data_2X6L
# 
_entry.id   2X6L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2X6L         
PDBE  EBI-42962    
WWPDB D_1290042962 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2011-04-06 
_pdbx_database_PDB_obs_spr.pdb_id           2X6L 
_pdbx_database_PDB_obs_spr.replace_pdb_id   3KKH 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1HUM unspecified .                                                                       
PDB 1JE4 unspecified 'SOLUTION STRUCTURE OF THE MONOMERIC VARIANT OF THECHEMOKINE MIP-1BETA' 
PDB 1HUN unspecified .                                                                       
PDB 2X6G unspecified 'X-RAY STRUCTURE OF MACROPHAGE INFLAMMATORY PROTEIN-1 ALPHA (D27A)'     
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2X6L 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, Q.'  1 
'Ren, M.'  2 
'Tang, W.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            29 
_citation.page_first                3952 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20959807 
_citation.pdbx_database_id_DOI      10.1038/EMBOJ.2010.256 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ren, M.'         1  
primary 'Guo, Q.'         2  
primary 'Guo, L.'         3  
primary 'Lenz, M.'        4  
primary 'Qian, F.'        5  
primary 'Koenen, R.R.'    6  
primary 'Xu, H.'          7  
primary 'Schilling, A.B.' 8  
primary 'Weber, C.'       9  
primary 'Ye, R.D.'        10 
primary 'Dinner, A.R.'    11 
primary 'Tang, W.'        12 
# 
_cell.entry_id           2X6L 
_cell.length_a           59.811 
_cell.length_b           87.892 
_cell.length_c           186.610 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              40 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2X6L 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'C-C MOTIF CHEMOKINE 4' 7824.742 5   ? ? ? ? 
2 non-polymer syn GLYCEROL                92.094   3   ? ? ? ? 
3 water       nat water                   18.015   145 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;SMALL-INDUCIBLE CYTOKINE A4, MACROPHAGE INFLAMMATORY PROTEIN 1-BETA, MIP-1-BETA(1-69), T-CELL ACTIVATION PROTEIN 2, PAT 744, PROTEIN H400, SIS-GAMMA, LYMPHOCYTE ACTIVATION GENE 1 PROTEIN, HC21, G-26 T-LYMPHOCYTE-SECRETED PROTEIN, MIP-1-BETA(3-69), MIP-1-BETA, ACT-2, LAG-1, MACROPHAGE INFLAMMATORY PROTEIN-1 BETA
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN 
_entity_poly.pdbx_seq_one_letter_code_can   APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN 
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  PRO n 
1 3  MET n 
1 4  GLY n 
1 5  SER n 
1 6  ASP n 
1 7  PRO n 
1 8  PRO n 
1 9  THR n 
1 10 ALA n 
1 11 CYS n 
1 12 CYS n 
1 13 PHE n 
1 14 SER n 
1 15 TYR n 
1 16 THR n 
1 17 ALA n 
1 18 ARG n 
1 19 LYS n 
1 20 LEU n 
1 21 PRO n 
1 22 ARG n 
1 23 ASN n 
1 24 PHE n 
1 25 VAL n 
1 26 VAL n 
1 27 ASP n 
1 28 TYR n 
1 29 TYR n 
1 30 GLU n 
1 31 THR n 
1 32 SER n 
1 33 SER n 
1 34 LEU n 
1 35 CYS n 
1 36 SER n 
1 37 GLN n 
1 38 PRO n 
1 39 ALA n 
1 40 VAL n 
1 41 VAL n 
1 42 PHE n 
1 43 GLN n 
1 44 THR n 
1 45 LYS n 
1 46 ARG n 
1 47 SER n 
1 48 LYS n 
1 49 GLN n 
1 50 VAL n 
1 51 CYS n 
1 52 ALA n 
1 53 ASP n 
1 54 PRO n 
1 55 SER n 
1 56 GLU n 
1 57 SER n 
1 58 TRP n 
1 59 VAL n 
1 60 GLN n 
1 61 GLU n 
1 62 TYR n 
1 63 VAL n 
1 64 TYR n 
1 65 ASP n 
1 66 LEU n 
1 67 GLU n 
1 68 LEU n 
1 69 ASN n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCL4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P13236 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2X6L A 1 ? 69 ? P13236 24 ? 92 ? 1 69 
2 1 2X6L B 1 ? 69 ? P13236 24 ? 92 ? 1 69 
3 1 2X6L C 1 ? 69 ? P13236 24 ? 92 ? 1 69 
4 1 2X6L D 1 ? 69 ? P13236 24 ? 92 ? 1 69 
5 1 2X6L E 1 ? 69 ? P13236 24 ? 92 ? 1 69 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2X6L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.11 
_exptl_crystal.density_percent_sol   60.20 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2001-11-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             0.9792 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2X6L 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   15529 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.60 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2X6L 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     14811 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.16 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.448 
_refine.ls_d_res_high                            2.602 
_refine.ls_percent_reflns_obs                    95.36 
_refine.ls_R_factor_obs                          0.1899 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1864 
_refine.ls_R_factor_R_free                       0.2603 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  738 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            9.7341 
_refine.aniso_B[2][2]                            -5.4940 
_refine.aniso_B[3][3]                            -4.2402 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.405 
_refine.solvent_model_param_bsol                 42.241 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.31 
_refine.pdbx_overall_phase_error                 24.09 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2627 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             145 
_refine_hist.number_atoms_total               2790 
_refine_hist.d_res_high                       2.602 
_refine_hist.d_res_low                        49.448 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 2747 'X-RAY DIFFRACTION' ? 
f_angle_d          1.045  ? ? 3732 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 21.849 ? ? 987  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.071  ? ? 403  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 484  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.6016 2.8025  2614 0.1930 90.00 0.2626 . . 138 . . 
'X-RAY DIFFRACTION' . 2.8025 3.0844  2699 0.1977 93.00 0.2921 . . 139 . . 
'X-RAY DIFFRACTION' . 3.0844 3.5307  2821 0.1805 96.00 0.2708 . . 166 . . 
'X-RAY DIFFRACTION' . 3.5307 4.4478  2918 0.1642 98.00 0.2539 . . 134 . . 
'X-RAY DIFFRACTION' . 4.4478 49.4566 3021 0.1917 98.00 0.2344 . . 161 . . 
# 
_struct.entry_id                  2X6L 
_struct.title                     'X-ray Structure of Macrophage Inflammatory Protein-1 beta' 
_struct.pdbx_descriptor           'C-C MOTIF CHEMOKINE 4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2X6L 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'INFLAMMATORY RESPONSE, CHEMOTAXIS, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 21 ? ASN A 23 ? PRO A 21 ASN A 23 5 ? 3  
HELX_P HELX_P2  2  GLU A 56 ? ASN A 69 ? GLU A 56 ASN A 69 1 ? 14 
HELX_P HELX_P3  3  PRO B 21 ? ASN B 23 ? PRO B 21 ASN B 23 5 ? 3  
HELX_P HELX_P4  4  GLU B 56 ? ASN B 69 ? GLU B 56 ASN B 69 1 ? 14 
HELX_P HELX_P5  5  PRO C 21 ? ASN C 23 ? PRO C 21 ASN C 23 5 ? 3  
HELX_P HELX_P6  6  GLU C 56 ? ASN C 69 ? GLU C 56 ASN C 69 1 ? 14 
HELX_P HELX_P7  7  PRO D 21 ? ASN D 23 ? PRO D 21 ASN D 23 5 ? 3  
HELX_P HELX_P8  8  GLU D 56 ? ASN D 69 ? GLU D 56 ASN D 69 1 ? 14 
HELX_P HELX_P9  9  PRO E 21 ? ASN E 23 ? PRO E 21 ASN E 23 5 ? 3  
HELX_P HELX_P10 10 GLU E 56 ? LEU E 68 ? GLU E 56 LEU E 68 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 11 A CYS 35 1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf2  disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 12 A CYS 51 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3  disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 35 SG ? ? B CYS 11 B CYS 35 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4  disulf ? ? B CYS 12 SG ? ? ? 1_555 B CYS 51 SG ? ? B CYS 12 B CYS 51 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf5  disulf ? ? C CYS 11 SG ? ? ? 1_555 C CYS 35 SG ? ? C CYS 11 C CYS 35 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf6  disulf ? ? C CYS 12 SG ? ? ? 1_555 C CYS 51 SG ? ? C CYS 12 C CYS 51 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf7  disulf ? ? D CYS 11 SG ? ? ? 1_555 D CYS 35 SG ? ? D CYS 11 D CYS 35 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf8  disulf ? ? D CYS 12 SG ? ? ? 1_555 D CYS 51 SG ? ? D CYS 12 D CYS 51 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf9  disulf ? ? E CYS 11 SG ? ? ? 1_555 E CYS 35 SG ? ? E CYS 11 E CYS 35 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf10 disulf ? ? E CYS 12 SG ? ? ? 1_555 E CYS 51 SG ? ? E CYS 12 E CYS 51 1_555 ? ? ? ? ? ? ? 2.036 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
BA ? 2 ? 
BB ? 3 ? 
CA ? 2 ? 
CB ? 3 ? 
DA ? 3 ? 
EA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 25 ? GLU A 30 ? VAL A 25 GLU A 30 
AA 2 VAL A 40 ? THR A 44 ? VAL A 40 THR A 44 
AA 3 GLN A 49 ? ALA A 52 ? GLN A 49 ALA A 52 
BA 1 THR B 9  ? CYS B 11 ? THR B 9  CYS B 11 
BA 2 THR D 9  ? CYS D 11 ? THR D 9  CYS D 11 
BB 1 VAL B 25 ? GLU B 30 ? VAL B 25 GLU B 30 
BB 2 VAL B 40 ? THR B 44 ? VAL B 40 THR B 44 
BB 3 GLN B 49 ? ALA B 52 ? GLN B 49 ALA B 52 
CA 1 THR C 9  ? CYS C 11 ? THR C 9  CYS C 11 
CA 2 THR E 9  ? CYS E 11 ? THR E 9  CYS E 11 
CB 1 VAL C 25 ? GLU C 30 ? VAL C 25 GLU C 30 
CB 2 VAL C 40 ? THR C 44 ? VAL C 40 THR C 44 
CB 3 GLN C 49 ? ALA C 52 ? GLN C 49 ALA C 52 
DA 1 VAL D 25 ? GLU D 30 ? VAL D 25 GLU D 30 
DA 2 VAL D 40 ? THR D 44 ? VAL D 40 THR D 44 
DA 3 GLN D 49 ? ALA D 52 ? GLN D 49 ALA D 52 
EA 1 VAL E 25 ? GLU E 30 ? VAL E 25 GLU E 30 
EA 2 VAL E 40 ? THR E 44 ? VAL E 40 THR E 44 
EA 3 GLN E 49 ? ALA E 52 ? GLN E 49 ALA E 52 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TYR A 29 ? N TYR A 29 O VAL A 41 ? O VAL A 41 
AA 2 3 N PHE A 42 ? N PHE A 42 O VAL A 50 ? O VAL A 50 
BA 1 2 N CYS B 11 ? N CYS B 11 O THR D 9  ? O THR D 9  
BB 1 2 N TYR B 29 ? N TYR B 29 O VAL B 41 ? O VAL B 41 
BB 2 3 N PHE B 42 ? N PHE B 42 O VAL B 50 ? O VAL B 50 
CA 1 2 N CYS C 11 ? N CYS C 11 O THR E 9  ? O THR E 9  
CB 1 2 N TYR C 29 ? N TYR C 29 O VAL C 41 ? O VAL C 41 
CB 2 3 N PHE C 42 ? N PHE C 42 O VAL C 50 ? O VAL C 50 
DA 1 2 N TYR D 29 ? N TYR D 29 O VAL D 41 ? O VAL D 41 
DA 2 3 N PHE D 42 ? N PHE D 42 O VAL D 50 ? O VAL D 50 
EA 1 2 N TYR E 29 ? N TYR E 29 O VAL E 41 ? O VAL E 41 
EA 2 3 N PHE E 42 ? N PHE E 42 O VAL E 50 ? O VAL E 50 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL B 1070' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL D 1070' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL C 1070' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLU B 61 ? GLU B 61   . ? 1_555 ? 
2  AC1 6 TYR B 64 ? TYR B 64   . ? 1_555 ? 
3  AC1 6 HOH J .  ? HOH B 2029 . ? 1_555 ? 
4  AC1 6 HOH J .  ? HOH B 2031 . ? 1_555 ? 
5  AC1 6 ASP C 53 ? ASP C 53   . ? 5_545 ? 
6  AC1 6 SER C 55 ? SER C 55   . ? 5_545 ? 
7  AC2 6 ASP A 53 ? ASP A 53   . ? 5_455 ? 
8  AC2 6 SER A 55 ? SER A 55   . ? 5_455 ? 
9  AC2 6 GLU D 61 ? GLU D 61   . ? 1_555 ? 
10 AC2 6 ASP D 65 ? ASP D 65   . ? 1_555 ? 
11 AC2 6 ASN D 69 ? ASN D 69   . ? 1_555 ? 
12 AC2 6 HOH L .  ? HOH D 2023 . ? 1_555 ? 
13 AC3 3 PRO C 8  ? PRO C 8    . ? 1_555 ? 
14 AC3 3 ALA C 10 ? ALA C 10   . ? 1_555 ? 
15 AC3 3 HOH K .  ? HOH C 2032 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2X6L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2X6L 
_atom_sites.fract_transf_matrix[1][1]   0.016719 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011378 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005359 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 4  ? -25.471 9.744   -9.889  1.00 28.23 ? 4    GLY A N   1 
ATOM   2    C CA  . GLY A 1 4  ? -24.122 9.412   -9.463  1.00 38.88 ? 4    GLY A CA  1 
ATOM   3    C C   . GLY A 1 4  ? -23.293 10.657  -9.224  1.00 33.00 ? 4    GLY A C   1 
ATOM   4    O O   . GLY A 1 4  ? -23.167 11.487  -10.122 1.00 40.57 ? 4    GLY A O   1 
ATOM   5    N N   . SER A 1 5  ? -22.749 10.793  -8.013  1.00 35.85 ? 5    SER A N   1 
ATOM   6    C CA  . SER A 1 5  ? -21.930 11.954  -7.617  1.00 33.69 ? 5    SER A CA  1 
ATOM   7    C C   . SER A 1 5  ? -20.605 11.465  -7.059  1.00 26.84 ? 5    SER A C   1 
ATOM   8    O O   . SER A 1 5  ? -19.744 11.012  -7.813  1.00 42.05 ? 5    SER A O   1 
ATOM   9    C CB  . SER A 1 5  ? -22.650 12.821  -6.573  1.00 29.19 ? 5    SER A CB  1 
ATOM   10   O OG  . SER A 1 5  ? -23.085 12.051  -5.459  1.00 27.89 ? 5    SER A OG  1 
ATOM   11   N N   . ASP A 1 6  ? -20.447 11.526  -5.740  1.00 24.12 ? 6    ASP A N   1 
ATOM   12   C CA  . ASP A 1 6  ? -19.293 10.899  -5.089  1.00 24.35 ? 6    ASP A CA  1 
ATOM   13   C C   . ASP A 1 6  ? -19.736 9.924   -3.990  1.00 23.60 ? 6    ASP A C   1 
ATOM   14   O O   . ASP A 1 6  ? -19.418 10.123  -2.817  1.00 22.56 ? 6    ASP A O   1 
ATOM   15   C CB  . ASP A 1 6  ? -18.350 11.958  -4.509  1.00 14.71 ? 6    ASP A CB  1 
ATOM   16   C CG  . ASP A 1 6  ? -18.139 13.146  -5.451  1.00 30.83 ? 6    ASP A CG  1 
ATOM   17   O OD1 . ASP A 1 6  ? -17.207 13.098  -6.287  1.00 32.29 ? 6    ASP A OD1 1 
ATOM   18   O OD2 . ASP A 1 6  ? -18.900 14.139  -5.344  1.00 31.71 ? 6    ASP A OD2 1 
ATOM   19   N N   . PRO A 1 7  ? -20.478 8.867   -4.361  1.00 20.14 ? 7    PRO A N   1 
ATOM   20   C CA  . PRO A 1 7  ? -20.913 7.916   -3.337  1.00 13.59 ? 7    PRO A CA  1 
ATOM   21   C C   . PRO A 1 7  ? -19.751 6.984   -3.000  1.00 21.99 ? 7    PRO A C   1 
ATOM   22   O O   . PRO A 1 7  ? -18.764 6.942   -3.743  1.00 17.80 ? 7    PRO A O   1 
ATOM   23   C CB  . PRO A 1 7  ? -22.014 7.130   -4.043  1.00 16.09 ? 7    PRO A CB  1 
ATOM   24   C CG  . PRO A 1 7  ? -21.548 7.078   -5.485  1.00 14.68 ? 7    PRO A CG  1 
ATOM   25   C CD  . PRO A 1 7  ? -20.777 8.387   -5.724  1.00 20.04 ? 7    PRO A CD  1 
ATOM   26   N N   . PRO A 1 8  ? -19.851 6.256   -1.880  1.00 18.83 ? 8    PRO A N   1 
ATOM   27   C CA  . PRO A 1 8  ? -18.770 5.328   -1.535  1.00 18.18 ? 8    PRO A CA  1 
ATOM   28   C C   . PRO A 1 8  ? -18.708 4.093   -2.434  1.00 15.30 ? 8    PRO A C   1 
ATOM   29   O O   . PRO A 1 8  ? -19.704 3.629   -2.987  1.00 12.10 ? 8    PRO A O   1 
ATOM   30   C CB  . PRO A 1 8  ? -19.112 4.910   -0.105  1.00 15.52 ? 8    PRO A CB  1 
ATOM   31   C CG  . PRO A 1 8  ? -20.599 5.182   0.021   1.00 12.72 ? 8    PRO A CG  1 
ATOM   32   C CD  . PRO A 1 8  ? -20.837 6.401   -0.794  1.00 12.72 ? 8    PRO A CD  1 
ATOM   33   N N   . THR A 1 9  ? -17.507 3.551   -2.552  1.00 17.81 ? 9    THR A N   1 
ATOM   34   C CA  . THR A 1 9  ? -17.269 2.341   -3.318  1.00 16.26 ? 9    THR A CA  1 
ATOM   35   C C   . THR A 1 9  ? -17.342 1.104   -2.421  1.00 17.70 ? 9    THR A C   1 
ATOM   36   O O   . THR A 1 9  ? -16.851 1.111   -1.293  1.00 15.15 ? 9    THR A O   1 
ATOM   37   C CB  . THR A 1 9  ? -15.886 2.404   -3.969  1.00 17.98 ? 9    THR A CB  1 
ATOM   38   O OG1 . THR A 1 9  ? -15.811 3.568   -4.800  1.00 30.12 ? 9    THR A OG1 1 
ATOM   39   C CG2 . THR A 1 9  ? -15.621 1.157   -4.808  1.00 15.71 ? 9    THR A CG2 1 
ATOM   40   N N   . ALA A 1 10 ? -17.964 0.044   -2.923  1.00 14.37 ? 10   ALA A N   1 
ATOM   41   C CA  . ALA A 1 10 ? -18.018 -1.214  -2.195  1.00 14.59 ? 10   ALA A CA  1 
ATOM   42   C C   . ALA A 1 10 ? -16.688 -1.977  -2.303  1.00 17.32 ? 10   ALA A C   1 
ATOM   43   O O   . ALA A 1 10 ? -16.197 -2.237  -3.401  1.00 20.73 ? 10   ALA A O   1 
ATOM   44   C CB  . ALA A 1 10 ? -19.155 -2.065  -2.724  1.00 13.68 ? 10   ALA A CB  1 
ATOM   45   N N   . CYS A 1 11 ? -16.114 -2.340  -1.164  1.00 11.12 ? 11   CYS A N   1 
ATOM   46   C CA  . CYS A 1 11 ? -14.876 -3.095  -1.151  1.00 12.11 ? 11   CYS A CA  1 
ATOM   47   C C   . CYS A 1 11 ? -14.963 -4.284  -0.191  1.00 15.56 ? 11   CYS A C   1 
ATOM   48   O O   . CYS A 1 11 ? -15.554 -4.172  0.873   1.00 15.36 ? 11   CYS A O   1 
ATOM   49   C CB  . CYS A 1 11 ? -13.720 -2.175  -0.763  1.00 13.82 ? 11   CYS A CB  1 
ATOM   50   S SG  . CYS A 1 11 ? -13.345 -0.946  -2.043  1.00 25.03 ? 11   CYS A SG  1 
ATOM   51   N N   . CYS A 1 12 ? -14.391 -5.424  -0.575  1.00 14.77 ? 12   CYS A N   1 
ATOM   52   C CA  . CYS A 1 12 ? -14.350 -6.577  0.315   1.00 17.80 ? 12   CYS A CA  1 
ATOM   53   C C   . CYS A 1 12 ? -12.972 -6.719  0.949   1.00 24.46 ? 12   CYS A C   1 
ATOM   54   O O   . CYS A 1 12 ? -11.952 -6.817  0.261   1.00 18.74 ? 12   CYS A O   1 
ATOM   55   C CB  . CYS A 1 12 ? -14.739 -7.882  -0.396  1.00 14.38 ? 12   CYS A CB  1 
ATOM   56   S SG  . CYS A 1 12 ? -16.436 -7.932  -1.055  1.00 19.24 ? 12   CYS A SG  1 
ATOM   57   N N   . PHE A 1 13 ? -12.948 -6.744  2.273   1.00 19.96 ? 13   PHE A N   1 
ATOM   58   C CA  . PHE A 1 13 ? -11.712 -7.024  2.975   1.00 25.87 ? 13   PHE A CA  1 
ATOM   59   C C   . PHE A 1 13 ? -11.650 -8.470  3.483   1.00 29.04 ? 13   PHE A C   1 
ATOM   60   O O   . PHE A 1 13 ? -10.622 -8.915  3.983   1.00 27.86 ? 13   PHE A O   1 
ATOM   61   C CB  . PHE A 1 13 ? -11.515 -6.015  4.089   1.00 15.31 ? 13   PHE A CB  1 
ATOM   62   C CG  . PHE A 1 13 ? -11.440 -4.614  3.598   1.00 19.04 ? 13   PHE A CG  1 
ATOM   63   C CD1 . PHE A 1 13 ? -10.303 -4.158  2.949   1.00 15.25 ? 13   PHE A CD1 1 
ATOM   64   C CD2 . PHE A 1 13 ? -12.511 -3.750  3.757   1.00 20.79 ? 13   PHE A CD2 1 
ATOM   65   C CE1 . PHE A 1 13 ? -10.230 -2.861  2.485   1.00 17.43 ? 13   PHE A CE1 1 
ATOM   66   C CE2 . PHE A 1 13 ? -12.445 -2.448  3.284   1.00 15.57 ? 13   PHE A CE2 1 
ATOM   67   C CZ  . PHE A 1 13 ? -11.305 -2.006  2.647   1.00 14.69 ? 13   PHE A CZ  1 
ATOM   68   N N   . SER A 1 14 ? -12.747 -9.199  3.320   1.00 21.54 ? 14   SER A N   1 
ATOM   69   C CA  . SER A 1 14 ? -12.805 -10.589 3.727   1.00 26.24 ? 14   SER A CA  1 
ATOM   70   C C   . SER A 1 14 ? -13.839 -11.331 2.886   1.00 23.52 ? 14   SER A C   1 
ATOM   71   O O   . SER A 1 14 ? -14.863 -10.767 2.507   1.00 19.63 ? 14   SER A O   1 
ATOM   72   C CB  . SER A 1 14 ? -13.164 -10.691 5.212   1.00 27.87 ? 14   SER A CB  1 
ATOM   73   O OG  . SER A 1 14 ? -14.529 -10.373 5.439   1.00 37.41 ? 14   SER A OG  1 
ATOM   74   N N   . TYR A 1 15 ? -13.576 -12.601 2.605   1.00 21.83 ? 15   TYR A N   1 
ATOM   75   C CA  . TYR A 1 15 ? -14.490 -13.397 1.797   1.00 20.76 ? 15   TYR A CA  1 
ATOM   76   C C   . TYR A 1 15 ? -15.286 -14.373 2.638   1.00 20.08 ? 15   TYR A C   1 
ATOM   77   O O   . TYR A 1 15 ? -14.769 -14.938 3.594   1.00 22.90 ? 15   TYR A O   1 
ATOM   78   C CB  . TYR A 1 15 ? -13.710 -14.206 0.780   1.00 17.45 ? 15   TYR A CB  1 
ATOM   79   C CG  . TYR A 1 15 ? -12.794 -13.398 -0.077  1.00 20.35 ? 15   TYR A CG  1 
ATOM   80   C CD1 . TYR A 1 15 ? -13.290 -12.386 -0.883  1.00 15.44 ? 15   TYR A CD1 1 
ATOM   81   C CD2 . TYR A 1 15 ? -11.428 -13.672 -0.118  1.00 21.47 ? 15   TYR A CD2 1 
ATOM   82   C CE1 . TYR A 1 15 ? -12.453 -11.650 -1.696  1.00 19.25 ? 15   TYR A CE1 1 
ATOM   83   C CE2 . TYR A 1 15 ? -10.579 -12.941 -0.928  1.00 21.62 ? 15   TYR A CE2 1 
ATOM   84   C CZ  . TYR A 1 15 ? -11.104 -11.922 -1.714  1.00 22.21 ? 15   TYR A CZ  1 
ATOM   85   O OH  . TYR A 1 15 ? -10.288 -11.181 -2.533  1.00 20.13 ? 15   TYR A OH  1 
ATOM   86   N N   . THR A 1 16 ? -16.534 -14.608 2.256   1.00 19.23 ? 16   THR A N   1 
ATOM   87   C CA  . THR A 1 16 ? -17.314 -15.662 2.890   1.00 17.42 ? 16   THR A CA  1 
ATOM   88   C C   . THR A 1 16 ? -16.560 -16.978 2.802   1.00 22.96 ? 16   THR A C   1 
ATOM   89   O O   . THR A 1 16 ? -15.935 -17.285 1.789   1.00 28.12 ? 16   THR A O   1 
ATOM   90   C CB  . THR A 1 16 ? -18.677 -15.828 2.227   1.00 20.14 ? 16   THR A CB  1 
ATOM   91   O OG1 . THR A 1 16 ? -19.508 -16.657 3.039   1.00 29.15 ? 16   THR A OG1 1 
ATOM   92   C CG2 . THR A 1 16 ? -18.529 -16.468 0.853   1.00 24.93 ? 16   THR A CG2 1 
ATOM   93   N N   . ALA A 1 17 ? -16.608 -17.759 3.867   1.00 30.06 ? 17   ALA A N   1 
ATOM   94   C CA  . ALA A 1 17 ? -15.957 -19.058 3.858   1.00 27.47 ? 17   ALA A CA  1 
ATOM   95   C C   . ALA A 1 17 ? -16.966 -20.161 3.590   1.00 29.07 ? 17   ALA A C   1 
ATOM   96   O O   . ALA A 1 17 ? -16.612 -21.330 3.504   1.00 35.18 ? 17   ALA A O   1 
ATOM   97   C CB  . ALA A 1 17 ? -15.255 -19.299 5.163   1.00 20.90 ? 17   ALA A CB  1 
ATOM   98   N N   A ARG A 1 18 ? -18.230 -19.790 3.432   0.42 29.07 ? 18   ARG A N   1 
ATOM   99   N N   B ARG A 1 18 ? -18.230 -19.785 3.488   0.58 29.14 ? 18   ARG A N   1 
ATOM   100  C CA  A ARG A 1 18 ? -19.272 -20.784 3.207   0.42 34.09 ? 18   ARG A CA  1 
ATOM   101  C CA  B ARG A 1 18 ? -19.253 -20.759 3.171   0.58 34.03 ? 18   ARG A CA  1 
ATOM   102  C C   A ARG A 1 18 ? -19.904 -20.651 1.821   0.42 36.75 ? 18   ARG A C   1 
ATOM   103  C C   B ARG A 1 18 ? -19.587 -20.656 1.691   0.58 36.33 ? 18   ARG A C   1 
ATOM   104  O O   A ARG A 1 18 ? -20.297 -19.556 1.418   0.42 37.72 ? 18   ARG A O   1 
ATOM   105  O O   B ARG A 1 18 ? -19.429 -19.599 1.086   0.58 34.22 ? 18   ARG A O   1 
ATOM   106  C CB  A ARG A 1 18 ? -20.328 -20.705 4.313   0.42 37.90 ? 18   ARG A CB  1 
ATOM   107  C CB  B ARG A 1 18 ? -20.490 -20.568 4.063   0.58 37.26 ? 18   ARG A CB  1 
ATOM   108  C CG  A ARG A 1 18 ? -19.842 -21.247 5.671   0.42 40.44 ? 18   ARG A CG  1 
ATOM   109  C CG  B ARG A 1 18 ? -20.446 -21.427 5.348   0.58 43.90 ? 18   ARG A CG  1 
ATOM   110  C CD  A ARG A 1 18 ? -19.791 -20.163 6.752   0.42 35.61 ? 18   ARG A CD  1 
ATOM   111  C CD  B ARG A 1 18 ? -21.517 -21.051 6.384   0.58 41.18 ? 18   ARG A CD  1 
ATOM   112  N NE  A ARG A 1 18 ? -18.928 -19.043 6.380   0.42 36.11 ? 18   ARG A NE  1 
ATOM   113  N NE  B ARG A 1 18 ? -21.034 -20.056 7.342   0.58 43.54 ? 18   ARG A NE  1 
ATOM   114  C CZ  A ARG A 1 18 ? -19.236 -17.760 6.551   0.42 32.48 ? 18   ARG A CZ  1 
ATOM   115  C CZ  B ARG A 1 18 ? -21.666 -19.727 8.469   0.58 41.00 ? 18   ARG A CZ  1 
ATOM   116  N NH1 A ARG A 1 18 ? -20.397 -17.411 7.096   0.42 33.69 ? 18   ARG A NH1 1 
ATOM   117  N NH1 B ARG A 1 18 ? -22.811 -20.325 8.787   0.58 32.64 ? 18   ARG A NH1 1 
ATOM   118  N NH2 A ARG A 1 18 ? -18.379 -16.824 6.176   0.42 27.87 ? 18   ARG A NH2 1 
ATOM   119  N NH2 B ARG A 1 18 ? -21.146 -18.809 9.283   0.58 25.12 ? 18   ARG A NH2 1 
ATOM   120  N N   . LYS A 1 19 ? -20.003 -21.767 1.098   1.00 32.55 ? 19   LYS A N   1 
ATOM   121  C CA  . LYS A 1 19 ? -20.497 -21.747 -0.267  1.00 26.36 ? 19   LYS A CA  1 
ATOM   122  C C   . LYS A 1 19 ? -22.007 -21.564 -0.314  1.00 34.01 ? 19   LYS A C   1 
ATOM   123  O O   . LYS A 1 19 ? -22.750 -22.259 0.383   1.00 33.49 ? 19   LYS A O   1 
ATOM   124  C CB  . LYS A 1 19 ? -20.133 -23.024 -1.015  1.00 31.39 ? 19   LYS A CB  1 
ATOM   125  C CG  . LYS A 1 19 ? -20.978 -23.210 -2.284  1.00 35.20 ? 19   LYS A CG  1 
ATOM   126  C CD  . LYS A 1 19 ? -20.643 -24.494 -3.022  1.00 33.33 ? 19   LYS A CD  1 
ATOM   127  C CE  . LYS A 1 19 ? -21.508 -24.651 -4.264  1.00 41.08 ? 19   LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 19 ? -21.132 -25.867 -5.047  1.00 43.20 ? 19   LYS A NZ  1 
ATOM   129  N N   . LEU A 1 20 ? -22.462 -20.645 -1.158  1.00 27.85 ? 20   LEU A N   1 
ATOM   130  C CA  . LEU A 1 20 ? -23.877 -20.338 -1.225  1.00 27.42 ? 20   LEU A CA  1 
ATOM   131  C C   . LEU A 1 20 ? -24.590 -21.286 -2.166  1.00 31.33 ? 20   LEU A C   1 
ATOM   132  O O   . LEU A 1 20 ? -24.141 -21.509 -3.290  1.00 27.36 ? 20   LEU A O   1 
ATOM   133  C CB  . LEU A 1 20 ? -24.085 -18.902 -1.687  1.00 28.63 ? 20   LEU A CB  1 
ATOM   134  C CG  . LEU A 1 20 ? -23.501 -17.828 -0.770  1.00 26.89 ? 20   LEU A CG  1 
ATOM   135  C CD1 . LEU A 1 20 ? -23.406 -16.487 -1.490  1.00 19.49 ? 20   LEU A CD1 1 
ATOM   136  C CD2 . LEU A 1 20 ? -24.358 -17.723 0.477   1.00 17.56 ? 20   LEU A CD2 1 
ATOM   137  N N   . PRO A 1 21 ? -25.695 -21.875 -1.695  1.00 32.88 ? 21   PRO A N   1 
ATOM   138  C CA  . PRO A 1 21 ? -26.562 -22.656 -2.576  1.00 24.12 ? 21   PRO A CA  1 
ATOM   139  C C   . PRO A 1 21 ? -26.883 -21.820 -3.806  1.00 30.00 ? 21   PRO A C   1 
ATOM   140  O O   . PRO A 1 21 ? -27.227 -20.653 -3.673  1.00 33.16 ? 21   PRO A O   1 
ATOM   141  C CB  . PRO A 1 21 ? -27.807 -22.865 -1.721  1.00 28.52 ? 21   PRO A CB  1 
ATOM   142  C CG  . PRO A 1 21 ? -27.282 -22.892 -0.316  1.00 25.05 ? 21   PRO A CG  1 
ATOM   143  C CD  . PRO A 1 21 ? -26.126 -21.935 -0.286  1.00 27.26 ? 21   PRO A CD  1 
ATOM   144  N N   . ARG A 1 22 ? -26.749 -22.397 -4.992  1.00 29.98 ? 22   ARG A N   1 
ATOM   145  C CA  . ARG A 1 22 ? -26.958 -21.635 -6.212  1.00 25.82 ? 22   ARG A CA  1 
ATOM   146  C C   . ARG A 1 22 ? -28.310 -20.923 -6.221  1.00 27.29 ? 22   ARG A C   1 
ATOM   147  O O   . ARG A 1 22 ? -28.435 -19.832 -6.771  1.00 25.95 ? 22   ARG A O   1 
ATOM   148  C CB  . ARG A 1 22 ? -26.810 -22.536 -7.443  1.00 20.23 ? 22   ARG A CB  1 
ATOM   149  C CG  . ARG A 1 22 ? -27.136 -21.872 -8.773  1.00 14.90 ? 22   ARG A CG  1 
ATOM   150  C CD  . ARG A 1 22 ? -26.180 -20.739 -9.112  1.00 21.32 ? 22   ARG A CD  1 
ATOM   151  N NE  . ARG A 1 22 ? -26.522 -20.070 -10.368 1.00 20.89 ? 22   ARG A NE  1 
ATOM   152  C CZ  . ARG A 1 22 ? -27.408 -19.081 -10.468 1.00 29.07 ? 22   ARG A CZ  1 
ATOM   153  N NH1 . ARG A 1 22 ? -28.043 -18.647 -9.385  1.00 25.82 ? 22   ARG A NH1 1 
ATOM   154  N NH2 . ARG A 1 22 ? -27.662 -18.520 -11.647 1.00 25.83 ? 22   ARG A NH2 1 
ATOM   155  N N   . ASN A 1 23 ? -29.337 -21.511 -5.621  1.00 27.38 ? 23   ASN A N   1 
ATOM   156  C CA  . ASN A 1 23 ? -30.629 -20.847 -5.734  1.00 32.12 ? 23   ASN A CA  1 
ATOM   157  C C   . ASN A 1 23 ? -30.904 -19.853 -4.624  1.00 33.02 ? 23   ASN A C   1 
ATOM   158  O O   . ASN A 1 23 ? -32.033 -19.416 -4.434  1.00 38.63 ? 23   ASN A O   1 
ATOM   159  C CB  . ASN A 1 23 ? -31.799 -21.805 -5.994  1.00 29.26 ? 23   ASN A CB  1 
ATOM   160  C CG  . ASN A 1 23 ? -31.973 -22.841 -4.913  1.00 47.19 ? 23   ASN A CG  1 
ATOM   161  O OD1 . ASN A 1 23 ? -31.052 -23.130 -4.145  1.00 46.01 ? 23   ASN A OD1 1 
ATOM   162  N ND2 . ASN A 1 23 ? -33.170 -23.427 -4.857  1.00 45.77 ? 23   ASN A ND2 1 
ATOM   163  N N   . PHE A 1 24 ? -29.847 -19.469 -3.918  1.00 30.97 ? 24   PHE A N   1 
ATOM   164  C CA  . PHE A 1 24 ? -29.913 -18.332 -3.017  1.00 24.08 ? 24   PHE A CA  1 
ATOM   165  C C   . PHE A 1 24 ? -29.518 -17.074 -3.796  1.00 35.36 ? 24   PHE A C   1 
ATOM   166  O O   . PHE A 1 24 ? -29.925 -15.959 -3.459  1.00 31.08 ? 24   PHE A O   1 
ATOM   167  C CB  . PHE A 1 24 ? -28.957 -18.531 -1.853  1.00 26.93 ? 24   PHE A CB  1 
ATOM   168  C CG  . PHE A 1 24 ? -29.503 -19.387 -0.754  1.00 33.70 ? 24   PHE A CG  1 
ATOM   169  C CD1 . PHE A 1 24 ? -29.154 -19.141 0.562   1.00 34.28 ? 24   PHE A CD1 1 
ATOM   170  C CD2 . PHE A 1 24 ? -30.368 -20.430 -1.028  1.00 38.85 ? 24   PHE A CD2 1 
ATOM   171  C CE1 . PHE A 1 24 ? -29.654 -19.920 1.578   1.00 39.42 ? 24   PHE A CE1 1 
ATOM   172  C CE2 . PHE A 1 24 ? -30.872 -21.215 -0.018  1.00 35.73 ? 24   PHE A CE2 1 
ATOM   173  C CZ  . PHE A 1 24 ? -30.515 -20.962 1.287   1.00 41.13 ? 24   PHE A CZ  1 
ATOM   174  N N   . VAL A 1 25 ? -28.733 -17.272 -4.852  1.00 27.21 ? 25   VAL A N   1 
ATOM   175  C CA  . VAL A 1 25 ? -28.144 -16.173 -5.605  1.00 21.13 ? 25   VAL A CA  1 
ATOM   176  C C   . VAL A 1 25 ? -29.008 -15.750 -6.798  1.00 25.33 ? 25   VAL A C   1 
ATOM   177  O O   . VAL A 1 25 ? -29.628 -16.578 -7.458  1.00 27.49 ? 25   VAL A O   1 
ATOM   178  C CB  . VAL A 1 25 ? -26.741 -16.562 -6.097  1.00 22.67 ? 25   VAL A CB  1 
ATOM   179  C CG1 . VAL A 1 25 ? -26.096 -15.420 -6.876  1.00 21.02 ? 25   VAL A CG1 1 
ATOM   180  C CG2 . VAL A 1 25 ? -25.869 -17.001 -4.912  1.00 19.60 ? 25   VAL A CG2 1 
ATOM   181  N N   . VAL A 1 26 ? -29.035 -14.453 -7.076  1.00 25.80 ? 26   VAL A N   1 
ATOM   182  C CA  . VAL A 1 26 ? -29.899 -13.923 -8.117  1.00 25.18 ? 26   VAL A CA  1 
ATOM   183  C C   . VAL A 1 26 ? -29.204 -12.832 -8.918  1.00 27.28 ? 26   VAL A C   1 
ATOM   184  O O   . VAL A 1 26 ? -29.695 -12.410 -9.952  1.00 30.15 ? 26   VAL A O   1 
ATOM   185  C CB  . VAL A 1 26 ? -31.207 -13.364 -7.528  1.00 23.54 ? 26   VAL A CB  1 
ATOM   186  C CG1 . VAL A 1 26 ? -31.949 -14.443 -6.790  1.00 26.07 ? 26   VAL A CG1 1 
ATOM   187  C CG2 . VAL A 1 26 ? -30.918 -12.207 -6.591  1.00 25.73 ? 26   VAL A CG2 1 
ATOM   188  N N   . ASP A 1 27 ? -28.062 -12.371 -8.425  1.00 33.67 ? 27   ASP A N   1 
ATOM   189  C CA  . ASP A 1 27 ? -27.246 -11.406 -9.157  1.00 22.72 ? 27   ASP A CA  1 
ATOM   190  C C   . ASP A 1 27 ? -25.868 -11.290 -8.523  1.00 24.45 ? 27   ASP A C   1 
ATOM   191  O O   . ASP A 1 27 ? -25.616 -11.869 -7.461  1.00 21.39 ? 27   ASP A O   1 
ATOM   192  C CB  . ASP A 1 27 ? -27.917 -10.049 -9.178  1.00 24.35 ? 27   ASP A CB  1 
ATOM   193  C CG  . ASP A 1 27 ? -27.490 -9.221  -10.357 1.00 34.12 ? 27   ASP A CG  1 
ATOM   194  O OD1 . ASP A 1 27 ? -26.609 -9.686  -11.108 1.00 42.76 ? 27   ASP A OD1 1 
ATOM   195  O OD2 . ASP A 1 27 ? -28.043 -8.114  -10.541 1.00 44.21 ? 27   ASP A OD2 1 
ATOM   196  N N   . TYR A 1 28 ? -24.976 -10.550 -9.173  1.00 15.84 ? 28   TYR A N   1 
ATOM   197  C CA  . TYR A 1 28 ? -23.626 -10.380 -8.660  1.00 16.44 ? 28   TYR A CA  1 
ATOM   198  C C   . TYR A 1 28 ? -23.072 -9.127  -9.271  1.00 13.91 ? 28   TYR A C   1 
ATOM   199  O O   . TYR A 1 28 ? -23.669 -8.559  -10.163 1.00 25.81 ? 28   TYR A O   1 
ATOM   200  C CB  . TYR A 1 28 ? -22.711 -11.577 -9.017  1.00 13.35 ? 28   TYR A CB  1 
ATOM   201  C CG  . TYR A 1 28 ? -22.157 -11.502 -10.424 1.00 13.90 ? 28   TYR A CG  1 
ATOM   202  C CD1 . TYR A 1 28 ? -20.868 -11.043 -10.658 1.00 15.55 ? 28   TYR A CD1 1 
ATOM   203  C CD2 . TYR A 1 28 ? -22.939 -11.851 -11.524 1.00 15.75 ? 28   TYR A CD2 1 
ATOM   204  C CE1 . TYR A 1 28 ? -20.365 -10.940 -11.943 1.00 17.32 ? 28   TYR A CE1 1 
ATOM   205  C CE2 . TYR A 1 28 ? -22.447 -11.765 -12.811 1.00 16.49 ? 28   TYR A CE2 1 
ATOM   206  C CZ  . TYR A 1 28 ? -21.157 -11.310 -13.017 1.00 25.08 ? 28   TYR A CZ  1 
ATOM   207  O OH  . TYR A 1 28 ? -20.651 -11.203 -14.298 1.00 26.92 ? 28   TYR A OH  1 
ATOM   208  N N   . TYR A 1 29 ? -21.932 -8.690  -8.761  1.00 16.38 ? 29   TYR A N   1 
ATOM   209  C CA  . TYR A 1 29 ? -21.106 -7.688  -9.417  1.00 16.02 ? 29   TYR A CA  1 
ATOM   210  C C   . TYR A 1 29 ? -19.687 -7.917  -8.945  1.00 15.45 ? 29   TYR A C   1 
ATOM   211  O O   . TYR A 1 29 ? -19.475 -8.657  -7.988  1.00 20.05 ? 29   TYR A O   1 
ATOM   212  C CB  . TYR A 1 29 ? -21.580 -6.259  -9.113  1.00 14.60 ? 29   TYR A CB  1 
ATOM   213  C CG  . TYR A 1 29 ? -21.510 -5.812  -7.661  1.00 15.96 ? 29   TYR A CG  1 
ATOM   214  C CD1 . TYR A 1 29 ? -20.303 -5.477  -7.073  1.00 21.30 ? 29   TYR A CD1 1 
ATOM   215  C CD2 . TYR A 1 29 ? -22.660 -5.686  -6.893  1.00 20.77 ? 29   TYR A CD2 1 
ATOM   216  C CE1 . TYR A 1 29 ? -20.237 -5.045  -5.759  1.00 20.42 ? 29   TYR A CE1 1 
ATOM   217  C CE2 . TYR A 1 29 ? -22.609 -5.253  -5.584  1.00 17.91 ? 29   TYR A CE2 1 
ATOM   218  C CZ  . TYR A 1 29 ? -21.391 -4.930  -5.015  1.00 24.60 ? 29   TYR A CZ  1 
ATOM   219  O OH  . TYR A 1 29 ? -21.320 -4.498  -3.696  1.00 20.05 ? 29   TYR A OH  1 
ATOM   220  N N   . GLU A 1 30 ? -18.717 -7.312  -9.617  1.00 15.84 ? 30   GLU A N   1 
ATOM   221  C CA  . GLU A 1 30 ? -17.338 -7.363  -9.135  1.00 22.38 ? 30   GLU A CA  1 
ATOM   222  C C   . GLU A 1 30 ? -16.945 -5.997  -8.554  1.00 18.11 ? 30   GLU A C   1 
ATOM   223  O O   . GLU A 1 30 ? -17.499 -4.965  -8.934  1.00 20.10 ? 30   GLU A O   1 
ATOM   224  C CB  . GLU A 1 30 ? -16.370 -7.771  -10.243 1.00 20.92 ? 30   GLU A CB  1 
ATOM   225  C CG  . GLU A 1 30 ? -16.715 -9.069  -10.936 1.00 25.28 ? 30   GLU A CG  1 
ATOM   226  C CD  . GLU A 1 30 ? -15.521 -10.019 -11.044 1.00 60.37 ? 30   GLU A CD  1 
ATOM   227  O OE1 . GLU A 1 30 ? -15.583 -10.944 -11.894 1.00 47.81 ? 30   GLU A OE1 1 
ATOM   228  O OE2 . GLU A 1 30 ? -14.530 -9.847  -10.275 1.00 52.39 ? 30   GLU A OE2 1 
ATOM   229  N N   . THR A 1 31 ? -16.014 -5.985  -7.611  1.00 18.32 ? 31   THR A N   1 
ATOM   230  C CA  . THR A 1 31 ? -15.669 -4.729  -6.954  1.00 18.11 ? 31   THR A CA  1 
ATOM   231  C C   . THR A 1 31 ? -14.757 -3.894  -7.821  1.00 18.84 ? 31   THR A C   1 
ATOM   232  O O   . THR A 1 31 ? -14.006 -4.414  -8.650  1.00 18.12 ? 31   THR A O   1 
ATOM   233  C CB  . THR A 1 31 ? -15.053 -4.919  -5.549  1.00 12.84 ? 31   THR A CB  1 
ATOM   234  O OG1 . THR A 1 31 ? -14.017 -5.900  -5.604  1.00 16.33 ? 31   THR A OG1 1 
ATOM   235  C CG2 . THR A 1 31 ? -16.104 -5.363  -4.552  1.00 14.19 ? 31   THR A CG2 1 
ATOM   236  N N   . SER A 1 32 ? -14.843 -2.586  -7.624  1.00 17.09 ? 32   SER A N   1 
ATOM   237  C CA  . SER A 1 32 ? -13.965 -1.659  -8.302  1.00 16.72 ? 32   SER A CA  1 
ATOM   238  C C   . SER A 1 32 ? -12.502 -2.071  -8.209  1.00 17.90 ? 32   SER A C   1 
ATOM   239  O O   . SER A 1 32 ? -12.047 -2.569  -7.186  1.00 19.23 ? 32   SER A O   1 
ATOM   240  C CB  . SER A 1 32 ? -14.137 -0.262  -7.733  1.00 12.22 ? 32   SER A CB  1 
ATOM   241  O OG  . SER A 1 32 ? -13.125 0.594   -8.230  1.00 21.07 ? 32   SER A OG  1 
ATOM   242  N N   . SER A 1 33 ? -11.769 -1.858  -9.294  1.00 17.11 ? 33   SER A N   1 
ATOM   243  C CA  . SER A 1 33 ? -10.329 -2.048  -9.294  1.00 20.65 ? 33   SER A CA  1 
ATOM   244  C C   . SER A 1 33 ? -9.640  -1.133  -8.280  1.00 19.31 ? 33   SER A C   1 
ATOM   245  O O   . SER A 1 33 ? -8.481  -1.341  -7.944  1.00 25.20 ? 33   SER A O   1 
ATOM   246  C CB  . SER A 1 33 ? -9.784  -1.768  -10.683 1.00 20.60 ? 33   SER A CB  1 
ATOM   247  O OG  . SER A 1 33 ? -10.039 -0.422  -11.039 1.00 18.60 ? 33   SER A OG  1 
ATOM   248  N N   . LEU A 1 34 ? -10.346 -0.114  -7.799  1.00 13.42 ? 34   LEU A N   1 
ATOM   249  C CA  . LEU A 1 34 ? -9.772  0.784   -6.807  1.00 20.28 ? 34   LEU A CA  1 
ATOM   250  C C   . LEU A 1 34 ? -9.555  0.084   -5.452  1.00 21.25 ? 34   LEU A C   1 
ATOM   251  O O   . LEU A 1 34 ? -8.794  0.570   -4.619  1.00 21.95 ? 34   LEU A O   1 
ATOM   252  C CB  . LEU A 1 34 ? -10.638 2.049   -6.633  1.00 14.80 ? 34   LEU A CB  1 
ATOM   253  C CG  . LEU A 1 34 ? -10.727 3.059   -7.792  1.00 25.54 ? 34   LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 34 ? -11.844 4.104   -7.610  1.00 10.88 ? 34   LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 34 ? -9.390  3.753   -8.064  1.00 15.01 ? 34   LEU A CD2 1 
ATOM   256  N N   . CYS A 1 35 ? -10.238 -1.036  -5.222  1.00 15.54 ? 35   CYS A N   1 
ATOM   257  C CA  . CYS A 1 35 ? -10.150 -1.703  -3.922  1.00 16.75 ? 35   CYS A CA  1 
ATOM   258  C C   . CYS A 1 35 ? -8.821  -2.431  -3.768  1.00 15.42 ? 35   CYS A C   1 
ATOM   259  O O   . CYS A 1 35 ? -8.100  -2.633  -4.737  1.00 18.74 ? 35   CYS A O   1 
ATOM   260  C CB  . CYS A 1 35 ? -11.332 -2.652  -3.687  1.00 10.17 ? 35   CYS A CB  1 
ATOM   261  S SG  . CYS A 1 35 ? -12.962 -1.862  -3.849  1.00 17.79 ? 35   CYS A SG  1 
ATOM   262  N N   . SER A 1 36 ? -8.500  -2.805  -2.536  1.00 18.43 ? 36   SER A N   1 
ATOM   263  C CA  . SER A 1 36 ? -7.201  -3.380  -2.212  1.00 18.41 ? 36   SER A CA  1 
ATOM   264  C C   . SER A 1 36 ? -7.071  -4.775  -2.774  1.00 21.07 ? 36   SER A C   1 
ATOM   265  O O   . SER A 1 36 ? -5.960  -5.261  -2.997  1.00 25.08 ? 36   SER A O   1 
ATOM   266  C CB  . SER A 1 36 ? -6.975  -3.403  -0.698  1.00 16.59 ? 36   SER A CB  1 
ATOM   267  O OG  . SER A 1 36 ? -7.967  -4.176  -0.049  1.00 19.36 ? 36   SER A OG  1 
ATOM   268  N N   . GLN A 1 37 ? -8.203  -5.431  -3.001  1.00 19.82 ? 37   GLN A N   1 
ATOM   269  C CA  . GLN A 1 37 ? -8.168  -6.760  -3.594  1.00 20.80 ? 37   GLN A CA  1 
ATOM   270  C C   . GLN A 1 37 ? -9.392  -6.980  -4.465  1.00 25.39 ? 37   GLN A C   1 
ATOM   271  O O   . GLN A 1 37 ? -10.382 -6.249  -4.355  1.00 23.48 ? 37   GLN A O   1 
ATOM   272  C CB  . GLN A 1 37 ? -8.055  -7.841  -2.513  1.00 14.65 ? 37   GLN A CB  1 
ATOM   273  C CG  . GLN A 1 37 ? -9.236  -7.911  -1.587  1.00 21.00 ? 37   GLN A CG  1 
ATOM   274  C CD  . GLN A 1 37 ? -9.163  -9.073  -0.605  1.00 33.05 ? 37   GLN A CD  1 
ATOM   275  O OE1 . GLN A 1 37 ? -10.048 -9.237  0.243   1.00 31.70 ? 37   GLN A OE1 1 
ATOM   276  N NE2 . GLN A 1 37 ? -8.113  -9.888  -0.715  1.00 27.01 ? 37   GLN A NE2 1 
ATOM   277  N N   . PRO A 1 38 ? -9.328  -7.983  -5.350  1.00 27.54 ? 38   PRO A N   1 
ATOM   278  C CA  . PRO A 1 38 ? -10.488 -8.277  -6.196  1.00 22.70 ? 38   PRO A CA  1 
ATOM   279  C C   . PRO A 1 38 ? -11.533 -9.024  -5.399  1.00 17.58 ? 38   PRO A C   1 
ATOM   280  O O   . PRO A 1 38 ? -11.224 -9.619  -4.377  1.00 19.24 ? 38   PRO A O   1 
ATOM   281  C CB  . PRO A 1 38 ? -9.911  -9.181  -7.289  1.00 14.77 ? 38   PRO A CB  1 
ATOM   282  C CG  . PRO A 1 38 ? -8.415  -9.051  -7.170  1.00 25.78 ? 38   PRO A CG  1 
ATOM   283  C CD  . PRO A 1 38 ? -8.159  -8.792  -5.722  1.00 18.13 ? 38   PRO A CD  1 
ATOM   284  N N   . ALA A 1 39 ? -12.768 -8.992  -5.866  1.00 19.38 ? 39   ALA A N   1 
ATOM   285  C CA  . ALA A 1 39 ? -13.843 -9.640  -5.152  1.00 16.81 ? 39   ALA A CA  1 
ATOM   286  C C   . ALA A 1 39 ? -15.076 -9.736  -6.024  1.00 14.94 ? 39   ALA A C   1 
ATOM   287  O O   . ALA A 1 39 ? -15.288 -8.911  -6.904  1.00 21.04 ? 39   ALA A O   1 
ATOM   288  C CB  . ALA A 1 39 ? -14.158 -8.879  -3.866  1.00 17.84 ? 39   ALA A CB  1 
ATOM   289  N N   . VAL A 1 40 ? -15.883 -10.759 -5.764  1.00 20.38 ? 40   VAL A N   1 
ATOM   290  C CA  . VAL A 1 40 ? -17.198 -10.907 -6.361  1.00 13.97 ? 40   VAL A CA  1 
ATOM   291  C C   . VAL A 1 40 ? -18.196 -10.754 -5.236  1.00 20.81 ? 40   VAL A C   1 
ATOM   292  O O   . VAL A 1 40 ? -18.059 -11.410 -4.199  1.00 24.43 ? 40   VAL A O   1 
ATOM   293  C CB  . VAL A 1 40 ? -17.380 -12.310 -6.974  1.00 13.21 ? 40   VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 40 ? -18.858 -12.605 -7.231  1.00 12.18 ? 40   VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 40 ? -16.549 -12.469 -8.247  1.00 12.14 ? 40   VAL A CG2 1 
ATOM   296  N N   . VAL A 1 41 ? -19.199 -9.899  -5.424  1.00 19.28 ? 41   VAL A N   1 
ATOM   297  C CA  . VAL A 1 41 ? -20.247 -9.738  -4.418  1.00 18.04 ? 41   VAL A CA  1 
ATOM   298  C C   . VAL A 1 41 ? -21.564 -10.299 -4.938  1.00 17.10 ? 41   VAL A C   1 
ATOM   299  O O   . VAL A 1 41 ? -22.135 -9.767  -5.889  1.00 19.96 ? 41   VAL A O   1 
ATOM   300  C CB  . VAL A 1 41 ? -20.468 -8.253  -4.038  1.00 19.56 ? 41   VAL A CB  1 
ATOM   301  C CG1 . VAL A 1 41 ? -21.468 -8.139  -2.909  1.00 13.17 ? 41   VAL A CG1 1 
ATOM   302  C CG2 . VAL A 1 41 ? -19.161 -7.586  -3.675  1.00 16.93 ? 41   VAL A CG2 1 
ATOM   303  N N   . PHE A 1 42 ? -22.049 -11.366 -4.311  1.00 18.14 ? 42   PHE A N   1 
ATOM   304  C CA  . PHE A 1 42 ? -23.320 -11.967 -4.707  1.00 17.13 ? 42   PHE A CA  1 
ATOM   305  C C   . PHE A 1 42 ? -24.480 -11.359 -3.940  1.00 18.65 ? 42   PHE A C   1 
ATOM   306  O O   . PHE A 1 42 ? -24.356 -10.997 -2.773  1.00 20.36 ? 42   PHE A O   1 
ATOM   307  C CB  . PHE A 1 42 ? -23.328 -13.478 -4.468  1.00 14.47 ? 42   PHE A CB  1 
ATOM   308  C CG  . PHE A 1 42 ? -22.411 -14.244 -5.359  1.00 16.53 ? 42   PHE A CG  1 
ATOM   309  C CD1 . PHE A 1 42 ? -22.730 -14.454 -6.693  1.00 19.19 ? 42   PHE A CD1 1 
ATOM   310  C CD2 . PHE A 1 42 ? -21.236 -14.783 -4.863  1.00 19.14 ? 42   PHE A CD2 1 
ATOM   311  C CE1 . PHE A 1 42 ? -21.882 -15.176 -7.525  1.00 19.79 ? 42   PHE A CE1 1 
ATOM   312  C CE2 . PHE A 1 42 ? -20.385 -15.513 -5.688  1.00 21.63 ? 42   PHE A CE2 1 
ATOM   313  C CZ  . PHE A 1 42 ? -20.705 -15.706 -7.019  1.00 18.70 ? 42   PHE A CZ  1 
ATOM   314  N N   . GLN A 1 43 ? -25.617 -11.278 -4.612  1.00 25.94 ? 43   GLN A N   1 
ATOM   315  C CA  . GLN A 1 43 ? -26.837 -10.752 -4.039  1.00 19.18 ? 43   GLN A CA  1 
ATOM   316  C C   . GLN A 1 43 ? -27.843 -11.896 -3.907  1.00 28.52 ? 43   GLN A C   1 
ATOM   317  O O   . GLN A 1 43 ? -28.141 -12.601 -4.872  1.00 28.53 ? 43   GLN A O   1 
ATOM   318  C CB  . GLN A 1 43 ? -27.345 -9.642  -4.938  1.00 21.62 ? 43   GLN A CB  1 
ATOM   319  C CG  . GLN A 1 43 ? -26.222 -8.639  -5.272  1.00 35.70 ? 43   GLN A CG  1 
ATOM   320  C CD  . GLN A 1 43 ? -26.620 -7.582  -6.307  1.00 55.06 ? 43   GLN A CD  1 
ATOM   321  O OE1 . GLN A 1 43 ? -25.761 -7.008  -6.984  1.00 45.74 ? 43   GLN A OE1 1 
ATOM   322  N NE2 . GLN A 1 43 ? -27.925 -7.325  -6.435  1.00 57.32 ? 43   GLN A NE2 1 
ATOM   323  N N   . THR A 1 44 ? -28.340 -12.104 -2.696  1.00 33.73 ? 44   THR A N   1 
ATOM   324  C CA  . THR A 1 44 ? -29.183 -13.255 -2.421  1.00 27.16 ? 44   THR A CA  1 
ATOM   325  C C   . THR A 1 44 ? -30.663 -12.965 -2.672  1.00 28.64 ? 44   THR A C   1 
ATOM   326  O O   . THR A 1 44 ? -31.074 -11.821 -2.877  1.00 24.60 ? 44   THR A O   1 
ATOM   327  C CB  . THR A 1 44 ? -28.968 -13.826 -0.975  1.00 28.29 ? 44   THR A CB  1 
ATOM   328  O OG1 . THR A 1 44 ? -29.488 -12.924 0.014   1.00 31.18 ? 44   THR A OG1 1 
ATOM   329  C CG2 . THR A 1 44 ? -27.502 -14.072 -0.702  1.00 16.18 ? 44   THR A CG2 1 
ATOM   330  N N   . LYS A 1 45 ? -31.452 -14.028 -2.671  1.00 31.22 ? 45   LYS A N   1 
ATOM   331  C CA  . LYS A 1 45 ? -32.885 -13.921 -2.843  1.00 34.28 ? 45   LYS A CA  1 
ATOM   332  C C   . LYS A 1 45 ? -33.440 -12.998 -1.774  1.00 38.19 ? 45   LYS A C   1 
ATOM   333  O O   . LYS A 1 45 ? -34.284 -12.148 -2.051  1.00 42.46 ? 45   LYS A O   1 
ATOM   334  C CB  . LYS A 1 45 ? -33.518 -15.304 -2.722  1.00 37.62 ? 45   LYS A CB  1 
ATOM   335  C CG  . LYS A 1 45 ? -35.011 -15.336 -2.979  1.00 48.64 ? 45   LYS A CG  1 
ATOM   336  C CD  . LYS A 1 45 ? -35.338 -15.991 -4.320  1.00 52.27 ? 45   LYS A CD  1 
ATOM   337  C CE  . LYS A 1 45 ? -36.843 -16.162 -4.480  1.00 46.51 ? 45   LYS A CE  1 
ATOM   338  N NZ  . LYS A 1 45 ? -37.572 -15.535 -3.327  1.00 53.33 ? 45   LYS A NZ  1 
ATOM   339  N N   . ARG A 1 46 ? -32.954 -13.156 -0.546  1.00 39.97 ? 46   ARG A N   1 
ATOM   340  C CA  . ARG A 1 46 ? -33.390 -12.284 0.543   1.00 48.23 ? 46   ARG A CA  1 
ATOM   341  C C   . ARG A 1 46 ? -32.718 -10.905 0.472   1.00 38.33 ? 46   ARG A C   1 
ATOM   342  O O   . ARG A 1 46 ? -32.880 -10.070 1.359   1.00 36.06 ? 46   ARG A O   1 
ATOM   343  C CB  . ARG A 1 46 ? -33.165 -12.949 1.902   1.00 43.52 ? 46   ARG A CB  1 
ATOM   344  C CG  . ARG A 1 46 ? -34.299 -12.721 2.883   1.00 43.55 ? 46   ARG A CG  1 
ATOM   345  C CD  . ARG A 1 46 ? -34.296 -13.781 3.985   1.00 58.80 ? 46   ARG A CD  1 
ATOM   346  N NE  . ARG A 1 46 ? -35.028 -13.354 5.183   1.00 66.22 ? 46   ARG A NE  1 
ATOM   347  C CZ  . ARG A 1 46 ? -36.329 -13.554 5.395   1.00 57.92 ? 46   ARG A CZ  1 
ATOM   348  N NH1 . ARG A 1 46 ? -37.075 -14.185 4.492   1.00 47.24 ? 46   ARG A NH1 1 
ATOM   349  N NH2 . ARG A 1 46 ? -36.889 -13.123 6.521   1.00 52.37 ? 46   ARG A NH2 1 
ATOM   350  N N   . SER A 1 47 ? -31.952 -10.684 -0.588  1.00 38.98 ? 47   SER A N   1 
ATOM   351  C CA  . SER A 1 47 ? -31.427 -9.362  -0.892  1.00 38.00 ? 47   SER A CA  1 
ATOM   352  C C   . SER A 1 47 ? -30.184 -9.012  -0.084  1.00 33.63 ? 47   SER A C   1 
ATOM   353  O O   . SER A 1 47 ? -29.840 -7.842  0.063   1.00 27.41 ? 47   SER A O   1 
ATOM   354  C CB  . SER A 1 47 ? -32.510 -8.310  -0.687  1.00 33.10 ? 47   SER A CB  1 
ATOM   355  O OG  . SER A 1 47 ? -32.307 -7.219  -1.562  1.00 49.58 ? 47   SER A OG  1 
ATOM   356  N N   . LYS A 1 48 ? -29.503 -10.031 0.424   1.00 35.68 ? 48   LYS A N   1 
ATOM   357  C CA  . LYS A 1 48 ? -28.280 -9.819  1.184   1.00 29.27 ? 48   LYS A CA  1 
ATOM   358  C C   . LYS A 1 48 ? -27.099 -9.724  0.214   1.00 33.81 ? 48   LYS A C   1 
ATOM   359  O O   . LYS A 1 48 ? -27.222 -10.068 -0.965  1.00 26.13 ? 48   LYS A O   1 
ATOM   360  C CB  . LYS A 1 48 ? -28.077 -10.962 2.180   1.00 34.25 ? 48   LYS A CB  1 
ATOM   361  C CG  . LYS A 1 48 ? -29.268 -11.205 3.125   1.00 44.05 ? 48   LYS A CG  1 
ATOM   362  C CD  . LYS A 1 48 ? -29.323 -12.666 3.606   1.00 42.44 ? 48   LYS A CD  1 
ATOM   363  C CE  . LYS A 1 48 ? -29.666 -12.774 5.110   1.00 57.07 ? 48   LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 48 ? -31.098 -13.117 5.421   1.00 44.24 ? 48   LYS A NZ  1 
ATOM   365  N N   . GLN A 1 49 ? -25.959 -9.258  0.710   1.00 27.23 ? 49   GLN A N   1 
ATOM   366  C CA  . GLN A 1 49 ? -24.772 -9.094  -0.118  1.00 20.10 ? 49   GLN A CA  1 
ATOM   367  C C   . GLN A 1 49 ? -23.574 -9.802  0.478   1.00 17.03 ? 49   GLN A C   1 
ATOM   368  O O   . GLN A 1 49 ? -23.193 -9.536  1.612   1.00 29.01 ? 49   GLN A O   1 
ATOM   369  C CB  . GLN A 1 49 ? -24.482 -7.619  -0.261  1.00 23.05 ? 49   GLN A CB  1 
ATOM   370  C CG  . GLN A 1 49 ? -25.708 -6.845  -0.631  1.00 23.62 ? 49   GLN A CG  1 
ATOM   371  C CD  . GLN A 1 49 ? -25.531 -6.118  -1.924  1.00 31.77 ? 49   GLN A CD  1 
ATOM   372  O OE1 . GLN A 1 49 ? -26.147 -6.473  -2.928  1.00 42.31 ? 49   GLN A OE1 1 
ATOM   373  N NE2 . GLN A 1 49 ? -24.654 -5.105  -1.929  1.00 37.21 ? 49   GLN A NE2 1 
ATOM   374  N N   . VAL A 1 50 ? -22.983 -10.711 -0.283  1.00 19.81 ? 50   VAL A N   1 
ATOM   375  C CA  . VAL A 1 50 ? -21.944 -11.598 0.249   1.00 19.17 ? 50   VAL A CA  1 
ATOM   376  C C   . VAL A 1 50 ? -20.654 -11.463 -0.547  1.00 17.45 ? 50   VAL A C   1 
ATOM   377  O O   . VAL A 1 50 ? -20.622 -11.750 -1.747  1.00 19.64 ? 50   VAL A O   1 
ATOM   378  C CB  . VAL A 1 50 ? -22.392 -13.099 0.206   1.00 20.30 ? 50   VAL A CB  1 
ATOM   379  C CG1 . VAL A 1 50 ? -21.428 -13.995 0.973   1.00 16.94 ? 50   VAL A CG1 1 
ATOM   380  C CG2 . VAL A 1 50 ? -23.777 -13.263 0.779   1.00 19.58 ? 50   VAL A CG2 1 
ATOM   381  N N   . CYS A 1 51 ? -19.585 -11.039 0.113   1.00 18.22 ? 51   CYS A N   1 
ATOM   382  C CA  . CYS A 1 51 ? -18.274 -11.003 -0.534  1.00 18.14 ? 51   CYS A CA  1 
ATOM   383  C C   . CYS A 1 51 ? -17.786 -12.411 -0.775  1.00 16.71 ? 51   CYS A C   1 
ATOM   384  O O   . CYS A 1 51 ? -17.768 -13.214 0.156   1.00 19.36 ? 51   CYS A O   1 
ATOM   385  C CB  . CYS A 1 51 ? -17.268 -10.274 0.355   1.00 12.71 ? 51   CYS A CB  1 
ATOM   386  S SG  . CYS A 1 51 ? -17.610 -8.529  0.502   1.00 18.49 ? 51   CYS A SG  1 
ATOM   387  N N   . ALA A 1 52 ? -17.387 -12.720 -2.008  1.00 18.32 ? 52   ALA A N   1 
ATOM   388  C CA  . ALA A 1 52 ? -16.788 -14.039 -2.309  1.00 22.26 ? 52   ALA A CA  1 
ATOM   389  C C   . ALA A 1 52 ? -15.421 -13.959 -2.988  1.00 16.11 ? 52   ALA A C   1 
ATOM   390  O O   . ALA A 1 52 ? -15.148 -13.025 -3.738  1.00 14.99 ? 52   ALA A O   1 
ATOM   391  C CB  . ALA A 1 52 ? -17.746 -14.922 -3.127  1.00 18.64 ? 52   ALA A CB  1 
ATOM   392  N N   . ASP A 1 53 ? -14.578 -14.953 -2.706  1.00 17.65 ? 53   ASP A N   1 
ATOM   393  C CA  . ASP A 1 53 ? -13.229 -15.057 -3.263  1.00 19.35 ? 53   ASP A CA  1 
ATOM   394  C C   . ASP A 1 53 ? -13.308 -15.415 -4.758  1.00 26.25 ? 53   ASP A C   1 
ATOM   395  O O   . ASP A 1 53 ? -13.872 -16.447 -5.128  1.00 22.61 ? 53   ASP A O   1 
ATOM   396  C CB  . ASP A 1 53 ? -12.457 -16.132 -2.498  1.00 20.46 ? 53   ASP A CB  1 
ATOM   397  C CG  . ASP A 1 53 ? -10.976 -16.166 -2.844  1.00 24.26 ? 53   ASP A CG  1 
ATOM   398  O OD1 . ASP A 1 53 ? -10.588 -15.640 -3.898  1.00 26.98 ? 53   ASP A OD1 1 
ATOM   399  O OD2 . ASP A 1 53 ? -10.193 -16.726 -2.053  1.00 26.76 ? 53   ASP A OD2 1 
ATOM   400  N N   . PRO A 1 54 ? -12.765 -14.552 -5.630  1.00 19.48 ? 54   PRO A N   1 
ATOM   401  C CA  . PRO A 1 54 ? -12.909 -14.779 -7.071  1.00 27.63 ? 54   PRO A CA  1 
ATOM   402  C C   . PRO A 1 54 ? -12.119 -15.994 -7.542  1.00 33.11 ? 54   PRO A C   1 
ATOM   403  O O   . PRO A 1 54 ? -12.352 -16.497 -8.644  1.00 36.86 ? 54   PRO A O   1 
ATOM   404  C CB  . PRO A 1 54 ? -12.305 -13.515 -7.696  1.00 19.83 ? 54   PRO A CB  1 
ATOM   405  C CG  . PRO A 1 54 ? -12.246 -12.526 -6.606  1.00 21.72 ? 54   PRO A CG  1 
ATOM   406  C CD  . PRO A 1 54 ? -12.058 -13.299 -5.343  1.00 22.52 ? 54   PRO A CD  1 
ATOM   407  N N   . SER A 1 55 ? -11.188 -16.462 -6.722  1.00 25.63 ? 55   SER A N   1 
ATOM   408  C CA  . SER A 1 55 ? -10.361 -17.592 -7.121  1.00 21.64 ? 55   SER A CA  1 
ATOM   409  C C   . SER A 1 55 ? -11.011 -18.948 -6.844  1.00 30.59 ? 55   SER A C   1 
ATOM   410  O O   . SER A 1 55 ? -10.424 -19.988 -7.153  1.00 32.16 ? 55   SER A O   1 
ATOM   411  C CB  . SER A 1 55 ? -9.006  -17.517 -6.444  1.00 19.84 ? 55   SER A CB  1 
ATOM   412  O OG  . SER A 1 55 ? -8.308  -16.362 -6.848  1.00 30.38 ? 55   SER A OG  1 
ATOM   413  N N   . GLU A 1 56 ? -12.212 -18.958 -6.272  1.00 23.13 ? 56   GLU A N   1 
ATOM   414  C CA  . GLU A 1 56 ? -12.862 -20.233 -5.984  1.00 22.89 ? 56   GLU A CA  1 
ATOM   415  C C   . GLU A 1 56 ? -13.656 -20.714 -7.174  1.00 29.42 ? 56   GLU A C   1 
ATOM   416  O O   . GLU A 1 56 ? -14.208 -19.916 -7.939  1.00 26.78 ? 56   GLU A O   1 
ATOM   417  C CB  . GLU A 1 56 ? -13.789 -20.132 -4.781  1.00 19.97 ? 56   GLU A CB  1 
ATOM   418  C CG  . GLU A 1 56 ? -13.118 -19.636 -3.529  1.00 26.10 ? 56   GLU A CG  1 
ATOM   419  C CD  . GLU A 1 56 ? -13.754 -20.210 -2.299  1.00 31.89 ? 56   GLU A CD  1 
ATOM   420  O OE1 . GLU A 1 56 ? -14.123 -21.402 -2.341  1.00 43.93 ? 56   GLU A OE1 1 
ATOM   421  O OE2 . GLU A 1 56 ? -13.881 -19.484 -1.295  1.00 30.64 ? 56   GLU A OE2 1 
ATOM   422  N N   . SER A 1 57 ? -13.737 -22.030 -7.304  1.00 24.47 ? 57   SER A N   1 
ATOM   423  C CA  . SER A 1 57 ? -14.457 -22.643 -8.409  1.00 27.92 ? 57   SER A CA  1 
ATOM   424  C C   . SER A 1 57 ? -15.941 -22.283 -8.433  1.00 23.55 ? 57   SER A C   1 
ATOM   425  O O   . SER A 1 57 ? -16.483 -21.897 -9.477  1.00 22.45 ? 57   SER A O   1 
ATOM   426  C CB  . SER A 1 57 ? -14.290 -24.161 -8.374  1.00 25.93 ? 57   SER A CB  1 
ATOM   427  O OG  . SER A 1 57 ? -15.426 -24.791 -8.935  1.00 36.21 ? 57   SER A OG  1 
ATOM   428  N N   . TRP A 1 58 ? -16.611 -22.414 -7.297  1.00 18.82 ? 58   TRP A N   1 
ATOM   429  C CA  . TRP A 1 58 ? -18.044 -22.179 -7.290  1.00 20.82 ? 58   TRP A CA  1 
ATOM   430  C C   . TRP A 1 58 ? -18.331 -20.722 -7.630  1.00 24.15 ? 58   TRP A C   1 
ATOM   431  O O   . TRP A 1 58 ? -19.300 -20.409 -8.320  1.00 22.92 ? 58   TRP A O   1 
ATOM   432  C CB  . TRP A 1 58 ? -18.670 -22.596 -5.963  1.00 20.28 ? 58   TRP A CB  1 
ATOM   433  C CG  . TRP A 1 58 ? -18.362 -21.703 -4.808  1.00 23.88 ? 58   TRP A CG  1 
ATOM   434  C CD1 . TRP A 1 58 ? -17.316 -21.809 -3.952  1.00 23.18 ? 58   TRP A CD1 1 
ATOM   435  C CD2 . TRP A 1 58 ? -19.122 -20.572 -4.368  1.00 24.68 ? 58   TRP A CD2 1 
ATOM   436  N NE1 . TRP A 1 58 ? -17.364 -20.809 -3.011  1.00 25.42 ? 58   TRP A NE1 1 
ATOM   437  C CE2 . TRP A 1 58 ? -18.475 -20.031 -3.249  1.00 21.13 ? 58   TRP A CE2 1 
ATOM   438  C CE3 . TRP A 1 58 ? -20.296 -19.954 -4.824  1.00 22.27 ? 58   TRP A CE3 1 
ATOM   439  C CZ2 . TRP A 1 58 ? -18.944 -18.927 -2.566  1.00 23.26 ? 58   TRP A CZ2 1 
ATOM   440  C CZ3 . TRP A 1 58 ? -20.765 -18.855 -4.153  1.00 24.01 ? 58   TRP A CZ3 1 
ATOM   441  C CH2 . TRP A 1 58 ? -20.092 -18.349 -3.033  1.00 28.67 ? 58   TRP A CH2 1 
ATOM   442  N N   . VAL A 1 59 ? -17.449 -19.839 -7.178  1.00 23.98 ? 59   VAL A N   1 
ATOM   443  C CA  . VAL A 1 59 ? -17.626 -18.414 -7.383  1.00 19.70 ? 59   VAL A CA  1 
ATOM   444  C C   . VAL A 1 59 ? -17.608 -18.062 -8.847  1.00 19.64 ? 59   VAL A C   1 
ATOM   445  O O   . VAL A 1 59 ? -18.468 -17.318 -9.303  1.00 27.63 ? 59   VAL A O   1 
ATOM   446  C CB  . VAL A 1 59 ? -16.570 -17.585 -6.642  1.00 24.96 ? 59   VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 59 ? -16.843 -16.113 -6.839  1.00 18.42 ? 59   VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 59 ? -16.591 -17.913 -5.164  1.00 18.13 ? 59   VAL A CG2 1 
ATOM   449  N N   . GLN A 1 60 ? -16.645 -18.600 -9.594  1.00 28.61 ? 60   GLN A N   1 
ATOM   450  C CA  . GLN A 1 60 ? -16.595 -18.402 -11.053 1.00 19.83 ? 60   GLN A CA  1 
ATOM   451  C C   . GLN A 1 60 ? -17.629 -19.237 -11.806 1.00 20.36 ? 60   GLN A C   1 
ATOM   452  O O   . GLN A 1 60 ? -17.993 -18.928 -12.926 1.00 22.32 ? 60   GLN A O   1 
ATOM   453  C CB  . GLN A 1 60 ? -15.215 -18.715 -11.600 1.00 16.93 ? 60   GLN A CB  1 
ATOM   454  C CG  . GLN A 1 60 ? -14.127 -17.784 -11.118 1.00 22.56 ? 60   GLN A CG  1 
ATOM   455  C CD  . GLN A 1 60 ? -14.504 -16.325 -11.274 1.00 28.13 ? 60   GLN A CD  1 
ATOM   456  O OE1 . GLN A 1 60 ? -15.070 -15.922 -12.287 1.00 28.65 ? 60   GLN A OE1 1 
ATOM   457  N NE2 . GLN A 1 60 ? -14.184 -15.524 -10.267 1.00 28.45 ? 60   GLN A NE2 1 
ATOM   458  N N   . GLU A 1 61 ? -18.104 -20.312 -11.206 1.00 24.36 ? 61   GLU A N   1 
ATOM   459  C CA  . GLU A 1 61 ? -19.169 -21.038 -11.861 1.00 22.68 ? 61   GLU A CA  1 
ATOM   460  C C   . GLU A 1 61 ? -20.405 -20.154 -11.830 1.00 27.59 ? 61   GLU A C   1 
ATOM   461  O O   . GLU A 1 61 ? -20.985 -19.866 -12.870 1.00 32.91 ? 61   GLU A O   1 
ATOM   462  C CB  . GLU A 1 61 ? -19.429 -22.364 -11.169 1.00 18.23 ? 61   GLU A CB  1 
ATOM   463  C CG  . GLU A 1 61 ? -20.534 -23.141 -11.810 1.00 23.52 ? 61   GLU A CG  1 
ATOM   464  C CD  . GLU A 1 61 ? -21.049 -24.284 -10.941 1.00 44.60 ? 61   GLU A CD  1 
ATOM   465  O OE1 . GLU A 1 61 ? -20.433 -24.593 -9.890  1.00 35.95 ? 61   GLU A OE1 1 
ATOM   466  O OE2 . GLU A 1 61 ? -22.084 -24.875 -11.319 1.00 56.19 ? 61   GLU A OE2 1 
ATOM   467  N N   . TYR A 1 62 ? -20.777 -19.687 -10.637 1.00 23.84 ? 62   TYR A N   1 
ATOM   468  C CA  . TYR A 1 62 ? -21.983 -18.886 -10.467 1.00 19.57 ? 62   TYR A CA  1 
ATOM   469  C C   . TYR A 1 62 ? -21.958 -17.662 -11.340 1.00 21.65 ? 62   TYR A C   1 
ATOM   470  O O   . TYR A 1 62 ? -22.963 -17.325 -11.966 1.00 21.78 ? 62   TYR A O   1 
ATOM   471  C CB  . TYR A 1 62 ? -22.169 -18.455 -9.015  1.00 22.73 ? 62   TYR A CB  1 
ATOM   472  C CG  . TYR A 1 62 ? -22.603 -19.562 -8.073  1.00 22.83 ? 62   TYR A CG  1 
ATOM   473  C CD1 . TYR A 1 62 ? -23.269 -19.266 -6.896  1.00 18.10 ? 62   TYR A CD1 1 
ATOM   474  C CD2 . TYR A 1 62 ? -22.325 -20.899 -8.351  1.00 22.99 ? 62   TYR A CD2 1 
ATOM   475  C CE1 . TYR A 1 62 ? -23.655 -20.256 -6.024  1.00 25.32 ? 62   TYR A CE1 1 
ATOM   476  C CE2 . TYR A 1 62 ? -22.710 -21.904 -7.475  1.00 24.31 ? 62   TYR A CE2 1 
ATOM   477  C CZ  . TYR A 1 62 ? -23.377 -21.572 -6.314  1.00 24.72 ? 62   TYR A CZ  1 
ATOM   478  O OH  . TYR A 1 62 ? -23.775 -22.541 -5.429  1.00 24.19 ? 62   TYR A OH  1 
ATOM   479  N N   . VAL A 1 63 ? -20.810 -16.993 -11.377 1.00 20.60 ? 63   VAL A N   1 
ATOM   480  C CA  . VAL A 1 63 ? -20.655 -15.788 -12.180 1.00 15.38 ? 63   VAL A CA  1 
ATOM   481  C C   . VAL A 1 63 ? -20.925 -16.070 -13.650 1.00 21.59 ? 63   VAL A C   1 
ATOM   482  O O   . VAL A 1 63 ? -21.634 -15.315 -14.310 1.00 24.77 ? 63   VAL A O   1 
ATOM   483  C CB  . VAL A 1 63 ? -19.256 -15.162 -12.002 1.00 22.32 ? 63   VAL A CB  1 
ATOM   484  C CG1 . VAL A 1 63 ? -18.967 -14.121 -13.096 1.00 17.49 ? 63   VAL A CG1 1 
ATOM   485  C CG2 . VAL A 1 63 ? -19.150 -14.523 -10.628 1.00 22.67 ? 63   VAL A CG2 1 
ATOM   486  N N   . TYR A 1 64 ? -20.369 -17.153 -14.176 1.00 22.54 ? 64   TYR A N   1 
ATOM   487  C CA  . TYR A 1 64 ? -20.659 -17.498 -15.560 1.00 29.08 ? 64   TYR A CA  1 
ATOM   488  C C   . TYR A 1 64 ? -22.132 -17.733 -15.747 1.00 24.91 ? 64   TYR A C   1 
ATOM   489  O O   . TYR A 1 64 ? -22.747 -17.158 -16.630 1.00 26.21 ? 64   TYR A O   1 
ATOM   490  C CB  . TYR A 1 64 ? -19.894 -18.738 -15.998 1.00 28.55 ? 64   TYR A CB  1 
ATOM   491  C CG  . TYR A 1 64 ? -18.498 -18.422 -16.455 1.00 39.56 ? 64   TYR A CG  1 
ATOM   492  C CD1 . TYR A 1 64 ? -17.482 -18.172 -15.523 1.00 31.91 ? 64   TYR A CD1 1 
ATOM   493  C CD2 . TYR A 1 64 ? -18.193 -18.337 -17.813 1.00 36.91 ? 64   TYR A CD2 1 
ATOM   494  C CE1 . TYR A 1 64 ? -16.196 -17.879 -15.926 1.00 35.30 ? 64   TYR A CE1 1 
ATOM   495  C CE2 . TYR A 1 64 ? -16.899 -18.035 -18.233 1.00 45.54 ? 64   TYR A CE2 1 
ATOM   496  C CZ  . TYR A 1 64 ? -15.902 -17.813 -17.282 1.00 40.75 ? 64   TYR A CZ  1 
ATOM   497  O OH  . TYR A 1 64 ? -14.619 -17.515 -17.689 1.00 38.32 ? 64   TYR A OH  1 
ATOM   498  N N   . ASP A 1 65 ? -22.696 -18.578 -14.899 1.00 17.57 ? 65   ASP A N   1 
ATOM   499  C CA  . ASP A 1 65 ? -24.078 -18.952 -15.065 1.00 25.87 ? 65   ASP A CA  1 
ATOM   500  C C   . ASP A 1 65 ? -24.968 -17.694 -15.032 1.00 36.07 ? 65   ASP A C   1 
ATOM   501  O O   . ASP A 1 65 ? -25.863 -17.519 -15.868 1.00 36.48 ? 65   ASP A O   1 
ATOM   502  C CB  . ASP A 1 65 ? -24.467 -19.972 -14.003 1.00 20.81 ? 65   ASP A CB  1 
ATOM   503  C CG  . ASP A 1 65 ? -25.838 -20.557 -14.233 1.00 32.34 ? 65   ASP A CG  1 
ATOM   504  O OD1 . ASP A 1 65 ? -26.044 -21.214 -15.266 1.00 33.33 ? 65   ASP A OD1 1 
ATOM   505  O OD2 . ASP A 1 65 ? -26.712 -20.369 -13.367 1.00 39.22 ? 65   ASP A OD2 1 
ATOM   506  N N   . LEU A 1 66 ? -24.686 -16.803 -14.087 1.00 28.09 ? 66   LEU A N   1 
ATOM   507  C CA  . LEU A 1 66 ? -25.440 -15.568 -13.944 1.00 20.71 ? 66   LEU A CA  1 
ATOM   508  C C   . LEU A 1 66 ? -25.259 -14.696 -15.161 1.00 34.84 ? 66   LEU A C   1 
ATOM   509  O O   . LEU A 1 66 ? -26.198 -14.047 -15.617 1.00 36.33 ? 66   LEU A O   1 
ATOM   510  C CB  . LEU A 1 66 ? -24.982 -14.808 -12.704 1.00 17.93 ? 66   LEU A CB  1 
ATOM   511  C CG  . LEU A 1 66 ? -25.552 -15.393 -11.414 1.00 23.22 ? 66   LEU A CG  1 
ATOM   512  C CD1 . LEU A 1 66 ? -24.870 -14.817 -10.190 1.00 17.30 ? 66   LEU A CD1 1 
ATOM   513  C CD2 . LEU A 1 66 ? -27.032 -15.151 -11.373 1.00 20.92 ? 66   LEU A CD2 1 
ATOM   514  N N   . GLU A 1 67 ? -24.043 -14.670 -15.691 1.00 27.78 ? 67   GLU A N   1 
ATOM   515  C CA  . GLU A 1 67 ? -23.752 -13.745 -16.768 1.00 27.70 ? 67   GLU A CA  1 
ATOM   516  C C   . GLU A 1 67 ? -24.296 -14.245 -18.104 1.00 38.35 ? 67   GLU A C   1 
ATOM   517  O O   . GLU A 1 67 ? -24.847 -13.466 -18.886 1.00 38.16 ? 67   GLU A O   1 
ATOM   518  C CB  . GLU A 1 67 ? -22.252 -13.446 -16.848 1.00 27.83 ? 67   GLU A CB  1 
ATOM   519  C CG  . GLU A 1 67 ? -21.895 -12.354 -17.841 1.00 28.46 ? 67   GLU A CG  1 
ATOM   520  C CD  . GLU A 1 67 ? -22.461 -10.977 -17.484 1.00 35.96 ? 67   GLU A CD  1 
ATOM   521  O OE1 . GLU A 1 67 ? -22.963 -10.291 -18.403 1.00 37.20 ? 67   GLU A OE1 1 
ATOM   522  O OE2 . GLU A 1 67 ? -22.394 -10.569 -16.298 1.00 39.66 ? 67   GLU A OE2 1 
ATOM   523  N N   . LEU A 1 68 ? -24.161 -15.544 -18.356 1.00 32.72 ? 68   LEU A N   1 
ATOM   524  C CA  . LEU A 1 68 ? -24.571 -16.106 -19.637 1.00 36.31 ? 68   LEU A CA  1 
ATOM   525  C C   . LEU A 1 68 ? -26.040 -16.538 -19.676 1.00 45.68 ? 68   LEU A C   1 
ATOM   526  O O   . LEU A 1 68 ? -26.773 -16.146 -20.580 1.00 57.12 ? 68   LEU A O   1 
ATOM   527  C CB  . LEU A 1 68 ? -23.655 -17.265 -20.051 1.00 36.74 ? 68   LEU A CB  1 
ATOM   528  C CG  . LEU A 1 68 ? -22.169 -16.919 -20.187 1.00 39.41 ? 68   LEU A CG  1 
ATOM   529  C CD1 . LEU A 1 68 ? -21.412 -18.008 -20.914 1.00 34.94 ? 68   LEU A CD1 1 
ATOM   530  C CD2 . LEU A 1 68 ? -21.987 -15.609 -20.905 1.00 39.20 ? 68   LEU A CD2 1 
ATOM   531  N N   . ASN A 1 69 ? -26.478 -17.328 -18.702 1.00 42.20 ? 69   ASN A N   1 
ATOM   532  C CA  . ASN A 1 69 ? -27.824 -17.912 -18.748 1.00 40.88 ? 69   ASN A CA  1 
ATOM   533  C C   . ASN A 1 69 ? -28.857 -17.191 -17.877 1.00 44.38 ? 69   ASN A C   1 
ATOM   534  O O   . ASN A 1 69 ? -29.323 -16.100 -18.216 1.00 46.25 ? 69   ASN A O   1 
ATOM   535  C CB  . ASN A 1 69 ? -27.757 -19.384 -18.367 1.00 30.57 ? 69   ASN A CB  1 
ATOM   536  C CG  . ASN A 1 69 ? -26.399 -19.980 -18.640 1.00 48.19 ? 69   ASN A CG  1 
ATOM   537  O OD1 . ASN A 1 69 ? -25.740 -19.624 -19.616 1.00 58.23 ? 69   ASN A OD1 1 
ATOM   538  N ND2 . ASN A 1 69 ? -25.961 -20.880 -17.773 1.00 51.08 ? 69   ASN A ND2 1 
ATOM   539  N N   . SER B 1 5  ? -29.625 17.227  -27.704 1.00 23.70 ? 5    SER B N   1 
ATOM   540  C CA  . SER B 1 5  ? -29.843 18.198  -26.623 1.00 25.97 ? 5    SER B CA  1 
ATOM   541  C C   . SER B 1 5  ? -28.519 18.585  -25.990 1.00 28.44 ? 5    SER B C   1 
ATOM   542  O O   . SER B 1 5  ? -27.557 18.859  -26.700 1.00 31.05 ? 5    SER B O   1 
ATOM   543  C CB  . SER B 1 5  ? -30.780 17.623  -25.561 1.00 24.82 ? 5    SER B CB  1 
ATOM   544  O OG  . SER B 1 5  ? -30.987 18.540  -24.497 1.00 35.16 ? 5    SER B OG  1 
ATOM   545  N N   . ASP B 1 6  ? -28.468 18.589  -24.656 1.00 33.29 ? 6    ASP B N   1 
ATOM   546  C CA  . ASP B 1 6  ? -27.211 18.766  -23.905 1.00 32.38 ? 6    ASP B CA  1 
ATOM   547  C C   . ASP B 1 6  ? -27.051 17.719  -22.790 1.00 30.79 ? 6    ASP B C   1 
ATOM   548  O O   . ASP B 1 6  ? -26.930 18.051  -21.616 1.00 30.11 ? 6    ASP B O   1 
ATOM   549  C CB  . ASP B 1 6  ? -27.107 20.196  -23.368 1.00 26.04 ? 6    ASP B CB  1 
ATOM   550  C CG  . ASP B 1 6  ? -27.293 21.234  -24.470 1.00 38.25 ? 6    ASP B CG  1 
ATOM   551  O OD1 . ASP B 1 6  ? -26.300 21.524  -25.174 1.00 37.72 ? 6    ASP B OD1 1 
ATOM   552  O OD2 . ASP B 1 6  ? -28.431 21.731  -24.659 1.00 33.57 ? 6    ASP B OD2 1 
ATOM   553  N N   . PRO B 1 7  ? -27.031 16.439  -23.176 1.00 28.34 ? 7    PRO B N   1 
ATOM   554  C CA  . PRO B 1 7  ? -26.974 15.324  -22.228 1.00 25.30 ? 7    PRO B CA  1 
ATOM   555  C C   . PRO B 1 7  ? -25.617 15.276  -21.551 1.00 24.86 ? 7    PRO B C   1 
ATOM   556  O O   . PRO B 1 7  ? -24.701 15.976  -21.974 1.00 30.13 ? 7    PRO B O   1 
ATOM   557  C CB  . PRO B 1 7  ? -27.131 14.080  -23.121 1.00 34.20 ? 7    PRO B CB  1 
ATOM   558  C CG  . PRO B 1 7  ? -27.260 14.577  -24.553 1.00 29.87 ? 7    PRO B CG  1 
ATOM   559  C CD  . PRO B 1 7  ? -26.777 16.002  -24.559 1.00 31.40 ? 7    PRO B CD  1 
ATOM   560  N N   . PRO B 1 8  ? -25.490 14.474  -20.488 1.00 25.38 ? 8    PRO B N   1 
ATOM   561  C CA  . PRO B 1 8  ? -24.165 14.281  -19.907 1.00 23.22 ? 8    PRO B CA  1 
ATOM   562  C C   . PRO B 1 8  ? -23.374 13.287  -20.745 1.00 23.25 ? 8    PRO B C   1 
ATOM   563  O O   . PRO B 1 8  ? -23.943 12.476  -21.478 1.00 20.68 ? 8    PRO B O   1 
ATOM   564  C CB  . PRO B 1 8  ? -24.470 13.702  -18.526 1.00 16.99 ? 8    PRO B CB  1 
ATOM   565  C CG  . PRO B 1 8  ? -25.786 13.048  -18.681 1.00 16.57 ? 8    PRO B CG  1 
ATOM   566  C CD  . PRO B 1 8  ? -26.549 13.848  -19.677 1.00 23.80 ? 8    PRO B CD  1 
ATOM   567  N N   . THR B 1 9  ? -22.060 13.363  -20.614 1.00 20.82 ? 9    THR B N   1 
ATOM   568  C CA  . THR B 1 9  ? -21.132 12.559  -21.383 1.00 22.37 ? 9    THR B CA  1 
ATOM   569  C C   . THR B 1 9  ? -20.513 11.493  -20.485 1.00 22.90 ? 9    THR B C   1 
ATOM   570  O O   . THR B 1 9  ? -20.232 11.747  -19.310 1.00 18.79 ? 9    THR B O   1 
ATOM   571  C CB  . THR B 1 9  ? -19.997 13.453  -21.897 1.00 27.42 ? 9    THR B CB  1 
ATOM   572  O OG1 . THR B 1 9  ? -20.552 14.605  -22.543 1.00 33.40 ? 9    THR B OG1 1 
ATOM   573  C CG2 . THR B 1 9  ? -19.107 12.705  -22.866 1.00 27.38 ? 9    THR B CG2 1 
ATOM   574  N N   . ALA B 1 10 ? -20.278 10.308  -21.037 1.00 21.14 ? 10   ALA B N   1 
ATOM   575  C CA  . ALA B 1 10 ? -19.660 9.238   -20.256 1.00 20.84 ? 10   ALA B CA  1 
ATOM   576  C C   . ALA B 1 10 ? -18.161 9.411   -20.257 1.00 22.71 ? 10   ALA B C   1 
ATOM   577  O O   . ALA B 1 10 ? -17.531 9.484   -21.317 1.00 24.97 ? 10   ALA B O   1 
ATOM   578  C CB  . ALA B 1 10 ? -20.031 7.881   -20.787 1.00 13.38 ? 10   ALA B CB  1 
ATOM   579  N N   . CYS B 1 11 ? -17.595 9.507   -19.062 1.00 18.07 ? 11   CYS B N   1 
ATOM   580  C CA  . CYS B 1 11 ? -16.151 9.545   -18.908 1.00 21.06 ? 11   CYS B CA  1 
ATOM   581  C C   . CYS B 1 11 ? -15.686 8.406   -17.990 1.00 23.86 ? 11   CYS B C   1 
ATOM   582  O O   . CYS B 1 11 ? -16.465 7.874   -17.200 1.00 19.14 ? 11   CYS B O   1 
ATOM   583  C CB  . CYS B 1 11 ? -15.711 10.909  -18.378 1.00 18.01 ? 11   CYS B CB  1 
ATOM   584  S SG  . CYS B 1 11 ? -15.853 12.269  -19.583 1.00 38.55 ? 11   CYS B SG  1 
ATOM   585  N N   . CYS B 1 12 ? -14.418 8.027   -18.103 1.00 27.51 ? 12   CYS B N   1 
ATOM   586  C CA  . CYS B 1 12 ? -13.854 7.010   -17.218 1.00 22.32 ? 12   CYS B CA  1 
ATOM   587  C C   . CYS B 1 12 ? -12.713 7.597   -16.413 1.00 23.14 ? 12   CYS B C   1 
ATOM   588  O O   . CYS B 1 12 ? -11.808 8.198   -16.980 1.00 25.28 ? 12   CYS B O   1 
ATOM   589  C CB  . CYS B 1 12 ? -13.343 5.805   -18.015 1.00 21.76 ? 12   CYS B CB  1 
ATOM   590  S SG  . CYS B 1 12 ? -14.639 4.783   -18.749 1.00 30.12 ? 12   CYS B SG  1 
ATOM   591  N N   . PHE B 1 13 ? -12.743 7.424   -15.096 1.00 20.89 ? 13   PHE B N   1 
ATOM   592  C CA  . PHE B 1 13 ? -11.620 7.879   -14.287 1.00 22.67 ? 13   PHE B CA  1 
ATOM   593  C C   . PHE B 1 13 ? -10.812 6.709   -13.708 1.00 23.97 ? 13   PHE B C   1 
ATOM   594  O O   . PHE B 1 13 ? -9.723  6.896   -13.172 1.00 31.79 ? 13   PHE B O   1 
ATOM   595  C CB  . PHE B 1 13 ? -12.083 8.887   -13.223 1.00 20.68 ? 13   PHE B CB  1 
ATOM   596  C CG  . PHE B 1 13 ? -12.780 10.102  -13.804 1.00 21.34 ? 13   PHE B CG  1 
ATOM   597  C CD1 . PHE B 1 13 ? -12.044 11.155  -14.348 1.00 18.32 ? 13   PHE B CD1 1 
ATOM   598  C CD2 . PHE B 1 13 ? -14.168 10.178  -13.832 1.00 18.80 ? 13   PHE B CD2 1 
ATOM   599  C CE1 . PHE B 1 13 ? -12.683 12.266  -14.896 1.00 21.13 ? 13   PHE B CE1 1 
ATOM   600  C CE2 . PHE B 1 13 ? -14.818 11.294  -14.382 1.00 22.65 ? 13   PHE B CE2 1 
ATOM   601  C CZ  . PHE B 1 13 ? -14.078 12.335  -14.909 1.00 16.08 ? 13   PHE B CZ  1 
ATOM   602  N N   . SER B 1 14 ? -11.337 5.498   -13.857 1.00 23.54 ? 14   SER B N   1 
ATOM   603  C CA  . SER B 1 14 ? -10.612 4.298   -13.467 1.00 26.39 ? 14   SER B CA  1 
ATOM   604  C C   . SER B 1 14 ? -10.972 3.121   -14.392 1.00 26.10 ? 14   SER B C   1 
ATOM   605  O O   . SER B 1 14 ? -12.088 3.046   -14.892 1.00 26.31 ? 14   SER B O   1 
ATOM   606  C CB  . SER B 1 14 ? -10.916 3.953   -12.015 1.00 22.26 ? 14   SER B CB  1 
ATOM   607  O OG  . SER B 1 14 ? -12.216 3.410   -11.901 1.00 30.24 ? 14   SER B OG  1 
ATOM   608  N N   . TYR B 1 15 ? -10.030 2.205   -14.611 1.00 28.44 ? 15   TYR B N   1 
ATOM   609  C CA  . TYR B 1 15 ? -10.254 1.078   -15.528 1.00 28.16 ? 15   TYR B CA  1 
ATOM   610  C C   . TYR B 1 15 ? -10.367 -0.242  -14.800 1.00 22.17 ? 15   TYR B C   1 
ATOM   611  O O   . TYR B 1 15 ? -9.686  -0.459  -13.809 1.00 22.08 ? 15   TYR B O   1 
ATOM   612  C CB  . TYR B 1 15 ? -9.110  0.949   -16.529 1.00 17.77 ? 15   TYR B CB  1 
ATOM   613  C CG  . TYR B 1 15 ? -8.772  2.215   -17.262 1.00 19.49 ? 15   TYR B CG  1 
ATOM   614  C CD1 . TYR B 1 15 ? -9.634  2.751   -18.225 1.00 22.98 ? 15   TYR B CD1 1 
ATOM   615  C CD2 . TYR B 1 15 ? -7.580  2.853   -17.028 1.00 15.89 ? 15   TYR B CD2 1 
ATOM   616  C CE1 . TYR B 1 15 ? -9.311  3.907   -18.904 1.00 18.31 ? 15   TYR B CE1 1 
ATOM   617  C CE2 . TYR B 1 15 ? -7.251  4.001   -17.696 1.00 29.73 ? 15   TYR B CE2 1 
ATOM   618  C CZ  . TYR B 1 15 ? -8.114  4.527   -18.628 1.00 24.62 ? 15   TYR B CZ  1 
ATOM   619  O OH  . TYR B 1 15 ? -7.739  5.675   -19.273 1.00 29.08 ? 15   TYR B OH  1 
ATOM   620  N N   . THR B 1 16 ? -11.210 -1.138  -15.299 1.00 21.73 ? 16   THR B N   1 
ATOM   621  C CA  . THR B 1 16 ? -11.255 -2.471  -14.724 1.00 22.55 ? 16   THR B CA  1 
ATOM   622  C C   . THR B 1 16 ? -9.848  -3.058  -14.745 1.00 29.64 ? 16   THR B C   1 
ATOM   623  O O   . THR B 1 16 ? -9.009  -2.676  -15.569 1.00 24.13 ? 16   THR B O   1 
ATOM   624  C CB  . THR B 1 16 ? -12.215 -3.406  -15.457 1.00 26.97 ? 16   THR B CB  1 
ATOM   625  O OG1 . THR B 1 16 ? -12.331 -4.628  -14.724 1.00 35.05 ? 16   THR B OG1 1 
ATOM   626  C CG2 . THR B 1 16 ? -11.724 -3.710  -16.875 1.00 22.52 ? 16   THR B CG2 1 
ATOM   627  N N   . ALA B 1 17 ? -9.587  -3.974  -13.822 1.00 33.39 ? 17   ALA B N   1 
ATOM   628  C CA  . ALA B 1 17 ? -8.260  -4.555  -13.696 1.00 28.67 ? 17   ALA B CA  1 
ATOM   629  C C   . ALA B 1 17 ? -8.308  -5.978  -14.154 1.00 28.58 ? 17   ALA B C   1 
ATOM   630  O O   . ALA B 1 17 ? -7.283  -6.641  -14.217 1.00 49.52 ? 17   ALA B O   1 
ATOM   631  C CB  . ALA B 1 17 ? -7.789  -4.498  -12.273 1.00 26.93 ? 17   ALA B CB  1 
ATOM   632  N N   . ARG B 1 18 ? -9.508  -6.454  -14.458 1.00 31.96 ? 18   ARG B N   1 
ATOM   633  C CA  . ARG B 1 18 ? -9.695  -7.847  -14.845 1.00 34.26 ? 18   ARG B CA  1 
ATOM   634  C C   . ARG B 1 18 ? -9.994  -7.953  -16.340 1.00 29.98 ? 18   ARG B C   1 
ATOM   635  O O   . ARG B 1 18 ? -10.822 -7.213  -16.856 1.00 40.04 ? 18   ARG B O   1 
ATOM   636  C CB  . ARG B 1 18 ? -10.846 -8.465  -14.035 1.00 47.33 ? 18   ARG B CB  1 
ATOM   637  C CG  . ARG B 1 18 ? -11.358 -7.629  -12.823 1.00 53.68 ? 18   ARG B CG  1 
ATOM   638  C CD  . ARG B 1 18 ? -10.862 -8.166  -11.452 1.00 40.11 ? 18   ARG B CD  1 
ATOM   639  N NE  . ARG B 1 18 ? -11.842 -7.989  -10.364 1.00 49.00 ? 18   ARG B NE  1 
ATOM   640  C CZ  . ARG B 1 18 ? -11.764 -7.088  -9.368  1.00 52.62 ? 18   ARG B CZ  1 
ATOM   641  N NH1 . ARG B 1 18 ? -10.733 -6.224  -9.275  1.00 24.52 ? 18   ARG B NH1 1 
ATOM   642  N NH2 . ARG B 1 18 ? -12.733 -7.057  -8.444  1.00 21.85 ? 18   ARG B NH2 1 
ATOM   643  N N   . LYS B 1 19 ? -9.328  -8.857  -17.049 1.00 22.37 ? 19   LYS B N   1 
ATOM   644  C CA  . LYS B 1 19 ? -9.734  -9.131  -18.419 1.00 21.00 ? 19   LYS B CA  1 
ATOM   645  C C   . LYS B 1 19 ? -11.064 -9.847  -18.423 1.00 24.74 ? 19   LYS B C   1 
ATOM   646  O O   . LYS B 1 19 ? -11.225 -10.878 -17.781 1.00 28.55 ? 19   LYS B O   1 
ATOM   647  C CB  . LYS B 1 19 ? -8.726  -9.984  -19.169 1.00 29.77 ? 19   LYS B CB  1 
ATOM   648  C CG  . LYS B 1 19 ? -9.335  -10.592 -20.434 1.00 27.63 ? 19   LYS B CG  1 
ATOM   649  C CD  . LYS B 1 19 ? -8.266  -11.188 -21.334 1.00 25.36 ? 19   LYS B CD  1 
ATOM   650  C CE  . LYS B 1 19 ? -8.874  -12.108 -22.382 1.00 29.11 ? 19   LYS B CE  1 
ATOM   651  N NZ  . LYS B 1 19 ? -7.826  -12.948 -23.027 1.00 41.96 ? 19   LYS B NZ  1 
ATOM   652  N N   . LEU B 1 20 ? -12.023 -9.292  -19.146 1.00 26.89 ? 20   LEU B N   1 
ATOM   653  C CA  . LEU B 1 20 ? -13.344 -9.882  -19.234 1.00 22.85 ? 20   LEU B CA  1 
ATOM   654  C C   . LEU B 1 20 ? -13.313 -11.061 -20.174 1.00 21.20 ? 20   LEU B C   1 
ATOM   655  O O   . LEU B 1 20 ? -12.648 -11.014 -21.208 1.00 24.21 ? 20   LEU B O   1 
ATOM   656  C CB  . LEU B 1 20 ? -14.342 -8.872  -19.791 1.00 18.96 ? 20   LEU B CB  1 
ATOM   657  C CG  . LEU B 1 20 ? -14.805 -7.727  -18.905 1.00 24.23 ? 20   LEU B CG  1 
ATOM   658  C CD1 . LEU B 1 20 ? -15.442 -6.657  -19.755 1.00 21.20 ? 20   LEU B CD1 1 
ATOM   659  C CD2 . LEU B 1 20 ? -15.784 -8.225  -17.865 1.00 28.68 ? 20   LEU B CD2 1 
ATOM   660  N N   . PRO B 1 21 ? -14.049 -12.119 -19.825 1.00 22.00 ? 21   PRO B N   1 
ATOM   661  C CA  . PRO B 1 21 ? -14.327 -13.220 -20.745 1.00 15.13 ? 21   PRO B CA  1 
ATOM   662  C C   . PRO B 1 21 ? -14.994 -12.679 -21.999 1.00 20.40 ? 21   PRO B C   1 
ATOM   663  O O   . PRO B 1 21 ? -15.919 -11.879 -21.886 1.00 25.32 ? 21   PRO B O   1 
ATOM   664  C CB  . PRO B 1 21 ? -15.329 -14.066 -19.963 1.00 27.38 ? 21   PRO B CB  1 
ATOM   665  C CG  . PRO B 1 21 ? -15.042 -13.768 -18.528 1.00 21.46 ? 21   PRO B CG  1 
ATOM   666  C CD  . PRO B 1 21 ? -14.637 -12.338 -18.491 1.00 21.38 ? 21   PRO B CD  1 
ATOM   667  N N   . ARG B 1 22 ? -14.531 -13.105 -23.168 1.00 21.65 ? 22   ARG B N   1 
ATOM   668  C CA  . ARG B 1 22 ? -15.030 -12.613 -24.445 1.00 17.81 ? 22   ARG B CA  1 
ATOM   669  C C   . ARG B 1 22 ? -16.547 -12.650 -24.553 1.00 25.76 ? 22   ARG B C   1 
ATOM   670  O O   . ARG B 1 22 ? -17.159 -11.694 -25.009 1.00 26.06 ? 22   ARG B O   1 
ATOM   671  C CB  . ARG B 1 22 ? -14.434 -13.429 -25.592 1.00 24.83 ? 22   ARG B CB  1 
ATOM   672  C CG  . ARG B 1 22 ? -14.926 -13.014 -26.972 1.00 24.65 ? 22   ARG B CG  1 
ATOM   673  C CD  . ARG B 1 22 ? -14.515 -11.586 -27.292 1.00 17.89 ? 22   ARG B CD  1 
ATOM   674  N NE  . ARG B 1 22 ? -15.235 -11.078 -28.447 1.00 19.68 ? 22   ARG B NE  1 
ATOM   675  C CZ  . ARG B 1 22 ? -16.511 -10.699 -28.438 1.00 29.14 ? 22   ARG B CZ  1 
ATOM   676  N NH1 . ARG B 1 22 ? -17.232 -10.760 -27.328 1.00 24.29 ? 22   ARG B NH1 1 
ATOM   677  N NH2 . ARG B 1 22 ? -17.077 -10.261 -29.553 1.00 31.70 ? 22   ARG B NH2 1 
ATOM   678  N N   . ASN B 1 23 ? -17.158 -13.757 -24.144 1.00 28.60 ? 23   ASN B N   1 
ATOM   679  C CA  . ASN B 1 23 ? -18.604 -13.910 -24.293 1.00 25.64 ? 23   ASN B CA  1 
ATOM   680  C C   . ASN B 1 23 ? -19.437 -13.290 -23.186 1.00 26.98 ? 23   ASN B C   1 
ATOM   681  O O   . ASN B 1 23 ? -20.657 -13.466 -23.139 1.00 34.51 ? 23   ASN B O   1 
ATOM   682  C CB  . ASN B 1 23 ? -18.981 -15.376 -24.501 1.00 28.97 ? 23   ASN B CB  1 
ATOM   683  C CG  . ASN B 1 23 ? -18.774 -15.820 -25.935 1.00 32.75 ? 23   ASN B CG  1 
ATOM   684  O OD1 . ASN B 1 23 ? -18.135 -16.834 -26.192 1.00 37.34 ? 23   ASN B OD1 1 
ATOM   685  N ND2 . ASN B 1 23 ? -19.302 -15.047 -26.879 1.00 29.13 ? 23   ASN B ND2 1 
ATOM   686  N N   . PHE B 1 24 ? -18.773 -12.569 -22.292 1.00 27.37 ? 24   PHE B N   1 
ATOM   687  C CA  . PHE B 1 24 ? -19.460 -11.671 -21.378 1.00 25.51 ? 24   PHE B CA  1 
ATOM   688  C C   . PHE B 1 24 ? -19.703 -10.331 -22.087 1.00 33.59 ? 24   PHE B C   1 
ATOM   689  O O   . PHE B 1 24 ? -20.556 -9.544  -21.670 1.00 31.94 ? 24   PHE B O   1 
ATOM   690  C CB  . PHE B 1 24 ? -18.625 -11.451 -20.118 1.00 25.82 ? 24   PHE B CB  1 
ATOM   691  C CG  . PHE B 1 24 ? -18.641 -12.611 -19.157 1.00 27.03 ? 24   PHE B CG  1 
ATOM   692  C CD1 . PHE B 1 24 ? -18.222 -12.439 -17.849 1.00 22.80 ? 24   PHE B CD1 1 
ATOM   693  C CD2 . PHE B 1 24 ? -19.097 -13.857 -19.551 1.00 26.70 ? 24   PHE B CD2 1 
ATOM   694  C CE1 . PHE B 1 24 ? -18.243 -13.486 -16.951 1.00 25.44 ? 24   PHE B CE1 1 
ATOM   695  C CE2 . PHE B 1 24 ? -19.122 -14.915 -18.663 1.00 29.50 ? 24   PHE B CE2 1 
ATOM   696  C CZ  . PHE B 1 24 ? -18.691 -14.732 -17.358 1.00 33.46 ? 24   PHE B CZ  1 
ATOM   697  N N   . VAL B 1 25 ? -18.959 -10.076 -23.165 1.00 23.10 ? 25   VAL B N   1 
ATOM   698  C CA  . VAL B 1 25 ? -19.042 -8.783  -23.834 1.00 27.71 ? 25   VAL B CA  1 
ATOM   699  C C   . VAL B 1 25 ? -19.889 -8.806  -25.106 1.00 28.95 ? 25   VAL B C   1 
ATOM   700  O O   . VAL B 1 25 ? -19.678 -9.635  -25.988 1.00 28.53 ? 25   VAL B O   1 
ATOM   701  C CB  . VAL B 1 25 ? -17.651 -8.202  -24.139 1.00 21.76 ? 25   VAL B CB  1 
ATOM   702  C CG1 . VAL B 1 25 ? -17.789 -6.856  -24.825 1.00 21.38 ? 25   VAL B CG1 1 
ATOM   703  C CG2 . VAL B 1 25 ? -16.876 -8.035  -22.864 1.00 22.87 ? 25   VAL B CG2 1 
ATOM   704  N N   . VAL B 1 26 ? -20.840 -7.882  -25.202 1.00 27.04 ? 26   VAL B N   1 
ATOM   705  C CA  . VAL B 1 26 ? -21.715 -7.832  -26.372 1.00 32.10 ? 26   VAL B CA  1 
ATOM   706  C C   . VAL B 1 26 ? -21.604 -6.522  -27.152 1.00 30.60 ? 26   VAL B C   1 
ATOM   707  O O   . VAL B 1 26 ? -22.222 -6.372  -28.197 1.00 33.06 ? 26   VAL B O   1 
ATOM   708  C CB  . VAL B 1 26 ? -23.201 -8.099  -26.011 1.00 26.48 ? 26   VAL B CB  1 
ATOM   709  C CG1 . VAL B 1 26 ? -23.315 -9.340  -25.152 1.00 33.59 ? 26   VAL B CG1 1 
ATOM   710  C CG2 . VAL B 1 26 ? -23.788 -6.923  -25.279 1.00 24.64 ? 26   VAL B CG2 1 
ATOM   711  N N   . ASP B 1 27 ? -20.820 -5.574  -26.654 1.00 32.64 ? 27   ASP B N   1 
ATOM   712  C CA  . ASP B 1 27 ? -20.655 -4.310  -27.368 1.00 23.83 ? 27   ASP B CA  1 
ATOM   713  C C   . ASP B 1 27 ? -19.655 -3.410  -26.695 1.00 22.90 ? 27   ASP B C   1 
ATOM   714  O O   . ASP B 1 27 ? -19.246 -3.645  -25.566 1.00 25.63 ? 27   ASP B O   1 
ATOM   715  C CB  . ASP B 1 27 ? -21.984 -3.566  -27.481 1.00 26.62 ? 27   ASP B CB  1 
ATOM   716  C CG  . ASP B 1 27 ? -22.022 -2.618  -28.668 1.00 42.47 ? 27   ASP B CG  1 
ATOM   717  O OD1 . ASP B 1 27 ? -20.998 -2.473  -29.374 1.00 38.43 ? 27   ASP B OD1 1 
ATOM   718  O OD2 . ASP B 1 27 ? -23.092 -2.024  -28.908 1.00 56.64 ? 27   ASP B OD2 1 
ATOM   719  N N   . TYR B 1 28 ? -19.268 -2.359  -27.398 1.00 25.21 ? 28   TYR B N   1 
ATOM   720  C CA  . TYR B 1 28 ? -18.335 -1.390  -26.862 1.00 23.68 ? 28   TYR B CA  1 
ATOM   721  C C   . TYR B 1 28 ? -18.625 -0.024  -27.434 1.00 20.10 ? 28   TYR B C   1 
ATOM   722  O O   . TYR B 1 28 ? -19.315 0.125   -28.435 1.00 22.24 ? 28   TYR B O   1 
ATOM   723  C CB  . TYR B 1 28 ? -16.904 -1.761  -27.229 1.00 20.66 ? 28   TYR B CB  1 
ATOM   724  C CG  . TYR B 1 28 ? -16.484 -1.185  -28.558 1.00 21.54 ? 28   TYR B CG  1 
ATOM   725  C CD1 . TYR B 1 28 ? -15.643 -0.082  -28.622 1.00 24.30 ? 28   TYR B CD1 1 
ATOM   726  C CD2 . TYR B 1 28 ? -16.943 -1.735  -29.751 1.00 23.72 ? 28   TYR B CD2 1 
ATOM   727  C CE1 . TYR B 1 28 ? -15.264 0.453   -29.837 1.00 31.53 ? 28   TYR B CE1 1 
ATOM   728  C CE2 . TYR B 1 28 ? -16.576 -1.210  -30.966 1.00 23.49 ? 28   TYR B CE2 1 
ATOM   729  C CZ  . TYR B 1 28 ? -15.736 -0.118  -31.010 1.00 32.20 ? 28   TYR B CZ  1 
ATOM   730  O OH  . TYR B 1 28 ? -15.358 0.404   -32.227 1.00 28.27 ? 28   TYR B OH  1 
ATOM   731  N N   . TYR B 1 29 ? -18.081 0.979   -26.779 1.00 21.02 ? 29   TYR B N   1 
ATOM   732  C CA  . TYR B 1 29 ? -18.024 2.289   -27.362 1.00 19.78 ? 29   TYR B CA  1 
ATOM   733  C C   . TYR B 1 29 ? -16.790 2.937   -26.783 1.00 21.83 ? 29   TYR B C   1 
ATOM   734  O O   . TYR B 1 29 ? -16.221 2.436   -25.803 1.00 22.80 ? 29   TYR B O   1 
ATOM   735  C CB  . TYR B 1 29 ? -19.313 3.088   -27.109 1.00 21.09 ? 29   TYR B CB  1 
ATOM   736  C CG  . TYR B 1 29 ? -19.587 3.537   -25.683 1.00 34.24 ? 29   TYR B CG  1 
ATOM   737  C CD1 . TYR B 1 29 ? -18.891 4.606   -25.120 1.00 25.50 ? 29   TYR B CD1 1 
ATOM   738  C CD2 . TYR B 1 29 ? -20.580 2.926   -24.921 1.00 24.04 ? 29   TYR B CD2 1 
ATOM   739  C CE1 . TYR B 1 29 ? -19.158 5.034   -23.834 1.00 21.45 ? 29   TYR B CE1 1 
ATOM   740  C CE2 . TYR B 1 29 ? -20.853 3.344   -23.641 1.00 26.99 ? 29   TYR B CE2 1 
ATOM   741  C CZ  . TYR B 1 29 ? -20.141 4.405   -23.095 1.00 32.73 ? 29   TYR B CZ  1 
ATOM   742  O OH  . TYR B 1 29 ? -20.408 4.833   -21.802 1.00 21.96 ? 29   TYR B OH  1 
ATOM   743  N N   . GLU B 1 30 ? -16.357 4.013   -27.421 1.00 17.41 ? 30   GLU B N   1 
ATOM   744  C CA  . GLU B 1 30 ? -15.187 4.752   -27.002 1.00 23.48 ? 30   GLU B CA  1 
ATOM   745  C C   . GLU B 1 30 ? -15.689 6.053   -26.370 1.00 27.91 ? 30   GLU B C   1 
ATOM   746  O O   . GLU B 1 30 ? -16.653 6.642   -26.857 1.00 27.51 ? 30   GLU B O   1 
ATOM   747  C CB  . GLU B 1 30 ? -14.317 5.040   -28.228 1.00 28.69 ? 30   GLU B CB  1 
ATOM   748  C CG  . GLU B 1 30 ? -12.841 5.232   -27.928 1.00 49.92 ? 30   GLU B CG  1 
ATOM   749  C CD  . GLU B 1 30 ? -11.998 4.028   -28.324 1.00 55.20 ? 30   GLU B CD  1 
ATOM   750  O OE1 . GLU B 1 30 ? -12.502 3.155   -29.071 1.00 36.95 ? 30   GLU B OE1 1 
ATOM   751  O OE2 . GLU B 1 30 ? -10.828 3.964   -27.883 1.00 53.16 ? 30   GLU B OE2 1 
ATOM   752  N N   . THR B 1 31 ? -15.058 6.498   -25.287 1.00 24.51 ? 31   THR B N   1 
ATOM   753  C CA  . THR B 1 31 ? -15.530 7.702   -24.595 1.00 25.62 ? 31   THR B CA  1 
ATOM   754  C C   . THR B 1 31 ? -15.123 8.987   -25.315 1.00 23.14 ? 31   THR B C   1 
ATOM   755  O O   . THR B 1 31 ? -14.069 9.056   -25.937 1.00 24.53 ? 31   THR B O   1 
ATOM   756  C CB  . THR B 1 31 ? -15.089 7.760   -23.095 1.00 26.14 ? 31   THR B CB  1 
ATOM   757  O OG1 . THR B 1 31 ? -13.664 7.825   -22.989 1.00 19.55 ? 31   THR B OG1 1 
ATOM   758  C CG2 . THR B 1 31 ? -15.593 6.548   -22.328 1.00 17.01 ? 31   THR B CG2 1 
ATOM   759  N N   . SER B 1 32 ? -15.971 10.004  -25.225 1.00 26.45 ? 32   SER B N   1 
ATOM   760  C CA  . SER B 1 32 ? -15.705 11.289  -25.860 1.00 23.92 ? 32   SER B CA  1 
ATOM   761  C C   . SER B 1 32 ? -14.265 11.752  -25.707 1.00 28.43 ? 32   SER B C   1 
ATOM   762  O O   . SER B 1 32 ? -13.561 11.340  -24.792 1.00 28.94 ? 32   SER B O   1 
ATOM   763  C CB  . SER B 1 32 ? -16.617 12.365  -25.286 1.00 25.98 ? 32   SER B CB  1 
ATOM   764  O OG  . SER B 1 32 ? -16.029 13.646  -25.480 1.00 28.11 ? 32   SER B OG  1 
ATOM   765  N N   . SER B 1 33 ? -13.839 12.631  -26.609 1.00 31.44 ? 33   SER B N   1 
ATOM   766  C CA  . SER B 1 33 ? -12.496 13.186  -26.565 1.00 21.23 ? 33   SER B CA  1 
ATOM   767  C C   . SER B 1 33 ? -12.460 14.355  -25.587 1.00 20.61 ? 33   SER B C   1 
ATOM   768  O O   . SER B 1 33 ? -11.397 14.848  -25.241 1.00 16.75 ? 33   SER B O   1 
ATOM   769  C CB  . SER B 1 33 ? -12.078 13.654  -27.950 1.00 30.22 ? 33   SER B CB  1 
ATOM   770  O OG  . SER B 1 33 ? -12.541 14.977  -28.188 1.00 43.00 ? 33   SER B OG  1 
ATOM   771  N N   . LEU B 1 34 ? -13.637 14.796  -25.154 1.00 24.55 ? 34   LEU B N   1 
ATOM   772  C CA  . LEU B 1 34 ? -13.755 15.828  -24.126 1.00 25.07 ? 34   LEU B CA  1 
ATOM   773  C C   . LEU B 1 34 ? -13.374 15.289  -22.741 1.00 32.93 ? 34   LEU B C   1 
ATOM   774  O O   . LEU B 1 34 ? -13.055 16.069  -21.836 1.00 29.85 ? 34   LEU B O   1 
ATOM   775  C CB  . LEU B 1 34 ? -15.190 16.358  -24.074 1.00 29.27 ? 34   LEU B CB  1 
ATOM   776  C CG  . LEU B 1 34 ? -15.757 16.964  -25.365 1.00 35.85 ? 34   LEU B CG  1 
ATOM   777  C CD1 . LEU B 1 34 ? -17.281 17.022  -25.336 1.00 26.60 ? 34   LEU B CD1 1 
ATOM   778  C CD2 . LEU B 1 34 ? -15.171 18.340  -25.605 1.00 29.16 ? 34   LEU B CD2 1 
ATOM   779  N N   . CYS B 1 35 ? -13.426 13.965  -22.565 1.00 20.31 ? 35   CYS B N   1 
ATOM   780  C CA  . CYS B 1 35 ? -13.099 13.388  -21.272 1.00 18.75 ? 35   CYS B CA  1 
ATOM   781  C C   . CYS B 1 35 ? -11.620 13.600  -21.047 1.00 24.09 ? 35   CYS B C   1 
ATOM   782  O O   . CYS B 1 35 ? -10.893 13.889  -21.996 1.00 30.29 ? 35   CYS B O   1 
ATOM   783  C CB  . CYS B 1 35 ? -13.455 11.911  -21.203 1.00 15.79 ? 35   CYS B CB  1 
ATOM   784  S SG  . CYS B 1 35 ? -15.213 11.578  -21.384 1.00 31.14 ? 35   CYS B SG  1 
ATOM   785  N N   . SER B 1 36 ? -11.176 13.457  -19.802 1.00 15.15 ? 36   SER B N   1 
ATOM   786  C CA  . SER B 1 36 ? -9.804  13.781  -19.436 1.00 19.35 ? 36   SER B CA  1 
ATOM   787  C C   . SER B 1 36 ? -8.790  12.727  -19.850 1.00 27.02 ? 36   SER B C   1 
ATOM   788  O O   . SER B 1 36 ? -7.589  12.990  -19.851 1.00 23.99 ? 36   SER B O   1 
ATOM   789  C CB  . SER B 1 36 ? -9.704  13.991  -17.934 1.00 19.17 ? 36   SER B CB  1 
ATOM   790  O OG  . SER B 1 36 ? -9.952  12.776  -17.261 1.00 31.59 ? 36   SER B OG  1 
ATOM   791  N N   . GLN B 1 37 ? -9.276  11.532  -20.173 1.00 24.87 ? 37   GLN B N   1 
ATOM   792  C CA  . GLN B 1 37 ? -8.411  10.458  -20.636 1.00 26.57 ? 37   GLN B CA  1 
ATOM   793  C C   . GLN B 1 37 ? -9.182  9.496   -21.552 1.00 33.07 ? 37   GLN B C   1 
ATOM   794  O O   . GLN B 1 37 ? -10.412 9.439   -21.497 1.00 34.33 ? 37   GLN B O   1 
ATOM   795  C CB  . GLN B 1 37 ? -7.820  9.712   -19.445 1.00 31.69 ? 37   GLN B CB  1 
ATOM   796  C CG  . GLN B 1 37 ? -8.823  8.892   -18.655 1.00 25.90 ? 37   GLN B CG  1 
ATOM   797  C CD  . GLN B 1 37 ? -8.135  8.074   -17.595 1.00 36.66 ? 37   GLN B CD  1 
ATOM   798  O OE1 . GLN B 1 37 ? -8.768  7.357   -16.816 1.00 40.22 ? 37   GLN B OE1 1 
ATOM   799  N NE2 . GLN B 1 37 ? -6.812  8.174   -17.561 1.00 42.64 ? 37   GLN B NE2 1 
ATOM   800  N N   . PRO B 1 38 ? -8.464  8.742   -22.401 1.00 28.19 ? 38   PRO B N   1 
ATOM   801  C CA  . PRO B 1 38 ? -9.118  7.866   -23.374 1.00 25.67 ? 38   PRO B CA  1 
ATOM   802  C C   . PRO B 1 38 ? -9.579  6.592   -22.703 1.00 31.31 ? 38   PRO B C   1 
ATOM   803  O O   . PRO B 1 38 ? -8.921  6.130   -21.779 1.00 37.00 ? 38   PRO B O   1 
ATOM   804  C CB  . PRO B 1 38 ? -7.990  7.535   -24.352 1.00 26.34 ? 38   PRO B CB  1 
ATOM   805  C CG  . PRO B 1 38 ? -6.864  8.474   -24.011 1.00 31.42 ? 38   PRO B CG  1 
ATOM   806  C CD  . PRO B 1 38 ? -7.005  8.727   -22.565 1.00 31.27 ? 38   PRO B CD  1 
ATOM   807  N N   . ALA B 1 39 ? -10.676 6.015   -23.168 1.00 25.18 ? 39   ALA B N   1 
ATOM   808  C CA  . ALA B 1 39 ? -11.190 4.808   -22.557 1.00 16.27 ? 39   ALA B CA  1 
ATOM   809  C C   . ALA B 1 39 ? -12.144 4.097   -23.507 1.00 24.60 ? 39   ALA B C   1 
ATOM   810  O O   . ALA B 1 39 ? -12.659 4.688   -24.461 1.00 25.67 ? 39   ALA B O   1 
ATOM   811  C CB  . ALA B 1 39 ? -11.889 5.139   -21.251 1.00 14.17 ? 39   ALA B CB  1 
ATOM   812  N N   . VAL B 1 40 ? -12.354 2.811   -23.247 1.00 20.45 ? 40   VAL B N   1 
ATOM   813  C CA  . VAL B 1 40 ? -13.340 2.020   -23.961 1.00 23.44 ? 40   VAL B CA  1 
ATOM   814  C C   . VAL B 1 40 ? -14.347 1.611   -22.910 1.00 23.76 ? 40   VAL B C   1 
ATOM   815  O O   . VAL B 1 40 ? -13.959 1.314   -21.784 1.00 23.37 ? 40   VAL B O   1 
ATOM   816  C CB  . VAL B 1 40 ? -12.722 0.732   -24.576 1.00 19.55 ? 40   VAL B CB  1 
ATOM   817  C CG1 . VAL B 1 40 ? -13.792 -0.122  -25.233 1.00 14.40 ? 40   VAL B CG1 1 
ATOM   818  C CG2 . VAL B 1 40 ? -11.629 1.073   -25.572 1.00 15.48 ? 40   VAL B CG2 1 
ATOM   819  N N   . VAL B 1 41 ? -15.629 1.610   -23.257 1.00 20.36 ? 41   VAL B N   1 
ATOM   820  C CA  . VAL B 1 41 ? -16.640 1.091   -22.341 1.00 20.51 ? 41   VAL B CA  1 
ATOM   821  C C   . VAL B 1 41 ? -17.290 -0.128  -22.957 1.00 22.08 ? 41   VAL B C   1 
ATOM   822  O O   . VAL B 1 41 ? -17.846 -0.047  -24.054 1.00 29.57 ? 41   VAL B O   1 
ATOM   823  C CB  . VAL B 1 41 ? -17.732 2.134   -22.017 1.00 22.87 ? 41   VAL B CB  1 
ATOM   824  C CG1 . VAL B 1 41 ? -18.836 1.511   -21.156 1.00 17.52 ? 41   VAL B CG1 1 
ATOM   825  C CG2 . VAL B 1 41 ? -17.122 3.354   -21.345 1.00 16.01 ? 41   VAL B CG2 1 
ATOM   826  N N   . PHE B 1 42 ? -17.211 -1.256  -22.256 1.00 18.78 ? 42   PHE B N   1 
ATOM   827  C CA  . PHE B 1 42 ? -17.762 -2.511  -22.746 1.00 19.36 ? 42   PHE B CA  1 
ATOM   828  C C   . PHE B 1 42 ? -19.141 -2.719  -22.171 1.00 25.61 ? 42   PHE B C   1 
ATOM   829  O O   . PHE B 1 42 ? -19.354 -2.492  -20.989 1.00 31.56 ? 42   PHE B O   1 
ATOM   830  C CB  . PHE B 1 42 ? -16.881 -3.691  -22.329 1.00 19.72 ? 42   PHE B CB  1 
ATOM   831  C CG  . PHE B 1 42 ? -15.627 -3.821  -23.127 1.00 24.65 ? 42   PHE B CG  1 
ATOM   832  C CD1 . PHE B 1 42 ? -15.684 -4.139  -24.482 1.00 27.71 ? 42   PHE B CD1 1 
ATOM   833  C CD2 . PHE B 1 42 ? -14.388 -3.632  -22.534 1.00 16.43 ? 42   PHE B CD2 1 
ATOM   834  C CE1 . PHE B 1 42 ? -14.526 -4.251  -25.229 1.00 21.46 ? 42   PHE B CE1 1 
ATOM   835  C CE2 . PHE B 1 42 ? -13.227 -3.749  -23.270 1.00 19.41 ? 42   PHE B CE2 1 
ATOM   836  C CZ  . PHE B 1 42 ? -13.297 -4.054  -24.622 1.00 28.56 ? 42   PHE B CZ  1 
ATOM   837  N N   . GLN B 1 43 ? -20.084 -3.143  -23.002 1.00 30.42 ? 43   GLN B N   1 
ATOM   838  C CA  . GLN B 1 43 ? -21.385 -3.526  -22.494 1.00 30.34 ? 43   GLN B CA  1 
ATOM   839  C C   . GLN B 1 43 ? -21.377 -5.026  -22.341 1.00 20.65 ? 43   GLN B C   1 
ATOM   840  O O   . GLN B 1 43 ? -20.812 -5.723  -23.165 1.00 30.52 ? 43   GLN B O   1 
ATOM   841  C CB  . GLN B 1 43 ? -22.518 -3.082  -23.419 1.00 28.15 ? 43   GLN B CB  1 
ATOM   842  C CG  . GLN B 1 43 ? -23.872 -3.148  -22.719 1.00 41.23 ? 43   GLN B CG  1 
ATOM   843  C CD  . GLN B 1 43 ? -25.014 -3.531  -23.638 1.00 48.22 ? 43   GLN B CD  1 
ATOM   844  O OE1 . GLN B 1 43 ? -25.305 -2.831  -24.606 1.00 44.30 ? 43   GLN B OE1 1 
ATOM   845  N NE2 . GLN B 1 43 ? -25.682 -4.643  -23.324 1.00 49.38 ? 43   GLN B NE2 1 
ATOM   846  N N   . THR B 1 44 ? -21.989 -5.528  -21.280 1.00 23.36 ? 44   THR B N   1 
ATOM   847  C CA  . THR B 1 44 ? -21.993 -6.962  -21.043 1.00 29.15 ? 44   THR B CA  1 
ATOM   848  C C   . THR B 1 44 ? -23.331 -7.602  -21.399 1.00 33.93 ? 44   THR B C   1 
ATOM   849  O O   . THR B 1 44 ? -24.279 -6.917  -21.806 1.00 25.52 ? 44   THR B O   1 
ATOM   850  C CB  . THR B 1 44 ? -21.628 -7.317  -19.586 1.00 30.61 ? 44   THR B CB  1 
ATOM   851  O OG1 . THR B 1 44 ? -22.708 -6.971  -18.713 1.00 30.38 ? 44   THR B OG1 1 
ATOM   852  C CG2 . THR B 1 44 ? -20.381 -6.584  -19.153 1.00 30.20 ? 44   THR B CG2 1 
ATOM   853  N N   . LYS B 1 45 ? -23.382 -8.925  -21.251 1.00 32.44 ? 45   LYS B N   1 
ATOM   854  C CA  . LYS B 1 45 ? -24.593 -9.689  -21.498 1.00 31.65 ? 45   LYS B CA  1 
ATOM   855  C C   . LYS B 1 45 ? -25.702 -9.215  -20.570 1.00 37.92 ? 45   LYS B C   1 
ATOM   856  O O   . LYS B 1 45 ? -26.833 -9.021  -21.009 1.00 37.78 ? 45   LYS B O   1 
ATOM   857  C CB  . LYS B 1 45 ? -24.332 -11.177 -21.287 1.00 37.69 ? 45   LYS B CB  1 
ATOM   858  C CG  . LYS B 1 45 ? -24.934 -12.081 -22.355 1.00 41.38 ? 45   LYS B CG  1 
ATOM   859  C CD  . LYS B 1 45 ? -24.532 -13.535 -22.109 1.00 60.17 ? 45   LYS B CD  1 
ATOM   860  C CE  . LYS B 1 45 ? -24.891 -14.456 -23.284 1.00 70.49 ? 45   LYS B CE  1 
ATOM   861  N NZ  . LYS B 1 45 ? -26.362 -14.744 -23.358 1.00 61.89 ? 45   LYS B NZ  1 
ATOM   862  N N   . ARG B 1 46 ? -25.370 -9.022  -19.290 1.00 34.43 ? 46   ARG B N   1 
ATOM   863  C CA  . ARG B 1 46 ? -26.320 -8.493  -18.312 1.00 30.20 ? 46   ARG B CA  1 
ATOM   864  C C   . ARG B 1 46 ? -26.458 -6.972  -18.395 1.00 28.59 ? 46   ARG B C   1 
ATOM   865  O O   . ARG B 1 46 ? -27.081 -6.345  -17.549 1.00 29.08 ? 46   ARG B O   1 
ATOM   866  C CB  . ARG B 1 46 ? -25.947 -8.940  -16.893 1.00 31.56 ? 46   ARG B CB  1 
ATOM   867  C CG  . ARG B 1 46 ? -26.255 -10.409 -16.629 1.00 34.44 ? 46   ARG B CG  1 
ATOM   868  C CD  . ARG B 1 46 ? -25.650 -10.919 -15.328 1.00 36.08 ? 46   ARG B CD  1 
ATOM   869  N NE  . ARG B 1 46 ? -26.497 -10.690 -14.149 1.00 48.72 ? 46   ARG B NE  1 
ATOM   870  C CZ  . ARG B 1 46 ? -27.543 -11.447 -13.800 1.00 48.24 ? 46   ARG B CZ  1 
ATOM   871  N NH1 . ARG B 1 46 ? -27.920 -12.485 -14.544 1.00 33.44 ? 46   ARG B NH1 1 
ATOM   872  N NH2 . ARG B 1 46 ? -28.234 -11.156 -12.704 1.00 45.55 ? 46   ARG B NH2 1 
ATOM   873  N N   . SER B 1 47 ? -25.876 -6.380  -19.426 1.00 29.82 ? 47   SER B N   1 
ATOM   874  C CA  . SER B 1 47 ? -26.059 -4.956  -19.679 1.00 34.71 ? 47   SER B CA  1 
ATOM   875  C C   . SER B 1 47 ? -25.359 -4.064  -18.658 1.00 35.73 ? 47   SER B C   1 
ATOM   876  O O   . SER B 1 47 ? -25.769 -2.922  -18.449 1.00 42.91 ? 47   SER B O   1 
ATOM   877  C CB  . SER B 1 47 ? -27.551 -4.600  -19.715 1.00 43.93 ? 47   SER B CB  1 
ATOM   878  O OG  . SER B 1 47 ? -28.275 -5.459  -20.581 1.00 51.35 ? 47   SER B OG  1 
ATOM   879  N N   . LYS B 1 48 ? -24.330 -4.581  -18.000 1.00 25.08 ? 48   LYS B N   1 
ATOM   880  C CA  A LYS B 1 48 ? -23.509 -3.733  -17.156 0.45 27.31 ? 48   LYS B CA  1 
ATOM   881  C CA  B LYS B 1 48 ? -23.476 -3.766  -17.148 0.55 27.33 ? 48   LYS B CA  1 
ATOM   882  C C   . LYS B 1 48 ? -22.528 -2.986  -18.060 1.00 33.54 ? 48   LYS B C   1 
ATOM   883  O O   . LYS B 1 48 ? -22.350 -3.348  -19.221 1.00 36.65 ? 48   LYS B O   1 
ATOM   884  C CB  A LYS B 1 48 ? -22.790 -4.564  -16.087 0.45 31.81 ? 48   LYS B CB  1 
ATOM   885  C CB  B LYS B 1 48 ? -22.672 -4.659  -16.193 0.55 31.88 ? 48   LYS B CB  1 
ATOM   886  C CG  A LYS B 1 48 ? -23.698 -5.075  -14.961 0.45 28.46 ? 48   LYS B CG  1 
ATOM   887  C CG  B LYS B 1 48 ? -23.425 -5.880  -15.647 0.55 34.44 ? 48   LYS B CG  1 
ATOM   888  C CD  A LYS B 1 48 ? -23.833 -6.602  -14.976 0.45 35.90 ? 48   LYS B CD  1 
ATOM   889  C CD  B LYS B 1 48 ? -22.616 -7.175  -15.858 0.55 30.77 ? 48   LYS B CD  1 
ATOM   890  C CE  A LYS B 1 48 ? -23.584 -7.223  -13.589 0.45 38.15 ? 48   LYS B CE  1 
ATOM   891  C CE  B LYS B 1 48 ? -22.348 -7.919  -14.547 0.55 31.24 ? 48   LYS B CE  1 
ATOM   892  N NZ  A LYS B 1 48 ? -24.286 -8.539  -13.373 0.45 25.21 ? 48   LYS B NZ  1 
ATOM   893  N NZ  B LYS B 1 48 ? -23.477 -8.817  -14.131 0.55 30.80 ? 48   LYS B NZ  1 
ATOM   894  N N   . GLN B 1 49 ? -21.903 -1.931  -17.546 1.00 27.93 ? 49   GLN B N   1 
ATOM   895  C CA  . GLN B 1 49 ? -20.972 -1.150  -18.358 1.00 19.76 ? 49   GLN B CA  1 
ATOM   896  C C   . GLN B 1 49 ? -19.619 -1.020  -17.665 1.00 26.25 ? 49   GLN B C   1 
ATOM   897  O O   . GLN B 1 49 ? -19.537 -0.750  -16.465 1.00 28.69 ? 49   GLN B O   1 
ATOM   898  C CB  . GLN B 1 49 ? -21.548 0.228   -18.650 1.00 26.10 ? 49   GLN B CB  1 
ATOM   899  C CG  . GLN B 1 49 ? -22.995 0.190   -19.122 1.00 34.32 ? 49   GLN B CG  1 
ATOM   900  C CD  . GLN B 1 49 ? -23.140 0.497   -20.604 1.00 49.93 ? 49   GLN B CD  1 
ATOM   901  O OE1 . GLN B 1 49 ? -22.454 -0.091  -21.444 1.00 50.47 ? 49   GLN B OE1 1 
ATOM   902  N NE2 . GLN B 1 49 ? -24.039 1.426   -20.933 1.00 60.44 ? 49   GLN B NE2 1 
ATOM   903  N N   . VAL B 1 50 ? -18.547 -1.218  -18.419 1.00 25.21 ? 50   VAL B N   1 
ATOM   904  C CA  . VAL B 1 50 ? -17.242 -1.388  -17.803 1.00 21.65 ? 50   VAL B CA  1 
ATOM   905  C C   . VAL B 1 50 ? -16.183 -0.530  -18.469 1.00 20.38 ? 50   VAL B C   1 
ATOM   906  O O   . VAL B 1 50 ? -15.914 -0.676  -19.645 1.00 23.72 ? 50   VAL B O   1 
ATOM   907  C CB  . VAL B 1 50 ? -16.786 -2.873  -17.861 1.00 32.17 ? 50   VAL B CB  1 
ATOM   908  C CG1 . VAL B 1 50 ? -15.574 -3.112  -16.967 1.00 19.65 ? 50   VAL B CG1 1 
ATOM   909  C CG2 . VAL B 1 50 ? -17.920 -3.814  -17.471 1.00 25.17 ? 50   VAL B CG2 1 
ATOM   910  N N   . CYS B 1 51 ? -15.573 0.362   -17.706 1.00 24.87 ? 51   CYS B N   1 
ATOM   911  C CA  . CYS B 1 51 ? -14.441 1.123   -18.205 1.00 22.11 ? 51   CYS B CA  1 
ATOM   912  C C   . CYS B 1 51 ? -13.208 0.217   -18.298 1.00 30.06 ? 51   CYS B C   1 
ATOM   913  O O   . CYS B 1 51 ? -12.889 -0.544  -17.361 1.00 25.96 ? 51   CYS B O   1 
ATOM   914  C CB  . CYS B 1 51 ? -14.181 2.338   -17.311 1.00 18.80 ? 51   CYS B CB  1 
ATOM   915  S SG  . CYS B 1 51 ? -15.508 3.558   -17.371 1.00 23.97 ? 51   CYS B SG  1 
ATOM   916  N N   . ALA B 1 52 ? -12.524 0.300   -19.434 1.00 29.99 ? 52   ALA B N   1 
ATOM   917  C CA  . ALA B 1 52 ? -11.403 -0.586  -19.732 1.00 19.67 ? 52   ALA B CA  1 
ATOM   918  C C   . ALA B 1 52 ? -10.282 0.214   -20.398 1.00 20.72 ? 52   ALA B C   1 
ATOM   919  O O   . ALA B 1 52 ? -10.550 1.091   -21.214 1.00 23.79 ? 52   ALA B O   1 
ATOM   920  C CB  . ALA B 1 52 ? -11.874 -1.699  -20.615 1.00 13.17 ? 52   ALA B CB  1 
ATOM   921  N N   . ASP B 1 53 ? -9.035  -0.062  -20.025 1.00 18.80 ? 53   ASP B N   1 
ATOM   922  C CA  . ASP B 1 53 ? -7.894  0.721   -20.499 1.00 21.62 ? 53   ASP B CA  1 
ATOM   923  C C   . ASP B 1 53 ? -7.527  0.361   -21.946 1.00 26.55 ? 53   ASP B C   1 
ATOM   924  O O   . ASP B 1 53 ? -7.214  -0.793  -22.237 1.00 28.51 ? 53   ASP B O   1 
ATOM   925  C CB  . ASP B 1 53 ? -6.707  0.484   -19.575 1.00 21.46 ? 53   ASP B CB  1 
ATOM   926  C CG  . ASP B 1 53 ? -5.484  1.288   -19.963 1.00 28.46 ? 53   ASP B CG  1 
ATOM   927  O OD1 . ASP B 1 53 ? -5.529  1.997   -20.992 1.00 33.03 ? 53   ASP B OD1 1 
ATOM   928  O OD2 . ASP B 1 53 ? -4.466  1.205   -19.235 1.00 29.46 ? 53   ASP B OD2 1 
ATOM   929  N N   . PRO B 1 54 ? -7.556  1.354   -22.853 1.00 21.50 ? 54   PRO B N   1 
ATOM   930  C CA  . PRO B 1 54 ? -7.342  1.119   -24.286 1.00 27.38 ? 54   PRO B CA  1 
ATOM   931  C C   . PRO B 1 54 ? -5.898  0.757   -24.594 1.00 27.54 ? 54   PRO B C   1 
ATOM   932  O O   . PRO B 1 54 ? -5.603  0.300   -25.695 1.00 29.47 ? 54   PRO B O   1 
ATOM   933  C CB  . PRO B 1 54 ? -7.679  2.479   -24.933 1.00 24.23 ? 54   PRO B CB  1 
ATOM   934  C CG  . PRO B 1 54 ? -8.333  3.299   -23.857 1.00 22.57 ? 54   PRO B CG  1 
ATOM   935  C CD  . PRO B 1 54 ? -7.813  2.775   -22.561 1.00 24.82 ? 54   PRO B CD  1 
ATOM   936  N N   . SER B 1 55 ? -5.005  0.973   -23.638 1.00 28.23 ? 55   SER B N   1 
ATOM   937  C CA  . SER B 1 55 ? -3.599  0.659   -23.843 1.00 24.57 ? 55   SER B CA  1 
ATOM   938  C C   . SER B 1 55 ? -3.315  -0.832  -23.787 1.00 27.10 ? 55   SER B C   1 
ATOM   939  O O   . SER B 1 55 ? -2.225  -1.265  -24.135 1.00 31.65 ? 55   SER B O   1 
ATOM   940  C CB  . SER B 1 55 ? -2.741  1.368   -22.805 1.00 28.72 ? 55   SER B CB  1 
ATOM   941  O OG  . SER B 1 55 ? -2.229  2.573   -23.341 1.00 50.58 ? 55   SER B OG  1 
ATOM   942  N N   . GLU B 1 56 ? -4.289  -1.621  -23.350 1.00 25.52 ? 56   GLU B N   1 
ATOM   943  C CA  . GLU B 1 56 ? -4.053  -3.044  -23.138 1.00 30.90 ? 56   GLU B CA  1 
ATOM   944  C C   . GLU B 1 56 ? -4.466  -3.940  -24.307 1.00 32.16 ? 56   GLU B C   1 
ATOM   945  O O   . GLU B 1 56 ? -5.501  -3.743  -24.939 1.00 30.14 ? 56   GLU B O   1 
ATOM   946  C CB  . GLU B 1 56 ? -4.737  -3.504  -21.861 1.00 23.57 ? 56   GLU B CB  1 
ATOM   947  C CG  . GLU B 1 56 ? -4.481  -2.592  -20.715 1.00 31.66 ? 56   GLU B CG  1 
ATOM   948  C CD  . GLU B 1 56 ? -4.998  -3.161  -19.428 1.00 43.41 ? 56   GLU B CD  1 
ATOM   949  O OE1 . GLU B 1 56 ? -5.537  -4.287  -19.467 1.00 53.30 ? 56   GLU B OE1 1 
ATOM   950  O OE2 . GLU B 1 56 ? -4.865  -2.488  -18.382 1.00 50.56 ? 56   GLU B OE2 1 
ATOM   951  N N   . SER B 1 57 ? -3.637  -4.938  -24.563 1.00 27.72 ? 57   SER B N   1 
ATOM   952  C CA  . SER B 1 57 ? -3.840  -5.852  -25.663 1.00 31.53 ? 57   SER B CA  1 
ATOM   953  C C   . SER B 1 57 ? -5.281  -6.357  -25.731 1.00 27.58 ? 57   SER B C   1 
ATOM   954  O O   . SER B 1 57 ? -5.954  -6.196  -26.742 1.00 25.15 ? 57   SER B O   1 
ATOM   955  C CB  . SER B 1 57 ? -2.866  -7.027  -25.527 1.00 31.54 ? 57   SER B CB  1 
ATOM   956  O OG  . SER B 1 57 ? -3.154  -8.044  -26.469 1.00 40.75 ? 57   SER B OG  1 
ATOM   957  N N   . TRP B 1 58 ? -5.754  -6.961  -24.649 1.00 26.86 ? 58   TRP B N   1 
ATOM   958  C CA  . TRP B 1 58 ? -7.042  -7.636  -24.664 1.00 18.99 ? 58   TRP B CA  1 
ATOM   959  C C   . TRP B 1 58 ? -8.193  -6.718  -25.050 1.00 27.63 ? 58   TRP B C   1 
ATOM   960  O O   . TRP B 1 58 ? -9.125  -7.148  -25.729 1.00 30.94 ? 58   TRP B O   1 
ATOM   961  C CB  . TRP B 1 58 ? -7.309  -8.335  -23.324 1.00 21.65 ? 58   TRP B CB  1 
ATOM   962  C CG  . TRP B 1 58 ? -7.793  -7.470  -22.214 1.00 20.80 ? 58   TRP B CG  1 
ATOM   963  C CD1 . TRP B 1 58 ? -7.030  -6.874  -21.246 1.00 22.34 ? 58   TRP B CD1 1 
ATOM   964  C CD2 . TRP B 1 58 ? -9.156  -7.123  -21.906 1.00 22.52 ? 58   TRP B CD2 1 
ATOM   965  N NE1 . TRP B 1 58 ? -7.825  -6.173  -20.380 1.00 25.95 ? 58   TRP B NE1 1 
ATOM   966  C CE2 . TRP B 1 58 ? -9.131  -6.307  -20.766 1.00 27.85 ? 58   TRP B CE2 1 
ATOM   967  C CE3 . TRP B 1 58 ? -10.384 -7.425  -22.511 1.00 20.86 ? 58   TRP B CE3 1 
ATOM   968  C CZ2 . TRP B 1 58 ? -10.304 -5.772  -20.200 1.00 24.98 ? 58   TRP B CZ2 1 
ATOM   969  C CZ3 . TRP B 1 58 ? -11.542 -6.897  -21.947 1.00 20.94 ? 58   TRP B CZ3 1 
ATOM   970  C CH2 . TRP B 1 58 ? -11.496 -6.083  -20.802 1.00 19.67 ? 58   TRP B CH2 1 
ATOM   971  N N   . VAL B 1 59 ? -8.122  -5.457  -24.626 1.00 25.27 ? 59   VAL B N   1 
ATOM   972  C CA  . VAL B 1 59 ? -9.136  -4.457  -24.949 1.00 23.18 ? 59   VAL B CA  1 
ATOM   973  C C   . VAL B 1 59 ? -9.203  -4.180  -26.451 1.00 30.82 ? 59   VAL B C   1 
ATOM   974  O O   . VAL B 1 59 ? -10.275 -4.198  -27.055 1.00 30.70 ? 59   VAL B O   1 
ATOM   975  C CB  . VAL B 1 59 ? -8.850  -3.127  -24.210 1.00 29.83 ? 59   VAL B CB  1 
ATOM   976  C CG1 . VAL B 1 59 ? -9.860  -2.069  -24.591 1.00 23.53 ? 59   VAL B CG1 1 
ATOM   977  C CG2 . VAL B 1 59 ? -8.870  -3.340  -22.706 1.00 31.06 ? 59   VAL B CG2 1 
ATOM   978  N N   . GLN B 1 60 ? -8.045  -3.911  -27.044 1.00 32.70 ? 60   GLN B N   1 
ATOM   979  C CA  . GLN B 1 60 ? -7.934  -3.705  -28.480 1.00 26.74 ? 60   GLN B CA  1 
ATOM   980  C C   . GLN B 1 60 ? -8.428  -4.899  -29.272 1.00 28.55 ? 60   GLN B C   1 
ATOM   981  O O   . GLN B 1 60 ? -9.021  -4.740  -30.328 1.00 32.79 ? 60   GLN B O   1 
ATOM   982  C CB  . GLN B 1 60 ? -6.482  -3.467  -28.843 1.00 23.88 ? 60   GLN B CB  1 
ATOM   983  C CG  . GLN B 1 60 ? -5.742  -2.670  -27.827 1.00 28.60 ? 60   GLN B CG  1 
ATOM   984  C CD  . GLN B 1 60 ? -4.750  -1.734  -28.460 1.00 42.72 ? 60   GLN B CD  1 
ATOM   985  O OE1 . GLN B 1 60 ? -3.744  -1.364  -27.847 1.00 43.26 ? 60   GLN B OE1 1 
ATOM   986  N NE2 . GLN B 1 60 ? -5.024  -1.339  -29.702 1.00 58.97 ? 60   GLN B NE2 1 
ATOM   987  N N   . GLU B 1 61 ? -8.154  -6.095  -28.766 1.00 20.77 ? 61   GLU B N   1 
ATOM   988  C CA  . GLU B 1 61 ? -8.539  -7.317  -29.438 1.00 19.99 ? 61   GLU B CA  1 
ATOM   989  C C   . GLU B 1 61 ? -10.044 -7.418  -29.530 1.00 27.77 ? 61   GLU B C   1 
ATOM   990  O O   . GLU B 1 61 ? -10.579 -7.852  -30.550 1.00 30.15 ? 61   GLU B O   1 
ATOM   991  C CB  . GLU B 1 61 ? -8.019  -8.533  -28.681 1.00 25.62 ? 61   GLU B CB  1 
ATOM   992  C CG  . GLU B 1 61 ? -6.523  -8.583  -28.503 1.00 24.03 ? 61   GLU B CG  1 
ATOM   993  C CD  . GLU B 1 61 ? -5.817  -8.717  -29.821 1.00 45.40 ? 61   GLU B CD  1 
ATOM   994  O OE1 . GLU B 1 61 ? -6.421  -9.295  -30.760 1.00 33.36 ? 61   GLU B OE1 1 
ATOM   995  O OE2 . GLU B 1 61 ? -4.660  -8.251  -29.914 1.00 58.43 ? 61   GLU B OE2 1 
ATOM   996  N N   . TYR B 1 62 ? -10.725 -7.046  -28.451 1.00 27.88 ? 62   TYR B N   1 
ATOM   997  C CA  . TYR B 1 62 ? -12.186 -7.124  -28.398 1.00 28.01 ? 62   TYR B CA  1 
ATOM   998  C C   . TYR B 1 62 ? -12.776 -5.997  -29.237 1.00 22.84 ? 62   TYR B C   1 
ATOM   999  O O   . TYR B 1 62 ? -13.823 -6.139  -29.875 1.00 22.75 ? 62   TYR B O   1 
ATOM   1000 C CB  . TYR B 1 62 ? -12.689 -6.983  -26.956 1.00 23.25 ? 62   TYR B CB  1 
ATOM   1001 C CG  . TYR B 1 62 ? -12.478 -8.184  -26.077 1.00 21.02 ? 62   TYR B CG  1 
ATOM   1002 C CD1 . TYR B 1 62 ? -13.316 -8.428  -25.005 1.00 20.48 ? 62   TYR B CD1 1 
ATOM   1003 C CD2 . TYR B 1 62 ? -11.446 -9.077  -26.317 1.00 30.13 ? 62   TYR B CD2 1 
ATOM   1004 C CE1 . TYR B 1 62 ? -13.133 -9.524  -24.191 1.00 28.46 ? 62   TYR B CE1 1 
ATOM   1005 C CE2 . TYR B 1 62 ? -11.252 -10.183 -25.507 1.00 23.45 ? 62   TYR B CE2 1 
ATOM   1006 C CZ  . TYR B 1 62 ? -12.097 -10.402 -24.447 1.00 28.54 ? 62   TYR B CZ  1 
ATOM   1007 O OH  . TYR B 1 62 ? -11.917 -11.500 -23.631 1.00 26.69 ? 62   TYR B OH  1 
ATOM   1008 N N   . VAL B 1 63 ? -12.107 -4.860  -29.216 1.00 16.10 ? 63   VAL B N   1 
ATOM   1009 C CA  . VAL B 1 63 ? -12.568 -3.746  -30.014 1.00 26.40 ? 63   VAL B CA  1 
ATOM   1010 C C   . VAL B 1 63 ? -12.492 -4.097  -31.495 1.00 27.66 ? 63   VAL B C   1 
ATOM   1011 O O   . VAL B 1 63 ? -13.499 -4.018  -32.194 1.00 32.44 ? 63   VAL B O   1 
ATOM   1012 C CB  . VAL B 1 63 ? -11.822 -2.459  -29.673 1.00 25.22 ? 63   VAL B CB  1 
ATOM   1013 C CG1 . VAL B 1 63 ? -11.991 -1.447  -30.785 1.00 29.01 ? 63   VAL B CG1 1 
ATOM   1014 C CG2 . VAL B 1 63 ? -12.364 -1.915  -28.367 1.00 24.40 ? 63   VAL B CG2 1 
ATOM   1015 N N   . TYR B 1 64 ? -11.320 -4.528  -31.955 1.00 22.65 ? 64   TYR B N   1 
ATOM   1016 C CA  . TYR B 1 64 ? -11.174 -5.031  -33.311 1.00 25.88 ? 64   TYR B CA  1 
ATOM   1017 C C   . TYR B 1 64 ? -12.209 -6.078  -33.681 1.00 28.66 ? 64   TYR B C   1 
ATOM   1018 O O   . TYR B 1 64 ? -12.715 -6.095  -34.800 1.00 28.70 ? 64   TYR B O   1 
ATOM   1019 C CB  . TYR B 1 64 ? -9.777  -5.587  -33.527 1.00 32.04 ? 64   TYR B CB  1 
ATOM   1020 C CG  . TYR B 1 64 ? -8.824  -4.562  -34.087 1.00 40.80 ? 64   TYR B CG  1 
ATOM   1021 C CD1 . TYR B 1 64 ? -8.253  -3.591  -33.266 1.00 33.88 ? 64   TYR B CD1 1 
ATOM   1022 C CD2 . TYR B 1 64 ? -8.509  -4.551  -35.445 1.00 41.15 ? 64   TYR B CD2 1 
ATOM   1023 C CE1 . TYR B 1 64 ? -7.384  -2.644  -33.781 1.00 34.80 ? 64   TYR B CE1 1 
ATOM   1024 C CE2 . TYR B 1 64 ? -7.643  -3.608  -35.971 1.00 37.95 ? 64   TYR B CE2 1 
ATOM   1025 C CZ  . TYR B 1 64 ? -7.083  -2.662  -35.140 1.00 43.75 ? 64   TYR B CZ  1 
ATOM   1026 O OH  . TYR B 1 64 ? -6.227  -1.735  -35.685 1.00 45.66 ? 64   TYR B OH  1 
ATOM   1027 N N   . ASP B 1 65 ? -12.544 -6.940  -32.736 1.00 27.58 ? 65   ASP B N   1 
ATOM   1028 C CA  . ASP B 1 65 ? -13.416 -8.058  -33.056 1.00 25.31 ? 65   ASP B CA  1 
ATOM   1029 C C   . ASP B 1 65 ? -14.870 -7.633  -33.141 1.00 30.59 ? 65   ASP B C   1 
ATOM   1030 O O   . ASP B 1 65 ? -15.609 -8.128  -33.990 1.00 34.20 ? 65   ASP B O   1 
ATOM   1031 C CB  . ASP B 1 65 ? -13.261 -9.186  -32.039 1.00 21.30 ? 65   ASP B CB  1 
ATOM   1032 C CG  . ASP B 1 65 ? -14.025 -10.431 -32.436 1.00 29.22 ? 65   ASP B CG  1 
ATOM   1033 O OD1 . ASP B 1 65 ? -13.618 -11.096 -33.418 1.00 22.38 ? 65   ASP B OD1 1 
ATOM   1034 O OD2 . ASP B 1 65 ? -15.034 -10.742 -31.767 1.00 25.87 ? 65   ASP B OD2 1 
ATOM   1035 N N   . LEU B 1 66 ? -15.286 -6.727  -32.257 1.00 28.93 ? 66   LEU B N   1 
ATOM   1036 C CA  . LEU B 1 66 ? -16.686 -6.299  -32.223 1.00 27.60 ? 66   LEU B CA  1 
ATOM   1037 C C   . LEU B 1 66 ? -16.973 -5.409  -33.412 1.00 26.80 ? 66   LEU B C   1 
ATOM   1038 O O   . LEU B 1 66 ? -18.077 -5.402  -33.945 1.00 32.03 ? 66   LEU B O   1 
ATOM   1039 C CB  . LEU B 1 66 ? -17.025 -5.561  -30.925 1.00 24.85 ? 66   LEU B CB  1 
ATOM   1040 C CG  . LEU B 1 66 ? -17.152 -6.347  -29.617 1.00 26.35 ? 66   LEU B CG  1 
ATOM   1041 C CD1 . LEU B 1 66 ? -16.957 -5.401  -28.433 1.00 24.13 ? 66   LEU B CD1 1 
ATOM   1042 C CD2 . LEU B 1 66 ? -18.483 -7.087  -29.518 1.00 14.27 ? 66   LEU B CD2 1 
ATOM   1043 N N   . GLU B 1 67 ? -15.959 -4.659  -33.818 1.00 24.81 ? 67   GLU B N   1 
ATOM   1044 C CA  . GLU B 1 67 ? -16.047 -3.796  -34.982 1.00 28.72 ? 67   GLU B CA  1 
ATOM   1045 C C   . GLU B 1 67 ? -16.108 -4.602  -36.283 1.00 39.73 ? 67   GLU B C   1 
ATOM   1046 O O   . GLU B 1 67 ? -16.998 -4.403  -37.108 1.00 38.25 ? 67   GLU B O   1 
ATOM   1047 C CB  . GLU B 1 67 ? -14.835 -2.864  -35.022 1.00 24.01 ? 67   GLU B CB  1 
ATOM   1048 C CG  . GLU B 1 67 ? -14.951 -1.743  -36.047 1.00 45.82 ? 67   GLU B CG  1 
ATOM   1049 C CD  . GLU B 1 67 ? -16.057 -0.742  -35.709 1.00 42.97 ? 67   GLU B CD  1 
ATOM   1050 O OE1 . GLU B 1 67 ? -16.987 -0.564  -36.529 1.00 34.48 ? 67   GLU B OE1 1 
ATOM   1051 O OE2 . GLU B 1 67 ? -16.002 -0.140  -34.617 1.00 47.73 ? 67   GLU B OE2 1 
ATOM   1052 N N   . LEU B 1 68 ? -15.158 -5.519  -36.460 1.00 38.17 ? 68   LEU B N   1 
ATOM   1053 C CA  . LEU B 1 68 ? -14.999 -6.199  -37.740 1.00 33.33 ? 68   LEU B CA  1 
ATOM   1054 C C   . LEU B 1 68 ? -15.901 -7.426  -37.942 1.00 37.30 ? 68   LEU B C   1 
ATOM   1055 O O   . LEU B 1 68 ? -16.435 -7.610  -39.028 1.00 42.04 ? 68   LEU B O   1 
ATOM   1056 C CB  . LEU B 1 68 ? -13.527 -6.529  -37.996 1.00 17.56 ? 68   LEU B CB  1 
ATOM   1057 C CG  . LEU B 1 68 ? -12.692 -5.261  -37.844 1.00 31.00 ? 68   LEU B CG  1 
ATOM   1058 C CD1 . LEU B 1 68 ? -11.255 -5.445  -38.287 1.00 35.60 ? 68   LEU B CD1 1 
ATOM   1059 C CD2 . LEU B 1 68 ? -13.334 -4.146  -38.636 1.00 38.27 ? 68   LEU B CD2 1 
ATOM   1060 N N   . ASN B 1 69 ? -16.089 -8.245  -36.911 1.00 36.06 ? 69   ASN B N   1 
ATOM   1061 C CA  . ASN B 1 69 ? -16.891 -9.464  -37.050 1.00 29.68 ? 69   ASN B CA  1 
ATOM   1062 C C   . ASN B 1 69 ? -18.307 -9.317  -36.521 1.00 26.41 ? 69   ASN B C   1 
ATOM   1063 O O   . ASN B 1 69 ? -18.777 -8.197  -36.315 1.00 40.62 ? 69   ASN B O   1 
ATOM   1064 C CB  . ASN B 1 69 ? -16.202 -10.632 -36.368 1.00 27.24 ? 69   ASN B CB  1 
ATOM   1065 C CG  . ASN B 1 69 ? -14.775 -10.807 -36.827 1.00 26.74 ? 69   ASN B CG  1 
ATOM   1066 O OD1 . ASN B 1 69 ? -14.495 -10.839 -38.018 1.00 42.30 ? 69   ASN B OD1 1 
ATOM   1067 N ND2 . ASN B 1 69 ? -13.863 -10.924 -35.882 1.00 30.47 ? 69   ASN B ND2 1 
ATOM   1068 N N   . GLY C 1 4  ? -21.887 6.648   -27.199 1.00 36.23 ? 4    GLY C N   1 
ATOM   1069 C CA  . GLY C 1 4  ? -21.260 7.264   -28.352 1.00 49.76 ? 4    GLY C CA  1 
ATOM   1070 C C   . GLY C 1 4  ? -19.954 7.951   -27.983 1.00 59.61 ? 4    GLY C C   1 
ATOM   1071 O O   . GLY C 1 4  ? -19.656 8.118   -26.794 1.00 39.54 ? 4    GLY C O   1 
ATOM   1072 N N   . SER C 1 5  ? -19.193 8.359   -29.004 1.00 51.25 ? 5    SER C N   1 
ATOM   1073 C CA  . SER C 1 5  ? -17.835 8.894   -28.839 1.00 40.92 ? 5    SER C CA  1 
ATOM   1074 C C   . SER C 1 5  ? -17.737 10.405  -29.109 1.00 45.97 ? 5    SER C C   1 
ATOM   1075 O O   . SER C 1 5  ? -17.962 11.226  -28.213 1.00 43.82 ? 5    SER C O   1 
ATOM   1076 C CB  . SER C 1 5  ? -16.896 8.161   -29.788 1.00 37.04 ? 5    SER C CB  1 
ATOM   1077 O OG  . SER C 1 5  ? -17.450 8.133   -31.092 1.00 38.10 ? 5    SER C OG  1 
ATOM   1078 N N   . ASP C 1 6  ? -17.383 10.759  -30.346 1.00 42.20 ? 6    ASP C N   1 
ATOM   1079 C CA  . ASP C 1 6  ? -17.408 12.148  -30.801 1.00 31.28 ? 6    ASP C CA  1 
ATOM   1080 C C   . ASP C 1 6  ? -18.286 12.266  -32.043 1.00 31.86 ? 6    ASP C C   1 
ATOM   1081 O O   . ASP C 1 6  ? -17.822 12.708  -33.097 1.00 28.43 ? 6    ASP C O   1 
ATOM   1082 C CB  . ASP C 1 6  ? -15.998 12.648  -31.121 1.00 29.54 ? 6    ASP C CB  1 
ATOM   1083 C CG  . ASP C 1 6  ? -15.047 12.489  -29.959 1.00 33.50 ? 6    ASP C CG  1 
ATOM   1084 O OD1 . ASP C 1 6  ? -15.170 13.255  -28.987 1.00 38.61 ? 6    ASP C OD1 1 
ATOM   1085 O OD2 . ASP C 1 6  ? -14.176 11.600  -30.016 1.00 37.19 ? 6    ASP C OD2 1 
ATOM   1086 N N   . PRO C 1 7  ? -19.562 11.869  -31.921 1.00 28.99 ? 7    PRO C N   1 
ATOM   1087 C CA  . PRO C 1 7  ? -20.498 11.898  -33.048 1.00 23.66 ? 7    PRO C CA  1 
ATOM   1088 C C   . PRO C 1 7  ? -20.945 13.332  -33.341 1.00 29.85 ? 7    PRO C C   1 
ATOM   1089 O O   . PRO C 1 7  ? -20.804 14.189  -32.480 1.00 32.43 ? 7    PRO C O   1 
ATOM   1090 C CB  . PRO C 1 7  ? -21.684 11.089  -32.523 1.00 28.20 ? 7    PRO C CB  1 
ATOM   1091 C CG  . PRO C 1 7  ? -21.686 11.358  -31.049 1.00 23.12 ? 7    PRO C CG  1 
ATOM   1092 C CD  . PRO C 1 7  ? -20.232 11.512  -30.653 1.00 23.16 ? 7    PRO C CD  1 
ATOM   1093 N N   . PRO C 1 8  ? -21.477 13.592  -34.544 1.00 31.30 ? 8    PRO C N   1 
ATOM   1094 C CA  . PRO C 1 8  ? -21.932 14.948  -34.875 1.00 29.27 ? 8    PRO C CA  1 
ATOM   1095 C C   . PRO C 1 8  ? -23.157 15.348  -34.066 1.00 26.28 ? 8    PRO C C   1 
ATOM   1096 O O   . PRO C 1 8  ? -23.899 14.499  -33.592 1.00 31.74 ? 8    PRO C O   1 
ATOM   1097 C CB  . PRO C 1 8  ? -22.306 14.835  -36.359 1.00 24.52 ? 8    PRO C CB  1 
ATOM   1098 C CG  . PRO C 1 8  ? -22.663 13.391  -36.524 1.00 34.93 ? 8    PRO C CG  1 
ATOM   1099 C CD  . PRO C 1 8  ? -21.661 12.662  -35.671 1.00 22.24 ? 8    PRO C CD  1 
ATOM   1100 N N   . THR C 1 9  ? -23.354 16.650  -33.930 1.00 24.14 ? 9    THR C N   1 
ATOM   1101 C CA  . THR C 1 9  ? -24.503 17.221  -33.263 1.00 21.81 ? 9    THR C CA  1 
ATOM   1102 C C   . THR C 1 9  ? -25.572 17.589  -34.296 1.00 23.87 ? 9    THR C C   1 
ATOM   1103 O O   . THR C 1 9  ? -25.256 17.989  -35.421 1.00 16.97 ? 9    THR C O   1 
ATOM   1104 C CB  . THR C 1 9  ? -24.081 18.513  -32.520 1.00 29.19 ? 9    THR C CB  1 
ATOM   1105 O OG1 . THR C 1 9  ? -22.797 18.317  -31.914 1.00 27.36 ? 9    THR C OG1 1 
ATOM   1106 C CG2 . THR C 1 9  ? -25.100 18.906  -31.446 1.00 26.44 ? 9    THR C CG2 1 
ATOM   1107 N N   . ALA C 1 10 ? -26.836 17.461  -33.900 1.00 22.64 ? 10   ALA C N   1 
ATOM   1108 C CA  . ALA C 1 10 ? -27.955 17.917  -34.714 1.00 20.72 ? 10   ALA C CA  1 
ATOM   1109 C C   . ALA C 1 10 ? -28.223 19.409  -34.497 1.00 21.69 ? 10   ALA C C   1 
ATOM   1110 O O   . ALA C 1 10 ? -28.369 19.858  -33.364 1.00 26.26 ? 10   ALA C O   1 
ATOM   1111 C CB  . ALA C 1 10 ? -29.194 17.108  -34.390 1.00 21.85 ? 10   ALA C CB  1 
ATOM   1112 N N   . CYS C 1 11 ? -28.297 20.172  -35.582 1.00 19.69 ? 11   CYS C N   1 
ATOM   1113 C CA  . CYS C 1 11 ? -28.562 21.613  -35.503 1.00 19.45 ? 11   CYS C CA  1 
ATOM   1114 C C   . CYS C 1 11 ? -29.614 22.049  -36.522 1.00 22.70 ? 11   CYS C C   1 
ATOM   1115 O O   . CYS C 1 11 ? -29.636 21.546  -37.646 1.00 20.85 ? 11   CYS C O   1 
ATOM   1116 C CB  . CYS C 1 11 ? -27.282 22.408  -35.771 1.00 25.71 ? 11   CYS C CB  1 
ATOM   1117 S SG  . CYS C 1 11 ? -26.064 22.345  -34.469 1.00 37.53 ? 11   CYS C SG  1 
ATOM   1118 N N   . CYS C 1 12 ? -30.459 23.003  -36.142 1.00 16.43 ? 12   CYS C N   1 
ATOM   1119 C CA  . CYS C 1 12 ? -31.441 23.553  -37.072 1.00 21.00 ? 12   CYS C CA  1 
ATOM   1120 C C   . CYS C 1 12 ? -31.000 24.869  -37.718 1.00 22.14 ? 12   CYS C C   1 
ATOM   1121 O O   . CYS C 1 12 ? -30.515 25.784  -37.054 1.00 21.88 ? 12   CYS C O   1 
ATOM   1122 C CB  . CYS C 1 12 ? -32.816 23.696  -36.414 1.00 17.23 ? 12   CYS C CB  1 
ATOM   1123 S SG  . CYS C 1 12 ? -33.612 22.079  -36.211 1.00 33.48 ? 12   CYS C SG  1 
ATOM   1124 N N   . PHE C 1 13 ? -31.159 24.952  -39.030 1.00 20.60 ? 13   PHE C N   1 
ATOM   1125 C CA  . PHE C 1 13 ? -30.811 26.178  -39.727 1.00 26.18 ? 13   PHE C CA  1 
ATOM   1126 C C   . PHE C 1 13 ? -32.045 26.800  -40.374 1.00 26.53 ? 13   PHE C C   1 
ATOM   1127 O O   . PHE C 1 13 ? -31.996 27.933  -40.865 1.00 30.75 ? 13   PHE C O   1 
ATOM   1128 C CB  . PHE C 1 13 ? -29.648 25.952  -40.700 1.00 21.16 ? 13   PHE C CB  1 
ATOM   1129 C CG  . PHE C 1 13 ? -28.365 25.603  -40.007 1.00 20.94 ? 13   PHE C CG  1 
ATOM   1130 C CD1 . PHE C 1 13 ? -27.651 26.567  -39.315 1.00 19.06 ? 13   PHE C CD1 1 
ATOM   1131 C CD2 . PHE C 1 13 ? -27.895 24.301  -40.000 1.00 25.94 ? 13   PHE C CD2 1 
ATOM   1132 C CE1 . PHE C 1 13 ? -26.469 26.242  -38.658 1.00 19.46 ? 13   PHE C CE1 1 
ATOM   1133 C CE2 . PHE C 1 13 ? -26.718 23.972  -39.342 1.00 18.34 ? 13   PHE C CE2 1 
ATOM   1134 C CZ  . PHE C 1 13 ? -26.003 24.942  -38.682 1.00 17.71 ? 13   PHE C CZ  1 
ATOM   1135 N N   . SER C 1 14 ? -33.166 26.080  -40.322 1.00 17.05 ? 14   SER C N   1 
ATOM   1136 C CA  . SER C 1 14 ? -34.446 26.674  -40.693 1.00 20.85 ? 14   SER C CA  1 
ATOM   1137 C C   . SER C 1 14 ? -35.539 26.086  -39.810 1.00 19.34 ? 14   SER C C   1 
ATOM   1138 O O   . SER C 1 14 ? -35.347 25.039  -39.218 1.00 21.10 ? 14   SER C O   1 
ATOM   1139 C CB  . SER C 1 14 ? -34.754 26.435  -42.178 1.00 21.93 ? 14   SER C CB  1 
ATOM   1140 O OG  . SER C 1 14 ? -34.971 25.052  -42.447 1.00 31.39 ? 14   SER C OG  1 
ATOM   1141 N N   . TYR C 1 15 ? -36.680 26.764  -39.713 1.00 26.42 ? 15   TYR C N   1 
ATOM   1142 C CA  . TYR C 1 15 ? -37.814 26.250  -38.948 1.00 20.59 ? 15   TYR C CA  1 
ATOM   1143 C C   . TYR C 1 15 ? -38.960 25.944  -39.883 1.00 19.07 ? 15   TYR C C   1 
ATOM   1144 O O   . TYR C 1 15 ? -39.164 26.648  -40.858 1.00 27.01 ? 15   TYR C O   1 
ATOM   1145 C CB  . TYR C 1 15 ? -38.310 27.283  -37.937 1.00 24.95 ? 15   TYR C CB  1 
ATOM   1146 C CG  . TYR C 1 15 ? -37.314 27.768  -36.908 1.00 27.63 ? 15   TYR C CG  1 
ATOM   1147 C CD1 . TYR C 1 15 ? -36.623 26.884  -36.089 1.00 15.28 ? 15   TYR C CD1 1 
ATOM   1148 C CD2 . TYR C 1 15 ? -37.109 29.130  -36.723 1.00 24.63 ? 15   TYR C CD2 1 
ATOM   1149 C CE1 . TYR C 1 15 ? -35.731 27.356  -35.130 1.00 22.48 ? 15   TYR C CE1 1 
ATOM   1150 C CE2 . TYR C 1 15 ? -36.230 29.604  -35.776 1.00 21.36 ? 15   TYR C CE2 1 
ATOM   1151 C CZ  . TYR C 1 15 ? -35.543 28.722  -34.985 1.00 27.02 ? 15   TYR C CZ  1 
ATOM   1152 O OH  . TYR C 1 15 ? -34.669 29.228  -34.056 1.00 29.84 ? 15   TYR C OH  1 
ATOM   1153 N N   . THR C 1 16 ? -39.748 24.926  -39.581 1.00 20.40 ? 16   THR C N   1 
ATOM   1154 C CA  . THR C 1 16 ? -40.862 24.605  -40.458 1.00 20.06 ? 16   THR C CA  1 
ATOM   1155 C C   . THR C 1 16 ? -41.866 25.754  -40.503 1.00 26.86 ? 16   THR C C   1 
ATOM   1156 O O   . THR C 1 16 ? -42.047 26.471  -39.518 1.00 35.69 ? 16   THR C O   1 
ATOM   1157 C CB  . THR C 1 16 ? -41.572 23.307  -40.046 1.00 26.13 ? 16   THR C CB  1 
ATOM   1158 O OG1 . THR C 1 16 ? -42.494 22.924  -41.072 1.00 30.66 ? 16   THR C OG1 1 
ATOM   1159 C CG2 . THR C 1 16 ? -42.327 23.484  -38.734 1.00 22.98 ? 16   THR C CG2 1 
ATOM   1160 N N   . ALA C 1 17 ? -42.514 25.930  -41.647 1.00 25.41 ? 17   ALA C N   1 
ATOM   1161 C CA  . ALA C 1 17 ? -43.487 26.997  -41.810 1.00 15.80 ? 17   ALA C CA  1 
ATOM   1162 C C   . ALA C 1 17 ? -44.883 26.421  -41.770 1.00 27.12 ? 17   ALA C C   1 
ATOM   1163 O O   . ALA C 1 17 ? -45.857 27.161  -41.724 1.00 32.08 ? 17   ALA C O   1 
ATOM   1164 C CB  . ALA C 1 17 ? -43.269 27.715  -43.112 1.00 14.14 ? 17   ALA C CB  1 
ATOM   1165 N N   . ARG C 1 18 ? -44.981 25.098  -41.791 1.00 32.49 ? 18   ARG C N   1 
ATOM   1166 C CA  . ARG C 1 18 ? -46.274 24.429  -41.771 1.00 33.12 ? 18   ARG C CA  1 
ATOM   1167 C C   . ARG C 1 18 ? -46.436 23.675  -40.460 1.00 37.59 ? 18   ARG C C   1 
ATOM   1168 O O   . ARG C 1 18 ? -45.551 22.925  -40.058 1.00 35.97 ? 18   ARG C O   1 
ATOM   1169 C CB  . ARG C 1 18 ? -46.387 23.471  -42.952 1.00 39.83 ? 18   ARG C CB  1 
ATOM   1170 C CG  . ARG C 1 18 ? -47.772 23.411  -43.586 1.00 52.43 ? 18   ARG C CG  1 
ATOM   1171 C CD  . ARG C 1 18 ? -47.736 22.717  -44.955 1.00 54.09 ? 18   ARG C CD  1 
ATOM   1172 N NE  . ARG C 1 18 ? -47.556 23.658  -46.065 1.00 72.78 ? 18   ARG C NE  1 
ATOM   1173 C CZ  . ARG C 1 18 ? -46.387 23.952  -46.634 1.00 71.38 ? 18   ARG C CZ  1 
ATOM   1174 N NH1 . ARG C 1 18 ? -45.266 23.383  -46.199 1.00 63.51 ? 18   ARG C NH1 1 
ATOM   1175 N NH2 . ARG C 1 18 ? -46.339 24.818  -47.642 1.00 60.15 ? 18   ARG C NH2 1 
ATOM   1176 N N   . LYS C 1 19 ? -47.557 23.886  -39.781 1.00 49.33 ? 19   LYS C N   1 
ATOM   1177 C CA  . LYS C 1 19 ? -47.796 23.211  -38.506 1.00 44.56 ? 19   LYS C CA  1 
ATOM   1178 C C   . LYS C 1 19 ? -47.932 21.697  -38.690 1.00 42.42 ? 19   LYS C C   1 
ATOM   1179 O O   . LYS C 1 19 ? -48.613 21.234  -39.603 1.00 48.67 ? 19   LYS C O   1 
ATOM   1180 C CB  . LYS C 1 19 ? -49.035 23.769  -37.805 1.00 33.44 ? 19   LYS C CB  1 
ATOM   1181 C CG  . LYS C 1 19 ? -49.218 23.176  -36.430 1.00 38.03 ? 19   LYS C CG  1 
ATOM   1182 C CD  . LYS C 1 19 ? -50.509 23.598  -35.773 1.00 39.50 ? 19   LYS C CD  1 
ATOM   1183 C CE  . LYS C 1 19 ? -51.331 22.379  -35.387 1.00 35.07 ? 19   LYS C CE  1 
ATOM   1184 N NZ  . LYS C 1 19 ? -52.394 22.699  -34.389 1.00 51.41 ? 19   LYS C NZ  1 
ATOM   1185 N N   . LEU C 1 20 ? -47.263 20.933  -37.831 1.00 38.47 ? 20   LEU C N   1 
ATOM   1186 C CA  . LEU C 1 20 ? -47.289 19.476  -37.899 1.00 31.38 ? 20   LEU C CA  1 
ATOM   1187 C C   . LEU C 1 20 ? -48.548 18.942  -37.235 1.00 38.65 ? 20   LEU C C   1 
ATOM   1188 O O   . LEU C 1 20 ? -48.821 19.273  -36.082 1.00 39.68 ? 20   LEU C O   1 
ATOM   1189 C CB  . LEU C 1 20 ? -46.104 18.914  -37.133 1.00 23.16 ? 20   LEU C CB  1 
ATOM   1190 C CG  . LEU C 1 20 ? -44.895 18.325  -37.831 1.00 23.87 ? 20   LEU C CG  1 
ATOM   1191 C CD1 . LEU C 1 20 ? -43.930 17.864  -36.764 1.00 27.16 ? 20   LEU C CD1 1 
ATOM   1192 C CD2 . LEU C 1 20 ? -45.269 17.163  -38.725 1.00 24.32 ? 20   LEU C CD2 1 
ATOM   1193 N N   . PRO C 1 21 ? -49.316 18.108  -37.948 1.00 32.51 ? 21   PRO C N   1 
ATOM   1194 C CA  . PRO C 1 21 ? -50.436 17.427  -37.298 1.00 32.80 ? 21   PRO C CA  1 
ATOM   1195 C C   . PRO C 1 21 ? -49.986 16.789  -35.996 1.00 35.00 ? 21   PRO C C   1 
ATOM   1196 O O   . PRO C 1 21 ? -49.040 16.004  -35.990 1.00 38.02 ? 21   PRO C O   1 
ATOM   1197 C CB  . PRO C 1 21 ? -50.809 16.349  -38.303 1.00 32.18 ? 21   PRO C CB  1 
ATOM   1198 C CG  . PRO C 1 21 ? -50.465 16.970  -39.617 1.00 38.62 ? 21   PRO C CG  1 
ATOM   1199 C CD  . PRO C 1 21 ? -49.230 17.787  -39.380 1.00 25.68 ? 21   PRO C CD  1 
ATOM   1200 N N   . ARG C 1 22 ? -50.664 17.131  -34.904 1.00 32.82 ? 22   ARG C N   1 
ATOM   1201 C CA  . ARG C 1 22 ? -50.272 16.668  -33.581 1.00 27.43 ? 22   ARG C CA  1 
ATOM   1202 C C   . ARG C 1 22 ? -50.131 15.154  -33.475 1.00 27.22 ? 22   ARG C C   1 
ATOM   1203 O O   . ARG C 1 22 ? -49.244 14.672  -32.786 1.00 34.06 ? 22   ARG C O   1 
ATOM   1204 C CB  . ARG C 1 22 ? -51.256 17.169  -32.525 1.00 27.24 ? 22   ARG C CB  1 
ATOM   1205 C CG  . ARG C 1 22 ? -51.000 16.617  -31.146 1.00 25.12 ? 22   ARG C CG  1 
ATOM   1206 C CD  . ARG C 1 22 ? -49.652 17.050  -30.655 1.00 32.95 ? 22   ARG C CD  1 
ATOM   1207 N NE  . ARG C 1 22 ? -49.328 16.428  -29.381 1.00 35.71 ? 22   ARG C NE  1 
ATOM   1208 C CZ  . ARG C 1 22 ? -48.728 15.252  -29.262 1.00 33.36 ? 22   ARG C CZ  1 
ATOM   1209 N NH1 . ARG C 1 22 ? -48.382 14.575  -30.343 1.00 30.44 ? 22   ARG C NH1 1 
ATOM   1210 N NH2 . ARG C 1 22 ? -48.468 14.758  -28.062 1.00 36.23 ? 22   ARG C NH2 1 
ATOM   1211 N N   . ASN C 1 23 ? -50.992 14.392  -34.140 1.00 29.76 ? 23   ASN C N   1 
ATOM   1212 C CA  . ASN C 1 23 ? -50.917 12.936  -33.998 1.00 37.54 ? 23   ASN C CA  1 
ATOM   1213 C C   . ASN C 1 23 ? -49.844 12.268  -34.859 1.00 40.09 ? 23   ASN C C   1 
ATOM   1214 O O   . ASN C 1 23 ? -49.615 11.066  -34.757 1.00 38.27 ? 23   ASN C O   1 
ATOM   1215 C CB  . ASN C 1 23 ? -52.285 12.260  -34.153 1.00 30.22 ? 23   ASN C CB  1 
ATOM   1216 C CG  . ASN C 1 23 ? -53.022 12.693  -35.402 1.00 46.79 ? 23   ASN C CG  1 
ATOM   1217 O OD1 . ASN C 1 23 ? -52.445 13.266  -36.323 1.00 44.60 ? 23   ASN C OD1 1 
ATOM   1218 N ND2 . ASN C 1 23 ? -54.316 12.413  -35.439 1.00 59.29 ? 23   ASN C ND2 1 
ATOM   1219 N N   . PHE C 1 24 ? -49.184 13.056  -35.699 1.00 35.70 ? 24   PHE C N   1 
ATOM   1220 C CA  . PHE C 1 24 ? -47.998 12.584  -36.399 1.00 34.45 ? 24   PHE C CA  1 
ATOM   1221 C C   . PHE C 1 24 ? -46.824 12.478  -35.433 1.00 34.42 ? 24   PHE C C   1 
ATOM   1222 O O   . PHE C 1 24 ? -45.906 11.697  -35.656 1.00 33.35 ? 24   PHE C O   1 
ATOM   1223 C CB  . PHE C 1 24 ? -47.606 13.572  -37.491 1.00 38.54 ? 24   PHE C CB  1 
ATOM   1224 C CG  . PHE C 1 24 ? -48.364 13.407  -38.772 1.00 37.66 ? 24   PHE C CG  1 
ATOM   1225 C CD1 . PHE C 1 24 ? -47.922 14.030  -39.931 1.00 32.31 ? 24   PHE C CD1 1 
ATOM   1226 C CD2 . PHE C 1 24 ? -49.509 12.628  -38.828 1.00 43.11 ? 24   PHE C CD2 1 
ATOM   1227 C CE1 . PHE C 1 24 ? -48.605 13.885  -41.123 1.00 31.10 ? 24   PHE C CE1 1 
ATOM   1228 C CE2 . PHE C 1 24 ? -50.202 12.476  -40.020 1.00 47.12 ? 24   PHE C CE2 1 
ATOM   1229 C CZ  . PHE C 1 24 ? -49.753 13.111  -41.169 1.00 43.34 ? 24   PHE C CZ  1 
ATOM   1230 N N   . VAL C 1 25 ? -46.851 13.288  -34.375 1.00 28.03 ? 25   VAL C N   1 
ATOM   1231 C CA  . VAL C 1 25 ? -45.677 13.519  -33.529 1.00 28.02 ? 25   VAL C CA  1 
ATOM   1232 C C   . VAL C 1 25 ? -45.627 12.615  -32.310 1.00 26.11 ? 25   VAL C C   1 
ATOM   1233 O O   . VAL C 1 25 ? -46.542 12.647  -31.492 1.00 30.54 ? 25   VAL C O   1 
ATOM   1234 C CB  . VAL C 1 25 ? -45.628 14.993  -33.031 1.00 26.32 ? 25   VAL C CB  1 
ATOM   1235 C CG1 . VAL C 1 25 ? -44.487 15.196  -32.053 1.00 26.99 ? 25   VAL C CG1 1 
ATOM   1236 C CG2 . VAL C 1 25 ? -45.490 15.941  -34.187 1.00 28.45 ? 25   VAL C CG2 1 
ATOM   1237 N N   . VAL C 1 26 ? -44.559 11.828  -32.173 1.00 23.51 ? 26   VAL C N   1 
ATOM   1238 C CA  . VAL C 1 26 ? -44.418 10.925  -31.016 1.00 26.36 ? 26   VAL C CA  1 
ATOM   1239 C C   . VAL C 1 26 ? -43.339 11.312  -30.019 1.00 27.21 ? 26   VAL C C   1 
ATOM   1240 O O   . VAL C 1 26 ? -43.305 10.769  -28.924 1.00 31.98 ? 26   VAL C O   1 
ATOM   1241 C CB  . VAL C 1 26 ? -44.095 9.472   -31.420 1.00 27.14 ? 26   VAL C CB  1 
ATOM   1242 C CG1 . VAL C 1 26 ? -45.206 8.893   -32.275 1.00 31.02 ? 26   VAL C CG1 1 
ATOM   1243 C CG2 . VAL C 1 26 ? -42.743 9.404   -32.135 1.00 25.47 ? 26   VAL C CG2 1 
ATOM   1244 N N   . ASP C 1 27 ? -42.440 12.213  -30.400 1.00 31.00 ? 27   ASP C N   1 
ATOM   1245 C CA  . ASP C 1 27 ? -41.324 12.586  -29.537 1.00 19.87 ? 27   ASP C CA  1 
ATOM   1246 C C   . ASP C 1 27 ? -40.736 13.903  -29.999 1.00 26.04 ? 27   ASP C C   1 
ATOM   1247 O O   . ASP C 1 27 ? -41.042 14.374  -31.092 1.00 27.92 ? 27   ASP C O   1 
ATOM   1248 C CB  . ASP C 1 27 ? -40.245 11.515  -29.601 1.00 32.19 ? 27   ASP C CB  1 
ATOM   1249 C CG  . ASP C 1 27 ? -39.532 11.333  -28.285 1.00 46.70 ? 27   ASP C CG  1 
ATOM   1250 O OD1 . ASP C 1 27 ? -39.697 12.196  -27.397 1.00 45.33 ? 27   ASP C OD1 1 
ATOM   1251 O OD2 . ASP C 1 27 ? -38.811 10.325  -28.137 1.00 60.04 ? 27   ASP C OD2 1 
ATOM   1252 N N   . TYR C 1 28 ? -39.890 14.502  -29.173 1.00 22.30 ? 28   TYR C N   1 
ATOM   1253 C CA  . TYR C 1 28 ? -39.258 15.768  -29.526 1.00 24.31 ? 28   TYR C CA  1 
ATOM   1254 C C   . TYR C 1 28 ? -37.961 15.864  -28.759 1.00 22.14 ? 28   TYR C C   1 
ATOM   1255 O O   . TYR C 1 28 ? -37.800 15.238  -27.714 1.00 23.80 ? 28   TYR C O   1 
ATOM   1256 C CB  . TYR C 1 28 ? -40.135 16.959  -29.120 1.00 20.44 ? 28   TYR C CB  1 
ATOM   1257 C CG  . TYR C 1 28 ? -39.914 17.365  -27.676 1.00 19.05 ? 28   TYR C CG  1 
ATOM   1258 C CD1 . TYR C 1 28 ? -39.013 18.370  -27.340 1.00 20.61 ? 28   TYR C CD1 1 
ATOM   1259 C CD2 . TYR C 1 28 ? -40.587 16.729  -26.651 1.00 22.37 ? 28   TYR C CD2 1 
ATOM   1260 C CE1 . TYR C 1 28 ? -38.795 18.725  -26.019 1.00 19.34 ? 28   TYR C CE1 1 
ATOM   1261 C CE2 . TYR C 1 28 ? -40.378 17.073  -25.332 1.00 25.67 ? 28   TYR C CE2 1 
ATOM   1262 C CZ  . TYR C 1 28 ? -39.482 18.068  -25.019 1.00 24.17 ? 28   TYR C CZ  1 
ATOM   1263 O OH  . TYR C 1 28 ? -39.282 18.403  -23.695 1.00 21.48 ? 28   TYR C OH  1 
ATOM   1264 N N   . TYR C 1 29 ? -37.038 16.664  -29.261 1.00 18.45 ? 29   TYR C N   1 
ATOM   1265 C CA  . TYR C 1 29 ? -35.868 17.005  -28.477 1.00 17.41 ? 29   TYR C CA  1 
ATOM   1266 C C   . TYR C 1 29 ? -35.481 18.435  -28.752 1.00 17.27 ? 29   TYR C C   1 
ATOM   1267 O O   . TYR C 1 29 ? -35.937 19.031  -29.710 1.00 19.40 ? 29   TYR C O   1 
ATOM   1268 C CB  . TYR C 1 29 ? -34.693 16.059  -28.743 1.00 18.76 ? 29   TYR C CB  1 
ATOM   1269 C CG  . TYR C 1 29 ? -34.118 16.087  -30.146 1.00 24.21 ? 29   TYR C CG  1 
ATOM   1270 C CD1 . TYR C 1 29 ? -33.181 17.042  -30.515 1.00 23.43 ? 29   TYR C CD1 1 
ATOM   1271 C CD2 . TYR C 1 29 ? -34.481 15.125  -31.089 1.00 21.97 ? 29   TYR C CD2 1 
ATOM   1272 C CE1 . TYR C 1 29 ? -32.631 17.054  -31.803 1.00 24.65 ? 29   TYR C CE1 1 
ATOM   1273 C CE2 . TYR C 1 29 ? -33.943 15.127  -32.369 1.00 21.70 ? 29   TYR C CE2 1 
ATOM   1274 C CZ  . TYR C 1 29 ? -33.015 16.090  -32.722 1.00 25.05 ? 29   TYR C CZ  1 
ATOM   1275 O OH  . TYR C 1 29 ? -32.482 16.099  -33.997 1.00 16.91 ? 29   TYR C OH  1 
ATOM   1276 N N   . GLU C 1 30 ? -34.643 18.974  -27.884 1.00 25.63 ? 30   GLU C N   1 
ATOM   1277 C CA  . GLU C 1 30 ? -34.135 20.320  -28.010 1.00 21.15 ? 30   GLU C CA  1 
ATOM   1278 C C   . GLU C 1 30 ? -32.737 20.200  -28.575 1.00 19.46 ? 30   GLU C C   1 
ATOM   1279 O O   . GLU C 1 30 ? -32.008 19.291  -28.210 1.00 26.43 ? 30   GLU C O   1 
ATOM   1280 C CB  . GLU C 1 30 ? -34.069 20.946  -26.627 1.00 32.66 ? 30   GLU C CB  1 
ATOM   1281 C CG  . GLU C 1 30 ? -34.074 22.451  -26.621 1.00 40.09 ? 30   GLU C CG  1 
ATOM   1282 C CD  . GLU C 1 30 ? -35.446 23.004  -26.347 1.00 48.74 ? 30   GLU C CD  1 
ATOM   1283 O OE1 . GLU C 1 30 ? -36.314 22.215  -25.908 1.00 39.56 ? 30   GLU C OE1 1 
ATOM   1284 O OE2 . GLU C 1 30 ? -35.654 24.220  -26.571 1.00 58.05 ? 30   GLU C OE2 1 
ATOM   1285 N N   . THR C 1 31 ? -32.351 21.086  -29.479 1.00 19.72 ? 31   THR C N   1 
ATOM   1286 C CA  . THR C 1 31 ? -31.015 20.972  -30.035 1.00 22.53 ? 31   THR C CA  1 
ATOM   1287 C C   . THR C 1 31 ? -29.974 21.508  -29.075 1.00 21.55 ? 31   THR C C   1 
ATOM   1288 O O   . THR C 1 31 ? -30.275 22.298  -28.192 1.00 25.00 ? 31   THR C O   1 
ATOM   1289 C CB  . THR C 1 31 ? -30.876 21.633  -31.424 1.00 25.88 ? 31   THR C CB  1 
ATOM   1290 O OG1 . THR C 1 31 ? -31.257 23.017  -31.361 1.00 21.78 ? 31   THR C OG1 1 
ATOM   1291 C CG2 . THR C 1 31 ? -31.724 20.882  -32.455 1.00 18.16 ? 31   THR C CG2 1 
ATOM   1292 N N   . SER C 1 32 ? -28.743 21.060  -29.254 1.00 26.02 ? 32   SER C N   1 
ATOM   1293 C CA  . SER C 1 32 ? -27.664 21.420  -28.354 1.00 28.66 ? 32   SER C CA  1 
ATOM   1294 C C   . SER C 1 32 ? -27.465 22.928  -28.314 1.00 28.02 ? 32   SER C C   1 
ATOM   1295 O O   . SER C 1 32 ? -27.694 23.613  -29.308 1.00 30.37 ? 32   SER C O   1 
ATOM   1296 C CB  . SER C 1 32 ? -26.369 20.735  -28.790 1.00 23.99 ? 32   SER C CB  1 
ATOM   1297 O OG  . SER C 1 32 ? -25.281 21.172  -27.991 1.00 33.35 ? 32   SER C OG  1 
ATOM   1298 N N   . SER C 1 33 ? -27.030 23.430  -27.165 1.00 23.19 ? 33   SER C N   1 
ATOM   1299 C CA  . SER C 1 33 ? -26.711 24.841  -27.003 1.00 24.77 ? 33   SER C CA  1 
ATOM   1300 C C   . SER C 1 33 ? -25.431 25.217  -27.751 1.00 23.10 ? 33   SER C C   1 
ATOM   1301 O O   . SER C 1 33 ? -25.105 26.391  -27.901 1.00 26.63 ? 33   SER C O   1 
ATOM   1302 C CB  . SER C 1 33 ? -26.557 25.177  -25.525 1.00 21.77 ? 33   SER C CB  1 
ATOM   1303 O OG  . SER C 1 33 ? -25.358 24.619  -25.016 1.00 22.46 ? 33   SER C OG  1 
ATOM   1304 N N   . LEU C 1 34 ? -24.691 24.223  -28.208 1.00 20.66 ? 34   LEU C N   1 
ATOM   1305 C CA  . LEU C 1 34 ? -23.547 24.494  -29.065 1.00 23.80 ? 34   LEU C CA  1 
ATOM   1306 C C   . LEU C 1 34 ? -23.997 25.034  -30.428 1.00 23.38 ? 34   LEU C C   1 
ATOM   1307 O O   . LEU C 1 34 ? -23.195 25.570  -31.177 1.00 25.86 ? 34   LEU C O   1 
ATOM   1308 C CB  . LEU C 1 34 ? -22.737 23.222  -29.279 1.00 25.88 ? 34   LEU C CB  1 
ATOM   1309 C CG  . LEU C 1 34 ? -22.091 22.616  -28.043 1.00 29.16 ? 34   LEU C CG  1 
ATOM   1310 C CD1 . LEU C 1 34 ? -21.615 21.209  -28.337 1.00 10.17 ? 34   LEU C CD1 1 
ATOM   1311 C CD2 . LEU C 1 34 ? -20.949 23.502  -27.566 1.00 27.19 ? 34   LEU C CD2 1 
ATOM   1312 N N   . CYS C 1 35 ? -25.271 24.866  -30.761 1.00 22.66 ? 35   CYS C N   1 
ATOM   1313 C CA  . CYS C 1 35 ? -25.768 25.291  -32.067 1.00 25.30 ? 35   CYS C CA  1 
ATOM   1314 C C   . CYS C 1 35 ? -25.952 26.813  -32.141 1.00 30.59 ? 35   CYS C C   1 
ATOM   1315 O O   . CYS C 1 35 ? -26.058 27.496  -31.112 1.00 27.36 ? 35   CYS C O   1 
ATOM   1316 C CB  . CYS C 1 35 ? -27.089 24.591  -32.411 1.00 21.99 ? 35   CYS C CB  1 
ATOM   1317 S SG  . CYS C 1 35 ? -26.960 22.806  -32.693 1.00 23.84 ? 35   CYS C SG  1 
ATOM   1318 N N   . SER C 1 36 ? -26.004 27.321  -33.370 1.00 22.99 ? 36   SER C N   1 
ATOM   1319 C CA  . SER C 1 36 ? -26.102 28.745  -33.640 1.00 25.53 ? 36   SER C CA  1 
ATOM   1320 C C   . SER C 1 36 ? -27.426 29.333  -33.178 1.00 23.65 ? 36   SER C C   1 
ATOM   1321 O O   . SER C 1 36 ? -27.500 30.519  -32.862 1.00 26.86 ? 36   SER C O   1 
ATOM   1322 C CB  . SER C 1 36 ? -25.897 29.027  -35.139 1.00 26.49 ? 36   SER C CB  1 
ATOM   1323 O OG  . SER C 1 36 ? -26.949 28.488  -35.923 1.00 25.88 ? 36   SER C OG  1 
ATOM   1324 N N   . GLN C 1 37 ? -28.471 28.516  -33.153 1.00 18.98 ? 37   GLN C N   1 
ATOM   1325 C CA  . GLN C 1 37 ? -29.767 28.977  -32.677 1.00 18.52 ? 37   GLN C CA  1 
ATOM   1326 C C   . GLN C 1 37 ? -30.509 27.837  -31.985 1.00 23.64 ? 37   GLN C C   1 
ATOM   1327 O O   . GLN C 1 37 ? -30.227 26.672  -32.234 1.00 22.49 ? 37   GLN C O   1 
ATOM   1328 C CB  . GLN C 1 37 ? -30.604 29.562  -33.825 1.00 21.95 ? 37   GLN C CB  1 
ATOM   1329 C CG  . GLN C 1 37 ? -31.046 28.540  -34.892 1.00 28.27 ? 37   GLN C CG  1 
ATOM   1330 C CD  . GLN C 1 37 ? -31.932 29.164  -35.963 1.00 33.39 ? 37   GLN C CD  1 
ATOM   1331 O OE1 . GLN C 1 37 ? -32.285 28.528  -36.963 1.00 29.84 ? 37   GLN C OE1 1 
ATOM   1332 N NE2 . GLN C 1 37 ? -32.293 30.419  -35.756 1.00 34.84 ? 37   GLN C NE2 1 
ATOM   1333 N N   . PRO C 1 38 ? -31.461 28.174  -31.103 1.00 32.34 ? 38   PRO C N   1 
ATOM   1334 C CA  . PRO C 1 38 ? -32.261 27.166  -30.405 1.00 24.42 ? 38   PRO C CA  1 
ATOM   1335 C C   . PRO C 1 38 ? -33.275 26.570  -31.361 1.00 20.53 ? 38   PRO C C   1 
ATOM   1336 O O   . PRO C 1 38 ? -33.624 27.211  -32.343 1.00 30.33 ? 38   PRO C O   1 
ATOM   1337 C CB  . PRO C 1 38 ? -33.000 27.990  -29.342 1.00 22.91 ? 38   PRO C CB  1 
ATOM   1338 C CG  . PRO C 1 38 ? -32.306 29.313  -29.316 1.00 19.60 ? 38   PRO C CG  1 
ATOM   1339 C CD  . PRO C 1 38 ? -31.835 29.534  -30.691 1.00 18.42 ? 38   PRO C CD  1 
ATOM   1340 N N   . ALA C 1 39 ? -33.758 25.373  -31.074 1.00 20.15 ? 39   ALA C N   1 
ATOM   1341 C CA  . ALA C 1 39 ? -34.700 24.710  -31.960 1.00 21.37 ? 39   ALA C CA  1 
ATOM   1342 C C   . ALA C 1 39 ? -35.300 23.488  -31.284 1.00 22.90 ? 39   ALA C C   1 
ATOM   1343 O O   . ALA C 1 39 ? -34.604 22.739  -30.598 1.00 22.64 ? 39   ALA C O   1 
ATOM   1344 C CB  . ALA C 1 39 ? -34.012 24.302  -33.257 1.00 20.27 ? 39   ALA C CB  1 
ATOM   1345 N N   . VAL C 1 40 ? -36.595 23.290  -31.466 1.00 14.20 ? 40   VAL C N   1 
ATOM   1346 C CA  . VAL C 1 40 ? -37.171 22.014  -31.110 1.00 22.71 ? 40   VAL C CA  1 
ATOM   1347 C C   . VAL C 1 40 ? -37.109 21.142  -32.356 1.00 21.79 ? 40   VAL C C   1 
ATOM   1348 O O   . VAL C 1 40 ? -37.458 21.593  -33.440 1.00 22.35 ? 40   VAL C O   1 
ATOM   1349 C CB  . VAL C 1 40 ? -38.623 22.148  -30.640 1.00 21.08 ? 40   VAL C CB  1 
ATOM   1350 C CG1 . VAL C 1 40 ? -39.215 20.776  -30.407 1.00 18.78 ? 40   VAL C CG1 1 
ATOM   1351 C CG2 . VAL C 1 40 ? -38.685 22.963  -29.360 1.00 22.88 ? 40   VAL C CG2 1 
ATOM   1352 N N   . VAL C 1 41 ? -36.644 19.907  -32.217 1.00 20.59 ? 41   VAL C N   1 
ATOM   1353 C CA  . VAL C 1 41 ? -36.777 18.946  -33.309 1.00 27.94 ? 41   VAL C CA  1 
ATOM   1354 C C   . VAL C 1 41 ? -37.900 17.951  -32.992 1.00 24.91 ? 41   VAL C C   1 
ATOM   1355 O O   . VAL C 1 41 ? -37.794 17.175  -32.041 1.00 26.34 ? 41   VAL C O   1 
ATOM   1356 C CB  . VAL C 1 41 ? -35.459 18.193  -33.580 1.00 22.74 ? 41   VAL C CB  1 
ATOM   1357 C CG1 . VAL C 1 41 ? -35.679 17.095  -34.610 1.00 22.75 ? 41   VAL C CG1 1 
ATOM   1358 C CG2 . VAL C 1 41 ? -34.387 19.151  -34.049 1.00 16.83 ? 41   VAL C CG2 1 
ATOM   1359 N N   . PHE C 1 42 ? -38.979 17.992  -33.768 1.00 17.49 ? 42   PHE C N   1 
ATOM   1360 C CA  . PHE C 1 42 ? -40.080 17.050  -33.571 1.00 17.75 ? 42   PHE C CA  1 
ATOM   1361 C C   . PHE C 1 42 ? -39.867 15.746  -34.334 1.00 27.12 ? 42   PHE C C   1 
ATOM   1362 O O   . PHE C 1 42 ? -39.327 15.731  -35.447 1.00 26.87 ? 42   PHE C O   1 
ATOM   1363 C CB  . PHE C 1 42 ? -41.418 17.669  -33.979 1.00 20.06 ? 42   PHE C CB  1 
ATOM   1364 C CG  . PHE C 1 42 ? -41.930 18.719  -33.017 1.00 25.00 ? 42   PHE C CG  1 
ATOM   1365 C CD1 . PHE C 1 42 ? -42.250 18.387  -31.708 1.00 21.58 ? 42   PHE C CD1 1 
ATOM   1366 C CD2 . PHE C 1 42 ? -42.106 20.028  -33.429 1.00 21.92 ? 42   PHE C CD2 1 
ATOM   1367 C CE1 . PHE C 1 42 ? -42.717 19.340  -30.828 1.00 28.52 ? 42   PHE C CE1 1 
ATOM   1368 C CE2 . PHE C 1 42 ? -42.575 20.993  -32.552 1.00 27.71 ? 42   PHE C CE2 1 
ATOM   1369 C CZ  . PHE C 1 42 ? -42.884 20.650  -31.250 1.00 24.83 ? 42   PHE C CZ  1 
ATOM   1370 N N   . GLN C 1 43 ? -40.311 14.643  -33.746 1.00 32.77 ? 43   GLN C N   1 
ATOM   1371 C CA  . GLN C 1 43 ? -40.159 13.348  -34.390 1.00 25.73 ? 43   GLN C CA  1 
ATOM   1372 C C   . GLN C 1 43 ? -41.501 12.683  -34.600 1.00 25.73 ? 43   GLN C C   1 
ATOM   1373 O O   . GLN C 1 43 ? -42.343 12.658  -33.698 1.00 27.48 ? 43   GLN C O   1 
ATOM   1374 C CB  . GLN C 1 43 ? -39.227 12.457  -33.584 1.00 21.57 ? 43   GLN C CB  1 
ATOM   1375 C CG  . GLN C 1 43 ? -37.811 12.944  -33.618 1.00 23.82 ? 43   GLN C CG  1 
ATOM   1376 C CD  . GLN C 1 43 ? -36.992 12.397  -32.484 1.00 31.61 ? 43   GLN C CD  1 
ATOM   1377 O OE1 . GLN C 1 43 ? -37.437 12.378  -31.337 1.00 36.06 ? 43   GLN C OE1 1 
ATOM   1378 N NE2 . GLN C 1 43 ? -35.782 11.951  -32.792 1.00 29.81 ? 43   GLN C NE2 1 
ATOM   1379 N N   . THR C 1 44 ? -41.691 12.158  -35.808 1.00 24.60 ? 44   THR C N   1 
ATOM   1380 C CA  . THR C 1 44 ? -42.938 11.515  -36.193 1.00 24.35 ? 44   THR C CA  1 
ATOM   1381 C C   . THR C 1 44 ? -42.821 10.003  -36.092 1.00 28.11 ? 44   THR C C   1 
ATOM   1382 O O   . THR C 1 44 ? -41.760 9.470   -35.761 1.00 30.04 ? 44   THR C O   1 
ATOM   1383 C CB  . THR C 1 44 ? -43.347 11.877  -37.627 1.00 32.16 ? 44   THR C CB  1 
ATOM   1384 O OG1 . THR C 1 44 ? -42.428 11.283  -38.553 1.00 31.58 ? 44   THR C OG1 1 
ATOM   1385 C CG2 . THR C 1 44 ? -43.373 13.386  -37.827 1.00 22.94 ? 44   THR C CG2 1 
ATOM   1386 N N   . LYS C 1 45 ? -43.925 9.325   -36.380 1.00 26.57 ? 45   LYS C N   1 
ATOM   1387 C CA  . LYS C 1 45 ? -43.992 7.873   -36.306 1.00 39.76 ? 45   LYS C CA  1 
ATOM   1388 C C   . LYS C 1 45 ? -43.103 7.195   -37.349 1.00 37.15 ? 45   LYS C C   1 
ATOM   1389 O O   . LYS C 1 45 ? -42.446 6.198   -37.061 1.00 36.30 ? 45   LYS C O   1 
ATOM   1390 C CB  . LYS C 1 45 ? -45.441 7.414   -36.454 1.00 45.84 ? 45   LYS C CB  1 
ATOM   1391 C CG  . LYS C 1 45 ? -46.314 7.745   -35.256 1.00 48.80 ? 45   LYS C CG  1 
ATOM   1392 C CD  . LYS C 1 45 ? -47.694 8.248   -35.680 1.00 54.31 ? 45   LYS C CD  1 
ATOM   1393 C CE  . LYS C 1 45 ? -48.633 8.406   -34.478 1.00 52.44 ? 45   LYS C CE  1 
ATOM   1394 N NZ  . LYS C 1 45 ? -49.102 7.092   -33.951 1.00 66.84 ? 45   LYS C NZ  1 
ATOM   1395 N N   . ARG C 1 46 ? -43.082 7.752   -38.554 1.00 32.08 ? 46   ARG C N   1 
ATOM   1396 C CA  . ARG C 1 46 ? -42.195 7.281   -39.608 1.00 34.29 ? 46   ARG C CA  1 
ATOM   1397 C C   . ARG C 1 46 ? -40.806 7.906   -39.498 1.00 32.09 ? 46   ARG C C   1 
ATOM   1398 O O   . ARG C 1 46 ? -40.046 7.934   -40.466 1.00 29.35 ? 46   ARG C O   1 
ATOM   1399 C CB  . ARG C 1 46 ? -42.796 7.555   -40.983 1.00 39.26 ? 46   ARG C CB  1 
ATOM   1400 C CG  . ARG C 1 46 ? -44.138 6.874   -41.185 1.00 36.60 ? 46   ARG C CG  1 
ATOM   1401 C CD  . ARG C 1 46 ? -44.328 6.443   -42.617 1.00 46.98 ? 46   ARG C CD  1 
ATOM   1402 N NE  . ARG C 1 46 ? -43.372 5.429   -43.079 1.00 57.92 ? 46   ARG C NE  1 
ATOM   1403 C CZ  . ARG C 1 46 ? -42.729 4.554   -42.304 1.00 65.12 ? 46   ARG C CZ  1 
ATOM   1404 N NH1 . ARG C 1 46 ? -42.925 4.539   -40.988 1.00 54.22 ? 46   ARG C NH1 1 
ATOM   1405 N NH2 . ARG C 1 46 ? -41.885 3.682   -42.857 1.00 56.26 ? 46   ARG C NH2 1 
ATOM   1406 N N   . SER C 1 47 ? -40.485 8.400   -38.305 1.00 27.15 ? 47   SER C N   1 
ATOM   1407 C CA  . SER C 1 47 ? -39.143 8.882   -38.001 1.00 26.74 ? 47   SER C CA  1 
ATOM   1408 C C   . SER C 1 47 ? -38.721 10.088  -38.823 1.00 27.77 ? 47   SER C C   1 
ATOM   1409 O O   . SER C 1 47 ? -37.529 10.325  -39.015 1.00 26.25 ? 47   SER C O   1 
ATOM   1410 C CB  . SER C 1 47 ? -38.120 7.763   -38.168 1.00 28.51 ? 47   SER C CB  1 
ATOM   1411 O OG  . SER C 1 47 ? -38.020 7.007   -36.972 1.00 43.04 ? 47   SER C OG  1 
ATOM   1412 N N   . LYS C 1 48 ? -39.692 10.856  -39.302 1.00 20.99 ? 48   LYS C N   1 
ATOM   1413 C CA  . LYS C 1 48 ? -39.372 12.117  -39.925 1.00 23.00 ? 48   LYS C CA  1 
ATOM   1414 C C   . LYS C 1 48 ? -38.917 13.113  -38.844 1.00 25.64 ? 48   LYS C C   1 
ATOM   1415 O O   . LYS C 1 48 ? -39.459 13.127  -37.744 1.00 28.34 ? 48   LYS C O   1 
ATOM   1416 C CB  . LYS C 1 48 ? -40.577 12.639  -40.699 1.00 27.29 ? 48   LYS C CB  1 
ATOM   1417 C CG  . LYS C 1 48 ? -41.201 11.620  -41.636 1.00 31.22 ? 48   LYS C CG  1 
ATOM   1418 C CD  . LYS C 1 48 ? -40.230 11.176  -42.721 1.00 23.75 ? 48   LYS C CD  1 
ATOM   1419 C CE  . LYS C 1 48 ? -40.941 10.349  -43.779 1.00 26.32 ? 48   LYS C CE  1 
ATOM   1420 N NZ  . LYS C 1 48 ? -40.230 9.059   -44.049 1.00 35.87 ? 48   LYS C NZ  1 
ATOM   1421 N N   . GLN C 1 49 ? -37.909 13.921  -39.166 1.00 22.60 ? 49   GLN C N   1 
ATOM   1422 C CA  . GLN C 1 49 ? -37.341 14.911  -38.252 1.00 25.56 ? 49   GLN C CA  1 
ATOM   1423 C C   . GLN C 1 49 ? -37.635 16.326  -38.741 1.00 23.42 ? 49   GLN C C   1 
ATOM   1424 O O   . GLN C 1 49 ? -37.233 16.691  -39.839 1.00 28.96 ? 49   GLN C O   1 
ATOM   1425 C CB  . GLN C 1 49 ? -35.828 14.738  -38.166 1.00 23.40 ? 49   GLN C CB  1 
ATOM   1426 C CG  . GLN C 1 49 ? -35.406 13.301  -38.029 1.00 32.85 ? 49   GLN C CG  1 
ATOM   1427 C CD  . GLN C 1 49 ? -35.866 12.710  -36.735 1.00 35.09 ? 49   GLN C CD  1 
ATOM   1428 O OE1 . GLN C 1 49 ? -36.722 11.815  -36.701 1.00 35.10 ? 49   GLN C OE1 1 
ATOM   1429 N NE2 . GLN C 1 49 ? -35.312 13.213  -35.646 1.00 31.87 ? 49   GLN C NE2 1 
ATOM   1430 N N   . VAL C 1 50 ? -38.312 17.122  -37.911 1.00 22.07 ? 50   VAL C N   1 
ATOM   1431 C CA  . VAL C 1 50 ? -38.787 18.453  -38.298 1.00 20.91 ? 50   VAL C CA  1 
ATOM   1432 C C   . VAL C 1 50 ? -38.318 19.542  -37.312 1.00 24.93 ? 50   VAL C C   1 
ATOM   1433 O O   . VAL C 1 50 ? -38.740 19.555  -36.148 1.00 23.55 ? 50   VAL C O   1 
ATOM   1434 C CB  . VAL C 1 50 ? -40.337 18.473  -38.361 1.00 21.41 ? 50   VAL C CB  1 
ATOM   1435 C CG1 . VAL C 1 50 ? -40.858 19.767  -38.957 1.00 21.76 ? 50   VAL C CG1 1 
ATOM   1436 C CG2 . VAL C 1 50 ? -40.857 17.296  -39.147 1.00 18.87 ? 50   VAL C CG2 1 
ATOM   1437 N N   . CYS C 1 51 ? -37.438 20.432  -37.772 1.00 14.96 ? 51   CYS C N   1 
ATOM   1438 C CA  . CYS C 1 51 ? -37.018 21.594  -36.987 1.00 22.02 ? 51   CYS C CA  1 
ATOM   1439 C C   . CYS C 1 51 ? -38.147 22.619  -36.805 1.00 24.50 ? 51   CYS C C   1 
ATOM   1440 O O   . CYS C 1 51 ? -38.829 22.956  -37.766 1.00 27.26 ? 51   CYS C O   1 
ATOM   1441 C CB  . CYS C 1 51 ? -35.842 22.279  -37.672 1.00 21.02 ? 51   CYS C CB  1 
ATOM   1442 S SG  . CYS C 1 51 ? -34.433 21.207  -37.846 1.00 28.02 ? 51   CYS C SG  1 
ATOM   1443 N N   . ALA C 1 52 ? -38.333 23.127  -35.584 1.00 24.96 ? 52   ALA C N   1 
ATOM   1444 C CA  . ALA C 1 52 ? -39.405 24.094  -35.308 1.00 20.75 ? 52   ALA C CA  1 
ATOM   1445 C C   . ALA C 1 52 ? -38.946 25.247  -34.416 1.00 19.76 ? 52   ALA C C   1 
ATOM   1446 O O   . ALA C 1 52 ? -38.036 25.086  -33.605 1.00 18.12 ? 52   ALA C O   1 
ATOM   1447 C CB  . ALA C 1 52 ? -40.614 23.399  -34.709 1.00 17.12 ? 52   ALA C CB  1 
ATOM   1448 N N   . ASP C 1 53 ? -39.565 26.414  -34.592 1.00 23.60 ? 53   ASP C N   1 
ATOM   1449 C CA  . ASP C 1 53 ? -39.187 27.607  -33.846 1.00 21.93 ? 53   ASP C CA  1 
ATOM   1450 C C   . ASP C 1 53 ? -39.739 27.447  -32.443 1.00 28.78 ? 53   ASP C C   1 
ATOM   1451 O O   . ASP C 1 53 ? -40.958 27.269  -32.262 1.00 26.14 ? 53   ASP C O   1 
ATOM   1452 C CB  . ASP C 1 53 ? -39.742 28.878  -34.515 1.00 25.62 ? 53   ASP C CB  1 
ATOM   1453 C CG  . ASP C 1 53 ? -39.178 30.172  -33.912 1.00 31.50 ? 53   ASP C CG  1 
ATOM   1454 O OD1 . ASP C 1 53 ? -38.740 30.168  -32.738 1.00 29.73 ? 53   ASP C OD1 1 
ATOM   1455 O OD2 . ASP C 1 53 ? -39.173 31.208  -34.616 1.00 38.85 ? 53   ASP C OD2 1 
ATOM   1456 N N   . PRO C 1 54 ? -38.843 27.477  -31.445 1.00 20.81 ? 54   PRO C N   1 
ATOM   1457 C CA  . PRO C 1 54 ? -39.245 27.331  -30.044 1.00 24.79 ? 54   PRO C CA  1 
ATOM   1458 C C   . PRO C 1 54 ? -40.171 28.468  -29.603 1.00 28.52 ? 54   PRO C C   1 
ATOM   1459 O O   . PRO C 1 54 ? -41.006 28.260  -28.719 1.00 29.06 ? 54   PRO C O   1 
ATOM   1460 C CB  . PRO C 1 54 ? -37.915 27.379  -29.295 1.00 22.65 ? 54   PRO C CB  1 
ATOM   1461 C CG  . PRO C 1 54 ? -36.894 26.979  -30.316 1.00 23.43 ? 54   PRO C CG  1 
ATOM   1462 C CD  . PRO C 1 54 ? -37.386 27.589  -31.588 1.00 20.24 ? 54   PRO C CD  1 
ATOM   1463 N N   . SER C 1 55 ? -40.060 29.631  -30.237 1.00 21.69 ? 55   SER C N   1 
ATOM   1464 C CA  . SER C 1 55 ? -40.888 30.786  -29.873 1.00 24.74 ? 55   SER C CA  1 
ATOM   1465 C C   . SER C 1 55 ? -42.318 30.677  -30.374 1.00 23.53 ? 55   SER C C   1 
ATOM   1466 O O   . SER C 1 55 ? -43.151 31.523  -30.078 1.00 21.55 ? 55   SER C O   1 
ATOM   1467 C CB  . SER C 1 55 ? -40.280 32.093  -30.393 1.00 15.00 ? 55   SER C CB  1 
ATOM   1468 O OG  . SER C 1 55 ? -38.964 32.264  -29.907 1.00 24.66 ? 55   SER C OG  1 
ATOM   1469 N N   . GLU C 1 56 ? -42.614 29.662  -31.164 1.00 23.89 ? 56   GLU C N   1 
ATOM   1470 C CA  . GLU C 1 56 ? -43.984 29.533  -31.626 1.00 27.94 ? 56   GLU C CA  1 
ATOM   1471 C C   . GLU C 1 56 ? -44.857 28.893  -30.558 1.00 27.12 ? 56   GLU C C   1 
ATOM   1472 O O   . GLU C 1 56 ? -44.376 28.160  -29.700 1.00 31.58 ? 56   GLU C O   1 
ATOM   1473 C CB  . GLU C 1 56 ? -44.064 28.772  -32.945 1.00 22.56 ? 56   GLU C CB  1 
ATOM   1474 C CG  . GLU C 1 56 ? -43.403 29.515  -34.081 1.00 33.72 ? 56   GLU C CG  1 
ATOM   1475 C CD  . GLU C 1 56 ? -43.903 29.077  -35.440 1.00 31.96 ? 56   GLU C CD  1 
ATOM   1476 O OE1 . GLU C 1 56 ? -45.069 29.374  -35.779 1.00 38.48 ? 56   GLU C OE1 1 
ATOM   1477 O OE2 . GLU C 1 56 ? -43.124 28.443  -36.169 1.00 32.80 ? 56   GLU C OE2 1 
ATOM   1478 N N   . SER C 1 57 ? -46.151 29.157  -30.627 1.00 24.81 ? 57   SER C N   1 
ATOM   1479 C CA  . SER C 1 57 ? -47.043 28.744  -29.564 1.00 30.60 ? 57   SER C CA  1 
ATOM   1480 C C   . SER C 1 57 ? -47.477 27.300  -29.720 1.00 22.90 ? 57   SER C C   1 
ATOM   1481 O O   . SER C 1 57 ? -47.706 26.604  -28.737 1.00 34.43 ? 57   SER C O   1 
ATOM   1482 C CB  . SER C 1 57 ? -48.245 29.701  -29.461 1.00 33.91 ? 57   SER C CB  1 
ATOM   1483 O OG  . SER C 1 57 ? -49.419 29.143  -30.009 1.00 27.03 ? 57   SER C OG  1 
ATOM   1484 N N   . TRP C 1 58 ? -47.590 26.837  -30.950 1.00 23.91 ? 58   TRP C N   1 
ATOM   1485 C CA  . TRP C 1 58 ? -47.986 25.461  -31.163 1.00 22.11 ? 58   TRP C CA  1 
ATOM   1486 C C   . TRP C 1 58 ? -46.809 24.535  -30.856 1.00 24.95 ? 58   TRP C C   1 
ATOM   1487 O O   . TRP C 1 58 ? -46.982 23.435  -30.348 1.00 19.49 ? 58   TRP C O   1 
ATOM   1488 C CB  . TRP C 1 58 ? -48.495 25.267  -32.585 1.00 23.54 ? 58   TRP C CB  1 
ATOM   1489 C CG  . TRP C 1 58 ? -47.439 25.324  -33.643 1.00 28.60 ? 58   TRP C CG  1 
ATOM   1490 C CD1 . TRP C 1 58 ? -47.144 26.381  -34.451 1.00 36.53 ? 58   TRP C CD1 1 
ATOM   1491 C CD2 . TRP C 1 58 ? -46.554 24.266  -34.030 1.00 30.58 ? 58   TRP C CD2 1 
ATOM   1492 N NE1 . TRP C 1 58 ? -46.133 26.051  -35.315 1.00 31.29 ? 58   TRP C NE1 1 
ATOM   1493 C CE2 . TRP C 1 58 ? -45.752 24.755  -35.077 1.00 30.22 ? 58   TRP C CE2 1 
ATOM   1494 C CE3 . TRP C 1 58 ? -46.356 22.955  -33.587 1.00 24.28 ? 58   TRP C CE3 1 
ATOM   1495 C CZ2 . TRP C 1 58 ? -44.773 23.985  -35.689 1.00 26.68 ? 58   TRP C CZ2 1 
ATOM   1496 C CZ3 . TRP C 1 58 ? -45.387 22.192  -34.197 1.00 30.04 ? 58   TRP C CZ3 1 
ATOM   1497 C CH2 . TRP C 1 58 ? -44.605 22.708  -35.238 1.00 28.37 ? 58   TRP C CH2 1 
ATOM   1498 N N   . VAL C 1 59 ? -45.604 24.999  -31.165 1.00 28.65 ? 59   VAL C N   1 
ATOM   1499 C CA  . VAL C 1 59 ? -44.397 24.269  -30.811 1.00 24.89 ? 59   VAL C CA  1 
ATOM   1500 C C   . VAL C 1 59 ? -44.381 24.011  -29.316 1.00 22.76 ? 59   VAL C C   1 
ATOM   1501 O O   . VAL C 1 59 ? -44.292 22.866  -28.880 1.00 29.98 ? 59   VAL C O   1 
ATOM   1502 C CB  . VAL C 1 59 ? -43.124 25.026  -31.229 1.00 24.77 ? 59   VAL C CB  1 
ATOM   1503 C CG1 . VAL C 1 59 ? -41.899 24.436  -30.555 1.00 21.57 ? 59   VAL C CG1 1 
ATOM   1504 C CG2 . VAL C 1 59 ? -42.972 24.960  -32.720 1.00 27.87 ? 59   VAL C CG2 1 
ATOM   1505 N N   . GLN C 1 60 ? -44.501 25.075  -28.533 1.00 24.92 ? 60   GLN C N   1 
ATOM   1506 C CA  . GLN C 1 60 ? -44.488 24.958  -27.083 1.00 24.41 ? 60   GLN C CA  1 
ATOM   1507 C C   . GLN C 1 60 ? -45.687 24.181  -26.552 1.00 26.93 ? 60   GLN C C   1 
ATOM   1508 O O   . GLN C 1 60 ? -45.620 23.523  -25.521 1.00 26.22 ? 60   GLN C O   1 
ATOM   1509 C CB  . GLN C 1 60 ? -44.422 26.336  -26.452 1.00 19.78 ? 60   GLN C CB  1 
ATOM   1510 C CG  . GLN C 1 60 ? -43.085 26.997  -26.607 1.00 23.26 ? 60   GLN C CG  1 
ATOM   1511 C CD  . GLN C 1 60 ? -41.956 26.154  -26.046 1.00 23.01 ? 60   GLN C CD  1 
ATOM   1512 O OE1 . GLN C 1 60 ? -42.132 25.445  -25.063 1.00 28.85 ? 60   GLN C OE1 1 
ATOM   1513 N NE2 . GLN C 1 60 ? -40.788 26.234  -26.668 1.00 23.84 ? 60   GLN C NE2 1 
ATOM   1514 N N   . GLU C 1 61 ? -46.792 24.253  -27.265 1.00 24.11 ? 61   GLU C N   1 
ATOM   1515 C CA  . GLU C 1 61 ? -47.969 23.535  -26.835 1.00 29.20 ? 61   GLU C CA  1 
ATOM   1516 C C   . GLU C 1 61 ? -47.730 22.048  -27.011 1.00 30.84 ? 61   GLU C C   1 
ATOM   1517 O O   . GLU C 1 61 ? -48.065 21.253  -26.134 1.00 30.61 ? 61   GLU C O   1 
ATOM   1518 C CB  . GLU C 1 61 ? -49.163 24.000  -27.642 1.00 33.25 ? 61   GLU C CB  1 
ATOM   1519 C CG  . GLU C 1 61 ? -50.399 23.171  -27.502 1.00 36.63 ? 61   GLU C CG  1 
ATOM   1520 C CD  . GLU C 1 61 ? -51.435 23.611  -28.511 1.00 52.69 ? 61   GLU C CD  1 
ATOM   1521 O OE1 . GLU C 1 61 ? -51.866 24.790  -28.442 1.00 50.77 ? 61   GLU C OE1 1 
ATOM   1522 O OE2 . GLU C 1 61 ? -51.784 22.791  -29.390 1.00 45.19 ? 61   GLU C OE2 1 
ATOM   1523 N N   . TYR C 1 62 ? -47.114 21.684  -28.133 1.00 29.15 ? 62   TYR C N   1 
ATOM   1524 C CA  . TYR C 1 62 ? -46.723 20.303  -28.386 1.00 25.77 ? 62   TYR C CA  1 
ATOM   1525 C C   . TYR C 1 62 ? -45.707 19.811  -27.382 1.00 25.29 ? 62   TYR C C   1 
ATOM   1526 O O   . TYR C 1 62 ? -45.826 18.703  -26.866 1.00 29.19 ? 62   TYR C O   1 
ATOM   1527 C CB  . TYR C 1 62 ? -46.125 20.151  -29.780 1.00 26.71 ? 62   TYR C CB  1 
ATOM   1528 C CG  . TYR C 1 62 ? -47.151 20.117  -30.880 1.00 30.03 ? 62   TYR C CG  1 
ATOM   1529 C CD1 . TYR C 1 62 ? -46.896 19.447  -32.071 1.00 23.56 ? 62   TYR C CD1 1 
ATOM   1530 C CD2 . TYR C 1 62 ? -48.377 20.756  -30.729 1.00 26.58 ? 62   TYR C CD2 1 
ATOM   1531 C CE1 . TYR C 1 62 ? -47.830 19.418  -33.087 1.00 28.24 ? 62   TYR C CE1 1 
ATOM   1532 C CE2 . TYR C 1 62 ? -49.317 20.729  -31.735 1.00 33.07 ? 62   TYR C CE2 1 
ATOM   1533 C CZ  . TYR C 1 62 ? -49.040 20.057  -32.914 1.00 33.32 ? 62   TYR C CZ  1 
ATOM   1534 O OH  . TYR C 1 62 ? -49.975 20.029  -33.921 1.00 31.29 ? 62   TYR C OH  1 
ATOM   1535 N N   . VAL C 1 63 ? -44.686 20.617  -27.129 1.00 19.29 ? 63   VAL C N   1 
ATOM   1536 C CA  . VAL C 1 63 ? -43.668 20.229  -26.163 1.00 25.12 ? 63   VAL C CA  1 
ATOM   1537 C C   . VAL C 1 63 ? -44.282 19.906  -24.787 1.00 28.30 ? 63   VAL C C   1 
ATOM   1538 O O   . VAL C 1 63 ? -43.888 18.929  -24.124 1.00 21.02 ? 63   VAL C O   1 
ATOM   1539 C CB  . VAL C 1 63 ? -42.584 21.306  -26.034 1.00 21.25 ? 63   VAL C CB  1 
ATOM   1540 C CG1 . VAL C 1 63 ? -41.668 20.996  -24.876 1.00 19.56 ? 63   VAL C CG1 1 
ATOM   1541 C CG2 . VAL C 1 63 ? -41.792 21.383  -27.323 1.00 23.99 ? 63   VAL C CG2 1 
ATOM   1542 N N   . TYR C 1 64 ? -45.256 20.714  -24.371 1.00 23.68 ? 64   TYR C N   1 
ATOM   1543 C CA  . TYR C 1 64 ? -45.886 20.520  -23.075 1.00 27.25 ? 64   TYR C CA  1 
ATOM   1544 C C   . TYR C 1 64 ? -46.698 19.234  -23.036 1.00 28.43 ? 64   TYR C C   1 
ATOM   1545 O O   . TYR C 1 64 ? -46.641 18.478  -22.066 1.00 25.03 ? 64   TYR C O   1 
ATOM   1546 C CB  . TYR C 1 64 ? -46.754 21.721  -22.707 1.00 23.59 ? 64   TYR C CB  1 
ATOM   1547 C CG  . TYR C 1 64 ? -45.987 22.841  -22.038 1.00 38.37 ? 64   TYR C CG  1 
ATOM   1548 C CD1 . TYR C 1 64 ? -45.204 23.731  -22.785 1.00 38.83 ? 64   TYR C CD1 1 
ATOM   1549 C CD2 . TYR C 1 64 ? -46.030 23.005  -20.659 1.00 40.22 ? 64   TYR C CD2 1 
ATOM   1550 C CE1 . TYR C 1 64 ? -44.492 24.761  -22.174 1.00 38.19 ? 64   TYR C CE1 1 
ATOM   1551 C CE2 . TYR C 1 64 ? -45.326 24.031  -20.038 1.00 39.84 ? 64   TYR C CE2 1 
ATOM   1552 C CZ  . TYR C 1 64 ? -44.561 24.910  -20.793 1.00 42.40 ? 64   TYR C CZ  1 
ATOM   1553 O OH  . TYR C 1 64 ? -43.866 25.923  -20.151 1.00 25.44 ? 64   TYR C OH  1 
ATOM   1554 N N   . ASP C 1 65 ? -47.452 18.987  -24.096 1.00 25.48 ? 65   ASP C N   1 
ATOM   1555 C CA  . ASP C 1 65 ? -48.274 17.800  -24.148 1.00 25.22 ? 65   ASP C CA  1 
ATOM   1556 C C   . ASP C 1 65 ? -47.382 16.567  -24.114 1.00 29.96 ? 65   ASP C C   1 
ATOM   1557 O O   . ASP C 1 65 ? -47.703 15.590  -23.447 1.00 34.94 ? 65   ASP C O   1 
ATOM   1558 C CB  . ASP C 1 65 ? -49.153 17.800  -25.397 1.00 24.68 ? 65   ASP C CB  1 
ATOM   1559 C CG  . ASP C 1 65 ? -50.247 16.761  -25.330 1.00 44.24 ? 65   ASP C CG  1 
ATOM   1560 O OD1 . ASP C 1 65 ? -51.082 16.836  -24.402 1.00 48.86 ? 65   ASP C OD1 1 
ATOM   1561 O OD2 . ASP C 1 65 ? -50.279 15.868  -26.202 1.00 42.13 ? 65   ASP C OD2 1 
ATOM   1562 N N   . LEU C 1 66 ? -46.253 16.623  -24.815 1.00 26.07 ? 66   LEU C N   1 
ATOM   1563 C CA  . LEU C 1 66 ? -45.367 15.466  -24.922 1.00 28.37 ? 66   LEU C CA  1 
ATOM   1564 C C   . LEU C 1 66 ? -44.700 15.160  -23.603 1.00 32.54 ? 66   LEU C C   1 
ATOM   1565 O O   . LEU C 1 66 ? -44.439 13.999  -23.277 1.00 36.82 ? 66   LEU C O   1 
ATOM   1566 C CB  . LEU C 1 66 ? -44.277 15.693  -25.970 1.00 28.70 ? 66   LEU C CB  1 
ATOM   1567 C CG  . LEU C 1 66 ? -44.704 15.575  -27.429 1.00 35.90 ? 66   LEU C CG  1 
ATOM   1568 C CD1 . LEU C 1 66 ? -43.615 16.116  -28.352 1.00 21.88 ? 66   LEU C CD1 1 
ATOM   1569 C CD2 . LEU C 1 66 ? -45.112 14.124  -27.782 1.00 20.49 ? 66   LEU C CD2 1 
ATOM   1570 N N   . GLU C 1 67 ? -44.410 16.209  -22.848 1.00 30.12 ? 67   GLU C N   1 
ATOM   1571 C CA  . GLU C 1 67 ? -43.617 16.059  -21.641 1.00 34.51 ? 67   GLU C CA  1 
ATOM   1572 C C   . GLU C 1 67 ? -44.492 15.654  -20.451 1.00 34.30 ? 67   GLU C C   1 
ATOM   1573 O O   . GLU C 1 67 ? -44.084 14.845  -19.620 1.00 41.62 ? 67   GLU C O   1 
ATOM   1574 C CB  . GLU C 1 67 ? -42.838 17.349  -21.368 1.00 30.09 ? 67   GLU C CB  1 
ATOM   1575 C CG  . GLU C 1 67 ? -41.765 17.236  -20.302 1.00 28.90 ? 67   GLU C CG  1 
ATOM   1576 C CD  . GLU C 1 67 ? -40.577 16.395  -20.727 1.00 35.67 ? 67   GLU C CD  1 
ATOM   1577 O OE1 . GLU C 1 67 ? -40.230 15.453  -19.986 1.00 40.42 ? 67   GLU C OE1 1 
ATOM   1578 O OE2 . GLU C 1 67 ? -39.983 16.671  -21.794 1.00 41.89 ? 67   GLU C OE2 1 
ATOM   1579 N N   . LEU C 1 68 ? -45.710 16.180  -20.398 1.00 37.11 ? 68   LEU C N   1 
ATOM   1580 C CA  . LEU C 1 68 ? -46.601 15.946  -19.258 1.00 36.10 ? 68   LEU C CA  1 
ATOM   1581 C C   . LEU C 1 68 ? -47.642 14.840  -19.460 1.00 41.53 ? 68   LEU C C   1 
ATOM   1582 O O   . LEU C 1 68 ? -48.078 14.220  -18.496 1.00 48.84 ? 68   LEU C O   1 
ATOM   1583 C CB  . LEU C 1 68 ? -47.298 17.247  -18.856 1.00 34.60 ? 68   LEU C CB  1 
ATOM   1584 C CG  . LEU C 1 68 ? -46.303 18.357  -18.508 1.00 35.29 ? 68   LEU C CG  1 
ATOM   1585 C CD1 . LEU C 1 68 ? -47.011 19.655  -18.175 1.00 32.52 ? 68   LEU C CD1 1 
ATOM   1586 C CD2 . LEU C 1 68 ? -45.402 17.915  -17.369 1.00 32.55 ? 68   LEU C CD2 1 
ATOM   1587 N N   . ASN C 1 69 ? -48.047 14.595  -20.701 1.00 45.17 ? 69   ASN C N   1 
ATOM   1588 C CA  . ASN C 1 69 ? -49.000 13.525  -20.981 1.00 37.09 ? 69   ASN C CA  1 
ATOM   1589 C C   . ASN C 1 69 ? -48.354 12.365  -21.729 1.00 40.30 ? 69   ASN C C   1 
ATOM   1590 O O   . ASN C 1 69 ? -47.161 12.099  -21.571 1.00 47.66 ? 69   ASN C O   1 
ATOM   1591 C CB  . ASN C 1 69 ? -50.194 14.065  -21.767 1.00 38.14 ? 69   ASN C CB  1 
ATOM   1592 C CG  . ASN C 1 69 ? -50.773 15.328  -21.151 1.00 58.50 ? 69   ASN C CG  1 
ATOM   1593 O OD1 . ASN C 1 69 ? -50.698 15.530  -19.939 1.00 67.44 ? 69   ASN C OD1 1 
ATOM   1594 N ND2 . ASN C 1 69 ? -51.353 16.185  -21.987 1.00 52.33 ? 69   ASN C ND2 1 
ATOM   1595 N N   . SER D 1 5  ? -18.726 -1.799  -9.453  1.00 19.75 ? 5    SER D N   1 
ATOM   1596 C CA  . SER D 1 5  ? -17.760 -2.215  -10.478 1.00 24.46 ? 5    SER D CA  1 
ATOM   1597 C C   . SER D 1 5  ? -16.863 -1.055  -10.906 1.00 29.90 ? 5    SER D C   1 
ATOM   1598 O O   . SER D 1 5  ? -16.391 -0.286  -10.066 1.00 23.12 ? 5    SER D O   1 
ATOM   1599 C CB  . SER D 1 5  ? -18.476 -2.780  -11.706 1.00 25.50 ? 5    SER D CB  1 
ATOM   1600 O OG  . SER D 1 5  ? -17.583 -2.902  -12.800 1.00 29.65 ? 5    SER D OG  1 
ATOM   1601 N N   . ASP D 1 6  ? -16.639 -0.931  -12.216 1.00 23.95 ? 6    ASP D N   1 
ATOM   1602 C CA  . ASP D 1 6  ? -15.866 0.178   -12.763 1.00 18.83 ? 6    ASP D CA  1 
ATOM   1603 C C   . ASP D 1 6  ? -16.547 0.811   -13.971 1.00 24.42 ? 6    ASP D C   1 
ATOM   1604 O O   . ASP D 1 6  ? -15.991 0.819   -15.061 1.00 28.26 ? 6    ASP D O   1 
ATOM   1605 C CB  . ASP D 1 6  ? -14.452 -0.271  -13.100 1.00 16.14 ? 6    ASP D CB  1 
ATOM   1606 C CG  . ASP D 1 6  ? -13.562 -0.331  -11.877 1.00 23.17 ? 6    ASP D CG  1 
ATOM   1607 O OD1 . ASP D 1 6  ? -13.551 0.642   -11.104 1.00 26.50 ? 6    ASP D OD1 1 
ATOM   1608 O OD2 . ASP D 1 6  ? -12.862 -1.342  -11.680 1.00 31.23 ? 6    ASP D OD2 1 
ATOM   1609 N N   . PRO D 1 7  ? -17.750 1.369   -13.764 1.00 23.21 ? 7    PRO D N   1 
ATOM   1610 C CA  . PRO D 1 7  ? -18.584 1.983   -14.798 1.00 23.53 ? 7    PRO D CA  1 
ATOM   1611 C C   . PRO D 1 7  ? -18.195 3.440   -15.110 1.00 24.23 ? 7    PRO D C   1 
ATOM   1612 O O   . PRO D 1 7  ? -17.401 4.047   -14.385 1.00 18.20 ? 7    PRO D O   1 
ATOM   1613 C CB  . PRO D 1 7  ? -19.978 1.964   -14.163 1.00 24.41 ? 7    PRO D CB  1 
ATOM   1614 C CG  . PRO D 1 7  ? -19.753 1.808   -12.664 1.00 18.52 ? 7    PRO D CG  1 
ATOM   1615 C CD  . PRO D 1 7  ? -18.284 1.642   -12.420 1.00 25.41 ? 7    PRO D CD  1 
ATOM   1616 N N   . PRO D 1 8  ? -18.750 3.995   -16.201 1.00 29.78 ? 8    PRO D N   1 
ATOM   1617 C CA  . PRO D 1 8  ? -18.522 5.398   -16.581 1.00 29.26 ? 8    PRO D CA  1 
ATOM   1618 C C   . PRO D 1 8  ? -19.094 6.375   -15.569 1.00 15.61 ? 8    PRO D C   1 
ATOM   1619 O O   . PRO D 1 8  ? -20.047 6.060   -14.881 1.00 17.39 ? 8    PRO D O   1 
ATOM   1620 C CB  . PRO D 1 8  ? -19.292 5.543   -17.904 1.00 21.66 ? 8    PRO D CB  1 
ATOM   1621 C CG  . PRO D 1 8  ? -19.475 4.174   -18.406 1.00 22.37 ? 8    PRO D CG  1 
ATOM   1622 C CD  . PRO D 1 8  ? -19.523 3.261   -17.218 1.00 17.58 ? 8    PRO D CD  1 
ATOM   1623 N N   . THR D 1 9  ? -18.504 7.559   -15.498 1.00 21.79 ? 9    THR D N   1 
ATOM   1624 C CA  . THR D 1 9  ? -19.037 8.661   -14.710 1.00 21.64 ? 9    THR D CA  1 
ATOM   1625 C C   . THR D 1 9  ? -19.677 9.719   -15.620 1.00 20.42 ? 9    THR D C   1 
ATOM   1626 O O   . THR D 1 9  ? -19.086 10.117  -16.616 1.00 19.81 ? 9    THR D O   1 
ATOM   1627 C CB  . THR D 1 9  ? -17.914 9.339   -13.930 1.00 24.32 ? 9    THR D CB  1 
ATOM   1628 O OG1 . THR D 1 9  ? -17.106 8.342   -13.291 1.00 28.16 ? 9    THR D OG1 1 
ATOM   1629 C CG2 . THR D 1 9  ? -18.485 10.288  -12.890 1.00 23.45 ? 9    THR D CG2 1 
ATOM   1630 N N   . ALA D 1 10 ? -20.882 10.168  -15.274 1.00 25.65 ? 10   ALA D N   1 
ATOM   1631 C CA  . ALA D 1 10 ? -21.552 11.250  -16.000 1.00 20.72 ? 10   ALA D CA  1 
ATOM   1632 C C   . ALA D 1 10 ? -20.823 12.545  -15.756 1.00 21.34 ? 10   ALA D C   1 
ATOM   1633 O O   . ALA D 1 10 ? -20.518 12.885  -14.609 1.00 21.61 ? 10   ALA D O   1 
ATOM   1634 C CB  . ALA D 1 10 ? -22.984 11.392  -15.548 1.00 19.30 ? 10   ALA D CB  1 
ATOM   1635 N N   . CYS D 1 11 ? -20.557 13.263  -16.842 1.00 22.62 ? 11   CYS D N   1 
ATOM   1636 C CA  . CYS D 1 11 ? -19.872 14.553  -16.809 1.00 19.54 ? 11   CYS D CA  1 
ATOM   1637 C C   . CYS D 1 11 ? -20.549 15.532  -17.767 1.00 27.49 ? 11   CYS D C   1 
ATOM   1638 O O   . CYS D 1 11 ? -21.019 15.130  -18.837 1.00 27.12 ? 11   CYS D O   1 
ATOM   1639 C CB  . CYS D 1 11 ? -18.407 14.376  -17.218 1.00 19.34 ? 11   CYS D CB  1 
ATOM   1640 S SG  . CYS D 1 11 ? -17.373 13.651  -15.944 1.00 35.74 ? 11   CYS D SG  1 
ATOM   1641 N N   . CYS D 1 12 ? -20.598 16.811  -17.396 1.00 32.49 ? 12   CYS D N   1 
ATOM   1642 C CA  . CYS D 1 12 ? -21.160 17.841  -18.284 1.00 26.94 ? 12   CYS D CA  1 
ATOM   1643 C C   . CYS D 1 12 ? -20.106 18.790  -18.819 1.00 29.25 ? 12   CYS D C   1 
ATOM   1644 O O   . CYS D 1 12 ? -19.422 19.473  -18.053 1.00 26.51 ? 12   CYS D O   1 
ATOM   1645 C CB  . CYS D 1 12 ? -22.234 18.653  -17.573 1.00 24.54 ? 12   CYS D CB  1 
ATOM   1646 S SG  . CYS D 1 12 ? -23.735 17.722  -17.289 1.00 35.18 ? 12   CYS D SG  1 
ATOM   1647 N N   . PHE D 1 13 ? -19.979 18.839  -20.140 1.00 29.92 ? 13   PHE D N   1 
ATOM   1648 C CA  . PHE D 1 13 ? -19.045 19.770  -20.762 1.00 36.16 ? 13   PHE D CA  1 
ATOM   1649 C C   . PHE D 1 13 ? -19.774 20.958  -21.371 1.00 35.96 ? 13   PHE D C   1 
ATOM   1650 O O   . PHE D 1 13 ? -19.225 22.050  -21.445 1.00 47.67 ? 13   PHE D O   1 
ATOM   1651 C CB  . PHE D 1 13 ? -18.171 19.055  -21.782 1.00 26.28 ? 13   PHE D CB  1 
ATOM   1652 C CG  . PHE D 1 13 ? -17.419 17.898  -21.202 1.00 27.27 ? 13   PHE D CG  1 
ATOM   1653 C CD1 . PHE D 1 13 ? -16.230 18.096  -20.529 1.00 20.61 ? 13   PHE D CD1 1 
ATOM   1654 C CD2 . PHE D 1 13 ? -17.923 16.616  -21.293 1.00 27.32 ? 13   PHE D CD2 1 
ATOM   1655 C CE1 . PHE D 1 13 ? -15.540 17.031  -19.989 1.00 20.82 ? 13   PHE D CE1 1 
ATOM   1656 C CE2 . PHE D 1 13 ? -17.242 15.556  -20.751 1.00 23.64 ? 13   PHE D CE2 1 
ATOM   1657 C CZ  . PHE D 1 13 ? -16.049 15.764  -20.100 1.00 22.51 ? 13   PHE D CZ  1 
ATOM   1658 N N   . SER D 1 14 ? -21.024 20.732  -21.762 1.00 38.37 ? 14   SER D N   1 
ATOM   1659 C CA  . SER D 1 14 ? -21.909 21.773  -22.273 1.00 26.21 ? 14   SER D CA  1 
ATOM   1660 C C   . SER D 1 14 ? -23.208 21.777  -21.456 1.00 33.37 ? 14   SER D C   1 
ATOM   1661 O O   . SER D 1 14 ? -23.749 20.715  -21.134 1.00 41.66 ? 14   SER D O   1 
ATOM   1662 C CB  . SER D 1 14 ? -22.183 21.523  -23.765 1.00 26.89 ? 14   SER D CB  1 
ATOM   1663 O OG  . SER D 1 14 ? -23.547 21.723  -24.105 1.00 36.06 ? 14   SER D OG  1 
ATOM   1664 N N   . TYR D 1 15 ? -23.695 22.958  -21.088 1.00 43.54 ? 15   TYR D N   1 
ATOM   1665 C CA  . TYR D 1 15 ? -24.949 23.061  -20.325 1.00 41.59 ? 15   TYR D CA  1 
ATOM   1666 C C   . TYR D 1 15 ? -26.116 23.494  -21.211 1.00 38.86 ? 15   TYR D C   1 
ATOM   1667 O O   . TYR D 1 15 ? -25.927 24.184  -22.214 1.00 35.80 ? 15   TYR D O   1 
ATOM   1668 C CB  . TYR D 1 15 ? -24.846 24.099  -19.218 1.00 30.60 ? 15   TYR D CB  1 
ATOM   1669 C CG  . TYR D 1 15 ? -23.707 23.966  -18.243 1.00 35.27 ? 15   TYR D CG  1 
ATOM   1670 C CD1 . TYR D 1 15 ? -23.732 23.008  -17.237 1.00 30.92 ? 15   TYR D CD1 1 
ATOM   1671 C CD2 . TYR D 1 15 ? -22.645 24.859  -18.272 1.00 34.37 ? 15   TYR D CD2 1 
ATOM   1672 C CE1 . TYR D 1 15 ? -22.714 22.918  -16.311 1.00 24.27 ? 15   TYR D CE1 1 
ATOM   1673 C CE2 . TYR D 1 15 ? -21.614 24.773  -17.353 1.00 34.58 ? 15   TYR D CE2 1 
ATOM   1674 C CZ  . TYR D 1 15 ? -21.656 23.799  -16.373 1.00 36.62 ? 15   TYR D CZ  1 
ATOM   1675 O OH  . TYR D 1 15 ? -20.634 23.719  -15.451 1.00 40.12 ? 15   TYR D OH  1 
ATOM   1676 N N   . THR D 1 16 ? -27.326 23.117  -20.825 1.00 34.24 ? 16   THR D N   1 
ATOM   1677 C CA  . THR D 1 16 ? -28.502 23.605  -21.526 1.00 38.21 ? 16   THR D CA  1 
ATOM   1678 C C   . THR D 1 16 ? -28.584 25.112  -21.332 1.00 41.41 ? 16   THR D C   1 
ATOM   1679 O O   . THR D 1 16 ? -28.072 25.653  -20.345 1.00 36.86 ? 16   THR D O   1 
ATOM   1680 C CB  . THR D 1 16 ? -29.799 22.979  -20.995 1.00 39.31 ? 16   THR D CB  1 
ATOM   1681 O OG1 . THR D 1 16 ? -30.846 23.195  -21.942 1.00 31.23 ? 16   THR D OG1 1 
ATOM   1682 C CG2 . THR D 1 16 ? -30.200 23.609  -19.659 1.00 27.73 ? 16   THR D CG2 1 
ATOM   1683 N N   . ALA D 1 17 ? -29.239 25.786  -22.269 1.00 35.95 ? 17   ALA D N   1 
ATOM   1684 C CA  . ALA D 1 17 ? -29.309 27.236  -22.232 1.00 43.70 ? 17   ALA D CA  1 
ATOM   1685 C C   . ALA D 1 17 ? -30.685 27.754  -21.801 1.00 42.39 ? 17   ALA D C   1 
ATOM   1686 O O   . ALA D 1 17 ? -30.831 28.919  -21.432 1.00 48.50 ? 17   ALA D O   1 
ATOM   1687 C CB  . ALA D 1 17 ? -28.910 27.813  -23.587 1.00 31.54 ? 17   ALA D CB  1 
ATOM   1688 N N   . ARG D 1 18 ? -31.688 26.886  -21.838 1.00 37.98 ? 18   ARG D N   1 
ATOM   1689 C CA  . ARG D 1 18 ? -33.042 27.280  -21.469 1.00 47.74 ? 18   ARG D CA  1 
ATOM   1690 C C   . ARG D 1 18 ? -33.316 26.990  -19.994 1.00 44.40 ? 18   ARG D C   1 
ATOM   1691 O O   . ARG D 1 18 ? -32.647 26.162  -19.387 1.00 41.32 ? 18   ARG D O   1 
ATOM   1692 C CB  . ARG D 1 18 ? -34.058 26.529  -22.331 1.00 56.94 ? 18   ARG D CB  1 
ATOM   1693 C CG  . ARG D 1 18 ? -34.275 25.065  -21.932 1.00 46.96 ? 18   ARG D CG  1 
ATOM   1694 C CD  . ARG D 1 18 ? -33.618 24.073  -22.909 1.00 60.33 ? 18   ARG D CD  1 
ATOM   1695 N NE  . ARG D 1 18 ? -34.101 22.701  -22.698 1.00 61.28 ? 18   ARG D NE  1 
ATOM   1696 C CZ  . ARG D 1 18 ? -33.455 21.592  -23.065 1.00 58.58 ? 18   ARG D CZ  1 
ATOM   1697 N NH1 . ARG D 1 18 ? -32.277 21.660  -23.675 1.00 61.89 ? 18   ARG D NH1 1 
ATOM   1698 N NH2 . ARG D 1 18 ? -33.989 20.401  -22.819 1.00 65.69 ? 18   ARG D NH2 1 
ATOM   1699 N N   . LYS D 1 19 ? -34.292 27.671  -19.407 1.00 41.11 ? 19   LYS D N   1 
ATOM   1700 C CA  . LYS D 1 19 ? -34.738 27.282  -18.081 1.00 33.24 ? 19   LYS D CA  1 
ATOM   1701 C C   . LYS D 1 19 ? -35.846 26.254  -18.200 1.00 35.32 ? 19   LYS D C   1 
ATOM   1702 O O   . LYS D 1 19 ? -36.862 26.491  -18.851 1.00 35.28 ? 19   LYS D O   1 
ATOM   1703 C CB  . LYS D 1 19 ? -35.244 28.469  -17.268 1.00 43.03 ? 19   LYS D CB  1 
ATOM   1704 C CG  . LYS D 1 19 ? -36.087 28.030  -16.069 1.00 36.42 ? 19   LYS D CG  1 
ATOM   1705 C CD  . LYS D 1 19 ? -36.436 29.184  -15.151 1.00 35.86 ? 19   LYS D CD  1 
ATOM   1706 C CE  . LYS D 1 19 ? -37.486 28.771  -14.116 1.00 42.26 ? 19   LYS D CE  1 
ATOM   1707 N NZ  . LYS D 1 19 ? -37.702 29.821  -13.063 1.00 42.21 ? 19   LYS D NZ  1 
ATOM   1708 N N   . LEU D 1 20 ? -35.655 25.104  -17.572 1.00 37.06 ? 20   LEU D N   1 
ATOM   1709 C CA  . LEU D 1 20 ? -36.670 24.072  -17.618 1.00 29.80 ? 20   LEU D CA  1 
ATOM   1710 C C   . LEU D 1 20 ? -37.855 24.494  -16.766 1.00 32.49 ? 20   LEU D C   1 
ATOM   1711 O O   . LEU D 1 20 ? -37.687 24.941  -15.630 1.00 26.29 ? 20   LEU D O   1 
ATOM   1712 C CB  . LEU D 1 20 ? -36.108 22.742  -17.120 1.00 30.55 ? 20   LEU D CB  1 
ATOM   1713 C CG  . LEU D 1 20 ? -35.154 22.009  -18.065 1.00 41.90 ? 20   LEU D CG  1 
ATOM   1714 C CD1 . LEU D 1 20 ? -34.429 20.885  -17.344 1.00 33.06 ? 20   LEU D CD1 1 
ATOM   1715 C CD2 . LEU D 1 20 ? -35.892 21.472  -19.278 1.00 40.54 ? 20   LEU D CD2 1 
ATOM   1716 N N   . PRO D 1 21 ? -39.059 24.393  -17.333 1.00 27.52 ? 21   PRO D N   1 
ATOM   1717 C CA  . PRO D 1 21 ? -40.282 24.472  -16.543 1.00 27.90 ? 21   PRO D CA  1 
ATOM   1718 C C   . PRO D 1 21 ? -40.178 23.498  -15.373 1.00 30.47 ? 21   PRO D C   1 
ATOM   1719 O O   . PRO D 1 21 ? -39.823 22.336  -15.588 1.00 20.28 ? 21   PRO D O   1 
ATOM   1720 C CB  . PRO D 1 21 ? -41.350 23.989  -17.525 1.00 28.58 ? 21   PRO D CB  1 
ATOM   1721 C CG  . PRO D 1 21 ? -40.818 24.357  -18.864 1.00 23.03 ? 21   PRO D CG  1 
ATOM   1722 C CD  . PRO D 1 21 ? -39.328 24.265  -18.775 1.00 25.64 ? 21   PRO D CD  1 
ATOM   1723 N N   . ARG D 1 22 ? -40.475 23.968  -14.163 1.00 25.63 ? 22   ARG D N   1 
ATOM   1724 C CA  . ARG D 1 22 ? -40.392 23.124  -12.985 1.00 25.64 ? 22   ARG D CA  1 
ATOM   1725 C C   . ARG D 1 22 ? -41.045 21.753  -13.182 1.00 26.50 ? 22   ARG D C   1 
ATOM   1726 O O   . ARG D 1 22 ? -40.474 20.727  -12.822 1.00 25.54 ? 22   ARG D O   1 
ATOM   1727 C CB  . ARG D 1 22 ? -41.029 23.807  -11.780 1.00 22.09 ? 22   ARG D CB  1 
ATOM   1728 C CG  . ARG D 1 22 ? -41.034 22.930  -10.522 1.00 21.75 ? 22   ARG D CG  1 
ATOM   1729 C CD  . ARG D 1 22 ? -39.616 22.531  -10.141 1.00 20.73 ? 22   ARG D CD  1 
ATOM   1730 N NE  . ARG D 1 22 ? -39.568 21.690  -8.955  1.00 17.48 ? 22   ARG D NE  1 
ATOM   1731 C CZ  . ARG D 1 22 ? -39.924 20.411  -8.941  1.00 21.73 ? 22   ARG D CZ  1 
ATOM   1732 N NH1 . ARG D 1 22 ? -40.347 19.832  -10.056 1.00 29.48 ? 22   ARG D NH1 1 
ATOM   1733 N NH2 . ARG D 1 22 ? -39.867 19.711  -7.817  1.00 15.85 ? 22   ARG D NH2 1 
ATOM   1734 N N   . ASN D 1 23 ? -42.242 21.734  -13.750 1.00 29.11 ? 23   ASN D N   1 
ATOM   1735 C CA  A ASN D 1 23 ? -43.013 20.505  -13.897 0.44 27.40 ? 23   ASN D CA  1 
ATOM   1736 C CA  B ASN D 1 23 ? -42.977 20.477  -13.861 0.56 27.46 ? 23   ASN D CA  1 
ATOM   1737 C C   . ASN D 1 23 ? -42.507 19.539  -14.974 1.00 33.49 ? 23   ASN D C   1 
ATOM   1738 O O   . ASN D 1 23 ? -43.117 18.497  -15.221 1.00 32.58 ? 23   ASN D O   1 
ATOM   1739 C CB  A ASN D 1 23 ? -44.516 20.798  -14.078 0.44 26.74 ? 23   ASN D CB  1 
ATOM   1740 C CB  B ASN D 1 23 ? -44.479 20.729  -13.946 0.56 26.68 ? 23   ASN D CB  1 
ATOM   1741 C CG  A ASN D 1 23 ? -44.810 22.228  -14.560 0.44 26.66 ? 23   ASN D CG  1 
ATOM   1742 C CG  B ASN D 1 23 ? -45.132 20.741  -12.589 0.56 22.85 ? 23   ASN D CG  1 
ATOM   1743 O OD1 A ASN D 1 23 ? -43.909 23.016  -14.855 0.44 21.63 ? 23   ASN D OD1 1 
ATOM   1744 O OD1 B ASN D 1 23 ? -44.759 19.969  -11.710 0.56 26.07 ? 23   ASN D OD1 1 
ATOM   1745 N ND2 A ASN D 1 23 ? -46.098 22.560  -14.639 0.44 26.12 ? 23   ASN D ND2 1 
ATOM   1746 N ND2 B ASN D 1 23 ? -46.109 21.614  -12.407 0.56 22.43 ? 23   ASN D ND2 1 
ATOM   1747 N N   . PHE D 1 24 ? -41.407 19.886  -15.630 1.00 25.46 ? 24   PHE D N   1 
ATOM   1748 C CA  . PHE D 1 24 ? -40.817 18.955  -16.579 1.00 24.37 ? 24   PHE D CA  1 
ATOM   1749 C C   . PHE D 1 24 ? -39.821 18.083  -15.835 1.00 27.15 ? 24   PHE D C   1 
ATOM   1750 O O   . PHE D 1 24 ? -39.391 17.036  -16.328 1.00 35.74 ? 24   PHE D O   1 
ATOM   1751 C CB  . PHE D 1 24 ? -40.073 19.689  -17.685 1.00 27.56 ? 24   PHE D CB  1 
ATOM   1752 C CG  . PHE D 1 24 ? -40.947 20.237  -18.763 1.00 23.44 ? 24   PHE D CG  1 
ATOM   1753 C CD1 . PHE D 1 24 ? -40.387 20.655  -19.958 1.00 26.78 ? 24   PHE D CD1 1 
ATOM   1754 C CD2 . PHE D 1 24 ? -42.311 20.344  -18.594 1.00 25.47 ? 24   PHE D CD2 1 
ATOM   1755 C CE1 . PHE D 1 24 ? -41.174 21.179  -20.967 1.00 29.96 ? 24   PHE D CE1 1 
ATOM   1756 C CE2 . PHE D 1 24 ? -43.107 20.857  -19.602 1.00 25.64 ? 24   PHE D CE2 1 
ATOM   1757 C CZ  . PHE D 1 24 ? -42.536 21.277  -20.790 1.00 28.08 ? 24   PHE D CZ  1 
ATOM   1758 N N   . VAL D 1 25 ? -39.449 18.526  -14.644 1.00 16.96 ? 25   VAL D N   1 
ATOM   1759 C CA  . VAL D 1 25 ? -38.378 17.887  -13.890 1.00 19.82 ? 25   VAL D CA  1 
ATOM   1760 C C   . VAL D 1 25 ? -38.936 16.964  -12.821 1.00 24.78 ? 25   VAL D C   1 
ATOM   1761 O O   . VAL D 1 25 ? -39.822 17.355  -12.064 1.00 26.76 ? 25   VAL D O   1 
ATOM   1762 C CB  . VAL D 1 25 ? -37.471 18.940  -13.222 1.00 17.34 ? 25   VAL D CB  1 
ATOM   1763 C CG1 . VAL D 1 25 ? -36.348 18.279  -12.461 1.00 21.59 ? 25   VAL D CG1 1 
ATOM   1764 C CG2 . VAL D 1 25 ? -36.911 19.901  -14.270 1.00 18.24 ? 25   VAL D CG2 1 
ATOM   1765 N N   . VAL D 1 26 ? -38.415 15.743  -12.764 1.00 24.66 ? 26   VAL D N   1 
ATOM   1766 C CA  . VAL D 1 26 ? -38.851 14.754  -11.783 1.00 27.97 ? 26   VAL D CA  1 
ATOM   1767 C C   . VAL D 1 26 ? -37.741 14.411  -10.784 1.00 31.72 ? 26   VAL D C   1 
ATOM   1768 O O   . VAL D 1 26 ? -38.021 14.038  -9.651  1.00 33.49 ? 26   VAL D O   1 
ATOM   1769 C CB  . VAL D 1 26 ? -39.372 13.436  -12.458 1.00 29.63 ? 26   VAL D CB  1 
ATOM   1770 C CG1 . VAL D 1 26 ? -40.506 13.726  -13.412 1.00 30.89 ? 26   VAL D CG1 1 
ATOM   1771 C CG2 . VAL D 1 26 ? -38.264 12.721  -13.194 1.00 24.32 ? 26   VAL D CG2 1 
ATOM   1772 N N   . ASP D 1 27 ? -36.486 14.541  -11.200 1.00 31.05 ? 27   ASP D N   1 
ATOM   1773 C CA  . ASP D 1 27 ? -35.363 14.173  -10.341 1.00 27.30 ? 27   ASP D CA  1 
ATOM   1774 C C   . ASP D 1 27 ? -34.100 14.927  -10.760 1.00 28.19 ? 27   ASP D C   1 
ATOM   1775 O O   . ASP D 1 27 ? -34.088 15.621  -11.781 1.00 23.90 ? 27   ASP D O   1 
ATOM   1776 C CB  . ASP D 1 27 ? -35.109 12.665  -10.419 1.00 25.88 ? 27   ASP D CB  1 
ATOM   1777 C CG  . ASP D 1 27 ? -34.633 12.070  -9.093  1.00 43.72 ? 27   ASP D CG  1 
ATOM   1778 O OD1 . ASP D 1 27 ? -33.950 12.771  -8.319  1.00 43.74 ? 27   ASP D OD1 1 
ATOM   1779 O OD2 . ASP D 1 27 ? -34.946 10.888  -8.823  1.00 50.95 ? 27   ASP D OD2 1 
ATOM   1780 N N   . TYR D 1 28 ? -33.037 14.782  -9.978  1.00 20.67 ? 28   TYR D N   1 
ATOM   1781 C CA  . TYR D 1 28 ? -31.764 15.389  -10.321 1.00 26.88 ? 28   TYR D CA  1 
ATOM   1782 C C   . TYR D 1 28 ? -30.642 14.615  -9.675  1.00 23.55 ? 28   TYR D C   1 
ATOM   1783 O O   . TYR D 1 28 ? -30.864 13.835  -8.764  1.00 33.88 ? 28   TYR D O   1 
ATOM   1784 C CB  . TYR D 1 28 ? -31.705 16.825  -9.814  1.00 21.44 ? 28   TYR D CB  1 
ATOM   1785 C CG  . TYR D 1 28 ? -31.211 16.922  -8.390  1.00 23.90 ? 28   TYR D CG  1 
ATOM   1786 C CD1 . TYR D 1 28 ? -29.866 17.138  -8.112  1.00 28.85 ? 28   TYR D CD1 1 
ATOM   1787 C CD2 . TYR D 1 28 ? -32.085 16.794  -7.317  1.00 24.00 ? 28   TYR D CD2 1 
ATOM   1788 C CE1 . TYR D 1 28 ? -29.407 17.224  -6.797  1.00 26.78 ? 28   TYR D CE1 1 
ATOM   1789 C CE2 . TYR D 1 28 ? -31.636 16.874  -6.011  1.00 26.07 ? 28   TYR D CE2 1 
ATOM   1790 C CZ  . TYR D 1 28 ? -30.298 17.091  -5.760  1.00 28.46 ? 28   TYR D CZ  1 
ATOM   1791 O OH  . TYR D 1 28 ? -29.849 17.165  -4.467  1.00 34.57 ? 28   TYR D OH  1 
ATOM   1792 N N   . TYR D 1 29 ? -29.429 14.850  -10.143 1.00 20.41 ? 29   TYR D N   1 
ATOM   1793 C CA  . TYR D 1 29 ? -28.246 14.377  -9.451  1.00 22.56 ? 29   TYR D CA  1 
ATOM   1794 C C   . TYR D 1 29 ? -27.114 15.328  -9.764  1.00 23.45 ? 29   TYR D C   1 
ATOM   1795 O O   . TYR D 1 29 ? -27.240 16.192  -10.620 1.00 28.47 ? 29   TYR D O   1 
ATOM   1796 C CB  . TYR D 1 29 ? -27.886 12.923  -9.805  1.00 23.33 ? 29   TYR D CB  1 
ATOM   1797 C CG  . TYR D 1 29 ? -27.416 12.676  -11.215 1.00 21.02 ? 29   TYR D CG  1 
ATOM   1798 C CD1 . TYR D 1 29 ? -26.100 12.918  -11.587 1.00 20.66 ? 29   TYR D CD1 1 
ATOM   1799 C CD2 . TYR D 1 29 ? -28.290 12.179  -12.175 1.00 19.56 ? 29   TYR D CD2 1 
ATOM   1800 C CE1 . TYR D 1 29 ? -25.673 12.678  -12.891 1.00 18.05 ? 29   TYR D CE1 1 
ATOM   1801 C CE2 . TYR D 1 29 ? -27.879 11.943  -13.462 1.00 14.47 ? 29   TYR D CE2 1 
ATOM   1802 C CZ  . TYR D 1 29 ? -26.571 12.190  -13.816 1.00 17.04 ? 29   TYR D CZ  1 
ATOM   1803 O OH  . TYR D 1 29 ? -26.182 11.951  -15.114 1.00 25.44 ? 29   TYR D OH  1 
ATOM   1804 N N   . GLU D 1 30 ? -26.010 15.188  -9.057  1.00 25.95 ? 30   GLU D N   1 
ATOM   1805 C CA  . GLU D 1 30 ? -24.921 16.118  -9.231  1.00 23.01 ? 30   GLU D CA  1 
ATOM   1806 C C   . GLU D 1 30 ? -23.663 15.376  -9.666  1.00 29.70 ? 30   GLU D C   1 
ATOM   1807 O O   . GLU D 1 30 ? -23.328 14.329  -9.105  1.00 32.94 ? 30   GLU D O   1 
ATOM   1808 C CB  . GLU D 1 30 ? -24.706 16.890  -7.943  1.00 24.10 ? 30   GLU D CB  1 
ATOM   1809 C CG  . GLU D 1 30 ? -24.795 18.378  -8.173  1.00 44.93 ? 30   GLU D CG  1 
ATOM   1810 C CD  . GLU D 1 30 ? -25.244 19.140  -6.952  1.00 46.77 ? 30   GLU D CD  1 
ATOM   1811 O OE1 . GLU D 1 30 ? -26.254 18.729  -6.337  1.00 38.94 ? 30   GLU D OE1 1 
ATOM   1812 O OE2 . GLU D 1 30 ? -24.591 20.156  -6.624  1.00 47.98 ? 30   GLU D OE2 1 
ATOM   1813 N N   . THR D 1 31 ? -22.978 15.904  -10.675 1.00 23.12 ? 31   THR D N   1 
ATOM   1814 C CA  . THR D 1 31 ? -21.889 15.158  -11.303 1.00 26.78 ? 31   THR D CA  1 
ATOM   1815 C C   . THR D 1 31 ? -20.686 15.010  -10.384 1.00 22.51 ? 31   THR D C   1 
ATOM   1816 O O   . THR D 1 31 ? -20.400 15.900  -9.587  1.00 30.35 ? 31   THR D O   1 
ATOM   1817 C CB  . THR D 1 31 ? -21.472 15.759  -12.664 1.00 19.67 ? 31   THR D CB  1 
ATOM   1818 O OG1 . THR D 1 31 ? -21.016 17.106  -12.485 1.00 26.90 ? 31   THR D OG1 1 
ATOM   1819 C CG2 . THR D 1 31 ? -22.642 15.738  -13.619 1.00 13.95 ? 31   THR D CG2 1 
ATOM   1820 N N   . SER D 1 32 ? -19.990 13.879  -10.492 1.00 25.01 ? 32   SER D N   1 
ATOM   1821 C CA  . SER D 1 32 ? -18.859 13.587  -9.604  1.00 24.48 ? 32   SER D CA  1 
ATOM   1822 C C   . SER D 1 32 ? -17.877 14.733  -9.570  1.00 24.41 ? 32   SER D C   1 
ATOM   1823 O O   . SER D 1 32 ? -17.700 15.427  -10.566 1.00 28.20 ? 32   SER D O   1 
ATOM   1824 C CB  . SER D 1 32 ? -18.118 12.317  -10.035 1.00 23.54 ? 32   SER D CB  1 
ATOM   1825 O OG  . SER D 1 32 ? -16.781 12.336  -9.548  1.00 22.86 ? 32   SER D OG  1 
ATOM   1826 N N   . SER D 1 33 ? -17.226 14.910  -8.425  1.00 29.13 ? 33   SER D N   1 
ATOM   1827 C CA  . SER D 1 33 ? -16.185 15.925  -8.276  1.00 25.57 ? 33   SER D CA  1 
ATOM   1828 C C   . SER D 1 33 ? -15.005 15.637  -9.182  1.00 22.57 ? 33   SER D C   1 
ATOM   1829 O O   . SER D 1 33 ? -14.159 16.500  -9.377  1.00 25.50 ? 33   SER D O   1 
ATOM   1830 C CB  . SER D 1 33 ? -15.706 16.027  -6.815  1.00 30.46 ? 33   SER D CB  1 
ATOM   1831 O OG  . SER D 1 33 ? -14.911 14.910  -6.431  1.00 27.13 ? 33   SER D OG  1 
ATOM   1832 N N   . LEU D 1 34 ? -14.940 14.425  -9.734  1.00 23.32 ? 34   LEU D N   1 
ATOM   1833 C CA  . LEU D 1 34 ? -13.846 14.080  -10.640 1.00 20.81 ? 34   LEU D CA  1 
ATOM   1834 C C   . LEU D 1 34 ? -13.990 14.768  -11.988 1.00 23.62 ? 34   LEU D C   1 
ATOM   1835 O O   . LEU D 1 34 ? -13.015 14.884  -12.734 1.00 23.34 ? 34   LEU D O   1 
ATOM   1836 C CB  . LEU D 1 34 ? -13.753 12.568  -10.860 1.00 26.57 ? 34   LEU D CB  1 
ATOM   1837 C CG  . LEU D 1 34 ? -13.596 11.680  -9.626  1.00 32.16 ? 34   LEU D CG  1 
ATOM   1838 C CD1 . LEU D 1 34 ? -13.634 10.210  -9.992  1.00 14.25 ? 34   LEU D CD1 1 
ATOM   1839 C CD2 . LEU D 1 34 ? -12.320 12.028  -8.876  1.00 26.53 ? 34   LEU D CD2 1 
ATOM   1840 N N   . CYS D 1 35 ? -15.207 15.192  -12.325 1.00 19.81 ? 35   CYS D N   1 
ATOM   1841 C CA  . CYS D 1 35 ? -15.408 15.891  -13.592 1.00 19.23 ? 35   CYS D CA  1 
ATOM   1842 C C   . CYS D 1 35 ? -14.680 17.234  -13.571 1.00 25.96 ? 35   CYS D C   1 
ATOM   1843 O O   . CYS D 1 35 ? -14.253 17.717  -12.511 1.00 28.26 ? 35   CYS D O   1 
ATOM   1844 C CB  . CYS D 1 35 ? -16.894 16.070  -13.903 1.00 21.00 ? 35   CYS D CB  1 
ATOM   1845 S SG  . CYS D 1 35 ? -17.800 14.506  -14.140 1.00 32.04 ? 35   CYS D SG  1 
ATOM   1846 N N   . SER D 1 36 ? -14.529 17.836  -14.741 1.00 25.03 ? 36   SER D N   1 
ATOM   1847 C CA  . SER D 1 36 ? -13.709 19.032  -14.869 1.00 23.18 ? 36   SER D CA  1 
ATOM   1848 C C   . SER D 1 36 ? -14.513 20.274  -14.549 1.00 28.37 ? 36   SER D C   1 
ATOM   1849 O O   . SER D 1 36 ? -13.953 21.344  -14.341 1.00 30.77 ? 36   SER D O   1 
ATOM   1850 C CB  . SER D 1 36 ? -13.167 19.137  -16.276 1.00 15.55 ? 36   SER D CB  1 
ATOM   1851 O OG  . SER D 1 36 ? -14.252 19.148  -17.184 1.00 33.76 ? 36   SER D OG  1 
ATOM   1852 N N   . GLN D 1 37 ? -15.831 20.138  -14.516 1.00 25.24 ? 37   GLN D N   1 
ATOM   1853 C CA  . GLN D 1 37 ? -16.663 21.247  -14.070 1.00 32.68 ? 37   GLN D CA  1 
ATOM   1854 C C   . GLN D 1 37 ? -17.876 20.760  -13.287 1.00 33.02 ? 37   GLN D C   1 
ATOM   1855 O O   . GLN D 1 37 ? -18.375 19.657  -13.528 1.00 28.70 ? 37   GLN D O   1 
ATOM   1856 C CB  . GLN D 1 37 ? -17.072 22.163  -15.238 1.00 31.86 ? 37   GLN D CB  1 
ATOM   1857 C CG  . GLN D 1 37 ? -17.829 21.500  -16.389 1.00 29.37 ? 37   GLN D CG  1 
ATOM   1858 C CD  . GLN D 1 37 ? -18.251 22.513  -17.449 1.00 40.79 ? 37   GLN D CD  1 
ATOM   1859 O OE1 . GLN D 1 37 ? -18.684 22.155  -18.551 1.00 37.36 ? 37   GLN D OE1 1 
ATOM   1860 N NE2 . GLN D 1 37 ? -18.113 23.796  -17.116 1.00 49.19 ? 37   GLN D NE2 1 
ATOM   1861 N N   . PRO D 1 38 ? -18.336 21.582  -12.332 1.00 26.61 ? 38   PRO D N   1 
ATOM   1862 C CA  . PRO D 1 38 ? -19.494 21.280  -11.495 1.00 18.35 ? 38   PRO D CA  1 
ATOM   1863 C C   . PRO D 1 38 ? -20.710 21.247  -12.384 1.00 29.46 ? 38   PRO D C   1 
ATOM   1864 O O   . PRO D 1 38 ? -20.756 21.975  -13.377 1.00 27.75 ? 38   PRO D O   1 
ATOM   1865 C CB  . PRO D 1 38 ? -19.582 22.488  -10.570 1.00 26.01 ? 38   PRO D CB  1 
ATOM   1866 C CG  . PRO D 1 38 ? -18.250 23.146  -10.646 1.00 29.45 ? 38   PRO D CG  1 
ATOM   1867 C CD  . PRO D 1 38 ? -17.778 22.909  -12.038 1.00 23.83 ? 38   PRO D CD  1 
ATOM   1868 N N   . ALA D 1 39 ? -21.677 20.405  -12.058 1.00 26.04 ? 39   ALA D N   1 
ATOM   1869 C CA  . ALA D 1 39 ? -22.871 20.335  -12.877 1.00 26.27 ? 39   ALA D CA  1 
ATOM   1870 C C   . ALA D 1 39 ? -24.011 19.699  -12.105 1.00 25.89 ? 39   ALA D C   1 
ATOM   1871 O O   . ALA D 1 39 ? -23.787 18.952  -11.164 1.00 23.79 ? 39   ALA D O   1 
ATOM   1872 C CB  . ALA D 1 39 ? -22.599 19.571  -14.166 1.00 22.15 ? 39   ALA D CB  1 
ATOM   1873 N N   . VAL D 1 40 ? -25.233 20.031  -12.504 1.00 28.11 ? 40   VAL D N   1 
ATOM   1874 C CA  . VAL D 1 40 ? -26.417 19.345  -12.027 1.00 22.14 ? 40   VAL D CA  1 
ATOM   1875 C C   . VAL D 1 40 ? -27.058 18.708  -13.228 1.00 20.79 ? 40   VAL D C   1 
ATOM   1876 O O   . VAL D 1 40 ? -27.141 19.323  -14.277 1.00 26.80 ? 40   VAL D O   1 
ATOM   1877 C CB  . VAL D 1 40 ? -27.405 20.322  -11.400 1.00 22.52 ? 40   VAL D CB  1 
ATOM   1878 C CG1 . VAL D 1 40 ? -28.661 19.591  -10.963 1.00 20.54 ? 40   VAL D CG1 1 
ATOM   1879 C CG2 . VAL D 1 40 ? -26.752 21.040  -10.228 1.00 15.27 ? 40   VAL D CG2 1 
ATOM   1880 N N   . VAL D 1 41 ? -27.482 17.463  -13.106 1.00 27.84 ? 41   VAL D N   1 
ATOM   1881 C CA  . VAL D 1 41 ? -28.178 16.826  -14.214 1.00 23.81 ? 41   VAL D CA  1 
ATOM   1882 C C   . VAL D 1 41 ? -29.630 16.656  -13.821 1.00 27.83 ? 41   VAL D C   1 
ATOM   1883 O O   . VAL D 1 41 ? -29.932 16.022  -12.802 1.00 29.04 ? 41   VAL D O   1 
ATOM   1884 C CB  . VAL D 1 41 ? -27.584 15.451  -14.577 1.00 18.71 ? 41   VAL D CB  1 
ATOM   1885 C CG1 . VAL D 1 41 ? -28.348 14.836  -15.745 1.00 21.74 ? 41   VAL D CG1 1 
ATOM   1886 C CG2 . VAL D 1 41 ? -26.119 15.572  -14.907 1.00 16.83 ? 41   VAL D CG2 1 
ATOM   1887 N N   . PHE D 1 42 ? -30.529 17.235  -14.613 1.00 22.62 ? 42   PHE D N   1 
ATOM   1888 C CA  . PHE D 1 42 ? -31.956 17.067  -14.364 1.00 23.73 ? 42   PHE D CA  1 
ATOM   1889 C C   . PHE D 1 42 ? -32.552 15.925  -15.180 1.00 25.65 ? 42   PHE D C   1 
ATOM   1890 O O   . PHE D 1 42 ? -32.208 15.748  -16.351 1.00 29.85 ? 42   PHE D O   1 
ATOM   1891 C CB  . PHE D 1 42 ? -32.710 18.366  -14.639 1.00 18.81 ? 42   PHE D CB  1 
ATOM   1892 C CG  . PHE D 1 42 ? -32.385 19.469  -13.676 1.00 18.48 ? 42   PHE D CG  1 
ATOM   1893 C CD1 . PHE D 1 42 ? -32.809 19.402  -12.363 1.00 17.00 ? 42   PHE D CD1 1 
ATOM   1894 C CD2 . PHE D 1 42 ? -31.653 20.576  -14.085 1.00 25.66 ? 42   PHE D CD2 1 
ATOM   1895 C CE1 . PHE D 1 42 ? -32.511 20.409  -11.463 1.00 19.40 ? 42   PHE D CE1 1 
ATOM   1896 C CE2 . PHE D 1 42 ? -31.344 21.589  -13.193 1.00 27.34 ? 42   PHE D CE2 1 
ATOM   1897 C CZ  . PHE D 1 42 ? -31.780 21.506  -11.874 1.00 29.29 ? 42   PHE D CZ  1 
ATOM   1898 N N   . GLN D 1 43 ? -33.432 15.143  -14.553 1.00 28.85 ? 43   GLN D N   1 
ATOM   1899 C CA  . GLN D 1 43 ? -34.206 14.136  -15.270 1.00 25.97 ? 43   GLN D CA  1 
ATOM   1900 C C   . GLN D 1 43 ? -35.613 14.641  -15.537 1.00 29.70 ? 43   GLN D C   1 
ATOM   1901 O O   . GLN D 1 43 ? -36.265 15.166  -14.643 1.00 30.85 ? 43   GLN D O   1 
ATOM   1902 C CB  . GLN D 1 43 ? -34.289 12.816  -14.510 1.00 30.31 ? 43   GLN D CB  1 
ATOM   1903 C CG  . GLN D 1 43 ? -35.145 11.796  -15.285 1.00 56.02 ? 43   GLN D CG  1 
ATOM   1904 C CD  . GLN D 1 43 ? -35.319 10.449  -14.586 1.00 66.22 ? 43   GLN D CD  1 
ATOM   1905 O OE1 . GLN D 1 43 ? -34.341 9.786   -14.218 1.00 67.63 ? 43   GLN D OE1 1 
ATOM   1906 N NE2 . GLN D 1 43 ? -36.577 10.026  -14.427 1.00 50.62 ? 43   GLN D NE2 1 
ATOM   1907 N N   . THR D 1 44 ? -36.082 14.480  -16.768 1.00 30.90 ? 44   THR D N   1 
ATOM   1908 C CA  . THR D 1 44 ? -37.393 14.989  -17.152 1.00 27.76 ? 44   THR D CA  1 
ATOM   1909 C C   . THR D 1 44 ? -38.446 13.887  -17.088 1.00 36.16 ? 44   THR D C   1 
ATOM   1910 O O   . THR D 1 44 ? -38.139 12.734  -16.757 1.00 32.98 ? 44   THR D O   1 
ATOM   1911 C CB  . THR D 1 44 ? -37.382 15.589  -18.568 1.00 30.24 ? 44   THR D CB  1 
ATOM   1912 O OG1 . THR D 1 44 ? -37.234 14.542  -19.533 1.00 27.68 ? 44   THR D OG1 1 
ATOM   1913 C CG2 . THR D 1 44 ? -36.239 16.571  -18.721 1.00 22.17 ? 44   THR D CG2 1 
ATOM   1914 N N   . LYS D 1 45 ? -39.690 14.246  -17.396 1.00 32.38 ? 45   LYS D N   1 
ATOM   1915 C CA  . LYS D 1 45 ? -40.784 13.286  -17.350 1.00 34.74 ? 45   LYS D CA  1 
ATOM   1916 C C   . LYS D 1 45 ? -40.666 12.266  -18.462 1.00 35.14 ? 45   LYS D C   1 
ATOM   1917 O O   . LYS D 1 45 ? -41.129 11.137  -18.333 1.00 38.12 ? 45   LYS D O   1 
ATOM   1918 C CB  . LYS D 1 45 ? -42.135 13.994  -17.408 1.00 31.39 ? 45   LYS D CB  1 
ATOM   1919 C CG  . LYS D 1 45 ? -42.316 14.995  -16.293 1.00 36.04 ? 45   LYS D CG  1 
ATOM   1920 C CD  . LYS D 1 45 ? -43.449 14.633  -15.346 1.00 47.14 ? 45   LYS D CD  1 
ATOM   1921 C CE  . LYS D 1 45 ? -43.451 15.555  -14.109 1.00 36.51 ? 45   LYS D CE  1 
ATOM   1922 N NZ  . LYS D 1 45 ? -44.620 16.489  -14.078 1.00 37.04 ? 45   LYS D NZ  1 
ATOM   1923 N N   . ARG D 1 46 ? -40.043 12.668  -19.558 1.00 35.23 ? 46   ARG D N   1 
ATOM   1924 C CA  . ARG D 1 46 ? -39.813 11.750  -20.656 1.00 33.44 ? 46   ARG D CA  1 
ATOM   1925 C C   . ARG D 1 46 ? -38.504 11.008  -20.455 1.00 32.36 ? 46   ARG D C   1 
ATOM   1926 O O   . ARG D 1 46 ? -38.011 10.355  -21.367 1.00 44.99 ? 46   ARG D O   1 
ATOM   1927 C CB  . ARG D 1 46 ? -39.817 12.484  -21.998 1.00 33.71 ? 46   ARG D CB  1 
ATOM   1928 C CG  . ARG D 1 46 ? -41.137 13.160  -22.335 1.00 34.07 ? 46   ARG D CG  1 
ATOM   1929 C CD  . ARG D 1 46 ? -41.520 12.991  -23.811 1.00 45.93 ? 46   ARG D CD  1 
ATOM   1930 N NE  . ARG D 1 46 ? -40.373 12.709  -24.680 1.00 52.71 ? 46   ARG D NE  1 
ATOM   1931 C CZ  . ARG D 1 46 ? -39.285 13.476  -24.780 1.00 56.47 ? 46   ARG D CZ  1 
ATOM   1932 N NH1 . ARG D 1 46 ? -39.169 14.586  -24.056 1.00 52.09 ? 46   ARG D NH1 1 
ATOM   1933 N NH2 . ARG D 1 46 ? -38.296 13.125  -25.593 1.00 57.27 ? 46   ARG D NH2 1 
ATOM   1934 N N   . SER D 1 47 ? -37.943 11.116  -19.257 1.00 31.45 ? 47   SER D N   1 
ATOM   1935 C CA  . SER D 1 47 ? -36.774 10.323  -18.877 1.00 35.06 ? 47   SER D CA  1 
ATOM   1936 C C   . SER D 1 47 ? -35.529 10.728  -19.646 1.00 42.54 ? 47   SER D C   1 
ATOM   1937 O O   . SER D 1 47 ? -34.618 9.914   -19.847 1.00 39.36 ? 47   SER D O   1 
ATOM   1938 C CB  . SER D 1 47 ? -37.036 8.834   -19.098 1.00 36.06 ? 47   SER D CB  1 
ATOM   1939 O OG  . SER D 1 47 ? -37.386 8.197   -17.886 1.00 43.75 ? 47   SER D OG  1 
ATOM   1940 N N   . LYS D 1 48 ? -35.498 11.977  -20.090 1.00 26.70 ? 48   LYS D N   1 
ATOM   1941 C CA  . LYS D 1 48 ? -34.310 12.510  -20.720 1.00 25.14 ? 48   LYS D CA  1 
ATOM   1942 C C   . LYS D 1 48 ? -33.419 13.140  -19.661 1.00 32.37 ? 48   LYS D C   1 
ATOM   1943 O O   . LYS D 1 48 ? -33.841 13.340  -18.520 1.00 36.44 ? 48   LYS D O   1 
ATOM   1944 C CB  . LYS D 1 48 ? -34.708 13.515  -21.795 1.00 38.16 ? 48   LYS D CB  1 
ATOM   1945 C CG  . LYS D 1 48 ? -35.532 12.880  -22.912 1.00 40.46 ? 48   LYS D CG  1 
ATOM   1946 C CD  . LYS D 1 48 ? -34.672 11.935  -23.753 1.00 48.45 ? 48   LYS D CD  1 
ATOM   1947 C CE  . LYS D 1 48 ? -35.441 10.689  -24.202 1.00 52.66 ? 48   LYS D CE  1 
ATOM   1948 N NZ  . LYS D 1 48 ? -36.679 11.030  -24.962 1.00 47.50 ? 48   LYS D NZ  1 
ATOM   1949 N N   . GLN D 1 49 ? -32.184 13.454  -20.033 1.00 30.03 ? 49   GLN D N   1 
ATOM   1950 C CA  . GLN D 1 49 ? -31.198 13.926  -19.071 1.00 20.90 ? 49   GLN D CA  1 
ATOM   1951 C C   . GLN D 1 49 ? -30.452 15.141  -19.586 1.00 30.17 ? 49   GLN D C   1 
ATOM   1952 O O   . GLN D 1 49 ? -29.853 15.100  -20.654 1.00 38.35 ? 49   GLN D O   1 
ATOM   1953 C CB  . GLN D 1 49 ? -30.227 12.810  -18.769 1.00 28.66 ? 49   GLN D CB  1 
ATOM   1954 C CG  . GLN D 1 49 ? -30.902 11.576  -18.235 1.00 19.57 ? 49   GLN D CG  1 
ATOM   1955 C CD  . GLN D 1 49 ? -30.395 11.265  -16.872 1.00 41.81 ? 49   GLN D CD  1 
ATOM   1956 O OE1 . GLN D 1 49 ? -31.152 11.269  -15.885 1.00 45.24 ? 49   GLN D OE1 1 
ATOM   1957 N NE2 . GLN D 1 49 ? -29.081 11.037  -16.782 1.00 42.33 ? 49   GLN D NE2 1 
ATOM   1958 N N   . VAL D 1 50 ? -30.483 16.222  -18.813 1.00 29.33 ? 50   VAL D N   1 
ATOM   1959 C CA  . VAL D 1 50 ? -30.063 17.525  -19.302 1.00 24.36 ? 50   VAL D CA  1 
ATOM   1960 C C   . VAL D 1 50 ? -29.027 18.145  -18.375 1.00 21.78 ? 50   VAL D C   1 
ATOM   1961 O O   . VAL D 1 50 ? -29.303 18.369  -17.211 1.00 23.03 ? 50   VAL D O   1 
ATOM   1962 C CB  . VAL D 1 50 ? -31.265 18.482  -19.309 1.00 28.50 ? 50   VAL D CB  1 
ATOM   1963 C CG1 . VAL D 1 50 ? -30.939 19.772  -20.047 1.00 32.83 ? 50   VAL D CG1 1 
ATOM   1964 C CG2 . VAL D 1 50 ? -32.476 17.801  -19.898 1.00 21.74 ? 50   VAL D CG2 1 
ATOM   1965 N N   . CYS D 1 51 ? -27.839 18.443  -18.877 1.00 27.42 ? 51   CYS D N   1 
ATOM   1966 C CA  . CYS D 1 51 ? -26.866 19.124  -18.038 1.00 25.55 ? 51   CYS D CA  1 
ATOM   1967 C C   . CYS D 1 51 ? -27.347 20.533  -17.769 1.00 32.90 ? 51   CYS D C   1 
ATOM   1968 O O   . CYS D 1 51 ? -27.979 21.156  -18.623 1.00 38.02 ? 51   CYS D O   1 
ATOM   1969 C CB  . CYS D 1 51 ? -25.488 19.131  -18.689 1.00 24.11 ? 51   CYS D CB  1 
ATOM   1970 S SG  . CYS D 1 51 ? -24.861 17.456  -18.947 1.00 37.13 ? 51   CYS D SG  1 
ATOM   1971 N N   . ALA D 1 52 ? -27.053 21.029  -16.576 1.00 28.83 ? 52   ALA D N   1 
ATOM   1972 C CA  . ALA D 1 52 ? -27.484 22.352  -16.177 1.00 19.94 ? 52   ALA D CA  1 
ATOM   1973 C C   . ALA D 1 52 ? -26.420 23.023  -15.321 1.00 28.43 ? 52   ALA D C   1 
ATOM   1974 O O   . ALA D 1 52 ? -25.788 22.388  -14.464 1.00 32.84 ? 52   ALA D O   1 
ATOM   1975 C CB  . ALA D 1 52 ? -28.781 22.263  -15.430 1.00 27.60 ? 52   ALA D CB  1 
ATOM   1976 N N   . ASP D 1 53 ? -26.228 24.314  -15.559 1.00 26.88 ? 53   ASP D N   1 
ATOM   1977 C CA  . ASP D 1 53 ? -25.198 25.086  -14.884 1.00 32.35 ? 53   ASP D CA  1 
ATOM   1978 C C   . ASP D 1 53 ? -25.572 25.355  -13.419 1.00 27.28 ? 53   ASP D C   1 
ATOM   1979 O O   . ASP D 1 53 ? -26.538 26.050  -13.141 1.00 28.27 ? 53   ASP D O   1 
ATOM   1980 C CB  . ASP D 1 53 ? -25.007 26.390  -15.652 1.00 35.62 ? 53   ASP D CB  1 
ATOM   1981 C CG  . ASP D 1 53 ? -23.826 27.190  -15.171 1.00 38.19 ? 53   ASP D CG  1 
ATOM   1982 O OD1 . ASP D 1 53 ? -23.394 27.008  -14.010 1.00 41.34 ? 53   ASP D OD1 1 
ATOM   1983 O OD2 . ASP D 1 53 ? -23.340 28.014  -15.968 1.00 34.27 ? 53   ASP D OD2 1 
ATOM   1984 N N   . PRO D 1 54 ? -24.796 24.802  -12.474 1.00 37.45 ? 54   PRO D N   1 
ATOM   1985 C CA  . PRO D 1 54 ? -25.120 24.927  -11.041 1.00 33.66 ? 54   PRO D CA  1 
ATOM   1986 C C   . PRO D 1 54 ? -24.984 26.358  -10.561 1.00 38.53 ? 54   PRO D C   1 
ATOM   1987 O O   . PRO D 1 54 ? -25.374 26.663  -9.434  1.00 41.65 ? 54   PRO D O   1 
ATOM   1988 C CB  . PRO D 1 54 ? -24.039 24.091  -10.341 1.00 27.86 ? 54   PRO D CB  1 
ATOM   1989 C CG  . PRO D 1 54 ? -23.298 23.372  -11.421 1.00 31.20 ? 54   PRO D CG  1 
ATOM   1990 C CD  . PRO D 1 54 ? -23.505 24.134  -12.697 1.00 31.84 ? 54   PRO D CD  1 
ATOM   1991 N N   . SER D 1 55 ? -24.410 27.223  -11.389 1.00 35.55 ? 55   SER D N   1 
ATOM   1992 C CA  . SER D 1 55 ? -24.220 28.608  -10.981 1.00 41.71 ? 55   SER D CA  1 
ATOM   1993 C C   . SER D 1 55 ? -25.464 29.434  -11.292 1.00 42.69 ? 55   SER D C   1 
ATOM   1994 O O   . SER D 1 55 ? -25.600 30.560  -10.831 1.00 43.84 ? 55   SER D O   1 
ATOM   1995 C CB  . SER D 1 55 ? -22.983 29.213  -11.649 1.00 38.16 ? 55   SER D CB  1 
ATOM   1996 O OG  . SER D 1 55 ? -23.130 29.275  -13.058 1.00 41.73 ? 55   SER D OG  1 
ATOM   1997 N N   . GLU D 1 56 ? -26.367 28.866  -12.080 1.00 36.51 ? 56   GLU D N   1 
ATOM   1998 C CA  . GLU D 1 56 ? -27.638 29.504  -12.343 1.00 29.79 ? 56   GLU D CA  1 
ATOM   1999 C C   . GLU D 1 56 ? -28.597 29.225  -11.200 1.00 42.00 ? 56   GLU D C   1 
ATOM   2000 O O   . GLU D 1 56 ? -28.569 28.148  -10.599 1.00 44.96 ? 56   GLU D O   1 
ATOM   2001 C CB  . GLU D 1 56 ? -28.201 29.045  -13.681 1.00 31.63 ? 56   GLU D CB  1 
ATOM   2002 C CG  . GLU D 1 56 ? -27.680 29.885  -14.831 1.00 38.56 ? 56   GLU D CG  1 
ATOM   2003 C CD  . GLU D 1 56 ? -27.855 29.227  -16.171 1.00 53.56 ? 56   GLU D CD  1 
ATOM   2004 O OE1 . GLU D 1 56 ? -29.009 28.906  -16.539 1.00 50.45 ? 56   GLU D OE1 1 
ATOM   2005 O OE2 . GLU D 1 56 ? -26.828 29.038  -16.859 1.00 58.20 ? 56   GLU D OE2 1 
ATOM   2006 N N   . SER D 1 57 ? -29.437 30.206  -10.892 1.00 37.01 ? 57   SER D N   1 
ATOM   2007 C CA  . SER D 1 57 ? -30.212 30.173  -9.658  1.00 40.90 ? 57   SER D CA  1 
ATOM   2008 C C   . SER D 1 57 ? -31.434 29.269  -9.751  1.00 35.11 ? 57   SER D C   1 
ATOM   2009 O O   . SER D 1 57 ? -31.790 28.590  -8.783  1.00 34.79 ? 57   SER D O   1 
ATOM   2010 C CB  . SER D 1 57 ? -30.618 31.589  -9.230  1.00 49.47 ? 57   SER D CB  1 
ATOM   2011 O OG  . SER D 1 57 ? -31.343 32.256  -10.252 1.00 37.75 ? 57   SER D OG  1 
ATOM   2012 N N   . TRP D 1 58 ? -32.086 29.247  -10.905 1.00 27.64 ? 58   TRP D N   1 
ATOM   2013 C CA  . TRP D 1 58 ? -33.210 28.332  -11.042 1.00 35.49 ? 58   TRP D CA  1 
ATOM   2014 C C   . TRP D 1 58 ? -32.702 26.900  -10.867 1.00 36.17 ? 58   TRP D C   1 
ATOM   2015 O O   . TRP D 1 58 ? -33.419 26.034  -10.360 1.00 34.31 ? 58   TRP D O   1 
ATOM   2016 C CB  . TRP D 1 58 ? -33.904 28.503  -12.379 1.00 27.67 ? 58   TRP D CB  1 
ATOM   2017 C CG  . TRP D 1 58 ? -33.110 27.983  -13.525 1.00 40.03 ? 58   TRP D CG  1 
ATOM   2018 C CD1 . TRP D 1 58 ? -32.213 28.677  -14.285 1.00 35.55 ? 58   TRP D CD1 1 
ATOM   2019 C CD2 . TRP D 1 58 ? -33.143 26.650  -14.057 1.00 37.14 ? 58   TRP D CD2 1 
ATOM   2020 N NE1 . TRP D 1 58 ? -31.693 27.864  -15.260 1.00 34.33 ? 58   TRP D NE1 1 
ATOM   2021 C CE2 . TRP D 1 58 ? -32.244 26.617  -15.141 1.00 38.42 ? 58   TRP D CE2 1 
ATOM   2022 C CE3 . TRP D 1 58 ? -33.840 25.487  -13.719 1.00 26.03 ? 58   TRP D CE3 1 
ATOM   2023 C CZ2 . TRP D 1 58 ? -32.024 25.458  -15.890 1.00 37.73 ? 58   TRP D CZ2 1 
ATOM   2024 C CZ3 . TRP D 1 58 ? -33.625 24.348  -14.463 1.00 24.66 ? 58   TRP D CZ3 1 
ATOM   2025 C CH2 . TRP D 1 58 ? -32.727 24.339  -15.539 1.00 25.19 ? 58   TRP D CH2 1 
ATOM   2026 N N   . VAL D 1 59 ? -31.459 26.656  -11.274 1.00 23.97 ? 59   VAL D N   1 
ATOM   2027 C CA  . VAL D 1 59 ? -30.837 25.372  -11.000 1.00 33.08 ? 59   VAL D CA  1 
ATOM   2028 C C   . VAL D 1 59 ? -30.803 25.094  -9.487  1.00 34.54 ? 59   VAL D C   1 
ATOM   2029 O O   . VAL D 1 59 ? -31.246 24.045  -9.028  1.00 34.04 ? 59   VAL D O   1 
ATOM   2030 C CB  . VAL D 1 59 ? -29.423 25.266  -11.618 1.00 34.31 ? 59   VAL D CB  1 
ATOM   2031 C CG1 . VAL D 1 59 ? -28.714 24.018  -11.109 1.00 23.42 ? 59   VAL D CG1 1 
ATOM   2032 C CG2 . VAL D 1 59 ? -29.499 25.259  -13.143 1.00 20.75 ? 59   VAL D CG2 1 
ATOM   2033 N N   . GLN D 1 60 ? -30.291 26.040  -8.712  1.00 35.87 ? 60   GLN D N   1 
ATOM   2034 C CA  . GLN D 1 60 ? -30.246 25.875  -7.269  1.00 31.52 ? 60   GLN D CA  1 
ATOM   2035 C C   . GLN D 1 60 ? -31.658 25.718  -6.725  1.00 33.43 ? 60   GLN D C   1 
ATOM   2036 O O   . GLN D 1 60 ? -31.932 24.804  -5.954  1.00 33.26 ? 60   GLN D O   1 
ATOM   2037 C CB  . GLN D 1 60 ? -29.553 27.067  -6.615  1.00 38.06 ? 60   GLN D CB  1 
ATOM   2038 C CG  . GLN D 1 60 ? -28.211 26.738  -5.982  1.00 53.99 ? 60   GLN D CG  1 
ATOM   2039 C CD  . GLN D 1 60 ? -27.923 27.592  -4.739  1.00 75.07 ? 60   GLN D CD  1 
ATOM   2040 O OE1 . GLN D 1 60 ? -26.774 27.968  -4.478  1.00 63.94 ? 60   GLN D OE1 1 
ATOM   2041 N NE2 . GLN D 1 60 ? -28.975 27.903  -3.971  1.00 60.12 ? 60   GLN D NE2 1 
ATOM   2042 N N   . GLU D 1 61 ? -32.557 26.602  -7.142  1.00 29.63 ? 61   GLU D N   1 
ATOM   2043 C CA  . GLU D 1 61 ? -33.953 26.553  -6.701  1.00 31.35 ? 61   GLU D CA  1 
ATOM   2044 C C   . GLU D 1 61 ? -34.575 25.160  -6.803  1.00 29.64 ? 61   GLU D C   1 
ATOM   2045 O O   . GLU D 1 61 ? -35.153 24.641  -5.844  1.00 28.38 ? 61   GLU D O   1 
ATOM   2046 C CB  . GLU D 1 61 ? -34.811 27.522  -7.524  1.00 34.77 ? 61   GLU D CB  1 
ATOM   2047 C CG  . GLU D 1 61 ? -34.421 28.976  -7.411  1.00 29.95 ? 61   GLU D CG  1 
ATOM   2048 C CD  . GLU D 1 61 ? -34.341 29.424  -5.975  1.00 46.32 ? 61   GLU D CD  1 
ATOM   2049 O OE1 . GLU D 1 61 ? -33.619 30.411  -5.706  1.00 61.68 ? 61   GLU D OE1 1 
ATOM   2050 O OE2 . GLU D 1 61 ? -34.990 28.784  -5.113  1.00 45.07 ? 61   GLU D OE2 1 
ATOM   2051 N N   . TYR D 1 62 ? -34.476 24.569  -7.988  1.00 33.27 ? 62   TYR D N   1 
ATOM   2052 C CA  . TYR D 1 62 ? -35.092 23.277  -8.245  1.00 27.70 ? 62   TYR D CA  1 
ATOM   2053 C C   . TYR D 1 62 ? -34.442 22.172  -7.412  1.00 24.13 ? 62   TYR D C   1 
ATOM   2054 O O   . TYR D 1 62 ? -35.088 21.183  -7.079  1.00 20.04 ? 62   TYR D O   1 
ATOM   2055 C CB  . TYR D 1 62 ? -34.979 22.927  -9.720  1.00 23.52 ? 62   TYR D CB  1 
ATOM   2056 C CG  . TYR D 1 62 ? -35.869 23.713  -10.657 1.00 21.55 ? 62   TYR D CG  1 
ATOM   2057 C CD1 . TYR D 1 62 ? -35.945 23.369  -12.002 1.00 23.88 ? 62   TYR D CD1 1 
ATOM   2058 C CD2 . TYR D 1 62 ? -36.628 24.788  -10.213 1.00 30.59 ? 62   TYR D CD2 1 
ATOM   2059 C CE1 . TYR D 1 62 ? -36.737 24.062  -12.872 1.00 23.31 ? 62   TYR D CE1 1 
ATOM   2060 C CE2 . TYR D 1 62 ? -37.437 25.499  -11.088 1.00 21.73 ? 62   TYR D CE2 1 
ATOM   2061 C CZ  . TYR D 1 62 ? -37.481 25.120  -12.417 1.00 27.81 ? 62   TYR D CZ  1 
ATOM   2062 O OH  . TYR D 1 62 ? -38.263 25.787  -13.319 1.00 32.31 ? 62   TYR D OH  1 
ATOM   2063 N N   . VAL D 1 63 ? -33.162 22.347  -7.091  1.00 26.95 ? 63   VAL D N   1 
ATOM   2064 C CA  . VAL D 1 63 ? -32.388 21.342  -6.364  1.00 19.63 ? 63   VAL D CA  1 
ATOM   2065 C C   . VAL D 1 63 ? -32.840 21.288  -4.921  1.00 26.49 ? 63   VAL D C   1 
ATOM   2066 O O   . VAL D 1 63 ? -33.093 20.212  -4.362  1.00 28.30 ? 63   VAL D O   1 
ATOM   2067 C CB  . VAL D 1 63 ? -30.877 21.649  -6.441  1.00 21.47 ? 63   VAL D CB  1 
ATOM   2068 C CG1 . VAL D 1 63 ? -30.115 20.981  -5.325  1.00 10.57 ? 63   VAL D CG1 1 
ATOM   2069 C CG2 . VAL D 1 63 ? -30.330 21.245  -7.797  1.00 18.49 ? 63   VAL D CG2 1 
ATOM   2070 N N   . TYR D 1 64 ? -32.947 22.459  -4.316  1.00 25.96 ? 64   TYR D N   1 
ATOM   2071 C CA  . TYR D 1 64 ? -33.507 22.551  -2.987  1.00 30.16 ? 64   TYR D CA  1 
ATOM   2072 C C   . TYR D 1 64 ? -34.906 21.966  -2.953  1.00 28.86 ? 64   TYR D C   1 
ATOM   2073 O O   . TYR D 1 64 ? -35.261 21.284  -2.003  1.00 30.23 ? 64   TYR D O   1 
ATOM   2074 C CB  . TYR D 1 64 ? -33.535 24.000  -2.530  1.00 39.94 ? 64   TYR D CB  1 
ATOM   2075 C CG  . TYR D 1 64 ? -32.179 24.512  -2.142  1.00 42.89 ? 64   TYR D CG  1 
ATOM   2076 C CD1 . TYR D 1 64 ? -31.161 24.627  -3.085  1.00 39.80 ? 64   TYR D CD1 1 
ATOM   2077 C CD2 . TYR D 1 64 ? -31.904 24.863  -0.828  1.00 38.68 ? 64   TYR D CD2 1 
ATOM   2078 C CE1 . TYR D 1 64 ? -29.910 25.096  -2.727  1.00 37.78 ? 64   TYR D CE1 1 
ATOM   2079 C CE2 . TYR D 1 64 ? -30.660 25.335  -0.463  1.00 38.69 ? 64   TYR D CE2 1 
ATOM   2080 C CZ  . TYR D 1 64 ? -29.669 25.454  -1.412  1.00 40.28 ? 64   TYR D CZ  1 
ATOM   2081 O OH  . TYR D 1 64 ? -28.436 25.929  -1.029  1.00 41.41 ? 64   TYR D OH  1 
ATOM   2082 N N   . ASP D 1 65 ? -35.702 22.217  -3.988  1.00 26.00 ? 65   ASP D N   1 
ATOM   2083 C CA  . ASP D 1 65 ? -37.080 21.737  -3.952  1.00 26.57 ? 65   ASP D CA  1 
ATOM   2084 C C   . ASP D 1 65 ? -37.164 20.229  -4.075  1.00 24.68 ? 65   ASP D C   1 
ATOM   2085 O O   . ASP D 1 65 ? -37.948 19.601  -3.370  1.00 33.32 ? 65   ASP D O   1 
ATOM   2086 C CB  . ASP D 1 65 ? -37.970 22.400  -5.003  1.00 17.48 ? 65   ASP D CB  1 
ATOM   2087 C CG  . ASP D 1 65 ? -39.434 22.124  -4.758  1.00 23.73 ? 65   ASP D CG  1 
ATOM   2088 O OD1 . ASP D 1 65 ? -40.010 22.705  -3.807  1.00 30.90 ? 65   ASP D OD1 1 
ATOM   2089 O OD2 . ASP D 1 65 ? -40.015 21.309  -5.496  1.00 25.88 ? 65   ASP D OD2 1 
ATOM   2090 N N   . LEU D 1 66 ? -36.367 19.653  -4.973  1.00 25.84 ? 66   LEU D N   1 
ATOM   2091 C CA  . LEU D 1 66 ? -36.330 18.199  -5.158  1.00 27.69 ? 66   LEU D CA  1 
ATOM   2092 C C   . LEU D 1 66 ? -35.803 17.469  -3.913  1.00 31.78 ? 66   LEU D C   1 
ATOM   2093 O O   . LEU D 1 66 ? -36.292 16.401  -3.564  1.00 37.17 ? 66   LEU D O   1 
ATOM   2094 C CB  . LEU D 1 66 ? -35.501 17.821  -6.391  1.00 17.80 ? 66   LEU D CB  1 
ATOM   2095 C CG  . LEU D 1 66 ? -36.089 18.122  -7.779  1.00 24.72 ? 66   LEU D CG  1 
ATOM   2096 C CD1 . LEU D 1 66 ? -35.042 17.930  -8.885  1.00 17.99 ? 66   LEU D CD1 1 
ATOM   2097 C CD2 . LEU D 1 66 ? -37.345 17.305  -8.080  1.00 15.47 ? 66   LEU D CD2 1 
ATOM   2098 N N   . GLU D 1 67 ? -34.811 18.054  -3.249  1.00 27.07 ? 67   GLU D N   1 
ATOM   2099 C CA  . GLU D 1 67 ? -34.224 17.470  -2.048  1.00 31.33 ? 67   GLU D CA  1 
ATOM   2100 C C   . GLU D 1 67 ? -35.159 17.557  -0.853  1.00 40.37 ? 67   GLU D C   1 
ATOM   2101 O O   . GLU D 1 67 ? -35.472 16.546  -0.219  1.00 35.96 ? 67   GLU D O   1 
ATOM   2102 C CB  . GLU D 1 67 ? -32.921 18.194  -1.687  1.00 39.28 ? 67   GLU D CB  1 
ATOM   2103 C CG  . GLU D 1 67 ? -31.659 17.453  -2.063  1.00 47.57 ? 67   GLU D CG  1 
ATOM   2104 C CD  . GLU D 1 67 ? -31.631 16.052  -1.504  1.00 44.63 ? 67   GLU D CD  1 
ATOM   2105 O OE1 . GLU D 1 67 ? -31.689 15.916  -0.269  1.00 38.25 ? 67   GLU D OE1 1 
ATOM   2106 O OE2 . GLU D 1 67 ? -31.563 15.090  -2.302  1.00 53.45 ? 67   GLU D OE2 1 
ATOM   2107 N N   . LEU D 1 68 ? -35.589 18.779  -0.543  1.00 37.61 ? 68   LEU D N   1 
ATOM   2108 C CA  . LEU D 1 68 ? -36.394 19.036  0.646   1.00 39.14 ? 68   LEU D CA  1 
ATOM   2109 C C   . LEU D 1 68 ? -37.825 18.513  0.527   1.00 41.82 ? 68   LEU D C   1 
ATOM   2110 O O   . LEU D 1 68 ? -38.344 17.884  1.449   1.00 41.35 ? 68   LEU D O   1 
ATOM   2111 C CB  . LEU D 1 68 ? -36.393 20.523  0.970   1.00 37.16 ? 68   LEU D CB  1 
ATOM   2112 C CG  . LEU D 1 68 ? -34.990 21.088  1.162   1.00 34.80 ? 68   LEU D CG  1 
ATOM   2113 C CD1 . LEU D 1 68 ? -35.057 22.499  1.714   1.00 30.20 ? 68   LEU D CD1 1 
ATOM   2114 C CD2 . LEU D 1 68 ? -34.216 20.193  2.092   1.00 33.23 ? 68   LEU D CD2 1 
ATOM   2115 N N   . ASN D 1 69 ? -38.458 18.751  -0.615  1.00 45.12 ? 69   ASN D N   1 
ATOM   2116 C CA  . ASN D 1 69 ? -39.832 18.302  -0.803  1.00 35.73 ? 69   ASN D CA  1 
ATOM   2117 C C   . ASN D 1 69 ? -39.935 17.061  -1.661  1.00 36.74 ? 69   ASN D C   1 
ATOM   2118 O O   . ASN D 1 69 ? -41.016 16.504  -1.812  1.00 46.37 ? 69   ASN D O   1 
ATOM   2119 C CB  . ASN D 1 69 ? -40.673 19.422  -1.389  1.00 27.39 ? 69   ASN D CB  1 
ATOM   2120 C CG  . ASN D 1 69 ? -40.484 20.725  -0.645  1.00 41.77 ? 69   ASN D CG  1 
ATOM   2121 O OD1 . ASN D 1 69 ? -40.695 20.797  0.567   1.00 46.75 ? 69   ASN D OD1 1 
ATOM   2122 N ND2 . ASN D 1 69 ? -40.065 21.762  -1.362  1.00 39.37 ? 69   ASN D ND2 1 
ATOM   2123 N N   . GLY E 1 4  ? -36.370 15.830  -45.371 1.00 31.91 ? 4    GLY E N   1 
ATOM   2124 C CA  . GLY E 1 4  ? -37.626 16.546  -45.162 1.00 28.32 ? 4    GLY E CA  1 
ATOM   2125 C C   . GLY E 1 4  ? -37.620 18.008  -45.584 1.00 30.67 ? 4    GLY E C   1 
ATOM   2126 O O   . GLY E 1 4  ? -36.654 18.482  -46.191 1.00 32.47 ? 4    GLY E O   1 
ATOM   2127 N N   . SER E 1 5  ? -38.694 18.735  -45.272 1.00 28.79 ? 5    SER E N   1 
ATOM   2128 C CA  . SER E 1 5  ? -38.771 20.155  -45.639 1.00 27.95 ? 5    SER E CA  1 
ATOM   2129 C C   . SER E 1 5  ? -37.792 21.042  -44.854 1.00 28.89 ? 5    SER E C   1 
ATOM   2130 O O   . SER E 1 5  ? -37.249 22.010  -45.403 1.00 24.98 ? 5    SER E O   1 
ATOM   2131 C CB  . SER E 1 5  ? -40.210 20.695  -45.552 1.00 26.70 ? 5    SER E CB  1 
ATOM   2132 O OG  . SER E 1 5  ? -40.535 21.176  -44.257 1.00 34.63 ? 5    SER E OG  1 
ATOM   2133 N N   . ASP E 1 6  ? -37.575 20.710  -43.581 1.00 26.47 ? 6    ASP E N   1 
ATOM   2134 C CA  . ASP E 1 6  ? -36.615 21.431  -42.744 1.00 30.68 ? 6    ASP E CA  1 
ATOM   2135 C C   . ASP E 1 6  ? -35.960 20.510  -41.717 1.00 25.02 ? 6    ASP E C   1 
ATOM   2136 O O   . ASP E 1 6  ? -36.159 20.689  -40.531 1.00 24.73 ? 6    ASP E O   1 
ATOM   2137 C CB  . ASP E 1 6  ? -37.284 22.596  -41.997 1.00 20.27 ? 6    ASP E CB  1 
ATOM   2138 C CG  . ASP E 1 6  ? -37.996 23.575  -42.926 1.00 28.47 ? 6    ASP E CG  1 
ATOM   2139 O OD1 . ASP E 1 6  ? -37.420 24.650  -43.230 1.00 25.56 ? 6    ASP E OD1 1 
ATOM   2140 O OD2 . ASP E 1 6  ? -39.148 23.283  -43.327 1.00 22.50 ? 6    ASP E OD2 1 
ATOM   2141 N N   . PRO E 1 7  ? -35.158 19.540  -42.171 1.00 27.13 ? 7    PRO E N   1 
ATOM   2142 C CA  . PRO E 1 7  ? -34.513 18.551  -41.292 1.00 22.07 ? 7    PRO E CA  1 
ATOM   2143 C C   . PRO E 1 7  ? -33.322 19.149  -40.563 1.00 26.27 ? 7    PRO E C   1 
ATOM   2144 O O   . PRO E 1 7  ? -32.753 20.132  -41.054 1.00 24.00 ? 7    PRO E O   1 
ATOM   2145 C CB  . PRO E 1 7  ? -33.992 17.490  -42.274 1.00 26.65 ? 7    PRO E CB  1 
ATOM   2146 C CG  . PRO E 1 7  ? -34.436 17.948  -43.671 1.00 22.39 ? 7    PRO E CG  1 
ATOM   2147 C CD  . PRO E 1 7  ? -34.723 19.405  -43.567 1.00 23.81 ? 7    PRO E CD  1 
ATOM   2148 N N   . PRO E 1 8  ? -32.949 18.571  -39.405 1.00 27.70 ? 8    PRO E N   1 
ATOM   2149 C CA  . PRO E 1 8  ? -31.749 18.982  -38.668 1.00 19.46 ? 8    PRO E CA  1 
ATOM   2150 C C   . PRO E 1 8  ? -30.522 18.706  -39.520 1.00 23.17 ? 8    PRO E C   1 
ATOM   2151 O O   . PRO E 1 8  ? -30.558 17.812  -40.352 1.00 20.16 ? 8    PRO E O   1 
ATOM   2152 C CB  . PRO E 1 8  ? -31.736 18.047  -37.460 1.00 15.60 ? 8    PRO E CB  1 
ATOM   2153 C CG  . PRO E 1 8  ? -33.127 17.503  -37.362 1.00 19.29 ? 8    PRO E CG  1 
ATOM   2154 C CD  . PRO E 1 8  ? -33.683 17.489  -38.728 1.00 25.82 ? 8    PRO E CD  1 
ATOM   2155 N N   . THR E 1 9  ? -29.453 19.463  -39.300 1.00 27.85 ? 9    THR E N   1 
ATOM   2156 C CA  . THR E 1 9  ? -28.181 19.257  -39.976 1.00 19.22 ? 9    THR E CA  1 
ATOM   2157 C C   . THR E 1 9  ? -27.153 18.644  -39.008 1.00 24.62 ? 9    THR E C   1 
ATOM   2158 O O   . THR E 1 9  ? -27.087 19.006  -37.834 1.00 22.94 ? 9    THR E O   1 
ATOM   2159 C CB  . THR E 1 9  ? -27.639 20.603  -40.490 1.00 26.61 ? 9    THR E CB  1 
ATOM   2160 O OG1 . THR E 1 9  ? -28.635 21.240  -41.295 1.00 24.52 ? 9    THR E OG1 1 
ATOM   2161 C CG2 . THR E 1 9  ? -26.385 20.411  -41.315 1.00 22.87 ? 9    THR E CG2 1 
ATOM   2162 N N   . ALA E 1 10 ? -26.358 17.705  -39.502 1.00 23.47 ? 10   ALA E N   1 
ATOM   2163 C CA  . ALA E 1 10 ? -25.266 17.148  -38.713 1.00 21.07 ? 10   ALA E CA  1 
ATOM   2164 C C   . ALA E 1 10 ? -24.062 18.092  -38.694 1.00 20.02 ? 10   ALA E C   1 
ATOM   2165 O O   . ALA E 1 10 ? -23.500 18.405  -39.742 1.00 19.64 ? 10   ALA E O   1 
ATOM   2166 C CB  . ALA E 1 10 ? -24.858 15.788  -39.280 1.00 15.95 ? 10   ALA E CB  1 
ATOM   2167 N N   . CYS E 1 11 ? -23.658 18.539  -37.508 1.00 22.37 ? 11   CYS E N   1 
ATOM   2168 C CA  . CYS E 1 11 ? -22.483 19.403  -37.382 1.00 17.81 ? 11   CYS E CA  1 
ATOM   2169 C C   . CYS E 1 11 ? -21.506 18.890  -36.327 1.00 28.89 ? 11   CYS E C   1 
ATOM   2170 O O   . CYS E 1 11 ? -21.921 18.320  -35.324 1.00 31.31 ? 11   CYS E O   1 
ATOM   2171 C CB  . CYS E 1 11 ? -22.910 20.828  -37.053 1.00 25.57 ? 11   CYS E CB  1 
ATOM   2172 S SG  . CYS E 1 11 ? -23.972 21.598  -38.306 1.00 28.78 ? 11   CYS E SG  1 
ATOM   2173 N N   . CYS E 1 12 ? -20.209 19.078  -36.553 1.00 30.09 ? 12   CYS E N   1 
ATOM   2174 C CA  . CYS E 1 12 ? -19.211 18.707  -35.547 1.00 28.59 ? 12   CYS E CA  1 
ATOM   2175 C C   . CYS E 1 12 ? -18.719 19.914  -34.766 1.00 32.04 ? 12   CYS E C   1 
ATOM   2176 O O   . CYS E 1 12 ? -18.290 20.906  -35.349 1.00 33.04 ? 12   CYS E O   1 
ATOM   2177 C CB  . CYS E 1 12 ? -18.004 18.028  -36.190 1.00 27.25 ? 12   CYS E CB  1 
ATOM   2178 S SG  . CYS E 1 12 ? -18.373 16.473  -36.992 1.00 42.09 ? 12   CYS E SG  1 
ATOM   2179 N N   . PHE E 1 13 ? -18.749 19.820  -33.446 1.00 30.25 ? 13   PHE E N   1 
ATOM   2180 C CA  . PHE E 1 13 ? -18.177 20.877  -32.627 1.00 32.84 ? 13   PHE E CA  1 
ATOM   2181 C C   . PHE E 1 13 ? -16.906 20.425  -31.927 1.00 33.88 ? 13   PHE E C   1 
ATOM   2182 O O   . PHE E 1 13 ? -15.987 21.214  -31.736 1.00 33.93 ? 13   PHE E O   1 
ATOM   2183 C CB  . PHE E 1 13 ? -19.214 21.414  -31.648 1.00 26.55 ? 13   PHE E CB  1 
ATOM   2184 C CG  . PHE E 1 13 ? -20.392 22.042  -32.332 1.00 26.24 ? 13   PHE E CG  1 
ATOM   2185 C CD1 . PHE E 1 13 ? -20.257 23.230  -33.011 1.00 23.90 ? 13   PHE E CD1 1 
ATOM   2186 C CD2 . PHE E 1 13 ? -21.624 21.424  -32.327 1.00 28.85 ? 13   PHE E CD2 1 
ATOM   2187 C CE1 . PHE E 1 13 ? -21.339 23.800  -33.653 1.00 31.79 ? 13   PHE E CE1 1 
ATOM   2188 C CE2 . PHE E 1 13 ? -22.704 21.990  -32.973 1.00 22.14 ? 13   PHE E CE2 1 
ATOM   2189 C CZ  . PHE E 1 13 ? -22.563 23.167  -33.637 1.00 22.81 ? 13   PHE E CZ  1 
ATOM   2190 N N   . SER E 1 14 ? -16.852 19.143  -31.576 1.00 44.97 ? 14   SER E N   1 
ATOM   2191 C CA  . SER E 1 14 ? -15.650 18.533  -31.003 1.00 40.20 ? 14   SER E CA  1 
ATOM   2192 C C   . SER E 1 14 ? -15.148 17.432  -31.932 1.00 39.77 ? 14   SER E C   1 
ATOM   2193 O O   . SER E 1 14 ? -15.944 16.672  -32.480 1.00 37.48 ? 14   SER E O   1 
ATOM   2194 C CB  . SER E 1 14 ? -15.949 17.942  -29.618 1.00 37.86 ? 14   SER E CB  1 
ATOM   2195 O OG  . SER E 1 14 ? -16.219 16.551  -29.687 1.00 40.60 ? 14   SER E OG  1 
ATOM   2196 N N   . TYR E 1 15 ? -13.836 17.340  -32.112 1.00 39.99 ? 15   TYR E N   1 
ATOM   2197 C CA  . TYR E 1 15 ? -13.275 16.277  -32.946 1.00 43.73 ? 15   TYR E CA  1 
ATOM   2198 C C   . TYR E 1 15 ? -12.775 15.100  -32.104 1.00 42.04 ? 15   TYR E C   1 
ATOM   2199 O O   . TYR E 1 15 ? -12.639 15.207  -30.893 1.00 44.99 ? 15   TYR E O   1 
ATOM   2200 C CB  . TYR E 1 15 ? -12.135 16.808  -33.817 1.00 31.05 ? 15   TYR E CB  1 
ATOM   2201 C CG  . TYR E 1 15 ? -12.510 17.944  -34.745 1.00 33.33 ? 15   TYR E CG  1 
ATOM   2202 C CD1 . TYR E 1 15 ? -13.436 17.763  -35.763 1.00 42.71 ? 15   TYR E CD1 1 
ATOM   2203 C CD2 . TYR E 1 15 ? -11.914 19.192  -34.621 1.00 40.00 ? 15   TYR E CD2 1 
ATOM   2204 C CE1 . TYR E 1 15 ? -13.772 18.806  -36.633 1.00 43.46 ? 15   TYR E CE1 1 
ATOM   2205 C CE2 . TYR E 1 15 ? -12.237 20.241  -35.482 1.00 43.20 ? 15   TYR E CE2 1 
ATOM   2206 C CZ  . TYR E 1 15 ? -13.167 20.044  -36.487 1.00 48.73 ? 15   TYR E CZ  1 
ATOM   2207 O OH  . TYR E 1 15 ? -13.489 21.086  -37.339 1.00 36.41 ? 15   TYR E OH  1 
ATOM   2208 N N   . THR E 1 16 ? -12.504 13.978  -32.756 1.00 37.19 ? 16   THR E N   1 
ATOM   2209 C CA  . THR E 1 16 ? -11.894 12.843  -32.088 1.00 33.14 ? 16   THR E CA  1 
ATOM   2210 C C   . THR E 1 16 ? -10.393 13.081  -31.976 1.00 40.90 ? 16   THR E C   1 
ATOM   2211 O O   . THR E 1 16 ? -9.762  13.555  -32.923 1.00 40.11 ? 16   THR E O   1 
ATOM   2212 C CB  . THR E 1 16 ? -12.137 11.547  -32.878 1.00 40.74 ? 16   THR E CB  1 
ATOM   2213 O OG1 . THR E 1 16 ? -11.852 10.411  -32.052 1.00 37.65 ? 16   THR E OG1 1 
ATOM   2214 C CG2 . THR E 1 16 ? -11.266 11.511  -34.133 1.00 29.64 ? 16   THR E CG2 1 
ATOM   2215 N N   . ALA E 1 17 ? -9.817  12.772  -30.818 1.00 47.25 ? 17   ALA E N   1 
ATOM   2216 C CA  . ALA E 1 17 ? -8.370  12.923  -30.646 1.00 52.93 ? 17   ALA E CA  1 
ATOM   2217 C C   . ALA E 1 17 ? -7.623  11.652  -31.083 1.00 45.12 ? 17   ALA E C   1 
ATOM   2218 O O   . ALA E 1 17 ? -6.395  11.624  -31.179 1.00 38.79 ? 17   ALA E O   1 
ATOM   2219 C CB  . ALA E 1 17 ? -8.040  13.280  -29.206 1.00 28.86 ? 17   ALA E CB  1 
ATOM   2220 N N   . ARG E 1 18 ? -8.384  10.605  -31.364 1.00 39.05 ? 18   ARG E N   1 
ATOM   2221 C CA  . ARG E 1 18 ? -7.808  9.337   -31.764 1.00 47.39 ? 18   ARG E CA  1 
ATOM   2222 C C   . ARG E 1 18 ? -7.721  9.215   -33.279 1.00 52.60 ? 18   ARG E C   1 
ATOM   2223 O O   . ARG E 1 18 ? -8.626  9.623   -34.006 1.00 43.76 ? 18   ARG E O   1 
ATOM   2224 C CB  . ARG E 1 18 ? -8.661  8.185   -31.235 1.00 48.51 ? 18   ARG E CB  1 
ATOM   2225 C CG  . ARG E 1 18 ? -9.540  8.548   -30.046 1.00 57.75 ? 18   ARG E CG  1 
ATOM   2226 C CD  . ARG E 1 18 ? -8.904  8.150   -28.719 1.00 57.58 ? 18   ARG E CD  1 
ATOM   2227 N NE  . ARG E 1 18 ? -9.923  7.724   -27.764 1.00 60.57 ? 18   ARG E NE  1 
ATOM   2228 C CZ  . ARG E 1 18 ? -10.449 8.507   -26.826 1.00 54.16 ? 18   ARG E CZ  1 
ATOM   2229 N NH1 . ARG E 1 18 ? -10.035 9.764   -26.698 1.00 42.81 ? 18   ARG E NH1 1 
ATOM   2230 N NH2 . ARG E 1 18 ? -11.382 8.025   -26.009 1.00 39.28 ? 18   ARG E NH2 1 
ATOM   2231 N N   . LYS E 1 19 ? -6.632  8.634   -33.758 1.00 52.61 ? 19   LYS E N   1 
ATOM   2232 C CA  . LYS E 1 19 ? -6.590  8.221   -35.141 1.00 42.80 ? 19   LYS E CA  1 
ATOM   2233 C C   . LYS E 1 19 ? -7.297  6.871   -35.223 1.00 40.99 ? 19   LYS E C   1 
ATOM   2234 O O   . LYS E 1 19 ? -6.884  5.913   -34.581 1.00 42.41 ? 19   LYS E O   1 
ATOM   2235 C CB  . LYS E 1 19 ? -5.150  8.123   -35.636 1.00 46.71 ? 19   LYS E CB  1 
ATOM   2236 C CG  . LYS E 1 19 ? -5.033  7.856   -37.127 1.00 45.78 ? 19   LYS E CG  1 
ATOM   2237 C CD  . LYS E 1 19 ? -3.579  7.830   -37.575 1.00 41.27 ? 19   LYS E CD  1 
ATOM   2238 C CE  . LYS E 1 19 ? -3.410  6.954   -38.816 1.00 45.33 ? 19   LYS E CE  1 
ATOM   2239 N NZ  . LYS E 1 19 ? -2.129  7.228   -39.547 1.00 53.77 ? 19   LYS E NZ  1 
ATOM   2240 N N   . LEU E 1 20 ? -8.387  6.814   -35.981 1.00 32.56 ? 20   LEU E N   1 
ATOM   2241 C CA  . LEU E 1 20 ? -9.116  5.572   -36.194 1.00 37.29 ? 20   LEU E CA  1 
ATOM   2242 C C   . LEU E 1 20 ? -8.271  4.563   -36.963 1.00 39.02 ? 20   LEU E C   1 
ATOM   2243 O O   . LEU E 1 20 ? -7.497  4.937   -37.846 1.00 34.94 ? 20   LEU E O   1 
ATOM   2244 C CB  . LEU E 1 20 ? -10.377 5.836   -37.018 1.00 34.80 ? 20   LEU E CB  1 
ATOM   2245 C CG  . LEU E 1 20 ? -11.653 6.391   -36.398 1.00 29.24 ? 20   LEU E CG  1 
ATOM   2246 C CD1 . LEU E 1 20 ? -12.597 6.755   -37.522 1.00 26.73 ? 20   LEU E CD1 1 
ATOM   2247 C CD2 . LEU E 1 20 ? -12.281 5.353   -35.488 1.00 31.22 ? 20   LEU E CD2 1 
ATOM   2248 N N   . PRO E 1 21 ? -8.417  3.277   -36.624 1.00 38.53 ? 21   PRO E N   1 
ATOM   2249 C CA  . PRO E 1 21 ? -7.876  2.212   -37.471 1.00 36.25 ? 21   PRO E CA  1 
ATOM   2250 C C   . PRO E 1 21 ? -8.512  2.288   -38.855 1.00 34.45 ? 21   PRO E C   1 
ATOM   2251 O O   . PRO E 1 21 ? -9.739  2.224   -38.963 1.00 34.41 ? 21   PRO E O   1 
ATOM   2252 C CB  . PRO E 1 21 ? -8.327  0.938   -36.755 1.00 36.11 ? 21   PRO E CB  1 
ATOM   2253 C CG  . PRO E 1 21 ? -8.492  1.336   -35.338 1.00 38.50 ? 21   PRO E CG  1 
ATOM   2254 C CD  . PRO E 1 21 ? -8.958  2.765   -35.355 1.00 38.35 ? 21   PRO E CD  1 
ATOM   2255 N N   . ARG E 1 22 ? -7.684  2.416   -39.889 1.00 34.58 ? 22   ARG E N   1 
ATOM   2256 C CA  . ARG E 1 22 ? -8.162  2.515   -41.262 1.00 33.30 ? 22   ARG E CA  1 
ATOM   2257 C C   . ARG E 1 22 ? -9.163  1.429   -41.628 1.00 32.58 ? 22   ARG E C   1 
ATOM   2258 O O   . ARG E 1 22 ? -10.074 1.658   -42.421 1.00 27.78 ? 22   ARG E O   1 
ATOM   2259 C CB  . ARG E 1 22 ? -6.999  2.471   -42.249 1.00 29.61 ? 22   ARG E CB  1 
ATOM   2260 C CG  . ARG E 1 22 ? -7.442  2.395   -43.717 1.00 41.65 ? 22   ARG E CG  1 
ATOM   2261 C CD  . ARG E 1 22 ? -8.154  3.674   -44.202 1.00 34.43 ? 22   ARG E CD  1 
ATOM   2262 N NE  . ARG E 1 22 ? -8.676  3.505   -45.556 1.00 35.81 ? 22   ARG E NE  1 
ATOM   2263 C CZ  . ARG E 1 22 ? -9.852  2.947   -45.841 1.00 38.71 ? 22   ARG E CZ  1 
ATOM   2264 N NH1 . ARG E 1 22 ? -10.634 2.516   -44.865 1.00 33.28 ? 22   ARG E NH1 1 
ATOM   2265 N NH2 . ARG E 1 22 ? -10.254 2.820   -47.101 1.00 31.21 ? 22   ARG E NH2 1 
ATOM   2266 N N   . ASN E 1 23 ? -9.005  0.246   -41.056 1.00 27.46 ? 23   ASN E N   1 
ATOM   2267 C CA  . ASN E 1 23 ? -9.892  -0.842  -41.423 1.00 32.27 ? 23   ASN E CA  1 
ATOM   2268 C C   . ASN E 1 23 ? -11.257 -0.782  -40.740 1.00 27.79 ? 23   ASN E C   1 
ATOM   2269 O O   . ASN E 1 23 ? -12.151 -1.569  -41.044 1.00 27.44 ? 23   ASN E O   1 
ATOM   2270 C CB  . ASN E 1 23 ? -9.209  -2.196  -41.225 1.00 42.20 ? 23   ASN E CB  1 
ATOM   2271 C CG  . ASN E 1 23 ? -8.579  -2.338  -39.860 1.00 50.54 ? 23   ASN E CG  1 
ATOM   2272 O OD1 . ASN E 1 23 ? -7.826  -1.468  -39.406 1.00 43.13 ? 23   ASN E OD1 1 
ATOM   2273 N ND2 . ASN E 1 23 ? -8.874  -3.452  -39.196 1.00 50.49 ? 23   ASN E ND2 1 
ATOM   2274 N N   . PHE E 1 24 ? -11.425 0.169   -39.831 1.00 34.59 ? 24   PHE E N   1 
ATOM   2275 C CA  . PHE E 1 24 ? -12.726 0.399   -39.203 1.00 34.05 ? 24   PHE E CA  1 
ATOM   2276 C C   . PHE E 1 24 ? -13.619 1.262   -40.101 1.00 36.01 ? 24   PHE E C   1 
ATOM   2277 O O   . PHE E 1 24 ? -14.848 1.167   -40.065 1.00 32.89 ? 24   PHE E O   1 
ATOM   2278 C CB  . PHE E 1 24 ? -12.538 1.094   -37.854 1.00 31.16 ? 24   PHE E CB  1 
ATOM   2279 C CG  . PHE E 1 24 ? -12.012 0.194   -36.767 1.00 50.11 ? 24   PHE E CG  1 
ATOM   2280 C CD1 . PHE E 1 24 ? -12.039 0.604   -35.441 1.00 37.46 ? 24   PHE E CD1 1 
ATOM   2281 C CD2 . PHE E 1 24 ? -11.499 -1.065  -37.063 1.00 45.69 ? 24   PHE E CD2 1 
ATOM   2282 C CE1 . PHE E 1 24 ? -11.563 -0.218  -34.435 1.00 36.94 ? 24   PHE E CE1 1 
ATOM   2283 C CE2 . PHE E 1 24 ? -11.021 -1.890  -36.059 1.00 33.29 ? 24   PHE E CE2 1 
ATOM   2284 C CZ  . PHE E 1 24 ? -11.055 -1.468  -34.746 1.00 40.69 ? 24   PHE E CZ  1 
ATOM   2285 N N   . VAL E 1 25 ? -12.973 2.091   -40.916 1.00 33.28 ? 25   VAL E N   1 
ATOM   2286 C CA  . VAL E 1 25 ? -13.635 3.124   -41.706 1.00 33.21 ? 25   VAL E CA  1 
ATOM   2287 C C   . VAL E 1 25 ? -14.100 2.627   -43.070 1.00 26.25 ? 25   VAL E C   1 
ATOM   2288 O O   . VAL E 1 25 ? -13.297 2.139   -43.857 1.00 31.72 ? 25   VAL E O   1 
ATOM   2289 C CB  . VAL E 1 25 ? -12.664 4.286   -41.944 1.00 31.26 ? 25   VAL E CB  1 
ATOM   2290 C CG1 . VAL E 1 25 ? -13.279 5.321   -42.859 1.00 22.22 ? 25   VAL E CG1 1 
ATOM   2291 C CG2 . VAL E 1 25 ? -12.233 4.884   -40.619 1.00 25.65 ? 25   VAL E CG2 1 
ATOM   2292 N N   . VAL E 1 26 ? -15.388 2.759   -43.365 1.00 24.17 ? 26   VAL E N   1 
ATOM   2293 C CA  . VAL E 1 26 ? -15.891 2.288   -44.652 1.00 30.29 ? 26   VAL E CA  1 
ATOM   2294 C C   . VAL E 1 26 ? -16.408 3.421   -45.539 1.00 36.57 ? 26   VAL E C   1 
ATOM   2295 O O   . VAL E 1 26 ? -16.723 3.205   -46.715 1.00 34.65 ? 26   VAL E O   1 
ATOM   2296 C CB  . VAL E 1 26 ? -16.994 1.219   -44.489 1.00 26.24 ? 26   VAL E CB  1 
ATOM   2297 C CG1 . VAL E 1 26 ? -16.467 0.023   -43.704 1.00 28.44 ? 26   VAL E CG1 1 
ATOM   2298 C CG2 . VAL E 1 26 ? -18.227 1.812   -43.821 1.00 18.15 ? 26   VAL E CG2 1 
ATOM   2299 N N   . ASP E 1 27 ? -16.487 4.627   -44.985 1.00 27.85 ? 27   ASP E N   1 
ATOM   2300 C CA  . ASP E 1 27 ? -17.063 5.740   -45.723 1.00 31.01 ? 27   ASP E CA  1 
ATOM   2301 C C   . ASP E 1 27 ? -16.818 7.058   -45.018 1.00 29.55 ? 27   ASP E C   1 
ATOM   2302 O O   . ASP E 1 27 ? -16.405 7.087   -43.862 1.00 31.01 ? 27   ASP E O   1 
ATOM   2303 C CB  . ASP E 1 27 ? -18.564 5.522   -45.887 1.00 31.06 ? 27   ASP E CB  1 
ATOM   2304 C CG  . ASP E 1 27 ? -19.083 5.993   -47.228 1.00 36.34 ? 27   ASP E CG  1 
ATOM   2305 O OD1 . ASP E 1 27 ? -18.333 6.673   -47.968 1.00 31.76 ? 27   ASP E OD1 1 
ATOM   2306 O OD2 . ASP E 1 27 ? -20.253 5.676   -47.538 1.00 39.45 ? 27   ASP E OD2 1 
ATOM   2307 N N   . TYR E 1 28 ? -17.064 8.154   -45.720 1.00 27.15 ? 28   TYR E N   1 
ATOM   2308 C CA  . TYR E 1 28 ? -16.981 9.460   -45.096 1.00 27.12 ? 28   TYR E CA  1 
ATOM   2309 C C   . TYR E 1 28 ? -18.048 10.345  -45.676 1.00 29.12 ? 28   TYR E C   1 
ATOM   2310 O O   . TYR E 1 28 ? -18.688 10.003  -46.667 1.00 28.10 ? 28   TYR E O   1 
ATOM   2311 C CB  . TYR E 1 28 ? -15.618 10.100  -45.335 1.00 28.12 ? 28   TYR E CB  1 
ATOM   2312 C CG  . TYR E 1 28 ? -15.451 10.680  -46.715 1.00 28.93 ? 28   TYR E CG  1 
ATOM   2313 C CD1 . TYR E 1 28 ? -15.520 12.049  -46.926 1.00 36.43 ? 28   TYR E CD1 1 
ATOM   2314 C CD2 . TYR E 1 28 ? -15.242 9.860   -47.815 1.00 34.42 ? 28   TYR E CD2 1 
ATOM   2315 C CE1 . TYR E 1 28 ? -15.376 12.586  -48.196 1.00 30.61 ? 28   TYR E CE1 1 
ATOM   2316 C CE2 . TYR E 1 28 ? -15.091 10.387  -49.087 1.00 30.80 ? 28   TYR E CE2 1 
ATOM   2317 C CZ  . TYR E 1 28 ? -15.159 11.751  -49.270 1.00 30.16 ? 28   TYR E CZ  1 
ATOM   2318 O OH  . TYR E 1 28 ? -15.016 12.287  -50.531 1.00 37.14 ? 28   TYR E OH  1 
ATOM   2319 N N   . TYR E 1 29 ? -18.246 11.488  -45.045 1.00 26.15 ? 29   TYR E N   1 
ATOM   2320 C CA  . TYR E 1 29 ? -19.029 12.542  -45.653 1.00 29.29 ? 29   TYR E CA  1 
ATOM   2321 C C   . TYR E 1 29 ? -18.638 13.839  -45.008 1.00 30.52 ? 29   TYR E C   1 
ATOM   2322 O O   . TYR E 1 29 ? -18.101 13.858  -43.902 1.00 34.59 ? 29   TYR E O   1 
ATOM   2323 C CB  . TYR E 1 29 ? -20.536 12.287  -45.535 1.00 32.38 ? 29   TYR E CB  1 
ATOM   2324 C CG  . TYR E 1 29 ? -21.156 12.574  -44.191 1.00 36.23 ? 29   TYR E CG  1 
ATOM   2325 C CD1 . TYR E 1 29 ? -21.396 13.884  -43.773 1.00 43.10 ? 29   TYR E CD1 1 
ATOM   2326 C CD2 . TYR E 1 29 ? -21.546 11.538  -43.351 1.00 40.16 ? 29   TYR E CD2 1 
ATOM   2327 C CE1 . TYR E 1 29 ? -21.998 14.155  -42.530 1.00 34.70 ? 29   TYR E CE1 1 
ATOM   2328 C CE2 . TYR E 1 29 ? -22.143 11.796  -42.115 1.00 37.66 ? 29   TYR E CE2 1 
ATOM   2329 C CZ  . TYR E 1 29 ? -22.365 13.105  -41.715 1.00 36.14 ? 29   TYR E CZ  1 
ATOM   2330 O OH  . TYR E 1 29 ? -22.946 13.358  -40.495 1.00 47.47 ? 29   TYR E OH  1 
ATOM   2331 N N   . GLU E 1 30 ? -18.891 14.930  -45.708 1.00 33.88 ? 30   GLU E N   1 
ATOM   2332 C CA  . GLU E 1 30 ? -18.511 16.224  -45.194 1.00 32.68 ? 30   GLU E CA  1 
ATOM   2333 C C   . GLU E 1 30 ? -19.740 16.941  -44.670 1.00 29.39 ? 30   GLU E C   1 
ATOM   2334 O O   . GLU E 1 30 ? -20.823 16.819  -45.236 1.00 34.46 ? 30   GLU E O   1 
ATOM   2335 C CB  . GLU E 1 30 ? -17.802 17.024  -46.275 1.00 30.73 ? 30   GLU E CB  1 
ATOM   2336 C CG  . GLU E 1 30 ? -16.413 17.437  -45.861 1.00 43.92 ? 30   GLU E CG  1 
ATOM   2337 C CD  . GLU E 1 30 ? -15.516 17.714  -47.039 1.00 43.10 ? 30   GLU E CD  1 
ATOM   2338 O OE1 . GLU E 1 30 ? -14.804 16.777  -47.466 1.00 38.93 ? 30   GLU E OE1 1 
ATOM   2339 O OE2 . GLU E 1 30 ? -15.522 18.865  -47.530 1.00 44.11 ? 30   GLU E OE2 1 
ATOM   2340 N N   . THR E 1 31 ? -19.578 17.662  -43.572 1.00 21.82 ? 31   THR E N   1 
ATOM   2341 C CA  . THR E 1 31 ? -20.697 18.354  -42.958 1.00 22.23 ? 31   THR E CA  1 
ATOM   2342 C C   . THR E 1 31 ? -21.084 19.603  -43.752 1.00 26.08 ? 31   THR E C   1 
ATOM   2343 O O   . THR E 1 31 ? -20.229 20.278  -44.327 1.00 26.75 ? 31   THR E O   1 
ATOM   2344 C CB  . THR E 1 31 ? -20.398 18.719  -41.480 1.00 24.25 ? 31   THR E CB  1 
ATOM   2345 O OG1 . THR E 1 31 ? -19.079 19.275  -41.366 1.00 23.97 ? 31   THR E OG1 1 
ATOM   2346 C CG2 . THR E 1 31 ? -20.483 17.475  -40.596 1.00 28.13 ? 31   THR E CG2 1 
ATOM   2347 N N   . SER E 1 32 ? -22.377 19.900  -43.770 1.00 20.67 ? 32   SER E N   1 
ATOM   2348 C CA  . SER E 1 32 ? -22.907 21.116  -44.380 1.00 22.46 ? 32   SER E CA  1 
ATOM   2349 C C   . SER E 1 32 ? -22.084 22.406  -44.212 1.00 28.54 ? 32   SER E C   1 
ATOM   2350 O O   . SER E 1 32 ? -21.540 22.704  -43.135 1.00 24.82 ? 32   SER E O   1 
ATOM   2351 C CB  . SER E 1 32 ? -24.320 21.375  -43.869 1.00 15.92 ? 32   SER E CB  1 
ATOM   2352 O OG  . SER E 1 32 ? -24.719 22.700  -44.188 1.00 24.73 ? 32   SER E OG  1 
ATOM   2353 N N   . SER E 1 33 ? -22.032 23.188  -45.286 1.00 25.34 ? 33   SER E N   1 
ATOM   2354 C CA  . SER E 1 33 ? -21.397 24.502  -45.242 1.00 25.59 ? 33   SER E CA  1 
ATOM   2355 C C   . SER E 1 33 ? -22.084 25.437  -44.255 1.00 22.16 ? 33   SER E C   1 
ATOM   2356 O O   . SER E 1 33 ? -21.502 26.431  -43.817 1.00 32.54 ? 33   SER E O   1 
ATOM   2357 C CB  . SER E 1 33 ? -21.383 25.132  -46.633 1.00 26.27 ? 33   SER E CB  1 
ATOM   2358 O OG  . SER E 1 33 ? -22.665 25.033  -47.237 1.00 33.83 ? 33   SER E OG  1 
ATOM   2359 N N   . LEU E 1 34 ? -23.326 25.127  -43.913 1.00 19.04 ? 34   LEU E N   1 
ATOM   2360 C CA  . LEU E 1 34 ? -24.031 25.892  -42.892 1.00 26.13 ? 34   LEU E CA  1 
ATOM   2361 C C   . LEU E 1 34 ? -23.393 25.730  -41.506 1.00 25.76 ? 34   LEU E C   1 
ATOM   2362 O O   . LEU E 1 34 ? -23.609 26.557  -40.630 1.00 24.20 ? 34   LEU E O   1 
ATOM   2363 C CB  . LEU E 1 34 ? -25.507 25.485  -42.834 1.00 24.81 ? 34   LEU E CB  1 
ATOM   2364 C CG  . LEU E 1 34 ? -26.268 25.619  -44.154 1.00 23.20 ? 34   LEU E CG  1 
ATOM   2365 C CD1 . LEU E 1 34 ? -27.589 24.865  -44.120 1.00 21.36 ? 34   LEU E CD1 1 
ATOM   2366 C CD2 . LEU E 1 34 ? -26.498 27.072  -44.496 1.00 8.22  ? 34   LEU E CD2 1 
ATOM   2367 N N   . CYS E 1 35 ? -22.622 24.664  -41.298 1.00 26.40 ? 35   CYS E N   1 
ATOM   2368 C CA  . CYS E 1 35 ? -22.008 24.439  -39.985 1.00 29.71 ? 35   CYS E CA  1 
ATOM   2369 C C   . CYS E 1 35 ? -20.933 25.466  -39.648 1.00 27.37 ? 35   CYS E C   1 
ATOM   2370 O O   . CYS E 1 35 ? -20.233 25.964  -40.524 1.00 35.15 ? 35   CYS E O   1 
ATOM   2371 C CB  . CYS E 1 35 ? -21.439 23.022  -39.846 1.00 27.57 ? 35   CYS E CB  1 
ATOM   2372 S SG  . CYS E 1 35 ? -22.663 21.690  -39.874 1.00 31.84 ? 35   CYS E SG  1 
ATOM   2373 N N   . SER E 1 36 ? -20.818 25.768  -38.363 1.00 26.32 ? 36   SER E N   1 
ATOM   2374 C CA  . SER E 1 36 ? -19.888 26.762  -37.872 1.00 25.56 ? 36   SER E CA  1 
ATOM   2375 C C   . SER E 1 36 ? -18.485 26.414  -38.307 1.00 31.14 ? 36   SER E C   1 
ATOM   2376 O O   . SER E 1 36 ? -17.684 27.297  -38.597 1.00 36.39 ? 36   SER E O   1 
ATOM   2377 C CB  . SER E 1 36 ? -19.944 26.817  -36.350 1.00 24.66 ? 36   SER E CB  1 
ATOM   2378 O OG  . SER E 1 36 ? -19.497 25.589  -35.814 1.00 41.25 ? 36   SER E OG  1 
ATOM   2379 N N   . GLN E 1 37 ? -18.182 25.120  -38.355 1.00 41.23 ? 37   GLN E N   1 
ATOM   2380 C CA  . GLN E 1 37 ? -16.860 24.686  -38.801 1.00 39.52 ? 37   GLN E CA  1 
ATOM   2381 C C   . GLN E 1 37 ? -16.901 23.486  -39.740 1.00 36.96 ? 37   GLN E C   1 
ATOM   2382 O O   . GLN E 1 37 ? -17.865 22.713  -39.737 1.00 32.59 ? 37   GLN E O   1 
ATOM   2383 C CB  . GLN E 1 37 ? -15.946 24.402  -37.609 1.00 34.96 ? 37   GLN E CB  1 
ATOM   2384 C CG  . GLN E 1 37 ? -16.392 23.266  -36.736 1.00 35.78 ? 37   GLN E CG  1 
ATOM   2385 C CD  . GLN E 1 37 ? -15.344 22.912  -35.702 1.00 43.24 ? 37   GLN E CD  1 
ATOM   2386 O OE1 . GLN E 1 37 ? -15.600 22.142  -34.770 1.00 50.32 ? 37   GLN E OE1 1 
ATOM   2387 N NE2 . GLN E 1 37 ? -14.150 23.477  -35.859 1.00 37.13 ? 37   GLN E NE2 1 
ATOM   2388 N N   . PRO E 1 38 ? -15.849 23.337  -40.559 1.00 37.46 ? 38   PRO E N   1 
ATOM   2389 C CA  . PRO E 1 38 ? -15.773 22.235  -41.522 1.00 30.16 ? 38   PRO E CA  1 
ATOM   2390 C C   . PRO E 1 38 ? -15.366 20.961  -40.807 1.00 37.52 ? 38   PRO E C   1 
ATOM   2391 O O   . PRO E 1 38 ? -14.566 21.018  -39.874 1.00 33.44 ? 38   PRO E O   1 
ATOM   2392 C CB  . PRO E 1 38 ? -14.648 22.670  -42.474 1.00 34.10 ? 38   PRO E CB  1 
ATOM   2393 C CG  . PRO E 1 38 ? -14.252 24.071  -42.048 1.00 41.96 ? 38   PRO E CG  1 
ATOM   2394 C CD  . PRO E 1 38 ? -14.664 24.208  -40.623 1.00 27.31 ? 38   PRO E CD  1 
ATOM   2395 N N   . ALA E 1 39 ? -15.908 19.825  -41.226 1.00 35.94 ? 39   ALA E N   1 
ATOM   2396 C CA  . ALA E 1 39 ? -15.527 18.566  -40.613 1.00 33.43 ? 39   ALA E CA  1 
ATOM   2397 C C   . ALA E 1 39 ? -15.714 17.426  -41.588 1.00 34.50 ? 39   ALA E C   1 
ATOM   2398 O O   . ALA E 1 39 ? -16.588 17.481  -42.453 1.00 38.49 ? 39   ALA E O   1 
ATOM   2399 C CB  . ALA E 1 39 ? -16.332 18.318  -39.339 1.00 27.25 ? 39   ALA E CB  1 
ATOM   2400 N N   . VAL E 1 40 ? -14.875 16.402  -41.456 1.00 32.50 ? 40   VAL E N   1 
ATOM   2401 C CA  . VAL E 1 40 ? -15.135 15.118  -42.086 1.00 27.54 ? 40   VAL E CA  1 
ATOM   2402 C C   . VAL E 1 40 ? -15.757 14.212  -41.037 1.00 30.54 ? 40   VAL E C   1 
ATOM   2403 O O   . VAL E 1 40 ? -15.296 14.164  -39.902 1.00 30.95 ? 40   VAL E O   1 
ATOM   2404 C CB  . VAL E 1 40 ? -13.854 14.456  -42.598 1.00 28.52 ? 40   VAL E CB  1 
ATOM   2405 C CG1 . VAL E 1 40 ? -14.117 12.985  -42.972 1.00 25.98 ? 40   VAL E CG1 1 
ATOM   2406 C CG2 . VAL E 1 40 ? -13.308 15.221  -43.777 1.00 29.72 ? 40   VAL E CG2 1 
ATOM   2407 N N   . VAL E 1 41 ? -16.813 13.504  -41.405 1.00 24.97 ? 41   VAL E N   1 
ATOM   2408 C CA  . VAL E 1 41 ? -17.382 12.529  -40.498 1.00 25.32 ? 41   VAL E CA  1 
ATOM   2409 C C   . VAL E 1 41 ? -17.100 11.158  -41.063 1.00 25.67 ? 41   VAL E C   1 
ATOM   2410 O O   . VAL E 1 41 ? -17.565 10.838  -42.159 1.00 25.26 ? 41   VAL E O   1 
ATOM   2411 C CB  . VAL E 1 41 ? -18.886 12.694  -40.375 1.00 25.93 ? 41   VAL E CB  1 
ATOM   2412 C CG1 . VAL E 1 41 ? -19.492 11.464  -39.713 1.00 22.35 ? 41   VAL E CG1 1 
ATOM   2413 C CG2 . VAL E 1 41 ? -19.213 13.969  -39.606 1.00 21.53 ? 41   VAL E CG2 1 
ATOM   2414 N N   . PHE E 1 42 ? -16.329 10.349  -40.338 1.00 22.08 ? 42   PHE E N   1 
ATOM   2415 C CA  . PHE E 1 42 ? -16.063 8.990   -40.804 1.00 20.07 ? 42   PHE E CA  1 
ATOM   2416 C C   . PHE E 1 42 ? -17.156 8.071   -40.319 1.00 24.76 ? 42   PHE E C   1 
ATOM   2417 O O   . PHE E 1 42 ? -17.754 8.313   -39.276 1.00 33.48 ? 42   PHE E O   1 
ATOM   2418 C CB  . PHE E 1 42 ? -14.697 8.484   -40.355 1.00 19.61 ? 42   PHE E CB  1 
ATOM   2419 C CG  . PHE E 1 42 ? -13.543 9.145   -41.055 1.00 20.74 ? 42   PHE E CG  1 
ATOM   2420 C CD1 . PHE E 1 42 ? -13.358 8.984   -42.424 1.00 23.30 ? 42   PHE E CD1 1 
ATOM   2421 C CD2 . PHE E 1 42 ? -12.636 9.922   -40.349 1.00 19.09 ? 42   PHE E CD2 1 
ATOM   2422 C CE1 . PHE E 1 42 ? -12.297 9.588   -43.075 1.00 17.15 ? 42   PHE E CE1 1 
ATOM   2423 C CE2 . PHE E 1 42 ? -11.564 10.529  -40.999 1.00 24.20 ? 42   PHE E CE2 1 
ATOM   2424 C CZ  . PHE E 1 42 ? -11.400 10.359  -42.365 1.00 22.59 ? 42   PHE E CZ  1 
ATOM   2425 N N   . GLN E 1 43 ? -17.427 7.027   -41.090 1.00 24.32 ? 43   GLN E N   1 
ATOM   2426 C CA  . GLN E 1 43 ? -18.454 6.060   -40.748 1.00 24.81 ? 43   GLN E CA  1 
ATOM   2427 C C   . GLN E 1 43 ? -17.820 4.683   -40.680 1.00 29.73 ? 43   GLN E C   1 
ATOM   2428 O O   . GLN E 1 43 ? -17.240 4.210   -41.652 1.00 25.61 ? 43   GLN E O   1 
ATOM   2429 C CB  . GLN E 1 43 ? -19.566 6.097   -41.790 1.00 35.12 ? 43   GLN E CB  1 
ATOM   2430 C CG  . GLN E 1 43 ? -19.952 7.543   -42.182 1.00 42.22 ? 43   GLN E CG  1 
ATOM   2431 C CD  . GLN E 1 43 ? -21.094 7.604   -43.176 1.00 50.03 ? 43   GLN E CD  1 
ATOM   2432 O OE1 . GLN E 1 43 ? -20.882 7.766   -44.384 1.00 52.19 ? 43   GLN E OE1 1 
ATOM   2433 N NE2 . GLN E 1 43 ? -22.318 7.469   -42.673 1.00 58.30 ? 43   GLN E NE2 1 
ATOM   2434 N N   . THR E 1 44 ? -17.920 4.055   -39.511 1.00 32.84 ? 44   THR E N   1 
ATOM   2435 C CA  . THR E 1 44 ? -17.271 2.775   -39.251 1.00 26.85 ? 44   THR E CA  1 
ATOM   2436 C C   . THR E 1 44 ? -18.077 1.609   -39.794 1.00 28.41 ? 44   THR E C   1 
ATOM   2437 O O   . THR E 1 44 ? -19.237 1.758   -40.182 1.00 27.45 ? 44   THR E O   1 
ATOM   2438 C CB  . THR E 1 44 ? -17.035 2.549   -37.741 1.00 32.53 ? 44   THR E CB  1 
ATOM   2439 O OG1 . THR E 1 44 ? -18.292 2.377   -37.072 1.00 28.99 ? 44   THR E OG1 1 
ATOM   2440 C CG2 . THR E 1 44 ? -16.277 3.721   -37.125 1.00 15.18 ? 44   THR E CG2 1 
ATOM   2441 N N   . LYS E 1 45 ? -17.445 0.443   -39.814 1.00 31.57 ? 45   LYS E N   1 
ATOM   2442 C CA  . LYS E 1 45 ? -18.104 -0.796  -40.211 1.00 32.10 ? 45   LYS E CA  1 
ATOM   2443 C C   . LYS E 1 45 ? -19.420 -0.973  -39.474 1.00 32.63 ? 45   LYS E C   1 
ATOM   2444 O O   . LYS E 1 45 ? -20.384 -1.500  -40.020 1.00 33.63 ? 45   LYS E O   1 
ATOM   2445 C CB  . LYS E 1 45 ? -17.193 -1.976  -39.899 1.00 31.36 ? 45   LYS E CB  1 
ATOM   2446 C CG  . LYS E 1 45 ? -17.361 -3.134  -40.848 1.00 42.84 ? 45   LYS E CG  1 
ATOM   2447 C CD  . LYS E 1 45 ? -16.007 -3.659  -41.312 1.00 40.89 ? 45   LYS E CD  1 
ATOM   2448 C CE  . LYS E 1 45 ? -16.170 -4.843  -42.269 1.00 50.34 ? 45   LYS E CE  1 
ATOM   2449 N NZ  . LYS E 1 45 ? -16.979 -5.969  -41.680 1.00 39.60 ? 45   LYS E NZ  1 
ATOM   2450 N N   . ARG E 1 46 ? -19.438 -0.518  -38.223 1.00 40.34 ? 46   ARG E N   1 
ATOM   2451 C CA  . ARG E 1 46 ? -20.587 -0.630  -37.329 1.00 39.53 ? 46   ARG E CA  1 
ATOM   2452 C C   . ARG E 1 46 ? -21.591 0.518   -37.457 1.00 42.34 ? 46   ARG E C   1 
ATOM   2453 O O   . ARG E 1 46 ? -22.500 0.617   -36.628 1.00 33.21 ? 46   ARG E O   1 
ATOM   2454 C CB  . ARG E 1 46 ? -20.109 -0.619  -35.878 1.00 45.06 ? 46   ARG E CB  1 
ATOM   2455 C CG  . ARG E 1 46 ? -19.736 -1.954  -35.269 1.00 47.17 ? 46   ARG E CG  1 
ATOM   2456 C CD  . ARG E 1 46 ? -19.126 -1.708  -33.869 1.00 52.48 ? 46   ARG E CD  1 
ATOM   2457 N NE  . ARG E 1 46 ? -19.709 -2.474  -32.752 1.00 51.20 ? 46   ARG E NE  1 
ATOM   2458 C CZ  . ARG E 1 46 ? -20.575 -3.486  -32.851 1.00 46.11 ? 46   ARG E CZ  1 
ATOM   2459 N NH1 . ARG E 1 46 ? -21.013 -3.912  -34.031 1.00 52.33 ? 46   ARG E NH1 1 
ATOM   2460 N NH2 . ARG E 1 46 ? -21.005 -4.084  -31.747 1.00 37.77 ? 46   ARG E NH2 1 
ATOM   2461 N N   . SER E 1 47 ? -21.414 1.398   -38.444 1.00 29.33 ? 47   SER E N   1 
ATOM   2462 C CA  . SER E 1 47 ? -22.299 2.553   -38.613 1.00 32.32 ? 47   SER E CA  1 
ATOM   2463 C C   . SER E 1 47 ? -22.105 3.652   -37.545 1.00 37.66 ? 47   SER E C   1 
ATOM   2464 O O   . SER E 1 47 ? -22.916 4.570   -37.430 1.00 28.55 ? 47   SER E O   1 
ATOM   2465 C CB  . SER E 1 47 ? -23.760 2.101   -38.621 1.00 44.08 ? 47   SER E CB  1 
ATOM   2466 O OG  . SER E 1 47 ? -23.864 0.762   -39.085 1.00 53.30 ? 47   SER E OG  1 
ATOM   2467 N N   . LYS E 1 48 ? -21.044 3.557   -36.754 1.00 32.69 ? 48   LYS E N   1 
ATOM   2468 C CA  . LYS E 1 48 ? -20.697 4.661   -35.875 1.00 26.29 ? 48   LYS E CA  1 
ATOM   2469 C C   . LYS E 1 48 ? -20.282 5.867   -36.716 1.00 34.23 ? 48   LYS E C   1 
ATOM   2470 O O   . LYS E 1 48 ? -19.935 5.739   -37.895 1.00 30.62 ? 48   LYS E O   1 
ATOM   2471 C CB  . LYS E 1 48 ? -19.557 4.277   -34.936 1.00 28.20 ? 48   LYS E CB  1 
ATOM   2472 C CG  . LYS E 1 48 ? -19.960 3.448   -33.738 1.00 29.72 ? 48   LYS E CG  1 
ATOM   2473 C CD  . LYS E 1 48 ? -18.708 2.835   -33.097 1.00 40.32 ? 48   LYS E CD  1 
ATOM   2474 C CE  . LYS E 1 48 ? -18.981 2.255   -31.693 1.00 51.04 ? 48   LYS E CE  1 
ATOM   2475 N NZ  . LYS E 1 48 ? -19.681 0.930   -31.702 1.00 50.17 ? 48   LYS E NZ  1 
ATOM   2476 N N   . GLN E 1 49 ? -20.318 7.036   -36.091 1.00 36.04 ? 49   GLN E N   1 
ATOM   2477 C CA  . GLN E 1 49 ? -20.044 8.293   -36.757 1.00 25.08 ? 49   GLN E CA  1 
ATOM   2478 C C   . GLN E 1 49 ? -19.007 9.060   -35.977 1.00 29.90 ? 49   GLN E C   1 
ATOM   2479 O O   . GLN E 1 49 ? -19.199 9.349   -34.796 1.00 37.54 ? 49   GLN E O   1 
ATOM   2480 C CB  . GLN E 1 49 ? -21.313 9.099   -36.807 1.00 24.59 ? 49   GLN E CB  1 
ATOM   2481 C CG  . GLN E 1 49 ? -22.430 8.358   -37.460 1.00 26.73 ? 49   GLN E CG  1 
ATOM   2482 C CD  . GLN E 1 49 ? -22.611 8.779   -38.881 1.00 43.15 ? 49   GLN E CD  1 
ATOM   2483 O OE1 . GLN E 1 49 ? -22.474 7.965   -39.805 1.00 46.06 ? 49   GLN E OE1 1 
ATOM   2484 N NE2 . GLN E 1 49 ? -22.913 10.072  -39.082 1.00 32.21 ? 49   GLN E NE2 1 
ATOM   2485 N N   . VAL E 1 50 ? -17.902 9.395   -36.628 1.00 25.90 ? 50   VAL E N   1 
ATOM   2486 C CA  . VAL E 1 50 ? -16.798 10.031  -35.926 1.00 25.47 ? 50   VAL E CA  1 
ATOM   2487 C C   . VAL E 1 50 ? -16.409 11.347  -36.579 1.00 21.53 ? 50   VAL E C   1 
ATOM   2488 O O   . VAL E 1 50 ? -15.925 11.370  -37.705 1.00 28.72 ? 50   VAL E O   1 
ATOM   2489 C CB  . VAL E 1 50 ? -15.565 9.099   -35.870 1.00 26.54 ? 50   VAL E CB  1 
ATOM   2490 C CG1 . VAL E 1 50 ? -14.496 9.670   -34.949 1.00 23.85 ? 50   VAL E CG1 1 
ATOM   2491 C CG2 . VAL E 1 50 ? -15.970 7.706   -35.401 1.00 21.63 ? 50   VAL E CG2 1 
ATOM   2492 N N   . CYS E 1 51 ? -16.619 12.447  -35.871 1.00 30.23 ? 51   CYS E N   1 
ATOM   2493 C CA  . CYS E 1 51 ? -16.200 13.748  -36.382 1.00 26.89 ? 51   CYS E CA  1 
ATOM   2494 C C   . CYS E 1 51 ? -14.690 13.829  -36.408 1.00 30.50 ? 51   CYS E C   1 
ATOM   2495 O O   . CYS E 1 51 ? -14.030 13.591  -35.397 1.00 37.73 ? 51   CYS E O   1 
ATOM   2496 C CB  . CYS E 1 51 ? -16.765 14.874  -35.523 1.00 23.03 ? 51   CYS E CB  1 
ATOM   2497 S SG  . CYS E 1 51 ? -18.554 15.015  -35.582 1.00 34.23 ? 51   CYS E SG  1 
ATOM   2498 N N   . ALA E 1 52 ? -14.134 14.168  -37.562 1.00 27.00 ? 52   ALA E N   1 
ATOM   2499 C CA  . ALA E 1 52 ? -12.693 14.312  -37.655 1.00 26.24 ? 52   ALA E CA  1 
ATOM   2500 C C   . ALA E 1 52 ? -12.313 15.685  -38.158 1.00 31.65 ? 52   ALA E C   1 
ATOM   2501 O O   . ALA E 1 52 ? -12.992 16.263  -39.005 1.00 31.74 ? 52   ALA E O   1 
ATOM   2502 C CB  . ALA E 1 52 ? -12.100 13.240  -38.528 1.00 29.18 ? 52   ALA E CB  1 
ATOM   2503 N N   . ASP E 1 53 ? -11.208 16.187  -37.616 1.00 40.42 ? 53   ASP E N   1 
ATOM   2504 C CA  . ASP E 1 53 ? -10.680 17.514  -37.901 1.00 42.92 ? 53   ASP E CA  1 
ATOM   2505 C C   . ASP E 1 53 ? -9.926  17.547  -39.241 1.00 38.31 ? 53   ASP E C   1 
ATOM   2506 O O   . ASP E 1 53 ? -8.838  16.994  -39.353 1.00 45.94 ? 53   ASP E O   1 
ATOM   2507 C CB  . ASP E 1 53 ? -9.758  17.906  -36.740 1.00 41.82 ? 53   ASP E CB  1 
ATOM   2508 C CG  . ASP E 1 53 ? -8.996  19.188  -36.992 1.00 44.99 ? 53   ASP E CG  1 
ATOM   2509 O OD1 . ASP E 1 53 ? -8.837  19.578  -38.163 1.00 40.83 ? 53   ASP E OD1 1 
ATOM   2510 O OD2 . ASP E 1 53 ? -8.541  19.804  -36.008 1.00 47.11 ? 53   ASP E OD2 1 
ATOM   2511 N N   . PRO E 1 54 ? -10.500 18.211  -40.258 1.00 37.90 ? 54   PRO E N   1 
ATOM   2512 C CA  . PRO E 1 54 ? -9.915  18.229  -41.609 1.00 41.08 ? 54   PRO E CA  1 
ATOM   2513 C C   . PRO E 1 54 ? -8.471  18.744  -41.652 1.00 40.74 ? 54   PRO E C   1 
ATOM   2514 O O   . PRO E 1 54 ? -7.761  18.479  -42.621 1.00 40.05 ? 54   PRO E O   1 
ATOM   2515 C CB  . PRO E 1 54 ? -10.841 19.180  -42.388 1.00 31.43 ? 54   PRO E CB  1 
ATOM   2516 C CG  . PRO E 1 54 ? -12.123 19.184  -41.632 1.00 35.29 ? 54   PRO E CG  1 
ATOM   2517 C CD  . PRO E 1 54 ? -11.742 19.001  -40.184 1.00 36.71 ? 54   PRO E CD  1 
ATOM   2518 N N   . SER E 1 55 ? -8.053  19.480  -40.626 1.00 33.92 ? 55   SER E N   1 
ATOM   2519 C CA  . SER E 1 55 ? -6.678  19.969  -40.528 1.00 40.57 ? 55   SER E CA  1 
ATOM   2520 C C   . SER E 1 55 ? -5.664  18.833  -40.371 1.00 52.33 ? 55   SER E C   1 
ATOM   2521 O O   . SER E 1 55 ? -4.469  19.032  -40.566 1.00 58.00 ? 55   SER E O   1 
ATOM   2522 C CB  . SER E 1 55 ? -6.529  20.891  -39.317 1.00 37.76 ? 55   SER E CB  1 
ATOM   2523 O OG  . SER E 1 55 ? -7.619  21.792  -39.210 1.00 73.68 ? 55   SER E OG  1 
ATOM   2524 N N   . GLU E 1 56 ? -6.137  17.653  -39.982 1.00 44.03 ? 56   GLU E N   1 
ATOM   2525 C CA  . GLU E 1 56 ? -5.245  16.561  -39.630 1.00 31.22 ? 56   GLU E CA  1 
ATOM   2526 C C   . GLU E 1 56 ? -4.928  15.709  -40.844 1.00 39.79 ? 56   GLU E C   1 
ATOM   2527 O O   . GLU E 1 56 ? -5.788  15.456  -41.682 1.00 43.80 ? 56   GLU E O   1 
ATOM   2528 C CB  . GLU E 1 56 ? -5.846  15.714  -38.507 1.00 39.54 ? 56   GLU E CB  1 
ATOM   2529 C CG  . GLU E 1 56 ? -5.680  16.323  -37.114 1.00 38.23 ? 56   GLU E CG  1 
ATOM   2530 C CD  . GLU E 1 56 ? -6.635  15.725  -36.097 1.00 49.23 ? 56   GLU E CD  1 
ATOM   2531 O OE1 . GLU E 1 56 ? -7.591  15.041  -36.515 1.00 59.79 ? 56   GLU E OE1 1 
ATOM   2532 O OE2 . GLU E 1 56 ? -6.444  15.938  -34.881 1.00 47.30 ? 56   GLU E OE2 1 
ATOM   2533 N N   . SER E 1 57 ? -3.680  15.270  -40.927 1.00 38.22 ? 57   SER E N   1 
ATOM   2534 C CA  . SER E 1 57 ? -3.169  14.635  -42.129 1.00 35.80 ? 57   SER E CA  1 
ATOM   2535 C C   . SER E 1 57 ? -3.784  13.260  -42.314 1.00 46.12 ? 57   SER E C   1 
ATOM   2536 O O   . SER E 1 57 ? -4.108  12.856  -43.439 1.00 48.13 ? 57   SER E O   1 
ATOM   2537 C CB  . SER E 1 57 ? -1.642  14.537  -42.072 1.00 32.92 ? 57   SER E CB  1 
ATOM   2538 O OG  . SER E 1 57 ? -1.228  13.617  -41.078 1.00 42.59 ? 57   SER E OG  1 
ATOM   2539 N N   . TRP E 1 58 ? -3.951  12.533  -41.217 1.00 37.84 ? 58   TRP E N   1 
ATOM   2540 C CA  . TRP E 1 58 ? -4.542  11.217  -41.326 1.00 39.37 ? 58   TRP E CA  1 
ATOM   2541 C C   . TRP E 1 58 ? -5.942  11.328  -41.902 1.00 41.00 ? 58   TRP E C   1 
ATOM   2542 O O   . TRP E 1 58 ? -6.333  10.523  -42.746 1.00 41.52 ? 58   TRP E O   1 
ATOM   2543 C CB  . TRP E 1 58 ? -4.539  10.485  -39.986 1.00 44.15 ? 58   TRP E CB  1 
ATOM   2544 C CG  . TRP E 1 58 ? -5.564  10.918  -38.984 1.00 42.37 ? 58   TRP E CG  1 
ATOM   2545 C CD1 . TRP E 1 58 ? -5.416  11.875  -38.025 1.00 43.07 ? 58   TRP E CD1 1 
ATOM   2546 C CD2 . TRP E 1 58 ? -6.881  10.373  -38.807 1.00 32.64 ? 58   TRP E CD2 1 
ATOM   2547 N NE1 . TRP E 1 58 ? -6.563  11.972  -37.272 1.00 42.58 ? 58   TRP E NE1 1 
ATOM   2548 C CE2 . TRP E 1 58 ? -7.474  11.063  -37.732 1.00 36.01 ? 58   TRP E CE2 1 
ATOM   2549 C CE3 . TRP E 1 58 ? -7.613  9.382   -39.459 1.00 35.36 ? 58   TRP E CE3 1 
ATOM   2550 C CZ2 . TRP E 1 58 ? -8.772  10.786  -37.293 1.00 29.09 ? 58   TRP E CZ2 1 
ATOM   2551 C CZ3 . TRP E 1 58 ? -8.903  9.111   -39.018 1.00 33.43 ? 58   TRP E CZ3 1 
ATOM   2552 C CH2 . TRP E 1 58 ? -9.467  9.813   -37.944 1.00 22.41 ? 58   TRP E CH2 1 
ATOM   2553 N N   . VAL E 1 59 ? -6.681  12.344  -41.462 1.00 39.28 ? 59   VAL E N   1 
ATOM   2554 C CA  . VAL E 1 59 ? -8.028  12.584  -41.972 1.00 39.06 ? 59   VAL E CA  1 
ATOM   2555 C C   . VAL E 1 59 ? -8.012  12.796  -43.481 1.00 38.06 ? 59   VAL E C   1 
ATOM   2556 O O   . VAL E 1 59 ? -8.799  12.181  -44.212 1.00 36.39 ? 59   VAL E O   1 
ATOM   2557 C CB  . VAL E 1 59 ? -8.689  13.788  -41.296 1.00 35.18 ? 59   VAL E CB  1 
ATOM   2558 C CG1 . VAL E 1 59 ? -10.062 14.044  -41.902 1.00 29.92 ? 59   VAL E CG1 1 
ATOM   2559 C CG2 . VAL E 1 59 ? -8.809  13.538  -39.813 1.00 32.63 ? 59   VAL E CG2 1 
ATOM   2560 N N   . GLN E 1 60 ? -7.105  13.651  -43.946 1.00 34.70 ? 60   GLN E N   1 
ATOM   2561 C CA  . GLN E 1 60 ? -6.977  13.921  -45.374 1.00 38.48 ? 60   GLN E CA  1 
ATOM   2562 C C   . GLN E 1 60 ? -6.617  12.643  -46.128 1.00 40.93 ? 60   GLN E C   1 
ATOM   2563 O O   . GLN E 1 60 ? -7.215  12.313  -47.154 1.00 41.81 ? 60   GLN E O   1 
ATOM   2564 C CB  . GLN E 1 60 ? -5.923  15.003  -45.622 1.00 36.50 ? 60   GLN E CB  1 
ATOM   2565 C CG  . GLN E 1 60 ? -6.019  16.201  -44.676 1.00 42.94 ? 60   GLN E CG  1 
ATOM   2566 C CD  . GLN E 1 60 ? -5.242  17.431  -45.160 1.00 62.71 ? 60   GLN E CD  1 
ATOM   2567 O OE1 . GLN E 1 60 ? -4.745  17.466  -46.294 1.00 61.60 ? 60   GLN E OE1 1 
ATOM   2568 N NE2 . GLN E 1 60 ? -5.142  18.450  -44.298 1.00 46.96 ? 60   GLN E NE2 1 
ATOM   2569 N N   . GLU E 1 61 ? -5.644  11.917  -45.596 1.00 39.95 ? 61   GLU E N   1 
ATOM   2570 C CA  . GLU E 1 61 ? -5.164  10.699  -46.223 1.00 35.50 ? 61   GLU E CA  1 
ATOM   2571 C C   . GLU E 1 61 ? -6.268  9.648   -46.306 1.00 38.92 ? 61   GLU E C   1 
ATOM   2572 O O   . GLU E 1 61 ? -6.438  8.987   -47.335 1.00 40.55 ? 61   GLU E O   1 
ATOM   2573 C CB  . GLU E 1 61 ? -3.940  10.178  -45.465 1.00 33.24 ? 61   GLU E CB  1 
ATOM   2574 C CG  . GLU E 1 61 ? -2.719  11.082  -45.640 1.00 45.17 ? 61   GLU E CG  1 
ATOM   2575 C CD  . GLU E 1 61 ? -1.667  10.917  -44.552 1.00 53.52 ? 61   GLU E CD  1 
ATOM   2576 O OE1 . GLU E 1 61 ? -1.799  9.995   -43.716 1.00 64.56 ? 61   GLU E OE1 1 
ATOM   2577 O OE2 . GLU E 1 61 ? -0.707  11.720  -44.532 1.00 45.55 ? 61   GLU E OE2 1 
ATOM   2578 N N   . TYR E 1 62 ? -7.029  9.504   -45.229 1.00 31.95 ? 62   TYR E N   1 
ATOM   2579 C CA  . TYR E 1 62 ? -8.149  8.570   -45.216 1.00 31.36 ? 62   TYR E CA  1 
ATOM   2580 C C   . TYR E 1 62 ? -9.170  8.888   -46.313 1.00 33.68 ? 62   TYR E C   1 
ATOM   2581 O O   . TYR E 1 62 ? -9.606  8.002   -47.053 1.00 35.63 ? 62   TYR E O   1 
ATOM   2582 C CB  . TYR E 1 62 ? -8.820  8.565   -43.841 1.00 33.12 ? 62   TYR E CB  1 
ATOM   2583 C CG  . TYR E 1 62 ? -8.152  7.658   -42.850 1.00 30.68 ? 62   TYR E CG  1 
ATOM   2584 C CD1 . TYR E 1 62 ? -8.878  7.060   -41.830 1.00 35.15 ? 62   TYR E CD1 1 
ATOM   2585 C CD2 . TYR E 1 62 ? -6.796  7.368   -42.950 1.00 38.75 ? 62   TYR E CD2 1 
ATOM   2586 C CE1 . TYR E 1 62 ? -8.272  6.206   -40.925 1.00 31.12 ? 62   TYR E CE1 1 
ATOM   2587 C CE2 . TYR E 1 62 ? -6.179  6.516   -42.050 1.00 39.93 ? 62   TYR E CE2 1 
ATOM   2588 C CZ  . TYR E 1 62 ? -6.922  5.940   -41.039 1.00 37.79 ? 62   TYR E CZ  1 
ATOM   2589 O OH  . TYR E 1 62 ? -6.314  5.094   -40.142 1.00 35.03 ? 62   TYR E OH  1 
ATOM   2590 N N   . VAL E 1 63 ? -9.552  10.154  -46.418 1.00 27.88 ? 63   VAL E N   1 
ATOM   2591 C CA  . VAL E 1 63 ? -10.490 10.556  -47.455 1.00 34.45 ? 63   VAL E CA  1 
ATOM   2592 C C   . VAL E 1 63 ? -9.945  10.223  -48.840 1.00 38.38 ? 63   VAL E C   1 
ATOM   2593 O O   . VAL E 1 63 ? -10.640 9.623   -49.665 1.00 40.63 ? 63   VAL E O   1 
ATOM   2594 C CB  . VAL E 1 63 ? -10.804 12.065  -47.404 1.00 41.14 ? 63   VAL E CB  1 
ATOM   2595 C CG1 . VAL E 1 63 ? -11.611 12.466  -48.632 1.00 26.97 ? 63   VAL E CG1 1 
ATOM   2596 C CG2 . VAL E 1 63 ? -11.545 12.423  -46.118 1.00 30.19 ? 63   VAL E CG2 1 
ATOM   2597 N N   . TYR E 1 64 ? -8.703  10.618  -49.098 1.00 33.49 ? 64   TYR E N   1 
ATOM   2598 C CA  . TYR E 1 64 ? -8.101  10.363  -50.400 1.00 34.96 ? 64   TYR E CA  1 
ATOM   2599 C C   . TYR E 1 64 ? -8.145  8.890   -50.738 1.00 38.71 ? 64   TYR E C   1 
ATOM   2600 O O   . TYR E 1 64 ? -8.476  8.510   -51.864 1.00 30.87 ? 64   TYR E O   1 
ATOM   2601 C CB  . TYR E 1 64 ? -6.660  10.874  -50.445 1.00 43.33 ? 64   TYR E CB  1 
ATOM   2602 C CG  . TYR E 1 64 ? -6.563  12.362  -50.741 1.00 66.62 ? 64   TYR E CG  1 
ATOM   2603 C CD1 . TYR E 1 64 ? -7.112  13.311  -49.866 1.00 54.40 ? 64   TYR E CD1 1 
ATOM   2604 C CD2 . TYR E 1 64 ? -5.933  12.821  -51.899 1.00 59.34 ? 64   TYR E CD2 1 
ATOM   2605 C CE1 . TYR E 1 64 ? -7.031  14.680  -50.139 1.00 54.85 ? 64   TYR E CE1 1 
ATOM   2606 C CE2 . TYR E 1 64 ? -5.843  14.189  -52.179 1.00 63.70 ? 64   TYR E CE2 1 
ATOM   2607 C CZ  . TYR E 1 64 ? -6.390  15.112  -51.301 1.00 66.58 ? 64   TYR E CZ  1 
ATOM   2608 O OH  . TYR E 1 64 ? -6.288  16.459  -51.600 1.00 43.41 ? 64   TYR E OH  1 
ATOM   2609 N N   . ASP E 1 65 ? -7.823  8.062   -49.746 1.00 34.16 ? 65   ASP E N   1 
ATOM   2610 C CA  . ASP E 1 65 ? -7.729  6.629   -49.966 1.00 27.99 ? 65   ASP E CA  1 
ATOM   2611 C C   . ASP E 1 65 ? -9.089  6.022   -50.248 1.00 31.53 ? 65   ASP E C   1 
ATOM   2612 O O   . ASP E 1 65 ? -9.216  5.098   -51.047 1.00 33.61 ? 65   ASP E O   1 
ATOM   2613 C CB  . ASP E 1 65 ? -7.101  5.935   -48.764 1.00 41.82 ? 65   ASP E CB  1 
ATOM   2614 C CG  . ASP E 1 65 ? -6.872  4.468   -49.012 1.00 44.02 ? 65   ASP E CG  1 
ATOM   2615 O OD1 . ASP E 1 65 ? -5.809  4.138   -49.584 1.00 46.78 ? 65   ASP E OD1 1 
ATOM   2616 O OD2 . ASP E 1 65 ? -7.761  3.656   -48.666 1.00 37.33 ? 65   ASP E OD2 1 
ATOM   2617 N N   . LEU E 1 66 ? -10.106 6.538   -49.575 1.00 31.04 ? 66   LEU E N   1 
ATOM   2618 C CA  . LEU E 1 66 ? -11.468 6.073   -49.796 1.00 35.02 ? 66   LEU E CA  1 
ATOM   2619 C C   . LEU E 1 66 ? -11.911 6.423   -51.199 1.00 35.44 ? 66   LEU E C   1 
ATOM   2620 O O   . LEU E 1 66 ? -12.493 5.603   -51.907 1.00 37.36 ? 66   LEU E O   1 
ATOM   2621 C CB  . LEU E 1 66 ? -12.413 6.714   -48.781 1.00 35.48 ? 66   LEU E CB  1 
ATOM   2622 C CG  . LEU E 1 66 ? -12.391 6.042   -47.416 1.00 31.24 ? 66   LEU E CG  1 
ATOM   2623 C CD1 . LEU E 1 66 ? -12.875 6.986   -46.358 1.00 21.44 ? 66   LEU E CD1 1 
ATOM   2624 C CD2 . LEU E 1 66 ? -13.242 4.790   -47.472 1.00 25.93 ? 66   LEU E CD2 1 
ATOM   2625 N N   . GLU E 1 67 ? -11.622 7.658   -51.592 1.00 33.44 ? 67   GLU E N   1 
ATOM   2626 C CA  . GLU E 1 67 ? -12.040 8.165   -52.883 1.00 37.88 ? 67   GLU E CA  1 
ATOM   2627 C C   . GLU E 1 67 ? -11.392 7.373   -54.029 1.00 39.38 ? 67   GLU E C   1 
ATOM   2628 O O   . GLU E 1 67 ? -12.094 6.780   -54.844 1.00 47.95 ? 67   GLU E O   1 
ATOM   2629 C CB  . GLU E 1 67 ? -11.740 9.666   -52.974 1.00 38.90 ? 67   GLU E CB  1 
ATOM   2630 C CG  . GLU E 1 67 ? -12.754 10.477  -53.768 1.00 40.39 ? 67   GLU E CG  1 
ATOM   2631 C CD  . GLU E 1 67 ? -14.199 10.153  -53.423 1.00 37.11 ? 67   GLU E CD  1 
ATOM   2632 O OE1 . GLU E 1 67 ? -14.731 9.169   -53.967 1.00 33.09 ? 67   GLU E OE1 1 
ATOM   2633 O OE2 . GLU E 1 67 ? -14.812 10.890  -52.626 1.00 37.82 ? 67   GLU E OE2 1 
ATOM   2634 N N   . LEU E 1 68 ? -10.065 7.323   -54.085 1.00 28.93 ? 68   LEU E N   1 
ATOM   2635 C CA  . LEU E 1 68 ? -9.424  6.585   -55.174 1.00 45.65 ? 68   LEU E CA  1 
ATOM   2636 C C   . LEU E 1 68 ? -8.745  5.260   -54.781 1.00 48.06 ? 68   LEU E C   1 
ATOM   2637 O O   . LEU E 1 68 ? -7.538  5.102   -54.951 1.00 54.56 ? 68   LEU E O   1 
ATOM   2638 C CB  . LEU E 1 68 ? -8.486  7.495   -55.997 1.00 55.96 ? 68   LEU E CB  1 
ATOM   2639 C CG  . LEU E 1 68 ? -7.596  8.538   -55.306 1.00 50.41 ? 68   LEU E CG  1 
ATOM   2640 C CD1 . LEU E 1 68 ? -6.452  7.878   -54.574 1.00 37.51 ? 68   LEU E CD1 1 
ATOM   2641 C CD2 . LEU E 1 68 ? -7.054  9.529   -56.312 1.00 43.09 ? 68   LEU E CD2 1 
ATOM   2642 N N   . ASN E 1 69 ? -9.534  4.305   -54.283 1.00 50.61 ? 69   ASN E N   1 
ATOM   2643 C CA  . ASN E 1 69 ? -9.039  2.958   -53.965 1.00 41.12 ? 69   ASN E CA  1 
ATOM   2644 C C   . ASN E 1 69 ? -10.155 1.963   -53.671 1.00 35.53 ? 69   ASN E C   1 
ATOM   2645 O O   . ASN E 1 69 ? -11.318 2.204   -54.002 1.00 45.70 ? 69   ASN E O   1 
ATOM   2646 C CB  . ASN E 1 69 ? -8.048  2.986   -52.802 1.00 37.40 ? 69   ASN E CB  1 
ATOM   2647 C CG  . ASN E 1 69 ? -6.633  3.202   -53.258 1.00 40.23 ? 69   ASN E CG  1 
ATOM   2648 O OD1 . ASN E 1 69 ? -6.101  2.416   -54.035 1.00 61.84 ? 69   ASN E OD1 1 
ATOM   2649 N ND2 . ASN E 1 69 ? -6.011  4.274   -52.785 1.00 38.40 ? 69   ASN E ND2 1 
HETATM 2650 C C1  . GOL F 2 .  ? -8.704  -8.884  -33.223 1.00 34.14 ? 1070 GOL B C1  1 
HETATM 2651 O O1  . GOL F 2 .  ? -9.173  -10.008 -32.572 1.00 36.53 ? 1070 GOL B O1  1 
HETATM 2652 C C2  . GOL F 2 .  ? -7.207  -8.831  -33.105 1.00 47.16 ? 1070 GOL B C2  1 
HETATM 2653 O O2  . GOL F 2 .  ? -6.673  -7.747  -33.794 1.00 37.98 ? 1070 GOL B O2  1 
HETATM 2654 C C3  . GOL F 2 .  ? -6.584  -10.156 -33.487 1.00 41.14 ? 1070 GOL B C3  1 
HETATM 2655 O O3  . GOL F 2 .  ? -5.393  -10.335 -32.781 1.00 35.89 ? 1070 GOL B O3  1 
HETATM 2656 C C1  . GOL G 2 .  ? -26.393 13.742  -33.034 1.00 36.65 ? 1070 GOL C C1  1 
HETATM 2657 O O1  . GOL G 2 .  ? -26.897 13.321  -34.255 1.00 40.41 ? 1070 GOL C O1  1 
HETATM 2658 C C2  . GOL G 2 .  ? -27.478 13.622  -32.004 1.00 41.87 ? 1070 GOL C C2  1 
HETATM 2659 O O2  . GOL G 2 .  ? -28.692 13.849  -32.630 1.00 33.44 ? 1070 GOL C O2  1 
HETATM 2660 C C3  . GOL G 2 .  ? -27.229 14.542  -30.830 1.00 29.25 ? 1070 GOL C C3  1 
HETATM 2661 O O3  . GOL G 2 .  ? -27.641 15.852  -31.106 1.00 32.61 ? 1070 GOL C O3  1 
HETATM 2662 C C1  . GOL H 2 .  ? -38.278 25.571  -3.636  1.00 39.40 ? 1070 GOL D C1  1 
HETATM 2663 O O1  . GOL H 2 .  ? -38.451 24.507  -2.746  1.00 26.44 ? 1070 GOL D O1  1 
HETATM 2664 C C2  . GOL H 2 .  ? -37.119 26.484  -3.278  1.00 52.96 ? 1070 GOL D C2  1 
HETATM 2665 O O2  . GOL H 2 .  ? -36.163 26.422  -4.272  1.00 36.22 ? 1070 GOL D O2  1 
HETATM 2666 C C3  . GOL H 2 .  ? -37.544 27.929  -3.102  1.00 51.09 ? 1070 GOL D C3  1 
HETATM 2667 O O3  . GOL H 2 .  ? -36.502 28.700  -2.587  1.00 36.73 ? 1070 GOL D O3  1 
HETATM 2668 O O   . HOH I 3 .  ? -26.806 8.175   -10.953 1.00 37.19 ? 2001 HOH A O   1 
HETATM 2669 O O   . HOH I 3 .  ? -24.227 10.428  -3.898  1.00 29.75 ? 2002 HOH A O   1 
HETATM 2670 O O   . HOH I 3 .  ? -16.693 8.559   -3.946  1.00 25.58 ? 2003 HOH A O   1 
HETATM 2671 O O   . HOH I 3 .  ? -19.251 0.206   -5.832  1.00 19.56 ? 2004 HOH A O   1 
HETATM 2672 O O   . HOH I 3 .  ? -24.635 -26.095 -2.412  1.00 37.68 ? 2005 HOH A O   1 
HETATM 2673 O O   . HOH I 3 .  ? -9.114  -11.734 2.602   1.00 27.24 ? 2006 HOH A O   1 
HETATM 2674 O O   . HOH I 3 .  ? -15.141 -6.494  4.117   1.00 30.20 ? 2007 HOH A O   1 
HETATM 2675 O O   . HOH I 3 .  ? -14.669 -7.350  6.737   1.00 27.63 ? 2008 HOH A O   1 
HETATM 2676 O O   . HOH I 3 .  ? -11.234 -13.767 3.593   1.00 25.00 ? 2009 HOH A O   1 
HETATM 2677 O O   . HOH I 3 .  ? -19.190 -7.222  -15.081 1.00 36.32 ? 2010 HOH A O   1 
HETATM 2678 O O   . HOH I 3 .  ? -9.129  0.000   0.000   0.50 44.26 ? 2011 HOH A O   1 
HETATM 2679 O O   . HOH I 3 .  ? -24.708 -5.668  2.744   1.00 28.38 ? 2012 HOH A O   1 
HETATM 2680 O O   . HOH I 3 .  ? -26.096 -24.994 -4.863  1.00 31.01 ? 2013 HOH A O   1 
HETATM 2681 O O   . HOH I 3 .  ? -30.031 -17.316 -10.982 1.00 26.12 ? 2014 HOH A O   1 
HETATM 2682 O O   . HOH I 3 .  ? -31.747 -18.084 -8.474  1.00 32.61 ? 2015 HOH A O   1 
HETATM 2683 O O   . HOH I 3 .  ? -19.658 -6.445  -12.299 1.00 22.14 ? 2016 HOH A O   1 
HETATM 2684 O O   . HOH I 3 .  ? -11.781 -5.043  -6.481  1.00 19.82 ? 2017 HOH A O   1 
HETATM 2685 O O   . HOH I 3 .  ? -13.060 -5.834  -3.045  1.00 22.49 ? 2018 HOH A O   1 
HETATM 2686 O O   . HOH I 3 .  ? -17.189 -1.931  -6.156  1.00 12.86 ? 2019 HOH A O   1 
HETATM 2687 O O   . HOH I 3 .  ? -6.471  -2.926  -9.173  1.00 30.28 ? 2020 HOH A O   1 
HETATM 2688 O O   . HOH I 3 .  ? -7.239  0.540   -2.109  1.00 29.50 ? 2021 HOH A O   1 
HETATM 2689 O O   . HOH I 3 .  ? -7.069  2.817   -4.926  1.00 21.43 ? 2022 HOH A O   1 
HETATM 2690 O O   . HOH I 3 .  ? -7.111  -5.098  -5.751  1.00 29.89 ? 2023 HOH A O   1 
HETATM 2691 O O   . HOH I 3 .  ? -5.814  -1.045  -5.807  1.00 34.07 ? 2024 HOH A O   1 
HETATM 2692 O O   . HOH I 3 .  ? -6.068  -4.078  2.684   1.00 26.05 ? 2025 HOH A O   1 
HETATM 2693 O O   . HOH I 3 .  ? -7.293  -6.133  1.874   1.00 24.29 ? 2026 HOH A O   1 
HETATM 2694 O O   . HOH I 3 .  ? -10.526 -4.604  -0.772  1.00 23.74 ? 2027 HOH A O   1 
HETATM 2695 O O   . HOH I 3 .  ? -7.153  -11.828 1.239   1.00 30.95 ? 2028 HOH A O   1 
HETATM 2696 O O   . HOH I 3 .  ? -30.094 -8.302  -4.833  1.00 44.20 ? 2029 HOH A O   1 
HETATM 2697 O O   . HOH I 3 .  ? -26.250 -7.437  3.289   1.00 24.29 ? 2030 HOH A O   1 
HETATM 2698 O O   . HOH I 3 .  ? -15.198 -17.052 -1.065  1.00 15.95 ? 2031 HOH A O   1 
HETATM 2699 O O   . HOH I 3 .  ? -10.614 -16.191 -10.824 1.00 35.65 ? 2032 HOH A O   1 
HETATM 2700 O O   . HOH I 3 .  ? -28.716 -17.253 -14.633 1.00 31.48 ? 2033 HOH A O   1 
HETATM 2701 O O   . HOH I 3 .  ? -29.235 -21.725 -12.700 1.00 44.04 ? 2034 HOH A O   1 
HETATM 2702 O O   . HOH J 3 .  ? -25.567 17.526  -27.859 1.00 27.01 ? 2001 HOH B O   1 
HETATM 2703 O O   . HOH J 3 .  ? -30.319 23.598  -25.108 1.00 38.22 ? 2002 HOH B O   1 
HETATM 2704 O O   . HOH J 3 .  ? -30.249 25.978  -27.376 1.00 24.99 ? 2003 HOH B O   1 
HETATM 2705 O O   . HOH J 3 .  ? -21.320 9.816   -23.748 1.00 19.03 ? 2004 HOH B O   1 
HETATM 2706 O O   . HOH J 3 .  ? -13.041 8.801   -20.388 1.00 20.98 ? 2005 HOH B O   1 
HETATM 2707 O O   . HOH J 3 .  ? -11.672 10.637  -18.340 1.00 23.37 ? 2006 HOH B O   1 
HETATM 2708 O O   . HOH J 3 .  ? -7.048  5.796   -14.228 1.00 38.35 ? 2007 HOH B O   1 
HETATM 2709 O O   . HOH J 3 .  ? -5.188  6.320   -20.150 1.00 41.64 ? 2008 HOH B O   1 
HETATM 2710 O O   . HOH J 3 .  ? -8.480  -2.290  -18.273 1.00 26.13 ? 2009 HOH B O   1 
HETATM 2711 O O   . HOH J 3 .  ? -11.301 -4.655  -11.245 1.00 35.45 ? 2010 HOH B O   1 
HETATM 2712 O O   . HOH J 3 .  ? -8.219  -5.116  -8.165  1.00 29.40 ? 2011 HOH B O   1 
HETATM 2713 O O   . HOH J 3 .  ? -22.223 -1.502  -13.233 1.00 27.76 ? 2012 HOH B O   1 
HETATM 2714 O O   . HOH J 3 .  ? -12.645 -15.466 -23.226 1.00 29.56 ? 2013 HOH B O   1 
HETATM 2715 O O   . HOH J 3 .  ? -20.230 -10.502 -29.367 1.00 31.67 ? 2014 HOH B O   1 
HETATM 2716 O O   . HOH J 3 .  ? -17.968 -18.313 -23.795 1.00 37.50 ? 2015 HOH B O   1 
HETATM 2717 O O   . HOH J 3 .  ? -16.349 -16.201 -23.279 1.00 34.92 ? 2016 HOH B O   1 
HETATM 2718 O O   . HOH J 3 .  ? -20.619 -11.990 -27.168 1.00 24.86 ? 2017 HOH B O   1 
HETATM 2719 O O   . HOH J 3 .  ? -22.076 3.284   -20.671 1.00 32.88 ? 2018 HOH B O   1 
HETATM 2720 O O   . HOH J 3 .  ? -18.456 9.247   -24.211 1.00 28.60 ? 2019 HOH B O   1 
HETATM 2721 O O   . HOH J 3 .  ? -12.262 9.655   -23.750 1.00 24.48 ? 2020 HOH B O   1 
HETATM 2722 O O   . HOH J 3 .  ? -9.202  13.604  -14.557 1.00 30.01 ? 2021 HOH B O   1 
HETATM 2723 O O   . HOH J 3 .  ? -29.972 -14.213 -14.570 1.00 38.44 ? 2022 HOH B O   1 
HETATM 2724 O O   . HOH J 3 .  ? -20.192 -2.154  -14.374 1.00 23.30 ? 2023 HOH B O   1 
HETATM 2725 O O   . HOH J 3 .  ? -23.437 -0.526  -15.249 1.00 24.54 ? 2024 HOH B O   1 
HETATM 2726 O O   . HOH J 3 .  ? -1.971  -5.862  -22.521 1.00 36.35 ? 2025 HOH B O   1 
HETATM 2727 O O   . HOH J 3 .  ? -3.887  -7.744  -22.599 1.00 36.30 ? 2026 HOH B O   1 
HETATM 2728 O O   . HOH J 3 .  ? -10.980 -8.847  -36.150 1.00 39.90 ? 2027 HOH B O   1 
HETATM 2729 O O   . HOH J 3 .  ? -16.810 -12.478 -32.588 1.00 29.90 ? 2028 HOH B O   1 
HETATM 2730 O O   . HOH J 3 .  ? -11.312 -10.460 -33.940 1.00 20.10 ? 2029 HOH B O   1 
HETATM 2731 O O   . HOH J 3 .  ? -19.599 -5.394  -37.284 1.00 36.58 ? 2030 HOH B O   1 
HETATM 2732 O O   . HOH J 3 .  ? -5.473  -5.476  -32.560 1.00 35.07 ? 2031 HOH B O   1 
HETATM 2733 O O   . HOH K 3 .  ? -23.554 5.119   -26.584 1.00 39.01 ? 2001 HOH C O   1 
HETATM 2734 O O   . HOH K 3 .  ? -18.631 15.548  -32.009 1.00 29.59 ? 2002 HOH C O   1 
HETATM 2735 O O   . HOH K 3 .  ? -31.459 31.805  -40.141 1.00 43.85 ? 2003 HOH C O   1 
HETATM 2736 O O   . HOH K 3 .  ? -20.244 17.766  -32.280 1.00 27.80 ? 2004 HOH C O   1 
HETATM 2737 O O   . HOH K 3 .  ? -28.603 18.970  -30.986 1.00 26.69 ? 2005 HOH C O   1 
HETATM 2738 O O   . HOH K 3 .  ? -30.421 24.267  -33.751 1.00 11.44 ? 2006 HOH C O   1 
HETATM 2739 O O   . HOH K 3 .  ? -29.281 29.749  -40.765 1.00 34.72 ? 2007 HOH C O   1 
HETATM 2740 O O   . HOH K 3 .  ? -36.404 29.494  -40.322 1.00 23.36 ? 2008 HOH C O   1 
HETATM 2741 O O   . HOH K 3 .  ? -35.512 30.652  -31.445 1.00 36.23 ? 2009 HOH C O   1 
HETATM 2742 O O   . HOH K 3 .  ? -33.920 27.891  -25.532 1.00 37.68 ? 2010 HOH C O   1 
HETATM 2743 O O   . HOH K 3 .  ? -41.305 25.026  -44.063 1.00 28.37 ? 2011 HOH C O   1 
HETATM 2744 O O   . HOH K 3 .  ? -36.402 27.578  -25.643 1.00 43.05 ? 2012 HOH C O   1 
HETATM 2745 O O   . HOH K 3 .  ? -34.368 17.586  -25.405 1.00 24.32 ? 2013 HOH C O   1 
HETATM 2746 O O   . HOH K 3 .  ? -29.660 25.169  -29.977 1.00 25.44 ? 2014 HOH C O   1 
HETATM 2747 O O   . HOH K 3 .  ? -22.579 27.208  -33.600 1.00 34.14 ? 2015 HOH C O   1 
HETATM 2748 O O   . HOH K 3 .  ? -20.966 26.573  -30.662 1.00 19.11 ? 2016 HOH C O   1 
HETATM 2749 O O   . HOH K 3 .  ? -24.117 29.049  -29.770 1.00 32.50 ? 2017 HOH C O   1 
HETATM 2750 O O   . HOH K 3 .  ? -28.366 26.286  -35.537 1.00 27.20 ? 2018 HOH C O   1 
HETATM 2751 O O   . HOH K 3 .  ? -28.242 29.986  -37.857 1.00 27.61 ? 2019 HOH C O   1 
HETATM 2752 O O   . HOH K 3 .  ? -24.051 25.972  -35.769 1.00 26.18 ? 2020 HOH C O   1 
HETATM 2753 O O   . HOH K 3 .  ? -34.073 30.649  -39.208 1.00 28.66 ? 2021 HOH C O   1 
HETATM 2754 O O   . HOH K 3 .  ? -36.138 12.298  -28.446 1.00 31.82 ? 2022 HOH C O   1 
HETATM 2755 O O   . HOH K 3 .  ? -40.334 5.295   -38.295 1.00 33.97 ? 2023 HOH C O   1 
HETATM 2756 O O   . HOH K 3 .  ? -44.813 4.257   -39.297 1.00 41.03 ? 2024 HOH C O   1 
HETATM 2757 O O   . HOH K 3 .  ? -32.996 14.143  -35.765 1.00 25.16 ? 2025 HOH C O   1 
HETATM 2758 O O   . HOH K 3 .  ? -38.732 17.937  -42.137 1.00 30.14 ? 2026 HOH C O   1 
HETATM 2759 O O   . HOH K 3 .  ? -37.097 9.439   -34.788 1.00 27.62 ? 2027 HOH C O   1 
HETATM 2760 O O   . HOH K 3 .  ? -35.845 13.507  -41.397 1.00 33.69 ? 2028 HOH C O   1 
HETATM 2761 O O   . HOH K 3 .  ? -40.727 31.068  -37.325 1.00 43.84 ? 2029 HOH C O   1 
HETATM 2762 O O   . HOH K 3 .  ? -36.076 30.565  -28.882 1.00 22.77 ? 2030 HOH C O   1 
HETATM 2763 O O   . HOH K 3 .  ? -41.495 26.346  -36.741 1.00 30.71 ? 2031 HOH C O   1 
HETATM 2764 O O   . HOH K 3 .  ? -27.713 13.885  -36.556 1.00 30.47 ? 2032 HOH C O   1 
HETATM 2765 O O   . HOH L 3 .  ? -17.652 1.266   -8.295  1.00 28.57 ? 2001 HOH D O   1 
HETATM 2766 O O   . HOH L 3 .  ? -13.879 -3.763  -11.742 1.00 26.09 ? 2002 HOH D O   1 
HETATM 2767 O O   . HOH L 3 .  ? -14.841 4.469   -13.964 1.00 27.11 ? 2003 HOH D O   1 
HETATM 2768 O O   . HOH L 3 .  ? -24.400 7.969   -14.121 1.00 27.46 ? 2004 HOH D O   1 
HETATM 2769 O O   . HOH L 3 .  ? -21.285 6.372   -11.900 1.00 28.20 ? 2005 HOH D O   1 
HETATM 2770 O O   . HOH L 3 .  ? -21.263 12.295  -12.290 1.00 13.91 ? 2006 HOH D O   1 
HETATM 2771 O O   . HOH L 3 .  ? -22.230 8.697   -12.489 1.00 22.57 ? 2007 HOH D O   1 
HETATM 2772 O O   . HOH L 3 .  ? -21.849 17.286  -21.739 1.00 28.10 ? 2008 HOH D O   1 
HETATM 2773 O O   . HOH L 3 .  ? -36.419 29.016  -21.023 1.00 39.52 ? 2009 HOH D O   1 
HETATM 2774 O O   . HOH L 3 .  ? -41.686 26.753  -13.892 1.00 31.60 ? 2010 HOH D O   1 
HETATM 2775 O O   . HOH L 3 .  ? -33.435 31.732  -14.542 1.00 39.04 ? 2011 HOH D O   1 
HETATM 2776 O O   . HOH L 3 .  ? -42.330 17.527  -11.351 1.00 34.34 ? 2012 HOH D O   1 
HETATM 2777 O O   . HOH L 3 .  ? -40.273 14.566  -8.451  1.00 24.56 ? 2013 HOH D O   1 
HETATM 2778 O O   . HOH L 3 .  ? -18.708 17.789  -11.552 1.00 20.65 ? 2014 HOH D O   1 
HETATM 2779 O O   . HOH L 3 .  ? -10.285 13.536  -12.137 1.00 21.38 ? 2015 HOH D O   1 
HETATM 2780 O O   . HOH L 3 .  ? -13.873 21.764  -11.386 1.00 32.87 ? 2016 HOH D O   1 
HETATM 2781 O O   . HOH L 3 .  ? -17.000 18.253  -16.326 1.00 35.70 ? 2017 HOH D O   1 
HETATM 2782 O O   . HOH L 3 .  ? -19.544 17.574  -14.796 1.00 21.37 ? 2018 HOH D O   1 
HETATM 2783 O O   . HOH L 3 .  ? -28.029 25.424  -17.394 1.00 30.76 ? 2019 HOH D O   1 
HETATM 2784 O O   . HOH L 3 .  ? -31.466 31.443  -12.912 1.00 29.91 ? 2020 HOH D O   1 
HETATM 2785 O O   . HOH L 3 .  ? -31.589 28.759  -3.917  1.00 50.71 ? 2021 HOH D O   1 
HETATM 2786 O O   . HOH L 3 .  ? -42.463 20.234  -5.171  1.00 29.88 ? 2022 HOH D O   1 
HETATM 2787 O O   . HOH L 3 .  ? -34.345 27.545  -1.816  1.00 39.48 ? 2023 HOH D O   1 
HETATM 2788 O O   . HOH M 3 .  ? -35.359 13.883  -47.317 1.00 37.52 ? 2001 HOH E O   1 
HETATM 2789 O O   . HOH M 3 .  ? -34.604 23.000  -45.227 1.00 36.52 ? 2002 HOH E O   1 
HETATM 2790 O O   . HOH M 3 .  ? -34.503 12.640  -49.031 1.00 44.28 ? 2003 HOH E O   1 
HETATM 2791 O O   . HOH M 3 .  ? -35.106 10.720  -47.309 1.00 35.08 ? 2004 HOH E O   1 
HETATM 2792 O O   . HOH M 3 .  ? -38.037 27.413  -43.738 1.00 36.91 ? 2005 HOH E O   1 
HETATM 2793 O O   . HOH M 3 .  ? -30.898 22.412  -40.469 1.00 29.06 ? 2006 HOH E O   1 
HETATM 2794 O O   . HOH M 3 .  ? -26.513 17.137  -42.775 1.00 18.14 ? 2007 HOH E O   1 
HETATM 2795 O O   . HOH M 3 .  ? -24.279 18.197  -42.401 1.00 12.64 ? 2008 HOH E O   1 
HETATM 2796 O O   . HOH M 3 .  ? -19.289 20.319  -38.718 1.00 24.02 ? 2009 HOH E O   1 
HETATM 2797 O O   . HOH M 3 .  ? -13.308 22.291  -32.269 1.00 26.08 ? 2010 HOH E O   1 
HETATM 2798 O O   . HOH M 3 .  ? -21.233 29.880  -39.100 1.00 39.22 ? 2011 HOH E O   1 
HETATM 2799 O O   . HOH M 3 .  ? -12.582 1.035   -47.198 1.00 20.23 ? 2012 HOH E O   1 
HETATM 2800 O O   . HOH M 3 .  ? -4.660  4.988   -45.687 1.00 47.05 ? 2013 HOH E O   1 
HETATM 2801 O O   . HOH M 3 .  ? -15.113 0.769   -47.994 1.00 35.09 ? 2014 HOH E O   1 
HETATM 2802 O O   . HOH M 3 .  ? -20.182 2.649   -47.962 1.00 38.84 ? 2015 HOH E O   1 
HETATM 2803 O O   . HOH M 3 .  ? -19.387 14.304  -48.608 1.00 25.24 ? 2016 HOH E O   1 
HETATM 2804 O O   . HOH M 3 .  ? -23.296 27.641  -38.092 1.00 26.30 ? 2017 HOH E O   1 
HETATM 2805 O O   . HOH M 3 .  ? -20.942 28.740  -41.401 1.00 32.90 ? 2018 HOH E O   1 
HETATM 2806 O O   . HOH M 3 .  ? -20.204 23.087  -36.829 1.00 37.32 ? 2019 HOH E O   1 
HETATM 2807 O O   . HOH M 3 .  ? -19.159 22.047  -41.889 1.00 28.36 ? 2020 HOH E O   1 
HETATM 2808 O O   . HOH M 3 .  ? -22.455 9.090   -46.299 1.00 42.58 ? 2021 HOH E O   1 
HETATM 2809 O O   . HOH M 3 .  ? -8.147  18.744  -33.911 1.00 40.82 ? 2022 HOH E O   1 
HETATM 2810 O O   . HOH M 3 .  ? -9.729  14.360  -35.664 1.00 42.36 ? 2023 HOH E O   1 
HETATM 2811 O O   . HOH M 3 .  ? -2.219  13.082  -38.625 1.00 42.69 ? 2024 HOH E O   1 
HETATM 2812 O O   . HOH M 3 .  ? -2.808  6.913   -44.355 1.00 38.23 ? 2025 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  ?  ?   ?   A . n 
A 1 2  PRO 2  2  ?  ?   ?   A . n 
A 1 3  MET 3  3  ?  ?   ?   A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  ASP 6  6  6  ASP ASP A . n 
A 1 7  PRO 7  7  7  PRO PRO A . n 
A 1 8  PRO 8  8  8  PRO PRO A . n 
A 1 9  THR 9  9  9  THR THR A . n 
A 1 10 ALA 10 10 10 ALA ALA A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 CYS 12 12 12 CYS CYS A . n 
A 1 13 PHE 13 13 13 PHE PHE A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 THR 16 16 16 THR THR A . n 
A 1 17 ALA 17 17 17 ALA ALA A . n 
A 1 18 ARG 18 18 18 ARG ARG A . n 
A 1 19 LYS 19 19 19 LYS LYS A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 PRO 21 21 21 PRO PRO A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 ASN 23 23 23 ASN ASN A . n 
A 1 24 PHE 24 24 24 PHE PHE A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 VAL 26 26 26 VAL VAL A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 TYR 28 28 28 TYR TYR A . n 
A 1 29 TYR 29 29 29 TYR TYR A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 SER 32 32 32 SER SER A . n 
A 1 33 SER 33 33 33 SER SER A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 CYS 35 35 35 CYS CYS A . n 
A 1 36 SER 36 36 36 SER SER A . n 
A 1 37 GLN 37 37 37 GLN GLN A . n 
A 1 38 PRO 38 38 38 PRO PRO A . n 
A 1 39 ALA 39 39 39 ALA ALA A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
A 1 41 VAL 41 41 41 VAL VAL A . n 
A 1 42 PHE 42 42 42 PHE PHE A . n 
A 1 43 GLN 43 43 43 GLN GLN A . n 
A 1 44 THR 44 44 44 THR THR A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 SER 47 47 47 SER SER A . n 
A 1 48 LYS 48 48 48 LYS LYS A . n 
A 1 49 GLN 49 49 49 GLN GLN A . n 
A 1 50 VAL 50 50 50 VAL VAL A . n 
A 1 51 CYS 51 51 51 CYS CYS A . n 
A 1 52 ALA 52 52 52 ALA ALA A . n 
A 1 53 ASP 53 53 53 ASP ASP A . n 
A 1 54 PRO 54 54 54 PRO PRO A . n 
A 1 55 SER 55 55 55 SER SER A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 SER 57 57 57 SER SER A . n 
A 1 58 TRP 58 58 58 TRP TRP A . n 
A 1 59 VAL 59 59 59 VAL VAL A . n 
A 1 60 GLN 60 60 60 GLN GLN A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 TYR 62 62 62 TYR TYR A . n 
A 1 63 VAL 63 63 63 VAL VAL A . n 
A 1 64 TYR 64 64 64 TYR TYR A . n 
A 1 65 ASP 65 65 65 ASP ASP A . n 
A 1 66 LEU 66 66 66 LEU LEU A . n 
A 1 67 GLU 67 67 67 GLU GLU A . n 
A 1 68 LEU 68 68 68 LEU LEU A . n 
A 1 69 ASN 69 69 69 ASN ASN A . n 
B 1 1  ALA 1  1  ?  ?   ?   B . n 
B 1 2  PRO 2  2  ?  ?   ?   B . n 
B 1 3  MET 3  3  ?  ?   ?   B . n 
B 1 4  GLY 4  4  ?  ?   ?   B . n 
B 1 5  SER 5  5  5  SER SER B . n 
B 1 6  ASP 6  6  6  ASP ASP B . n 
B 1 7  PRO 7  7  7  PRO PRO B . n 
B 1 8  PRO 8  8  8  PRO PRO B . n 
B 1 9  THR 9  9  9  THR THR B . n 
B 1 10 ALA 10 10 10 ALA ALA B . n 
B 1 11 CYS 11 11 11 CYS CYS B . n 
B 1 12 CYS 12 12 12 CYS CYS B . n 
B 1 13 PHE 13 13 13 PHE PHE B . n 
B 1 14 SER 14 14 14 SER SER B . n 
B 1 15 TYR 15 15 15 TYR TYR B . n 
B 1 16 THR 16 16 16 THR THR B . n 
B 1 17 ALA 17 17 17 ALA ALA B . n 
B 1 18 ARG 18 18 18 ARG ARG B . n 
B 1 19 LYS 19 19 19 LYS LYS B . n 
B 1 20 LEU 20 20 20 LEU LEU B . n 
B 1 21 PRO 21 21 21 PRO PRO B . n 
B 1 22 ARG 22 22 22 ARG ARG B . n 
B 1 23 ASN 23 23 23 ASN ASN B . n 
B 1 24 PHE 24 24 24 PHE PHE B . n 
B 1 25 VAL 25 25 25 VAL VAL B . n 
B 1 26 VAL 26 26 26 VAL VAL B . n 
B 1 27 ASP 27 27 27 ASP ASP B . n 
B 1 28 TYR 28 28 28 TYR TYR B . n 
B 1 29 TYR 29 29 29 TYR TYR B . n 
B 1 30 GLU 30 30 30 GLU GLU B . n 
B 1 31 THR 31 31 31 THR THR B . n 
B 1 32 SER 32 32 32 SER SER B . n 
B 1 33 SER 33 33 33 SER SER B . n 
B 1 34 LEU 34 34 34 LEU LEU B . n 
B 1 35 CYS 35 35 35 CYS CYS B . n 
B 1 36 SER 36 36 36 SER SER B . n 
B 1 37 GLN 37 37 37 GLN GLN B . n 
B 1 38 PRO 38 38 38 PRO PRO B . n 
B 1 39 ALA 39 39 39 ALA ALA B . n 
B 1 40 VAL 40 40 40 VAL VAL B . n 
B 1 41 VAL 41 41 41 VAL VAL B . n 
B 1 42 PHE 42 42 42 PHE PHE B . n 
B 1 43 GLN 43 43 43 GLN GLN B . n 
B 1 44 THR 44 44 44 THR THR B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 ARG 46 46 46 ARG ARG B . n 
B 1 47 SER 47 47 47 SER SER B . n 
B 1 48 LYS 48 48 48 LYS LYS B . n 
B 1 49 GLN 49 49 49 GLN GLN B . n 
B 1 50 VAL 50 50 50 VAL VAL B . n 
B 1 51 CYS 51 51 51 CYS CYS B . n 
B 1 52 ALA 52 52 52 ALA ALA B . n 
B 1 53 ASP 53 53 53 ASP ASP B . n 
B 1 54 PRO 54 54 54 PRO PRO B . n 
B 1 55 SER 55 55 55 SER SER B . n 
B 1 56 GLU 56 56 56 GLU GLU B . n 
B 1 57 SER 57 57 57 SER SER B . n 
B 1 58 TRP 58 58 58 TRP TRP B . n 
B 1 59 VAL 59 59 59 VAL VAL B . n 
B 1 60 GLN 60 60 60 GLN GLN B . n 
B 1 61 GLU 61 61 61 GLU GLU B . n 
B 1 62 TYR 62 62 62 TYR TYR B . n 
B 1 63 VAL 63 63 63 VAL VAL B . n 
B 1 64 TYR 64 64 64 TYR TYR B . n 
B 1 65 ASP 65 65 65 ASP ASP B . n 
B 1 66 LEU 66 66 66 LEU LEU B . n 
B 1 67 GLU 67 67 67 GLU GLU B . n 
B 1 68 LEU 68 68 68 LEU LEU B . n 
B 1 69 ASN 69 69 69 ASN ASN B . n 
C 1 1  ALA 1  1  ?  ?   ?   C . n 
C 1 2  PRO 2  2  ?  ?   ?   C . n 
C 1 3  MET 3  3  ?  ?   ?   C . n 
C 1 4  GLY 4  4  4  GLY GLY C . n 
C 1 5  SER 5  5  5  SER SER C . n 
C 1 6  ASP 6  6  6  ASP ASP C . n 
C 1 7  PRO 7  7  7  PRO PRO C . n 
C 1 8  PRO 8  8  8  PRO PRO C . n 
C 1 9  THR 9  9  9  THR THR C . n 
C 1 10 ALA 10 10 10 ALA ALA C . n 
C 1 11 CYS 11 11 11 CYS CYS C . n 
C 1 12 CYS 12 12 12 CYS CYS C . n 
C 1 13 PHE 13 13 13 PHE PHE C . n 
C 1 14 SER 14 14 14 SER SER C . n 
C 1 15 TYR 15 15 15 TYR TYR C . n 
C 1 16 THR 16 16 16 THR THR C . n 
C 1 17 ALA 17 17 17 ALA ALA C . n 
C 1 18 ARG 18 18 18 ARG ARG C . n 
C 1 19 LYS 19 19 19 LYS LYS C . n 
C 1 20 LEU 20 20 20 LEU LEU C . n 
C 1 21 PRO 21 21 21 PRO PRO C . n 
C 1 22 ARG 22 22 22 ARG ARG C . n 
C 1 23 ASN 23 23 23 ASN ASN C . n 
C 1 24 PHE 24 24 24 PHE PHE C . n 
C 1 25 VAL 25 25 25 VAL VAL C . n 
C 1 26 VAL 26 26 26 VAL VAL C . n 
C 1 27 ASP 27 27 27 ASP ASP C . n 
C 1 28 TYR 28 28 28 TYR TYR C . n 
C 1 29 TYR 29 29 29 TYR TYR C . n 
C 1 30 GLU 30 30 30 GLU GLU C . n 
C 1 31 THR 31 31 31 THR THR C . n 
C 1 32 SER 32 32 32 SER SER C . n 
C 1 33 SER 33 33 33 SER SER C . n 
C 1 34 LEU 34 34 34 LEU LEU C . n 
C 1 35 CYS 35 35 35 CYS CYS C . n 
C 1 36 SER 36 36 36 SER SER C . n 
C 1 37 GLN 37 37 37 GLN GLN C . n 
C 1 38 PRO 38 38 38 PRO PRO C . n 
C 1 39 ALA 39 39 39 ALA ALA C . n 
C 1 40 VAL 40 40 40 VAL VAL C . n 
C 1 41 VAL 41 41 41 VAL VAL C . n 
C 1 42 PHE 42 42 42 PHE PHE C . n 
C 1 43 GLN 43 43 43 GLN GLN C . n 
C 1 44 THR 44 44 44 THR THR C . n 
C 1 45 LYS 45 45 45 LYS LYS C . n 
C 1 46 ARG 46 46 46 ARG ARG C . n 
C 1 47 SER 47 47 47 SER SER C . n 
C 1 48 LYS 48 48 48 LYS LYS C . n 
C 1 49 GLN 49 49 49 GLN GLN C . n 
C 1 50 VAL 50 50 50 VAL VAL C . n 
C 1 51 CYS 51 51 51 CYS CYS C . n 
C 1 52 ALA 52 52 52 ALA ALA C . n 
C 1 53 ASP 53 53 53 ASP ASP C . n 
C 1 54 PRO 54 54 54 PRO PRO C . n 
C 1 55 SER 55 55 55 SER SER C . n 
C 1 56 GLU 56 56 56 GLU GLU C . n 
C 1 57 SER 57 57 57 SER SER C . n 
C 1 58 TRP 58 58 58 TRP TRP C . n 
C 1 59 VAL 59 59 59 VAL VAL C . n 
C 1 60 GLN 60 60 60 GLN GLN C . n 
C 1 61 GLU 61 61 61 GLU GLU C . n 
C 1 62 TYR 62 62 62 TYR TYR C . n 
C 1 63 VAL 63 63 63 VAL VAL C . n 
C 1 64 TYR 64 64 64 TYR TYR C . n 
C 1 65 ASP 65 65 65 ASP ASP C . n 
C 1 66 LEU 66 66 66 LEU LEU C . n 
C 1 67 GLU 67 67 67 GLU GLU C . n 
C 1 68 LEU 68 68 68 LEU LEU C . n 
C 1 69 ASN 69 69 69 ASN ASN C . n 
D 1 1  ALA 1  1  ?  ?   ?   D . n 
D 1 2  PRO 2  2  ?  ?   ?   D . n 
D 1 3  MET 3  3  ?  ?   ?   D . n 
D 1 4  GLY 4  4  ?  ?   ?   D . n 
D 1 5  SER 5  5  5  SER SER D . n 
D 1 6  ASP 6  6  6  ASP ASP D . n 
D 1 7  PRO 7  7  7  PRO PRO D . n 
D 1 8  PRO 8  8  8  PRO PRO D . n 
D 1 9  THR 9  9  9  THR THR D . n 
D 1 10 ALA 10 10 10 ALA ALA D . n 
D 1 11 CYS 11 11 11 CYS CYS D . n 
D 1 12 CYS 12 12 12 CYS CYS D . n 
D 1 13 PHE 13 13 13 PHE PHE D . n 
D 1 14 SER 14 14 14 SER SER D . n 
D 1 15 TYR 15 15 15 TYR TYR D . n 
D 1 16 THR 16 16 16 THR THR D . n 
D 1 17 ALA 17 17 17 ALA ALA D . n 
D 1 18 ARG 18 18 18 ARG ARG D . n 
D 1 19 LYS 19 19 19 LYS LYS D . n 
D 1 20 LEU 20 20 20 LEU LEU D . n 
D 1 21 PRO 21 21 21 PRO PRO D . n 
D 1 22 ARG 22 22 22 ARG ARG D . n 
D 1 23 ASN 23 23 23 ASN ASN D . n 
D 1 24 PHE 24 24 24 PHE PHE D . n 
D 1 25 VAL 25 25 25 VAL VAL D . n 
D 1 26 VAL 26 26 26 VAL VAL D . n 
D 1 27 ASP 27 27 27 ASP ASP D . n 
D 1 28 TYR 28 28 28 TYR TYR D . n 
D 1 29 TYR 29 29 29 TYR TYR D . n 
D 1 30 GLU 30 30 30 GLU GLU D . n 
D 1 31 THR 31 31 31 THR THR D . n 
D 1 32 SER 32 32 32 SER SER D . n 
D 1 33 SER 33 33 33 SER SER D . n 
D 1 34 LEU 34 34 34 LEU LEU D . n 
D 1 35 CYS 35 35 35 CYS CYS D . n 
D 1 36 SER 36 36 36 SER SER D . n 
D 1 37 GLN 37 37 37 GLN GLN D . n 
D 1 38 PRO 38 38 38 PRO PRO D . n 
D 1 39 ALA 39 39 39 ALA ALA D . n 
D 1 40 VAL 40 40 40 VAL VAL D . n 
D 1 41 VAL 41 41 41 VAL VAL D . n 
D 1 42 PHE 42 42 42 PHE PHE D . n 
D 1 43 GLN 43 43 43 GLN GLN D . n 
D 1 44 THR 44 44 44 THR THR D . n 
D 1 45 LYS 45 45 45 LYS LYS D . n 
D 1 46 ARG 46 46 46 ARG ARG D . n 
D 1 47 SER 47 47 47 SER SER D . n 
D 1 48 LYS 48 48 48 LYS LYS D . n 
D 1 49 GLN 49 49 49 GLN GLN D . n 
D 1 50 VAL 50 50 50 VAL VAL D . n 
D 1 51 CYS 51 51 51 CYS CYS D . n 
D 1 52 ALA 52 52 52 ALA ALA D . n 
D 1 53 ASP 53 53 53 ASP ASP D . n 
D 1 54 PRO 54 54 54 PRO PRO D . n 
D 1 55 SER 55 55 55 SER SER D . n 
D 1 56 GLU 56 56 56 GLU GLU D . n 
D 1 57 SER 57 57 57 SER SER D . n 
D 1 58 TRP 58 58 58 TRP TRP D . n 
D 1 59 VAL 59 59 59 VAL VAL D . n 
D 1 60 GLN 60 60 60 GLN GLN D . n 
D 1 61 GLU 61 61 61 GLU GLU D . n 
D 1 62 TYR 62 62 62 TYR TYR D . n 
D 1 63 VAL 63 63 63 VAL VAL D . n 
D 1 64 TYR 64 64 64 TYR TYR D . n 
D 1 65 ASP 65 65 65 ASP ASP D . n 
D 1 66 LEU 66 66 66 LEU LEU D . n 
D 1 67 GLU 67 67 67 GLU GLU D . n 
D 1 68 LEU 68 68 68 LEU LEU D . n 
D 1 69 ASN 69 69 69 ASN ASN D . n 
E 1 1  ALA 1  1  ?  ?   ?   E . n 
E 1 2  PRO 2  2  ?  ?   ?   E . n 
E 1 3  MET 3  3  ?  ?   ?   E . n 
E 1 4  GLY 4  4  4  GLY GLY E . n 
E 1 5  SER 5  5  5  SER SER E . n 
E 1 6  ASP 6  6  6  ASP ASP E . n 
E 1 7  PRO 7  7  7  PRO PRO E . n 
E 1 8  PRO 8  8  8  PRO PRO E . n 
E 1 9  THR 9  9  9  THR THR E . n 
E 1 10 ALA 10 10 10 ALA ALA E . n 
E 1 11 CYS 11 11 11 CYS CYS E . n 
E 1 12 CYS 12 12 12 CYS CYS E . n 
E 1 13 PHE 13 13 13 PHE PHE E . n 
E 1 14 SER 14 14 14 SER SER E . n 
E 1 15 TYR 15 15 15 TYR TYR E . n 
E 1 16 THR 16 16 16 THR THR E . n 
E 1 17 ALA 17 17 17 ALA ALA E . n 
E 1 18 ARG 18 18 18 ARG ARG E . n 
E 1 19 LYS 19 19 19 LYS LYS E . n 
E 1 20 LEU 20 20 20 LEU LEU E . n 
E 1 21 PRO 21 21 21 PRO PRO E . n 
E 1 22 ARG 22 22 22 ARG ARG E . n 
E 1 23 ASN 23 23 23 ASN ASN E . n 
E 1 24 PHE 24 24 24 PHE PHE E . n 
E 1 25 VAL 25 25 25 VAL VAL E . n 
E 1 26 VAL 26 26 26 VAL VAL E . n 
E 1 27 ASP 27 27 27 ASP ASP E . n 
E 1 28 TYR 28 28 28 TYR TYR E . n 
E 1 29 TYR 29 29 29 TYR TYR E . n 
E 1 30 GLU 30 30 30 GLU GLU E . n 
E 1 31 THR 31 31 31 THR THR E . n 
E 1 32 SER 32 32 32 SER SER E . n 
E 1 33 SER 33 33 33 SER SER E . n 
E 1 34 LEU 34 34 34 LEU LEU E . n 
E 1 35 CYS 35 35 35 CYS CYS E . n 
E 1 36 SER 36 36 36 SER SER E . n 
E 1 37 GLN 37 37 37 GLN GLN E . n 
E 1 38 PRO 38 38 38 PRO PRO E . n 
E 1 39 ALA 39 39 39 ALA ALA E . n 
E 1 40 VAL 40 40 40 VAL VAL E . n 
E 1 41 VAL 41 41 41 VAL VAL E . n 
E 1 42 PHE 42 42 42 PHE PHE E . n 
E 1 43 GLN 43 43 43 GLN GLN E . n 
E 1 44 THR 44 44 44 THR THR E . n 
E 1 45 LYS 45 45 45 LYS LYS E . n 
E 1 46 ARG 46 46 46 ARG ARG E . n 
E 1 47 SER 47 47 47 SER SER E . n 
E 1 48 LYS 48 48 48 LYS LYS E . n 
E 1 49 GLN 49 49 49 GLN GLN E . n 
E 1 50 VAL 50 50 50 VAL VAL E . n 
E 1 51 CYS 51 51 51 CYS CYS E . n 
E 1 52 ALA 52 52 52 ALA ALA E . n 
E 1 53 ASP 53 53 53 ASP ASP E . n 
E 1 54 PRO 54 54 54 PRO PRO E . n 
E 1 55 SER 55 55 55 SER SER E . n 
E 1 56 GLU 56 56 56 GLU GLU E . n 
E 1 57 SER 57 57 57 SER SER E . n 
E 1 58 TRP 58 58 58 TRP TRP E . n 
E 1 59 VAL 59 59 59 VAL VAL E . n 
E 1 60 GLN 60 60 60 GLN GLN E . n 
E 1 61 GLU 61 61 61 GLU GLU E . n 
E 1 62 TYR 62 62 62 TYR TYR E . n 
E 1 63 VAL 63 63 63 VAL VAL E . n 
E 1 64 TYR 64 64 64 TYR TYR E . n 
E 1 65 ASP 65 65 65 ASP ASP E . n 
E 1 66 LEU 66 66 66 LEU LEU E . n 
E 1 67 GLU 67 67 67 GLU GLU E . n 
E 1 68 LEU 68 68 68 LEU LEU E . n 
E 1 69 ASN 69 69 69 ASN ASN E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 2 GOL 1  1070 1070 GOL GOL B . 
G 2 GOL 1  1070 1070 GOL GOL C . 
H 2 GOL 1  1070 1070 GOL GOL D . 
I 3 HOH 1  2001 2001 HOH HOH A . 
I 3 HOH 2  2002 2002 HOH HOH A . 
I 3 HOH 3  2003 2003 HOH HOH A . 
I 3 HOH 4  2004 2004 HOH HOH A . 
I 3 HOH 5  2005 2005 HOH HOH A . 
I 3 HOH 6  2006 2006 HOH HOH A . 
I 3 HOH 7  2007 2007 HOH HOH A . 
I 3 HOH 8  2008 2008 HOH HOH A . 
I 3 HOH 9  2009 2009 HOH HOH A . 
I 3 HOH 10 2010 2010 HOH HOH A . 
I 3 HOH 11 2011 2011 HOH HOH A . 
I 3 HOH 12 2012 2012 HOH HOH A . 
I 3 HOH 13 2013 2013 HOH HOH A . 
I 3 HOH 14 2014 2014 HOH HOH A . 
I 3 HOH 15 2015 2015 HOH HOH A . 
I 3 HOH 16 2016 2016 HOH HOH A . 
I 3 HOH 17 2017 2017 HOH HOH A . 
I 3 HOH 18 2018 2018 HOH HOH A . 
I 3 HOH 19 2019 2019 HOH HOH A . 
I 3 HOH 20 2020 2020 HOH HOH A . 
I 3 HOH 21 2021 2021 HOH HOH A . 
I 3 HOH 22 2022 2022 HOH HOH A . 
I 3 HOH 23 2023 2023 HOH HOH A . 
I 3 HOH 24 2024 2024 HOH HOH A . 
I 3 HOH 25 2025 2025 HOH HOH A . 
I 3 HOH 26 2026 2026 HOH HOH A . 
I 3 HOH 27 2027 2027 HOH HOH A . 
I 3 HOH 28 2028 2028 HOH HOH A . 
I 3 HOH 29 2029 2029 HOH HOH A . 
I 3 HOH 30 2030 2030 HOH HOH A . 
I 3 HOH 31 2031 2031 HOH HOH A . 
I 3 HOH 32 2032 2032 HOH HOH A . 
I 3 HOH 33 2033 2033 HOH HOH A . 
I 3 HOH 34 2034 2034 HOH HOH A . 
J 3 HOH 1  2001 2001 HOH HOH B . 
J 3 HOH 2  2002 2002 HOH HOH B . 
J 3 HOH 3  2003 2003 HOH HOH B . 
J 3 HOH 4  2004 2004 HOH HOH B . 
J 3 HOH 5  2005 2005 HOH HOH B . 
J 3 HOH 6  2006 2006 HOH HOH B . 
J 3 HOH 7  2007 2007 HOH HOH B . 
J 3 HOH 8  2008 2008 HOH HOH B . 
J 3 HOH 9  2009 2009 HOH HOH B . 
J 3 HOH 10 2010 2010 HOH HOH B . 
J 3 HOH 11 2011 2011 HOH HOH B . 
J 3 HOH 12 2012 2012 HOH HOH B . 
J 3 HOH 13 2013 2013 HOH HOH B . 
J 3 HOH 14 2014 2014 HOH HOH B . 
J 3 HOH 15 2015 2015 HOH HOH B . 
J 3 HOH 16 2016 2016 HOH HOH B . 
J 3 HOH 17 2017 2017 HOH HOH B . 
J 3 HOH 18 2018 2018 HOH HOH B . 
J 3 HOH 19 2019 2019 HOH HOH B . 
J 3 HOH 20 2020 2020 HOH HOH B . 
J 3 HOH 21 2021 2021 HOH HOH B . 
J 3 HOH 22 2022 2022 HOH HOH B . 
J 3 HOH 23 2023 2023 HOH HOH B . 
J 3 HOH 24 2024 2024 HOH HOH B . 
J 3 HOH 25 2025 2025 HOH HOH B . 
J 3 HOH 26 2026 2026 HOH HOH B . 
J 3 HOH 27 2027 2027 HOH HOH B . 
J 3 HOH 28 2028 2028 HOH HOH B . 
J 3 HOH 29 2029 2029 HOH HOH B . 
J 3 HOH 30 2030 2030 HOH HOH B . 
J 3 HOH 31 2031 2031 HOH HOH B . 
K 3 HOH 1  2001 2001 HOH HOH C . 
K 3 HOH 2  2002 2002 HOH HOH C . 
K 3 HOH 3  2003 2003 HOH HOH C . 
K 3 HOH 4  2004 2004 HOH HOH C . 
K 3 HOH 5  2005 2005 HOH HOH C . 
K 3 HOH 6  2006 2006 HOH HOH C . 
K 3 HOH 7  2007 2007 HOH HOH C . 
K 3 HOH 8  2008 2008 HOH HOH C . 
K 3 HOH 9  2009 2009 HOH HOH C . 
K 3 HOH 10 2010 2010 HOH HOH C . 
K 3 HOH 11 2011 2011 HOH HOH C . 
K 3 HOH 12 2012 2012 HOH HOH C . 
K 3 HOH 13 2013 2013 HOH HOH C . 
K 3 HOH 14 2014 2014 HOH HOH C . 
K 3 HOH 15 2015 2015 HOH HOH C . 
K 3 HOH 16 2016 2016 HOH HOH C . 
K 3 HOH 17 2017 2017 HOH HOH C . 
K 3 HOH 18 2018 2018 HOH HOH C . 
K 3 HOH 19 2019 2019 HOH HOH C . 
K 3 HOH 20 2020 2020 HOH HOH C . 
K 3 HOH 21 2021 2021 HOH HOH C . 
K 3 HOH 22 2022 2022 HOH HOH C . 
K 3 HOH 23 2023 2023 HOH HOH C . 
K 3 HOH 24 2024 2024 HOH HOH C . 
K 3 HOH 25 2025 2025 HOH HOH C . 
K 3 HOH 26 2026 2026 HOH HOH C . 
K 3 HOH 27 2027 2027 HOH HOH C . 
K 3 HOH 28 2028 2028 HOH HOH C . 
K 3 HOH 29 2029 2029 HOH HOH C . 
K 3 HOH 30 2030 2030 HOH HOH C . 
K 3 HOH 31 2031 2031 HOH HOH C . 
K 3 HOH 32 2032 2032 HOH HOH C . 
L 3 HOH 1  2001 2001 HOH HOH D . 
L 3 HOH 2  2002 2002 HOH HOH D . 
L 3 HOH 3  2003 2003 HOH HOH D . 
L 3 HOH 4  2004 2004 HOH HOH D . 
L 3 HOH 5  2005 2005 HOH HOH D . 
L 3 HOH 6  2006 2006 HOH HOH D . 
L 3 HOH 7  2007 2007 HOH HOH D . 
L 3 HOH 8  2008 2008 HOH HOH D . 
L 3 HOH 9  2009 2009 HOH HOH D . 
L 3 HOH 10 2010 2010 HOH HOH D . 
L 3 HOH 11 2011 2011 HOH HOH D . 
L 3 HOH 12 2012 2012 HOH HOH D . 
L 3 HOH 13 2013 2013 HOH HOH D . 
L 3 HOH 14 2014 2014 HOH HOH D . 
L 3 HOH 15 2015 2015 HOH HOH D . 
L 3 HOH 16 2016 2016 HOH HOH D . 
L 3 HOH 17 2017 2017 HOH HOH D . 
L 3 HOH 18 2018 2018 HOH HOH D . 
L 3 HOH 19 2019 2019 HOH HOH D . 
L 3 HOH 20 2020 2020 HOH HOH D . 
L 3 HOH 21 2021 2021 HOH HOH D . 
L 3 HOH 22 2022 2022 HOH HOH D . 
L 3 HOH 23 2023 2023 HOH HOH D . 
M 3 HOH 1  2001 2001 HOH HOH E . 
M 3 HOH 2  2002 2002 HOH HOH E . 
M 3 HOH 3  2003 2003 HOH HOH E . 
M 3 HOH 4  2004 2004 HOH HOH E . 
M 3 HOH 5  2005 2005 HOH HOH E . 
M 3 HOH 6  2006 2006 HOH HOH E . 
M 3 HOH 7  2007 2007 HOH HOH E . 
M 3 HOH 8  2008 2008 HOH HOH E . 
M 3 HOH 9  2009 2009 HOH HOH E . 
M 3 HOH 10 2010 2010 HOH HOH E . 
M 3 HOH 11 2011 2011 HOH HOH E . 
M 3 HOH 12 2012 2012 HOH HOH E . 
M 3 HOH 13 2013 2013 HOH HOH E . 
M 3 HOH 14 2014 2014 HOH HOH E . 
M 3 HOH 15 2015 2015 HOH HOH E . 
M 3 HOH 16 2016 2016 HOH HOH E . 
M 3 HOH 17 2017 2017 HOH HOH E . 
M 3 HOH 18 2018 2018 HOH HOH E . 
M 3 HOH 19 2019 2019 HOH HOH E . 
M 3 HOH 20 2020 2020 HOH HOH E . 
M 3 HOH 21 2021 2021 HOH HOH E . 
M 3 HOH 22 2022 2022 HOH HOH E . 
M 3 HOH 23 2023 2023 HOH HOH E . 
M 3 HOH 24 2024 2024 HOH HOH E . 
M 3 HOH 25 2025 2025 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA decameric 10 
2 author_and_software_defined_assembly PISA dimeric   2  
3 author_and_software_defined_assembly PISA dimeric   2  
4 author_and_software_defined_assembly PISA dimeric   2  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C,D,E,F,G,H,I,J,K,L,M 
2 1   C,E,G,K,M                 
3 1   B,D,F,H,J,L               
4 1,2 A,I                       
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 18030 ? 
1 MORE         -70.9 ? 
1 'SSA (A^2)'  31060 ? 
2 'ABSA (A^2)' 1520  ? 
2 MORE         -11.4 ? 
2 'SSA (A^2)'  8310  ? 
3 'ABSA (A^2)' 1490  ? 
3 MORE         -10.1 ? 
3 'SSA (A^2)'  8150  ? 
4 'ABSA (A^2)' 1590  ? 
4 MORE         -11.5 ? 
4 'SSA (A^2)'  8560  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2011 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-03 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             PHENIX 
_software.classification   refinement 
_software.version          '(PHENIX.REFINE)' 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 5  ? ? -127.04 -105.08 
2 1 VAL A 26 ? ? -140.27 -11.50  
3 1 SER A 47 ? ? 81.08   21.21   
4 1 SER B 32 ? ? -42.35  157.59  
5 1 SER C 5  ? ? -109.15 -94.38  
6 1 SER E 32 ? ? -38.22  140.22  
7 1 LEU E 68 ? ? -108.46 62.37   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1 ? A ALA 1 
2  1 Y 1 A PRO 2 ? A PRO 2 
3  1 Y 1 A MET 3 ? A MET 3 
4  1 Y 1 B ALA 1 ? B ALA 1 
5  1 Y 1 B PRO 2 ? B PRO 2 
6  1 Y 1 B MET 3 ? B MET 3 
7  1 Y 1 B GLY 4 ? B GLY 4 
8  1 Y 1 C ALA 1 ? C ALA 1 
9  1 Y 1 C PRO 2 ? C PRO 2 
10 1 Y 1 C MET 3 ? C MET 3 
11 1 Y 1 D ALA 1 ? D ALA 1 
12 1 Y 1 D PRO 2 ? D PRO 2 
13 1 Y 1 D MET 3 ? D MET 3 
14 1 Y 1 D GLY 4 ? D GLY 4 
15 1 Y 1 E ALA 1 ? E ALA 1 
16 1 Y 1 E PRO 2 ? E PRO 2 
17 1 Y 1 E MET 3 ? E MET 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
#