEU LEU A . n 
A 1 58  GLY 58  1131 1131 GLY GLY A . n 
A 1 59  GLU 59  1132 1132 GLU GLU A . n 
A 1 60  GLN 60  1133 1133 GLN GLN A . n 
A 1 61  MET 61  1134 1134 MET MET A . n 
A 1 62  THR 62  1135 1135 THR THR A . n 
A 1 63  GLN 63  1136 1136 GLN GLN A . n 
A 1 64  GLU 64  1137 1137 GLU GLU A . n 
A 1 65  ALA 65  1138 1138 ALA ALA A . n 
A 1 66  ARG 66  1139 1139 ARG ARG A . n 
A 1 67  GLU 67  1140 1140 GLU GLU A . n 
A 1 68  HIS 68  1141 1141 HIS HIS A . n 
A 1 69  LEU 69  1142 1142 LEU LEU A . n 
A 1 70  TYR 70  1143 1143 TYR TYR A . n 
A 1 71  LEU 71  1144 1144 LEU LEU A . n 
A 1 72  VAL 72  1145 1145 VAL VAL A . n 
A 1 73  LEU 73  1146 1146 LEU LEU A . n 
A 1 74  PHE 74  1147 1147 PHE PHE A . n 
A 1 75  PHE 75  1148 1148 PHE PHE A . n 
A 1 76  ASP 76  1149 1149 ASP ASP A . n 
A 1 77  ASN 77  1150 1150 ASN ASN A . n 
A 1 78  LYS 78  1151 1151 LYS LYS A . n 
A 1 79  ARG 79  1152 1152 ARG ARG A . n 
A 1 80  THR 80  1153 1153 THR THR A . n 
A 1 81  TRP 81  1154 1154 TRP TRP A . n 
A 1 82  GLN 82  1155 1155 GLN GLN A . n 
A 1 83  TRP 83  1156 1156 TRP TRP A . n 
A 1 84  LEU 84  1157 1157 LEU LEU A . n 
A 1 85  PRO 85  1158 1158 PRO PRO A . n 
A 1 86  ARG 86  1159 1159 ARG ARG A . n 
A 1 87  THR 87  1160 1160 THR THR A . n 
A 1 88  LYS 88  1161 1161 LYS LYS A . n 
A 1 89  LEU 89  1162 1162 LEU LEU A . n 
A 1 90  VAL 90  1163 1163 VAL VAL A . n 
A 1 91  PRO 91  1164 1164 PRO PRO A . n 
A 1 92  LEU 92  1165 1165 LEU LEU A . n 
A 1 93  GLY 93  1166 1166 GLY GLY A . n 
A 1 94  VAL 94  1167 1167 VAL VAL A . n 
A 1 95  ASN 95  1168 1168 ASN ASN A . n 
A 1 96  GLN 96  1169 1169 GLN GLN A . n 
A 1 97  ASP 97  1170 1170 ASP ASP A . n 
A 1 98  LEU 98  1171 1171 LEU LEU A . n 
A 1 99  ASP 99  1172 1172 ASP ASP A . n 
A 1 100 LYS 100 1173 1173 LYS LYS A . n 
A 1 101 GLU 101 1174 1174 GLU GLU A . n 
A 1 102 LYS 102 1175 1175 LYS LYS A . n 
A 1 103 MET 103 1176 1176 MET MET A . n 
A 1 104 LEU 104 1177 1177 LEU LEU A . n 
A 1 105 GLU 105 1178 1178 GLU GLU A . n 
A 1 106 GLY 106 1179 1179 GLY GLY A . n 
A 1 107 ARG 107 1180 1180 ARG ARG A . n 
A 1 108 LYS 108 1181 1181 LYS LYS A . n 
A 1 109 SER 109 1182 1182 SER SER A . n 
A 1 110 ASN 110 1183 1183 ASN ASN A . n 
A 1 111 ILE 111 1184 1184 ILE ILE A . n 
A 1 112 ARG 112 1185 1185 ARG ARG A . n 
A 1 113 LYS 113 1186 1186 LYS LYS A . n 
A 1 114 SER 114 1187 1187 SER SER A . n 
A 1 115 VAL 115 1188 1188 VAL VAL A . n 
A 1 116 GLN 116 1189 1189 GLN GLN A . n 
A 1 117 ILE 117 1190 1190 ILE ILE A . n 
A 1 118 ALA 118 1191 1191 ALA ALA A . n 
A 1 119 TYR 119 1192 1192 TYR TYR A . n 
A 1 120 HIS 120 1193 1193 HIS HIS A . n 
A 1 121 ARG 121 1194 1194 ARG ARG A . n 
A 1 122 ALA 122 1195 1195 ALA ALA A . n 
A 1 123 LEU 123 1196 1196 LEU LEU A . n 
A 1 124 GLN 124 1197 1197 GLN GLN A . n 
A 1 125 HIS 125 1198 1198 HIS HIS A . n 
A 1 126 ARG 126 1199 1199 ARG ARG A . n 
A 1 127 SER 127 1200 1200 SER SER A . n 
A 1 128 LYS 128 1201 1201 LYS LYS A . n 
A 1 129 VAL 129 1202 1202 VAL VAL A . n 
A 1 130 GLN 130 1203 1203 GLN GLN A . n 
A 1 131 GLY 131 1204 1204 GLY GLY A . n 
A 1 132 GLU 132 1205 1205 GLU GLU A . n 
B 2 1   THR 1   22   ?    ?   ?   B . n 
B 2 2   LYS 2   23   ?    ?   ?   B . n 
B 2 3   ALA 3   24   ?    ?   ?   B . n 
B 2 4   ALA 4   25   ?    ?   ?   B . n 
B 2 5   ARG 5   26   ?    ?   ?   B . n 
B 2 6   LYS 6   27   ?    ?   ?   B . n 
B 2 7   SER 7   28   28   SER SER B . n 
B 2 8   ALA 8   29   29   ALA ALA B . n 
B 2 9   PRO 9   30   30   PRO PRO B . n 
B 2 10  ALA 10  31   31   ALA ALA B . n 
B 2 11  THR 11  32   32   THR THR B . n 
B 2 12  GLY 12  33   33   GLY GLY B . n 
B 2 13  GLY 13  34   34   GLY GLY B . n 
B 2 14  VAL 14  35   35   VAL VAL B . n 
B 2 15  M3L 15  36   36   M3L M3L B . n 
B 2 16  LYS 16  37   37   LYS LYS B . n 
B 2 17  PRO 17  38   38   PRO PRO B . n 
B 2 18  HIS 18  39   39   HIS HIS B . n 
B 2 19  ARG 19  40   40   ARG ARG B . n 
B 2 20  TYR 20  41   41   TYR TYR B . n 
B 2 21  ARG 21  42   ?    ?   ?   B . n 
C 1 1   GLY 1   1074 ?    ?   ?   C . n 
C 1 2   GLY 2   1075 ?    ?   ?   C . n 
C 1 3   SER 3   1076 ?    ?   ?   C . n 
C 1 4   GLU 4   1077 ?    ?   ?   C . n 
C 1 5   ASP 5   1078 ?    ?   ?   C . n 
C 1 6   GLU 6   1079 ?    ?   ?   C . n 
C 1 7   ASP 7   1080 1080 ASP ASP C . n 
C 1 8   SER 8   1081 1081 SER SER C . n 
C 1 9   PRO 9   1082 1082 PRO PRO C . n 
C 1 10  LEU 10  1083 1083 LEU LEU C . n 
C 1 11  ASP 11  1084 1084 ASP ASP C . n 
C 1 12  ALA 12  1085 1085 ALA ALA C . n 
C 1 13  LEU 13  1086 1086 LEU LEU C . n 
C 1 14  ASP 14  1087 1087 ASP ASP C . n 
C 1 15  LEU 15  1088 1088 LEU LEU C . n 
C 1 16  VAL 16  1089 1089 VAL VAL C . n 
C 1 17  TRP 17  1090 1090 TRP TRP C . n 
C 1 18  ALA 18  1091 1091 ALA ALA C . n 
C 1 19  LYS 19  1092 1092 LYS LYS C . n 
C 1 20  CYS 20  1093 1093 CYS CYS C . n 
C 1 21  ARG 21  1094 1094 ARG ARG C . n 
C 1 22  GLY 22  1095 1095 GLY GLY C . n 
C 1 23  TYR 23  1096 1096 TYR TYR C . n 
C 1 24  PRO 24  1097 1097 PRO PRO C . n 
C 1 25  SER 25  1098 1098 SER SER C . n 
C 1 26  TYR 26  1099 1099 TYR TYR C . n 
C 1 27  PRO 27  1100 1100 PRO PRO C . n 
C 1 28  ALA 28  1101 1101 ALA ALA C . n 
C 1 29  LEU 29  1102 1102 LEU LEU C . n 
C 1 30  ILE 30  1103 1103 ILE ILE C . n 
C 1 31  ILE 31  1104 1104 ILE ILE C . n 
C 1 32  ASP 32  1105 1105 ASP ASP C . n 
C 1 33  PRO 33  1106 1106 PRO PRO C . n 
C 1 34  LYS 34  1107 1107 LYS LYS C . n 
C 1 35  MET 35  1108 1108 MET MET C . n 
C 1 36  PRO 36  1109 1109 PRO PRO C . n 
C 1 37  ARG 37  1110 1110 ARG ARG C . n 
C 1 38  GLU 38  1111 1111 GLU GLU C . n 
C 1 39  GLY 39  1112 1112 GLY GLY C . n 
C 1 40  MET 40  1113 1113 MET MET C . n 
C 1 41  PHE 41  1114 1114 PHE PHE C . n 
C 1 42  HIS 42  1115 1115 HIS HIS C . n 
C 1 43  HIS 43  1116 1116 HIS HIS C . n 
C 1 44  GLY 44  1117 1117 GLY GLY C . n 
C 1 45  VAL 45  1118 1118 VAL VAL C . n 
C 1 46  PRO 46  1119 1119 PRO PRO C . n 
C 1 47  ILE 47  1120 1120 ILE ILE C . n 
C 1 48  PRO 48  1121 1121 PRO PRO C . n 
C 1 49  VAL 49  1122 1122 VAL VAL C . n 
C 1 50  PRO 50  1123 1123 PRO PRO C . n 
C 1 51  PRO 51  1124 1124 PRO PRO C . n 
C 1 52  LEU 52  1125 1125 LEU LEU C . n 
C 1 53  GLU 53  1126 1126 GLU GLU C . n 
C 1 54  VAL 54  1127 1127 VAL VAL C . n 
C 1 55  LEU 55  1128 1128 LEU LEU C . n 
C 1 56  LYS 56  1129 1129 LYS LYS C . n 
C 1 57  LEU 57  1130 1130 LEU LEU C . n 
C 1 58  GLY 58  1131 1131 GLY GLY C . n 
C 1 59  GLU 59  1132 1132 GLU GLU C . n 
C 1 60  GLN 60  1133 1133 GLN GLN C . n 
C 1 61  MET 61  1134 1134 MET MET C . n 
C 1 62  THR 62  1135 1135 THR THR C . n 
C 1 63  GLN 63  1136 1136 GLN GLN C . n 
C 1 64  GLU 64  1137 1137 GLU GLU C . n 
C 1 65  ALA 65  1138 1138 ALA ALA C . n 
C 1 66  ARG 66  1139 1139 ARG ARG C . n 
C 1 67  GLU 67  1140 1140 GLU GLU C . n 
C 1 68  HIS 68  1141 1141 HIS HIS C . n 
C 1 69  LEU 69  1142 1142 LEU LEU C . n 
C 1 70  TYR 70  1143 1143 TYR TYR C . n 
C 1 71  LEU 71  1144 1144 LEU LEU C . n 
C 1 72  VAL 72  1145 1145 VAL VAL C . n 
C 1 73  LEU 73  1146 1146 LEU LEU C . n 
C 1 74  PHE 74  1147 1147 PHE PHE C . n 
C 1 75  PHE 75  1148 1148 PHE PHE C . n 
C 1 76  ASP 76  1149 1149 ASP ASP C . n 
C 1 77  ASN 77  1150 1150 ASN ASN C . n 
C 1 78  LYS 78  1151 1151 LYS LYS C . n 
C 1 79  ARG 79  1152 1152 ARG ARG C . n 
C 1 80  THR 80  1153 1153 THR THR C . n 
C 1 81  TRP 81  1154 1154 TRP TRP C . n 
C 1 82  GLN 82  1155 1155 GLN GLN C . n 
C 1 83  TRP 83  1156 1156 TRP TRP C . n 
C 1 84  LEU 84  1157 1157 LEU LEU C . n 
C 1 85  PRO 85  1158 1158 PRO PRO C . n 
C 1 86  ARG 86  1159 1159 ARG ARG C . n 
C 1 87  THR 87  1160 1160 THR THR C . n 
C 1 88  LYS 88  1161 1161 LYS LYS C . n 
C 1 89  LEU 89  1162 1162 LEU LEU C . n 
C 1 90  VAL 90  1163 1163 VAL VAL C . n 
C 1 91  PRO 91  1164 1164 PRO PRO C . n 
C 1 92  LEU 92  1165 1165 LEU LEU C . n 
C 1 93  GLY 93  1166 1166 GLY GLY C . n 
C 1 94  VAL 94  1167 1167 VAL VAL C . n 
C 1 95  ASN 95  1168 1168 ASN ASN C . n 
C 1 96  GLN 96  1169 1169 GLN GLN C . n 
C 1 97  ASP 97  1170 1170 ASP ASP C . n 
C 1 98  LEU 98  1171 1171 LEU LEU C . n 
C 1 99  ASP 99  1172 1172 ASP ASP C . n 
C 1 100 LYS 100 1173 1173 LYS LYS C . n 
C 1 101 GLU 101 1174 1174 GLU GLU C . n 
C 1 102 LYS 102 1175 1175 LYS LYS C . n 
C 1 103 MET 103 1176 1176 MET MET C . n 
C 1 104 LEU 104 1177 1177 LEU LEU C . n 
C 1 105 GLU 105 1178 1178 GLU GLU C . n 
C 1 106 GLY 106 1179 1179 GLY GLY C . n 
C 1 107 ARG 107 1180 1180 ARG ARG C . n 
C 1 108 LYS 108 1181 1181 LYS LYS C . n 
C 1 109 SER 109 1182 1182 SER SER C . n 
C 1 110 ASN 110 1183 1183 ASN ASN C . n 
C 1 111 ILE 111 1184 1184 ILE ILE C . n 
C 1 112 ARG 112 1185 1185 ARG ARG C . n 
C 1 113 LYS 113 1186 1186 LYS LYS C . n 
C 1 114 SER 114 1187 1187 SER SER C . n 
C 1 115 VAL 115 1188 1188 VAL VAL C . n 
C 1 116 GLN 116 1189 1189 GLN GLN C . n 
C 1 117 ILE 117 1190 1190 ILE ILE C . n 
C 1 118 ALA 118 1191 1191 ALA ALA C . n 
C 1 119 TYR 119 1192 1192 TYR TYR C . n 
C 1 120 HIS 120 1193 1193 HIS HIS C . n 
C 1 121 ARG 121 1194 1194 ARG ARG C . n 
C 1 122 ALA 122 1195 1195 ALA ALA C . n 
C 1 123 LEU 123 1196 1196 LEU LEU C . n 
C 1 124 GLN 124 1197 1197 GLN GLN C . n 
C 1 125 HIS 125 1198 1198 HIS HIS C . n 
C 1 126 ARG 126 1199 1199 ARG ARG C . n 
C 1 127 SER 127 1200 1200 SER SER C . n 
C 1 128 LYS 128 1201 1201 LYS LYS C . n 
C 1 129 VAL 129 1202 1202 VAL VAL C . n 
C 1 130 GLN 130 1203 1203 GLN GLN C . n 
C 1 131 GLY 131 1204 1204 GLY GLY C . n 
C 1 132 GLU 132 1205 ?    ?   ?   C . n 
D 2 1   THR 1   22   ?    ?   ?   D . n 
D 2 2   LYS 2   23   ?    ?   ?   D . n 
D 2 3   ALA 3   24   ?    ?   ?   D . n 
D 2 4   ALA 4   25   ?    ?   ?   D . n 
D 2 5   ARG 5   26   ?    ?   ?   D . n 
D 2 6   LYS 6   27   ?    ?   ?   D . n 
D 2 7   SER 7   28   28   SER SER D . n 
D 2 8   ALA 8   29   29   ALA ALA D . n 
D 2 9   PRO 9   30   30   PRO PRO D . n 
D 2 10  ALA 10  31   31   ALA ALA D . n 
D 2 11  THR 11  32   32   THR THR D . n 
D 2 12  GLY 12  33   33   GLY GLY D . n 
D 2 13  GLY 13  34   34   GLY GLY D . n 
D 2 14  VAL 14  35   35   VAL VAL D . n 
D 2 15  M3L 15  36   36   M3L M3L D . n 
D 2 16  LYS 16  37   37   LYS LYS D . n 
D 2 17  PRO 17  38   38   PRO PRO D . n 
D 2 18  HIS 18  39   39   HIS HIS D . n 
D 2 19  ARG 19  40   ?    ?   ?   D . n 
D 2 20  TYR 20  41   ?    ?   ?   D . n 
D 2 21  ARG 21  42   ?    ?   ?   D . n 
E 1 1   GLY 1   1074 ?    ?   ?   E . n 
E 1 2   GLY 2   1075 ?    ?   ?   E . n 
E 1 3   SER 3   1076 ?    ?   ?   E . n 
E 1 4   GLU 4   1077 ?    ?   ?   E . n 
E 1 5   ASP 5   1078 ?    ?   ?   E . n 
E 1 6   GLU 6   1079 ?    ?   ?   E . n 
E 1 7   ASP 7   1080 1080 ASP ASP E . n 
E 1 8   SER 8   1081 1081 SER SER E . n 
E 1 9   PRO 9   1082 1082 PRO PRO E . n 
E 1 10  LEU 10  1083 1083 LEU LEU E . n 
E 1 11  ASP 11  1084 1084 ASP ASP E . n 
E 1 12  ALA 12  1085 1085 ALA ALA E . n 
E 1 13  LEU 13  1086 1086 LEU LEU E . n 
E 1 14  ASP 14  1087 1087 ASP ASP E . n 
E 1 15  LEU 15  1088 1088 LEU LEU E . n 
E 1 16  VAL 16  1089 1089 VAL VAL E . n 
E 1 17  TRP 17  1090 1090 TRP TRP E . n 
E 1 18  ALA 18  1091 1091 ALA ALA E . n 
E 1 19  LYS 19  1092 1092 LYS LYS E . n 
E 1 20  CYS 20  1093 1093 CYS CYS E . n 
E 1 21  ARG 21  1094 1094 ARG ARG E . n 
E 1 22  GLY 22  1095 1095 GLY GLY E . n 
E 1 23  TYR 23  1096 1096 TYR TYR E . n 
E 1 24  PRO 24  1097 1097 PRO PRO E . n 
E 1 25  SER 25  1098 1098 SER SER E . n 
E 1 26  TYR 26  1099 1099 TYR TYR E . n 
E 1 27  PRO 27  1100 1100 PRO PRO E . n 
E 1 28  ALA 28  1101 1101 ALA ALA E . n 
E 1 29  LEU 29  1102 1102 LEU LEU E . n 
E 1 30  ILE 30  1103 1103 ILE ILE E . n 
E 1 31  ILE 31  1104 1104 ILE ILE E . n 
E 1 32  ASP 32  1105 1105 ASP ASP E . n 
E 1 33  PRO 33  1106 1106 PRO PRO E . n 
E 1 34  LYS 34  1107 1107 LYS LYS E . n 
E 1 35  MET 35  1108 1108 MET MET E . n 
E 1 36  PRO 36  1109 1109 PRO PRO E . n 
E 1 37  ARG 37  1110 1110 ARG ARG E . n 
E 1 38  GLU 38  1111 1111 GLU GLU E . n 
E 1 39  GLY 39  1112 1112 GLY GLY E . n 
E 1 40  MET 40  1113 1113 MET MET E . n 
E 1 41  PHE 41  1114 1114 PHE PHE E . n 
E 1 42  HIS 42  1115 1115 HIS HIS E . n 
E 1 43  HIS 43  1116 1116 HIS HIS E . n 
E 1 44  GLY 44  1117 1117 GLY GLY E . n 
E 1 45  VAL 45  1118 1118 VAL VAL E . n 
E 1 46  PRO 46  1119 1119 PRO PRO E . n 
E 1 47  ILE 47  1120 1120 ILE ILE E . n 
E 1 48  PRO 48  1121 1121 PRO PRO E . n 
E 1 49  VAL 49  1122 1122 VAL VAL E . n 
E 1 50  PRO 50  1123 1123 PRO PRO E . n 
E 1 51  PRO 51  1124 1124 PRO PRO E . n 
E 1 52  LEU 52  1125 1125 LEU LEU E . n 
E 1 53  GLU 53  1126 1126 GLU GLU E . n 
E 1 54  VAL 54  1127 1127 VAL VAL E . n 
E 1 55  LEU 55  1128 1128 LEU LEU E . n 
E 1 56  LYS 56  1129 1129 LYS LYS E . n 
E 1 57  LEU 57  1130 1130 LEU LEU E . n 
E 1 58  GLY 58  1131 1131 GLY GLY E . n 
E 1 59  GLU 59  1132 1132 GLU GLU E . n 
E 1 60  GLN 60  1133 1133 GLN GLN E . n 
E 1 61  MET 61  1134 1134 MET MET E . n 
E 1 62  THR 62  1135 1135 THR THR E . n 
E 1 63  GLN 63  1136 1136 GLN GLN E . n 
E 1 64  GLU 64  1137 1137 GLU GLU E . n 
E 1 65  ALA 65  1138 1138 ALA ALA E . n 
E 1 66  ARG 66  1139 1139 ARG ARG E . n 
E 1 67  GLU 67  1140 1140 GLU GLU E . n 
E 1 68  HIS 68  1141 1141 HIS HIS E . n 
E 1 69  LEU 69  1142 1142 LEU LEU E . n 
E 1 70  TYR 70  1143 1143 TYR TYR E . n 
E 1 71  LEU 71  1144 1144 LEU LEU E . n 
E 1 72  VAL 72  1145 1145 VAL VAL E . n 
E 1 73  LEU 73  1146 1146 LEU LEU E . n 
E 1 74  PHE 74  1147 1147 PHE PHE E . n 
E 1 75  PHE 75  1148 1148 PHE PHE E . n 
E 1 76  ASP 76  1149 1149 ASP ASP E . n 
E 1 77  ASN 77  1150 1150 ASN ASN E . n 
E 1 78  LYS 78  1151 1151 LYS LYS E . n 
E 1 79  ARG 79  1152 1152 ARG ARG E . n 
E 1 80  THR 80  1153 1153 THR THR E . n 
E 1 81  TRP 81  1154 1154 TRP TRP E . n 
E 1 82  GLN 82  1155 1155 GLN GLN E . n 
E 1 83  TRP 83  1156 1156 TRP TRP E . n 
E 1 84  LEU 84  1157 1157 LEU LEU E . n 
E 1 85  PRO 85  1158 1158 PRO PRO E . n 
E 1 86  ARG 86  1159 1159 ARG ARG E . n 
E 1 87  THR 87  1160 1160 THR THR E . n 
E 1 88  LYS 88  1161 1161 LYS LYS E . n 
E 1 89  LEU 89  1162 1162 LEU LEU E . n 
E 1 90  VAL 90  1163 1163 VAL VAL E . n 
E 1 91  PRO 91  1164 1164 PRO PRO E . n 
E 1 92  LEU 92  1165 1165 LEU LEU E . n 
E 1 93  GLY 93  1166 1166 GLY GLY E . n 
E 1 94  VAL 94  1167 1167 VAL VAL E . n 
E 1 95  ASN 95  1168 1168 ASN ASN E . n 
E 1 96  GLN 96  1169 1169 GLN GLN E . n 
E 1 97  ASP 97  1170 1170 ASP ASP E . n 
E 1 98  LEU 98  1171 1171 LEU LEU E . n 
E 1 99  ASP 99  1172 1172 ASP ASP E . n 
E 1 100 LYS 100 1173 1173 LYS LYS E . n 
E 1 101 GLU 101 1174 1174 GLU GLU E . n 
E 1 102 LYS 102 1175 1175 LYS LYS E . n 
E 1 103 MET 103 1176 1176 MET MET E . n 
E 1 104 LEU 104 1177 1177 LEU LEU E . n 
E 1 105 GLU 105 1178 1178 GLU GLU E . n 
E 1 106 GLY 106 1179 1179 GLY GLY E . n 
E 1 107 ARG 107 1180 1180 ARG ARG E . n 
E 1 108 LYS 108 1181 1181 LYS LYS E . n 
E 1 109 SER 109 1182 1182 SER SER E . n 
E 1 110 ASN 110 1183 1183 ASN ASN E . n 
E 1 111 ILE 111 1184 1184 ILE ILE E . n 
E 1 112 ARG 112 1185 1185 ARG ARG E . n 
E 1 113 LYS 113 1186 1186 LYS LYS E . n 
E 1 114 SER 114 1187 1187 SER SER E . n 
E 1 115 VAL 115 1188 1188 VAL VAL E . n 
E 1 116 GLN 116 1189 1189 GLN GLN E . n 
E 1 117 ILE 117 1190 1190 ILE ILE E . n 
E 1 118 ALA 118 1191 1191 ALA ALA E . n 
E 1 119 TYR 119 1192 1192 TYR TYR E . n 
E 1 120 HIS 120 1193 1193 HIS HIS E . n 
E 1 121 ARG 121 1194 1194 ARG ARG E . n 
E 1 122 ALA 122 1195 1195 ALA ALA E . n 
E 1 123 LEU 123 1196 1196 LEU LEU E . n 
E 1 124 GLN 124 1197 1197 GLN GLN E . n 
E 1 125 HIS 125 1198 1198 HIS HIS E . n 
E 1 126 ARG 126 1199 1199 ARG ARG E . n 
E 1 127 SER 127 1200 1200 SER SER E . n 
E 1 128 LYS 128 1201 1201 LYS LYS E . n 
E 1 129 VAL 129 1202 1202 VAL VAL E . n 
E 1 130 GLN 130 1203 1203 GLN GLN E . n 
E 1 131 GLY 131 1204 1204 GLY GLY E . n 
E 1 132 GLU 132 1205 1205 GLU GLU E . n 
F 2 1   THR 1   22   ?    ?   ?   F . n 
F 2 2   LYS 2   23   ?    ?   ?   F . n 
F 2 3   ALA 3   24   ?    ?   ?   F . n 
F 2 4   ALA 4   25   ?    ?   ?   F . n 
F 2 5   ARG 5   26   ?    ?   ?   F . n 
F 2 6   LYS 6   27   ?    ?   ?   F . n 
F 2 7   SER 7   28   28   SER SER F . n 
F 2 8   ALA 8   29   29   ALA ALA F . n 
F 2 9   PRO 9   30   30   PRO PRO F . n 
F 2 10  ALA 10  31   31   ALA ALA F . n 
F 2 11  THR 11  32   32   THR THR F . n 
F 2 12  GLY 12  33   33   GLY GLY F . n 
F 2 13  GLY 13  34   34   GLY GLY F . n 
F 2 14  VAL 14  35   35   VAL VAL F . n 
F 2 15  M3L 15  36   36   M3L M3L F . n 
F 2 16  LYS 16  37   37   LYS LYS F . n 
F 2 17  PRO 17  38   38   PRO PRO F . n 
F 2 18  HIS 18  39   ?    ?   ?   F . n 
F 2 19  ARG 19  40   ?    ?   ?   F . n 
F 2 20  TYR 20  41   ?    ?   ?   F . n 
F 2 21  ARG 21  42   ?    ?   ?   F . n 
G 1 1   GLY 1   1074 ?    ?   ?   G . n 
G 1 2   GLY 2   1075 ?    ?   ?   G . n 
G 1 3   SER 3   1076 ?    ?   ?   G . n 
G 1 4   GLU 4   1077 ?    ?   ?   G . n 
G 1 5   ASP 5   1078 ?    ?   ?   G . n 
G 1 6   GLU 6   1079 ?    ?   ?   G . n 
G 1 7   ASP 7   1080 ?    ?   ?   G . n 
G 1 8   SER 8   1081 ?    ?   ?   G . n 
G 1 9   PRO 9   1082 1082 PRO PRO G . n 
G 1 10  LEU 10  1083 1083 LEU LEU G . n 
G 1 11  ASP 11  1084 1084 ASP ASP G . n 
G 1 12  ALA 12  1085 1085 ALA ALA G . n 
G 1 13  LEU 13  1086 1086 LEU LEU G . n 
G 1 14  ASP 14  1087 1087 ASP ASP G . n 
G 1 15  LEU 15  1088 1088 LEU LEU G . n 
G 1 16  VAL 16  1089 1089 VAL VAL G . n 
G 1 17  TRP 17  1090 1090 TRP TRP G . n 
G 1 18  ALA 18  1091 1091 ALA ALA G . n 
G 1 19  LYS 19  1092 1092 LYS LYS G . n 
G 1 20  CYS 20  1093 1093 CYS CYS G . n 
G 1 21  ARG 21  1094 1094 ARG ARG G . n 
G 1 22  GLY 22  1095 1095 GLY GLY G . n 
G 1 23  TYR 23  1096 1096 TYR TYR G . n 
G 1 24  PRO 24  1097 1097 PRO PRO G . n 
G 1 25  SER 25  1098 1098 SER SER G . n 
G 1 26  TYR 26  1099 1099 TYR TYR G . n 
G 1 27  PRO 27  1100 1100 PRO PRO G . n 
G 1 28  ALA 28  1101 1101 ALA ALA G . n 
G 1 29  LEU 29  1102 1102 LEU LEU G . n 
G 1 30  ILE 30  1103 1103 ILE ILE G . n 
G 1 31  ILE 31  1104 1104 ILE ILE G . n 
G 1 32  ASP 32  1105 1105 ASP ASP G . n 
G 1 33  PRO 33  1106 1106 PRO PRO G . n 
G 1 34  LYS 34  1107 1107 LYS LYS G . n 
G 1 35  MET 35  1108 1108 MET MET G . n 
G 1 36  PRO 36  1109 1109 PRO PRO G . n 
G 1 37  ARG 37  1110 1110 ARG ARG G . n 
G 1 38  GLU 38  1111 1111 GLU GLU G . n 
G 1 39  GLY 39  1112 1112 GLY GLY G . n 
G 1 40  MET 40  1113 1113 MET MET G . n 
G 1 41  PHE 41  1114 1114 PHE PHE G . n 
G 1 42  HIS 42  1115 1115 HIS HIS G . n 
G 1 43  HIS 43  1116 1116 HIS HIS G . n 
G 1 44  GLY 44  1117 1117 GLY GLY G . n 
G 1 45  VAL 45  1118 1118 VAL VAL G . n 
G 1 46  PRO 46  1119 1119 PRO PRO G . n 
G 1 47  ILE 47  1120 1120 ILE ILE G . n 
G 1 48  PRO 48  1121 1121 PRO PRO G . n 
G 1 49  VAL 49  1122 1122 VAL VAL G . n 
G 1 50  PRO 50  1123 1123 PRO PRO G . n 
G 1 51  PRO 51  1124 1124 PRO PRO G . n 
G 1 52  LEU 52  1125 1125 LEU LEU G . n 
G 1 53  GLU 53  1126 1126 GLU GLU G . n 
G 1 54  VAL 54  1127 1127 VAL VAL G . n 
G 1 55  LEU 55  1128 1128 LEU LEU G . n 
G 1 56  LYS 56  1129 1129 LYS LYS G . n 
G 1 57  LEU 57  1130 1130 LEU LEU G . n 
G 1 58  GLY 58  1131 1131 GLY GLY G . n 
G 1 59  GLU 59  1132 1132 GLU GLU G . n 
G 1 60  GLN 60  1133 1133 GLN GLN G . n 
G 1 61  MET 61  1134 1134 MET MET G . n 
G 1 62  THR 62  1135 1135 THR THR G . n 
G 1 63  GLN 63  1136 1136 GLN GLN G . n 
G 1 64  GLU 64  1137 1137 GLU GLU G . n 
G 1 65  ALA 65  1138 1138 ALA ALA G . n 
G 1 66  ARG 66  1139 1139 ARG ARG G . n 
G 1 67  GLU 67  1140 1140 GLU GLU G . n 
G 1 68  HIS 68  1141 1141 HIS HIS G . n 
G 1 69  LEU 69  1142 1142 LEU LEU G . n 
G 1 70  TYR 70  1143 1143 TYR TYR G . n 
G 1 71  LEU 71  1144 1144 LEU LEU G . n 
G 1 72  VAL 72  1145 1145 VAL VAL G . n 
G 1 73  LEU 73  1146 1146 LEU LEU G . n 
G 1 74  PHE 74  1147 1147 PHE PHE G . n 
G 1 75  PHE 75  1148 1148 PHE PHE G . n 
G 1 76  ASP 76  1149 1149 ASP ASP G . n 
G 1 77  ASN 77  1150 1150 ASN ASN G . n 
G 1 78  LYS 78  1151 1151 LYS LYS G . n 
G 1 79  ARG 79  1152 1152 ARG ARG G . n 
G 1 80  THR 80  1153 1153 THR THR G . n 
G 1 81  TRP 81  1154 1154 TRP TRP G . n 
G 1 82  GLN 82  1155 1155 GLN GLN G . n 
G 1 83  TRP 83  1156 1156 TRP TRP G . n 
G 1 84  LEU 84  1157 1157 LEU LEU G . n 
G 1 85  PRO 85  1158 1158 PRO PRO G . n 
G 1 86  ARG 86  1159 1159 ARG ARG G . n 
G 1 87  THR 87  1160 1160 THR THR G . n 
G 1 88  LYS 88  1161 1161 LYS LYS G . n 
G 1 89  LEU 89  1162 1162 LEU LEU G . n 
G 1 90  VAL 90  1163 1163 VAL VAL G . n 
G 1 91  PRO 91  1164 1164 PRO PRO G . n 
G 1 92  LEU 92  1165 1165 LEU LEU G . n 
G 1 93  GLY 93  1166 1166 GLY GLY G . n 
G 1 94  VAL 94  1167 1167 VAL VAL G . n 
G 1 95  ASN 95  1168 1168 ASN ASN G . n 
G 1 96  GLN 96  1169 1169 GLN GLN G . n 
G 1 97  ASP 97  1170 1170 ASP ASP G . n 
G 1 98  LEU 98  1171 1171 LEU LEU G . n 
G 1 99  ASP 99  1172 1172 ASP ASP G . n 
G 1 100 LYS 100 1173 1173 LYS LYS G . n 
G 1 101 GLU 101 1174 1174 GLU GLU G . n 
G 1 102 LYS 102 1175 1175 LYS LYS G . n 
G 1 103 MET 103 1176 1176 MET MET G . n 
G 1 104 LEU 104 1177 1177 LEU LEU G . n 
G 1 105 GLU 105 1178 1178 GLU GLU G . n 
G 1 106 GLY 106 1179 1179 GLY GLY G . n 
G 1 107 ARG 107 1180 1180 ARG ARG G . n 
G 1 108 LYS 108 1181 1181 LYS LYS G . n 
G 1 109 SER 109 1182 1182 SER SER G . n 
G 1 110 ASN 110 1183 1183 ASN ASN G . n 
G 1 111 ILE 111 1184 1184 ILE ILE G . n 
G 1 112 ARG 112 1185 1185 ARG ARG G . n 
G 1 113 LYS 113 1186 1186 LYS LYS G . n 
G 1 114 SER 114 1187 1187 SER SER G . n 
G 1 115 VAL 115 1188 1188 VAL VAL G . n 
G 1 116 GLN 116 1189 1189 GLN GLN G . n 
G 1 117 ILE 117 1190 1190 ILE ILE G . n 
G 1 118 ALA 118 1191 1191 ALA ALA G . n 
G 1 119 TYR 119 1192 1192 TYR TYR G . n 
G 1 120 HIS 120 1193 1193 HIS HIS G . n 
G 1 121 ARG 121 1194 1194 ARG ARG G . n 
G 1 122 ALA 122 1195 1195 ALA ALA G . n 
G 1 123 LEU 123 1196 1196 LEU LEU G . n 
G 1 124 GLN 124 1197 1197 GLN GLN G . n 
G 1 125 HIS 125 1198 1198 HIS HIS G . n 
G 1 126 ARG 126 1199 1199 ARG ARG G . n 
G 1 127 SER 127 1200 1200 SER SER G . n 
G 1 128 LYS 128 1201 1201 LYS LYS G . n 
G 1 129 VAL 129 1202 1202 VAL VAL G . n 
G 1 130 GLN 130 1203 1203 GLN GLN G . n 
G 1 131 GLY 131 1204 ?    ?   ?   G . n 
G 1 132 GLU 132 1205 ?    ?   ?   G . n 
H 2 1   THR 1   22   ?    ?   ?   H . n 
H 2 2   LYS 2   23   ?    ?   ?   H . n 
H 2 3   ALA 3   24   ?    ?   ?   H . n 
H 2 4   ALA 4   25   ?    ?   ?   H . n 
H 2 5   ARG 5   26   ?    ?   ?   H . n 
H 2 6   LYS 6   27   ?    ?   ?   H . n 
H 2 7   SER 7   28   28   SER SER H . n 
H 2 8   ALA 8   29   29   ALA ALA H . n 
H 2 9   PRO 9   30   30   PRO PRO H . n 
H 2 10  ALA 10  31   31   ALA ALA H . n 
H 2 11  THR 11  32   32   THR THR H . n 
H 2 12  GLY 12  33   33   GLY GLY H . n 
H 2 13  GLY 13  34   34   GLY GLY H . n 
H 2 14  VAL 14  35   35   VAL VAL H . n 
H 2 15  M3L 15  36   36   M3L M3L H . n 
H 2 16  LYS 16  37   37   LYS LYS H . n 
H 2 17  PRO 17  38   38   PRO PRO H . n 
H 2 18  HIS 18  39   39   HIS HIS H . n 
H 2 19  ARG 19  40   ?    ?   ?   H . n 
H 2 20  TYR 20  41   ?    ?   ?   H . n 
H 2 21  ARG 21  42   ?    ?   ?   H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 3 SO4 1   2206 2206 SO4 SO4 A . 
J 4 HOH 1   2001 2001 HOH HOH A . 
J 4 HOH 2   2002 2002 HOH HOH A . 
J 4 HOH 3   2003 2003 HOH HOH A . 
J 4 HOH 4   2004 2004 HOH HOH A . 
J 4 HOH 5   2005 2005 HOH HOH A . 
J 4 HOH 6   2006 2006 HOH HOH A . 
J 4 HOH 7   2007 2007 HOH HOH A . 
J 4 HOH 8   2008 2008 HOH HOH A . 
J 4 HOH 9   2009 2009 HOH HOH A . 
J 4 HOH 10  2010 2010 HOH HOH A . 
J 4 HOH 11  2011 2011 HOH HOH A . 
J 4 HOH 12  2012 2012 HOH HOH A . 
J 4 HOH 13  2013 2013 HOH HOH A . 
J 4 HOH 14  2014 2014 HOH HOH A . 
J 4 HOH 15  2015 2015 HOH HOH A . 
J 4 HOH 16  2016 2016 HOH HOH A . 
J 4 HOH 17  2017 2017 HOH HOH A . 
J 4 HOH 18  2018 2018 HOH HOH A . 
J 4 HOH 19  2019 2019 HOH HOH A . 
J 4 HOH 20  2020 2020 HOH HOH A . 
J 4 HOH 21  2021 2021 HOH HOH A . 
J 4 HOH 22  2022 2022 HOH HOH A . 
J 4 HOH 23  2023 2023 HOH HOH A . 
J 4 HOH 24  2024 2024 HOH HOH A . 
J 4 HOH 25  2025 2025 HOH HOH A . 
J 4 HOH 26  2026 2026 HOH HOH A . 
J 4 HOH 27  2027 2027 HOH HOH A . 
J 4 HOH 28  2028 2028 HOH HOH A . 
J 4 HOH 29  2029 2029 HOH HOH A . 
J 4 HOH 30  2030 2030 HOH HOH A . 
J 4 HOH 31  2031 2031 HOH HOH A . 
J 4 HOH 32  2032 2032 HOH HOH A . 
J 4 HOH 33  2033 2033 HOH HOH A . 
J 4 HOH 34  2034 2034 HOH HOH A . 
J 4 HOH 35  2035 2035 HOH HOH A . 
J 4 HOH 36  2036 2036 HOH HOH A . 
J 4 HOH 37  2037 2037 HOH HOH A . 
J 4 HOH 38  2038 2038 HOH HOH A . 
J 4 HOH 39  2039 2039 HOH HOH A . 
J 4 HOH 40  2040 2040 HOH HOH A . 
J 4 HOH 41  2041 2041 HOH HOH A . 
J 4 HOH 42  2042 2042 HOH HOH A . 
J 4 HOH 43  2043 2043 HOH HOH A . 
J 4 HOH 44  2044 2044 HOH HOH A . 
J 4 HOH 45  2045 2045 HOH HOH A . 
J 4 HOH 46  2046 2046 HOH HOH A . 
J 4 HOH 47  2047 2047 HOH HOH A . 
J 4 HOH 48  2048 2048 HOH HOH A . 
J 4 HOH 49  2049 2049 HOH HOH A . 
J 4 HOH 50  2050 2050 HOH HOH A . 
J 4 HOH 51  2051 2051 HOH HOH A . 
J 4 HOH 52  2052 2052 HOH HOH A . 
J 4 HOH 53  2053 2053 HOH HOH A . 
J 4 HOH 54  2054 2054 HOH HOH A . 
J 4 HOH 55  2055 2055 HOH HOH A . 
J 4 HOH 56  2056 2056 HOH HOH A . 
J 4 HOH 57  2057 2057 HOH HOH A . 
J 4 HOH 58  2058 2058 HOH HOH A . 
J 4 HOH 59  2059 2059 HOH HOH A . 
J 4 HOH 60  2060 2060 HOH HOH A . 
J 4 HOH 61  2061 2061 HOH HOH A . 
J 4 HOH 62  2062 2062 HOH HOH A . 
J 4 HOH 63  2063 2063 HOH HOH A . 
J 4 HOH 64  2064 2064 HOH HOH A . 
J 4 HOH 65  2065 2065 HOH HOH A . 
J 4 HOH 66  2066 2066 HOH HOH A . 
J 4 HOH 67  2067 2067 HOH HOH A . 
J 4 HOH 68  2068 2068 HOH HOH A . 
J 4 HOH 69  2069 2069 HOH HOH A . 
J 4 HOH 70  2070 2070 HOH HOH A . 
J 4 HOH 71  2071 2071 HOH HOH A . 
J 4 HOH 72  2072 2072 HOH HOH A . 
J 4 HOH 73  2073 2073 HOH HOH A . 
J 4 HOH 74  2074 2074 HOH HOH A . 
J 4 HOH 75  2075 2075 HOH HOH A . 
J 4 HOH 76  2076 2076 HOH HOH A . 
J 4 HOH 77  2077 2077 HOH HOH A . 
J 4 HOH 78  2078 2078 HOH HOH A . 
J 4 HOH 79  2079 2079 HOH HOH A . 
J 4 HOH 80  2080 2080 HOH HOH A . 
J 4 HOH 81  2081 2081 HOH HOH A . 
J 4 HOH 82  2082 2082 HOH HOH A . 
J 4 HOH 83  2083 2083 HOH HOH A . 
J 4 HOH 84  2084 2084 HOH HOH A . 
J 4 HOH 85  2085 2085 HOH HOH A . 
J 4 HOH 86  2086 2086 HOH HOH A . 
J 4 HOH 87  2087 2087 HOH HOH A . 
J 4 HOH 88  2088 2088 HOH HOH A . 
J 4 HOH 89  2089 2089 HOH HOH A . 
J 4 HOH 90  2090 2090 HOH HOH A . 
J 4 HOH 91  2091 2091 HOH HOH A . 
J 4 HOH 92  2092 2092 HOH HOH A . 
J 4 HOH 93  2093 2093 HOH HOH A . 
J 4 HOH 94  2094 2094 HOH HOH A . 
J 4 HOH 95  2095 2095 HOH HOH A . 
J 4 HOH 96  2096 2096 HOH HOH A . 
J 4 HOH 97  2097 2097 HOH HOH A . 
J 4 HOH 98  2098 2098 HOH HOH A . 
J 4 HOH 99  2099 2099 HOH HOH A . 
J 4 HOH 100 2100 2100 HOH HOH A . 
J 4 HOH 101 2101 2101 HOH HOH A . 
J 4 HOH 102 2102 2102 HOH HOH A . 
J 4 HOH 103 2103 2103 HOH HOH A . 
J 4 HOH 104 2104 2104 HOH HOH A . 
J 4 HOH 105 2105 2105 HOH HOH A . 
J 4 HOH 106 2106 2106 HOH HOH A . 
J 4 HOH 107 2107 2107 HOH HOH A . 
J 4 HOH 108 2108 2108 HOH HOH A . 
J 4 HOH 109 2109 2109 HOH HOH A . 
J 4 HOH 110 2110 2110 HOH HOH A . 
J 4 HOH 111 2111 2111 HOH HOH A . 
J 4 HOH 112 2112 2112 HOH HOH A . 
J 4 HOH 113 2113 2113 HOH HOH A . 
J 4 HOH 114 2114 2114 HOH HOH A . 
J 4 HOH 115 2115 2115 HOH HOH A . 
J 4 HOH 116 2116 2116 HOH HOH A . 
J 4 HOH 117 2117 2117 HOH HOH A . 
J 4 HOH 118 2118 2118 HOH HOH A . 
J 4 HOH 119 2119 2119 HOH HOH A . 
J 4 HOH 120 2120 2120 HOH HOH A . 
J 4 HOH 121 2121 2121 HOH HOH A . 
J 4 HOH 122 2122 2122 HOH HOH A . 
J 4 HOH 123 2123 2123 HOH HOH A . 
J 4 HOH 124 2124 2124 HOH HOH A . 
J 4 HOH 125 2125 2125 HOH HOH A . 
J 4 HOH 126 2126 2126 HOH HOH A . 
J 4 HOH 127 2127 2127 HOH HOH A . 
J 4 HOH 128 2128 2128 HOH HOH A . 
J 4 HOH 129 2129 2129 HOH HOH A . 
J 4 HOH 130 2130 2130 HOH HOH A . 
J 4 HOH 131 2131 2131 HOH HOH A . 
J 4 HOH 132 2132 2132 HOH HOH A . 
J 4 HOH 133 2133 2133 HOH HOH A . 
J 4 HOH 134 2134 2134 HOH HOH A . 
J 4 HOH 135 2135 2135 HOH HOH A . 
J 4 HOH 136 2136 2136 HOH HOH A . 
J 4 HOH 137 2137 2137 HOH HOH A . 
J 4 HOH 138 2138 2138 HOH HOH A . 
J 4 HOH 139 2139 2139 HOH HOH A . 
J 4 HOH 140 2140 2140 HOH HOH A . 
J 4 HOH 141 2141 2141 HOH HOH A . 
J 4 HOH 142 2142 2142 HOH HOH A . 
J 4 HOH 143 2143 2143 HOH HOH A . 
J 4 HOH 144 2144 2144 HOH HOH A . 
J 4 HOH 145 2145 2145 HOH HOH A . 
J 4 HOH 146 2146 2146 HOH HOH A . 
J 4 HOH 147 2147 2147 HOH HOH A . 
J 4 HOH 148 2148 2148 HOH HOH A . 
J 4 HOH 149 2149 2149 HOH HOH A . 
J 4 HOH 150 2150 2150 HOH HOH A . 
K 4 HOH 1   2001 2001 HOH HOH B . 
K 4 HOH 2   2002 2002 HOH HOH B . 
K 4 HOH 3   2003 2003 HOH HOH B . 
K 4 HOH 4   2004 2004 HOH HOH B . 
K 4 HOH 5   2005 2005 HOH HOH B . 
K 4 HOH 6   2006 2006 HOH HOH B . 
K 4 HOH 7   2007 2007 HOH HOH B . 
K 4 HOH 8   2008 2008 HOH HOH B . 
K 4 HOH 9   2009 2009 HOH HOH B . 
L 4 HOH 1   2001 2001 HOH HOH C . 
L 4 HOH 2   2002 2002 HOH HOH C . 
L 4 HOH 3   2003 2003 HOH HOH C . 
L 4 HOH 4   2004 2004 HOH HOH C . 
L 4 HOH 5   2005 2005 HOH HOH C . 
L 4 HOH 6   2006 2006 HOH HOH C . 
L 4 HOH 7   2007 2007 HOH HOH C . 
L 4 HOH 8   2008 2008 HOH HOH C . 
L 4 HOH 9   2009 2009 HOH HOH C . 
L 4 HOH 10  2010 2010 HOH HOH C . 
L 4 HOH 11  2011 2011 HOH HOH C . 
L 4 HOH 12  2012 2012 HOH HOH C . 
L 4 HOH 13  2013 2013 HOH HOH C . 
L 4 HOH 14  2014 2014 HOH HOH C . 
L 4 HOH 15  2015 2015 HOH HOH C . 
L 4 HOH 16  2016 2016 HOH HOH C . 
L 4 HOH 17  2017 2017 HOH HOH C . 
L 4 HOH 18  2018 2018 HOH HOH C . 
L 4 HOH 19  2019 2019 HOH HOH C . 
L 4 HOH 20  2020 2020 HOH HOH C . 
L 4 HOH 21  2021 2021 HOH HOH C . 
L 4 HOH 22  2022 2022 HOH HOH C . 
L 4 HOH 23  2023 2023 HOH HOH C . 
L 4 HOH 24  2024 2024 HOH HOH C . 
L 4 HOH 25  2025 2025 HOH HOH C . 
L 4 HOH 26  2026 2026 HOH HOH C . 
L 4 HOH 27  2027 2027 HOH HOH C . 
L 4 HOH 28  2028 2028 HOH HOH C . 
L 4 HOH 29  2029 2029 HOH HOH C . 
L 4 HOH 30  2030 2030 HOH HOH C . 
L 4 HOH 31  2031 2031 HOH HOH C . 
L 4 HOH 32  2032 2032 HOH HOH C . 
L 4 HOH 33  2033 2033 HOH HOH C . 
L 4 HOH 34  2034 2034 HOH HOH C . 
L 4 HOH 35  2035 2035 HOH HOH C . 
L 4 HOH 36  2036 2036 HOH HOH C . 
L 4 HOH 37  2037 2037 HOH HOH C . 
L 4 HOH 38  2038 2038 HOH HOH C . 
L 4 HOH 39  2039 2039 HOH HOH C . 
L 4 HOH 40  2040 2040 HOH HOH C . 
L 4 HOH 41  2041 2041 HOH HOH C . 
L 4 HOH 42  2042 2042 HOH HOH C . 
L 4 HOH 43  2043 2043 HOH HOH C . 
L 4 HOH 44  2044 2044 HOH HOH C . 
L 4 HOH 45  2045 2045 HOH HOH C . 
L 4 HOH 46  2046 2046 HOH HOH C . 
L 4 HOH 47  2047 2047 HOH HOH C . 
L 4 HOH 48  2048 2048 HOH HOH C . 
L 4 HOH 49  2049 2049 HOH HOH C . 
L 4 HOH 50  2050 2050 HOH HOH C . 
L 4 HOH 51  2051 2051 HOH HOH C . 
L 4 HOH 52  2052 2052 HOH HOH C . 
L 4 HOH 53  2053 2053 HOH HOH C . 
L 4 HOH 54  2054 2054 HOH HOH C . 
L 4 HOH 55  2055 2055 HOH HOH C . 
L 4 HOH 56  2056 2056 HOH HOH C . 
L 4 HOH 57  2057 2057 HOH HOH C . 
L 4 HOH 58  2058 2058 HOH HOH C . 
L 4 HOH 59  2059 2059 HOH HOH C . 
L 4 HOH 60  2060 2060 HOH HOH C . 
L 4 HOH 61  2061 2061 HOH HOH C . 
L 4 HOH 62  2062 2062 HOH HOH C . 
L 4 HOH 63  2063 2063 HOH HOH C . 
L 4 HOH 64  2064 2064 HOH HOH C . 
L 4 HOH 65  2065 2065 HOH HOH C . 
L 4 HOH 66  2066 2066 HOH HOH C . 
L 4 HOH 67  2067 2067 HOH HOH C . 
L 4 HOH 68  2068 2068 HOH HOH C . 
L 4 HOH 69  2069 2069 HOH HOH C . 
L 4 HOH 70  2070 2070 HOH HOH C . 
L 4 HOH 71  2071 2071 HOH HOH C . 
L 4 HOH 72  2072 2072 HOH HOH C . 
L 4 HOH 73  2073 2073 HOH HOH C . 
L 4 HOH 74  2074 2074 HOH HOH C . 
L 4 HOH 75  2075 2075 HOH HOH C . 
L 4 HOH 76  2076 2076 HOH HOH C . 
L 4 HOH 77  2077 2077 HOH HOH C . 
L 4 HOH 78  2078 2078 HOH HOH C . 
L 4 HOH 79  2079 2079 HOH HOH C . 
L 4 HOH 80  2080 2080 HOH HOH C . 
L 4 HOH 81  2081 2081 HOH HOH C . 
L 4 HOH 82  2082 2082 HOH HOH C . 
L 4 HOH 83  2083 2083 HOH HOH C . 
L 4 HOH 84  2084 2084 HOH HOH C . 
L 4 HOH 85  2085 2085 HOH HOH C . 
L 4 HOH 86  2086 2086 HOH HOH C . 
L 4 HOH 87  2087 2087 HOH HOH C . 
L 4 HOH 88  2088 2088 HOH HOH C . 
L 4 HOH 89  2089 2089 HOH HOH C . 
L 4 HOH 90  2090 2090 HOH HOH C . 
L 4 HOH 91  2091 2091 HOH HOH C . 
L 4 HOH 92  2092 2092 HOH HOH C . 
L 4 HOH 93  2093 2093 HOH HOH C . 
L 4 HOH 94  2094 2094 HOH HOH C . 
L 4 HOH 95  2095 2095 HOH HOH C . 
L 4 HOH 96  2096 2096 HOH HOH C . 
L 4 HOH 97  2097 2097 HOH HOH C . 
L 4 HOH 98  2098 2098 HOH HOH C . 
L 4 HOH 99  2099 2099 HOH HOH C . 
L 4 HOH 100 2100 2100 HOH HOH C . 
L 4 HOH 101 2101 2101 HOH HOH C . 
L 4 HOH 102 2102 2102 HOH HOH C . 
L 4 HOH 103 2103 2103 HOH HOH C . 
L 4 HOH 104 2104 2104 HOH HOH C . 
L 4 HOH 105 2105 2105 HOH HOH C . 
L 4 HOH 106 2106 2106 HOH HOH C . 
L 4 HOH 107 2107 2107 HOH HOH C . 
L 4 HOH 108 2108 2108 HOH HOH C . 
L 4 HOH 109 2109 2109 HOH HOH C . 
L 4 HOH 110 2110 2110 HOH HOH C . 
L 4 HOH 111 2111 2111 HOH HOH C . 
L 4 HOH 112 2112 2112 HOH HOH C . 
L 4 HOH 113 2113 2113 HOH HOH C . 
L 4 HOH 114 2114 2114 HOH HOH C . 
L 4 HOH 115 2115 2115 HOH HOH C . 
L 4 HOH 116 2116 2116 HOH HOH C . 
L 4 HOH 117 2117 2117 HOH HOH C . 
L 4 HOH 118 2118 2118 HOH HOH C . 
L 4 HOH 119 2119 2119 HOH HOH C . 
L 4 HOH 120 2120 2120 HOH HOH C . 
L 4 HOH 121 2121 2121 HOH HOH C . 
L 4 HOH 122 2122 2122 HOH HOH C . 
L 4 HOH 123 2123 2123 HOH HOH C . 
L 4 HOH 124 2124 2124 HOH HOH C . 
L 4 HOH 125 2125 2125 HOH HOH C . 
L 4 HOH 126 2126 2126 HOH HOH C . 
L 4 HOH 127 2127 2127 HOH HOH C . 
L 4 HOH 128 2128 2128 HOH HOH C . 
L 4 HOH 129 2129 2129 HOH HOH C . 
L 4 HOH 130 2130 2130 HOH HOH C . 
L 4 HOH 131 2131 2131 HOH HOH C . 
L 4 HOH 132 2132 2132 HOH HOH C . 
L 4 HOH 133 2133 2133 HOH HOH C . 
L 4 HOH 134 2134 2134 HOH HOH C . 
L 4 HOH 135 2135 2135 HOH HOH C . 
L 4 HOH 136 2136 2136 HOH HOH C . 
L 4 HOH 137 2137 2137 HOH HOH C . 
L 4 HOH 138 2138 2138 HOH HOH C . 
L 4 HOH 139 2139 2139 HOH HOH C . 
L 4 HOH 140 2140 2140 HOH HOH C . 
L 4 HOH 141 2141 2141 HOH HOH C . 
L 4 HOH 142 2142 2142 HOH HOH C . 
L 4 HOH 143 2143 2143 HOH HOH C . 
L 4 HOH 144 2144 2144 HOH HOH C . 
L 4 HOH 145 2145 2145 HOH HOH C . 
M 4 HOH 1   2001 2001 HOH HOH D . 
M 4 HOH 2   2002 2002 HOH HOH D . 
M 4 HOH 3   2003 2003 HOH HOH D . 
M 4 HOH 4   2004 2004 HOH HOH D . 
M 4 HOH 5   2005 2005 HOH HOH D . 
M 4 HOH 6   2006 2006 HOH HOH D . 
M 4 HOH 7   2007 2007 HOH HOH D . 
N 4 HOH 1   2001 2001 HOH HOH E . 
N 4 HOH 2   2002 2002 HOH HOH E . 
N 4 HOH 3   2003 2003 HOH HOH E . 
N 4 HOH 4   2004 2004 HOH HOH E . 
N 4 HOH 5   2005 2005 HOH HOH E . 
N 4 HOH 6   2006 2006 HOH HOH E . 
N 4 HOH 7   2007 2007 HOH HOH E . 
N 4 HOH 8   2008 2008 HOH HOH E . 
N 4 HOH 9   2009 2009 HOH HOH E . 
N 4 HOH 10  2010 2010 HOH HOH E . 
N 4 HOH 11  2011 2011 HOH HOH E . 
N 4 HOH 12  2012 2012 HOH HOH E . 
N 4 HOH 13  2013 2013 HOH HOH E . 
N 4 HOH 14  2014 2014 HOH HOH E . 
N 4 HOH 15  2015 2015 HOH HOH E . 
N 4 HOH 16  2016 2016 HOH HOH E . 
N 4 HOH 17  2017 2017 HOH HOH E . 
N 4 HOH 18  2018 2018 HOH HOH E . 
N 4 HOH 19  2019 2019 HOH HOH E . 
N 4 HOH 20  2020 2020 HOH HOH E . 
N 4 HOH 21  2021 2021 HOH HOH E . 
N 4 HOH 22  2022 2022 HOH HOH E . 
N 4 HOH 23  2023 2023 HOH HOH E . 
N 4 HOH 24  2024 2024 HOH HOH E . 
N 4 HOH 25  2025 2025 HOH HOH E . 
N 4 HOH 26  2026 2026 HOH HOH E . 
N 4 HOH 27  2027 2027 HOH HOH E . 
N 4 HOH 28  2028 2028 HOH HOH E . 
N 4 HOH 29  2029 2029 HOH HOH E . 
N 4 HOH 30  2030 2030 HOH HOH E . 
N 4 HOH 31  2031 2031 HOH HOH E . 
N 4 HOH 32  2032 2032 HOH HOH E . 
N 4 HOH 33  2033 2033 HOH HOH E . 
N 4 HOH 34  2034 2034 HOH HOH E . 
N 4 HOH 35  2035 2035 HOH HOH E . 
N 4 HOH 36  2036 2036 HOH HOH E . 
N 4 HOH 37  2037 2037 HOH HOH E . 
N 4 HOH 38  2038 2038 HOH HOH E . 
N 4 HOH 39  2039 2039 HOH HOH E . 
N 4 HOH 40  2040 2040 HOH HOH E . 
N 4 HOH 41  2041 2041 HOH HOH E . 
N 4 HOH 42  2042 2042 HOH HOH E . 
N 4 HOH 43  2043 2043 HOH HOH E . 
N 4 HOH 44  2044 2044 HOH HOH E . 
N 4 HOH 45  2045 2045 HOH HOH E . 
N 4 HOH 46  2046 2046 HOH HOH E . 
N 4 HOH 47  2047 2047 HOH HOH E . 
N 4 HOH 48  2048 2048 HOH HOH E . 
N 4 HOH 49  2049 2049 HOH HOH E . 
N 4 HOH 50  2050 2050 HOH HOH E . 
N 4 HOH 51  2051 2051 HOH HOH E . 
N 4 HOH 52  2052 2052 HOH HOH E . 
N 4 HOH 53  2053 2053 HOH HOH E . 
N 4 HOH 54  2054 2054 HOH HOH E . 
N 4 HOH 55  2055 2055 HOH HOH E . 
N 4 HOH 56  2056 2056 HOH HOH E . 
N 4 HOH 57  2057 2057 HOH HOH E . 
N 4 HOH 58  2058 2058 HOH HOH E . 
N 4 HOH 59  2059 2059 HOH HOH E . 
N 4 HOH 60  2060 2060 HOH HOH E . 
N 4 HOH 61  2061 2061 HOH HOH E . 
N 4 HOH 62  2062 2062 HOH HOH E . 
N 4 HOH 63  2063 2063 HOH HOH E . 
N 4 HOH 64  2064 2064 HOH HOH E . 
N 4 HOH 65  2065 2065 HOH HOH E . 
N 4 HOH 66  2066 2066 HOH HOH E . 
N 4 HOH 67  2067 2067 HOH HOH E . 
N 4 HOH 68  2068 2068 HOH HOH E . 
N 4 HOH 69  2069 2069 HOH HOH E . 
N 4 HOH 70  2070 2070 HOH HOH E . 
N 4 HOH 71  2071 2071 HOH HOH E . 
N 4 HOH 72  2072 2072 HOH HOH E . 
N 4 HOH 73  2073 2073 HOH HOH E . 
N 4 HOH 74  2074 2074 HOH HOH E . 
N 4 HOH 75  2075 2075 HOH HOH E . 
N 4 HOH 76  2076 2076 HOH HOH E . 
N 4 HOH 77  2077 2077 HOH HOH E . 
N 4 HOH 78  2078 2078 HOH HOH E . 
N 4 HOH 79  2079 2079 HOH HOH E . 
N 4 HOH 80  2080 2080 HOH HOH E . 
N 4 HOH 81  2081 2081 HOH HOH E . 
N 4 HOH 82  2082 2082 HOH HOH E . 
N 4 HOH 83  2083 2083 HOH HOH E . 
N 4 HOH 84  2084 2084 HOH HOH E . 
N 4 HOH 85  2085 2085 HOH HOH E . 
N 4 HOH 86  2086 2086 HOH HOH E . 
N 4 HOH 87  2087 2087 HOH HOH E . 
N 4 HOH 88  2088 2088 HOH HOH E . 
N 4 HOH 89  2089 2089 HOH HOH E . 
N 4 HOH 90  2090 2090 HOH HOH E . 
N 4 HOH 91  2091 2091 HOH HOH E . 
N 4 HOH 92  2092 2092 HOH HOH E . 
N 4 HOH 93  2093 2093 HOH HOH E . 
N 4 HOH 94  2094 2094 HOH HOH E . 
N 4 HOH 95  2095 2095 HOH HOH E . 
N 4 HOH 96  2096 2096 HOH HOH E . 
N 4 HOH 97  2097 2097 HOH HOH E . 
N 4 HOH 98  2098 2098 HOH HOH E . 
N 4 HOH 99  2099 2099 HOH HOH E . 
N 4 HOH 100 2100 2100 HOH HOH E . 
N 4 HOH 101 2101 2101 HOH HOH E . 
N 4 HOH 102 2102 2102 HOH HOH E . 
N 4 HOH 103 2103 2103 HOH HOH E . 
N 4 HOH 104 2104 2104 HOH HOH E . 
N 4 HOH 105 2105 2105 HOH HOH E . 
N 4 HOH 106 2106 2106 HOH HOH E . 
N 4 HOH 107 2107 2107 HOH HOH E . 
N 4 HOH 108 2108 2108 HOH HOH E . 
N 4 HOH 109 2109 2109 HOH HOH E . 
N 4 HOH 110 2110 2110 HOH HOH E . 
N 4 HOH 111 2111 2111 HOH HOH E . 
N 4 HOH 112 2112 2112 HOH HOH E . 
N 4 HOH 113 2113 2113 HOH HOH E . 
N 4 HOH 114 2114 2114 HOH HOH E . 
N 4 HOH 115 2115 2115 HOH HOH E . 
N 4 HOH 116 2116 2116 HOH HOH E . 
N 4 HOH 117 2117 2117 HOH HOH E . 
N 4 HOH 118 2118 2118 HOH HOH E . 
N 4 HOH 119 2119 2119 HOH HOH E . 
N 4 HOH 120 2120 2120 HOH HOH E . 
N 4 HOH 121 2121 2121 HOH HOH E . 
N 4 HOH 122 2122 2122 HOH HOH E . 
N 4 HOH 123 2123 2123 HOH HOH E . 
N 4 HOH 124 2124 2124 HOH HOH E . 
N 4 HOH 125 2125 2125 HOH HOH E . 
N 4 HOH 126 2126 2126 HOH HOH E . 
N 4 HOH 127 2127 2127 HOH HOH E . 
N 4 HOH 128 2128 2128 HOH HOH E . 
N 4 HOH 129 2129 2129 HOH HOH E . 
N 4 HOH 130 2130 2130 HOH HOH E . 
N 4 HOH 131 2131 2131 HOH HOH E . 
O 4 HOH 1   2001 2001 HOH HOH F . 
O 4 HOH 2   2002 2002 HOH HOH F . 
O 4 HOH 3   2003 2003 HOH HOH F . 
O 4 HOH 4   2004 2004 HOH HOH F . 
P 4 HOH 1   2001 2001 HOH HOH G . 
P 4 HOH 2   2002 2002 HOH HOH G . 
P 4 HOH 3   2003 2003 HOH HOH G . 
P 4 HOH 4   2004 2004 HOH HOH G . 
P 4 HOH 5   2005 2005 HOH HOH G . 
P 4 HOH 6   2006 2006 HOH HOH G . 
P 4 HOH 7   2007 2007 HOH HOH G . 
P 4 HOH 8   2008 2008 HOH HOH G . 
P 4 HOH 9   2009 2009 HOH HOH G . 
P 4 HOH 10  2010 2010 HOH HOH G . 
P 4 HOH 11  2011 2011 HOH HOH G . 
P 4 HOH 12  2012 2012 HOH HOH G . 
P 4 HOH 13  2013 2013 HOH HOH G . 
P 4 HOH 14  2014 2014 HOH HOH G . 
P 4 HOH 15  2015 2015 HOH HOH G . 
P 4 HOH 16  2016 2016 HOH HOH G . 
P 4 HOH 17  2017 2017 HOH HOH G . 
P 4 HOH 18  2018 2018 HOH HOH G . 
P 4 HOH 19  2019 2019 HOH HOH G . 
P 4 HOH 20  2020 2020 HOH HOH G . 
P 4 HOH 21  2021 2021 HOH HOH G . 
P 4 HOH 22  2022 2022 HOH HOH G . 
P 4 HOH 23  2023 2023 HOH HOH G . 
P 4 HOH 24  2024 2024 HOH HOH G . 
P 4 HOH 25  2025 2025 HOH HOH G . 
P 4 HOH 26  2026 2026 HOH HOH G . 
P 4 HOH 27  2027 2027 HOH HOH G . 
P 4 HOH 28  2028 2028 HOH HOH G . 
P 4 HOH 29  2029 2029 HOH HOH G . 
P 4 HOH 30  2030 2030 HOH HOH G . 
P 4 HOH 31  2031 2031 HOH HOH G . 
P 4 HOH 32  2032 2032 HOH HOH G . 
P 4 HOH 33  2033 2033 HOH HOH G . 
P 4 HOH 34  2034 2034 HOH HOH G . 
P 4 HOH 35  2035 2035 HOH HOH G . 
P 4 HOH 36  2036 2036 HOH HOH G . 
P 4 HOH 37  2037 2037 HOH HOH G . 
P 4 HOH 38  2038 2038 HOH HOH G . 
P 4 HOH 39  2039 2039 HOH HOH G . 
P 4 HOH 40  2040 2040 HOH HOH G . 
P 4 HOH 41  2041 2041 HOH HOH G . 
P 4 HOH 42  2042 2042 HOH HOH G . 
P 4 HOH 43  2043 2043 HOH HOH G . 
P 4 HOH 44  2044 2044 HOH HOH G . 
P 4 HOH 45  2045 2045 HOH HOH G . 
P 4 HOH 46  2046 2046 HOH HOH G . 
P 4 HOH 47  2047 2047 HOH HOH G . 
P 4 HOH 48  2048 2048 HOH HOH G . 
P 4 HOH 49  2049 2049 HOH HOH G . 
P 4 HOH 50  2050 2050 HOH HOH G . 
P 4 HOH 51  2051 2051 HOH HOH G . 
P 4 HOH 52  2052 2052 HOH HOH G . 
P 4 HOH 53  2053 2053 HOH HOH G . 
P 4 HOH 54  2054 2054 HOH HOH G . 
P 4 HOH 55  2055 2055 HOH HOH G . 
P 4 HOH 56  2056 2056 HOH HOH G . 
P 4 HOH 57  2057 2057 HOH HOH G . 
P 4 HOH 58  2058 2058 HOH HOH G . 
P 4 HOH 59  2059 2059 HOH HOH G . 
P 4 HOH 60  2060 2060 HOH HOH G . 
P 4 HOH 61  2061 2061 HOH HOH G . 
P 4 HOH 62  2062 2062 HOH HOH G . 
P 4 HOH 63  2063 2063 HOH HOH G . 
P 4 HOH 64  2064 2064 HOH HOH G . 
P 4 HOH 65  2065 2065 HOH HOH G . 
P 4 HOH 66  2066 2066 HOH HOH G . 
P 4 HOH 67  2067 2067 HOH HOH G . 
P 4 HOH 68  2068 2068 HOH HOH G . 
P 4 HOH 69  2069 2069 HOH HOH G . 
P 4 HOH 70  2070 2070 HOH HOH G . 
P 4 HOH 71  2071 2071 HOH HOH G . 
P 4 HOH 72  2072 2072 HOH HOH G . 
P 4 HOH 73  2073 2073 HOH HOH G . 
P 4 HOH 74  2074 2074 HOH HOH G . 
P 4 HOH 75  2075 2075 HOH HOH G . 
P 4 HOH 76  2076 2076 HOH HOH G . 
P 4 HOH 77  2077 2077 HOH HOH G . 
P 4 HOH 78  2078 2078 HOH HOH G . 
P 4 HOH 79  2079 2079 HOH HOH G . 
P 4 HOH 80  2080 2080 HOH HOH G . 
P 4 HOH 81  2081 2081 HOH HOH G . 
P 4 HOH 82  2082 2082 HOH HOH G . 
P 4 HOH 83  2083 2083 HOH HOH G . 
P 4 HOH 84  2084 2084 HOH HOH G . 
P 4 HOH 85  2085 2085 HOH HOH G . 
P 4 HOH 86  2086 2086 HOH HOH G . 
P 4 HOH 87  2087 2087 HOH HOH G . 
P 4 HOH 88  2088 2088 HOH HOH G . 
P 4 HOH 89  2089 2089 HOH HOH G . 
P 4 HOH 90  2090 2090 HOH HOH G . 
P 4 HOH 91  2091 2091 HOH HOH G . 
P 4 HOH 92  2092 2092 HOH HOH G . 
P 4 HOH 93  2093 2093 HOH HOH G . 
P 4 HOH 94  2094 2094 HOH HOH G . 
P 4 HOH 95  2095 2095 HOH HOH G . 
P 4 HOH 96  2096 2096 HOH HOH G . 
P 4 HOH 97  2097 2097 HOH HOH G . 
P 4 HOH 98  2098 2098 HOH HOH G . 
P 4 HOH 99  2099 2099 HOH HOH G . 
P 4 HOH 100 2100 2100 HOH HOH G . 
P 4 HOH 101 2101 2101 HOH HOH G . 
P 4 HOH 102 2102 2102 HOH HOH G . 
P 4 HOH 103 2103 2103 HOH HOH G . 
P 4 HOH 104 2104 2104 HOH HOH G . 
P 4 HOH 105 2105 2105 HOH HOH G . 
P 4 HOH 106 2106 2106 HOH HOH G . 
P 4 HOH 107 2107 2107 HOH HOH G . 
P 4 HOH 108 2108 2108 HOH HOH G . 
P 4 HOH 109 2109 2109 HOH HOH G . 
P 4 HOH 110 2110 2110 HOH HOH G . 
P 4 HOH 111 2111 2111 HOH HOH G . 
P 4 HOH 112 2112 2112 HOH HOH G . 
P 4 HOH 113 2113 2113 HOH HOH G . 
P 4 HOH 114 2114 2114 HOH HOH G . 
P 4 HOH 115 2115 2115 HOH HOH G . 
P 4 HOH 116 2116 2116 HOH HOH G . 
P 4 HOH 117 2117 2117 HOH HOH G . 
P 4 HOH 118 2118 2118 HOH HOH G . 
P 4 HOH 119 2119 2119 HOH HOH G . 
P 4 HOH 120 2120 2120 HOH HOH G . 
P 4 HOH 121 2121 2121 HOH HOH G . 
Q 4 HOH 1   2001 2001 HOH HOH H . 
Q 4 HOH 2   2002 2002 HOH HOH H . 
Q 4 HOH 3   2003 2003 HOH HOH H . 
Q 4 HOH 4   2004 2004 HOH HOH H . 
Q 4 HOH 5   2005 2005 HOH HOH H . 
Q 4 HOH 6   2006 2006 HOH HOH H . 
Q 4 HOH 7   2007 2007 HOH HOH H . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B M3L 15 B M3L 36 ? LYS N-TRIMETHYLLYSINE 
2 D M3L 15 D M3L 36 ? LYS N-TRIMETHYLLYSINE 
3 F M3L 15 F M3L 36 ? LYS N-TRIMETHYLLYSINE 
4 H M3L 15 H M3L 36 ? LYS N-TRIMETHYLLYSINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
4 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 E,F,N,O   
2 1 C,D,L,M   
3 1 G,H,P,Q   
4 1 A,B,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1290  ? 
1 MORE         -12.3 ? 
1 'SSA (A^2)'  8400  ? 
2 'ABSA (A^2)' 1350  ? 
2 MORE         -11.2 ? 
2 'SSA (A^2)'  8330  ? 
3 'ABSA (A^2)' 1350  ? 
3 MORE         -11.1 ? 
3 'SSA (A^2)'  8250  ? 
4 'ABSA (A^2)' 1580  ? 
4 MORE         -21.8 ? 
4 'SSA (A^2)'  8650  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-04-21 
2 'Structure model' 1 1 2011-06-09 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Source and taxonomy'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            entity_src_gen 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
2 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
3 4 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
4 4 'Structure model' '_entity_src_gen.pdbx_host_org_variant'          
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
MOSFLM 'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
_pdbx_entry_details.entry_id             2X4X 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'LYSINE 36 IS TRIMETHYLATED' 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O3 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SO4 
_pdbx_validate_close_contact.auth_seq_id_1    2206 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2147 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 1148 ? ? -87.89 30.85  
2 1 ARG A 1152 ? ? 56.27  71.09  
3 1 ARG C 1152 ? ? 55.49  71.14  
4 1 PHE E 1148 ? ? -85.98 34.26  
5 1 ARG E 1152 ? ? 61.30  66.50  
6 1 LEU G 1086 ? ? 80.79  5.44   
7 1 PHE G 1148 ? ? -91.64 31.74  
8 1 ARG G 1152 ? ? 58.53  71.11  
9 1 PRO H 38   ? ? -49.61 150.87 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2007 ? 5.89 . 
2 1 O ? E HOH 2004 ? 5.82 . 
3 1 O ? E HOH 2005 ? 5.81 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1074 ? A GLY 1   
2  1 Y 1 A GLY 1075 ? A GLY 2   
3  1 Y 1 A SER 1076 ? A SER 3   
4  1 Y 1 A GLU 1077 ? A GLU 4   
5  1 Y 1 A ASP 1078 ? A ASP 5   
6  1 Y 1 A GLU 1079 ? A GLU 6   
7  1 Y 1 B THR 22   ? B THR 1   
8  1 Y 1 B LYS 23   ? B LYS 2   
9  1 Y 1 B ALA 24   ? B ALA 3   
10 1 Y 1 B ALA 25   ? B ALA 4   
11 1 Y 1 B ARG 26   ? B ARG 5   
12 1 Y 1 B LYS 27   ? B LYS 6   
13 1 Y 1 B ARG 42   ? B ARG 21  
14 1 Y 1 C GLY 1074 ? C GLY 1   
15 1 Y 1 C GLY 1075 ? C GLY 2   
16 1 Y 1 C SER 1076 ? C SER 3   
17 1 Y 1 C GLU 1077 ? C GLU 4   
18 1 Y 1 C ASP 1078 ? C ASP 5   
19 1 Y 1 C GLU 1079 ? C GLU 6   
20 1 Y 1 C GLU 1205 ? C GLU 132 
21 1 Y 1 D THR 22   ? D THR 1   
22 1 Y 1 D LYS 23   ? D LYS 2   
23 1 Y 1 D ALA 24   ? D ALA 3   
24 1 Y 1 D ALA 25   ? D ALA 4   
25 1 Y 1 D ARG 26   ? D ARG 5   
26 1 Y 1 D LYS 27   ? D LYS 6   
27 1 Y 1 D ARG 40   ? D ARG 19  
28 1 Y 1 D TYR 41   ? D TYR 20  
29 1 Y 1 D ARG 42   ? D ARG 21  
30 1 Y 1 E GLY 1074 ? E GLY 1   
31 1 Y 1 E GLY 1075 ? E GLY 2   
32 1 Y 1 E SER 1076 ? E SER 3   
33 1 Y 1 E GLU 1077 ? E GLU 4   
34 1 Y 1 E ASP 1078 ? E ASP 5   
35 1 Y 1 E GLU 1079 ? E GLU 6   
36 1 Y 1 F THR 22   ? F THR 1   
37 1 Y 1 F LYS 23   ? F LYS 2   
38 1 Y 1 F ALA 24   ? F ALA 3   
39 1 Y 1 F ALA 25   ? F ALA 4   
40 1 Y 1 F ARG 26   ? F ARG 5   
41 1 Y 1 F LYS 27   ? F LYS 6   
42 1 Y 1 F HIS 39   ? F HIS 18  
43 1 Y 1 F ARG 40   ? F ARG 19  
44 1 Y 1 F TYR 41   ? F TYR 20  
45 1 Y 1 F ARG 42   ? F ARG 21  
46 1 Y 1 G GLY 1074 ? G GLY 1   
47 1 Y 1 G GLY 1075 ? G GLY 2   
48 1 Y 1 G SER 1076 ? G SER 3   
49 1 Y 1 G GLU 1077 ? G GLU 4   
50 1 Y 1 G ASP 1078 ? G ASP 5   
51 1 Y 1 G GLU 1079 ? G GLU 6   
52 1 Y 1 G ASP 1080 ? G ASP 7   
53 1 Y 1 G SER 1081 ? G SER 8   
54 1 Y 1 G GLY 1204 ? G GLY 131 
55 1 Y 1 G GLU 1205 ? G GLU 132 
56 1 Y 1 H THR 22   ? H THR 1   
57 1 Y 1 H LYS 23   ? H LYS 2   
58 1 Y 1 H ALA 24   ? H ALA 3   
59 1 Y 1 H ALA 25   ? H ALA 4   
60 1 Y 1 H ARG 26   ? H ARG 5   
61 1 Y 1 H LYS 27   ? H LYS 6   
62 1 Y 1 H ARG 40   ? H ARG 19  
63 1 Y 1 H TYR 41   ? H TYR 20  
64 1 Y 1 H ARG 42   ? H ARG 21  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#