data_2X6B
# 
_entry.id   2X6B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2X6B         
PDBE  EBI-42932    
WWPDB D_1290042932 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1XL4 unspecified 'INTERMEDIATE GATING STRUCTURE 1 OF THE INWARDLY RECTIFYINGK+ CHANNEL KIRBAC3.1'                          
PDB 1XL6 unspecified 'INTERMEDIATE GATING STRUCTURE 2 OF THE INWARDLY RECTIFYINGK+ CHANNEL KIRBAC3.1'                          
PDB 2X6A unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2X6C unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLN unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLO unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLJ unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLL unspecified 'POTASSIUM CHANNEL FROM BURKHOLDERIA PSEUDOMALLEI'                                                        
PDB 2WLI unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLM unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLK unspecified 'STRUCTURE OF THE ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM' 
PDB 2WLH unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2X6B 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clarke, O.B.'     1 
'Caputo, A.T.'     2 
'Hill, A.P.'       3 
'Vandenberg, J.I.' 4 
'Smith, B.J.'      5 
'Gulbis, J.M.'     6 
# 
_citation.id                        primary 
_citation.title                     
'Domain Reorientation and Rotation of an Intracellular Assembly Regulate Conduction in Kir Potassium Channels.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            141 
_citation.page_first                1018 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20564790 
_citation.pdbx_database_id_DOI      10.1016/J.CELL.2010.05.003 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Clarke, O.B.'     1 
primary 'Caputo, A.T.'     2 
primary 'Hill, A.P.'       3 
primary 'Vandenberg, J.I.' 4 
primary 'Smith, B.J.'      5 
primary 'Gulbis, J.M.'     6 
# 
_cell.entry_id           2X6B 
_cell.length_a           104.798 
_cell.length_b           104.798 
_cell.length_c           88.417 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2X6B 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL 10' 33725.715 1 ? ? 'RESIDUES 26-320' 'C-TERMINAL HIS-TAG' 
2 non-polymer syn 'BARIUM ION'                                          137.327   1 ? ? ?                 ?                    
3 non-polymer syn 'POTASSIUM ION'                                       39.098    3 ? ? ?                 ?                    
4 non-polymer syn PHOSPHOCHOLINE                                        184.151   1 ? ? ?                 ?                    
5 water       nat water                                                 18.015    1 ? ? ?                 ?                    
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        KIRBAC3.1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEAIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEAIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   GLY n 
1 4   GLY n 
1 5   MET n 
1 6   LYS n 
1 7   PRO n 
1 8   PRO n 
1 9   ALA n 
1 10  ARG n 
1 11  LYS n 
1 12  PRO n 
1 13  ARG n 
1 14  ILE n 
1 15  LEU n 
1 16  ASN n 
1 17  SER n 
1 18  ASP n 
1 19  GLY n 
1 20  SER n 
1 21  SER n 
1 22  ASN n 
1 23  ILE n 
1 24  THR n 
1 25  ARG n 
1 26  LEU n 
1 27  GLY n 
1 28  LEU n 
1 29  GLU n 
1 30  LYS n 
1 31  ARG n 
1 32  GLY n 
1 33  TRP n 
1 34  LEU n 
1 35  ASP n 
1 36  ASP n 
1 37  HIS n 
1 38  TYR n 
1 39  HIS n 
1 40  ASP n 
1 41  LEU n 
1 42  LEU n 
1 43  THR n 
1 44  VAL n 
1 45  SER n 
1 46  TRP n 
1 47  PRO n 
1 48  VAL n 
1 49  PHE n 
1 50  ILE n 
1 51  THR n 
1 52  LEU n 
1 53  ILE n 
1 54  THR n 
1 55  GLY n 
1 56  LEU n 
1 57  TYR n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  ASN n 
1 62  ALA n 
1 63  LEU n 
1 64  PHE n 
1 65  ALA n 
1 66  LEU n 
1 67  ALA n 
1 68  TYR n 
1 69  LEU n 
1 70  ALA n 
1 71  CYS n 
1 72  GLY n 
1 73  ASP n 
1 74  VAL n 
1 75  ILE n 
1 76  GLU n 
1 77  ASN n 
1 78  ALA n 
1 79  ARG n 
1 80  PRO n 
1 81  GLY n 
1 82  SER n 
1 83  PHE n 
1 84  THR n 
1 85  ASP n 
1 86  ALA n 
1 87  PHE n 
1 88  PHE n 
1 89  PHE n 
1 90  SER n 
1 91  VAL n 
1 92  GLN n 
1 93  THR n 
1 94  MET n 
1 95  ALA n 
1 96  THR n 
1 97  ILE n 
1 98  GLY n 
1 99  TYR n 
1 100 GLY n 
1 101 LYS n 
1 102 LEU n 
1 103 ILE n 
1 104 PRO n 
1 105 ILE n 
1 106 GLY n 
1 107 PRO n 
1 108 LEU n 
1 109 ALA n 
1 110 ASN n 
1 111 THR n 
1 112 LEU n 
1 113 VAL n 
1 114 THR n 
1 115 LEU n 
1 116 GLU n 
1 117 ALA n 
1 118 LEU n 
1 119 CYS n 
1 120 GLY n 
1 121 MET n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 ALA n 
1 126 VAL n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ILE n 
1 132 TYR n 
1 133 ALA n 
1 134 ARG n 
1 135 PHE n 
1 136 THR n 
1 137 ARG n 
1 138 PRO n 
1 139 THR n 
1 140 ALA n 
1 141 GLY n 
1 142 VAL n 
1 143 LEU n 
1 144 PHE n 
1 145 SER n 
1 146 SER n 
1 147 ARG n 
1 148 MET n 
1 149 VAL n 
1 150 ILE n 
1 151 SER n 
1 152 ASP n 
1 153 PHE n 
1 154 GLU n 
1 155 GLY n 
1 156 LYS n 
1 157 PRO n 
1 158 THR n 
1 159 LEU n 
1 160 MET n 
1 161 MET n 
1 162 ARG n 
1 163 LEU n 
1 164 ALA n 
1 165 ASN n 
1 166 LEU n 
1 167 ARG n 
1 168 ILE n 
1 169 GLU n 
1 170 ALA n 
1 171 ILE n 
1 172 ILE n 
1 173 GLU n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 HIS n 
1 178 LEU n 
1 179 VAL n 
1 180 LEU n 
1 181 VAL n 
1 182 ARG n 
1 183 SER n 
1 184 GLU n 
1 185 ILE n 
1 186 SER n 
1 187 GLN n 
1 188 GLU n 
1 189 GLY n 
1 190 MET n 
1 191 VAL n 
1 192 PHE n 
1 193 ARG n 
1 194 ARG n 
1 195 PHE n 
1 196 HIS n 
1 197 ASP n 
1 198 LEU n 
1 199 THR n 
1 200 LEU n 
1 201 THR n 
1 202 ARG n 
1 203 SER n 
1 204 ARG n 
1 205 SER n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 SER n 
1 210 LEU n 
1 211 SER n 
1 212 TRP n 
1 213 THR n 
1 214 VAL n 
1 215 MET n 
1 216 HIS n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 HIS n 
1 221 HIS n 
1 222 SER n 
1 223 PRO n 
1 224 ILE n 
1 225 TYR n 
1 226 GLY n 
1 227 GLU n 
1 228 THR n 
1 229 ASP n 
1 230 GLU n 
1 231 THR n 
1 232 LEU n 
1 233 ARG n 
1 234 ASN n 
1 235 SER n 
1 236 HIS n 
1 237 SER n 
1 238 GLU n 
1 239 PHE n 
1 240 LEU n 
1 241 VAL n 
1 242 LEU n 
1 243 PHE n 
1 244 THR n 
1 245 GLY n 
1 246 HIS n 
1 247 HIS n 
1 248 GLU n 
1 249 ALA n 
1 250 PHE n 
1 251 ALA n 
1 252 GLN n 
1 253 ASN n 
1 254 VAL n 
1 255 HIS n 
1 256 ALA n 
1 257 ARG n 
1 258 HIS n 
1 259 ALA n 
1 260 TYR n 
1 261 SER n 
1 262 CYS n 
1 263 ASP n 
1 264 GLU n 
1 265 ILE n 
1 266 ILE n 
1 267 TRP n 
1 268 GLY n 
1 269 GLY n 
1 270 HIS n 
1 271 PHE n 
1 272 VAL n 
1 273 ASP n 
1 274 VAL n 
1 275 PHE n 
1 276 THR n 
1 277 THR n 
1 278 LEU n 
1 279 PRO n 
1 280 ASP n 
1 281 GLY n 
1 282 ARG n 
1 283 ARG n 
1 284 ALA n 
1 285 LEU n 
1 286 ASP n 
1 287 LEU n 
1 288 GLY n 
1 289 LYS n 
1 290 PHE n 
1 291 HIS n 
1 292 GLU n 
1 293 ILE n 
1 294 ALA n 
1 295 GLN n 
1 296 HIS n 
1 297 HIS n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MAGNETOSPIRILLUM MAGNETOTACTICUM' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     188 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)STAR' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2X6B 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          2X6B 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2X6B A 1   ? 4   ? 2X6B 1   ? 4   ? 1   4   
2 1 2X6B A 5   ? 295 ? 2X6B 5   ? 295 ? 5   295 
3 1 2X6B A 296 ? 301 ? 2X6B 296 ? 301 ? 296 301 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
BA  non-polymer         . 'BARIUM ION'    ? 'Ba 2'            137.327 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER           ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'   149.211 
PC  non-polymer         . PHOSPHOCHOLINE  ? 'C5 H15 N O4 P 1' 184.151 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2X6B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.25 
_exptl_crystal.density_percent_sol   71 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;THE CRYSTAL WAS OBTAINED UNDER THE SAME CONDITIONS AS PDB ENTRY 2X6A, BUT SOAKED WITH BARIUM CHLORIDE (5MM FINAL CONCENTRATION) FOR 16HRS PRIOR TO CRYOCOOLING AND DATA COLLECTION, pH 7.5
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-09-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54975 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
_diffrn_source.pdbx_wavelength             1.54975 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2X6B 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.30 
_reflns.number_obs                   14195 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.10 
_reflns.B_iso_Wilson_estimate        96.54 
_reflns.pdbx_redundancy              5.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.30 
_reflns_shell.d_res_low              3.42 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.87 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.90 
_reflns_shell.pdbx_redundancy        5.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2X6B 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     14168 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.91 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.409 
_refine.ls_d_res_high                            3.30 
_refine.ls_percent_reflns_obs                    99.84 
_refine.ls_R_factor_obs                          0.2368 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2343 
_refine.ls_R_factor_R_free                       0.2919 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.5 
_refine.ls_number_reflns_R_free                  643 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            3.3216 
_refine.aniso_B[2][2]                            3.3216 
_refine.aniso_B[3][3]                            -6.6431 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.258 
_refine.solvent_model_param_bsol                 47.559 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'PHOSPHOCHOLINE IN STUCTURE REPRESENTS ZWITTERIONIC HEAD-GROUP OF FOS-CHOLINE DETERGENT FROM CRYSTALLISATION CONDITION.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2WLH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.43 
_refine.pdbx_overall_phase_error                 31.16 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2229 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               2245 
_refine_hist.d_res_high                       3.30 
_refine_hist.d_res_low                        41.409 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.028  ? ? 2323 'X-RAY DIFFRACTION' ? 
f_angle_d          1.019  ? ? 3134 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 22.055 ? ? 1357 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.066  ? ? 361  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 396  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.2981 3.5527  2693 0.2834 99.00  0.4044 . . 113 . . 
'X-RAY DIFFRACTION' . 3.5527 3.9099  2732 0.2416 100.00 0.3414 . . 133 . . 
'X-RAY DIFFRACTION' . 3.9099 4.4751  2677 0.2028 100.00 0.3039 . . 135 . . 
'X-RAY DIFFRACTION' . 4.4751 5.6359  2697 0.1773 100.00 0.2250 . . 141 . . 
'X-RAY DIFFRACTION' . 5.6359 41.4126 2726 0.2721 100.00 0.2917 . . 121 . . 
# 
_struct.entry_id                  2X6B 
_struct.title                     'Potassium Channel from Magnetospirillum Magnetotacticum' 
_struct.pdbx_descriptor           'ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL 10' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2X6B 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'ION CHANNEL, METAL TRANSPORT, INTEGRAL MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 3 ? 
G N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 36  ? VAL A 44  ? ASP A 36  VAL A 44  1 ? 9  
HELX_P HELX_P2 2 SER A 45  ? CYS A 71  ? SER A 45  CYS A 71  1 ? 27 
HELX_P HELX_P3 3 SER A 82  ? ALA A 95  ? SER A 82  ALA A 95  1 ? 14 
HELX_P HELX_P4 4 ILE A 105 ? ARG A 134 ? ILE A 105 ARG A 134 1 ? 30 
HELX_P HELX_P5 5 THR A 228 ? SER A 235 ? THR A 228 SER A 235 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B BA . BA ? ? ? 1_555 A THR 96 OG1 ? ? A BA 1301 A THR 96 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc2  metalc ? ? B BA . BA ? ? ? 1_555 A THR 96 OG1 ? ? A BA 1301 A THR 96 3_555 ? ? ? ? ? ? ? 2.688 ? 
metalc3  metalc ? ? B BA . BA ? ? ? 1_555 A THR 96 OG1 ? ? A BA 1301 A THR 96 2_565 ? ? ? ? ? ? ? 2.688 ? 
metalc4  metalc ? ? B BA . BA ? ? ? 1_555 A THR 96 OG1 ? ? A BA 1301 A THR 96 4_455 ? ? ? ? ? ? ? 2.688 ? 
metalc5  metalc ? ? C K  . K  ? ? ? 1_555 A ILE 97 O   ? ? A K  1302 A ILE 97 2_565 ? ? ? ? ? ? ? 2.445 ? 
metalc6  metalc ? ? C K  . K  ? ? ? 1_555 A ILE 97 O   ? ? A K  1302 A ILE 97 3_555 ? ? ? ? ? ? ? 2.445 ? 
metalc7  metalc ? ? C K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1302 A GLY 98 2_565 ? ? ? ? ? ? ? 3.008 ? 
metalc8  metalc ? ? C K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1302 A GLY 98 3_555 ? ? ? ? ? ? ? 3.008 ? 
metalc9  metalc ? ? C K  . K  ? ? ? 1_555 A ILE 97 O   ? ? A K  1302 A ILE 97 1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc10 metalc ? ? C K  . K  ? ? ? 1_555 A ILE 97 O   ? ? A K  1302 A ILE 97 4_455 ? ? ? ? ? ? ? 2.445 ? 
metalc11 metalc ? ? C K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1302 A GLY 98 4_455 ? ? ? ? ? ? ? 3.008 ? 
metalc12 metalc ? ? C K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1302 A GLY 98 1_555 ? ? ? ? ? ? ? 3.008 ? 
metalc13 metalc ? ? D K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1303 A GLY 98 3_555 ? ? ? ? ? ? ? 2.688 ? 
metalc14 metalc ? ? D K  . K  ? ? ? 1_555 A TYR 99 O   ? ? A K  1303 A TYR 99 2_565 ? ? ? ? ? ? ? 2.463 ? 
metalc15 metalc ? ? D K  . K  ? ? ? 1_555 A TYR 99 O   ? ? A K  1303 A TYR 99 3_555 ? ? ? ? ? ? ? 2.463 ? 
metalc16 metalc ? ? D K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1303 A GLY 98 2_565 ? ? ? ? ? ? ? 2.688 ? 
metalc17 metalc ? ? D K  . K  ? ? ? 1_555 A TYR 99 O   ? ? A K  1303 A TYR 99 4_455 ? ? ? ? ? ? ? 2.463 ? 
metalc18 metalc ? ? D K  . K  ? ? ? 1_555 A TYR 99 O   ? ? A K  1303 A TYR 99 1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc19 metalc ? ? D K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1303 A GLY 98 4_455 ? ? ? ? ? ? ? 2.688 ? 
metalc20 metalc ? ? D K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1303 A GLY 98 1_555 ? ? ? ? ? ? ? 2.688 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 4 ? 
AH ? 4 ? 
AI ? 2 ? 
AJ ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? anti-parallel 
AD 3 4 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AA 2 PRO A 157 ? ASN A 165 ? PRO A 157 ASN A 165 
AB 1 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217 
AB 2 PRO A 157 ? ASN A 165 ? PRO A 157 ASN A 165 
AC 1 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267 
AC 2 MET A 148 ? ASP A 152 ? MET A 148 ASP A 152 
AC 3 PRO A 157 ? ASN A 165 ? PRO A 157 ASN A 165 
AC 4 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217 
AD 1 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267 
AD 2 MET A 148 ? ASP A 152 ? MET A 148 ASP A 152 
AD 3 PRO A 157 ? ASN A 165 ? PRO A 157 ASN A 165 
AD 4 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AE 1 VAL A 191 ? LEU A 198 ? VAL A 191 LEU A 198 
AE 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AF 1 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208 
AF 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AG 1 GLN A 252 ? SER A 261 ? GLN A 252 SER A 261 
AG 2 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247 
AG 3 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AG 4 VAL A 191 ? LEU A 198 ? VAL A 191 LEU A 198 
AH 1 GLN A 252 ? SER A 261 ? GLN A 252 SER A 261 
AH 2 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247 
AH 3 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AH 4 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208 
AI 1 HIS A 270 ? PHE A 271 ? HIS A 270 PHE A 271 
AI 2 ILE A 293 ? ALA A 294 ? ILE A 293 ALA A 294 
AJ 1 PHE A 275 ? THR A 277 ? PHE A 275 THR A 277 
AJ 2 ARG A 283 ? LEU A 285 ? ARG A 283 LEU A 285 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
AB 1 2 N HIS A 216 ? N HIS A 216 O LEU A 159 ? O LEU A 159 
AC 1 2 N ILE A 266 ? N ILE A 266 O MET A 148 ? O MET A 148 
AC 2 3 N SER A 151 ? N SER A 151 O THR A 158 ? O THR A 158 
AC 3 4 N LEU A 163 ? N LEU A 163 O TRP A 212 ? O TRP A 212 
AD 1 2 N ILE A 266 ? N ILE A 266 O MET A 148 ? O MET A 148 
AD 2 3 N SER A 151 ? N SER A 151 O THR A 158 ? O THR A 158 
AD 3 4 N ALA A 164 ? N ALA A 164 O LEU A 143 ? O LEU A 143 
AE 1 2 N LEU A 198 ? N LEU A 198 O LEU A 178 ? O LEU A 178 
AF 1 2 N PHE A 208 ? N PHE A 208 O ILE A 171 ? O ILE A 171 
AG 1 2 N TYR A 260 ? N TYR A 260 O PHE A 239 ? O PHE A 239 
AG 2 3 N HIS A 246 ? N HIS A 246 O ILE A 172 ? O ILE A 172 
AG 3 4 N GLU A 184 ? N GLU A 184 O PHE A 192 ? O PHE A 192 
AH 1 2 N TYR A 260 ? N TYR A 260 O PHE A 239 ? O PHE A 239 
AH 2 3 N HIS A 246 ? N HIS A 246 O ILE A 172 ? O ILE A 172 
AH 3 4 N ALA A 174 ? N ALA A 174 O SER A 205 ? O SER A 205 
AI 1 2 N HIS A 270 ? N HIS A 270 O ALA A 294 ? O ALA A 294 
AJ 1 2 N THR A 276 ? N THR A 276 O ALA A 284 ? O ALA A 284 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE BA A 1301' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE K A 1302'  
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE K A 1303'  
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PC A 1304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  THR A 96  ? THR A 96   . ? 1_555 ? 
2  AC1 4  THR A 96  ? THR A 96   . ? 4_455 ? 
3  AC1 4  THR A 96  ? THR A 96   . ? 2_565 ? 
4  AC1 4  THR A 96  ? THR A 96   . ? 3_555 ? 
5  AC2 12 ILE A 97  ? ILE A 97   . ? 1_555 ? 
6  AC2 12 ILE A 97  ? ILE A 97   . ? 4_455 ? 
7  AC2 12 ILE A 97  ? ILE A 97   . ? 3_555 ? 
8  AC2 12 ILE A 97  ? ILE A 97   . ? 2_565 ? 
9  AC2 12 GLY A 98  ? GLY A 98   . ? 3_555 ? 
10 AC2 12 GLY A 98  ? GLY A 98   . ? 2_565 ? 
11 AC2 12 GLY A 98  ? GLY A 98   . ? 4_455 ? 
12 AC2 12 GLY A 98  ? GLY A 98   . ? 1_555 ? 
13 AC2 12 K   D .   ? K   A 1303 . ? 4_455 ? 
14 AC2 12 K   D .   ? K   A 1303 . ? 3_555 ? 
15 AC2 12 K   D .   ? K   A 1303 . ? 2_565 ? 
16 AC2 12 K   D .   ? K   A 1303 . ? 1_555 ? 
17 AC3 12 GLY A 98  ? GLY A 98   . ? 1_555 ? 
18 AC3 12 GLY A 98  ? GLY A 98   . ? 4_455 ? 
19 AC3 12 GLY A 98  ? GLY A 98   . ? 3_555 ? 
20 AC3 12 GLY A 98  ? GLY A 98   . ? 2_565 ? 
21 AC3 12 TYR A 99  ? TYR A 99   . ? 2_565 ? 
22 AC3 12 TYR A 99  ? TYR A 99   . ? 3_555 ? 
23 AC3 12 TYR A 99  ? TYR A 99   . ? 1_555 ? 
24 AC3 12 TYR A 99  ? TYR A 99   . ? 4_455 ? 
25 AC3 12 K   C .   ? K   A 1302 . ? 4_455 ? 
26 AC3 12 K   C .   ? K   A 1302 . ? 3_555 ? 
27 AC3 12 K   C .   ? K   A 1302 . ? 2_565 ? 
28 AC3 12 K   C .   ? K   A 1302 . ? 1_555 ? 
29 AC4 9  PHE A 195 ? PHE A 195  . ? 4_455 ? 
30 AC4 9  ARG A 202 ? ARG A 202  . ? 1_555 ? 
31 AC4 9  SER A 205 ? SER A 205  . ? 1_555 ? 
32 AC4 9  ILE A 207 ? ILE A 207  . ? 1_555 ? 
33 AC4 9  PHE A 208 ? PHE A 208  . ? 1_555 ? 
34 AC4 9  SER A 209 ? SER A 209  . ? 1_555 ? 
35 AC4 9  LEU A 210 ? LEU A 210  . ? 1_555 ? 
36 AC4 9  SER A 211 ? SER A 211  . ? 1_555 ? 
37 AC4 9  TRP A 212 ? TRP A 212  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2X6B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2X6B 
_atom_sites.fract_transf_matrix[1][1]   0.009542 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009542 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011310 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BA 
C  
K  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 8   ? -38.988 48.002 -4.669  1.00 259.90 ? 8    PRO A N   1 
ATOM   2    C  CA  . PRO A 1 8   ? -39.991 49.043 -4.455  1.00 263.43 ? 8    PRO A CA  1 
ATOM   3    C  C   . PRO A 1 8   ? -40.474 49.001 -3.011  1.00 261.17 ? 8    PRO A C   1 
ATOM   4    O  O   . PRO A 1 8   ? -40.537 50.027 -2.334  1.00 262.78 ? 8    PRO A O   1 
ATOM   5    C  CB  . PRO A 1 8   ? -41.131 48.616 -5.383  1.00 266.82 ? 8    PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 8   ? -40.614 47.412 -6.170  1.00 264.60 ? 8    PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 8   ? -39.587 46.805 -5.274  1.00 261.57 ? 8    PRO A CD  1 
ATOM   8    N  N   . ALA A 1 9   ? -40.806 47.795 -2.557  1.00 259.36 ? 9    ALA A N   1 
ATOM   9    C  CA  . ALA A 1 9   ? -41.371 47.570 -1.230  1.00 256.56 ? 9    ALA A CA  1 
ATOM   10   C  C   . ALA A 1 9   ? -40.346 47.761 -0.116  1.00 249.80 ? 9    ALA A C   1 
ATOM   11   O  O   . ALA A 1 9   ? -39.151 47.543 -0.314  1.00 247.57 ? 9    ALA A O   1 
ATOM   12   C  CB  . ALA A 1 9   ? -41.982 46.179 -1.150  1.00 258.13 ? 9    ALA A CB  1 
ATOM   13   N  N   . ARG A 1 10  ? -40.830 48.157 1.058   1.00 245.90 ? 10   ARG A N   1 
ATOM   14   C  CA  . ARG A 1 10  ? -39.980 48.347 2.228   1.00 238.05 ? 10   ARG A CA  1 
ATOM   15   C  C   . ARG A 1 10  ? -39.407 47.017 2.718   1.00 231.16 ? 10   ARG A C   1 
ATOM   16   O  O   . ARG A 1 10  ? -40.060 45.978 2.620   1.00 232.48 ? 10   ARG A O   1 
ATOM   17   C  CB  . ARG A 1 10  ? -40.764 49.040 3.347   1.00 240.03 ? 10   ARG A CB  1 
ATOM   18   N  N   . LYS A 1 11  ? -38.188 47.060 3.252   1.00 222.71 ? 11   LYS A N   1 
ATOM   19   C  CA  . LYS A 1 11  ? -37.468 45.849 3.650   1.00 213.81 ? 11   LYS A CA  1 
ATOM   20   C  C   . LYS A 1 11  ? -36.808 45.996 5.027   1.00 203.69 ? 11   LYS A C   1 
ATOM   21   O  O   . LYS A 1 11  ? -36.737 47.101 5.567   1.00 201.32 ? 11   LYS A O   1 
ATOM   22   C  CB  . LYS A 1 11  ? -36.408 45.509 2.598   1.00 212.09 ? 11   LYS A CB  1 
ATOM   23   N  N   . PRO A 1 12  ? -36.322 44.879 5.601   1.00 195.99 ? 12   PRO A N   1 
ATOM   24   C  CA  . PRO A 1 12  ? -35.637 44.921 6.900   1.00 187.09 ? 12   PRO A CA  1 
ATOM   25   C  C   . PRO A 1 12  ? -34.181 45.390 6.789   1.00 173.17 ? 12   PRO A C   1 
ATOM   26   O  O   . PRO A 1 12  ? -33.460 44.955 5.887   1.00 173.92 ? 12   PRO A O   1 
ATOM   27   C  CB  . PRO A 1 12  ? -35.679 43.462 7.354   1.00 189.83 ? 12   PRO A CB  1 
ATOM   28   C  CG  . PRO A 1 12  ? -35.648 42.690 6.081   1.00 191.47 ? 12   PRO A CG  1 
ATOM   29   C  CD  . PRO A 1 12  ? -36.475 43.497 5.108   1.00 195.18 ? 12   PRO A CD  1 
ATOM   30   N  N   . ARG A 1 13  ? -33.758 46.259 7.705   1.00 157.31 ? 13   ARG A N   1 
ATOM   31   C  CA  . ARG A 1 13  ? -32.392 46.784 7.698   1.00 140.41 ? 13   ARG A CA  1 
ATOM   32   C  C   . ARG A 1 13  ? -31.364 45.744 8.140   1.00 129.88 ? 13   ARG A C   1 
ATOM   33   O  O   . ARG A 1 13  ? -31.490 45.141 9.205   1.00 130.20 ? 13   ARG A O   1 
ATOM   34   C  CB  . ARG A 1 13  ? -32.282 48.026 8.590   1.00 137.63 ? 13   ARG A CB  1 
ATOM   35   C  CG  . ARG A 1 13  ? -32.748 49.322 7.946   1.00 138.00 ? 13   ARG A CG  1 
ATOM   36   C  CD  . ARG A 1 13  ? -32.983 50.410 9.000   1.00 141.22 ? 13   ARG A CD  1 
ATOM   37   N  NE  . ARG A 1 13  ? -31.928 51.425 9.139   1.00 141.37 ? 13   ARG A NE  1 
ATOM   38   C  CZ  . ARG A 1 13  ? -30.877 51.593 8.337   1.00 140.09 ? 13   ARG A CZ  1 
ATOM   39   N  NH1 . ARG A 1 13  ? -30.680 50.813 7.286   1.00 137.55 ? 13   ARG A NH1 1 
ATOM   40   N  NH2 . ARG A 1 13  ? -30.012 52.564 8.594   1.00 141.04 ? 13   ARG A NH2 1 
ATOM   41   N  N   . ILE A 1 14  ? -30.339 45.547 7.319   1.00 120.76 ? 14   ILE A N   1 
ATOM   42   C  CA  . ILE A 1 14  ? -29.233 44.670 7.680   1.00 114.91 ? 14   ILE A CA  1 
ATOM   43   C  C   . ILE A 1 14  ? -28.284 45.369 8.652   1.00 108.49 ? 14   ILE A C   1 
ATOM   44   O  O   . ILE A 1 14  ? -27.753 44.743 9.578   1.00 110.71 ? 14   ILE A O   1 
ATOM   45   C  CB  . ILE A 1 14  ? -28.444 44.216 6.438   1.00 115.12 ? 14   ILE A CB  1 
ATOM   46   C  CG1 . ILE A 1 14  ? -29.359 43.453 5.471   1.00 121.59 ? 14   ILE A CG1 1 
ATOM   47   C  CG2 . ILE A 1 14  ? -27.230 43.382 6.843   1.00 109.03 ? 14   ILE A CG2 1 
ATOM   48   C  CD1 . ILE A 1 14  ? -30.072 42.254 6.085   1.00 123.43 ? 14   ILE A CD1 1 
ATOM   49   N  N   . LEU A 1 15  ? -28.074 46.667 8.431   1.00 97.36  ? 15   LEU A N   1 
ATOM   50   C  CA  . LEU A 1 15  ? -27.258 47.489 9.319   1.00 86.23  ? 15   LEU A CA  1 
ATOM   51   C  C   . LEU A 1 15  ? -28.123 48.597 9.876   1.00 77.27  ? 15   LEU A C   1 
ATOM   52   O  O   . LEU A 1 15  ? -29.024 49.064 9.196   1.00 75.18  ? 15   LEU A O   1 
ATOM   53   C  CB  . LEU A 1 15  ? -26.097 48.122 8.556   1.00 85.72  ? 15   LEU A CB  1 
ATOM   54   C  CG  . LEU A 1 15  ? -25.424 47.324 7.440   1.00 82.51  ? 15   LEU A CG  1 
ATOM   55   C  CD1 . LEU A 1 15  ? -24.423 48.198 6.701   1.00 79.92  ? 15   LEU A CD1 1 
ATOM   56   C  CD2 . LEU A 1 15  ? -24.752 46.077 7.978   1.00 80.95  ? 15   LEU A CD2 1 
ATOM   57   N  N   . ASN A 1 16  ? -27.852 49.024 11.104  1.00 78.33  ? 16   ASN A N   1 
ATOM   58   C  CA  . ASN A 1 16  ? -28.588 50.139 11.692  1.00 82.83  ? 16   ASN A CA  1 
ATOM   59   C  C   . ASN A 1 16  ? -27.843 51.452 11.486  1.00 79.70  ? 16   ASN A C   1 
ATOM   60   O  O   . ASN A 1 16  ? -26.669 51.456 11.129  1.00 80.18  ? 16   ASN A O   1 
ATOM   61   C  CB  . ASN A 1 16  ? -28.842 49.903 13.183  1.00 90.18  ? 16   ASN A CB  1 
ATOM   62   C  CG  . ASN A 1 16  ? -29.507 48.564 13.465  1.00 95.37  ? 16   ASN A CG  1 
ATOM   63   O  OD1 . ASN A 1 16  ? -29.722 47.761 12.562  1.00 95.88  ? 16   ASN A OD1 1 
ATOM   64   N  ND2 . ASN A 1 16  ? -29.833 48.321 14.730  1.00 99.83  ? 16   ASN A ND2 1 
ATOM   65   N  N   . SER A 1 17  ? -28.524 52.567 11.707  1.00 80.90  ? 17   SER A N   1 
ATOM   66   C  CA  . SER A 1 17  ? -27.909 53.872 11.498  1.00 85.94  ? 17   SER A CA  1 
ATOM   67   C  C   . SER A 1 17  ? -26.505 53.955 12.091  1.00 91.15  ? 17   SER A C   1 
ATOM   68   O  O   . SER A 1 17  ? -25.643 54.635 11.546  1.00 96.26  ? 17   SER A O   1 
ATOM   69   C  CB  . SER A 1 17  ? -28.780 54.971 12.100  1.00 90.16  ? 17   SER A CB  1 
ATOM   70   O  OG  . SER A 1 17  ? -30.116 54.519 12.240  1.00 94.87  ? 17   SER A OG  1 
ATOM   71   N  N   . ASP A 1 18  ? -26.276 53.266 13.207  1.00 91.47  ? 18   ASP A N   1 
ATOM   72   C  CA  . ASP A 1 18  ? -24.980 53.321 13.885  1.00 92.17  ? 18   ASP A CA  1 
ATOM   73   C  C   . ASP A 1 18  ? -23.985 52.296 13.348  1.00 88.91  ? 18   ASP A C   1 
ATOM   74   O  O   . ASP A 1 18  ? -22.981 51.991 13.990  1.00 73.55  ? 18   ASP A O   1 
ATOM   75   C  CB  . ASP A 1 18  ? -25.137 53.193 15.403  1.00 95.77  ? 18   ASP A CB  1 
ATOM   76   C  CG  . ASP A 1 18  ? -25.870 51.936 15.815  1.00 98.20  ? 18   ASP A CG  1 
ATOM   77   O  OD1 . ASP A 1 18  ? -26.737 51.472 15.054  1.00 97.38  ? 18   ASP A OD1 1 
ATOM   78   O  OD2 . ASP A 1 18  ? -25.584 51.416 16.915  1.00 102.06 ? 18   ASP A OD2 1 
ATOM   79   N  N   . GLY A 1 19  ? -24.272 51.787 12.153  1.00 88.70  ? 19   GLY A N   1 
ATOM   80   C  CA  . GLY A 1 19  ? -23.384 50.876 11.454  1.00 87.25  ? 19   GLY A CA  1 
ATOM   81   C  C   . GLY A 1 19  ? -23.210 49.534 12.132  1.00 85.67  ? 19   GLY A C   1 
ATOM   82   O  O   . GLY A 1 19  ? -22.275 48.800 11.827  1.00 82.06  ? 19   GLY A O   1 
ATOM   83   N  N   . SER A 1 20  ? -24.111 49.222 13.057  1.00 89.79  ? 20   SER A N   1 
ATOM   84   C  CA  . SER A 1 20  ? -24.115 47.938 13.746  1.00 92.66  ? 20   SER A CA  1 
ATOM   85   C  C   . SER A 1 20  ? -24.958 46.896 13.000  1.00 97.23  ? 20   SER A C   1 
ATOM   86   O  O   . SER A 1 20  ? -25.834 47.237 12.207  1.00 95.21  ? 20   SER A O   1 
ATOM   87   C  CB  . SER A 1 20  ? -24.646 48.117 15.157  1.00 92.32  ? 20   SER A CB  1 
ATOM   88   O  OG  . SER A 1 20  ? -25.943 48.673 15.113  1.00 93.99  ? 20   SER A OG  1 
ATOM   89   N  N   . SER A 1 21  ? -24.692 45.623 13.279  1.00 101.69 ? 21   SER A N   1 
ATOM   90   C  CA  . SER A 1 21  ? -25.280 44.511 12.535  1.00 99.22  ? 21   SER A CA  1 
ATOM   91   C  C   . SER A 1 21  ? -26.514 43.888 13.200  1.00 97.52  ? 21   SER A C   1 
ATOM   92   O  O   . SER A 1 21  ? -26.696 43.962 14.425  1.00 95.40  ? 21   SER A O   1 
ATOM   93   C  CB  . SER A 1 21  ? -24.219 43.432 12.306  1.00 98.27  ? 21   SER A CB  1 
ATOM   94   O  OG  . SER A 1 21  ? -24.814 42.206 11.929  1.00 98.57  ? 21   SER A OG  1 
ATOM   95   N  N   . ASN A 1 22  ? -27.354 43.265 12.377  1.00 94.56  ? 22   ASN A N   1 
ATOM   96   C  CA  . ASN A 1 22  ? -28.563 42.603 12.855  1.00 93.72  ? 22   ASN A CA  1 
ATOM   97   C  C   . ASN A 1 22  ? -28.516 41.103 12.634  1.00 95.59  ? 22   ASN A C   1 
ATOM   98   O  O   . ASN A 1 22  ? -29.550 40.430 12.630  1.00 99.64  ? 22   ASN A O   1 
ATOM   99   C  CB  . ASN A 1 22  ? -29.798 43.187 12.180  1.00 93.29  ? 22   ASN A CB  1 
ATOM   100  C  CG  . ASN A 1 22  ? -30.248 44.482 12.821  1.00 93.87  ? 22   ASN A CG  1 
ATOM   101  O  OD1 . ASN A 1 22  ? -29.860 44.797 13.949  1.00 95.43  ? 22   ASN A OD1 1 
ATOM   102  N  ND2 . ASN A 1 22  ? -31.072 45.240 12.109  1.00 91.54  ? 22   ASN A ND2 1 
ATOM   103  N  N   . ILE A 1 23  ? -27.303 40.595 12.438  1.00 92.52  ? 23   ILE A N   1 
ATOM   104  C  CA  . ILE A 1 23  ? -27.067 39.168 12.318  1.00 90.41  ? 23   ILE A CA  1 
ATOM   105  C  C   . ILE A 1 23  ? -26.804 38.616 13.695  1.00 91.08  ? 23   ILE A C   1 
ATOM   106  O  O   . ILE A 1 23  ? -26.130 39.249 14.504  1.00 89.78  ? 23   ILE A O   1 
ATOM   107  C  CB  . ILE A 1 23  ? -25.834 38.877 11.466  1.00 87.90  ? 23   ILE A CB  1 
ATOM   108  C  CG1 . ILE A 1 23  ? -26.172 38.984 9.982   1.00 85.76  ? 23   ILE A CG1 1 
ATOM   109  C  CG2 . ILE A 1 23  ? -25.289 37.500 11.780  1.00 92.20  ? 23   ILE A CG2 1 
ATOM   110  C  CD1 . ILE A 1 23  ? -26.253 40.402 9.477   1.00 84.40  ? 23   ILE A CD1 1 
ATOM   111  N  N   . THR A 1 24  ? -27.333 37.434 13.964  1.00 94.73  ? 24   THR A N   1 
ATOM   112  C  CA  . THR A 1 24  ? -27.090 36.802 15.243  1.00 103.29 ? 24   THR A CA  1 
ATOM   113  C  C   . THR A 1 24  ? -26.143 35.629 15.066  1.00 109.44 ? 24   THR A C   1 
ATOM   114  O  O   . THR A 1 24  ? -26.491 34.646 14.425  1.00 113.57 ? 24   THR A O   1 
ATOM   115  C  CB  . THR A 1 24  ? -28.396 36.299 15.852  1.00 108.46 ? 24   THR A CB  1 
ATOM   116  O  OG1 . THR A 1 24  ? -29.390 37.328 15.752  1.00 109.66 ? 24   THR A OG1 1 
ATOM   117  C  CG2 . THR A 1 24  ? -28.189 35.905 17.312  1.00 109.00 ? 24   THR A CG2 1 
ATOM   118  N  N   . ARG A 1 25  ? -24.942 35.722 15.624  1.00 111.14 ? 25   ARG A N   1 
ATOM   119  C  CA  . ARG A 1 25  ? -24.022 34.594 15.550  1.00 116.85 ? 25   ARG A CA  1 
ATOM   120  C  C   . ARG A 1 25  ? -24.607 33.403 16.294  1.00 122.83 ? 25   ARG A C   1 
ATOM   121  O  O   . ARG A 1 25  ? -25.706 33.484 16.841  1.00 126.38 ? 25   ARG A O   1 
ATOM   122  C  CB  . ARG A 1 25  ? -22.674 34.950 16.152  1.00 117.09 ? 25   ARG A CB  1 
ATOM   123  C  CG  . ARG A 1 25  ? -22.065 36.199 15.589  1.00 116.58 ? 25   ARG A CG  1 
ATOM   124  C  CD  . ARG A 1 25  ? -20.845 36.568 16.390  1.00 119.01 ? 25   ARG A CD  1 
ATOM   125  N  NE  . ARG A 1 25  ? -20.437 37.940 16.133  1.00 121.91 ? 25   ARG A NE  1 
ATOM   126  C  CZ  . ARG A 1 25  ? -19.454 38.272 15.310  1.00 122.37 ? 25   ARG A CZ  1 
ATOM   127  N  NH1 . ARG A 1 25  ? -18.787 37.317 14.678  1.00 121.65 ? 25   ARG A NH1 1 
ATOM   128  N  NH2 . ARG A 1 25  ? -19.139 39.550 15.127  1.00 121.11 ? 25   ARG A NH2 1 
ATOM   129  N  N   . LEU A 1 26  ? -23.871 32.298 16.318  1.00 124.08 ? 26   LEU A N   1 
ATOM   130  C  CA  . LEU A 1 26  ? -24.345 31.099 17.003  1.00 129.74 ? 26   LEU A CA  1 
ATOM   131  C  C   . LEU A 1 26  ? -23.212 30.399 17.745  1.00 136.96 ? 26   LEU A C   1 
ATOM   132  O  O   . LEU A 1 26  ? -22.311 29.820 17.129  1.00 136.52 ? 26   LEU A O   1 
ATOM   133  C  CB  . LEU A 1 26  ? -25.030 30.140 16.020  1.00 124.00 ? 26   LEU A CB  1 
ATOM   134  C  CG  . LEU A 1 26  ? -26.272 30.706 15.327  1.00 114.65 ? 26   LEU A CG  1 
ATOM   135  C  CD1 . LEU A 1 26  ? -26.787 29.783 14.240  1.00 110.43 ? 26   LEU A CD1 1 
ATOM   136  C  CD2 . LEU A 1 26  ? -27.346 30.981 16.348  1.00 116.96 ? 26   LEU A CD2 1 
ATOM   137  N  N   . GLY A 1 27  ? -23.272 30.466 19.074  1.00 141.56 ? 27   GLY A N   1 
ATOM   138  C  CA  . GLY A 1 27  ? -22.264 29.864 19.930  1.00 145.33 ? 27   GLY A CA  1 
ATOM   139  C  C   . GLY A 1 27  ? -22.681 29.870 21.389  1.00 149.34 ? 27   GLY A C   1 
ATOM   140  O  O   . GLY A 1 27  ? -22.017 29.285 22.243  1.00 151.68 ? 27   GLY A O   1 
ATOM   141  N  N   . LEU A 1 34  ? -14.623 33.975 30.151  1.00 141.56 ? 34   LEU A N   1 
ATOM   142  C  CA  . LEU A 1 34  ? -13.961 32.828 30.769  1.00 145.03 ? 34   LEU A CA  1 
ATOM   143  C  C   . LEU A 1 34  ? -13.092 32.101 29.754  1.00 147.28 ? 34   LEU A C   1 
ATOM   144  O  O   . LEU A 1 34  ? -11.922 31.810 30.012  1.00 144.14 ? 34   LEU A O   1 
ATOM   145  C  CB  . LEU A 1 34  ? -14.988 31.859 31.363  1.00 146.51 ? 34   LEU A CB  1 
ATOM   146  C  CG  . LEU A 1 34  ? -14.377 30.635 32.049  1.00 148.16 ? 34   LEU A CG  1 
ATOM   147  C  CD1 . LEU A 1 34  ? -13.236 31.068 32.961  1.00 147.97 ? 34   LEU A CD1 1 
ATOM   148  C  CD2 . LEU A 1 34  ? -15.425 29.838 32.820  1.00 149.65 ? 34   LEU A CD2 1 
ATOM   149  N  N   . ASP A 1 35  ? -13.685 31.804 28.602  1.00 151.29 ? 35   ASP A N   1 
ATOM   150  C  CA  . ASP A 1 35  ? -12.964 31.210 27.485  1.00 148.80 ? 35   ASP A CA  1 
ATOM   151  C  C   . ASP A 1 35  ? -12.318 32.337 26.692  1.00 141.33 ? 35   ASP A C   1 
ATOM   152  O  O   . ASP A 1 35  ? -11.560 32.098 25.756  1.00 136.09 ? 35   ASP A O   1 
ATOM   153  C  CB  . ASP A 1 35  ? -13.920 30.413 26.592  1.00 151.81 ? 35   ASP A CB  1 
ATOM   154  C  CG  . ASP A 1 35  ? -14.775 29.420 27.378  1.00 156.48 ? 35   ASP A CG  1 
ATOM   155  O  OD1 . ASP A 1 35  ? -14.686 29.392 28.626  1.00 156.44 ? 35   ASP A OD1 1 
ATOM   156  O  OD2 . ASP A 1 35  ? -15.546 28.666 26.745  1.00 158.10 ? 35   ASP A OD2 1 
ATOM   157  N  N   . ASP A 1 36  ? -12.629 33.567 27.093  1.00 140.90 ? 36   ASP A N   1 
ATOM   158  C  CA  . ASP A 1 36  ? -12.155 34.769 26.418  1.00 138.39 ? 36   ASP A CA  1 
ATOM   159  C  C   . ASP A 1 36  ? -12.166 35.933 27.401  1.00 137.56 ? 36   ASP A C   1 
ATOM   160  O  O   . ASP A 1 36  ? -12.837 36.943 27.184  1.00 135.85 ? 36   ASP A O   1 
ATOM   161  C  CB  . ASP A 1 36  ? -13.054 35.088 25.223  1.00 136.98 ? 36   ASP A CB  1 
ATOM   162  C  CG  . ASP A 1 36  ? -12.483 36.170 24.341  1.00 131.11 ? 36   ASP A CG  1 
ATOM   163  O  OD1 . ASP A 1 36  ? -11.275 36.450 24.464  1.00 128.71 ? 36   ASP A OD1 1 
ATOM   164  O  OD2 . ASP A 1 36  ? -13.239 36.735 23.526  1.00 130.31 ? 36   ASP A OD2 1 
ATOM   165  N  N   . HIS A 1 37  ? -11.408 35.778 28.479  1.00 140.81 ? 37   HIS A N   1 
ATOM   166  C  CA  . HIS A 1 37  ? -11.429 36.703 29.614  1.00 144.38 ? 37   HIS A CA  1 
ATOM   167  C  C   . HIS A 1 37  ? -11.058 38.163 29.309  1.00 134.27 ? 37   HIS A C   1 
ATOM   168  O  O   . HIS A 1 37  ? -11.794 39.082 29.667  1.00 130.21 ? 37   HIS A O   1 
ATOM   169  C  CB  . HIS A 1 37  ? -10.533 36.162 30.731  1.00 153.12 ? 37   HIS A CB  1 
ATOM   170  C  CG  . HIS A 1 37  ? -9.192  35.696 30.253  1.00 158.45 ? 37   HIS A CG  1 
ATOM   171  N  ND1 . HIS A 1 37  ? -8.991  34.450 29.696  1.00 161.80 ? 37   HIS A ND1 1 
ATOM   172  C  CD2 . HIS A 1 37  ? -7.986  36.311 30.246  1.00 157.72 ? 37   HIS A CD2 1 
ATOM   173  C  CE1 . HIS A 1 37  ? -7.719  34.318 29.368  1.00 161.23 ? 37   HIS A CE1 1 
ATOM   174  N  NE2 . HIS A 1 37  ? -7.086  35.433 29.691  1.00 159.08 ? 37   HIS A NE2 1 
ATOM   175  N  N   . TYR A 1 38  ? -9.911  38.374 28.673  1.00 128.63 ? 38   TYR A N   1 
ATOM   176  C  CA  . TYR A 1 38  ? -9.450  39.725 28.368  1.00 125.25 ? 38   TYR A CA  1 
ATOM   177  C  C   . TYR A 1 38  ? -10.517 40.519 27.604  1.00 127.80 ? 38   TYR A C   1 
ATOM   178  O  O   . TYR A 1 38  ? -10.909 41.612 28.016  1.00 127.29 ? 38   TYR A O   1 
ATOM   179  C  CB  . TYR A 1 38  ? -8.135  39.674 27.583  1.00 121.48 ? 38   TYR A CB  1 
ATOM   180  C  CG  . TYR A 1 38  ? -7.374  40.984 27.558  1.00 116.87 ? 38   TYR A CG  1 
ATOM   181  C  CD1 . TYR A 1 38  ? -7.176  41.713 28.716  1.00 117.67 ? 38   TYR A CD1 1 
ATOM   182  C  CD2 . TYR A 1 38  ? -6.837  41.481 26.379  1.00 115.24 ? 38   TYR A CD2 1 
ATOM   183  C  CE1 . TYR A 1 38  ? -6.481  42.911 28.701  1.00 116.70 ? 38   TYR A CE1 1 
ATOM   184  C  CE2 . TYR A 1 38  ? -6.136  42.677 26.356  1.00 113.97 ? 38   TYR A CE2 1 
ATOM   185  C  CZ  . TYR A 1 38  ? -5.962  43.386 27.521  1.00 113.40 ? 38   TYR A CZ  1 
ATOM   186  O  OH  . TYR A 1 38  ? -5.267  44.573 27.517  1.00 109.92 ? 38   TYR A OH  1 
ATOM   187  N  N   . HIS A 1 39  ? -10.984 39.963 26.490  1.00 129.26 ? 39   HIS A N   1 
ATOM   188  C  CA  . HIS A 1 39  ? -12.100 40.547 25.756  1.00 128.22 ? 39   HIS A CA  1 
ATOM   189  C  C   . HIS A 1 39  ? -13.280 40.762 26.698  1.00 126.84 ? 39   HIS A C   1 
ATOM   190  O  O   . HIS A 1 39  ? -13.796 41.872 26.809  1.00 130.95 ? 39   HIS A O   1 
ATOM   191  C  CB  . HIS A 1 39  ? -12.505 39.642 24.588  1.00 132.81 ? 39   HIS A CB  1 
ATOM   192  C  CG  . HIS A 1 39  ? -13.652 40.164 23.780  1.00 137.68 ? 39   HIS A CG  1 
ATOM   193  N  ND1 . HIS A 1 39  ? -14.952 39.746 23.973  1.00 142.63 ? 39   HIS A ND1 1 
ATOM   194  C  CD2 . HIS A 1 39  ? -13.694 41.064 22.769  1.00 139.10 ? 39   HIS A CD2 1 
ATOM   195  C  CE1 . HIS A 1 39  ? -15.745 40.368 23.118  1.00 145.02 ? 39   HIS A CE1 1 
ATOM   196  N  NE2 . HIS A 1 39  ? -15.006 41.175 22.377  1.00 143.57 ? 39   HIS A NE2 1 
ATOM   197  N  N   . ASP A 1 40  ? -13.689 39.700 27.387  1.00 120.39 ? 40   ASP A N   1 
ATOM   198  C  CA  . ASP A 1 40  ? -14.824 39.764 28.304  1.00 114.72 ? 40   ASP A CA  1 
ATOM   199  C  C   . ASP A 1 40  ? -14.621 40.937 29.260  1.00 108.45 ? 40   ASP A C   1 
ATOM   200  O  O   . ASP A 1 40  ? -15.500 41.782 29.402  1.00 112.93 ? 40   ASP A O   1 
ATOM   201  C  CB  . ASP A 1 40  ? -15.090 38.396 28.938  1.00 117.44 ? 40   ASP A CB  1 
ATOM   202  C  CG  . ASP A 1 40  ? -15.881 37.474 28.027  1.00 122.51 ? 40   ASP A CG  1 
ATOM   203  O  OD1 . ASP A 1 40  ? -16.423 37.964 27.013  1.00 122.74 ? 40   ASP A OD1 1 
ATOM   204  O  OD2 . ASP A 1 40  ? -15.964 36.263 28.329  1.00 124.87 ? 40   ASP A OD2 1 
ATOM   205  N  N   . LEU A 1 41  ? -13.466 40.993 29.912  1.00 100.49 ? 41   LEU A N   1 
ATOM   206  C  CA  . LEU A 1 41  ? -13.224 41.992 30.953  1.00 96.61  ? 41   LEU A CA  1 
ATOM   207  C  C   . LEU A 1 41  ? -13.438 43.415 30.448  1.00 95.03  ? 41   LEU A C   1 
ATOM   208  O  O   . LEU A 1 41  ? -14.230 44.168 31.008  1.00 96.30  ? 41   LEU A O   1 
ATOM   209  C  CB  . LEU A 1 41  ? -11.820 41.849 31.547  1.00 93.29  ? 41   LEU A CB  1 
ATOM   210  C  CG  . LEU A 1 41  ? -11.613 40.830 32.677  1.00 90.12  ? 41   LEU A CG  1 
ATOM   211  C  CD1 . LEU A 1 41  ? -10.176 40.859 33.158  1.00 86.18  ? 41   LEU A CD1 1 
ATOM   212  C  CD2 . LEU A 1 41  ? -12.554 41.092 33.841  1.00 87.31  ? 41   LEU A CD2 1 
ATOM   213  N  N   . LEU A 1 42  ? -12.725 43.778 29.389  1.00 94.69  ? 42   LEU A N   1 
ATOM   214  C  CA  . LEU A 1 42  ? -12.862 45.097 28.778  1.00 96.83  ? 42   LEU A CA  1 
ATOM   215  C  C   . LEU A 1 42  ? -14.249 45.314 28.173  1.00 101.83 ? 42   LEU A C   1 
ATOM   216  O  O   . LEU A 1 42  ? -14.737 46.439 28.095  1.00 104.36 ? 42   LEU A O   1 
ATOM   217  C  CB  . LEU A 1 42  ? -11.798 45.280 27.696  1.00 94.89  ? 42   LEU A CB  1 
ATOM   218  C  CG  . LEU A 1 42  ? -10.337 45.221 28.137  1.00 91.25  ? 42   LEU A CG  1 
ATOM   219  C  CD1 . LEU A 1 42  ? -9.448  44.959 26.958  1.00 90.00  ? 42   LEU A CD1 1 
ATOM   220  C  CD2 . LEU A 1 42  ? -9.941  46.519 28.790  1.00 91.88  ? 42   LEU A CD2 1 
ATOM   221  N  N   . THR A 1 43  ? -14.841 44.225 27.706  1.00 105.41 ? 43   THR A N   1 
ATOM   222  C  CA  . THR A 1 43  ? -16.154 44.214 27.069  1.00 111.24 ? 43   THR A CA  1 
ATOM   223  C  C   . THR A 1 43  ? -17.359 44.580 27.933  1.00 110.93 ? 43   THR A C   1 
ATOM   224  O  O   . THR A 1 43  ? -18.286 45.239 27.475  1.00 115.42 ? 43   THR A O   1 
ATOM   225  C  CB  . THR A 1 43  ? -16.423 42.840 26.447  1.00 120.00 ? 43   THR A CB  1 
ATOM   226  O  OG1 . THR A 1 43  ? -16.362 41.840 27.470  1.00 129.79 ? 43   THR A OG1 1 
ATOM   227  C  CG2 . THR A 1 43  ? -15.389 42.526 25.389  1.00 116.70 ? 43   THR A CG2 1 
ATOM   228  N  N   . VAL A 1 44  ? -17.342 44.135 29.180  1.00 106.73 ? 44   VAL A N   1 
ATOM   229  C  CA  . VAL A 1 44  ? -18.450 44.330 30.113  1.00 108.37 ? 44   VAL A CA  1 
ATOM   230  C  C   . VAL A 1 44  ? -18.805 45.754 30.535  1.00 113.56 ? 44   VAL A C   1 
ATOM   231  O  O   . VAL A 1 44  ? -17.971 46.656 30.518  1.00 113.71 ? 44   VAL A O   1 
ATOM   232  C  CB  . VAL A 1 44  ? -18.233 43.492 31.376  1.00 106.71 ? 44   VAL A CB  1 
ATOM   233  C  CG1 . VAL A 1 44  ? -18.374 42.020 31.050  1.00 102.61 ? 44   VAL A CG1 1 
ATOM   234  C  CG2 . VAL A 1 44  ? -16.864 43.776 31.955  1.00 107.94 ? 44   VAL A CG2 1 
ATOM   235  N  N   . SER A 1 45  ? -20.072 45.923 30.911  1.00 119.85 ? 45   SER A N   1 
ATOM   236  C  CA  . SER A 1 45  ? -20.625 47.203 31.344  1.00 122.00 ? 45   SER A CA  1 
ATOM   237  C  C   . SER A 1 45  ? -19.903 47.683 32.587  1.00 122.65 ? 45   SER A C   1 
ATOM   238  O  O   . SER A 1 45  ? -19.497 46.890 33.428  1.00 122.96 ? 45   SER A O   1 
ATOM   239  C  CB  . SER A 1 45  ? -22.118 47.074 31.630  1.00 123.21 ? 45   SER A CB  1 
ATOM   240  O  OG  . SER A 1 45  ? -22.438 45.769 32.076  1.00 122.03 ? 45   SER A OG  1 
ATOM   241  N  N   . TRP A 1 46  ? -19.732 48.993 32.689  1.00 121.84 ? 46   TRP A N   1 
ATOM   242  C  CA  . TRP A 1 46  ? -18.987 49.580 33.804  1.00 123.08 ? 46   TRP A CA  1 
ATOM   243  C  C   . TRP A 1 46  ? -19.383 49.134 35.223  1.00 124.58 ? 46   TRP A C   1 
ATOM   244  O  O   . TRP A 1 46  ? -18.526 49.053 36.103  1.00 121.02 ? 46   TRP A O   1 
ATOM   245  C  CB  . TRP A 1 46  ? -18.988 51.101 33.694  1.00 124.53 ? 46   TRP A CB  1 
ATOM   246  C  CG  . TRP A 1 46  ? -17.949 51.569 32.760  1.00 124.24 ? 46   TRP A CG  1 
ATOM   247  C  CD1 . TRP A 1 46  ? -18.137 52.110 31.523  1.00 126.34 ? 46   TRP A CD1 1 
ATOM   248  C  CD2 . TRP A 1 46  ? -16.535 51.512 32.969  1.00 121.38 ? 46   TRP A CD2 1 
ATOM   249  N  NE1 . TRP A 1 46  ? -16.920 52.412 30.954  1.00 124.77 ? 46   TRP A NE1 1 
ATOM   250  C  CE2 . TRP A 1 46  ? -15.922 52.053 31.821  1.00 119.71 ? 46   TRP A CE2 1 
ATOM   251  C  CE3 . TRP A 1 46  ? -15.729 51.063 34.020  1.00 118.16 ? 46   TRP A CE3 1 
ATOM   252  C  CZ2 . TRP A 1 46  ? -14.538 52.155 31.694  1.00 112.92 ? 46   TRP A CZ2 1 
ATOM   253  C  CZ3 . TRP A 1 46  ? -14.356 51.166 33.893  1.00 113.92 ? 46   TRP A CZ3 1 
ATOM   254  C  CH2 . TRP A 1 46  ? -13.774 51.708 32.737  1.00 111.20 ? 46   TRP A CH2 1 
ATOM   255  N  N   . PRO A 1 47  ? -20.682 48.876 35.457  1.00 127.68 ? 47   PRO A N   1 
ATOM   256  C  CA  . PRO A 1 47  ? -21.116 48.325 36.747  1.00 124.63 ? 47   PRO A CA  1 
ATOM   257  C  C   . PRO A 1 47  ? -20.625 46.898 36.969  1.00 121.05 ? 47   PRO A C   1 
ATOM   258  O  O   . PRO A 1 47  ? -20.079 46.593 38.034  1.00 119.38 ? 47   PRO A O   1 
ATOM   259  C  CB  . PRO A 1 47  ? -22.643 48.331 36.633  1.00 126.24 ? 47   PRO A CB  1 
ATOM   260  C  CG  . PRO A 1 47  ? -22.940 49.400 35.654  1.00 128.34 ? 47   PRO A CG  1 
ATOM   261  C  CD  . PRO A 1 47  ? -21.827 49.339 34.653  1.00 129.86 ? 47   PRO A CD  1 
ATOM   262  N  N   . VAL A 1 48  ? -20.826 46.039 35.974  1.00 119.38 ? 48   VAL A N   1 
ATOM   263  C  CA  . VAL A 1 48  ? -20.415 44.640 36.065  1.00 118.51 ? 48   VAL A CA  1 
ATOM   264  C  C   . VAL A 1 48  ? -18.933 44.510 36.392  1.00 124.08 ? 48   VAL A C   1 
ATOM   265  O  O   . VAL A 1 48  ? -18.510 43.543 37.022  1.00 128.30 ? 48   VAL A O   1 
ATOM   266  C  CB  . VAL A 1 48  ? -20.707 43.879 34.763  1.00 109.02 ? 48   VAL A CB  1 
ATOM   267  C  CG1 . VAL A 1 48  ? -20.071 42.502 34.798  1.00 101.19 ? 48   VAL A CG1 1 
ATOM   268  C  CG2 . VAL A 1 48  ? -22.204 43.785 34.533  1.00 111.91 ? 48   VAL A CG2 1 
ATOM   269  N  N   . PHE A 1 49  ? -18.150 45.494 35.966  1.00 122.79 ? 49   PHE A N   1 
ATOM   270  C  CA  . PHE A 1 49  ? -16.715 45.508 36.222  1.00 120.37 ? 49   PHE A CA  1 
ATOM   271  C  C   . PHE A 1 49  ? -16.387 45.834 37.690  1.00 116.10 ? 49   PHE A C   1 
ATOM   272  O  O   . PHE A 1 49  ? -15.728 45.050 38.387  1.00 111.90 ? 49   PHE A O   1 
ATOM   273  C  CB  . PHE A 1 49  ? -16.052 46.514 35.293  1.00 122.16 ? 49   PHE A CB  1 
ATOM   274  C  CG  . PHE A 1 49  ? -14.563 46.522 35.375  1.00 126.69 ? 49   PHE A CG  1 
ATOM   275  C  CD1 . PHE A 1 49  ? -13.810 45.706 34.548  1.00 129.19 ? 49   PHE A CD1 1 
ATOM   276  C  CD2 . PHE A 1 49  ? -13.909 47.352 36.272  1.00 127.29 ? 49   PHE A CD2 1 
ATOM   277  C  CE1 . PHE A 1 49  ? -12.425 45.717 34.614  1.00 128.99 ? 49   PHE A CE1 1 
ATOM   278  C  CE2 . PHE A 1 49  ? -12.527 47.369 36.345  1.00 126.86 ? 49   PHE A CE2 1 
ATOM   279  C  CZ  . PHE A 1 49  ? -11.783 46.552 35.513  1.00 127.40 ? 49   PHE A CZ  1 
ATOM   280  N  N   . ILE A 1 50  ? -16.848 46.993 38.152  1.00 113.10 ? 50   ILE A N   1 
ATOM   281  C  CA  . ILE A 1 50  ? -16.705 47.360 39.551  1.00 105.59 ? 50   ILE A CA  1 
ATOM   282  C  C   . ILE A 1 50  ? -17.239 46.227 40.407  1.00 104.23 ? 50   ILE A C   1 
ATOM   283  O  O   . ILE A 1 50  ? -16.813 46.054 41.542  1.00 107.50 ? 50   ILE A O   1 
ATOM   284  C  CB  . ILE A 1 50  ? -17.461 48.654 39.890  1.00 102.86 ? 50   ILE A CB  1 
ATOM   285  C  CG1 . ILE A 1 50  ? -16.848 49.845 39.151  1.00 99.60  ? 50   ILE A CG1 1 
ATOM   286  C  CG2 . ILE A 1 50  ? -17.427 48.909 41.379  1.00 103.06 ? 50   ILE A CG2 1 
ATOM   287  C  CD1 . ILE A 1 50  ? -17.511 51.180 39.475  1.00 99.61  ? 50   ILE A CD1 1 
ATOM   288  N  N   . THR A 1 51  ? -18.166 45.447 39.856  1.00 102.11 ? 51   THR A N   1 
ATOM   289  C  CA  . THR A 1 51  ? -18.708 44.286 40.566  1.00 106.47 ? 51   THR A CA  1 
ATOM   290  C  C   . THR A 1 51  ? -17.727 43.117 40.643  1.00 110.77 ? 51   THR A C   1 
ATOM   291  O  O   . THR A 1 51  ? -17.444 42.606 41.729  1.00 109.21 ? 51   THR A O   1 
ATOM   292  C  CB  . THR A 1 51  ? -20.028 43.790 39.945  1.00 102.57 ? 51   THR A CB  1 
ATOM   293  O  OG1 . THR A 1 51  ? -21.074 44.710 40.263  1.00 105.38 ? 51   THR A OG1 1 
ATOM   294  C  CG2 . THR A 1 51  ? -20.400 42.414 40.491  1.00 96.62  ? 51   THR A CG2 1 
ATOM   295  N  N   . LEU A 1 52  ? -17.216 42.690 39.491  1.00 112.05 ? 52   LEU A N   1 
ATOM   296  C  CA  . LEU A 1 52  ? -16.251 41.596 39.448  1.00 112.66 ? 52   LEU A CA  1 
ATOM   297  C  C   . LEU A 1 52  ? -15.097 41.873 40.395  1.00 117.52 ? 52   LEU A C   1 
ATOM   298  O  O   . LEU A 1 52  ? -14.783 41.061 41.272  1.00 120.52 ? 52   LEU A O   1 
ATOM   299  C  CB  . LEU A 1 52  ? -15.710 41.408 38.035  1.00 106.52 ? 52   LEU A CB  1 
ATOM   300  C  CG  . LEU A 1 52  ? -16.661 40.744 37.044  1.00 106.26 ? 52   LEU A CG  1 
ATOM   301  C  CD1 . LEU A 1 52  ? -16.006 40.637 35.668  1.00 105.89 ? 52   LEU A CD1 1 
ATOM   302  C  CD2 . LEU A 1 52  ? -17.088 39.378 37.562  1.00 101.05 ? 52   LEU A CD2 1 
ATOM   303  N  N   . ILE A 1 53  ? -14.469 43.030 40.207  1.00 112.73 ? 53   ILE A N   1 
ATOM   304  C  CA  . ILE A 1 53  ? -13.370 43.454 41.067  1.00 103.15 ? 53   ILE A CA  1 
ATOM   305  C  C   . ILE A 1 53  ? -13.760 43.496 42.544  1.00 101.67 ? 53   ILE A C   1 
ATOM   306  O  O   . ILE A 1 53  ? -13.182 42.778 43.363  1.00 102.21 ? 53   ILE A O   1 
ATOM   307  C  CB  . ILE A 1 53  ? -12.838 44.819 40.641  1.00 92.14  ? 53   ILE A CB  1 
ATOM   308  C  CG1 . ILE A 1 53  ? -11.970 44.661 39.400  1.00 84.98  ? 53   ILE A CG1 1 
ATOM   309  C  CG2 . ILE A 1 53  ? -12.031 45.445 41.765  1.00 92.45  ? 53   ILE A CG2 1 
ATOM   310  C  CD1 . ILE A 1 53  ? -10.935 45.741 39.272  1.00 81.26  ? 53   ILE A CD1 1 
ATOM   311  N  N   . THR A 1 54  ? -14.736 44.339 42.875  1.00 97.03  ? 54   THR A N   1 
ATOM   312  C  CA  . THR A 1 54  ? -15.242 44.418 44.231  1.00 96.33  ? 54   THR A CA  1 
ATOM   313  C  C   . THR A 1 54  ? -15.361 43.015 44.781  1.00 105.07 ? 54   THR A C   1 
ATOM   314  O  O   . THR A 1 54  ? -15.089 42.773 45.955  1.00 109.13 ? 54   THR A O   1 
ATOM   315  C  CB  . THR A 1 54  ? -16.616 45.087 44.274  1.00 94.73  ? 54   THR A CB  1 
ATOM   316  O  OG1 . THR A 1 54  ? -16.453 46.507 44.188  1.00 95.09  ? 54   THR A OG1 1 
ATOM   317  C  CG2 . THR A 1 54  ? -17.335 44.747 45.565  1.00 95.52  ? 54   THR A CG2 1 
ATOM   318  N  N   . GLY A 1 55  ? -15.752 42.088 43.913  1.00 109.56 ? 55   GLY A N   1 
ATOM   319  C  CA  . GLY A 1 55  ? -15.905 40.695 44.292  1.00 118.47 ? 55   GLY A CA  1 
ATOM   320  C  C   . GLY A 1 55  ? -14.593 40.004 44.609  1.00 122.45 ? 55   GLY A C   1 
ATOM   321  O  O   . GLY A 1 55  ? -14.377 39.555 45.734  1.00 124.76 ? 55   GLY A O   1 
ATOM   322  N  N   . LEU A 1 56  ? -13.717 39.916 43.613  1.00 123.47 ? 56   LEU A N   1 
ATOM   323  C  CA  . LEU A 1 56  ? -12.421 39.261 43.779  1.00 125.77 ? 56   LEU A CA  1 
ATOM   324  C  C   . LEU A 1 56  ? -11.725 39.693 45.067  1.00 123.75 ? 56   LEU A C   1 
ATOM   325  O  O   . LEU A 1 56  ? -11.280 38.861 45.864  1.00 121.95 ? 56   LEU A O   1 
ATOM   326  C  CB  . LEU A 1 56  ? -11.527 39.561 42.576  1.00 123.99 ? 56   LEU A CB  1 
ATOM   327  C  CG  . LEU A 1 56  ? -10.128 38.949 42.618  1.00 124.42 ? 56   LEU A CG  1 
ATOM   328  C  CD1 . LEU A 1 56  ? -10.200 37.434 42.792  1.00 126.05 ? 56   LEU A CD1 1 
ATOM   329  C  CD2 . LEU A 1 56  ? -9.366  39.318 41.359  1.00 121.12 ? 56   LEU A CD2 1 
ATOM   330  N  N   . TYR A 1 57  ? -11.629 41.005 45.247  1.00 120.88 ? 57   TYR A N   1 
ATOM   331  C  CA  . TYR A 1 57  ? -11.134 41.591 46.479  1.00 120.96 ? 57   TYR A CA  1 
ATOM   332  C  C   . TYR A 1 57  ? -11.667 40.830 47.695  1.00 120.93 ? 57   TYR A C   1 
ATOM   333  O  O   . TYR A 1 57  ? -10.900 40.322 48.517  1.00 121.24 ? 57   TYR A O   1 
ATOM   334  C  CB  . TYR A 1 57  ? -11.575 43.051 46.548  1.00 124.33 ? 57   TYR A CB  1 
ATOM   335  C  CG  . TYR A 1 57  ? -10.980 43.827 47.700  1.00 131.01 ? 57   TYR A CG  1 
ATOM   336  C  CD1 . TYR A 1 57  ? -9.661  44.252 47.658  1.00 132.47 ? 57   TYR A CD1 1 
ATOM   337  C  CD2 . TYR A 1 57  ? -11.737 44.148 48.821  1.00 132.64 ? 57   TYR A CD2 1 
ATOM   338  C  CE1 . TYR A 1 57  ? -9.105  44.965 48.702  1.00 131.72 ? 57   TYR A CE1 1 
ATOM   339  C  CE2 . TYR A 1 57  ? -11.187 44.867 49.872  1.00 132.03 ? 57   TYR A CE2 1 
ATOM   340  C  CZ  . TYR A 1 57  ? -9.868  45.271 49.805  1.00 130.29 ? 57   TYR A CZ  1 
ATOM   341  O  OH  . TYR A 1 57  ? -9.297  45.985 50.835  1.00 128.46 ? 57   TYR A OH  1 
ATOM   342  N  N   . LEU A 1 58  ? -12.989 40.752 47.798  1.00 117.81 ? 58   LEU A N   1 
ATOM   343  C  CA  . LEU A 1 58  ? -13.634 40.097 48.925  1.00 115.31 ? 58   LEU A CA  1 
ATOM   344  C  C   . LEU A 1 58  ? -13.184 38.651 49.091  1.00 121.42 ? 58   LEU A C   1 
ATOM   345  O  O   . LEU A 1 58  ? -12.900 38.207 50.202  1.00 126.08 ? 58   LEU A O   1 
ATOM   346  C  CB  . LEU A 1 58  ? -15.153 40.166 48.774  1.00 106.82 ? 58   LEU A CB  1 
ATOM   347  C  CG  . LEU A 1 58  ? -15.708 41.589 48.741  1.00 99.11  ? 58   LEU A CG  1 
ATOM   348  C  CD1 . LEU A 1 58  ? -17.213 41.584 48.628  1.00 96.79  ? 58   LEU A CD1 1 
ATOM   349  C  CD2 . LEU A 1 58  ? -15.272 42.350 49.977  1.00 98.84  ? 58   LEU A CD2 1 
ATOM   350  N  N   . VAL A 1 59  ? -13.113 37.921 47.983  1.00 122.71 ? 59   VAL A N   1 
ATOM   351  C  CA  . VAL A 1 59  ? -12.806 36.492 48.031  1.00 126.19 ? 59   VAL A CA  1 
ATOM   352  C  C   . VAL A 1 59  ? -11.405 36.196 48.558  1.00 125.90 ? 59   VAL A C   1 
ATOM   353  O  O   . VAL A 1 59  ? -11.207 35.246 49.317  1.00 128.46 ? 59   VAL A O   1 
ATOM   354  C  CB  . VAL A 1 59  ? -13.004 35.819 46.660  1.00 122.38 ? 59   VAL A CB  1 
ATOM   355  C  CG1 . VAL A 1 59  ? -12.352 34.447 46.641  1.00 122.51 ? 59   VAL A CG1 1 
ATOM   356  C  CG2 . VAL A 1 59  ? -14.485 35.716 46.332  1.00 121.61 ? 59   VAL A CG2 1 
ATOM   357  N  N   . THR A 1 60  ? -10.441 37.016 48.158  1.00 119.42 ? 60   THR A N   1 
ATOM   358  C  CA  . THR A 1 60  ? -9.062  36.844 48.603  1.00 113.73 ? 60   THR A CA  1 
ATOM   359  C  C   . THR A 1 60  ? -8.912  37.085 50.111  1.00 114.77 ? 60   THR A C   1 
ATOM   360  O  O   . THR A 1 60  ? -8.286  36.289 50.818  1.00 113.81 ? 60   THR A O   1 
ATOM   361  C  CB  . THR A 1 60  ? -8.119  37.776 47.834  1.00 102.97 ? 60   THR A CB  1 
ATOM   362  O  OG1 . THR A 1 60  ? -8.465  39.135 48.121  1.00 102.70 ? 60   THR A OG1 1 
ATOM   363  C  CG2 . THR A 1 60  ? -8.251  37.533 46.343  1.00 95.73  ? 60   THR A CG2 1 
ATOM   364  N  N   . ASN A 1 61  ? -9.484  38.181 50.600  1.00 112.73 ? 61   ASN A N   1 
ATOM   365  C  CA  . ASN A 1 61  ? -9.486  38.455 52.030  1.00 114.45 ? 61   ASN A CA  1 
ATOM   366  C  C   . ASN A 1 61  ? -10.294 37.422 52.794  1.00 120.37 ? 61   ASN A C   1 
ATOM   367  O  O   . ASN A 1 61  ? -10.085 37.216 53.986  1.00 124.67 ? 61   ASN A O   1 
ATOM   368  C  CB  . ASN A 1 61  ? -10.028 39.850 52.306  1.00 113.69 ? 61   ASN A CB  1 
ATOM   369  C  CG  . ASN A 1 61  ? -9.114  40.926 51.796  1.00 111.75 ? 61   ASN A CG  1 
ATOM   370  O  OD1 . ASN A 1 61  ? -7.988  40.653 51.387  1.00 109.39 ? 61   ASN A OD1 1 
ATOM   371  N  ND2 . ASN A 1 61  ? -9.589  42.162 51.817  1.00 112.26 ? 61   ASN A ND2 1 
ATOM   372  N  N   . ALA A 1 62  ? -11.232 36.785 52.103  1.00 120.24 ? 62   ALA A N   1 
ATOM   373  C  CA  . ALA A 1 62  ? -11.965 35.670 52.675  1.00 120.49 ? 62   ALA A CA  1 
ATOM   374  C  C   . ALA A 1 62  ? -11.021 34.486 52.730  1.00 118.99 ? 62   ALA A C   1 
ATOM   375  O  O   . ALA A 1 62  ? -11.104 33.653 53.621  1.00 125.34 ? 62   ALA A O   1 
ATOM   376  C  CB  . ALA A 1 62  ? -13.181 35.348 51.835  1.00 120.70 ? 62   ALA A CB  1 
ATOM   377  N  N   . LEU A 1 63  ? -10.110 34.425 51.768  1.00 112.44 ? 63   LEU A N   1 
ATOM   378  C  CA  . LEU A 1 63  ? -9.123  33.357 51.722  1.00 114.95 ? 63   LEU A CA  1 
ATOM   379  C  C   . LEU A 1 63  ? -8.017  33.558 52.745  1.00 120.07 ? 63   LEU A C   1 
ATOM   380  O  O   . LEU A 1 63  ? -7.673  32.635 53.480  1.00 120.99 ? 63   LEU A O   1 
ATOM   381  C  CB  . LEU A 1 63  ? -8.530  33.240 50.320  1.00 109.08 ? 63   LEU A CB  1 
ATOM   382  C  CG  . LEU A 1 63  ? -9.472  32.535 49.349  1.00 102.94 ? 63   LEU A CG  1 
ATOM   383  C  CD1 . LEU A 1 63  ? -8.986  32.662 47.902  1.00 92.20  ? 63   LEU A CD1 1 
ATOM   384  C  CD2 . LEU A 1 63  ? -9.634  31.078 49.785  1.00 102.63 ? 63   LEU A CD2 1 
ATOM   385  N  N   . PHE A 1 64  ? -7.458  34.764 52.788  1.00 120.53 ? 64   PHE A N   1 
ATOM   386  C  CA  . PHE A 1 64  ? -6.412  35.084 53.761  1.00 119.70 ? 64   PHE A CA  1 
ATOM   387  C  C   . PHE A 1 64  ? -6.928  35.017 55.198  1.00 116.42 ? 64   PHE A C   1 
ATOM   388  O  O   . PHE A 1 64  ? -6.312  34.387 56.055  1.00 107.80 ? 64   PHE A O   1 
ATOM   389  C  CB  . PHE A 1 64  ? -5.801  36.456 53.480  1.00 114.83 ? 64   PHE A CB  1 
ATOM   390  C  CG  . PHE A 1 64  ? -4.785  36.455 52.368  1.00 110.34 ? 64   PHE A CG  1 
ATOM   391  C  CD1 . PHE A 1 64  ? -5.094  36.978 51.122  1.00 105.91 ? 64   PHE A CD1 1 
ATOM   392  C  CD2 . PHE A 1 64  ? -3.516  35.937 52.572  1.00 109.44 ? 64   PHE A CD2 1 
ATOM   393  C  CE1 . PHE A 1 64  ? -4.156  36.989 50.103  1.00 99.19  ? 64   PHE A CE1 1 
ATOM   394  C  CE2 . PHE A 1 64  ? -2.578  35.941 51.550  1.00 103.93 ? 64   PHE A CE2 1 
ATOM   395  C  CZ  . PHE A 1 64  ? -2.901  36.468 50.315  1.00 98.13  ? 64   PHE A CZ  1 
ATOM   396  N  N   . ALA A 1 65  ? -8.052  35.677 55.456  1.00 119.96 ? 65   ALA A N   1 
ATOM   397  C  CA  . ALA A 1 65  ? -8.702  35.581 56.751  1.00 123.68 ? 65   ALA A CA  1 
ATOM   398  C  C   . ALA A 1 65  ? -8.808  34.116 57.094  1.00 131.88 ? 65   ALA A C   1 
ATOM   399  O  O   . ALA A 1 65  ? -8.701  33.723 58.251  1.00 137.91 ? 65   ALA A O   1 
ATOM   400  C  CB  . ALA A 1 65  ? -10.078 36.191 56.690  1.00 121.82 ? 65   ALA A CB  1 
ATOM   401  N  N   . LEU A 1 66  ? -9.014  33.310 56.060  1.00 134.33 ? 66   LEU A N   1 
ATOM   402  C  CA  . LEU A 1 66  ? -9.167  31.870 56.206  1.00 142.37 ? 66   LEU A CA  1 
ATOM   403  C  C   . LEU A 1 66  ? -7.810  31.201 56.413  1.00 147.88 ? 66   LEU A C   1 
ATOM   404  O  O   . LEU A 1 66  ? -7.732  30.074 56.904  1.00 150.08 ? 66   LEU A O   1 
ATOM   405  C  CB  . LEU A 1 66  ? -9.856  31.299 54.967  1.00 136.48 ? 66   LEU A CB  1 
ATOM   406  C  CG  . LEU A 1 66  ? -10.436 29.894 55.027  1.00 133.49 ? 66   LEU A CG  1 
ATOM   407  C  CD1 . LEU A 1 66  ? -11.530 29.850 56.081  1.00 133.74 ? 66   LEU A CD1 1 
ATOM   408  C  CD2 . LEU A 1 66  ? -10.968 29.510 53.648  1.00 128.23 ? 66   LEU A CD2 1 
ATOM   409  N  N   . ALA A 1 67  ? -6.745  31.902 56.033  1.00 147.32 ? 67   ALA A N   1 
ATOM   410  C  CA  . ALA A 1 67  ? -5.386  31.403 56.222  1.00 149.29 ? 67   ALA A CA  1 
ATOM   411  C  C   . ALA A 1 67  ? -4.888  31.631 57.653  1.00 158.21 ? 67   ALA A C   1 
ATOM   412  O  O   . ALA A 1 67  ? -4.401  30.702 58.301  1.00 162.02 ? 67   ALA A O   1 
ATOM   413  C  CB  . ALA A 1 67  ? -4.437  32.043 55.218  1.00 139.55 ? 67   ALA A CB  1 
ATOM   414  N  N   . TYR A 1 68  ? -5.008  32.863 58.145  1.00 159.88 ? 68   TYR A N   1 
ATOM   415  C  CA  . TYR A 1 68  ? -4.566  33.189 59.502  1.00 162.38 ? 68   TYR A CA  1 
ATOM   416  C  C   . TYR A 1 68  ? -5.337  32.379 60.539  1.00 164.52 ? 68   TYR A C   1 
ATOM   417  O  O   . TYR A 1 68  ? -4.883  32.209 61.668  1.00 165.60 ? 68   TYR A O   1 
ATOM   418  C  CB  . TYR A 1 68  ? -4.716  34.685 59.789  1.00 161.06 ? 68   TYR A CB  1 
ATOM   419  C  CG  . TYR A 1 68  ? -4.015  35.571 58.787  1.00 157.21 ? 68   TYR A CG  1 
ATOM   420  C  CD1 . TYR A 1 68  ? -4.739  36.297 57.850  1.00 156.05 ? 68   TYR A CD1 1 
ATOM   421  C  CD2 . TYR A 1 68  ? -2.631  35.677 58.769  1.00 154.80 ? 68   TYR A CD2 1 
ATOM   422  C  CE1 . TYR A 1 68  ? -4.107  37.111 56.927  1.00 150.38 ? 68   TYR A CE1 1 
ATOM   423  C  CE2 . TYR A 1 68  ? -1.990  36.488 57.851  1.00 150.60 ? 68   TYR A CE2 1 
ATOM   424  C  CZ  . TYR A 1 68  ? -2.735  37.203 56.932  1.00 147.27 ? 68   TYR A CZ  1 
ATOM   425  O  OH  . TYR A 1 68  ? -2.110  38.014 56.011  1.00 140.97 ? 68   TYR A OH  1 
ATOM   426  N  N   . LEU A 1 69  ? -6.509  31.889 60.151  1.00 164.73 ? 69   LEU A N   1 
ATOM   427  C  CA  . LEU A 1 69  ? -7.289  31.014 61.011  1.00 169.71 ? 69   LEU A CA  1 
ATOM   428  C  C   . LEU A 1 69  ? -6.911  29.558 60.765  1.00 173.48 ? 69   LEU A C   1 
ATOM   429  O  O   . LEU A 1 69  ? -7.048  28.719 61.653  1.00 182.56 ? 69   LEU A O   1 
ATOM   430  C  CB  . LEU A 1 69  ? -8.786  31.221 60.786  1.00 168.66 ? 69   LEU A CB  1 
ATOM   431  C  CG  . LEU A 1 69  ? -9.375  32.535 61.295  1.00 165.27 ? 69   LEU A CG  1 
ATOM   432  C  CD1 . LEU A 1 69  ? -10.888 32.510 61.181  1.00 166.00 ? 69   LEU A CD1 1 
ATOM   433  C  CD2 . LEU A 1 69  ? -8.954  32.781 62.731  1.00 167.15 ? 69   LEU A CD2 1 
ATOM   434  N  N   . ALA A 1 70  ? -6.439  29.263 59.556  1.00 166.83 ? 70   ALA A N   1 
ATOM   435  C  CA  . ALA A 1 70  ? -5.971  27.922 59.226  1.00 166.60 ? 70   ALA A CA  1 
ATOM   436  C  C   . ALA A 1 70  ? -4.886  27.515 60.209  1.00 170.93 ? 70   ALA A C   1 
ATOM   437  O  O   . ALA A 1 70  ? -4.777  26.349 60.589  1.00 174.90 ? 70   ALA A O   1 
ATOM   438  C  CB  . ALA A 1 70  ? -5.443  27.876 57.808  1.00 161.07 ? 70   ALA A CB  1 
ATOM   439  N  N   . CYS A 1 71  ? -4.079  28.494 60.606  1.00 171.80 ? 71   CYS A N   1 
ATOM   440  C  CA  . CYS A 1 71  ? -3.141  28.332 61.709  1.00 177.94 ? 71   CYS A CA  1 
ATOM   441  C  C   . CYS A 1 71  ? -3.778  28.893 62.981  1.00 182.17 ? 71   CYS A C   1 
ATOM   442  O  O   . CYS A 1 71  ? -4.810  29.562 62.917  1.00 183.26 ? 71   CYS A O   1 
ATOM   443  C  CB  . CYS A 1 71  ? -1.817  29.039 61.403  1.00 173.96 ? 71   CYS A CB  1 
ATOM   444  S  SG  . CYS A 1 71  ? -1.956  30.481 60.309  1.00 167.23 ? 71   CYS A SG  1 
ATOM   445  N  N   . GLY A 1 72  ? -3.179  28.614 64.132  1.00 183.48 ? 72   GLY A N   1 
ATOM   446  C  CA  . GLY A 1 72  ? -3.732  29.082 65.388  1.00 187.69 ? 72   GLY A CA  1 
ATOM   447  C  C   . GLY A 1 72  ? -4.038  30.570 65.378  1.00 187.14 ? 72   GLY A C   1 
ATOM   448  O  O   . GLY A 1 72  ? -3.881  31.243 64.360  1.00 183.05 ? 72   GLY A O   1 
ATOM   449  N  N   . ASP A 1 73  ? -4.477  31.084 66.523  1.00 192.17 ? 73   ASP A N   1 
ATOM   450  C  CA  . ASP A 1 73  ? -4.749  32.510 66.691  1.00 187.40 ? 73   ASP A CA  1 
ATOM   451  C  C   . ASP A 1 73  ? -3.468  33.321 66.516  1.00 178.12 ? 73   ASP A C   1 
ATOM   452  O  O   . ASP A 1 73  ? -2.810  33.661 67.503  1.00 184.27 ? 73   ASP A O   1 
ATOM   453  C  CB  . ASP A 1 73  ? -5.314  32.760 68.090  1.00 192.33 ? 73   ASP A CB  1 
ATOM   454  C  CG  . ASP A 1 73  ? -6.251  31.660 68.542  1.00 195.95 ? 73   ASP A CG  1 
ATOM   455  O  OD1 . ASP A 1 73  ? -6.222  31.305 69.742  1.00 197.63 ? 73   ASP A OD1 1 
ATOM   456  O  OD2 . ASP A 1 73  ? -7.009  31.143 67.692  1.00 196.26 ? 73   ASP A OD2 1 
ATOM   457  N  N   . VAL A 1 74  ? -3.112  33.630 65.271  1.00 161.00 ? 74   VAL A N   1 
ATOM   458  C  CA  . VAL A 1 74  ? -1.819  34.251 65.002  1.00 150.63 ? 74   VAL A CA  1 
ATOM   459  C  C   . VAL A 1 74  ? -1.825  35.761 65.139  1.00 150.44 ? 74   VAL A C   1 
ATOM   460  O  O   . VAL A 1 74  ? -0.824  36.349 65.532  1.00 153.18 ? 74   VAL A O   1 
ATOM   461  C  CB  . VAL A 1 74  ? -1.285  33.911 63.607  1.00 141.08 ? 74   VAL A CB  1 
ATOM   462  C  CG1 . VAL A 1 74  ? -0.005  34.673 63.327  1.00 139.19 ? 74   VAL A CG1 1 
ATOM   463  C  CG2 . VAL A 1 74  ? -1.097  32.410 63.469  1.00 140.30 ? 74   VAL A CG2 1 
ATOM   464  N  N   . ILE A 1 75  ? -2.937  36.397 64.805  1.00 147.59 ? 75   ILE A N   1 
ATOM   465  C  CA  . ILE A 1 75  ? -2.984  37.850 64.874  1.00 143.44 ? 75   ILE A CA  1 
ATOM   466  C  C   . ILE A 1 75  ? -3.418  38.301 66.259  1.00 145.86 ? 75   ILE A C   1 
ATOM   467  O  O   . ILE A 1 75  ? -4.268  37.673 66.888  1.00 151.63 ? 75   ILE A O   1 
ATOM   468  C  CB  . ILE A 1 75  ? -3.895  38.454 63.788  1.00 141.35 ? 75   ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 75  ? -5.367  38.196 64.097  1.00 146.47 ? 75   ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 75  ? -3.535  37.892 62.414  1.00 137.43 ? 75   ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 75  ? -6.266  38.408 62.896  1.00 145.44 ? 75   ILE A CD1 1 
ATOM   472  N  N   . GLU A 1 76  ? -2.808  39.382 66.735  1.00 141.81 ? 76   GLU A N   1 
ATOM   473  C  CA  . GLU A 1 76  ? -3.105  39.928 68.052  1.00 142.85 ? 76   GLU A CA  1 
ATOM   474  C  C   . GLU A 1 76  ? -4.287  40.898 68.000  1.00 140.10 ? 76   GLU A C   1 
ATOM   475  O  O   . GLU A 1 76  ? -4.435  41.657 67.041  1.00 137.48 ? 76   GLU A O   1 
ATOM   476  C  CB  . GLU A 1 76  ? -1.870  40.623 68.631  1.00 142.79 ? 76   GLU A CB  1 
ATOM   477  C  CG  . GLU A 1 76  ? -2.063  41.114 70.057  1.00 147.81 ? 76   GLU A CG  1 
ATOM   478  C  CD  . GLU A 1 76  ? -0.810  41.720 70.660  1.00 144.88 ? 76   GLU A CD  1 
ATOM   479  O  OE1 . GLU A 1 76  ? 0.219   41.809 69.956  1.00 141.88 ? 76   GLU A OE1 1 
ATOM   480  O  OE2 . GLU A 1 76  ? -0.861  42.105 71.846  1.00 145.38 ? 76   GLU A OE2 1 
ATOM   481  N  N   . ASN A 1 77  ? -5.124  40.851 69.036  1.00 139.43 ? 77   ASN A N   1 
ATOM   482  C  CA  . ASN A 1 77  ? -6.297  41.722 69.174  1.00 134.68 ? 77   ASN A CA  1 
ATOM   483  C  C   . ASN A 1 77  ? -7.534  41.257 68.404  1.00 136.61 ? 77   ASN A C   1 
ATOM   484  O  O   . ASN A 1 77  ? -8.577  41.909 68.443  1.00 131.49 ? 77   ASN A O   1 
ATOM   485  C  CB  . ASN A 1 77  ? -5.957  43.167 68.821  1.00 126.73 ? 77   ASN A CB  1 
ATOM   486  C  CG  . ASN A 1 77  ? -4.869  43.730 69.697  1.00 126.99 ? 77   ASN A CG  1 
ATOM   487  O  OD1 . ASN A 1 77  ? -4.639  43.245 70.804  1.00 135.09 ? 77   ASN A OD1 1 
ATOM   488  N  ND2 . ASN A 1 77  ? -4.189  44.759 69.212  1.00 120.28 ? 77   ASN A ND2 1 
ATOM   489  N  N   . ALA A 1 78  ? -7.407  40.131 67.707  1.00 144.45 ? 78   ALA A N   1 
ATOM   490  C  CA  . ALA A 1 78  ? -8.548  39.473 67.078  1.00 148.95 ? 78   ALA A CA  1 
ATOM   491  C  C   . ALA A 1 78  ? -9.040  38.328 67.962  1.00 161.56 ? 78   ALA A C   1 
ATOM   492  O  O   . ALA A 1 78  ? -8.242  37.651 68.615  1.00 165.54 ? 78   ALA A O   1 
ATOM   493  C  CB  . ALA A 1 78  ? -8.165  38.951 65.711  1.00 141.82 ? 78   ALA A CB  1 
ATOM   494  N  N   . ARG A 1 79  ? -10.352 38.113 67.991  1.00 166.96 ? 79   ARG A N   1 
ATOM   495  C  CA  . ARG A 1 79  ? -10.918 37.011 68.766  1.00 173.99 ? 79   ARG A CA  1 
ATOM   496  C  C   . ARG A 1 79  ? -10.645 35.687 68.061  1.00 178.15 ? 79   ARG A C   1 
ATOM   497  O  O   . ARG A 1 79  ? -10.703 35.607 66.827  1.00 177.34 ? 79   ARG A O   1 
ATOM   498  C  CB  . ARG A 1 79  ? -12.423 37.197 68.969  1.00 172.19 ? 79   ARG A CB  1 
ATOM   499  C  CG  . ARG A 1 79  ? -12.807 38.491 69.658  1.00 168.37 ? 79   ARG A CG  1 
ATOM   500  C  CD  . ARG A 1 79  ? -14.241 38.869 69.331  1.00 166.17 ? 79   ARG A CD  1 
ATOM   501  N  NE  . ARG A 1 79  ? -14.434 39.068 67.896  1.00 160.09 ? 79   ARG A NE  1 
ATOM   502  C  CZ  . ARG A 1 79  ? -15.610 39.304 67.324  1.00 156.98 ? 79   ARG A CZ  1 
ATOM   503  N  NH1 . ARG A 1 79  ? -16.706 39.366 68.070  1.00 162.21 ? 79   ARG A NH1 1 
ATOM   504  N  NH2 . ARG A 1 79  ? -15.693 39.470 66.009  1.00 147.57 ? 79   ARG A NH2 1 
ATOM   505  N  N   . PRO A 1 80  ? -10.337 34.646 68.846  1.00 179.74 ? 80   PRO A N   1 
ATOM   506  C  CA  . PRO A 1 80  ? -10.022 33.308 68.334  1.00 181.57 ? 80   PRO A CA  1 
ATOM   507  C  C   . PRO A 1 80  ? -11.131 32.700 67.467  1.00 181.32 ? 80   PRO A C   1 
ATOM   508  O  O   . PRO A 1 80  ? -12.311 32.764 67.823  1.00 187.05 ? 80   PRO A O   1 
ATOM   509  C  CB  . PRO A 1 80  ? -9.836  32.488 69.616  1.00 184.99 ? 80   PRO A CB  1 
ATOM   510  C  CG  . PRO A 1 80  ? -9.387  33.481 70.623  1.00 181.59 ? 80   PRO A CG  1 
ATOM   511  C  CD  . PRO A 1 80  ? -10.149 34.734 70.304  1.00 179.17 ? 80   PRO A CD  1 
ATOM   512  N  N   . GLY A 1 81  ? -10.743 32.115 66.337  1.00 173.75 ? 81   GLY A N   1 
ATOM   513  C  CA  . GLY A 1 81  ? -11.672 31.386 65.491  1.00 172.08 ? 81   GLY A CA  1 
ATOM   514  C  C   . GLY A 1 81  ? -12.694 32.246 64.772  1.00 166.50 ? 81   GLY A C   1 
ATOM   515  O  O   . GLY A 1 81  ? -13.404 31.761 63.888  1.00 168.31 ? 81   GLY A O   1 
ATOM   516  N  N   . SER A 1 82  ? -12.780 33.518 65.154  1.00 158.13 ? 82   SER A N   1 
ATOM   517  C  CA  . SER A 1 82  ? -13.675 34.455 64.484  1.00 146.70 ? 82   SER A CA  1 
ATOM   518  C  C   . SER A 1 82  ? -13.111 34.831 63.135  1.00 134.61 ? 82   SER A C   1 
ATOM   519  O  O   . SER A 1 82  ? -12.084 35.501 63.060  1.00 126.83 ? 82   SER A O   1 
ATOM   520  C  CB  . SER A 1 82  ? -13.870 35.723 65.313  1.00 143.02 ? 82   SER A CB  1 
ATOM   521  O  OG  . SER A 1 82  ? -14.604 36.693 64.582  1.00 134.71 ? 82   SER A OG  1 
ATOM   522  N  N   . PHE A 1 83  ? -13.785 34.398 62.076  1.00 135.01 ? 83   PHE A N   1 
ATOM   523  C  CA  . PHE A 1 83  ? -13.375 34.735 60.723  1.00 134.66 ? 83   PHE A CA  1 
ATOM   524  C  C   . PHE A 1 83  ? -13.466 36.231 60.458  1.00 139.47 ? 83   PHE A C   1 
ATOM   525  O  O   . PHE A 1 83  ? -12.687 36.782 59.677  1.00 134.98 ? 83   PHE A O   1 
ATOM   526  C  CB  . PHE A 1 83  ? -14.238 34.001 59.703  1.00 131.18 ? 83   PHE A CB  1 
ATOM   527  C  CG  . PHE A 1 83  ? -14.159 34.587 58.320  1.00 120.95 ? 83   PHE A CG  1 
ATOM   528  C  CD1 . PHE A 1 83  ? -13.322 34.036 57.369  1.00 116.63 ? 83   PHE A CD1 1 
ATOM   529  C  CD2 . PHE A 1 83  ? -14.913 35.705 57.984  1.00 114.60 ? 83   PHE A CD2 1 
ATOM   530  C  CE1 . PHE A 1 83  ? -13.250 34.580 56.116  1.00 114.30 ? 83   PHE A CE1 1 
ATOM   531  C  CE2 . PHE A 1 83  ? -14.845 36.251 56.742  1.00 109.66 ? 83   PHE A CE2 1 
ATOM   532  C  CZ  . PHE A 1 83  ? -14.013 35.690 55.800  1.00 111.64 ? 83   PHE A CZ  1 
ATOM   533  N  N   . THR A 1 84  ? -14.439 36.878 61.094  1.00 148.09 ? 84   THR A N   1 
ATOM   534  C  CA  . THR A 1 84  ? -14.672 38.303 60.894  1.00 148.94 ? 84   THR A CA  1 
ATOM   535  C  C   . THR A 1 84  ? -13.376 39.071 61.085  1.00 149.38 ? 84   THR A C   1 
ATOM   536  O  O   . THR A 1 84  ? -12.914 39.769 60.180  1.00 143.92 ? 84   THR A O   1 
ATOM   537  C  CB  . THR A 1 84  ? -15.714 38.846 61.886  1.00 151.62 ? 84   THR A CB  1 
ATOM   538  O  OG1 . THR A 1 84  ? -16.887 38.024 61.854  1.00 157.22 ? 84   THR A OG1 1 
ATOM   539  C  CG2 . THR A 1 84  ? -16.085 40.281 61.544  1.00 144.42 ? 84   THR A CG2 1 
ATOM   540  N  N   . ASP A 1 85  ? -12.795 38.923 62.271  1.00 155.06 ? 85   ASP A N   1 
ATOM   541  C  CA  . ASP A 1 85  ? -11.555 39.598 62.635  1.00 154.19 ? 85   ASP A CA  1 
ATOM   542  C  C   . ASP A 1 85  ? -10.441 39.344 61.621  1.00 150.15 ? 85   ASP A C   1 
ATOM   543  O  O   . ASP A 1 85  ? -9.742  40.271 61.216  1.00 151.42 ? 85   ASP A O   1 
ATOM   544  C  CB  . ASP A 1 85  ? -11.100 39.163 64.031  1.00 162.52 ? 85   ASP A CB  1 
ATOM   545  C  CG  . ASP A 1 85  ? -12.057 39.601 65.128  1.00 168.86 ? 85   ASP A CG  1 
ATOM   546  O  OD1 . ASP A 1 85  ? -13.171 40.062 64.806  1.00 171.12 ? 85   ASP A OD1 1 
ATOM   547  O  OD2 . ASP A 1 85  ? -11.691 39.484 66.315  1.00 170.72 ? 85   ASP A OD2 1 
ATOM   548  N  N   . ALA A 1 86  ? -10.274 38.090 61.212  1.00 145.03 ? 86   ALA A N   1 
ATOM   549  C  CA  . ALA A 1 86  ? -9.239  37.751 60.243  1.00 137.20 ? 86   ALA A CA  1 
ATOM   550  C  C   . ALA A 1 86  ? -9.497  38.439 58.907  1.00 132.44 ? 86   ALA A C   1 
ATOM   551  O  O   . ALA A 1 86  ? -8.561  38.775 58.187  1.00 125.69 ? 86   ALA A O   1 
ATOM   552  C  CB  . ALA A 1 86  ? -9.144  36.248 60.060  1.00 136.26 ? 86   ALA A CB  1 
ATOM   553  N  N   . PHE A 1 87  ? -10.769 38.660 58.584  1.00 135.93 ? 87   PHE A N   1 
ATOM   554  C  CA  . PHE A 1 87  ? -11.125 39.250 57.299  1.00 137.71 ? 87   PHE A CA  1 
ATOM   555  C  C   . PHE A 1 87  ? -10.881 40.760 57.230  1.00 145.89 ? 87   PHE A C   1 
ATOM   556  O  O   . PHE A 1 87  ? -10.370 41.262 56.226  1.00 146.46 ? 87   PHE A O   1 
ATOM   557  C  CB  . PHE A 1 87  ? -12.570 38.932 56.913  1.00 133.68 ? 87   PHE A CB  1 
ATOM   558  C  CG  . PHE A 1 87  ? -12.895 39.286 55.493  1.00 126.12 ? 87   PHE A CG  1 
ATOM   559  C  CD1 . PHE A 1 87  ? -13.026 38.302 54.536  1.00 124.92 ? 87   PHE A CD1 1 
ATOM   560  C  CD2 . PHE A 1 87  ? -13.036 40.609 55.110  1.00 122.55 ? 87   PHE A CD2 1 
ATOM   561  C  CE1 . PHE A 1 87  ? -13.315 38.626 53.226  1.00 122.70 ? 87   PHE A CE1 1 
ATOM   562  C  CE2 . PHE A 1 87  ? -13.316 40.941 53.800  1.00 119.21 ? 87   PHE A CE2 1 
ATOM   563  C  CZ  . PHE A 1 87  ? -13.457 39.950 52.856  1.00 118.91 ? 87   PHE A CZ  1 
ATOM   564  N  N   . PHE A 1 88  ? -11.260 41.484 58.281  1.00 150.32 ? 88   PHE A N   1 
ATOM   565  C  CA  . PHE A 1 88  ? -11.057 42.933 58.307  1.00 148.48 ? 88   PHE A CA  1 
ATOM   566  C  C   . PHE A 1 88  ? -9.590  43.258 58.491  1.00 143.24 ? 88   PHE A C   1 
ATOM   567  O  O   . PHE A 1 88  ? -9.087  44.250 57.965  1.00 138.74 ? 88   PHE A O   1 
ATOM   568  C  CB  . PHE A 1 88  ? -11.898 43.586 59.397  1.00 153.98 ? 88   PHE A CB  1 
ATOM   569  C  CG  . PHE A 1 88  ? -13.361 43.554 59.109  1.00 159.90 ? 88   PHE A CG  1 
ATOM   570  C  CD1 . PHE A 1 88  ? -14.235 42.888 59.947  1.00 166.74 ? 88   PHE A CD1 1 
ATOM   571  C  CD2 . PHE A 1 88  ? -13.860 44.163 57.974  1.00 158.75 ? 88   PHE A CD2 1 
ATOM   572  C  CE1 . PHE A 1 88  ? -15.586 42.851 59.670  1.00 169.22 ? 88   PHE A CE1 1 
ATOM   573  C  CE2 . PHE A 1 88  ? -15.208 44.129 57.690  1.00 161.31 ? 88   PHE A CE2 1 
ATOM   574  C  CZ  . PHE A 1 88  ? -16.073 43.472 58.539  1.00 166.00 ? 88   PHE A CZ  1 
ATOM   575  N  N   . PHE A 1 89  ? -8.912  42.409 59.249  1.00 142.38 ? 89   PHE A N   1 
ATOM   576  C  CA  . PHE A 1 89  ? -7.467  42.432 59.303  1.00 138.25 ? 89   PHE A CA  1 
ATOM   577  C  C   . PHE A 1 89  ? -6.946  42.254 57.887  1.00 135.88 ? 89   PHE A C   1 
ATOM   578  O  O   . PHE A 1 89  ? -6.062  42.988 57.443  1.00 133.32 ? 89   PHE A O   1 
ATOM   579  C  CB  . PHE A 1 89  ? -6.962  41.298 60.188  1.00 140.33 ? 89   PHE A CB  1 
ATOM   580  C  CG  . PHE A 1 89  ? -5.483  41.086 60.114  1.00 141.21 ? 89   PHE A CG  1 
ATOM   581  C  CD1 . PHE A 1 89  ? -4.608  42.045 60.592  1.00 139.97 ? 89   PHE A CD1 1 
ATOM   582  C  CD2 . PHE A 1 89  ? -4.963  39.921 59.577  1.00 144.34 ? 89   PHE A CD2 1 
ATOM   583  C  CE1 . PHE A 1 89  ? -3.243  41.850 60.527  1.00 139.16 ? 89   PHE A CE1 1 
ATOM   584  C  CE2 . PHE A 1 89  ? -3.596  39.719 59.512  1.00 143.31 ? 89   PHE A CE2 1 
ATOM   585  C  CZ  . PHE A 1 89  ? -2.736  40.686 59.987  1.00 140.05 ? 89   PHE A CZ  1 
ATOM   586  N  N   . SER A 1 90  ? -7.523  41.281 57.181  1.00 135.00 ? 90   SER A N   1 
ATOM   587  C  CA  . SER A 1 90  ? -7.094  40.917 55.831  1.00 123.64 ? 90   SER A CA  1 
ATOM   588  C  C   . SER A 1 90  ? -7.132  42.096 54.876  1.00 111.38 ? 90   SER A C   1 
ATOM   589  O  O   . SER A 1 90  ? -6.238  42.249 54.054  1.00 106.05 ? 90   SER A O   1 
ATOM   590  C  CB  . SER A 1 90  ? -7.939  39.764 55.279  1.00 123.60 ? 90   SER A CB  1 
ATOM   591  O  OG  . SER A 1 90  ? -7.413  39.281 54.056  1.00 118.97 ? 90   SER A OG  1 
ATOM   592  N  N   . VAL A 1 91  ? -8.164  42.927 54.980  1.00 111.66 ? 91   VAL A N   1 
ATOM   593  C  CA  . VAL A 1 91  ? -8.247  44.121 54.142  1.00 112.39 ? 91   VAL A CA  1 
ATOM   594  C  C   . VAL A 1 91  ? -7.186  45.143 54.556  1.00 111.78 ? 91   VAL A C   1 
ATOM   595  O  O   . VAL A 1 91  ? -6.570  45.796 53.711  1.00 103.97 ? 91   VAL A O   1 
ATOM   596  C  CB  . VAL A 1 91  ? -9.658  44.764 54.179  1.00 87.13  ? 91   VAL A CB  1 
ATOM   597  C  CG1 . VAL A 1 91  ? -10.666 43.801 54.783  1.00 89.41  ? 91   VAL A CG1 1 
ATOM   598  C  CG2 . VAL A 1 91  ? -9.633  46.094 54.938  1.00 85.33  ? 91   VAL A CG2 1 
ATOM   599  N  N   . GLN A 1 92  ? -6.967  45.254 55.864  1.00 118.29 ? 92   GLN A N   1 
ATOM   600  C  CA  . GLN A 1 92  ? -6.009  46.204 56.420  1.00 116.80 ? 92   GLN A CA  1 
ATOM   601  C  C   . GLN A 1 92  ? -4.566  45.803 56.143  1.00 120.27 ? 92   GLN A C   1 
ATOM   602  O  O   . GLN A 1 92  ? -3.661  46.632 56.216  1.00 119.67 ? 92   GLN A O   1 
ATOM   603  C  CB  . GLN A 1 92  ? -6.217  46.356 57.925  1.00 114.28 ? 92   GLN A CB  1 
ATOM   604  C  CG  . GLN A 1 92  ? -7.539  46.983 58.300  1.00 113.97 ? 92   GLN A CG  1 
ATOM   605  C  CD  . GLN A 1 92  ? -7.765  47.017 59.801  1.00 119.04 ? 92   GLN A CD  1 
ATOM   606  O  OE1 . GLN A 1 92  ? -6.827  46.877 60.591  1.00 119.68 ? 92   GLN A OE1 1 
ATOM   607  N  NE2 . GLN A 1 92  ? -9.019  47.202 60.203  1.00 121.26 ? 92   GLN A NE2 1 
ATOM   608  N  N   . THR A 1 93  ? -4.350  44.530 55.838  1.00 124.40 ? 93   THR A N   1 
ATOM   609  C  CA  . THR A 1 93  ? -3.009  44.046 55.534  1.00 125.58 ? 93   THR A CA  1 
ATOM   610  C  C   . THR A 1 93  ? -2.737  44.050 54.029  1.00 121.66 ? 93   THR A C   1 
ATOM   611  O  O   . THR A 1 93  ? -1.588  44.127 53.595  1.00 120.67 ? 93   THR A O   1 
ATOM   612  C  CB  . THR A 1 93  ? -2.760  42.628 56.114  1.00 175.78 ? 93   THR A CB  1 
ATOM   613  O  OG1 . THR A 1 93  ? -1.556  42.080 55.562  1.00 174.05 ? 93   THR A OG1 1 
ATOM   614  C  CG2 . THR A 1 93  ? -3.907  41.702 55.785  1.00 177.66 ? 93   THR A CG2 1 
ATOM   615  N  N   . MET A 1 94  ? -3.794  43.968 53.231  1.00 117.31 ? 94   MET A N   1 
ATOM   616  C  CA  . MET A 1 94  ? -3.613  43.900 51.792  1.00 111.79 ? 94   MET A CA  1 
ATOM   617  C  C   . MET A 1 94  ? -3.738  45.283 51.179  1.00 111.28 ? 94   MET A C   1 
ATOM   618  O  O   . MET A 1 94  ? -3.253  45.516 50.075  1.00 114.34 ? 94   MET A O   1 
ATOM   619  C  CB  . MET A 1 94  ? -4.609  42.934 51.152  1.00 111.05 ? 94   MET A CB  1 
ATOM   620  C  CG  . MET A 1 94  ? -4.233  42.535 49.736  1.00 109.72 ? 94   MET A CG  1 
ATOM   621  S  SD  . MET A 1 94  ? -5.409  41.402 48.978  1.00 166.69 ? 94   MET A SD  1 
ATOM   622  C  CE  . MET A 1 94  ? -6.927  42.329 49.164  1.00 65.66  ? 94   MET A CE  1 
ATOM   623  N  N   . ALA A 1 95  ? -4.384  46.195 51.902  1.00 107.50 ? 95   ALA A N   1 
ATOM   624  C  CA  . ALA A 1 95  ? -4.542  47.573 51.443  1.00 100.73 ? 95   ALA A CA  1 
ATOM   625  C  C   . ALA A 1 95  ? -3.449  48.483 52.022  1.00 99.21  ? 95   ALA A C   1 
ATOM   626  O  O   . ALA A 1 95  ? -3.422  49.690 51.770  1.00 94.74  ? 95   ALA A O   1 
ATOM   627  C  CB  . ALA A 1 95  ? -5.936  48.093 51.790  1.00 97.91  ? 95   ALA A CB  1 
ATOM   628  N  N   . THR A 1 96  ? -2.550  47.884 52.797  1.00 100.71 ? 96   THR A N   1 
ATOM   629  C  CA  . THR A 1 96  ? -1.450  48.604 53.443  1.00 97.46  ? 96   THR A CA  1 
ATOM   630  C  C   . THR A 1 96  ? -1.909  49.827 54.243  1.00 99.93  ? 96   THR A C   1 
ATOM   631  O  O   . THR A 1 96  ? -1.376  50.923 54.079  1.00 95.42  ? 96   THR A O   1 
ATOM   632  C  CB  . THR A 1 96  ? -0.385  49.053 52.448  1.00 85.39  ? 96   THR A CB  1 
ATOM   633  O  OG1 . THR A 1 96  ? -0.917  50.093 51.630  1.00 83.34  ? 96   THR A OG1 1 
ATOM   634  C  CG2 . THR A 1 96  ? 0.037   47.900 51.566  1.00 78.27  ? 96   THR A CG2 1 
ATOM   635  N  N   . ILE A 1 97  ? -2.898  49.635 55.111  1.00 105.95 ? 97   ILE A N   1 
ATOM   636  C  CA  . ILE A 1 97  ? -3.275  50.667 56.075  1.00 109.43 ? 97   ILE A CA  1 
ATOM   637  C  C   . ILE A 1 97  ? -2.471  50.421 57.351  1.00 108.98 ? 97   ILE A C   1 
ATOM   638  O  O   . ILE A 1 97  ? -1.773  51.301 57.840  1.00 107.12 ? 97   ILE A O   1 
ATOM   639  C  CB  . ILE A 1 97  ? -4.782  50.635 56.396  1.00 108.81 ? 97   ILE A CB  1 
ATOM   640  C  CG1 . ILE A 1 97  ? -5.584  50.189 55.169  1.00 109.91 ? 97   ILE A CG1 1 
ATOM   641  C  CG2 . ILE A 1 97  ? -5.251  51.988 56.926  1.00 101.21 ? 97   ILE A CG2 1 
ATOM   642  C  CD1 . ILE A 1 97  ? -7.031  49.851 55.491  1.00 113.28 ? 97   ILE A CD1 1 
ATOM   643  N  N   . GLY A 1 98  ? -2.584  49.214 57.887  1.00 108.96 ? 98   GLY A N   1 
ATOM   644  C  CA  . GLY A 1 98  ? -1.818  48.824 59.053  1.00 117.84 ? 98   GLY A CA  1 
ATOM   645  C  C   . GLY A 1 98  ? -1.960  49.715 60.277  1.00 125.66 ? 98   GLY A C   1 
ATOM   646  O  O   . GLY A 1 98  ? -0.962  50.143 60.858  1.00 129.83 ? 98   GLY A O   1 
ATOM   647  N  N   . TYR A 1 99  ? -3.191  49.987 60.695  1.00 126.28 ? 99   TYR A N   1 
ATOM   648  C  CA  . TYR A 1 99  ? -3.388  50.789 61.894  1.00 126.19 ? 99   TYR A CA  1 
ATOM   649  C  C   . TYR A 1 99  ? -2.417  50.455 63.013  1.00 130.87 ? 99   TYR A C   1 
ATOM   650  O  O   . TYR A 1 99  ? -1.625  51.296 63.443  1.00 131.24 ? 99   TYR A O   1 
ATOM   651  C  CB  . TYR A 1 99  ? -4.771  50.566 62.470  1.00 128.27 ? 99   TYR A CB  1 
ATOM   652  C  CG  . TYR A 1 99  ? -5.908  51.062 61.615  1.00 128.05 ? 99   TYR A CG  1 
ATOM   653  C  CD1 . TYR A 1 99  ? -6.715  50.169 60.920  1.00 128.75 ? 99   TYR A CD1 1 
ATOM   654  C  CD2 . TYR A 1 99  ? -6.201  52.420 61.526  1.00 128.08 ? 99   TYR A CD2 1 
ATOM   655  C  CE1 . TYR A 1 99  ? -7.777  50.609 60.153  1.00 127.29 ? 99   TYR A CE1 1 
ATOM   656  C  CE2 . TYR A 1 99  ? -7.260  52.873 60.760  1.00 126.47 ? 99   TYR A CE2 1 
ATOM   657  C  CZ  . TYR A 1 99  ? -8.047  51.961 60.075  1.00 126.05 ? 99   TYR A CZ  1 
ATOM   658  O  OH  . TYR A 1 99  ? -9.106  52.396 59.309  1.00 123.95 ? 99   TYR A OH  1 
ATOM   659  N  N   . GLY A 1 100 ? -2.499  49.223 63.503  1.00 135.69 ? 100  GLY A N   1 
ATOM   660  C  CA  . GLY A 1 100 ? -1.652  48.798 64.599  1.00 139.73 ? 100  GLY A CA  1 
ATOM   661  C  C   . GLY A 1 100 ? -2.357  48.183 65.792  1.00 143.02 ? 100  GLY A C   1 
ATOM   662  O  O   . GLY A 1 100 ? -1.705  47.833 66.773  1.00 149.04 ? 100  GLY A O   1 
ATOM   663  N  N   . LYS A 1 101 ? -3.682  48.056 65.725  1.00 139.45 ? 101  LYS A N   1 
ATOM   664  C  CA  . LYS A 1 101 ? -4.461  47.189 66.613  1.00 139.55 ? 101  LYS A CA  1 
ATOM   665  C  C   . LYS A 1 101 ? -4.363  45.720 66.181  1.00 142.88 ? 101  LYS A C   1 
ATOM   666  O  O   . LYS A 1 101 ? -3.669  44.923 66.811  1.00 143.66 ? 101  LYS A O   1 
ATOM   667  C  CB  . LYS A 1 101 ? -5.922  47.643 66.664  1.00 130.71 ? 101  LYS A CB  1 
ATOM   668  C  CG  . LYS A 1 101 ? -6.296  48.463 67.893  1.00 122.97 ? 101  LYS A CG  1 
ATOM   669  C  CD  . LYS A 1 101 ? -6.802  47.573 69.029  1.00 125.55 ? 101  LYS A CD  1 
ATOM   670  C  CE  . LYS A 1 101 ? -7.394  48.391 70.190  1.00 128.12 ? 101  LYS A CE  1 
ATOM   671  N  NZ  . LYS A 1 101 ? -7.483  47.615 71.473  1.00 129.92 ? 101  LYS A NZ  1 
ATOM   672  N  N   . LEU A 1 102 ? -5.077  45.365 65.117  1.00 144.05 ? 102  LEU A N   1 
ATOM   673  C  CA  . LEU A 1 102 ? -4.971  44.028 64.543  1.00 145.81 ? 102  LEU A CA  1 
ATOM   674  C  C   . LEU A 1 102 ? -3.592  43.825 63.916  1.00 144.75 ? 102  LEU A C   1 
ATOM   675  O  O   . LEU A 1 102 ? -3.286  44.395 62.862  1.00 144.59 ? 102  LEU A O   1 
ATOM   676  C  CB  . LEU A 1 102 ? -6.075  43.789 63.516  1.00 142.48 ? 102  LEU A CB  1 
ATOM   677  C  CG  . LEU A 1 102 ? -7.473  43.592 64.100  1.00 143.08 ? 102  LEU A CG  1 
ATOM   678  C  CD1 . LEU A 1 102 ? -8.488  43.460 62.977  1.00 142.76 ? 102  LEU A CD1 1 
ATOM   679  C  CD2 . LEU A 1 102 ? -7.517  42.378 65.024  1.00 144.12 ? 102  LEU A CD2 1 
ATOM   680  N  N   . ILE A 1 103 ? -2.774  42.998 64.568  1.00 141.75 ? 103  ILE A N   1 
ATOM   681  C  CA  . ILE A 1 103 ? -1.349  42.875 64.254  1.00 133.81 ? 103  ILE A CA  1 
ATOM   682  C  C   . ILE A 1 103 ? -0.916  41.394 64.285  1.00 132.96 ? 103  ILE A C   1 
ATOM   683  O  O   . ILE A 1 103 ? -1.530  40.588 64.986  1.00 142.09 ? 103  ILE A O   1 
ATOM   684  C  CB  . ILE A 1 103 ? -0.525  43.732 65.259  1.00 122.92 ? 103  ILE A CB  1 
ATOM   685  C  CG1 . ILE A 1 103 ? 0.851   44.093 64.702  1.00 121.51 ? 103  ILE A CG1 1 
ATOM   686  C  CG2 . ILE A 1 103 ? -0.438  43.056 66.631  1.00 127.58 ? 103  ILE A CG2 1 
ATOM   687  C  CD1 . ILE A 1 103 ? 1.664   44.964 65.629  1.00 124.57 ? 103  ILE A CD1 1 
ATOM   688  N  N   . PRO A 1 104 ? 0.124   41.021 63.512  1.00 123.66 ? 104  PRO A N   1 
ATOM   689  C  CA  . PRO A 1 104 ? 0.547   39.614 63.465  1.00 128.61 ? 104  PRO A CA  1 
ATOM   690  C  C   . PRO A 1 104 ? 1.331   39.182 64.700  1.00 142.89 ? 104  PRO A C   1 
ATOM   691  O  O   . PRO A 1 104 ? 1.640   39.989 65.578  1.00 149.26 ? 104  PRO A O   1 
ATOM   692  C  CB  . PRO A 1 104 ? 1.481   39.559 62.250  1.00 120.83 ? 104  PRO A CB  1 
ATOM   693  C  CG  . PRO A 1 104 ? 1.305   40.844 61.539  1.00 116.86 ? 104  PRO A CG  1 
ATOM   694  C  CD  . PRO A 1 104 ? 0.900   41.841 62.573  1.00 116.63 ? 104  PRO A CD  1 
ATOM   695  N  N   . ILE A 1 105 ? 1.587   37.881 64.766  1.00 145.73 ? 105  ILE A N   1 
ATOM   696  C  CA  . ILE A 1 105 ? 2.346   37.281 65.844  1.00 149.23 ? 105  ILE A CA  1 
ATOM   697  C  C   . ILE A 1 105 ? 3.070   36.056 65.309  1.00 151.75 ? 105  ILE A C   1 
ATOM   698  O  O   . ILE A 1 105 ? 2.488   35.255 64.584  1.00 148.79 ? 105  ILE A O   1 
ATOM   699  C  CB  . ILE A 1 105 ? 1.433   36.853 66.992  1.00 152.86 ? 105  ILE A CB  1 
ATOM   700  C  CG1 . ILE A 1 105 ? 1.454   37.901 68.102  1.00 151.55 ? 105  ILE A CG1 1 
ATOM   701  C  CG2 . ILE A 1 105 ? 1.860   35.500 67.524  1.00 159.33 ? 105  ILE A CG2 1 
ATOM   702  C  CD1 . ILE A 1 105 ? 0.309   37.773 69.076  1.00 155.31 ? 105  ILE A CD1 1 
ATOM   703  N  N   . GLY A 1 106 ? 4.336   35.904 65.666  1.00 157.82 ? 106  GLY A N   1 
ATOM   704  C  CA  . GLY A 1 106 ? 5.105   34.755 65.233  1.00 162.05 ? 106  GLY A CA  1 
ATOM   705  C  C   . GLY A 1 106 ? 5.626   34.896 63.821  1.00 155.23 ? 106  GLY A C   1 
ATOM   706  O  O   . GLY A 1 106 ? 5.217   35.790 63.089  1.00 138.08 ? 106  GLY A O   1 
ATOM   707  N  N   . PRO A 1 107 ? 6.525   33.998 63.439  1.00 165.83 ? 107  PRO A N   1 
ATOM   708  C  CA  . PRO A 1 107 ? 7.107   33.994 62.095  1.00 164.65 ? 107  PRO A CA  1 
ATOM   709  C  C   . PRO A 1 107 ? 6.106   33.681 60.984  1.00 167.92 ? 107  PRO A C   1 
ATOM   710  O  O   . PRO A 1 107 ? 6.167   34.286 59.917  1.00 168.18 ? 107  PRO A O   1 
ATOM   711  C  CB  . PRO A 1 107 ? 8.160   32.894 62.185  1.00 167.09 ? 107  PRO A CB  1 
ATOM   712  C  CG  . PRO A 1 107 ? 8.598   32.935 63.603  1.00 173.63 ? 107  PRO A CG  1 
ATOM   713  C  CD  . PRO A 1 107 ? 7.376   33.286 64.408  1.00 174.76 ? 107  PRO A CD  1 
ATOM   714  N  N   . LEU A 1 108 ? 5.207   32.733 61.228  1.00 169.35 ? 108  LEU A N   1 
ATOM   715  C  CA  . LEU A 1 108 ? 4.229   32.340 60.218  1.00 164.23 ? 108  LEU A CA  1 
ATOM   716  C  C   . LEU A 1 108 ? 3.255   33.439 59.800  1.00 151.86 ? 108  LEU A C   1 
ATOM   717  O  O   . LEU A 1 108 ? 2.982   33.612 58.616  1.00 138.31 ? 108  LEU A O   1 
ATOM   718  C  CB  . LEU A 1 108 ? 3.449   31.112 60.691  1.00 172.83 ? 108  LEU A CB  1 
ATOM   719  C  CG  . LEU A 1 108 ? 4.239   29.813 60.868  1.00 176.16 ? 108  LEU A CG  1 
ATOM   720  C  CD1 . LEU A 1 108 ? 3.355   28.739 61.479  1.00 179.03 ? 108  LEU A CD1 1 
ATOM   721  C  CD2 . LEU A 1 108 ? 4.819   29.344 59.545  1.00 172.69 ? 108  LEU A CD2 1 
ATOM   722  N  N   . ALA A 1 109 ? 2.735   34.184 60.767  1.00 154.59 ? 109  ALA A N   1 
ATOM   723  C  CA  . ALA A 1 109 ? 1.794   35.258 60.464  1.00 145.46 ? 109  ALA A CA  1 
ATOM   724  C  C   . ALA A 1 109 ? 2.460   36.341 59.633  1.00 130.81 ? 109  ALA A C   1 
ATOM   725  O  O   . ALA A 1 109 ? 1.866   36.883 58.709  1.00 121.30 ? 109  ALA A O   1 
ATOM   726  C  CB  . ALA A 1 109 ? 1.221   35.841 61.737  1.00 151.86 ? 109  ALA A CB  1 
ATOM   727  N  N   . ASN A 1 110 ? 3.702   36.653 59.977  1.00 135.55 ? 110  ASN A N   1 
ATOM   728  C  CA  . ASN A 1 110 ? 4.456   37.665 59.262  1.00 134.69 ? 110  ASN A CA  1 
ATOM   729  C  C   . ASN A 1 110 ? 4.672   37.247 57.817  1.00 133.24 ? 110  ASN A C   1 
ATOM   730  O  O   . ASN A 1 110 ? 4.575   38.067 56.907  1.00 133.09 ? 110  ASN A O   1 
ATOM   731  C  CB  . ASN A 1 110 ? 5.802   37.909 59.945  1.00 143.10 ? 110  ASN A CB  1 
ATOM   732  C  CG  . ASN A 1 110 ? 5.663   38.629 61.270  1.00 153.16 ? 110  ASN A CG  1 
ATOM   733  O  OD1 . ASN A 1 110 ? 4.673   39.317 61.513  1.00 151.03 ? 110  ASN A OD1 1 
ATOM   734  N  ND2 . ASN A 1 110 ? 6.655   38.468 62.141  1.00 162.96 ? 110  ASN A ND2 1 
ATOM   735  N  N   . THR A 1 111 ? 4.966   35.969 57.604  1.00 135.33 ? 111  THR A N   1 
ATOM   736  C  CA  . THR A 1 111 ? 5.196   35.471 56.253  1.00 136.76 ? 111  THR A CA  1 
ATOM   737  C  C   . THR A 1 111 ? 3.951   35.604 55.382  1.00 133.66 ? 111  THR A C   1 
ATOM   738  O  O   . THR A 1 111 ? 4.033   36.018 54.231  1.00 130.58 ? 111  THR A O   1 
ATOM   739  C  CB  . THR A 1 111 ? 5.644   34.005 56.264  1.00 140.53 ? 111  THR A CB  1 
ATOM   740  O  OG1 . THR A 1 111 ? 7.066   33.939 56.115  1.00 141.57 ? 111  THR A OG1 1 
ATOM   741  C  CG2 . THR A 1 111 ? 4.989   33.246 55.129  1.00 136.52 ? 111  THR A CG2 1 
ATOM   742  N  N   . LEU A 1 112 ? 2.797   35.260 55.938  1.00 133.29 ? 112  LEU A N   1 
ATOM   743  C  CA  . LEU A 1 112 ? 1.547   35.363 55.201  1.00 126.00 ? 112  LEU A CA  1 
ATOM   744  C  C   . LEU A 1 112 ? 1.251   36.819 54.874  1.00 118.61 ? 112  LEU A C   1 
ATOM   745  O  O   . LEU A 1 112 ? 0.778   37.139 53.789  1.00 116.32 ? 112  LEU A O   1 
ATOM   746  C  CB  . LEU A 1 112 ? 0.394   34.747 55.990  1.00 131.76 ? 112  LEU A CB  1 
ATOM   747  C  CG  . LEU A 1 112 ? 0.474   33.240 56.234  1.00 135.76 ? 112  LEU A CG  1 
ATOM   748  C  CD1 . LEU A 1 112 ? -0.648  32.786 57.147  1.00 143.44 ? 112  LEU A CD1 1 
ATOM   749  C  CD2 . LEU A 1 112 ? 0.437   32.484 54.921  1.00 126.35 ? 112  LEU A CD2 1 
ATOM   750  N  N   . VAL A 1 113 ? 1.533   37.701 55.826  1.00 119.06 ? 113  VAL A N   1 
ATOM   751  C  CA  . VAL A 1 113 ? 1.285   39.121 55.638  1.00 119.88 ? 113  VAL A CA  1 
ATOM   752  C  C   . VAL A 1 113 ? 2.117   39.652 54.487  1.00 126.02 ? 113  VAL A C   1 
ATOM   753  O  O   . VAL A 1 113 ? 1.638   40.442 53.680  1.00 131.31 ? 113  VAL A O   1 
ATOM   754  C  CB  . VAL A 1 113 ? 1.628   39.929 56.896  1.00 118.94 ? 113  VAL A CB  1 
ATOM   755  C  CG1 . VAL A 1 113 ? 1.474   41.410 56.619  1.00 117.67 ? 113  VAL A CG1 1 
ATOM   756  C  CG2 . VAL A 1 113 ? 0.739   39.510 58.050  1.00 123.05 ? 113  VAL A CG2 1 
ATOM   757  N  N   . THR A 1 114 ? 3.366   39.218 54.402  1.00 125.90 ? 114  THR A N   1 
ATOM   758  C  CA  . THR A 1 114 ? 4.220   39.672 53.319  1.00 125.27 ? 114  THR A CA  1 
ATOM   759  C  C   . THR A 1 114 ? 3.617   39.202 52.005  1.00 124.20 ? 114  THR A C   1 
ATOM   760  O  O   . THR A 1 114 ? 3.600   39.933 51.017  1.00 122.89 ? 114  THR A O   1 
ATOM   761  C  CB  . THR A 1 114 ? 5.641   39.122 53.451  1.00 124.68 ? 114  THR A CB  1 
ATOM   762  O  OG1 . THR A 1 114 ? 5.589   37.798 53.990  1.00 127.94 ? 114  THR A OG1 1 
ATOM   763  C  CG2 . THR A 1 114 ? 6.467   40.005 54.369  1.00 124.38 ? 114  THR A CG2 1 
ATOM   764  N  N   . LEU A 1 115 ? 3.123   37.970 52.001  1.00 121.76 ? 115  LEU A N   1 
ATOM   765  C  CA  . LEU A 1 115 ? 2.513   37.401 50.810  1.00 118.09 ? 115  LEU A CA  1 
ATOM   766  C  C   . LEU A 1 115 ? 1.257   38.151 50.400  1.00 112.70 ? 115  LEU A C   1 
ATOM   767  O  O   . LEU A 1 115 ? 1.039   38.396 49.221  1.00 111.35 ? 115  LEU A O   1 
ATOM   768  C  CB  . LEU A 1 115 ? 2.193   35.922 51.022  1.00 125.80 ? 115  LEU A CB  1 
ATOM   769  C  CG  . LEU A 1 115 ? 1.480   35.219 49.867  1.00 130.57 ? 115  LEU A CG  1 
ATOM   770  C  CD1 . LEU A 1 115 ? 2.352   35.207 48.623  1.00 133.40 ? 115  LEU A CD1 1 
ATOM   771  C  CD2 . LEU A 1 115 ? 1.077   33.810 50.263  1.00 129.00 ? 115  LEU A CD2 1 
ATOM   772  N  N   . GLU A 1 116 ? 0.429   38.520 51.369  1.00 111.70 ? 116  GLU A N   1 
ATOM   773  C  CA  . GLU A 1 116 ? -0.800  39.237 51.054  1.00 113.64 ? 116  GLU A CA  1 
ATOM   774  C  C   . GLU A 1 116 ? -0.484  40.647 50.548  1.00 112.19 ? 116  GLU A C   1 
ATOM   775  O  O   . GLU A 1 116 ? -1.171  41.182 49.668  1.00 106.14 ? 116  GLU A O   1 
ATOM   776  C  CB  . GLU A 1 116 ? -1.725  39.294 52.271  1.00 116.89 ? 116  GLU A CB  1 
ATOM   777  C  CG  . GLU A 1 116 ? -3.116  39.807 51.939  1.00 119.69 ? 116  GLU A CG  1 
ATOM   778  C  CD  . GLU A 1 116 ? -4.088  39.670 53.093  1.00 126.09 ? 116  GLU A CD  1 
ATOM   779  O  OE1 . GLU A 1 116 ? -3.696  39.120 54.147  1.00 130.54 ? 116  GLU A OE1 1 
ATOM   780  O  OE2 . GLU A 1 116 ? -5.248  40.112 52.937  1.00 125.56 ? 116  GLU A OE2 1 
ATOM   781  N  N   . ALA A 1 117 ? 0.564   41.238 51.115  1.00 113.58 ? 117  ALA A N   1 
ATOM   782  C  CA  . ALA A 1 117 ? 1.047   42.540 50.680  1.00 110.01 ? 117  ALA A CA  1 
ATOM   783  C  C   . ALA A 1 117 ? 1.594   42.450 49.262  1.00 106.53 ? 117  ALA A C   1 
ATOM   784  O  O   . ALA A 1 117 ? 1.437   43.376 48.464  1.00 98.28  ? 117  ALA A O   1 
ATOM   785  C  CB  . ALA A 1 117 ? 2.122   43.040 51.624  1.00 110.52 ? 117  ALA A CB  1 
ATOM   786  N  N   . LEU A 1 118 ? 2.244   41.330 48.958  1.00 112.20 ? 118  LEU A N   1 
ATOM   787  C  CA  . LEU A 1 118 ? 2.750   41.092 47.613  1.00 113.23 ? 118  LEU A CA  1 
ATOM   788  C  C   . LEU A 1 118 ? 1.585   41.032 46.631  1.00 110.83 ? 118  LEU A C   1 
ATOM   789  O  O   . LEU A 1 118 ? 1.620   41.667 45.579  1.00 109.78 ? 118  LEU A O   1 
ATOM   790  C  CB  . LEU A 1 118 ? 3.584   39.808 47.563  1.00 115.32 ? 118  LEU A CB  1 
ATOM   791  C  CG  . LEU A 1 118 ? 4.275   39.489 46.232  1.00 115.32 ? 118  LEU A CG  1 
ATOM   792  C  CD1 . LEU A 1 118 ? 4.968   40.727 45.642  1.00 112.73 ? 118  LEU A CD1 1 
ATOM   793  C  CD2 . LEU A 1 118 ? 5.256   38.328 46.396  1.00 114.81 ? 118  LEU A CD2 1 
ATOM   794  N  N   . CYS A 1 119 ? 0.545   40.288 46.994  1.00 109.97 ? 119  CYS A N   1 
ATOM   795  C  CA  . CYS A 1 119 ? -0.659  40.193 46.175  1.00 107.50 ? 119  CYS A CA  1 
ATOM   796  C  C   . CYS A 1 119 ? -1.416  41.520 46.094  1.00 108.19 ? 119  CYS A C   1 
ATOM   797  O  O   . CYS A 1 119 ? -1.756  41.976 45.009  1.00 99.50  ? 119  CYS A O   1 
ATOM   798  C  CB  . CYS A 1 119 ? -1.583  39.101 46.710  1.00 108.87 ? 119  CYS A CB  1 
ATOM   799  S  SG  . CYS A 1 119 ? -0.813  37.471 46.809  1.00 118.51 ? 119  CYS A SG  1 
ATOM   800  N  N   . GLY A 1 120 ? -1.688  42.130 47.245  1.00 117.24 ? 120  GLY A N   1 
ATOM   801  C  CA  . GLY A 1 120 ? -2.380  43.408 47.281  1.00 118.63 ? 120  GLY A CA  1 
ATOM   802  C  C   . GLY A 1 120 ? -1.748  44.418 46.342  1.00 117.08 ? 120  GLY A C   1 
ATOM   803  O  O   . GLY A 1 120 ? -2.425  45.295 45.799  1.00 112.10 ? 120  GLY A O   1 
ATOM   804  N  N   . MET A 1 121 ? -0.438  44.288 46.157  1.00 119.93 ? 121  MET A N   1 
ATOM   805  C  CA  . MET A 1 121 ? 0.301   45.138 45.232  1.00 116.60 ? 121  MET A CA  1 
ATOM   806  C  C   . MET A 1 121 ? 0.179   44.626 43.803  1.00 108.45 ? 121  MET A C   1 
ATOM   807  O  O   . MET A 1 121 ? 0.105   45.418 42.875  1.00 106.21 ? 121  MET A O   1 
ATOM   808  C  CB  . MET A 1 121 ? 1.772   45.275 45.650  1.00 122.00 ? 121  MET A CB  1 
ATOM   809  C  CG  . MET A 1 121 ? 2.001   46.191 46.867  1.00 124.50 ? 121  MET A CG  1 
ATOM   810  S  SD  . MET A 1 121 ? 3.742   46.579 47.196  1.00 161.57 ? 121  MET A SD  1 
ATOM   811  C  CE  . MET A 1 121 ? 4.412   44.928 47.411  1.00 87.96  ? 121  MET A CE  1 
ATOM   812  N  N   . LEU A 1 122 ? 0.150   43.307 43.625  1.00 107.09 ? 122  LEU A N   1 
ATOM   813  C  CA  . LEU A 1 122 ? -0.163  42.727 42.314  1.00 104.40 ? 122  LEU A CA  1 
ATOM   814  C  C   . LEU A 1 122 ? -1.631  42.994 41.956  1.00 102.28 ? 122  LEU A C   1 
ATOM   815  O  O   . LEU A 1 122 ? -1.972  43.199 40.792  1.00 98.79  ? 122  LEU A O   1 
ATOM   816  C  CB  . LEU A 1 122 ? 0.131   41.215 42.263  1.00 104.88 ? 122  LEU A CB  1 
ATOM   817  C  CG  . LEU A 1 122 ? 1.565   40.656 42.360  1.00 102.77 ? 122  LEU A CG  1 
ATOM   818  C  CD1 . LEU A 1 122 ? 1.606   39.124 42.142  1.00 99.73  ? 122  LEU A CD1 1 
ATOM   819  C  CD2 . LEU A 1 122 ? 2.531   41.366 41.408  1.00 97.08  ? 122  LEU A CD2 1 
ATOM   820  N  N   . GLY A 1 123 ? -2.493  42.997 42.969  1.00 101.01 ? 123  GLY A N   1 
ATOM   821  C  CA  . GLY A 1 123 ? -3.906  43.267 42.783  1.00 95.24  ? 123  GLY A CA  1 
ATOM   822  C  C   . GLY A 1 123 ? -4.173  44.624 42.168  1.00 89.14  ? 123  GLY A C   1 
ATOM   823  O  O   . GLY A 1 123 ? -4.903  44.730 41.192  1.00 86.95  ? 123  GLY A O   1 
ATOM   824  N  N   . LEU A 1 124 ? -3.579  45.665 42.736  1.00 88.38  ? 124  LEU A N   1 
ATOM   825  C  CA  . LEU A 1 124 ? -3.749  47.011 42.210  1.00 91.26  ? 124  LEU A CA  1 
ATOM   826  C  C   . LEU A 1 124 ? -3.141  47.193 40.807  1.00 92.49  ? 124  LEU A C   1 
ATOM   827  O  O   . LEU A 1 124 ? -3.749  47.810 39.922  1.00 85.32  ? 124  LEU A O   1 
ATOM   828  C  CB  . LEU A 1 124 ? -3.121  48.024 43.163  1.00 92.97  ? 124  LEU A CB  1 
ATOM   829  C  CG  . LEU A 1 124 ? -3.273  49.465 42.677  1.00 90.54  ? 124  LEU A CG  1 
ATOM   830  C  CD1 . LEU A 1 124 ? -4.755  49.810 42.626  1.00 93.91  ? 124  LEU A CD1 1 
ATOM   831  C  CD2 . LEU A 1 124 ? -2.487  50.466 43.538  1.00 83.12  ? 124  LEU A CD2 1 
ATOM   832  N  N   . ALA A 1 125 ? -1.932  46.666 40.622  1.00 96.75  ? 125  ALA A N   1 
ATOM   833  C  CA  . ALA A 1 125 ? -1.175  46.855 39.387  1.00 95.43  ? 125  ALA A CA  1 
ATOM   834  C  C   . ALA A 1 125 ? -2.004  46.388 38.218  1.00 99.41  ? 125  ALA A C   1 
ATOM   835  O  O   . ALA A 1 125 ? -1.949  46.956 37.128  1.00 100.29 ? 125  ALA A O   1 
ATOM   836  C  CB  . ALA A 1 125 ? 0.132   46.075 39.439  1.00 93.20  ? 125  ALA A CB  1 
ATOM   837  N  N   . VAL A 1 126 ? -2.770  45.335 38.465  1.00 101.95 ? 126  VAL A N   1 
ATOM   838  C  CA  . VAL A 1 126 ? -3.614  44.728 37.454  1.00 98.34  ? 126  VAL A CA  1 
ATOM   839  C  C   . VAL A 1 126 ? -4.965  45.428 37.396  1.00 96.57  ? 126  VAL A C   1 
ATOM   840  O  O   . VAL A 1 126 ? -5.460  45.762 36.323  1.00 102.46 ? 126  VAL A O   1 
ATOM   841  C  CB  . VAL A 1 126 ? -3.800  43.236 37.743  1.00 93.95  ? 126  VAL A CB  1 
ATOM   842  C  CG1 . VAL A 1 126 ? -4.996  42.694 36.996  1.00 95.62  ? 126  VAL A CG1 1 
ATOM   843  C  CG2 . VAL A 1 126 ? -2.543  42.476 37.385  1.00 87.91  ? 126  VAL A CG2 1 
ATOM   844  N  N   . ALA A 1 127 ? -5.560  45.662 38.553  1.00 85.97  ? 127  ALA A N   1 
ATOM   845  C  CA  . ALA A 1 127 ? -6.809  46.385 38.589  1.00 81.05  ? 127  ALA A CA  1 
ATOM   846  C  C   . ALA A 1 127 ? -6.629  47.730 37.904  1.00 78.75  ? 127  ALA A C   1 
ATOM   847  O  O   . ALA A 1 127 ? -7.591  48.346 37.470  1.00 79.90  ? 127  ALA A O   1 
ATOM   848  C  CB  . ALA A 1 127 ? -7.256  46.579 40.014  1.00 86.06  ? 127  ALA A CB  1 
ATOM   849  N  N   . ALA A 1 128 ? -5.389  48.188 37.809  1.00 81.70  ? 128  ALA A N   1 
ATOM   850  C  CA  . ALA A 1 128 ? -5.119  49.490 37.206  1.00 85.83  ? 128  ALA A CA  1 
ATOM   851  C  C   . ALA A 1 128 ? -4.881  49.382 35.708  1.00 84.83  ? 128  ALA A C   1 
ATOM   852  O  O   . ALA A 1 128 ? -5.199  50.305 34.960  1.00 81.45  ? 128  ALA A O   1 
ATOM   853  C  CB  . ALA A 1 128 ? -3.941  50.156 37.886  1.00 87.23  ? 128  ALA A CB  1 
ATOM   854  N  N   . SER A 1 129 ? -4.309  48.259 35.281  1.00 89.84  ? 129  SER A N   1 
ATOM   855  C  CA  . SER A 1 129 ? -4.100  47.981 33.865  1.00 93.72  ? 129  SER A CA  1 
ATOM   856  C  C   . SER A 1 129 ? -5.427  48.073 33.134  1.00 94.89  ? 129  SER A C   1 
ATOM   857  O  O   . SER A 1 129 ? -5.602  48.887 32.231  1.00 98.95  ? 129  SER A O   1 
ATOM   858  C  CB  . SER A 1 129 ? -3.506  46.583 33.662  1.00 96.48  ? 129  SER A CB  1 
ATOM   859  O  OG  . SER A 1 129 ? -2.180  46.498 34.154  1.00 98.58  ? 129  SER A OG  1 
ATOM   860  N  N   . LEU A 1 130 ? -6.365  47.234 33.542  1.00 92.06  ? 130  LEU A N   1 
ATOM   861  C  CA  . LEU A 1 130 ? -7.685  47.211 32.933  1.00 96.35  ? 130  LEU A CA  1 
ATOM   862  C  C   . LEU A 1 130 ? -8.434  48.526 33.158  1.00 96.10  ? 130  LEU A C   1 
ATOM   863  O  O   . LEU A 1 130 ? -9.052  49.068 32.246  1.00 97.87  ? 130  LEU A O   1 
ATOM   864  C  CB  . LEU A 1 130 ? -8.484  46.026 33.474  1.00 100.12 ? 130  LEU A CB  1 
ATOM   865  C  CG  . LEU A 1 130 ? -7.640  44.769 33.737  1.00 100.66 ? 130  LEU A CG  1 
ATOM   866  C  CD1 . LEU A 1 130 ? -8.512  43.629 34.239  1.00 99.55  ? 130  LEU A CD1 1 
ATOM   867  C  CD2 . LEU A 1 130 ? -6.841  44.330 32.506  1.00 98.48  ? 130  LEU A CD2 1 
ATOM   868  N  N   . ILE A 1 131 ? -8.369  49.042 34.376  1.00 93.42  ? 131  ILE A N   1 
ATOM   869  C  CA  . ILE A 1 131 ? -8.962  50.331 34.678  1.00 93.37  ? 131  ILE A CA  1 
ATOM   870  C  C   . ILE A 1 131 ? -8.571  51.369 33.635  1.00 87.40  ? 131  ILE A C   1 
ATOM   871  O  O   . ILE A 1 131 ? -9.292  52.330 33.399  1.00 86.14  ? 131  ILE A O   1 
ATOM   872  C  CB  . ILE A 1 131 ? -8.513  50.831 36.070  1.00 101.11 ? 131  ILE A CB  1 
ATOM   873  C  CG1 . ILE A 1 131 ? -8.873  49.806 37.147  1.00 104.79 ? 131  ILE A CG1 1 
ATOM   874  C  CG2 . ILE A 1 131 ? -9.124  52.190 36.382  1.00 102.85 ? 131  ILE A CG2 1 
ATOM   875  C  CD1 . ILE A 1 131 ? -10.353 49.507 37.222  1.00 107.21 ? 131  ILE A CD1 1 
ATOM   876  N  N   . TYR A 1 132 ? -7.419  51.166 33.013  1.00 87.63  ? 132  TYR A N   1 
ATOM   877  C  CA  . TYR A 1 132 ? -6.865  52.128 32.065  1.00 91.63  ? 132  TYR A CA  1 
ATOM   878  C  C   . TYR A 1 132 ? -7.172  51.724 30.633  1.00 90.41  ? 132  TYR A C   1 
ATOM   879  O  O   . TYR A 1 132 ? -7.501  52.559 29.789  1.00 81.27  ? 132  TYR A O   1 
ATOM   880  C  CB  . TYR A 1 132 ? -5.355  52.204 32.259  1.00 94.05  ? 132  TYR A CB  1 
ATOM   881  C  CG  . TYR A 1 132 ? -4.589  52.936 31.175  1.00 97.18  ? 132  TYR A CG  1 
ATOM   882  C  CD1 . TYR A 1 132 ? -4.071  54.204 31.404  1.00 98.11  ? 132  TYR A CD1 1 
ATOM   883  C  CD2 . TYR A 1 132 ? -4.346  52.346 29.940  1.00 96.45  ? 132  TYR A CD2 1 
ATOM   884  C  CE1 . TYR A 1 132 ? -3.346  54.875 30.429  1.00 95.78  ? 132  TYR A CE1 1 
ATOM   885  C  CE2 . TYR A 1 132 ? -3.623  53.011 28.958  1.00 94.61  ? 132  TYR A CE2 1 
ATOM   886  C  CZ  . TYR A 1 132 ? -3.127  54.275 29.211  1.00 92.21  ? 132  TYR A CZ  1 
ATOM   887  O  OH  . TYR A 1 132 ? -2.411  54.948 28.249  1.00 88.20  ? 132  TYR A OH  1 
ATOM   888  N  N   . ALA A 1 133 ? -7.037  50.431 30.367  1.00 97.56  ? 133  ALA A N   1 
ATOM   889  C  CA  . ALA A 1 133 ? -7.341  49.886 29.056  1.00 102.45 ? 133  ALA A CA  1 
ATOM   890  C  C   . ALA A 1 133 ? -8.770  50.244 28.683  1.00 103.19 ? 133  ALA A C   1 
ATOM   891  O  O   . ALA A 1 133 ? -9.028  50.773 27.600  1.00 102.32 ? 133  ALA A O   1 
ATOM   892  C  CB  . ALA A 1 133 ? -7.147  48.379 29.055  1.00 101.88 ? 133  ALA A CB  1 
ATOM   893  N  N   . ARG A 1 134 ? -9.695  49.950 29.591  1.00 102.07 ? 134  ARG A N   1 
ATOM   894  C  CA  . ARG A 1 134 ? -11.095 50.283 29.387  1.00 102.70 ? 134  ARG A CA  1 
ATOM   895  C  C   . ARG A 1 134 ? -11.222 51.780 29.135  1.00 107.25 ? 134  ARG A C   1 
ATOM   896  O  O   . ARG A 1 134 ? -12.024 52.221 28.312  1.00 110.60 ? 134  ARG A O   1 
ATOM   897  C  CB  . ARG A 1 134 ? -11.932 49.871 30.603  1.00 96.82  ? 134  ARG A CB  1 
ATOM   898  C  CG  . ARG A 1 134 ? -11.883 48.381 30.928  1.00 91.90  ? 134  ARG A CG  1 
ATOM   899  C  CD  . ARG A 1 134 ? -13.042 47.966 31.828  1.00 89.74  ? 134  ARG A CD  1 
ATOM   900  N  NE  . ARG A 1 134 ? -14.313 48.435 31.292  1.00 91.39  ? 134  ARG A NE  1 
ATOM   901  C  CZ  . ARG A 1 134 ? -15.452 47.758 31.343  1.00 90.65  ? 134  ARG A CZ  1 
ATOM   902  N  NH1 . ARG A 1 134 ? -15.489 46.568 31.915  1.00 84.80  ? 134  ARG A NH1 1 
ATOM   903  N  NH2 . ARG A 1 134 ? -16.552 48.279 30.811  1.00 96.30  ? 134  ARG A NH2 1 
ATOM   904  N  N   . PHE A 1 135 ? -10.404 52.553 29.839  1.00 106.37 ? 135  PHE A N   1 
ATOM   905  C  CA  . PHE A 1 135 ? -10.463 54.004 29.764  1.00 108.18 ? 135  PHE A CA  1 
ATOM   906  C  C   . PHE A 1 135 ? -9.998  54.552 28.428  1.00 110.85 ? 135  PHE A C   1 
ATOM   907  O  O   . PHE A 1 135 ? -10.633 55.433 27.857  1.00 112.53 ? 135  PHE A O   1 
ATOM   908  C  CB  . PHE A 1 135 ? -9.644  54.619 30.895  1.00 112.01 ? 135  PHE A CB  1 
ATOM   909  C  CG  . PHE A 1 135 ? -10.483 55.135 32.015  1.00 118.68 ? 135  PHE A CG  1 
ATOM   910  C  CD1 . PHE A 1 135 ? -11.375 54.299 32.666  1.00 121.02 ? 135  PHE A CD1 1 
ATOM   911  C  CD2 . PHE A 1 135 ? -10.403 56.462 32.406  1.00 121.58 ? 135  PHE A CD2 1 
ATOM   912  C  CE1 . PHE A 1 135 ? -12.167 54.772 33.692  1.00 122.23 ? 135  PHE A CE1 1 
ATOM   913  C  CE2 . PHE A 1 135 ? -11.195 56.944 33.433  1.00 123.20 ? 135  PHE A CE2 1 
ATOM   914  C  CZ  . PHE A 1 135 ? -12.078 56.098 34.077  1.00 122.54 ? 135  PHE A CZ  1 
ATOM   915  N  N   . THR A 1 136 ? -8.890  54.020 27.929  1.00 114.30 ? 136  THR A N   1 
ATOM   916  C  CA  . THR A 1 136 ? -8.265  54.523 26.707  1.00 116.27 ? 136  THR A CA  1 
ATOM   917  C  C   . THR A 1 136 ? -8.877  53.957 25.419  1.00 114.22 ? 136  THR A C   1 
ATOM   918  O  O   . THR A 1 136 ? -8.174  53.423 24.562  1.00 111.33 ? 136  THR A O   1 
ATOM   919  C  CB  . THR A 1 136 ? -6.752  54.258 26.725  1.00 117.82 ? 136  THR A CB  1 
ATOM   920  O  OG1 . THR A 1 136 ? -6.516  52.868 26.983  1.00 118.86 ? 136  THR A OG1 1 
ATOM   921  C  CG2 . THR A 1 136 ? -6.093  55.079 27.820  1.00 116.70 ? 136  THR A CG2 1 
ATOM   922  N  N   . ARG A 1 137 ? -10.193 54.075 25.297  1.00 114.14 ? 137  ARG A N   1 
ATOM   923  C  CA  . ARG A 1 137 ? -10.902 53.681 24.090  1.00 110.63 ? 137  ARG A CA  1 
ATOM   924  C  C   . ARG A 1 137 ? -11.867 54.809 23.791  1.00 106.75 ? 137  ARG A C   1 
ATOM   925  O  O   . ARG A 1 137 ? -13.015 54.776 24.232  1.00 109.38 ? 137  ARG A O   1 
ATOM   926  C  CB  . ARG A 1 137 ? -11.670 52.378 24.313  1.00 111.91 ? 137  ARG A CB  1 
ATOM   927  C  CG  . ARG A 1 137 ? -10.797 51.145 24.496  1.00 109.92 ? 137  ARG A CG  1 
ATOM   928  C  CD  . ARG A 1 137 ? -11.636 49.901 24.737  1.00 111.61 ? 137  ARG A CD  1 
ATOM   929  N  NE  . ARG A 1 137 ? -12.420 50.016 25.964  1.00 115.96 ? 137  ARG A NE  1 
ATOM   930  C  CZ  . ARG A 1 137 ? -13.090 49.013 26.524  1.00 120.20 ? 137  ARG A CZ  1 
ATOM   931  N  NH1 . ARG A 1 137 ? -13.777 49.211 27.644  1.00 119.41 ? 137  ARG A NH1 1 
ATOM   932  N  NH2 . ARG A 1 137 ? -13.073 47.811 25.964  1.00 123.70 ? 137  ARG A NH2 1 
ATOM   933  N  N   . PRO A 1 138 ? -11.387 55.830 23.064  1.00 116.43 ? 138  PRO A N   1 
ATOM   934  C  CA  . PRO A 1 138 ? -12.077 57.100 22.822  1.00 110.14 ? 138  PRO A CA  1 
ATOM   935  C  C   . PRO A 1 138 ? -12.981 57.055 21.606  1.00 105.79 ? 138  PRO A C   1 
ATOM   936  O  O   . PRO A 1 138 ? -12.767 56.249 20.694  1.00 102.76 ? 138  PRO A O   1 
ATOM   937  C  CB  . PRO A 1 138 ? -10.926 58.080 22.542  1.00 107.10 ? 138  PRO A CB  1 
ATOM   938  C  CG  . PRO A 1 138 ? -9.645  57.274 22.661  1.00 108.71 ? 138  PRO A CG  1 
ATOM   939  C  CD  . PRO A 1 138 ? -10.034 55.846 22.496  1.00 112.54 ? 138  PRO A CD  1 
ATOM   940  N  N   . THR A 1 139 ? -13.986 57.921 21.604  1.00 104.06 ? 139  THR A N   1 
ATOM   941  C  CA  . THR A 1 139 ? -14.843 58.095 20.443  1.00 104.10 ? 139  THR A CA  1 
ATOM   942  C  C   . THR A 1 139 ? -14.202 59.162 19.572  1.00 98.82  ? 139  THR A C   1 
ATOM   943  O  O   . THR A 1 139 ? -13.319 59.880 20.039  1.00 97.59  ? 139  THR A O   1 
ATOM   944  C  CB  . THR A 1 139 ? -16.261 58.509 20.858  1.00 105.74 ? 139  THR A CB  1 
ATOM   945  O  OG1 . THR A 1 139 ? -16.192 59.631 21.746  1.00 105.57 ? 139  THR A OG1 1 
ATOM   946  C  CG2 . THR A 1 139 ? -16.950 57.356 21.575  1.00 106.17 ? 139  THR A CG2 1 
ATOM   947  N  N   . ALA A 1 140 ? -14.611 59.258 18.311  1.00 92.64  ? 140  ALA A N   1 
ATOM   948  C  CA  . ALA A 1 140 ? -14.028 60.270 17.432  1.00 86.74  ? 140  ALA A CA  1 
ATOM   949  C  C   . ALA A 1 140 ? -14.823 61.564 17.522  1.00 85.89  ? 140  ALA A C   1 
ATOM   950  O  O   . ALA A 1 140 ? -14.336 62.639 17.142  1.00 83.54  ? 140  ALA A O   1 
ATOM   951  C  CB  . ALA A 1 140 ? -13.958 59.776 15.992  1.00 79.75  ? 140  ALA A CB  1 
ATOM   952  N  N   . GLY A 1 141 ? -16.041 61.459 18.048  1.00 84.18  ? 141  GLY A N   1 
ATOM   953  C  CA  . GLY A 1 141 ? -16.945 62.590 18.051  1.00 82.00  ? 141  GLY A CA  1 
ATOM   954  C  C   . GLY A 1 141 ? -17.049 63.117 16.632  1.00 77.18  ? 141  GLY A C   1 
ATOM   955  O  O   . GLY A 1 141 ? -16.923 64.318 16.376  1.00 73.26  ? 141  GLY A O   1 
ATOM   956  N  N   . VAL A 1 142 ? -17.237 62.195 15.695  1.00 73.65  ? 142  VAL A N   1 
ATOM   957  C  CA  . VAL A 1 142 ? -17.509 62.565 14.321  1.00 71.28  ? 142  VAL A CA  1 
ATOM   958  C  C   . VAL A 1 142 ? -18.988 62.434 14.074  1.00 70.54  ? 142  VAL A C   1 
ATOM   959  O  O   . VAL A 1 142 ? -19.609 61.449 14.466  1.00 74.75  ? 142  VAL A O   1 
ATOM   960  C  CB  . VAL A 1 142 ? -16.781 61.671 13.319  1.00 70.25  ? 142  VAL A CB  1 
ATOM   961  C  CG1 . VAL A 1 142 ? -17.527 61.658 11.998  1.00 64.87  ? 142  VAL A CG1 1 
ATOM   962  C  CG2 . VAL A 1 142 ? -15.375 62.173 13.109  1.00 74.77  ? 142  VAL A CG2 1 
ATOM   963  N  N   . LEU A 1 143 ? -19.549 63.433 13.414  1.00 63.94  ? 143  LEU A N   1 
ATOM   964  C  CA  . LEU A 1 143 ? -20.959 63.425 13.110  1.00 59.56  ? 143  LEU A CA  1 
ATOM   965  C  C   . LEU A 1 143 ? -21.192 63.109 11.633  1.00 58.89  ? 143  LEU A C   1 
ATOM   966  O  O   . LEU A 1 143 ? -20.542 63.684 10.765  1.00 53.11  ? 143  LEU A O   1 
ATOM   967  C  CB  . LEU A 1 143 ? -21.571 64.770 13.486  1.00 58.93  ? 143  LEU A CB  1 
ATOM   968  C  CG  . LEU A 1 143 ? -22.966 65.024 12.933  1.00 61.76  ? 143  LEU A CG  1 
ATOM   969  C  CD1 . LEU A 1 143 ? -23.941 63.967 13.431  1.00 68.06  ? 143  LEU A CD1 1 
ATOM   970  C  CD2 . LEU A 1 143 ? -23.426 66.406 13.305  1.00 57.03  ? 143  LEU A CD2 1 
ATOM   971  N  N   . PHE A 1 144 ? -22.121 62.188 11.369  1.00 61.95  ? 144  PHE A N   1 
ATOM   972  C  CA  . PHE A 1 144 ? -22.506 61.795 10.015  1.00 61.21  ? 144  PHE A CA  1 
ATOM   973  C  C   . PHE A 1 144 ? -23.813 62.464 9.575   1.00 57.83  ? 144  PHE A C   1 
ATOM   974  O  O   . PHE A 1 144 ? -24.725 62.653 10.385  1.00 54.21  ? 144  PHE A O   1 
ATOM   975  C  CB  . PHE A 1 144 ? -22.704 60.289 9.955   1.00 44.51  ? 144  PHE A CB  1 
ATOM   976  C  CG  . PHE A 1 144 ? -21.468 59.496 10.227  1.00 56.81  ? 144  PHE A CG  1 
ATOM   977  C  CD1 . PHE A 1 144 ? -21.140 59.118 11.513  1.00 57.74  ? 144  PHE A CD1 1 
ATOM   978  C  CD2 . PHE A 1 144 ? -20.651 59.088 9.192   1.00 60.27  ? 144  PHE A CD2 1 
ATOM   979  C  CE1 . PHE A 1 144 ? -20.015 58.366 11.764  1.00 59.86  ? 144  PHE A CE1 1 
ATOM   980  C  CE2 . PHE A 1 144 ? -19.531 58.338 9.434   1.00 60.78  ? 144  PHE A CE2 1 
ATOM   981  C  CZ  . PHE A 1 144 ? -19.211 57.978 10.723  1.00 62.03  ? 144  PHE A CZ  1 
ATOM   982  N  N   . SER A 1 145 ? -23.917 62.794 8.290   1.00 55.93  ? 145  SER A N   1 
ATOM   983  C  CA  . SER A 1 145 ? -25.134 63.410 7.772   1.00 58.32  ? 145  SER A CA  1 
ATOM   984  C  C   . SER A 1 145 ? -26.274 62.401 7.787   1.00 59.97  ? 145  SER A C   1 
ATOM   985  O  O   . SER A 1 145 ? -26.052 61.206 7.623   1.00 58.36  ? 145  SER A O   1 
ATOM   986  C  CB  . SER A 1 145 ? -24.917 63.974 6.365   1.00 59.70  ? 145  SER A CB  1 
ATOM   987  O  OG  . SER A 1 145 ? -24.652 62.943 5.432   1.00 62.03  ? 145  SER A OG  1 
ATOM   988  N  N   . SER A 1 146 ? -27.494 62.892 7.984   1.00 62.93  ? 146  SER A N   1 
ATOM   989  C  CA  . SER A 1 146 ? -28.658 62.028 8.181   1.00 65.28  ? 146  SER A CA  1 
ATOM   990  C  C   . SER A 1 146 ? -29.075 61.292 6.913   1.00 66.42  ? 146  SER A C   1 
ATOM   991  O  O   . SER A 1 146 ? -29.666 60.213 6.971   1.00 63.82  ? 146  SER A O   1 
ATOM   992  C  CB  . SER A 1 146 ? -29.832 62.855 8.672   1.00 65.62  ? 146  SER A CB  1 
ATOM   993  O  OG  . SER A 1 146 ? -30.222 63.764 7.665   1.00 69.96  ? 146  SER A OG  1 
ATOM   994  N  N   . ARG A 1 147 ? -28.779 61.898 5.772   1.00 69.56  ? 147  ARG A N   1 
ATOM   995  C  CA  . ARG A 1 147 ? -29.079 61.315 4.479   1.00 68.65  ? 147  ARG A CA  1 
ATOM   996  C  C   . ARG A 1 147 ? -27.810 61.328 3.662   1.00 67.87  ? 147  ARG A C   1 
ATOM   997  O  O   . ARG A 1 147 ? -26.771 61.809 4.110   1.00 69.02  ? 147  ARG A O   1 
ATOM   998  C  CB  . ARG A 1 147 ? -30.115 62.164 3.751   1.00 64.75  ? 147  ARG A CB  1 
ATOM   999  C  CG  . ARG A 1 147 ? -31.393 62.384 4.514   1.00 65.12  ? 147  ARG A CG  1 
ATOM   1000 C  CD  . ARG A 1 147 ? -32.301 61.166 4.457   1.00 65.46  ? 147  ARG A CD  1 
ATOM   1001 N  NE  . ARG A 1 147 ? -33.505 61.359 5.262   1.00 69.04  ? 147  ARG A NE  1 
ATOM   1002 C  CZ  . ARG A 1 147 ? -33.537 61.239 6.589   1.00 71.66  ? 147  ARG A CZ  1 
ATOM   1003 N  NH1 . ARG A 1 147 ? -32.431 60.929 7.257   1.00 70.50  ? 147  ARG A NH1 1 
ATOM   1004 N  NH2 . ARG A 1 147 ? -34.669 61.427 7.253   1.00 73.84  ? 147  ARG A NH2 1 
ATOM   1005 N  N   . MET A 1 148 ? -27.897 60.801 2.455   1.00 64.31  ? 148  MET A N   1 
ATOM   1006 C  CA  . MET A 1 148 ? -26.889 61.075 1.460   1.00 66.50  ? 148  MET A CA  1 
ATOM   1007 C  C   . MET A 1 148 ? -27.607 61.567 0.219   1.00 68.17  ? 148  MET A C   1 
ATOM   1008 O  O   . MET A 1 148 ? -28.831 61.496 0.135   1.00 73.31  ? 148  MET A O   1 
ATOM   1009 C  CB  . MET A 1 148 ? -26.051 59.836 1.167   1.00 69.71  ? 148  MET A CB  1 
ATOM   1010 C  CG  . MET A 1 148 ? -26.841 58.577 0.938   1.00 74.54  ? 148  MET A CG  1 
ATOM   1011 S  SD  . MET A 1 148 ? -25.904 57.135 1.467   1.00 86.89  ? 148  MET A SD  1 
ATOM   1012 C  CE  . MET A 1 148 ? -24.327 57.478 0.716   1.00 58.89  ? 148  MET A CE  1 
ATOM   1013 N  N   . VAL A 1 149 ? -26.859 62.092 -0.737  1.00 64.43  ? 149  VAL A N   1 
ATOM   1014 C  CA  . VAL A 1 149 ? -27.478 62.556 -1.959  1.00 65.01  ? 149  VAL A CA  1 
ATOM   1015 C  C   . VAL A 1 149 ? -26.830 61.893 -3.153  1.00 69.74  ? 149  VAL A C   1 
ATOM   1016 O  O   . VAL A 1 149 ? -25.694 61.426 -3.081  1.00 74.22  ? 149  VAL A O   1 
ATOM   1017 C  CB  . VAL A 1 149 ? -27.338 64.074 -2.109  1.00 63.18  ? 149  VAL A CB  1 
ATOM   1018 C  CG1 . VAL A 1 149 ? -28.052 64.783 -0.982  1.00 63.43  ? 149  VAL A CG1 1 
ATOM   1019 C  CG2 . VAL A 1 149 ? -25.887 64.459 -2.116  1.00 62.17  ? 149  VAL A CG2 1 
ATOM   1020 N  N   . ILE A 1 150 ? -27.565 61.827 -4.252  1.00 67.47  ? 150  ILE A N   1 
ATOM   1021 C  CA  . ILE A 1 150 ? -26.937 61.571 -5.532  1.00 66.08  ? 150  ILE A CA  1 
ATOM   1022 C  C   . ILE A 1 150 ? -27.233 62.778 -6.378  1.00 67.28  ? 150  ILE A C   1 
ATOM   1023 O  O   . ILE A 1 150 ? -28.390 63.088 -6.631  1.00 66.79  ? 150  ILE A O   1 
ATOM   1024 C  CB  . ILE A 1 150 ? -27.496 60.348 -6.238  1.00 62.66  ? 150  ILE A CB  1 
ATOM   1025 C  CG1 . ILE A 1 150 ? -27.321 59.105 -5.381  1.00 63.79  ? 150  ILE A CG1 1 
ATOM   1026 C  CG2 . ILE A 1 150 ? -26.776 60.143 -7.550  1.00 59.89  ? 150  ILE A CG2 1 
ATOM   1027 C  CD1 . ILE A 1 150 ? -27.571 57.839 -6.153  1.00 64.54  ? 150  ILE A CD1 1 
ATOM   1028 N  N   . SER A 1 151 ? -26.189 63.470 -6.802  1.00 72.79  ? 151  SER A N   1 
ATOM   1029 C  CA  . SER A 1 151 ? -26.379 64.705 -7.528  1.00 84.75  ? 151  SER A CA  1 
ATOM   1030 C  C   . SER A 1 151 ? -25.244 64.911 -8.495  1.00 91.98  ? 151  SER A C   1 
ATOM   1031 O  O   . SER A 1 151 ? -24.103 64.517 -8.235  1.00 96.13  ? 151  SER A O   1 
ATOM   1032 C  CB  . SER A 1 151 ? -26.443 65.893 -6.565  1.00 91.91  ? 151  SER A CB  1 
ATOM   1033 O  OG  . SER A 1 151 ? -25.156 66.238 -6.071  1.00 96.43  ? 151  SER A OG  1 
ATOM   1034 N  N   . ASP A 1 152 ? -25.546 65.558 -9.607  1.00 94.75  ? 152  ASP A N   1 
ATOM   1035 C  CA  . ASP A 1 152 ? -24.526 65.825 -10.586 1.00 100.60 ? 152  ASP A CA  1 
ATOM   1036 C  C   . ASP A 1 152 ? -23.497 66.748 -9.967  1.00 99.35  ? 152  ASP A C   1 
ATOM   1037 O  O   . ASP A 1 152 ? -23.840 67.743 -9.341  1.00 99.89  ? 152  ASP A O   1 
ATOM   1038 C  CB  . ASP A 1 152 ? -25.143 66.519 -11.799 1.00 108.16 ? 152  ASP A CB  1 
ATOM   1039 C  CG  . ASP A 1 152 ? -25.326 65.590 -12.976 1.00 118.50 ? 152  ASP A CG  1 
ATOM   1040 O  OD1 . ASP A 1 152 ? -24.894 64.423 -12.889 1.00 121.89 ? 152  ASP A OD1 1 
ATOM   1041 O  OD2 . ASP A 1 152 ? -25.903 66.026 -13.992 1.00 123.25 ? 152  ASP A OD2 1 
ATOM   1042 N  N   . PHE A 1 153 ? -22.231 66.419 -10.161 1.00 98.99  ? 153  PHE A N   1 
ATOM   1043 C  CA  . PHE A 1 153 ? -21.135 67.232 -9.687  1.00 99.96  ? 153  PHE A CA  1 
ATOM   1044 C  C   . PHE A 1 153 ? -20.061 67.214 -10.733 1.00 104.42 ? 153  PHE A C   1 
ATOM   1045 O  O   . PHE A 1 153 ? -19.560 66.147 -11.090 1.00 103.60 ? 153  PHE A O   1 
ATOM   1046 C  CB  . PHE A 1 153 ? -20.557 66.697 -8.392  1.00 101.04 ? 153  PHE A CB  1 
ATOM   1047 C  CG  . PHE A 1 153 ? -19.220 67.275 -8.070  1.00 105.82 ? 153  PHE A CG  1 
ATOM   1048 C  CD1 . PHE A 1 153 ? -19.116 68.542 -7.512  1.00 106.75 ? 153  PHE A CD1 1 
ATOM   1049 C  CD2 . PHE A 1 153 ? -18.060 66.572 -8.354  1.00 108.57 ? 153  PHE A CD2 1 
ATOM   1050 C  CE1 . PHE A 1 153 ? -17.880 69.087 -7.223  1.00 108.53 ? 153  PHE A CE1 1 
ATOM   1051 C  CE2 . PHE A 1 153 ? -16.816 67.112 -8.067  1.00 109.93 ? 153  PHE A CE2 1 
ATOM   1052 C  CZ  . PHE A 1 153 ? -16.727 68.370 -7.501  1.00 109.98 ? 153  PHE A CZ  1 
ATOM   1053 N  N   . GLU A 1 154 ? -19.697 68.399 -11.209 1.00 110.38 ? 154  GLU A N   1 
ATOM   1054 C  CA  . GLU A 1 154 ? -18.762 68.520 -12.317 1.00 112.84 ? 154  GLU A CA  1 
ATOM   1055 C  C   . GLU A 1 154 ? -19.186 67.543 -13.399 1.00 110.55 ? 154  GLU A C   1 
ATOM   1056 O  O   . GLU A 1 154 ? -18.407 66.686 -13.822 1.00 107.03 ? 154  GLU A O   1 
ATOM   1057 C  CB  . GLU A 1 154 ? -17.326 68.259 -11.856 1.00 112.68 ? 154  GLU A CB  1 
ATOM   1058 C  CG  . GLU A 1 154 ? -16.820 69.314 -10.881 1.00 113.42 ? 154  GLU A CG  1 
ATOM   1059 C  CD  . GLU A 1 154 ? -15.341 69.180 -10.573 1.00 115.36 ? 154  GLU A CD  1 
ATOM   1060 O  OE1 . GLU A 1 154 ? -14.819 68.042 -10.624 1.00 114.13 ? 154  GLU A OE1 1 
ATOM   1061 O  OE2 . GLU A 1 154 ? -14.707 70.220 -10.275 1.00 116.21 ? 154  GLU A OE2 1 
ATOM   1062 N  N   . GLY A 1 155 ? -20.448 67.670 -13.808 1.00 109.71 ? 155  GLY A N   1 
ATOM   1063 C  CA  . GLY A 1 155 ? -21.028 66.839 -14.845 1.00 110.99 ? 155  GLY A CA  1 
ATOM   1064 C  C   . GLY A 1 155 ? -20.769 65.353 -14.689 1.00 110.79 ? 155  GLY A C   1 
ATOM   1065 O  O   . GLY A 1 155 ? -20.189 64.719 -15.567 1.00 116.82 ? 155  GLY A O   1 
ATOM   1066 N  N   . LYS A 1 156 ? -21.192 64.795 -13.564 1.00 102.11 ? 156  LYS A N   1 
ATOM   1067 C  CA  . LYS A 1 156 ? -21.138 63.357 -13.353 1.00 96.35  ? 156  LYS A CA  1 
ATOM   1068 C  C   . LYS A 1 156 ? -21.955 63.050 -12.114 1.00 96.29  ? 156  LYS A C   1 
ATOM   1069 O  O   . LYS A 1 156 ? -21.719 63.624 -11.047 1.00 97.03  ? 156  LYS A O   1 
ATOM   1070 C  CB  . LYS A 1 156 ? -19.697 62.863 -13.193 1.00 91.46  ? 156  LYS A CB  1 
ATOM   1071 N  N   . PRO A 1 157 ? -22.942 62.161 -12.257 1.00 91.45  ? 157  PRO A N   1 
ATOM   1072 C  CA  . PRO A 1 157 ? -23.811 61.810 -11.136 1.00 87.56  ? 157  PRO A CA  1 
ATOM   1073 C  C   . PRO A 1 157 ? -22.965 61.263 -9.995  1.00 86.83  ? 157  PRO A C   1 
ATOM   1074 O  O   . PRO A 1 157 ? -22.376 60.193 -10.119 1.00 90.14  ? 157  PRO A O   1 
ATOM   1075 C  CB  . PRO A 1 157 ? -24.703 60.719 -11.720 1.00 85.31  ? 157  PRO A CB  1 
ATOM   1076 C  CG  . PRO A 1 157 ? -24.640 60.929 -13.189 1.00 86.79  ? 157  PRO A CG  1 
ATOM   1077 C  CD  . PRO A 1 157 ? -23.259 61.389 -13.466 1.00 88.22  ? 157  PRO A CD  1 
ATOM   1078 N  N   . THR A 1 158 ? -22.884 62.008 -8.902  1.00 79.42  ? 158  THR A N   1 
ATOM   1079 C  CA  . THR A 1 158 ? -22.013 61.621 -7.817  1.00 72.81  ? 158  THR A CA  1 
ATOM   1080 C  C   . THR A 1 158 ? -22.798 61.380 -6.555  1.00 72.19  ? 158  THR A C   1 
ATOM   1081 O  O   . THR A 1 158 ? -23.592 62.223 -6.141  1.00 71.73  ? 158  THR A O   1 
ATOM   1082 C  CB  . THR A 1 158 ? -20.993 62.705 -7.520  1.00 70.74  ? 158  THR A CB  1 
ATOM   1083 O  OG1 . THR A 1 158 ? -20.358 63.109 -8.736  1.00 70.30  ? 158  THR A OG1 1 
ATOM   1084 C  CG2 . THR A 1 158 ? -19.950 62.175 -6.557  1.00 71.46  ? 158  THR A CG2 1 
ATOM   1085 N  N   . LEU A 1 159 ? -22.566 60.221 -5.948  1.00 71.93  ? 159  LEU A N   1 
ATOM   1086 C  CA  . LEU A 1 159 ? -23.149 59.878 -4.653  1.00 65.66  ? 159  LEU A CA  1 
ATOM   1087 C  C   . LEU A 1 159 ? -22.304 60.479 -3.555  1.00 62.96  ? 159  LEU A C   1 
ATOM   1088 O  O   . LEU A 1 159 ? -21.090 60.288 -3.521  1.00 63.88  ? 159  LEU A O   1 
ATOM   1089 C  CB  . LEU A 1 159 ? -23.188 58.364 -4.460  1.00 60.35  ? 159  LEU A CB  1 
ATOM   1090 C  CG  . LEU A 1 159 ? -23.577 57.941 -3.045  1.00 56.01  ? 159  LEU A CG  1 
ATOM   1091 C  CD1 . LEU A 1 159 ? -25.063 58.161 -2.835  1.00 53.45  ? 159  LEU A CD1 1 
ATOM   1092 C  CD2 . LEU A 1 159 ? -23.185 56.496 -2.743  1.00 53.05  ? 159  LEU A CD2 1 
ATOM   1093 N  N   . MET A 1 160 ? -22.925 61.220 -2.647  1.00 59.97  ? 160  MET A N   1 
ATOM   1094 C  CA  . MET A 1 160 ? -22.160 61.836 -1.571  1.00 60.93  ? 160  MET A CA  1 
ATOM   1095 C  C   . MET A 1 160 ? -22.843 61.902 -0.214  1.00 65.47  ? 160  MET A C   1 
ATOM   1096 O  O   . MET A 1 160 ? -24.060 61.879 -0.108  1.00 70.46  ? 160  MET A O   1 
ATOM   1097 C  CB  . MET A 1 160 ? -21.703 63.237 -1.978  1.00 59.01  ? 160  MET A CB  1 
ATOM   1098 C  CG  . MET A 1 160 ? -22.585 63.904 -3.002  1.00 58.49  ? 160  MET A CG  1 
ATOM   1099 S  SD  . MET A 1 160 ? -22.048 65.573 -3.371  1.00 77.96  ? 160  MET A SD  1 
ATOM   1100 C  CE  . MET A 1 160 ? -20.310 65.317 -3.676  1.00 100.88 ? 160  MET A CE  1 
ATOM   1101 N  N   . MET A 1 161 ? -22.018 61.983 0.819   1.00 66.65  ? 161  MET A N   1 
ATOM   1102 C  CA  . MET A 1 161 ? -22.454 62.086 2.197   1.00 61.99  ? 161  MET A CA  1 
ATOM   1103 C  C   . MET A 1 161 ? -21.387 62.914 2.888   1.00 65.36  ? 161  MET A C   1 
ATOM   1104 O  O   . MET A 1 161 ? -20.270 62.986 2.401   1.00 70.44  ? 161  MET A O   1 
ATOM   1105 C  CB  . MET A 1 161 ? -22.554 60.707 2.828   1.00 61.86  ? 161  MET A CB  1 
ATOM   1106 C  CG  . MET A 1 161 ? -21.263 59.938 2.822   1.00 68.19  ? 161  MET A CG  1 
ATOM   1107 S  SD  . MET A 1 161 ? -20.440 60.059 4.403   1.00 79.50  ? 161  MET A SD  1 
ATOM   1108 C  CE  . MET A 1 161 ? -21.170 61.559 5.023   1.00 92.35  ? 161  MET A CE  1 
ATOM   1109 N  N   . ARG A 1 162 ? -21.709 63.549 4.007   1.00 62.17  ? 162  ARG A N   1 
ATOM   1110 C  CA  . ARG A 1 162 ? -20.714 64.363 4.696   1.00 57.82  ? 162  ARG A CA  1 
ATOM   1111 C  C   . ARG A 1 162 ? -20.658 64.125 6.198   1.00 59.85  ? 162  ARG A C   1 
ATOM   1112 O  O   . ARG A 1 162 ? -21.640 63.716 6.798   1.00 69.49  ? 162  ARG A O   1 
ATOM   1113 C  CB  . ARG A 1 162 ? -20.936 65.842 4.393   1.00 56.25  ? 162  ARG A CB  1 
ATOM   1114 C  CG  . ARG A 1 162 ? -21.979 66.524 5.248   1.00 56.49  ? 162  ARG A CG  1 
ATOM   1115 C  CD  . ARG A 1 162 ? -21.914 68.029 5.060   1.00 63.63  ? 162  ARG A CD  1 
ATOM   1116 N  NE  . ARG A 1 162 ? -23.224 68.610 4.797   1.00 67.16  ? 162  ARG A NE  1 
ATOM   1117 C  CZ  . ARG A 1 162 ? -23.425 69.883 4.483   1.00 63.84  ? 162  ARG A CZ  1 
ATOM   1118 N  NH1 . ARG A 1 162 ? -22.403 70.714 4.386   1.00 59.90  ? 162  ARG A NH1 1 
ATOM   1119 N  NH2 . ARG A 1 162 ? -24.649 70.326 4.263   1.00 66.69  ? 162  ARG A NH2 1 
ATOM   1120 N  N   . LEU A 1 163 ? -19.499 64.379 6.797   1.00 52.71  ? 163  LEU A N   1 
ATOM   1121 C  CA  . LEU A 1 163 ? -19.317 64.194 8.211   1.00 58.45  ? 163  LEU A CA  1 
ATOM   1122 C  C   . LEU A 1 163 ? -18.565 65.395 8.755   1.00 61.25  ? 163  LEU A C   1 
ATOM   1123 O  O   . LEU A 1 163 ? -17.897 66.095 7.996   1.00 60.01  ? 163  LEU A O   1 
ATOM   1124 C  CB  . LEU A 1 163 ? -18.571 62.884 8.466   1.00 64.13  ? 163  LEU A CB  1 
ATOM   1125 C  CG  . LEU A 1 163 ? -17.159 62.776 7.890   1.00 67.12  ? 163  LEU A CG  1 
ATOM   1126 C  CD1 . LEU A 1 163 ? -16.147 63.488 8.766   1.00 79.09  ? 163  LEU A CD1 1 
ATOM   1127 C  CD2 . LEU A 1 163 ? -16.794 61.338 7.785   1.00 61.48  ? 163  LEU A CD2 1 
ATOM   1128 N  N   . ALA A 1 164 ? -18.688 65.644 10.059  1.00 61.72  ? 164  ALA A N   1 
ATOM   1129 C  CA  . ALA A 1 164 ? -18.030 66.787 10.685  1.00 62.26  ? 164  ALA A CA  1 
ATOM   1130 C  C   . ALA A 1 164 ? -17.423 66.426 12.023  1.00 67.02  ? 164  ALA A C   1 
ATOM   1131 O  O   . ALA A 1 164 ? -17.943 65.569 12.733  1.00 68.93  ? 164  ALA A O   1 
ATOM   1132 C  CB  . ALA A 1 164 ? -19.003 67.914 10.868  1.00 60.83  ? 164  ALA A CB  1 
ATOM   1133 N  N   . ASN A 1 165 ? -16.324 67.094 12.362  1.00 69.77  ? 165  ASN A N   1 
ATOM   1134 C  CA  . ASN A 1 165 ? -15.650 66.876 13.633  1.00 73.54  ? 165  ASN A CA  1 
ATOM   1135 C  C   . ASN A 1 165 ? -16.257 67.722 14.738  1.00 77.58  ? 165  ASN A C   1 
ATOM   1136 O  O   . ASN A 1 165 ? -16.206 68.951 14.681  1.00 80.71  ? 165  ASN A O   1 
ATOM   1137 C  CB  . ASN A 1 165 ? -14.170 67.206 13.509  1.00 75.90  ? 165  ASN A CB  1 
ATOM   1138 C  CG  . ASN A 1 165 ? -13.421 66.989 14.799  1.00 81.27  ? 165  ASN A CG  1 
ATOM   1139 O  OD1 . ASN A 1 165 ? -13.940 66.372 15.736  1.00 87.81  ? 165  ASN A OD1 1 
ATOM   1140 N  ND2 . ASN A 1 165 ? -12.190 67.487 14.859  1.00 80.17  ? 165  ASN A ND2 1 
ATOM   1141 N  N   . LEU A 1 166 ? -16.815 67.064 15.752  1.00 77.05  ? 166  LEU A N   1 
ATOM   1142 C  CA  . LEU A 1 166 ? -17.522 67.756 16.829  1.00 74.83  ? 166  LEU A CA  1 
ATOM   1143 C  C   . LEU A 1 166 ? -16.604 68.369 17.879  1.00 79.64  ? 166  LEU A C   1 
ATOM   1144 O  O   . LEU A 1 166 ? -17.066 69.050 18.786  1.00 81.82  ? 166  LEU A O   1 
ATOM   1145 C  CB  . LEU A 1 166 ? -18.491 66.801 17.517  1.00 70.45  ? 166  LEU A CB  1 
ATOM   1146 C  CG  . LEU A 1 166 ? -19.596 66.235 16.629  1.00 66.60  ? 166  LEU A CG  1 
ATOM   1147 C  CD1 . LEU A 1 166 ? -20.287 65.038 17.265  1.00 64.88  ? 166  LEU A CD1 1 
ATOM   1148 C  CD2 . LEU A 1 166 ? -20.593 67.315 16.291  1.00 61.58  ? 166  LEU A CD2 1 
ATOM   1149 N  N   . ARG A 1 167 ? -15.306 68.129 17.765  1.00 82.64  ? 167  ARG A N   1 
ATOM   1150 C  CA  . ARG A 1 167 ? -14.380 68.592 18.786  1.00 87.21  ? 167  ARG A CA  1 
ATOM   1151 C  C   . ARG A 1 167 ? -13.446 69.675 18.278  1.00 86.87  ? 167  ARG A C   1 
ATOM   1152 O  O   . ARG A 1 167 ? -13.045 69.663 17.116  1.00 83.88  ? 167  ARG A O   1 
ATOM   1153 C  CB  . ARG A 1 167 ? -13.572 67.415 19.324  1.00 89.41  ? 167  ARG A CB  1 
ATOM   1154 C  CG  . ARG A 1 167 ? -14.415 66.418 20.069  1.00 88.35  ? 167  ARG A CG  1 
ATOM   1155 C  CD  . ARG A 1 167 ? -13.704 65.101 20.205  1.00 89.23  ? 167  ARG A CD  1 
ATOM   1156 N  NE  . ARG A 1 167 ? -14.382 64.241 21.168  1.00 88.94  ? 167  ARG A NE  1 
ATOM   1157 C  CZ  . ARG A 1 167 ? -14.291 62.918 21.178  1.00 87.33  ? 167  ARG A CZ  1 
ATOM   1158 N  NH1 . ARG A 1 167 ? -13.554 62.300 20.271  1.00 86.25  ? 167  ARG A NH1 1 
ATOM   1159 N  NH2 . ARG A 1 167 ? -14.941 62.214 22.090  1.00 89.30  ? 167  ARG A NH2 1 
ATOM   1160 N  N   . ILE A 1 168 ? -13.104 70.610 19.158  1.00 89.80  ? 168  ILE A N   1 
ATOM   1161 C  CA  . ILE A 1 168 ? -12.138 71.644 18.826  1.00 92.01  ? 168  ILE A CA  1 
ATOM   1162 C  C   . ILE A 1 168 ? -10.914 71.010 18.206  1.00 90.75  ? 168  ILE A C   1 
ATOM   1163 O  O   . ILE A 1 168 ? -10.471 71.400 17.129  1.00 91.10  ? 168  ILE A O   1 
ATOM   1164 C  CB  . ILE A 1 168 ? -11.667 72.382 20.079  1.00 95.38  ? 168  ILE A CB  1 
ATOM   1165 C  CG1 . ILE A 1 168 ? -12.815 73.193 20.678  1.00 97.35  ? 168  ILE A CG1 1 
ATOM   1166 C  CG2 . ILE A 1 168 ? -10.460 73.260 19.751  1.00 94.88  ? 168  ILE A CG2 1 
ATOM   1167 C  CD1 . ILE A 1 168 ? -13.411 74.209 19.723  1.00 96.58  ? 168  ILE A CD1 1 
ATOM   1168 N  N   . GLU A 1 169 ? -10.375 70.027 18.916  1.00 90.34  ? 169  GLU A N   1 
ATOM   1169 C  CA  . GLU A 1 169 ? -9.167  69.335 18.509  1.00 91.07  ? 169  GLU A CA  1 
ATOM   1170 C  C   . GLU A 1 169 ? -9.405  68.616 17.185  1.00 84.91  ? 169  GLU A C   1 
ATOM   1171 O  O   . GLU A 1 169 ? -10.526 68.214 16.886  1.00 81.27  ? 169  GLU A O   1 
ATOM   1172 C  CB  . GLU A 1 169 ? -8.721  68.364 19.609  1.00 96.35  ? 169  GLU A CB  1 
ATOM   1173 C  CG  . GLU A 1 169 ? -7.997  69.022 20.788  1.00 103.45 ? 169  GLU A CG  1 
ATOM   1174 C  CD  . GLU A 1 169 ? -8.878  69.962 21.614  1.00 112.57 ? 169  GLU A CD  1 
ATOM   1175 O  OE1 . GLU A 1 169 ? -10.110 69.751 21.664  1.00 115.23 ? 169  GLU A OE1 1 
ATOM   1176 O  OE2 . GLU A 1 169 ? -8.333  70.909 22.230  1.00 115.85 ? 169  GLU A OE2 1 
ATOM   1177 N  N   . ALA A 1 170 ? -8.341  68.465 16.399  1.00 82.79  ? 170  ALA A N   1 
ATOM   1178 C  CA  . ALA A 1 170 ? -8.433  67.945 15.034  1.00 79.39  ? 170  ALA A CA  1 
ATOM   1179 C  C   . ALA A 1 170 ? -8.143  66.460 14.962  1.00 76.75  ? 170  ALA A C   1 
ATOM   1180 O  O   . ALA A 1 170 ? -7.633  65.880 15.911  1.00 79.94  ? 170  ALA A O   1 
ATOM   1181 C  CB  . ALA A 1 170 ? -7.471  68.692 14.129  1.00 81.97  ? 170  ALA A CB  1 
ATOM   1182 N  N   . ILE A 1 171 ? -8.464  65.850 13.825  1.00 71.85  ? 171  ILE A N   1 
ATOM   1183 C  CA  . ILE A 1 171 ? -8.139  64.446 13.572  1.00 70.86  ? 171  ILE A CA  1 
ATOM   1184 C  C   . ILE A 1 171 ? -7.231  64.376 12.364  1.00 68.67  ? 171  ILE A C   1 
ATOM   1185 O  O   . ILE A 1 171 ? -7.519  64.985 11.334  1.00 64.21  ? 171  ILE A O   1 
ATOM   1186 C  CB  . ILE A 1 171 ? -9.397  63.605 13.245  1.00 69.02  ? 171  ILE A CB  1 
ATOM   1187 C  CG1 . ILE A 1 171 ? -10.478 63.779 14.308  1.00 64.00  ? 171  ILE A CG1 1 
ATOM   1188 C  CG2 . ILE A 1 171 ? -9.045  62.134 13.070  1.00 65.87  ? 171  ILE A CG2 1 
ATOM   1189 C  CD1 . ILE A 1 171 ? -11.725 63.055 13.966  1.00 58.39  ? 171  ILE A CD1 1 
ATOM   1190 N  N   . ILE A 1 172 ? -6.153  63.611 12.472  1.00 72.58  ? 172  ILE A N   1 
ATOM   1191 C  CA  . ILE A 1 172 ? -5.135  63.612 11.425  1.00 74.87  ? 172  ILE A CA  1 
ATOM   1192 C  C   . ILE A 1 172 ? -4.954  62.280 10.681  1.00 72.76  ? 172  ILE A C   1 
ATOM   1193 O  O   . ILE A 1 172 ? -5.232  61.200 11.204  1.00 60.74  ? 172  ILE A O   1 
ATOM   1194 C  CB  . ILE A 1 172 ? -3.789  64.124 11.963  1.00 76.66  ? 172  ILE A CB  1 
ATOM   1195 C  CG1 . ILE A 1 172 ? -3.327  63.241 13.119  1.00 78.57  ? 172  ILE A CG1 1 
ATOM   1196 C  CG2 . ILE A 1 172 ? -3.923  65.569 12.419  1.00 73.80  ? 172  ILE A CG2 1 
ATOM   1197 C  CD1 . ILE A 1 172 ? -2.351  63.908 14.041  1.00 80.20  ? 172  ILE A CD1 1 
ATOM   1198 N  N   . GLU A 1 173 ? -4.469  62.398 9.448   1.00 84.73  ? 173  GLU A N   1 
ATOM   1199 C  CA  . GLU A 1 173 ? -4.463  61.318 8.463   1.00 92.92  ? 173  GLU A CA  1 
ATOM   1200 C  C   . GLU A 1 173 ? -5.759  60.510 8.442   1.00 87.70  ? 173  GLU A C   1 
ATOM   1201 O  O   . GLU A 1 173 ? -5.745  59.320 8.148   1.00 84.33  ? 173  GLU A O   1 
ATOM   1202 C  CB  . GLU A 1 173 ? -3.234  60.412 8.605   1.00 102.42 ? 173  GLU A CB  1 
ATOM   1203 C  CG  . GLU A 1 173 ? -1.913  61.056 8.163   1.00 111.62 ? 173  GLU A CG  1 
ATOM   1204 C  CD  . GLU A 1 173 ? -2.018  61.824 6.845   1.00 119.30 ? 173  GLU A CD  1 
ATOM   1205 O  OE1 . GLU A 1 173 ? -2.637  61.313 5.879   1.00 118.82 ? 173  GLU A OE1 1 
ATOM   1206 O  OE2 . GLU A 1 173 ? -1.466  62.946 6.778   1.00 123.87 ? 173  GLU A OE2 1 
ATOM   1207 N  N   . ALA A 1 174 ? -6.871  61.178 8.733   1.00 86.62  ? 174  ALA A N   1 
ATOM   1208 C  CA  . ALA A 1 174 ? -8.187  60.556 8.721   1.00 84.87  ? 174  ALA A CA  1 
ATOM   1209 C  C   . ALA A 1 174 ? -8.544  60.059 7.325   1.00 85.24  ? 174  ALA A C   1 
ATOM   1210 O  O   . ALA A 1 174 ? -8.188  60.697 6.331   1.00 83.95  ? 174  ALA A O   1 
ATOM   1211 C  CB  . ALA A 1 174 ? -9.235  61.553 9.204   1.00 80.35  ? 174  ALA A CB  1 
ATOM   1212 N  N   . ASP A 1 175 ? -9.231  58.918 7.253   1.00 83.05  ? 175  ASP A N   1 
ATOM   1213 C  CA  . ASP A 1 175 ? -9.777  58.436 5.982   1.00 81.56  ? 175  ASP A CA  1 
ATOM   1214 C  C   . ASP A 1 175 ? -11.067 57.636 6.138   1.00 72.53  ? 175  ASP A C   1 
ATOM   1215 O  O   . ASP A 1 175 ? -11.378 57.129 7.213   1.00 68.70  ? 175  ASP A O   1 
ATOM   1216 C  CB  . ASP A 1 175 ? -8.747  57.641 5.176   1.00 89.06  ? 175  ASP A CB  1 
ATOM   1217 C  CG  . ASP A 1 175 ? -8.310  56.375 5.875   1.00 96.48  ? 175  ASP A CG  1 
ATOM   1218 O  OD1 . ASP A 1 175 ? -7.919  55.413 5.169   1.00 99.06  ? 175  ASP A OD1 1 
ATOM   1219 O  OD2 . ASP A 1 175 ? -8.360  56.348 7.127   1.00 95.93  ? 175  ASP A OD2 1 
ATOM   1220 N  N   . VAL A 1 176 ? -11.808 57.532 5.041   1.00 69.12  ? 176  VAL A N   1 
ATOM   1221 C  CA  . VAL A 1 176 ? -13.156 57.001 5.067   1.00 70.17  ? 176  VAL A CA  1 
ATOM   1222 C  C   . VAL A 1 176 ? -13.343 56.041 3.919   1.00 76.58  ? 176  VAL A C   1 
ATOM   1223 O  O   . VAL A 1 176 ? -12.611 56.104 2.931   1.00 76.48  ? 176  VAL A O   1 
ATOM   1224 C  CB  . VAL A 1 176 ? -14.188 58.115 4.855   1.00 63.98  ? 176  VAL A CB  1 
ATOM   1225 C  CG1 . VAL A 1 176 ? -13.919 59.275 5.782   1.00 61.72  ? 176  VAL A CG1 1 
ATOM   1226 C  CG2 . VAL A 1 176 ? -14.136 58.581 3.428   1.00 62.06  ? 176  VAL A CG2 1 
ATOM   1227 N  N   . HIS A 1 177 ? -14.342 55.170 4.050   1.00 80.02  ? 177  HIS A N   1 
ATOM   1228 C  CA  . HIS A 1 177 ? -14.688 54.219 3.005   1.00 80.95  ? 177  HIS A CA  1 
ATOM   1229 C  C   . HIS A 1 177 ? -16.168 54.255 2.775   1.00 80.96  ? 177  HIS A C   1 
ATOM   1230 O  O   . HIS A 1 177 ? -16.930 54.178 3.730   1.00 86.97  ? 177  HIS A O   1 
ATOM   1231 C  CB  . HIS A 1 177 ? -14.314 52.811 3.437   1.00 83.54  ? 177  HIS A CB  1 
ATOM   1232 C  CG  . HIS A 1 177 ? -12.861 52.648 3.732   1.00 87.39  ? 177  HIS A CG  1 
ATOM   1233 N  ND1 . HIS A 1 177 ? -12.002 51.981 2.887   1.00 87.08  ? 177  HIS A ND1 1 
ATOM   1234 C  CD2 . HIS A 1 177 ? -12.108 53.092 4.766   1.00 89.53  ? 177  HIS A CD2 1 
ATOM   1235 C  CE1 . HIS A 1 177 ? -10.784 52.011 3.395   1.00 91.92  ? 177  HIS A CE1 1 
ATOM   1236 N  NE2 . HIS A 1 177 ? -10.820 52.683 4.532   1.00 92.53  ? 177  HIS A NE2 1 
ATOM   1237 N  N   . LEU A 1 178 ? -16.583 54.370 1.519   1.00 77.27  ? 178  LEU A N   1 
ATOM   1238 C  CA  . LEU A 1 178 ? -17.984 54.150 1.185   1.00 78.86  ? 178  LEU A CA  1 
ATOM   1239 C  C   . LEU A 1 178 ? -18.154 52.751 0.631   1.00 82.95  ? 178  LEU A C   1 
ATOM   1240 O  O   . LEU A 1 178 ? -17.576 52.416 -0.402  1.00 89.52  ? 178  LEU A O   1 
ATOM   1241 C  CB  . LEU A 1 178 ? -18.494 55.173 0.181   1.00 79.93  ? 178  LEU A CB  1 
ATOM   1242 C  CG  . LEU A 1 178 ? -19.065 56.433 0.825   1.00 87.73  ? 178  LEU A CG  1 
ATOM   1243 C  CD1 . LEU A 1 178 ? -19.698 57.342 -0.218  1.00 91.85  ? 178  LEU A CD1 1 
ATOM   1244 C  CD2 . LEU A 1 178 ? -20.074 56.059 1.891   1.00 90.19  ? 178  LEU A CD2 1 
ATOM   1245 N  N   . VAL A 1 179 ? -18.946 51.932 1.316   1.00 77.51  ? 179  VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 179 ? -19.069 50.529 0.942   1.00 73.50  ? 179  VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 179 ? -20.497 50.102 0.661   1.00 68.91  ? 179  VAL A C   1 
ATOM   1248 O  O   . VAL A 1 179 ? -21.232 49.758 1.576   1.00 67.83  ? 179  VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 179 ? -18.548 49.616 2.053   1.00 76.02  ? 179  VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 179 ? -18.200 48.260 1.477   1.00 80.65  ? 179  VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 179 ? -17.341 50.238 2.733   1.00 74.85  ? 179  VAL A CG2 1 
ATOM   1252 N  N   . LEU A 1 180 ? -20.885 50.105 -0.604  1.00 67.55  ? 180  LEU A N   1 
ATOM   1253 C  CA  . LEU A 1 180 ? -22.187 49.585 -0.982  1.00 69.55  ? 180  LEU A CA  1 
ATOM   1254 C  C   . LEU A 1 180 ? -22.344 48.114 -0.575  1.00 70.83  ? 180  LEU A C   1 
ATOM   1255 O  O   . LEU A 1 180 ? -21.403 47.322 -0.652  1.00 73.07  ? 180  LEU A O   1 
ATOM   1256 C  CB  . LEU A 1 180 ? -22.387 49.737 -2.486  1.00 71.12  ? 180  LEU A CB  1 
ATOM   1257 C  CG  . LEU A 1 180 ? -23.294 48.709 -3.158  1.00 73.24  ? 180  LEU A CG  1 
ATOM   1258 C  CD1 . LEU A 1 180 ? -24.773 49.030 -2.934  1.00 66.70  ? 180  LEU A CD1 1 
ATOM   1259 C  CD2 . LEU A 1 180 ? -22.954 48.658 -4.635  1.00 77.79  ? 180  LEU A CD2 1 
ATOM   1260 N  N   . VAL A 1 181 ? -23.537 47.747 -0.136  1.00 68.66  ? 181  VAL A N   1 
ATOM   1261 C  CA  . VAL A 1 181 ? -23.814 46.357 0.185   1.00 76.88  ? 181  VAL A CA  1 
ATOM   1262 C  C   . VAL A 1 181 ? -25.151 45.985 -0.418  1.00 81.74  ? 181  VAL A C   1 
ATOM   1263 O  O   . VAL A 1 181 ? -26.146 46.646 -0.160  1.00 86.20  ? 181  VAL A O   1 
ATOM   1264 C  CB  . VAL A 1 181 ? -23.910 46.143 1.695   1.00 79.60  ? 181  VAL A CB  1 
ATOM   1265 C  CG1 . VAL A 1 181 ? -24.448 44.761 1.993   1.00 82.44  ? 181  VAL A CG1 1 
ATOM   1266 C  CG2 . VAL A 1 181 ? -22.560 46.341 2.345   1.00 81.07  ? 181  VAL A CG2 1 
ATOM   1267 N  N   . ARG A 1 182 ? -25.194 44.934 -1.222  1.00 81.57  ? 182  ARG A N   1 
ATOM   1268 C  CA  . ARG A 1 182 ? -26.447 44.582 -1.866  1.00 83.05  ? 182  ARG A CA  1 
ATOM   1269 C  C   . ARG A 1 182 ? -26.422 43.160 -2.369  1.00 90.31  ? 182  ARG A C   1 
ATOM   1270 O  O   . ARG A 1 182 ? -25.368 42.649 -2.761  1.00 88.35  ? 182  ARG A O   1 
ATOM   1271 C  CB  . ARG A 1 182 ? -26.716 45.507 -3.046  1.00 81.78  ? 182  ARG A CB  1 
ATOM   1272 C  CG  . ARG A 1 182 ? -25.759 45.268 -4.192  1.00 84.85  ? 182  ARG A CG  1 
ATOM   1273 C  CD  . ARG A 1 182 ? -26.261 45.856 -5.492  1.00 86.44  ? 182  ARG A CD  1 
ATOM   1274 N  NE  . ARG A 1 182 ? -25.185 45.906 -6.474  1.00 90.33  ? 182  ARG A NE  1 
ATOM   1275 C  CZ  . ARG A 1 182 ? -25.131 46.778 -7.471  1.00 90.72  ? 182  ARG A CZ  1 
ATOM   1276 N  NH1 . ARG A 1 182 ? -26.100 47.670 -7.614  1.00 92.04  ? 182  ARG A NH1 1 
ATOM   1277 N  NH2 . ARG A 1 182 ? -24.109 46.759 -8.318  1.00 88.55  ? 182  ARG A NH2 1 
ATOM   1278 N  N   . SER A 1 183 ? -27.600 42.539 -2.375  1.00 96.95  ? 183  SER A N   1 
ATOM   1279 C  CA  . SER A 1 183 ? -27.771 41.188 -2.899  1.00 103.00 ? 183  SER A CA  1 
ATOM   1280 C  C   . SER A 1 183 ? -27.549 41.136 -4.412  1.00 106.76 ? 183  SER A C   1 
ATOM   1281 O  O   . SER A 1 183 ? -28.060 41.977 -5.157  1.00 104.56 ? 183  SER A O   1 
ATOM   1282 C  CB  . SER A 1 183 ? -29.159 40.655 -2.547  1.00 102.53 ? 183  SER A CB  1 
ATOM   1283 N  N   . GLU A 1 184 ? -26.778 40.146 -4.854  1.00 112.04 ? 184  GLU A N   1 
ATOM   1284 C  CA  . GLU A 1 184 ? -26.424 40.003 -6.259  1.00 116.73 ? 184  GLU A CA  1 
ATOM   1285 C  C   . GLU A 1 184 ? -26.313 38.527 -6.620  1.00 121.73 ? 184  GLU A C   1 
ATOM   1286 O  O   . GLU A 1 184 ? -25.645 37.767 -5.925  1.00 122.58 ? 184  GLU A O   1 
ATOM   1287 C  CB  . GLU A 1 184 ? -25.094 40.703 -6.550  1.00 117.39 ? 184  GLU A CB  1 
ATOM   1288 C  CG  . GLU A 1 184 ? -24.987 42.108 -5.997  1.00 117.43 ? 184  GLU A CG  1 
ATOM   1289 C  CD  . GLU A 1 184 ? -23.733 42.819 -6.456  1.00 122.05 ? 184  GLU A CD  1 
ATOM   1290 O  OE1 . GLU A 1 184 ? -23.023 42.274 -7.323  1.00 126.38 ? 184  GLU A OE1 1 
ATOM   1291 O  OE2 . GLU A 1 184 ? -23.458 43.927 -5.951  1.00 122.19 ? 184  GLU A OE2 1 
ATOM   1292 N  N   . ILE A 1 185 ? -26.965 38.125 -7.707  1.00 124.24 ? 185  ILE A N   1 
ATOM   1293 C  CA  . ILE A 1 185 ? -26.916 36.739 -8.169  1.00 128.33 ? 185  ILE A CA  1 
ATOM   1294 C  C   . ILE A 1 185 ? -25.502 36.364 -8.614  1.00 131.63 ? 185  ILE A C   1 
ATOM   1295 O  O   . ILE A 1 185 ? -24.879 37.088 -9.388  1.00 130.91 ? 185  ILE A O   1 
ATOM   1296 C  CB  . ILE A 1 185 ? -27.910 36.487 -9.340  1.00 112.34 ? 185  ILE A CB  1 
ATOM   1297 C  CG1 . ILE A 1 185 ? -29.338 36.270 -8.825  1.00 109.03 ? 185  ILE A CG1 1 
ATOM   1298 C  CG2 . ILE A 1 185 ? -27.485 35.286 -10.164 1.00 117.06 ? 185  ILE A CG2 1 
ATOM   1299 C  CD1 . ILE A 1 185 ? -30.098 37.543 -8.503  1.00 102.35 ? 185  ILE A CD1 1 
ATOM   1300 N  N   . SER A 1 186 ? -24.996 35.238 -8.118  1.00 137.20 ? 186  SER A N   1 
ATOM   1301 C  CA  . SER A 1 186 ? -23.685 34.742 -8.533  1.00 143.36 ? 186  SER A CA  1 
ATOM   1302 C  C   . SER A 1 186 ? -23.700 34.348 -10.010 1.00 149.54 ? 186  SER A C   1 
ATOM   1303 O  O   . SER A 1 186 ? -24.767 34.188 -10.602 1.00 151.87 ? 186  SER A O   1 
ATOM   1304 C  CB  . SER A 1 186 ? -23.275 33.539 -7.678  1.00 144.65 ? 186  SER A CB  1 
ATOM   1305 N  N   . GLN A 1 187 ? -22.520 34.193 -10.606 1.00 152.28 ? 187  GLN A N   1 
ATOM   1306 C  CA  . GLN A 1 187 ? -22.423 33.682 -11.972 1.00 156.48 ? 187  GLN A CA  1 
ATOM   1307 C  C   . GLN A 1 187 ? -23.062 32.297 -12.031 1.00 164.29 ? 187  GLN A C   1 
ATOM   1308 O  O   . GLN A 1 187 ? -23.615 31.889 -13.054 1.00 165.62 ? 187  GLN A O   1 
ATOM   1309 C  CB  . GLN A 1 187 ? -20.964 33.610 -12.424 1.00 156.68 ? 187  GLN A CB  1 
ATOM   1310 N  N   . GLU A 1 188 ? -22.966 31.583 -10.915 1.00 169.08 ? 188  GLU A N   1 
ATOM   1311 C  CA  . GLU A 1 188 ? -23.673 30.327 -10.714 1.00 174.77 ? 188  GLU A CA  1 
ATOM   1312 C  C   . GLU A 1 188 ? -24.032 30.214 -9.238  1.00 178.02 ? 188  GLU A C   1 
ATOM   1313 O  O   . GLU A 1 188 ? -23.310 30.723 -8.378  1.00 177.48 ? 188  GLU A O   1 
ATOM   1314 C  CB  . GLU A 1 188 ? -22.810 29.140 -11.141 1.00 178.60 ? 188  GLU A CB  1 
ATOM   1315 N  N   . GLY A 1 189 ? -25.149 29.557 -8.945  1.00 181.05 ? 189  GLY A N   1 
ATOM   1316 C  CA  . GLY A 1 189 ? -25.581 29.378 -7.571  1.00 181.92 ? 189  GLY A CA  1 
ATOM   1317 C  C   . GLY A 1 189 ? -26.520 30.461 -7.071  1.00 178.12 ? 189  GLY A C   1 
ATOM   1318 O  O   . GLY A 1 189 ? -27.046 31.264 -7.850  1.00 174.84 ? 189  GLY A O   1 
ATOM   1319 N  N   . MET A 1 190 ? -26.718 30.488 -5.756  1.00 175.69 ? 190  MET A N   1 
ATOM   1320 C  CA  . MET A 1 190 ? -27.695 31.383 -5.140  1.00 166.29 ? 190  MET A CA  1 
ATOM   1321 C  C   . MET A 1 190 ? -27.232 32.839 -4.981  1.00 153.34 ? 190  MET A C   1 
ATOM   1322 O  O   . MET A 1 190 ? -26.155 33.235 -5.444  1.00 144.59 ? 190  MET A O   1 
ATOM   1323 C  CB  . MET A 1 190 ? -28.161 30.816 -3.793  1.00 167.01 ? 190  MET A CB  1 
ATOM   1324 N  N   . VAL A 1 191 ? -28.076 33.624 -4.321  1.00 151.62 ? 191  VAL A N   1 
ATOM   1325 C  CA  . VAL A 1 191 ? -27.845 35.049 -4.152  1.00 150.20 ? 191  VAL A CA  1 
ATOM   1326 C  C   . VAL A 1 191 ? -27.019 35.345 -2.896  1.00 150.54 ? 191  VAL A C   1 
ATOM   1327 O  O   . VAL A 1 191 ? -27.190 34.699 -1.862  1.00 150.83 ? 191  VAL A O   1 
ATOM   1328 C  CB  . VAL A 1 191 ? -29.194 35.841 -4.153  1.00 122.18 ? 191  VAL A CB  1 
ATOM   1329 C  CG1 . VAL A 1 191 ? -29.896 35.716 -5.511  1.00 126.39 ? 191  VAL A CG1 1 
ATOM   1330 C  CG2 . VAL A 1 191 ? -30.101 35.397 -3.016  1.00 120.74 ? 191  VAL A CG2 1 
ATOM   1331 N  N   . PHE A 1 192 ? -26.106 36.307 -3.011  1.00 148.06 ? 192  PHE A N   1 
ATOM   1332 C  CA  . PHE A 1 192 ? -25.268 36.736 -1.897  1.00 142.13 ? 192  PHE A CA  1 
ATOM   1333 C  C   . PHE A 1 192 ? -25.112 38.242 -1.948  1.00 138.93 ? 192  PHE A C   1 
ATOM   1334 O  O   . PHE A 1 192 ? -25.095 38.832 -3.030  1.00 142.57 ? 192  PHE A O   1 
ATOM   1335 C  CB  . PHE A 1 192 ? -23.885 36.078 -1.957  1.00 140.10 ? 192  PHE A CB  1 
ATOM   1336 C  CG  . PHE A 1 192 ? -23.093 36.433 -3.186  1.00 137.89 ? 192  PHE A CG  1 
ATOM   1337 C  CD1 . PHE A 1 192 ? -22.368 37.609 -3.249  1.00 134.45 ? 192  PHE A CD1 1 
ATOM   1338 C  CD2 . PHE A 1 192 ? -23.063 35.580 -4.276  1.00 142.24 ? 192  PHE A CD2 1 
ATOM   1339 C  CE1 . PHE A 1 192 ? -21.639 37.929 -4.383  1.00 135.34 ? 192  PHE A CE1 1 
ATOM   1340 C  CE2 . PHE A 1 192 ? -22.332 35.898 -5.411  1.00 141.34 ? 192  PHE A CE2 1 
ATOM   1341 C  CZ  . PHE A 1 192 ? -21.620 37.073 -5.463  1.00 137.00 ? 192  PHE A CZ  1 
ATOM   1342 N  N   . ARG A 1 193 ? -25.002 38.863 -0.781  1.00 131.87 ? 193  ARG A N   1 
ATOM   1343 C  CA  . ARG A 1 193 ? -24.758 40.293 -0.710  1.00 123.87 ? 193  ARG A CA  1 
ATOM   1344 C  C   . ARG A 1 193 ? -23.292 40.561 -1.041  1.00 118.43 ? 193  ARG A C   1 
ATOM   1345 O  O   . ARG A 1 193 ? -22.398 39.938 -0.466  1.00 115.63 ? 193  ARG A O   1 
ATOM   1346 C  CB  . ARG A 1 193 ? -25.140 40.810 0.674   1.00 123.00 ? 193  ARG A CB  1 
ATOM   1347 C  CG  . ARG A 1 193 ? -26.563 40.430 1.042   1.00 128.12 ? 193  ARG A CG  1 
ATOM   1348 C  CD  . ARG A 1 193 ? -26.944 40.807 2.465   1.00 135.72 ? 193  ARG A CD  1 
ATOM   1349 N  NE  . ARG A 1 193 ? -26.255 40.018 3.497   1.00 146.35 ? 193  ARG A NE  1 
ATOM   1350 C  CZ  . ARG A 1 193 ? -26.524 38.745 3.808   1.00 150.22 ? 193  ARG A CZ  1 
ATOM   1351 N  NH1 . ARG A 1 193 ? -27.461 38.066 3.150   1.00 152.59 ? 193  ARG A NH1 1 
ATOM   1352 N  NH2 . ARG A 1 193 ? -25.840 38.139 4.776   1.00 148.64 ? 193  ARG A NH2 1 
ATOM   1353 N  N   . ARG A 1 194 ? -23.044 41.453 -1.997  1.00 114.63 ? 194  ARG A N   1 
ATOM   1354 C  CA  . ARG A 1 194 ? -21.669 41.739 -2.380  1.00 116.06 ? 194  ARG A CA  1 
ATOM   1355 C  C   . ARG A 1 194 ? -21.147 42.988 -1.702  1.00 113.76 ? 194  ARG A C   1 
ATOM   1356 O  O   . ARG A 1 194 ? -21.845 43.997 -1.574  1.00 111.87 ? 194  ARG A O   1 
ATOM   1357 C  CB  . ARG A 1 194 ? -21.480 41.819 -3.900  1.00 119.43 ? 194  ARG A CB  1 
ATOM   1358 C  CG  . ARG A 1 194 ? -20.512 40.761 -4.442  1.00 125.99 ? 194  ARG A CG  1 
ATOM   1359 C  CD  . ARG A 1 194 ? -19.529 41.298 -5.477  1.00 129.73 ? 194  ARG A CD  1 
ATOM   1360 N  NE  . ARG A 1 194 ? -18.200 41.533 -4.910  1.00 136.58 ? 194  ARG A NE  1 
ATOM   1361 C  CZ  . ARG A 1 194 ? -17.141 41.924 -5.616  1.00 141.21 ? 194  ARG A CZ  1 
ATOM   1362 N  NH1 . ARG A 1 194 ? -17.251 42.122 -6.923  1.00 142.83 ? 194  ARG A NH1 1 
ATOM   1363 N  NH2 . ARG A 1 194 ? -15.969 42.119 -5.021  1.00 141.30 ? 194  ARG A NH2 1 
ATOM   1364 N  N   . PHE A 1 195 ? -19.903 42.888 -1.257  1.00 112.00 ? 195  PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 195 ? -19.236 43.968 -0.573  1.00 107.30 ? 195  PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 195 ? -18.538 44.840 -1.596  1.00 104.39 ? 195  PHE A C   1 
ATOM   1367 O  O   . PHE A 1 195 ? -17.396 44.574 -1.971  1.00 107.57 ? 195  PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 195 ? -18.200 43.376 0.363   1.00 113.23 ? 195  PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 195 ? -18.048 44.120 1.650   1.00 118.07 ? 195  PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 195 ? -17.019 45.041 1.822   1.00 116.58 ? 195  PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 195 ? -18.924 43.890 2.701   1.00 120.43 ? 195  PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 195 ? -16.870 45.718 3.020   1.00 113.48 ? 195  PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 195 ? -18.782 44.565 3.903   1.00 118.23 ? 195  PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 195 ? -17.754 45.481 4.061   1.00 115.01 ? 195  PHE A CZ  1 
ATOM   1375 N  N   . HIS A 1 196 ? -19.218 45.877 -2.063  1.00 98.98  ? 196  HIS A N   1 
ATOM   1376 C  CA  . HIS A 1 196 ? -18.602 46.761 -3.034  1.00 96.02  ? 196  HIS A CA  1 
ATOM   1377 C  C   . HIS A 1 196 ? -17.981 47.973 -2.388  1.00 91.63  ? 196  HIS A C   1 
ATOM   1378 O  O   . HIS A 1 196 ? -18.686 48.865 -1.929  1.00 92.47  ? 196  HIS A O   1 
ATOM   1379 C  CB  . HIS A 1 196 ? -19.609 47.186 -4.086  1.00 97.37  ? 196  HIS A CB  1 
ATOM   1380 C  CG  . HIS A 1 196 ? -19.797 46.171 -5.162  1.00 105.61 ? 196  HIS A CG  1 
ATOM   1381 N  ND1 . HIS A 1 196 ? -18.829 45.910 -6.109  1.00 111.71 ? 196  HIS A ND1 1 
ATOM   1382 C  CD2 . HIS A 1 196 ? -20.827 45.338 -5.434  1.00 107.98 ? 196  HIS A CD2 1 
ATOM   1383 C  CE1 . HIS A 1 196 ? -19.261 44.966 -6.925  1.00 116.09 ? 196  HIS A CE1 1 
ATOM   1384 N  NE2 . HIS A 1 196 ? -20.472 44.603 -6.538  1.00 114.02 ? 196  HIS A NE2 1 
ATOM   1385 N  N   . ASP A 1 197 ? -16.656 48.008 -2.343  1.00 89.35  ? 197  ASP A N   1 
ATOM   1386 C  CA  . ASP A 1 197 ? -15.984 49.188 -1.827  1.00 86.28  ? 197  ASP A CA  1 
ATOM   1387 C  C   . ASP A 1 197 ? -15.941 50.253 -2.910  1.00 81.21  ? 197  ASP A C   1 
ATOM   1388 O  O   . ASP A 1 197 ? -15.345 50.051 -3.958  1.00 83.17  ? 197  ASP A O   1 
ATOM   1389 C  CB  . ASP A 1 197 ? -14.580 48.868 -1.329  1.00 90.64  ? 197  ASP A CB  1 
ATOM   1390 C  CG  . ASP A 1 197 ? -14.009 49.979 -0.468  1.00 96.10  ? 197  ASP A CG  1 
ATOM   1391 O  OD1 . ASP A 1 197 ? -14.387 51.152 -0.685  1.00 96.13  ? 197  ASP A OD1 1 
ATOM   1392 O  OD2 . ASP A 1 197 ? -13.194 49.684 0.434   1.00 100.75 ? 197  ASP A OD2 1 
ATOM   1393 N  N   . LEU A 1 198 ? -16.584 51.386 -2.653  1.00 76.39  ? 198  LEU A N   1 
ATOM   1394 C  CA  . LEU A 1 198 ? -16.739 52.415 -3.669  1.00 77.37  ? 198  LEU A CA  1 
ATOM   1395 C  C   . LEU A 1 198 ? -15.585 53.418 -3.695  1.00 81.10  ? 198  LEU A C   1 
ATOM   1396 O  O   . LEU A 1 198 ? -15.194 53.982 -2.662  1.00 76.00  ? 198  LEU A O   1 
ATOM   1397 C  CB  . LEU A 1 198 ? -18.062 53.150 -3.479  1.00 74.58  ? 198  LEU A CB  1 
ATOM   1398 C  CG  . LEU A 1 198 ? -19.264 52.285 -3.122  1.00 73.26  ? 198  LEU A CG  1 
ATOM   1399 C  CD1 . LEU A 1 198 ? -20.425 53.169 -2.720  1.00 71.30  ? 198  LEU A CD1 1 
ATOM   1400 C  CD2 . LEU A 1 198 ? -19.640 51.389 -4.282  1.00 78.98  ? 198  LEU A CD2 1 
ATOM   1401 N  N   . THR A 1 199 ? -15.070 53.631 -4.905  1.00 87.70  ? 199  THR A N   1 
ATOM   1402 C  CA  . THR A 1 199 ? -13.967 54.550 -5.191  1.00 89.43  ? 199  THR A CA  1 
ATOM   1403 C  C   . THR A 1 199 ? -14.348 56.010 -4.935  1.00 86.53  ? 199  THR A C   1 
ATOM   1404 O  O   . THR A 1 199 ? -15.347 56.500 -5.469  1.00 90.11  ? 199  THR A O   1 
ATOM   1405 C  CB  . THR A 1 199 ? -13.529 54.407 -6.671  1.00 82.21  ? 199  THR A CB  1 
ATOM   1406 O  OG1 . THR A 1 199 ? -13.111 53.059 -6.923  1.00 83.74  ? 199  THR A OG1 1 
ATOM   1407 C  CG2 . THR A 1 199 ? -12.397 55.355 -6.994  1.00 81.68  ? 199  THR A CG2 1 
ATOM   1408 N  N   . LEU A 1 200 ? -13.552 56.707 -4.132  1.00 80.38  ? 200  LEU A N   1 
ATOM   1409 C  CA  . LEU A 1 200 ? -13.859 58.093 -3.784  1.00 80.61  ? 200  LEU A CA  1 
ATOM   1410 C  C   . LEU A 1 200 ? -12.889 59.084 -4.433  1.00 88.75  ? 200  LEU A C   1 
ATOM   1411 O  O   . LEU A 1 200 ? -11.787 58.708 -4.839  1.00 96.17  ? 200  LEU A O   1 
ATOM   1412 C  CB  . LEU A 1 200 ? -13.843 58.275 -2.262  1.00 76.07  ? 200  LEU A CB  1 
ATOM   1413 C  CG  . LEU A 1 200 ? -14.676 57.301 -1.429  1.00 73.88  ? 200  LEU A CG  1 
ATOM   1414 C  CD1 . LEU A 1 200 ? -14.548 57.623 0.040   1.00 70.12  ? 200  LEU A CD1 1 
ATOM   1415 C  CD2 . LEU A 1 200 ? -16.126 57.348 -1.851  1.00 76.33  ? 200  LEU A CD2 1 
ATOM   1416 N  N   . THR A 1 201 ? -13.295 60.351 -4.521  1.00 86.79  ? 201  THR A N   1 
ATOM   1417 C  CA  . THR A 1 201 ? -12.427 61.397 -5.069  1.00 84.80  ? 201  THR A CA  1 
ATOM   1418 C  C   . THR A 1 201 ? -11.335 61.800 -4.078  1.00 92.11  ? 201  THR A C   1 
ATOM   1419 O  O   . THR A 1 201 ? -10.243 62.219 -4.472  1.00 98.32  ? 201  THR A O   1 
ATOM   1420 C  CB  . THR A 1 201 ? -13.220 62.653 -5.485  1.00 72.26  ? 201  THR A CB  1 
ATOM   1421 O  OG1 . THR A 1 201 ? -13.761 63.279 -4.324  1.00 68.35  ? 201  THR A OG1 1 
ATOM   1422 C  CG2 . THR A 1 201 ? -14.350 62.285 -6.403  1.00 69.73  ? 201  THR A CG2 1 
ATOM   1423 N  N   . ARG A 1 202 ? -11.645 61.683 -2.791  1.00 88.70  ? 202  ARG A N   1 
ATOM   1424 C  CA  . ARG A 1 202 ? -10.661 61.885 -1.741  1.00 84.37  ? 202  ARG A CA  1 
ATOM   1425 C  C   . ARG A 1 202 ? -10.945 60.927 -0.601  1.00 81.53  ? 202  ARG A C   1 
ATOM   1426 O  O   . ARG A 1 202 ? -11.805 61.178 0.236   1.00 76.45  ? 202  ARG A O   1 
ATOM   1427 C  CB  . ARG A 1 202 ? -10.649 63.331 -1.240  1.00 83.97  ? 202  ARG A CB  1 
ATOM   1428 C  CG  . ARG A 1 202 ? -9.789  63.517 -0.002  1.00 88.13  ? 202  ARG A CG  1 
ATOM   1429 C  CD  . ARG A 1 202 ? -9.360  64.954 0.218   1.00 91.82  ? 202  ARG A CD  1 
ATOM   1430 N  NE  . ARG A 1 202 ? -8.643  65.501 -0.930  1.00 99.76  ? 202  ARG A NE  1 
ATOM   1431 C  CZ  . ARG A 1 202 ? -9.047  66.567 -1.615  1.00 106.64 ? 202  ARG A CZ  1 
ATOM   1432 N  NH1 . ARG A 1 202 ? -10.163 67.196 -1.253  1.00 105.23 ? 202  ARG A NH1 1 
ATOM   1433 N  NH2 . ARG A 1 202 ? -8.340  67.011 -2.653  1.00 110.41 ? 202  ARG A NH2 1 
ATOM   1434 N  N   . SER A 1 203 ? -10.211 59.821 -0.595  1.00 85.72  ? 203  SER A N   1 
ATOM   1435 C  CA  . SER A 1 203 ? -10.320 58.795 0.428   1.00 83.64  ? 203  SER A CA  1 
ATOM   1436 C  C   . SER A 1 203 ? -9.607  59.246 1.702   1.00 82.42  ? 203  SER A C   1 
ATOM   1437 O  O   . SER A 1 203 ? -10.126 59.100 2.804   1.00 72.98  ? 203  SER A O   1 
ATOM   1438 C  CB  . SER A 1 203 ? -9.689  57.501 -0.098  1.00 85.05  ? 203  SER A CB  1 
ATOM   1439 O  OG  . SER A 1 203 ? -10.184 56.357 0.579   1.00 89.18  ? 203  SER A OG  1 
ATOM   1440 N  N   . ARG A 1 204 ? -8.413  59.806 1.532   1.00 92.80  ? 204  ARG A N   1 
ATOM   1441 C  CA  . ARG A 1 204 ? -7.579  60.245 2.648   1.00 98.98  ? 204  ARG A CA  1 
ATOM   1442 C  C   . ARG A 1 204 ? -7.672  61.740 2.874   1.00 94.64  ? 204  ARG A C   1 
ATOM   1443 O  O   . ARG A 1 204 ? -7.967  62.508 1.966   1.00 97.39  ? 204  ARG A O   1 
ATOM   1444 C  CB  . ARG A 1 204 ? -6.117  59.902 2.377   1.00 110.80 ? 204  ARG A CB  1 
ATOM   1445 C  CG  . ARG A 1 204 ? -5.578  58.708 3.139   1.00 116.84 ? 204  ARG A CG  1 
ATOM   1446 C  CD  . ARG A 1 204 ? -5.346  59.042 4.595   1.00 121.66 ? 204  ARG A CD  1 
ATOM   1447 N  NE  . ARG A 1 204 ? -4.298  58.200 5.161   1.00 129.87 ? 204  ARG A NE  1 
ATOM   1448 C  CZ  . ARG A 1 204 ? -4.405  56.887 5.340   1.00 135.70 ? 204  ARG A CZ  1 
ATOM   1449 N  NH1 . ARG A 1 204 ? -5.516  56.252 4.994   1.00 135.15 ? 204  ARG A NH1 1 
ATOM   1450 N  NH2 . ARG A 1 204 ? -3.396  56.203 5.862   1.00 140.73 ? 204  ARG A NH2 1 
ATOM   1451 N  N   . SER A 1 205 ? -7.394  62.153 4.096   1.00 90.16  ? 205  SER A N   1 
ATOM   1452 C  CA  . SER A 1 205 ? -7.362  63.564 4.416   1.00 87.08  ? 205  SER A CA  1 
ATOM   1453 C  C   . SER A 1 205 ? -6.359  63.728 5.543   1.00 86.41  ? 205  SER A C   1 
ATOM   1454 O  O   . SER A 1 205 ? -6.571  63.229 6.650   1.00 83.57  ? 205  SER A O   1 
ATOM   1455 C  CB  . SER A 1 205 ? -8.753  64.058 4.821   1.00 81.72  ? 205  SER A CB  1 
ATOM   1456 O  OG  . SER A 1 205 ? -8.756  65.447 5.092   1.00 76.47  ? 205  SER A OG  1 
ATOM   1457 N  N   . PRO A 1 206 ? -5.245  64.408 5.253   1.00 88.53  ? 206  PRO A N   1 
ATOM   1458 C  CA  . PRO A 1 206 ? -4.126  64.500 6.193   1.00 89.42  ? 206  PRO A CA  1 
ATOM   1459 C  C   . PRO A 1 206 ? -4.592  65.106 7.498   1.00 84.57  ? 206  PRO A C   1 
ATOM   1460 O  O   . PRO A 1 206 ? -4.036  64.836 8.555   1.00 87.53  ? 206  PRO A O   1 
ATOM   1461 C  CB  . PRO A 1 206 ? -3.151  65.450 5.492   1.00 94.97  ? 206  PRO A CB  1 
ATOM   1462 C  CG  . PRO A 1 206 ? -3.537  65.418 4.048   1.00 96.68  ? 206  PRO A CG  1 
ATOM   1463 C  CD  . PRO A 1 206 ? -5.018  65.197 4.032   1.00 91.91  ? 206  PRO A CD  1 
ATOM   1464 N  N   . ILE A 1 207 ? -5.626  65.926 7.416   1.00 79.14  ? 207  ILE A N   1 
ATOM   1465 C  CA  . ILE A 1 207 ? -6.143  66.591 8.592   1.00 75.59  ? 207  ILE A CA  1 
ATOM   1466 C  C   . ILE A 1 207 ? -7.635  66.849 8.410   1.00 75.99  ? 207  ILE A C   1 
ATOM   1467 O  O   . ILE A 1 207 ? -8.111  66.996 7.282   1.00 78.37  ? 207  ILE A O   1 
ATOM   1468 C  CB  . ILE A 1 207 ? -5.432  67.914 8.818   1.00 70.96  ? 207  ILE A CB  1 
ATOM   1469 C  CG1 . ILE A 1 207 ? -5.486  68.292 10.287  1.00 74.98  ? 207  ILE A CG1 1 
ATOM   1470 C  CG2 . ILE A 1 207 ? -6.073  68.991 7.992   1.00 65.14  ? 207  ILE A CG2 1 
ATOM   1471 C  CD1 . ILE A 1 207 ? -5.296  69.750 10.509  1.00 80.12  ? 207  ILE A CD1 1 
ATOM   1472 N  N   . PHE A 1 208 ? -8.369  66.895 9.518   1.00 71.71  ? 208  PHE A N   1 
ATOM   1473 C  CA  . PHE A 1 208 ? -9.814  67.048 9.469   1.00 70.60  ? 208  PHE A CA  1 
ATOM   1474 C  C   . PHE A 1 208 ? -10.295 67.651 10.766  1.00 71.32  ? 208  PHE A C   1 
ATOM   1475 O  O   . PHE A 1 208 ? -10.198 67.015 11.812  1.00 77.46  ? 208  PHE A O   1 
ATOM   1476 C  CB  . PHE A 1 208 ? -10.469 65.682 9.263   1.00 71.46  ? 208  PHE A CB  1 
ATOM   1477 C  CG  . PHE A 1 208 ? -11.974 65.696 9.368   1.00 67.36  ? 208  PHE A CG  1 
ATOM   1478 C  CD1 . PHE A 1 208 ? -12.729 66.554 8.591   1.00 67.49  ? 208  PHE A CD1 1 
ATOM   1479 C  CD2 . PHE A 1 208 ? -12.628 64.825 10.225  1.00 64.67  ? 208  PHE A CD2 1 
ATOM   1480 C  CE1 . PHE A 1 208 ? -14.101 66.555 8.682   1.00 68.90  ? 208  PHE A CE1 1 
ATOM   1481 C  CE2 . PHE A 1 208 ? -14.000 64.819 10.323  1.00 64.71  ? 208  PHE A CE2 1 
ATOM   1482 C  CZ  . PHE A 1 208 ? -14.740 65.682 9.552   1.00 68.01  ? 208  PHE A CZ  1 
ATOM   1483 N  N   . SER A 1 209 ? -10.809 68.874 10.718  1.00 66.42  ? 209  SER A N   1 
ATOM   1484 C  CA  . SER A 1 209 ? -11.263 69.509 11.946  1.00 72.36  ? 209  SER A CA  1 
ATOM   1485 C  C   . SER A 1 209 ? -12.691 70.003 11.856  1.00 74.90  ? 209  SER A C   1 
ATOM   1486 O  O   . SER A 1 209 ? -13.388 70.071 12.867  1.00 81.81  ? 209  SER A O   1 
ATOM   1487 C  CB  . SER A 1 209 ? -10.335 70.653 12.345  1.00 78.34  ? 209  SER A CB  1 
ATOM   1488 O  OG  . SER A 1 209 ? -10.115 71.511 11.240  1.00 85.07  ? 209  SER A OG  1 
ATOM   1489 N  N   . LEU A 1 210 ? -13.135 70.327 10.647  1.00 72.43  ? 210  LEU A N   1 
ATOM   1490 C  CA  . LEU A 1 210 ? -14.451 70.932 10.469  1.00 72.37  ? 210  LEU A CA  1 
ATOM   1491 C  C   . LEU A 1 210 ? -15.480 70.025 9.783   1.00 74.75  ? 210  LEU A C   1 
ATOM   1492 O  O   . LEU A 1 210 ? -16.205 69.277 10.443  1.00 73.87  ? 210  LEU A O   1 
ATOM   1493 C  CB  . LEU A 1 210 ? -14.309 72.235 9.685   1.00 72.34  ? 210  LEU A CB  1 
ATOM   1494 C  CG  . LEU A 1 210 ? -13.184 73.132 10.210  1.00 77.12  ? 210  LEU A CG  1 
ATOM   1495 C  CD1 . LEU A 1 210 ? -13.015 74.368 9.352   1.00 80.11  ? 210  LEU A CD1 1 
ATOM   1496 C  CD2 . LEU A 1 210 ? -13.450 73.513 11.648  1.00 80.07  ? 210  LEU A CD2 1 
ATOM   1497 N  N   . SER A 1 211 ? -15.545 70.107 8.456   1.00 74.81  ? 211  SER A N   1 
ATOM   1498 C  CA  . SER A 1 211 ? -16.517 69.342 7.686   1.00 70.52  ? 211  SER A CA  1 
ATOM   1499 C  C   . SER A 1 211 ? -15.872 68.719 6.457   1.00 71.24  ? 211  SER A C   1 
ATOM   1500 O  O   . SER A 1 211 ? -14.971 69.303 5.865   1.00 79.70  ? 211  SER A O   1 
ATOM   1501 C  CB  . SER A 1 211 ? -17.681 70.244 7.271   1.00 67.65  ? 211  SER A CB  1 
ATOM   1502 O  OG  . SER A 1 211 ? -18.650 69.529 6.531   1.00 67.08  ? 211  SER A OG  1 
ATOM   1503 N  N   . TRP A 1 212 ? -16.358 67.547 6.063   1.00 61.86  ? 212  TRP A N   1 
ATOM   1504 C  CA  . TRP A 1 212 ? -15.816 66.832 4.918   1.00 57.58  ? 212  TRP A CA  1 
ATOM   1505 C  C   . TRP A 1 212 ? -16.948 66.229 4.100   1.00 57.24  ? 212  TRP A C   1 
ATOM   1506 O  O   . TRP A 1 212 ? -17.691 65.395 4.605   1.00 62.21  ? 212  TRP A O   1 
ATOM   1507 C  CB  . TRP A 1 212 ? -14.892 65.714 5.420   1.00 59.03  ? 212  TRP A CB  1 
ATOM   1508 C  CG  . TRP A 1 212 ? -14.206 64.905 4.350   1.00 54.52  ? 212  TRP A CG  1 
ATOM   1509 C  CD1 . TRP A 1 212 ? -14.323 65.060 3.005   1.00 57.21  ? 212  TRP A CD1 1 
ATOM   1510 C  CD2 . TRP A 1 212 ? -13.297 63.821 4.550   1.00 50.14  ? 212  TRP A CD2 1 
ATOM   1511 N  NE1 . TRP A 1 212 ? -13.546 64.135 2.348   1.00 57.13  ? 212  TRP A NE1 1 
ATOM   1512 C  CE2 . TRP A 1 212 ? -12.897 63.368 3.279   1.00 53.58  ? 212  TRP A CE2 1 
ATOM   1513 C  CE3 . TRP A 1 212 ? -12.775 63.189 5.680   1.00 54.00  ? 212  TRP A CE3 1 
ATOM   1514 C  CZ2 . TRP A 1 212 ? -12.004 62.310 3.107   1.00 56.37  ? 212  TRP A CZ2 1 
ATOM   1515 C  CZ3 . TRP A 1 212 ? -11.884 62.137 5.508   1.00 55.14  ? 212  TRP A CZ3 1 
ATOM   1516 C  CH2 . TRP A 1 212 ? -11.515 61.707 4.233   1.00 56.45  ? 212  TRP A CH2 1 
ATOM   1517 N  N   . THR A 1 213 ? -17.103 66.637 2.846   1.00 58.15  ? 213  THR A N   1 
ATOM   1518 C  CA  . THR A 1 213 ? -18.066 65.943 1.992   1.00 64.52  ? 213  THR A CA  1 
ATOM   1519 C  C   . THR A 1 213 ? -17.342 64.814 1.286   1.00 68.49  ? 213  THR A C   1 
ATOM   1520 O  O   . THR A 1 213 ? -16.443 65.048 0.477   1.00 72.57  ? 213  THR A O   1 
ATOM   1521 C  CB  . THR A 1 213 ? -18.732 66.846 0.911   1.00 57.67  ? 213  THR A CB  1 
ATOM   1522 O  OG1 . THR A 1 213 ? -19.371 67.978 1.514   1.00 58.90  ? 213  THR A OG1 1 
ATOM   1523 C  CG2 . THR A 1 213 ? -19.771 66.055 0.131   1.00 52.36  ? 213  THR A CG2 1 
ATOM   1524 N  N   . VAL A 1 214 ? -17.717 63.585 1.608   1.00 66.73  ? 214  VAL A N   1 
ATOM   1525 C  CA  . VAL A 1 214 ? -17.192 62.430 0.896   1.00 67.17  ? 214  VAL A CA  1 
ATOM   1526 C  C   . VAL A 1 214 ? -18.019 62.274 -0.370  1.00 69.69  ? 214  VAL A C   1 
ATOM   1527 O  O   . VAL A 1 214 ? -19.201 62.597 -0.371  1.00 64.75  ? 214  VAL A O   1 
ATOM   1528 C  CB  . VAL A 1 214 ? -17.286 61.148 1.754   1.00 57.90  ? 214  VAL A CB  1 
ATOM   1529 C  CG1 . VAL A 1 214 ? -16.995 59.901 0.925   1.00 54.91  ? 214  VAL A CG1 1 
ATOM   1530 C  CG2 . VAL A 1 214 ? -16.347 61.249 2.944   1.00 54.35  ? 214  VAL A CG2 1 
ATOM   1531 N  N   . MET A 1 215 ? -17.404 61.805 -1.453  1.00 75.03  ? 215  MET A N   1 
ATOM   1532 C  CA  . MET A 1 215 ? -18.157 61.586 -2.678  1.00 76.79  ? 215  MET A CA  1 
ATOM   1533 C  C   . MET A 1 215 ? -17.566 60.551 -3.609  1.00 79.00  ? 215  MET A C   1 
ATOM   1534 O  O   . MET A 1 215 ? -16.355 60.485 -3.814  1.00 78.18  ? 215  MET A O   1 
ATOM   1535 C  CB  . MET A 1 215 ? -18.383 62.897 -3.417  1.00 78.03  ? 215  MET A CB  1 
ATOM   1536 C  CG  . MET A 1 215 ? -17.198 63.825 -3.396  1.00 80.20  ? 215  MET A CG  1 
ATOM   1537 S  SD  . MET A 1 215 ? -17.669 65.476 -3.932  1.00 93.02  ? 215  MET A SD  1 
ATOM   1538 C  CE  . MET A 1 215 ? -16.084 66.318 -3.817  1.00 83.06  ? 215  MET A CE  1 
ATOM   1539 N  N   . HIS A 1 216 ? -18.464 59.752 -4.171  1.00 80.29  ? 216  HIS A N   1 
ATOM   1540 C  CA  . HIS A 1 216 ? -18.138 58.682 -5.095  1.00 78.62  ? 216  HIS A CA  1 
ATOM   1541 C  C   . HIS A 1 216 ? -18.793 58.998 -6.426  1.00 76.05  ? 216  HIS A C   1 
ATOM   1542 O  O   . HIS A 1 216 ? -20.010 58.919 -6.557  1.00 77.45  ? 216  HIS A O   1 
ATOM   1543 C  CB  . HIS A 1 216 ? -18.666 57.355 -4.539  1.00 80.66  ? 216  HIS A CB  1 
ATOM   1544 C  CG  . HIS A 1 216 ? -18.972 56.320 -5.582  1.00 81.77  ? 216  HIS A CG  1 
ATOM   1545 N  ND1 . HIS A 1 216 ? -18.036 55.415 -6.034  1.00 81.78  ? 216  HIS A ND1 1 
ATOM   1546 C  CD2 . HIS A 1 216 ? -20.125 56.023 -6.230  1.00 80.41  ? 216  HIS A CD2 1 
ATOM   1547 C  CE1 . HIS A 1 216 ? -18.594 54.616 -6.925  1.00 83.23  ? 216  HIS A CE1 1 
ATOM   1548 N  NE2 . HIS A 1 216 ? -19.861 54.965 -7.064  1.00 80.88  ? 216  HIS A NE2 1 
ATOM   1549 N  N   . PRO A 1 217 ? -17.987 59.391 -7.415  1.00 73.67  ? 217  PRO A N   1 
ATOM   1550 C  CA  . PRO A 1 217 ? -18.498 59.715 -8.749  1.00 73.28  ? 217  PRO A CA  1 
ATOM   1551 C  C   . PRO A 1 217 ? -19.064 58.472 -9.384  1.00 75.98  ? 217  PRO A C   1 
ATOM   1552 O  O   . PRO A 1 217 ? -18.429 57.429 -9.296  1.00 81.82  ? 217  PRO A O   1 
ATOM   1553 C  CB  . PRO A 1 217 ? -17.246 60.143 -9.510  1.00 71.05  ? 217  PRO A CB  1 
ATOM   1554 C  CG  . PRO A 1 217 ? -16.257 60.494 -8.464  1.00 71.59  ? 217  PRO A CG  1 
ATOM   1555 C  CD  . PRO A 1 217 ? -16.537 59.604 -7.310  1.00 72.15  ? 217  PRO A CD  1 
ATOM   1556 N  N   . ILE A 1 218 ? -20.227 58.559 -10.009 1.00 75.11  ? 218  ILE A N   1 
ATOM   1557 C  CA  . ILE A 1 218 ? -20.798 57.371 -10.621 1.00 78.54  ? 218  ILE A CA  1 
ATOM   1558 C  C   . ILE A 1 218 ? -20.475 57.319 -12.108 1.00 85.84  ? 218  ILE A C   1 
ATOM   1559 O  O   . ILE A 1 218 ? -21.142 57.954 -12.925 1.00 88.60  ? 218  ILE A O   1 
ATOM   1560 C  CB  . ILE A 1 218 ? -22.308 57.274 -10.381 1.00 73.29  ? 218  ILE A CB  1 
ATOM   1561 C  CG1 . ILE A 1 218 ? -22.609 57.427 -8.896  1.00 64.88  ? 218  ILE A CG1 1 
ATOM   1562 C  CG2 . ILE A 1 218 ? -22.842 55.948 -10.874 1.00 75.07  ? 218  ILE A CG2 1 
ATOM   1563 C  CD1 . ILE A 1 218 ? -23.974 57.961 -8.630  1.00 59.02  ? 218  ILE A CD1 1 
ATOM   1564 N  N   . ASP A 1 219 ? -19.432 56.566 -12.440 1.00 89.11  ? 219  ASP A N   1 
ATOM   1565 C  CA  . ASP A 1 219 ? -19.023 56.365 -13.820 1.00 95.52  ? 219  ASP A CA  1 
ATOM   1566 C  C   . ASP A 1 219 ? -19.216 54.906 -14.234 1.00 97.66  ? 219  ASP A C   1 
ATOM   1567 O  O   . ASP A 1 219 ? -19.779 54.110 -13.485 1.00 96.59  ? 219  ASP A O   1 
ATOM   1568 C  CB  . ASP A 1 219 ? -17.570 56.784 -14.002 1.00 101.29 ? 219  ASP A CB  1 
ATOM   1569 C  CG  . ASP A 1 219 ? -16.633 56.045 -13.073 1.00 103.47 ? 219  ASP A CG  1 
ATOM   1570 O  OD1 . ASP A 1 219 ? -16.865 54.844 -12.823 1.00 106.75 ? 219  ASP A OD1 1 
ATOM   1571 O  OD2 . ASP A 1 219 ? -15.655 56.663 -12.603 1.00 100.55 ? 219  ASP A OD2 1 
ATOM   1572 N  N   . HIS A 1 220 ? -18.743 54.556 -15.424 1.00 102.76 ? 220  HIS A N   1 
ATOM   1573 C  CA  . HIS A 1 220 ? -19.022 53.240 -15.989 1.00 111.89 ? 220  HIS A CA  1 
ATOM   1574 C  C   . HIS A 1 220 ? -18.556 52.086 -15.102 1.00 110.93 ? 220  HIS A C   1 
ATOM   1575 O  O   . HIS A 1 220 ? -19.140 50.997 -15.135 1.00 112.44 ? 220  HIS A O   1 
ATOM   1576 C  CB  . HIS A 1 220 ? -18.465 53.108 -17.420 1.00 125.07 ? 220  HIS A CB  1 
ATOM   1577 C  CG  . HIS A 1 220 ? -17.272 53.971 -17.697 1.00 136.71 ? 220  HIS A CG  1 
ATOM   1578 N  ND1 . HIS A 1 220 ? -17.378 55.252 -18.196 1.00 140.57 ? 220  HIS A ND1 1 
ATOM   1579 C  CD2 . HIS A 1 220 ? -15.946 53.733 -17.554 1.00 141.81 ? 220  HIS A CD2 1 
ATOM   1580 C  CE1 . HIS A 1 220 ? -16.169 55.769 -18.342 1.00 142.36 ? 220  HIS A CE1 1 
ATOM   1581 N  NE2 . HIS A 1 220 ? -15.283 54.867 -17.961 1.00 143.44 ? 220  HIS A NE2 1 
ATOM   1582 N  N   . HIS A 1 221 ? -17.523 52.328 -14.299 1.00 108.12 ? 221  HIS A N   1 
ATOM   1583 C  CA  . HIS A 1 221 ? -16.975 51.283 -13.433 1.00 109.29 ? 221  HIS A CA  1 
ATOM   1584 C  C   . HIS A 1 221 ? -17.758 51.090 -12.129 1.00 105.82 ? 221  HIS A C   1 
ATOM   1585 O  O   . HIS A 1 221 ? -17.665 50.037 -11.493 1.00 107.60 ? 221  HIS A O   1 
ATOM   1586 C  CB  . HIS A 1 221 ? -15.501 51.554 -13.129 1.00 111.12 ? 221  HIS A CB  1 
ATOM   1587 C  CG  . HIS A 1 221 ? -14.631 51.561 -14.348 1.00 117.39 ? 221  HIS A CG  1 
ATOM   1588 N  ND1 . HIS A 1 221 ? -13.845 52.640 -14.695 1.00 118.21 ? 221  HIS A ND1 1 
ATOM   1589 C  CD2 . HIS A 1 221 ? -14.440 50.627 -15.308 1.00 119.62 ? 221  HIS A CD2 1 
ATOM   1590 C  CE1 . HIS A 1 221 ? -13.198 52.365 -15.813 1.00 120.23 ? 221  HIS A CE1 1 
ATOM   1591 N  NE2 . HIS A 1 221 ? -13.543 51.152 -16.208 1.00 122.13 ? 221  HIS A NE2 1 
ATOM   1592 N  N   . SER A 1 222 ? -18.533 52.103 -11.750 1.00 97.17  ? 222  SER A N   1 
ATOM   1593 C  CA  . SER A 1 222 ? -19.250 52.116 -10.482 1.00 85.89  ? 222  SER A CA  1 
ATOM   1594 C  C   . SER A 1 222 ? -20.319 51.048 -10.380 1.00 89.40  ? 222  SER A C   1 
ATOM   1595 O  O   . SER A 1 222 ? -21.086 50.840 -11.317 1.00 93.10  ? 222  SER A O   1 
ATOM   1596 C  CB  . SER A 1 222 ? -19.906 53.471 -10.269 1.00 80.91  ? 222  SER A CB  1 
ATOM   1597 O  OG  . SER A 1 222 ? -20.898 53.380 -9.264  1.00 80.96  ? 222  SER A OG  1 
ATOM   1598 N  N   . PRO A 1 223 ? -20.379 50.373 -9.226  1.00 91.56  ? 223  PRO A N   1 
ATOM   1599 C  CA  . PRO A 1 223 ? -21.417 49.383 -8.928  1.00 90.97  ? 223  PRO A CA  1 
ATOM   1600 C  C   . PRO A 1 223 ? -22.804 49.970 -9.114  1.00 91.80  ? 223  PRO A C   1 
ATOM   1601 O  O   . PRO A 1 223 ? -23.706 49.270 -9.569  1.00 97.69  ? 223  PRO A O   1 
ATOM   1602 C  CB  . PRO A 1 223 ? -21.190 49.078 -7.450  1.00 89.20  ? 223  PRO A CB  1 
ATOM   1603 C  CG  . PRO A 1 223 ? -19.743 49.314 -7.247  1.00 93.10  ? 223  PRO A CG  1 
ATOM   1604 C  CD  . PRO A 1 223 ? -19.369 50.455 -8.157  1.00 92.79  ? 223  PRO A CD  1 
ATOM   1605 N  N   . ILE A 1 224 ? -22.970 51.243 -8.768  1.00 89.21  ? 224  ILE A N   1 
ATOM   1606 C  CA  . ILE A 1 224 ? -24.280 51.883 -8.840  1.00 91.15  ? 224  ILE A CA  1 
ATOM   1607 C  C   . ILE A 1 224 ? -24.457 52.652 -10.138 1.00 93.01  ? 224  ILE A C   1 
ATOM   1608 O  O   . ILE A 1 224 ? -25.271 53.575 -10.213 1.00 90.19  ? 224  ILE A O   1 
ATOM   1609 C  CB  . ILE A 1 224 ? -24.525 52.857 -7.667  1.00 90.16  ? 224  ILE A CB  1 
ATOM   1610 C  CG1 . ILE A 1 224 ? -23.666 54.109 -7.819  1.00 90.47  ? 224  ILE A CG1 1 
ATOM   1611 C  CG2 . ILE A 1 224 ? -24.255 52.188 -6.330  1.00 87.96  ? 224  ILE A CG2 1 
ATOM   1612 C  CD1 . ILE A 1 224 ? -24.047 55.201 -6.872  1.00 88.02  ? 224  ILE A CD1 1 
ATOM   1613 N  N   . TYR A 1 225 ? -23.691 52.278 -11.158 1.00 98.50  ? 225  TYR A N   1 
ATOM   1614 C  CA  . TYR A 1 225 ? -23.797 52.936 -12.454 1.00 100.12 ? 225  TYR A CA  1 
ATOM   1615 C  C   . TYR A 1 225 ? -25.080 52.531 -13.159 1.00 99.39  ? 225  TYR A C   1 
ATOM   1616 O  O   . TYR A 1 225 ? -25.288 51.359 -13.456 1.00 97.37  ? 225  TYR A O   1 
ATOM   1617 C  CB  . TYR A 1 225 ? -22.598 52.608 -13.331 1.00 102.33 ? 225  TYR A CB  1 
ATOM   1618 C  CG  . TYR A 1 225 ? -22.672 53.262 -14.683 1.00 104.88 ? 225  TYR A CG  1 
ATOM   1619 C  CD1 . TYR A 1 225 ? -22.355 54.600 -14.843 1.00 106.87 ? 225  TYR A CD1 1 
ATOM   1620 C  CD2 . TYR A 1 225 ? -23.071 52.547 -15.799 1.00 107.85 ? 225  TYR A CD2 1 
ATOM   1621 C  CE1 . TYR A 1 225 ? -22.423 55.209 -16.082 1.00 110.17 ? 225  TYR A CE1 1 
ATOM   1622 C  CE2 . TYR A 1 225 ? -23.144 53.146 -17.044 1.00 111.51 ? 225  TYR A CE2 1 
ATOM   1623 C  CZ  . TYR A 1 225 ? -22.817 54.479 -17.182 1.00 111.50 ? 225  TYR A CZ  1 
ATOM   1624 O  OH  . TYR A 1 225 ? -22.884 55.082 -18.422 1.00 111.44 ? 225  TYR A OH  1 
ATOM   1625 N  N   . GLY A 1 226 ? -25.941 53.510 -13.416 1.00 101.14 ? 226  GLY A N   1 
ATOM   1626 C  CA  . GLY A 1 226 ? -27.238 53.249 -14.014 1.00 101.83 ? 226  GLY A CA  1 
ATOM   1627 C  C   . GLY A 1 226 ? -28.309 52.877 -13.001 1.00 99.63  ? 226  GLY A C   1 
ATOM   1628 O  O   . GLY A 1 226 ? -29.504 52.976 -13.281 1.00 96.30  ? 226  GLY A O   1 
ATOM   1629 N  N   . GLU A 1 227 ? -27.879 52.443 -11.821 1.00 100.38 ? 227  GLU A N   1 
ATOM   1630 C  CA  . GLU A 1 227 ? -28.804 52.088 -10.752 1.00 97.00  ? 227  GLU A CA  1 
ATOM   1631 C  C   . GLU A 1 227 ? -29.765 53.236 -10.440 1.00 90.32  ? 227  GLU A C   1 
ATOM   1632 O  O   . GLU A 1 227 ? -29.370 54.402 -10.393 1.00 86.70  ? 227  GLU A O   1 
ATOM   1633 C  CB  . GLU A 1 227 ? -28.030 51.700 -9.497  1.00 99.03  ? 227  GLU A CB  1 
ATOM   1634 C  CG  . GLU A 1 227 ? -28.640 50.547 -8.749  1.00 106.36 ? 227  GLU A CG  1 
ATOM   1635 C  CD  . GLU A 1 227 ? -28.377 49.225 -9.427  1.00 115.61 ? 227  GLU A CD  1 
ATOM   1636 O  OE1 . GLU A 1 227 ? -27.602 49.217 -10.412 1.00 117.55 ? 227  GLU A OE1 1 
ATOM   1637 O  OE2 . GLU A 1 227 ? -28.935 48.200 -8.970  1.00 119.04 ? 227  GLU A OE2 1 
ATOM   1638 N  N   . THR A 1 228 ? -31.031 52.896 -10.237 1.00 87.33  ? 228  THR A N   1 
ATOM   1639 C  CA  . THR A 1 228 ? -32.049 53.884 -9.925  1.00 87.12  ? 228  THR A CA  1 
ATOM   1640 C  C   . THR A 1 228 ? -32.495 53.650 -8.509  1.00 85.41  ? 228  THR A C   1 
ATOM   1641 O  O   . THR A 1 228 ? -31.994 52.752 -7.840  1.00 84.57  ? 228  THR A O   1 
ATOM   1642 C  CB  . THR A 1 228 ? -33.281 53.715 -10.809 1.00 90.03  ? 228  THR A CB  1 
ATOM   1643 O  OG1 . THR A 1 228 ? -33.942 52.486 -10.475 1.00 92.52  ? 228  THR A OG1 1 
ATOM   1644 C  CG2 . THR A 1 228 ? -32.880 53.692 -12.263 1.00 92.13  ? 228  THR A CG2 1 
ATOM   1645 N  N   . ASP A 1 229 ? -33.445 54.444 -8.042  1.00 82.82  ? 229  ASP A N   1 
ATOM   1646 C  CA  . ASP A 1 229 ? -33.989 54.141 -6.751  1.00 85.35  ? 229  ASP A CA  1 
ATOM   1647 C  C   . ASP A 1 229 ? -34.485 52.715 -6.802  1.00 91.30  ? 229  ASP A C   1 
ATOM   1648 O  O   . ASP A 1 229 ? -34.050 51.876 -6.021  1.00 98.11  ? 229  ASP A O   1 
ATOM   1649 C  CB  . ASP A 1 229 ? -35.138 55.055 -6.384  1.00 89.10  ? 229  ASP A CB  1 
ATOM   1650 C  CG  . ASP A 1 229 ? -35.675 54.744 -5.007  1.00 96.18  ? 229  ASP A CG  1 
ATOM   1651 O  OD1 . ASP A 1 229 ? -35.260 55.428 -4.046  1.00 100.36 ? 229  ASP A OD1 1 
ATOM   1652 O  OD2 . ASP A 1 229 ? -36.472 53.786 -4.880  1.00 95.47  ? 229  ASP A OD2 1 
ATOM   1653 N  N   . GLU A 1 230 ? -35.389 52.445 -7.738  1.00 90.33  ? 230  GLU A N   1 
ATOM   1654 C  CA  . GLU A 1 230 ? -35.982 51.120 -7.872  1.00 89.25  ? 230  GLU A CA  1 
ATOM   1655 C  C   . GLU A 1 230 ? -34.978 49.975 -7.862  1.00 88.43  ? 230  GLU A C   1 
ATOM   1656 O  O   . GLU A 1 230 ? -34.983 49.141 -6.958  1.00 88.04  ? 230  GLU A O   1 
ATOM   1657 C  CB  . GLU A 1 230 ? -36.782 51.012 -9.172  1.00 89.08  ? 230  GLU A CB  1 
ATOM   1658 N  N   . THR A 1 231 ? -34.106 49.951 -8.863  1.00 87.98  ? 231  THR A N   1 
ATOM   1659 C  CA  . THR A 1 231 ? -33.109 48.896 -9.000  1.00 88.62  ? 231  THR A CA  1 
ATOM   1660 C  C   . THR A 1 231 ? -32.277 48.784 -7.727  1.00 90.60  ? 231  THR A C   1 
ATOM   1661 O  O   . THR A 1 231 ? -31.808 47.704 -7.382  1.00 90.40  ? 231  THR A O   1 
ATOM   1662 C  CB  . THR A 1 231 ? -32.168 49.210 -10.163 1.00 86.77  ? 231  THR A CB  1 
ATOM   1663 O  OG1 . THR A 1 231 ? -31.422 50.394 -9.859  1.00 83.37  ? 231  THR A OG1 1 
ATOM   1664 C  CG2 . THR A 1 231 ? -32.967 49.449 -11.423 1.00 88.21  ? 231  THR A CG2 1 
ATOM   1665 N  N   . LEU A 1 232 ? -32.084 49.912 -7.046  1.00 91.02  ? 232  LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 232 ? -31.347 49.949 -5.787  1.00 85.76  ? 232  LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 232 ? -32.158 49.288 -4.705  1.00 88.89  ? 232  LEU A C   1 
ATOM   1668 O  O   . LEU A 1 232 ? -31.674 48.402 -4.010  1.00 89.47  ? 232  LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 232 ? -31.052 51.384 -5.370  1.00 76.13  ? 232  LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 232 ? -29.711 51.900 -5.869  1.00 73.45  ? 232  LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 232 ? -29.417 53.250 -5.267  1.00 70.97  ? 232  LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 232 ? -28.619 50.909 -5.516  1.00 75.07  ? 232  LEU A CD2 1 
ATOM   1673 N  N   . ARG A 1 233 ? -33.395 49.746 -4.563  1.00 92.27  ? 233  ARG A N   1 
ATOM   1674 C  CA  . ARG A 1 233 ? -34.336 49.171 -3.623  1.00 96.07  ? 233  ARG A CA  1 
ATOM   1675 C  C   . ARG A 1 233 ? -34.338 47.674 -3.801  1.00 99.45  ? 233  ARG A C   1 
ATOM   1676 O  O   . ARG A 1 233 ? -34.174 46.915 -2.853  1.00 95.48  ? 233  ARG A O   1 
ATOM   1677 C  CB  . ARG A 1 233 ? -35.730 49.716 -3.900  1.00 100.05 ? 233  ARG A CB  1 
ATOM   1678 C  CG  . ARG A 1 233 ? -35.887 51.179 -3.570  1.00 107.33 ? 233  ARG A CG  1 
ATOM   1679 C  CD  . ARG A 1 233 ? -36.247 51.334 -2.110  1.00 118.30 ? 233  ARG A CD  1 
ATOM   1680 N  NE  . ARG A 1 233 ? -36.079 52.697 -1.615  1.00 124.57 ? 233  ARG A NE  1 
ATOM   1681 C  CZ  . ARG A 1 233 ? -36.956 53.676 -1.805  1.00 128.69 ? 233  ARG A CZ  1 
ATOM   1682 N  NH1 . ARG A 1 233 ? -38.063 53.449 -2.502  1.00 131.09 ? 233  ARG A NH1 1 
ATOM   1683 N  NH2 . ARG A 1 233 ? -36.721 54.885 -1.308  1.00 129.08 ? 233  ARG A NH2 1 
ATOM   1684 N  N   . ASN A 1 234 ? -34.508 47.260 -5.046  1.00 107.18 ? 234  ASN A N   1 
ATOM   1685 C  CA  . ASN A 1 234 ? -34.627 45.850 -5.386  1.00 112.89 ? 234  ASN A CA  1 
ATOM   1686 C  C   . ASN A 1 234 ? -33.356 45.066 -5.089  1.00 108.37 ? 234  ASN A C   1 
ATOM   1687 O  O   . ASN A 1 234 ? -33.422 43.935 -4.620  1.00 109.36 ? 234  ASN A O   1 
ATOM   1688 C  CB  . ASN A 1 234 ? -35.015 45.699 -6.859  1.00 119.01 ? 234  ASN A CB  1 
ATOM   1689 C  CG  . ASN A 1 234 ? -36.188 46.586 -7.241  1.00 121.30 ? 234  ASN A CG  1 
ATOM   1690 O  OD1 . ASN A 1 234 ? -37.033 46.911 -6.401  1.00 121.31 ? 234  ASN A OD1 1 
ATOM   1691 N  ND2 . ASN A 1 234 ? -36.242 46.988 -8.510  1.00 120.91 ? 234  ASN A ND2 1 
ATOM   1692 N  N   . SER A 1 235 ? -32.203 45.662 -5.369  1.00 103.94 ? 235  SER A N   1 
ATOM   1693 C  CA  . SER A 1 235 ? -30.933 45.021 -5.061  1.00 105.53 ? 235  SER A CA  1 
ATOM   1694 C  C   . SER A 1 235 ? -30.744 45.029 -3.555  1.00 104.80 ? 235  SER A C   1 
ATOM   1695 O  O   . SER A 1 235 ? -29.734 44.553 -3.038  1.00 104.59 ? 235  SER A O   1 
ATOM   1696 C  CB  . SER A 1 235 ? -29.770 45.731 -5.765  1.00 111.76 ? 235  SER A CB  1 
ATOM   1697 O  OG  . SER A 1 235 ? -29.813 47.139 -5.579  1.00 113.52 ? 235  SER A OG  1 
ATOM   1698 N  N   . HIS A 1 236 ? -31.744 45.568 -2.859  1.00 106.58 ? 236  HIS A N   1 
ATOM   1699 C  CA  . HIS A 1 236 ? -31.725 45.687 -1.403  1.00 108.51 ? 236  HIS A CA  1 
ATOM   1700 C  C   . HIS A 1 236 ? -30.454 46.348 -0.908  1.00 103.37 ? 236  HIS A C   1 
ATOM   1701 O  O   . HIS A 1 236 ? -29.900 45.938 0.103   1.00 103.49 ? 236  HIS A O   1 
ATOM   1702 C  CB  . HIS A 1 236 ? -31.876 44.321 -0.744  1.00 119.36 ? 236  HIS A CB  1 
ATOM   1703 C  CG  . HIS A 1 236 ? -33.295 43.860 -0.634  1.00 134.52 ? 236  HIS A CG  1 
ATOM   1704 N  ND1 . HIS A 1 236 ? -33.841 42.919 -1.480  1.00 142.53 ? 236  HIS A ND1 1 
ATOM   1705 C  CD2 . HIS A 1 236 ? -34.284 44.217 0.221   1.00 139.22 ? 236  HIS A CD2 1 
ATOM   1706 C  CE1 . HIS A 1 236 ? -35.105 42.712 -1.150  1.00 144.63 ? 236  HIS A CE1 1 
ATOM   1707 N  NE2 . HIS A 1 236 ? -35.398 43.486 -0.121  1.00 143.48 ? 236  HIS A NE2 1 
ATOM   1708 N  N   . SER A 1 237 ? -30.009 47.381 -1.614  1.00 96.28  ? 237  SER A N   1 
ATOM   1709 C  CA  . SER A 1 237 ? -28.716 47.987 -1.349  1.00 87.01  ? 237  SER A CA  1 
ATOM   1710 C  C   . SER A 1 237 ? -28.705 48.920 -0.138  1.00 86.66  ? 237  SER A C   1 
ATOM   1711 O  O   . SER A 1 237 ? -29.617 49.724 0.050   1.00 88.61  ? 237  SER A O   1 
ATOM   1712 C  CB  . SER A 1 237 ? -28.235 48.728 -2.593  1.00 79.09  ? 237  SER A CB  1 
ATOM   1713 O  OG  . SER A 1 237 ? -28.345 47.899 -3.732  1.00 75.70  ? 237  SER A OG  1 
ATOM   1714 N  N   . GLU A 1 238 ? -27.658 48.790 0.677   1.00 85.30  ? 238  GLU A N   1 
ATOM   1715 C  CA  . GLU A 1 238 ? -27.364 49.706 1.776   1.00 81.86  ? 238  GLU A CA  1 
ATOM   1716 C  C   . GLU A 1 238 ? -25.945 50.218 1.629   1.00 84.28  ? 238  GLU A C   1 
ATOM   1717 O  O   . GLU A 1 238 ? -25.125 49.600 0.945   1.00 89.39  ? 238  GLU A O   1 
ATOM   1718 C  CB  . GLU A 1 238 ? -27.451 48.992 3.113   1.00 81.54  ? 238  GLU A CB  1 
ATOM   1719 C  CG  . GLU A 1 238 ? -28.735 48.250 3.328   1.00 89.35  ? 238  GLU A CG  1 
ATOM   1720 C  CD  . GLU A 1 238 ? -28.887 47.791 4.760   1.00 98.29  ? 238  GLU A CD  1 
ATOM   1721 O  OE1 . GLU A 1 238 ? -28.275 48.426 5.646   1.00 101.19 ? 238  GLU A OE1 1 
ATOM   1722 O  OE2 . GLU A 1 238 ? -29.618 46.804 5.000   1.00 102.15 ? 238  GLU A OE2 1 
ATOM   1723 N  N   . PHE A 1 239 ? -25.648 51.334 2.288   1.00 80.52  ? 239  PHE A N   1 
ATOM   1724 C  CA  . PHE A 1 239 ? -24.306 51.908 2.247   1.00 77.23  ? 239  PHE A CA  1 
ATOM   1725 C  C   . PHE A 1 239 ? -23.757 52.114 3.643   1.00 81.62  ? 239  PHE A C   1 
ATOM   1726 O  O   . PHE A 1 239 ? -24.488 52.415 4.580   1.00 84.15  ? 239  PHE A O   1 
ATOM   1727 C  CB  . PHE A 1 239 ? -24.303 53.215 1.474   1.00 70.56  ? 239  PHE A CB  1 
ATOM   1728 C  CG  . PHE A 1 239 ? -24.912 53.098 0.118   1.00 75.54  ? 239  PHE A CG  1 
ATOM   1729 C  CD1 . PHE A 1 239 ? -26.288 53.041 -0.030  1.00 79.00  ? 239  PHE A CD1 1 
ATOM   1730 C  CD2 . PHE A 1 239 ? -24.114 53.024 -1.011  1.00 78.18  ? 239  PHE A CD2 1 
ATOM   1731 C  CE1 . PHE A 1 239 ? -26.856 52.921 -1.275  1.00 82.58  ? 239  PHE A CE1 1 
ATOM   1732 C  CE2 . PHE A 1 239 ? -24.673 52.913 -2.261  1.00 78.99  ? 239  PHE A CE2 1 
ATOM   1733 C  CZ  . PHE A 1 239 ? -26.047 52.860 -2.394  1.00 83.28  ? 239  PHE A CZ  1 
ATOM   1734 N  N   . LEU A 1 240 ? -22.454 51.945 3.779   1.00 80.58  ? 240  LEU A N   1 
ATOM   1735 C  CA  . LEU A 1 240 ? -21.843 51.946 5.088   1.00 75.80  ? 240  LEU A CA  1 
ATOM   1736 C  C   . LEU A 1 240 ? -20.615 52.835 5.075   1.00 74.88  ? 240  LEU A C   1 
ATOM   1737 O  O   . LEU A 1 240 ? -19.709 52.661 4.261   1.00 73.16  ? 240  LEU A O   1 
ATOM   1738 C  CB  . LEU A 1 240 ? -21.469 50.516 5.477   1.00 77.05  ? 240  LEU A CB  1 
ATOM   1739 C  CG  . LEU A 1 240 ? -20.726 50.282 6.793   1.00 79.33  ? 240  LEU A CG  1 
ATOM   1740 C  CD1 . LEU A 1 240 ? -21.589 50.610 8.006   1.00 82.11  ? 240  LEU A CD1 1 
ATOM   1741 C  CD2 . LEU A 1 240 ? -20.237 48.855 6.859   1.00 75.20  ? 240  LEU A CD2 1 
ATOM   1742 N  N   . VAL A 1 241 ? -20.595 53.798 5.982   1.00 75.78  ? 241  VAL A N   1 
ATOM   1743 C  CA  . VAL A 1 241 ? -19.454 54.680 6.104   1.00 77.62  ? 241  VAL A CA  1 
ATOM   1744 C  C   . VAL A 1 241 ? -18.481 54.215 7.181   1.00 76.87  ? 241  VAL A C   1 
ATOM   1745 O  O   . VAL A 1 241 ? -18.824 54.087 8.361   1.00 77.51  ? 241  VAL A O   1 
ATOM   1746 C  CB  . VAL A 1 241 ? -19.888 56.108 6.403   1.00 80.03  ? 241  VAL A CB  1 
ATOM   1747 C  CG1 . VAL A 1 241 ? -18.666 56.979 6.622   1.00 81.70  ? 241  VAL A CG1 1 
ATOM   1748 C  CG2 . VAL A 1 241 ? -20.744 56.634 5.261   1.00 80.29  ? 241  VAL A CG2 1 
ATOM   1749 N  N   . LEU A 1 242 ? -17.253 53.965 6.761   1.00 73.93  ? 242  LEU A N   1 
ATOM   1750 C  CA  . LEU A 1 242 ? -16.223 53.578 7.691   1.00 76.30  ? 242  LEU A CA  1 
ATOM   1751 C  C   . LEU A 1 242 ? -15.209 54.700 7.814   1.00 73.47  ? 242  LEU A C   1 
ATOM   1752 O  O   . LEU A 1 242 ? -14.382 54.914 6.934   1.00 74.12  ? 242  LEU A O   1 
ATOM   1753 C  CB  . LEU A 1 242 ? -15.582 52.287 7.214   1.00 82.72  ? 242  LEU A CB  1 
ATOM   1754 C  CG  . LEU A 1 242 ? -16.689 51.274 6.893   1.00 82.58  ? 242  LEU A CG  1 
ATOM   1755 C  CD1 . LEU A 1 242 ? -16.180 50.108 6.066   1.00 81.19  ? 242  LEU A CD1 1 
ATOM   1756 C  CD2 . LEU A 1 242 ? -17.368 50.784 8.169   1.00 82.77  ? 242  LEU A CD2 1 
ATOM   1757 N  N   . PHE A 1 243 ? -15.309 55.438 8.907   1.00 70.32  ? 243  PHE A N   1 
ATOM   1758 C  CA  . PHE A 1 243 ? -14.373 56.505 9.178   1.00 69.56  ? 243  PHE A CA  1 
ATOM   1759 C  C   . PHE A 1 243 ? -13.370 56.104 10.234  1.00 73.08  ? 243  PHE A C   1 
ATOM   1760 O  O   . PHE A 1 243 ? -13.724 55.527 11.259  1.00 75.54  ? 243  PHE A O   1 
ATOM   1761 C  CB  . PHE A 1 243 ? -15.081 57.756 9.673   1.00 68.12  ? 243  PHE A CB  1 
ATOM   1762 C  CG  . PHE A 1 243 ? -14.134 58.793 10.188  1.00 66.67  ? 243  PHE A CG  1 
ATOM   1763 C  CD1 . PHE A 1 243 ? -13.735 59.842 9.387   1.00 61.53  ? 243  PHE A CD1 1 
ATOM   1764 C  CD2 . PHE A 1 243 ? -13.600 58.687 11.454  1.00 68.34  ? 243  PHE A CD2 1 
ATOM   1765 C  CE1 . PHE A 1 243 ? -12.843 60.780 9.849   1.00 63.84  ? 243  PHE A CE1 1 
ATOM   1766 C  CE2 . PHE A 1 243 ? -12.707 59.624 11.916  1.00 69.87  ? 243  PHE A CE2 1 
ATOM   1767 C  CZ  . PHE A 1 243 ? -12.328 60.675 11.112  1.00 67.24  ? 243  PHE A CZ  1 
ATOM   1768 N  N   . THR A 1 244 ? -12.119 56.461 10.003  1.00 76.44  ? 244  THR A N   1 
ATOM   1769 C  CA  . THR A 1 244 ? -11.064 56.177 10.954  1.00 82.72  ? 244  THR A CA  1 
ATOM   1770 C  C   . THR A 1 244 ? -10.014 57.255 10.845  1.00 82.67  ? 244  THR A C   1 
ATOM   1771 O  O   . THR A 1 244 ? -9.866  57.893 9.803   1.00 82.80  ? 244  THR A O   1 
ATOM   1772 C  CB  . THR A 1 244 ? -10.397 54.820 10.674  1.00 90.10  ? 244  THR A CB  1 
ATOM   1773 O  OG1 . THR A 1 244 ? -9.992  54.754 9.299   1.00 89.24  ? 244  THR A OG1 1 
ATOM   1774 C  CG2 . THR A 1 244 ? -11.363 53.677 10.961  1.00 96.19  ? 244  THR A CG2 1 
ATOM   1775 N  N   . GLY A 1 245 ? -9.276  57.451 11.923  1.00 82.97  ? 245  GLY A N   1 
ATOM   1776 C  CA  . GLY A 1 245 ? -8.255  58.472 11.947  1.00 85.66  ? 245  GLY A CA  1 
ATOM   1777 C  C   . GLY A 1 245 ? -7.716  58.666 13.344  1.00 92.23  ? 245  GLY A C   1 
ATOM   1778 O  O   . GLY A 1 245 ? -8.305  58.204 14.320  1.00 92.45  ? 245  GLY A O   1 
ATOM   1779 N  N   . HIS A 1 246 ? -6.594  59.374 13.424  1.00 96.79  ? 246  HIS A N   1 
ATOM   1780 C  CA  . HIS A 1 246 ? -5.838  59.562 14.654  1.00 94.55  ? 246  HIS A CA  1 
ATOM   1781 C  C   . HIS A 1 246 ? -6.198  60.900 15.300  1.00 89.62  ? 246  HIS A C   1 
ATOM   1782 O  O   . HIS A 1 246 ? -5.823  61.954 14.792  1.00 88.10  ? 246  HIS A O   1 
ATOM   1783 C  CB  . HIS A 1 246 ? -4.352  59.510 14.298  1.00 98.11  ? 246  HIS A CB  1 
ATOM   1784 C  CG  . HIS A 1 246 ? -3.435  59.740 15.455  1.00 107.02 ? 246  HIS A CG  1 
ATOM   1785 N  ND1 . HIS A 1 246 ? -3.350  60.950 16.106  1.00 112.67 ? 246  HIS A ND1 1 
ATOM   1786 C  CD2 . HIS A 1 246 ? -2.544  58.921 16.061  1.00 111.22 ? 246  HIS A CD2 1 
ATOM   1787 C  CE1 . HIS A 1 246 ? -2.454  60.863 17.075  1.00 116.02 ? 246  HIS A CE1 1 
ATOM   1788 N  NE2 . HIS A 1 246 ? -1.953  59.642 17.069  1.00 114.88 ? 246  HIS A NE2 1 
ATOM   1789 N  N   . HIS A 1 247 ? -6.936  60.869 16.407  1.00 88.55  ? 247  HIS A N   1 
ATOM   1790 C  CA  . HIS A 1 247 ? -7.367  62.113 17.050  1.00 89.91  ? 247  HIS A CA  1 
ATOM   1791 C  C   . HIS A 1 247 ? -6.189  62.839 17.692  1.00 93.56  ? 247  HIS A C   1 
ATOM   1792 O  O   . HIS A 1 247 ? -5.430  62.268 18.462  1.00 92.59  ? 247  HIS A O   1 
ATOM   1793 C  CB  . HIS A 1 247 ? -8.486  61.875 18.076  1.00 89.96  ? 247  HIS A CB  1 
ATOM   1794 C  CG  . HIS A 1 247 ? -9.517  62.964 18.116  1.00 96.84  ? 247  HIS A CG  1 
ATOM   1795 N  ND1 . HIS A 1 247 ? -9.270  64.210 18.651  1.00 102.12 ? 247  HIS A ND1 1 
ATOM   1796 C  CD2 . HIS A 1 247 ? -10.805 62.990 17.690  1.00 99.31  ? 247  HIS A CD2 1 
ATOM   1797 C  CE1 . HIS A 1 247 ? -10.357 64.957 18.550  1.00 102.27 ? 247  HIS A CE1 1 
ATOM   1798 N  NE2 . HIS A 1 247 ? -11.305 64.240 17.971  1.00 98.93  ? 247  HIS A NE2 1 
ATOM   1799 N  N   . GLU A 1 248 ? -6.045  64.109 17.352  1.00 96.60  ? 248  GLU A N   1 
ATOM   1800 C  CA  . GLU A 1 248 ? -4.975  64.937 17.874  1.00 98.63  ? 248  GLU A CA  1 
ATOM   1801 C  C   . GLU A 1 248 ? -5.159  65.092 19.372  1.00 102.20 ? 248  GLU A C   1 
ATOM   1802 O  O   . GLU A 1 248 ? -4.184  65.123 20.127  1.00 106.07 ? 248  GLU A O   1 
ATOM   1803 C  CB  . GLU A 1 248 ? -5.032  66.307 17.200  1.00 97.82  ? 248  GLU A CB  1 
ATOM   1804 C  CG  . GLU A 1 248 ? -3.825  67.189 17.381  1.00 97.11  ? 248  GLU A CG  1 
ATOM   1805 C  CD  . GLU A 1 248 ? -4.094  68.619 16.937  1.00 100.69 ? 248  GLU A CD  1 
ATOM   1806 O  OE1 . GLU A 1 248 ? -5.186  68.896 16.383  1.00 93.32  ? 248  GLU A OE1 1 
ATOM   1807 O  OE2 . GLU A 1 248 ? -3.209  69.473 17.153  1.00 110.43 ? 248  GLU A OE2 1 
ATOM   1808 N  N   . ALA A 1 249 ? -6.420  65.180 19.793  1.00 102.20 ? 249  ALA A N   1 
ATOM   1809 C  CA  . ALA A 1 249 ? -6.768  65.414 21.193  1.00 103.53 ? 249  ALA A CA  1 
ATOM   1810 C  C   . ALA A 1 249 ? -6.258  64.308 22.119  1.00 108.30 ? 249  ALA A C   1 
ATOM   1811 O  O   . ALA A 1 249 ? -5.591  64.578 23.126  1.00 109.78 ? 249  ALA A O   1 
ATOM   1812 C  CB  . ALA A 1 249 ? -8.281  65.583 21.345  1.00 97.65  ? 249  ALA A CB  1 
ATOM   1813 N  N   . PHE A 1 250 ? -6.568  63.063 21.772  1.00 109.20 ? 250  PHE A N   1 
ATOM   1814 C  CA  . PHE A 1 250 ? -6.178  61.924 22.598  1.00 108.13 ? 250  PHE A CA  1 
ATOM   1815 C  C   . PHE A 1 250 ? -4.764  61.449 22.284  1.00 100.23 ? 250  PHE A C   1 
ATOM   1816 O  O   . PHE A 1 250 ? -4.195  60.665 23.031  1.00 95.50  ? 250  PHE A O   1 
ATOM   1817 C  CB  . PHE A 1 250 ? -7.162  60.762 22.416  1.00 109.31 ? 250  PHE A CB  1 
ATOM   1818 C  CG  . PHE A 1 250 ? -8.603  61.153 22.591  1.00 106.18 ? 250  PHE A CG  1 
ATOM   1819 C  CD1 . PHE A 1 250 ? -9.493  61.054 21.538  1.00 104.53 ? 250  PHE A CD1 1 
ATOM   1820 C  CD2 . PHE A 1 250 ? -9.063  61.630 23.805  1.00 106.94 ? 250  PHE A CD2 1 
ATOM   1821 C  CE1 . PHE A 1 250 ? -10.820 61.416 21.694  1.00 105.12 ? 250  PHE A CE1 1 
ATOM   1822 C  CE2 . PHE A 1 250 ? -10.387 61.996 23.967  1.00 107.88 ? 250  PHE A CE2 1 
ATOM   1823 C  CZ  . PHE A 1 250 ? -11.267 61.888 22.910  1.00 106.64 ? 250  PHE A CZ  1 
ATOM   1824 N  N   . ALA A 1 251 ? -4.211  61.936 21.178  1.00 101.72 ? 251  ALA A N   1 
ATOM   1825 C  CA  . ALA A 1 251 ? -2.935  61.447 20.660  1.00 107.18 ? 251  ALA A CA  1 
ATOM   1826 C  C   . ALA A 1 251 ? -3.020  59.946 20.391  1.00 109.69 ? 251  ALA A C   1 
ATOM   1827 O  O   . ALA A 1 251 ? -2.148  59.176 20.795  1.00 106.29 ? 251  ALA A O   1 
ATOM   1828 C  CB  . ALA A 1 251 ? -1.807  61.764 21.622  1.00 110.72 ? 251  ALA A CB  1 
ATOM   1829 N  N   . GLN A 1 252 ? -4.066  59.551 19.668  1.00 115.87 ? 252  GLN A N   1 
ATOM   1830 C  CA  . GLN A 1 252 ? -4.506  58.163 19.625  1.00 119.39 ? 252  GLN A CA  1 
ATOM   1831 C  C   . GLN A 1 252 ? -5.469  57.952 18.459  1.00 114.59 ? 252  GLN A C   1 
ATOM   1832 O  O   . GLN A 1 252 ? -5.964  58.921 17.883  1.00 112.56 ? 252  GLN A O   1 
ATOM   1833 C  CB  . GLN A 1 252 ? -5.219  57.869 20.939  1.00 125.03 ? 252  GLN A CB  1 
ATOM   1834 C  CG  . GLN A 1 252 ? -5.501  56.422 21.230  1.00 129.62 ? 252  GLN A CG  1 
ATOM   1835 C  CD  . GLN A 1 252 ? -6.064  56.254 22.622  1.00 133.52 ? 252  GLN A CD  1 
ATOM   1836 O  OE1 . GLN A 1 252 ? -5.904  57.132 23.476  1.00 131.21 ? 252  GLN A OE1 1 
ATOM   1837 N  NE2 . GLN A 1 252 ? -6.734  55.131 22.862  1.00 138.21 ? 252  GLN A NE2 1 
ATOM   1838 N  N   . ASN A 1 253 ? -5.743  56.694 18.116  1.00 112.58 ? 253  ASN A N   1 
ATOM   1839 C  CA  . ASN A 1 253 ? -6.676  56.386 17.024  1.00 109.87 ? 253  ASN A CA  1 
ATOM   1840 C  C   . ASN A 1 253 ? -8.159  56.390 17.438  1.00 110.21 ? 253  ASN A C   1 
ATOM   1841 O  O   . ASN A 1 253 ? -8.489  56.123 18.594  1.00 113.22 ? 253  ASN A O   1 
ATOM   1842 C  CB  . ASN A 1 253 ? -6.308  55.059 16.346  1.00 108.14 ? 253  ASN A CB  1 
ATOM   1843 C  CG  . ASN A 1 253 ? -5.183  55.210 15.326  1.00 109.13 ? 253  ASN A CG  1 
ATOM   1844 O  OD1 . ASN A 1 253 ? -4.929  56.303 14.816  1.00 108.44 ? 253  ASN A OD1 1 
ATOM   1845 N  ND2 . ASN A 1 253 ? -4.514  54.104 15.016  1.00 110.21 ? 253  ASN A ND2 1 
ATOM   1846 N  N   . VAL A 1 254 ? -9.042  56.709 16.488  1.00 104.99 ? 254  VAL A N   1 
ATOM   1847 C  CA  . VAL A 1 254 ? -10.489 56.724 16.720  1.00 94.53  ? 254  VAL A CA  1 
ATOM   1848 C  C   . VAL A 1 254 ? -11.233 56.323 15.461  1.00 93.73  ? 254  VAL A C   1 
ATOM   1849 O  O   . VAL A 1 254 ? -10.721 56.483 14.353  1.00 90.13  ? 254  VAL A O   1 
ATOM   1850 C  CB  . VAL A 1 254 ? -10.983 58.112 17.112  1.00 83.52  ? 254  VAL A CB  1 
ATOM   1851 C  CG1 . VAL A 1 254 ? -10.418 58.503 18.451  1.00 88.88  ? 254  VAL A CG1 1 
ATOM   1852 C  CG2 . VAL A 1 254 ? -10.594 59.118 16.057  1.00 72.93  ? 254  VAL A CG2 1 
ATOM   1853 N  N   . HIS A 1 255 ? -12.446 55.808 15.624  1.00 98.21  ? 255  HIS A N   1 
ATOM   1854 C  CA  . HIS A 1 255 ? -13.257 55.474 14.461  1.00 104.26 ? 255  HIS A CA  1 
ATOM   1855 C  C   . HIS A 1 255 ? -14.745 55.701 14.685  1.00 100.63 ? 255  HIS A C   1 
ATOM   1856 O  O   . HIS A 1 255 ? -15.178 56.074 15.783  1.00 101.36 ? 255  HIS A O   1 
ATOM   1857 C  CB  . HIS A 1 255 ? -13.011 54.037 14.030  1.00 114.32 ? 255  HIS A CB  1 
ATOM   1858 C  CG  . HIS A 1 255 ? -13.341 53.035 15.085  1.00 128.75 ? 255  HIS A CG  1 
ATOM   1859 N  ND1 . HIS A 1 255 ? -12.447 52.668 16.068  1.00 135.32 ? 255  HIS A ND1 1 
ATOM   1860 C  CD2 . HIS A 1 255 ? -14.472 52.326 15.319  1.00 136.36 ? 255  HIS A CD2 1 
ATOM   1861 C  CE1 . HIS A 1 255 ? -13.009 51.771 16.859  1.00 141.41 ? 255  HIS A CE1 1 
ATOM   1862 N  NE2 . HIS A 1 255 ? -14.238 51.547 16.426  1.00 142.44 ? 255  HIS A NE2 1 
ATOM   1863 N  N   . ALA A 1 256 ? -15.515 55.465 13.627  1.00 93.24  ? 256  ALA A N   1 
ATOM   1864 C  CA  . ALA A 1 256 ? -16.943 55.721 13.636  1.00 88.90  ? 256  ALA A CA  1 
ATOM   1865 C  C   . ALA A 1 256 ? -17.609 55.079 12.427  1.00 89.34  ? 256  ALA A C   1 
ATOM   1866 O  O   . ALA A 1 256 ? -17.098 55.156 11.311  1.00 89.56  ? 256  ALA A O   1 
ATOM   1867 C  CB  . ALA A 1 256 ? -17.195 57.209 13.635  1.00 86.84  ? 256  ALA A CB  1 
ATOM   1868 N  N   . ARG A 1 257 ? -18.754 54.445 12.651  1.00 88.84  ? 257  ARG A N   1 
ATOM   1869 C  CA  . ARG A 1 257 ? -19.535 53.883 11.555  1.00 82.85  ? 257  ARG A CA  1 
ATOM   1870 C  C   . ARG A 1 257 ? -20.910 54.520 11.446  1.00 81.84  ? 257  ARG A C   1 
ATOM   1871 O  O   . ARG A 1 257 ? -21.445 55.093 12.401  1.00 85.29  ? 257  ARG A O   1 
ATOM   1872 C  CB  . ARG A 1 257 ? -19.717 52.383 11.719  1.00 82.45  ? 257  ARG A CB  1 
ATOM   1873 C  CG  . ARG A 1 257 ? -18.441 51.613 11.908  1.00 89.74  ? 257  ARG A CG  1 
ATOM   1874 C  CD  . ARG A 1 257 ? -18.708 50.143 11.704  1.00 92.17  ? 257  ARG A CD  1 
ATOM   1875 N  NE  . ARG A 1 257 ? -18.317 49.333 12.848  1.00 92.39  ? 257  ARG A NE  1 
ATOM   1876 C  CZ  . ARG A 1 257 ? -19.079 49.139 13.914  1.00 97.69  ? 257  ARG A CZ  1 
ATOM   1877 N  NH1 . ARG A 1 257 ? -20.268 49.715 13.989  1.00 100.13 ? 257  ARG A NH1 1 
ATOM   1878 N  NH2 . ARG A 1 257 ? -18.649 48.375 14.906  1.00 102.77 ? 257  ARG A NH2 1 
ATOM   1879 N  N   . HIS A 1 258 ? -21.484 54.408 10.262  1.00 75.71  ? 258  HIS A N   1 
ATOM   1880 C  CA  . HIS A 1 258 ? -22.840 54.840 10.051  1.00 68.45  ? 258  HIS A CA  1 
ATOM   1881 C  C   . HIS A 1 258 ? -23.383 54.063 8.871   1.00 69.65  ? 258  HIS A C   1 
ATOM   1882 O  O   . HIS A 1 258 ? -22.619 53.565 8.049   1.00 69.77  ? 258  HIS A O   1 
ATOM   1883 C  CB  . HIS A 1 258 ? -22.889 56.336 9.775   1.00 64.40  ? 258  HIS A CB  1 
ATOM   1884 C  CG  . HIS A 1 258 ? -24.246 56.935 9.970   1.00 65.44  ? 258  HIS A CG  1 
ATOM   1885 N  ND1 . HIS A 1 258 ? -25.004 57.413 8.924   1.00 63.88  ? 258  HIS A ND1 1 
ATOM   1886 C  CD2 . HIS A 1 258 ? -24.984 57.118 11.090  1.00 66.20  ? 258  HIS A CD2 1 
ATOM   1887 C  CE1 . HIS A 1 258 ? -26.154 57.872 9.394   1.00 64.58  ? 258  HIS A CE1 1 
ATOM   1888 N  NE2 . HIS A 1 258 ? -26.166 57.703 10.702  1.00 64.89  ? 258  HIS A NE2 1 
ATOM   1889 N  N   . ALA A 1 259 ? -24.701 53.939 8.798   1.00 69.31  ? 259  ALA A N   1 
ATOM   1890 C  CA  . ALA A 1 259 ? -25.326 53.251 7.685   1.00 67.23  ? 259  ALA A CA  1 
ATOM   1891 C  C   . ALA A 1 259 ? -26.495 54.044 7.116   1.00 70.70  ? 259  ALA A C   1 
ATOM   1892 O  O   . ALA A 1 259 ? -27.258 54.677 7.850   1.00 72.57  ? 259  ALA A O   1 
ATOM   1893 C  CB  . ALA A 1 259 ? -25.752 51.874 8.090   1.00 64.79  ? 259  ALA A CB  1 
ATOM   1894 N  N   . TYR A 1 260 ? -26.638 53.943 5.801   1.00 74.25  ? 260  TYR A N   1 
ATOM   1895 C  CA  . TYR A 1 260 ? -27.685 54.608 5.054   1.00 77.09  ? 260  TYR A CA  1 
ATOM   1896 C  C   . TYR A 1 260 ? -28.465 53.565 4.272   1.00 80.66  ? 260  TYR A C   1 
ATOM   1897 O  O   . TYR A 1 260 ? -27.972 52.479 4.008   1.00 82.70  ? 260  TYR A O   1 
ATOM   1898 C  CB  . TYR A 1 260 ? -27.090 55.628 4.090   1.00 74.45  ? 260  TYR A CB  1 
ATOM   1899 C  CG  . TYR A 1 260 ? -26.289 56.718 4.751   1.00 70.82  ? 260  TYR A CG  1 
ATOM   1900 C  CD1 . TYR A 1 260 ? -24.922 56.792 4.586   1.00 71.35  ? 260  TYR A CD1 1 
ATOM   1901 C  CD2 . TYR A 1 260 ? -26.903 57.674 5.532   1.00 67.62  ? 260  TYR A CD2 1 
ATOM   1902 C  CE1 . TYR A 1 260 ? -24.193 57.779 5.183   1.00 70.28  ? 260  TYR A CE1 1 
ATOM   1903 C  CE2 . TYR A 1 260 ? -26.179 58.665 6.131   1.00 67.44  ? 260  TYR A CE2 1 
ATOM   1904 C  CZ  . TYR A 1 260 ? -24.827 58.712 5.953   1.00 69.93  ? 260  TYR A CZ  1 
ATOM   1905 O  OH  . TYR A 1 260 ? -24.103 59.704 6.550   1.00 70.84  ? 260  TYR A OH  1 
ATOM   1906 N  N   . SER A 1 261 ? -29.691 53.909 3.913   1.00 84.74  ? 261  SER A N   1 
ATOM   1907 C  CA  . SER A 1 261 ? -30.578 53.023 3.179   1.00 88.47  ? 261  SER A CA  1 
ATOM   1908 C  C   . SER A 1 261 ? -31.129 53.751 1.965   1.00 92.99  ? 261  SER A C   1 
ATOM   1909 O  O   . SER A 1 261 ? -30.937 54.949 1.815   1.00 100.48 ? 261  SER A O   1 
ATOM   1910 C  CB  . SER A 1 261 ? -31.710 52.529 4.070   1.00 90.84  ? 261  SER A CB  1 
ATOM   1911 O  OG  . SER A 1 261 ? -32.812 53.408 4.015   1.00 93.99  ? 261  SER A OG  1 
ATOM   1912 N  N   . CYS A 1 262 ? -31.811 53.026 1.093   1.00 91.14  ? 262  CYS A N   1 
ATOM   1913 C  CA  . CYS A 1 262 ? -32.353 53.617 -0.119  1.00 86.58  ? 262  CYS A CA  1 
ATOM   1914 C  C   . CYS A 1 262 ? -33.300 54.763 0.191   1.00 79.83  ? 262  CYS A C   1 
ATOM   1915 O  O   . CYS A 1 262 ? -33.355 55.734 -0.547  1.00 73.50  ? 262  CYS A O   1 
ATOM   1916 C  CB  . CYS A 1 262 ? -33.064 52.557 -0.949  1.00 87.45  ? 262  CYS A CB  1 
ATOM   1917 S  SG  . CYS A 1 262 ? -32.141 51.032 -1.086  1.00 103.55 ? 262  CYS A SG  1 
ATOM   1918 N  N   . ASP A 1 263 ? -34.053 54.649 1.273   1.00 80.19  ? 263  ASP A N   1 
ATOM   1919 C  CA  . ASP A 1 263 ? -34.991 55.695 1.650   1.00 86.39  ? 263  ASP A CA  1 
ATOM   1920 C  C   . ASP A 1 263 ? -34.273 57.012 1.919   1.00 85.57  ? 263  ASP A C   1 
ATOM   1921 O  O   . ASP A 1 263 ? -34.776 58.082 1.596   1.00 96.68  ? 263  ASP A O   1 
ATOM   1922 C  CB  . ASP A 1 263 ? -35.777 55.280 2.889   1.00 87.61  ? 263  ASP A CB  1 
ATOM   1923 C  CG  . ASP A 1 263 ? -36.254 53.852 2.818   1.00 90.96  ? 263  ASP A CG  1 
ATOM   1924 O  OD1 . ASP A 1 263 ? -36.207 53.161 3.851   1.00 91.79  ? 263  ASP A OD1 1 
ATOM   1925 O  OD2 . ASP A 1 263 ? -36.676 53.419 1.731   1.00 90.63  ? 263  ASP A OD2 1 
ATOM   1926 N  N   . GLU A 1 264 ? -33.104 56.917 2.530   1.00 73.57  ? 264  GLU A N   1 
ATOM   1927 C  CA  . GLU A 1 264 ? -32.271 58.067 2.881   1.00 77.22  ? 264  GLU A CA  1 
ATOM   1928 C  C   . GLU A 1 264 ? -31.684 58.943 1.759   1.00 79.62  ? 264  GLU A C   1 
ATOM   1929 O  O   . GLU A 1 264 ? -31.540 60.145 1.924   1.00 93.80  ? 264  GLU A O   1 
ATOM   1930 C  CB  . GLU A 1 264 ? -31.149 57.615 3.812   1.00 79.67  ? 264  GLU A CB  1 
ATOM   1931 C  CG  . GLU A 1 264 ? -31.546 57.594 5.274   1.00 85.61  ? 264  GLU A CG  1 
ATOM   1932 C  CD  . GLU A 1 264 ? -31.797 56.201 5.789   1.00 94.21  ? 264  GLU A CD  1 
ATOM   1933 O  OE1 . GLU A 1 264 ? -31.852 55.264 4.974   1.00 103.26 ? 264  GLU A OE1 1 
ATOM   1934 O  OE2 . GLU A 1 264 ? -31.938 56.041 7.013   1.00 96.71  ? 264  GLU A OE2 1 
ATOM   1935 N  N   . ILE A 1 265 ? -31.312 58.330 0.646   1.00 65.34  ? 265  ILE A N   1 
ATOM   1936 C  CA  . ILE A 1 265 ? -30.668 58.992 -0.473  1.00 58.97  ? 265  ILE A CA  1 
ATOM   1937 C  C   . ILE A 1 265 ? -31.615 59.992 -1.099  1.00 56.95  ? 265  ILE A C   1 
ATOM   1938 O  O   . ILE A 1 265 ? -32.636 59.616 -1.662  1.00 64.93  ? 265  ILE A O   1 
ATOM   1939 C  CB  . ILE A 1 265 ? -30.224 57.992 -1.529  1.00 58.86  ? 265  ILE A CB  1 
ATOM   1940 C  CG1 . ILE A 1 265 ? -29.310 56.936 -0.898  1.00 62.47  ? 265  ILE A CG1 1 
ATOM   1941 C  CG2 . ILE A 1 265 ? -29.541 58.712 -2.677  1.00 51.17  ? 265  ILE A CG2 1 
ATOM   1942 C  CD1 . ILE A 1 265 ? -29.331 55.592 -1.606  1.00 65.01  ? 265  ILE A CD1 1 
ATOM   1943 N  N   . ILE A 1 266 ? -31.301 61.272 -0.973  1.00 50.19  ? 266  ILE A N   1 
ATOM   1944 C  CA  . ILE A 1 266 ? -32.067 62.273 -1.682  1.00 56.75  ? 266  ILE A CA  1 
ATOM   1945 C  C   . ILE A 1 266 ? -31.448 62.423 -3.058  1.00 69.39  ? 266  ILE A C   1 
ATOM   1946 O  O   . ILE A 1 266 ? -30.292 62.837 -3.189  1.00 72.29  ? 266  ILE A O   1 
ATOM   1947 C  CB  . ILE A 1 266 ? -32.037 63.622 -0.988  1.00 58.54  ? 266  ILE A CB  1 
ATOM   1948 C  CG1 . ILE A 1 266 ? -33.121 63.712 0.091   1.00 53.41  ? 266  ILE A CG1 1 
ATOM   1949 C  CG2 . ILE A 1 266 ? -32.257 64.717 -2.014  1.00 63.08  ? 266  ILE A CG2 1 
ATOM   1950 C  CD1 . ILE A 1 266 ? -32.852 62.888 1.291   1.00 50.19  ? 266  ILE A CD1 1 
ATOM   1951 N  N   . TRP A 1 267 ? -32.209 62.060 -4.084  1.00 76.04  ? 267  TRP A N   1 
ATOM   1952 C  CA  . TRP A 1 267 ? -31.727 62.150 -5.456  1.00 74.92  ? 267  TRP A CA  1 
ATOM   1953 C  C   . TRP A 1 267 ? -31.847 63.579 -5.969  1.00 75.94  ? 267  TRP A C   1 
ATOM   1954 O  O   . TRP A 1 267 ? -32.921 64.195 -5.928  1.00 80.26  ? 267  TRP A O   1 
ATOM   1955 C  CB  . TRP A 1 267 ? -32.504 61.197 -6.353  1.00 76.00  ? 267  TRP A CB  1 
ATOM   1956 C  CG  . TRP A 1 267 ? -32.403 59.775 -5.936  1.00 77.59  ? 267  TRP A CG  1 
ATOM   1957 C  CD1 . TRP A 1 267 ? -33.034 59.188 -4.880  1.00 83.43  ? 267  TRP A CD1 1 
ATOM   1958 C  CD2 . TRP A 1 267 ? -31.632 58.747 -6.568  1.00 74.51  ? 267  TRP A CD2 1 
ATOM   1959 N  NE1 . TRP A 1 267 ? -32.694 57.854 -4.806  1.00 86.50  ? 267  TRP A NE1 1 
ATOM   1960 C  CE2 . TRP A 1 267 ? -31.837 57.559 -5.837  1.00 82.44  ? 267  TRP A CE2 1 
ATOM   1961 C  CE3 . TRP A 1 267 ? -30.783 58.716 -7.674  1.00 68.35  ? 267  TRP A CE3 1 
ATOM   1962 C  CZ2 . TRP A 1 267 ? -31.227 56.353 -6.181  1.00 80.38  ? 267  TRP A CZ2 1 
ATOM   1963 C  CZ3 . TRP A 1 267 ? -30.178 57.516 -8.015  1.00 69.54  ? 267  TRP A CZ3 1 
ATOM   1964 C  CH2 . TRP A 1 267 ? -30.404 56.353 -7.273  1.00 74.02  ? 267  TRP A CH2 1 
ATOM   1965 N  N   . GLY A 1 268 ? -30.734 64.107 -6.455  1.00 72.90  ? 268  GLY A N   1 
ATOM   1966 C  CA  . GLY A 1 268 ? -30.685 65.491 -6.877  1.00 71.24  ? 268  GLY A CA  1 
ATOM   1967 C  C   . GLY A 1 268 ? -30.471 66.379 -5.675  1.00 70.89  ? 268  GLY A C   1 
ATOM   1968 O  O   . GLY A 1 268 ? -30.674 67.585 -5.737  1.00 73.49  ? 268  GLY A O   1 
ATOM   1969 N  N   . GLY A 1 269 ? -30.063 65.767 -4.571  1.00 69.17  ? 269  GLY A N   1 
ATOM   1970 C  CA  . GLY A 1 269 ? -29.841 66.496 -3.345  1.00 69.05  ? 269  GLY A CA  1 
ATOM   1971 C  C   . GLY A 1 269 ? -28.538 67.244 -3.427  1.00 75.54  ? 269  GLY A C   1 
ATOM   1972 O  O   . GLY A 1 269 ? -27.618 66.813 -4.105  1.00 75.90  ? 269  GLY A O   1 
ATOM   1973 N  N   . HIS A 1 270 ? -28.471 68.383 -2.751  1.00 84.18  ? 270  HIS A N   1 
ATOM   1974 C  CA  . HIS A 1 270 ? -27.218 69.104 -2.586  1.00 87.08  ? 270  HIS A CA  1 
ATOM   1975 C  C   . HIS A 1 270 ? -27.067 69.521 -1.129  1.00 82.80  ? 270  HIS A C   1 
ATOM   1976 O  O   . HIS A 1 270 ? -27.911 70.229 -0.568  1.00 80.24  ? 270  HIS A O   1 
ATOM   1977 C  CB  . HIS A 1 270 ? -27.157 70.323 -3.507  1.00 93.32  ? 270  HIS A CB  1 
ATOM   1978 C  CG  . HIS A 1 270 ? -27.359 69.992 -4.951  1.00 104.00 ? 270  HIS A CG  1 
ATOM   1979 N  ND1 . HIS A 1 270 ? -28.493 70.351 -5.647  1.00 109.21 ? 270  HIS A ND1 1 
ATOM   1980 C  CD2 . HIS A 1 270 ? -26.576 69.317 -5.828  1.00 108.76 ? 270  HIS A CD2 1 
ATOM   1981 C  CE1 . HIS A 1 270 ? -28.397 69.923 -6.894  1.00 111.62 ? 270  HIS A CE1 1 
ATOM   1982 N  NE2 . HIS A 1 270 ? -27.244 69.291 -7.029  1.00 111.91 ? 270  HIS A NE2 1 
ATOM   1983 N  N   . PHE A 1 271 ? -26.002 69.057 -0.498  1.00 78.71  ? 271  PHE A N   1 
ATOM   1984 C  CA  . PHE A 1 271 ? -25.752 69.501 0.854   1.00 72.77  ? 271  PHE A CA  1 
ATOM   1985 C  C   . PHE A 1 271 ? -25.631 71.004 0.832   1.00 66.54  ? 271  PHE A C   1 
ATOM   1986 O  O   . PHE A 1 271 ? -25.254 71.584 -0.172  1.00 64.67  ? 271  PHE A O   1 
ATOM   1987 C  CB  . PHE A 1 271 ? -24.527 68.815 1.439   1.00 72.54  ? 271  PHE A CB  1 
ATOM   1988 C  CG  . PHE A 1 271 ? -24.772 67.382 1.769   1.00 76.08  ? 271  PHE A CG  1 
ATOM   1989 C  CD1 . PHE A 1 271 ? -24.185 66.375 1.032   1.00 81.00  ? 271  PHE A CD1 1 
ATOM   1990 C  CD2 . PHE A 1 271 ? -25.646 67.042 2.785   1.00 77.60  ? 271  PHE A CD2 1 
ATOM   1991 C  CE1 . PHE A 1 271 ? -24.434 65.045 1.331   1.00 82.63  ? 271  PHE A CE1 1 
ATOM   1992 C  CE2 . PHE A 1 271 ? -25.901 65.719 3.086   1.00 79.88  ? 271  PHE A CE2 1 
ATOM   1993 C  CZ  . PHE A 1 271 ? -25.291 64.718 2.358   1.00 80.78  ? 271  PHE A CZ  1 
ATOM   1994 N  N   . VAL A 1 272 ? -25.993 71.628 1.936   1.00 68.83  ? 272  VAL A N   1 
ATOM   1995 C  CA  . VAL A 1 272 ? -26.085 73.069 2.006   1.00 72.25  ? 272  VAL A CA  1 
ATOM   1996 C  C   . VAL A 1 272 ? -24.881 73.600 2.746   1.00 80.12  ? 272  VAL A C   1 
ATOM   1997 O  O   . VAL A 1 272 ? -24.505 73.046 3.771   1.00 86.17  ? 272  VAL A O   1 
ATOM   1998 C  CB  . VAL A 1 272 ? -27.370 73.459 2.740   1.00 70.68  ? 272  VAL A CB  1 
ATOM   1999 C  CG1 . VAL A 1 272 ? -27.190 74.755 3.487   1.00 72.15  ? 272  VAL A CG1 1 
ATOM   2000 C  CG2 . VAL A 1 272 ? -28.526 73.529 1.749   1.00 72.70  ? 272  VAL A CG2 1 
ATOM   2001 N  N   . ASP A 1 273 ? -24.267 74.666 2.235   1.00 83.05  ? 273  ASP A N   1 
ATOM   2002 C  CA  . ASP A 1 273 ? -23.041 75.189 2.849   1.00 88.26  ? 273  ASP A CA  1 
ATOM   2003 C  C   . ASP A 1 273 ? -23.185 75.499 4.344   1.00 83.43  ? 273  ASP A C   1 
ATOM   2004 O  O   . ASP A 1 273 ? -24.003 76.330 4.738   1.00 86.02  ? 273  ASP A O   1 
ATOM   2005 C  CB  . ASP A 1 273 ? -22.538 76.432 2.117   1.00 96.74  ? 273  ASP A CB  1 
ATOM   2006 C  CG  . ASP A 1 273 ? -21.085 76.757 2.453   1.00 99.25  ? 273  ASP A CG  1 
ATOM   2007 O  OD1 . ASP A 1 273 ? -20.291 75.815 2.665   1.00 101.01 ? 273  ASP A OD1 1 
ATOM   2008 O  OD2 . ASP A 1 273 ? -20.735 77.953 2.497   1.00 98.21  ? 273  ASP A OD2 1 
ATOM   2009 N  N   . VAL A 1 274 ? -22.363 74.835 5.155   1.00 75.06  ? 274  VAL A N   1 
ATOM   2010 C  CA  . VAL A 1 274 ? -22.413 74.948 6.606   1.00 71.10  ? 274  VAL A CA  1 
ATOM   2011 C  C   . VAL A 1 274 ? -21.528 76.065 7.125   1.00 77.74  ? 274  VAL A C   1 
ATOM   2012 O  O   . VAL A 1 274 ? -21.387 76.238 8.335   1.00 80.22  ? 274  VAL A O   1 
ATOM   2013 C  CB  . VAL A 1 274 ? -21.935 73.653 7.290   1.00 66.84  ? 274  VAL A CB  1 
ATOM   2014 C  CG1 . VAL A 1 274 ? -22.909 72.514 7.033   1.00 71.61  ? 274  VAL A CG1 1 
ATOM   2015 C  CG2 . VAL A 1 274 ? -20.522 73.290 6.833   1.00 57.31  ? 274  VAL A CG2 1 
ATOM   2016 N  N   . PHE A 1 275 ? -20.909 76.817 6.226   1.00 81.93  ? 275  PHE A N   1 
ATOM   2017 C  CA  . PHE A 1 275 ? -20.010 77.862 6.682   1.00 91.09  ? 275  PHE A CA  1 
ATOM   2018 C  C   . PHE A 1 275 ? -20.694 79.218 6.738   1.00 107.27 ? 275  PHE A C   1 
ATOM   2019 O  O   . PHE A 1 275 ? -21.304 79.667 5.766   1.00 112.48 ? 275  PHE A O   1 
ATOM   2020 C  CB  . PHE A 1 275 ? -18.739 77.881 5.848   1.00 89.52  ? 275  PHE A CB  1 
ATOM   2021 C  CG  . PHE A 1 275 ? -17.839 76.711 6.118   1.00 87.42  ? 275  PHE A CG  1 
ATOM   2022 C  CD1 . PHE A 1 275 ? -17.746 75.661 5.216   1.00 80.72  ? 275  PHE A CD1 1 
ATOM   2023 C  CD2 . PHE A 1 275 ? -17.107 76.648 7.294   1.00 89.11  ? 275  PHE A CD2 1 
ATOM   2024 C  CE1 . PHE A 1 275 ? -16.926 74.581 5.472   1.00 77.80  ? 275  PHE A CE1 1 
ATOM   2025 C  CE2 . PHE A 1 275 ? -16.285 75.570 7.555   1.00 86.74  ? 275  PHE A CE2 1 
ATOM   2026 C  CZ  . PHE A 1 275 ? -16.196 74.532 6.640   1.00 81.04  ? 275  PHE A CZ  1 
ATOM   2027 N  N   . THR A 1 276 ? -20.596 79.858 7.898   1.00 114.48 ? 276  THR A N   1 
ATOM   2028 C  CA  . THR A 1 276 ? -21.371 81.054 8.177   1.00 119.79 ? 276  THR A CA  1 
ATOM   2029 C  C   . THR A 1 276 ? -20.485 82.164 8.714   1.00 121.39 ? 276  THR A C   1 
ATOM   2030 O  O   . THR A 1 276 ? -19.505 81.900 9.412   1.00 120.14 ? 276  THR A O   1 
ATOM   2031 C  CB  . THR A 1 276 ? -22.488 80.756 9.205   1.00 122.78 ? 276  THR A CB  1 
ATOM   2032 O  OG1 . THR A 1 276 ? -23.255 79.623 8.775   1.00 118.25 ? 276  THR A OG1 1 
ATOM   2033 C  CG2 . THR A 1 276 ? -23.412 81.957 9.362   1.00 129.39 ? 276  THR A CG2 1 
ATOM   2034 N  N   . THR A 1 277 ? -20.839 83.404 8.381   1.00 124.11 ? 277  THR A N   1 
ATOM   2035 C  CA  . THR A 1 277 ? -20.147 84.578 8.908   1.00 125.85 ? 277  THR A CA  1 
ATOM   2036 C  C   . THR A 1 277 ? -20.822 85.123 10.171  1.00 126.96 ? 277  THR A C   1 
ATOM   2037 O  O   . THR A 1 277 ? -22.032 85.346 10.190  1.00 124.28 ? 277  THR A O   1 
ATOM   2038 C  CB  . THR A 1 277 ? -20.077 85.707 7.857   1.00 125.16 ? 277  THR A CB  1 
ATOM   2039 O  OG1 . THR A 1 277 ? -19.400 85.238 6.684   1.00 120.45 ? 277  THR A OG1 1 
ATOM   2040 C  CG2 . THR A 1 277 ? -19.336 86.906 8.417   1.00 129.06 ? 277  THR A CG2 1 
ATOM   2041 N  N   . LEU A 1 278 ? -20.029 85.305 11.214  1.00 133.09 ? 278  LEU A N   1 
ATOM   2042 C  CA  . LEU A 1 278 ? -20.523 85.813 12.478  1.00 141.88 ? 278  LEU A CA  1 
ATOM   2043 C  C   . LEU A 1 278 ? -20.789 87.307 12.377  1.00 151.88 ? 278  LEU A C   1 
ATOM   2044 O  O   . LEU A 1 278 ? -20.307 87.970 11.462  1.00 156.53 ? 278  LEU A O   1 
ATOM   2045 C  CB  . LEU A 1 278 ? -19.536 85.509 13.603  1.00 140.42 ? 278  LEU A CB  1 
ATOM   2046 C  CG  . LEU A 1 278 ? -19.771 84.172 14.306  1.00 136.34 ? 278  LEU A CG  1 
ATOM   2047 C  CD1 . LEU A 1 278 ? -18.779 83.977 15.430  1.00 136.60 ? 278  LEU A CD1 1 
ATOM   2048 C  CD2 . LEU A 1 278 ? -21.193 84.091 14.828  1.00 137.78 ? 278  LEU A CD2 1 
ATOM   2049 N  N   . PRO A 1 279 ? -21.554 87.831 13.323  1.00 153.40 ? 279  PRO A N   1 
ATOM   2050 C  CA  . PRO A 1 279 ? -21.885 89.256 13.340  1.00 154.84 ? 279  PRO A CA  1 
ATOM   2051 C  C   . PRO A 1 279 ? -20.588 90.041 13.441  1.00 153.75 ? 279  PRO A C   1 
ATOM   2052 O  O   . PRO A 1 279 ? -20.445 91.104 12.844  1.00 152.58 ? 279  PRO A O   1 
ATOM   2053 C  CB  . PRO A 1 279 ? -22.696 89.405 14.624  1.00 156.59 ? 279  PRO A CB  1 
ATOM   2054 C  CG  . PRO A 1 279 ? -23.305 88.068 14.835  1.00 154.15 ? 279  PRO A CG  1 
ATOM   2055 C  CD  . PRO A 1 279 ? -22.302 87.076 14.342  1.00 151.21 ? 279  PRO A CD  1 
ATOM   2056 N  N   . ASP A 1 280 ? -19.646 89.495 14.197  1.00 153.69 ? 280  ASP A N   1 
ATOM   2057 C  CA  . ASP A 1 280 ? -18.345 90.107 14.395  1.00 155.80 ? 280  ASP A CA  1 
ATOM   2058 C  C   . ASP A 1 280 ? -17.652 90.192 13.043  1.00 153.37 ? 280  ASP A C   1 
ATOM   2059 O  O   . ASP A 1 280 ? -16.769 91.018 12.829  1.00 151.74 ? 280  ASP A O   1 
ATOM   2060 C  CB  . ASP A 1 280 ? -17.511 89.278 15.368  1.00 157.43 ? 280  ASP A CB  1 
ATOM   2061 C  CG  . ASP A 1 280 ? -18.364 88.470 16.330  1.00 157.51 ? 280  ASP A CG  1 
ATOM   2062 O  OD1 . ASP A 1 280 ? -19.598 88.642 16.331  1.00 157.97 ? 280  ASP A OD1 1 
ATOM   2063 O  OD2 . ASP A 1 280 ? -17.798 87.659 17.091  1.00 156.46 ? 280  ASP A OD2 1 
ATOM   2064 N  N   . GLY A 1 281 ? -18.066 89.319 12.135  1.00 153.84 ? 281  GLY A N   1 
ATOM   2065 C  CA  . GLY A 1 281 ? -17.510 89.254 10.797  1.00 153.27 ? 281  GLY A CA  1 
ATOM   2066 C  C   . GLY A 1 281 ? -16.495 88.144 10.650  1.00 149.53 ? 281  GLY A C   1 
ATOM   2067 O  O   . GLY A 1 281 ? -16.100 87.797 9.538   1.00 144.78 ? 281  GLY A O   1 
ATOM   2068 N  N   . ARG A 1 282 ? -16.077 87.571 11.772  1.00 151.62 ? 282  ARG A N   1 
ATOM   2069 C  CA  . ARG A 1 282 ? -15.142 86.465 11.726  1.00 153.14 ? 282  ARG A CA  1 
ATOM   2070 C  C   . ARG A 1 282 ? -15.959 85.303 11.200  1.00 143.47 ? 282  ARG A C   1 
ATOM   2071 O  O   . ARG A 1 282 ? -17.146 85.206 11.495  1.00 141.78 ? 282  ARG A O   1 
ATOM   2072 C  CB  . ARG A 1 282 ? -14.589 86.153 13.113  1.00 161.12 ? 282  ARG A CB  1 
ATOM   2073 C  CG  . ARG A 1 282 ? -15.624 86.163 14.221  1.00 166.73 ? 282  ARG A CG  1 
ATOM   2074 C  CD  . ARG A 1 282 ? -14.975 85.885 15.566  1.00 170.29 ? 282  ARG A CD  1 
ATOM   2075 N  NE  . ARG A 1 282 ? -15.950 85.820 16.648  1.00 174.26 ? 282  ARG A NE  1 
ATOM   2076 C  CZ  . ARG A 1 282 ? -15.648 85.501 17.901  1.00 177.53 ? 282  ARG A CZ  1 
ATOM   2077 N  NH1 . ARG A 1 282 ? -14.396 85.216 18.229  1.00 177.83 ? 282  ARG A NH1 1 
ATOM   2078 N  NH2 . ARG A 1 282 ? -16.597 85.465 18.827  1.00 179.59 ? 282  ARG A NH2 1 
ATOM   2079 N  N   . ARG A 1 283 ? -15.345 84.424 10.419  1.00 135.86 ? 283  ARG A N   1 
ATOM   2080 C  CA  . ARG A 1 283 ? -16.084 83.290 9.877   1.00 126.44 ? 283  ARG A CA  1 
ATOM   2081 C  C   . ARG A 1 283 ? -16.206 82.139 10.878  1.00 119.45 ? 283  ARG A C   1 
ATOM   2082 O  O   . ARG A 1 283 ? -15.463 82.069 11.863  1.00 121.34 ? 283  ARG A O   1 
ATOM   2083 C  CB  . ARG A 1 283 ? -15.441 82.810 8.575   1.00 124.07 ? 283  ARG A CB  1 
ATOM   2084 C  CG  . ARG A 1 283 ? -16.340 81.915 7.745   1.00 123.87 ? 283  ARG A CG  1 
ATOM   2085 C  CD  . ARG A 1 283 ? -15.688 81.524 6.431   1.00 124.05 ? 283  ARG A CD  1 
ATOM   2086 N  N   . ALA A 1 284 ? -17.144 81.234 10.617  1.00 108.85 ? 284  ALA A N   1 
ATOM   2087 C  CA  . ALA A 1 284 ? -17.473 80.190 11.572  1.00 102.82 ? 284  ALA A CA  1 
ATOM   2088 C  C   . ALA A 1 284 ? -18.169 79.015 10.902  1.00 99.91  ? 284  ALA A C   1 
ATOM   2089 O  O   . ALA A 1 284 ? -18.567 79.100 9.742   1.00 103.80 ? 284  ALA A O   1 
ATOM   2090 C  CB  . ALA A 1 284 ? -18.351 80.757 12.647  1.00 106.57 ? 284  ALA A CB  1 
ATOM   2091 N  N   . LEU A 1 285 ? -18.315 77.921 11.643  1.00 94.03  ? 285  LEU A N   1 
ATOM   2092 C  CA  . LEU A 1 285 ? -18.968 76.714 11.141  1.00 88.44  ? 285  LEU A CA  1 
ATOM   2093 C  C   . LEU A 1 285 ? -20.299 76.539 11.834  1.00 83.32  ? 285  LEU A C   1 
ATOM   2094 O  O   . LEU A 1 285 ? -20.376 76.556 13.054  1.00 87.79  ? 285  LEU A O   1 
ATOM   2095 C  CB  . LEU A 1 285 ? -18.105 75.480 11.413  1.00 90.60  ? 285  LEU A CB  1 
ATOM   2096 C  CG  . LEU A 1 285 ? -18.815 74.131 11.240  1.00 89.01  ? 285  LEU A CG  1 
ATOM   2097 C  CD1 . LEU A 1 285 ? -19.000 73.821 9.779   1.00 90.23  ? 285  LEU A CD1 1 
ATOM   2098 C  CD2 . LEU A 1 285 ? -18.040 73.017 11.892  1.00 86.23  ? 285  LEU A CD2 1 
ATOM   2099 N  N   . ASP A 1 286 ? -21.353 76.355 11.061  1.00 78.77  ? 286  ASP A N   1 
ATOM   2100 C  CA  . ASP A 1 286 ? -22.687 76.293 11.639  1.00 84.68  ? 286  ASP A CA  1 
ATOM   2101 C  C   . ASP A 1 286 ? -23.264 74.908 11.465  1.00 77.93  ? 286  ASP A C   1 
ATOM   2102 O  O   . ASP A 1 286 ? -23.861 74.595 10.435  1.00 74.92  ? 286  ASP A O   1 
ATOM   2103 C  CB  . ASP A 1 286 ? -23.608 77.337 10.987  1.00 96.21  ? 286  ASP A CB  1 
ATOM   2104 C  CG  . ASP A 1 286 ? -25.050 77.253 11.482  1.00 99.06  ? 286  ASP A CG  1 
ATOM   2105 O  OD1 . ASP A 1 286 ? -25.285 76.650 12.551  1.00 100.55 ? 286  ASP A OD1 1 
ATOM   2106 O  OD2 . ASP A 1 286 ? -25.947 77.800 10.798  1.00 97.27  ? 286  ASP A OD2 1 
ATOM   2107 N  N   . LEU A 1 287 ? -23.097 74.074 12.479  1.00 76.82  ? 287  LEU A N   1 
ATOM   2108 C  CA  . LEU A 1 287 ? -23.579 72.702 12.388  1.00 78.11  ? 287  LEU A CA  1 
ATOM   2109 C  C   . LEU A 1 287 ? -25.101 72.572 12.317  1.00 78.41  ? 287  LEU A C   1 
ATOM   2110 O  O   . LEU A 1 287 ? -25.630 71.470 12.401  1.00 80.71  ? 287  LEU A O   1 
ATOM   2111 C  CB  . LEU A 1 287 ? -23.032 71.858 13.535  1.00 76.58  ? 287  LEU A CB  1 
ATOM   2112 C  CG  . LEU A 1 287 ? -21.519 71.675 13.491  1.00 78.24  ? 287  LEU A CG  1 
ATOM   2113 C  CD1 . LEU A 1 287 ? -21.083 70.909 14.713  1.00 83.12  ? 287  LEU A CD1 1 
ATOM   2114 C  CD2 . LEU A 1 287 ? -21.071 70.970 12.211  1.00 71.14  ? 287  LEU A CD2 1 
ATOM   2115 N  N   . GLY A 1 288 ? -25.806 73.685 12.156  1.00 75.25  ? 288  GLY A N   1 
ATOM   2116 C  CA  . GLY A 1 288 ? -27.251 73.635 12.037  1.00 76.92  ? 288  GLY A CA  1 
ATOM   2117 C  C   . GLY A 1 288 ? -27.683 73.235 10.642  1.00 85.17  ? 288  GLY A C   1 
ATOM   2118 O  O   . GLY A 1 288 ? -28.769 72.696 10.446  1.00 89.01  ? 288  GLY A O   1 
ATOM   2119 N  N   . LYS A 1 289 ? -26.821 73.496 9.668   1.00 90.75  ? 289  LYS A N   1 
ATOM   2120 C  CA  . LYS A 1 289 ? -27.135 73.211 8.277   1.00 93.04  ? 289  LYS A CA  1 
ATOM   2121 C  C   . LYS A 1 289 ? -26.559 71.872 7.865   1.00 85.94  ? 289  LYS A C   1 
ATOM   2122 O  O   . LYS A 1 289 ? -26.682 71.465 6.706   1.00 89.36  ? 289  LYS A O   1 
ATOM   2123 C  CB  . LYS A 1 289 ? -26.581 74.316 7.375   1.00 100.07 ? 289  LYS A CB  1 
ATOM   2124 C  CG  . LYS A 1 289 ? -27.027 75.711 7.764   1.00 105.20 ? 289  LYS A CG  1 
ATOM   2125 C  CD  . LYS A 1 289 ? -26.304 76.760 6.954   1.00 110.38 ? 289  LYS A CD  1 
ATOM   2126 C  CE  . LYS A 1 289 ? -26.465 78.120 7.589   1.00 119.78 ? 289  LYS A CE  1 
ATOM   2127 N  NZ  . LYS A 1 289 ? -27.897 78.396 7.904   1.00 125.88 ? 289  LYS A NZ  1 
ATOM   2128 N  N   . PHE A 1 290 ? -25.938 71.186 8.817   1.00 74.86  ? 290  PHE A N   1 
ATOM   2129 C  CA  . PHE A 1 290 ? -25.226 69.962 8.492   1.00 69.97  ? 290  PHE A CA  1 
ATOM   2130 C  C   . PHE A 1 290 ? -26.110 68.984 7.747   1.00 65.87  ? 290  PHE A C   1 
ATOM   2131 O  O   . PHE A 1 290 ? -25.661 68.362 6.798   1.00 61.49  ? 290  PHE A O   1 
ATOM   2132 C  CB  . PHE A 1 290 ? -24.612 69.300 9.730   1.00 71.79  ? 290  PHE A CB  1 
ATOM   2133 C  CG  . PHE A 1 290 ? -23.675 68.156 9.408   1.00 71.40  ? 290  PHE A CG  1 
ATOM   2134 C  CD1 . PHE A 1 290 ? -22.507 68.379 8.703   1.00 69.92  ? 290  PHE A CD1 1 
ATOM   2135 C  CD2 . PHE A 1 290 ? -23.960 66.862 9.817   1.00 71.36  ? 290  PHE A CD2 1 
ATOM   2136 C  CE1 . PHE A 1 290 ? -21.648 67.331 8.399   1.00 68.51  ? 290  PHE A CE1 1 
ATOM   2137 C  CE2 . PHE A 1 290 ? -23.101 65.813 9.517   1.00 68.61  ? 290  PHE A CE2 1 
ATOM   2138 C  CZ  . PHE A 1 290 ? -21.948 66.051 8.808   1.00 68.27  ? 290  PHE A CZ  1 
ATOM   2139 N  N   . HIS A 1 291 ? -27.369 68.861 8.154   1.00 68.92  ? 291  HIS A N   1 
ATOM   2140 C  CA  . HIS A 1 291 ? -28.252 67.872 7.537   1.00 70.90  ? 291  HIS A CA  1 
ATOM   2141 C  C   . HIS A 1 291 ? -29.167 68.442 6.482   1.00 74.44  ? 291  HIS A C   1 
ATOM   2142 O  O   . HIS A 1 291 ? -30.024 67.726 5.959   1.00 74.38  ? 291  HIS A O   1 
ATOM   2143 C  CB  . HIS A 1 291 ? -29.105 67.192 8.591   1.00 73.27  ? 291  HIS A CB  1 
ATOM   2144 C  CG  . HIS A 1 291 ? -28.308 66.545 9.671   1.00 70.47  ? 291  HIS A CG  1 
ATOM   2145 N  ND1 . HIS A 1 291 ? -27.529 65.429 9.449   1.00 67.67  ? 291  HIS A ND1 1 
ATOM   2146 C  CD2 . HIS A 1 291 ? -28.154 66.857 10.976  1.00 66.49  ? 291  HIS A CD2 1 
ATOM   2147 C  CE1 . HIS A 1 291 ? -26.931 65.086 10.573  1.00 67.47  ? 291  HIS A CE1 1 
ATOM   2148 N  NE2 . HIS A 1 291 ? -27.294 65.936 11.517  1.00 63.80  ? 291  HIS A NE2 1 
ATOM   2149 N  N   . GLU A 1 292 ? -28.994 69.727 6.180   1.00 77.66  ? 292  GLU A N   1 
ATOM   2150 C  CA  . GLU A 1 292 ? -29.839 70.393 5.200   1.00 77.36  ? 292  GLU A CA  1 
ATOM   2151 C  C   . GLU A 1 292 ? -29.423 70.051 3.791   1.00 71.78  ? 292  GLU A C   1 
ATOM   2152 O  O   . GLU A 1 292 ? -28.255 70.177 3.426   1.00 67.30  ? 292  GLU A O   1 
ATOM   2153 C  CB  . GLU A 1 292 ? -29.848 71.901 5.404   1.00 83.98  ? 292  GLU A CB  1 
ATOM   2154 C  CG  . GLU A 1 292 ? -30.852 72.330 6.446   1.00 94.53  ? 292  GLU A CG  1 
ATOM   2155 C  CD  . GLU A 1 292 ? -30.863 73.822 6.666   1.00 104.23 ? 292  GLU A CD  1 
ATOM   2156 O  OE1 . GLU A 1 292 ? -30.253 74.537 5.846   1.00 104.77 ? 292  GLU A OE1 1 
ATOM   2157 O  OE2 . GLU A 1 292 ? -31.484 74.277 7.655   1.00 109.78 ? 292  GLU A OE2 1 
ATOM   2158 N  N   . ILE A 1 293 ? -30.407 69.617 3.013   1.00 69.86  ? 293  ILE A N   1 
ATOM   2159 C  CA  . ILE A 1 293 ? -30.201 69.214 1.639   1.00 69.02  ? 293  ILE A CA  1 
ATOM   2160 C  C   . ILE A 1 293 ? -31.108 69.985 0.678   1.00 71.92  ? 293  ILE A C   1 
ATOM   2161 O  O   . ILE A 1 293 ? -32.342 69.889 0.733   1.00 66.39  ? 293  ILE A O   1 
ATOM   2162 C  CB  . ILE A 1 293 ? -30.424 67.713 1.493   1.00 65.55  ? 293  ILE A CB  1 
ATOM   2163 C  CG1 . ILE A 1 293 ? -29.314 66.962 2.230   1.00 57.22  ? 293  ILE A CG1 1 
ATOM   2164 C  CG2 . ILE A 1 293 ? -30.494 67.322 0.023   1.00 67.29  ? 293  ILE A CG2 1 
ATOM   2165 C  CD1 . ILE A 1 293 ? -29.473 65.473 2.199   1.00 55.29  ? 293  ILE A CD1 1 
ATOM   2166 N  N   . ALA A 1 294 ? -30.467 70.765 -0.189  1.00 77.13  ? 294  ALA A N   1 
ATOM   2167 C  CA  . ALA A 1 294 ? -31.151 71.524 -1.230  1.00 78.10  ? 294  ALA A CA  1 
ATOM   2168 C  C   . ALA A 1 294 ? -31.662 70.589 -2.318  1.00 73.44  ? 294  ALA A C   1 
ATOM   2169 O  O   . ALA A 1 294 ? -30.973 69.682 -2.758  1.00 64.25  ? 294  ALA A O   1 
ATOM   2170 C  CB  . ALA A 1 294 ? -30.222 72.570 -1.827  1.00 79.56  ? 294  ALA A CB  1 
ATOM   2171 N  N   . GLN A 1 295 ? -32.883 70.830 -2.752  1.00 79.92  ? 295  GLN A N   1 
ATOM   2172 C  CA  . GLN A 1 295 ? -33.517 69.979 -3.725  1.00 80.95  ? 295  GLN A CA  1 
ATOM   2173 C  C   . GLN A 1 295 ? -34.289 70.895 -4.651  1.00 82.46  ? 295  GLN A C   1 
ATOM   2174 O  O   . GLN A 1 295 ? -34.838 71.907 -4.226  1.00 86.72  ? 295  GLN A O   1 
ATOM   2175 C  CB  . GLN A 1 295 ? -34.455 69.024 -3.001  1.00 85.70  ? 295  GLN A CB  1 
ATOM   2176 C  CG  . GLN A 1 295 ? -34.750 67.734 -3.723  1.00 92.25  ? 295  GLN A CG  1 
ATOM   2177 C  CD  . GLN A 1 295 ? -35.468 66.751 -2.824  1.00 100.39 ? 295  GLN A CD  1 
ATOM   2178 O  OE1 . GLN A 1 295 ? -35.243 66.731 -1.609  1.00 103.37 ? 295  GLN A OE1 1 
ATOM   2179 N  NE2 . GLN A 1 295 ? -36.340 65.933 -3.410  1.00 102.09 ? 295  GLN A NE2 1 
ATOM   2180 N  N   . HIS A 1 296 ? -34.312 70.564 -5.928  1.00 80.74  ? 296  HIS A N   1 
ATOM   2181 C  CA  . HIS A 1 296 ? -35.071 71.351 -6.885  1.00 86.51  ? 296  HIS A CA  1 
ATOM   2182 C  C   . HIS A 1 296 ? -36.432 70.689 -7.113  1.00 86.82  ? 296  HIS A C   1 
ATOM   2183 O  O   . HIS A 1 296 ? -36.523 69.478 -7.302  1.00 82.82  ? 296  HIS A O   1 
ATOM   2184 C  CB  . HIS A 1 296 ? -34.261 71.505 -8.179  1.00 95.69  ? 296  HIS A CB  1 
ATOM   2185 C  CG  . HIS A 1 296 ? -35.078 71.876 -9.378  1.00 107.45 ? 296  HIS A CG  1 
ATOM   2186 N  ND1 . HIS A 1 296 ? -36.443 72.004 -9.329  1.00 115.54 ? 296  HIS A ND1 1 
ATOM   2187 C  CD2 . HIS A 1 296 ? -34.714 72.130 -10.656 1.00 112.78 ? 296  HIS A CD2 1 
ATOM   2188 C  CE1 . HIS A 1 296 ? -36.896 72.325 -10.533 1.00 119.09 ? 296  HIS A CE1 1 
ATOM   2189 N  NE2 . HIS A 1 296 ? -35.870 72.406 -11.353 1.00 117.81 ? 296  HIS A NE2 1 
ATOM   2190 N  N   . HIS A 1 297 ? -37.492 71.491 -7.069  1.00 92.45  ? 297  HIS A N   1 
ATOM   2191 C  CA  . HIS A 1 297 ? -38.851 70.986 -7.233  1.00 95.12  ? 297  HIS A CA  1 
ATOM   2192 C  C   . HIS A 1 297 ? -39.468 71.454 -8.554  1.00 104.68 ? 297  HIS A C   1 
ATOM   2193 O  O   . HIS A 1 297 ? -39.578 72.648 -8.795  1.00 102.71 ? 297  HIS A O   1 
ATOM   2194 C  CB  . HIS A 1 297 ? -39.708 71.417 -6.041  1.00 90.73  ? 297  HIS A CB  1 
ATOM   2195 C  CG  . HIS A 1 297 ? -39.185 70.933 -4.729  1.00 89.83  ? 297  HIS A CG  1 
ATOM   2196 N  ND1 . HIS A 1 297 ? -38.025 71.416 -4.167  1.00 92.07  ? 297  HIS A ND1 1 
ATOM   2197 C  CD2 . HIS A 1 297 ? -39.657 69.998 -3.872  1.00 93.13  ? 297  HIS A CD2 1 
ATOM   2198 C  CE1 . HIS A 1 297 ? -37.804 70.803 -3.016  1.00 93.76  ? 297  HIS A CE1 1 
ATOM   2199 N  NE2 . HIS A 1 297 ? -38.780 69.938 -2.814  1.00 95.17  ? 297  HIS A NE2 1 
ATOM   2200 N  N   . HIS A 1 298 ? -39.845 70.504 -9.412  1.00 119.34 ? 298  HIS A N   1 
ATOM   2201 C  CA  . HIS A 1 298 ? -40.492 70.811 -10.693 1.00 131.58 ? 298  HIS A CA  1 
ATOM   2202 C  C   . HIS A 1 298 ? -41.973 71.112 -10.483 1.00 139.24 ? 298  HIS A C   1 
ATOM   2203 O  O   . HIS A 1 298 ? -42.469 71.096 -9.358  1.00 139.52 ? 298  HIS A O   1 
ATOM   2204 C  CB  . HIS A 1 298 ? -40.355 69.659 -11.704 1.00 134.48 ? 298  HIS A CB  1 
ATOM   2205 C  CG  . HIS A 1 298 ? -39.203 68.739 -11.437 1.00 140.15 ? 298  HIS A CG  1 
ATOM   2206 N  ND1 . HIS A 1 298 ? -39.261 67.723 -10.506 1.00 144.03 ? 298  HIS A ND1 1 
ATOM   2207 C  CD2 . HIS A 1 298 ? -37.969 68.670 -11.991 1.00 141.33 ? 298  HIS A CD2 1 
ATOM   2208 C  CE1 . HIS A 1 298 ? -38.109 67.076 -10.488 1.00 142.11 ? 298  HIS A CE1 1 
ATOM   2209 N  NE2 . HIS A 1 298 ? -37.309 67.628 -11.381 1.00 141.84 ? 298  HIS A NE2 1 
ATOM   2210 N  N   . HIS A 1 299 ? -42.686 71.359 -11.573 1.00 146.47 ? 299  HIS A N   1 
ATOM   2211 C  CA  . HIS A 1 299 ? -44.061 71.820 -11.470 1.00 157.14 ? 299  HIS A CA  1 
ATOM   2212 C  C   . HIS A 1 299 ? -45.068 70.685 -11.303 1.00 160.67 ? 299  HIS A C   1 
ATOM   2213 O  O   . HIS A 1 299 ? -44.875 69.580 -11.818 1.00 159.08 ? 299  HIS A O   1 
ATOM   2214 C  CB  . HIS A 1 299 ? -44.407 72.693 -12.673 1.00 164.48 ? 299  HIS A CB  1 
ATOM   2215 C  CG  . HIS A 1 299 ? -43.270 73.563 -13.119 1.00 168.59 ? 299  HIS A CG  1 
ATOM   2216 N  ND1 . HIS A 1 299 ? -42.407 74.167 -12.235 1.00 169.06 ? 299  HIS A ND1 1 
ATOM   2217 C  CD2 . HIS A 1 299 ? -42.858 73.923 -14.359 1.00 170.70 ? 299  HIS A CD2 1 
ATOM   2218 C  CE1 . HIS A 1 299 ? -41.506 74.866 -12.908 1.00 169.93 ? 299  HIS A CE1 1 
ATOM   2219 N  NE2 . HIS A 1 299 ? -41.760 74.734 -14.196 1.00 171.50 ? 299  HIS A NE2 1 
ATOM   2220 N  N   . HIS A 1 300 ? -46.141 70.983 -10.573 1.00 164.56 ? 300  HIS A N   1 
ATOM   2221 C  CA  . HIS A 1 300 ? -47.178 70.009 -10.235 1.00 163.10 ? 300  HIS A CA  1 
ATOM   2222 C  C   . HIS A 1 300 ? -46.660 68.894 -9.319  1.00 154.99 ? 300  HIS A C   1 
ATOM   2223 O  O   . HIS A 1 300 ? -46.728 68.999 -8.092  1.00 147.60 ? 300  HIS A O   1 
ATOM   2224 C  CB  . HIS A 1 300 ? -47.820 69.430 -11.501 1.00 165.70 ? 300  HIS A CB  1 
ATOM   2225 C  CG  . HIS A 1 300 ? -48.639 70.423 -12.270 1.00 170.37 ? 300  HIS A CG  1 
ATOM   2226 N  ND1 . HIS A 1 300 ? -49.756 71.030 -11.744 1.00 173.47 ? 300  HIS A ND1 1 
ATOM   2227 C  CD2 . HIS A 1 300 ? -48.506 70.902 -13.531 1.00 172.18 ? 300  HIS A CD2 1 
ATOM   2228 C  CE1 . HIS A 1 300 ? -50.277 71.848 -12.645 1.00 176.34 ? 300  HIS A CE1 1 
ATOM   2229 N  NE2 . HIS A 1 300 ? -49.538 71.788 -13.736 1.00 175.04 ? 300  HIS A NE2 1 
HETATM 2230 BA BA  . BA  B 2 .   ? 0.000   52.399 52.662  0.50 116.87 ? 1301 BA  A BA  1 
HETATM 2231 K  K   . K   C 3 .   ? 0.000   52.399 59.117  0.50 70.72  ? 1302 K   A K   1 
HETATM 2232 K  K   . K   D 3 .   ? 0.000   52.399 61.957  0.50 39.39  ? 1303 K   A K   1 
HETATM 2233 P  P1  . PC  E 4 .   ? -11.254 70.645 7.163   1.00 122.92 ? 1304 PC  A P1  1 
HETATM 2234 O  O1  . PC  E 4 .   ? -12.343 71.496 6.685   1.00 121.79 ? 1304 PC  A O1  1 
HETATM 2235 O  O3  . PC  E 4 .   ? -9.794  71.336 6.846   1.00 58.30  ? 1304 PC  A O3  1 
HETATM 2236 O  O4  . PC  E 4 .   ? -11.414 70.383 8.790   1.00 67.50  ? 1304 PC  A O4  1 
HETATM 2237 O  O2  . PC  E 4 .   ? -11.266 69.200 6.366   1.00 74.86  ? 1304 PC  A O2  1 
HETATM 2238 C  C1  . PC  E 4 .   ? -10.217 69.001 5.462   1.00 76.92  ? 1304 PC  A C1  1 
HETATM 2239 C  C2  . PC  E 4 .   ? -10.598 69.021 3.980   1.00 83.46  ? 1304 PC  A C2  1 
HETATM 2240 N  N1  . PC  E 4 .   ? -11.460 67.917 3.575   1.00 91.21  ? 1304 PC  A N1  1 
HETATM 2241 C  C3  . PC  E 4 .   ? -12.827 68.353 3.827   1.00 97.96  ? 1304 PC  A C3  1 
HETATM 2242 C  C4  . PC  E 4 .   ? -11.349 66.551 4.080   1.00 91.57  ? 1304 PC  A C4  1 
HETATM 2243 C  C5  . PC  E 4 .   ? -11.161 67.781 2.159   1.00 90.17  ? 1304 PC  A C5  1 
HETATM 2244 K  K   . K   F 3 .   ? 0.000   52.399 67.078  0.50 120.11 ? 1305 K   A K   1 
HETATM 2245 O  O   . HOH G 5 .   ? -37.276 65.021 0.524   1.00 62.08  ? 2001 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 8   ? 3.2050 3.2125 3.4573 0.3656  -0.2233 -0.3199 8   PRO A N   
2    C CA  . PRO A 8   ? 3.2534 3.2593 3.4965 0.3948  -0.2210 -0.3216 8   PRO A CA  
3    C C   . PRO A 8   ? 3.1976 3.2285 3.4972 0.3703  -0.1927 -0.3120 8   PRO A C   
4    O O   . PRO A 8   ? 3.2434 3.2427 3.4983 0.3772  -0.1712 -0.2981 8   PRO A O   
5    C CB  . PRO A 8   ? 3.2590 3.3190 3.5600 0.4294  -0.2601 -0.3555 8   PRO A CB  
6    C CG  . PRO A 8   ? 3.2153 3.2944 3.5438 0.4194  -0.2850 -0.3725 8   PRO A CG  
7    C CD  . PRO A 8   ? 3.1800 3.2426 3.5160 0.3706  -0.2568 -0.3509 8   PRO A CD  
8    N N   . ALA A 9   ? 3.1234 3.2105 3.5205 0.3426  -0.1941 -0.3192 9   ALA A N   
9    C CA  . ALA A 9   ? 3.0519 3.1801 3.5160 0.3194  -0.1680 -0.3084 9   ALA A CA  
10   C C   . ALA A 9   ? 2.9934 3.0837 3.4140 0.2862  -0.1303 -0.2791 9   ALA A C   
11   O O   . ALA A 9   ? 2.9949 3.0436 3.3678 0.2669  -0.1267 -0.2684 9   ALA A O   
12   C CB  . ALA A 9   ? 3.0097 3.2057 3.5925 0.2959  -0.1827 -0.3199 9   ALA A CB  
13   N N   . ARG A 10  ? 2.9309 3.0427 3.3695 0.2821  -0.1030 -0.2677 10  ARG A N   
14   C CA  . ARG A 10  ? 2.8528 2.9372 3.2548 0.2539  -0.0682 -0.2429 10  ARG A CA  
15   C C   . ARG A 10  ? 2.7384 2.8475 3.1971 0.2098  -0.0593 -0.2292 10  ARG A C   
16   O O   . ARG A 10  ? 2.7061 2.8700 3.2572 0.1984  -0.0717 -0.2355 10  ARG A O   
17   C CB  . ARG A 10  ? 2.8655 2.9778 3.2766 0.2674  -0.0439 -0.2383 10  ARG A CB  
18   N N   . LYS A 11  ? 2.6634 2.7305 3.0680 0.1851  -0.0394 -0.2104 11  LYS A N   
19   C CA  . LYS A 11  ? 2.5337 2.6129 2.9773 0.1472  -0.0328 -0.1966 11  LYS A CA  
20   C C   . LYS A 11  ? 2.4166 2.4883 2.8344 0.1231  0.0030  -0.1714 11  LYS A C   
21   O O   . LYS A 11  ? 2.4148 2.4616 2.7730 0.1356  0.0199  -0.1678 11  LYS A O   
22   C CB  . LYS A 11  ? 2.5393 2.5785 2.9406 0.1440  -0.0534 -0.2033 11  LYS A CB  
23   N N   . PRO A 12  ? 2.2983 2.3889 2.7593 0.0907  0.0123  -0.1551 12  PRO A N   
24   C CA  . PRO A 12  ? 2.1951 2.2826 2.6307 0.0691  0.0446  -0.1309 12  PRO A CA  
25   C C   . PRO A 12  ? 2.0681 2.0971 2.4146 0.0606  0.0483  -0.1267 12  PRO A C   
26   O O   . PRO A 12  ? 2.0897 2.0963 2.4221 0.0561  0.0294  -0.1330 12  PRO A O   
27   C CB  . PRO A 12  ? 2.1894 2.3160 2.7074 0.0399  0.0471  -0.1145 12  PRO A CB  
28   C CG  . PRO A 12  ? 2.2024 2.3195 2.7530 0.0414  0.0113  -0.1335 12  PRO A CG  
29   C CD  . PRO A 12  ? 2.2532 2.3696 2.7930 0.0747  -0.0092 -0.1593 12  PRO A CD  
30   N N   . ARG A 13  ? 1.8931 1.9020 2.1819 0.0592  0.0714  -0.1172 13  ARG A N   
31   C CA  . ARG A 13  ? 1.7227 1.6806 1.9316 0.0473  0.0755  -0.1121 13  ARG A CA  
32   C C   . ARG A 13  ? 1.5813 1.5501 1.8033 0.0179  0.0832  -0.0960 13  ARG A C   
33   O O   . ARG A 13  ? 1.5619 1.5646 1.8205 0.0045  0.1016  -0.0803 13  ARG A O   
34   C CB  . ARG A 13  ? 1.7169 1.6480 1.8643 0.0545  0.0935  -0.1108 13  ARG A CB  
35   C CG  . ARG A 13  ? 1.7525 1.6403 1.8507 0.0832  0.0808  -0.1267 13  ARG A CG  
36   C CD  . ARG A 13  ? 1.8134 1.6832 1.8691 0.0966  0.0965  -0.1300 13  ARG A CD  
37   N NE  . ARG A 13  ? 1.8657 1.6679 1.8380 0.0873  0.0963  -0.1293 13  ARG A NE  
38   C CZ  . ARG A 13  ? 1.8776 1.6365 1.8084 0.0695  0.0850  -0.1234 13  ARG A CZ  
39   N NH1 . ARG A 13  ? 1.8315 1.6061 1.7886 0.0636  0.0723  -0.1202 13  ARG A NH1 
40   N NH2 . ARG A 13  ? 1.9314 1.6332 1.7943 0.0580  0.0856  -0.1212 13  ARG A NH2 
41   N N   . ILE A 14  ? 1.4852 1.4280 1.6750 0.0104  0.0695  -0.0985 14  ILE A N   
42   C CA  . ILE A 14  ? 1.4083 1.3581 1.5997 -0.0129 0.0750  -0.0855 14  ILE A CA  
43   C C   . ILE A 14  ? 1.3529 1.2852 1.4839 -0.0275 0.0961  -0.0735 14  ILE A C   
44   O O   . ILE A 14  ? 1.3708 1.3227 1.5130 -0.0441 0.1103  -0.0587 14  ILE A O   
45   C CB  . ILE A 14  ? 1.4199 1.3574 1.5968 -0.0111 0.0526  -0.0947 14  ILE A CB  
46   C CG1 . ILE A 14  ? 1.4759 1.4307 1.7133 0.0052  0.0267  -0.1117 14  ILE A CG1 
47   C CG2 . ILE A 14  ? 1.3413 1.2874 1.5140 -0.0309 0.0581  -0.0827 14  ILE A CG2 
48   C CD1 . ILE A 14  ? 1.4587 1.4479 1.7831 -0.0053 0.0268  -0.1056 14  ILE A CD1 
49   N N   . LEU A 15  ? 1.2462 1.1395 1.3136 -0.0208 0.0959  -0.0799 15  LEU A N   
50   C CA  . LEU A 15  ? 1.1319 1.0024 1.1418 -0.0342 0.1111  -0.0733 15  LEU A CA  
51   C C   . LEU A 15  ? 1.0320 0.8835 1.0206 -0.0164 0.1179  -0.0818 15  LEU A C   
52   O O   . LEU A 15  ? 1.0081 0.8468 1.0017 0.0059  0.1066  -0.0930 15  LEU A O   
53   C CB  . LEU A 15  ? 1.1579 0.9914 1.1078 -0.0457 0.1019  -0.0726 15  LEU A CB  
54   C CG  . LEU A 15  ? 1.1093 0.9567 1.0690 -0.0497 0.0878  -0.0712 15  LEU A CG  
55   C CD1 . LEU A 15  ? 1.1080 0.9238 1.0048 -0.0592 0.0823  -0.0667 15  LEU A CD1 
56   C CD2 . LEU A 15  ? 1.0659 0.9514 1.0585 -0.0644 0.0937  -0.0626 15  LEU A CD2 
57   N N   . ASN A 16  ? 1.0543 0.9051 1.0167 -0.0224 0.1344  -0.0787 16  ASN A N   
58   C CA  . ASN A 16  ? 1.1279 0.9577 1.0617 -0.0010 0.1391  -0.0909 16  ASN A CA  
59   C C   . ASN A 16  ? 1.1365 0.8969 0.9947 -0.0061 0.1291  -0.0989 16  ASN A C   
60   O O   . ASN A 16  ? 1.1583 0.8990 0.9891 -0.0314 0.1240  -0.0912 16  ASN A O   
61   C CB  . ASN A 16  ? 1.2027 1.0743 1.1493 0.0019  0.1614  -0.0859 16  ASN A CB  
62   C CG  . ASN A 16  ? 1.2196 1.1596 1.2443 0.0006  0.1730  -0.0703 16  ASN A CG  
63   O OD1 . ASN A 16  ? 1.2064 1.1588 1.2779 -0.0043 0.1616  -0.0665 16  ASN A OD1 
64   N ND2 . ASN A 16  ? 1.2565 1.2410 1.2955 0.0051  0.1948  -0.0606 16  ASN A ND2 
65   N N   . SER A 17  ? 1.1744 0.8985 1.0008 0.0179  0.1252  -0.1139 17  SER A N   
66   C CA  . SER A 17  ? 1.2872 0.9341 1.0440 0.0128  0.1121  -0.1210 17  SER A CA  
67   C C   . SER A 17  ? 1.3683 1.0029 1.0920 -0.0220 0.1158  -0.1143 17  SER A C   
68   O O   . SER A 17  ? 1.4641 1.0472 1.1462 -0.0425 0.1037  -0.1100 17  SER A O   
69   C CB  . SER A 17  ? 1.3620 0.9750 1.0887 0.0457  0.1092  -0.1413 17  SER A CB  
70   O OG  . SER A 17  ? 1.3870 1.0540 1.1636 0.0776  0.1171  -0.1471 17  SER A OG  
71   N N   . ASP A 18  ? 1.3491 1.0343 1.0923 -0.0289 0.1324  -0.1114 18  ASP A N   
72   C CA  . ASP A 18  ? 1.3688 1.0507 1.0824 -0.0584 0.1351  -0.1078 18  ASP A CA  
73   C C   . ASP A 18  ? 1.3081 1.0246 1.0457 -0.0870 0.1369  -0.0888 18  ASP A C   
74   O O   . ASP A 18  ? 1.1096 0.8469 0.8381 -0.1085 0.1423  -0.0835 18  ASP A O   
75   C CB  . ASP A 18  ? 1.4033 1.1208 1.1147 -0.0478 0.1505  -0.1151 18  ASP A CB  
76   C CG  . ASP A 18  ? 1.3886 1.1822 1.1605 -0.0353 0.1697  -0.1017 18  ASP A CG  
77   O OD1 . ASP A 18  ? 1.3582 1.1681 1.1737 -0.0231 0.1688  -0.0967 18  ASP A OD1 
78   O OD2 . ASP A 18  ? 1.4214 1.2586 1.1979 -0.0381 0.1848  -0.0952 18  ASP A OD2 
79   N N   . GLY A 19  ? 1.2934 1.0172 1.0596 -0.0833 0.1303  -0.0812 19  GLY A N   
80   C CA  . GLY A 19  ? 1.2590 1.0121 1.0440 -0.1031 0.1282  -0.0673 19  GLY A CA  
81   C C   . GLY A 19  ? 1.2040 1.0180 1.0331 -0.1071 0.1408  -0.0582 19  GLY A C   
82   O O   . GLY A 19  ? 1.1473 0.9859 0.9848 -0.1232 0.1393  -0.0487 19  GLY A O   
83   N N   . SER A 20  ? 1.2385 1.0783 1.0950 -0.0910 0.1533  -0.0595 20  SER A N   
84   C CA  . SER A 20  ? 1.2415 1.1360 1.1433 -0.0934 0.1661  -0.0457 20  SER A CA  
85   C C   . SER A 20  ? 1.2695 1.1892 1.2357 -0.0833 0.1613  -0.0403 20  SER A C   
86   O O   . SER A 20  ? 1.2449 1.1490 1.2237 -0.0679 0.1516  -0.0500 20  SER A O   
87   C CB  . SER A 20  ? 1.2306 1.1474 1.1298 -0.0819 0.1839  -0.0452 20  SER A CB  
88   O OG  . SER A 20  ? 1.2505 1.1607 1.1602 -0.0572 0.1853  -0.0554 20  SER A OG  
89   N N   . SER A 21  ? 1.2999 1.2567 1.3072 -0.0913 0.1659  -0.0254 21  SER A N   
90   C CA  . SER A 21  ? 1.2415 1.2165 1.3120 -0.0866 0.1558  -0.0217 21  SER A CA  
91   C C   . SER A 21  ? 1.1876 1.1981 1.3196 -0.0787 0.1676  -0.0103 21  SER A C   
92   O O   . SER A 21  ? 1.1538 1.1883 1.2826 -0.0784 0.1883  0.0020  21  SER A O   
93   C CB  . SER A 21  ? 1.2218 1.2091 1.3030 -0.0992 0.1486  -0.0130 21  SER A CB  
94   O OG  . SER A 21  ? 1.1976 1.2020 1.3457 -0.0954 0.1392  -0.0079 21  SER A OG  
95   N N   . ASN A 22  ? 1.1284 1.1467 1.3179 -0.0724 0.1537  -0.0142 22  ASN A N   
96   C CA  . ASN A 22  ? 1.0811 1.1382 1.3416 -0.0695 0.1624  -0.0014 22  ASN A CA  
97   C C   . ASN A 22  ? 1.0783 1.1497 1.4038 -0.0822 0.1518  0.0121  22  ASN A C   
98   O O   . ASN A 22  ? 1.0968 1.1945 1.4948 -0.0838 0.1497  0.0203  22  ASN A O   
99   C CB  . ASN A 22  ? 1.0675 1.1260 1.3510 -0.0511 0.1532  -0.0186 22  ASN A CB  
100  C CG  . ASN A 22  ? 1.0902 1.1469 1.3295 -0.0345 0.1689  -0.0258 22  ASN A CG  
101  O OD1 . ASN A 22  ? 1.1183 1.1839 1.3236 -0.0369 0.1892  -0.0159 22  ASN A OD1 
102  N ND2 . ASN A 22  ? 1.0655 1.1100 1.3026 -0.0140 0.1574  -0.0450 22  ASN A ND2 
103  N N   . ILE A 23  ? 1.0535 1.1075 1.3542 -0.0911 0.1433  0.0137  23  ILE A N   
104  C CA  . ILE A 23  ? 1.0081 1.0665 1.3604 -0.1006 0.1312  0.0256  23  ILE A CA  
105  C C   . ILE A 23  ? 1.0064 1.0881 1.3662 -0.1121 0.1544  0.0576  23  ILE A C   
106  O O   . ILE A 23  ? 1.0075 1.0938 1.3100 -0.1125 0.1726  0.0634  23  ILE A O   
107  C CB  . ILE A 23  ? 0.9962 1.0299 1.3138 -0.0986 0.1109  0.0109  23  ILE A CB  
108  C CG1 . ILE A 23  ? 0.9716 0.9883 1.2984 -0.0850 0.0831  -0.0173 23  ILE A CG1 
109  C CG2 . ILE A 23  ? 1.0386 1.0748 1.3899 -0.1063 0.1042  0.0271  23  ILE A CG2 
110  C CD1 . ILE A 23  ? 0.9777 0.9805 1.2487 -0.0749 0.0856  -0.0334 23  ILE A CD1 
111  N N   . THR A 24  ? 1.0244 1.1199 1.4549 -0.1217 0.1522  0.0792  24  THR A N   
112  C CA  . THR A 24  ? 1.1228 1.2400 1.5619 -0.1318 0.1738  0.1155  24  THR A CA  
113  C C   . THR A 24  ? 1.2052 1.2993 1.6536 -0.1372 0.1563  0.1234  24  THR A C   
114  O O   . THR A 24  ? 1.2431 1.3204 1.7518 -0.1417 0.1331  0.1223  24  THR A O   
115  C CB  . THR A 24  ? 1.1510 1.3045 1.6656 -0.1410 0.1883  0.1440  24  THR A CB  
116  O OG1 . THR A 24  ? 1.1584 1.3347 1.6734 -0.1307 0.1979  0.1296  24  THR A OG1 
117  C CG2 . THR A 24  ? 1.1493 1.3337 1.6584 -0.1478 0.2179  0.1858  24  THR A CG2 
118  N N   . ARG A 25  ? 1.2469 1.3396 1.6364 -0.1350 0.1647  0.1290  25  ARG A N   
119  C CA  . ARG A 25  ? 1.3232 1.3976 1.7190 -0.1355 0.1487  0.1374  25  ARG A CA  
120  C C   . ARG A 25  ? 1.3754 1.4551 1.8366 -0.1468 0.1542  0.1770  25  ARG A C   
121  O O   . ARG A 25  ? 1.3981 1.5034 1.9004 -0.1559 0.1724  0.1984  25  ARG A O   
122  C CB  . ARG A 25  ? 1.3476 1.4303 1.6709 -0.1306 0.1589  0.1387  25  ARG A CB  
123  C CG  . ARG A 25  ? 1.3632 1.4435 1.6228 -0.1255 0.1571  0.1070  25  ARG A CG  
124  C CD  . ARG A 25  ? 1.4093 1.5062 1.6064 -0.1253 0.1691  0.1117  25  ARG A CD  
125  N NE  . ARG A 25  ? 1.4654 1.5617 1.6051 -0.1268 0.1725  0.0879  25  ARG A NE  
126  C CZ  . ARG A 25  ? 1.4848 1.5747 1.5901 -0.1265 0.1581  0.0672  25  ARG A CZ  
127  N NH1 . ARG A 25  ? 1.4713 1.5597 1.5911 -0.1197 0.1397  0.0640  25  ARG A NH1 
128  N NH2 . ARG A 25  ? 1.4863 1.5719 1.5433 -0.1323 0.1617  0.0506  25  ARG A NH2 
129  N N   . LEU A 26  ? 1.3953 1.4523 1.8667 -0.1457 0.1385  0.1884  26  LEU A N   
130  C CA  . LEU A 26  ? 1.4481 1.5003 1.9812 -0.1582 0.1409  0.2305  26  LEU A CA  
131  C C   . LEU A 26  ? 1.5534 1.5974 2.0531 -0.1514 0.1429  0.2537  26  LEU A C   
132  O O   . LEU A 26  ? 1.5627 1.5755 2.0490 -0.1390 0.1160  0.2352  26  LEU A O   
133  C CB  . LEU A 26  ? 1.3609 1.3768 1.9738 -0.1654 0.1068  0.2205  26  LEU A CB  
134  C CG  . LEU A 26  ? 1.2234 1.2526 1.8803 -0.1720 0.1028  0.2005  26  LEU A CG  
135  C CD1 . LEU A 26  ? 1.1583 1.1500 1.8875 -0.1759 0.0619  0.1811  26  LEU A CD1 
136  C CD2 . LEU A 26  ? 1.2255 1.3009 1.9174 -0.1879 0.1371  0.2381  26  LEU A CD2 
137  N N   . GLY A 27  ? 1.6060 1.6828 2.0900 -0.1556 0.1748  0.2937  27  GLY A N   
138  C CA  . GLY A 27  ? 1.6657 1.7420 2.1144 -0.1469 0.1799  0.3202  27  GLY A CA  
139  C C   . GLY A 27  ? 1.7038 1.8215 2.1490 -0.1523 0.2165  0.3701  27  GLY A C   
140  O O   . GLY A 27  ? 1.7403 1.8612 2.1617 -0.1450 0.2236  0.4014  27  GLY A O   
141  N N   . LEU A 34  ? 2.1286 1.6589 1.5912 -0.3886 0.0494  0.2338  34  LEU A N   
142  C CA  . LEU A 34  ? 2.2114 1.6746 1.6246 -0.3925 0.0456  0.2423  34  LEU A CA  
143  C C   . LEU A 34  ? 2.2562 1.6831 1.6568 -0.3813 0.0261  0.2357  34  LEU A C   
144  O O   . LEU A 34  ? 2.2400 1.6252 1.6116 -0.3628 0.0160  0.2362  34  LEU A O   
145  C CB  . LEU A 34  ? 2.2419 1.6850 1.6400 -0.4272 0.0583  0.2503  34  LEU A CB  
146  C CG  . LEU A 34  ? 2.3069 1.6738 1.6489 -0.4328 0.0539  0.2615  34  LEU A CG  
147  C CD1 . LEU A 34  ? 2.3234 1.6657 1.6332 -0.4059 0.0499  0.2668  34  LEU A CD1 
148  C CD2 . LEU A 34  ? 2.3379 1.6855 1.6625 -0.4688 0.0719  0.2721  34  LEU A CD2 
149  N N   . ASP A 35  ? 2.2933 1.7377 1.7173 -0.3921 0.0201  0.2272  35  ASP A N   
150  C CA  . ASP A 35  ? 2.2721 1.6919 1.6896 -0.3816 0.0024  0.2179  35  ASP A CA  
151  C C   . ASP A 35  ? 2.1586 1.6134 1.5978 -0.3548 -0.0026 0.2095  35  ASP A C   
152  O O   . ASP A 35  ? 2.0984 1.5393 1.5332 -0.3415 -0.0148 0.2004  35  ASP A O   
153  C CB  . ASP A 35  ? 2.3038 1.7282 1.7362 -0.4045 -0.0023 0.2112  35  ASP A CB  
154  C CG  . ASP A 35  ? 2.3763 1.7737 1.7955 -0.4360 0.0073  0.2196  35  ASP A CG  
155  O OD1 . ASP A 35  ? 2.3912 1.7671 1.7858 -0.4407 0.0188  0.2322  35  ASP A OD1 
156  O OD2 . ASP A 35  ? 2.3925 1.7894 1.8252 -0.4565 0.0038  0.2131  35  ASP A OD2 
157  N N   . ASP A 36  ? 2.1305 1.6300 1.5932 -0.3478 0.0081  0.2123  36  ASP A N   
158  C CA  . ASP A 36  ? 2.0793 1.6139 1.5650 -0.3247 0.0060  0.2065  36  ASP A CA  
159  C C   . ASP A 36  ? 2.0539 1.6184 1.5544 -0.3147 0.0177  0.2117  36  ASP A C   
160  O O   . ASP A 36  ? 2.0054 1.6181 1.5382 -0.3134 0.0226  0.2104  36  ASP A O   
161  C CB  . ASP A 36  ? 2.0391 1.6125 1.5529 -0.3313 0.0018  0.1998  36  ASP A CB  
162  C CG  . ASP A 36  ? 1.9517 1.5497 1.4801 -0.3082 -0.0019 0.1951  36  ASP A CG  
163  O OD1 . ASP A 36  ? 1.9311 1.5112 1.4480 -0.2886 -0.0018 0.1944  36  ASP A OD1 
164  O OD2 . ASP A 36  ? 1.9221 1.5559 1.4731 -0.3096 -0.0051 0.1915  36  ASP A OD2 
165  N N   . HIS A 37  ? 2.1133 1.6475 1.5894 -0.3063 0.0203  0.2165  37  HIS A N   
166  C CA  . HIS A 37  ? 2.1483 1.7049 1.6326 -0.2983 0.0312  0.2210  37  HIS A CA  
167  C C   . HIS A 37  ? 1.9947 1.5937 1.5131 -0.2758 0.0328  0.2157  37  HIS A C   
168  O O   . HIS A 37  ? 1.9196 1.5622 1.4656 -0.2779 0.0415  0.2167  37  HIS A O   
169  C CB  . HIS A 37  ? 2.2881 1.7964 1.7335 -0.2898 0.0293  0.2253  37  HIS A CB  
170  C CG  . HIS A 37  ? 2.3746 1.8429 1.8027 -0.2706 0.0149  0.2179  37  HIS A CG  
171  N ND1 . HIS A 37  ? 2.4392 1.8649 1.8437 -0.2794 0.0040  0.2160  37  HIS A ND1 
172  C CD2 . HIS A 37  ? 2.3639 1.8302 1.7986 -0.2432 0.0097  0.2094  37  HIS A CD2 
173  C CE1 . HIS A 37  ? 2.4429 1.8431 1.8400 -0.2578 -0.0075 0.2061  37  HIS A CE1 
174  N NE2 . HIS A 37  ? 2.4013 1.8258 1.8171 -0.2361 -0.0036 0.2016  37  HIS A NE2 
175  N N   . TYR A 38  ? 1.9282 1.5136 1.4457 -0.2549 0.0250  0.2092  38  TYR A N   
176  C CA  . TYR A 38  ? 1.8640 1.4829 1.4120 -0.2342 0.0277  0.2047  38  TYR A CA  
177  C C   . TYR A 38  ? 1.8698 1.5360 1.4501 -0.2413 0.0301  0.2056  38  TYR A C   
178  O O   . TYR A 38  ? 1.8414 1.5454 1.4497 -0.2356 0.0362  0.2064  38  TYR A O   
179  C CB  . TYR A 38  ? 1.8259 1.4215 1.3683 -0.2156 0.0209  0.1962  38  TYR A CB  
180  C CG  . TYR A 38  ? 1.7506 1.3695 1.3204 -0.1930 0.0258  0.1913  38  TYR A CG  
181  C CD1 . TYR A 38  ? 1.7521 1.3845 1.3345 -0.1821 0.0312  0.1915  38  TYR A CD1 
182  C CD2 . TYR A 38  ? 1.7235 1.3495 1.3056 -0.1831 0.0258  0.1859  38  TYR A CD2 
183  C CE1 . TYR A 38  ? 1.7230 1.3764 1.3345 -0.1619 0.0355  0.1857  38  TYR A CE1 
184  C CE2 . TYR A 38  ? 1.6924 1.3371 1.3007 -0.1644 0.0322  0.1819  38  TYR A CE2 
185  C CZ  . TYR A 38  ? 1.6749 1.3335 1.3002 -0.1538 0.0365  0.1814  38  TYR A CZ  
186  O OH  . TYR A 38  ? 1.6147 1.2917 1.2701 -0.1356 0.0426  0.1761  38  TYR A OH  
187  N N   . HIS A 39  ? 1.8905 1.5539 1.4670 -0.2524 0.0233  0.2039  39  HIS A N   
188  C CA  . HIS A 39  ? 1.8549 1.5587 1.4580 -0.2599 0.0217  0.2033  39  HIS A CA  
189  C C   . HIS A 39  ? 1.8207 1.5553 1.4432 -0.2752 0.0295  0.2057  39  HIS A C   
190  O O   . HIS A 39  ? 1.8485 1.6243 1.5028 -0.2695 0.0323  0.2047  39  HIS A O   
191  C CB  . HIS A 39  ? 1.9215 1.6123 1.5124 -0.2720 0.0116  0.1995  39  HIS A CB  
192  C CG  . HIS A 39  ? 1.9619 1.6912 1.5780 -0.2780 0.0062  0.1968  39  HIS A CG  
193  N ND1 . HIS A 39  ? 2.0131 1.7620 1.6441 -0.2993 0.0058  0.1942  39  HIS A ND1 
194  C CD2 . HIS A 39  ? 1.9689 1.7190 1.5973 -0.2650 0.0000  0.1952  39  HIS A CD2 
195  C CE1 . HIS A 39  ? 2.0247 1.8067 1.6787 -0.2975 -0.0026 0.1894  39  HIS A CE1 
196  N NE2 . HIS A 39  ? 2.0080 1.7892 1.6578 -0.2764 -0.0069 0.1912  39  HIS A NE2 
197  N N   . ASP A 40  ? 1.7525 1.4659 1.3558 -0.2949 0.0336  0.2084  40  ASP A N   
198  C CA  . ASP A 40  ? 1.6666 1.4069 1.2854 -0.3134 0.0445  0.2097  40  ASP A CA  
199  C C   . ASP A 40  ? 1.5721 1.3400 1.2087 -0.2986 0.0532  0.2105  40  ASP A C   
200  O O   . ASP A 40  ? 1.6013 1.4161 1.2733 -0.3013 0.0574  0.2064  40  ASP A O   
201  C CB  . ASP A 40  ? 1.7239 1.4267 1.3115 -0.3367 0.0498  0.2144  40  ASP A CB  
202  C CG  . ASP A 40  ? 1.7887 1.4868 1.3794 -0.3574 0.0433  0.2099  40  ASP A CG  
203  O OD1 . ASP A 40  ? 1.7710 1.5022 1.3904 -0.3548 0.0353  0.2023  40  ASP A OD1 
204  O OD2 . ASP A 40  ? 1.8404 1.5001 1.4042 -0.3756 0.0452  0.2137  40  ASP A OD2 
205  N N   . LEU A 41  ? 1.4879 1.2279 1.1025 -0.2821 0.0543  0.2136  41  LEU A N   
206  C CA  . LEU A 41  ? 1.4266 1.1889 1.0552 -0.2680 0.0620  0.2131  41  LEU A CA  
207  C C   . LEU A 41  ? 1.3755 1.1859 1.0492 -0.2533 0.0601  0.2077  41  LEU A C   
208  O O   . LEU A 41  ? 1.3681 1.2200 1.0709 -0.2562 0.0667  0.2046  41  LEU A O   
209  C CB  . LEU A 41  ? 1.4068 1.1301 1.0076 -0.2483 0.0593  0.2139  41  LEU A CB  
210  C CG  . LEU A 41  ? 1.3956 1.0765 0.9521 -0.2570 0.0629  0.2199  41  LEU A CG  
211  C CD1 . LEU A 41  ? 1.3639 1.0108 0.8999 -0.2321 0.0558  0.2169  41  LEU A CD1 
212  C CD2 . LEU A 41  ? 1.3503 1.0570 0.9101 -0.2704 0.0772  0.2228  41  LEU A CD2 
213  N N   . LEU A 42  ? 1.3721 1.1753 1.0506 -0.2377 0.0513  0.2063  42  LEU A N   
214  C CA  . LEU A 42  ? 1.3745 1.2144 1.0901 -0.2236 0.0483  0.2034  42  LEU A CA  
215  C C   . LEU A 42  ? 1.4174 1.2935 1.1583 -0.2374 0.0441  0.2009  42  LEU A C   
216  O O   . LEU A 42  ? 1.4247 1.3393 1.2012 -0.2293 0.0423  0.1977  42  LEU A O   
217  C CB  . LEU A 42  ? 1.3603 1.1775 1.0674 -0.2075 0.0420  0.2036  42  LEU A CB  
218  C CG  . LEU A 42  ? 1.3297 1.1158 1.0216 -0.1906 0.0446  0.2016  42  LEU A CG  
219  C CD1 . LEU A 42  ? 1.3278 1.0869 1.0048 -0.1830 0.0401  0.1999  42  LEU A CD1 
220  C CD2 . LEU A 42  ? 1.3189 1.1302 1.0419 -0.1720 0.0496  0.1985  42  LEU A CD2 
221  N N   . THR A 43  ? 1.4730 1.3351 1.1971 -0.2569 0.0407  0.2009  43  THR A N   
222  C CA  . THR A 43  ? 1.5289 1.4216 1.2762 -0.2711 0.0346  0.1955  43  THR A CA  
223  C C   . THR A 43  ? 1.4992 1.4359 1.2799 -0.2843 0.0424  0.1892  43  THR A C   
224  O O   . THR A 43  ? 1.5312 1.5069 1.3473 -0.2846 0.0354  0.1815  43  THR A O   
225  C CB  . THR A 43  ? 1.6579 1.5219 1.3797 -0.2896 0.0296  0.1950  43  THR A CB  
226  O OG1 . THR A 43  ? 1.7982 1.6368 1.4963 -0.3058 0.0404  0.1986  43  THR A OG1 
227  C CG2 . THR A 43  ? 1.6374 1.4654 1.3314 -0.2770 0.0203  0.1977  43  THR A CG2 
228  N N   . VAL A 44  ? 1.4528 1.3819 1.2207 -0.2950 0.0567  0.1914  44  VAL A N   
229  C CA  . VAL A 44  ? 1.4517 1.4198 1.2461 -0.3110 0.0686  0.1846  44  VAL A CA  
230  C C   . VAL A 44  ? 1.4860 1.5046 1.3243 -0.2970 0.0698  0.1769  44  VAL A C   
231  O O   . VAL A 44  ? 1.4862 1.5045 1.3297 -0.2729 0.0653  0.1794  44  VAL A O   
232  C CB  . VAL A 44  ? 1.4515 1.3918 1.2113 -0.3250 0.0849  0.1909  44  VAL A CB  
233  C CG1 . VAL A 44  ? 1.4241 1.3238 1.1510 -0.3470 0.0851  0.1957  44  VAL A CG1 
234  C CG2 . VAL A 44  ? 1.4859 1.3965 1.2189 -0.3024 0.0852  0.1982  44  VAL A CG2 
235  N N   . SER A 45  ? 1.5394 1.6020 1.4124 -0.3132 0.0761  0.1657  45  SER A N   
236  C CA  . SER A 45  ? 1.5328 1.6490 1.4538 -0.3029 0.0767  0.1546  45  SER A CA  
237  C C   . SER A 45  ? 1.5449 1.6594 1.4558 -0.2912 0.0890  0.1579  45  SER A C   
238  O O   . SER A 45  ? 1.5720 1.6560 1.4440 -0.3008 0.1021  0.1652  45  SER A O   
239  C CB  . SER A 45  ? 1.5204 1.6824 1.4788 -0.3263 0.0840  0.1391  45  SER A CB  
240  O OG  . SER A 45  ? 1.5227 1.6615 1.4525 -0.3546 0.0992  0.1424  45  SER A OG  
241  N N   . TRP A 46  ? 1.5130 1.6581 1.4581 -0.2691 0.0831  0.1522  46  TRP A N   
242  C CA  . TRP A 46  ? 1.5298 1.6761 1.4706 -0.2538 0.0918  0.1528  46  TRP A CA  
243  C C   . TRP A 46  ? 1.5505 1.7058 1.4771 -0.2702 0.1123  0.1494  46  TRP A C   
244  O O   . TRP A 46  ? 1.5236 1.6550 1.4197 -0.2609 0.1192  0.1548  46  TRP A O   
245  C CB  . TRP A 46  ? 1.5187 1.7043 1.5087 -0.2305 0.0823  0.1440  46  TRP A CB  
246  C CG  . TRP A 46  ? 1.5264 1.6841 1.5102 -0.2084 0.0686  0.1527  46  TRP A CG  
247  C CD1 . TRP A 46  ? 1.5448 1.7074 1.5482 -0.2000 0.0527  0.1535  46  TRP A CD1 
248  C CD2 . TRP A 46  ? 1.5132 1.6312 1.4673 -0.1924 0.0703  0.1613  46  TRP A CD2 
249  N NE1 . TRP A 46  ? 1.5419 1.6703 1.5283 -0.1813 0.0473  0.1632  46  TRP A NE1 
250  C CE2 . TRP A 46  ? 1.4952 1.5980 1.4551 -0.1765 0.0580  0.1666  46  TRP A CE2 
251  C CE3 . TRP A 46  ? 1.4912 1.5845 1.4139 -0.1894 0.0805  0.1638  46  TRP A CE3 
252  C CZ2 . TRP A 46  ? 1.4273 1.4948 1.3682 -0.1595 0.0579  0.1726  46  TRP A CZ2 
253  C CZ3 . TRP A 46  ? 1.4551 1.5133 1.3601 -0.1702 0.0769  0.1687  46  TRP A CZ3 
254  C CH2 . TRP A 46  ? 1.4202 1.4677 1.3372 -0.1563 0.0668  0.1722  46  TRP A CH2 
255  N N   . PRO A 47  ? 1.5706 1.7610 1.5196 -0.2942 0.1221  0.1392  47  PRO A N   
256  C CA  . PRO A 47  ? 1.5373 1.7320 1.4662 -0.3145 0.1452  0.1373  47  PRO A CA  
257  C C   . PRO A 47  ? 1.5342 1.6671 1.3981 -0.3309 0.1537  0.1536  47  PRO A C   
258  O O   . PRO A 47  ? 1.5353 1.6424 1.3583 -0.3300 0.1653  0.1607  47  PRO A O   
259  C CB  . PRO A 47  ? 1.5253 1.7714 1.4997 -0.3381 0.1524  0.1207  47  PRO A CB  
260  C CG  . PRO A 47  ? 1.5216 1.8043 1.5504 -0.3197 0.1310  0.1098  47  PRO A CG  
261  C CD  . PRO A 47  ? 1.5654 1.8014 1.5671 -0.3001 0.1125  0.1253  47  PRO A CD  
262  N N   . VAL A 48  ? 1.5245 1.6330 1.3785 -0.3446 0.1463  0.1588  48  VAL A N   
263  C CA  . VAL A 48  ? 1.5528 1.6010 1.3490 -0.3608 0.1517  0.1733  48  VAL A CA  
264  C C   . VAL A 48  ? 1.6562 1.6530 1.4053 -0.3384 0.1453  0.1861  48  VAL A C   
265  O O   . VAL A 48  ? 1.7433 1.6920 1.4396 -0.3477 0.1528  0.1972  48  VAL A O   
266  C CB  . VAL A 48  ? 1.4375 1.4686 1.2361 -0.3725 0.1395  0.1747  48  VAL A CB  
267  C CG1 . VAL A 48  ? 1.3806 1.3445 1.1197 -0.3837 0.1411  0.1897  48  VAL A CG1 
268  C CG2 . VAL A 48  ? 1.4443 1.5212 1.2865 -0.3978 0.1465  0.1602  48  VAL A CG2 
269  N N   . PHE A 49  ? 1.6300 1.6361 1.3993 -0.3088 0.1309  0.1836  49  PHE A N   
270  C CA  . PHE A 49  ? 1.6246 1.5888 1.3603 -0.2850 0.1237  0.1912  49  PHE A CA  
271  C C   . PHE A 49  ? 1.5756 1.5417 1.2939 -0.2765 0.1346  0.1899  49  PHE A C   
272  O O   . PHE A 49  ? 1.5559 1.4742 1.2215 -0.2767 0.1375  0.1987  49  PHE A O   
273  C CB  . PHE A 49  ? 1.6321 1.6093 1.4003 -0.2585 0.1077  0.1874  49  PHE A CB  
274  C CG  . PHE A 49  ? 1.7117 1.6483 1.4536 -0.2348 0.1001  0.1918  49  PHE A CG  
275  C CD1 . PHE A 49  ? 1.7685 1.6587 1.4812 -0.2334 0.0908  0.1985  49  PHE A CD1 
276  C CD2 . PHE A 49  ? 1.7131 1.6601 1.4631 -0.2133 0.1015  0.1865  49  PHE A CD2 
277  C CE1 . PHE A 49  ? 1.7838 1.6394 1.4776 -0.2114 0.0837  0.1990  49  PHE A CE1 
278  C CE2 . PHE A 49  ? 1.7255 1.6374 1.4570 -0.1909 0.0937  0.1871  49  PHE A CE2 
279  C CZ  . PHE A 49  ? 1.7565 1.6232 1.4609 -0.1901 0.0851  0.1930  49  PHE A CZ  
280  N N   . ILE A 50  ? 1.5052 1.5255 1.2667 -0.2680 0.1391  0.1781  50  ILE A N   
281  C CA  . ILE A 50  ? 1.4110 1.4413 1.1598 -0.2610 0.1503  0.1740  50  ILE A CA  
282  C C   . ILE A 50  ? 1.4188 1.4234 1.1182 -0.2887 0.1685  0.1819  50  ILE A C   
283  O O   . ILE A 50  ? 1.4808 1.4640 1.1398 -0.2839 0.1760  0.1851  50  ILE A O   
284  C CB  . ILE A 50  ? 1.3335 1.4332 1.1414 -0.2549 0.1548  0.1575  50  ILE A CB  
285  C CG1 . ILE A 50  ? 1.2705 1.3899 1.1239 -0.2259 0.1371  0.1512  50  ILE A CG1 
286  C CG2 . ILE A 50  ? 1.3383 1.4491 1.1285 -0.2511 0.1686  0.1521  50  ILE A CG2 
287  C CD1 . ILE A 50  ? 1.2285 1.4134 1.1426 -0.2166 0.1381  0.1342  50  ILE A CD1 
288  N N   . THR A 51  ? 1.3914 1.3959 1.0926 -0.3178 0.1752  0.1848  51  THR A N   
289  C CA  . THR A 51  ? 1.4719 1.4470 1.1263 -0.3482 0.1942  0.1937  51  THR A CA  
290  C C   . THR A 51  ? 1.5755 1.4719 1.1612 -0.3471 0.1875  0.2111  51  THR A C   
291  O O   . THR A 51  ? 1.5858 1.4463 1.1172 -0.3507 0.1974  0.2197  51  THR A O   
292  C CB  . THR A 51  ? 1.4045 1.4048 1.0880 -0.3810 0.2039  0.1889  51  THR A CB  
293  O OG1 . THR A 51  ? 1.3979 1.4691 1.1367 -0.3870 0.2153  0.1711  51  THR A OG1 
294  C CG2 . THR A 51  ? 1.3620 1.3171 0.9920 -0.4133 0.2220  0.2013  51  THR A CG2 
295  N N   . LEU A 52  ? 1.6008 1.4693 1.1873 -0.3415 0.1699  0.2155  52  LEU A N   
296  C CA  . LEU A 52  ? 1.6525 1.4478 1.1804 -0.3383 0.1603  0.2290  52  LEU A CA  
297  C C   . LEU A 52  ? 1.7353 1.5022 1.2276 -0.3111 0.1543  0.2311  52  LEU A C   
298  O O   . LEU A 52  ? 1.8101 1.5267 1.2422 -0.3162 0.1586  0.2416  52  LEU A O   
299  C CB  . LEU A 52  ? 1.5744 1.3547 1.1180 -0.3284 0.1404  0.2285  52  LEU A CB  
300  C CG  . LEU A 52  ? 1.5627 1.3502 1.1245 -0.3550 0.1417  0.2283  52  LEU A CG  
301  C CD1 . LEU A 52  ? 1.5596 1.3316 1.1320 -0.3411 0.1212  0.2269  52  LEU A CD1 
302  C CD2 . LEU A 52  ? 1.5276 1.2699 1.0421 -0.3849 0.1538  0.2394  52  LEU A CD2 
303  N N   . ILE A 53  ? 1.6519 1.4497 1.1818 -0.2816 0.1435  0.2206  53  ILE A N   
304  C CA  . ILE A 53  ? 1.5438 1.3235 1.0519 -0.2526 0.1361  0.2179  53  ILE A CA  
305  C C   . ILE A 53  ? 1.5345 1.3179 1.0107 -0.2585 0.1521  0.2189  53  ILE A C   
306  O O   . ILE A 53  ? 1.5798 1.3096 0.9940 -0.2548 0.1503  0.2275  53  ILE A O   
307  C CB  . ILE A 53  ? 1.3713 1.1937 0.9361 -0.2238 0.1256  0.2043  53  ILE A CB  
308  C CG1 . ILE A 53  ? 1.2852 1.0835 0.8603 -0.2111 0.1086  0.2047  53  ILE A CG1 
309  C CG2 . ILE A 53  ? 1.3794 1.2004 0.9330 -0.1972 0.1225  0.1970  53  ILE A CG2 
310  C CD1 . ILE A 53  ? 1.2220 1.0353 0.8303 -0.1783 0.0975  0.1935  53  ILE A CD1 
311  N N   . THR A 54  ? 1.4413 1.2869 0.9585 -0.2668 0.1669  0.2094  54  THR A N   
312  C CA  . THR A 54  ? 1.4377 1.2944 0.9279 -0.2754 0.1855  0.2085  54  THR A CA  
313  C C   . THR A 54  ? 1.5947 1.3881 1.0095 -0.2990 0.1956  0.2261  54  THR A C   
314  O O   . THR A 54  ? 1.6742 1.4384 1.0339 -0.2953 0.2020  0.2313  54  THR A O   
315  C CB  . THR A 54  ? 1.3760 1.3041 0.9193 -0.2951 0.2043  0.1969  54  THR A CB  
316  O OG1 . THR A 54  ? 1.3416 1.3258 0.9455 -0.2693 0.1958  0.1800  54  THR A OG1 
317  C CG2 . THR A 54  ? 1.3987 1.3283 0.9025 -0.3164 0.2298  0.1992  54  THR A CG2 
318  N N   . GLY A 55  ? 1.6607 1.4304 1.0715 -0.3225 0.1959  0.2352  55  GLY A N   
319  C CA  . GLY A 55  ? 1.8174 1.5234 1.1607 -0.3475 0.2047  0.2527  55  GLY A CA  
320  C C   . GLY A 55  ? 1.9146 1.5442 1.1937 -0.3264 0.1855  0.2635  55  GLY A C   
321  O O   . GLY A 55  ? 1.9794 1.5670 1.1940 -0.3269 0.1914  0.2729  55  GLY A O   
322  N N   . LEU A 56  ? 1.9282 1.5392 1.2240 -0.3075 0.1619  0.2609  56  LEU A N   
323  C CA  . LEU A 56  ? 1.9977 1.5390 1.2419 -0.2855 0.1405  0.2669  56  LEU A CA  
324  C C   . LEU A 56  ? 1.9894 1.5163 1.1964 -0.2600 0.1366  0.2641  56  LEU A C   
325  O O   . LEU A 56  ? 2.0121 1.4742 1.1472 -0.2582 0.1318  0.2754  56  LEU A O   
326  C CB  . LEU A 56  ? 1.9598 1.5058 1.2456 -0.2624 0.1180  0.2570  56  LEU A CB  
327  C CG  . LEU A 56  ? 2.0006 1.4814 1.2456 -0.2374 0.0940  0.2576  56  LEU A CG  
328  C CD1 . LEU A 56  ? 2.0675 1.4752 1.2466 -0.2577 0.0921  0.2743  56  LEU A CD1 
329  C CD2 . LEU A 56  ? 1.9380 1.4329 1.2313 -0.2187 0.0773  0.2457  56  LEU A CD2 
330  N N   . TYR A 57  ? 1.9169 1.5031 1.1730 -0.2393 0.1369  0.2484  57  TYR A N   
331  C CA  . TYR A 57  ? 1.9258 1.5128 1.1574 -0.2155 0.1351  0.2420  57  TYR A CA  
332  C C   . TYR A 57  ? 1.9637 1.5122 1.1190 -0.2355 0.1520  0.2567  57  TYR A C   
333  O O   . TYR A 57  ? 2.0095 1.4988 1.0982 -0.2198 0.1403  0.2628  57  TYR A O   
334  C CB  . TYR A 57  ? 1.9180 1.5874 1.2187 -0.2060 0.1438  0.2247  57  TYR A CB  
335  C CG  . TYR A 57  ? 2.0033 1.6824 1.2921 -0.1766 0.1388  0.2132  57  TYR A CG  
336  C CD1 . TYR A 57  ? 2.0231 1.6878 1.3224 -0.1391 0.1145  0.2014  57  TYR A CD1 
337  C CD2 . TYR A 57  ? 2.0215 1.7267 1.2914 -0.1863 0.1589  0.2117  57  TYR A CD2 
338  C CE1 . TYR A 57  ? 2.0127 1.6873 1.3046 -0.1109 0.1081  0.1883  57  TYR A CE1 
339  C CE2 . TYR A 57  ? 2.0142 1.7295 1.2729 -0.1578 0.1530  0.1994  57  TYR A CE2 
340  C CZ  . TYR A 57  ? 1.9936 1.6931 1.2639 -0.1195 0.1265  0.1876  57  TYR A CZ  
341  O OH  . TYR A 57  ? 1.9695 1.6795 1.2320 -0.0896 0.1185  0.1728  57  TYR A OH  
342  N N   . LEU A 58  ? 1.9102 1.4913 1.0749 -0.2704 0.1795  0.2616  58  LEU A N   
343  C CA  . LEU A 58  ? 1.9113 1.4623 1.0075 -0.2945 0.2019  0.2754  58  LEU A CA  
344  C C   . LEU A 58  ? 2.0477 1.5041 1.0614 -0.3037 0.1936  0.2967  58  LEU A C   
345  O O   . LEU A 58  ? 2.1497 1.5545 1.0861 -0.2998 0.1952  0.3073  58  LEU A O   
346  C CB  . LEU A 58  ? 1.7745 1.3782 0.9062 -0.3342 0.2335  0.2748  58  LEU A CB  
347  C CG  . LEU A 58  ? 1.6196 1.3163 0.8298 -0.3261 0.2421  0.2529  58  LEU A CG  
348  C CD1 . LEU A 58  ? 1.5617 1.3088 0.8071 -0.3653 0.2721  0.2495  58  LEU A CD1 
349  C CD2 . LEU A 58  ? 1.6202 1.3285 0.8067 -0.3007 0.2425  0.2442  58  LEU A CD2 
350  N N   . VAL A 59  ? 2.0671 1.4993 1.0959 -0.3149 0.1836  0.3024  59  VAL A N   
351  C CA  . VAL A 59  ? 2.1645 1.5082 1.1219 -0.3274 0.1760  0.3220  59  VAL A CA  
352  C C   . VAL A 59  ? 2.2021 1.4792 1.1023 -0.2911 0.1463  0.3237  59  VAL A C   
353  O O   . VAL A 59  ? 2.2874 1.4892 1.1043 -0.2967 0.1442  0.3408  59  VAL A O   
354  C CB  . VAL A 59  ? 2.1067 1.4436 1.0996 -0.3449 0.1693  0.3241  59  VAL A CB  
355  C CG1 . VAL A 59  ? 2.1624 1.4050 1.0875 -0.3466 0.1521  0.3401  59  VAL A CG1 
356  C CG2 . VAL A 59  ? 2.0706 1.4516 1.0984 -0.3871 0.1992  0.3262  59  VAL A CG2 
357  N N   . THR A 60  ? 2.0961 1.3998 1.0416 -0.2540 0.1232  0.3053  60  THR A N   
358  C CA  . THR A 60  ? 2.0559 1.3051 0.9602 -0.2162 0.0929  0.3009  60  THR A CA  
359  C C   . THR A 60  ? 2.0963 1.3261 0.9384 -0.2020 0.0959  0.3032  60  THR A C   
360  O O   . THR A 60  ? 2.1363 1.2887 0.8994 -0.1907 0.0801  0.3135  60  THR A O   
361  C CB  . THR A 60  ? 1.8819 1.1726 0.8579 -0.1818 0.0717  0.2776  60  THR A CB  
362  O OG1 . THR A 60  ? 1.8351 1.2029 0.8642 -0.1726 0.0843  0.2632  60  THR A OG1 
363  C CG2 . THR A 60  ? 1.7667 1.0739 0.7968 -0.1951 0.0691  0.2757  60  THR A CG2 
364  N N   . ASN A 61  ? 2.0360 1.3347 0.9124 -0.2015 0.1146  0.2929  61  ASN A N   
365  C CA  . ASN A 61  ? 2.0807 1.3686 0.8994 -0.1908 0.1212  0.2941  61  ASN A CA  
366  C C   . ASN A 61  ? 2.2022 1.4363 0.9351 -0.2257 0.1441  0.3195  61  ASN A C   
367  O O   . ASN A 61  ? 2.2972 1.4879 0.9517 -0.2166 0.1439  0.3271  61  ASN A O   
368  C CB  . ASN A 61  ? 2.0197 1.3988 0.9010 -0.1858 0.1382  0.2759  61  ASN A CB  
369  C CG  . ASN A 61  ? 1.9560 1.3794 0.9106 -0.1476 0.1151  0.2512  61  ASN A CG  
370  O OD1 . ASN A 61  ? 1.9395 1.3244 0.8926 -0.1221 0.0865  0.2461  61  ASN A OD1 
371  N ND2 . ASN A 61  ? 1.9130 1.4178 0.9346 -0.1438 0.1276  0.2347  61  ASN A ND2 
372  N N   . ALA A 62  ? 2.1946 1.4314 0.9424 -0.2660 0.1644  0.3322  62  ALA A N   
373  C CA  . ALA A 62  ? 2.2432 1.4216 0.9132 -0.3029 0.1866  0.3574  62  ALA A CA  
374  C C   . ALA A 62  ? 2.2835 1.3587 0.8787 -0.2907 0.1583  0.3729  62  ALA A C   
375  O O   . ALA A 62  ? 2.4191 1.4220 0.9212 -0.3024 0.1643  0.3936  62  ALA A O   
376  C CB  . ALA A 62  ? 2.2182 1.4318 0.9362 -0.3476 0.2135  0.3625  62  ALA A CB  
377  N N   . LEU A 63  ? 2.1895 1.2573 0.8256 -0.2668 0.1271  0.3619  63  LEU A N   
378  C CA  . LEU A 63  ? 2.2720 1.2470 0.8486 -0.2509 0.0957  0.3713  63  LEU A CA  
379  C C   . LEU A 63  ? 2.3701 1.3025 0.8894 -0.2083 0.0687  0.3653  63  LEU A C   
380  O O   . LEU A 63  ? 2.4421 1.2863 0.8686 -0.2054 0.0568  0.3823  63  LEU A O   
381  C CB  . LEU A 63  ? 2.1714 1.1579 0.8152 -0.2402 0.0730  0.3584  63  LEU A CB  
382  C CG  . LEU A 63  ? 2.0827 1.0746 0.7539 -0.2821 0.0910  0.3694  63  LEU A CG  
383  C CD1 . LEU A 63  ? 1.9114 0.9329 0.6588 -0.2709 0.0723  0.3531  63  LEU A CD1 
384  C CD2 . LEU A 63  ? 2.1407 1.0359 0.7229 -0.3052 0.0914  0.3954  63  LEU A CD2 
385  N N   . PHE A 64  ? 2.3372 1.3304 0.9120 -0.1745 0.0579  0.3404  64  PHE A N   
386  C CA  . PHE A 64  ? 2.3515 1.3142 0.8822 -0.1312 0.0313  0.3296  64  PHE A CA  
387  C C   . PHE A 64  ? 2.3482 1.2837 0.7916 -0.1392 0.0493  0.3444  64  PHE A C   
388  O O   . PHE A 64  ? 2.2959 1.1511 0.6491 -0.1211 0.0291  0.3537  64  PHE A O   
389  C CB  . PHE A 64  ? 2.2351 1.2755 0.8525 -0.0968 0.0197  0.2983  64  PHE A CB  
390  C CG  . PHE A 64  ? 2.1577 1.1993 0.8353 -0.0738 -0.0090 0.2809  64  PHE A CG  
391  C CD1 . PHE A 64  ? 2.0486 1.1565 0.8188 -0.0861 0.0016  0.2714  64  PHE A CD1 
392  C CD2 . PHE A 64  ? 2.1805 1.1567 0.8211 -0.0393 -0.0467 0.2726  64  PHE A CD2 
393  C CE1 . PHE A 64  ? 1.9459 1.0550 0.7680 -0.0661 -0.0219 0.2551  64  PHE A CE1 
394  C CE2 . PHE A 64  ? 2.0898 1.0704 0.7887 -0.0193 -0.0706 0.2539  64  PHE A CE2 
395  C CZ  . PHE A 64  ? 1.9643 1.0115 0.7526 -0.0337 -0.0566 0.2458  64  PHE A CZ  
396  N N   . ALA A 65  ? 2.3621 1.3643 0.8317 -0.1654 0.0866  0.3454  65  ALA A N   
397  C CA  . ALA A 65  ? 2.4429 1.4247 0.8316 -0.1802 0.1110  0.3601  65  ALA A CA  
398  C C   . ALA A 65  ? 2.6161 1.4930 0.9019 -0.2025 0.1114  0.3911  65  ALA A C   
399  O O   . ALA A 65  ? 2.7466 1.5613 0.9321 -0.1975 0.1113  0.4054  65  ALA A O   
400  C CB  . ALA A 65  ? 2.3754 1.4392 0.8140 -0.2174 0.1552  0.3591  65  ALA A CB  
401  N N   . LEU A 66  ? 2.6458 1.5017 0.9564 -0.2269 0.1112  0.4013  66  LEU A N   
402  C CA  . LEU A 66  ? 2.8092 1.5663 1.0339 -0.2519 0.1117  0.4306  66  LEU A CA  
403  C C   . LEU A 66  ? 2.9297 1.5958 1.0934 -0.2127 0.0642  0.4317  66  LEU A C   
404  O O   . LEU A 66  ? 3.0218 1.5903 1.0902 -0.2226 0.0577  0.4562  66  LEU A O   
405  C CB  . LEU A 66  ? 2.7098 1.4831 0.9926 -0.2897 0.1261  0.4369  66  LEU A CB  
406  C CG  . LEU A 66  ? 2.7227 1.4139 0.9356 -0.3300 0.1403  0.4674  66  LEU A CG  
407  C CD1 . LEU A 66  ? 2.7464 1.4352 0.8999 -0.3655 0.1841  0.4857  66  LEU A CD1 
408  C CD2 . LEU A 66  ? 2.6199 1.3415 0.9106 -0.3588 0.1477  0.4650  66  LEU A CD2 
409  N N   . ALA A 67  ? 2.8929 1.5908 1.1138 -0.1685 0.0309  0.4039  67  ALA A N   
410  C CA  . ALA A 67  ? 2.9580 1.5804 1.1342 -0.1263 -0.0168 0.3975  67  ALA A CA  
411  C C   . ALA A 67  ? 3.1133 1.6947 1.2035 -0.0950 -0.0310 0.3974  67  ALA A C   
412  O O   . ALA A 67  ? 3.2279 1.7091 1.2192 -0.0839 -0.0538 0.4132  67  ALA A O   
413  C CB  . ALA A 67  ? 2.7844 1.4581 1.0599 -0.0932 -0.0448 0.3655  67  ALA A CB  
414  N N   . TYR A 68  ? 3.0972 1.7541 1.2235 -0.0798 -0.0192 0.3790  68  TYR A N   
415  C CA  . TYR A 68  ? 3.1641 1.7916 1.2140 -0.0484 -0.0322 0.3754  68  TYR A CA  
416  C C   . TYR A 68  ? 3.2559 1.8116 1.1835 -0.0782 -0.0080 0.4099  68  TYR A C   
417  O O   . TYR A 68  ? 3.3219 1.8161 1.1538 -0.0537 -0.0250 0.4152  68  TYR A O   
418  C CB  . TYR A 68  ? 3.0903 1.8202 1.2091 -0.0320 -0.0189 0.3490  68  TYR A CB  
419  C CG  . TYR A 68  ? 2.9767 1.7795 1.2169 -0.0054 -0.0381 0.3161  68  TYR A CG  
420  C CD1 . TYR A 68  ? 2.8965 1.7922 1.2406 -0.0296 -0.0106 0.3077  68  TYR A CD1 
421  C CD2 . TYR A 68  ? 2.9511 1.7284 1.2020 0.0435  -0.0838 0.2927  68  TYR A CD2 
422  C CE1 . TYR A 68  ? 2.7687 1.7265 1.2184 -0.0067 -0.0263 0.2799  68  TYR A CE1 
423  C CE2 . TYR A 68  ? 2.8391 1.6821 1.2009 0.0652  -0.0978 0.2627  68  TYR A CE2 
424  C CZ  . TYR A 68  ? 2.7354 1.6668 1.1935 0.0393  -0.0681 0.2579  68  TYR A CZ  
425  O OH  . TYR A 68  ? 2.6003 1.5926 1.1634 0.0594  -0.0803 0.2304  68  TYR A OH  
426  N N   . LEU A 69  ? 3.2548 1.8183 1.1858 -0.1313 0.0321  0.4326  69  LEU A N   
427  C CA  . LEU A 69  ? 3.3792 1.8708 1.1980 -0.1665 0.0595  0.4673  69  LEU A CA  
428  C C   . LEU A 69  ? 3.4880 1.8660 1.2374 -0.1743 0.0370  0.4917  69  LEU A C   
429  O O   . LEU A 69  ? 3.6737 1.9586 1.3043 -0.1852 0.0406  0.5199  69  LEU A O   
430  C CB  . LEU A 69  ? 3.3304 1.8886 1.1895 -0.2216 0.1164  0.4771  69  LEU A CB  
431  C CG  . LEU A 69  ? 3.2390 1.8975 1.1432 -0.2208 0.1451  0.4580  69  LEU A CG  
432  C CD1 . LEU A 69  ? 3.2242 1.9313 1.1518 -0.2784 0.2011  0.4700  69  LEU A CD1 
433  C CD2 . LEU A 69  ? 3.3086 1.9279 1.1145 -0.1918 0.1363  0.4591  69  LEU A CD2 
434  N N   . ALA A 70  ? 3.3772 1.7619 1.1996 -0.1689 0.0141  0.4809  70  ALA A N   
435  C CA  . ALA A 70  ? 3.4264 1.7081 1.1956 -0.1715 -0.0127 0.4987  70  ALA A CA  
436  C C   . ALA A 70  ? 3.5479 1.7330 1.2137 -0.1276 -0.0561 0.5015  70  ALA A C   
437  O O   . ALA A 70  ? 3.6673 1.7431 1.2351 -0.1355 -0.0686 0.5280  70  ALA A O   
438  C CB  . ALA A 70  ? 3.3110 1.6265 1.1825 -0.1620 -0.0356 0.4782  70  ALA A CB  
439  N N   . CYS A 71  ? 3.5371 1.7630 1.2275 -0.0803 -0.0804 0.4727  71  CYS A N   
440  C CA  . CYS A 71  ? 3.6732 1.8213 1.2662 -0.0358 -0.1190 0.4711  71  CYS A CA  
441  C C   . CYS A 71  ? 3.7460 1.9065 1.2691 -0.0422 -0.0892 0.4815  71  CYS A C   
442  O O   . CYS A 71  ? 3.7163 1.9598 1.2870 -0.0751 -0.0425 0.4822  71  CYS A O   
443  C CB  . CYS A 71  ? 3.5878 1.7710 1.2509 0.0219  -0.1660 0.4299  71  CYS A CB  
444  S SG  . CYS A 71  ? 3.3943 1.7314 1.2282 0.0225  -0.1469 0.3936  71  CYS A SG  
445  N N   . GLY A 72  ? 3.8279 1.9060 1.2377 -0.0105 -0.1165 0.4883  72  GLY A N   
446  C CA  . GLY A 72  ? 3.9059 1.9878 1.2377 -0.0148 -0.0898 0.4983  72  GLY A CA  
447  C C   . GLY A 72  ? 3.8229 2.0355 1.2521 -0.0075 -0.0671 0.4679  72  GLY A C   
448  O O   . GLY A 72  ? 3.6991 1.9991 1.2569 -0.0023 -0.0695 0.4415  72  GLY A O   
449  N N   . ASP A 73  ? 3.9040 2.1281 1.2694 -0.0070 -0.0450 0.4716  73  ASP A N   
450  C CA  . ASP A 73  ? 3.7772 2.1193 1.2239 0.0034  -0.0258 0.4418  73  ASP A CA  
451  C C   . ASP A 73  ? 3.6242 2.0029 1.1406 0.0643  -0.0756 0.4006  73  ASP A C   
452  O O   . ASP A 73  ? 3.7299 2.0839 1.1876 0.1065  -0.1025 0.3872  73  ASP A O   
453  C CB  . ASP A 73  ? 3.8783 2.2070 1.2224 -0.0020 0.0008  0.4536  73  ASP A CB  
454  C CG  . ASP A 73  ? 3.9886 2.2368 1.2200 -0.0528 0.0381  0.4986  73  ASP A CG  
455  O OD1 . ASP A 73  ? 4.0797 2.2518 1.1775 -0.0453 0.0377  0.5170  73  ASP A OD1 
456  O OD2 . ASP A 73  ? 3.9742 2.2333 1.2494 -0.1002 0.0677  0.5153  73  ASP A OD2 
457  N N   . VAL A 74  ? 3.3468 1.7834 0.9870 0.0689  -0.0873 0.3796  74  VAL A N   
458  C CA  . VAL A 74  ? 3.1848 1.6461 0.8924 0.1242  -0.1351 0.3411  74  VAL A CA  
459  C C   . VAL A 74  ? 3.1150 1.6883 0.9127 0.1443  -0.1261 0.3068  74  VAL A C   
460  O O   . VAL A 74  ? 3.1420 1.7233 0.9548 0.1945  -0.1630 0.2764  74  VAL A O   
461  C CB  . VAL A 74  ? 3.0313 1.5000 0.8291 0.1242  -0.1548 0.3312  74  VAL A CB  
462  C CG1 . VAL A 74  ? 2.9683 1.4743 0.8459 0.1782  -0.1977 0.2883  74  VAL A CG1 
463  C CG2 . VAL A 74  ? 3.0882 1.4417 0.8009 0.1121  -0.1725 0.3600  74  VAL A CG2 
464  N N   . ILE A 75  ? 3.0287 1.6887 0.8904 0.1062  -0.0789 0.3095  75  ILE A N   
465  C CA  . ILE A 75  ? 2.9094 1.6773 0.8633 0.1239  -0.0704 0.2768  75  ILE A CA  
466  C C   . ILE A 75  ? 2.9638 1.7369 0.8414 0.1298  -0.0540 0.2775  75  ILE A C   
467  O O   . ILE A 75  ? 3.0827 1.8127 0.8660 0.0962  -0.0237 0.3079  75  ILE A O   
468  C CB  . ILE A 75  ? 2.8108 1.6771 0.8830 0.0861  -0.0327 0.2734  75  ILE A CB  
469  C CG1 . ILE A 75  ? 2.8848 1.7636 0.9167 0.0324  0.0201  0.3009  75  ILE A CG1 
470  C CG2 . ILE A 75  ? 2.7443 1.5983 0.8792 0.0769  -0.0465 0.2761  75  ILE A CG2 
471  C CD1 . ILE A 75  ? 2.8136 1.7648 0.9478 -0.0087 0.0522  0.3032  75  ILE A CD1 
472  N N   . GLU A 76  ? 2.8817 1.7064 0.8000 0.1727  -0.0742 0.2427  76  GLU A N   
473  C CA  . GLU A 76  ? 2.9125 1.7493 0.7659 0.1852  -0.0632 0.2369  76  GLU A CA  
474  C C   . GLU A 76  ? 2.8183 1.7623 0.7425 0.1532  -0.0141 0.2301  76  GLU A C   
475  O O   . GLU A 76  ? 2.7144 1.7436 0.7656 0.1468  -0.0060 0.2118  76  GLU A O   
476  C CB  . GLU A 76  ? 2.9069 1.7477 0.7710 0.2489  -0.1108 0.1997  76  GLU A CB  
477  C CG  . GLU A 76  ? 2.9958 1.8393 0.7811 0.2675  -0.1055 0.1921  76  GLU A CG  
478  C CD  . GLU A 76  ? 2.9577 1.7984 0.7485 0.3325  -0.1563 0.1542  76  GLU A CD  
479  O OE1 . GLU A 76  ? 2.8952 1.7367 0.7590 0.3627  -0.1942 0.1317  76  GLU A OE1 
480  O OE2 . GLU A 76  ? 2.9876 1.8261 0.7101 0.3533  -0.1576 0.1454  76  GLU A OE2 
481  N N   . ASN A 77  ? 2.8409 1.7775 0.6795 0.1332  0.0181  0.2447  77  ASN A N   
482  C CA  . ASN A 77  ? 2.7303 1.7643 0.6227 0.1031  0.0657  0.2369  77  ASN A CA  
483  C C   . ASN A 77  ? 2.7372 1.7935 0.6598 0.0410  0.1127  0.2620  77  ASN A C   
484  O O   . ASN A 77  ? 2.6291 1.7662 0.6008 0.0126  0.1531  0.2552  77  ASN A O   
485  C CB  . ASN A 77  ? 2.5498 1.6904 0.5749 0.1334  0.0532  0.1943  77  ASN A CB  
486  C CG  . ASN A 77  ? 2.5653 1.6948 0.5650 0.1927  0.0118  0.1655  77  ASN A CG  
487  O OD1 . ASN A 77  ? 2.7324 1.7915 0.6090 0.2083  0.0015  0.1755  77  ASN A OD1 
488  N ND2 . ASN A 77  ? 2.4193 1.6165 0.5343 0.2263  -0.0126 0.1292  77  ASN A ND2 
489  N N   . ALA A 78  ? 2.8689 1.8544 0.7650 0.0213  0.1056  0.2885  78  ALA A N   
490  C CA  . ALA A 78  ? 2.9221 1.9101 0.8271 -0.0379 0.1479  0.3154  78  ALA A CA  
491  C C   . ALA A 78  ? 3.1624 2.0547 0.9213 -0.0671 0.1699  0.3526  78  ALA A C   
492  O O   . ALA A 78  ? 3.2806 2.0757 0.9333 -0.0408 0.1392  0.3652  78  ALA A O   
493  C CB  . ALA A 78  ? 2.8146 1.7876 0.7861 -0.0441 0.1287  0.3205  78  ALA A CB  
494  N N   . ARG A 79  ? 3.2243 2.1422 0.9774 -0.1212 0.2229  0.3695  79  ARG A N   
495  C CA  . ARG A 79  ? 3.3880 2.2163 1.0066 -0.1560 0.2506  0.4067  79  ARG A CA  
496  C C   . ARG A 79  ? 3.4838 2.2184 1.0666 -0.1730 0.2353  0.4364  79  ARG A C   
497  O O   . ARG A 79  ? 3.4301 2.1978 1.1101 -0.1856 0.2308  0.4320  79  ARG A O   
498  C CB  . ARG A 79  ? 3.3396 2.2294 0.9734 -0.2111 0.3146  0.4124  79  ARG A CB  
499  C CG  . ARG A 79  ? 3.2458 2.2327 0.9187 -0.1983 0.3333  0.3817  79  ARG A CG  
500  C CD  . ARG A 79  ? 3.1620 2.2404 0.9113 -0.2500 0.3892  0.3757  79  ARG A CD  
501  N NE  . ARG A 79  ? 3.0207 2.1589 0.9032 -0.2624 0.3842  0.3652  79  ARG A NE  
502  C CZ  . ARG A 79  ? 2.9283 2.1429 0.8935 -0.3058 0.4245  0.3590  79  ARG A CZ  
503  N NH1 . ARG A 79  ? 2.9956 2.2391 0.9287 -0.3428 0.4750  0.3610  79  ARG A NH1 
504  N NH2 . ARG A 79  ? 2.7554 2.0171 0.8345 -0.3122 0.4143  0.3497  79  ARG A NH2 
505  N N   . PRO A 80  ? 3.5910 2.2064 1.0319 -0.1721 0.2259  0.4665  80  PRO A N   
506  C CA  . PRO A 80  ? 3.6656 2.1776 1.0555 -0.1855 0.2081  0.4962  80  PRO A CA  
507  C C   . PRO A 80  ? 3.6414 2.1700 1.0781 -0.2474 0.2504  0.5151  80  PRO A C   
508  O O   . PRO A 80  ? 3.7060 2.2687 1.1324 -0.2925 0.3038  0.5244  80  PRO A O   
509  C CB  . PRO A 80  ? 3.8061 2.1989 1.0239 -0.1816 0.2053  0.5260  80  PRO A CB  
510  C CG  . PRO A 80  ? 3.7604 2.1869 0.9523 -0.1378 0.1914  0.5014  80  PRO A CG  
511  C CD  . PRO A 80  ? 3.6406 2.2091 0.9578 -0.1513 0.2255  0.4715  80  PRO A CD  
512  N N   . GLY A 81  ? 3.5353 2.0412 1.0251 -0.2488 0.2260  0.5185  81  GLY A N   
513  C CA  . GLY A 81  ? 3.5017 2.0085 1.0279 -0.3038 0.2586  0.5370  81  GLY A CA  
514  C C   . GLY A 81  ? 3.3455 1.9798 1.0010 -0.3338 0.2965  0.5160  81  GLY A C   
515  O O   . GLY A 81  ? 3.3458 1.9948 1.0543 -0.3743 0.3179  0.5243  81  GLY A O   
516  N N   . SER A 82  ? 3.1920 1.9175 0.8986 -0.3132 0.3034  0.4877  82  SER A N   
517  C CA  . SER A 82  ? 2.9633 1.8130 0.7976 -0.3348 0.3334  0.4639  82  SER A CA  
518  C C   . SER A 82  ? 2.7549 1.6521 0.7076 -0.3133 0.3004  0.4435  82  SER A C   
519  O O   . SER A 82  ? 2.6399 1.5543 0.6248 -0.2640 0.2612  0.4220  82  SER A O   
520  C CB  . SER A 82  ? 2.8834 1.8136 0.7370 -0.3157 0.3469  0.4382  82  SER A CB  
521  O OG  . SER A 82  ? 2.6943 1.7443 0.6798 -0.3295 0.3673  0.4120  82  SER A OG  
522  N N   . PHE A 83  ? 2.7318 1.6496 0.7484 -0.3506 0.3172  0.4494  83  PHE A N   
523  C CA  . PHE A 83  ? 2.6742 1.6395 0.8027 -0.3354 0.2908  0.4312  83  PHE A CA  
524  C C   . PHE A 83  ? 2.6600 1.7419 0.8972 -0.3144 0.2912  0.3967  83  PHE A C   
525  O O   . PHE A 83  ? 2.5680 1.6815 0.8791 -0.2815 0.2584  0.3774  83  PHE A O   
526  C CB  . PHE A 83  ? 2.6139 1.5833 0.7868 -0.3827 0.3128  0.4434  83  PHE A CB  
527  C CG  . PHE A 83  ? 2.4171 1.4612 0.7170 -0.3743 0.2976  0.4211  83  PHE A CG  
528  C CD1 . PHE A 83  ? 2.3701 1.3726 0.6885 -0.3575 0.2615  0.4232  83  PHE A CD1 
529  C CD2 . PHE A 83  ? 2.2669 1.4219 0.6655 -0.3821 0.3187  0.3974  83  PHE A CD2 
530  C CE1 . PHE A 83  ? 2.2822 1.3508 0.7100 -0.3502 0.2493  0.4037  83  PHE A CE1 
531  C CE2 . PHE A 83  ? 2.1474 1.3653 0.6542 -0.3738 0.3043  0.3788  83  PHE A CE2 
532  C CZ  . PHE A 83  ? 2.1826 1.3570 0.7023 -0.3583 0.2705  0.3826  83  PHE A CZ  
533  N N   . THR A 84  ? 2.7443 1.8899 0.9926 -0.3350 0.3297  0.3885  84  THR A N   
534  C CA  . THR A 84  ? 2.6830 1.9410 1.0350 -0.3190 0.3333  0.3558  84  THR A CA  
535  C C   . THR A 84  ? 2.6833 1.9451 1.0475 -0.2602 0.2899  0.3359  84  THR A C   
536  O O   . THR A 84  ? 2.5653 1.8782 1.0246 -0.2373 0.2669  0.3156  84  THR A O   
537  C CB  . THR A 84  ? 2.7043 2.0153 1.0413 -0.3417 0.3768  0.3488  84  THR A CB  
538  O OG1 . THR A 84  ? 2.7876 2.0850 1.1010 -0.3981 0.4196  0.3681  84  THR A OG1 
539  C CG2 . THR A 84  ? 2.5337 1.9643 0.9894 -0.3295 0.3812  0.3142  84  THR A CG2 
540  N N   . ASP A 85  ? 2.8069 2.0121 1.0725 -0.2364 0.2791  0.3416  85  ASP A N   
541  C CA  . ASP A 85  ? 2.7963 1.9991 1.0630 -0.1796 0.2378  0.3212  85  ASP A CA  
542  C C   . ASP A 85  ? 2.7415 1.9140 1.0495 -0.1516 0.1942  0.3169  85  ASP A C   
543  O O   . ASP A 85  ? 2.7146 1.9377 1.1011 -0.1161 0.1691  0.2902  85  ASP A O   
544  C CB  . ASP A 85  ? 2.9720 2.0963 1.1067 -0.1613 0.2301  0.3335  85  ASP A CB  
545  C CG  . ASP A 85  ? 3.0532 2.2148 1.1480 -0.1812 0.2711  0.3319  85  ASP A CG  
546  O OD1 . ASP A 85  ? 3.0321 2.2732 1.1964 -0.2157 0.3088  0.3244  85  ASP A OD1 
547  O OD2 . ASP A 85  ? 3.1272 2.2387 1.1207 -0.1616 0.2650  0.3368  85  ASP A OD2 
548  N N   . ALA A 86  ? 2.7215 1.8114 0.9778 -0.1682 0.1862  0.3422  86  ALA A N   
549  C CA  . ALA A 86  ? 2.6209 1.6792 0.9128 -0.1441 0.1465  0.3377  86  ALA A CA  
550  C C   . ALA A 86  ? 2.4885 1.6325 0.9111 -0.1515 0.1503  0.3201  86  ALA A C   
551  O O   . ALA A 86  ? 2.3800 1.5350 0.8606 -0.1206 0.1186  0.3031  86  ALA A O   
552  C CB  . ALA A 86  ? 2.6696 1.6252 0.8826 -0.1645 0.1401  0.3680  86  ALA A CB  
553  N N   . PHE A 87  ? 2.4973 1.7018 0.9655 -0.1924 0.1892  0.3231  87  PHE A N   
554  C CA  . PHE A 87  ? 2.4555 1.7364 1.0406 -0.2021 0.1933  0.3087  87  PHE A CA  
555  C C   . PHE A 87  ? 2.4998 1.8702 1.1733 -0.1716 0.1856  0.2774  87  PHE A C   
556  O O   . PHE A 87  ? 2.4688 1.8731 1.2230 -0.1541 0.1661  0.2626  87  PHE A O   
557  C CB  . PHE A 87  ? 2.3858 1.6994 0.9940 -0.2551 0.2341  0.3203  87  PHE A CB  
558  C CG  . PHE A 87  ? 2.2343 1.6082 0.9493 -0.2657 0.2332  0.3094  87  PHE A CG  
559  C CD1 . PHE A 87  ? 2.2312 1.5666 0.9487 -0.2888 0.2305  0.3244  87  PHE A CD1 
560  C CD2 . PHE A 87  ? 2.1266 1.5926 0.9373 -0.2505 0.2330  0.2838  87  PHE A CD2 
561  C CE1 . PHE A 87  ? 2.1544 1.5431 0.9647 -0.2968 0.2283  0.3140  87  PHE A CE1 
562  C CE2 . PHE A 87  ? 2.0371 1.5531 0.9391 -0.2585 0.2305  0.2749  87  PHE A CE2 
563  C CZ  . PHE A 87  ? 2.0466 1.5243 0.9470 -0.2814 0.2282  0.2899  87  PHE A CZ  
564  N N   . PHE A 88  ? 2.5483 1.9565 1.2066 -0.1662 0.2019  0.2672  88  PHE A N   
565  C CA  . PHE A 88  ? 2.4695 1.9616 1.2105 -0.1372 0.1947  0.2367  88  PHE A CA  
566  C C   . PHE A 88  ? 2.4137 1.8782 1.1506 -0.0857 0.1531  0.2215  88  PHE A C   
567  O O   . PHE A 88  ? 2.3098 1.8287 1.1328 -0.0596 0.1367  0.1980  88  PHE A O   
568  C CB  . PHE A 88  ? 2.5277 2.0690 1.2540 -0.1464 0.2240  0.2279  88  PHE A CB  
569  C CG  . PHE A 88  ? 2.5745 2.1664 1.3347 -0.1942 0.2649  0.2330  88  PHE A CG  
570  C CD1 . PHE A 88  ? 2.6953 2.2613 1.3787 -0.2288 0.2992  0.2501  88  PHE A CD1 
571  C CD2 . PHE A 88  ? 2.5002 2.1629 1.3686 -0.2049 0.2689  0.2204  88  PHE A CD2 
572  C CE1 . PHE A 88  ? 2.6976 2.3130 1.4188 -0.2737 0.3376  0.2515  88  PHE A CE1 
573  C CE2 . PHE A 88  ? 2.5049 2.2153 1.4089 -0.2473 0.3039  0.2219  88  PHE A CE2 
574  C CZ  . PHE A 88  ? 2.5948 2.2837 1.4286 -0.2821 0.3386  0.2362  88  PHE A CZ  
575  N N   . PHE A 89  ? 2.4651 1.8432 1.1013 -0.0714 0.1360  0.2347  89  PHE A N   
576  C CA  . PHE A 89  ? 2.4296 1.7666 1.0566 -0.0247 0.0930  0.2218  89  PHE A CA  
577  C C   . PHE A 89  ? 2.3758 1.7137 1.0732 -0.0228 0.0752  0.2189  89  PHE A C   
578  O O   . PHE A 89  ? 2.3111 1.6786 1.0759 0.0102  0.0509  0.1953  89  PHE A O   
579  C CB  . PHE A 89  ? 2.5330 1.7651 1.0338 -0.0167 0.0776  0.2414  89  PHE A CB  
580  C CG  . PHE A 89  ? 2.5655 1.7450 1.0550 0.0283  0.0307  0.2291  89  PHE A CG  
581  C CD1 . PHE A 89  ? 2.5296 1.7388 1.0499 0.0743  0.0056  0.1988  89  PHE A CD1 
582  C CD2 . PHE A 89  ? 2.6440 1.7450 1.0951 0.0250  0.0109  0.2454  89  PHE A CD2 
583  C CE1 . PHE A 89  ? 2.5362 1.6996 1.0517 0.1158  -0.0377 0.1839  89  PHE A CE1 
584  C CE2 . PHE A 89  ? 2.6486 1.7032 1.0933 0.0670  -0.0330 0.2306  89  PHE A CE2 
585  C CZ  . PHE A 89  ? 2.5855 1.6722 1.0634 0.1123  -0.0570 0.1993  89  PHE A CZ  
586  N N   . SER A 90  ? 2.3802 1.6868 1.0624 -0.0597 0.0890  0.2423  90  SER A N   
587  C CA  . SER A 90  ? 2.2213 1.5196 0.9568 -0.0619 0.0737  0.2426  90  SER A CA  
588  C C   . SER A 90  ? 1.9971 1.3839 0.8509 -0.0548 0.0754  0.2204  90  SER A C   
589  O O   . SER A 90  ? 1.9135 1.3000 0.8158 -0.0333 0.0518  0.2081  90  SER A O   
590  C CB  . SER A 90  ? 2.2434 1.5047 0.9480 -0.1072 0.0935  0.2700  90  SER A CB  
591  O OG  . SER A 90  ? 2.1786 1.4206 0.9211 -0.1061 0.0751  0.2702  90  SER A OG  
592  N N   . VAL A 91  ? 1.9607 1.4219 0.8602 -0.0729 0.1034  0.2148  91  VAL A N   
593  C CA  . VAL A 91  ? 1.9058 1.4497 0.9147 -0.0651 0.1043  0.1943  91  VAL A CA  
594  C C   . VAL A 91  ? 1.8792 1.4461 0.9220 -0.0187 0.0802  0.1676  91  VAL A C   
595  O O   . VAL A 91  ? 1.7450 1.3424 0.8631 -0.0004 0.0655  0.1518  91  VAL A O   
596  C CB  . VAL A 91  ? 1.5469 1.1652 0.5985 -0.0952 0.1383  0.1927  91  VAL A CB  
597  C CG1 . VAL A 91  ? 1.6117 1.1972 0.5883 -0.1337 0.1661  0.2154  91  VAL A CG1 
598  C CG2 . VAL A 91  ? 1.4899 1.1718 0.5806 -0.0705 0.1394  0.1684  91  VAL A CG2 
599  N N   . GLN A 92  ? 1.9867 1.5364 0.9712 -0.0003 0.0765  0.1625  92  GLN A N   
600  C CA  . GLN A 92  ? 1.9518 1.5227 0.9635 0.0442  0.0536  0.1352  92  GLN A CA  
601  C C   . GLN A 92  ? 2.0169 1.5327 1.0199 0.0774  0.0170  0.1269  92  GLN A C   
602  O O   . GLN A 92  ? 1.9850 1.5249 1.0371 0.1137  -0.0039 0.1006  92  GLN A O   
603  C CB  . GLN A 92  ? 1.9446 1.5092 0.8883 0.0544  0.0594  0.1319  92  GLN A CB  
604  C CG  . GLN A 92  ? 1.9111 1.5430 0.8762 0.0279  0.0946  0.1313  92  GLN A CG  
605  C CD  . GLN A 92  ? 2.0053 1.6256 0.8922 0.0353  0.1030  0.1296  92  GLN A CD  
606  O OE1 . GLN A 92  ? 2.0474 1.6215 0.8785 0.0692  0.0777  0.1226  92  GLN A OE1 
607  N NE2 . GLN A 92  ? 2.0211 1.6835 0.9029 0.0038  0.1386  0.1346  92  GLN A NE2 
608  N N   . THR A 93  ? 2.1136 1.5560 1.0569 0.0651  0.0091  0.1473  93  THR A N   
609  C CA  . THR A 93  ? 2.1494 1.5374 1.0845 0.0950  -0.0261 0.1383  93  THR A CA  
610  C C   . THR A 93  ? 2.0683 1.4745 1.0797 0.0871  -0.0291 0.1353  93  THR A C   
611  O O   . THR A 93  ? 2.0495 1.4421 1.0933 0.1152  -0.0549 0.1174  93  THR A O   
612  C CB  . THR A 93  ? 2.8558 2.1448 1.6782 0.0922  -0.0393 0.1595  93  THR A CB  
613  O OG1 . THR A 93  ? 2.8487 2.0889 1.6756 0.1160  -0.0724 0.1503  93  THR A OG1 
614  C CG2 . THR A 93  ? 2.9007 2.1672 1.6825 0.0439  -0.0113 0.1916  93  THR A CG2 
615  N N   . MET A 94  ? 1.9931 1.4306 1.0334 0.0489  -0.0025 0.1513  94  MET A N   
616  C CA  . MET A 94  ? 1.8980 1.3488 1.0008 0.0395  -0.0044 0.1506  94  MET A CA  
617  C C   . MET A 94  ? 1.8302 1.3644 1.0337 0.0458  0.0041  0.1322  94  MET A C   
618  O O   . MET A 94  ? 1.8444 1.3930 1.1071 0.0503  -0.0027 0.1243  94  MET A O   
619  C CB  . MET A 94  ? 1.9039 1.3347 0.9808 -0.0036 0.0151  0.1774  94  MET A CB  
620  C CG  . MET A 94  ? 1.8762 1.2983 0.9944 -0.0100 0.0068  0.1780  94  MET A CG  
621  S SD  . MET A 94  ? 2.6137 2.0142 1.7056 -0.0593 0.0277  0.2063  94  MET A SD  
622  C CE  . MET A 94  ? 1.2934 0.7753 0.4260 -0.0866 0.0624  0.2089  94  MET A CE  
623  N N   . ALA A 95  ? 1.7588 1.3458 0.9798 0.0462  0.0189  0.1252  95  ALA A N   
624  C CA  . ALA A 95  ? 1.6157 1.2807 0.9307 0.0537  0.0257  0.1073  95  ALA A CA  
625  C C   . ALA A 95  ? 1.5808 1.2610 0.9277 0.0966  0.0050  0.0789  95  ALA A C   
626  O O   . ALA A 95  ? 1.4782 1.2187 0.9028 0.1080  0.0075  0.0614  95  ALA A O   
627  C CB  . ALA A 95  ? 1.5572 1.2777 0.8851 0.0283  0.0537  0.1128  95  ALA A CB  
628  N N   . THR A 96  ? 1.6390 1.2619 0.9257 0.1208  -0.0169 0.0739  96  THR A N   
629  C CA  . THR A 96  ? 1.5880 1.2176 0.8975 0.1637  -0.0401 0.0449  96  THR A CA  
630  C C   . THR A 96  ? 1.5862 1.2800 0.9306 0.1742  -0.0304 0.0287  96  THR A C   
631  O O   . THR A 96  ? 1.4885 1.2275 0.9097 0.1972  -0.0380 0.0040  96  THR A O   
632  C CB  . THR A 96  ? 1.4058 1.0466 0.7921 0.1831  -0.0555 0.0254  96  THR A CB  
633  O OG1 . THR A 96  ? 1.3287 1.0375 0.8002 0.1705  -0.0375 0.0219  96  THR A OG1 
634  C CG2 . THR A 96  ? 1.3431 0.9278 0.7031 0.1718  -0.0637 0.0387  96  THR A CG2 
635  N N   . ILE A 97  ? 1.6799 1.3773 0.9685 0.1567  -0.0127 0.0418  97  ILE A N   
636  C CA  . ILE A 97  ? 1.6999 1.4508 1.0069 0.1698  -0.0058 0.0244  97  ILE A CA  
637  C C   . ILE A 97  ? 1.7317 1.4389 0.9703 0.2035  -0.0285 0.0122  97  ILE A C   
638  O O   . ILE A 97  ? 1.6862 1.4202 0.9637 0.2384  -0.0454 -0.0165 97  ILE A O   
639  C CB  . ILE A 97  ? 1.6892 1.4717 0.9734 0.1334  0.0271  0.0413  97  ILE A CB  
640  C CG1 . ILE A 97  ? 1.6924 1.4819 1.0018 0.0943  0.0460  0.0630  97  ILE A CG1 
641  C CG2 . ILE A 97  ? 1.5471 1.4080 0.8907 0.1438  0.0366  0.0188  97  ILE A CG2 
642  C CD1 . ILE A 97  ? 1.7409 1.5474 1.0159 0.0555  0.0777  0.0810  97  ILE A CD1 
643  N N   . GLY A 98  ? 1.7888 1.4267 0.9243 0.1930  -0.0297 0.0338  98  GLY A N   
644  C CA  . GLY A 98  ? 1.9455 1.5292 1.0026 0.2247  -0.0541 0.0257  98  GLY A CA  
645  C C   . GLY A 98  ? 2.0339 1.6565 1.0843 0.2467  -0.0535 0.0053  98  GLY A C   
646  O O   . GLY A 98  ? 2.0863 1.7034 1.1433 0.2885  -0.0818 -0.0214 98  GLY A O   
647  N N   . TYR A 99  ? 2.0325 1.6953 1.0704 0.2195  -0.0217 0.0153  99  TYR A N   
648  C CA  . TYR A 99  ? 2.0227 1.7229 1.0490 0.2389  -0.0193 -0.0045 99  TYR A CA  
649  C C   . TYR A 99  ? 2.1279 1.7699 1.0745 0.2785  -0.0502 -0.0160 99  TYR A C   
650  O O   . TYR A 99  ? 2.1103 1.7782 1.0980 0.3187  -0.0737 -0.0485 99  TYR A O   
651  C CB  . TYR A 99  ? 2.0616 1.7775 1.0347 0.2021  0.0178  0.0149  99  TYR A CB  
652  C CG  . TYR A 99  ? 2.0093 1.7949 1.0611 0.1652  0.0496  0.0204  99  TYR A CG  
653  C CD1 . TYR A 99  ? 2.0331 1.7964 1.0622 0.1218  0.0724  0.0505  99  TYR A CD1 
654  C CD2 . TYR A 99  ? 1.9483 1.8212 1.0969 0.1744  0.0554  -0.0057 99  TYR A CD2 
655  C CE1 . TYR A 99  ? 1.9698 1.7964 1.0701 0.0895  0.0991  0.0535  99  TYR A CE1 
656  C CE2 . TYR A 99  ? 1.8841 1.8184 1.1027 0.1425  0.0815  -0.0017 99  TYR A CE2 
657  C CZ  . TYR A 99  ? 1.8948 1.8061 1.0886 0.1006  0.1029  0.0275  99  TYR A CZ  
658  O OH  . TYR A 99  ? 1.8247 1.7965 1.0884 0.0705  0.1262  0.0293  99  TYR A OH  
659  N N   . GLY A 100 ? 2.2544 1.8159 1.0855 0.2673  -0.0509 0.0104  100 GLY A N   
660  C CA  . GLY A 100 ? 2.3572 1.8539 1.0980 0.3039  -0.0814 0.0029  100 GLY A CA  
661  C C   . GLY A 100 ? 2.4547 1.9091 1.0702 0.2900  -0.0645 0.0240  100 GLY A C   
662  O O   . GLY A 100 ? 2.5786 1.9755 1.1086 0.3211  -0.0902 0.0190  100 GLY A O   
663  N N   . LYS A 101 ? 2.4044 1.8862 1.0077 0.2438  -0.0214 0.0464  101 LYS A N   
664  C CA  . LYS A 101 ? 2.4647 1.8939 0.9437 0.2174  0.0024  0.0754  101 LYS A CA  
665  C C   . LYS A 101 ? 2.5638 1.8984 0.9665 0.1951  -0.0014 0.1109  101 LYS A C   
666  O O   . LYS A 101 ? 2.6357 1.8832 0.9395 0.2162  -0.0275 0.1200  101 LYS A O   
667  C CB  . LYS A 101 ? 2.3199 1.8203 0.8261 0.1751  0.0515  0.0818  101 LYS A CB  
668  C CG  . LYS A 101 ? 2.2145 1.7604 0.6976 0.1892  0.0634  0.0617  101 LYS A CG  
669  C CD  . LYS A 101 ? 2.3178 1.7972 0.6554 0.1718  0.0828  0.0873  101 LYS A CD  
670  C CE  . LYS A 101 ? 2.3389 1.8732 0.6558 0.1775  0.1038  0.0682  101 LYS A CE  
671  N NZ  . LYS A 101 ? 2.4390 1.8963 0.6009 0.1773  0.1103  0.0873  101 LYS A NZ  
672  N N   . LEU A 102 ? 2.5580 1.9090 1.0063 0.1531  0.0235  0.1301  102 LEU A N   
673  C CA  . LEU A 102 ? 2.6257 1.8945 1.0199 0.1316  0.0189  0.1607  102 LEU A CA  
674  C C   . LEU A 102 ? 2.6143 1.8457 1.0399 0.1684  -0.0270 0.1470  102 LEU A C   
675  O O   . LEU A 102 ? 2.5588 1.8419 1.0931 0.1733  -0.0336 0.1304  102 LEU A O   
676  C CB  . LEU A 102 ? 2.5543 1.8587 1.0006 0.0797  0.0555  0.1798  102 LEU A CB  
677  C CG  . LEU A 102 ? 2.5732 1.8929 0.9705 0.0355  0.1026  0.1992  102 LEU A CG  
678  C CD1 . LEU A 102 ? 2.5312 1.8945 0.9987 -0.0112 0.1337  0.2112  102 LEU A CD1 
679  C CD2 . LEU A 102 ? 2.6690 1.8864 0.9204 0.0249  0.1056  0.2290  102 LEU A CD2 
680  N N   . ILE A 103 ? 2.6395 1.7789 0.9676 0.1937  -0.0582 0.1537  103 ILE A N   
681  C CA  . ILE A 103 ? 2.5438 1.6466 0.8938 0.2373  -0.1065 0.1333  103 ILE A CA  
682  C C   . ILE A 103 ? 2.6046 1.5933 0.8540 0.2351  -0.1279 0.1592  103 ILE A C   
683  O O   . ILE A 103 ? 2.7770 1.7052 0.9166 0.2128  -0.1122 0.1892  103 ILE A O   
684  C CB  . ILE A 103 ? 2.4012 1.5204 0.7487 0.2898  -0.1357 0.0989  103 ILE A CB  
685  C CG1 . ILE A 103 ? 2.3553 1.4805 0.7809 0.3332  -0.1783 0.0652  103 ILE A CG1 
686  C CG2 . ILE A 103 ? 2.5358 1.5729 0.7388 0.3043  -0.1478 0.1126  103 ILE A CG2 
687  C CD1 . ILE A 103 ? 2.3841 1.5302 0.8189 0.3847  -0.2077 0.0279  103 ILE A CD1 
688  N N   . PRO A 104 ? 2.4845 1.4425 0.7716 0.2568  -0.1625 0.1476  104 PRO A N   
689  C CA  . PRO A 104 ? 2.6120 1.4628 0.8116 0.2554  -0.1852 0.1701  104 PRO A CA  
690  C C   . PRO A 104 ? 2.8571 1.6253 0.9469 0.2961  -0.2229 0.1661  104 PRO A C   
691  O O   . PRO A 104 ? 2.9304 1.7258 1.0151 0.3289  -0.2343 0.1428  104 PRO A O   
692  C CB  . PRO A 104 ? 2.4801 1.3397 0.7711 0.2708  -0.2114 0.1501  104 PRO A CB  
693  C CG  . PRO A 104 ? 2.3498 1.3195 0.7709 0.2683  -0.1927 0.1262  104 PRO A CG  
694  C CD  . PRO A 104 ? 2.3323 1.3528 0.7465 0.2795  -0.1793 0.1142  104 PRO A CD  
695  N N   . ILE A 105 ? 2.9577 1.6229 0.9564 0.2923  -0.2417 0.1901  105 ILE A N   
696  C CA  . ILE A 105 ? 3.0717 1.6423 0.9560 0.3300  -0.2819 0.1903  105 ILE A CA  
697  C C   . ILE A 105 ? 3.1450 1.6247 0.9962 0.3368  -0.3164 0.1997  105 ILE A C   
698  O O   . ILE A 105 ? 3.1178 1.5724 0.9632 0.2958  -0.2957 0.2281  105 ILE A O   
699  C CB  . ILE A 105 ? 3.1783 1.6991 0.9307 0.3072  -0.2559 0.2243  105 ILE A CB  
700  C CG1 . ILE A 105 ? 3.1515 1.7175 0.8893 0.3362  -0.2558 0.2019  105 ILE A CG1 
701  C CG2 . ILE A 105 ? 3.3494 1.7366 0.9677 0.3166  -0.2864 0.2495  105 ILE A CG2 
702  C CD1 . ILE A 105 ? 3.2377 1.7892 0.8742 0.3040  -0.2146 0.2321  105 ILE A CD1 
703  N N   . GLY A 106 ? 3.2446 1.6755 1.0764 0.3893  -0.3703 0.1738  106 GLY A N   
704  C CA  . GLY A 106 ? 3.3382 1.6808 1.1382 0.4012  -0.4083 0.1781  106 GLY A CA  
705  C C   . GLY A 106 ? 3.1918 1.5850 1.1212 0.3999  -0.4145 0.1551  106 GLY A C   
706  O O   . GLY A 106 ? 2.9058 1.3977 0.9428 0.3809  -0.3831 0.1441  106 GLY A O   
707  N N   . PRO A 107 ? 3.3539 1.6769 1.2699 0.4202  -0.4554 0.1479  107 PRO A N   
708  C CA  . PRO A 107 ? 3.2884 1.6492 1.3183 0.4202  -0.4638 0.1254  107 PRO A CA  
709  C C   . PRO A 107 ? 3.3054 1.6976 1.3773 0.3630  -0.4194 0.1537  107 PRO A C   
710  O O   . PRO A 107 ? 3.2436 1.7148 1.4314 0.3537  -0.4044 0.1354  107 PRO A O   
711  C CB  . PRO A 107 ? 3.3717 1.6307 1.3462 0.4527  -0.5182 0.1172  107 PRO A CB  
712  C CG  . PRO A 107 ? 3.5056 1.7085 1.3830 0.4939  -0.5510 0.1107  107 PRO A CG  
713  C CD  . PRO A 107 ? 3.5371 1.7561 1.3469 0.4631  -0.5071 0.1437  107 PRO A CD  
714  N N   . LEU A 108 ? 3.3761 1.7047 1.3538 0.3255  -0.3992 0.1973  108 LEU A N   
715  C CA  . LEU A 108 ? 3.2920 1.6440 1.3039 0.2714  -0.3592 0.2239  108 LEU A CA  
716  C C   . LEU A 108 ? 3.0702 1.5343 1.1657 0.2400  -0.3094 0.2241  108 LEU A C   
717  O O   . LEU A 108 ? 2.8498 1.3701 1.0351 0.2162  -0.2900 0.2208  108 LEU A O   
718  C CB  . LEU A 108 ? 3.4731 1.7307 1.3629 0.2376  -0.3470 0.2699  108 LEU A CB  
719  C CG  . LEU A 108 ? 3.5826 1.7204 1.3903 0.2582  -0.3931 0.2771  108 LEU A CG  
720  C CD1 . LEU A 108 ? 3.6913 1.7382 1.3727 0.2221  -0.3751 0.3254  108 LEU A CD1 
721  C CD2 . LEU A 108 ? 3.5098 1.6524 1.3991 0.2582  -0.4109 0.2608  108 LEU A CD2 
722  N N   . ALA A 109 ? 3.1041 1.6002 1.1694 0.2412  -0.2899 0.2268  109 ALA A N   
723  C CA  . ALA A 109 ? 2.9275 1.5291 1.0700 0.2138  -0.2449 0.2251  109 ALA A CA  
724  C C   . ALA A 109 ? 2.6683 1.3582 0.9436 0.2369  -0.2534 0.1862  109 ALA A C   
725  O O   . ALA A 109 ? 2.4937 1.2588 0.8562 0.2096  -0.2233 0.1855  109 ALA A O   
726  C CB  . ALA A 109 ? 3.0238 1.6398 1.1062 0.2158  -0.2267 0.2311  109 ALA A CB  
727  N N   . ASN A 110 ? 2.7277 1.4060 1.0167 0.2877  -0.2950 0.1531  110 ASN A N   
728  C CA  . ASN A 110 ? 2.6501 1.4052 1.0622 0.3122  -0.3048 0.1139  110 ASN A CA  
729  C C   . ASN A 110 ? 2.6051 1.3693 1.0880 0.2949  -0.3035 0.1122  110 ASN A C   
730  O O   . ASN A 110 ? 2.5418 1.3862 1.1288 0.2854  -0.2846 0.0980  110 ASN A O   
731  C CB  . ASN A 110 ? 2.7667 1.4965 1.1738 0.3704  -0.3529 0.0775  110 ASN A CB  
732  C CG  . ASN A 110 ? 2.9046 1.6481 1.2666 0.3926  -0.3540 0.0701  110 ASN A CG  
733  O OD1 . ASN A 110 ? 2.8549 1.6562 1.2273 0.3681  -0.3164 0.0817  110 ASN A OD1 
734  N ND2 . ASN A 110 ? 3.0632 1.7537 1.3747 0.4402  -0.3985 0.0488  110 ASN A ND2 
735  N N   . THR A 111 ? 2.6791 1.3591 1.1036 0.2912  -0.3241 0.1266  111 THR A N   
736  C CA  . THR A 111 ? 2.6762 1.3592 1.1609 0.2757  -0.3248 0.1241  111 THR A CA  
737  C C   . THR A 111 ? 2.6056 1.3423 1.1307 0.2240  -0.2778 0.1487  111 THR A C   
738  O O   . THR A 111 ? 2.5163 1.3105 1.1345 0.2149  -0.2670 0.1357  111 THR A O   
739  C CB  . THR A 111 ? 2.7850 1.3626 1.1919 0.2796  -0.3557 0.1368  111 THR A CB  
740  O OG1 . THR A 111 ? 2.7938 1.3511 1.2343 0.3250  -0.4006 0.0993  111 THR A OG1 
741  C CG2 . THR A 111 ? 2.7302 1.3024 1.1545 0.2362  -0.3338 0.1599  111 THR A CG2 
742  N N   . LEU A 112 ? 2.6305 1.3485 1.0852 0.1904  -0.2499 0.1830  112 LEU A N   
743  C CA  . LEU A 112 ? 2.5096 1.2778 1.0001 0.1414  -0.2061 0.2049  112 LEU A CA  
744  C C   . LEU A 112 ? 2.3473 1.2234 0.9359 0.1416  -0.1828 0.1859  112 LEU A C   
745  O O   . LEU A 112 ? 2.2746 1.2071 0.9380 0.1173  -0.1610 0.1864  112 LEU A O   
746  C CB  . LEU A 112 ? 2.6277 1.3552 1.0233 0.1065  -0.1798 0.2421  112 LEU A CB  
747  C CG  . LEU A 112 ? 2.7486 1.3656 1.0440 0.0969  -0.1965 0.2677  112 LEU A CG  
748  C CD1 . LEU A 112 ? 2.8895 1.4701 1.0904 0.0633  -0.1668 0.3030  112 LEU A CD1 
749  C CD2 . LEU A 112 ? 2.6189 1.2256 0.9564 0.0741  -0.1966 0.2731  112 LEU A CD2 
750  N N   . VAL A 113 ? 2.3451 1.2475 0.9313 0.1702  -0.1892 0.1688  113 VAL A N   
751  C CA  . VAL A 113 ? 2.2924 1.2936 0.9689 0.1735  -0.1697 0.1495  113 VAL A CA  
752  C C   . VAL A 113 ? 2.3206 1.3656 1.1019 0.1896  -0.1816 0.1219  113 VAL A C   
753  O O   . VAL A 113 ? 2.3360 1.4542 1.1988 0.1723  -0.1576 0.1181  113 VAL A O   
754  C CB  . VAL A 113 ? 2.2826 1.2982 0.9383 0.2077  -0.1810 0.1311  113 VAL A CB  
755  C CG1 . VAL A 113 ? 2.1985 1.3154 0.9570 0.2134  -0.1644 0.1082  113 VAL A CG1 
756  C CG2 . VAL A 113 ? 2.3817 1.3605 0.9331 0.1898  -0.1641 0.1582  113 VAL A CG2 
757  N N   . THR A 114 ? 2.3351 1.3344 1.1141 0.2225  -0.2187 0.1019  114 THR A N   
758  C CA  . THR A 114 ? 2.2819 1.3196 1.1581 0.2372  -0.2286 0.0740  114 THR A CA  
759  C C   . THR A 114 ? 2.2541 1.3031 1.1617 0.1986  -0.2068 0.0923  114 THR A C   
760  O O   . THR A 114 ? 2.1873 1.2995 1.1824 0.1912  -0.1918 0.0811  114 THR A O   
761  C CB  . THR A 114 ? 2.2975 1.2782 1.1616 0.2771  -0.2726 0.0485  114 THR A CB  
762  O OG1 . THR A 114 ? 2.4047 1.2927 1.1638 0.2737  -0.2903 0.0704  114 THR A OG1 
763  C CG2 . THR A 114 ? 2.2810 1.2813 1.1635 0.3216  -0.2947 0.0158  114 THR A CG2 
764  N N   . LEU A 115 ? 2.2692 1.2541 1.1029 0.1744  -0.2058 0.1204  115 LEU A N   
765  C CA  . LEU A 115 ? 2.2138 1.2032 1.0697 0.1377  -0.1873 0.1380  115 LEU A CA  
766  C C   . LEU A 115 ? 2.1065 1.1694 1.0060 0.1032  -0.1471 0.1521  115 LEU A C   
767  O O   . LEU A 115 ? 2.0533 1.1588 1.0187 0.0865  -0.1334 0.1500  115 LEU A O   
768  C CB  . LEU A 115 ? 2.3711 1.2734 1.1352 0.1185  -0.1945 0.1654  115 LEU A CB  
769  C CG  . LEU A 115 ? 2.4266 1.3280 1.2063 0.0789  -0.1761 0.1844  115 LEU A CG  
770  C CD1 . LEU A 115 ? 2.4333 1.3508 1.2847 0.0911  -0.1907 0.1611  115 LEU A CD1 
771  C CD2 . LEU A 115 ? 2.4677 1.2814 1.1523 0.0588  -0.1813 0.2129  115 LEU A CD2 
772  N N   . GLU A 116 ? 2.1014 1.1791 0.9637 0.0932  -0.1288 0.1652  116 GLU A N   
773  C CA  . GLU A 116 ? 2.0883 1.2367 0.9930 0.0615  -0.0920 0.1761  116 GLU A CA  
774  C C   . GLU A 116 ? 2.0090 1.2399 1.0139 0.0786  -0.0879 0.1502  116 GLU A C   
775  O O   . GLU A 116 ? 1.8925 1.1811 0.9590 0.0563  -0.0655 0.1532  116 GLU A O   
776  C CB  . GLU A 116 ? 2.1516 1.2970 0.9927 0.0475  -0.0728 0.1932  116 GLU A CB  
777  C CG  . GLU A 116 ? 2.1528 1.3638 1.0311 0.0097  -0.0343 0.2056  116 GLU A CG  
778  C CD  . GLU A 116 ? 2.2595 1.4617 1.0696 -0.0099 -0.0120 0.2236  116 GLU A CD  
779  O OE1 . GLU A 116 ? 2.3654 1.5042 1.0904 0.0048  -0.0260 0.2299  116 GLU A OE1 
780  O OE2 . GLU A 116 ? 2.2238 1.4821 1.0649 -0.0399 0.0197  0.2306  116 GLU A OE2 
781  N N   . ALA A 117 ? 2.0206 1.2541 1.0406 0.1190  -0.1107 0.1242  117 ALA A N   
782  C CA  . ALA A 117 ? 1.9207 1.2238 1.0353 0.1387  -0.1101 0.0973  117 ALA A CA  
783  C C   . ALA A 117 ? 1.8527 1.1652 1.0298 0.1359  -0.1137 0.0884  117 ALA A C   
784  O O   . ALA A 117 ? 1.7016 1.0761 0.9565 0.1304  -0.0988 0.0802  117 ALA A O   
785  C CB  . ALA A 117 ? 1.9302 1.2256 1.0436 0.1832  -0.1366 0.0696  117 ALA A CB  
786  N N   . LEU A 118 ? 1.9579 1.2066 1.0985 0.1402  -0.1340 0.0896  118 LEU A N   
787  C CA  . LEU A 118 ? 1.9531 1.2052 1.1441 0.1358  -0.1369 0.0814  118 LEU A CA  
788  C C   . LEU A 118 ? 1.9055 1.1892 1.1164 0.0949  -0.1080 0.1042  118 LEU A C   
789  O O   . LEU A 118 ? 1.8532 1.1841 1.1337 0.0895  -0.0969 0.0961  118 LEU A O   
790  C CB  . LEU A 118 ? 2.0216 1.1962 1.1638 0.1473  -0.1653 0.0784  118 LEU A CB  
791  C CG  . LEU A 118 ? 2.0052 1.1792 1.1970 0.1470  -0.1715 0.0647  118 LEU A CG  
792  C CD1 . LEU A 118 ? 1.9199 1.1577 1.2057 0.1651  -0.1667 0.0361  118 LEU A CD1 
793  C CD2 . LEU A 118 ? 2.0388 1.1373 1.1860 0.1669  -0.2051 0.0544  118 LEU A CD2 
794  N N   . CYS A 119 ? 1.9242 1.1811 1.0731 0.0664  -0.0957 0.1319  119 CYS A N   
795  C CA  . CYS A 119 ? 1.8775 1.1641 1.0428 0.0272  -0.0690 0.1523  119 CYS A CA  
796  C C   . CYS A 119 ? 1.8395 1.2067 1.0645 0.0197  -0.0456 0.1495  119 CYS A C   
797  O O   . CYS A 119 ? 1.6959 1.1064 0.9783 0.0062  -0.0330 0.1489  119 CYS A O   
798  C CB  . CYS A 119 ? 1.9372 1.1757 1.0235 -0.0015 -0.0603 0.1803  119 CYS A CB  
799  S SG  . CYS A 119 ? 2.1183 1.2552 1.1294 0.0047  -0.0888 0.1869  119 CYS A SG  
800  N N   . GLY A 120 ? 1.9532 1.3388 1.1625 0.0290  -0.0407 0.1474  120 GLY A N   
801  C CA  . GLY A 120 ? 1.9267 1.3878 1.1928 0.0247  -0.0210 0.1422  120 GLY A CA  
802  C C   . GLY A 120 ? 1.8625 1.3709 1.2149 0.0408  -0.0240 0.1221  120 GLY A C   
803  O O   . GLY A 120 ? 1.7615 1.3285 1.1695 0.0287  -0.0069 0.1224  120 GLY A O   
804  N N   . MET A 121 ? 1.9043 1.3850 1.2675 0.0683  -0.0461 0.1039  121 MET A N   
805  C CA  . MET A 121 ? 1.8238 1.3410 1.2654 0.0829  -0.0481 0.0841  121 MET A CA  
806  C C   . MET A 121 ? 1.7167 1.2282 1.1757 0.0617  -0.0417 0.0932  121 MET A C   
807  O O   . MET A 121 ? 1.6535 1.2086 1.1734 0.0574  -0.0307 0.0887  121 MET A O   
808  C CB  . MET A 121 ? 1.8955 1.3910 1.3489 0.1215  -0.0727 0.0563  121 MET A CB  
809  C CG  . MET A 121 ? 1.9158 1.4360 1.3787 0.1478  -0.0787 0.0397  121 MET A CG  
810  S SD  . MET A 121 ? 2.3768 1.8855 1.8766 0.1943  -0.1070 0.0005  121 MET A SD  
811  C CE  . MET A 121 ? 1.5007 0.9209 0.9205 0.2014  -0.1336 0.0039  121 MET A CE  
812  N N   . LEU A 122 ? 1.7363 1.1924 1.1401 0.0487  -0.0492 0.1061  122 LEU A N   
813  C CA  . LEU A 122 ? 1.7009 1.1518 1.1142 0.0250  -0.0421 0.1166  122 LEU A CA  
814  C C   . LEU A 122 ? 1.6576 1.1482 1.0802 -0.0074 -0.0184 0.1367  122 LEU A C   
815  O O   . LEU A 122 ? 1.5924 1.1093 1.0520 -0.0220 -0.0088 0.1399  122 LEU A O   
816  C CB  . LEU A 122 ? 1.7508 1.1312 1.1032 0.0191  -0.0574 0.1245  122 LEU A CB  
817  C CG  . LEU A 122 ? 1.7437 1.0760 1.0850 0.0480  -0.0844 0.1041  122 LEU A CG  
818  C CD1 . LEU A 122 ? 1.7470 1.0119 1.0303 0.0359  -0.0975 0.1154  122 LEU A CD1 
819  C CD2 . LEU A 122 ? 1.6373 1.0012 1.0500 0.0649  -0.0860 0.0795  122 LEU A CD2 
820  N N   . GLY A 123 ? 1.6513 1.1465 1.0400 -0.0180 -0.0093 0.1485  123 GLY A N   
821  C CA  . GLY A 123 ? 1.5611 1.0967 0.9610 -0.0476 0.0130  0.1637  123 GLY A CA  
822  C C   . GLY A 123 ? 1.4361 1.0400 0.9107 -0.0443 0.0234  0.1546  123 GLY A C   
823  O O   . GLY A 123 ? 1.3905 1.0205 0.8925 -0.0646 0.0340  0.1621  123 GLY A O   
824  N N   . LEU A 124 ? 1.4065 1.0376 0.9139 -0.0179 0.0190  0.1376  124 LEU A N   
825  C CA  . LEU A 124 ? 1.3989 1.0907 0.9780 -0.0124 0.0273  0.1284  124 LEU A CA  
826  C C   . LEU A 124 ? 1.3998 1.0942 1.0202 -0.0097 0.0246  0.1234  124 LEU A C   
827  O O   . LEU A 124 ? 1.2832 1.0147 0.9438 -0.0217 0.0349  0.1278  124 LEU A O   
828  C CB  . LEU A 124 ? 1.4042 1.1191 1.0093 0.0172  0.0213  0.1092  124 LEU A CB  
829  C CG  . LEU A 124 ? 1.3279 1.1032 1.0090 0.0239  0.0291  0.0993  124 LEU A CG  
830  C CD1 . LEU A 124 ? 1.3530 1.1704 1.0447 -0.0009 0.0456  0.1118  124 LEU A CD1 
831  C CD2 . LEU A 124 ? 1.2161 1.0121 0.9301 0.0556  0.0210  0.0769  124 LEU A CD2 
832  N N   . ALA A 125 ? 1.4709 1.1251 1.0801 0.0070  0.0104  0.1129  125 ALA A N   
833  C CA  . ALA A 125 ? 1.4412 1.0963 1.0885 0.0123  0.0089  0.1043  125 ALA A CA  
834  C C   . ALA A 125 ? 1.4926 1.1497 1.1348 -0.0157 0.0183  0.1212  125 ALA A C   
835  O O   . ALA A 125 ? 1.4831 1.1629 1.1647 -0.0184 0.0247  0.1198  125 ALA A O   
836  C CB  . ALA A 125 ? 1.4360 1.0422 1.0629 0.0306  -0.0082 0.0901  125 ALA A CB  
837  N N   . VAL A 126 ? 1.5504 1.1813 1.1420 -0.0364 0.0187  0.1369  126 VAL A N   
838  C CA  . VAL A 126 ? 1.5083 1.1374 1.0906 -0.0636 0.0255  0.1517  126 VAL A CA  
839  C C   . VAL A 126 ? 1.4615 1.1402 1.0676 -0.0815 0.0400  0.1615  126 VAL A C   
840  O O   . VAL A 126 ? 1.5185 1.2218 1.1526 -0.0926 0.0455  0.1655  126 VAL A O   
841  C CB  . VAL A 126 ? 1.4912 1.0671 1.0115 -0.0784 0.0191  0.1626  126 VAL A CB  
842  C CG1 . VAL A 126 ? 1.5127 1.0954 1.0250 -0.1097 0.0285  0.1782  126 VAL A CG1 
843  C CG2 . VAL A 126 ? 1.4358 0.9643 0.9401 -0.0635 0.0031  0.1519  126 VAL A CG2 
844  N N   . ALA A 127 ? 1.3261 1.0197 0.9207 -0.0835 0.0454  0.1640  127 ALA A N   
845  C CA  . ALA A 127 ? 1.2373 0.9820 0.8602 -0.0985 0.0586  0.1689  127 ALA A CA  
846  C C   . ALA A 127 ? 1.1725 0.9615 0.8583 -0.0849 0.0597  0.1598  127 ALA A C   
847  O O   . ALA A 127 ? 1.1630 0.9927 0.8803 -0.0965 0.0671  0.1632  127 ALA A O   
848  C CB  . ALA A 127 ? 1.3027 1.0593 0.9079 -0.0976 0.0646  0.1682  127 ALA A CB  
849  N N   . ALA A 128 ? 1.2064 0.9863 0.9115 -0.0602 0.0521  0.1473  128 ALA A N   
850  C CA  . ALA A 128 ? 1.2269 1.0436 0.9906 -0.0471 0.0544  0.1389  128 ALA A CA  
851  C C   . ALA A 128 ? 1.2136 1.0209 0.9885 -0.0534 0.0546  0.1431  128 ALA A C   
852  O O   . ALA A 128 ? 1.1477 0.9857 0.9614 -0.0539 0.0591  0.1444  128 ALA A O   
853  C CB  . ALA A 128 ? 1.2373 1.0537 1.0234 -0.0181 0.0484  0.1211  128 ALA A CB  
854  N N   . SER A 129 ? 1.3037 1.0671 1.0428 -0.0573 0.0490  0.1448  129 SER A N   
855  C CA  . SER A 129 ? 1.3561 1.1073 1.0974 -0.0648 0.0496  0.1482  129 SER A CA  
856  C C   . SER A 129 ? 1.3613 1.1373 1.1070 -0.0866 0.0549  0.1618  129 SER A C   
857  O O   . SER A 129 ? 1.3949 1.1938 1.1710 -0.0859 0.0583  0.1634  129 SER A O   
858  C CB  . SER A 129 ? 1.4226 1.1233 1.1199 -0.0689 0.0416  0.1477  129 SER A CB  
859  O OG  . SER A 129 ? 1.4573 1.1338 1.1547 -0.0466 0.0341  0.1318  129 SER A OG  
860  N N   . LEU A 130 ? 1.3378 1.1076 1.0527 -0.1057 0.0551  0.1709  130 LEU A N   
861  C CA  . LEU A 130 ? 1.3821 1.1760 1.1027 -0.1271 0.0588  0.1806  130 LEU A CA  
862  C C   . LEU A 130 ? 1.3467 1.1928 1.1118 -0.1235 0.0637  0.1787  130 LEU A C   
863  O O   . LEU A 130 ? 1.3533 1.2232 1.1423 -0.1287 0.0633  0.1819  130 LEU A O   
864  C CB  . LEU A 130 ? 1.4489 1.2248 1.1304 -0.1491 0.0602  0.1884  130 LEU A CB  
865  C CG  . LEU A 130 ? 1.4900 1.2099 1.1247 -0.1481 0.0536  0.1888  130 LEU A CG  
866  C CD1 . LEU A 130 ? 1.4958 1.1953 1.0915 -0.1725 0.0564  0.1987  130 LEU A CD1 
867  C CD2 . LEU A 130 ? 1.4728 1.1661 1.1029 -0.1439 0.0465  0.1858  130 LEU A CD2 
868  N N   . ILE A 131 ? 1.3038 1.1664 1.0792 -0.1133 0.0666  0.1726  131 ILE A N   
869  C CA  . ILE A 131 ? 1.2714 1.1837 1.0926 -0.1069 0.0700  0.1677  131 ILE A CA  
870  C C   . ILE A 131 ? 1.1783 1.1042 1.0383 -0.0944 0.0673  0.1659  131 ILE A C   
871  O O   . ILE A 131 ? 1.1376 1.1009 1.0343 -0.0940 0.0674  0.1654  131 ILE A O   
872  C CB  . ILE A 131 ? 1.3636 1.2861 1.1919 -0.0901 0.0716  0.1575  131 ILE A CB  
873  C CG1 . ILE A 131 ? 1.4323 1.3357 1.2137 -0.1024 0.0753  0.1611  131 ILE A CG1 
874  C CG2 . ILE A 131 ? 1.3508 1.3265 1.2305 -0.0826 0.0742  0.1503  131 ILE A CG2 
875  C CD1 . ILE A 131 ? 1.4557 1.3838 1.2340 -0.1285 0.0837  0.1678  131 ILE A CD1 
876  N N   . TYR A 132 ? 1.1949 1.0888 1.0459 -0.0844 0.0651  0.1644  132 TYR A N   
877  C CA  . TYR A 132 ? 1.2328 1.1328 1.1158 -0.0725 0.0657  0.1629  132 TYR A CA  
878  C C   . TYR A 132 ? 1.2274 1.1135 1.0942 -0.0855 0.0642  0.1729  132 TYR A C   
879  O O   . TYR A 132 ? 1.0988 1.0010 0.9879 -0.0841 0.0638  0.1774  132 TYR A O   
880  C CB  . TYR A 132 ? 1.2702 1.1460 1.1572 -0.0536 0.0666  0.1519  132 TYR A CB  
881  C CG  . TYR A 132 ? 1.3034 1.1743 1.2147 -0.0449 0.0709  0.1505  132 TYR A CG  
882  C CD1 . TYR A 132 ? 1.2933 1.1839 1.2505 -0.0280 0.0745  0.1421  132 TYR A CD1 
883  C CD2 . TYR A 132 ? 1.3107 1.1558 1.1981 -0.0539 0.0723  0.1568  132 TYR A CD2 
884  C CE1 . TYR A 132 ? 1.2595 1.1423 1.2373 -0.0219 0.0812  0.1416  132 TYR A CE1 
885  C CE2 . TYR A 132 ? 1.2837 1.1223 1.1887 -0.0473 0.0792  0.1559  132 TYR A CE2 
886  C CZ  . TYR A 132 ? 1.2325 1.0889 1.1822 -0.0321 0.0845  0.1490  132 TYR A CZ  
887  O OH  . TYR A 132 ? 1.1791 1.0265 1.1454 -0.0276 0.0940  0.1491  132 TYR A OH  
888  N N   . ALA A 133 ? 1.3426 1.1960 1.1682 -0.0969 0.0621  0.1761  133 ALA A N   
889  C CA  . ALA A 133 ? 1.4161 1.2549 1.2216 -0.1095 0.0596  0.1837  133 ALA A CA  
890  C C   . ALA A 133 ? 1.4107 1.2811 1.2291 -0.1220 0.0562  0.1907  133 ALA A C   
891  O O   . ALA A 133 ? 1.3945 1.2715 1.2216 -0.1216 0.0534  0.1954  133 ALA A O   
892  C CB  . ALA A 133 ? 1.4357 1.2378 1.1975 -0.1210 0.0564  0.1844  133 ALA A CB  
893  N N   . ARG A 134 ? 1.3900 1.2793 1.2088 -0.1330 0.0563  0.1903  134 ARG A N   
894  C CA  . ARG A 134 ? 1.3798 1.3043 1.2178 -0.1449 0.0531  0.1925  134 ARG A CA  
895  C C   . ARG A 134 ? 1.4129 1.3686 1.2937 -0.1301 0.0508  0.1907  134 ARG A C   
896  O O   . ARG A 134 ? 1.4449 1.4180 1.3396 -0.1335 0.0435  0.1936  134 ARG A O   
897  C CB  . ARG A 134 ? 1.2995 1.2426 1.1366 -0.1578 0.0579  0.1894  134 ARG A CB  
898  C CG  . ARG A 134 ? 1.2636 1.1719 1.0562 -0.1741 0.0605  0.1929  134 ARG A CG  
899  C CD  . ARG A 134 ? 1.2295 1.1588 1.0213 -0.1936 0.0672  0.1919  134 ARG A CD  
900  N NE  . ARG A 134 ? 1.2259 1.1960 1.0505 -0.2039 0.0643  0.1889  134 ARG A NE  
901  C CZ  . ARG A 134 ? 1.2129 1.1954 1.0359 -0.2273 0.0673  0.1877  134 ARG A CZ  
902  N NH1 . ARG A 134 ? 1.1603 1.1144 0.9472 -0.2444 0.0749  0.1917  134 ARG A NH1 
903  N NH2 . ARG A 134 ? 1.2594 1.2813 1.1182 -0.2333 0.0620  0.1815  134 ARG A NH2 
904  N N   . PHE A 135 ? 1.3932 1.3536 1.2948 -0.1128 0.0553  0.1853  135 PHE A N   
905  C CA  . PHE A 135 ? 1.3921 1.3806 1.3376 -0.0980 0.0535  0.1827  135 PHE A CA  
906  C C   . PHE A 135 ? 1.4311 1.4028 1.3778 -0.0910 0.0509  0.1898  135 PHE A C   
907  O O   . PHE A 135 ? 1.4385 1.4291 1.4080 -0.0879 0.0443  0.1931  135 PHE A O   
908  C CB  . PHE A 135 ? 1.4305 1.4267 1.3985 -0.0812 0.0590  0.1730  135 PHE A CB  
909  C CG  . PHE A 135 ? 1.4919 1.5295 1.4881 -0.0808 0.0591  0.1650  135 PHE A CG  
910  C CD1 . PHE A 135 ? 1.5245 1.5722 1.5015 -0.0979 0.0615  0.1643  135 PHE A CD1 
911  C CD2 . PHE A 135 ? 1.5032 1.5700 1.5462 -0.0643 0.0579  0.1573  135 PHE A CD2 
912  C CE1 . PHE A 135 ? 1.5179 1.6060 1.5204 -0.0989 0.0640  0.1554  135 PHE A CE1 
913  C CE2 . PHE A 135 ? 1.5008 1.6087 1.5713 -0.0636 0.0580  0.1475  135 PHE A CE2 
914  C CZ  . PHE A 135 ? 1.4955 1.6151 1.5451 -0.0811 0.0618  0.1462  135 PHE A CZ  
915  N N   . THR A 136 ? 1.4959 1.4306 1.4164 -0.0884 0.0561  0.1915  136 THR A N   
916  C CA  . THR A 136 ? 1.5285 1.4433 1.4460 -0.0821 0.0581  0.1976  136 THR A CA  
917  C C   . THR A 136 ? 1.5179 1.4186 1.4032 -0.0945 0.0514  0.2072  136 THR A C   
918  O O   . THR A 136 ? 1.5016 1.3711 1.3573 -0.0964 0.0554  0.2099  136 THR A O   
919  C CB  . THR A 136 ? 1.5611 1.4457 1.4697 -0.0734 0.0683  0.1916  136 THR A CB  
920  O OG1 . THR A 136 ? 1.5936 1.4559 1.4667 -0.0824 0.0676  0.1882  136 THR A OG1 
921  C CG2 . THR A 136 ? 1.5291 1.4288 1.4762 -0.0573 0.0731  0.1807  136 THR A CG2 
922  N N   . ARG A 137 ? 1.5060 1.4316 1.3990 -0.1022 0.0407  0.2098  137 ARG A N   
923  C CA  . ARG A 137 ? 1.4728 1.3899 1.3406 -0.1115 0.0309  0.2167  137 ARG A CA  
924  C C   . ARG A 137 ? 1.4048 1.3495 1.3017 -0.1056 0.0193  0.2193  137 ARG A C   
925  O O   . ARG A 137 ? 1.4213 1.3973 1.3375 -0.1124 0.0106  0.2138  137 ARG A O   
926  C CB  . ARG A 137 ? 1.4952 1.4143 1.3426 -0.1296 0.0263  0.2133  137 ARG A CB  
927  C CG  . ARG A 137 ? 1.4921 1.3783 1.3059 -0.1359 0.0340  0.2113  137 ARG A CG  
928  C CD  . ARG A 137 ? 1.5195 1.4061 1.3152 -0.1551 0.0296  0.2090  137 ARG A CD  
929  N NE  . ARG A 137 ? 1.5561 1.4737 1.3762 -0.1611 0.0316  0.2042  137 ARG A NE  
930  C CZ  . ARG A 137 ? 1.6131 1.5324 1.4217 -0.1789 0.0326  0.2017  137 ARG A CZ  
931  N NH1 . ARG A 137 ? 1.5860 1.5346 1.4163 -0.1847 0.0375  0.1971  137 ARG A NH1 
932  N NH2 . ARG A 137 ? 1.6778 1.5689 1.4533 -0.1916 0.0298  0.2033  137 ARG A NH2 
933  N N   . PRO A 138 ? 1.3287 1.5121 1.5830 0.1028  -0.2394 0.2358  138 PRO A N   
934  C CA  . PRO A 138 ? 1.2444 1.4539 1.4865 0.1019  -0.2224 0.2139  138 PRO A CA  
935  C C   . PRO A 138 ? 1.2014 1.3873 1.4309 0.0964  -0.2017 0.2088  138 PRO A C   
936  O O   . PRO A 138 ? 1.1725 1.3181 1.4138 0.0972  -0.1961 0.2141  138 PRO A O   
937  C CB  . PRO A 138 ? 1.1927 1.4039 1.4725 0.1169  -0.2179 0.1896  138 PRO A CB  
938  C CG  . PRO A 138 ? 1.2080 1.4010 1.5213 0.1260  -0.2315 0.1983  138 PRO A CG  
939  C CD  . PRO A 138 ? 1.2715 1.4332 1.5713 0.1195  -0.2385 0.2229  138 PRO A CD  
940  N N   . THR A 139 ? 1.1785 1.3908 1.3845 0.0921  -0.1917 0.1969  139 THR A N   
941  C CA  . THR A 139 ? 1.1886 1.3832 1.3836 0.0886  -0.1723 0.1886  139 THR A CA  
942  C C   . THR A 139 ? 1.1179 1.2983 1.3385 0.1008  -0.1592 0.1635  139 THR A C   
943  O O   . THR A 139 ? 1.0912 1.2843 1.3323 0.1095  -0.1657 0.1519  139 THR A O   
944  C CB  . THR A 139 ? 1.2088 1.4416 1.3672 0.0794  -0.1696 0.1872  139 THR A CB  
945  O OG1 . THR A 139 ? 1.1935 1.4677 1.3501 0.0872  -0.1761 0.1706  139 THR A OG1 
946  C CG2 . THR A 139 ? 1.2189 1.4651 1.3500 0.0617  -0.1807 0.2153  139 THR A CG2 
947  N N   . ALA A 140 ? 1.0490 1.2030 1.2679 0.0996  -0.1418 0.1560  140 ALA A N   
948  C CA  . ALA A 140 ? 0.9721 1.1117 1.2118 0.1076  -0.1296 0.1350  140 ALA A CA  
949  C C   . ALA A 140 ? 0.9607 1.1208 1.1819 0.1095  -0.1269 0.1183  140 ALA A C   
950  O O   . ALA A 140 ? 0.9285 1.0819 1.1636 0.1152  -0.1232 0.1010  140 ALA A O   
951  C CB  . ALA A 140 ? 0.8938 0.9951 1.1413 0.1057  -0.1130 0.1345  140 ALA A CB  
952  N N   . GLY A 141 ? 0.9407 1.1269 1.1308 0.1044  -0.1302 0.1231  141 GLY A N   
953  C CA  . GLY A 141 ? 0.9126 1.1187 1.0843 0.1089  -0.1281 0.1053  141 GLY A CA  
954  C C   . GLY A 141 ? 0.8620 1.0329 1.0376 0.1107  -0.1132 0.0945  141 GLY A C   
955  O O   . GLY A 141 ? 0.8127 0.9782 0.9926 0.1181  -0.1132 0.0763  141 GLY A O   
956  N N   . VAL A 142 ? 0.8269 0.9709 1.0004 0.1031  -0.1017 0.1064  142 VAL A N   
957  C CA  . VAL A 142 ? 0.8078 0.9220 0.9787 0.1025  -0.0870 0.0984  142 VAL A CA  
958  C C   . VAL A 142 ? 0.8044 0.9310 0.9448 0.0980  -0.0831 0.1000  142 VAL A C   
959  O O   . VAL A 142 ? 0.8577 0.9987 0.9838 0.0893  -0.0853 0.1148  142 VAL A O   
960  C CB  . VAL A 142 ? 0.8009 0.8794 0.9890 0.0978  -0.0757 0.1066  142 VAL A CB  
961  C CG1 . VAL A 142 ? 0.7455 0.8011 0.9180 0.0930  -0.0609 0.1040  142 VAL A CG1 
962  C CG2 . VAL A 142 ? 0.8516 0.9177 1.0715 0.1028  -0.0743 0.0981  142 VAL A CG2 
963  N N   . LEU A 143 ? 0.7261 0.8467 0.8566 0.1032  -0.0786 0.0853  143 LEU A N   
964  C CA  . LEU A 143 ? 0.6747 0.8099 0.7786 0.1011  -0.0754 0.0838  143 LEU A CA  
965  C C   . LEU A 143 ? 0.6799 0.7788 0.7790 0.0950  -0.0608 0.0868  143 LEU A C   
966  O O   . LEU A 143 ? 0.6134 0.6809 0.7235 0.0974  -0.0545 0.0798  143 LEU A O   
967  C CB  . LEU A 143 ? 0.6624 0.8204 0.7563 0.1142  -0.0841 0.0634  143 LEU A CB  
968  C CG  . LEU A 143 ? 0.7022 0.8719 0.7726 0.1163  -0.0809 0.0566  143 LEU A CG  
969  C CD1 . LEU A 143 ? 0.7749 0.9827 0.8283 0.1054  -0.0798 0.0696  143 LEU A CD1 
970  C CD2 . LEU A 143 ? 0.6382 0.8257 0.7029 0.1334  -0.0926 0.0334  143 LEU A CD2 
971  N N   . PHE A 144 ? 0.7222 0.8277 0.8038 0.0852  -0.0561 0.0975  144 PHE A N   
972  C CA  . PHE A 144 ? 0.7256 0.8013 0.7988 0.0785  -0.0432 0.0999  144 PHE A CA  
973  C C   . PHE A 144 ? 0.6854 0.7763 0.7357 0.0817  -0.0426 0.0901  144 PHE A C   
974  O O   . PHE A 144 ? 0.6299 0.7628 0.6672 0.0842  -0.0506 0.0868  144 PHE A O   
975  C CB  . PHE A 144 ? 0.5179 0.5871 0.5864 0.0645  -0.0404 0.1178  144 PHE A CB  
976  C CG  . PHE A 144 ? 0.6728 0.7215 0.7640 0.0631  -0.0423 0.1272  144 PHE A CG  
977  C CD1 . PHE A 144 ? 0.6755 0.7461 0.7724 0.0624  -0.0552 0.1369  144 PHE A CD1 
978  C CD2 . PHE A 144 ? 0.7244 0.7346 0.8308 0.0630  -0.0321 0.1259  144 PHE A CD2 
979  C CE1 . PHE A 144 ? 0.7017 0.7527 0.8201 0.0630  -0.0595 0.1456  144 PHE A CE1 
980  C CE2 . PHE A 144 ? 0.7284 0.7229 0.8581 0.0646  -0.0352 0.1321  144 PHE A CE2 
981  C CZ  . PHE A 144 ? 0.7358 0.7489 0.8720 0.0653  -0.0498 0.1422  144 PHE A CZ  
982  N N   . SER A 145 ? 0.6732 0.7333 0.7185 0.0816  -0.0334 0.0851  145 SER A N   
983  C CA  . SER A 145 ? 0.7069 0.7778 0.7312 0.0859  -0.0343 0.0760  145 SER A CA  
984  C C   . SER A 145 ? 0.7253 0.8209 0.7324 0.0745  -0.0318 0.0854  145 SER A C   
985  O O   . SER A 145 ? 0.7087 0.7911 0.7177 0.0609  -0.0260 0.0996  145 SER A O   
986  C CB  . SER A 145 ? 0.7391 0.7691 0.7601 0.0866  -0.0262 0.0710  145 SER A CB  
987  O OG  . SER A 145 ? 0.7773 0.7813 0.7983 0.0737  -0.0128 0.0812  145 SER A OG  
988  N N   . SER A 146 ? 0.7561 0.8877 0.7472 0.0801  -0.0375 0.0764  146 SER A N   
989  C CA  . SER A 146 ? 0.7792 0.9467 0.7544 0.0676  -0.0367 0.0845  146 SER A CA  
990  C C   . SER A 146 ? 0.8066 0.9462 0.7710 0.0548  -0.0263 0.0920  146 SER A C   
991  O O   . SER A 146 ? 0.7722 0.9252 0.7274 0.0379  -0.0242 0.1045  146 SER A O   
992  C CB  . SER A 146 ? 0.7699 0.9896 0.7336 0.0796  -0.0454 0.0690  146 SER A CB  
993  O OG  . SER A 146 ? 0.8336 1.0334 0.7911 0.0921  -0.0457 0.0553  146 SER A OG  
994  N N   . ARG A 147 ? 0.8592 0.9604 0.8233 0.0615  -0.0209 0.0844  147 ARG A N   
995  C CA  . ARG A 147 ? 0.8608 0.9337 0.8140 0.0508  -0.0109 0.0890  147 ARG A CA  
996  C C   . ARG A 147 ? 0.8638 0.8861 0.8290 0.0506  -0.0018 0.0900  147 ARG A C   
997  O O   . ARG A 147 ? 0.8761 0.8881 0.8585 0.0580  -0.0038 0.0876  147 ARG A O   
998  C CB  . ARG A 147 ? 0.8138 0.8959 0.7503 0.0593  -0.0136 0.0773  147 ARG A CB  
999  C CG  . ARG A 147 ? 0.8023 0.9426 0.7294 0.0640  -0.0231 0.0708  147 ARG A CG  
1000 C CD  . ARG A 147 ? 0.8022 0.9671 0.7178 0.0439  -0.0190 0.0821  147 ARG A CD  
1001 N NE  . ARG A 147 ? 0.8278 1.0589 0.7362 0.0464  -0.0271 0.0757  147 ARG A NE  
1002 C CZ  . ARG A 147 ? 0.8447 1.1197 0.7584 0.0452  -0.0327 0.0777  147 ARG A CZ  
1003 N NH1 . ARG A 147 ? 0.8323 1.0878 0.7583 0.0421  -0.0327 0.0871  147 ARG A NH1 
1004 N NH2 . ARG A 147 ? 0.8522 1.1945 0.7588 0.0469  -0.0387 0.0699  147 ARG A NH2 
1005 N N   . MET A 148 ? 0.8308 0.8255 0.7871 0.0415  0.0084  0.0924  148 MET A N   
1006 C CA  . MET A 148 ? 0.8697 0.8242 0.8327 0.0422  0.0181  0.0894  148 MET A CA  
1007 C C   . MET A 148 ? 0.9019 0.8446 0.8436 0.0414  0.0217  0.0842  148 MET A C   
1008 O O   . MET A 148 ? 0.9656 0.9298 0.8902 0.0401  0.0171  0.0833  148 MET A O   
1009 C CB  . MET A 148 ? 0.9141 0.8450 0.8894 0.0323  0.0276  0.0961  148 MET A CB  
1010 C CG  . MET A 148 ? 0.9791 0.9112 0.9420 0.0192  0.0289  0.1031  148 MET A CG  
1011 S SD  . MET A 148 ? 1.1350 1.0490 1.1177 0.0126  0.0285  0.1126  148 MET A SD  
1012 C CE  . MET A 148 ? 0.7831 0.6668 0.7877 0.0212  0.0402  0.1030  148 MET A CE  
1013 N N   . VAL A 149 ? 0.8648 0.7765 0.8067 0.0413  0.0292  0.0813  149 VAL A N   
1014 C CA  . VAL A 149 ? 0.8843 0.7822 0.8035 0.0392  0.0318  0.0784  149 VAL A CA  
1015 C C   . VAL A 149 ? 0.9543 0.8244 0.8711 0.0273  0.0478  0.0798  149 VAL A C   
1016 O O   . VAL A 149 ? 1.0084 0.8672 0.9446 0.0244  0.0563  0.0804  149 VAL A O   
1017 C CB  . VAL A 149 ? 0.8665 0.7532 0.7808 0.0493  0.0228  0.0735  149 VAL A CB  
1018 C CG1 . VAL A 149 ? 0.8595 0.7752 0.7754 0.0643  0.0056  0.0674  149 VAL A CG1 
1019 C CG2 . VAL A 149 ? 0.8548 0.7198 0.7874 0.0473  0.0284  0.0745  149 VAL A CG2 
1020 N N   . ILE A 150 ? 0.9360 0.7983 0.8293 0.0213  0.0514  0.0788  150 ILE A N   
1021 C CA  . ILE A 150 ? 0.9289 0.7662 0.8154 0.0116  0.0660  0.0775  150 ILE A CA  
1022 C C   . ILE A 150 ? 0.9555 0.7805 0.8203 0.0126  0.0620  0.0775  150 ILE A C   
1023 O O   . ILE A 150 ? 0.9537 0.7863 0.7979 0.0155  0.0528  0.0772  150 ILE A O   
1024 C CB  . ILE A 150 ? 0.8906 0.7255 0.7648 0.0013  0.0737  0.0763  150 ILE A CB  
1025 C CG1 . ILE A 150 ? 0.8964 0.7380 0.7892 -0.0009 0.0734  0.0784  150 ILE A CG1 
1026 C CG2 . ILE A 150 ? 0.8650 0.6783 0.7324 -0.0073 0.0893  0.0719  150 ILE A CG2 
1027 C CD1 . ILE A 150 ? 0.9130 0.7422 0.7969 -0.0119 0.0809  0.0757  150 ILE A CD1 
1028 N N   . SER A 151 ? 1.0299 0.8367 0.8992 0.0094  0.0676  0.0785  151 SER A N   
1029 C CA  . SER A 151 ? 1.1942 0.9840 1.0421 0.0085  0.0606  0.0816  151 SER A CA  
1030 C C   . SER A 151 ? 1.2923 1.0638 1.1386 -0.0052 0.0750  0.0842  151 SER A C   
1031 O O   . SER A 151 ? 1.3356 1.1106 1.2064 -0.0088 0.0863  0.0821  151 SER A O   
1032 C CB  . SER A 151 ? 1.2823 1.0722 1.1375 0.0218  0.0418  0.0816  151 SER A CB  
1033 O OG  . SER A 151 ? 1.3339 1.1173 1.2125 0.0199  0.0450  0.0825  151 SER A OG  
1034 N N   . ASP A 152 ? 1.3426 1.0974 1.1601 -0.0133 0.0738  0.0889  152 ASP A N   
1035 C CA  . ASP A 152 ? 1.4227 1.1651 1.2345 -0.0297 0.0876  0.0927  152 ASP A CA  
1036 C C   . ASP A 152 ? 1.4029 1.1379 1.2340 -0.0306 0.0826  0.0968  152 ASP A C   
1037 O O   . ASP A 152 ? 1.4141 1.1379 1.2433 -0.0213 0.0629  0.1001  152 ASP A O   
1038 C CB  . ASP A 152 ? 1.5375 1.2617 1.3104 -0.0389 0.0825  0.1004  152 ASP A CB  
1039 C CG  . ASP A 152 ? 1.6726 1.4029 1.4269 -0.0505 0.0995  0.0966  152 ASP A CG  
1040 O OD1 . ASP A 152 ? 1.7041 1.4499 1.4771 -0.0513 0.1154  0.0869  152 ASP A OD1 
1041 O OD2 . ASP A 152 ? 1.7480 1.4664 1.4685 -0.0583 0.0954  0.1027  152 ASP A OD2 
1042 N N   . PHE A 153 ? 1.3894 1.1321 1.2398 -0.0413 0.0999  0.0949  153 PHE A N   
1043 C CA  . PHE A 153 ? 1.3963 1.1355 1.2663 -0.0463 0.0974  0.0987  153 PHE A CA  
1044 C C   . PHE A 153 ? 1.4516 1.1960 1.3201 -0.0674 0.1171  0.1006  153 PHE A C   
1045 O O   . PHE A 153 ? 1.4298 1.1949 1.3115 -0.0699 0.1367  0.0911  153 PHE A O   
1046 C CB  . PHE A 153 ? 1.3909 1.1484 1.2998 -0.0339 0.0974  0.0912  153 PHE A CB  
1047 C CG  . PHE A 153 ? 1.4421 1.2031 1.3754 -0.0421 0.1003  0.0928  153 PHE A CG  
1048 C CD1 . PHE A 153 ? 1.4597 1.2038 1.3926 -0.0417 0.0817  0.0990  153 PHE A CD1 
1049 C CD2 . PHE A 153 ? 1.4620 1.2439 1.4192 -0.0501 0.1205  0.0868  153 PHE A CD2 
1050 C CE1 . PHE A 153 ? 1.4736 1.2212 1.4290 -0.0519 0.0836  0.1008  153 PHE A CE1 
1051 C CE2 . PHE A 153 ? 1.4681 1.2589 1.4497 -0.0590 0.1233  0.0878  153 PHE A CE2 
1052 C CZ  . PHE A 153 ? 1.4751 1.2484 1.4554 -0.0614 0.1050  0.0958  153 PHE A CZ  
1053 N N   . GLU A 154 ? 1.5383 1.2648 1.3909 -0.0830 0.1109  0.1125  154 GLU A N   
1054 C CA  . GLU A 154 ? 1.5693 1.3042 1.4139 -0.1078 0.1293  0.1170  154 GLU A CA  
1055 C C   . GLU A 154 ? 1.5427 1.2902 1.3674 -0.1117 0.1466  0.1104  154 GLU A C   
1056 O O   . GLU A 154 ? 1.4837 1.2589 1.3241 -0.1174 0.1689  0.0994  154 GLU A O   
1057 C CB  . GLU A 154 ? 1.5447 1.3069 1.4295 -0.1131 0.1435  0.1101  154 GLU A CB  
1058 C CG  . GLU A 154 ? 1.5526 1.3020 1.4549 -0.1132 0.1261  0.1171  154 GLU A CG  
1059 C CD  . GLU A 154 ? 1.5547 1.3337 1.4949 -0.1226 0.1400  0.1118  154 GLU A CD  
1060 O OE1 . GLU A 154 ? 1.5202 1.3315 1.4846 -0.1167 0.1592  0.0980  154 GLU A OE1 
1061 O OE2 . GLU A 154 ? 1.5665 1.3359 1.5129 -0.1355 0.1301  0.1209  154 GLU A OE2 
1062 N N   . GLY A 155 ? 1.5495 1.2779 1.3411 -0.1068 0.1346  0.1150  155 GLY A N   
1063 C CA  . GLY A 155 ? 1.5709 1.3073 1.3388 -0.1106 0.1470  0.1093  155 GLY A CA  
1064 C C   . GLY A 155 ? 1.5514 1.3136 1.3444 -0.1013 0.1648  0.0908  155 GLY A C   
1065 O O   . GLY A 155 ? 1.6222 1.4031 1.4134 -0.1119 0.1855  0.0819  155 GLY A O   
1066 N N   . LYS A 156 ? 1.4334 1.1969 1.2493 -0.0815 0.1557  0.0845  156 LYS A N   
1067 C CA  . LYS A 156 ? 1.3485 1.1276 1.1846 -0.0718 0.1667  0.0691  156 LYS A CA  
1068 C C   . LYS A 156 ? 1.3450 1.1198 1.1939 -0.0538 0.1498  0.0694  156 LYS A C   
1069 O O   . LYS A 156 ? 1.3483 1.1223 1.2163 -0.0458 0.1382  0.0742  156 LYS A O   
1070 C CB  . LYS A 156 ? 1.2677 1.0679 1.1394 -0.0731 0.1833  0.0586  156 LYS A CB  
1071 N N   . PRO A 157 ? 1.2878 1.0622 1.1247 -0.0489 0.1479  0.0644  157 PRO A N   
1072 C CA  . PRO A 157 ? 1.2350 1.0111 1.0807 -0.0355 0.1327  0.0658  157 PRO A CA  
1073 C C   . PRO A 157 ? 1.2099 0.9951 1.0942 -0.0266 0.1334  0.0619  157 PRO A C   
1074 O O   . PRO A 157 ? 1.2449 1.0341 1.1458 -0.0262 0.1445  0.0524  157 PRO A O   
1075 C CB  . PRO A 157 ? 1.2120 0.9884 1.0409 -0.0379 0.1359  0.0594  157 PRO A CB  
1076 C CG  . PRO A 157 ? 1.2418 1.0131 1.0428 -0.0509 0.1474  0.0574  157 PRO A CG  
1077 C CD  . PRO A 157 ? 1.2540 1.0291 1.0689 -0.0575 0.1603  0.0564  157 PRO A CD  
1078 N N   . THR A 158 ? 1.1106 0.8984 1.0088 -0.0185 0.1203  0.0681  158 THR A N   
1079 C CA  . THR A 158 ? 1.0118 0.8090 0.9454 -0.0106 0.1197  0.0657  158 THR A CA  
1080 C C   . THR A 158 ? 0.9994 0.8045 0.9391 0.0001  0.1038  0.0694  158 THR A C   
1081 O O   . THR A 158 ? 0.9971 0.8045 0.9238 0.0049  0.0901  0.0742  158 THR A O   
1082 C CB  . THR A 158 ? 0.9802 0.7783 0.9292 -0.0122 0.1187  0.0688  158 THR A CB  
1083 O OG1 . THR A 158 ? 0.9796 0.7737 0.9177 -0.0263 0.1327  0.0681  158 THR A OG1 
1084 C CG2 . THR A 158 ? 0.9724 0.7830 0.9597 -0.0049 0.1203  0.0646  158 THR A CG2 
1085 N N   . LEU A 159 ? 0.9878 0.7982 0.9469 0.0040  0.1048  0.0669  159 LEU A N   
1086 C CA  . LEU A 159 ? 0.9020 0.7239 0.8688 0.0113  0.0905  0.0722  159 LEU A CA  
1087 C C   . LEU A 159 ? 0.8564 0.6875 0.8485 0.0192  0.0836  0.0741  159 LEU A C   
1088 O O   . LEU A 159 ? 0.8603 0.6900 0.8767 0.0201  0.0908  0.0705  159 LEU A O   
1089 C CB  . LEU A 159 ? 0.8331 0.6514 0.8086 0.0098  0.0918  0.0713  159 LEU A CB  
1090 C CG  . LEU A 159 ? 0.7705 0.6021 0.7556 0.0140  0.0772  0.0796  159 LEU A CG  
1091 C CD1 . LEU A 159 ? 0.7414 0.5879 0.7016 0.0107  0.0677  0.0849  159 LEU A CD1 
1092 C CD2 . LEU A 159 ? 0.7317 0.5522 0.7319 0.0127  0.0761  0.0805  159 LEU A CD2 
1093 N N   . MET A 160 ? 0.8158 0.6595 0.8034 0.0257  0.0693  0.0781  160 MET A N   
1094 C CA  . MET A 160 ? 0.8173 0.6704 0.8274 0.0333  0.0612  0.0785  160 MET A CA  
1095 C C   . MET A 160 ? 0.8670 0.7425 0.8783 0.0415  0.0455  0.0817  160 MET A C   
1096 O O   . MET A 160 ? 0.9326 0.8202 0.9243 0.0421  0.0390  0.0829  160 MET A O   
1097 C CB  . MET A 160 ? 0.7973 0.6403 0.8044 0.0327  0.0602  0.0764  160 MET A CB  
1098 C CG  . MET A 160 ? 0.8054 0.6356 0.7813 0.0286  0.0596  0.0769  160 MET A CG  
1099 S SD  . MET A 160 ? 1.0602 0.8715 1.0306 0.0260  0.0532  0.0778  160 MET A SD  
1100 C CE  . MET A 160 ? 1.3415 1.1517 1.3400 0.0152  0.0698  0.0771  160 MET A CE  
1101 N N   . MET A 161 ? 0.8708 0.7558 0.9058 0.0471  0.0397  0.0822  161 MET A N   
1102 C CA  . MET A 161 ? 0.8023 0.7127 0.8404 0.0544  0.0252  0.0845  161 MET A CA  
1103 C C   . MET A 161 ? 0.8369 0.7498 0.8969 0.0610  0.0195  0.0808  161 MET A C   
1104 O O   . MET A 161 ? 0.9004 0.7986 0.9773 0.0577  0.0280  0.0790  161 MET A O   
1105 C CB  . MET A 161 ? 0.7955 0.7152 0.8399 0.0505  0.0237  0.0928  161 MET A CB  
1106 C CG  . MET A 161 ? 0.8717 0.7771 0.9420 0.0499  0.0294  0.0943  161 MET A CG  
1107 S SD  . MET A 161 ? 1.0001 0.9253 1.0953 0.0580  0.0161  0.0977  161 MET A SD  
1108 C CE  . MET A 161 ? 1.1600 1.1079 1.2411 0.0649  0.0053  0.0916  161 MET A CE  
1109 N N   . ARG A 162 ? 0.7891 0.7236 0.8495 0.0697  0.0052  0.0782  162 ARG A N   
1110 C CA  . ARG A 162 ? 0.7267 0.6630 0.8073 0.0754  -0.0021 0.0735  162 ARG A CA  
1111 C C   . ARG A 162 ? 0.7390 0.7048 0.8303 0.0820  -0.0144 0.0748  162 ARG A C   
1112 O O   . ARG A 162 ? 0.8577 0.8475 0.9351 0.0835  -0.0203 0.0777  162 ARG A O   
1113 C CB  . ARG A 162 ? 0.7143 0.6389 0.7839 0.0802  -0.0098 0.0648  162 ARG A CB  
1114 C CG  . ARG A 162 ? 0.7145 0.6616 0.7703 0.0927  -0.0262 0.0570  162 ARG A CG  
1115 C CD  . ARG A 162 ? 0.8130 0.7409 0.8637 0.0995  -0.0380 0.0470  162 ARG A CD  
1116 N NE  . ARG A 162 ? 0.8648 0.7958 0.8911 0.1090  -0.0473 0.0398  162 ARG A NE  
1117 C CZ  . ARG A 162 ? 0.8336 0.7422 0.8498 0.1166  -0.0605 0.0313  162 ARG A CZ  
1118 N NH1 . ARG A 162 ? 0.7896 0.6698 0.8165 0.1126  -0.0655 0.0304  162 ARG A NH1 
1119 N NH2 . ARG A 162 ? 0.8747 0.7889 0.8705 0.1278  -0.0703 0.0236  162 ARG A NH2 
1120 N N   . LEU A 163 ? 0.6400 0.6071 0.7555 0.0846  -0.0183 0.0732  163 LEU A N   
1121 C CA  . LEU A 163 ? 0.7001 0.6948 0.8258 0.0903  -0.0307 0.0747  163 LEU A CA  
1122 C C   . LEU A 163 ? 0.7304 0.7267 0.8702 0.0968  -0.0407 0.0644  163 LEU A C   
1123 O O   . LEU A 163 ? 0.7199 0.6926 0.8677 0.0933  -0.0360 0.0600  163 LEU A O   
1124 C CB  . LEU A 163 ? 0.7661 0.7603 0.9101 0.0859  -0.0269 0.0857  163 LEU A CB  
1125 C CG  . LEU A 163 ? 0.8010 0.7762 0.9730 0.0840  -0.0182 0.0839  163 LEU A CG  
1126 C CD1 . LEU A 163 ? 0.9408 0.9285 1.1359 0.0893  -0.0282 0.0786  163 LEU A CD1 
1127 C CD2 . LEU A 163 ? 0.7282 0.6966 0.9113 0.0816  -0.0137 0.0929  163 LEU A CD2 
1128 N N   . ALA A 164 ? 0.7262 0.7513 0.8676 0.1045  -0.0550 0.0607  164 ALA A N   
1129 C CA  . ALA A 164 ? 0.7281 0.7557 0.8819 0.1112  -0.0672 0.0491  164 ALA A CA  
1130 C C   . ALA A 164 ? 0.7736 0.8294 0.9434 0.1146  -0.0775 0.0512  164 ALA A C   
1131 O O   . ALA A 164 ? 0.7920 0.8736 0.9534 0.1145  -0.0802 0.0596  164 ALA A O   
1132 C CB  . ALA A 164 ? 0.7147 0.7480 0.8484 0.1214  -0.0788 0.0348  164 ALA A CB  
1133 N N   . ASN A 165 ? 0.8026 0.8540 0.9942 0.1159  -0.0841 0.0446  165 ASN A N   
1134 C CA  . ASN A 165 ? 0.8361 0.9142 1.0439 0.1196  -0.0957 0.0454  165 ASN A CA  
1135 C C   . ASN A 165 ? 0.8826 0.9882 1.0769 0.1301  -0.1127 0.0317  165 ASN A C   
1136 O O   . ASN A 165 ? 0.9263 1.0204 1.1199 0.1353  -0.1211 0.0161  165 ASN A O   
1137 C CB  . ASN A 165 ? 0.8596 0.9252 1.0990 0.1157  -0.0956 0.0430  165 ASN A CB  
1138 C CG  . ASN A 165 ? 0.9124 1.0057 1.1699 0.1199  -0.1089 0.0437  165 ASN A CG  
1139 O OD1 . ASN A 165 ? 0.9901 1.1102 1.2360 0.1239  -0.1165 0.0498  165 ASN A OD1 
1140 N ND2 . ASN A 165 ? 0.8907 0.9798 1.1758 0.1174  -0.1123 0.0383  165 ASN A ND2 
1141 N N   . LEU A 166 ? 0.8674 1.0098 1.0505 0.1327  -0.1189 0.0372  166 LEU A N   
1142 C CA  . LEU A 166 ? 0.8322 1.0110 0.9999 0.1432  -0.1335 0.0225  166 LEU A CA  
1143 C C   . LEU A 166 ? 0.8827 1.0765 1.0669 0.1487  -0.1489 0.0122  166 LEU A C   
1144 O O   . LEU A 166 ? 0.9040 1.1276 1.0771 0.1588  -0.1622 -0.0039 166 LEU A O   
1145 C CB  . LEU A 166 ? 0.7701 0.9894 0.9173 0.1402  -0.1335 0.0335  166 LEU A CB  
1146 C CG  . LEU A 166 ? 0.7299 0.9430 0.8576 0.1344  -0.1208 0.0416  166 LEU A CG  
1147 C CD1 . LEU A 166 ? 0.7018 0.9499 0.8136 0.1245  -0.1201 0.0592  166 LEU A CD1 
1148 C CD2 . LEU A 166 ? 0.6702 0.8877 0.7817 0.1458  -0.1237 0.0212  166 LEU A CD2 
1149 N N   . ARG A 167 ? 0.9175 1.0938 1.1287 0.1426  -0.1474 0.0197  167 ARG A N   
1150 C CA  . ARG A 167 ? 0.9639 1.1571 1.1924 0.1463  -0.1623 0.0115  167 ARG A CA  
1151 C C   . ARG A 167 ? 0.9631 1.1253 1.2122 0.1448  -0.1654 -0.0010 167 ARG A C   
1152 O O   . ARG A 167 ? 0.9330 1.0617 1.1926 0.1365  -0.1526 0.0046  167 ARG A O   
1153 C CB  . ARG A 167 ? 0.9815 1.1889 1.2268 0.1408  -0.1628 0.0302  167 ARG A CB  
1154 C CG  . ARG A 167 ? 0.9647 1.2046 1.1878 0.1394  -0.1651 0.0442  167 ARG A CG  
1155 C CD  . ARG A 167 ? 0.9720 1.2084 1.2098 0.1327  -0.1642 0.0668  167 ARG A CD  
1156 N NE  . ARG A 167 ? 0.9647 1.2344 1.1802 0.1286  -0.1719 0.0820  167 ARG A NE  
1157 C CZ  . ARG A 167 ? 0.9469 1.2093 1.1620 0.1208  -0.1714 0.1057  167 ARG A CZ  
1158 N NH1 . ARG A 167 ? 0.9381 1.1631 1.1760 0.1195  -0.1630 0.1135  167 ARG A NH1 
1159 N NH2 . ARG A 167 ? 0.9695 1.2625 1.1610 0.1137  -0.1801 0.1212  167 ARG A NH2 
1160 N N   . ILE A 168 ? 0.9944 1.1696 1.2482 0.1511  -0.1829 -0.0180 168 ILE A N   
1161 C CA  . ILE A 168 ? 1.0248 1.1722 1.2990 0.1466  -0.1891 -0.0289 168 ILE A CA  
1162 C C   . ILE A 168 ? 1.0029 1.1377 1.3075 0.1339  -0.1771 -0.0138 168 ILE A C   
1163 O O   . ILE A 168 ? 1.0146 1.1174 1.3292 0.1239  -0.1678 -0.0126 168 ILE A O   
1164 C CB  . ILE A 168 ? 1.0575 1.2278 1.3387 0.1533  -0.2107 -0.0457 168 ILE A CB  
1165 C CG1 . ILE A 168 ? 1.0871 1.2712 1.3405 0.1685  -0.2244 -0.0672 168 ILE A CG1 
1166 C CG2 . ILE A 168 ? 1.0515 1.1945 1.3589 0.1436  -0.2168 -0.0527 168 ILE A CG2 
1167 C CD1 . ILE A 168 ? 1.0955 1.2379 1.3362 0.1715  -0.2256 -0.0793 168 ILE A CD1 
1168 N N   . GLU A 169 ? 0.9837 1.1463 1.3024 0.1345  -0.1783 -0.0026 169 GLU A N   
1169 C CA  . GLU A 169 ? 0.9832 1.1423 1.3345 0.1267  -0.1698 0.0090  169 GLU A CA  
1170 C C   . GLU A 169 ? 0.9141 1.0486 1.2635 0.1207  -0.1484 0.0211  169 GLU A C   
1171 O O   . GLU A 169 ? 0.8787 1.0078 1.2013 0.1233  -0.1416 0.0264  169 GLU A O   
1172 C CB  . GLU A 169 ? 1.0354 1.2278 1.3976 0.1318  -0.1792 0.0191  169 GLU A CB  
1173 C CG  . GLU A 169 ? 1.1124 1.3299 1.4881 0.1350  -0.1995 0.0075  169 GLU A CG  
1174 C CD  . GLU A 169 ? 1.2328 1.4639 1.5805 0.1424  -0.2139 -0.0094 169 GLU A CD  
1175 O OE1 . GLU A 169 ? 1.2748 1.5120 1.5916 0.1475  -0.2106 -0.0080 169 GLU A OE1 
1176 O OE2 . GLU A 169 ? 1.2687 1.5070 1.6262 0.1436  -0.2293 -0.0257 169 GLU A OE2 
1177 N N   . ALA A 170 ? 0.8811 1.0048 1.2596 0.1123  -0.1378 0.0240  170 ALA A N   
1178 C CA  . ALA A 170 ? 0.8457 0.9467 1.2241 0.1056  -0.1169 0.0314  170 ALA A CA  
1179 C C   . ALA A 170 ? 0.8049 0.9146 1.1967 0.1098  -0.1094 0.0442  170 ALA A C   
1180 O O   . ALA A 170 ? 0.8329 0.9645 1.2399 0.1164  -0.1210 0.0486  170 ALA A O   
1181 C CB  . ALA A 170 ? 0.8755 0.9630 1.2759 0.0925  -0.1086 0.0255  170 ALA A CB  
1182 N N   . ILE A 171 ? 0.7514 0.8418 1.1369 0.1062  -0.0918 0.0498  171 ILE A N   
1183 C CA  . ILE A 171 ? 0.7337 0.8252 1.1336 0.1107  -0.0849 0.0594  171 ILE A CA  
1184 C C   . ILE A 171 ? 0.6996 0.7843 1.1252 0.1044  -0.0675 0.0542  171 ILE A C   
1185 O O   . ILE A 171 ? 0.6530 0.7207 1.0662 0.0946  -0.0543 0.0502  171 ILE A O   
1186 C CB  . ILE A 171 ? 0.7261 0.8021 1.0941 0.1120  -0.0791 0.0695  171 ILE A CB  
1187 C CG1 . ILE A 171 ? 0.6685 0.7570 1.0062 0.1152  -0.0932 0.0737  171 ILE A CG1 
1188 C CG2 . ILE A 171 ? 0.6830 0.7544 1.0654 0.1171  -0.0764 0.0789  171 ILE A CG2 
1189 C CD1 . ILE A 171 ? 0.6112 0.6890 0.9183 0.1132  -0.0873 0.0832  171 ILE A CD1 
1190 N N   . ILE A 172 ? 0.7323 0.8324 1.1931 0.1103  -0.0680 0.0539  172 ILE A N   
1191 C CA  . ILE A 172 ? 0.7493 0.8553 1.2401 0.1048  -0.0519 0.0455  172 ILE A CA  
1192 C C   . ILE A 172 ? 0.7204 0.8210 1.2233 0.1129  -0.0405 0.0463  172 ILE A C   
1193 O O   . ILE A 172 ? 0.5711 0.6656 1.0712 0.1249  -0.0503 0.0544  172 ILE A O   
1194 C CB  . ILE A 172 ? 0.7488 0.8850 1.2792 0.1036  -0.0598 0.0376  172 ILE A CB  
1195 C CG1 . ILE A 172 ? 0.7603 0.9145 1.3106 0.1195  -0.0782 0.0423  172 ILE A CG1 
1196 C CG2 . ILE A 172 ? 0.7168 0.8522 1.2350 0.0925  -0.0691 0.0336  172 ILE A CG2 
1197 C CD1 . ILE A 172 ? 0.7621 0.9453 1.3400 0.1189  -0.0932 0.0365  172 ILE A CD1 
1198 N N   . GLU A 173 ? 0.8671 0.9698 1.3825 0.1052  -0.0206 0.0375  173 GLU A N   
1199 C CA  . GLU A 173 ? 0.9720 1.0663 1.4920 0.1110  -0.0061 0.0340  173 GLU A CA  
1200 C C   . GLU A 173 ? 0.9285 0.9914 1.4124 0.1160  -0.0088 0.0445  173 GLU A C   
1201 O O   . GLU A 173 ? 0.8870 0.9400 1.3773 0.1263  -0.0075 0.0441  173 GLU A O   
1202 C CB  . GLU A 173 ? 1.0688 1.1877 1.6350 0.1258  -0.0091 0.0255  173 GLU A CB  
1203 C CG  . GLU A 173 ? 1.1597 1.3163 1.7649 0.1184  0.0015  0.0115  173 GLU A CG  
1204 C CD  . GLU A 173 ? 1.2618 1.4178 1.8534 0.0982  0.0251  0.0061  173 GLU A CD  
1205 O OE1 . GLU A 173 ? 1.2690 1.4059 1.8398 0.0977  0.0392  0.0050  173 GLU A OE1 
1206 O OE2 . GLU A 173 ? 1.3106 1.4847 1.9113 0.0813  0.0282  0.0036  173 GLU A OE2 
1207 N N   . ALA A 174 ? 0.9323 0.9801 1.3789 0.1084  -0.0133 0.0526  174 ALA A N   
1208 C CA  . ALA A 174 ? 0.9301 0.9540 1.3407 0.1096  -0.0154 0.0627  174 ALA A CA  
1209 C C   . ALA A 174 ? 0.9448 0.9501 1.3440 0.1054  0.0037  0.0584  174 ALA A C   
1210 O O   . ALA A 174 ? 0.9261 0.9346 1.3290 0.0963  0.0198  0.0496  174 ALA A O   
1211 C CB  . ALA A 174 ? 0.8854 0.9054 1.2623 0.1027  -0.0223 0.0676  174 ALA A CB  
1212 N N   . ASP A 175 ? 0.9283 0.9144 1.3128 0.1106  0.0011  0.0651  175 ASP A N   
1213 C CA  . ASP A 175 ? 0.9218 0.8879 1.2891 0.1061  0.0172  0.0610  175 ASP A CA  
1214 C C   . ASP A 175 ? 0.8261 0.7691 1.1607 0.1050  0.0103  0.0729  175 ASP A C   
1215 O O   . ASP A 175 ? 0.7793 0.7214 1.1094 0.1089  -0.0072 0.0849  175 ASP A O   
1216 C CB  . ASP A 175 ? 1.0050 0.9750 1.4038 0.1141  0.0279  0.0475  175 ASP A CB  
1217 C CG  . ASP A 175 ? 1.0938 1.0580 1.5142 0.1301  0.0118  0.0501  175 ASP A CG  
1218 O OD1 . ASP A 175 ? 1.1244 1.0796 1.5598 0.1392  0.0173  0.0395  175 ASP A OD1 
1219 O OD2 . ASP A 175 ? 1.0852 1.0532 1.5066 0.1339  -0.0076 0.0621  175 ASP A OD2 
1220 N N   . VAL A 176 ? 0.7964 0.7227 1.1073 0.0976  0.0240  0.0700  176 VAL A N   
1221 C CA  . VAL A 176 ? 0.8271 0.7354 1.1037 0.0923  0.0194  0.0807  176 VAL A CA  
1222 C C   . VAL A 176 ? 0.9176 0.8037 1.1886 0.0916  0.0303  0.0742  176 VAL A C   
1223 O O   . VAL A 176 ? 0.9103 0.7988 1.1967 0.0932  0.0456  0.0600  176 VAL A O   
1224 C CB  . VAL A 176 ? 0.7581 0.6698 1.0030 0.0823  0.0238  0.0829  176 VAL A CB  
1225 C CG1 . VAL A 176 ? 0.7206 0.6530 0.9717 0.0837  0.0147  0.0835  176 VAL A CG1 
1226 C CG2 . VAL A 176 ? 0.7387 0.6427 0.9766 0.0756  0.0430  0.0725  176 VAL A CG2 
1227 N N   . HIS A 177 ? 0.9752 0.8422 1.2230 0.0878  0.0224  0.0843  177 HIS A N   
1228 C CA  . HIS A 177 ? 0.9985 0.8406 1.2365 0.0859  0.0301  0.0784  177 HIS A CA  
1229 C C   . HIS A 177 ? 1.0146 0.8481 1.2133 0.0728  0.0305  0.0875  177 HIS A C   
1230 O O   . HIS A 177 ? 1.0943 0.9328 1.2775 0.0676  0.0167  0.1025  177 HIS A O   
1231 C CB  . HIS A 177 ? 1.0333 0.8541 1.2869 0.0948  0.0151  0.0818  177 HIS A CB  
1232 C CG  . HIS A 177 ? 1.0648 0.8957 1.3600 0.1107  0.0116  0.0721  177 HIS A CG  
1233 N ND1 . HIS A 177 ? 1.0551 0.8785 1.3750 0.1225  0.0192  0.0533  177 HIS A ND1 
1234 C CD2 . HIS A 177 ? 1.0773 0.9295 1.3950 0.1175  0.0014  0.0766  177 HIS A CD2 
1235 C CE1 . HIS A 177 ? 1.0980 0.9392 1.4554 0.1363  0.0136  0.0470  177 HIS A CE1 
1236 N NE2 . HIS A 177 ? 1.1004 0.9583 1.4569 0.1329  0.0026  0.0616  177 HIS A NE2 
1237 N N   . LEU A 178 ? 0.9763 0.8012 1.1586 0.0668  0.0459  0.0781  178 LEU A N   
1238 C CA  . LEU A 178 ? 1.0115 0.8263 1.1585 0.0550  0.0453  0.0852  178 LEU A CA  
1239 C C   . LEU A 178 ? 1.0741 0.8595 1.2180 0.0538  0.0432  0.0823  178 LEU A C   
1240 O O   . LEU A 178 ? 1.1577 0.9323 1.3112 0.0585  0.0552  0.0662  178 LEU A O   
1241 C CB  . LEU A 178 ? 1.0296 0.8515 1.1558 0.0481  0.0603  0.0784  178 LEU A CB  
1242 C CG  . LEU A 178 ? 1.1256 0.9688 1.2389 0.0459  0.0552  0.0856  178 LEU A CG  
1243 C CD1 . LEU A 178 ? 1.1859 1.0290 1.2750 0.0394  0.0661  0.0805  178 LEU A CD1 
1244 C CD2 . LEU A 178 ? 1.1588 1.0107 1.2572 0.0420  0.0395  0.0996  178 LEU A CD2 
1245 N N   . VAL A 179 ? 1.0139 0.7874 1.1437 0.0465  0.0274  0.0973  179 VAL A N   
1246 C CA  . VAL A 179 ? 0.9754 0.7142 1.1031 0.0447  0.0203  0.0963  179 VAL A CA  
1247 C C   . VAL A 179 ? 0.9321 0.6610 1.0253 0.0270  0.0170  0.1054  179 VAL A C   
1248 O O   . VAL A 179 ? 0.9220 0.6536 1.0015 0.0158  0.0021  0.1243  179 VAL A O   
1249 C CB  . VAL A 179 ? 1.0065 0.7301 1.1518 0.0503  -0.0013 0.1083  179 VAL A CB  
1250 C CG1 . VAL A 179 ? 1.0761 0.7581 1.2302 0.0559  -0.0082 0.0995  179 VAL A CG1 
1251 C CG2 . VAL A 179 ? 0.9740 0.7190 1.1508 0.0652  -0.0022 0.1051  179 VAL A CG2 
1252 N N   . LEU A 180 ? 0.9226 0.6428 1.0012 0.0229  0.0309  0.0923  180 LEU A N   
1253 C CA  . LEU A 180 ? 0.9617 0.6712 1.0097 0.0060  0.0274  0.0987  180 LEU A CA  
1254 C C   . LEU A 180 ? 0.9900 0.6639 1.0373 -0.0007 0.0082  0.1083  180 LEU A C   
1255 O O   . LEU A 180 ? 1.0206 0.6662 1.0897 0.0114  0.0022  0.0999  180 LEU A O   
1256 C CB  . LEU A 180 ? 0.9880 0.6910 1.0230 0.0046  0.0448  0.0805  180 LEU A CB  
1257 C CG  . LEU A 180 ? 1.0312 0.7078 1.0438 -0.0088 0.0402  0.0793  180 LEU A CG  
1258 C CD1 . LEU A 180 ? 0.9518 0.6483 0.9343 -0.0271 0.0361  0.0940  180 LEU A CD1 
1259 C CD2 . LEU A 180 ? 1.0933 0.7590 1.1032 -0.0038 0.0569  0.0558  180 LEU A CD2 
1260 N N   . VAL A 181 ? 0.9701 0.6460 0.9927 -0.0203 -0.0028 0.1258  181 VAL A N   
1261 C CA  . VAL A 181 ? 1.0886 0.7270 1.1054 -0.0319 -0.0227 0.1377  181 VAL A CA  
1262 C C   . VAL A 181 ? 1.1618 0.7964 1.1477 -0.0539 -0.0227 0.1412  181 VAL A C   
1263 O O   . VAL A 181 ? 1.2121 0.8841 1.1791 -0.0666 -0.0190 0.1508  181 VAL A O   
1264 C CB  . VAL A 181 ? 1.1196 0.7677 1.1371 -0.0401 -0.0421 0.1636  181 VAL A CB  
1265 C CG1 . VAL A 181 ? 1.1731 0.7826 1.1764 -0.0594 -0.0642 0.1806  181 VAL A CG1 
1266 C CG2 . VAL A 181 ? 1.1279 0.7757 1.1768 -0.0189 -0.0461 0.1610  181 VAL A CG2 
1267 N N   . ARG A 182 ? 1.1756 0.7670 1.1569 -0.0577 -0.0276 0.1318  182 ARG A N   
1268 C CA  . ARG A 182 ? 1.2051 0.7932 1.1574 -0.0794 -0.0276 0.1335  182 ARG A CA  
1269 C C   . ARG A 182 ? 1.3172 0.8479 1.2662 -0.0858 -0.0422 0.1283  182 ARG A C   
1270 O O   . ARG A 182 ? 1.2970 0.7931 1.2667 -0.0664 -0.0438 0.1111  182 ARG A O   
1271 C CB  . ARG A 182 ? 1.1840 0.7963 1.1269 -0.0738 -0.0045 0.1139  182 ARG A CB  
1272 C CG  . ARG A 182 ? 1.2275 0.8125 1.1838 -0.0558 0.0069  0.0868  182 ARG A CG  
1273 C CD  . ARG A 182 ? 1.2488 0.8491 1.1865 -0.0580 0.0256  0.0703  182 ARG A CD  
1274 N NE  . ARG A 182 ? 1.2967 0.8860 1.2494 -0.0394 0.0402  0.0445  182 ARG A NE  
1275 C CZ  . ARG A 182 ? 1.2971 0.9085 1.2412 -0.0353 0.0603  0.0304  182 ARG A CZ  
1276 N NH1 . ARG A 182 ? 1.3117 0.9524 1.2331 -0.0463 0.0659  0.0395  182 ARG A NH1 
1277 N NH2 . ARG A 182 ? 1.2667 0.8730 1.2249 -0.0204 0.0738  0.0073  182 ARG A NH2 
1278 N N   . SER A 183 ? 1.4126 0.9352 1.3360 -0.1130 -0.0532 0.1417  183 SER A N   
1279 C CA  . SER A 183 ? 1.5110 0.9761 1.4264 -0.1237 -0.0694 0.1373  183 SER A CA  
1280 C C   . SER A 183 ? 1.5645 1.0129 1.4790 -0.1110 -0.0541 0.1047  183 SER A C   
1281 O O   . SER A 183 ? 1.5289 1.0131 1.4307 -0.1123 -0.0344 0.0946  183 SER A O   
1282 C CB  . SER A 183 ? 1.5135 0.9818 1.4003 -0.1600 -0.0837 0.1606  183 SER A CB  
1283 N N   . GLU A 184 ? 1.6449 1.0395 1.5727 -0.0979 -0.0645 0.0876  184 GLU A N   
1284 C CA  . GLU A 184 ? 1.7089 1.0884 1.6379 -0.0834 -0.0507 0.0534  184 GLU A CA  
1285 C C   . GLU A 184 ? 1.7952 1.1066 1.7236 -0.0849 -0.0732 0.0422  184 GLU A C   
1286 O O   . GLU A 184 ? 1.8133 1.0850 1.7594 -0.0761 -0.0947 0.0482  184 GLU A O   
1287 C CB  . GLU A 184 ? 1.7010 1.1007 1.6587 -0.0514 -0.0319 0.0317  184 GLU A CB  
1288 C CG  . GLU A 184 ? 1.6806 1.1376 1.6437 -0.0476 -0.0152 0.0442  184 GLU A CG  
1289 C CD  . GLU A 184 ? 1.7234 1.2018 1.7121 -0.0207 0.0047  0.0219  184 GLU A CD  
1290 O OE1 . GLU A 184 ? 1.7815 1.2384 1.7819 -0.0052 0.0090  -0.0056 184 GLU A OE1 
1291 O OE2 . GLU A 184 ? 1.7090 1.2276 1.7061 -0.0158 0.0157  0.0309  184 GLU A OE2 
1292 N N   . ILE A 185 ? 1.8388 1.1350 1.7466 -0.0955 -0.0703 0.0253  185 ILE A N   
1293 C CA  . ILE A 185 ? 1.9140 1.1428 1.8193 -0.0969 -0.0923 0.0105  185 ILE A CA  
1294 C C   . ILE A 185 ? 1.9542 1.1569 1.8901 -0.0600 -0.0911 -0.0224 185 ILE A C   
1295 O O   . ILE A 185 ? 1.9296 1.1682 1.8761 -0.0393 -0.0649 -0.0478 185 ILE A O   
1296 C CB  . ILE A 185 ? 1.7228 0.9469 1.5988 -0.1152 -0.0870 -0.0046 185 ILE A CB  
1297 C CG1 . ILE A 185 ? 1.6890 0.9168 1.5367 -0.1553 -0.1012 0.0272  185 ILE A CG1 
1298 C CG2 . ILE A 185 ? 1.8024 0.9634 1.6820 -0.1036 -0.1016 -0.0357 185 ILE A CG2 
1299 C CD1 . ILE A 185 ? 1.5840 0.8847 1.4200 -0.1679 -0.0816 0.0467  185 ILE A CD1 
1300 N N   . SER A 186 ? 2.0404 1.1821 1.9905 -0.0521 -0.1205 -0.0218 186 SER A N   
1301 C CA  . SER A 186 ? 2.1169 1.2316 2.0984 -0.0150 -0.1235 -0.0561 186 SER A CA  
1302 C C   . SER A 186 ? 2.2023 1.3039 2.1757 -0.0059 -0.1134 -0.0976 186 SER A C   
1303 O O   . SER A 186 ? 2.2440 1.3399 2.1865 -0.0308 -0.1126 -0.0963 186 SER A O   
1304 C CB  . SER A 186 ? 2.1522 1.1966 2.1474 -0.0097 -0.1629 -0.0450 186 SER A CB  
1305 N N   . GLN A 187 ? 2.2277 1.3289 2.2293 0.0297  -0.1057 -0.1355 187 GLN A N   
1306 C CA  . GLN A 187 ? 2.2876 1.3742 2.2836 0.0416  -0.0989 -0.1790 187 GLN A CA  
1307 C C   . GLN A 187 ? 2.4188 1.4251 2.3983 0.0280  -0.1344 -0.1804 187 GLN A C   
1308 O O   . GLN A 187 ? 2.4481 1.4388 2.4060 0.0197  -0.1327 -0.2032 187 GLN A O   
1309 C CB  . GLN A 187 ? 2.2732 1.3728 2.3070 0.0840  -0.0891 -0.2198 187 GLN A CB  
1310 N N   . GLU A 188 ? 2.4937 1.4479 2.4826 0.0248  -0.1680 -0.1549 188 GLU A N   
1311 C CA  . GLU A 188 ? 2.5987 1.4728 2.5689 0.0037  -0.2064 -0.1439 188 GLU A CA  
1312 C C   . GLU A 188 ? 2.6477 1.5027 2.6136 -0.0199 -0.2306 -0.0922 188 GLU A C   
1313 O O   . GLU A 188 ? 2.6244 1.5056 2.6136 -0.0049 -0.2272 -0.0771 188 GLU A O   
1314 C CB  . GLU A 188 ? 2.6626 1.4688 2.6547 0.0366  -0.2321 -0.1830 188 GLU A CB  
1315 N N   . GLY A 189 ? 2.7101 1.5231 2.6457 -0.0586 -0.2548 -0.0649 189 GLY A N   
1316 C CA  . GLY A 189 ? 2.7296 1.5262 2.6564 -0.0864 -0.2787 -0.0144 189 GLY A CA  
1317 C C   . GLY A 189 ? 2.6635 1.5343 2.5698 -0.1181 -0.2555 0.0204  189 GLY A C   
1318 O O   . GLY A 189 ? 2.6077 1.5340 2.5014 -0.1239 -0.2247 0.0080  189 GLY A O   
1319 N N   . MET A 190 ? 2.6332 1.5061 2.5362 -0.1376 -0.2715 0.0636  190 MET A N   
1320 C CA  . MET A 190 ? 2.4984 1.4389 2.3811 -0.1699 -0.2552 0.0981  190 MET A CA  
1321 C C   . MET A 190 ? 2.3011 1.3247 2.2004 -0.1488 -0.2192 0.0943  190 MET A C   
1322 O O   . MET A 190 ? 2.1775 1.2128 2.1036 -0.1110 -0.2029 0.0644  190 MET A O   
1323 C CB  . MET A 190 ? 2.5207 1.4354 2.3897 -0.2028 -0.2866 0.1460  190 MET A CB  
1324 N N   . VAL A 191 ? 2.2652 1.3474 2.1482 -0.1747 -0.2080 0.1244  191 VAL A N   
1325 C CA  . VAL A 191 ? 2.2178 1.3777 2.1113 -0.1600 -0.1763 0.1232  191 VAL A CA  
1326 C C   . VAL A 191 ? 2.2112 1.3825 2.1260 -0.1464 -0.1836 0.1431  191 VAL A C   
1327 O O   . VAL A 191 ? 2.2263 1.3701 2.1346 -0.1651 -0.2107 0.1741  191 VAL A O   
1328 C CB  . VAL A 191 ? 1.8509 1.0738 1.7174 -0.1904 -0.1597 0.1399  191 VAL A CB  
1329 C CG1 . VAL A 191 ? 1.9115 1.1311 1.7598 -0.1985 -0.1488 0.1158  191 VAL A CG1 
1330 C CG2 . VAL A 191 ? 1.8390 1.0629 1.6858 -0.2290 -0.1820 0.1813  191 VAL A CG2 
1331 N N   . PHE A 192 ? 2.1584 1.3696 2.0977 -0.1151 -0.1603 0.1255  192 PHE A N   
1332 C CA  . PHE A 192 ? 2.0696 1.2996 2.0310 -0.0998 -0.1640 0.1404  192 PHE A CA  
1333 C C   . PHE A 192 ? 2.0018 1.3060 1.9711 -0.0876 -0.1315 0.1337  192 PHE A C   
1334 O O   . PHE A 192 ? 2.0402 1.3671 2.0095 -0.0770 -0.1069 0.1076  192 PHE A O   
1335 C CB  . PHE A 192 ? 2.0489 1.2313 2.0428 -0.0658 -0.1778 0.1204  192 PHE A CB  
1336 C CG  . PHE A 192 ? 2.0105 1.2041 2.0247 -0.0343 -0.1537 0.0772  192 PHE A CG  
1337 C CD1 . PHE A 192 ? 1.9409 1.1917 1.9758 -0.0131 -0.1266 0.0650  192 PHE A CD1 
1338 C CD2 . PHE A 192 ? 2.0815 1.2294 2.0935 -0.0272 -0.1589 0.0483  192 PHE A CD2 
1339 C CE1 . PHE A 192 ? 1.9417 1.2071 1.9935 0.0120  -0.1040 0.0270  192 PHE A CE1 
1340 C CE2 . PHE A 192 ? 2.0588 1.2236 2.0881 0.0005  -0.1357 0.0078  192 PHE A CE2 
1341 C CZ  . PHE A 192 ? 1.9771 1.2023 2.0259 0.0189  -0.1078 -0.0017 192 PHE A CZ  
1342 N N   . ARG A 193 ? 1.8986 1.2388 1.8729 -0.0901 -0.1328 0.1573  193 ARG A N   
1343 C CA  . ARG A 193 ? 1.7726 1.1773 1.7565 -0.0770 -0.1062 0.1512  193 ARG A CA  
1344 C C   . ARG A 193 ? 1.6931 1.0944 1.7122 -0.0410 -0.0966 0.1255  193 ARG A C   
1345 O O   . ARG A 193 ? 1.6608 1.0310 1.7015 -0.0263 -0.1151 0.1279  193 ARG A O   
1346 C CB  . ARG A 193 ? 1.7509 1.1948 1.7279 -0.0916 -0.1129 0.1828  193 ARG A CB  
1347 C CG  . ARG A 193 ? 1.8242 1.2759 1.7680 -0.1290 -0.1238 0.2082  193 ARG A CG  
1348 C CD  . ARG A 193 ? 1.9093 1.4021 1.8451 -0.1451 -0.1322 0.2392  193 ARG A CD  
1349 N NE  . ARG A 193 ? 2.0528 1.5098 1.9980 -0.1447 -0.1588 0.2596  193 ARG A NE  
1350 C CZ  . ARG A 193 ? 2.1239 1.5280 2.0559 -0.1660 -0.1871 0.2797  193 ARG A CZ  
1351 N NH1 . ARG A 193 ? 2.1695 1.5491 2.0790 -0.1905 -0.1923 0.2810  193 ARG A NH1 
1352 N NH2 . ARG A 193 ? 2.1114 1.4844 2.0520 -0.1635 -0.2122 0.2991  193 ARG A NH2 
1353 N N   . ARG A 194 ? 1.6324 1.0660 1.6571 -0.0275 -0.0688 0.1010  194 ARG A N   
1354 C CA  . ARG A 194 ? 1.6379 1.0763 1.6957 0.0036  -0.0574 0.0758  194 ARG A CA  
1355 C C   . ARG A 194 ? 1.5865 1.0761 1.6597 0.0127  -0.0445 0.0826  194 ARG A C   
1356 O O   . ARG A 194 ? 1.5547 1.0851 1.6110 0.0004  -0.0315 0.0927  194 ARG A O   
1357 C CB  . ARG A 194 ? 1.6805 1.1192 1.7381 0.0138  -0.0364 0.0422  194 ARG A CB  
1358 C CG  . ARG A 194 ? 1.7701 1.1658 1.8512 0.0366  -0.0460 0.0155  194 ARG A CG  
1359 C CD  . ARG A 194 ? 1.8009 1.2250 1.9031 0.0598  -0.0203 -0.0190 194 ARG A CD  
1360 N NE  . ARG A 194 ? 1.8692 1.3096 2.0104 0.0844  -0.0208 -0.0253 194 ARG A NE  
1361 C CZ  . ARG A 194 ? 1.9098 1.3789 2.0767 0.1058  -0.0013 -0.0542 194 ARG A CZ  
1362 N NH1 . ARG A 194 ? 1.9293 1.4128 2.0846 0.1051  0.0205  -0.0788 194 ARG A NH1 
1363 N NH2 . ARG A 194 ? 1.8928 1.3796 2.0964 0.1265  -0.0035 -0.0584 194 ARG A NH2 
1364 N N   . PHE A 195 ? 1.5545 1.0402 1.6608 0.0353  -0.0502 0.0759  195 PHE A N   
1365 C CA  . PHE A 195 ? 1.4741 1.0035 1.5993 0.0454  -0.0411 0.0806  195 PHE A CA  
1366 C C   . PHE A 195 ? 1.4220 0.9822 1.5621 0.0601  -0.0133 0.0534  195 PHE A C   
1367 O O   . PHE A 195 ? 1.4537 1.0096 1.6238 0.0817  -0.0102 0.0317  195 PHE A O   
1368 C CB  . PHE A 195 ? 1.5455 1.0563 1.7004 0.0622  -0.0623 0.0859  195 PHE A CB  
1369 C CG  . PHE A 195 ? 1.5939 1.1379 1.7542 0.0597  -0.0677 0.1079  195 PHE A CG  
1370 C CD1 . PHE A 195 ? 1.5533 1.1342 1.7419 0.0773  -0.0552 0.0971  195 PHE A CD1 
1371 C CD2 . PHE A 195 ? 1.6327 1.1738 1.7694 0.0385  -0.0856 0.1390  195 PHE A CD2 
1372 C CE1 . PHE A 195 ? 1.5026 1.1131 1.6958 0.0754  -0.0615 0.1156  195 PHE A CE1 
1373 C CE2 . PHE A 195 ? 1.5922 1.1672 1.7327 0.0367  -0.0908 0.1574  195 PHE A CE2 
1374 C CZ  . PHE A 195 ? 1.5310 1.1390 1.6997 0.0561  -0.0792 0.1449  195 PHE A CZ  
1375 N N   . HIS A 196 ? 1.3498 0.9422 1.4687 0.0480  0.0060  0.0542  196 HIS A N   
1376 C CA  . HIS A 196 ? 1.2996 0.9207 1.4281 0.0575  0.0314  0.0323  196 HIS A CA  
1377 C C   . HIS A 196 ? 1.2253 0.8858 1.3704 0.0631  0.0389  0.0383  196 HIS A C   
1378 O O   . HIS A 196 ? 1.2345 0.9172 1.3617 0.0514  0.0407  0.0539  196 HIS A O   
1379 C CB  . HIS A 196 ? 1.3251 0.9537 1.4207 0.0423  0.0469  0.0277  196 HIS A CB  
1380 C CG  . HIS A 196 ? 1.4430 1.0401 1.5295 0.0422  0.0477  0.0091  196 HIS A CG  
1381 N ND1 . HIS A 196 ? 1.5143 1.1106 1.6197 0.0585  0.0600  -0.0197 196 HIS A ND1 
1382 C CD2 . HIS A 196 ? 1.4915 1.0586 1.5525 0.0277  0.0371  0.0136  196 HIS A CD2 
1383 C CE1 . HIS A 196 ? 1.5848 1.1503 1.6759 0.0556  0.0567  -0.0335 196 HIS A CE1 
1384 N NE2 . HIS A 196 ? 1.5743 1.1195 1.6384 0.0363  0.0423  -0.0131 196 HIS A NE2 
1385 N N   . ASP A 197 ? 1.1814 0.8519 1.3618 0.0816  0.0423  0.0242  197 ASP A N   
1386 C CA  . ASP A 197 ? 1.1242 0.8323 1.3217 0.0857  0.0501  0.0275  197 ASP A CA  
1387 C C   . ASP A 197 ? 1.0543 0.7889 1.2423 0.0800  0.0753  0.0150  197 ASP A C   
1388 O O   . ASP A 197 ? 1.0747 0.8129 1.2723 0.0863  0.0897  -0.0068 197 ASP A O   
1389 C CB  . ASP A 197 ? 1.1633 0.8773 1.4035 0.1061  0.0433  0.0181  197 ASP A CB  
1390 C CG  . ASP A 197 ? 1.2154 0.9641 1.4718 0.1076  0.0444  0.0271  197 ASP A CG  
1391 O OD1 . ASP A 197 ? 1.2135 0.9854 1.4538 0.0962  0.0577  0.0310  197 ASP A OD1 
1392 O OD2 . ASP A 197 ? 1.2640 1.0152 1.5489 0.1203  0.0300  0.0302  197 ASP A OD2 
1393 N N   . LEU A 198 ? 0.9936 0.7471 1.1618 0.0681  0.0793  0.0287  198 LEU A N   
1394 C CA  . LEU A 198 ? 1.0055 0.7769 1.1574 0.0595  0.0991  0.0215  198 LEU A CA  
1395 C C   . LEU A 198 ? 1.0347 0.8356 1.2110 0.0640  0.1105  0.0147  198 LEU A C   
1396 O O   . LEU A 198 ? 0.9604 0.7748 1.1525 0.0675  0.1017  0.0244  198 LEU A O   
1397 C CB  . LEU A 198 ? 0.9807 0.7548 1.0980 0.0456  0.0957  0.0378  198 LEU A CB  
1398 C CG  . LEU A 198 ? 0.9781 0.7321 1.0731 0.0380  0.0815  0.0494  198 LEU A CG  
1399 C CD1 . LEU A 198 ? 0.9571 0.7265 1.0255 0.0275  0.0774  0.0640  198 LEU A CD1 
1400 C CD2 . LEU A 198 ? 1.0631 0.7946 1.1432 0.0337  0.0878  0.0370  198 LEU A CD2 
1401 N N   . THR A 199 ? 1.1141 0.9265 1.2915 0.0620  0.1298  -0.0019 199 THR A N   
1402 C CA  . THR A 199 ? 1.1188 0.9622 1.3168 0.0613  0.1437  -0.0096 199 THR A CA  
1403 C C   . THR A 199 ? 1.0847 0.9380 1.2651 0.0485  0.1438  0.0058  199 THR A C   
1404 O O   . THR A 199 ? 1.1449 0.9887 1.2903 0.0370  0.1464  0.0127  199 THR A O   
1405 C CB  . THR A 199 ? 1.0244 0.8802 1.2192 0.0576  0.1655  -0.0299 199 THR A CB  
1406 O OG1 . THR A 199 ? 1.0404 0.8871 1.2542 0.0727  0.1642  -0.0486 199 THR A OG1 
1407 C CG2 . THR A 199 ? 0.9988 0.8911 1.2135 0.0525  0.1804  -0.0361 199 THR A CG2 
1408 N N   . LEU A 200 ? 0.9926 0.8640 1.1973 0.0513  0.1393  0.0100  200 LEU A N   
1409 C CA  . LEU A 200 ? 0.9986 0.8752 1.1890 0.0411  0.1356  0.0230  200 LEU A CA  
1410 C C   . LEU A 200 ? 1.0909 0.9896 1.2917 0.0306  0.1499  0.0177  200 LEU A C   
1411 O O   . LEU A 200 ? 1.1685 1.0884 1.3970 0.0335  0.1616  0.0039  200 LEU A O   
1412 C CB  . LEU A 200 ? 0.9356 0.8142 1.1405 0.0493  0.1163  0.0338  200 LEU A CB  
1413 C CG  . LEU A 200 ? 0.9158 0.7782 1.1130 0.0569  0.1003  0.0421  200 LEU A CG  
1414 C CD1 . LEU A 200 ? 0.8607 0.7324 1.0711 0.0629  0.0829  0.0525  200 LEU A CD1 
1415 C CD2 . LEU A 200 ? 0.9654 0.8123 1.1227 0.0483  0.0994  0.0492  200 LEU A CD2 
1416 N N   . THR A 201 ? 1.0748 0.9693 1.2535 0.0180  0.1478  0.0284  201 THR A N   
1417 C CA  . THR A 201 ? 1.0419 0.9533 1.2268 0.0035  0.1582  0.0276  201 THR A CA  
1418 C C   . THR A 201 ? 1.1154 1.0468 1.3377 0.0074  0.1512  0.0272  201 THR A C   
1419 O O   . THR A 201 ? 1.1790 1.1352 1.4215 -0.0023 0.1623  0.0217  201 THR A O   
1420 C CB  . THR A 201 ? 0.9017 0.7948 1.0493 -0.0115 0.1540  0.0404  201 THR A CB  
1421 O OG1 . THR A 201 ? 0.8573 0.7380 1.0017 -0.0047 0.1335  0.0501  201 THR A OG1 
1422 C CG2 . THR A 201 ? 0.8880 0.7630 0.9985 -0.0146 0.1587  0.0414  201 THR A CG2 
1423 N N   . ARG A 202 ? 1.0720 0.9960 1.3024 0.0201  0.1327  0.0333  202 ARG A N   
1424 C CA  . ARG A 202 ? 0.9988 0.9418 1.2652 0.0265  0.1237  0.0321  202 ARG A CA  
1425 C C   . ARG A 202 ? 0.9606 0.8986 1.2386 0.0447  0.1083  0.0342  202 ARG A C   
1426 O O   . ARG A 202 ? 0.9062 0.8316 1.1669 0.0481  0.0930  0.0441  202 ARG A O   
1427 C CB  . ARG A 202 ? 0.9969 0.9369 1.2566 0.0164  0.1131  0.0409  202 ARG A CB  
1428 C CG  . ARG A 202 ? 1.0321 0.9902 1.3261 0.0240  0.1004  0.0400  202 ARG A CG  
1429 C CD  . ARG A 202 ? 1.0779 1.0376 1.3731 0.0102  0.0938  0.0441  202 ARG A CD  
1430 N NE  . ARG A 202 ? 1.1743 1.1446 1.4713 -0.0101 0.1105  0.0422  202 ARG A NE  
1431 C CZ  . ARG A 202 ? 1.2782 1.2285 1.5453 -0.0282 0.1108  0.0502  202 ARG A CZ  
1432 N NH1 . ARG A 202 ? 1.2811 1.2000 1.5173 -0.0247 0.0947  0.0581  202 ARG A NH1 
1433 N NH2 . ARG A 202 ? 1.3212 1.2845 1.5891 -0.0499 0.1262  0.0504  202 ARG A NH2 
1434 N N   . SER A 203 ? 1.0004 0.9495 1.3071 0.0563  0.1118  0.0242  203 SER A N   
1435 C CA  . SER A 203 ? 0.9721 0.9142 1.2917 0.0726  0.0959  0.0273  203 SER A CA  
1436 C C   . SER A 203 ? 0.9421 0.9015 1.2881 0.0784  0.0811  0.0315  203 SER A C   
1437 O O   . SER A 203 ? 0.8272 0.7791 1.1665 0.0844  0.0635  0.0421  203 SER A O   
1438 C CB  . SER A 203 ? 0.9814 0.9260 1.3242 0.0846  0.1027  0.0131  203 SER A CB  
1439 O OG  . SER A 203 ? 1.0417 0.9643 1.3824 0.0968  0.0868  0.0188  203 SER A OG  
1440 N N   . ARG A 204 ? 1.0547 1.0409 1.4302 0.0749  0.0885  0.0229  204 ARG A N   
1441 C CA  . ARG A 204 ? 1.1164 1.1233 1.5212 0.0795  0.0754  0.0244  204 ARG A CA  
1442 C C   . ARG A 204 ? 1.0648 1.0739 1.4571 0.0647  0.0722  0.0304  204 ARG A C   
1443 O O   . ARG A 204 ? 1.1093 1.1108 1.4802 0.0493  0.0835  0.0310  204 ARG A O   
1444 C CB  . ARG A 204 ? 1.2399 1.2799 1.6901 0.0850  0.0838  0.0095  204 ARG A CB  
1445 C CG  . ARG A 204 ? 1.3045 1.3496 1.7854 0.1069  0.0704  0.0055  204 ARG A CG  
1446 C CD  . ARG A 204 ? 1.3590 1.4113 1.8523 0.1123  0.0488  0.0152  204 ARG A CD  
1447 N NE  . ARG A 204 ? 1.4425 1.5138 1.9781 0.1307  0.0385  0.0077  204 ARG A NE  
1448 C CZ  . ARG A 204 ? 1.5202 1.5741 2.0616 0.1481  0.0286  0.0074  204 ARG A CZ  
1449 N NH1 . ARG A 204 ? 1.5364 1.5547 2.0438 0.1472  0.0289  0.0144  204 ARG A NH1 
1450 N NH2 . ARG A 204 ? 1.5649 1.6357 2.1465 0.1663  0.0168  0.0002  204 ARG A NH2 
1451 N N   . SER A 205 ? 1.0006 1.0188 1.4061 0.0694  0.0549  0.0346  205 SER A N   
1452 C CA  . SER A 205 ? 0.9639 0.9829 1.3619 0.0572  0.0484  0.0376  205 SER A CA  
1453 C C   . SER A 205 ? 0.9353 0.9794 1.3684 0.0634  0.0346  0.0351  205 SER A C   
1454 O O   . SER A 205 ? 0.8980 0.9434 1.3341 0.0769  0.0184  0.0395  205 SER A O   
1455 C CB  . SER A 205 ? 0.9179 0.9115 1.2756 0.0574  0.0369  0.0465  205 SER A CB  
1456 O OG  . SER A 205 ? 0.8556 0.8448 1.2050 0.0478  0.0282  0.0471  205 SER A OG  
1457 N N   . PRO A 206 ? 0.9458 1.0125 1.4052 0.0518  0.0408  0.0285  206 PRO A N   
1458 C CA  . PRO A 206 ? 0.9341 1.0307 1.4327 0.0567  0.0295  0.0240  206 PRO A CA  
1459 C C   . PRO A 206 ? 0.8797 0.9676 1.3659 0.0611  0.0067  0.0300  206 PRO A C   
1460 O O   . PRO A 206 ? 0.9029 1.0098 1.4128 0.0718  -0.0078 0.0290  206 PRO A O   
1461 C CB  . PRO A 206 ? 0.9914 1.1088 1.5082 0.0355  0.0409  0.0183  206 PRO A CB  
1462 C CG  . PRO A 206 ? 1.0244 1.1300 1.5192 0.0232  0.0624  0.0182  206 PRO A CG  
1463 C CD  . PRO A 206 ? 0.9916 1.0579 1.4428 0.0304  0.0578  0.0266  206 PRO A CD  
1464 N N   . ILE A 207 ? 0.8325 0.8932 1.2811 0.0539  0.0027  0.0350  207 ILE A N   
1465 C CA  . ILE A 207 ? 0.7944 0.8490 1.2288 0.0589  -0.0184 0.0371  207 ILE A CA  
1466 C C   . ILE A 207 ? 0.8240 0.8496 1.2136 0.0604  -0.0206 0.0420  207 ILE A C   
1467 O O   . ILE A 207 ? 0.8672 0.8736 1.2368 0.0516  -0.0071 0.0437  207 ILE A O   
1468 C CB  . ILE A 207 ? 0.7301 0.7896 1.1764 0.0453  -0.0266 0.0321  207 ILE A CB  
1469 C CG1 . ILE A 207 ? 0.7773 0.8456 1.2258 0.0551  -0.0501 0.0297  207 ILE A CG1 
1470 C CG2 . ILE A 207 ? 0.6771 0.7056 1.0924 0.0302  -0.0234 0.0338  207 ILE A CG2 
1471 C CD1 . ILE A 207 ? 0.8474 0.9052 1.2918 0.0428  -0.0624 0.0243  207 ILE A CD1 
1472 N N   . PHE A 208 ? 0.7747 0.8013 1.1488 0.0716  -0.0375 0.0436  208 PHE A N   
1473 C CA  . PHE A 208 ? 0.7798 0.7882 1.1147 0.0755  -0.0406 0.0464  208 PHE A CA  
1474 C C   . PHE A 208 ? 0.7891 0.8073 1.1133 0.0843  -0.0615 0.0424  208 PHE A C   
1475 O O   . PHE A 208 ? 0.8569 0.8969 1.1895 0.0935  -0.0711 0.0451  208 PHE A O   
1476 C CB  . PHE A 208 ? 0.7944 0.8020 1.1187 0.0823  -0.0325 0.0544  208 PHE A CB  
1477 C CG  . PHE A 208 ? 0.7581 0.7564 1.0449 0.0863  -0.0366 0.0576  208 PHE A CG  
1478 C CD1 . PHE A 208 ? 0.7750 0.7530 1.0364 0.0811  -0.0332 0.0545  208 PHE A CD1 
1479 C CD2 . PHE A 208 ? 0.7228 0.7345 0.9997 0.0944  -0.0446 0.0646  208 PHE A CD2 
1480 C CE1 . PHE A 208 ? 0.8042 0.7793 1.0342 0.0862  -0.0373 0.0557  208 PHE A CE1 
1481 C CE2 . PHE A 208 ? 0.7344 0.7456 0.9788 0.0965  -0.0475 0.0670  208 PHE A CE2 
1482 C CZ  . PHE A 208 ? 0.7890 0.7837 1.0114 0.0936  -0.0436 0.0613  208 PHE A CZ  
1483 N N   . SER A 209 ? 0.7388 0.7411 1.0438 0.0821  -0.0700 0.0354  209 SER A N   
1484 C CA  . SER A 209 ? 0.8132 0.8275 1.1085 0.0925  -0.0906 0.0272  209 SER A CA  
1485 C C   . SER A 209 ? 0.8612 0.8640 1.1209 0.0997  -0.0960 0.0225  209 SER A C   
1486 O O   . SER A 209 ? 0.9462 0.9694 1.1931 0.1116  -0.1090 0.0167  209 SER A O   
1487 C CB  . SER A 209 ? 0.8838 0.8956 1.1971 0.0870  -0.1036 0.0174  209 SER A CB  
1488 O OG  . SER A 209 ? 0.9806 0.9614 1.2902 0.0728  -0.0980 0.0167  209 SER A OG  
1489 N N   . LEU A 210 ? 0.8449 0.8188 1.0884 0.0928  -0.0864 0.0247  210 LEU A N   
1490 C CA  . LEU A 210 ? 0.8591 0.8202 1.0706 0.1007  -0.0936 0.0186  210 LEU A CA  
1491 C C   . LEU A 210 ? 0.8959 0.8574 1.0867 0.1017  -0.0799 0.0271  210 LEU A C   
1492 O O   . LEU A 210 ? 0.8790 0.8666 1.0611 0.1099  -0.0812 0.0291  210 LEU A O   
1493 C CB  . LEU A 210 ? 0.8739 0.7971 1.0777 0.0928  -0.0997 0.0136  210 LEU A CB  
1494 C CG  . LEU A 210 ? 0.9289 0.8469 1.1545 0.0867  -0.1128 0.0067  210 LEU A CG  
1495 C CD1 . LEU A 210 ? 0.9843 0.8592 1.2002 0.0744  -0.1197 0.0055  210 LEU A CD1 
1496 C CD2 . LEU A 210 ? 0.9586 0.8991 1.1844 0.1031  -0.1334 -0.0077 210 LEU A CD2 
1497 N N   . SER A 211 ? 0.9091 0.8426 1.0908 0.0915  -0.0674 0.0326  211 SER A N   
1498 C CA  . SER A 211 ? 0.8626 0.7932 1.0236 0.0911  -0.0551 0.0394  211 SER A CA  
1499 C C   . SER A 211 ? 0.8744 0.7895 1.0431 0.0768  -0.0347 0.0486  211 SER A C   
1500 O O   . SER A 211 ? 0.9830 0.8823 1.1629 0.0655  -0.0306 0.0488  211 SER A O   
1501 C CB  . SER A 211 ? 0.8416 0.7552 0.9734 0.0974  -0.0643 0.0329  211 SER A CB  
1502 O OG  . SER A 211 ? 0.8412 0.7547 0.9530 0.0965  -0.0534 0.0389  211 SER A OG  
1503 N N   . TRP A 212 ? 0.7558 0.6771 0.9176 0.0764  -0.0224 0.0553  212 TRP A N   
1504 C CA  . TRP A 212 ? 0.7030 0.6133 0.8715 0.0654  -0.0030 0.0608  212 TRP A CA  
1505 C C   . TRP A 212 ? 0.7105 0.6122 0.8522 0.0643  0.0055  0.0647  212 TRP A C   
1506 O O   . TRP A 212 ? 0.7713 0.6868 0.9056 0.0702  0.0031  0.0677  212 TRP A O   
1507 C CB  . TRP A 212 ? 0.7055 0.6339 0.9035 0.0673  0.0022  0.0634  212 TRP A CB  
1508 C CG  . TRP A 212 ? 0.6462 0.5688 0.8567 0.0596  0.0211  0.0646  212 TRP A CG  
1509 C CD1 . TRP A 212 ? 0.6903 0.5965 0.8868 0.0493  0.0353  0.0642  212 TRP A CD1 
1510 C CD2 . TRP A 212 ? 0.5769 0.5121 0.8163 0.0631  0.0265  0.0645  212 TRP A CD2 
1511 N NE1 . TRP A 212 ? 0.6814 0.5927 0.8965 0.0463  0.0508  0.0621  212 TRP A NE1 
1512 C CE2 . TRP A 212 ? 0.6216 0.5495 0.8646 0.0559  0.0449  0.0615  212 TRP A CE2 
1513 C CE3 . TRP A 212 ? 0.6124 0.5647 0.8748 0.0725  0.0161  0.0663  212 TRP A CE3 
1514 C CZ2 . TRP A 212 ? 0.6445 0.5821 0.9153 0.0601  0.0531  0.0574  212 TRP A CZ2 
1515 C CZ3 . TRP A 212 ? 0.6158 0.5738 0.9053 0.0762  0.0227  0.0647  212 TRP A CZ3 
1516 C CH2 . TRP A 212 ? 0.6332 0.5840 0.9276 0.0712  0.0409  0.0590  212 TRP A CH2 
1517 N N   . THR A 213 ? 0.7346 0.6147 0.8603 0.0549  0.0147  0.0655  213 THR A N   
1518 C CA  . THR A 213 ? 0.8252 0.6986 0.9276 0.0527  0.0240  0.0688  213 THR A CA  
1519 C C   . THR A 213 ? 0.8707 0.7443 0.9874 0.0456  0.0421  0.0703  213 THR A C   
1520 O O   . THR A 213 ? 0.9213 0.7885 1.0475 0.0359  0.0536  0.0688  213 THR A O   
1521 C CB  . THR A 213 ? 0.7558 0.6059 0.8293 0.0468  0.0239  0.0692  213 THR A CB  
1522 O OG1 . THR A 213 ? 0.7768 0.6231 0.8382 0.0561  0.0045  0.0650  213 THR A OG1 
1523 C CG2 . THR A 213 ? 0.6971 0.5448 0.7474 0.0452  0.0322  0.0718  213 THR A CG2 
1524 N N   . VAL A 214 ? 0.8448 0.7270 0.9634 0.0502  0.0437  0.0727  214 VAL A N   
1525 C CA  . VAL A 214 ? 0.8481 0.7264 0.9777 0.0464  0.0584  0.0716  214 VAL A CA  
1526 C C   . VAL A 214 ? 0.8946 0.7579 0.9955 0.0388  0.0687  0.0714  214 VAL A C   
1527 O O   . VAL A 214 ? 0.8415 0.7021 0.9164 0.0395  0.0616  0.0743  214 VAL A O   
1528 C CB  . VAL A 214 ? 0.7242 0.6105 0.8651 0.0534  0.0522  0.0755  214 VAL A CB  
1529 C CG1 . VAL A 214 ? 0.6880 0.5633 0.8349 0.0514  0.0643  0.0724  214 VAL A CG1 
1530 C CG2 . VAL A 214 ? 0.6644 0.5662 0.8344 0.0607  0.0421  0.0760  214 VAL A CG2 
1531 N N   . MET A 215 ? 0.9626 0.8199 1.0685 0.0322  0.0850  0.0664  215 MET A N   
1532 C CA  . MET A 215 ? 0.9984 0.8429 1.0763 0.0245  0.0948  0.0654  215 MET A CA  
1533 C C   . MET A 215 ? 1.0241 0.8669 1.1108 0.0214  0.1113  0.0571  215 MET A C   
1534 O O   . MET A 215 ? 1.0019 0.8546 1.1139 0.0209  0.1207  0.0501  215 MET A O   
1535 C CB  . MET A 215 ? 1.0246 0.8598 1.0805 0.0156  0.0956  0.0678  215 MET A CB  
1536 C CG  . MET A 215 ? 1.0447 0.8836 1.1189 0.0098  0.0978  0.0672  215 MET A CG  
1537 S SD  . MET A 215 ? 1.2235 1.0426 1.2681 0.0001  0.0891  0.0741  215 MET A SD  
1538 C CE  . MET A 215 ? 1.0861 0.9119 1.1581 -0.0109 0.0922  0.0741  215 MET A CE  
1539 N N   . HIS A 216 ? 1.0508 0.8832 1.1165 0.0196  0.1138  0.0562  216 HIS A N   
1540 C CA  . HIS A 216 ? 1.0303 0.8578 1.0992 0.0180  0.1272  0.0458  216 HIS A CA  
1541 C C   . HIS A 216 ? 1.0114 0.8311 1.0471 0.0068  0.1374  0.0440  216 HIS A C   
1542 O O   . HIS A 216 ? 1.0411 0.8519 1.0499 0.0042  0.1309  0.0492  216 HIS A O   
1543 C CB  . HIS A 216 ? 1.0585 0.8763 1.1301 0.0244  0.1181  0.0469  216 HIS A CB  
1544 C CG  . HIS A 216 ? 1.0812 0.8853 1.1404 0.0211  0.1269  0.0373  216 HIS A CG  
1545 N ND1 . HIS A 216 ? 1.0748 0.8766 1.1557 0.0271  0.1355  0.0226  216 HIS A ND1 
1546 C CD2 . HIS A 216 ? 1.0781 0.8710 1.1062 0.0134  0.1269  0.0386  216 HIS A CD2 
1547 C CE1 . HIS A 216 ? 1.1043 0.8915 1.1667 0.0233  0.1403  0.0146  216 HIS A CE1 
1548 N NE2 . HIS A 216 ? 1.0872 0.8687 1.1172 0.0138  0.1354  0.0249  216 HIS A NE2 
1549 N N   . PRO A 217 ? 0.9784 0.8052 1.0155 -0.0011 0.1530  0.0370  217 PRO A N   
1550 C CA  . PRO A 217 ? 0.9864 0.8075 0.9902 -0.0136 0.1631  0.0361  217 PRO A CA  
1551 C C   . PRO A 217 ? 1.0274 0.8403 1.0193 -0.0123 0.1681  0.0265  217 PRO A C   
1552 O O   . PRO A 217 ? 1.0926 0.9082 1.1081 -0.0045 0.1728  0.0146  217 PRO A O   
1553 C CB  . PRO A 217 ? 0.9486 0.7867 0.9645 -0.0228 0.1801  0.0292  217 PRO A CB  
1554 C CG  . PRO A 217 ? 0.9394 0.7900 0.9909 -0.0166 0.1749  0.0307  217 PRO A CG  
1555 C CD  . PRO A 217 ? 0.9423 0.7872 1.0120 -0.0004 0.1616  0.0305  217 PRO A CD  
1556 N N   . ILE A 218 ? 1.0316 0.8337 0.9887 -0.0191 0.1656  0.0307  218 ILE A N   
1557 C CA  . ILE A 218 ? 1.0821 0.8751 1.0270 -0.0195 0.1691  0.0211  218 ILE A CA  
1558 C C   . ILE A 218 ? 1.1786 0.9767 1.1064 -0.0293 0.1871  0.0093  218 ILE A C   
1559 O O   . ILE A 218 ? 1.2254 1.0209 1.1201 -0.0400 0.1888  0.0149  218 ILE A O   
1560 C CB  . ILE A 218 ? 1.0276 0.8103 0.9467 -0.0213 0.1550  0.0306  218 ILE A CB  
1561 C CG1 . ILE A 218 ? 0.9149 0.7007 0.8493 -0.0131 0.1382  0.0420  218 ILE A CG1 
1562 C CG2 . ILE A 218 ? 1.0570 0.8283 0.9670 -0.0231 0.1562  0.0209  218 ILE A CG2 
1563 C CD1 . ILE A 218 ? 0.8482 0.6364 0.7579 -0.0151 0.1252  0.0524  218 ILE A CD1 
1564 N N   . ASP A 219 ? 1.2090 1.0168 1.1599 -0.0247 0.1998  -0.0079 219 ASP A N   
1565 C CA  . ASP A 219 ? 1.2906 1.1104 1.2285 -0.0326 0.2186  -0.0234 219 ASP A CA  
1566 C C   . ASP A 219 ? 1.3206 1.1299 1.2601 -0.0252 0.2204  -0.0429 219 ASP A C   
1567 O O   . ASP A 219 ? 1.3117 1.1003 1.2581 -0.0170 0.2056  -0.0406 219 ASP A O   
1568 C CB  . ASP A 219 ? 1.3456 1.1937 1.3094 -0.0340 0.2337  -0.0313 219 ASP A CB  
1569 C CG  . ASP A 219 ? 1.3557 1.2102 1.3654 -0.0166 0.2305  -0.0418 219 ASP A CG  
1570 O OD1 . ASP A 219 ? 1.3994 1.2378 1.4189 -0.0040 0.2235  -0.0524 219 ASP A OD1 
1571 O OD2 . ASP A 219 ? 1.3035 1.1778 1.3391 -0.0161 0.2336  -0.0390 219 ASP A OD2 
1572 N N   . HIS A 220 ? 1.3827 1.2065 1.3151 -0.0290 0.2377  -0.0624 220 HIS A N   
1573 C CA  . HIS A 220 ? 1.5041 1.3151 1.4320 -0.0228 0.2385  -0.0834 220 HIS A CA  
1574 C C   . HIS A 220 ? 1.4847 1.2804 1.4497 -0.0037 0.2277  -0.0945 220 HIS A C   
1575 O O   . HIS A 220 ? 1.5144 1.2837 1.4741 0.0010  0.2177  -0.1031 220 HIS A O   
1576 C CB  . HIS A 220 ? 1.6668 1.5028 1.5825 -0.0287 0.2602  -0.1061 220 HIS A CB  
1577 C CG  . HIS A 220 ? 1.7967 1.6711 1.7268 -0.0344 0.2776  -0.1076 220 HIS A CG  
1578 N ND1 . HIS A 220 ? 1.8498 1.7381 1.7531 -0.0542 0.2846  -0.0897 220 HIS A ND1 
1579 C CD2 . HIS A 220 ? 1.8389 1.7417 1.8076 -0.0240 0.2882  -0.1247 220 HIS A CD2 
1580 C CE1 . HIS A 220 ? 1.8540 1.7774 1.7776 -0.0586 0.2993  -0.0942 220 HIS A CE1 
1581 N NE2 . HIS A 220 ? 1.8497 1.7860 1.8144 -0.0401 0.3027  -0.1163 220 HIS A NE2 
1582 N N   . HIS A 221 ? 1.4321 1.2422 1.4338 0.0063  0.2276  -0.0931 221 HIS A N   
1583 C CA  . HIS A 221 ? 1.4395 1.2354 1.4778 0.0255  0.2154  -0.1025 221 HIS A CA  
1584 C C   . HIS A 221 ? 1.4050 1.1717 1.4442 0.0272  0.1919  -0.0797 221 HIS A C   
1585 O O   . HIS A 221 ? 1.4289 1.1723 1.4870 0.0394  0.1772  -0.0839 221 HIS A O   
1586 C CB  . HIS A 221 ? 1.4384 1.2661 1.5176 0.0365  0.2244  -0.1124 221 HIS A CB  
1587 C CG  . HIS A 221 ? 1.5043 1.3680 1.5879 0.0358  0.2477  -0.1382 221 HIS A CG  
1588 N ND1 . HIS A 221 ? 1.4993 1.4041 1.5880 0.0249  0.2650  -0.1357 221 HIS A ND1 
1589 C CD2 . HIS A 221 ? 1.5319 1.3991 1.6142 0.0435  0.2565  -0.1676 221 HIS A CD2 
1590 C CE1 . HIS A 221 ? 1.5137 1.4505 1.6040 0.0248  0.2848  -0.1617 221 HIS A CE1 
1591 N NE2 . HIS A 221 ? 1.5460 1.4616 1.6328 0.0375  0.2803  -0.1829 221 HIS A NE2 
1592 N N   . SER A 222 ? 1.3017 1.0705 1.3197 0.0149  0.1875  -0.0561 222 SER A N   
1593 C CA  . SER A 222 ? 1.1640 0.9171 1.1824 0.0152  0.1674  -0.0344 222 SER A CA  
1594 C C   . SER A 222 ? 1.2239 0.9474 1.2254 0.0119  0.1532  -0.0320 222 SER A C   
1595 O O   . SER A 222 ? 1.2828 0.9991 1.2556 0.0023  0.1576  -0.0377 222 SER A O   
1596 C CB  . SER A 222 ? 1.1039 0.8691 1.1010 0.0042  0.1664  -0.0146 222 SER A CB  
1597 O OG  . SER A 222 ? 1.1109 0.8651 1.1000 0.0025  0.1483  0.0029  222 SER A OG  
1598 N N   . PRO A 223 ? 1.2514 0.9580 1.2695 0.0178  0.1350  -0.0222 223 PRO A N   
1599 C CA  . PRO A 223 ? 1.2586 0.9369 1.2610 0.0106  0.1182  -0.0146 223 PRO A CA  
1600 C C   . PRO A 223 ? 1.2783 0.9643 1.2452 -0.0060 0.1169  -0.0005 223 PRO A C   
1601 O O   . PRO A 223 ? 1.3658 1.0348 1.3110 -0.0161 0.1115  -0.0021 223 PRO A O   
1602 C CB  . PRO A 223 ? 1.2312 0.9023 1.2555 0.0163  0.0999  0.0016  223 PRO A CB  
1603 C CG  . PRO A 223 ? 1.2645 0.9489 1.3240 0.0330  0.1066  -0.0090 223 PRO A CG  
1604 C CD  . PRO A 223 ? 1.2527 0.9666 1.3063 0.0307  0.1286  -0.0180 223 PRO A CD  
1605 N N   . ILE A 224 ? 1.2389 0.9500 1.2007 -0.0081 0.1202  0.0121  224 ILE A N   
1606 C CA  . ILE A 224 ? 1.2700 0.9920 1.2014 -0.0201 0.1165  0.0246  224 ILE A CA  
1607 C C   . ILE A 224 ? 1.2982 1.0296 1.2063 -0.0254 0.1312  0.0165  224 ILE A C   
1608 O O   . ILE A 224 ? 1.2649 1.0097 1.1521 -0.0310 0.1292  0.0263  224 ILE A O   
1609 C CB  . ILE A 224 ? 1.2487 0.9915 1.1853 -0.0180 0.1077  0.0422  224 ILE A CB  
1610 C CG1 . ILE A 224 ? 1.2443 1.0028 1.1904 -0.0113 0.1182  0.0399  224 ILE A CG1 
1611 C CG2 . ILE A 224 ? 1.2152 0.9530 1.1739 -0.0137 0.0933  0.0519  224 ILE A CG2 
1612 C CD1 . ILE A 224 ? 1.2073 0.9843 1.1527 -0.0090 0.1090  0.0536  224 ILE A CD1 
1613 N N   . TYR A 225 ? 1.3686 1.0944 1.2797 -0.0230 0.1451  -0.0020 225 TYR A N   
1614 C CA  . TYR A 225 ? 1.3940 1.1298 1.2803 -0.0303 0.1595  -0.0093 225 TYR A CA  
1615 C C   . TYR A 225 ? 1.3987 1.1259 1.2517 -0.0417 0.1552  -0.0099 225 TYR A C   
1616 O O   . TYR A 225 ? 1.3798 1.0891 1.2309 -0.0434 0.1522  -0.0211 225 TYR A O   
1617 C CB  . TYR A 225 ? 1.4162 1.1564 1.3153 -0.0254 0.1767  -0.0306 225 TYR A CB  
1618 C CG  . TYR A 225 ? 1.4537 1.2071 1.3243 -0.0358 0.1920  -0.0368 225 TYR A CG  
1619 C CD1 . TYR A 225 ? 1.4752 1.2462 1.3391 -0.0412 0.1988  -0.0260 225 TYR A CD1 
1620 C CD2 . TYR A 225 ? 1.5009 1.2478 1.3493 -0.0415 0.1980  -0.0526 225 TYR A CD2 
1621 C CE1 . TYR A 225 ? 1.5233 1.3048 1.3578 -0.0532 0.2111  -0.0284 225 TYR A CE1 
1622 C CE2 . TYR A 225 ? 1.5522 1.3132 1.3715 -0.0523 0.2116  -0.0571 225 TYR A CE2 
1623 C CZ  . TYR A 225 ? 1.5487 1.3271 1.3605 -0.0587 0.2180  -0.0437 225 TYR A CZ  
1624 O OH  . TYR A 225 ? 1.5545 1.3454 1.3344 -0.0719 0.2298  -0.0452 225 TYR A OH  
1625 N N   . GLY A 226 ? 1.4255 1.1644 1.2528 -0.0490 0.1531  0.0016  226 GLY A N   
1626 C CA  . GLY A 226 ? 1.4455 1.1818 1.2418 -0.0597 0.1472  0.0025  226 GLY A CA  
1627 C C   . GLY A 226 ? 1.4172 1.1544 1.2139 -0.0629 0.1294  0.0154  226 GLY A C   
1628 O O   . GLY A 226 ? 1.3804 1.1253 1.1534 -0.0715 0.1224  0.0202  226 GLY A O   
1629 N N   . GLU A 227 ? 1.4191 1.1520 1.2428 -0.0568 0.1219  0.0213  227 GLU A N   
1630 C CA  . GLU A 227 ? 1.3739 1.1128 1.1988 -0.0621 0.1055  0.0354  227 GLU A CA  
1631 C C   . GLU A 227 ? 1.2847 1.0520 1.0950 -0.0628 0.0993  0.0472  227 GLU A C   
1632 O O   . GLU A 227 ? 1.2345 1.0125 1.0472 -0.0541 0.1031  0.0496  227 GLU A O   
1633 C CB  . GLU A 227 ? 1.3913 1.1246 1.2466 -0.0545 0.0988  0.0420  227 GLU A CB  
1634 C CG  . GLU A 227 ? 1.4872 1.2096 1.3443 -0.0644 0.0836  0.0506  227 GLU A CG  
1635 C CD  . GLU A 227 ? 1.6162 1.3035 1.4731 -0.0685 0.0831  0.0374  227 GLU A CD  
1636 O OE1 . GLU A 227 ? 1.6435 1.3202 1.5026 -0.0607 0.0964  0.0193  227 GLU A OE1 
1637 O OE2 . GLU A 227 ? 1.6658 1.3370 1.5201 -0.0802 0.0688  0.0447  227 GLU A OE2 
1638 N N   . THR A 228 ? 1.2475 1.0274 1.0431 -0.0733 0.0885  0.0536  228 THR A N   
1639 C CA  . THR A 228 ? 1.2384 1.0499 1.0218 -0.0720 0.0808  0.0617  228 THR A CA  
1640 C C   . THR A 228 ? 1.2052 1.0382 1.0019 -0.0739 0.0685  0.0737  228 THR A C   
1641 O O   . THR A 228 ? 1.1938 1.0128 1.0066 -0.0775 0.0656  0.0777  228 THR A O   
1642 C CB  . THR A 228 ? 1.2813 1.1022 1.0373 -0.0833 0.0776  0.0587  228 THR A CB  
1643 O OG1 . THR A 228 ? 1.3134 1.1335 1.0685 -0.0988 0.0697  0.0618  228 THR A OG1 
1644 C CG2 . THR A 228 ? 1.3207 1.1198 1.0600 -0.0851 0.0895  0.0465  228 THR A CG2 
1645 N N   . ASP A 229 ? 1.1629 1.0315 0.9526 -0.0712 0.0602  0.0789  229 ASP A N   
1646 C CA  . ASP A 229 ? 1.1822 1.0793 0.9813 -0.0761 0.0494  0.0893  229 ASP A CA  
1647 C C   . ASP A 229 ? 1.2629 1.1501 1.0561 -0.0971 0.0451  0.0937  229 ASP A C   
1648 O O   . ASP A 229 ? 1.3489 1.2236 1.1553 -0.1037 0.0406  0.1018  229 ASP A O   
1649 C CB  . ASP A 229 ? 1.2171 1.1608 1.0075 -0.0712 0.0409  0.0903  229 ASP A CB  
1650 C CG  . ASP A 229 ? 1.2909 1.2726 1.0907 -0.0775 0.0312  0.1001  229 ASP A CG  
1651 O OD1 . ASP A 229 ? 1.3338 1.3317 1.1478 -0.0644 0.0282  0.1019  229 ASP A OD1 
1652 O OD2 . ASP A 229 ? 1.2799 1.2751 1.0724 -0.0975 0.0263  0.1064  229 ASP A OD2 
1653 N N   . GLU A 230 ? 1.2564 1.1468 1.0291 -0.1082 0.0449  0.0887  230 GLU A N   
1654 C CA  . GLU A 230 ? 1.2488 1.1291 1.0133 -0.1309 0.0389  0.0923  230 GLU A CA  
1655 C C   . GLU A 230 ? 1.2510 1.0822 1.0267 -0.1354 0.0397  0.0918  230 GLU A C   
1656 O O   . GLU A 230 ? 1.2451 1.0708 1.0291 -0.1471 0.0298  0.1038  230 GLU A O   
1657 C CB  . GLU A 230 ? 1.2548 1.1340 0.9959 -0.1395 0.0409  0.0825  230 GLU A CB  
1658 N N   . THR A 231 ? 1.2568 1.0536 1.0325 -0.1257 0.0505  0.0776  231 THR A N   
1659 C CA  . THR A 231 ? 1.2762 1.0271 1.0640 -0.1254 0.0513  0.0716  231 THR A CA  
1660 C C   . THR A 231 ? 1.2943 1.0406 1.1073 -0.1176 0.0459  0.0825  231 THR A C   
1661 O O   . THR A 231 ? 1.2992 1.0130 1.1224 -0.1223 0.0378  0.0850  231 THR A O   
1662 C CB  . THR A 231 ? 1.2597 0.9896 1.0474 -0.1114 0.0668  0.0529  231 THR A CB  
1663 O OG1 . THR A 231 ? 1.2072 0.9530 1.0076 -0.0941 0.0752  0.0542  231 THR A OG1 
1664 C CG2 . THR A 231 ? 1.2846 1.0220 1.0448 -0.1185 0.0720  0.0432  231 THR A CG2 
1665 N N   . LEU A 232 ? 1.2865 1.0632 1.1087 -0.1051 0.0487  0.0884  232 LEU A N   
1666 C CA  . LEU A 232 ? 1.2116 0.9907 1.0563 -0.0974 0.0431  0.0989  232 LEU A CA  
1667 C C   . LEU A 232 ? 1.2469 1.0422 1.0884 -0.1152 0.0277  0.1170  232 LEU A C   
1668 O O   . LEU A 232 ? 1.2581 1.0304 1.1109 -0.1202 0.0180  0.1263  232 LEU A O   
1669 C CB  . LEU A 232 ? 1.0769 0.8863 0.9296 -0.0807 0.0486  0.0989  232 LEU A CB  
1670 C CG  . LEU A 232 ? 1.0444 0.8339 0.9123 -0.0636 0.0608  0.0872  232 LEU A CG  
1671 C CD1 . LEU A 232 ? 1.0015 0.8168 0.8782 -0.0500 0.0622  0.0898  232 LEU A CD1 
1672 C CD2 . LEU A 232 ? 1.0681 0.8262 0.9580 -0.0601 0.0585  0.0863  232 LEU A CD2 
1673 N N   . ARG A 233 ? 1.2808 1.1184 1.1066 -0.1249 0.0247  0.1223  233 ARG A N   
1674 C CA  . ARG A 233 ? 1.3221 1.1868 1.1414 -0.1460 0.0116  0.1393  233 ARG A CA  
1675 C C   . ARG A 233 ? 1.3808 1.2025 1.1955 -0.1663 0.0021  0.1455  233 ARG A C   
1676 O O   . ARG A 233 ? 1.3320 1.1436 1.1524 -0.1781 -0.0103 0.1617  233 ARG A O   
1677 C CB  . ARG A 233 ? 1.3622 1.2757 1.1637 -0.1544 0.0116  0.1376  233 ARG A CB  
1678 C CG  . ARG A 233 ? 1.4383 1.3960 1.2439 -0.1342 0.0160  0.1321  233 ARG A CG  
1679 C CD  . ARG A 233 ? 1.5594 1.5637 1.3718 -0.1387 0.0074  0.1451  233 ARG A CD  
1680 N NE  . ARG A 233 ? 1.6249 1.6619 1.4461 -0.1151 0.0098  0.1379  233 ARG A NE  
1681 C CZ  . ARG A 233 ? 1.6653 1.7452 1.4792 -0.1055 0.0096  0.1284  233 ARG A CZ  
1682 N NH1 . ARG A 233 ? 1.6946 1.7935 1.4929 -0.1177 0.0082  0.1253  233 ARG A NH1 
1683 N NH2 . ARG A 233 ? 1.6598 1.7620 1.4825 -0.0829 0.0090  0.1208  233 ARG A NH2 
1684 N N   . ASN A 234 ? 1.4918 1.2856 1.2948 -0.1702 0.0065  0.1321  234 ASN A N   
1685 C CA  . ASN A 234 ? 1.5813 1.3308 1.3771 -0.1896 -0.0041 0.1340  234 ASN A CA  
1686 C C   . ASN A 234 ? 1.5357 1.2318 1.3500 -0.1803 -0.0100 0.1338  234 ASN A C   
1687 O O   . ASN A 234 ? 1.5590 1.2242 1.3721 -0.1974 -0.0267 0.1462  234 ASN A O   
1688 C CB  . ASN A 234 ? 1.6697 1.4032 1.4491 -0.1922 0.0031  0.1154  234 ASN A CB  
1689 C CG  . ASN A 234 ? 1.6866 1.4728 1.4494 -0.1966 0.0085  0.1136  234 ASN A CG  
1690 O OD1 . ASN A 234 ? 1.6716 1.5055 1.4321 -0.2069 0.0026  0.1274  234 ASN A OD1 
1691 N ND2 . ASN A 234 ? 1.6874 1.4681 1.4386 -0.1883 0.0191  0.0958  234 ASN A ND2 
1692 N N   . SER A 235 ? 1.4774 1.1628 1.3088 -0.1537 0.0021  0.1198  235 SER A N   
1693 C CA  . SER A 235 ? 1.5047 1.1471 1.3579 -0.1406 -0.0032 0.1172  235 SER A CA  
1694 C C   . SER A 235 ? 1.4868 1.1436 1.3516 -0.1433 -0.0154 0.1397  235 SER A C   
1695 O O   . SER A 235 ? 1.4877 1.1146 1.3718 -0.1327 -0.0232 0.1421  235 SER A O   
1696 C CB  . SER A 235 ? 1.5798 1.2174 1.4490 -0.1133 0.0145  0.0959  235 SER A CB  
1697 O OG  . SER A 235 ? 1.5867 1.2692 1.4572 -0.1030 0.0267  0.0971  235 SER A OG  
1698 N N   . HIS A 236 ? 1.4968 1.2029 1.3497 -0.1571 -0.0175 0.1552  236 HIS A N   
1699 C CA  . HIS A 236 ? 1.5104 1.2425 1.3700 -0.1619 -0.0279 0.1766  236 HIS A CA  
1700 C C   . HIS A 236 ? 1.4372 1.1688 1.3215 -0.1355 -0.0225 0.1719  236 HIS A C   
1701 O O   . HIS A 236 ? 1.4383 1.1598 1.3339 -0.1356 -0.0349 0.1860  236 HIS A O   
1702 C CB  . HIS A 236 ? 1.6606 1.3595 1.5151 -0.1853 -0.0497 0.1970  236 HIS A CB  
1703 C CG  . HIS A 236 ? 1.8527 1.5753 1.6830 -0.2185 -0.0581 0.2117  236 HIS A CG  
1704 N ND1 . HIS A 236 ? 1.9708 1.6582 1.7864 -0.2372 -0.0646 0.2082  236 HIS A ND1 
1705 C CD2 . HIS A 236 ? 1.8962 1.6785 1.7150 -0.2371 -0.0611 0.2287  236 HIS A CD2 
1706 C CE1 . HIS A 236 ? 1.9916 1.7156 1.7881 -0.2676 -0.0714 0.2240  236 HIS A CE1 
1707 N NE2 . HIS A 236 ? 1.9562 1.7405 1.7547 -0.2679 -0.0688 0.2363  236 HIS A NE2 
1708 N N   . SER A 237 ? 1.3413 1.0843 1.2326 -0.1146 -0.0053 0.1532  237 SER A N   
1709 C CA  . SER A 237 ? 1.2170 0.9560 1.1328 -0.0907 0.0011  0.1458  237 SER A CA  
1710 C C   . SER A 237 ? 1.1957 0.9785 1.1185 -0.0851 -0.0013 0.1566  237 SER A C   
1711 O O   . SER A 237 ? 1.2105 1.0364 1.1201 -0.0892 0.0016  0.1587  237 SER A O   
1712 C CB  . SER A 237 ? 1.1172 0.8519 1.0359 -0.0746 0.0198  0.1233  237 SER A CB  
1713 O OG  . SER A 237 ? 1.0888 0.7894 0.9981 -0.0803 0.0225  0.1112  237 SER A OG  
1714 N N   . GLU A 238 ? 1.1750 0.9470 1.1191 -0.0743 -0.0077 0.1618  238 GLU A N   
1715 C CA  . GLU A 238 ? 1.1157 0.9244 1.0701 -0.0649 -0.0094 0.1680  238 GLU A CA  
1716 C C   . GLU A 238 ? 1.1420 0.9369 1.1232 -0.0420 -0.0018 0.1551  238 GLU A C   
1717 O O   . GLU A 238 ? 1.2149 0.9723 1.2091 -0.0345 0.0011  0.1450  238 GLU A O   
1718 C CB  . GLU A 238 ? 1.1100 0.9241 1.0642 -0.0775 -0.0279 0.1906  238 GLU A CB  
1719 C CG  . GLU A 238 ? 1.2136 1.0384 1.1429 -0.1052 -0.0376 0.2068  238 GLU A CG  
1720 C CD  . GLU A 238 ? 1.3221 1.1650 1.2475 -0.1199 -0.0548 0.2314  238 GLU A CD  
1721 O OE1 . GLU A 238 ? 1.3469 1.2127 1.2853 -0.1069 -0.0564 0.2333  238 GLU A OE1 
1722 O OE2 . GLU A 238 ? 1.3794 1.2144 1.2875 -0.1462 -0.0675 0.2494  238 GLU A OE2 
1723 N N   . PHE A 239 ? 1.0807 0.9080 1.0708 -0.0308 0.0006  0.1541  239 PHE A N   
1724 C CA  . PHE A 239 ? 1.0327 0.8527 1.0490 -0.0116 0.0070  0.1431  239 PHE A CA  
1725 C C   . PHE A 239 ? 1.0771 0.9158 1.1085 -0.0060 -0.0047 0.1537  239 PHE A C   
1726 O O   . PHE A 239 ? 1.1022 0.9738 1.1215 -0.0132 -0.0128 0.1648  239 PHE A O   
1727 C CB  . PHE A 239 ? 0.9442 0.7793 0.9576 -0.0029 0.0221  0.1283  239 PHE A CB  
1728 C CG  . PHE A 239 ? 1.0179 0.8392 1.0129 -0.0092 0.0329  0.1190  239 PHE A CG  
1729 C CD1 . PHE A 239 ? 1.0654 0.9019 1.0344 -0.0222 0.0302  0.1242  239 PHE A CD1 
1730 C CD2 . PHE A 239 ? 1.0565 0.8539 1.0602 -0.0028 0.0458  0.1043  239 PHE A CD2 
1731 C CE1 . PHE A 239 ? 1.1206 0.9452 1.0721 -0.0283 0.0389  0.1156  239 PHE A CE1 
1732 C CE2 . PHE A 239 ? 1.0768 0.8632 1.0612 -0.0092 0.0554  0.0955  239 PHE A CE2 
1733 C CZ  . PHE A 239 ? 1.1361 0.9342 1.0941 -0.0218 0.0514  0.1015  239 PHE A CZ  
1734 N N   . LEU A 240 ? 1.0606 0.8819 1.1191 0.0072  -0.0058 0.1489  240 LEU A N   
1735 C CA  . LEU A 240 ? 0.9907 0.8249 1.0645 0.0123  -0.0193 0.1597  240 LEU A CA  
1736 C C   . LEU A 240 ? 0.9674 0.8091 1.0685 0.0299  -0.0119 0.1463  240 LEU A C   
1737 O O   . LEU A 240 ? 0.9461 0.7672 1.0663 0.0394  -0.0031 0.1330  240 LEU A O   
1738 C CB  . LEU A 240 ? 1.0152 0.8162 1.0962 0.0085  -0.0353 0.1720  240 LEU A CB  
1739 C CG  . LEU A 240 ? 1.0367 0.8434 1.1340 0.0137  -0.0526 0.1853  240 LEU A CG  
1740 C CD1 . LEU A 240 ? 1.0658 0.9114 1.1426 0.0003  -0.0627 0.2033  240 LEU A CD1 
1741 C CD2 . LEU A 240 ? 0.9963 0.7584 1.1026 0.0135  -0.0688 0.1938  240 LEU A CD2 
1742 N N   . VAL A 241 ? 0.9673 0.8417 1.0703 0.0337  -0.0159 0.1488  241 VAL A N   
1743 C CA  . VAL A 241 ? 0.9791 0.8625 1.1076 0.0477  -0.0115 0.1378  241 VAL A CA  
1744 C C   . VAL A 241 ? 0.9613 0.8459 1.1134 0.0549  -0.0261 0.1456  241 VAL A C   
1745 O O   . VAL A 241 ? 0.9660 0.8689 1.1101 0.0504  -0.0406 0.1598  241 VAL A O   
1746 C CB  . VAL A 241 ? 1.0026 0.9168 1.1214 0.0496  -0.0089 0.1325  241 VAL A CB  
1747 C CG1 . VAL A 241 ? 1.0125 0.9337 1.1581 0.0612  -0.0072 0.1228  241 VAL A CG1 
1748 C CG2 . VAL A 241 ? 1.0143 0.9244 1.1118 0.0449  0.0039  0.1241  241 VAL A CG2 
1749 N N   . LEU A 242 ? 0.9196 0.7883 1.1011 0.0661  -0.0222 0.1357  242 LEU A N   
1750 C CA  . LEU A 242 ? 0.9403 0.8108 1.1480 0.0757  -0.0364 0.1407  242 LEU A CA  
1751 C C   . LEU A 242 ? 0.8886 0.7815 1.1214 0.0859  -0.0303 0.1281  242 LEU A C   
1752 O O   . LEU A 242 ? 0.8915 0.7796 1.1451 0.0924  -0.0172 0.1128  242 LEU A O   
1753 C CB  . LEU A 242 ? 1.0272 0.8635 1.2524 0.0824  -0.0407 0.1384  242 LEU A CB  
1754 C CG  . LEU A 242 ? 1.0439 0.8532 1.2406 0.0691  -0.0455 0.1492  242 LEU A CG  
1755 C CD1 . LEU A 242 ? 1.0348 0.8047 1.2454 0.0765  -0.0467 0.1402  242 LEU A CD1 
1756 C CD2 . LEU A 242 ? 1.0509 0.8655 1.2286 0.0571  -0.0664 0.1741  242 LEU A CD2 
1757 N N   . PHE A 243 ? 0.8408 0.7608 1.0702 0.0855  -0.0398 0.1341  243 PHE A N   
1758 C CA  . PHE A 243 ? 0.8166 0.7572 1.0690 0.0933  -0.0378 0.1234  243 PHE A CA  
1759 C C   . PHE A 243 ? 0.8495 0.7990 1.1281 0.1022  -0.0541 0.1289  243 PHE A C   
1760 O O   . PHE A 243 ? 0.8828 0.8367 1.1508 0.0997  -0.0710 0.1448  243 PHE A O   
1761 C CB  . PHE A 243 ? 0.7968 0.7619 1.0296 0.0893  -0.0389 0.1219  243 PHE A CB  
1762 C CG  . PHE A 243 ? 0.7646 0.7487 1.0197 0.0960  -0.0422 0.1128  243 PHE A CG  
1763 C CD1 . PHE A 243 ? 0.6977 0.6799 0.9604 0.0954  -0.0299 0.0992  243 PHE A CD1 
1764 C CD2 . PHE A 243 ? 0.7751 0.7778 1.0435 0.1011  -0.0588 0.1190  243 PHE A CD2 
1765 C CE1 . PHE A 243 ? 0.7148 0.7124 0.9984 0.0989  -0.0343 0.0914  243 PHE A CE1 
1766 C CE2 . PHE A 243 ? 0.7816 0.8017 1.0714 0.1064  -0.0627 0.1097  243 PHE A CE2 
1767 C CZ  . PHE A 243 ? 0.7466 0.7636 1.0446 0.1048  -0.0505 0.0957  243 PHE A CZ  
1768 N N   . THR A 244 ? 0.8787 0.8347 1.1911 0.1113  -0.0495 0.1164  244 THR A N   
1769 C CA  . THR A 244 ? 0.9445 0.9126 1.2859 0.1214  -0.0652 0.1193  244 THR A CA  
1770 C C   . THR A 244 ? 0.9269 0.9174 1.2967 0.1255  -0.0582 0.1041  244 THR A C   
1771 O O   . THR A 244 ? 0.9280 0.9173 1.3009 0.1215  -0.0401 0.0914  244 THR A O   
1772 C CB  . THR A 244 ? 1.0381 0.9835 1.4016 0.1316  -0.0712 0.1201  244 THR A CB  
1773 O OG1 . THR A 244 ? 1.0260 0.9611 1.4037 0.1347  -0.0515 0.1027  244 THR A OG1 
1774 C CG2 . THR A 244 ? 1.1332 1.0525 1.4692 0.1253  -0.0837 0.1385  244 THR A CG2 
1775 N N   . GLY A 245 ? 0.9173 0.9285 1.3066 0.1317  -0.0735 0.1065  245 GLY A N   
1776 C CA  . GLY A 245 ? 0.9344 0.9688 1.3516 0.1335  -0.0697 0.0931  245 GLY A CA  
1777 C C   . GLY A 245 ? 1.0054 1.0634 1.4356 0.1389  -0.0904 0.0983  245 GLY A C   
1778 O O   . GLY A 245 ? 1.0145 1.0734 1.4250 0.1390  -0.1065 0.1131  245 GLY A O   
1779 N N   . HIS A 246 ? 1.0451 1.1248 1.5077 0.1415  -0.0899 0.0865  246 HIS A N   
1780 C CA  . HIS A 246 ? 1.0018 1.1067 1.4841 0.1476  -0.1093 0.0883  246 HIS A CA  
1781 C C   . HIS A 246 ? 0.9396 1.0607 1.4050 0.1396  -0.1140 0.0843  246 HIS A C   
1782 O O   . HIS A 246 ? 0.9153 1.0417 1.3904 0.1329  -0.1043 0.0714  246 HIS A O   
1783 C CB  . HIS A 246 ? 1.0248 1.1470 1.5560 0.1549  -0.1060 0.0755  246 HIS A CB  
1784 C CG  . HIS A 246 ? 1.1193 1.2705 1.6763 0.1612  -0.1255 0.0752  246 HIS A CG  
1785 N ND1 . HIS A 246 ? 1.1856 1.3564 1.7390 0.1536  -0.1315 0.0703  246 HIS A ND1 
1786 C CD2 . HIS A 246 ? 1.1585 1.3215 1.7458 0.1753  -0.1419 0.0782  246 HIS A CD2 
1787 C CE1 . HIS A 246 ? 1.2110 1.4068 1.7906 0.1613  -0.1498 0.0705  246 HIS A CE1 
1788 N NE2 . HIS A 246 ? 1.1907 1.3829 1.7913 0.1748  -0.1566 0.0759  246 HIS A NE2 
1789 N N   . HIS A 247 ? 0.9320 1.0611 1.3712 0.1397  -0.1297 0.0946  247 HIS A N   
1790 C CA  . HIS A 247 ? 0.9499 1.0951 1.3713 0.1349  -0.1356 0.0874  247 HIS A CA  
1791 C C   . HIS A 247 ? 0.9777 1.1470 1.4301 0.1373  -0.1465 0.0772  247 HIS A C   
1792 O O   . HIS A 247 ? 0.9531 1.1386 1.4264 0.1445  -0.1609 0.0827  247 HIS A O   
1793 C CB  . HIS A 247 ? 0.9590 1.1151 1.3438 0.1343  -0.1485 0.0990  247 HIS A CB  
1794 C CG  . HIS A 247 ? 1.0546 1.2157 1.4092 0.1299  -0.1455 0.0893  247 HIS A CG  
1795 N ND1 . HIS A 247 ? 1.1150 1.2922 1.4727 0.1311  -0.1535 0.0742  247 HIS A ND1 
1796 C CD2 . HIS A 247 ? 1.0998 1.2519 1.4215 0.1258  -0.1370 0.0912  247 HIS A CD2 
1797 C CE1 . HIS A 247 ? 1.1271 1.3032 1.4554 0.1298  -0.1509 0.0663  247 HIS A CE1 
1798 N NE2 . HIS A 247 ? 1.0963 1.2597 1.4029 0.1267  -0.1405 0.0765  247 HIS A NE2 
1799 N N   . GLU A 248 ? 1.0154 1.1849 1.4701 0.1306  -0.1411 0.0628  248 GLU A N   
1800 C CA  . GLU A 248 ? 1.0248 1.2151 1.5075 0.1293  -0.1511 0.0517  248 GLU A CA  
1801 C C   . GLU A 248 ? 1.0660 1.2802 1.5369 0.1349  -0.1735 0.0535  248 GLU A C   
1802 O O   . GLU A 248 ? 1.0987 1.3361 1.5956 0.1383  -0.1874 0.0511  248 GLU A O   
1803 C CB  . GLU A 248 ? 1.0203 1.1978 1.4985 0.1181  -0.1431 0.0381  248 GLU A CB  
1804 C CG  . GLU A 248 ? 0.9954 1.1883 1.5061 0.1114  -0.1495 0.0265  248 GLU A CG  
1805 C CD  . GLU A 248 ? 1.0518 1.2255 1.5485 0.0992  -0.1482 0.0152  248 GLU A CD  
1806 O OE1 . GLU A 248 ? 0.9779 1.1261 1.4418 0.0978  -0.1410 0.0160  248 GLU A OE1 
1807 O OE2 . GLU A 248 ? 1.1647 1.3477 1.6834 0.0908  -0.1562 0.0058  248 GLU A OE2 
1808 N N   . ALA A 249 ? 1.0796 1.2924 1.5110 0.1356  -0.1769 0.0569  249 ALA A N   
1809 C CA  . ALA A 249 ? 1.0932 1.3338 1.5068 0.1398  -0.1965 0.0565  249 ALA A CA  
1810 C C   . ALA A 249 ? 1.1436 1.4038 1.5673 0.1451  -0.2112 0.0724  249 ALA A C   
1811 O O   . ALA A 249 ? 1.1496 1.4358 1.5856 0.1483  -0.2285 0.0687  249 ALA A O   
1812 C CB  . ALA A 249 ? 1.0332 1.2742 1.4031 0.1394  -0.1945 0.0569  249 ALA A CB  
1813 N N   . PHE A 250 ? 1.1620 1.4073 1.5797 0.1459  -0.2062 0.0902  250 PHE A N   
1814 C CA  . PHE A 250 ? 1.1431 1.3988 1.5664 0.1506  -0.2227 0.1086  250 PHE A CA  
1815 C C   . PHE A 250 ? 1.0288 1.2809 1.4987 0.1582  -0.2253 0.1075  250 PHE A C   
1816 O O   . PHE A 250 ? 0.9615 1.2236 1.4434 0.1647  -0.2431 0.1196  250 PHE A O   
1817 C CB  . PHE A 250 ? 1.1738 1.4112 1.5685 0.1470  -0.2199 0.1292  250 PHE A CB  
1818 C CG  . PHE A 250 ? 1.1458 1.3914 1.4969 0.1391  -0.2148 0.1296  250 PHE A CG  
1819 C CD1 . PHE A 250 ? 1.1386 1.3602 1.4729 0.1341  -0.1965 0.1292  250 PHE A CD1 
1820 C CD2 . PHE A 250 ? 1.1513 1.4330 1.4790 0.1374  -0.2286 0.1285  250 PHE A CD2 
1821 C CE1 . PHE A 250 ? 1.1543 1.3884 1.4513 0.1282  -0.1924 0.1280  250 PHE A CE1 
1822 C CE2 . PHE A 250 ? 1.1707 1.4673 1.4608 0.1319  -0.2237 0.1258  250 PHE A CE2 
1823 C CZ  . PHE A 250 ? 1.1676 1.4408 1.4434 0.1276  -0.2058 0.1256  250 PHE A CZ  
1824 N N   . ALA A 251 ? 1.0428 1.2834 1.5385 0.1570  -0.2082 0.0928  251 ALA A N   
1825 C CA  . ALA A 251 ? 1.0964 1.3379 1.6380 0.1642  -0.2060 0.0889  251 ALA A CA  
1826 C C   . ALA A 251 ? 1.1348 1.3550 1.6778 0.1727  -0.2082 0.1045  251 ALA A C   
1827 O O   . ALA A 251 ? 1.0801 1.3076 1.6509 0.1840  -0.2230 0.1097  251 ALA A O   
1828 C CB  . ALA A 251 ? 1.1203 1.3944 1.6920 0.1693  -0.2250 0.0836  251 ALA A CB  
1829 N N   . GLN A 252 ? 1.2321 1.4243 1.7462 0.1675  -0.1945 0.1109  252 GLN A N   
1830 C CA  . GLN A 252 ? 1.2893 1.4563 1.7907 0.1718  -0.2008 0.1290  252 GLN A CA  
1831 C C   . GLN A 252 ? 1.2461 1.3832 1.7244 0.1648  -0.1798 0.1287  252 GLN A C   
1832 O O   . GLN A 252 ? 1.2245 1.3627 1.6897 0.1562  -0.1631 0.1174  252 GLN A O   
1833 C CB  . GLN A 252 ? 1.3688 1.5455 1.8362 0.1673  -0.2216 0.1486  252 GLN A CB  
1834 C CG  . GLN A 252 ? 1.4390 1.5920 1.8940 0.1694  -0.2367 0.1720  252 GLN A CG  
1835 C CD  . GLN A 252 ? 1.4931 1.6647 1.9155 0.1618  -0.2581 0.1921  252 GLN A CD  
1836 O OE1 . GLN A 252 ? 1.4531 1.6596 1.8727 0.1603  -0.2651 0.1857  252 GLN A OE1 
1837 N NE2 . GLN A 252 ? 1.5687 1.7179 1.9647 0.1554  -0.2691 0.2163  252 GLN A NE2 
1838 N N   . ASN A 253 ? 1.2321 1.3405 1.7049 0.1683  -0.1825 0.1409  253 ASN A N   
1839 C CA  . ASN A 253 ? 1.2150 1.2946 1.6652 0.1612  -0.1642 0.1410  253 ASN A CA  
1840 C C   . ASN A 253 ? 1.2369 1.3126 1.6378 0.1474  -0.1659 0.1559  253 ASN A C   
1841 O O   . ASN A 253 ? 1.2770 1.3653 1.6595 0.1437  -0.1846 0.1722  253 ASN A O   
1842 C CB  . ASN A 253 ? 1.1979 1.2461 1.6651 0.1712  -0.1658 0.1437  253 ASN A CB  
1843 C CG  . ASN A 253 ? 1.1943 1.2477 1.7044 0.1821  -0.1509 0.1212  253 ASN A CG  
1844 O OD1 . ASN A 253 ? 1.1761 1.2489 1.6953 0.1765  -0.1336 0.1056  253 ASN A OD1 
1845 N ND2 . ASN A 253 ? 1.2048 1.2415 1.7412 0.1971  -0.1583 0.1191  253 ASN A ND2 
1846 N N   . VAL A 254 ? 1.1821 1.2448 1.5621 0.1391  -0.1464 0.1499  254 VAL A N   
1847 C CA  . VAL A 254 ? 1.0641 1.1274 1.4001 0.1263  -0.1456 0.1610  254 VAL A CA  
1848 C C   . VAL A 254 ? 1.0685 1.1028 1.3900 0.1206  -0.1282 0.1592  254 VAL A C   
1849 O O   . VAL A 254 ? 1.0210 1.0412 1.3622 0.1252  -0.1125 0.1446  254 VAL A O   
1850 C CB  . VAL A 254 ? 0.9200 1.0130 1.2403 0.1222  -0.1415 0.1502  254 VAL A CB  
1851 C CG1 . VAL A 254 ? 0.9747 1.0991 1.3030 0.1262  -0.1600 0.1518  254 VAL A CG1 
1852 C CG2 . VAL A 254 ? 0.7825 0.8696 1.1189 0.1243  -0.1231 0.1293  254 VAL A CG2 
1853 N N   . HIS A 255 ? 1.1389 1.1675 1.4252 0.1090  -0.1309 0.1738  255 HIS A N   
1854 C CA  . HIS A 255 ? 1.2294 1.2330 1.4991 0.1021  -0.1153 0.1718  255 HIS A CA  
1855 C C   . HIS A 255 ? 1.1918 1.2104 1.4212 0.0882  -0.1132 0.1795  255 HIS A C   
1856 O O   . HIS A 255 ? 1.1956 1.2467 1.4090 0.0838  -0.1238 0.1863  255 HIS A O   
1857 C CB  . HIS A 255 ? 1.3668 1.3329 1.6441 0.1037  -0.1212 0.1815  255 HIS A CB  
1858 C CG  . HIS A 255 ? 1.5566 1.5177 1.8176 0.0962  -0.1442 0.2066  255 HIS A CG  
1859 N ND1 . HIS A 255 ? 1.6322 1.5981 1.9113 0.1042  -0.1648 0.2160  255 HIS A ND1 
1860 C CD2 . HIS A 255 ? 1.6672 1.6199 1.8941 0.0794  -0.1510 0.2260  255 HIS A CD2 
1861 C CE1 . HIS A 255 ? 1.7200 1.6779 1.9751 0.0922  -0.1839 0.2414  255 HIS A CE1 
1862 N NE2 . HIS A 255 ? 1.7460 1.6967 1.9692 0.0759  -0.1755 0.2481  255 HIS A NE2 
1863 N N   . ALA A 256 ? 1.1099 1.1086 1.3240 0.0815  -0.0995 0.1770  256 ALA A N   
1864 C CA  . ALA A 256 ? 1.0611 1.0764 1.2401 0.0692  -0.0952 0.1809  256 ALA A CA  
1865 C C   . ALA A 256 ? 1.0810 1.0661 1.2473 0.0617  -0.0834 0.1812  256 ALA A C   
1866 O O   . ALA A 256 ? 1.0867 1.0477 1.2685 0.0682  -0.0702 0.1679  256 ALA A O   
1867 C CB  . ALA A 256 ? 1.0272 1.0699 1.2024 0.0745  -0.0872 0.1635  256 ALA A CB  
1868 N N   . ARG A 257 ? 1.0828 1.0725 1.2202 0.0463  -0.0882 0.1961  257 ARG A N   
1869 C CA  . ARG A 257 ? 1.0204 0.9854 1.1423 0.0369  -0.0781 0.1961  257 ARG A CA  
1870 C C   . ARG A 257 ? 1.0069 1.0025 1.1001 0.0275  -0.0708 0.1933  257 ARG A C   
1871 O O   . ARG A 257 ? 1.0408 1.0785 1.1214 0.0249  -0.0769 0.1959  257 ARG A O   
1872 C CB  . ARG A 257 ? 1.0277 0.9639 1.1413 0.0245  -0.0914 0.2166  257 ARG A CB  
1873 C CG  . ARG A 257 ? 1.1213 1.0259 1.2624 0.0355  -0.1033 0.2203  257 ARG A CG  
1874 C CD  . ARG A 257 ? 1.1692 1.0321 1.3008 0.0244  -0.1155 0.2364  257 ARG A CD  
1875 N NE  . ARG A 257 ? 1.1743 1.0290 1.3070 0.0205  -0.1404 0.2588  257 ARG A NE  
1876 C CZ  . ARG A 257 ? 1.2421 1.1215 1.3482 0.0015  -0.1537 0.2819  257 ARG A CZ  
1877 N NH1 . ARG A 257 ? 1.2691 1.1871 1.3483 -0.0133 -0.1436 0.2827  257 ARG A NH1 
1878 N NH2 . ARG A 257 ? 1.3102 1.1783 1.4163 -0.0027 -0.1778 0.3039  257 ARG A NH2 
1879 N N   . HIS A 258 ? 0.9389 0.9154 1.0223 0.0233  -0.0582 0.1864  258 HIS A N   
1880 C CA  . HIS A 258 ? 0.8469 0.8501 0.9039 0.0143  -0.0526 0.1842  258 HIS A CA  
1881 C C   . HIS A 258 ? 0.8763 0.8480 0.9221 0.0043  -0.0447 0.1851  258 HIS A C   
1882 O O   . HIS A 258 ? 0.8862 0.8178 0.9469 0.0095  -0.0396 0.1800  258 HIS A O   
1883 C CB  . HIS A 258 ? 0.7880 0.8113 0.8475 0.0279  -0.0437 0.1643  258 HIS A CB  
1884 C CG  . HIS A 258 ? 0.7959 0.8595 0.8312 0.0235  -0.0433 0.1607  258 HIS A CG  
1885 N ND1 . HIS A 258 ? 0.7814 0.8415 0.8043 0.0243  -0.0331 0.1496  258 HIS A ND1 
1886 C CD2 . HIS A 258 ? 0.7938 0.9059 0.8154 0.0188  -0.0525 0.1656  258 HIS A CD2 
1887 C CE1 . HIS A 258 ? 0.7814 0.8860 0.7863 0.0221  -0.0367 0.1468  258 HIS A CE1 
1888 N NE2 . HIS A 258 ? 0.7742 0.9131 0.7781 0.0186  -0.0475 0.1556  258 HIS A NE2 
1889 N N   . ALA A 259 ? 0.8733 0.8666 0.8935 -0.0099 -0.0441 0.1902  259 ALA A N   
1890 C CA  . ALA A 259 ? 0.8601 0.8270 0.8675 -0.0209 -0.0374 0.1902  259 ALA A CA  
1891 C C   . ALA A 259 ? 0.9007 0.8963 0.8892 -0.0227 -0.0283 0.1796  259 ALA A C   
1892 O O   . ALA A 259 ? 0.9120 0.9556 0.8897 -0.0238 -0.0319 0.1795  259 ALA A O   
1893 C CB  . ALA A 259 ? 0.8376 0.7916 0.8326 -0.0418 -0.0500 0.2117  259 ALA A CB  
1894 N N   . TYR A 260 ? 0.9565 0.9237 0.9410 -0.0227 -0.0175 0.1701  260 TYR A N   
1895 C CA  . TYR A 260 ? 0.9919 0.9780 0.9589 -0.0235 -0.0096 0.1599  260 TYR A CA  
1896 C C   . TYR A 260 ? 1.0488 1.0168 0.9991 -0.0417 -0.0083 0.1658  260 TYR A C   
1897 O O   . TYR A 260 ? 1.0859 1.0150 1.0412 -0.0488 -0.0108 0.1724  260 TYR A O   
1898 C CB  . TYR A 260 ? 0.9617 0.9297 0.9372 -0.0068 0.0020  0.1422  260 TYR A CB  
1899 C CG  . TYR A 260 ? 0.9060 0.8868 0.8981 0.0097  -0.0001 0.1351  260 TYR A CG  
1900 C CD1 . TYR A 260 ? 0.9144 0.8676 0.9292 0.0189  0.0038  0.1310  260 TYR A CD1 
1901 C CD2 . TYR A 260 ? 0.8536 0.8761 0.8394 0.0163  -0.0066 0.1308  260 TYR A CD2 
1902 C CE1 . TYR A 260 ? 0.8918 0.8564 0.9219 0.0316  0.0010  0.1248  260 TYR A CE1 
1903 C CE2 . TYR A 260 ? 0.8437 0.8746 0.8439 0.0310  -0.0102 0.1230  260 TYR A CE2 
1904 C CZ  . TYR A 260 ? 0.8782 0.8789 0.9000 0.0373  -0.0066 0.1210  260 TYR A CZ  
1905 O OH  . TYR A 260 ? 0.8819 0.8911 0.9184 0.0498  -0.0112 0.1133  260 TYR A OH  
1906 N N   . SER A 261 ? 1.0971 1.0942 1.0284 -0.0482 -0.0058 0.1621  261 SER A N   
1907 C CA  . SER A 261 ? 1.1536 1.1406 1.0674 -0.0670 -0.0052 0.1666  261 SER A CA  
1908 C C   . SER A 261 ? 1.2140 1.2020 1.1172 -0.0601 0.0050  0.1508  261 SER A C   
1909 O O   . SER A 261 ? 1.3037 1.3029 1.2112 -0.0423 0.0094  0.1387  261 SER A O   
1910 C CB  . SER A 261 ? 1.1739 1.2049 1.0726 -0.0880 -0.0152 0.1817  261 SER A CB  
1911 O OG  . SER A 261 ? 1.2005 1.2829 1.0877 -0.0850 -0.0126 0.1724  261 SER A OG  
1912 N N   . CYS A 262 ? 1.2002 1.1742 1.0886 -0.0749 0.0070  0.1514  262 CYS A N   
1913 C CA  . CYS A 262 ? 1.1468 1.1200 1.0227 -0.0700 0.0153  0.1378  262 CYS A CA  
1914 C C   . CYS A 262 ? 1.0465 1.0720 0.9147 -0.0614 0.0128  0.1315  262 CYS A C   
1915 O O   . CYS A 262 ? 0.9684 0.9917 0.8327 -0.0472 0.0175  0.1191  262 CYS A O   
1916 C CB  . CYS A 262 ? 1.1689 1.1249 1.0287 -0.0901 0.0153  0.1404  262 CYS A CB  
1917 S SG  . CYS A 262 ? 1.3898 1.2866 1.2581 -0.1009 0.0123  0.1476  262 CYS A SG  
1918 N N   . ASP A 263 ? 1.0358 1.1095 0.9014 -0.0700 0.0042  0.1398  263 ASP A N   
1919 C CA  . ASP A 263 ? 1.0972 1.2276 0.9576 -0.0596 0.0005  0.1306  263 ASP A CA  
1920 C C   . ASP A 263 ? 1.0832 1.2122 0.9559 -0.0329 0.0005  0.1185  263 ASP A C   
1921 O O   . ASP A 263 ? 1.2193 1.3669 1.0874 -0.0170 -0.0013 0.1050  263 ASP A O   
1922 C CB  . ASP A 263 ? 1.0944 1.2826 0.9517 -0.0746 -0.0077 0.1413  263 ASP A CB  
1923 C CG  . ASP A 263 ? 1.1427 1.3238 0.9894 -0.1058 -0.0102 0.1583  263 ASP A CG  
1924 O OD1 . ASP A 263 ? 1.1479 1.3445 0.9953 -0.1222 -0.0170 0.1748  263 ASP A OD1 
1925 O OD2 . ASP A 263 ? 1.1496 1.3081 0.9860 -0.1151 -0.0067 0.1558  263 ASP A OD2 
1926 N N   . GLU A 264 ? 0.9336 1.0397 0.8219 -0.0282 0.0006  0.1236  264 GLU A N   
1927 C CA  . GLU A 264 ? 0.9770 1.0781 0.8790 -0.0060 -0.0005 0.1138  264 GLU A CA  
1928 C C   . GLU A 264 ? 1.0202 1.0819 0.9232 0.0082  0.0058  0.1023  264 GLU A C   
1929 O O   . GLU A 264 ? 1.1963 1.2647 1.1031 0.0257  0.0015  0.0918  264 GLU A O   
1930 C CB  . GLU A 264 ? 1.0068 1.0945 0.9259 -0.0072 -0.0027 0.1234  264 GLU A CB  
1931 C CG  . GLU A 264 ? 1.0645 1.2038 0.9845 -0.0101 -0.0125 0.1294  264 GLU A CG  
1932 C CD  . GLU A 264 ? 1.1736 1.3181 1.0878 -0.0346 -0.0163 0.1493  264 GLU A CD  
1933 O OE1 . GLU A 264 ? 1.3018 1.4114 1.2102 -0.0487 -0.0125 0.1563  264 GLU A OE1 
1934 O OE2 . GLU A 264 ? 1.1927 1.3751 1.1069 -0.0405 -0.0242 0.1580  264 GLU A OE2 
1935 N N   . ILE A 265 ? 0.8543 0.8747 0.7536 -0.0003 0.0152  0.1044  265 ILE A N   
1936 C CA  . ILE A 265 ? 0.7862 0.7699 0.6845 0.0079  0.0229  0.0964  265 ILE A CA  
1937 C C   . ILE A 265 ? 0.7618 0.7590 0.6429 0.0163  0.0188  0.0873  265 ILE A C   
1938 O O   . ILE A 265 ? 0.8643 0.8737 0.7291 0.0082  0.0186  0.0872  265 ILE A O   
1939 C CB  . ILE A 265 ? 0.7986 0.7440 0.6939 -0.0043 0.0339  0.0987  265 ILE A CB  
1940 C CG1 . ILE A 265 ? 0.8435 0.7730 0.7572 -0.0102 0.0347  0.1066  265 ILE A CG1 
1941 C CG2 . ILE A 265 ? 0.7123 0.6270 0.6050 0.0020  0.0430  0.0908  265 ILE A CG2 
1942 C CD1 . ILE A 265 ? 0.8865 0.7887 0.7949 -0.0246 0.0394  0.1095  265 ILE A CD1 
1943 N N   . ILE A 266 ? 0.6758 0.6706 0.5607 0.0328  0.0133  0.0797  266 ILE A N   
1944 C CA  . ILE A 266 ? 0.7637 0.7606 0.6320 0.0426  0.0069  0.0714  266 ILE A CA  
1945 C C   . ILE A 266 ? 0.9421 0.8935 0.8010 0.0375  0.0165  0.0726  266 ILE A C   
1946 O O   . ILE A 266 ? 0.9850 0.9079 0.8540 0.0394  0.0212  0.0734  266 ILE A O   
1947 C CB  . ILE A 266 ? 0.7805 0.7889 0.6548 0.0629  -0.0066 0.0621  266 ILE A CB  
1948 C CG1 . ILE A 266 ? 0.6961 0.7618 0.5715 0.0712  -0.0179 0.0554  266 ILE A CG1 
1949 C CG2 . ILE A 266 ? 0.8517 0.8345 0.7104 0.0723  -0.0127 0.0563  266 ILE A CG2 
1950 C CD1 . ILE A 266 ? 0.6417 0.7344 0.5309 0.0631  -0.0157 0.0621  266 ILE A CD1 
1951 N N   . TRP A 267 ? 1.0339 0.9820 0.8732 0.0294  0.0197  0.0727  267 TRP A N   
1952 C CA  . TRP A 267 ? 1.0368 0.9472 0.8628 0.0226  0.0293  0.0735  267 TRP A CA  
1953 C C   . TRP A 267 ? 1.0586 0.9550 0.8716 0.0343  0.0194  0.0703  267 TRP A C   
1954 O O   . TRP A 267 ? 1.1107 1.0264 0.9122 0.0449  0.0054  0.0655  267 TRP A O   
1955 C CB  . TRP A 267 ? 1.0557 0.9679 0.8641 0.0088  0.0352  0.0742  267 TRP A CB  
1956 C CG  . TRP A 267 ? 1.0707 0.9881 0.8893 -0.0043 0.0420  0.0781  267 TRP A CG  
1957 C CD1 . TRP A 267 ? 1.1312 1.0812 0.9574 -0.0077 0.0352  0.0817  267 TRP A CD1 
1958 C CD2 . TRP A 267 ? 1.0404 0.9288 0.8618 -0.0163 0.0552  0.0787  267 TRP A CD2 
1959 N NE1 . TRP A 267 ? 1.1724 1.1093 1.0048 -0.0223 0.0416  0.0870  267 TRP A NE1 
1960 C CE2 . TRP A 267 ? 1.1344 1.0328 0.9652 -0.0258 0.0533  0.0836  267 TRP A CE2 
1961 C CE3 . TRP A 267 ? 0.9745 0.8313 0.7912 -0.0199 0.0677  0.0749  267 TRP A CE3 
1962 C CZ2 . TRP A 267 ? 1.1152 0.9871 0.9516 -0.0362 0.0613  0.0836  267 TRP A CZ2 
1963 C CZ3 . TRP A 267 ? 0.9936 0.8315 0.8173 -0.0292 0.0778  0.0724  267 TRP A CZ3 
1964 C CH2 . TRP A 267 ? 1.0454 0.8879 0.8793 -0.0360 0.0735  0.0762  267 TRP A CH2 
1965 N N   . GLY A 268 ? 1.0306 0.8936 0.8457 0.0320  0.0253  0.0730  268 GLY A N   
1966 C CA  . GLY A 268 ? 1.0207 0.8628 0.8235 0.0404  0.0138  0.0729  268 GLY A CA  
1967 C C   . GLY A 268 ? 1.0079 0.8579 0.8278 0.0564  -0.0006 0.0685  268 GLY A C   
1968 O O   . GLY A 268 ? 1.0483 0.8844 0.8595 0.0679  -0.0168 0.0659  268 GLY A O   
1969 N N   . GLY A 269 ? 0.9714 0.8422 0.8146 0.0573  0.0037  0.0673  269 GLY A N   
1970 C CA  . GLY A 269 ? 0.9601 0.8435 0.8201 0.0719  -0.0092 0.0616  269 GLY A CA  
1971 C C   . GLY A 269 ? 1.0501 0.9002 0.9200 0.0697  -0.0083 0.0644  269 GLY A C   
1972 O O   . GLY A 269 ? 1.0605 0.8901 0.9333 0.0551  0.0072  0.0711  269 GLY A O   
1973 N N   . HIS A 270 ? 1.1590 1.0055 1.0340 0.0841  -0.0256 0.0580  270 HIS A N   
1974 C CA  . HIS A 270 ? 1.2005 1.0198 1.0884 0.0811  -0.0271 0.0603  270 HIS A CA  
1975 C C   . HIS A 270 ? 1.1327 0.9729 1.0405 0.0960  -0.0401 0.0508  270 HIS A C   
1976 O O   . HIS A 270 ? 1.0973 0.9514 1.0000 0.1143  -0.0587 0.0397  270 HIS A O   
1977 C CB  . HIS A 270 ? 1.2997 1.0780 1.1679 0.0798  -0.0386 0.0636  270 HIS A CB  
1978 C CG  . HIS A 270 ? 1.4487 1.2092 1.2936 0.0648  -0.0273 0.0728  270 HIS A CG  
1979 N ND1 . HIS A 270 ? 1.5252 1.2802 1.3440 0.0711  -0.0385 0.0722  270 HIS A ND1 
1980 C CD2 . HIS A 270 ? 1.5128 1.2633 1.3564 0.0447  -0.0059 0.0814  270 HIS A CD2 
1981 C CE1 . HIS A 270 ? 1.5666 1.3071 1.3672 0.0541  -0.0247 0.0813  270 HIS A CE1 
1982 N NE2 . HIS A 270 ? 1.5662 1.3047 1.3813 0.0380  -0.0043 0.0862  270 HIS A NE2 
1983 N N   . PHE A 271 ? 1.0713 0.9170 1.0022 0.0895  -0.0309 0.0536  271 PHE A N   
1984 C CA  . PHE A 271 ? 0.9841 0.8482 0.9327 0.1023  -0.0435 0.0449  271 PHE A CA  
1985 C C   . PHE A 271 ? 0.9165 0.7519 0.8596 0.1119  -0.0633 0.0379  271 PHE A C   
1986 O O   . PHE A 271 ? 0.9096 0.7061 0.8413 0.1022  -0.0633 0.0448  271 PHE A O   
1987 C CB  . PHE A 271 ? 0.9705 0.8411 0.9448 0.0932  -0.0319 0.0501  271 PHE A CB  
1988 C CG  . PHE A 271 ? 1.0038 0.9029 0.9839 0.0880  -0.0196 0.0554  271 PHE A CG  
1989 C CD1 . PHE A 271 ? 1.0685 0.9558 1.0534 0.0734  -0.0015 0.0644  271 PHE A CD1 
1990 C CD2 . PHE A 271 ? 1.0104 0.9486 0.9894 0.0971  -0.0275 0.0510  271 PHE A CD2 
1991 C CE1 . PHE A 271 ? 1.0814 0.9879 1.0703 0.0685  0.0063  0.0695  271 PHE A CE1 
1992 C CE2 . PHE A 271 ? 1.0308 0.9917 1.0125 0.0889  -0.0185 0.0587  271 PHE A CE2 
1993 C CZ  . PHE A 271 ? 1.0472 0.9883 1.0337 0.0748  -0.0027 0.0684  271 PHE A CZ  
1994 N N   . VAL A 272 ? 0.9371 0.7916 0.8864 0.1305  -0.0813 0.0240  272 VAL A N   
1995 C CA  . VAL A 272 ? 0.9920 0.8185 0.9347 0.1439  -0.1051 0.0136  272 VAL A CA  
1996 C C   . VAL A 272 ? 1.0891 0.9029 1.0521 0.1413  -0.1108 0.0112  272 VAL A C   
1997 O O   . VAL A 272 ? 1.1484 0.9952 1.1304 0.1431  -0.1058 0.0079  272 VAL A O   
1998 C CB  . VAL A 272 ? 0.9629 0.8232 0.8994 0.1697  -0.1233 -0.0053 272 VAL A CB  
1999 C CG1 . VAL A 272 ? 0.9846 0.8300 0.9266 0.1880  -0.1490 -0.0221 272 VAL A CG1 
2000 C CG2 . VAL A 272 ? 0.9981 0.8531 0.9110 0.1746  -0.1270 -0.0048 272 VAL A CG2 
2001 N N   . ASP A 273 ? 1.1438 0.9097 1.1022 0.1355  -0.1225 0.0140  273 ASP A N   
2002 C CA  . ASP A 273 ? 1.2077 0.9596 1.1861 0.1291  -0.1279 0.0128  273 ASP A CA  
2003 C C   . ASP A 273 ? 1.1316 0.9137 1.1245 0.1497  -0.1439 -0.0064 273 ASP A C   
2004 O O   . ASP A 273 ? 1.1682 0.9487 1.1516 0.1714  -0.1665 -0.0233 273 ASP A O   
2005 C CB  . ASP A 273 ? 1.3380 1.0321 1.3054 0.1193  -0.1433 0.0181  273 ASP A CB  
2006 C CG  . ASP A 273 ? 1.3673 1.0477 1.3562 0.1027  -0.1420 0.0227  273 ASP A CG  
2007 O OD1 . ASP A 273 ? 1.3732 1.0817 1.3829 0.0909  -0.1205 0.0290  273 ASP A OD1 
2008 O OD2 . ASP A 273 ? 1.3684 1.0093 1.3539 0.1013  -0.1639 0.0197  273 ASP A OD2 
2009 N N   . VAL A 274 ? 1.0087 0.8187 1.0247 0.1435  -0.1328 -0.0046 274 VAL A N   
2010 C CA  . VAL A 274 ? 0.9421 0.7879 0.9715 0.1600  -0.1447 -0.0208 274 VAL A CA  
2011 C C   . VAL A 274 ? 1.0312 0.8501 1.0723 0.1610  -0.1635 -0.0299 274 VAL A C   
2012 O O   . VAL A 274 ? 1.0496 0.8955 1.1030 0.1730  -0.1742 -0.0442 274 VAL A O   
2013 C CB  . VAL A 274 ? 0.8679 0.7563 0.9155 0.1522  -0.1261 -0.0128 274 VAL A CB  
2014 C CG1 . VAL A 274 ? 0.9218 0.8411 0.9579 0.1520  -0.1113 -0.0060 274 VAL A CG1 
2015 C CG2 . VAL A 274 ? 0.7477 0.6159 0.8138 0.1303  -0.1111 0.0024  274 VAL A CG2 
2016 N N   . PHE A 275 ? 1.1031 0.8701 1.1397 0.1464  -0.1681 -0.0211 275 PHE A N   
2017 C CA  . PHE A 275 ? 1.2248 0.9633 1.2728 0.1431  -0.1866 -0.0280 275 PHE A CA  
2018 C C   . PHE A 275 ? 1.4476 1.1496 1.4786 0.1614  -0.2186 -0.0447 275 PHE A C   
2019 O O   . PHE A 275 ? 1.5327 1.1992 1.5418 0.1617  -0.2256 -0.0395 275 PHE A O   
2020 C CB  . PHE A 275 ? 1.2117 0.9205 1.2691 0.1127  -0.1739 -0.0085 275 PHE A CB  
2021 C CG  . PHE A 275 ? 1.1642 0.9109 1.2465 0.0999  -0.1489 0.0010  275 PHE A CG  
2022 C CD1 . PHE A 275 ? 1.0763 0.8330 1.1575 0.0861  -0.1225 0.0168  275 PHE A CD1 
2023 C CD2 . PHE A 275 ? 1.1688 0.9413 1.2756 0.1034  -0.1538 -0.0075 275 PHE A CD2 
2024 C CE1 . PHE A 275 ? 1.0207 0.8094 1.1260 0.0776  -0.1026 0.0234  275 PHE A CE1 
2025 C CE2 . PHE A 275 ? 1.1198 0.9256 1.2503 0.0939  -0.1339 0.0011  275 PHE A CE2 
2026 C CZ  . PHE A 275 ? 1.0454 0.8582 1.1757 0.0818  -0.1088 0.0162  275 PHE A CZ  
2027 N N   . THR A 276 ? 1.5324 1.2435 1.5736 0.1779  -0.2394 -0.0658 276 THR A N   
2028 C CA  . THR A 276 ? 1.6129 1.2981 1.6404 0.2028  -0.2722 -0.0886 276 THR A CA  
2029 C C   . THR A 276 ? 1.6423 1.2899 1.6799 0.1999  -0.2968 -0.0989 276 THR A C   
2030 O O   . THR A 276 ? 1.6126 1.2804 1.6717 0.1887  -0.2898 -0.0980 276 THR A O   
2031 C CB  . THR A 276 ? 1.6311 1.3760 1.6579 0.2343  -0.2771 -0.1132 276 THR A CB  
2032 O OG1 . THR A 276 ? 1.5631 1.3474 1.5824 0.2330  -0.2531 -0.1019 276 THR A OG1 
2033 C CG2 . THR A 276 ? 1.7275 1.4487 1.7402 0.2643  -0.3110 -0.1398 276 THR A CG2 
2034 N N   . THR A 277 ? 1.7010 1.2918 1.7228 0.2099  -0.3276 -0.1088 277 THR A N   
2035 C CA  . THR A 277 ? 1.7352 1.2830 1.7634 0.2095  -0.3572 -0.1220 277 THR A CA  
2036 C C   . THR A 277 ? 1.7400 1.3126 1.7714 0.2470  -0.3829 -0.1600 277 THR A C   
2037 O O   . THR A 277 ? 1.7076 1.2894 1.7251 0.2765  -0.3958 -0.1782 277 THR A O   
2038 C CB  . THR A 277 ? 1.7616 1.2244 1.7695 0.1977  -0.3815 -0.1110 277 THR A CB  
2039 O OG1 . THR A 277 ? 1.7093 1.1541 1.7131 0.1607  -0.3570 -0.0764 277 THR A OG1 
2040 C CG2 . THR A 277 ? 1.8249 1.2395 1.8394 0.1945  -0.4140 -0.1238 277 THR A CG2 
2041 N N   . LEU A 278 ? 1.8061 1.3944 1.8564 0.2456  -0.3895 -0.1727 278 LEU A N   
2042 C CA  . LEU A 278 ? 1.9067 1.5232 1.9611 0.2789  -0.4129 -0.2104 278 LEU A CA  
2043 C C   . LEU A 278 ? 2.0609 1.6072 2.1029 0.2958  -0.4558 -0.2315 278 LEU A C   
2044 O O   . LEU A 278 ? 2.1472 1.6201 2.1803 0.2747  -0.4680 -0.2132 278 LEU A O   
2045 C CB  . LEU A 278 ? 1.8676 1.5227 1.9450 0.2702  -0.4067 -0.2160 278 LEU A CB  
2046 C CG  . LEU A 278 ? 1.7839 1.5257 1.8707 0.2743  -0.3773 -0.2136 278 LEU A CG  
2047 C CD1 . LEU A 278 ? 1.7691 1.5440 1.8771 0.2668  -0.3761 -0.2194 278 LEU A CD1 
2048 C CD2 . LEU A 278 ? 1.7901 1.5804 1.8643 0.3096  -0.3834 -0.2397 278 LEU A CD2 
2049 N N   . PRO A 279 ? 2.0727 1.6423 2.1136 0.3336  -0.4797 -0.2704 279 PRO A N   
2050 C CA  . PRO A 279 ? 2.1164 1.6201 2.1466 0.3562  -0.5247 -0.2965 279 PRO A CA  
2051 C C   . PRO A 279 ? 2.1206 1.5623 2.1591 0.3303  -0.5432 -0.2901 279 PRO A C   
2052 O O   . PRO A 279 ? 2.1378 1.4951 2.1643 0.3252  -0.5740 -0.2878 279 PRO A O   
2053 C CB  . PRO A 279 ? 2.1163 1.6819 2.1515 0.3988  -0.5388 -0.3421 279 PRO A CB  
2054 C CG  . PRO A 279 ? 2.0540 1.7110 2.0920 0.4016  -0.5014 -0.3346 279 PRO A CG  
2055 C CD  . PRO A 279 ? 2.0122 1.6740 2.0590 0.3589  -0.4658 -0.2922 279 PRO A CD  
2056 N N   . ASP A 280 ? 2.0987 1.5831 2.1576 0.3127  -0.5251 -0.2860 280 ASP A N   
2057 C CA  . ASP A 280 ? 2.1362 1.5763 2.2074 0.2857  -0.5388 -0.2800 280 ASP A CA  
2058 C C   . ASP A 280 ? 2.1281 1.5064 2.1927 0.2446  -0.5301 -0.2390 280 ASP A C   
2059 O O   . ASP A 280 ? 2.1275 1.4439 2.1939 0.2201  -0.5501 -0.2310 280 ASP A O   
2060 C CB  . ASP A 280 ? 2.1257 1.6351 2.2210 0.2739  -0.5153 -0.2790 280 ASP A CB  
2061 C CG  . ASP A 280 ? 2.0961 1.6950 2.1936 0.3047  -0.5007 -0.3007 280 ASP A CG  
2062 O OD1 . ASP A 280 ? 2.1028 1.7139 2.1855 0.3370  -0.5105 -0.3214 280 ASP A OD1 
2063 O OD2 . ASP A 280 ? 2.0572 1.7164 2.1712 0.2958  -0.4802 -0.2967 280 ASP A OD2 
2064 N N   . GLY A 281 ? 2.1303 1.5286 2.1864 0.2358  -0.5000 -0.2133 281 GLY A N   
2065 C CA  . GLY A 281 ? 2.1413 1.4935 2.1889 0.1976  -0.4867 -0.1744 281 GLY A CA  
2066 C C   . GLY A 281 ? 2.0714 1.4708 2.1394 0.1647  -0.4463 -0.1475 281 GLY A C   
2067 O O   . GLY A 281 ? 2.0186 1.4011 2.0812 0.1347  -0.4262 -0.1159 281 GLY A O   
2068 N N   . ARG A 282 ? 2.0698 1.5302 2.1607 0.1714  -0.4350 -0.1608 282 ARG A N   
2069 C CA  . ARG A 282 ? 2.0659 1.5742 2.1785 0.1452  -0.3990 -0.1382 282 ARG A CA  
2070 C C   . ARG A 282 ? 1.9323 1.4826 2.0362 0.1533  -0.3684 -0.1258 282 ARG A C   
2071 O O   . ARG A 282 ? 1.9085 1.4796 1.9991 0.1843  -0.3741 -0.1433 282 ARG A O   
2072 C CB  . ARG A 282 ? 2.1408 1.7030 2.2778 0.1536  -0.3986 -0.1563 282 ARG A CB  
2073 C CG  . ARG A 282 ? 2.2005 1.8030 2.3314 0.1944  -0.4118 -0.1896 282 ARG A CG  
2074 C CD  . ARG A 282 ? 2.2210 1.8754 2.3738 0.1985  -0.4121 -0.2048 282 ARG A CD  
2075 N NE  . ARG A 282 ? 2.2573 1.9606 2.4031 0.2352  -0.4218 -0.2361 282 ARG A NE  
2076 C CZ  . ARG A 282 ? 2.2759 2.0346 2.4349 0.2439  -0.4221 -0.2518 282 ARG A CZ  
2077 N NH1 . ARG A 282 ? 2.2686 2.0382 2.4500 0.2202  -0.4145 -0.2392 282 ARG A NH1 
2078 N NH2 . ARG A 282 ? 2.2890 2.0960 2.4387 0.2760  -0.4302 -0.2802 282 ARG A NH2 
2079 N N   . ARG A 283 ? 1.8285 1.3934 1.9403 0.1259  -0.3368 -0.0973 283 ARG A N   
2080 C CA  . ARG A 283 ? 1.7000 1.3008 1.8033 0.1316  -0.3085 -0.0853 283 ARG A CA  
2081 C C   . ARG A 283 ? 1.5814 1.2565 1.7008 0.1458  -0.2899 -0.0928 283 ARG A C   
2082 O O   . ARG A 283 ? 1.5894 1.2911 1.7298 0.1449  -0.2929 -0.1012 283 ARG A O   
2083 C CB  . ARG A 283 ? 1.6753 1.2605 1.7783 0.0982  -0.2833 -0.0541 283 ARG A CB  
2084 C CG  . ARG A 283 ? 1.6726 1.2747 1.7590 0.1032  -0.2609 -0.0424 283 ARG A CG  
2085 C CD  . ARG A 283 ? 1.6810 1.2672 1.7652 0.0706  -0.2375 -0.0145 283 ARG A CD  
2086 N N   . ALA A 284 ? 1.4399 1.1475 1.5484 0.1573  -0.2718 -0.0885 284 ALA A N   
2087 C CA  . ALA A 284 ? 1.3382 1.1128 1.4558 0.1713  -0.2581 -0.0949 284 ALA A CA  
2088 C C   . ALA A 284 ? 1.2959 1.0963 1.4038 0.1696  -0.2319 -0.0790 284 ALA A C   
2089 O O   . ALA A 284 ? 1.3613 1.1297 1.4531 0.1626  -0.2265 -0.0674 284 ALA A O   
2090 C CB  . ALA A 284 ? 1.3810 1.1774 1.4907 0.2025  -0.2815 -0.1251 284 ALA A CB  
2091 N N   . LEU A 285 ? 1.1998 1.0567 1.3163 0.1748  -0.2171 -0.0779 285 LEU A N   
2092 C CA  . LEU A 285 ? 1.1229 1.0063 1.2311 0.1722  -0.1937 -0.0634 285 LEU A CA  
2093 C C   . LEU A 285 ? 1.0486 0.9749 1.1422 0.1958  -0.2001 -0.0793 285 LEU A C   
2094 O O   . LEU A 285 ? 1.0903 1.0559 1.1896 0.2084  -0.2093 -0.0941 285 LEU A O   
2095 C CB  . LEU A 285 ? 1.1333 1.0471 1.2621 0.1574  -0.1724 -0.0470 285 LEU A CB  
2096 C CG  . LEU A 285 ? 1.1044 1.0518 1.2257 0.1569  -0.1524 -0.0348 285 LEU A CG  
2097 C CD1 . LEU A 285 ? 1.1338 1.0503 1.2443 0.1441  -0.1365 -0.0196 285 LEU A CD1 
2098 C CD2 . LEU A 285 ? 1.0517 1.0314 1.1933 0.1488  -0.1404 -0.0236 285 LEU A CD2 
2099 N N   . ASP A 286 ? 0.9984 0.9218 1.0728 0.2008  -0.1948 -0.0764 286 ASP A N   
2100 C CA  . ASP A 286 ? 1.0630 1.0306 1.1238 0.2231  -0.2018 -0.0934 286 ASP A CA  
2101 C C   . ASP A 286 ? 0.9659 0.9733 1.0217 0.2147  -0.1788 -0.0775 286 ASP A C   
2102 O O   . ASP A 286 ? 0.9369 0.9301 0.9797 0.2098  -0.1691 -0.0674 286 ASP A O   
2103 C CB  . ASP A 286 ? 1.2257 1.1616 1.2682 0.2401  -0.2202 -0.1079 286 ASP A CB  
2104 C CG  . ASP A 286 ? 1.2485 1.2368 1.2787 0.2642  -0.2263 -0.1272 286 ASP A CG  
2105 O OD1 . ASP A 286 ? 1.2450 1.2948 1.2805 0.2692  -0.2212 -0.1340 286 ASP A OD1 
2106 O OD2 . ASP A 286 ? 1.2367 1.2070 1.2519 0.2776  -0.2368 -0.1354 286 ASP A OD2 
2107 N N   . LEU A 287 ? 0.9327 0.9888 0.9974 0.2121  -0.1717 -0.0746 287 LEU A N   
2108 C CA  . LEU A 287 ? 0.9392 1.0296 0.9990 0.2012  -0.1521 -0.0574 287 LEU A CA  
2109 C C   . LEU A 287 ? 0.9374 1.0641 0.9778 0.2128  -0.1529 -0.0662 287 LEU A C   
2110 O O   . LEU A 287 ? 0.9567 1.1185 0.9914 0.2033  -0.1395 -0.0537 287 LEU A O   
2111 C CB  . LEU A 287 ? 0.9023 1.0333 0.9741 0.1944  -0.1476 -0.0501 287 LEU A CB  
2112 C CG  . LEU A 287 ? 0.9260 1.0270 1.0198 0.1804  -0.1429 -0.0374 287 LEU A CG  
2113 C CD1 . LEU A 287 ? 0.9704 1.1135 1.0743 0.1770  -0.1429 -0.0316 287 LEU A CD1 
2114 C CD2 . LEU A 287 ? 0.8472 0.9110 0.9448 0.1626  -0.1239 -0.0163 287 LEU A CD2 
2115 N N   . GLY A 288 ? 0.9033 1.0215 0.9342 0.2330  -0.1700 -0.0878 288 GLY A N   
2116 C CA  . GLY A 288 ? 0.9173 1.0730 0.9324 0.2461  -0.1721 -0.0987 288 GLY A CA  
2117 C C   . GLY A 288 ? 1.0358 1.1607 1.0394 0.2352  -0.1600 -0.0825 288 GLY A C   
2118 O O   . GLY A 288 ? 1.0761 1.2372 1.0686 0.2363  -0.1538 -0.0820 288 GLY A O   
2119 N N   . LYS A 289 ? 1.1269 1.1882 1.1330 0.2231  -0.1566 -0.0693 289 LYS A N   
2120 C CA  . LYS A 289 ? 1.1710 1.1994 1.1645 0.2122  -0.1460 -0.0547 289 LYS A CA  
2121 C C   . LYS A 289 ? 1.0798 1.1069 1.0787 0.1871  -0.1213 -0.0299 289 LYS A C   
2122 O O   . LYS A 289 ? 1.1348 1.1362 1.1242 0.1750  -0.1095 -0.0167 289 LYS A O   
2123 C CB  . LYS A 289 ? 1.2839 1.2449 1.2735 0.2122  -0.1574 -0.0545 289 LYS A CB  
2124 C CG  . LYS A 289 ? 1.3541 1.3037 1.3391 0.2380  -0.1863 -0.0795 289 LYS A CG  
2125 C CD  . LYS A 289 ? 1.4453 1.3223 1.4263 0.2324  -0.1991 -0.0750 289 LYS A CD  
2126 C CE  . LYS A 289 ? 1.5698 1.4303 1.5510 0.2570  -0.2308 -0.1007 289 LYS A CE  
2127 N NZ  . LYS A 289 ? 1.6377 1.5362 1.6091 0.2865  -0.2452 -0.1242 289 LYS A NZ  
2128 N N   . PHE A 290 ? 0.9256 0.9798 0.9391 0.1802  -0.1152 -0.0245 290 PHE A N   
2129 C CA  . PHE A 290 ? 0.8633 0.9099 0.8853 0.1589  -0.0954 -0.0028 290 PHE A CA  
2130 C C   . PHE A 290 ? 0.8128 0.8696 0.8203 0.1493  -0.0820 0.0082  290 PHE A C   
2131 O O   . PHE A 290 ? 0.7671 0.7940 0.7751 0.1344  -0.0677 0.0224  290 PHE A O   
2132 C CB  . PHE A 290 ? 0.8703 0.9495 0.9078 0.1551  -0.0943 0.0015  290 PHE A CB  
2133 C CG  . PHE A 290 ? 0.8665 0.9294 0.9168 0.1365  -0.0781 0.0218  290 PHE A CG  
2134 C CD1 . PHE A 290 ? 0.8573 0.8779 0.9215 0.1287  -0.0721 0.0271  290 PHE A CD1 
2135 C CD2 . PHE A 290 ? 0.8572 0.9481 0.9060 0.1268  -0.0703 0.0350  290 PHE A CD2 
2136 C CE1 . PHE A 290 ? 0.8383 0.8479 0.9167 0.1150  -0.0580 0.0419  290 PHE A CE1 
2137 C CE2 . PHE A 290 ? 0.8244 0.8964 0.8860 0.1130  -0.0585 0.0514  290 PHE A CE2 
2138 C CZ  . PHE A 290 ? 0.8279 0.8609 0.9053 0.1089  -0.0522 0.0531  290 PHE A CZ  
2139 N N   . HIS A 291 ? 0.8408 0.9421 0.8358 0.1576  -0.0869 0.0003  291 HIS A N   
2140 C CA  . HIS A 291 ? 0.8654 0.9813 0.8471 0.1461  -0.0752 0.0110  291 HIS A CA  
2141 C C   . HIS A 291 ? 0.9206 1.0223 0.8854 0.1535  -0.0787 0.0038  291 HIS A C   
2142 O O   . HIS A 291 ? 0.9186 1.0361 0.8715 0.1453  -0.0710 0.0101  291 HIS A O   
2143 C CB  . HIS A 291 ? 0.8753 1.0554 0.8530 0.1449  -0.0763 0.0103  291 HIS A CB  
2144 C CG  . HIS A 291 ? 0.8300 1.0268 0.8206 0.1364  -0.0746 0.0199  291 HIS A CG  
2145 N ND1 . HIS A 291 ? 0.8000 0.9731 0.7982 0.1178  -0.0629 0.0404  291 HIS A ND1 
2146 C CD2 . HIS A 291 ? 0.7650 0.9993 0.7620 0.1448  -0.0847 0.0111  291 HIS A CD2 
2147 C CE1 . HIS A 291 ? 0.7871 0.9806 0.7959 0.1153  -0.0668 0.0455  291 HIS A CE1 
2148 N NE2 . HIS A 291 ? 0.7283 0.9602 0.7357 0.1304  -0.0794 0.0285  291 HIS A NE2 
2149 N N   . GLU A 292 ? 0.9721 1.0430 0.9356 0.1683  -0.0923 -0.0087 292 GLU A N   
2150 C CA  . GLU A 292 ? 0.9799 1.0330 0.9265 0.1777  -0.1000 -0.0155 292 GLU A CA  
2151 C C   . GLU A 292 ? 0.9283 0.9328 0.8662 0.1601  -0.0868 0.0013  292 GLU A C   
2152 O O   . GLU A 292 ? 0.8825 0.8464 0.8281 0.1495  -0.0810 0.0103  292 GLU A O   
2153 C CB  . GLU A 292 ? 1.0706 1.1037 1.0167 0.2003  -0.1233 -0.0345 292 GLU A CB  
2154 C CG  . GLU A 292 ? 1.1851 1.2747 1.1318 0.2240  -0.1387 -0.0580 292 GLU A CG  
2155 C CD  . GLU A 292 ? 1.3158 1.3818 1.2627 0.2492  -0.1647 -0.0800 292 GLU A CD  
2156 O OE1 . GLU A 292 ? 1.3455 1.3472 1.2880 0.2462  -0.1717 -0.0740 292 GLU A OE1 
2157 O OE2 . GLU A 292 ? 1.3694 1.4815 1.3204 0.2714  -0.1789 -0.1036 292 GLU A OE2 
2158 N N   . ILE A 293 ? 0.9061 0.9202 0.8281 0.1568  -0.0822 0.0043  293 ILE A N   
2159 C CA  . ILE A 293 ? 0.9123 0.8879 0.8223 0.1404  -0.0694 0.0183  293 ILE A CA  
2160 C C   . ILE A 293 ? 0.9613 0.9208 0.8505 0.1503  -0.0813 0.0127  293 ILE A C   
2161 O O   . ILE A 293 ? 0.8820 0.8780 0.7624 0.1599  -0.0875 0.0044  293 ILE A O   
2162 C CB  . ILE A 293 ? 0.8611 0.8587 0.7707 0.1221  -0.0510 0.0303  293 ILE A CB  
2163 C CG1 . ILE A 293 ? 0.7486 0.7472 0.6783 0.1114  -0.0406 0.0388  293 ILE A CG1 
2164 C CG2 . ILE A 293 ? 0.8993 0.8647 0.7928 0.1082  -0.0397 0.0401  293 ILE A CG2 
2165 C CD1 . ILE A 293 ? 0.7188 0.7331 0.6488 0.0942  -0.0264 0.0507  293 ILE A CD1 
2166 N N   . ALA A 294 ? 1.0478 0.9537 0.9290 0.1470  -0.0853 0.0180  294 ALA A N   
2167 C CA  . ALA A 294 ? 1.0766 0.9556 0.9352 0.1536  -0.0979 0.0169  294 ALA A CA  
2168 C C   . ALA A 294 ? 1.0219 0.9039 0.8645 0.1378  -0.0823 0.0277  294 ALA A C   
2169 O O   . ALA A 294 ? 0.9079 0.7804 0.7531 0.1172  -0.0616 0.0400  294 ALA A O   
2170 C CB  . ALA A 294 ? 1.1169 0.9362 0.9697 0.1491  -0.1066 0.0233  294 ALA A CB  
2171 N N   . GLN A 295 ? 1.1046 1.0007 0.9312 0.1492  -0.0938 0.0211  295 GLN A N   
2172 C CA  . GLN A 295 ? 1.1205 1.0243 0.9311 0.1358  -0.0818 0.0289  295 GLN A CA  
2173 C C   . GLN A 295 ? 1.1545 1.0363 0.9422 0.1472  -0.1004 0.0262  295 GLN A C   
2174 O O   . GLN A 295 ? 1.2071 1.0927 0.9951 0.1713  -0.1239 0.0128  295 GLN A O   
2175 C CB  . GLN A 295 ? 1.1572 1.1230 0.9761 0.1370  -0.0764 0.0223  295 GLN A CB  
2176 C CG  . GLN A 295 ? 1.2400 1.2150 1.0500 0.1153  -0.0580 0.0327  295 GLN A CG  
2177 C CD  . GLN A 295 ? 1.3203 1.3536 1.1407 0.1113  -0.0528 0.0295  295 GLN A CD  
2178 O OE1 . GLN A 295 ? 1.3431 1.4036 1.1807 0.1171  -0.0548 0.0250  295 GLN A OE1 
2179 N NE2 . GLN A 295 ? 1.3387 1.3927 1.1475 0.0996  -0.0470 0.0325  295 GLN A NE2 
2180 N N   . HIS A 296 ? 1.1479 1.0051 0.9150 0.1310  -0.0914 0.0383  296 HIS A N   
2181 C CA  . HIS A 296 ? 1.2362 1.0720 0.9786 0.1401  -0.1096 0.0383  296 HIS A CA  
2182 C C   . HIS A 296 ? 1.2272 1.1093 0.9625 0.1441  -0.1099 0.0316  296 HIS A C   
2183 O O   . HIS A 296 ? 1.1685 1.0735 0.9050 0.1260  -0.0895 0.0367  296 HIS A O   
2184 C CB  . HIS A 296 ? 1.3777 1.1597 1.0986 0.1187  -0.1015 0.0562  296 HIS A CB  
2185 C CG  . HIS A 296 ? 1.5423 1.3073 1.2329 0.1197  -0.1138 0.0609  296 HIS A CG  
2186 N ND1 . HIS A 296 ? 1.6360 1.4326 1.3214 0.1392  -0.1305 0.0492  296 HIS A ND1 
2187 C CD2 . HIS A 296 ? 1.6329 1.3560 1.2963 0.1029  -0.1119 0.0762  296 HIS A CD2 
2188 C CE1 . HIS A 296 ? 1.6988 1.4707 1.3553 0.1356  -0.1398 0.0573  296 HIS A CE1 
2189 N NE2 . HIS A 296 ? 1.7028 1.4294 1.3440 0.1130  -0.1288 0.0744  296 HIS A NE2 
2190 N N   . HIS A 297 ? 1.2955 1.1921 1.0249 0.1685  -0.1345 0.0191  297 HIS A N   
2191 C CA  . HIS A 297 ? 1.3138 1.2613 1.0389 0.1745  -0.1376 0.0105  297 HIS A CA  
2192 C C   . HIS A 297 ? 1.4533 1.3738 1.1502 0.1768  -0.1514 0.0156  297 HIS A C   
2193 O O   . HIS A 297 ? 1.4428 1.3300 1.1297 0.1957  -0.1765 0.0126  297 HIS A O   
2194 C CB  . HIS A 297 ? 1.2334 1.2362 0.9777 0.2028  -0.1544 -0.0119 297 HIS A CB  
2195 C CG  . HIS A 297 ? 1.2032 1.2379 0.9722 0.1995  -0.1417 -0.0163 297 HIS A CG  
2196 N ND1 . HIS A 297 ? 1.2397 1.2394 1.0191 0.2003  -0.1415 -0.0139 297 HIS A ND1 
2197 C CD2 . HIS A 297 ? 1.2187 1.3173 1.0026 0.1933  -0.1297 -0.0215 297 HIS A CD2 
2198 C CE1 . HIS A 297 ? 1.2407 1.2814 1.0405 0.1967  -0.1302 -0.0180 297 HIS A CE1 
2199 N NE2 . HIS A 297 ? 1.2380 1.3382 1.0399 0.1918  -0.1230 -0.0217 297 HIS A NE2 
2200 N N   . HIS A 298 ? 1.6398 1.5718 1.3227 0.1569  -0.1366 0.0238  298 HIS A N   
2201 C CA  . HIS A 298 ? 1.8108 1.7235 1.4653 0.1568  -0.1485 0.0291  298 HIS A CA  
2202 C C   . HIS A 298 ? 1.8899 1.8529 1.5475 0.1819  -0.1702 0.0118  298 HIS A C   
2203 O O   . HIS A 298 ? 1.8683 1.8830 1.5499 0.1984  -0.1746 -0.0047 298 HIS A O   
2204 C CB  . HIS A 298 ? 1.8543 1.7631 1.4923 0.1263  -0.1249 0.0417  298 HIS A CB  
2205 C CG  . HIS A 298 ? 1.9256 1.8240 1.5754 0.1029  -0.0966 0.0498  298 HIS A CG  
2206 N ND1 . HIS A 298 ? 1.9529 1.8935 1.6260 0.0964  -0.0817 0.0443  298 HIS A ND1 
2207 C CD2 . HIS A 298 ? 1.9584 1.8112 1.6004 0.0844  -0.0816 0.0627  298 HIS A CD2 
2208 C CE1 . HIS A 298 ? 1.9341 1.8514 1.6138 0.0775  -0.0605 0.0529  298 HIS A CE1 
2209 N NE2 . HIS A 298 ? 1.9531 1.8205 1.6156 0.0705  -0.0590 0.0628  298 HIS A NE2 
2210 N N   . HIS A 299 ? 1.9929 1.9458 1.6266 0.1843  -0.1835 0.0151  299 HIS A N   
2211 C CA  . HIS A 299 ? 2.1123 2.1093 1.7490 0.2118  -0.2084 -0.0022 299 HIS A CA  
2212 C C   . HIS A 299 ? 2.1286 2.2004 1.7755 0.2026  -0.1956 -0.0107 299 HIS A C   
2213 O O   . HIS A 299 ? 2.1108 2.1841 1.7493 0.1726  -0.1724 0.0008  299 HIS A O   
2214 C CB  . HIS A 299 ? 2.2304 2.1822 1.8369 0.2212  -0.2332 0.0051  299 HIS A CB  
2215 C CG  . HIS A 299 ? 2.3156 2.1859 1.9041 0.2159  -0.2401 0.0219  299 HIS A CG  
2216 N ND1 . HIS A 299 ? 2.3246 2.1695 1.9294 0.2240  -0.2429 0.0193  299 HIS A ND1 
2217 C CD2 . HIS A 299 ? 2.3733 2.1845 1.9280 0.2007  -0.2449 0.0421  299 HIS A CD2 
2218 C CE1 . HIS A 299 ? 2.3668 2.1398 1.9498 0.2132  -0.2493 0.0377  299 HIS A CE1 
2219 N NE2 . HIS A 299 ? 2.4040 2.1564 1.9557 0.1985  -0.2503 0.0523  299 HIS A NE2 
2220 N N   . HIS A 300 ? 2.1508 2.2854 1.8162 0.2286  -0.2121 -0.0320 300 HIS A N   
2221 C CA  . HIS A 300 ? 2.1006 2.3170 1.7793 0.2206  -0.2025 -0.0419 300 HIS A CA  
2222 C C   . HIS A 300 ? 1.9824 2.2274 1.6790 0.1957  -0.1743 -0.0372 300 HIS A C   
2223 O O   . HIS A 300 ? 1.8666 2.1548 1.5867 0.2076  -0.1747 -0.0498 300 HIS A O   
2224 C CB  . HIS A 300 ? 2.1407 2.3586 1.7966 0.2033  -0.2007 -0.0333 300 HIS A CB  
2225 C CG  . HIS A 300 ? 2.2072 2.4175 1.8485 0.2299  -0.2317 -0.0406 300 HIS A CG  
2226 N ND1 . HIS A 300 ? 2.2208 2.4907 1.8796 0.2632  -0.2555 -0.0640 300 HIS A ND1 
2227 C CD2 . HIS A 300 ? 2.2600 2.4115 1.8705 0.2283  -0.2439 -0.0275 300 HIS A CD2 
2228 C CE1 . HIS A 300 ? 2.2718 2.5162 1.9121 0.2830  -0.2828 -0.0652 300 HIS A CE1 
2229 N NE2 . HIS A 300 ? 2.2898 2.4615 1.8993 0.2611  -0.2765 -0.0418 300 HIS A NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   MET 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  LEU 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  LYS 30  30  ?   ?   ?   A . n 
A 1 31  ARG 31  31  ?   ?   ?   A . n 
A 1 32  GLY 32  32  ?   ?   ?   A . n 
A 1 33  TRP 33  33  ?   ?   ?   A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  TRP 46  46  46  TRP TRP A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 CYS 119 119 119 CYS CYS A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 MET 161 161 161 MET MET A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 HIS 196 196 196 HIS HIS A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 HIS 236 236 236 HIS HIS A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 HIS 247 247 247 HIS HIS A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 GLN 252 252 252 GLN GLN A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 HIS 255 255 255 HIS HIS A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 TYR 260 260 260 TYR TYR A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 CYS 262 262 262 CYS CYS A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 ILE 266 266 266 ILE ILE A . n 
A 1 267 TRP 267 267 267 TRP TRP A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 HIS 270 270 270 HIS HIS A . n 
A 1 271 PHE 271 271 271 PHE PHE A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 HIS 291 291 291 HIS HIS A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 HIS 298 298 298 HIS HIS A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 HIS 300 300 300 HIS HIS A . n 
A 1 301 HIS 301 301 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 BA  1 1301 1301 BA  BA  A . 
C 3 K   1 1302 1302 K   K   A . 
D 3 K   1 1303 1303 K   K   A . 
E 4 PC  1 1304 1304 PC  PC  A . 
F 3 K   1 1305 1305 K   K   A . 
G 5 HOH 1 2001 2001 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 19150  ? 
1 MORE         -117.6 ? 
1 'SSA (A^2)'  52200  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 3_555 -y+1/2,x+1/2,z 0.0000000000  -1.0000000000 0.0000000000 52.3990000000  1.0000000000  
0.0000000000  0.0000000000 52.3990000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 2_565 -x,-y+1,z      -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 104.7980000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_455 y-1/2,-x+1/2,z 0.0000000000  1.0000000000  0.0000000000 -52.3990000000 -1.0000000000 
0.0000000000  0.0000000000 52.3990000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A BA 1301 ? B BA . 
2 1 A K  1302 ? C K  . 
3 1 A K  1303 ? D K  . 
4 1 A K  1305 ? F K  . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 96 ? A THR 96 ? 1_555 BA ? B BA . ? A BA 1301 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 3_555 81.5  ? 
2  OG1 ? A THR 96 ? A THR 96 ? 1_555 BA ? B BA . ? A BA 1301 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 2_565 134.8 ? 
3  OG1 ? A THR 96 ? A THR 96 ? 3_555 BA ? B BA . ? A BA 1301 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 2_565 81.5  ? 
4  OG1 ? A THR 96 ? A THR 96 ? 1_555 BA ? B BA . ? A BA 1301 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 4_455 81.5  ? 
5  OG1 ? A THR 96 ? A THR 96 ? 3_555 BA ? B BA . ? A BA 1301 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 4_455 134.8 ? 
6  OG1 ? A THR 96 ? A THR 96 ? 2_565 BA ? B BA . ? A BA 1301 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 4_455 81.5  ? 
7  O   ? A ILE 97 ? A ILE 97 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 3_555 74.2  ? 
8  O   ? A ILE 97 ? A ILE 97 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_565 74.5  ? 
9  O   ? A ILE 97 ? A ILE 97 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_565 134.6 ? 
10 O   ? A ILE 97 ? A ILE 97 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 3_555 84.4  ? 
11 O   ? A ILE 97 ? A ILE 97 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 3_555 74.5  ? 
12 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 3_555 70.4  ? 
13 O   ? A ILE 97 ? A ILE 97 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 1_555 117.0 ? 
14 O   ? A ILE 97 ? A ILE 97 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 1_555 74.2  ? 
15 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 1_555 150.6 ? 
16 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 1_555 134.6 ? 
17 O   ? A ILE 97 ? A ILE 97 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 4_455 74.2  ? 
18 O   ? A ILE 97 ? A ILE 97 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 4_455 117.0 ? 
19 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 4_455 84.4  ? 
20 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 4_455 150.6 ? 
21 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 4_455 74.2  ? 
22 O   ? A ILE 97 ? A ILE 97 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 134.6 ? 
23 O   ? A ILE 97 ? A ILE 97 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 150.6 ? 
24 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 70.4  ? 
25 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 109.3 ? 
26 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 84.4  ? 
27 O   ? A ILE 97 ? A ILE 97 ? 4_455 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 74.5  ? 
28 O   ? A ILE 97 ? A ILE 97 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 150.6 ? 
29 O   ? A ILE 97 ? A ILE 97 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 84.4  ? 
30 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 109.3 ? 
31 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 70.4  ? 
32 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 74.5  ? 
33 O   ? A ILE 97 ? A ILE 97 ? 4_455 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 134.6 ? 
34 O   ? A GLY 98 ? A GLY 98 ? 4_455 K  ? C K  . ? A K  1302 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 70.4  ? 
35 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 2_565 81.6  ? 
36 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 3_555 68.6  ? 
37 O   ? A TYR 99 ? A TYR 99 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 3_555 68.7  ? 
38 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_565 80.4  ? 
39 O   ? A TYR 99 ? A TYR 99 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_565 68.6  ? 
40 O   ? A TYR 99 ? A TYR 99 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_565 129.8 ? 
41 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 4_455 149.2 ? 
42 O   ? A TYR 99 ? A TYR 99 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 4_455 68.7  ? 
43 O   ? A TYR 99 ? A TYR 99 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 4_455 105.8 ? 
44 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 4_455 81.6  ? 
45 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 1_555 129.8 ? 
46 O   ? A TYR 99 ? A TYR 99 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 1_555 105.8 ? 
47 O   ? A TYR 99 ? A TYR 99 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 1_555 68.7  ? 
48 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 1_555 149.2 ? 
49 O   ? A TYR 99 ? A TYR 99 ? 4_455 K  ? D K  . ? A K  1303 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 1_555 68.7  ? 
50 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 131.7 ? 
51 O   ? A TYR 99 ? A TYR 99 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 129.8 ? 
52 O   ? A TYR 99 ? A TYR 99 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 149.2 ? 
53 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 80.4  ? 
54 O   ? A TYR 99 ? A TYR 99 ? 4_455 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 68.6  ? 
55 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 4_455 81.6  ? 
56 O   ? A GLY 98 ? A GLY 98 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 80.4  ? 
57 O   ? A TYR 99 ? A TYR 99 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 149.2 ? 
58 O   ? A TYR 99 ? A TYR 99 ? 3_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 81.6  ? 
59 O   ? A GLY 98 ? A GLY 98 ? 2_565 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 131.7 ? 
60 O   ? A TYR 99 ? A TYR 99 ? 4_455 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 129.8 ? 
61 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 68.6  ? 
62 O   ? A GLY 98 ? A GLY 98 ? 4_455 K  ? D K  . ? A K  1303 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 1_555 80.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-23 
2 'Structure model' 1 1 2012-06-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'       
2 2 'Structure model' 'Non-polymer description'   
3 2 'Structure model' 'Refinement description'    
4 2 'Structure model' 'Structure summary'         
5 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -7.5900  41.4276 48.4564 1.3108 0.7721 0.4307 -0.1191 0.0726 0.2261  2.0937 2.9987 1.4920 -0.3669 
0.5283 1.9225  -0.0646 -0.7763 -0.0921 1.1795  0.2691  0.1213  1.4815  -0.7069 -0.2004 
'X-RAY DIFFRACTION' 2 ? refined -29.0884 44.3237 10.3888 0.8465 0.8382 1.0543 -0.0380 0.1226 -0.0513 5.3271 2.5156 5.2264 -2.2319 
1.8396 -0.0266 0.1708  -0.4476 -0.6833 -0.0045 -0.1697 1.0363  -0.5964 -0.4847 -0.0007 
'X-RAY DIFFRACTION' 3 ? refined -21.0969 60.2658 2.5826  0.5455 0.4476 0.6167 0.0505  0.0317 0.0916  3.0441 1.2789 3.4744 0.5633  
1.7632 0.6816  -0.1081 -0.2450 -0.1981 -0.1891 0.1168  -0.5549 0.1200  -0.1878 0.0039  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 34:137'  
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 8:27'    
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 138:301' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX    refinement       '(PHENIX.REFINE)' ? 1 
DENZO     'data reduction' .                 ? 2 
SCALEPACK 'data scaling'   .                 ? 3 
PHASER    phasing          .                 ? 4 
# 
_pdbx_entry_details.entry_id             2X6B 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES 5-295 CORRESPOND TO GENBANK ACCESSION ZP_00055625
C-TERMINAL HIS-TAG IN PRESENT ENTRY. Q170 HAS BEEN MUTATED
TO ALANINE.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A ALA 127 ? ? CG1 A ILE 131 ? ? 1.97 
2 1 O A ASP 40  ? ? OG1 A THR 43  ? ? 2.12 
3 1 O A VAL 44  ? ? NH2 A ARG 134 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 25  ? ? -63.49  -179.63 
2 1 ASP A 36  ? ? -156.03 59.82   
3 1 ASP A 73  ? ? -63.05  83.83   
4 1 ASN A 77  ? ? 82.04   0.03    
5 1 LYS A 101 ? ? -78.19  -75.90  
6 1 LEU A 210 ? ? -110.57 -90.55  
7 1 LEU A 287 ? ? -66.39  9.20    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 10  ? CG  ? A ARG 10  CG  
2  1 Y 1 A ARG 10  ? CD  ? A ARG 10  CD  
3  1 Y 1 A ARG 10  ? NE  ? A ARG 10  NE  
4  1 Y 1 A ARG 10  ? CZ  ? A ARG 10  CZ  
5  1 Y 1 A ARG 10  ? NH1 ? A ARG 10  NH1 
6  1 Y 1 A ARG 10  ? NH2 ? A ARG 10  NH2 
7  1 Y 1 A LYS 11  ? CG  ? A LYS 11  CG  
8  1 Y 1 A LYS 11  ? CD  ? A LYS 11  CD  
9  1 Y 1 A LYS 11  ? CE  ? A LYS 11  CE  
10 1 Y 1 A LYS 11  ? NZ  ? A LYS 11  NZ  
11 1 Y 1 A LYS 156 ? CG  ? A LYS 156 CG  
12 1 Y 1 A LYS 156 ? CD  ? A LYS 156 CD  
13 1 Y 1 A LYS 156 ? CE  ? A LYS 156 CE  
14 1 Y 1 A LYS 156 ? NZ  ? A LYS 156 NZ  
15 1 Y 1 A SER 183 ? OG  ? A SER 183 OG  
16 1 Y 1 A SER 186 ? OG  ? A SER 186 OG  
17 1 Y 1 A GLN 187 ? CG  ? A GLN 187 CG  
18 1 Y 1 A GLN 187 ? CD  ? A GLN 187 CD  
19 1 Y 1 A GLN 187 ? OE1 ? A GLN 187 OE1 
20 1 Y 1 A GLN 187 ? NE2 ? A GLN 187 NE2 
21 1 Y 1 A GLU 188 ? CG  ? A GLU 188 CG  
22 1 Y 1 A GLU 188 ? CD  ? A GLU 188 CD  
23 1 Y 1 A GLU 188 ? OE1 ? A GLU 188 OE1 
24 1 Y 1 A GLU 188 ? OE2 ? A GLU 188 OE2 
25 1 Y 1 A MET 190 ? CG  ? A MET 190 CG  
26 1 Y 1 A MET 190 ? SD  ? A MET 190 SD  
27 1 Y 1 A MET 190 ? CE  ? A MET 190 CE  
28 1 Y 1 A GLU 230 ? CG  ? A GLU 230 CG  
29 1 Y 1 A GLU 230 ? CD  ? A GLU 230 CD  
30 1 Y 1 A GLU 230 ? OE1 ? A GLU 230 OE1 
31 1 Y 1 A GLU 230 ? OE2 ? A GLU 230 OE2 
32 1 Y 1 A ARG 283 ? NE  ? A ARG 283 NE  
33 1 Y 1 A ARG 283 ? CZ  ? A ARG 283 CZ  
34 1 Y 1 A ARG 283 ? NH1 ? A ARG 283 NH1 
35 1 Y 1 A ARG 283 ? NH2 ? A ARG 283 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A GLY 4   ? A GLY 4   
5  1 Y 1 A MET 5   ? A MET 5   
6  1 Y 1 A LYS 6   ? A LYS 6   
7  1 Y 1 A PRO 7   ? A PRO 7   
8  1 Y 1 A LEU 28  ? A LEU 28  
9  1 Y 1 A GLU 29  ? A GLU 29  
10 1 Y 1 A LYS 30  ? A LYS 30  
11 1 Y 1 A ARG 31  ? A ARG 31  
12 1 Y 1 A GLY 32  ? A GLY 32  
13 1 Y 1 A TRP 33  ? A TRP 33  
14 1 Y 1 A HIS 301 ? A HIS 301 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'BARIUM ION'    BA  
3 'POTASSIUM ION' K   
4 PHOSPHOCHOLINE  PC  
5 water           HOH 
#