data_2XCV
# 
_entry.id   2XCV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XCV         
PDBE  EBI-43609    
WWPDB D_1290043609 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JC9 unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH ADENOSINE
;
PDB 2XJD unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II IN COMPLEX WITH INORGANIC PHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2XJF unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II WITH A COVALENTLY MODIFIED ASN52
;
PDB 2J2C unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'-NUCLEOTIDASE II (NT5C2, CN-II)
;
PDB 2JCM unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH BERYLLIUM TRIFLUORIDE
;
PDB 2XCX unspecified 
;CRYSTAL STRUCTURE OF THE APOFORM OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II
;
PDB 2XJE unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II IN COMPLEX WITH URIDINE 5'- MONOPHOSPHATE AND ADENOSINE TRIPHOSPHATE
;
PDB 2XCW unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND ATP
;
PDB 2XJB unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II IN COMPLEX WITH DEOXYGUANOSINE MONOPHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2XJC unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II IN COMPLEX WITH GUANOSINE MONOPHOSPHATE AND DIADENOSINE TETRAPHOSPHATE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XCV 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wallden, K.'  1 
'Nordlund, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                684 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21396942 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2011.02.059 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wallden, K.'  1 
primary 'Nordlund, P.' 2 
# 
_cell.entry_id           2XCV 
_cell.length_a           91.570 
_cell.length_b           127.790 
_cell.length_c           130.610 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XCV 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE
;
63956.750 1   3.1.3.5 YES ? ? 
2 non-polymer syn '(2R)-2,3-diphosphoglyceric acid'  266.037   1   ?       ?   ? ? 
3 non-polymer syn GLYCEROL                           92.094    1   ?       ?   ? ? 
4 non-polymer syn 'INOSINIC ACID'                    348.206   1   ?       ?   ? ? 
5 non-polymer syn 'MAGNESIUM ION'                    24.305    1   ?       ?   ? ? 
6 water       nat water                              18.015    258 ?       ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CYTOSOLIC 5'-NUCLEOTIDASE II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  MET n 
1 20  SER n 
1 21  THR n 
1 22  SER n 
1 23  TRP n 
1 24  SER n 
1 25  ASP n 
1 26  ARG n 
1 27  LEU n 
1 28  GLN n 
1 29  ASN n 
1 30  ALA n 
1 31  ALA n 
1 32  ASP n 
1 33  MET n 
1 34  PRO n 
1 35  ALA n 
1 36  ASN n 
1 37  MET n 
1 38  ASP n 
1 39  LYS n 
1 40  HIS n 
1 41  ALA n 
1 42  LEU n 
1 43  LYS n 
1 44  LYS n 
1 45  TYR n 
1 46  ARG n 
1 47  ARG n 
1 48  GLU n 
1 49  ALA n 
1 50  TYR n 
1 51  HIS n 
1 52  ARG n 
1 53  VAL n 
1 54  PHE n 
1 55  VAL n 
1 56  ASN n 
1 57  ARG n 
1 58  SER n 
1 59  LEU n 
1 60  ALA n 
1 61  MET n 
1 62  GLU n 
1 63  LYS n 
1 64  ILE n 
1 65  LYS n 
1 66  CYS n 
1 67  PHE n 
1 68  GLY n 
1 69  PHE n 
1 70  ASN n 
1 71  MET n 
1 72  ASP n 
1 73  TYR n 
1 74  THR n 
1 75  LEU n 
1 76  ALA n 
1 77  VAL n 
1 78  TYR n 
1 79  LYS n 
1 80  SER n 
1 81  PRO n 
1 82  GLU n 
1 83  TYR n 
1 84  GLU n 
1 85  SER n 
1 86  LEU n 
1 87  GLY n 
1 88  PHE n 
1 89  GLU n 
1 90  LEU n 
1 91  THR n 
1 92  VAL n 
1 93  GLU n 
1 94  ARG n 
1 95  LEU n 
1 96  VAL n 
1 97  SER n 
1 98  ILE n 
1 99  GLY n 
1 100 TYR n 
1 101 PRO n 
1 102 GLN n 
1 103 GLU n 
1 104 LEU n 
1 105 LEU n 
1 106 SER n 
1 107 PHE n 
1 108 ALA n 
1 109 TYR n 
1 110 ASP n 
1 111 SER n 
1 112 THR n 
1 113 PHE n 
1 114 PRO n 
1 115 THR n 
1 116 ARG n 
1 117 GLY n 
1 118 LEU n 
1 119 VAL n 
1 120 PHE n 
1 121 ASP n 
1 122 THR n 
1 123 LEU n 
1 124 TYR n 
1 125 GLY n 
1 126 ASN n 
1 127 LEU n 
1 128 LEU n 
1 129 LYS n 
1 130 VAL n 
1 131 ASP n 
1 132 ALA n 
1 133 TYR n 
1 134 GLY n 
1 135 ASN n 
1 136 LEU n 
1 137 LEU n 
1 138 VAL n 
1 139 CYS n 
1 140 ALA n 
1 141 HIS n 
1 142 GLY n 
1 143 PHE n 
1 144 ASN n 
1 145 PHE n 
1 146 ILE n 
1 147 ARG n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 THR n 
1 152 ARG n 
1 153 GLU n 
1 154 GLN n 
1 155 TYR n 
1 156 PRO n 
1 157 ASN n 
1 158 LYS n 
1 159 PHE n 
1 160 ILE n 
1 161 GLN n 
1 162 ARG n 
1 163 ASP n 
1 164 ASP n 
1 165 THR n 
1 166 GLU n 
1 167 ARG n 
1 168 PHE n 
1 169 TYR n 
1 170 ILE n 
1 171 LEU n 
1 172 ASN n 
1 173 THR n 
1 174 LEU n 
1 175 PHE n 
1 176 ASN n 
1 177 LEU n 
1 178 PRO n 
1 179 GLU n 
1 180 THR n 
1 181 TYR n 
1 182 LEU n 
1 183 LEU n 
1 184 ALA n 
1 185 CYS n 
1 186 LEU n 
1 187 VAL n 
1 188 ASP n 
1 189 PHE n 
1 190 PHE n 
1 191 THR n 
1 192 ASN n 
1 193 CYS n 
1 194 PRO n 
1 195 ARG n 
1 196 TYR n 
1 197 THR n 
1 198 SER n 
1 199 CYS n 
1 200 GLU n 
1 201 THR n 
1 202 GLY n 
1 203 PHE n 
1 204 LYS n 
1 205 ASP n 
1 206 GLY n 
1 207 ASP n 
1 208 LEU n 
1 209 PHE n 
1 210 MET n 
1 211 SER n 
1 212 TYR n 
1 213 ARG n 
1 214 SER n 
1 215 MET n 
1 216 PHE n 
1 217 GLN n 
1 218 ASP n 
1 219 VAL n 
1 220 ARG n 
1 221 ASP n 
1 222 ALA n 
1 223 VAL n 
1 224 ASP n 
1 225 TRP n 
1 226 VAL n 
1 227 HIS n 
1 228 TYR n 
1 229 LYS n 
1 230 GLY n 
1 231 SER n 
1 232 LEU n 
1 233 LYS n 
1 234 GLU n 
1 235 LYS n 
1 236 THR n 
1 237 VAL n 
1 238 GLU n 
1 239 ASN n 
1 240 LEU n 
1 241 GLU n 
1 242 LYS n 
1 243 TYR n 
1 244 VAL n 
1 245 VAL n 
1 246 LYS n 
1 247 ASP n 
1 248 GLY n 
1 249 LYS n 
1 250 LEU n 
1 251 PRO n 
1 252 LEU n 
1 253 LEU n 
1 254 LEU n 
1 255 SER n 
1 256 ARG n 
1 257 MET n 
1 258 LYS n 
1 259 GLU n 
1 260 VAL n 
1 261 GLY n 
1 262 LYS n 
1 263 VAL n 
1 264 PHE n 
1 265 LEU n 
1 266 ALA n 
1 267 THR n 
1 268 ASN n 
1 269 SER n 
1 270 ASP n 
1 271 TYR n 
1 272 LYS n 
1 273 TYR n 
1 274 THR n 
1 275 ASP n 
1 276 LYS n 
1 277 ILE n 
1 278 MET n 
1 279 THR n 
1 280 TYR n 
1 281 LEU n 
1 282 PHE n 
1 283 ASP n 
1 284 PHE n 
1 285 PRO n 
1 286 HIS n 
1 287 GLY n 
1 288 PRO n 
1 289 LYS n 
1 290 PRO n 
1 291 GLY n 
1 292 SER n 
1 293 SER n 
1 294 HIS n 
1 295 ARG n 
1 296 PRO n 
1 297 TRP n 
1 298 GLN n 
1 299 SER n 
1 300 TYR n 
1 301 PHE n 
1 302 ASP n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 VAL n 
1 307 ASP n 
1 308 ALA n 
1 309 ARG n 
1 310 LYS n 
1 311 PRO n 
1 312 LEU n 
1 313 PHE n 
1 314 PHE n 
1 315 GLY n 
1 316 GLU n 
1 317 GLY n 
1 318 THR n 
1 319 VAL n 
1 320 LEU n 
1 321 ARG n 
1 322 GLN n 
1 323 VAL n 
1 324 ASP n 
1 325 THR n 
1 326 LYS n 
1 327 THR n 
1 328 GLY n 
1 329 LYS n 
1 330 LEU n 
1 331 LYS n 
1 332 ILE n 
1 333 GLY n 
1 334 THR n 
1 335 TYR n 
1 336 THR n 
1 337 GLY n 
1 338 PRO n 
1 339 LEU n 
1 340 GLN n 
1 341 HIS n 
1 342 GLY n 
1 343 ILE n 
1 344 VAL n 
1 345 TYR n 
1 346 SER n 
1 347 GLY n 
1 348 GLY n 
1 349 SER n 
1 350 SER n 
1 351 ASP n 
1 352 THR n 
1 353 ILE n 
1 354 CYS n 
1 355 ASP n 
1 356 LEU n 
1 357 LEU n 
1 358 GLY n 
1 359 ALA n 
1 360 LYS n 
1 361 GLY n 
1 362 LYS n 
1 363 ASP n 
1 364 ILE n 
1 365 LEU n 
1 366 TYR n 
1 367 ILE n 
1 368 GLY n 
1 369 ASP n 
1 370 HIS n 
1 371 ILE n 
1 372 PHE n 
1 373 GLY n 
1 374 ASP n 
1 375 ILE n 
1 376 LEU n 
1 377 LYS n 
1 378 SER n 
1 379 LYS n 
1 380 LYS n 
1 381 ARG n 
1 382 GLN n 
1 383 GLY n 
1 384 TRP n 
1 385 ARG n 
1 386 THR n 
1 387 PHE n 
1 388 LEU n 
1 389 VAL n 
1 390 ILE n 
1 391 PRO n 
1 392 GLU n 
1 393 LEU n 
1 394 ALA n 
1 395 GLN n 
1 396 GLU n 
1 397 LEU n 
1 398 HIS n 
1 399 VAL n 
1 400 TRP n 
1 401 THR n 
1 402 ASP n 
1 403 LYS n 
1 404 SER n 
1 405 SER n 
1 406 LEU n 
1 407 PHE n 
1 408 GLU n 
1 409 GLU n 
1 410 LEU n 
1 411 GLN n 
1 412 SER n 
1 413 LEU n 
1 414 ASP n 
1 415 ILE n 
1 416 PHE n 
1 417 LEU n 
1 418 ALA n 
1 419 GLU n 
1 420 LEU n 
1 421 TYR n 
1 422 LYS n 
1 423 HIS n 
1 424 LEU n 
1 425 ASP n 
1 426 SER n 
1 427 SER n 
1 428 SER n 
1 429 ASN n 
1 430 GLU n 
1 431 ARG n 
1 432 PRO n 
1 433 ASP n 
1 434 ILE n 
1 435 SER n 
1 436 SER n 
1 437 ILE n 
1 438 GLN n 
1 439 ARG n 
1 440 ARG n 
1 441 ILE n 
1 442 LYS n 
1 443 LYS n 
1 444 VAL n 
1 445 THR n 
1 446 HIS n 
1 447 ASP n 
1 448 MET n 
1 449 ASP n 
1 450 MET n 
1 451 CYS n 
1 452 TYR n 
1 453 GLY n 
1 454 MET n 
1 455 MET n 
1 456 GLY n 
1 457 SER n 
1 458 LEU n 
1 459 PHE n 
1 460 ARG n 
1 461 SER n 
1 462 GLY n 
1 463 SER n 
1 464 ARG n 
1 465 GLN n 
1 466 THR n 
1 467 LEU n 
1 468 PHE n 
1 469 ALA n 
1 470 SER n 
1 471 GLN n 
1 472 VAL n 
1 473 MET n 
1 474 ARG n 
1 475 TYR n 
1 476 ALA n 
1 477 ASP n 
1 478 LEU n 
1 479 TYR n 
1 480 ALA n 
1 481 ALA n 
1 482 SER n 
1 483 PHE n 
1 484 ILE n 
1 485 ASN n 
1 486 LEU n 
1 487 LEU n 
1 488 TYR n 
1 489 TYR n 
1 490 PRO n 
1 491 PHE n 
1 492 SER n 
1 493 TYR n 
1 494 LEU n 
1 495 PHE n 
1 496 ARG n 
1 497 ALA n 
1 498 ALA n 
1 499 HIS n 
1 500 VAL n 
1 501 LEU n 
1 502 MET n 
1 503 PRO n 
1 504 HIS n 
1 505 GLU n 
1 506 SER n 
1 507 THR n 
1 508 VAL n 
1 509 GLU n 
1 510 HIS n 
1 511 THR n 
1 512 HIS n 
1 513 VAL n 
1 514 ASP n 
1 515 ILE n 
1 516 ASN n 
1 517 GLU n 
1 518 MET n 
1 519 GLU n 
1 520 SER n 
1 521 PRO n 
1 522 LEU n 
1 523 ALA n 
1 524 THR n 
1 525 ARG n 
1 526 ASN n 
1 527 ARG n 
1 528 THR n 
1 529 SER n 
1 530 VAL n 
1 531 ASP n 
1 532 PHE n 
1 533 LYS n 
1 534 ASP n 
1 535 THR n 
1 536 ASP n 
1 537 TYR n 
1 538 LYS n 
1 539 ARG n 
1 540 HIS n 
1 541 GLN n 
1 542 LEU n 
1 543 THR n 
1 544 ARG n 
1 545 SER n 
1 546 ILE n 
1 547 SER n 
1 548 GLU n 
1 549 ILE n 
1 550 LYS n 
1 551 PRO n 
1 552 PRO n 
1 553 ASN n 
1 554 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'R3 PRARE2' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               P28A-LIC 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    5NTC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P49902 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XCV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 554 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49902 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  536 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       536 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XCV GLY A 1  ? UNP P49902 ?   ?  'expression tag'      -17 1  
1 2XCV SER A 2  ? UNP P49902 ?   ?  'expression tag'      -16 2  
1 2XCV SER A 3  ? UNP P49902 ?   ?  'expression tag'      -15 3  
1 2XCV HIS A 4  ? UNP P49902 ?   ?  'expression tag'      -14 4  
1 2XCV HIS A 5  ? UNP P49902 ?   ?  'expression tag'      -13 5  
1 2XCV HIS A 6  ? UNP P49902 ?   ?  'expression tag'      -12 6  
1 2XCV HIS A 7  ? UNP P49902 ?   ?  'expression tag'      -11 7  
1 2XCV HIS A 8  ? UNP P49902 ?   ?  'expression tag'      -10 8  
1 2XCV HIS A 9  ? UNP P49902 ?   ?  'expression tag'      -9  9  
1 2XCV SER A 10 ? UNP P49902 ?   ?  'expression tag'      -8  10 
1 2XCV SER A 11 ? UNP P49902 ?   ?  'expression tag'      -7  11 
1 2XCV GLY A 12 ? UNP P49902 ?   ?  'expression tag'      -6  12 
1 2XCV LEU A 13 ? UNP P49902 ?   ?  'expression tag'      -5  13 
1 2XCV VAL A 14 ? UNP P49902 ?   ?  'expression tag'      -4  14 
1 2XCV PRO A 15 ? UNP P49902 ?   ?  'expression tag'      -3  15 
1 2XCV ARG A 16 ? UNP P49902 ?   ?  'expression tag'      -2  16 
1 2XCV GLY A 17 ? UNP P49902 ?   ?  'expression tag'      -1  17 
1 2XCV SER A 18 ? UNP P49902 ?   ?  'expression tag'      0   18 
1 2XCV ASN A 70 ? UNP P49902 ASP 52 'engineered mutation' 52  19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'    121.158 
DG2 non-polymer         . '(2R)-2,3-diphosphoglyceric acid' 
;2,3-Bisphosphoglyceric acid; 2,3-bisphosphoglycerate; 2,3-BPG; 2,3-diphosphoglyceric acid; 2,3-diphosphoglycerate; 2,3-DPG; (2~{R})-2,3-diphosphonooxypropanoic acid
;
'C3 H8 O10 P2'    266.037 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                          'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                             ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'     131.173 
IMP non-polymer         n 'INOSINIC ACID'                   ? 'C10 H13 N4 O8 P' 348.206 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                   ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2XCV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2008-01-30 
_diffrn_detector.details                'DYNAMICALLY BENDABLE' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0081 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.0081 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XCV 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   34216 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.80 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.40 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.41 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.60 
_reflns_shell.pdbx_redundancy        5.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XCV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     32486 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.68 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.42 
_refine.ls_R_factor_obs                          0.17893 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17627 
_refine.ls_R_factor_R_free                       0.22868 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1729 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               35.669 
_refine.aniso_B[1][1]                            1.16 
_refine.aniso_B[2][2]                            1.08 
_refine.aniso_B[3][3]                            -2.24 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2JCM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.212 
_refine.pdbx_overall_ESU_R_Free                  0.192 
_refine.overall_SU_ML                            0.129 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.283 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3767 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             258 
_refine_hist.number_atoms_total               4070 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        48.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.021  0.022  ? 4025 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.849  1.973  ? 5452 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.592  5.000  ? 482  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.158 22.812 ? 192  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.823 15.000 ? 699  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.439 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.126  0.200  ? 570  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 3081 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.209  0.200  ? 1717 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.310  0.200  ? 2742 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.163  0.200  ? 252  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.063  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.236  0.200  ? 54   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.168  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.218  1.500  ? 2436 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.021  2.000  ? 3821 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.059  3.000  ? 1830 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.410  4.500  ? 1631 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             2364 
_refine_ls_shell.R_factor_R_work                  0.223 
_refine_ls_shell.percent_reflns_obs               99.20 
_refine_ls_shell.R_factor_R_free                  0.289 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             126 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XCV 
_struct.title                     
;Crystal structure of the D52N variant of cytosolic 5'-nucleotidase II in complex with inosine monophosphate and 2,3-bisphosphoglycerate
;
_struct.pdbx_descriptor           
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE (E.C.3.1.3.5)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XCV 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, METAL-BINDING, NUCLEOTIDE METABOLISM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 22  ? MET A 33  ? SER A 4   MET A 15  1 ? 12 
HELX_P HELX_P2  2  ASP A 38  ? ARG A 46  ? ASP A 20  ARG A 28  1 ? 9  
HELX_P HELX_P3  3  ARG A 47  ? ARG A 52  ? ARG A 29  ARG A 34  5 ? 6  
HELX_P HELX_P4  4  GLU A 62  ? ILE A 64  ? GLU A 44  ILE A 46  5 ? 3  
HELX_P HELX_P5  5  PRO A 81  ? ILE A 98  ? PRO A 63  ILE A 80  1 ? 18 
HELX_P HELX_P6  6  PRO A 101 ? PHE A 107 ? PRO A 83  PHE A 89  5 ? 7  
HELX_P HELX_P7  7  ARG A 147 ? TYR A 155 ? ARG A 129 TYR A 137 1 ? 9  
HELX_P HELX_P8  8  THR A 173 ? PHE A 175 ? THR A 155 PHE A 157 5 ? 3  
HELX_P HELX_P9  9  ASN A 176 ? CYS A 193 ? ASN A 158 CYS A 175 1 ? 18 
HELX_P HELX_P10 10 TYR A 212 ? LYS A 229 ? TYR A 194 LYS A 211 1 ? 18 
HELX_P HELX_P11 11 SER A 231 ? GLU A 238 ? SER A 213 GLU A 220 1 ? 8  
HELX_P HELX_P12 12 ASN A 239 ? VAL A 244 ? ASN A 221 VAL A 226 1 ? 6  
HELX_P HELX_P13 13 LYS A 249 ? GLY A 261 ? LYS A 231 GLY A 243 1 ? 13 
HELX_P HELX_P14 14 ASP A 270 ? PHE A 282 ? ASP A 252 PHE A 264 1 ? 13 
HELX_P HELX_P15 15 PRO A 296 ? PHE A 301 ? PRO A 278 PHE A 283 5 ? 6  
HELX_P HELX_P16 16 PRO A 311 ? GLY A 315 ? PRO A 293 GLY A 297 5 ? 5  
HELX_P HELX_P17 17 SER A 349 ? LEU A 357 ? SER A 331 LEU A 339 1 ? 9  
HELX_P HELX_P18 18 LYS A 360 ? LYS A 362 ? LYS A 342 LYS A 344 5 ? 3  
HELX_P HELX_P19 19 HIS A 370 ? ASP A 374 ? HIS A 352 ASP A 356 1 ? 5  
HELX_P HELX_P20 20 ILE A 375 ? GLY A 383 ? ILE A 357 GLY A 365 1 ? 9  
HELX_P HELX_P21 21 GLU A 392 ? ASP A 402 ? GLU A 374 ASP A 384 1 ? 11 
HELX_P HELX_P22 22 LYS A 403 ? ASP A 414 ? LYS A 385 ASP A 396 1 ? 12 
HELX_P HELX_P23 23 ARG A 439 ? CYS A 451 ? ARG A 421 CYS A 433 1 ? 13 
HELX_P HELX_P24 24 THR A 466 ? ALA A 476 ? THR A 448 ALA A 458 1 ? 11 
HELX_P HELX_P25 25 SER A 482 ? TYR A 489 ? SER A 464 TYR A 471 5 ? 8  
HELX_P HELX_P26 26 MET A 502 ? SER A 506 ? MET A 484 SER A 488 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D IMP . O2P ? ? ? 1_555 E MG  .   MG  ? ? A IMP 1491 A MG  1492 1_555 ? ? ? ? ? ? ? 1.927 ? 
metalc2 metalc ? ? E MG  . MG  ? ? ? 1_555 A ASP 369 OD1 ? ? A MG  1492 A ASP 351  1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc3 metalc ? ? E MG  . MG  ? ? ? 1_555 F HOH .   O   ? ? A MG  1492 A HOH 2218 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc4 metalc ? ? E MG  . MG  ? ? ? 1_555 A ASN 70  ND2 ? ? A MG  1492 A ASN 52   1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc5 metalc ? ? E MG  . MG  ? ? ? 1_555 A ASP 72  O   ? ? A MG  1492 A ASP 54   1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc6 metalc ? ? E MG  . MG  ? ? ? 1_555 F HOH .   O   ? ? A MG  1492 A HOH 2215 1_555 ? ? ? ? ? ? ? 2.221 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 80  A . ? SER 62  A PRO 81  A ? PRO 63  A 1 -1.70 
2 LYS 310 A . ? LYS 292 A PRO 311 A ? PRO 293 A 1 3.46  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 9 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 3 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
AA 8 9 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 54  ? VAL A 55  ? PHE A 36  VAL A 37  
AA 2 LEU A 478 ? ALA A 480 ? LEU A 460 ALA A 462 
AA 3 ARG A 385 ? VAL A 389 ? ARG A 367 VAL A 371 
AA 4 ILE A 364 ? GLY A 368 ? ILE A 346 GLY A 350 
AA 5 CYS A 66  ? PHE A 69  ? CYS A 48  PHE A 51  
AA 6 LYS A 262 ? ALA A 266 ? LYS A 244 ALA A 248 
AA 7 LEU A 303 ? VAL A 306 ? LEU A 285 VAL A 288 
AA 8 VAL A 344 ? GLY A 347 ? VAL A 326 GLY A 329 
AA 9 LEU A 320 ? VAL A 323 ? LEU A 302 VAL A 305 
AB 1 LEU A 59  ? ALA A 60  ? LEU A 41  ALA A 42  
AB 2 LEU A 494 ? PHE A 495 ? LEU A 476 PHE A 477 
AC 1 ASN A 144 ? ILE A 146 ? ASN A 126 ILE A 128 
AC 2 LEU A 136 ? HIS A 141 ? LEU A 118 HIS A 123 
AC 3 ASN A 126 ? VAL A 130 ? ASN A 108 VAL A 112 
AC 4 LEU A 118 ? ASP A 121 ? LEU A 100 ASP A 103 
AC 5 PHE A 168 ? LEU A 171 ? PHE A 150 LEU A 153 
AD 1 THR A 197 ? CYS A 199 ? THR A 179 CYS A 181 
AD 2 GLY A 202 ? ASP A 205 ? GLY A 184 ASP A 187 
AD 3 LEU A 208 ? SER A 211 ? LEU A 190 SER A 193 
AE 1 ARG A 460 ? SER A 461 ? ARG A 442 SER A 443 
AE 2 ARG A 464 ? GLN A 465 ? ARG A 446 GLN A 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N PHE A 54  ? N PHE A 36  O TYR A 479 ? O TYR A 461 
AA 2 3 N LEU A 478 ? N LEU A 460 O THR A 386 ? O THR A 368 
AA 3 4 N ARG A 385 ? N ARG A 367 O ILE A 364 ? O ILE A 346 
AA 4 5 N LEU A 365 ? N LEU A 347 O CYS A 66  ? O CYS A 48  
AA 5 6 N PHE A 67  ? N PHE A 49  O LYS A 262 ? O LYS A 244 
AA 6 7 N LEU A 265 ? N LEU A 247 O LEU A 303 ? O LEU A 285 
AA 7 8 N VAL A 306 ? N VAL A 288 O TYR A 345 ? O TYR A 327 
AA 8 9 N SER A 346 ? N SER A 328 O ARG A 321 ? O ARG A 303 
AB 1 2 N LEU A 59  ? N LEU A 41  O PHE A 495 ? O PHE A 477 
AC 1 2 N ILE A 146 ? N ILE A 128 O CYS A 139 ? O CYS A 121 
AC 2 3 N ALA A 140 ? N ALA A 122 O LEU A 127 ? O LEU A 109 
AC 3 4 N LEU A 128 ? N LEU A 110 O VAL A 119 ? O VAL A 101 
AC 4 5 N PHE A 120 ? N PHE A 102 O TYR A 169 ? O TYR A 151 
AD 1 2 N CYS A 199 ? N CYS A 181 O GLY A 202 ? O GLY A 184 
AD 2 3 N ASP A 205 ? N ASP A 187 O LEU A 208 ? O LEU A 190 
AE 1 2 N SER A 461 ? N SER A 443 O ARG A 464 ? O ARG A 446 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE DG2 A 1489' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 1490' 
AC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE IMP A 1491' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 1492'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ARG A 162 ? ARG A 144  . ? 3_556 ? 
2  AC1 8  ARG A 162 ? ARG A 144  . ? 1_555 ? 
3  AC1 8  LYS A 380 ? LYS A 362  . ? 1_555 ? 
4  AC1 8  LYS A 380 ? LYS A 362  . ? 3_556 ? 
5  AC1 8  ARG A 474 ? ARG A 456  . ? 3_556 ? 
6  AC1 8  ARG A 474 ? ARG A 456  . ? 1_555 ? 
7  AC1 8  TYR A 475 ? TYR A 457  . ? 1_555 ? 
8  AC1 8  TYR A 475 ? TYR A 457  . ? 3_556 ? 
9  AC2 8  PHE A 301 ? PHE A 283  . ? 1_555 ? 
10 AC2 8  ASP A 302 ? ASP A 284  . ? 1_555 ? 
11 AC2 8  LEU A 303 ? LEU A 285  . ? 1_555 ? 
12 AC2 8  ILE A 304 ? ILE A 286  . ? 1_555 ? 
13 AC2 8  GLN A 340 ? GLN A 322  . ? 1_555 ? 
14 AC2 8  GLY A 342 ? GLY A 324  . ? 1_555 ? 
15 AC2 8  ILE A 343 ? ILE A 325  . ? 1_555 ? 
16 AC2 8  HOH F .   ? HOH A 2256 . ? 1_555 ? 
17 AC3 18 ASN A 70  ? ASN A 52   . ? 1_555 ? 
18 AC3 18 MET A 71  ? MET A 53   . ? 1_555 ? 
19 AC3 18 ASP A 72  ? ASP A 54   . ? 1_555 ? 
20 AC3 18 PHE A 175 ? PHE A 157  . ? 1_555 ? 
21 AC3 18 ARG A 220 ? ARG A 202  . ? 1_555 ? 
22 AC3 18 ASP A 224 ? ASP A 206  . ? 1_555 ? 
23 AC3 18 HIS A 227 ? HIS A 209  . ? 1_555 ? 
24 AC3 18 TYR A 228 ? TYR A 210  . ? 1_555 ? 
25 AC3 18 LYS A 233 ? LYS A 215  . ? 1_555 ? 
26 AC3 18 THR A 267 ? THR A 249  . ? 1_555 ? 
27 AC3 18 ASN A 268 ? ASN A 250  . ? 1_555 ? 
28 AC3 18 SER A 269 ? SER A 251  . ? 1_555 ? 
29 AC3 18 LYS A 310 ? LYS A 292  . ? 1_555 ? 
30 AC3 18 MG  E .   ? MG  A 1492 . ? 1_555 ? 
31 AC3 18 HOH F .   ? HOH A 2107 . ? 1_555 ? 
32 AC3 18 HOH F .   ? HOH A 2215 . ? 1_555 ? 
33 AC3 18 HOH F .   ? HOH A 2218 . ? 1_555 ? 
34 AC3 18 HOH F .   ? HOH A 2257 . ? 1_555 ? 
35 AC4 6  ASN A 70  ? ASN A 52   . ? 1_555 ? 
36 AC4 6  ASP A 72  ? ASP A 54   . ? 1_555 ? 
37 AC4 6  ASP A 369 ? ASP A 351  . ? 1_555 ? 
38 AC4 6  IMP D .   ? IMP A 1491 . ? 1_555 ? 
39 AC4 6  HOH F .   ? HOH A 2215 . ? 1_555 ? 
40 AC4 6  HOH F .   ? HOH A 2218 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XCV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XCV 
_atom_sites.fract_transf_matrix[1][1]   0.010921 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007825 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007656 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 21  ? -8.612  37.229 33.074 1.00 55.45 ? 3    THR A N     1 
ATOM   2    C  CA    . THR A 1 21  ? -7.178  37.283 33.567 1.00 54.77 ? 3    THR A CA    1 
ATOM   3    C  C     . THR A 1 21  ? -6.916  36.332 34.743 1.00 53.02 ? 3    THR A C     1 
ATOM   4    O  O     . THR A 1 21  ? -7.082  36.711 35.918 1.00 53.97 ? 3    THR A O     1 
ATOM   5    C  CB    . THR A 1 21  ? -6.730  38.701 34.023 1.00 55.16 ? 3    THR A CB    1 
ATOM   6    O  OG1   . THR A 1 21  ? -6.934  39.642 32.961 1.00 58.93 ? 3    THR A OG1   1 
ATOM   7    C  CG2   . THR A 1 21  ? -5.250  38.699 34.388 1.00 54.60 ? 3    THR A CG2   1 
ATOM   8    N  N     . SER A 1 22  ? -6.475  35.120 34.417 1.00 49.46 ? 4    SER A N     1 
ATOM   9    C  CA    . SER A 1 22  ? -6.024  34.160 35.405 1.00 45.91 ? 4    SER A CA    1 
ATOM   10   C  C     . SER A 1 22  ? -4.736  34.670 36.109 1.00 44.14 ? 4    SER A C     1 
ATOM   11   O  O     . SER A 1 22  ? -4.041  35.588 35.616 1.00 44.22 ? 4    SER A O     1 
ATOM   12   C  CB    . SER A 1 22  ? -5.756  32.842 34.704 1.00 45.16 ? 4    SER A CB    1 
ATOM   13   O  OG    . SER A 1 22  ? -4.475  32.883 34.107 1.00 44.42 ? 4    SER A OG    1 
ATOM   14   N  N     . TRP A 1 23  ? -4.402  34.058 37.242 1.00 41.46 ? 5    TRP A N     1 
ATOM   15   C  CA    . TRP A 1 23  ? -3.120  34.341 37.927 1.00 38.69 ? 5    TRP A CA    1 
ATOM   16   C  C     . TRP A 1 23  ? -1.906  33.961 37.085 1.00 38.05 ? 5    TRP A C     1 
ATOM   17   O  O     . TRP A 1 23  ? -0.862  34.595 37.178 1.00 37.08 ? 5    TRP A O     1 
ATOM   18   C  CB    . TRP A 1 23  ? -3.048  33.583 39.248 1.00 37.01 ? 5    TRP A CB    1 
ATOM   19   C  CG    . TRP A 1 23  ? -3.638  32.161 39.262 1.00 33.60 ? 5    TRP A CG    1 
ATOM   20   C  CD1   . TRP A 1 23  ? -4.928  31.809 39.606 1.00 33.40 ? 5    TRP A CD1   1 
ATOM   21   C  CD2   . TRP A 1 23  ? -2.949  30.941 39.019 1.00 31.35 ? 5    TRP A CD2   1 
ATOM   22   N  NE1   . TRP A 1 23  ? -5.083  30.440 39.560 1.00 32.01 ? 5    TRP A NE1   1 
ATOM   23   C  CE2   . TRP A 1 23  ? -3.879  29.880 39.222 1.00 32.79 ? 5    TRP A CE2   1 
ATOM   24   C  CE3   . TRP A 1 23  ? -1.629  30.627 38.645 1.00 33.34 ? 5    TRP A CE3   1 
ATOM   25   C  CZ2   . TRP A 1 23  ? -3.526  28.517 39.068 1.00 33.97 ? 5    TRP A CZ2   1 
ATOM   26   C  CZ3   . TRP A 1 23  ? -1.281  29.269 38.464 1.00 32.89 ? 5    TRP A CZ3   1 
ATOM   27   C  CH2   . TRP A 1 23  ? -2.237  28.239 38.663 1.00 33.64 ? 5    TRP A CH2   1 
ATOM   28   N  N     . SER A 1 24  ? -2.051  32.905 36.279 1.00 38.52 ? 6    SER A N     1 
ATOM   29   C  CA    . SER A 1 24  ? -0.963  32.471 35.387 1.00 39.50 ? 6    SER A CA    1 
ATOM   30   C  C     . SER A 1 24  ? -0.706  33.492 34.234 1.00 40.22 ? 6    SER A C     1 
ATOM   31   O  O     . SER A 1 24  ? 0.451   33.583 33.783 1.00 40.26 ? 6    SER A O     1 
ATOM   32   C  CB    . SER A 1 24  ? -1.167  31.053 34.863 1.00 37.99 ? 6    SER A CB    1 
ATOM   33   O  OG    . SER A 1 24  ? -2.255  31.022 33.961 1.00 37.36 ? 6    SER A OG    1 
ATOM   34   N  N     . ASP A 1 25  ? -1.752  34.252 33.812 1.00 40.34 ? 7    ASP A N     1 
ATOM   35   C  CA    . ASP A 1 25  ? -1.616  35.428 32.888 1.00 41.17 ? 7    ASP A CA    1 
ATOM   36   C  C     . ASP A 1 25  ? -0.797  36.555 33.524 1.00 41.34 ? 7    ASP A C     1 
ATOM   37   O  O     . ASP A 1 25  ? 0.107   37.112 32.903 1.00 41.68 ? 7    ASP A O     1 
ATOM   38   C  CB    . ASP A 1 25  ? -2.990  36.027 32.465 1.00 41.66 ? 7    ASP A CB    1 
ATOM   39   C  CG    . ASP A 1 25  ? -3.840  35.072 31.628 1.00 43.24 ? 7    ASP A CG    1 
ATOM   40   O  OD1   . ASP A 1 25  ? -3.273  34.120 31.061 1.00 49.06 ? 7    ASP A OD1   1 
ATOM   41   O  OD2   . ASP A 1 25  ? -5.091  35.252 31.521 1.00 48.93 ? 7    ASP A OD2   1 
ATOM   42   N  N     . ARG A 1 26  ? -1.126  36.919 34.758 1.00 41.38 ? 8    ARG A N     1 
ATOM   43   C  CA    . ARG A 1 26  ? -0.270  37.860 35.513 1.00 42.14 ? 8    ARG A CA    1 
ATOM   44   C  C     . ARG A 1 26  ? 1.187   37.401 35.570 1.00 42.05 ? 8    ARG A C     1 
ATOM   45   O  O     . ARG A 1 26  ? 2.112   38.167 35.271 1.00 41.40 ? 8    ARG A O     1 
ATOM   46   C  CB    . ARG A 1 26  ? -0.798  38.037 36.943 1.00 42.46 ? 8    ARG A CB    1 
ATOM   47   C  CG    . ARG A 1 26  ? -2.256  38.476 37.014 1.00 45.04 ? 8    ARG A CG    1 
ATOM   48   C  CD    . ARG A 1 26  ? -2.383  39.981 36.787 1.00 51.24 ? 8    ARG A CD    1 
ATOM   49   N  NE    . ARG A 1 26  ? -3.782  40.429 36.874 1.00 55.40 ? 8    ARG A NE    1 
ATOM   50   C  CZ    . ARG A 1 26  ? -4.233  41.599 36.419 1.00 56.61 ? 8    ARG A CZ    1 
ATOM   51   N  NH1   . ARG A 1 26  ? -3.401  42.467 35.845 1.00 56.98 ? 8    ARG A NH1   1 
ATOM   52   N  NH2   . ARG A 1 26  ? -5.528  41.895 36.518 1.00 58.74 ? 8    ARG A NH2   1 
ATOM   53   N  N     . LEU A 1 27  ? 1.380   36.139 35.968 1.00 41.54 ? 9    LEU A N     1 
ATOM   54   C  CA    . LEU A 1 27  ? 2.714   35.578 36.044 1.00 40.81 ? 9    LEU A CA    1 
ATOM   55   C  C     . LEU A 1 27  ? 3.443   35.581 34.685 1.00 40.67 ? 9    LEU A C     1 
ATOM   56   O  O     . LEU A 1 27  ? 4.651   35.893 34.608 1.00 39.94 ? 9    LEU A O     1 
ATOM   57   C  CB    . LEU A 1 27  ? 2.656   34.149 36.649 1.00 40.46 ? 9    LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 27  ? 2.265   34.060 38.165 1.00 39.36 ? 9    LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 27  ? 2.141   32.620 38.644 1.00 33.86 ? 9    LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 27  ? 3.245   34.863 39.045 1.00 33.72 ? 9    LEU A CD2   1 
ATOM   61   N  N     . GLN A 1 28  ? 2.739   35.191 33.621 1.00 40.91 ? 10   GLN A N     1 
ATOM   62   C  CA    . GLN A 1 28  ? 3.392   35.106 32.313 1.00 41.31 ? 10   GLN A CA    1 
ATOM   63   C  C     . GLN A 1 28  ? 3.701   36.528 31.795 1.00 41.77 ? 10   GLN A C     1 
ATOM   64   O  O     . GLN A 1 28  ? 4.778   36.737 31.212 1.00 42.81 ? 10   GLN A O     1 
ATOM   65   C  CB    . GLN A 1 28  ? 2.635   34.210 31.303 1.00 40.48 ? 10   GLN A CB    1 
ATOM   66   C  CG    . GLN A 1 28  ? 3.333   34.132 29.914 1.00 40.92 ? 10   GLN A CG    1 
ATOM   67   C  CD    . GLN A 1 28  ? 4.663   33.343 29.914 1.00 40.94 ? 10   GLN A CD    1 
ATOM   68   O  OE1   . GLN A 1 28  ? 4.668   32.119 29.933 1.00 43.63 ? 10   GLN A OE1   1 
ATOM   69   N  NE2   . GLN A 1 28  ? 5.778   34.048 29.844 1.00 40.83 ? 10   GLN A NE2   1 
ATOM   70   N  N     . ASN A 1 29  ? 2.813   37.496 32.058 1.00 41.56 ? 11   ASN A N     1 
ATOM   71   C  CA    . ASN A 1 29  ? 3.090   38.913 31.744 1.00 43.32 ? 11   ASN A CA    1 
ATOM   72   C  C     . ASN A 1 29  ? 4.360   39.391 32.418 1.00 43.43 ? 11   ASN A C     1 
ATOM   73   O  O     . ASN A 1 29  ? 5.243   39.999 31.778 1.00 43.74 ? 11   ASN A O     1 
ATOM   74   C  CB    . ASN A 1 29  ? 1.905   39.846 32.078 1.00 42.85 ? 11   ASN A CB    1 
ATOM   75   C  CG    . ASN A 1 29  ? 0.685   39.591 31.158 1.00 46.10 ? 11   ASN A CG    1 
ATOM   76   O  OD1   . ASN A 1 29  ? 0.770   38.835 30.174 1.00 44.93 ? 11   ASN A OD1   1 
ATOM   77   N  ND2   . ASN A 1 29  ? -0.458  40.194 31.497 1.00 47.76 ? 11   ASN A ND2   1 
ATOM   78   N  N     . ALA A 1 30  ? 4.485   39.089 33.700 1.00 42.86 ? 12   ALA A N     1 
ATOM   79   C  CA    . ALA A 1 30  ? 5.697   39.495 34.399 1.00 43.08 ? 12   ALA A CA    1 
ATOM   80   C  C     . ALA A 1 30  ? 6.923   38.746 33.857 1.00 42.40 ? 12   ALA A C     1 
ATOM   81   O  O     . ALA A 1 30  ? 8.022   39.320 33.791 1.00 41.24 ? 12   ALA A O     1 
ATOM   82   C  CB    . ALA A 1 30  ? 5.547   39.339 35.947 1.00 43.10 ? 12   ALA A CB    1 
ATOM   83   N  N     . ALA A 1 31  ? 6.716   37.484 33.470 1.00 42.83 ? 13   ALA A N     1 
ATOM   84   C  CA    . ALA A 1 31  ? 7.787   36.620 32.932 1.00 44.86 ? 13   ALA A CA    1 
ATOM   85   C  C     . ALA A 1 31  ? 8.358   37.117 31.605 1.00 46.22 ? 13   ALA A C     1 
ATOM   86   O  O     . ALA A 1 31  ? 9.526   36.875 31.301 1.00 46.56 ? 13   ALA A O     1 
ATOM   87   C  CB    . ALA A 1 31  ? 7.328   35.144 32.819 1.00 44.07 ? 13   ALA A CB    1 
ATOM   88   N  N     . ASP A 1 32  ? 7.537   37.827 30.836 1.00 48.70 ? 14   ASP A N     1 
ATOM   89   C  CA    . ASP A 1 32  ? 7.915   38.310 29.510 1.00 51.64 ? 14   ASP A CA    1 
ATOM   90   C  C     . ASP A 1 32  ? 8.858   39.508 29.612 1.00 53.09 ? 14   ASP A C     1 
ATOM   91   O  O     . ASP A 1 32  ? 9.599   39.815 28.658 1.00 53.73 ? 14   ASP A O     1 
ATOM   92   C  CB    . ASP A 1 32  ? 6.672   38.721 28.707 1.00 52.24 ? 14   ASP A CB    1 
ATOM   93   C  CG    . ASP A 1 32  ? 5.826   37.528 28.255 1.00 54.22 ? 14   ASP A CG    1 
ATOM   94   O  OD1   . ASP A 1 32  ? 6.371   36.402 28.123 1.00 53.50 ? 14   ASP A OD1   1 
ATOM   95   O  OD2   . ASP A 1 32  ? 4.606   37.743 28.012 1.00 58.66 ? 14   ASP A OD2   1 
ATOM   96   N  N     . MET A 1 33  ? 8.827   40.190 30.758 1.00 53.92 ? 15   MET A N     1 
ATOM   97   C  CA    . MET A 1 33  ? 9.751   41.301 31.017 1.00 55.48 ? 15   MET A CA    1 
ATOM   98   C  C     . MET A 1 33  ? 11.211  40.891 31.261 1.00 54.98 ? 15   MET A C     1 
ATOM   99   O  O     . MET A 1 33  ? 11.508  40.017 32.109 1.00 55.56 ? 15   MET A O     1 
ATOM   100  C  CB    . MET A 1 33  ? 9.259   42.148 32.165 1.00 56.20 ? 15   MET A CB    1 
ATOM   101  C  CG    . MET A 1 33  ? 7.748   42.217 32.190 1.00 62.38 ? 15   MET A CG    1 
ATOM   102  S  SD    . MET A 1 33  ? 7.249   43.926 32.112 1.00 74.94 ? 15   MET A SD    1 
ATOM   103  C  CE    . MET A 1 33  ? 7.327   44.209 30.325 1.00 73.86 ? 15   MET A CE    1 
ATOM   104  N  N     . PRO A 1 34  ? 12.137  41.523 30.510 1.00 54.26 ? 16   PRO A N     1 
ATOM   105  C  CA    . PRO A 1 34  ? 13.563  41.325 30.776 1.00 52.70 ? 16   PRO A CA    1 
ATOM   106  C  C     . PRO A 1 34  ? 13.909  41.947 32.115 1.00 51.42 ? 16   PRO A C     1 
ATOM   107  O  O     . PRO A 1 34  ? 13.226  42.850 32.566 1.00 50.64 ? 16   PRO A O     1 
ATOM   108  C  CB    . PRO A 1 34  ? 14.246  42.082 29.643 1.00 52.16 ? 16   PRO A CB    1 
ATOM   109  C  CG    . PRO A 1 34  ? 13.266  43.125 29.214 1.00 53.78 ? 16   PRO A CG    1 
ATOM   110  C  CD    . PRO A 1 34  ? 11.896  42.472 29.404 1.00 54.29 ? 16   PRO A CD    1 
ATOM   111  N  N     . ALA A 1 35  ? 14.970  41.448 32.730 1.00 50.96 ? 17   ALA A N     1 
ATOM   112  C  CA    . ALA A 1 35  ? 15.425  41.900 34.035 1.00 50.10 ? 17   ALA A CA    1 
ATOM   113  C  C     . ALA A 1 35  ? 16.247  43.183 33.896 1.00 49.95 ? 17   ALA A C     1 
ATOM   114  O  O     . ALA A 1 35  ? 17.273  43.172 33.202 1.00 49.44 ? 17   ALA A O     1 
ATOM   115  C  CB    . ALA A 1 35  ? 16.279  40.796 34.685 1.00 49.38 ? 17   ALA A CB    1 
ATOM   116  N  N     . ASN A 1 36  ? 15.820  44.271 34.559 1.00 49.59 ? 18   ASN A N     1 
ATOM   117  C  CA    . ASN A 1 36  ? 16.653  45.473 34.692 1.00 48.68 ? 18   ASN A CA    1 
ATOM   118  C  C     . ASN A 1 36  ? 17.314  45.469 36.055 1.00 48.73 ? 18   ASN A C     1 
ATOM   119  O  O     . ASN A 1 36  ? 16.664  45.798 37.056 1.00 48.34 ? 18   ASN A O     1 
ATOM   120  C  CB    . ASN A 1 36  ? 15.827  46.743 34.489 1.00 48.65 ? 18   ASN A CB    1 
ATOM   121  C  CG    . ASN A 1 36  ? 16.655  48.060 34.662 1.00 49.13 ? 18   ASN A CG    1 
ATOM   122  O  OD1   . ASN A 1 36  ? 17.818  48.068 35.113 1.00 48.78 ? 18   ASN A OD1   1 
ATOM   123  N  ND2   . ASN A 1 36  ? 16.030  49.176 34.298 1.00 47.05 ? 18   ASN A ND2   1 
ATOM   124  N  N     . MET A 1 37  ? 18.606  45.121 36.084 1.00 48.48 ? 19   MET A N     1 
ATOM   125  C  CA    . MET A 1 37  ? 19.347  44.886 37.350 1.00 48.90 ? 19   MET A CA    1 
ATOM   126  C  C     . MET A 1 37  ? 20.006  46.124 37.992 1.00 49.18 ? 19   MET A C     1 
ATOM   127  O  O     . MET A 1 37  ? 20.851  45.995 38.887 1.00 49.07 ? 19   MET A O     1 
ATOM   128  C  CB    . MET A 1 37  ? 20.383  43.739 37.184 1.00 48.55 ? 19   MET A CB    1 
ATOM   129  C  CG    . MET A 1 37  ? 19.759  42.368 36.820 1.00 47.23 ? 19   MET A CG    1 
ATOM   130  S  SD    . MET A 1 37  ? 18.576  41.792 38.061 1.00 45.43 ? 19   MET A SD    1 
ATOM   131  C  CE    . MET A 1 37  ? 19.736  41.221 39.367 1.00 41.88 ? 19   MET A CE    1 
ATOM   132  N  N     . ASP A 1 38  ? 19.632  47.311 37.522 1.00 50.08 ? 20   ASP A N     1 
ATOM   133  C  CA    . ASP A 1 38  ? 20.041  48.558 38.153 1.00 51.07 ? 20   ASP A CA    1 
ATOM   134  C  C     . ASP A 1 38  ? 19.455  48.620 39.580 1.00 51.61 ? 20   ASP A C     1 
ATOM   135  O  O     . ASP A 1 38  ? 18.254  48.441 39.743 1.00 50.60 ? 20   ASP A O     1 
ATOM   136  C  CB    . ASP A 1 38  ? 19.567  49.756 37.304 1.00 51.67 ? 20   ASP A CB    1 
ATOM   137  C  CG    . ASP A 1 38  ? 19.798  51.104 38.007 1.00 53.93 ? 20   ASP A CG    1 
ATOM   138  O  OD1   . ASP A 1 38  ? 20.968  51.545 38.010 1.00 57.34 ? 20   ASP A OD1   1 
ATOM   139  O  OD2   . ASP A 1 38  ? 18.830  51.715 38.567 1.00 55.58 ? 20   ASP A OD2   1 
ATOM   140  N  N     . LYS A 1 39  ? 20.311  48.873 40.582 1.00 52.98 ? 21   LYS A N     1 
ATOM   141  C  CA    . LYS A 1 39  ? 19.939  48.989 42.015 1.00 55.72 ? 21   LYS A CA    1 
ATOM   142  C  C     . LYS A 1 39  ? 18.670  49.786 42.352 1.00 55.49 ? 21   LYS A C     1 
ATOM   143  O  O     . LYS A 1 39  ? 17.916  49.413 43.264 1.00 55.48 ? 21   LYS A O     1 
ATOM   144  C  CB    . LYS A 1 39  ? 21.082  49.601 42.825 1.00 56.45 ? 21   LYS A CB    1 
ATOM   145  C  CG    . LYS A 1 39  ? 22.300  48.698 42.989 1.00 58.55 ? 21   LYS A CG    1 
ATOM   146  C  CD    . LYS A 1 39  ? 23.284  49.320 44.024 1.00 59.37 ? 21   LYS A CD    1 
ATOM   147  C  CE    . LYS A 1 39  ? 24.604  48.457 44.162 1.00 62.26 ? 21   LYS A CE    1 
ATOM   148  N  NZ    . LYS A 1 39  ? 24.386  46.994 43.814 1.00 61.55 ? 21   LYS A NZ    1 
ATOM   149  N  N     . HIS A 1 40  ? 18.460  50.893 41.646 1.00 54.80 ? 22   HIS A N     1 
ATOM   150  C  CA    . HIS A 1 40  ? 17.304  51.734 41.894 1.00 54.63 ? 22   HIS A CA    1 
ATOM   151  C  C     . HIS A 1 40  ? 16.057  51.176 41.225 1.00 52.90 ? 22   HIS A C     1 
ATOM   152  O  O     . HIS A 1 40  ? 14.956  51.305 41.766 1.00 52.86 ? 22   HIS A O     1 
ATOM   153  C  CB    . HIS A 1 40  ? 17.593  53.162 41.444 1.00 55.54 ? 22   HIS A CB    1 
ATOM   154  C  CG    . HIS A 1 40  ? 18.753  53.762 42.162 1.00 59.61 ? 22   HIS A CG    1 
ATOM   155  N  ND1   . HIS A 1 40  ? 20.047  53.664 41.693 1.00 62.55 ? 22   HIS A ND1   1 
ATOM   156  C  CD2   . HIS A 1 40  ? 18.827  54.405 43.356 1.00 63.46 ? 22   HIS A CD2   1 
ATOM   157  C  CE1   . HIS A 1 40  ? 20.866  54.243 42.556 1.00 64.27 ? 22   HIS A CE1   1 
ATOM   158  N  NE2   . HIS A 1 40  ? 20.153  54.699 43.574 1.00 64.06 ? 22   HIS A NE2   1 
ATOM   159  N  N     . ALA A 1 41  ? 16.252  50.570 40.050 1.00 50.90 ? 23   ALA A N     1 
ATOM   160  C  CA    . ALA A 1 41  ? 15.202  49.911 39.299 1.00 49.16 ? 23   ALA A CA    1 
ATOM   161  C  C     . ALA A 1 41  ? 14.717  48.680 40.084 1.00 48.51 ? 23   ALA A C     1 
ATOM   162  O  O     . ALA A 1 41  ? 13.497  48.474 40.201 1.00 48.47 ? 23   ALA A O     1 
ATOM   163  C  CB    . ALA A 1 41  ? 15.683  49.530 37.898 1.00 48.53 ? 23   ALA A CB    1 
ATOM   164  N  N     . LEU A 1 42  ? 15.639  47.900 40.656 1.00 47.00 ? 24   LEU A N     1 
ATOM   165  C  CA    . LEU A 1 42  ? 15.238  46.739 41.475 1.00 47.43 ? 24   LEU A CA    1 
ATOM   166  C  C     . LEU A 1 42  ? 14.401  47.198 42.656 1.00 49.05 ? 24   LEU A C     1 
ATOM   167  O  O     . LEU A 1 42  ? 13.258  46.754 42.824 1.00 49.16 ? 24   LEU A O     1 
ATOM   168  C  CB    . LEU A 1 42  ? 16.440  45.952 41.972 1.00 46.37 ? 24   LEU A CB    1 
ATOM   169  C  CG    . LEU A 1 42  ? 17.215  45.230 40.869 1.00 43.88 ? 24   LEU A CG    1 
ATOM   170  C  CD1   . LEU A 1 42  ? 18.524  44.692 41.423 1.00 43.07 ? 24   LEU A CD1   1 
ATOM   171  C  CD2   . LEU A 1 42  ? 16.365  44.148 40.213 1.00 37.53 ? 24   LEU A CD2   1 
ATOM   172  N  N     . LYS A 1 43  ? 14.958  48.136 43.427 1.00 50.46 ? 25   LYS A N     1 
ATOM   173  C  CA    . LYS A 1 43  ? 14.317  48.719 44.586 1.00 52.18 ? 25   LYS A CA    1 
ATOM   174  C  C     . LYS A 1 43  ? 12.888  49.212 44.318 1.00 52.64 ? 25   LYS A C     1 
ATOM   175  O  O     . LYS A 1 43  ? 11.995  48.935 45.122 1.00 53.34 ? 25   LYS A O     1 
ATOM   176  C  CB    . LYS A 1 43  ? 15.202  49.822 45.171 1.00 52.91 ? 25   LYS A CB    1 
ATOM   177  C  CG    . LYS A 1 43  ? 14.691  50.374 46.497 1.00 57.79 ? 25   LYS A CG    1 
ATOM   178  C  CD    . LYS A 1 43  ? 15.695  51.307 47.146 1.00 63.30 ? 25   LYS A CD    1 
ATOM   179  C  CE    . LYS A 1 43  ? 15.022  52.086 48.300 1.00 68.05 ? 25   LYS A CE    1 
ATOM   180  N  NZ    . LYS A 1 43  ? 14.790  51.234 49.521 1.00 68.32 ? 25   LYS A NZ    1 
ATOM   181  N  N     . LYS A 1 44  ? 12.632  49.888 43.199 1.00 52.85 ? 26   LYS A N     1 
ATOM   182  C  CA    . LYS A 1 44  ? 11.265  50.410 42.987 1.00 53.99 ? 26   LYS A CA    1 
ATOM   183  C  C     . LYS A 1 44  ? 10.262  49.365 42.438 1.00 53.28 ? 26   LYS A C     1 
ATOM   184  O  O     . LYS A 1 44  ? 9.047   49.448 42.689 1.00 52.74 ? 26   LYS A O     1 
ATOM   185  C  CB    . LYS A 1 44  ? 11.255  51.743 42.214 1.00 54.56 ? 26   LYS A CB    1 
ATOM   186  C  CG    . LYS A 1 44  ? 11.197  51.621 40.696 1.00 58.87 ? 26   LYS A CG    1 
ATOM   187  C  CD    . LYS A 1 44  ? 10.640  52.926 40.085 1.00 63.97 ? 26   LYS A CD    1 
ATOM   188  C  CE    . LYS A 1 44  ? 9.447   52.616 39.120 1.00 66.89 ? 26   LYS A CE    1 
ATOM   189  N  NZ    . LYS A 1 44  ? 9.074   53.820 38.292 1.00 67.70 ? 26   LYS A NZ    1 
ATOM   190  N  N     . TYR A 1 45  ? 10.791  48.379 41.724 1.00 52.36 ? 27   TYR A N     1 
ATOM   191  C  CA    . TYR A 1 45  ? 10.032  47.206 41.292 1.00 52.28 ? 27   TYR A CA    1 
ATOM   192  C  C     . TYR A 1 45  ? 9.378   46.416 42.477 1.00 52.23 ? 27   TYR A C     1 
ATOM   193  O  O     . TYR A 1 45  ? 8.186   46.129 42.457 1.00 51.20 ? 27   TYR A O     1 
ATOM   194  C  CB    . TYR A 1 45  ? 10.927  46.293 40.413 1.00 52.18 ? 27   TYR A CB    1 
ATOM   195  C  CG    . TYR A 1 45  ? 10.159  45.531 39.363 1.00 51.65 ? 27   TYR A CG    1 
ATOM   196  C  CD1   . TYR A 1 45  ? 9.419   46.210 38.385 1.00 52.17 ? 27   TYR A CD1   1 
ATOM   197  C  CD2   . TYR A 1 45  ? 10.155  44.145 39.348 1.00 51.14 ? 27   TYR A CD2   1 
ATOM   198  C  CE1   . TYR A 1 45  ? 8.690   45.523 37.421 1.00 52.72 ? 27   TYR A CE1   1 
ATOM   199  C  CE2   . TYR A 1 45  ? 9.416   43.433 38.400 1.00 52.53 ? 27   TYR A CE2   1 
ATOM   200  C  CZ    . TYR A 1 45  ? 8.687   44.132 37.427 1.00 52.88 ? 27   TYR A CZ    1 
ATOM   201  O  OH    . TYR A 1 45  ? 7.962   43.452 36.456 1.00 52.77 ? 27   TYR A OH    1 
ATOM   202  N  N     . ARG A 1 46  ? 10.174  46.112 43.505 1.00 52.97 ? 28   ARG A N     1 
ATOM   203  C  CA    . ARG A 1 46  ? 9.709   45.447 44.727 1.00 53.65 ? 28   ARG A CA    1 
ATOM   204  C  C     . ARG A 1 46  ? 8.886   46.354 45.642 1.00 55.89 ? 28   ARG A C     1 
ATOM   205  O  O     . ARG A 1 46  ? 8.572   45.966 46.766 1.00 57.28 ? 28   ARG A O     1 
ATOM   206  C  CB    . ARG A 1 46  ? 10.875  44.832 45.502 1.00 52.47 ? 28   ARG A CB    1 
ATOM   207  C  CG    . ARG A 1 46  ? 11.786  45.812 46.216 1.00 48.98 ? 28   ARG A CG    1 
ATOM   208  C  CD    . ARG A 1 46  ? 13.075  45.150 46.608 1.00 42.35 ? 28   ARG A CD    1 
ATOM   209  N  NE    . ARG A 1 46  ? 13.849  45.958 47.551 1.00 45.86 ? 28   ARG A NE    1 
ATOM   210  C  CZ    . ARG A 1 46  ? 15.163  46.251 47.440 1.00 49.23 ? 28   ARG A CZ    1 
ATOM   211  N  NH1   . ARG A 1 46  ? 15.941  45.812 46.420 1.00 44.08 ? 28   ARG A NH1   1 
ATOM   212  N  NH2   . ARG A 1 46  ? 15.718  47.008 48.374 1.00 49.21 ? 28   ARG A NH2   1 
ATOM   213  N  N     . ARG A 1 47  ? 8.561   47.556 45.168 1.00 57.30 ? 29   ARG A N     1 
ATOM   214  C  CA    . ARG A 1 47  ? 7.555   48.399 45.799 1.00 59.10 ? 29   ARG A CA    1 
ATOM   215  C  C     . ARG A 1 47  ? 6.195   47.806 45.473 1.00 58.48 ? 29   ARG A C     1 
ATOM   216  O  O     . ARG A 1 47  ? 5.293   47.770 46.336 1.00 59.16 ? 29   ARG A O     1 
ATOM   217  C  CB    . ARG A 1 47  ? 7.582   49.863 45.270 1.00 60.40 ? 29   ARG A CB    1 
ATOM   218  C  CG    . ARG A 1 47  ? 8.363   50.927 46.103 1.00 64.59 ? 29   ARG A CG    1 
ATOM   219  C  CD    . ARG A 1 47  ? 8.493   50.578 47.605 1.00 71.87 ? 29   ARG A CD    1 
ATOM   220  N  NE    . ARG A 1 47  ? 9.777   49.924 47.900 1.00 76.15 ? 29   ARG A NE    1 
ATOM   221  C  CZ    . ARG A 1 47  ? 10.950  50.560 47.999 1.00 78.93 ? 29   ARG A CZ    1 
ATOM   222  N  NH1   . ARG A 1 47  ? 11.016  51.888 47.830 1.00 79.19 ? 29   ARG A NH1   1 
ATOM   223  N  NH2   . ARG A 1 47  ? 12.062  49.866 48.264 1.00 78.29 ? 29   ARG A NH2   1 
ATOM   224  N  N     . GLU A 1 48  ? 6.026   47.374 44.224 1.00 56.77 ? 30   GLU A N     1 
ATOM   225  C  CA    . GLU A 1 48  ? 4.733   46.832 43.826 1.00 55.53 ? 30   GLU A CA    1 
ATOM   226  C  C     . GLU A 1 48  ? 4.486   45.501 44.526 1.00 53.33 ? 30   GLU A C     1 
ATOM   227  O  O     . GLU A 1 48  ? 5.434   44.718 44.703 1.00 51.99 ? 30   GLU A O     1 
ATOM   228  C  CB    . GLU A 1 48  ? 4.656   46.679 42.326 1.00 56.52 ? 30   GLU A CB    1 
ATOM   229  C  CG    . GLU A 1 48  ? 4.710   48.016 41.591 1.00 61.35 ? 30   GLU A CG    1 
ATOM   230  C  CD    . GLU A 1 48  ? 4.301   47.843 40.145 1.00 66.55 ? 30   GLU A CD    1 
ATOM   231  O  OE1   . GLU A 1 48  ? 3.068   47.710 39.901 1.00 68.78 ? 30   GLU A OE1   1 
ATOM   232  O  OE2   . GLU A 1 48  ? 5.219   47.802 39.282 1.00 67.12 ? 30   GLU A OE2   1 
ATOM   233  N  N     . ALA A 1 49  ? 3.234   45.263 44.940 1.00 50.80 ? 31   ALA A N     1 
ATOM   234  C  CA    . ALA A 1 49  ? 2.944   44.106 45.777 1.00 48.38 ? 31   ALA A CA    1 
ATOM   235  C  C     . ALA A 1 49  ? 3.233   42.838 44.994 1.00 47.10 ? 31   ALA A C     1 
ATOM   236  O  O     . ALA A 1 49  ? 3.763   41.884 45.563 1.00 46.36 ? 31   ALA A O     1 
ATOM   237  C  CB    . ALA A 1 49  ? 1.517   44.147 46.296 1.00 48.34 ? 31   ALA A CB    1 
ATOM   238  N  N     . TYR A 1 50  ? 2.997   42.890 43.668 1.00 46.10 ? 32   TYR A N     1 
ATOM   239  C  CA    . TYR A 1 50  ? 3.171   41.742 42.702 1.00 44.84 ? 32   TYR A CA    1 
ATOM   240  C  C     . TYR A 1 50  ? 4.574   41.179 42.705 1.00 41.41 ? 32   TYR A C     1 
ATOM   241  O  O     . TYR A 1 50  ? 4.786   39.983 42.494 1.00 41.17 ? 32   TYR A O     1 
ATOM   242  C  CB    . TYR A 1 50  ? 2.672   42.126 41.249 1.00 47.60 ? 32   TYR A CB    1 
ATOM   243  C  CG    . TYR A 1 50  ? 1.477   43.066 41.370 1.00 51.48 ? 32   TYR A CG    1 
ATOM   244  C  CD1   . TYR A 1 50  ? 0.251   42.590 41.906 1.00 54.61 ? 32   TYR A CD1   1 
ATOM   245  C  CD2   . TYR A 1 50  ? 1.592   44.461 41.099 1.00 53.11 ? 32   TYR A CD2   1 
ATOM   246  C  CE1   . TYR A 1 50  ? -0.869  43.464 42.137 1.00 55.03 ? 32   TYR A CE1   1 
ATOM   247  C  CE2   . TYR A 1 50  ? 0.466   45.352 41.324 1.00 54.63 ? 32   TYR A CE2   1 
ATOM   248  C  CZ    . TYR A 1 50  ? -0.760  44.828 41.854 1.00 55.37 ? 32   TYR A CZ    1 
ATOM   249  O  OH    . TYR A 1 50  ? -1.883  45.633 42.077 1.00 55.54 ? 32   TYR A OH    1 
ATOM   250  N  N     . HIS A 1 51  ? 5.522   42.051 42.990 1.00 37.65 ? 33   HIS A N     1 
ATOM   251  C  CA    . HIS A 1 51  ? 6.912   41.741 42.919 1.00 35.62 ? 33   HIS A CA    1 
ATOM   252  C  C     . HIS A 1 51  ? 7.587   41.695 44.284 1.00 33.13 ? 33   HIS A C     1 
ATOM   253  O  O     . HIS A 1 51  ? 8.798   41.581 44.358 1.00 31.04 ? 33   HIS A O     1 
ATOM   254  C  CB    . HIS A 1 51  ? 7.580   42.766 41.971 1.00 36.64 ? 33   HIS A CB    1 
ATOM   255  C  CG    . HIS A 1 51  ? 6.907   42.830 40.631 1.00 38.89 ? 33   HIS A CG    1 
ATOM   256  N  ND1   . HIS A 1 51  ? 6.300   43.976 40.147 1.00 38.65 ? 33   HIS A ND1   1 
ATOM   257  C  CD2   . HIS A 1 51  ? 6.659   41.856 39.717 1.00 38.15 ? 33   HIS A CD2   1 
ATOM   258  C  CE1   . HIS A 1 51  ? 5.752   43.715 38.974 1.00 38.08 ? 33   HIS A CE1   1 
ATOM   259  N  NE2   . HIS A 1 51  ? 5.955   42.437 38.689 1.00 39.36 ? 33   HIS A NE2   1 
ATOM   260  N  N     . ARG A 1 52  ? 6.795   41.758 45.357 1.00 31.50 ? 34   ARG A N     1 
ATOM   261  C  CA    . ARG A 1 52  ? 7.329   41.696 46.722 1.00 31.61 ? 34   ARG A CA    1 
ATOM   262  C  C     . ARG A 1 52  ? 7.476   40.294 47.236 1.00 29.95 ? 34   ARG A C     1 
ATOM   263  O  O     . ARG A 1 52  ? 6.724   39.388 46.855 1.00 29.25 ? 34   ARG A O     1 
ATOM   264  C  CB    . ARG A 1 52  ? 6.450   42.510 47.693 1.00 32.40 ? 34   ARG A CB    1 
ATOM   265  C  CG    . ARG A 1 52  ? 6.628   44.025 47.539 1.00 38.21 ? 34   ARG A CG    1 
ATOM   266  C  CD    . ARG A 1 52  ? 5.924   44.815 48.578 1.00 42.70 ? 34   ARG A CD    1 
ATOM   267  N  NE    . ARG A 1 52  ? 6.410   44.451 49.914 1.00 52.67 ? 34   ARG A NE    1 
ATOM   268  C  CZ    . ARG A 1 52  ? 5.770   44.793 51.046 1.00 55.89 ? 34   ARG A CZ    1 
ATOM   269  N  NH1   . ARG A 1 52  ? 4.646   45.491 50.970 1.00 56.53 ? 34   ARG A NH1   1 
ATOM   270  N  NH2   . ARG A 1 52  ? 6.227   44.444 52.241 1.00 53.87 ? 34   ARG A NH2   1 
ATOM   271  N  N     . VAL A 1 53  ? 8.477   40.121 48.090 1.00 29.78 ? 35   VAL A N     1 
ATOM   272  C  CA    . VAL A 1 53  ? 8.570   38.978 48.993 1.00 28.67 ? 35   VAL A CA    1 
ATOM   273  C  C     . VAL A 1 53  ? 7.954   39.384 50.368 1.00 30.10 ? 35   VAL A C     1 
ATOM   274  O  O     . VAL A 1 53  ? 8.384   40.404 50.973 1.00 29.87 ? 35   VAL A O     1 
ATOM   275  C  CB    . VAL A 1 53  ? 10.011  38.521 49.100 1.00 29.06 ? 35   VAL A CB    1 
ATOM   276  C  CG1   . VAL A 1 53  ? 10.190  37.426 50.138 1.00 23.87 ? 35   VAL A CG1   1 
ATOM   277  C  CG2   . VAL A 1 53  ? 10.466  37.996 47.709 1.00 26.35 ? 35   VAL A CG2   1 
ATOM   278  N  N     . PHE A 1 54  ? 6.931   38.627 50.827 1.00 29.10 ? 36   PHE A N     1 
ATOM   279  C  CA    . PHE A 1 54  ? 6.257   38.896 52.126 1.00 28.25 ? 36   PHE A CA    1 
ATOM   280  C  C     . PHE A 1 54  ? 6.879   38.079 53.248 1.00 28.47 ? 36   PHE A C     1 
ATOM   281  O  O     . PHE A 1 54  ? 7.295   36.953 53.012 1.00 28.51 ? 36   PHE A O     1 
ATOM   282  C  CB    . PHE A 1 54  ? 4.743   38.711 52.017 1.00 26.68 ? 36   PHE A CB    1 
ATOM   283  C  CG    . PHE A 1 54  ? 4.120   39.632 50.989 1.00 26.57 ? 36   PHE A CG    1 
ATOM   284  C  CD1   . PHE A 1 54  ? 3.881   40.967 51.293 1.00 20.73 ? 36   PHE A CD1   1 
ATOM   285  C  CD2   . PHE A 1 54  ? 3.832   39.163 49.694 1.00 24.67 ? 36   PHE A CD2   1 
ATOM   286  C  CE1   . PHE A 1 54  ? 3.336   41.828 50.343 1.00 24.32 ? 36   PHE A CE1   1 
ATOM   287  C  CE2   . PHE A 1 54  ? 3.283   40.020 48.743 1.00 28.28 ? 36   PHE A CE2   1 
ATOM   288  C  CZ    . PHE A 1 54  ? 3.055   41.365 49.060 1.00 25.53 ? 36   PHE A CZ    1 
ATOM   289  N  N     . VAL A 1 55  ? 6.999   38.680 54.448 1.00 28.94 ? 37   VAL A N     1 
ATOM   290  C  CA    . VAL A 1 55  ? 7.790   38.112 55.582 1.00 27.06 ? 37   VAL A CA    1 
ATOM   291  C  C     . VAL A 1 55  ? 6.885   37.763 56.795 1.00 27.25 ? 37   VAL A C     1 
ATOM   292  O  O     . VAL A 1 55  ? 6.192   38.619 57.310 1.00 25.47 ? 37   VAL A O     1 
ATOM   293  C  CB    . VAL A 1 55  ? 8.899   39.103 56.022 1.00 27.91 ? 37   VAL A CB    1 
ATOM   294  C  CG1   . VAL A 1 55  ? 9.836   38.464 57.046 1.00 24.95 ? 37   VAL A CG1   1 
ATOM   295  C  CG2   . VAL A 1 55  ? 9.737   39.555 54.752 1.00 27.49 ? 37   VAL A CG2   1 
ATOM   296  N  N     . ASN A 1 56  ? 6.876   36.494 57.200 1.00 26.10 ? 38   ASN A N     1 
ATOM   297  C  CA    . ASN A 1 56  ? 6.196   36.092 58.426 1.00 26.98 ? 38   ASN A CA    1 
ATOM   298  C  C     . ASN A 1 56  ? 7.177   36.072 59.597 1.00 28.28 ? 38   ASN A C     1 
ATOM   299  O  O     . ASN A 1 56  ? 6.805   36.449 60.714 1.00 27.01 ? 38   ASN A O     1 
ATOM   300  C  CB    . ASN A 1 56  ? 5.546   34.715 58.246 1.00 26.15 ? 38   ASN A CB    1 
ATOM   301  C  CG    . ASN A 1 56  ? 4.380   34.771 57.298 1.00 25.45 ? 38   ASN A CG    1 
ATOM   302  O  OD1   . ASN A 1 56  ? 4.272   33.991 56.356 1.00 27.05 ? 38   ASN A OD1   1 
ATOM   303  N  ND2   . ASN A 1 56  ? 3.512   35.694 57.535 1.00 20.57 ? 38   ASN A ND2   1 
ATOM   304  N  N     . ARG A 1 57  ? 8.431   35.674 59.311 1.00 28.72 ? 39   ARG A N     1 
ATOM   305  C  CA    . ARG A 1 57  ? 9.506   35.714 60.291 1.00 30.33 ? 39   ARG A CA    1 
ATOM   306  C  C     . ARG A 1 57  ? 10.756  36.214 59.629 1.00 31.53 ? 39   ARG A C     1 
ATOM   307  O  O     . ARG A 1 57  ? 11.031  35.855 58.496 1.00 33.52 ? 39   ARG A O     1 
ATOM   308  C  CB    . ARG A 1 57  ? 9.773   34.327 60.931 1.00 29.55 ? 39   ARG A CB    1 
ATOM   309  C  CG    . ARG A 1 57  ? 8.765   33.966 62.090 1.00 28.53 ? 39   ARG A CG    1 
ATOM   310  C  CD    . ARG A 1 57  ? 8.785   32.483 62.384 1.00 29.12 ? 39   ARG A CD    1 
ATOM   311  N  NE    . ARG A 1 57  ? 8.446   31.724 61.192 1.00 32.07 ? 39   ARG A NE    1 
ATOM   312  C  CZ    . ARG A 1 57  ? 7.217   31.620 60.670 1.00 35.98 ? 39   ARG A CZ    1 
ATOM   313  N  NH1   . ARG A 1 57  ? 6.148   32.211 61.247 1.00 32.16 ? 39   ARG A NH1   1 
ATOM   314  N  NH2   . ARG A 1 57  ? 7.062   30.914 59.550 1.00 34.76 ? 39   ARG A NH2   1 
ATOM   315  N  N     . SER A 1 58  ? 11.548  36.979 60.380 1.00 31.68 ? 40   SER A N     1 
ATOM   316  C  CA    . SER A 1 58  ? 12.777  37.554 59.907 1.00 31.05 ? 40   SER A CA    1 
ATOM   317  C  C     . SER A 1 58  ? 13.740  36.510 59.382 1.00 31.12 ? 40   SER A C     1 
ATOM   318  O  O     . SER A 1 58  ? 13.892  35.428 59.982 1.00 30.52 ? 40   SER A O     1 
ATOM   319  C  CB    . SER A 1 58  ? 13.424  38.374 61.010 1.00 30.05 ? 40   SER A CB    1 
ATOM   320  O  OG    . SER A 1 58  ? 12.637  39.527 61.171 1.00 31.86 ? 40   SER A OG    1 
ATOM   321  N  N     . LEU A 1 59  ? 14.381  36.850 58.256 1.00 30.12 ? 41   LEU A N     1 
ATOM   322  C  CA    . LEU A 1 59  ? 15.321  35.937 57.656 1.00 29.30 ? 41   LEU A CA    1 
ATOM   323  C  C     . LEU A 1 59  ? 16.451  36.770 57.065 1.00 30.74 ? 41   LEU A C     1 
ATOM   324  O  O     . LEU A 1 59  ? 16.197  37.698 56.262 1.00 30.28 ? 41   LEU A O     1 
ATOM   325  C  CB    . LEU A 1 59  ? 14.612  35.073 56.602 1.00 27.94 ? 41   LEU A CB    1 
ATOM   326  C  CG    . LEU A 1 59  ? 15.333  33.876 55.970 1.00 27.26 ? 41   LEU A CG    1 
ATOM   327  C  CD1   . LEU A 1 59  ? 14.324  32.861 55.390 1.00 25.71 ? 41   LEU A CD1   1 
ATOM   328  C  CD2   . LEU A 1 59  ? 16.273  34.309 54.888 1.00 28.58 ? 41   LEU A CD2   1 
ATOM   329  N  N     . ALA A 1 60  ? 17.689  36.469 57.502 1.00 31.69 ? 42   ALA A N     1 
ATOM   330  C  CA    . ALA A 1 60  ? 18.870  37.220 57.078 1.00 32.59 ? 42   ALA A CA    1 
ATOM   331  C  C     . ALA A 1 60  ? 19.439  36.482 55.855 1.00 33.83 ? 42   ALA A C     1 
ATOM   332  O  O     . ALA A 1 60  ? 19.990  35.388 55.970 1.00 33.55 ? 42   ALA A O     1 
ATOM   333  C  CB    . ALA A 1 60  ? 19.911  37.259 58.227 1.00 31.55 ? 42   ALA A CB    1 
ATOM   334  N  N     . MET A 1 61  ? 19.296  37.057 54.670 1.00 35.74 ? 43   MET A N     1 
ATOM   335  C  CA    . MET A 1 61  ? 19.649  36.292 53.475 1.00 36.67 ? 43   MET A CA    1 
ATOM   336  C  C     . MET A 1 61  ? 21.106  35.899 53.432 1.00 37.30 ? 43   MET A C     1 
ATOM   337  O  O     . MET A 1 61  ? 21.423  34.902 52.776 1.00 37.10 ? 43   MET A O     1 
ATOM   338  C  CB    . MET A 1 61  ? 19.248  37.011 52.173 1.00 36.81 ? 43   MET A CB    1 
ATOM   339  C  CG    . MET A 1 61  ? 17.776  36.838 51.771 1.00 38.92 ? 43   MET A CG    1 
ATOM   340  S  SD    . MET A 1 61  ? 17.431  35.144 51.205 1.00 42.57 ? 43   MET A SD    1 
ATOM   341  C  CE    . MET A 1 61  ? 18.345  35.143 49.647 1.00 43.18 ? 43   MET A CE    1 
ATOM   342  N  N     . GLU A 1 62  ? 21.987  36.629 54.140 1.00 37.95 ? 44   GLU A N     1 
ATOM   343  C  CA    . GLU A 1 62  ? 23.425  36.292 54.129 1.00 41.03 ? 44   GLU A CA    1 
ATOM   344  C  C     . GLU A 1 62  ? 23.799  35.025 54.868 1.00 39.16 ? 44   GLU A C     1 
ATOM   345  O  O     . GLU A 1 62  ? 24.879  34.447 54.621 1.00 38.85 ? 44   GLU A O     1 
ATOM   346  C  CB    . GLU A 1 62  ? 24.299  37.431 54.639 1.00 40.75 ? 44   GLU A CB    1 
ATOM   347  C  CG    . GLU A 1 62  ? 24.465  37.462 56.173 1.00 47.99 ? 44   GLU A CG    1 
ATOM   348  C  CD    . GLU A 1 62  ? 25.104  38.810 56.642 1.00 50.35 ? 44   GLU A CD    1 
ATOM   349  O  OE1   . GLU A 1 62  ? 24.451  39.567 57.460 1.00 57.56 ? 44   GLU A OE1   1 
ATOM   350  O  OE2   . GLU A 1 62  ? 26.241  39.106 56.109 1.00 58.68 ? 44   GLU A OE2   1 
ATOM   351  N  N     . LYS A 1 63  ? 22.918  34.575 55.760 1.00 38.02 ? 45   LYS A N     1 
ATOM   352  C  CA    . LYS A 1 63  ? 23.164  33.341 56.473 1.00 38.57 ? 45   LYS A CA    1 
ATOM   353  C  C     . LYS A 1 63  ? 22.747  32.098 55.679 1.00 37.31 ? 45   LYS A C     1 
ATOM   354  O  O     . LYS A 1 63  ? 23.092  30.973 56.076 1.00 37.35 ? 45   LYS A O     1 
ATOM   355  C  CB    . LYS A 1 63  ? 22.451  33.344 57.840 1.00 39.66 ? 45   LYS A CB    1 
ATOM   356  C  CG    . LYS A 1 63  ? 22.928  34.432 58.853 1.00 42.86 ? 45   LYS A CG    1 
ATOM   357  C  CD    . LYS A 1 63  ? 22.792  33.895 60.304 1.00 49.42 ? 45   LYS A CD    1 
ATOM   358  C  CE    . LYS A 1 63  ? 22.304  34.989 61.282 1.00 53.16 ? 45   LYS A CE    1 
ATOM   359  N  NZ    . LYS A 1 63  ? 20.792  35.202 61.141 1.00 56.03 ? 45   LYS A NZ    1 
ATOM   360  N  N     . ILE A 1 64  ? 21.992  32.301 54.593 1.00 36.30 ? 46   ILE A N     1 
ATOM   361  C  CA    . ILE A 1 64  ? 21.537  31.202 53.702 1.00 35.26 ? 46   ILE A CA    1 
ATOM   362  C  C     . ILE A 1 64  ? 22.696  30.706 52.817 1.00 35.54 ? 46   ILE A C     1 
ATOM   363  O  O     . ILE A 1 64  ? 23.251  31.466 51.995 1.00 36.95 ? 46   ILE A O     1 
ATOM   364  C  CB    . ILE A 1 64  ? 20.304  31.610 52.805 1.00 34.54 ? 46   ILE A CB    1 
ATOM   365  C  CG1   . ILE A 1 64  ? 19.059  32.004 53.646 1.00 32.53 ? 46   ILE A CG1   1 
ATOM   366  C  CG2   . ILE A 1 64  ? 19.962  30.527 51.813 1.00 32.41 ? 46   ILE A CG2   1 
ATOM   367  C  CD1   . ILE A 1 64  ? 18.655  31.019 54.763 1.00 31.44 ? 46   ILE A CD1   1 
ATOM   368  N  N     . LYS A 1 65  ? 23.032  29.432 52.970 1.00 34.75 ? 47   LYS A N     1 
ATOM   369  C  CA    . LYS A 1 65  ? 24.103  28.819 52.236 1.00 35.96 ? 47   LYS A CA    1 
ATOM   370  C  C     . LYS A 1 65  ? 23.652  27.889 51.082 1.00 35.60 ? 47   LYS A C     1 
ATOM   371  O  O     . LYS A 1 65  ? 24.477  27.572 50.227 1.00 35.77 ? 47   LYS A O     1 
ATOM   372  C  CB    . LYS A 1 65  ? 25.012  28.047 53.228 1.00 37.06 ? 47   LYS A CB    1 
ATOM   373  C  CG    . LYS A 1 65  ? 25.413  28.845 54.519 1.00 41.09 ? 47   LYS A CG    1 
ATOM   374  C  CD    . LYS A 1 65  ? 26.618  29.806 54.378 1.00 47.98 ? 47   LYS A CD    1 
ATOM   375  C  CE    . LYS A 1 65  ? 26.271  31.147 53.681 1.00 52.70 ? 47   LYS A CE    1 
ATOM   376  N  NZ    . LYS A 1 65  ? 26.911  32.349 54.386 1.00 53.07 ? 47   LYS A NZ    1 
ATOM   377  N  N     . CYS A 1 66  ? 22.400  27.394 51.120 1.00 34.25 ? 48   CYS A N     1 
ATOM   378  C  CA    . CYS A 1 66  ? 21.801  26.538 50.076 1.00 33.53 ? 48   CYS A CA    1 
ATOM   379  C  C     . CYS A 1 66  ? 20.412  26.967 49.741 1.00 30.92 ? 48   CYS A C     1 
ATOM   380  O  O     . CYS A 1 66  ? 19.574  27.198 50.609 1.00 29.69 ? 48   CYS A O     1 
ATOM   381  C  CB    . CYS A 1 66  ? 21.643  25.080 50.466 1.00 33.30 ? 48   CYS A CB    1 
ATOM   382  S  SG    . CYS A 1 66  ? 23.040  24.416 51.141 1.00 43.42 ? 48   CYS A SG    1 
ATOM   383  N  N     . PHE A 1 67  ? 20.141  27.027 48.460 1.00 29.43 ? 49   PHE A N     1 
ATOM   384  C  CA    . PHE A 1 67  ? 18.809  27.325 48.060 1.00 27.19 ? 49   PHE A CA    1 
ATOM   385  C  C     . PHE A 1 67  ? 18.280  26.067 47.439 1.00 26.50 ? 49   PHE A C     1 
ATOM   386  O  O     . PHE A 1 67  ? 18.928  25.477 46.555 1.00 27.46 ? 49   PHE A O     1 
ATOM   387  C  CB    . PHE A 1 67  ? 18.850  28.439 47.072 1.00 27.34 ? 49   PHE A CB    1 
ATOM   388  C  CG    . PHE A 1 67  ? 19.505  29.711 47.597 1.00 28.02 ? 49   PHE A CG    1 
ATOM   389  C  CD1   . PHE A 1 67  ? 18.736  30.692 48.243 1.00 27.95 ? 49   PHE A CD1   1 
ATOM   390  C  CD2   . PHE A 1 67  ? 20.870  29.939 47.399 1.00 28.89 ? 49   PHE A CD2   1 
ATOM   391  C  CE1   . PHE A 1 67  ? 19.297  31.883 48.687 1.00 29.73 ? 49   PHE A CE1   1 
ATOM   392  C  CE2   . PHE A 1 67  ? 21.471  31.112 47.855 1.00 32.30 ? 49   PHE A CE2   1 
ATOM   393  C  CZ    . PHE A 1 67  ? 20.653  32.121 48.485 1.00 31.99 ? 49   PHE A CZ    1 
ATOM   394  N  N     . GLY A 1 68  ? 17.122  25.622 47.889 1.00 24.42 ? 50   GLY A N     1 
ATOM   395  C  CA    . GLY A 1 68  ? 16.562  24.427 47.302 1.00 23.66 ? 50   GLY A CA    1 
ATOM   396  C  C     . GLY A 1 68  ? 15.239  24.720 46.673 1.00 23.73 ? 50   GLY A C     1 
ATOM   397  O  O     . GLY A 1 68  ? 14.500  25.609 47.135 1.00 24.47 ? 50   GLY A O     1 
ATOM   398  N  N     . PHE A 1 69  ? 14.929  23.984 45.622 1.00 23.59 ? 51   PHE A N     1 
ATOM   399  C  CA    . PHE A 1 69  ? 13.693  24.269 44.823 1.00 24.35 ? 51   PHE A CA    1 
ATOM   400  C  C     . PHE A 1 69  ? 12.973  22.993 44.540 1.00 23.35 ? 51   PHE A C     1 
ATOM   401  O  O     . PHE A 1 69  ? 13.550  21.943 44.417 1.00 23.35 ? 51   PHE A O     1 
ATOM   402  C  CB    . PHE A 1 69  ? 13.957  24.912 43.438 1.00 24.61 ? 51   PHE A CB    1 
ATOM   403  C  CG    . PHE A 1 69  ? 14.532  26.268 43.471 1.00 23.81 ? 51   PHE A CG    1 
ATOM   404  C  CD1   . PHE A 1 69  ? 13.733  27.367 43.223 1.00 23.19 ? 51   PHE A CD1   1 
ATOM   405  C  CD2   . PHE A 1 69  ? 15.905  26.445 43.705 1.00 25.97 ? 51   PHE A CD2   1 
ATOM   406  C  CE1   . PHE A 1 69  ? 14.275  28.669 43.216 1.00 24.82 ? 51   PHE A CE1   1 
ATOM   407  C  CE2   . PHE A 1 69  ? 16.474  27.719 43.719 1.00 23.98 ? 51   PHE A CE2   1 
ATOM   408  C  CZ    . PHE A 1 69  ? 15.638  28.852 43.490 1.00 25.03 ? 51   PHE A CZ    1 
ATOM   409  N  N     . ASN A 1 70  ? 11.686  23.128 44.445 1.00 24.23 ? 52   ASN A N     1 
ATOM   410  C  CA    . ASN A 1 70  ? 10.794  22.095 44.028 1.00 24.59 ? 52   ASN A CA    1 
ATOM   411  C  C     . ASN A 1 70  ? 10.473  22.482 42.585 1.00 23.80 ? 52   ASN A C     1 
ATOM   412  O  O     . ASN A 1 70  ? 10.670  23.635 42.210 1.00 23.21 ? 52   ASN A O     1 
ATOM   413  C  CB    . ASN A 1 70  ? 9.556   22.282 44.911 1.00 26.57 ? 52   ASN A CB    1 
ATOM   414  C  CG    . ASN A 1 70  ? 8.481   21.386 44.533 1.00 28.35 ? 52   ASN A CG    1 
ATOM   415  O  OD1   . ASN A 1 70  ? 8.712   20.170 44.660 1.00 34.67 ? 52   ASN A OD1   1 
ATOM   416  N  ND2   . ASN A 1 70  ? 7.468   21.899 44.044 1.00 28.45 ? 52   ASN A ND2   1 
ATOM   417  N  N     . MET A 1 71  ? 9.956   21.552 41.795 1.00 23.24 ? 53   MET A N     1 
ATOM   418  C  CA    . MET A 1 71  ? 9.733   21.805 40.420 1.00 24.71 ? 53   MET A CA    1 
ATOM   419  C  C     . MET A 1 71  ? 8.311   22.176 40.101 1.00 23.86 ? 53   MET A C     1 
ATOM   420  O  O     . MET A 1 71  ? 8.043   23.301 39.721 1.00 23.69 ? 53   MET A O     1 
ATOM   421  C  CB    . MET A 1 71  ? 10.141  20.621 39.542 1.00 26.28 ? 53   MET A CB    1 
ATOM   422  C  CG    . MET A 1 71  ? 10.064  21.017 38.065 1.00 25.21 ? 53   MET A CG    1 
ATOM   423  S  SD    . MET A 1 71  ? 10.425  19.656 36.972 1.00 29.59 ? 53   MET A SD    1 
ATOM   424  C  CE    . MET A 1 71  ? 8.994   18.582 37.117 1.00 22.70 ? 53   MET A CE    1 
ATOM   425  N  N     . ASP A 1 72  ? 7.404   21.225 40.220 1.00 24.25 ? 54   ASP A N     1 
ATOM   426  C  CA    . ASP A 1 72  ? 5.981   21.466 39.876 1.00 26.35 ? 54   ASP A CA    1 
ATOM   427  C  C     . ASP A 1 72  ? 5.283   22.484 40.746 1.00 26.67 ? 54   ASP A C     1 
ATOM   428  O  O     . ASP A 1 72  ? 5.298   22.364 41.992 1.00 26.03 ? 54   ASP A O     1 
ATOM   429  C  CB    . ASP A 1 72  ? 5.204   20.181 39.863 1.00 27.42 ? 54   ASP A CB    1 
ATOM   430  C  CG    . ASP A 1 72  ? 5.468   19.376 38.611 1.00 31.51 ? 54   ASP A CG    1 
ATOM   431  O  OD1   . ASP A 1 72  ? 6.078   19.910 37.689 1.00 36.94 ? 54   ASP A OD1   1 
ATOM   432  O  OD2   . ASP A 1 72  ? 4.994   18.247 38.487 1.00 39.47 ? 54   ASP A OD2   1 
ATOM   433  N  N     . TYR A 1 73  ? 4.697   23.472 40.050 1.00 25.88 ? 55   TYR A N     1 
ATOM   434  C  CA    . TYR A 1 73  ? 4.056   24.658 40.590 1.00 25.67 ? 55   TYR A CA    1 
ATOM   435  C  C     . TYR A 1 73  ? 4.973   25.557 41.386 1.00 26.06 ? 55   TYR A C     1 
ATOM   436  O  O     . TYR A 1 73  ? 4.522   26.475 42.092 1.00 26.81 ? 55   TYR A O     1 
ATOM   437  C  CB    . TYR A 1 73  ? 2.774   24.299 41.354 1.00 25.47 ? 55   TYR A CB    1 
ATOM   438  C  CG    . TYR A 1 73  ? 1.532   24.096 40.448 1.00 25.14 ? 55   TYR A CG    1 
ATOM   439  C  CD1   . TYR A 1 73  ? 0.986   25.157 39.696 1.00 20.32 ? 55   TYR A CD1   1 
ATOM   440  C  CD2   . TYR A 1 73  ? 0.922   22.861 40.356 1.00 23.51 ? 55   TYR A CD2   1 
ATOM   441  C  CE1   . TYR A 1 73  ? -0.129  24.968 38.902 1.00 21.15 ? 55   TYR A CE1   1 
ATOM   442  C  CE2   . TYR A 1 73  ? -0.189  22.680 39.554 1.00 21.71 ? 55   TYR A CE2   1 
ATOM   443  C  CZ    . TYR A 1 73  ? -0.715  23.725 38.866 1.00 21.78 ? 55   TYR A CZ    1 
ATOM   444  O  OH    . TYR A 1 73  ? -1.861  23.494 38.146 1.00 25.17 ? 55   TYR A OH    1 
ATOM   445  N  N     . THR A 1 74  ? 6.272   25.329 41.244 1.00 25.60 ? 56   THR A N     1 
ATOM   446  C  CA    . THR A 1 74  ? 7.289   26.207 41.835 1.00 24.43 ? 56   THR A CA    1 
ATOM   447  C  C     . THR A 1 74  ? 8.158   26.734 40.700 1.00 23.92 ? 56   THR A C     1 
ATOM   448  O  O     . THR A 1 74  ? 8.036   27.896 40.366 1.00 24.48 ? 56   THR A O     1 
ATOM   449  C  CB    . THR A 1 74  ? 8.123   25.478 42.915 1.00 24.23 ? 56   THR A CB    1 
ATOM   450  O  OG1   . THR A 1 74  ? 7.271   25.069 43.976 1.00 28.53 ? 56   THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 74  ? 9.244   26.341 43.511 1.00 22.45 ? 56   THR A CG2   1 
ATOM   452  N  N     . LEU A 1 75  ? 9.040   25.907 40.125 1.00 23.31 ? 57   LEU A N     1 
ATOM   453  C  CA    . LEU A 1 75  ? 9.862   26.351 38.990 1.00 23.97 ? 57   LEU A CA    1 
ATOM   454  C  C     . LEU A 1 75  ? 8.959   26.313 37.713 1.00 24.85 ? 57   LEU A C     1 
ATOM   455  O  O     . LEU A 1 75  ? 9.040   27.184 36.848 1.00 25.39 ? 57   LEU A O     1 
ATOM   456  C  CB    . LEU A 1 75  ? 11.054  25.445 38.828 1.00 23.77 ? 57   LEU A CB    1 
ATOM   457  C  CG    . LEU A 1 75  ? 12.279  25.651 39.760 1.00 27.00 ? 57   LEU A CG    1 
ATOM   458  C  CD1   . LEU A 1 75  ? 13.348  24.625 39.462 1.00 28.98 ? 57   LEU A CD1   1 
ATOM   459  C  CD2   . LEU A 1 75  ? 12.918  27.023 39.717 1.00 26.35 ? 57   LEU A CD2   1 
ATOM   460  N  N     . ALA A 1 76  ? 8.055   25.334 37.652 1.00 23.21 ? 58   ALA A N     1 
ATOM   461  C  CA    . ALA A 1 76  ? 7.258   25.081 36.496 1.00 23.67 ? 58   ALA A CA    1 
ATOM   462  C  C     . ALA A 1 76  ? 5.840   25.338 36.918 1.00 23.24 ? 58   ALA A C     1 
ATOM   463  O  O     . ALA A 1 76  ? 5.195   24.487 37.512 1.00 22.57 ? 58   ALA A O     1 
ATOM   464  C  CB    . ALA A 1 76  ? 7.441   23.625 36.039 1.00 20.61 ? 58   ALA A CB    1 
ATOM   465  N  N     . VAL A 1 77  ? 5.364   26.542 36.626 1.00 24.39 ? 59   VAL A N     1 
ATOM   466  C  CA    . VAL A 1 77  ? 4.014   26.915 36.965 1.00 24.15 ? 59   VAL A CA    1 
ATOM   467  C  C     . VAL A 1 77  ? 3.092   26.623 35.774 1.00 25.81 ? 59   VAL A C     1 
ATOM   468  O  O     . VAL A 1 77  ? 3.257   27.160 34.694 1.00 27.53 ? 59   VAL A O     1 
ATOM   469  C  CB    . VAL A 1 77  ? 3.917   28.396 37.409 1.00 23.98 ? 59   VAL A CB    1 
ATOM   470  C  CG1   . VAL A 1 77  ? 2.464   28.833 37.537 1.00 21.42 ? 59   VAL A CG1   1 
ATOM   471  C  CG2   . VAL A 1 77  ? 4.660   28.618 38.723 1.00 21.61 ? 59   VAL A CG2   1 
ATOM   472  N  N     . TYR A 1 78  ? 2.081   25.808 35.995 1.00 26.92 ? 60   TYR A N     1 
ATOM   473  C  CA    . TYR A 1 78  ? 1.173   25.434 34.907 1.00 26.31 ? 60   TYR A CA    1 
ATOM   474  C  C     . TYR A 1 78  ? 0.114   26.473 34.635 1.00 26.47 ? 60   TYR A C     1 
ATOM   475  O  O     . TYR A 1 78  ? -0.507  27.022 35.545 1.00 25.41 ? 60   TYR A O     1 
ATOM   476  C  CB    . TYR A 1 78  ? 0.569   24.084 35.228 1.00 25.10 ? 60   TYR A CB    1 
ATOM   477  C  CG    . TYR A 1 78  ? 1.619   22.998 35.294 1.00 25.75 ? 60   TYR A CG    1 
ATOM   478  C  CD1   . TYR A 1 78  ? 2.164   22.470 34.095 1.00 22.91 ? 60   TYR A CD1   1 
ATOM   479  C  CD2   . TYR A 1 78  ? 2.101   22.507 36.557 1.00 24.84 ? 60   TYR A CD2   1 
ATOM   480  C  CE1   . TYR A 1 78  ? 3.125   21.487 34.120 1.00 22.49 ? 60   TYR A CE1   1 
ATOM   481  C  CE2   . TYR A 1 78  ? 3.029   21.517 36.623 1.00 22.05 ? 60   TYR A CE2   1 
ATOM   482  C  CZ    . TYR A 1 78  ? 3.565   20.991 35.365 1.00 26.96 ? 60   TYR A CZ    1 
ATOM   483  O  OH    . TYR A 1 78  ? 4.568   20.004 35.349 1.00 26.65 ? 60   TYR A OH    1 
ATOM   484  N  N     . LYS A 1 79  ? -0.146  26.717 33.354 1.00 28.28 ? 61   LYS A N     1 
ATOM   485  C  CA    . LYS A 1 79  ? -1.129  27.741 32.969 1.00 28.13 ? 61   LYS A CA    1 
ATOM   486  C  C     . LYS A 1 79  ? -2.568  27.393 33.324 1.00 27.90 ? 61   LYS A C     1 
ATOM   487  O  O     . LYS A 1 79  ? -3.000  26.258 33.201 1.00 27.98 ? 61   LYS A O     1 
ATOM   488  C  CB    . LYS A 1 79  ? -0.987  28.095 31.513 1.00 27.97 ? 61   LYS A CB    1 
ATOM   489  C  CG    . LYS A 1 79  ? 0.215   28.908 31.316 1.00 29.19 ? 61   LYS A CG    1 
ATOM   490  C  CD    . LYS A 1 79  ? 0.478   29.143 29.865 1.00 30.22 ? 61   LYS A CD    1 
ATOM   491  C  CE    . LYS A 1 79  ? 1.734   29.956 29.833 1.00 28.68 ? 61   LYS A CE    1 
ATOM   492  N  NZ    . LYS A 1 79  ? 2.050   30.218 28.428 1.00 33.25 ? 61   LYS A NZ    1 
ATOM   493  N  N     . SER A 1 80  ? -3.286  28.407 33.783 1.00 28.09 ? 62   SER A N     1 
ATOM   494  C  CA    . SER A 1 80  ? -4.646  28.241 34.284 1.00 28.45 ? 62   SER A CA    1 
ATOM   495  C  C     . SER A 1 80  ? -5.563  29.066 33.417 1.00 27.99 ? 62   SER A C     1 
ATOM   496  O  O     . SER A 1 80  ? -5.191  30.190 33.075 1.00 27.99 ? 62   SER A O     1 
ATOM   497  C  CB    . SER A 1 80  ? -4.709  28.783 35.720 1.00 27.61 ? 62   SER A CB    1 
ATOM   498  O  OG    . SER A 1 80  ? -6.050  28.790 36.151 1.00 28.10 ? 62   SER A OG    1 
ATOM   499  N  N     . PRO A 1 81  ? -6.780  28.569 33.107 1.00 28.34 ? 63   PRO A N     1 
ATOM   500  C  CA    . PRO A 1 81  ? -7.407  27.268 33.458 1.00 27.57 ? 63   PRO A CA    1 
ATOM   501  C  C     . PRO A 1 81  ? -6.999  26.099 32.564 1.00 27.89 ? 63   PRO A C     1 
ATOM   502  O  O     . PRO A 1 81  ? -7.442  24.992 32.820 1.00 28.85 ? 63   PRO A O     1 
ATOM   503  C  CB    . PRO A 1 81  ? -8.891  27.543 33.277 1.00 27.43 ? 63   PRO A CB    1 
ATOM   504  C  CG    . PRO A 1 81  ? -8.938  28.567 32.087 1.00 28.47 ? 63   PRO A CG    1 
ATOM   505  C  CD    . PRO A 1 81  ? -7.697  29.437 32.311 1.00 27.58 ? 63   PRO A CD    1 
ATOM   506  N  N     . GLU A 1 82  ? -6.105  26.293 31.585 1.00 28.02 ? 64   GLU A N     1 
ATOM   507  C  CA    . GLU A 1 82  ? -5.853  25.223 30.594 1.00 26.94 ? 64   GLU A CA    1 
ATOM   508  C  C     . GLU A 1 82  ? -5.339  23.951 31.219 1.00 26.37 ? 64   GLU A C     1 
ATOM   509  O  O     . GLU A 1 82  ? -5.780  22.896 30.866 1.00 24.67 ? 64   GLU A O     1 
ATOM   510  C  CB    . GLU A 1 82  ? -4.858  25.643 29.492 1.00 27.70 ? 64   GLU A CB    1 
ATOM   511  C  CG    . GLU A 1 82  ? -5.416  26.575 28.391 1.00 29.91 ? 64   GLU A CG    1 
ATOM   512  C  CD    . GLU A 1 82  ? -5.568  28.033 28.866 1.00 37.41 ? 64   GLU A CD    1 
ATOM   513  O  OE1   . GLU A 1 82  ? -5.000  28.379 29.940 1.00 38.69 ? 64   GLU A OE1   1 
ATOM   514  O  OE2   . GLU A 1 82  ? -6.279  28.844 28.185 1.00 42.11 ? 64   GLU A OE2   1 
ATOM   515  N  N     . TYR A 1 83  ? -4.375  24.033 32.147 1.00 25.33 ? 65   TYR A N     1 
ATOM   516  C  CA    . TYR A 1 83  ? -3.856  22.776 32.707 1.00 24.03 ? 65   TYR A CA    1 
ATOM   517  C  C     . TYR A 1 83  ? -4.887  22.080 33.650 1.00 23.98 ? 65   TYR A C     1 
ATOM   518  O  O     . TYR A 1 83  ? -5.001  20.872 33.654 1.00 24.06 ? 65   TYR A O     1 
ATOM   519  C  CB    . TYR A 1 83  ? -2.519  23.050 33.370 1.00 23.46 ? 65   TYR A CB    1 
ATOM   520  C  CG    . TYR A 1 83  ? -1.819  21.823 33.898 1.00 22.94 ? 65   TYR A CG    1 
ATOM   521  C  CD1   . TYR A 1 83  ? -1.167  20.956 33.039 1.00 20.79 ? 65   TYR A CD1   1 
ATOM   522  C  CD2   . TYR A 1 83  ? -1.769  21.554 35.286 1.00 22.54 ? 65   TYR A CD2   1 
ATOM   523  C  CE1   . TYR A 1 83  ? -0.505  19.839 33.493 1.00 21.15 ? 65   TYR A CE1   1 
ATOM   524  C  CE2   . TYR A 1 83  ? -1.120  20.381 35.760 1.00 20.38 ? 65   TYR A CE2   1 
ATOM   525  C  CZ    . TYR A 1 83  ? -0.499  19.547 34.871 1.00 20.72 ? 65   TYR A CZ    1 
ATOM   526  O  OH    . TYR A 1 83  ? 0.210   18.456 35.315 1.00 20.77 ? 65   TYR A OH    1 
ATOM   527  N  N     . GLU A 1 84  ? -5.625  22.849 34.453 1.00 23.68 ? 66   GLU A N     1 
ATOM   528  C  CA    . GLU A 1 84  ? -6.599  22.274 35.354 1.00 24.86 ? 66   GLU A CA    1 
ATOM   529  C  C     . GLU A 1 84  ? -7.636  21.596 34.487 1.00 25.01 ? 66   GLU A C     1 
ATOM   530  O  O     . GLU A 1 84  ? -8.103  20.477 34.773 1.00 24.24 ? 66   GLU A O     1 
ATOM   531  C  CB    . GLU A 1 84  ? -7.322  23.356 36.204 1.00 26.04 ? 66   GLU A CB    1 
ATOM   532  C  CG    . GLU A 1 84  ? -6.487  24.069 37.251 1.00 27.69 ? 66   GLU A CG    1 
ATOM   533  C  CD    . GLU A 1 84  ? -5.885  25.348 36.709 1.00 32.17 ? 66   GLU A CD    1 
ATOM   534  O  OE1   . GLU A 1 84  ? -5.180  25.267 35.670 1.00 28.22 ? 66   GLU A OE1   1 
ATOM   535  O  OE2   . GLU A 1 84  ? -6.114  26.426 37.327 1.00 30.95 ? 66   GLU A OE2   1 
ATOM   536  N  N     . SER A 1 85  ? -8.022  22.340 33.440 1.00 24.93 ? 67   SER A N     1 
ATOM   537  C  CA    . SER A 1 85  ? -9.000  21.878 32.509 1.00 26.28 ? 67   SER A CA    1 
ATOM   538  C  C     . SER A 1 85  ? -8.561  20.586 31.748 1.00 25.94 ? 67   SER A C     1 
ATOM   539  O  O     . SER A 1 85  ? -9.322  19.655 31.627 1.00 27.40 ? 67   SER A O     1 
ATOM   540  C  CB    . SER A 1 85  ? -9.407  23.034 31.610 1.00 26.70 ? 67   SER A CB    1 
ATOM   541  O  OG    . SER A 1 85  ? -10.350 22.508 30.759 1.00 31.22 ? 67   SER A OG    1 
ATOM   542  N  N     . LEU A 1 86  ? -7.289  20.464 31.376 1.00 26.66 ? 68   LEU A N     1 
ATOM   543  C  CA    . LEU A 1 86  ? -6.751  19.180 30.882 1.00 26.48 ? 68   LEU A CA    1 
ATOM   544  C  C     . LEU A 1 86  ? -6.839  18.057 31.907 1.00 26.73 ? 68   LEU A C     1 
ATOM   545  O  O     . LEU A 1 86  ? -7.249  16.967 31.592 1.00 28.25 ? 68   LEU A O     1 
ATOM   546  C  CB    . LEU A 1 86  ? -5.320  19.351 30.389 1.00 26.05 ? 68   LEU A CB    1 
ATOM   547  C  CG    . LEU A 1 86  ? -4.597  18.095 29.870 1.00 27.74 ? 68   LEU A CG    1 
ATOM   548  C  CD1   . LEU A 1 86  ? -5.256  17.587 28.579 1.00 28.97 ? 68   LEU A CD1   1 
ATOM   549  C  CD2   . LEU A 1 86  ? -3.113  18.266 29.705 1.00 25.07 ? 68   LEU A CD2   1 
ATOM   550  N  N     . GLY A 1 87  ? -6.461  18.304 33.159 1.00 26.75 ? 69   GLY A N     1 
ATOM   551  C  CA    . GLY A 1 87  ? -6.498  17.236 34.160 1.00 24.60 ? 69   GLY A CA    1 
ATOM   552  C  C     . GLY A 1 87  ? -7.900  16.800 34.467 1.00 24.15 ? 69   GLY A C     1 
ATOM   553  O  O     . GLY A 1 87  ? -8.154  15.613 34.712 1.00 24.47 ? 69   GLY A O     1 
ATOM   554  N  N     . PHE A 1 88  ? -8.801  17.772 34.493 1.00 23.96 ? 70   PHE A N     1 
ATOM   555  C  CA    . PHE A 1 88  ? -10.244 17.524 34.686 1.00 24.59 ? 70   PHE A CA    1 
ATOM   556  C  C     . PHE A 1 88  ? -10.828 16.579 33.601 1.00 25.04 ? 70   PHE A C     1 
ATOM   557  O  O     . PHE A 1 88  ? -11.514 15.566 33.943 1.00 23.40 ? 70   PHE A O     1 
ATOM   558  C  CB    . PHE A 1 88  ? -10.999 18.868 34.774 1.00 23.30 ? 70   PHE A CB    1 
ATOM   559  C  CG    . PHE A 1 88  ? -12.511 18.723 34.975 1.00 22.96 ? 70   PHE A CG    1 
ATOM   560  C  CD1   . PHE A 1 88  ? -13.066 18.727 36.253 1.00 18.64 ? 70   PHE A CD1   1 
ATOM   561  C  CD2   . PHE A 1 88  ? -13.378 18.568 33.859 1.00 23.06 ? 70   PHE A CD2   1 
ATOM   562  C  CE1   . PHE A 1 88  ? -14.426 18.611 36.445 1.00 21.35 ? 70   PHE A CE1   1 
ATOM   563  C  CE2   . PHE A 1 88  ? -14.775 18.435 34.030 1.00 20.73 ? 70   PHE A CE2   1 
ATOM   564  C  CZ    . PHE A 1 88  ? -15.305 18.467 35.304 1.00 24.43 ? 70   PHE A CZ    1 
ATOM   565  N  N     A GLU A 1 89  ? -10.497 16.883 32.334 0.50 25.63 ? 71   GLU A N     1 
ATOM   566  N  N     B GLU A 1 89  ? -10.578 16.839 32.315 0.50 25.80 ? 71   GLU A N     1 
ATOM   567  C  CA    A GLU A 1 89  ? -10.942 16.074 31.161 0.50 27.06 ? 71   GLU A CA    1 
ATOM   568  C  CA    B GLU A 1 89  ? -11.192 15.918 31.304 0.50 26.66 ? 71   GLU A CA    1 
ATOM   569  C  C     A GLU A 1 89  ? -10.510 14.630 31.263 0.50 25.98 ? 71   GLU A C     1 
ATOM   570  C  C     B GLU A 1 89  ? -10.520 14.537 31.220 0.50 25.99 ? 71   GLU A C     1 
ATOM   571  O  O     A GLU A 1 89  ? -11.306 13.710 31.127 0.50 26.43 ? 71   GLU A O     1 
ATOM   572  O  O     B GLU A 1 89  ? -11.185 13.542 30.941 0.50 26.23 ? 71   GLU A O     1 
ATOM   573  C  CB    A GLU A 1 89  ? -10.387 16.653 29.860 0.50 26.40 ? 71   GLU A CB    1 
ATOM   574  C  CB    B GLU A 1 89  ? -11.407 16.575 29.932 0.50 27.34 ? 71   GLU A CB    1 
ATOM   575  C  CG    A GLU A 1 89  ? -11.033 17.981 29.457 0.50 28.72 ? 71   GLU A CG    1 
ATOM   576  C  CG    B GLU A 1 89  ? -12.803 17.262 29.753 0.50 30.13 ? 71   GLU A CG    1 
ATOM   577  C  CD    A GLU A 1 89  ? -10.503 18.499 28.105 0.50 30.15 ? 71   GLU A CD    1 
ATOM   578  C  CD    B GLU A 1 89  ? -14.023 16.292 29.804 0.50 34.87 ? 71   GLU A CD    1 
ATOM   579  O  OE1   A GLU A 1 89  ? -9.928  19.627 28.070 0.50 34.47 ? 71   GLU A OE1   1 
ATOM   580  O  OE1   B GLU A 1 89  ? -13.956 15.156 29.222 0.50 31.70 ? 71   GLU A OE1   1 
ATOM   581  O  OE2   A GLU A 1 89  ? -10.640 17.752 27.095 0.50 33.39 ? 71   GLU A OE2   1 
ATOM   582  O  OE2   B GLU A 1 89  ? -15.063 16.696 30.417 0.50 33.69 ? 71   GLU A OE2   1 
ATOM   583  N  N     . LEU A 1 90  ? -9.226  14.448 31.517 1.00 25.84 ? 72   LEU A N     1 
ATOM   584  C  CA    . LEU A 1 90  ? -8.615  13.132 31.622 1.00 25.28 ? 72   LEU A CA    1 
ATOM   585  C  C     . LEU A 1 90  ? -9.097  12.326 32.816 1.00 25.93 ? 72   LEU A C     1 
ATOM   586  O  O     . LEU A 1 90  ? -9.153  11.088 32.722 1.00 26.03 ? 72   LEU A O     1 
ATOM   587  C  CB    . LEU A 1 90  ? -7.084  13.247 31.657 1.00 25.70 ? 72   LEU A CB    1 
ATOM   588  C  CG    . LEU A 1 90  ? -6.405  13.897 30.425 1.00 26.96 ? 72   LEU A CG    1 
ATOM   589  C  CD1   . LEU A 1 90  ? -4.887  13.998 30.610 1.00 25.24 ? 72   LEU A CD1   1 
ATOM   590  C  CD2   . LEU A 1 90  ? -6.701  13.126 29.169 1.00 25.17 ? 72   LEU A CD2   1 
ATOM   591  N  N     . THR A 1 91  ? -9.437  13.004 33.933 1.00 25.28 ? 73   THR A N     1 
ATOM   592  C  CA    . THR A 1 91  ? -9.962  12.313 35.130 1.00 25.25 ? 73   THR A CA    1 
ATOM   593  C  C     . THR A 1 91  ? -11.399 11.874 34.880 1.00 25.95 ? 73   THR A C     1 
ATOM   594  O  O     . THR A 1 91  ? -11.767 10.760 35.235 1.00 26.95 ? 73   THR A O     1 
ATOM   595  C  CB    . THR A 1 91  ? -9.902  13.233 36.362 1.00 25.29 ? 73   THR A CB    1 
ATOM   596  O  OG1   . THR A 1 91  ? -8.541  13.648 36.548 1.00 25.28 ? 73   THR A OG1   1 
ATOM   597  C  CG2   . THR A 1 91  ? -10.455 12.545 37.643 1.00 21.43 ? 73   THR A CG2   1 
ATOM   598  N  N     . VAL A 1 92  ? -12.209 12.758 34.296 1.00 25.87 ? 74   VAL A N     1 
ATOM   599  C  CA    . VAL A 1 92  ? -13.560 12.404 33.840 1.00 26.34 ? 74   VAL A CA    1 
ATOM   600  C  C     . VAL A 1 92  ? -13.480 11.183 32.891 1.00 27.45 ? 74   VAL A C     1 
ATOM   601  O  O     . VAL A 1 92  ? -14.175 10.190 33.086 1.00 26.97 ? 74   VAL A O     1 
ATOM   602  C  CB    . VAL A 1 92  ? -14.258 13.630 33.163 1.00 26.01 ? 74   VAL A CB    1 
ATOM   603  C  CG1   . VAL A 1 92  ? -15.503 13.200 32.352 1.00 27.24 ? 74   VAL A CG1   1 
ATOM   604  C  CG2   . VAL A 1 92  ? -14.645 14.636 34.223 1.00 23.64 ? 74   VAL A CG2   1 
ATOM   605  N  N     A GLU A 1 93  ? -12.587 11.236 31.904 0.50 27.68 ? 75   GLU A N     1 
ATOM   606  N  N     B GLU A 1 93  ? -12.603 11.278 31.892 0.50 27.85 ? 75   GLU A N     1 
ATOM   607  C  CA    A GLU A 1 93  ? -12.493 10.162 30.899 0.50 27.89 ? 75   GLU A CA    1 
ATOM   608  C  CA    B GLU A 1 93  ? -12.444 10.227 30.887 0.50 28.36 ? 75   GLU A CA    1 
ATOM   609  C  C     A GLU A 1 93  ? -12.089 8.858  31.533 0.50 27.67 ? 75   GLU A C     1 
ATOM   610  C  C     B GLU A 1 93  ? -12.169 8.913  31.599 0.50 27.83 ? 75   GLU A C     1 
ATOM   611  O  O     A GLU A 1 93  ? -12.548 7.800  31.134 0.50 27.75 ? 75   GLU A O     1 
ATOM   612  O  O     B GLU A 1 93  ? -12.819 7.916  31.336 0.50 27.87 ? 75   GLU A O     1 
ATOM   613  C  CB    A GLU A 1 93  ? -11.564 10.560 29.739 0.50 27.22 ? 75   GLU A CB    1 
ATOM   614  C  CB    B GLU A 1 93  ? -11.348 10.606 29.862 0.50 27.49 ? 75   GLU A CB    1 
ATOM   615  C  CG    A GLU A 1 93  ? -12.250 11.514 28.801 0.50 29.19 ? 75   GLU A CG    1 
ATOM   616  C  CG    B GLU A 1 93  ? -10.810 9.428  29.096 0.50 29.84 ? 75   GLU A CG    1 
ATOM   617  C  CD    A GLU A 1 93  ? -11.370 12.059 27.701 0.50 30.97 ? 75   GLU A CD    1 
ATOM   618  C  CD    B GLU A 1 93  ? -9.718  9.757  28.093 0.50 29.52 ? 75   GLU A CD    1 
ATOM   619  O  OE1   A GLU A 1 93  ? -10.206 11.625 27.575 0.50 33.31 ? 75   GLU A OE1   1 
ATOM   620  O  OE1   B GLU A 1 93  ? -8.643  10.288 28.459 0.50 29.37 ? 75   GLU A OE1   1 
ATOM   621  O  OE2   A GLU A 1 93  ? -11.863 12.928 26.947 0.50 29.13 ? 75   GLU A OE2   1 
ATOM   622  O  OE2   B GLU A 1 93  ? -9.925  9.411  26.915 0.50 33.30 ? 75   GLU A OE2   1 
ATOM   623  N  N     . ARG A 1 94  ? -11.239 8.940  32.548 1.00 28.52 ? 76   ARG A N     1 
ATOM   624  C  CA    . ARG A 1 94  ? -10.848 7.734  33.349 1.00 28.58 ? 76   ARG A CA    1 
ATOM   625  C  C     . ARG A 1 94  ? -12.052 7.144  34.107 1.00 29.61 ? 76   ARG A C     1 
ATOM   626  O  O     . ARG A 1 94  ? -12.255 5.938  34.144 1.00 29.76 ? 76   ARG A O     1 
ATOM   627  C  CB    . ARG A 1 94  ? -9.704  8.110  34.312 1.00 28.10 ? 76   ARG A CB    1 
ATOM   628  C  CG    . ARG A 1 94  ? -9.198  7.002  35.229 1.00 27.04 ? 76   ARG A CG    1 
ATOM   629  C  CD    . ARG A 1 94  ? -8.987  5.706  34.483 1.00 28.68 ? 76   ARG A CD    1 
ATOM   630  N  NE    . ARG A 1 94  ? -8.605  4.671  35.444 1.00 31.06 ? 76   ARG A NE    1 
ATOM   631  C  CZ    . ARG A 1 94  ? -8.265  3.412  35.153 1.00 33.40 ? 76   ARG A CZ    1 
ATOM   632  N  NH1   . ARG A 1 94  ? -8.229  2.970  33.888 1.00 29.79 ? 76   ARG A NH1   1 
ATOM   633  N  NH2   . ARG A 1 94  ? -7.979  2.589  36.155 1.00 32.11 ? 76   ARG A NH2   1 
ATOM   634  N  N     . LEU A 1 95  ? -12.850 8.019  34.719 1.00 30.70 ? 77   LEU A N     1 
ATOM   635  C  CA    . LEU A 1 95  ? -13.980 7.563  35.505 1.00 30.83 ? 77   LEU A CA    1 
ATOM   636  C  C     . LEU A 1 95  ? -15.030 6.896  34.592 1.00 30.54 ? 77   LEU A C     1 
ATOM   637  O  O     . LEU A 1 95  ? -15.616 5.900  34.965 1.00 30.19 ? 77   LEU A O     1 
ATOM   638  C  CB    . LEU A 1 95  ? -14.613 8.732  36.286 1.00 30.02 ? 77   LEU A CB    1 
ATOM   639  C  CG    . LEU A 1 95  ? -13.947 9.371  37.535 1.00 28.12 ? 77   LEU A CG    1 
ATOM   640  C  CD1   . LEU A 1 95  ? -14.778 10.601 37.948 1.00 23.59 ? 77   LEU A CD1   1 
ATOM   641  C  CD2   . LEU A 1 95  ? -13.724 8.432  38.691 1.00 18.13 ? 77   LEU A CD2   1 
ATOM   642  N  N     . VAL A 1 96  ? -15.307 7.513  33.438 1.00 31.87 ? 78   VAL A N     1 
ATOM   643  C  CA    . VAL A 1 96  ? -16.260 6.973  32.467 1.00 31.29 ? 78   VAL A CA    1 
ATOM   644  C  C     . VAL A 1 96  ? -15.747 5.612  31.993 1.00 31.49 ? 78   VAL A C     1 
ATOM   645  O  O     . VAL A 1 96  ? -16.466 4.664  31.935 1.00 32.41 ? 78   VAL A O     1 
ATOM   646  C  CB    . VAL A 1 96  ? -16.531 7.941  31.279 1.00 31.82 ? 78   VAL A CB    1 
ATOM   647  C  CG1   . VAL A 1 96  ? -17.456 7.255  30.206 1.00 29.14 ? 78   VAL A CG1   1 
ATOM   648  C  CG2   . VAL A 1 96  ? -17.203 9.190  31.769 1.00 27.40 ? 78   VAL A CG2   1 
ATOM   649  N  N     . SER A 1 97  ? -14.464 5.512  31.740 1.00 32.71 ? 79   SER A N     1 
ATOM   650  C  CA    . SER A 1 97  ? -13.898 4.279  31.256 1.00 33.63 ? 79   SER A CA    1 
ATOM   651  C  C     . SER A 1 97  ? -13.960 3.098  32.275 1.00 34.05 ? 79   SER A C     1 
ATOM   652  O  O     . SER A 1 97  ? -14.023 1.935  31.864 1.00 33.59 ? 79   SER A O     1 
ATOM   653  C  CB    . SER A 1 97  ? -12.495 4.550  30.726 1.00 33.85 ? 79   SER A CB    1 
ATOM   654  O  OG    . SER A 1 97  ? -11.552 4.000  31.573 1.00 36.81 ? 79   SER A OG    1 
ATOM   655  N  N     . ILE A 1 98  ? -14.015 3.375  33.581 1.00 33.78 ? 80   ILE A N     1 
ATOM   656  C  CA    . ILE A 1 98  ? -14.241 2.291  34.562 1.00 33.87 ? 80   ILE A CA    1 
ATOM   657  C  C     . ILE A 1 98  ? -15.713 2.151  34.926 1.00 33.79 ? 80   ILE A C     1 
ATOM   658  O  O     . ILE A 1 98  ? -16.053 1.390  35.795 1.00 34.36 ? 80   ILE A O     1 
ATOM   659  C  CB    . ILE A 1 98  ? -13.397 2.463  35.897 1.00 34.81 ? 80   ILE A CB    1 
ATOM   660  C  CG1   . ILE A 1 98  ? -13.871 3.722  36.656 1.00 35.26 ? 80   ILE A CG1   1 
ATOM   661  C  CG2   . ILE A 1 98  ? -11.894 2.547  35.604 1.00 33.72 ? 80   ILE A CG2   1 
ATOM   662  C  CD1   . ILE A 1 98  ? -13.562 3.757  38.117 1.00 35.40 ? 80   ILE A CD1   1 
ATOM   663  N  N     . GLY A 1 99  ? -16.612 2.909  34.309 1.00 34.03 ? 81   GLY A N     1 
ATOM   664  C  CA    . GLY A 1 99  ? -18.001 2.612  34.533 1.00 33.73 ? 81   GLY A CA    1 
ATOM   665  C  C     . GLY A 1 99  ? -18.916 3.701  35.049 1.00 34.19 ? 81   GLY A C     1 
ATOM   666  O  O     . GLY A 1 99  ? -20.115 3.471  35.128 1.00 33.14 ? 81   GLY A O     1 
ATOM   667  N  N     . TYR A 1 100 ? -18.375 4.866  35.414 1.00 33.15 ? 82   TYR A N     1 
ATOM   668  C  CA    . TYR A 1 100 ? -19.235 6.010  35.666 1.00 33.37 ? 82   TYR A CA    1 
ATOM   669  C  C     . TYR A 1 100 ? -20.130 6.350  34.438 1.00 34.70 ? 82   TYR A C     1 
ATOM   670  O  O     . TYR A 1 100 ? -19.774 6.076  33.279 1.00 35.21 ? 82   TYR A O     1 
ATOM   671  C  CB    . TYR A 1 100 ? -18.403 7.214  36.166 1.00 32.43 ? 82   TYR A CB    1 
ATOM   672  C  CG    . TYR A 1 100 ? -18.144 7.136  37.646 1.00 31.29 ? 82   TYR A CG    1 
ATOM   673  C  CD1   . TYR A 1 100 ? -17.325 6.137  38.154 1.00 30.78 ? 82   TYR A CD1   1 
ATOM   674  C  CD2   . TYR A 1 100 ? -18.735 8.038  38.550 1.00 32.57 ? 82   TYR A CD2   1 
ATOM   675  C  CE1   . TYR A 1 100 ? -17.110 5.998  39.482 1.00 31.00 ? 82   TYR A CE1   1 
ATOM   676  C  CE2   . TYR A 1 100 ? -18.503 7.922  39.912 1.00 30.23 ? 82   TYR A CE2   1 
ATOM   677  C  CZ    . TYR A 1 100 ? -17.701 6.860  40.362 1.00 32.41 ? 82   TYR A CZ    1 
ATOM   678  O  OH    . TYR A 1 100 ? -17.404 6.650  41.683 1.00 29.71 ? 82   TYR A OH    1 
ATOM   679  N  N     . PRO A 1 101 ? -21.317 6.910  34.688 1.00 36.25 ? 83   PRO A N     1 
ATOM   680  C  CA    . PRO A 1 101 ? -22.152 7.165  33.533 1.00 37.88 ? 83   PRO A CA    1 
ATOM   681  C  C     . PRO A 1 101 ? -21.639 8.244  32.531 1.00 39.10 ? 83   PRO A C     1 
ATOM   682  O  O     . PRO A 1 101 ? -20.979 9.197  32.932 1.00 39.40 ? 83   PRO A O     1 
ATOM   683  C  CB    . PRO A 1 101 ? -23.500 7.534  34.157 1.00 37.61 ? 83   PRO A CB    1 
ATOM   684  C  CG    . PRO A 1 101 ? -23.154 7.996  35.501 1.00 37.47 ? 83   PRO A CG    1 
ATOM   685  C  CD    . PRO A 1 101 ? -21.980 7.273  35.948 1.00 35.41 ? 83   PRO A CD    1 
ATOM   686  N  N     . GLN A 1 102 ? -22.000 8.071  31.253 1.00 38.74 ? 84   GLN A N     1 
ATOM   687  C  CA    . GLN A 1 102 ? -21.579 8.899  30.157 1.00 40.04 ? 84   GLN A CA    1 
ATOM   688  C  C     . GLN A 1 102 ? -21.905 10.380 30.289 1.00 39.31 ? 84   GLN A C     1 
ATOM   689  O  O     . GLN A 1 102 ? -21.199 11.201 29.725 1.00 38.71 ? 84   GLN A O     1 
ATOM   690  C  CB    . GLN A 1 102 ? -22.200 8.358  28.847 1.00 42.47 ? 84   GLN A CB    1 
ATOM   691  C  CG    . GLN A 1 102 ? -21.829 6.887  28.546 1.00 46.43 ? 84   GLN A CG    1 
ATOM   692  C  CD    . GLN A 1 102 ? -20.539 6.760  27.766 1.00 53.47 ? 84   GLN A CD    1 
ATOM   693  O  OE1   . GLN A 1 102 ? -20.323 7.476  26.765 1.00 55.38 ? 84   GLN A OE1   1 
ATOM   694  N  NE2   . GLN A 1 102 ? -19.679 5.820  28.187 1.00 54.16 ? 84   GLN A NE2   1 
ATOM   695  N  N     . GLU A 1 103 ? -22.980 10.740 30.990 1.00 38.73 ? 85   GLU A N     1 
ATOM   696  C  CA    . GLU A 1 103 ? -23.247 12.148 31.249 1.00 38.55 ? 85   GLU A CA    1 
ATOM   697  C  C     . GLU A 1 103 ? -22.064 12.949 31.772 1.00 37.91 ? 85   GLU A C     1 
ATOM   698  O  O     . GLU A 1 103 ? -22.032 14.175 31.574 1.00 38.36 ? 85   GLU A O     1 
ATOM   699  C  CB    . GLU A 1 103 ? -24.341 12.325 32.275 1.00 39.90 ? 85   GLU A CB    1 
ATOM   700  C  CG    . GLU A 1 103 ? -25.710 12.067 31.748 1.00 43.23 ? 85   GLU A CG    1 
ATOM   701  C  CD    . GLU A 1 103 ? -26.133 10.659 32.000 1.00 46.86 ? 85   GLU A CD    1 
ATOM   702  O  OE1   . GLU A 1 103 ? -25.312 9.837  32.468 1.00 51.46 ? 85   GLU A OE1   1 
ATOM   703  O  OE2   . GLU A 1 103 ? -27.311 10.371 31.753 1.00 53.22 ? 85   GLU A OE2   1 
ATOM   704  N  N     . LEU A 1 104 ? -21.128 12.293 32.473 1.00 36.72 ? 86   LEU A N     1 
ATOM   705  C  CA    . LEU A 1 104 ? -19.905 12.970 32.981 1.00 34.87 ? 86   LEU A CA    1 
ATOM   706  C  C     . LEU A 1 104 ? -19.176 13.654 31.847 1.00 34.74 ? 86   LEU A C     1 
ATOM   707  O  O     . LEU A 1 104 ? -18.574 14.723 32.040 1.00 34.43 ? 86   LEU A O     1 
ATOM   708  C  CB    . LEU A 1 104 ? -18.958 11.988 33.662 1.00 34.54 ? 86   LEU A CB    1 
ATOM   709  C  CG    . LEU A 1 104 ? -19.139 11.693 35.146 1.00 33.79 ? 86   LEU A CG    1 
ATOM   710  C  CD1   . LEU A 1 104 ? -20.486 11.047 35.466 1.00 30.55 ? 86   LEU A CD1   1 
ATOM   711  C  CD2   . LEU A 1 104 ? -18.001 10.814 35.648 1.00 33.43 ? 86   LEU A CD2   1 
ATOM   712  N  N     . LEU A 1 105 ? -19.270 13.060 30.659 1.00 33.99 ? 87   LEU A N     1 
ATOM   713  C  CA    . LEU A 1 105 ? -18.646 13.627 29.453 1.00 34.56 ? 87   LEU A CA    1 
ATOM   714  C  C     . LEU A 1 105 ? -19.111 15.021 29.130 1.00 34.38 ? 87   LEU A C     1 
ATOM   715  O  O     . LEU A 1 105 ? -18.447 15.731 28.373 1.00 35.10 ? 87   LEU A O     1 
ATOM   716  C  CB    . LEU A 1 105 ? -18.795 12.707 28.229 1.00 33.59 ? 87   LEU A CB    1 
ATOM   717  C  CG    . LEU A 1 105 ? -18.143 11.335 28.408 1.00 34.18 ? 87   LEU A CG    1 
ATOM   718  C  CD1   . LEU A 1 105 ? -18.390 10.405 27.127 1.00 33.73 ? 87   LEU A CD1   1 
ATOM   719  C  CD2   . LEU A 1 105 ? -16.634 11.458 28.785 1.00 29.58 ? 87   LEU A CD2   1 
ATOM   720  N  N     . SER A 1 106 ? -20.204 15.453 29.748 1.00 34.07 ? 88   SER A N     1 
ATOM   721  C  CA    . SER A 1 106 ? -20.693 16.781 29.457 1.00 34.62 ? 88   SER A CA    1 
ATOM   722  C  C     . SER A 1 106 ? -20.393 17.822 30.561 1.00 34.42 ? 88   SER A C     1 
ATOM   723  O  O     . SER A 1 106 ? -20.851 18.996 30.447 1.00 34.80 ? 88   SER A O     1 
ATOM   724  C  CB    . SER A 1 106 ? -22.189 16.727 29.181 1.00 34.59 ? 88   SER A CB    1 
ATOM   725  O  OG    . SER A 1 106 ? -22.819 16.531 30.429 1.00 40.33 ? 88   SER A OG    1 
ATOM   726  N  N     . PHE A 1 107 ? -19.659 17.413 31.613 1.00 32.34 ? 89   PHE A N     1 
ATOM   727  C  CA    . PHE A 1 107 ? -19.062 18.366 32.575 1.00 31.42 ? 89   PHE A CA    1 
ATOM   728  C  C     . PHE A 1 107 ? -17.971 19.180 31.836 1.00 30.48 ? 89   PHE A C     1 
ATOM   729  O  O     . PHE A 1 107 ? -17.399 18.683 30.893 1.00 30.16 ? 89   PHE A O     1 
ATOM   730  C  CB    . PHE A 1 107 ? -18.376 17.640 33.736 1.00 30.58 ? 89   PHE A CB    1 
ATOM   731  C  CG    . PHE A 1 107 ? -19.282 16.756 34.573 1.00 28.33 ? 89   PHE A CG    1 
ATOM   732  C  CD1   . PHE A 1 107 ? -20.673 16.796 34.455 1.00 27.90 ? 89   PHE A CD1   1 
ATOM   733  C  CD2   . PHE A 1 107 ? -18.709 15.902 35.510 1.00 27.99 ? 89   PHE A CD2   1 
ATOM   734  C  CE1   . PHE A 1 107 ? -21.512 15.960 35.264 1.00 29.76 ? 89   PHE A CE1   1 
ATOM   735  C  CE2   . PHE A 1 107 ? -19.539 15.078 36.387 1.00 31.48 ? 89   PHE A CE2   1 
ATOM   736  C  CZ    . PHE A 1 107 ? -20.949 15.114 36.247 1.00 27.44 ? 89   PHE A CZ    1 
ATOM   737  N  N     . ALA A 1 108 ? -17.710 20.414 32.237 1.00 29.44 ? 90   ALA A N     1 
ATOM   738  C  CA    . ALA A 1 108 ? -16.566 21.134 31.689 1.00 29.91 ? 90   ALA A CA    1 
ATOM   739  C  C     . ALA A 1 108 ? -16.032 21.934 32.827 1.00 28.96 ? 90   ALA A C     1 
ATOM   740  O  O     . ALA A 1 108 ? -16.811 22.461 33.586 1.00 28.57 ? 90   ALA A O     1 
ATOM   741  C  CB    . ALA A 1 108 ? -16.969 22.078 30.555 1.00 28.89 ? 90   ALA A CB    1 
ATOM   742  N  N     . TYR A 1 109 ? -14.707 22.024 32.915 1.00 28.92 ? 91   TYR A N     1 
ATOM   743  C  CA    . TYR A 1 109 ? -14.036 22.659 34.037 1.00 28.13 ? 91   TYR A CA    1 
ATOM   744  C  C     . TYR A 1 109 ? -14.483 24.109 34.134 1.00 29.11 ? 91   TYR A C     1 
ATOM   745  O  O     . TYR A 1 109 ? -14.411 24.855 33.147 1.00 29.97 ? 91   TYR A O     1 
ATOM   746  C  CB    . TYR A 1 109 ? -12.503 22.526 33.936 1.00 27.04 ? 91   TYR A CB    1 
ATOM   747  C  CG    . TYR A 1 109 ? -11.776 23.129 35.124 1.00 26.89 ? 91   TYR A CG    1 
ATOM   748  C  CD1   . TYR A 1 109 ? -11.794 22.501 36.375 1.00 28.11 ? 91   TYR A CD1   1 
ATOM   749  C  CD2   . TYR A 1 109 ? -11.106 24.340 35.012 1.00 27.21 ? 91   TYR A CD2   1 
ATOM   750  C  CE1   . TYR A 1 109 ? -11.145 23.059 37.493 1.00 28.55 ? 91   TYR A CE1   1 
ATOM   751  C  CE2   . TYR A 1 109 ? -10.445 24.923 36.121 1.00 27.02 ? 91   TYR A CE2   1 
ATOM   752  C  CZ    . TYR A 1 109 ? -10.482 24.270 37.347 1.00 27.39 ? 91   TYR A CZ    1 
ATOM   753  O  OH    . TYR A 1 109 ? -9.842  24.813 38.419 1.00 29.02 ? 91   TYR A OH    1 
ATOM   754  N  N     . ASP A 1 110 ? -14.911 24.514 35.326 1.00 29.04 ? 92   ASP A N     1 
ATOM   755  C  CA    . ASP A 1 110 ? -15.199 25.905 35.611 1.00 29.87 ? 92   ASP A CA    1 
ATOM   756  C  C     . ASP A 1 110 ? -14.196 26.433 36.656 1.00 30.10 ? 92   ASP A C     1 
ATOM   757  O  O     . ASP A 1 110 ? -14.251 26.070 37.832 1.00 30.19 ? 92   ASP A O     1 
ATOM   758  C  CB    . ASP A 1 110 ? -16.629 25.995 36.103 1.00 30.39 ? 92   ASP A CB    1 
ATOM   759  C  CG    . ASP A 1 110 ? -17.091 27.422 36.394 1.00 35.87 ? 92   ASP A CG    1 
ATOM   760  O  OD1   . ASP A 1 110 ? -16.472 28.432 35.990 1.00 37.17 ? 92   ASP A OD1   1 
ATOM   761  O  OD2   . ASP A 1 110 ? -18.138 27.515 37.071 1.00 44.01 ? 92   ASP A OD2   1 
ATOM   762  N  N     . SER A 1 111 ? -13.277 27.281 36.231 1.00 29.25 ? 93   SER A N     1 
ATOM   763  C  CA    . SER A 1 111 ? -12.311 27.824 37.152 1.00 30.32 ? 93   SER A CA    1 
ATOM   764  C  C     . SER A 1 111 ? -12.889 28.807 38.187 1.00 29.78 ? 93   SER A C     1 
ATOM   765  O  O     . SER A 1 111 ? -12.207 29.152 39.130 1.00 30.52 ? 93   SER A O     1 
ATOM   766  C  CB    . SER A 1 111 ? -11.189 28.515 36.385 1.00 30.40 ? 93   SER A CB    1 
ATOM   767  O  OG    . SER A 1 111 ? -11.682 29.690 35.764 1.00 34.69 ? 93   SER A OG    1 
ATOM   768  N  N     . THR A 1 112 ? -14.122 29.292 38.005 1.00 29.42 ? 94   THR A N     1 
ATOM   769  C  CA    . THR A 1 112 ? -14.656 30.240 38.948 1.00 27.25 ? 94   THR A CA    1 
ATOM   770  C  C     . THR A 1 112 ? -15.193 29.550 40.228 1.00 27.45 ? 94   THR A C     1 
ATOM   771  O  O     . THR A 1 112 ? -15.390 30.221 41.226 1.00 27.51 ? 94   THR A O     1 
ATOM   772  C  CB    . THR A 1 112 ? -15.726 31.122 38.312 1.00 28.19 ? 94   THR A CB    1 
ATOM   773  O  OG1   . THR A 1 112 ? -16.895 30.340 38.007 1.00 27.97 ? 94   THR A OG1   1 
ATOM   774  C  CG2   . THR A 1 112 ? -15.180 31.823 37.037 1.00 27.19 ? 94   THR A CG2   1 
ATOM   775  N  N     . PHE A 1 113 ? -15.420 28.235 40.177 1.00 25.98 ? 95   PHE A N     1 
ATOM   776  C  CA    . PHE A 1 113 ? -15.888 27.476 41.345 1.00 26.89 ? 95   PHE A CA    1 
ATOM   777  C  C     . PHE A 1 113 ? -14.812 27.141 42.399 1.00 27.15 ? 95   PHE A C     1 
ATOM   778  O  O     . PHE A 1 113 ? -14.923 27.636 43.499 1.00 28.35 ? 95   PHE A O     1 
ATOM   779  C  CB    . PHE A 1 113 ? -16.690 26.221 41.000 1.00 23.67 ? 95   PHE A CB    1 
ATOM   780  C  CG    . PHE A 1 113 ? -17.096 25.439 42.216 1.00 23.51 ? 95   PHE A CG    1 
ATOM   781  C  CD1   . PHE A 1 113 ? -18.261 25.731 42.868 1.00 19.44 ? 95   PHE A CD1   1 
ATOM   782  C  CD2   . PHE A 1 113 ? -16.295 24.367 42.698 1.00 20.68 ? 95   PHE A CD2   1 
ATOM   783  C  CE1   . PHE A 1 113 ? -18.655 24.967 44.019 1.00 22.15 ? 95   PHE A CE1   1 
ATOM   784  C  CE2   . PHE A 1 113 ? -16.649 23.628 43.820 1.00 16.24 ? 95   PHE A CE2   1 
ATOM   785  C  CZ    . PHE A 1 113 ? -17.865 23.945 44.494 1.00 20.13 ? 95   PHE A CZ    1 
ATOM   786  N  N     . PRO A 1 114 ? -13.751 26.388 42.057 1.00 26.74 ? 96   PRO A N     1 
ATOM   787  C  CA    . PRO A 1 114 ? -12.982 25.892 43.207 1.00 27.90 ? 96   PRO A CA    1 
ATOM   788  C  C     . PRO A 1 114 ? -12.009 26.956 43.768 1.00 27.99 ? 96   PRO A C     1 
ATOM   789  O  O     . PRO A 1 114 ? -11.426 27.742 43.026 1.00 27.98 ? 96   PRO A O     1 
ATOM   790  C  CB    . PRO A 1 114 ? -12.171 24.727 42.621 1.00 27.28 ? 96   PRO A CB    1 
ATOM   791  C  CG    . PRO A 1 114 ? -11.994 25.056 41.158 1.00 25.98 ? 96   PRO A CG    1 
ATOM   792  C  CD    . PRO A 1 114 ? -13.115 26.028 40.784 1.00 27.43 ? 96   PRO A CD    1 
ATOM   793  N  N     . THR A 1 115 ? -11.867 26.979 45.074 1.00 27.16 ? 97   THR A N     1 
ATOM   794  C  CA    . THR A 1 115 ? -10.772 27.710 45.677 1.00 26.53 ? 97   THR A CA    1 
ATOM   795  C  C     . THR A 1 115 ? -9.934  26.624 46.277 1.00 24.94 ? 97   THR A C     1 
ATOM   796  O  O     . THR A 1 115 ? -10.461 25.603 46.613 1.00 23.41 ? 97   THR A O     1 
ATOM   797  C  CB    . THR A 1 115 ? -11.316 28.677 46.715 1.00 27.06 ? 97   THR A CB    1 
ATOM   798  O  OG1   . THR A 1 115 ? -11.963 29.725 45.999 1.00 27.53 ? 97   THR A OG1   1 
ATOM   799  C  CG2   . THR A 1 115 ? -10.200 29.284 47.587 1.00 25.41 ? 97   THR A CG2   1 
ATOM   800  N  N     . ARG A 1 116 ? -8.640  26.847 46.351 1.00 24.62 ? 98   ARG A N     1 
ATOM   801  C  CA    . ARG A 1 116 ? -7.742  25.893 46.971 1.00 24.76 ? 98   ARG A CA    1 
ATOM   802  C  C     . ARG A 1 116 ? -7.847  25.831 48.506 1.00 23.91 ? 98   ARG A C     1 
ATOM   803  O  O     . ARG A 1 116 ? -8.074  26.844 49.174 1.00 23.68 ? 98   ARG A O     1 
ATOM   804  C  CB    . ARG A 1 116 ? -6.308  26.221 46.606 1.00 24.19 ? 98   ARG A CB    1 
ATOM   805  C  CG    . ARG A 1 116 ? -5.376  25.114 46.994 1.00 24.88 ? 98   ARG A CG    1 
ATOM   806  C  CD    . ARG A 1 116 ? -4.067  25.185 46.206 1.00 28.27 ? 98   ARG A CD    1 
ATOM   807  N  NE    . ARG A 1 116 ? -3.372  26.486 46.140 1.00 26.39 ? 98   ARG A NE    1 
ATOM   808  C  CZ    . ARG A 1 116 ? -2.155  26.703 46.639 1.00 25.20 ? 98   ARG A CZ    1 
ATOM   809  N  NH1   . ARG A 1 116 ? -1.523  25.729 47.308 1.00 27.00 ? 98   ARG A NH1   1 
ATOM   810  N  NH2   . ARG A 1 116 ? -1.555  27.888 46.465 1.00 22.41 ? 98   ARG A NH2   1 
ATOM   811  N  N     . GLY A 1 117 ? -7.639  24.641 49.042 1.00 23.89 ? 99   GLY A N     1 
ATOM   812  C  CA    . GLY A 1 117 ? -7.557  24.433 50.484 1.00 23.65 ? 99   GLY A CA    1 
ATOM   813  C  C     . GLY A 1 117 ? -8.890  23.977 51.070 1.00 24.14 ? 99   GLY A C     1 
ATOM   814  O  O     . GLY A 1 117 ? -9.045  23.919 52.288 1.00 26.17 ? 99   GLY A O     1 
ATOM   815  N  N     . LEU A 1 118 ? -9.877  23.671 50.237 1.00 23.35 ? 100  LEU A N     1 
ATOM   816  C  CA    . LEU A 1 118 ? -11.163 23.209 50.761 1.00 22.11 ? 100  LEU A CA    1 
ATOM   817  C  C     . LEU A 1 118 ? -11.038 21.853 51.381 1.00 20.98 ? 100  LEU A C     1 
ATOM   818  O  O     . LEU A 1 118 ? -10.132 21.126 51.100 1.00 20.34 ? 100  LEU A O     1 
ATOM   819  C  CB    . LEU A 1 118 ? -12.247 23.218 49.644 1.00 21.67 ? 100  LEU A CB    1 
ATOM   820  C  CG    . LEU A 1 118 ? -12.487 24.606 49.045 1.00 22.67 ? 100  LEU A CG    1 
ATOM   821  C  CD1   . LEU A 1 118 ? -13.451 24.571 47.854 1.00 22.89 ? 100  LEU A CD1   1 
ATOM   822  C  CD2   . LEU A 1 118 ? -12.910 25.675 50.037 1.00 23.98 ? 100  LEU A CD2   1 
ATOM   823  N  N     . VAL A 1 119 ? -12.023 21.474 52.192 1.00 22.77 ? 101  VAL A N     1 
ATOM   824  C  CA    . VAL A 1 119 ? -12.050 20.163 52.803 1.00 21.35 ? 101  VAL A CA    1 
ATOM   825  C  C     . VAL A 1 119 ? -13.234 19.385 52.252 1.00 22.92 ? 101  VAL A C     1 
ATOM   826  O  O     . VAL A 1 119 ? -14.375 19.893 52.270 1.00 25.31 ? 101  VAL A O     1 
ATOM   827  C  CB    . VAL A 1 119 ? -12.195 20.380 54.355 1.00 22.55 ? 101  VAL A CB    1 
ATOM   828  C  CG1   . VAL A 1 119 ? -12.304 19.052 55.118 1.00 21.98 ? 101  VAL A CG1   1 
ATOM   829  C  CG2   . VAL A 1 119 ? -11.045 21.253 54.893 1.00 17.14 ? 101  VAL A CG2   1 
ATOM   830  N  N     . PHE A 1 120 ? -13.007 18.175 51.758 1.00 22.05 ? 102  PHE A N     1 
ATOM   831  C  CA    . PHE A 1 120 ? -14.103 17.313 51.408 1.00 21.93 ? 102  PHE A CA    1 
ATOM   832  C  C     . PHE A 1 120 ? -14.464 16.407 52.585 1.00 22.71 ? 102  PHE A C     1 
ATOM   833  O  O     . PHE A 1 120 ? -13.607 15.667 53.120 1.00 23.59 ? 102  PHE A O     1 
ATOM   834  C  CB    . PHE A 1 120 ? -13.810 16.423 50.176 1.00 21.19 ? 102  PHE A CB    1 
ATOM   835  C  CG    . PHE A 1 120 ? -15.081 15.747 49.597 1.00 20.65 ? 102  PHE A CG    1 
ATOM   836  C  CD1   . PHE A 1 120 ? -16.020 16.484 48.892 1.00 20.54 ? 102  PHE A CD1   1 
ATOM   837  C  CD2   . PHE A 1 120 ? -15.347 14.399 49.825 1.00 18.60 ? 102  PHE A CD2   1 
ATOM   838  C  CE1   . PHE A 1 120 ? -17.176 15.864 48.359 1.00 18.77 ? 102  PHE A CE1   1 
ATOM   839  C  CE2   . PHE A 1 120 ? -16.485 13.767 49.321 1.00 17.49 ? 102  PHE A CE2   1 
ATOM   840  C  CZ    . PHE A 1 120 ? -17.398 14.482 48.590 1.00 18.89 ? 102  PHE A CZ    1 
ATOM   841  N  N     . ASP A 1 121 ? -15.720 16.485 52.979 1.00 22.28 ? 103  ASP A N     1 
ATOM   842  C  CA    . ASP A 1 121 ? -16.240 15.670 54.021 1.00 24.25 ? 103  ASP A CA    1 
ATOM   843  C  C     . ASP A 1 121 ? -16.829 14.451 53.368 1.00 24.69 ? 103  ASP A C     1 
ATOM   844  O  O     . ASP A 1 121 ? -17.853 14.538 52.748 1.00 25.59 ? 103  ASP A O     1 
ATOM   845  C  CB    . ASP A 1 121 ? -17.333 16.435 54.805 1.00 24.02 ? 103  ASP A CB    1 
ATOM   846  C  CG    . ASP A 1 121 ? -17.954 15.596 55.904 1.00 24.54 ? 103  ASP A CG    1 
ATOM   847  O  OD1   . ASP A 1 121 ? -17.671 14.377 56.000 1.00 23.74 ? 103  ASP A OD1   1 
ATOM   848  O  OD2   . ASP A 1 121 ? -18.759 16.159 56.664 1.00 26.84 ? 103  ASP A OD2   1 
ATOM   849  N  N     . THR A 1 122 ? -16.169 13.305 53.510 1.00 26.80 ? 104  THR A N     1 
ATOM   850  C  CA    . THR A 1 122 ? -16.585 12.073 52.846 1.00 26.84 ? 104  THR A CA    1 
ATOM   851  C  C     . THR A 1 122 ? -17.820 11.453 53.507 1.00 28.02 ? 104  THR A C     1 
ATOM   852  O  O     . THR A 1 122 ? -18.414 10.556 52.935 1.00 28.38 ? 104  THR A O     1 
ATOM   853  C  CB    . THR A 1 122 ? -15.475 11.036 52.868 1.00 27.29 ? 104  THR A CB    1 
ATOM   854  O  OG1   . THR A 1 122 ? -15.090 10.785 54.235 1.00 28.63 ? 104  THR A OG1   1 
ATOM   855  C  CG2   . THR A 1 122 ? -14.223 11.496 52.077 1.00 23.04 ? 104  THR A CG2   1 
ATOM   856  N  N     . LEU A 1 123 ? -18.216 11.909 54.707 1.00 27.85 ? 105  LEU A N     1 
ATOM   857  C  CA    . LEU A 1 123 ? -19.376 11.291 55.346 1.00 27.10 ? 105  LEU A CA    1 
ATOM   858  C  C     . LEU A 1 123 ? -20.615 11.827 54.650 1.00 27.71 ? 105  LEU A C     1 
ATOM   859  O  O     . LEU A 1 123 ? -21.422 11.042 54.158 1.00 28.24 ? 105  LEU A O     1 
ATOM   860  C  CB    . LEU A 1 123 ? -19.427 11.574 56.835 1.00 26.85 ? 105  LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 123 ? -20.506 10.901 57.710 1.00 27.31 ? 105  LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 123 ? -20.554 9.335  57.629 1.00 23.43 ? 105  LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 123 ? -20.291 11.366 59.138 1.00 25.03 ? 105  LEU A CD2   1 
ATOM   864  N  N     . TYR A 1 124 ? -20.732 13.154 54.580 1.00 27.24 ? 106  TYR A N     1 
ATOM   865  C  CA    . TYR A 1 124 ? -21.897 13.818 54.030 1.00 27.27 ? 106  TYR A CA    1 
ATOM   866  C  C     . TYR A 1 124 ? -21.796 14.416 52.609 1.00 27.28 ? 106  TYR A C     1 
ATOM   867  O  O     . TYR A 1 124 ? -22.821 14.946 52.107 1.00 27.29 ? 106  TYR A O     1 
ATOM   868  C  CB    . TYR A 1 124 ? -22.302 14.943 54.977 1.00 29.03 ? 106  TYR A CB    1 
ATOM   869  C  CG    . TYR A 1 124 ? -22.661 14.439 56.340 1.00 30.53 ? 106  TYR A CG    1 
ATOM   870  C  CD1   . TYR A 1 124 ? -23.595 13.388 56.491 1.00 31.93 ? 106  TYR A CD1   1 
ATOM   871  C  CD2   . TYR A 1 124 ? -22.076 14.992 57.466 1.00 29.99 ? 106  TYR A CD2   1 
ATOM   872  C  CE1   . TYR A 1 124 ? -23.953 12.922 57.738 1.00 33.68 ? 106  TYR A CE1   1 
ATOM   873  C  CE2   . TYR A 1 124 ? -22.414 14.537 58.732 1.00 34.31 ? 106  TYR A CE2   1 
ATOM   874  C  CZ    . TYR A 1 124 ? -23.352 13.501 58.856 1.00 34.41 ? 106  TYR A CZ    1 
ATOM   875  O  OH    . TYR A 1 124 ? -23.691 13.041 60.105 1.00 35.44 ? 106  TYR A OH    1 
ATOM   876  N  N     . GLY A 1 125 ? -20.581 14.428 52.020 1.00 25.41 ? 107  GLY A N     1 
ATOM   877  C  CA    . GLY A 1 125 ? -20.376 14.872 50.651 1.00 24.05 ? 107  GLY A CA    1 
ATOM   878  C  C     . GLY A 1 125 ? -20.368 16.360 50.489 1.00 24.61 ? 107  GLY A C     1 
ATOM   879  O  O     . GLY A 1 125 ? -20.858 16.833 49.509 1.00 25.97 ? 107  GLY A O     1 
ATOM   880  N  N     . ASN A 1 126 ? -19.788 17.112 51.430 1.00 23.50 ? 108  ASN A N     1 
ATOM   881  C  CA    . ASN A 1 126 ? -19.798 18.561 51.361 1.00 22.33 ? 108  ASN A CA    1 
ATOM   882  C  C     . ASN A 1 126 ? -18.375 18.997 51.140 1.00 21.86 ? 108  ASN A C     1 
ATOM   883  O  O     . ASN A 1 126 ? -17.456 18.309 51.574 1.00 21.85 ? 108  ASN A O     1 
ATOM   884  C  CB    . ASN A 1 126 ? -20.309 19.183 52.670 1.00 22.24 ? 108  ASN A CB    1 
ATOM   885  C  CG    . ASN A 1 126 ? -21.732 18.813 52.973 1.00 23.61 ? 108  ASN A CG    1 
ATOM   886  O  OD1   . ASN A 1 126 ? -22.607 18.955 52.123 1.00 28.74 ? 108  ASN A OD1   1 
ATOM   887  N  ND2   . ASN A 1 126 ? -21.992 18.375 54.185 1.00 18.90 ? 108  ASN A ND2   1 
ATOM   888  N  N     . LEU A 1 127 ? -18.193 20.121 50.456 1.00 20.45 ? 109  LEU A N     1 
ATOM   889  C  CA    . LEU A 1 127 ? -16.917 20.811 50.440 1.00 21.43 ? 109  LEU A CA    1 
ATOM   890  C  C     . LEU A 1 127 ? -17.017 21.928 51.454 1.00 21.37 ? 109  LEU A C     1 
ATOM   891  O  O     . LEU A 1 127 ? -18.027 22.646 51.492 1.00 21.02 ? 109  LEU A O     1 
ATOM   892  C  CB    . LEU A 1 127 ? -16.639 21.434 49.069 1.00 20.62 ? 109  LEU A CB    1 
ATOM   893  C  CG    . LEU A 1 127 ? -16.154 20.505 47.992 1.00 21.97 ? 109  LEU A CG    1 
ATOM   894  C  CD1   . LEU A 1 127 ? -16.361 21.240 46.616 1.00 18.92 ? 109  LEU A CD1   1 
ATOM   895  C  CD2   . LEU A 1 127 ? -14.702 20.210 48.240 1.00 16.39 ? 109  LEU A CD2   1 
ATOM   896  N  N     . LEU A 1 128 ? -16.015 22.027 52.307 1.00 22.15 ? 110  LEU A N     1 
ATOM   897  C  CA    . LEU A 1 128 ? -16.064 23.011 53.405 1.00 22.02 ? 110  LEU A CA    1 
ATOM   898  C  C     . LEU A 1 128 ? -14.861 23.897 53.299 1.00 21.20 ? 110  LEU A C     1 
ATOM   899  O  O     . LEU A 1 128 ? -13.794 23.415 52.924 1.00 20.20 ? 110  LEU A O     1 
ATOM   900  C  CB    . LEU A 1 128 ? -16.029 22.304 54.788 1.00 21.98 ? 110  LEU A CB    1 
ATOM   901  C  CG    . LEU A 1 128 ? -17.085 21.188 54.913 1.00 23.00 ? 110  LEU A CG    1 
ATOM   902  C  CD1   . LEU A 1 128 ? -16.775 20.323 56.094 1.00 23.34 ? 110  LEU A CD1   1 
ATOM   903  C  CD2   . LEU A 1 128 ? -18.537 21.755 55.002 1.00 20.29 ? 110  LEU A CD2   1 
ATOM   904  N  N     . LYS A 1 129 ? -15.062 25.168 53.601 1.00 20.26 ? 111  LYS A N     1 
ATOM   905  C  CA    . LYS A 1 129 ? -13.984 26.059 53.834 1.00 22.52 ? 111  LYS A CA    1 
ATOM   906  C  C     . LYS A 1 129 ? -14.023 26.340 55.345 1.00 22.96 ? 111  LYS A C     1 
ATOM   907  O  O     . LYS A 1 129 ? -15.059 26.731 55.913 1.00 23.25 ? 111  LYS A O     1 
ATOM   908  C  CB    . LYS A 1 129 ? -14.135 27.368 53.072 1.00 22.34 ? 111  LYS A CB    1 
ATOM   909  C  CG    . LYS A 1 129 ? -12.818 28.153 52.873 1.00 22.01 ? 111  LYS A CG    1 
ATOM   910  C  CD    . LYS A 1 129 ? -13.336 29.586 52.454 1.00 23.07 ? 111  LYS A CD    1 
ATOM   911  C  CE    . LYS A 1 129 ? -12.360 30.332 51.654 1.00 25.19 ? 111  LYS A CE    1 
ATOM   912  N  NZ    . LYS A 1 129 ? -12.963 31.642 51.202 1.00 26.73 ? 111  LYS A NZ    1 
ATOM   913  N  N     . VAL A 1 130 ? -12.892 26.085 55.981 1.00 23.29 ? 112  VAL A N     1 
ATOM   914  C  CA    . VAL A 1 130 ? -12.774 26.147 57.451 1.00 23.69 ? 112  VAL A CA    1 
ATOM   915  C  C     . VAL A 1 130 ? -11.667 27.119 57.843 1.00 24.35 ? 112  VAL A C     1 
ATOM   916  O  O     . VAL A 1 130 ? -10.738 27.379 57.050 1.00 23.35 ? 112  VAL A O     1 
ATOM   917  C  CB    . VAL A 1 130 ? -12.535 24.716 58.089 1.00 23.38 ? 112  VAL A CB    1 
ATOM   918  C  CG1   . VAL A 1 130 ? -13.607 23.739 57.605 1.00 20.85 ? 112  VAL A CG1   1 
ATOM   919  C  CG2   . VAL A 1 130 ? -11.195 24.168 57.702 1.00 20.30 ? 112  VAL A CG2   1 
ATOM   920  N  N     . ASP A 1 131 ? -11.755 27.625 59.074 1.00 25.00 ? 113  ASP A N     1 
ATOM   921  C  CA    . ASP A 1 131 ? -10.612 28.325 59.683 1.00 25.81 ? 113  ASP A CA    1 
ATOM   922  C  C     . ASP A 1 131 ? -9.626  27.365 60.362 1.00 25.85 ? 113  ASP A C     1 
ATOM   923  O  O     . ASP A 1 131 ? -9.839  26.107 60.315 1.00 23.82 ? 113  ASP A O     1 
ATOM   924  C  CB    . ASP A 1 131 ? -11.090 29.458 60.632 1.00 26.98 ? 113  ASP A CB    1 
ATOM   925  C  CG    . ASP A 1 131 ? -11.704 28.938 61.945 1.00 31.24 ? 113  ASP A CG    1 
ATOM   926  O  OD1   . ASP A 1 131 ? -11.657 27.693 62.221 1.00 37.37 ? 113  ASP A OD1   1 
ATOM   927  O  OD2   . ASP A 1 131 ? -12.245 29.800 62.700 1.00 35.91 ? 113  ASP A OD2   1 
ATOM   928  N  N     . ALA A 1 132 ? -8.557  27.933 60.983 1.00 26.19 ? 114  ALA A N     1 
ATOM   929  C  CA    . ALA A 1 132 ? -7.498  27.130 61.651 1.00 26.99 ? 114  ALA A CA    1 
ATOM   930  C  C     . ALA A 1 132 ? -8.031  26.243 62.780 1.00 29.39 ? 114  ALA A C     1 
ATOM   931  O  O     . ALA A 1 132 ? -7.368  25.280 63.163 1.00 29.92 ? 114  ALA A O     1 
ATOM   932  C  CB    . ALA A 1 132 ? -6.471  28.069 62.254 1.00 27.42 ? 114  ALA A CB    1 
ATOM   933  N  N     . TYR A 1 133 ? -9.201  26.600 63.332 1.00 28.87 ? 115  TYR A N     1 
ATOM   934  C  CA    . TYR A 1 133 ? -9.816  25.863 64.450 1.00 30.59 ? 115  TYR A CA    1 
ATOM   935  C  C     . TYR A 1 133 ? -10.854 24.854 64.025 1.00 30.98 ? 115  TYR A C     1 
ATOM   936  O  O     . TYR A 1 133 ? -11.470 24.233 64.888 1.00 33.99 ? 115  TYR A O     1 
ATOM   937  C  CB    . TYR A 1 133 ? -10.403 26.854 65.469 1.00 29.36 ? 115  TYR A CB    1 
ATOM   938  C  CG    . TYR A 1 133 ? -9.284  27.692 65.987 1.00 28.73 ? 115  TYR A CG    1 
ATOM   939  C  CD1   . TYR A 1 133 ? -8.336  27.140 66.875 1.00 30.28 ? 115  TYR A CD1   1 
ATOM   940  C  CD2   . TYR A 1 133 ? -9.086  28.974 65.522 1.00 29.22 ? 115  TYR A CD2   1 
ATOM   941  C  CE1   . TYR A 1 133 ? -7.256  27.879 67.311 1.00 27.61 ? 115  TYR A CE1   1 
ATOM   942  C  CE2   . TYR A 1 133 ? -8.013  29.714 65.930 1.00 28.04 ? 115  TYR A CE2   1 
ATOM   943  C  CZ    . TYR A 1 133 ? -7.092  29.145 66.824 1.00 30.15 ? 115  TYR A CZ    1 
ATOM   944  O  OH    . TYR A 1 133 ? -6.016  29.892 67.267 1.00 32.67 ? 115  TYR A OH    1 
ATOM   945  N  N     . GLY A 1 134 ? -11.090 24.705 62.715 1.00 29.92 ? 116  GLY A N     1 
ATOM   946  C  CA    . GLY A 1 134 ? -12.094 23.765 62.238 1.00 26.92 ? 116  GLY A CA    1 
ATOM   947  C  C     . GLY A 1 134 ? -13.485 24.404 62.203 1.00 26.74 ? 116  GLY A C     1 
ATOM   948  O  O     . GLY A 1 134 ? -14.426 23.715 61.996 1.00 25.67 ? 116  GLY A O     1 
ATOM   949  N  N     . ASN A 1 135 ? -13.613 25.717 62.399 1.00 25.94 ? 117  ASN A N     1 
ATOM   950  C  CA    . ASN A 1 135 ? -14.907 26.352 62.249 1.00 27.09 ? 117  ASN A CA    1 
ATOM   951  C  C     . ASN A 1 135 ? -15.304 26.554 60.766 1.00 27.81 ? 117  ASN A C     1 
ATOM   952  O  O     . ASN A 1 135 ? -14.460 26.914 59.965 1.00 26.54 ? 117  ASN A O     1 
ATOM   953  C  CB    . ASN A 1 135 ? -14.933 27.724 62.903 1.00 27.05 ? 117  ASN A CB    1 
ATOM   954  C  CG    . ASN A 1 135 ? -14.426 27.699 64.301 1.00 30.61 ? 117  ASN A CG    1 
ATOM   955  O  OD1   . ASN A 1 135 ? -14.826 26.859 65.110 1.00 28.01 ? 117  ASN A OD1   1 
ATOM   956  N  ND2   . ASN A 1 135 ? -13.505 28.612 64.603 1.00 28.44 ? 117  ASN A ND2   1 
ATOM   957  N  N     . LEU A 1 136 ? -16.603 26.384 60.458 1.00 27.75 ? 118  LEU A N     1 
ATOM   958  C  CA    . LEU A 1 136 ? -17.113 26.363 59.090 1.00 28.55 ? 118  LEU A CA    1 
ATOM   959  C  C     . LEU A 1 136 ? -17.287 27.753 58.655 1.00 28.22 ? 118  LEU A C     1 
ATOM   960  O  O     . LEU A 1 136 ? -17.961 28.540 59.345 1.00 28.23 ? 118  LEU A O     1 
ATOM   961  C  CB    . LEU A 1 136 ? -18.472 25.687 59.002 1.00 28.39 ? 118  LEU A CB    1 
ATOM   962  C  CG    . LEU A 1 136 ? -18.455 24.225 58.543 1.00 34.94 ? 118  LEU A CG    1 
ATOM   963  C  CD1   . LEU A 1 136 ? -17.728 23.304 59.525 1.00 36.38 ? 118  LEU A CD1   1 
ATOM   964  C  CD2   . LEU A 1 136 ? -19.859 23.734 58.332 1.00 36.83 ? 118  LEU A CD2   1 
ATOM   965  N  N     . LEU A 1 137 ? -16.692 28.069 57.504 1.00 28.58 ? 119  LEU A N     1 
ATOM   966  C  CA    . LEU A 1 137 ? -16.858 29.400 56.879 1.00 27.39 ? 119  LEU A CA    1 
ATOM   967  C  C     . LEU A 1 137 ? -17.797 29.297 55.722 1.00 27.84 ? 119  LEU A C     1 
ATOM   968  O  O     . LEU A 1 137 ? -18.600 30.199 55.520 1.00 27.71 ? 119  LEU A O     1 
ATOM   969  C  CB    . LEU A 1 137 ? -15.524 29.933 56.390 1.00 27.13 ? 119  LEU A CB    1 
ATOM   970  C  CG    . LEU A 1 137 ? -14.444 30.033 57.481 1.00 25.96 ? 119  LEU A CG    1 
ATOM   971  C  CD1   . LEU A 1 137 ? -13.211 30.675 56.845 1.00 23.36 ? 119  LEU A CD1   1 
ATOM   972  C  CD2   . LEU A 1 137 ? -14.886 30.810 58.780 1.00 26.20 ? 119  LEU A CD2   1 
ATOM   973  N  N     . VAL A 1 138 ? -17.696 28.199 54.963 1.00 27.42 ? 120  VAL A N     1 
ATOM   974  C  CA    . VAL A 1 138 ? -18.569 27.940 53.827 1.00 27.62 ? 120  VAL A CA    1 
ATOM   975  C  C     . VAL A 1 138 ? -18.849 26.435 53.778 1.00 28.69 ? 120  VAL A C     1 
ATOM   976  O  O     . VAL A 1 138 ? -17.982 25.627 54.022 1.00 28.87 ? 120  VAL A O     1 
ATOM   977  C  CB    . VAL A 1 138 ? -17.915 28.355 52.485 1.00 28.18 ? 120  VAL A CB    1 
ATOM   978  C  CG1   . VAL A 1 138 ? -18.876 28.149 51.321 1.00 27.12 ? 120  VAL A CG1   1 
ATOM   979  C  CG2   . VAL A 1 138 ? -17.352 29.803 52.532 1.00 24.70 ? 120  VAL A CG2   1 
ATOM   980  N  N     . CYS A 1 139 ? -20.070 26.086 53.432 1.00 29.91 ? 121  CYS A N     1 
ATOM   981  C  CA    . CYS A 1 139 ? -20.451 24.716 53.213 1.00 29.99 ? 121  CYS A CA    1 
ATOM   982  C  C     . CYS A 1 139 ? -21.277 24.621 51.919 1.00 29.33 ? 121  CYS A C     1 
ATOM   983  O  O     . CYS A 1 139 ? -22.324 25.290 51.790 1.00 28.82 ? 121  CYS A O     1 
ATOM   984  C  CB    . CYS A 1 139 ? -21.269 24.222 54.412 1.00 30.33 ? 121  CYS A CB    1 
ATOM   985  S  SG    . CYS A 1 139 ? -21.901 22.490 54.268 1.00 33.46 ? 121  CYS A SG    1 
ATOM   986  N  N     . ALA A 1 140 ? -20.770 23.841 50.960 1.00 27.42 ? 122  ALA A N     1 
ATOM   987  C  CA    . ALA A 1 140 ? -21.452 23.580 49.706 1.00 26.10 ? 122  ALA A CA    1 
ATOM   988  C  C     . ALA A 1 140 ? -21.672 22.098 49.490 1.00 25.77 ? 122  ALA A C     1 
ATOM   989  O  O     . ALA A 1 140 ? -20.746 21.333 49.544 1.00 26.53 ? 122  ALA A O     1 
ATOM   990  C  CB    . ALA A 1 140 ? -20.645 24.167 48.506 1.00 26.47 ? 122  ALA A CB    1 
ATOM   991  N  N     . HIS A 1 141 ? -22.905 21.713 49.178 1.00 26.14 ? 123  HIS A N     1 
ATOM   992  C  CA    . HIS A 1 141 ? -23.267 20.348 48.778 1.00 25.27 ? 123  HIS A CA    1 
ATOM   993  C  C     . HIS A 1 141 ? -23.595 20.369 47.239 1.00 25.46 ? 123  HIS A C     1 
ATOM   994  O  O     . HIS A 1 141 ? -24.600 20.966 46.824 1.00 24.89 ? 123  HIS A O     1 
ATOM   995  C  CB    . HIS A 1 141 ? -24.467 19.885 49.623 1.00 24.58 ? 123  HIS A CB    1 
ATOM   996  C  CG    . HIS A 1 141 ? -24.818 18.453 49.423 1.00 24.05 ? 123  HIS A CG    1 
ATOM   997  N  ND1   . HIS A 1 141 ? -24.057 17.433 49.931 1.00 26.00 ? 123  HIS A ND1   1 
ATOM   998  C  CD2   . HIS A 1 141 ? -25.806 17.864 48.705 1.00 25.19 ? 123  HIS A CD2   1 
ATOM   999  C  CE1   . HIS A 1 141 ? -24.577 16.270 49.568 1.00 27.61 ? 123  HIS A CE1   1 
ATOM   1000 N  NE2   . HIS A 1 141 ? -25.623 16.505 48.795 1.00 25.45 ? 123  HIS A NE2   1 
ATOM   1001 N  N     . GLY A 1 142 ? -22.715 19.795 46.408 1.00 24.15 ? 124  GLY A N     1 
ATOM   1002 C  CA    . GLY A 1 142 ? -22.786 20.021 44.969 1.00 24.72 ? 124  GLY A CA    1 
ATOM   1003 C  C     . GLY A 1 142 ? -22.599 21.508 44.766 1.00 24.55 ? 124  GLY A C     1 
ATOM   1004 O  O     . GLY A 1 142 ? -21.621 22.064 45.249 1.00 22.57 ? 124  GLY A O     1 
ATOM   1005 N  N     . PHE A 1 143 ? -23.549 22.161 44.092 1.00 25.93 ? 125  PHE A N     1 
ATOM   1006 C  CA    . PHE A 1 143 ? -23.472 23.608 43.859 1.00 28.43 ? 125  PHE A CA    1 
ATOM   1007 C  C     . PHE A 1 143 ? -24.456 24.404 44.753 1.00 30.53 ? 125  PHE A C     1 
ATOM   1008 O  O     . PHE A 1 143 ? -24.721 25.574 44.502 1.00 31.23 ? 125  PHE A O     1 
ATOM   1009 C  CB    . PHE A 1 143 ? -23.651 23.928 42.352 1.00 27.40 ? 125  PHE A CB    1 
ATOM   1010 C  CG    . PHE A 1 143 ? -22.657 23.190 41.440 1.00 25.67 ? 125  PHE A CG    1 
ATOM   1011 C  CD1   . PHE A 1 143 ? -21.282 23.314 41.624 1.00 24.41 ? 125  PHE A CD1   1 
ATOM   1012 C  CD2   . PHE A 1 143 ? -23.101 22.387 40.432 1.00 21.28 ? 125  PHE A CD2   1 
ATOM   1013 C  CE1   . PHE A 1 143 ? -20.368 22.649 40.774 1.00 20.99 ? 125  PHE A CE1   1 
ATOM   1014 C  CE2   . PHE A 1 143 ? -22.193 21.708 39.571 1.00 23.99 ? 125  PHE A CE2   1 
ATOM   1015 C  CZ    . PHE A 1 143 ? -20.832 21.819 39.774 1.00 22.41 ? 125  PHE A CZ    1 
ATOM   1016 N  N     . ASN A 1 144 ? -24.959 23.759 45.798 1.00 31.75 ? 126  ASN A N     1 
ATOM   1017 C  CA    . ASN A 1 144 ? -25.909 24.340 46.691 1.00 34.92 ? 126  ASN A CA    1 
ATOM   1018 C  C     . ASN A 1 144 ? -25.148 24.803 47.953 1.00 35.55 ? 126  ASN A C     1 
ATOM   1019 O  O     . ASN A 1 144 ? -24.697 23.978 48.722 1.00 35.18 ? 126  ASN A O     1 
ATOM   1020 C  CB    . ASN A 1 144 ? -27.002 23.275 47.023 1.00 35.91 ? 126  ASN A CB    1 
ATOM   1021 C  CG    . ASN A 1 144 ? -27.991 23.734 48.134 1.00 42.58 ? 126  ASN A CG    1 
ATOM   1022 O  OD1   . ASN A 1 144 ? -28.409 24.917 48.190 1.00 49.45 ? 126  ASN A OD1   1 
ATOM   1023 N  ND2   . ASN A 1 144 ? -28.391 22.785 49.012 1.00 42.45 ? 126  ASN A ND2   1 
ATOM   1024 N  N     . PHE A 1 145 ? -24.991 26.123 48.113 1.00 36.53 ? 127  PHE A N     1 
ATOM   1025 C  CA    . PHE A 1 145 ? -24.424 26.750 49.290 1.00 37.81 ? 127  PHE A CA    1 
ATOM   1026 C  C     . PHE A 1 145 ? -25.360 26.813 50.485 1.00 39.56 ? 127  PHE A C     1 
ATOM   1027 O  O     . PHE A 1 145 ? -26.332 27.560 50.497 1.00 39.26 ? 127  PHE A O     1 
ATOM   1028 C  CB    . PHE A 1 145 ? -23.795 28.106 48.923 1.00 37.66 ? 127  PHE A CB    1 
ATOM   1029 C  CG    . PHE A 1 145 ? -22.561 27.956 48.046 1.00 37.75 ? 127  PHE A CG    1 
ATOM   1030 C  CD1   . PHE A 1 145 ? -22.685 27.550 46.685 1.00 38.18 ? 127  PHE A CD1   1 
ATOM   1031 C  CD2   . PHE A 1 145 ? -21.295 28.157 48.566 1.00 35.75 ? 127  PHE A CD2   1 
ATOM   1032 C  CE1   . PHE A 1 145 ? -21.553 27.398 45.838 1.00 37.58 ? 127  PHE A CE1   1 
ATOM   1033 C  CE2   . PHE A 1 145 ? -20.129 27.989 47.751 1.00 35.38 ? 127  PHE A CE2   1 
ATOM   1034 C  CZ    . PHE A 1 145 ? -20.268 27.603 46.390 1.00 38.94 ? 127  PHE A CZ    1 
ATOM   1035 N  N     . ILE A 1 146 ? -25.038 25.977 51.474 1.00 41.55 ? 128  ILE A N     1 
ATOM   1036 C  CA    . ILE A 1 146 ? -25.812 25.775 52.693 1.00 44.11 ? 128  ILE A CA    1 
ATOM   1037 C  C     . ILE A 1 146 ? -25.550 26.913 53.688 1.00 46.40 ? 128  ILE A C     1 
ATOM   1038 O  O     . ILE A 1 146 ? -24.414 27.369 53.852 1.00 45.66 ? 128  ILE A O     1 
ATOM   1039 C  CB    . ILE A 1 146 ? -25.445 24.434 53.377 1.00 43.69 ? 128  ILE A CB    1 
ATOM   1040 C  CG1   . ILE A 1 146 ? -25.235 23.315 52.344 1.00 44.36 ? 128  ILE A CG1   1 
ATOM   1041 C  CG2   . ILE A 1 146 ? -26.492 24.037 54.400 1.00 43.58 ? 128  ILE A CG2   1 
ATOM   1042 C  CD1   . ILE A 1 146 ? -26.461 22.986 51.524 1.00 40.98 ? 128  ILE A CD1   1 
ATOM   1043 N  N     . ARG A 1 147 ? -26.615 27.376 54.341 1.00 49.76 ? 129  ARG A N     1 
ATOM   1044 C  CA    . ARG A 1 147 ? -26.538 28.547 55.224 1.00 52.72 ? 129  ARG A CA    1 
ATOM   1045 C  C     . ARG A 1 147 ? -26.674 28.027 56.647 1.00 53.01 ? 129  ARG A C     1 
ATOM   1046 O  O     . ARG A 1 147 ? -27.078 26.874 56.822 1.00 53.20 ? 129  ARG A O     1 
ATOM   1047 C  CB    . ARG A 1 147 ? -27.638 29.563 54.890 1.00 53.46 ? 129  ARG A CB    1 
ATOM   1048 C  CG    . ARG A 1 147 ? -27.934 29.660 53.403 1.00 58.49 ? 129  ARG A CG    1 
ATOM   1049 C  CD    . ARG A 1 147 ? -28.181 31.115 52.929 1.00 67.68 ? 129  ARG A CD    1 
ATOM   1050 N  NE    . ARG A 1 147 ? -29.566 31.568 53.144 1.00 72.75 ? 129  ARG A NE    1 
ATOM   1051 C  CZ    . ARG A 1 147 ? -29.917 32.687 53.788 1.00 75.62 ? 129  ARG A CZ    1 
ATOM   1052 N  NH1   . ARG A 1 147 ? -28.988 33.516 54.285 1.00 75.84 ? 129  ARG A NH1   1 
ATOM   1053 N  NH2   . ARG A 1 147 ? -31.206 32.991 53.919 1.00 75.60 ? 129  ARG A NH2   1 
ATOM   1054 N  N     . GLY A 1 148 ? -26.349 28.877 57.638 1.00 53.53 ? 130  GLY A N     1 
ATOM   1055 C  CA    . GLY A 1 148 ? -26.330 28.525 59.064 1.00 53.28 ? 130  GLY A CA    1 
ATOM   1056 C  C     . GLY A 1 148 ? -27.229 27.409 59.622 1.00 53.77 ? 130  GLY A C     1 
ATOM   1057 O  O     . GLY A 1 148 ? -26.720 26.405 60.163 1.00 53.55 ? 130  GLY A O     1 
ATOM   1058 N  N     . PRO A 1 149 ? -28.568 27.605 59.578 1.00 53.48 ? 131  PRO A N     1 
ATOM   1059 C  CA    . PRO A 1 149 ? -29.489 26.644 60.233 1.00 53.05 ? 131  PRO A CA    1 
ATOM   1060 C  C     . PRO A 1 149 ? -29.478 25.265 59.632 1.00 53.06 ? 131  PRO A C     1 
ATOM   1061 O  O     . PRO A 1 149 ? -29.572 24.266 60.364 1.00 52.77 ? 131  PRO A O     1 
ATOM   1062 C  CB    . PRO A 1 149 ? -30.874 27.297 60.081 1.00 53.27 ? 131  PRO A CB    1 
ATOM   1063 C  CG    . PRO A 1 149 ? -30.558 28.821 59.864 1.00 53.36 ? 131  PRO A CG    1 
ATOM   1064 C  CD    . PRO A 1 149 ? -29.275 28.789 59.039 1.00 53.66 ? 131  PRO A CD    1 
ATOM   1065 N  N     . GLU A 1 150 ? -29.350 25.199 58.307 1.00 53.23 ? 132  GLU A N     1 
ATOM   1066 C  CA    . GLU A 1 150 ? -29.251 23.904 57.609 1.00 53.03 ? 132  GLU A CA    1 
ATOM   1067 C  C     . GLU A 1 150 ? -27.904 23.179 57.873 1.00 51.24 ? 132  GLU A C     1 
ATOM   1068 O  O     . GLU A 1 150 ? -27.861 21.937 57.895 1.00 51.05 ? 132  GLU A O     1 
ATOM   1069 C  CB    . GLU A 1 150 ? -29.506 24.095 56.098 1.00 53.13 ? 132  GLU A CB    1 
ATOM   1070 C  CG    . GLU A 1 150 ? -29.984 22.797 55.338 1.00 54.99 ? 132  GLU A CG    1 
ATOM   1071 C  CD    . GLU A 1 150 ? -29.982 22.931 53.774 1.00 55.54 ? 132  GLU A CD    1 
ATOM   1072 O  OE1   . GLU A 1 150 ? -30.256 24.041 53.218 1.00 58.57 ? 132  GLU A OE1   1 
ATOM   1073 O  OE2   . GLU A 1 150 ? -29.695 21.911 53.092 1.00 57.08 ? 132  GLU A OE2   1 
ATOM   1074 N  N     . THR A 1 151 ? -26.818 23.945 58.060 1.00 49.28 ? 133  THR A N     1 
ATOM   1075 C  CA    . THR A 1 151 ? -25.508 23.335 58.295 1.00 48.53 ? 133  THR A CA    1 
ATOM   1076 C  C     . THR A 1 151 ? -25.470 22.671 59.655 1.00 47.31 ? 133  THR A C     1 
ATOM   1077 O  O     . THR A 1 151 ? -24.889 21.588 59.820 1.00 45.52 ? 133  THR A O     1 
ATOM   1078 C  CB    . THR A 1 151 ? -24.298 24.318 58.216 1.00 48.29 ? 133  THR A CB    1 
ATOM   1079 O  OG1   . THR A 1 151 ? -24.318 25.147 59.363 1.00 51.48 ? 133  THR A OG1   1 
ATOM   1080 C  CG2   . THR A 1 151 ? -24.326 25.191 56.994 1.00 46.55 ? 133  THR A CG2   1 
ATOM   1081 N  N     . ARG A 1 152 ? -26.099 23.344 60.622 1.00 47.21 ? 134  ARG A N     1 
ATOM   1082 C  CA    . ARG A 1 152 ? -26.185 22.873 62.010 1.00 47.37 ? 134  ARG A CA    1 
ATOM   1083 C  C     . ARG A 1 152 ? -26.873 21.524 62.145 1.00 46.26 ? 134  ARG A C     1 
ATOM   1084 O  O     . ARG A 1 152 ? -26.666 20.826 63.125 1.00 46.83 ? 134  ARG A O     1 
ATOM   1085 C  CB    . ARG A 1 152 ? -26.848 23.919 62.932 1.00 47.40 ? 134  ARG A CB    1 
ATOM   1086 C  CG    . ARG A 1 152 ? -25.911 25.026 63.405 1.00 47.11 ? 134  ARG A CG    1 
ATOM   1087 C  CD    . ARG A 1 152 ? -26.540 25.818 64.543 1.00 49.63 ? 134  ARG A CD    1 
ATOM   1088 N  NE    . ARG A 1 152 ? -25.828 27.081 64.813 1.00 55.00 ? 134  ARG A NE    1 
ATOM   1089 C  CZ    . ARG A 1 152 ? -24.698 27.209 65.538 1.00 54.40 ? 134  ARG A CZ    1 
ATOM   1090 N  NH1   . ARG A 1 152 ? -24.068 26.143 66.082 1.00 51.50 ? 134  ARG A NH1   1 
ATOM   1091 N  NH2   . ARG A 1 152 ? -24.181 28.424 65.688 1.00 52.60 ? 134  ARG A NH2   1 
ATOM   1092 N  N     . GLU A 1 153 ? -27.658 21.119 61.161 1.00 45.03 ? 135  GLU A N     1 
ATOM   1093 C  CA    . GLU A 1 153 ? -28.186 19.744 61.206 1.00 45.88 ? 135  GLU A CA    1 
ATOM   1094 C  C     . GLU A 1 153 ? -27.089 18.687 61.083 1.00 42.11 ? 135  GLU A C     1 
ATOM   1095 O  O     . GLU A 1 153 ? -27.181 17.677 61.745 1.00 41.95 ? 135  GLU A O     1 
ATOM   1096 C  CB    . GLU A 1 153 ? -29.279 19.515 60.149 1.00 46.31 ? 135  GLU A CB    1 
ATOM   1097 C  CG    . GLU A 1 153 ? -30.264 20.679 60.032 1.00 50.10 ? 135  GLU A CG    1 
ATOM   1098 C  CD    . GLU A 1 153 ? -31.368 20.430 58.989 1.00 52.77 ? 135  GLU A CD    1 
ATOM   1099 O  OE1   . GLU A 1 153 ? -31.032 20.191 57.794 1.00 60.03 ? 135  GLU A OE1   1 
ATOM   1100 O  OE2   . GLU A 1 153 ? -32.579 20.509 59.371 1.00 62.17 ? 135  GLU A OE2   1 
ATOM   1101 N  N     . GLN A 1 154 ? -26.060 18.929 60.249 1.00 38.25 ? 136  GLN A N     1 
ATOM   1102 C  CA    . GLN A 1 154 ? -24.965 17.973 60.062 1.00 34.82 ? 136  GLN A CA    1 
ATOM   1103 C  C     . GLN A 1 154 ? -23.732 18.302 60.885 1.00 32.17 ? 136  GLN A C     1 
ATOM   1104 O  O     . GLN A 1 154 ? -22.936 17.406 61.190 1.00 31.44 ? 136  GLN A O     1 
ATOM   1105 C  CB    . GLN A 1 154 ? -24.569 17.883 58.573 1.00 35.64 ? 136  GLN A CB    1 
ATOM   1106 C  CG    . GLN A 1 154 ? -25.630 17.222 57.699 1.00 36.06 ? 136  GLN A CG    1 
ATOM   1107 C  CD    . GLN A 1 154 ? -25.183 17.060 56.224 1.00 33.99 ? 136  GLN A CD    1 
ATOM   1108 O  OE1   . GLN A 1 154 ? -24.376 17.817 55.713 1.00 32.70 ? 136  GLN A OE1   1 
ATOM   1109 N  NE2   . GLN A 1 154 ? -25.703 16.054 55.579 1.00 32.42 ? 136  GLN A NE2   1 
ATOM   1110 N  N     . TYR A 1 155 ? -23.570 19.587 61.203 1.00 30.25 ? 137  TYR A N     1 
ATOM   1111 C  CA    . TYR A 1 155 ? -22.458 20.124 62.021 1.00 30.23 ? 137  TYR A CA    1 
ATOM   1112 C  C     . TYR A 1 155 ? -23.051 20.953 63.154 1.00 30.05 ? 137  TYR A C     1 
ATOM   1113 O  O     . TYR A 1 155 ? -23.163 22.189 63.049 1.00 29.71 ? 137  TYR A O     1 
ATOM   1114 C  CB    . TYR A 1 155 ? -21.511 21.024 61.149 1.00 30.06 ? 137  TYR A CB    1 
ATOM   1115 C  CG    . TYR A 1 155 ? -21.088 20.352 59.844 1.00 30.55 ? 137  TYR A CG    1 
ATOM   1116 C  CD1   . TYR A 1 155 ? -19.991 19.492 59.816 1.00 27.44 ? 137  TYR A CD1   1 
ATOM   1117 C  CD2   . TYR A 1 155 ? -21.844 20.542 58.649 1.00 28.77 ? 137  TYR A CD2   1 
ATOM   1118 C  CE1   . TYR A 1 155 ? -19.634 18.846 58.645 1.00 30.96 ? 137  TYR A CE1   1 
ATOM   1119 C  CE2   . TYR A 1 155 ? -21.488 19.905 57.466 1.00 30.75 ? 137  TYR A CE2   1 
ATOM   1120 C  CZ    . TYR A 1 155 ? -20.374 19.060 57.460 1.00 28.25 ? 137  TYR A CZ    1 
ATOM   1121 O  OH    . TYR A 1 155 ? -20.002 18.424 56.292 1.00 29.45 ? 137  TYR A OH    1 
ATOM   1122 N  N     . PRO A 1 156 ? -23.449 20.292 64.249 1.00 31.40 ? 138  PRO A N     1 
ATOM   1123 C  CA    . PRO A 1 156 ? -24.226 20.974 65.322 1.00 31.82 ? 138  PRO A CA    1 
ATOM   1124 C  C     . PRO A 1 156 ? -23.389 22.090 66.054 1.00 31.73 ? 138  PRO A C     1 
ATOM   1125 O  O     . PRO A 1 156 ? -23.927 23.102 66.516 1.00 33.05 ? 138  PRO A O     1 
ATOM   1126 C  CB    . PRO A 1 156 ? -24.658 19.820 66.237 1.00 32.29 ? 138  PRO A CB    1 
ATOM   1127 C  CG    . PRO A 1 156 ? -24.392 18.516 65.387 1.00 34.05 ? 138  PRO A CG    1 
ATOM   1128 C  CD    . PRO A 1 156 ? -23.176 18.879 64.563 1.00 32.17 ? 138  PRO A CD    1 
ATOM   1129 N  N     . ASN A 1 157 ? -22.064 21.959 66.048 1.00 31.45 ? 139  ASN A N     1 
ATOM   1130 C  CA    . ASN A 1 157 ? -21.214 22.992 66.607 1.00 29.45 ? 139  ASN A CA    1 
ATOM   1131 C  C     . ASN A 1 157 ? -20.596 23.853 65.502 1.00 29.27 ? 139  ASN A C     1 
ATOM   1132 O  O     . ASN A 1 157 ? -19.711 24.703 65.742 1.00 29.21 ? 139  ASN A O     1 
ATOM   1133 C  CB    . ASN A 1 157 ? -20.171 22.336 67.510 1.00 28.54 ? 139  ASN A CB    1 
ATOM   1134 C  CG    . ASN A 1 157 ? -19.491 23.329 68.422 1.00 30.96 ? 139  ASN A CG    1 
ATOM   1135 O  OD1   . ASN A 1 157 ? -20.092 24.355 68.844 1.00 30.33 ? 139  ASN A OD1   1 
ATOM   1136 N  ND2   . ASN A 1 157 ? -18.217 23.066 68.714 1.00 28.28 ? 139  ASN A ND2   1 
ATOM   1137 N  N     . LYS A 1 158 ? -21.063 23.650 64.264 1.00 28.97 ? 140  LYS A N     1 
ATOM   1138 C  CA    . LYS A 1 158 ? -20.438 24.318 63.064 1.00 27.44 ? 140  LYS A CA    1 
ATOM   1139 C  C     . LYS A 1 158 ? -18.913 24.209 63.041 1.00 24.05 ? 140  LYS A C     1 
ATOM   1140 O  O     . LYS A 1 158 ? -18.225 25.175 62.846 1.00 23.13 ? 140  LYS A O     1 
ATOM   1141 C  CB    . LYS A 1 158 ? -20.893 25.790 62.977 1.00 28.97 ? 140  LYS A CB    1 
ATOM   1142 C  CG    . LYS A 1 158 ? -21.953 26.040 61.908 1.00 33.17 ? 140  LYS A CG    1 
ATOM   1143 C  CD    . LYS A 1 158 ? -22.901 27.128 62.316 1.00 38.53 ? 140  LYS A CD    1 
ATOM   1144 C  CE    . LYS A 1 158 ? -22.616 28.469 61.694 1.00 39.37 ? 140  LYS A CE    1 
ATOM   1145 N  NZ    . LYS A 1 158 ? -23.957 29.192 61.649 1.00 37.66 ? 140  LYS A NZ    1 
ATOM   1146 N  N     . PHE A 1 159 ? -18.404 22.992 63.186 1.00 23.56 ? 141  PHE A N     1 
ATOM   1147 C  CA    . PHE A 1 159 ? -16.979 22.752 63.507 1.00 22.99 ? 141  PHE A CA    1 
ATOM   1148 C  C     . PHE A 1 159 ? -16.738 21.346 63.065 1.00 22.22 ? 141  PHE A C     1 
ATOM   1149 O  O     . PHE A 1 159 ? -17.630 20.491 63.172 1.00 21.65 ? 141  PHE A O     1 
ATOM   1150 C  CB    . PHE A 1 159 ? -16.766 22.956 65.089 1.00 22.82 ? 141  PHE A CB    1 
ATOM   1151 C  CG    . PHE A 1 159 ? -15.663 22.193 65.680 1.00 22.19 ? 141  PHE A CG    1 
ATOM   1152 C  CD1   . PHE A 1 159 ? -14.417 22.782 65.850 1.00 25.92 ? 141  PHE A CD1   1 
ATOM   1153 C  CD2   . PHE A 1 159 ? -15.843 20.880 66.093 1.00 24.35 ? 141  PHE A CD2   1 
ATOM   1154 C  CE1   . PHE A 1 159 ? -13.355 22.069 66.374 1.00 22.93 ? 141  PHE A CE1   1 
ATOM   1155 C  CE2   . PHE A 1 159 ? -14.766 20.161 66.589 1.00 20.23 ? 141  PHE A CE2   1 
ATOM   1156 C  CZ    . PHE A 1 159 ? -13.531 20.764 66.734 1.00 21.18 ? 141  PHE A CZ    1 
ATOM   1157 N  N     . ILE A 1 160 ? -15.538 21.072 62.584 1.00 22.54 ? 142  ILE A N     1 
ATOM   1158 C  CA    . ILE A 1 160 ? -15.156 19.700 62.243 1.00 24.04 ? 142  ILE A CA    1 
ATOM   1159 C  C     . ILE A 1 160 ? -13.827 19.456 62.927 1.00 26.74 ? 142  ILE A C     1 
ATOM   1160 O  O     . ILE A 1 160 ? -13.073 20.410 63.138 1.00 26.05 ? 142  ILE A O     1 
ATOM   1161 C  CB    . ILE A 1 160 ? -14.950 19.516 60.692 1.00 23.61 ? 142  ILE A CB    1 
ATOM   1162 C  CG1   . ILE A 1 160 ? -13.866 20.485 60.168 1.00 22.92 ? 142  ILE A CG1   1 
ATOM   1163 C  CG2   . ILE A 1 160 ? -16.229 19.791 59.949 1.00 22.05 ? 142  ILE A CG2   1 
ATOM   1164 C  CD1   . ILE A 1 160 ? -13.241 20.101 58.810 1.00 23.47 ? 142  ILE A CD1   1 
ATOM   1165 N  N     . GLN A 1 161 ? -13.516 18.198 63.241 1.00 29.93 ? 143  GLN A N     1 
ATOM   1166 C  CA    . GLN A 1 161 ? -12.205 17.862 63.805 1.00 33.83 ? 143  GLN A CA    1 
ATOM   1167 C  C     . GLN A 1 161 ? -11.250 17.540 62.682 1.00 34.58 ? 143  GLN A C     1 
ATOM   1168 O  O     . GLN A 1 161 ? -11.329 16.439 62.134 1.00 33.87 ? 143  GLN A O     1 
ATOM   1169 C  CB    . GLN A 1 161 ? -12.291 16.633 64.761 1.00 33.91 ? 143  GLN A CB    1 
ATOM   1170 C  CG    . GLN A 1 161 ? -13.647 16.438 65.454 1.00 37.04 ? 143  GLN A CG    1 
ATOM   1171 C  CD    . GLN A 1 161 ? -13.688 15.215 66.452 1.00 37.50 ? 143  GLN A CD    1 
ATOM   1172 O  OE1   . GLN A 1 161 ? -13.695 15.405 67.682 1.00 41.16 ? 143  GLN A OE1   1 
ATOM   1173 N  NE2   . GLN A 1 161 ? -13.750 13.989 65.916 1.00 37.16 ? 143  GLN A NE2   1 
ATOM   1174 N  N     . ARG A 1 162 ? -10.342 18.458 62.315 1.00 38.16 ? 144  ARG A N     1 
ATOM   1175 C  CA    . ARG A 1 162 ? -9.455  18.162 61.147 1.00 41.90 ? 144  ARG A CA    1 
ATOM   1176 C  C     . ARG A 1 162 ? -8.591  16.948 61.349 1.00 43.06 ? 144  ARG A C     1 
ATOM   1177 O  O     . ARG A 1 162 ? -8.241  16.317 60.375 1.00 44.66 ? 144  ARG A O     1 
ATOM   1178 C  CB    . ARG A 1 162 ? -8.545  19.319 60.696 1.00 42.60 ? 144  ARG A CB    1 
ATOM   1179 C  CG    . ARG A 1 162 ? -9.076  20.712 60.974 1.00 46.26 ? 144  ARG A CG    1 
ATOM   1180 C  CD    . ARG A 1 162 ? -8.116  21.693 60.400 1.00 47.94 ? 144  ARG A CD    1 
ATOM   1181 N  NE    . ARG A 1 162 ? -7.208  22.268 61.377 1.00 48.55 ? 144  ARG A NE    1 
ATOM   1182 C  CZ    . ARG A 1 162 ? -5.915  21.989 61.451 1.00 47.18 ? 144  ARG A CZ    1 
ATOM   1183 N  NH1   . ARG A 1 162 ? -5.362  21.117 60.622 1.00 45.73 ? 144  ARG A NH1   1 
ATOM   1184 N  NH2   . ARG A 1 162 ? -5.174  22.606 62.359 1.00 47.01 ? 144  ARG A NH2   1 
ATOM   1185 N  N     . ASP A 1 163 ? -8.266  16.590 62.592 1.00 44.46 ? 145  ASP A N     1 
ATOM   1186 C  CA    . ASP A 1 163 ? -7.487  15.368 62.829 1.00 46.14 ? 145  ASP A CA    1 
ATOM   1187 C  C     . ASP A 1 163 ? -8.152  14.063 62.392 1.00 44.75 ? 145  ASP A C     1 
ATOM   1188 O  O     . ASP A 1 163 ? -7.513  13.009 62.443 1.00 46.11 ? 145  ASP A O     1 
ATOM   1189 C  CB    . ASP A 1 163 ? -7.032  15.253 64.302 1.00 47.65 ? 145  ASP A CB    1 
ATOM   1190 C  CG    . ASP A 1 163 ? -8.193  15.111 65.294 1.00 54.35 ? 145  ASP A CG    1 
ATOM   1191 O  OD1   . ASP A 1 163 ? -9.398  15.089 64.902 1.00 59.87 ? 145  ASP A OD1   1 
ATOM   1192 O  OD2   . ASP A 1 163 ? -7.884  15.051 66.523 1.00 65.03 ? 145  ASP A OD2   1 
ATOM   1193 N  N     . ASP A 1 164 ? -9.435  14.113 62.021 1.00 42.29 ? 146  ASP A N     1 
ATOM   1194 C  CA    . ASP A 1 164 ? -10.143 12.941 61.570 1.00 39.36 ? 146  ASP A CA    1 
ATOM   1195 C  C     . ASP A 1 164 ? -9.895  12.744 60.069 1.00 39.34 ? 146  ASP A C     1 
ATOM   1196 O  O     . ASP A 1 164 ? -10.810 12.867 59.249 1.00 38.45 ? 146  ASP A O     1 
ATOM   1197 C  CB    . ASP A 1 164 ? -11.617 13.062 61.917 1.00 38.17 ? 146  ASP A CB    1 
ATOM   1198 C  CG    . ASP A 1 164 ? -12.379 11.809 61.641 1.00 37.83 ? 146  ASP A CG    1 
ATOM   1199 O  OD1   . ASP A 1 164 ? -11.733 10.818 61.220 1.00 39.68 ? 146  ASP A OD1   1 
ATOM   1200 O  OD2   . ASP A 1 164 ? -13.629 11.802 61.813 1.00 35.79 ? 146  ASP A OD2   1 
ATOM   1201 N  N     . THR A 1 165 ? -8.649  12.398 59.740 1.00 38.78 ? 147  THR A N     1 
ATOM   1202 C  CA    . THR A 1 165 ? -8.165  12.262 58.371 1.00 39.23 ? 147  THR A CA    1 
ATOM   1203 C  C     . THR A 1 165 ? -8.797  11.115 57.577 1.00 39.08 ? 147  THR A C     1 
ATOM   1204 O  O     . THR A 1 165 ? -8.638  10.993 56.371 1.00 39.71 ? 147  THR A O     1 
ATOM   1205 C  CB    . THR A 1 165 ? -6.639  12.113 58.392 1.00 40.59 ? 147  THR A CB    1 
ATOM   1206 O  OG1   . THR A 1 165 ? -6.284  10.985 59.218 1.00 42.68 ? 147  THR A OG1   1 
ATOM   1207 C  CG2   . THR A 1 165 ? -5.992  13.380 58.957 1.00 39.72 ? 147  THR A CG2   1 
ATOM   1208 N  N     . GLU A 1 166 ? -9.543  10.272 58.252 1.00 38.99 ? 148  GLU A N     1 
ATOM   1209 C  CA    . GLU A 1 166 ? -10.293 9.236  57.598 1.00 38.92 ? 148  GLU A CA    1 
ATOM   1210 C  C     . GLU A 1 166 ? -11.591 9.842  57.038 1.00 36.68 ? 148  GLU A C     1 
ATOM   1211 O  O     . GLU A 1 166 ? -12.118 9.334  56.064 1.00 37.72 ? 148  GLU A O     1 
ATOM   1212 C  CB    . GLU A 1 166 ? -10.650 8.166  58.633 1.00 40.10 ? 148  GLU A CB    1 
ATOM   1213 C  CG    . GLU A 1 166 ? -10.598 6.735  58.125 1.00 49.63 ? 148  GLU A CG    1 
ATOM   1214 C  CD    . GLU A 1 166 ? -9.178  6.169  58.239 1.00 60.96 ? 148  GLU A CD    1 
ATOM   1215 O  OE1   . GLU A 1 166 ? -8.903  5.432  59.234 1.00 64.64 ? 148  GLU A OE1   1 
ATOM   1216 O  OE2   . GLU A 1 166 ? -8.321  6.512  57.366 1.00 65.00 ? 148  GLU A OE2   1 
ATOM   1217 N  N     . ARG A 1 167 ? -12.117 10.894 57.665 1.00 32.95 ? 149  ARG A N     1 
ATOM   1218 C  CA    . ARG A 1 167 ? -13.382 11.488 57.225 1.00 30.57 ? 149  ARG A CA    1 
ATOM   1219 C  C     . ARG A 1 167 ? -13.212 12.718 56.273 1.00 29.28 ? 149  ARG A C     1 
ATOM   1220 O  O     . ARG A 1 167 ? -14.008 12.943 55.363 1.00 29.92 ? 149  ARG A O     1 
ATOM   1221 C  CB    . ARG A 1 167 ? -14.218 11.885 58.433 1.00 30.20 ? 149  ARG A CB    1 
ATOM   1222 C  CG    . ARG A 1 167 ? -15.530 12.588 58.076 1.00 30.17 ? 149  ARG A CG    1 
ATOM   1223 C  CD    . ARG A 1 167 ? -16.478 12.729 59.258 1.00 28.90 ? 149  ARG A CD    1 
ATOM   1224 N  NE    . ARG A 1 167 ? -17.525 13.711 58.957 1.00 28.42 ? 149  ARG A NE    1 
ATOM   1225 C  CZ    . ARG A 1 167 ? -18.312 14.304 59.854 1.00 26.86 ? 149  ARG A CZ    1 
ATOM   1226 N  NH1   . ARG A 1 167 ? -18.184 14.014 61.127 1.00 26.49 ? 149  ARG A NH1   1 
ATOM   1227 N  NH2   . ARG A 1 167 ? -19.216 15.199 59.485 1.00 26.09 ? 149  ARG A NH2   1 
ATOM   1228 N  N     . PHE A 1 168 ? -12.175 13.486 56.510 1.00 27.06 ? 150  PHE A N     1 
ATOM   1229 C  CA    . PHE A 1 168 ? -11.991 14.789 55.948 1.00 28.20 ? 150  PHE A CA    1 
ATOM   1230 C  C     . PHE A 1 168 ? -10.708 14.776 55.127 1.00 28.41 ? 150  PHE A C     1 
ATOM   1231 O  O     . PHE A 1 168 ? -9.691  14.366 55.598 1.00 28.67 ? 150  PHE A O     1 
ATOM   1232 C  CB    . PHE A 1 168 ? -11.874 15.862 57.056 1.00 27.36 ? 150  PHE A CB    1 
ATOM   1233 C  CG    . PHE A 1 168 ? -13.157 16.042 57.891 1.00 27.39 ? 150  PHE A CG    1 
ATOM   1234 C  CD1   . PHE A 1 168 ? -14.324 16.569 57.309 1.00 22.88 ? 150  PHE A CD1   1 
ATOM   1235 C  CD2   . PHE A 1 168 ? -13.164 15.723 59.237 1.00 25.08 ? 150  PHE A CD2   1 
ATOM   1236 C  CE1   . PHE A 1 168 ? -15.498 16.711 58.011 1.00 23.49 ? 150  PHE A CE1   1 
ATOM   1237 C  CE2   . PHE A 1 168 ? -14.345 15.883 59.986 1.00 30.09 ? 150  PHE A CE2   1 
ATOM   1238 C  CZ    . PHE A 1 168 ? -15.520 16.409 59.356 1.00 27.37 ? 150  PHE A CZ    1 
ATOM   1239 N  N     . TYR A 1 169 ? -10.768 15.230 53.890 1.00 29.26 ? 151  TYR A N     1 
ATOM   1240 C  CA    . TYR A 1 169 ? -9.561  15.295 53.078 1.00 28.21 ? 151  TYR A CA    1 
ATOM   1241 C  C     . TYR A 1 169 ? -9.342  16.736 52.648 1.00 27.25 ? 151  TYR A C     1 
ATOM   1242 O  O     . TYR A 1 169 ? -10.238 17.393 52.169 1.00 27.61 ? 151  TYR A O     1 
ATOM   1243 C  CB    . TYR A 1 169 ? -9.704  14.342 51.884 1.00 28.39 ? 151  TYR A CB    1 
ATOM   1244 C  CG    . TYR A 1 169 ? -8.467  14.258 51.005 1.00 28.33 ? 151  TYR A CG    1 
ATOM   1245 C  CD1   . TYR A 1 169 ? -7.522  13.225 51.176 1.00 26.90 ? 151  TYR A CD1   1 
ATOM   1246 C  CD2   . TYR A 1 169 ? -8.266  15.175 49.971 1.00 27.03 ? 151  TYR A CD2   1 
ATOM   1247 C  CE1   . TYR A 1 169 ? -6.383  13.134 50.346 1.00 29.50 ? 151  TYR A CE1   1 
ATOM   1248 C  CE2   . TYR A 1 169 ? -7.124  15.090 49.091 1.00 31.32 ? 151  TYR A CE2   1 
ATOM   1249 C  CZ    . TYR A 1 169 ? -6.194  14.069 49.302 1.00 32.79 ? 151  TYR A CZ    1 
ATOM   1250 O  OH    . TYR A 1 169 ? -5.066  13.995 48.489 1.00 36.87 ? 151  TYR A OH    1 
ATOM   1251 N  N     . ILE A 1 170 ? -8.143  17.235 52.826 1.00 26.64 ? 152  ILE A N     1 
ATOM   1252 C  CA    . ILE A 1 170 ? -7.871  18.637 52.585 1.00 26.40 ? 152  ILE A CA    1 
ATOM   1253 C  C     . ILE A 1 170 ? -7.207  18.795 51.220 1.00 26.06 ? 152  ILE A C     1 
ATOM   1254 O  O     . ILE A 1 170 ? -6.192  18.119 50.910 1.00 24.73 ? 152  ILE A O     1 
ATOM   1255 C  CB    . ILE A 1 170 ? -7.093  19.271 53.812 1.00 27.21 ? 152  ILE A CB    1 
ATOM   1256 C  CG1   . ILE A 1 170 ? -8.052  19.258 55.016 1.00 30.59 ? 152  ILE A CG1   1 
ATOM   1257 C  CG2   . ILE A 1 170 ? -6.622  20.708 53.554 1.00 24.60 ? 152  ILE A CG2   1 
ATOM   1258 C  CD1   . ILE A 1 170 ? -7.420  19.085 56.297 1.00 36.17 ? 152  ILE A CD1   1 
ATOM   1259 N  N     . LEU A 1 171 ? -7.814  19.660 50.397 1.00 25.53 ? 153  LEU A N     1 
ATOM   1260 C  CA    . LEU A 1 171 ? -7.499  19.705 48.974 1.00 27.04 ? 153  LEU A CA    1 
ATOM   1261 C  C     . LEU A 1 171 ? -6.531  20.880 48.801 1.00 27.39 ? 153  LEU A C     1 
ATOM   1262 O  O     . LEU A 1 171 ? -6.883  21.973 48.359 1.00 27.71 ? 153  LEU A O     1 
ATOM   1263 C  CB    . LEU A 1 171 ? -8.782  19.822 48.149 1.00 27.50 ? 153  LEU A CB    1 
ATOM   1264 C  CG    . LEU A 1 171 ? -9.709  18.608 48.116 1.00 26.63 ? 153  LEU A CG    1 
ATOM   1265 C  CD1   . LEU A 1 171 ? -11.191 19.032 47.970 1.00 26.12 ? 153  LEU A CD1   1 
ATOM   1266 C  CD2   . LEU A 1 171 ? -9.348  17.601 47.042 1.00 26.80 ? 153  LEU A CD2   1 
ATOM   1267 N  N     . ASN A 1 172 ? -5.297  20.590 49.185 1.00 27.04 ? 154  ASN A N     1 
ATOM   1268 C  CA    . ASN A 1 172 ? -4.246  21.534 49.441 1.00 28.47 ? 154  ASN A CA    1 
ATOM   1269 C  C     . ASN A 1 172 ? -3.402  22.112 48.308 1.00 27.63 ? 154  ASN A C     1 
ATOM   1270 O  O     . ASN A 1 172 ? -2.710  23.150 48.504 1.00 27.47 ? 154  ASN A O     1 
ATOM   1271 C  CB    . ASN A 1 172 ? -3.226  20.804 50.347 1.00 29.40 ? 154  ASN A CB    1 
ATOM   1272 C  CG    . ASN A 1 172 ? -3.297  21.326 51.693 1.00 35.49 ? 154  ASN A CG    1 
ATOM   1273 O  OD1   . ASN A 1 172 ? -3.843  22.450 51.891 1.00 41.92 ? 154  ASN A OD1   1 
ATOM   1274 N  ND2   . ASN A 1 172 ? -2.814  20.572 52.650 1.00 35.13 ? 154  ASN A ND2   1 
ATOM   1275 N  N     . THR A 1 173 ? -3.350  21.405 47.181 1.00 25.52 ? 155  THR A N     1 
ATOM   1276 C  CA    . THR A 1 173 ? -2.384  21.806 46.159 1.00 25.40 ? 155  THR A CA    1 
ATOM   1277 C  C     . THR A 1 173 ? -3.154  22.240 44.916 1.00 24.70 ? 155  THR A C     1 
ATOM   1278 O  O     . THR A 1 173 ? -4.374  22.024 44.798 1.00 22.14 ? 155  THR A O     1 
ATOM   1279 C  CB    . THR A 1 173 ? -1.437  20.660 45.815 1.00 25.68 ? 155  THR A CB    1 
ATOM   1280 O  OG1   . THR A 1 173 ? -2.162  19.724 45.031 1.00 25.82 ? 155  THR A OG1   1 
ATOM   1281 C  CG2   . THR A 1 173 ? -0.903  19.870 47.166 1.00 25.95 ? 155  THR A CG2   1 
ATOM   1282 N  N     . LEU A 1 174 ? -2.421  22.855 43.996 1.00 24.07 ? 156  LEU A N     1 
ATOM   1283 C  CA    . LEU A 1 174 ? -3.033  23.354 42.816 1.00 23.58 ? 156  LEU A CA    1 
ATOM   1284 C  C     . LEU A 1 174 ? -3.435  22.132 41.883 1.00 23.13 ? 156  LEU A C     1 
ATOM   1285 O  O     . LEU A 1 174 ? -4.359  22.239 41.120 1.00 23.41 ? 156  LEU A O     1 
ATOM   1286 C  CB    . LEU A 1 174 ? -2.073  24.363 42.186 1.00 24.87 ? 156  LEU A CB    1 
ATOM   1287 C  CG    . LEU A 1 174 ? -2.000  25.765 42.768 1.00 26.82 ? 156  LEU A CG    1 
ATOM   1288 C  CD1   . LEU A 1 174 ? -0.890  26.543 42.124 1.00 30.47 ? 156  LEU A CD1   1 
ATOM   1289 C  CD2   . LEU A 1 174 ? -3.265  26.480 42.425 1.00 30.51 ? 156  LEU A CD2   1 
ATOM   1290 N  N     . PHE A 1 175 ? -2.785  20.981 42.034 1.00 21.07 ? 157  PHE A N     1 
ATOM   1291 C  CA    . PHE A 1 175 ? -3.165  19.724 41.403 1.00 20.49 ? 157  PHE A CA    1 
ATOM   1292 C  C     . PHE A 1 175 ? -4.518  19.212 41.786 1.00 21.52 ? 157  PHE A C     1 
ATOM   1293 O  O     . PHE A 1 175 ? -5.027  18.283 41.143 1.00 22.87 ? 157  PHE A O     1 
ATOM   1294 C  CB    . PHE A 1 175 ? -2.113  18.645 41.767 1.00 18.51 ? 157  PHE A CB    1 
ATOM   1295 C  CG    . PHE A 1 175 ? -0.756  18.842 41.052 1.00 22.29 ? 157  PHE A CG    1 
ATOM   1296 C  CD1   . PHE A 1 175 ? -0.654  18.737 39.614 1.00 21.14 ? 157  PHE A CD1   1 
ATOM   1297 C  CD2   . PHE A 1 175 ? 0.413   19.148 41.781 1.00 20.00 ? 157  PHE A CD2   1 
ATOM   1298 C  CE1   . PHE A 1 175 ? 0.611   18.927 38.925 1.00 17.08 ? 157  PHE A CE1   1 
ATOM   1299 C  CE2   . PHE A 1 175 ? 1.656   19.356 41.110 1.00 23.15 ? 157  PHE A CE2   1 
ATOM   1300 C  CZ    . PHE A 1 175 ? 1.754   19.251 39.688 1.00 17.48 ? 157  PHE A CZ    1 
ATOM   1301 N  N     . ASN A 1 176 ? -5.084  19.744 42.869 1.00 23.01 ? 158  ASN A N     1 
ATOM   1302 C  CA    . ASN A 1 176 ? -6.378  19.282 43.445 1.00 22.52 ? 158  ASN A CA    1 
ATOM   1303 C  C     . ASN A 1 176 ? -7.570  20.140 43.004 1.00 22.55 ? 158  ASN A C     1 
ATOM   1304 O  O     . ASN A 1 176 ? -8.735  19.837 43.333 1.00 21.48 ? 158  ASN A O     1 
ATOM   1305 C  CB    . ASN A 1 176 ? -6.369  19.352 44.983 1.00 22.71 ? 158  ASN A CB    1 
ATOM   1306 C  CG    . ASN A 1 176 ? -5.421  18.330 45.657 1.00 23.64 ? 158  ASN A CG    1 
ATOM   1307 O  OD1   . ASN A 1 176 ? -4.688  18.706 46.570 1.00 27.24 ? 158  ASN A OD1   1 
ATOM   1308 N  ND2   . ASN A 1 176 ? -5.444  17.068 45.228 1.00 18.97 ? 158  ASN A ND2   1 
ATOM   1309 N  N     . LEU A 1 177 ? -7.280  21.236 42.312 1.00 22.09 ? 159  LEU A N     1 
ATOM   1310 C  CA    . LEU A 1 177 ? -8.319  22.066 41.755 1.00 22.57 ? 159  LEU A CA    1 
ATOM   1311 C  C     . LEU A 1 177 ? -9.242  21.333 40.817 1.00 23.16 ? 159  LEU A C     1 
ATOM   1312 O  O     . LEU A 1 177 ? -10.480 21.390 41.008 1.00 24.83 ? 159  LEU A O     1 
ATOM   1313 C  CB    . LEU A 1 177 ? -7.727  23.286 41.123 1.00 23.01 ? 159  LEU A CB    1 
ATOM   1314 C  CG    . LEU A 1 177 ? -7.209  24.432 42.061 1.00 23.95 ? 159  LEU A CG    1 
ATOM   1315 C  CD1   . LEU A 1 177 ? -6.714  25.630 41.195 1.00 24.20 ? 159  LEU A CD1   1 
ATOM   1316 C  CD2   . LEU A 1 177 ? -8.268  24.933 43.038 1.00 20.24 ? 159  LEU A CD2   1 
ATOM   1317 N  N     . PRO A 1 178 ? -8.699  20.577 39.833 1.00 23.20 ? 160  PRO A N     1 
ATOM   1318 C  CA    . PRO A 1 178 ? -9.687  19.775 39.105 1.00 22.63 ? 160  PRO A CA    1 
ATOM   1319 C  C     . PRO A 1 178 ? -10.606 18.867 39.944 1.00 22.36 ? 160  PRO A C     1 
ATOM   1320 O  O     . PRO A 1 178 ? -11.843 18.813 39.721 1.00 22.54 ? 160  PRO A O     1 
ATOM   1321 C  CB    . PRO A 1 178 ? -8.832  18.932 38.140 1.00 22.33 ? 160  PRO A CB    1 
ATOM   1322 C  CG    . PRO A 1 178 ? -7.573  19.636 38.030 1.00 23.95 ? 160  PRO A CG    1 
ATOM   1323 C  CD    . PRO A 1 178 ? -7.332  20.382 39.307 1.00 22.91 ? 160  PRO A CD    1 
ATOM   1324 N  N     . GLU A 1 179 ? -10.037 18.089 40.842 1.00 23.46 ? 161  GLU A N     1 
ATOM   1325 C  CA    . GLU A 1 179 ? -10.863 17.192 41.635 1.00 24.61 ? 161  GLU A CA    1 
ATOM   1326 C  C     . GLU A 1 179 ? -11.835 17.901 42.596 1.00 23.64 ? 161  GLU A C     1 
ATOM   1327 O  O     . GLU A 1 179 ? -12.910 17.371 42.798 1.00 25.41 ? 161  GLU A O     1 
ATOM   1328 C  CB    . GLU A 1 179 ? -10.036 16.092 42.319 1.00 25.21 ? 161  GLU A CB    1 
ATOM   1329 C  CG    . GLU A 1 179 ? -9.392  16.524 43.573 1.00 27.37 ? 161  GLU A CG    1 
ATOM   1330 C  CD    . GLU A 1 179 ? -8.303  15.595 44.006 1.00 30.01 ? 161  GLU A CD    1 
ATOM   1331 O  OE1   . GLU A 1 179 ? -8.583  14.778 44.904 1.00 31.69 ? 161  GLU A OE1   1 
ATOM   1332 O  OE2   . GLU A 1 179 ? -7.154  15.705 43.476 1.00 29.83 ? 161  GLU A OE2   1 
ATOM   1333 N  N     . THR A 1 180 ? -11.493 19.089 43.106 1.00 22.47 ? 162  THR A N     1 
ATOM   1334 C  CA    . THR A 1 180 ? -12.375 19.928 43.927 1.00 22.17 ? 162  THR A CA    1 
ATOM   1335 C  C     . THR A 1 180 ? -13.627 20.247 43.120 1.00 23.43 ? 162  THR A C     1 
ATOM   1336 O  O     . THR A 1 180 ? -14.755 20.132 43.625 1.00 25.03 ? 162  THR A O     1 
ATOM   1337 C  CB    . THR A 1 180 ? -11.717 21.290 44.305 1.00 22.18 ? 162  THR A CB    1 
ATOM   1338 O  OG1   . THR A 1 180 ? -10.490 21.060 44.969 1.00 22.78 ? 162  THR A OG1   1 
ATOM   1339 C  CG2   . THR A 1 180 ? -12.592 22.196 45.176 1.00 17.30 ? 162  THR A CG2   1 
ATOM   1340 N  N     . TYR A 1 181 ? -13.447 20.687 41.875 1.00 23.80 ? 163  TYR A N     1 
ATOM   1341 C  CA    . TYR A 1 181 ? -14.603 20.953 41.000 1.00 22.47 ? 163  TYR A CA    1 
ATOM   1342 C  C     . TYR A 1 181 ? -15.337 19.675 40.646 1.00 21.92 ? 163  TYR A C     1 
ATOM   1343 O  O     . TYR A 1 181 ? -16.570 19.620 40.664 1.00 22.47 ? 163  TYR A O     1 
ATOM   1344 C  CB    . TYR A 1 181 ? -14.176 21.780 39.750 1.00 22.93 ? 163  TYR A CB    1 
ATOM   1345 C  CG    . TYR A 1 181 ? -15.340 22.177 38.879 1.00 22.39 ? 163  TYR A CG    1 
ATOM   1346 C  CD1   . TYR A 1 181 ? -16.337 23.061 39.354 1.00 23.57 ? 163  TYR A CD1   1 
ATOM   1347 C  CD2   . TYR A 1 181 ? -15.484 21.624 37.611 1.00 24.87 ? 163  TYR A CD2   1 
ATOM   1348 C  CE1   . TYR A 1 181 ? -17.447 23.406 38.573 1.00 22.65 ? 163  TYR A CE1   1 
ATOM   1349 C  CE2   . TYR A 1 181 ? -16.545 21.955 36.820 1.00 25.66 ? 163  TYR A CE2   1 
ATOM   1350 C  CZ    . TYR A 1 181 ? -17.532 22.822 37.289 1.00 25.44 ? 163  TYR A CZ    1 
ATOM   1351 O  OH    . TYR A 1 181 ? -18.573 23.084 36.446 1.00 24.60 ? 163  TYR A OH    1 
ATOM   1352 N  N     . LEU A 1 182 ? -14.595 18.613 40.363 1.00 21.69 ? 164  LEU A N     1 
ATOM   1353 C  CA    . LEU A 1 182 ? -15.231 17.340 40.014 1.00 22.73 ? 164  LEU A CA    1 
ATOM   1354 C  C     . LEU A 1 182 ? -16.145 16.724 41.091 1.00 23.68 ? 164  LEU A C     1 
ATOM   1355 O  O     . LEU A 1 182 ? -17.237 16.186 40.785 1.00 25.48 ? 164  LEU A O     1 
ATOM   1356 C  CB    . LEU A 1 182 ? -14.199 16.343 39.564 1.00 21.26 ? 164  LEU A CB    1 
ATOM   1357 C  CG    . LEU A 1 182 ? -14.634 15.023 38.991 1.00 22.50 ? 164  LEU A CG    1 
ATOM   1358 C  CD1   . LEU A 1 182 ? -15.676 15.160 37.807 1.00 18.89 ? 164  LEU A CD1   1 
ATOM   1359 C  CD2   . LEU A 1 182 ? -13.374 14.305 38.579 1.00 21.99 ? 164  LEU A CD2   1 
ATOM   1360 N  N     . LEU A 1 183 ? -15.725 16.789 42.345 1.00 24.02 ? 165  LEU A N     1 
ATOM   1361 C  CA    . LEU A 1 183 ? -16.564 16.296 43.454 1.00 23.39 ? 165  LEU A CA    1 
ATOM   1362 C  C     . LEU A 1 183 ? -17.889 17.021 43.526 1.00 23.07 ? 165  LEU A C     1 
ATOM   1363 O  O     . LEU A 1 183 ? -18.917 16.363 43.634 1.00 25.74 ? 165  LEU A O     1 
ATOM   1364 C  CB    . LEU A 1 183 ? -15.810 16.389 44.816 1.00 22.11 ? 165  LEU A CB    1 
ATOM   1365 C  CG    . LEU A 1 183 ? -14.575 15.453 44.855 1.00 21.88 ? 165  LEU A CG    1 
ATOM   1366 C  CD1   . LEU A 1 183 ? -13.508 15.982 45.881 1.00 18.20 ? 165  LEU A CD1   1 
ATOM   1367 C  CD2   . LEU A 1 183 ? -15.045 13.916 45.074 1.00 16.56 ? 165  LEU A CD2   1 
ATOM   1368 N  N     . ALA A 1 184 ? -17.865 18.357 43.516 1.00 22.48 ? 166  ALA A N     1 
ATOM   1369 C  CA    . ALA A 1 184 ? -19.058 19.183 43.355 1.00 21.98 ? 166  ALA A CA    1 
ATOM   1370 C  C     . ALA A 1 184 ? -19.952 18.795 42.141 1.00 22.25 ? 166  ALA A C     1 
ATOM   1371 O  O     . ALA A 1 184 ? -21.127 18.515 42.313 1.00 23.29 ? 166  ALA A O     1 
ATOM   1372 C  CB    . ALA A 1 184 ? -18.651 20.629 43.311 1.00 21.47 ? 166  ALA A CB    1 
ATOM   1373 N  N     . CYS A 1 185 ? -19.379 18.724 40.943 1.00 23.54 ? 167  CYS A N     1 
ATOM   1374 C  CA    . CYS A 1 185 ? -20.068 18.188 39.735 1.00 25.79 ? 167  CYS A CA    1 
ATOM   1375 C  C     . CYS A 1 185 ? -20.753 16.861 39.941 1.00 26.18 ? 167  CYS A C     1 
ATOM   1376 O  O     . CYS A 1 185 ? -21.919 16.713 39.582 1.00 27.08 ? 167  CYS A O     1 
ATOM   1377 C  CB    . CYS A 1 185 ? -19.113 18.007 38.533 1.00 26.16 ? 167  CYS A CB    1 
ATOM   1378 S  SG    . CYS A 1 185 ? -18.585 19.542 37.891 1.00 26.41 ? 167  CYS A SG    1 
ATOM   1379 N  N     . LEU A 1 186 ? -20.012 15.905 40.481 1.00 25.72 ? 168  LEU A N     1 
ATOM   1380 C  CA    . LEU A 1 186 ? -20.533 14.564 40.765 1.00 25.24 ? 168  LEU A CA    1 
ATOM   1381 C  C     . LEU A 1 186 ? -21.665 14.537 41.797 1.00 25.23 ? 168  LEU A C     1 
ATOM   1382 O  O     . LEU A 1 186 ? -22.694 13.909 41.560 1.00 24.68 ? 168  LEU A O     1 
ATOM   1383 C  CB    . LEU A 1 186 ? -19.402 13.658 41.231 1.00 23.69 ? 168  LEU A CB    1 
ATOM   1384 C  CG    . LEU A 1 186 ? -18.384 13.231 40.192 1.00 23.36 ? 168  LEU A CG    1 
ATOM   1385 C  CD1   . LEU A 1 186 ? -17.159 12.529 40.867 1.00 19.94 ? 168  LEU A CD1   1 
ATOM   1386 C  CD2   . LEU A 1 186 ? -18.981 12.310 39.082 1.00 20.69 ? 168  LEU A CD2   1 
ATOM   1387 N  N     . VAL A 1 187 ? -21.473 15.183 42.947 1.00 24.16 ? 169  VAL A N     1 
ATOM   1388 C  CA    . VAL A 1 187 ? -22.555 15.290 43.921 1.00 23.65 ? 169  VAL A CA    1 
ATOM   1389 C  C     . VAL A 1 187 ? -23.824 15.977 43.317 1.00 24.75 ? 169  VAL A C     1 
ATOM   1390 O  O     . VAL A 1 187 ? -24.963 15.517 43.523 1.00 24.22 ? 169  VAL A O     1 
ATOM   1391 C  CB    . VAL A 1 187 ? -22.118 16.023 45.209 1.00 23.21 ? 169  VAL A CB    1 
ATOM   1392 C  CG1   . VAL A 1 187 ? -23.362 16.290 46.083 1.00 20.41 ? 169  VAL A CG1   1 
ATOM   1393 C  CG2   . VAL A 1 187 ? -21.049 15.235 45.953 1.00 23.23 ? 169  VAL A CG2   1 
ATOM   1394 N  N     . ASP A 1 188 ? -23.614 17.055 42.560 1.00 25.55 ? 170  ASP A N     1 
ATOM   1395 C  CA    . ASP A 1 188 ? -24.727 17.740 41.831 1.00 26.67 ? 170  ASP A CA    1 
ATOM   1396 C  C     . ASP A 1 188 ? -25.434 16.844 40.812 1.00 27.30 ? 170  ASP A C     1 
ATOM   1397 O  O     . ASP A 1 188 ? -26.670 16.716 40.844 1.00 28.52 ? 170  ASP A O     1 
ATOM   1398 C  CB    . ASP A 1 188 ? -24.252 19.048 41.221 1.00 26.33 ? 170  ASP A CB    1 
ATOM   1399 C  CG    . ASP A 1 188 ? -25.306 19.691 40.310 1.00 30.89 ? 170  ASP A CG    1 
ATOM   1400 O  OD1   . ASP A 1 188 ? -26.285 20.329 40.789 1.00 29.96 ? 170  ASP A OD1   1 
ATOM   1401 O  OD2   . ASP A 1 188 ? -25.158 19.536 39.081 1.00 33.80 ? 170  ASP A OD2   1 
ATOM   1402 N  N     . PHE A 1 189 ? -24.666 16.148 39.987 1.00 27.56 ? 171  PHE A N     1 
ATOM   1403 C  CA    . PHE A 1 189 ? -25.187 15.163 39.043 1.00 27.52 ? 171  PHE A CA    1 
ATOM   1404 C  C     . PHE A 1 189 ? -26.039 14.087 39.705 1.00 28.13 ? 171  PHE A C     1 
ATOM   1405 O  O     . PHE A 1 189 ? -27.227 13.973 39.408 1.00 29.71 ? 171  PHE A O     1 
ATOM   1406 C  CB    . PHE A 1 189 ? -24.059 14.530 38.199 1.00 27.89 ? 171  PHE A CB    1 
ATOM   1407 C  CG    . PHE A 1 189 ? -24.557 13.444 37.279 1.00 30.58 ? 171  PHE A CG    1 
ATOM   1408 C  CD1   . PHE A 1 189 ? -25.341 13.773 36.164 1.00 31.52 ? 171  PHE A CD1   1 
ATOM   1409 C  CD2   . PHE A 1 189 ? -24.319 12.087 37.563 1.00 30.72 ? 171  PHE A CD2   1 
ATOM   1410 C  CE1   . PHE A 1 189 ? -25.861 12.757 35.323 1.00 32.25 ? 171  PHE A CE1   1 
ATOM   1411 C  CE2   . PHE A 1 189 ? -24.840 11.076 36.727 1.00 31.03 ? 171  PHE A CE2   1 
ATOM   1412 C  CZ    . PHE A 1 189 ? -25.611 11.429 35.618 1.00 30.95 ? 171  PHE A CZ    1 
ATOM   1413 N  N     . PHE A 1 190 ? -25.488 13.314 40.634 1.00 28.05 ? 172  PHE A N     1 
ATOM   1414 C  CA    . PHE A 1 190 ? -26.250 12.225 41.240 1.00 28.36 ? 172  PHE A CA    1 
ATOM   1415 C  C     . PHE A 1 190 ? -27.473 12.703 42.055 1.00 29.46 ? 172  PHE A C     1 
ATOM   1416 O  O     . PHE A 1 190 ? -28.492 12.023 42.076 1.00 30.16 ? 172  PHE A O     1 
ATOM   1417 C  CB    . PHE A 1 190 ? -25.368 11.292 42.090 1.00 27.70 ? 172  PHE A CB    1 
ATOM   1418 C  CG    . PHE A 1 190 ? -24.273 10.617 41.330 1.00 30.30 ? 172  PHE A CG    1 
ATOM   1419 C  CD1   . PHE A 1 190 ? -24.567 9.604  40.389 1.00 33.39 ? 172  PHE A CD1   1 
ATOM   1420 C  CD2   . PHE A 1 190 ? -22.941 10.943 41.565 1.00 29.08 ? 172  PHE A CD2   1 
ATOM   1421 C  CE1   . PHE A 1 190 ? -23.541 8.947  39.678 1.00 30.65 ? 172  PHE A CE1   1 
ATOM   1422 C  CE2   . PHE A 1 190 ? -21.882 10.297 40.843 1.00 28.05 ? 172  PHE A CE2   1 
ATOM   1423 C  CZ    . PHE A 1 190 ? -22.176 9.318  39.910 1.00 29.95 ? 172  PHE A CZ    1 
ATOM   1424 N  N     . THR A 1 191 ? -27.366 13.849 42.738 1.00 31.04 ? 173  THR A N     1 
ATOM   1425 C  CA    . THR A 1 191 ? -28.497 14.430 43.445 1.00 32.45 ? 173  THR A CA    1 
ATOM   1426 C  C     . THR A 1 191 ? -29.708 14.732 42.555 1.00 33.90 ? 173  THR A C     1 
ATOM   1427 O  O     . THR A 1 191 ? -30.857 14.578 42.979 1.00 33.34 ? 173  THR A O     1 
ATOM   1428 C  CB    . THR A 1 191 ? -28.113 15.699 44.182 1.00 31.69 ? 173  THR A CB    1 
ATOM   1429 O  OG1   . THR A 1 191 ? -27.063 15.390 45.094 1.00 34.40 ? 173  THR A OG1   1 
ATOM   1430 C  CG2   . THR A 1 191 ? -29.355 16.273 45.024 1.00 32.92 ? 173  THR A CG2   1 
ATOM   1431 N  N     . ASN A 1 192 ? -29.438 15.218 41.351 1.00 35.52 ? 174  ASN A N     1 
ATOM   1432 C  CA    . ASN A 1 192 ? -30.484 15.681 40.472 1.00 37.45 ? 174  ASN A CA    1 
ATOM   1433 C  C     . ASN A 1 192 ? -30.864 14.704 39.388 1.00 38.45 ? 174  ASN A C     1 
ATOM   1434 O  O     . ASN A 1 192 ? -31.736 15.013 38.622 1.00 38.93 ? 174  ASN A O     1 
ATOM   1435 C  CB    . ASN A 1 192 ? -30.074 17.006 39.846 1.00 37.63 ? 174  ASN A CB    1 
ATOM   1436 C  CG    . ASN A 1 192 ? -29.977 18.106 40.890 1.00 40.90 ? 174  ASN A CG    1 
ATOM   1437 O  OD1   . ASN A 1 192 ? -28.891 18.611 41.166 1.00 45.10 ? 174  ASN A OD1   1 
ATOM   1438 N  ND2   . ASN A 1 192 ? -31.108 18.431 41.536 1.00 39.96 ? 174  ASN A ND2   1 
ATOM   1439 N  N     . CYS A 1 193 ? -30.213 13.541 39.310 1.00 39.52 ? 175  CYS A N     1 
ATOM   1440 C  CA    . CYS A 1 193 ? -30.563 12.577 38.302 1.00 40.10 ? 175  CYS A CA    1 
ATOM   1441 C  C     . CYS A 1 193 ? -31.459 11.542 38.970 1.00 41.33 ? 175  CYS A C     1 
ATOM   1442 O  O     . CYS A 1 193 ? -31.101 10.989 40.007 1.00 40.91 ? 175  CYS A O     1 
ATOM   1443 C  CB    . CYS A 1 193 ? -29.328 11.981 37.679 1.00 40.73 ? 175  CYS A CB    1 
ATOM   1444 S  SG    . CYS A 1 193 ? -29.616 10.493 36.752 1.00 41.88 ? 175  CYS A SG    1 
ATOM   1445 N  N     . PRO A 1 194 ? -32.689 11.362 38.419 1.00 42.43 ? 176  PRO A N     1 
ATOM   1446 C  CA    . PRO A 1 194 ? -33.785 10.601 39.031 1.00 41.89 ? 176  PRO A CA    1 
ATOM   1447 C  C     . PRO A 1 194 ? -33.602 9.082  39.033 1.00 41.67 ? 176  PRO A C     1 
ATOM   1448 O  O     . PRO A 1 194 ? -34.334 8.414  39.747 1.00 40.49 ? 176  PRO A O     1 
ATOM   1449 C  CB    . PRO A 1 194 ? -35.032 11.042 38.236 1.00 42.58 ? 176  PRO A CB    1 
ATOM   1450 C  CG    . PRO A 1 194 ? -34.583 12.276 37.408 1.00 43.67 ? 176  PRO A CG    1 
ATOM   1451 C  CD    . PRO A 1 194 ? -33.108 12.009 37.152 1.00 42.73 ? 176  PRO A CD    1 
ATOM   1452 N  N     . ARG A 1 195 ? -32.605 8.559  38.311 1.00 41.53 ? 177  ARG A N     1 
ATOM   1453 C  CA    . ARG A 1 195 ? -32.121 7.183  38.518 1.00 42.43 ? 177  ARG A CA    1 
ATOM   1454 C  C     . ARG A 1 195 ? -31.583 6.914  39.951 1.00 41.55 ? 177  ARG A C     1 
ATOM   1455 O  O     . ARG A 1 195 ? -31.665 5.793  40.465 1.00 41.83 ? 177  ARG A O     1 
ATOM   1456 C  CB    . ARG A 1 195 ? -31.015 6.822  37.494 1.00 42.87 ? 177  ARG A CB    1 
ATOM   1457 C  CG    . ARG A 1 195 ? -31.293 7.268  36.031 1.00 46.11 ? 177  ARG A CG    1 
ATOM   1458 C  CD    . ARG A 1 195 ? -30.478 6.446  34.982 1.00 46.64 ? 177  ARG A CD    1 
ATOM   1459 N  NE    . ARG A 1 195 ? -29.023 6.658  35.052 1.00 51.80 ? 177  ARG A NE    1 
ATOM   1460 C  CZ    . ARG A 1 195 ? -28.378 7.681  34.458 1.00 52.76 ? 177  ARG A CZ    1 
ATOM   1461 N  NH1   . ARG A 1 195 ? -29.067 8.579  33.767 1.00 52.18 ? 177  ARG A NH1   1 
ATOM   1462 N  NH2   . ARG A 1 195 ? -27.037 7.814  34.553 1.00 52.08 ? 177  ARG A NH2   1 
ATOM   1463 N  N     . TYR A 1 196 ? -31.047 7.933  40.622 1.00 41.08 ? 178  TYR A N     1 
ATOM   1464 C  CA    . TYR A 1 196 ? -30.467 7.705  41.957 1.00 40.44 ? 178  TYR A CA    1 
ATOM   1465 C  C     . TYR A 1 196 ? -31.316 8.269  43.105 1.00 40.21 ? 178  TYR A C     1 
ATOM   1466 O  O     . TYR A 1 196 ? -32.019 9.249  42.920 1.00 40.04 ? 178  TYR A O     1 
ATOM   1467 C  CB    . TYR A 1 196 ? -29.061 8.298  41.985 1.00 40.66 ? 178  TYR A CB    1 
ATOM   1468 C  CG    . TYR A 1 196 ? -28.212 7.869  40.818 1.00 39.75 ? 178  TYR A CG    1 
ATOM   1469 C  CD1   . TYR A 1 196 ? -27.462 6.689  40.868 1.00 40.22 ? 178  TYR A CD1   1 
ATOM   1470 C  CD2   . TYR A 1 196 ? -28.157 8.643  39.658 1.00 41.77 ? 178  TYR A CD2   1 
ATOM   1471 C  CE1   . TYR A 1 196 ? -26.658 6.279  39.751 1.00 40.95 ? 178  TYR A CE1   1 
ATOM   1472 C  CE2   . TYR A 1 196 ? -27.365 8.270  38.559 1.00 43.53 ? 178  TYR A CE2   1 
ATOM   1473 C  CZ    . TYR A 1 196 ? -26.617 7.097  38.604 1.00 41.52 ? 178  TYR A CZ    1 
ATOM   1474 O  OH    . TYR A 1 196 ? -25.857 6.750  37.491 1.00 43.22 ? 178  TYR A OH    1 
ATOM   1475 N  N     . THR A 1 197 ? -31.247 7.654  44.283 1.00 39.94 ? 179  THR A N     1 
ATOM   1476 C  CA    . THR A 1 197 ? -31.886 8.206  45.497 1.00 39.98 ? 179  THR A CA    1 
ATOM   1477 C  C     . THR A 1 197 ? -30.821 8.753  46.470 1.00 40.26 ? 179  THR A C     1 
ATOM   1478 O  O     . THR A 1 197 ? -29.845 8.060  46.819 1.00 40.05 ? 179  THR A O     1 
ATOM   1479 C  CB    . THR A 1 197 ? -32.793 7.123  46.197 1.00 40.15 ? 179  THR A CB    1 
ATOM   1480 O  OG1   . THR A 1 197 ? -33.728 6.621  45.243 1.00 40.77 ? 179  THR A OG1   1 
ATOM   1481 C  CG2   . THR A 1 197 ? -33.565 7.667  47.386 1.00 38.94 ? 179  THR A CG2   1 
ATOM   1482 N  N     . SER A 1 198 ? -31.018 9.991  46.905 1.00 39.71 ? 180  SER A N     1 
ATOM   1483 C  CA    . SER A 1 198 ? -30.095 10.643 47.780 1.00 40.51 ? 180  SER A CA    1 
ATOM   1484 C  C     . SER A 1 198 ? -30.342 10.194 49.175 1.00 41.29 ? 180  SER A C     1 
ATOM   1485 O  O     . SER A 1 198 ? -31.462 10.304 49.653 1.00 43.78 ? 180  SER A O     1 
ATOM   1486 C  CB    . SER A 1 198 ? -30.339 12.124 47.729 1.00 39.93 ? 180  SER A CB    1 
ATOM   1487 O  OG    . SER A 1 198 ? -29.943 12.581 46.458 1.00 44.26 ? 180  SER A OG    1 
ATOM   1488 N  N     . CYS A 1 199 ? -29.322 9.700  49.845 1.00 40.73 ? 181  CYS A N     1 
ATOM   1489 C  CA    . CYS A 1 199 ? -29.403 9.414  51.267 1.00 40.58 ? 181  CYS A CA    1 
ATOM   1490 C  C     . CYS A 1 199 ? -28.394 10.311 52.008 1.00 39.34 ? 181  CYS A C     1 
ATOM   1491 O  O     . CYS A 1 199 ? -27.630 11.041 51.399 1.00 37.79 ? 181  CYS A O     1 
ATOM   1492 C  CB    . CYS A 1 199 ? -29.065 7.955  51.520 1.00 40.95 ? 181  CYS A CB    1 
ATOM   1493 S  SG    . CYS A 1 199 ? -29.970 6.778  50.457 1.00 46.56 ? 181  CYS A SG    1 
ATOM   1494 N  N     . GLU A 1 200 ? -28.346 10.202 53.322 1.00 39.11 ? 182  GLU A N     1 
ATOM   1495 C  CA    . GLU A 1 200 ? -27.487 11.082 54.080 1.00 39.78 ? 182  GLU A CA    1 
ATOM   1496 C  C     . GLU A 1 200 ? -26.004 10.953 53.681 1.00 36.39 ? 182  GLU A C     1 
ATOM   1497 O  O     . GLU A 1 200 ? -25.267 11.971 53.655 1.00 35.66 ? 182  GLU A O     1 
ATOM   1498 C  CB    . GLU A 1 200 ? -27.717 10.917 55.618 1.00 39.64 ? 182  GLU A CB    1 
ATOM   1499 C  CG    . GLU A 1 200 ? -27.798 12.309 56.343 1.00 43.91 ? 182  GLU A CG    1 
ATOM   1500 C  CD    . GLU A 1 200 ? -27.699 12.241 57.889 1.00 46.64 ? 182  GLU A CD    1 
ATOM   1501 O  OE1   . GLU A 1 200 ? -27.779 11.092 58.447 1.00 51.03 ? 182  GLU A OE1   1 
ATOM   1502 O  OE2   . GLU A 1 200 ? -27.515 13.353 58.533 1.00 54.34 ? 182  GLU A OE2   1 
ATOM   1503 N  N     . THR A 1 201 ? -25.590 9.717  53.367 1.00 33.22 ? 183  THR A N     1 
ATOM   1504 C  CA    . THR A 1 201 ? -24.174 9.374  53.215 1.00 31.52 ? 183  THR A CA    1 
ATOM   1505 C  C     . THR A 1 201 ? -23.791 8.895  51.821 1.00 30.90 ? 183  THR A C     1 
ATOM   1506 O  O     . THR A 1 201 ? -22.634 8.515  51.605 1.00 29.70 ? 183  THR A O     1 
ATOM   1507 C  CB    . THR A 1 201 ? -23.667 8.330  54.281 1.00 31.35 ? 183  THR A CB    1 
ATOM   1508 O  OG1   . THR A 1 201 ? -24.254 7.052  54.040 1.00 30.63 ? 183  THR A OG1   1 
ATOM   1509 C  CG2   . THR A 1 201 ? -24.020 8.784  55.716 1.00 30.88 ? 183  THR A CG2   1 
ATOM   1510 N  N     . GLY A 1 202 ? -24.740 8.965  50.888 1.00 29.17 ? 184  GLY A N     1 
ATOM   1511 C  CA    . GLY A 1 202 ? -24.491 8.592  49.507 1.00 30.11 ? 184  GLY A CA    1 
ATOM   1512 C  C     . GLY A 1 202 ? -25.744 8.486  48.662 1.00 30.76 ? 184  GLY A C     1 
ATOM   1513 O  O     . GLY A 1 202 ? -26.791 9.072  49.012 1.00 28.59 ? 184  GLY A O     1 
ATOM   1514 N  N     . PHE A 1 203 ? -25.631 7.680  47.602 1.00 31.12 ? 185  PHE A N     1 
ATOM   1515 C  CA    . PHE A 1 203 ? -26.677 7.464  46.586 1.00 33.33 ? 185  PHE A CA    1 
ATOM   1516 C  C     . PHE A 1 203 ? -26.996 5.999  46.415 1.00 35.14 ? 185  PHE A C     1 
ATOM   1517 O  O     . PHE A 1 203 ? -26.098 5.166  46.314 1.00 35.20 ? 185  PHE A O     1 
ATOM   1518 C  CB    . PHE A 1 203 ? -26.227 8.042  45.212 1.00 32.54 ? 185  PHE A CB    1 
ATOM   1519 C  CG    . PHE A 1 203 ? -25.927 9.503  45.289 1.00 32.81 ? 185  PHE A CG    1 
ATOM   1520 C  CD1   . PHE A 1 203 ? -26.987 10.437 45.354 1.00 31.40 ? 185  PHE A CD1   1 
ATOM   1521 C  CD2   . PHE A 1 203 ? -24.615 9.952  45.403 1.00 32.16 ? 185  PHE A CD2   1 
ATOM   1522 C  CE1   . PHE A 1 203 ? -26.768 11.781 45.496 1.00 28.90 ? 185  PHE A CE1   1 
ATOM   1523 C  CE2   . PHE A 1 203 ? -24.359 11.333 45.546 1.00 35.87 ? 185  PHE A CE2   1 
ATOM   1524 C  CZ    . PHE A 1 203 ? -25.465 12.259 45.605 1.00 35.25 ? 185  PHE A CZ    1 
ATOM   1525 N  N     . LYS A 1 204 ? -28.281 5.701  46.389 1.00 37.40 ? 186  LYS A N     1 
ATOM   1526 C  CA    . LYS A 1 204 ? -28.812 4.370  46.113 1.00 40.29 ? 186  LYS A CA    1 
ATOM   1527 C  C     . LYS A 1 204 ? -29.218 4.274  44.616 1.00 41.44 ? 186  LYS A C     1 
ATOM   1528 O  O     . LYS A 1 204 ? -29.925 5.140  44.112 1.00 41.52 ? 186  LYS A O     1 
ATOM   1529 C  CB    . LYS A 1 204 ? -30.021 4.188  47.000 1.00 40.76 ? 186  LYS A CB    1 
ATOM   1530 C  CG    . LYS A 1 204 ? -30.517 2.814  47.185 1.00 44.04 ? 186  LYS A CG    1 
ATOM   1531 C  CD    . LYS A 1 204 ? -31.850 2.901  47.935 1.00 47.92 ? 186  LYS A CD    1 
ATOM   1532 C  CE    . LYS A 1 204 ? -32.359 1.502  48.366 1.00 52.31 ? 186  LYS A CE    1 
ATOM   1533 N  NZ    . LYS A 1 204 ? -32.217 0.477  47.289 1.00 53.09 ? 186  LYS A NZ    1 
ATOM   1534 N  N     . ASP A 1 205 ? -28.711 3.271  43.906 1.00 43.10 ? 187  ASP A N     1 
ATOM   1535 C  CA    . ASP A 1 205 ? -29.048 3.032  42.487 1.00 45.58 ? 187  ASP A CA    1 
ATOM   1536 C  C     . ASP A 1 205 ? -29.538 1.585  42.365 1.00 45.61 ? 187  ASP A C     1 
ATOM   1537 O  O     . ASP A 1 205 ? -28.777 0.702  42.026 1.00 45.81 ? 187  ASP A O     1 
ATOM   1538 C  CB    . ASP A 1 205 ? -27.807 3.315  41.592 1.00 46.75 ? 187  ASP A CB    1 
ATOM   1539 C  CG    . ASP A 1 205 ? -27.944 2.802  40.129 1.00 50.38 ? 187  ASP A CG    1 
ATOM   1540 O  OD1   . ASP A 1 205 ? -29.061 2.755  39.565 1.00 52.76 ? 187  ASP A OD1   1 
ATOM   1541 O  OD2   . ASP A 1 205 ? -26.881 2.447  39.535 1.00 55.65 ? 187  ASP A OD2   1 
ATOM   1542 N  N     . GLY A 1 206 ? -30.805 1.347  42.684 1.00 45.81 ? 188  GLY A N     1 
ATOM   1543 C  CA    . GLY A 1 206 ? -31.299 -0.020 42.797 1.00 45.57 ? 188  GLY A CA    1 
ATOM   1544 C  C     . GLY A 1 206 ? -30.663 -0.725 43.988 1.00 44.79 ? 188  GLY A C     1 
ATOM   1545 O  O     . GLY A 1 206 ? -30.875 -0.327 45.115 1.00 44.38 ? 188  GLY A O     1 
ATOM   1546 N  N     . ASP A 1 207 ? -29.889 -1.777 43.709 1.00 44.41 ? 189  ASP A N     1 
ATOM   1547 C  CA    . ASP A 1 207 ? -29.154 -2.571 44.728 1.00 43.75 ? 189  ASP A CA    1 
ATOM   1548 C  C     . ASP A 1 207 ? -27.672 -2.182 44.847 1.00 41.78 ? 189  ASP A C     1 
ATOM   1549 O  O     . ASP A 1 207 ? -26.896 -2.860 45.517 1.00 41.97 ? 189  ASP A O     1 
ATOM   1550 C  CB    . ASP A 1 207 ? -29.202 -4.071 44.410 1.00 44.62 ? 189  ASP A CB    1 
ATOM   1551 C  CG    . ASP A 1 207 ? -30.599 -4.620 44.400 1.00 46.73 ? 189  ASP A CG    1 
ATOM   1552 O  OD1   . ASP A 1 207 ? -31.301 -4.505 45.452 1.00 49.81 ? 189  ASP A OD1   1 
ATOM   1553 O  OD2   . ASP A 1 207 ? -30.965 -5.177 43.336 1.00 47.71 ? 189  ASP A OD2   1 
ATOM   1554 N  N     . LEU A 1 208 ? -27.271 -1.107 44.190 1.00 39.41 ? 190  LEU A N     1 
ATOM   1555 C  CA    . LEU A 1 208 ? -25.946 -0.587 44.450 1.00 36.79 ? 190  LEU A CA    1 
ATOM   1556 C  C     . LEU A 1 208 ? -26.065 0.648  45.329 1.00 35.58 ? 190  LEU A C     1 
ATOM   1557 O  O     . LEU A 1 208 ? -26.932 1.491  45.098 1.00 36.04 ? 190  LEU A O     1 
ATOM   1558 C  CB    . LEU A 1 208 ? -25.283 -0.260 43.145 1.00 36.70 ? 190  LEU A CB    1 
ATOM   1559 C  CG    . LEU A 1 208 ? -25.238 -1.389 42.109 1.00 36.28 ? 190  LEU A CG    1 
ATOM   1560 C  CD1   . LEU A 1 208 ? -25.163 -0.743 40.699 1.00 37.22 ? 190  LEU A CD1   1 
ATOM   1561 C  CD2   . LEU A 1 208 ? -24.038 -2.263 42.309 1.00 35.49 ? 190  LEU A CD2   1 
ATOM   1562 N  N     . PHE A 1 209 ? -25.223 0.735  46.351 1.00 33.85 ? 191  PHE A N     1 
ATOM   1563 C  CA    . PHE A 1 209 ? -25.088 1.940  47.171 1.00 32.37 ? 191  PHE A CA    1 
ATOM   1564 C  C     . PHE A 1 209 ? -23.707 2.574  46.990 1.00 32.29 ? 191  PHE A C     1 
ATOM   1565 O  O     . PHE A 1 209 ? -22.683 1.950  47.322 1.00 32.62 ? 191  PHE A O     1 
ATOM   1566 C  CB    . PHE A 1 209 ? -25.250 1.618  48.653 1.00 30.77 ? 191  PHE A CB    1 
ATOM   1567 C  CG    . PHE A 1 209 ? -25.115 2.813  49.522 1.00 32.37 ? 191  PHE A CG    1 
ATOM   1568 C  CD1   . PHE A 1 209 ? -26.139 3.757  49.590 1.00 34.69 ? 191  PHE A CD1   1 
ATOM   1569 C  CD2   . PHE A 1 209 ? -23.966 3.036  50.241 1.00 30.11 ? 191  PHE A CD2   1 
ATOM   1570 C  CE1   . PHE A 1 209 ? -26.008 4.890  50.365 1.00 32.25 ? 191  PHE A CE1   1 
ATOM   1571 C  CE2   . PHE A 1 209 ? -23.838 4.123  51.016 1.00 32.32 ? 191  PHE A CE2   1 
ATOM   1572 C  CZ    . PHE A 1 209 ? -24.864 5.074  51.090 1.00 32.78 ? 191  PHE A CZ    1 
ATOM   1573 N  N     A MET A 1 210 ? -23.683 3.797  46.458 0.50 31.42 ? 192  MET A N     1 
ATOM   1574 N  N     B MET A 1 210 ? -23.663 3.812  46.502 0.50 31.75 ? 192  MET A N     1 
ATOM   1575 C  CA    A MET A 1 210 ? -22.455 4.555  46.345 0.50 30.66 ? 192  MET A CA    1 
ATOM   1576 C  CA    B MET A 1 210 ? -22.400 4.503  46.315 0.50 31.17 ? 192  MET A CA    1 
ATOM   1577 C  C     A MET A 1 210 ? -22.386 5.619  47.452 0.50 30.06 ? 192  MET A C     1 
ATOM   1578 C  C     B MET A 1 210 ? -22.261 5.656  47.339 0.50 30.45 ? 192  MET A C     1 
ATOM   1579 O  O     A MET A 1 210 ? -23.170 6.585  47.489 0.50 29.95 ? 192  MET A O     1 
ATOM   1580 O  O     B MET A 1 210 ? -22.895 6.716  47.214 0.50 30.45 ? 192  MET A O     1 
ATOM   1581 C  CB    A MET A 1 210 ? -22.336 5.175  44.955 0.50 30.80 ? 192  MET A CB    1 
ATOM   1582 C  CB    B MET A 1 210 ? -22.287 4.942  44.850 0.50 32.07 ? 192  MET A CB    1 
ATOM   1583 C  CG    A MET A 1 210 ? -21.153 6.135  44.774 0.50 31.71 ? 192  MET A CG    1 
ATOM   1584 C  CG    B MET A 1 210 ? -21.079 5.794  44.438 0.50 35.41 ? 192  MET A CG    1 
ATOM   1585 S  SD    A MET A 1 210 ? -20.994 6.839  43.113 0.50 32.33 ? 192  MET A SD    1 
ATOM   1586 S  SD    B MET A 1 210 ? -19.420 5.334  45.011 0.50 43.78 ? 192  MET A SD    1 
ATOM   1587 C  CE    A MET A 1 210 ? -22.669 7.402  42.857 0.50 32.81 ? 192  MET A CE    1 
ATOM   1588 C  CE    B MET A 1 210 ? -19.060 3.770  44.241 0.50 37.84 ? 192  MET A CE    1 
ATOM   1589 N  N     . SER A 1 211 ? -21.461 5.415  48.379 1.00 28.53 ? 193  SER A N     1 
ATOM   1590 C  CA    . SER A 1 211 ? -21.241 6.363  49.417 1.00 27.14 ? 193  SER A CA    1 
ATOM   1591 C  C     . SER A 1 211 ? -20.386 7.524  48.868 1.00 26.52 ? 193  SER A C     1 
ATOM   1592 O  O     . SER A 1 211 ? -19.618 7.350  47.946 1.00 26.87 ? 193  SER A O     1 
ATOM   1593 C  CB    . SER A 1 211 ? -20.558 5.652  50.593 1.00 27.01 ? 193  SER A CB    1 
ATOM   1594 O  OG    . SER A 1 211 ? -19.194 5.330  50.329 1.00 27.48 ? 193  SER A OG    1 
ATOM   1595 N  N     . TYR A 1 212 ? -20.552 8.722  49.398 1.00 25.74 ? 194  TYR A N     1 
ATOM   1596 C  CA    . TYR A 1 212 ? -19.628 9.818  49.105 1.00 25.64 ? 194  TYR A CA    1 
ATOM   1597 C  C     . TYR A 1 212 ? -18.160 9.444  49.372 1.00 26.01 ? 194  TYR A C     1 
ATOM   1598 O  O     . TYR A 1 212 ? -17.268 9.983  48.725 1.00 25.65 ? 194  TYR A O     1 
ATOM   1599 C  CB    . TYR A 1 212 ? -19.987 11.020 49.970 1.00 25.54 ? 194  TYR A CB    1 
ATOM   1600 C  CG    . TYR A 1 212 ? -21.316 11.589 49.686 1.00 24.98 ? 194  TYR A CG    1 
ATOM   1601 C  CD1   . TYR A 1 212 ? -21.623 12.049 48.413 1.00 26.83 ? 194  TYR A CD1   1 
ATOM   1602 C  CD2   . TYR A 1 212 ? -22.284 11.690 50.668 1.00 26.76 ? 194  TYR A CD2   1 
ATOM   1603 C  CE1   . TYR A 1 212 ? -22.875 12.599 48.126 1.00 28.67 ? 194  TYR A CE1   1 
ATOM   1604 C  CE2   . TYR A 1 212 ? -23.563 12.269 50.382 1.00 24.02 ? 194  TYR A CE2   1 
ATOM   1605 C  CZ    . TYR A 1 212 ? -23.818 12.721 49.131 1.00 25.70 ? 194  TYR A CZ    1 
ATOM   1606 O  OH    . TYR A 1 212 ? -25.028 13.286 48.811 1.00 31.24 ? 194  TYR A OH    1 
ATOM   1607 N  N     . ARG A 1 213 ? -17.922 8.553  50.350 1.00 26.43 ? 195  ARG A N     1 
ATOM   1608 C  CA    . ARG A 1 213 ? -16.593 8.075  50.706 1.00 27.47 ? 195  ARG A CA    1 
ATOM   1609 C  C     . ARG A 1 213 ? -15.987 7.280  49.548 1.00 27.98 ? 195  ARG A C     1 
ATOM   1610 O  O     . ARG A 1 213 ? -14.867 7.535  49.124 1.00 27.55 ? 195  ARG A O     1 
ATOM   1611 C  CB    . ARG A 1 213 ? -16.708 7.199  51.955 1.00 28.29 ? 195  ARG A CB    1 
ATOM   1612 C  CG    . ARG A 1 213 ? -15.507 7.289  52.953 1.00 34.54 ? 195  ARG A CG    1 
ATOM   1613 C  CD    . ARG A 1 213 ? -14.253 6.866  52.316 1.00 43.62 ? 195  ARG A CD    1 
ATOM   1614 N  NE    . ARG A 1 213 ? -13.030 7.376  52.957 1.00 52.10 ? 195  ARG A NE    1 
ATOM   1615 C  CZ    . ARG A 1 213 ? -11.783 7.177  52.480 1.00 52.96 ? 195  ARG A CZ    1 
ATOM   1616 N  NH1   . ARG A 1 213 ? -11.562 6.475  51.345 1.00 49.06 ? 195  ARG A NH1   1 
ATOM   1617 N  NH2   . ARG A 1 213 ? -10.757 7.697  53.146 1.00 52.92 ? 195  ARG A NH2   1 
ATOM   1618 N  N     . SER A 1 214 ? -16.726 6.314  48.995 1.00 27.95 ? 196  SER A N     1 
ATOM   1619 C  CA    . SER A 1 214 ? -16.174 5.520  47.937 1.00 28.07 ? 196  SER A CA    1 
ATOM   1620 C  C     . SER A 1 214 ? -16.156 6.252  46.558 1.00 28.35 ? 196  SER A C     1 
ATOM   1621 O  O     . SER A 1 214 ? -15.226 6.070  45.743 1.00 27.87 ? 196  SER A O     1 
ATOM   1622 C  CB    . SER A 1 214 ? -16.950 4.218  47.866 1.00 29.35 ? 196  SER A CB    1 
ATOM   1623 O  OG    . SER A 1 214 ? -18.194 4.484  47.273 1.00 33.22 ? 196  SER A OG    1 
ATOM   1624 N  N     . MET A 1 215 ? -17.147 7.104  46.323 1.00 27.24 ? 197  MET A N     1 
ATOM   1625 C  CA    . MET A 1 215 ? -17.077 8.089  45.257 1.00 28.10 ? 197  MET A CA    1 
ATOM   1626 C  C     . MET A 1 215 ? -15.803 8.970  45.329 1.00 26.55 ? 197  MET A C     1 
ATOM   1627 O  O     . MET A 1 215 ? -15.104 9.103  44.345 1.00 25.48 ? 197  MET A O     1 
ATOM   1628 C  CB    . MET A 1 215 ? -18.300 8.981  45.281 1.00 26.74 ? 197  MET A CB    1 
ATOM   1629 C  CG    . MET A 1 215 ? -18.427 9.807  43.994 1.00 30.73 ? 197  MET A CG    1 
ATOM   1630 S  SD    . MET A 1 215 ? -19.724 11.033 44.102 1.00 34.96 ? 197  MET A SD    1 
ATOM   1631 C  CE    . MET A 1 215 ? -18.727 12.231 44.980 1.00 31.60 ? 197  MET A CE    1 
ATOM   1632 N  N     . PHE A 1 216 ? -15.543 9.571  46.480 1.00 24.32 ? 198  PHE A N     1 
ATOM   1633 C  CA    . PHE A 1 216 ? -14.348 10.356 46.685 1.00 25.00 ? 198  PHE A CA    1 
ATOM   1634 C  C     . PHE A 1 216 ? -13.092 9.546  46.348 1.00 25.01 ? 198  PHE A C     1 
ATOM   1635 O  O     . PHE A 1 216 ? -12.193 10.066 45.738 1.00 23.60 ? 198  PHE A O     1 
ATOM   1636 C  CB    . PHE A 1 216 ? -14.235 10.849 48.130 1.00 23.98 ? 198  PHE A CB    1 
ATOM   1637 C  CG    . PHE A 1 216 ? -12.838 11.365 48.491 1.00 24.23 ? 198  PHE A CG    1 
ATOM   1638 C  CD1   . PHE A 1 216 ? -12.442 12.633 48.123 1.00 22.67 ? 198  PHE A CD1   1 
ATOM   1639 C  CD2   . PHE A 1 216 ? -11.941 10.566 49.182 1.00 21.93 ? 198  PHE A CD2   1 
ATOM   1640 C  CE1   . PHE A 1 216 ? -11.188 13.141 48.439 1.00 23.88 ? 198  PHE A CE1   1 
ATOM   1641 C  CE2   . PHE A 1 216 ? -10.654 11.052 49.478 1.00 22.25 ? 198  PHE A CE2   1 
ATOM   1642 C  CZ    . PHE A 1 216 ? -10.281 12.324 49.104 1.00 21.61 ? 198  PHE A CZ    1 
ATOM   1643 N  N     . GLN A 1 217 ? -13.039 8.297  46.794 1.00 27.35 ? 199  GLN A N     1 
ATOM   1644 C  CA    . GLN A 1 217 ? -11.861 7.417  46.635 1.00 28.13 ? 199  GLN A CA    1 
ATOM   1645 C  C     . GLN A 1 217 ? -11.662 7.119  45.144 1.00 27.45 ? 199  GLN A C     1 
ATOM   1646 O  O     . GLN A 1 217 ? -10.536 7.159  44.670 1.00 27.43 ? 199  GLN A O     1 
ATOM   1647 C  CB    . GLN A 1 217 ? -12.008 6.082  47.415 1.00 27.81 ? 199  GLN A CB    1 
ATOM   1648 C  CG    . GLN A 1 217 ? -10.669 5.280  47.564 1.00 30.97 ? 199  GLN A CG    1 
ATOM   1649 C  CD    . GLN A 1 217 ? -9.487  6.175  48.023 1.00 37.73 ? 199  GLN A CD    1 
ATOM   1650 O  OE1   . GLN A 1 217 ? -9.559  6.841  49.068 1.00 38.53 ? 199  GLN A OE1   1 
ATOM   1651 N  NE2   . GLN A 1 217 ? -8.433  6.240  47.200 1.00 38.14 ? 199  GLN A NE2   1 
ATOM   1652 N  N     . ASP A 1 218 ? -12.756 6.858  44.423 1.00 25.98 ? 200  ASP A N     1 
ATOM   1653 C  CA    . ASP A 1 218 ? -12.708 6.759  42.938 1.00 26.56 ? 200  ASP A CA    1 
ATOM   1654 C  C     . ASP A 1 218 ? -12.092 7.985  42.259 1.00 25.76 ? 200  ASP A C     1 
ATOM   1655 O  O     . ASP A 1 218 ? -11.286 7.819  41.387 1.00 26.55 ? 200  ASP A O     1 
ATOM   1656 C  CB    . ASP A 1 218 ? -14.095 6.542  42.339 1.00 26.02 ? 200  ASP A CB    1 
ATOM   1657 C  CG    . ASP A 1 218 ? -14.610 5.141  42.551 1.00 28.39 ? 200  ASP A CG    1 
ATOM   1658 O  OD1   . ASP A 1 218 ? -13.833 4.289  42.992 1.00 30.98 ? 200  ASP A OD1   1 
ATOM   1659 O  OD2   . ASP A 1 218 ? -15.806 4.872  42.262 1.00 34.99 ? 200  ASP A OD2   1 
ATOM   1660 N  N     . VAL A 1 219 ? -12.493 9.194  42.639 1.00 25.09 ? 201  VAL A N     1 
ATOM   1661 C  CA    . VAL A 1 219 ? -11.972 10.397 42.017 1.00 26.54 ? 201  VAL A CA    1 
ATOM   1662 C  C     . VAL A 1 219 ? -10.473 10.487 42.290 1.00 27.23 ? 201  VAL A C     1 
ATOM   1663 O  O     . VAL A 1 219 ? -9.675  10.811 41.422 1.00 28.11 ? 201  VAL A O     1 
ATOM   1664 C  CB    . VAL A 1 219 ? -12.672 11.661 42.552 1.00 26.67 ? 201  VAL A CB    1 
ATOM   1665 C  CG1   . VAL A 1 219 ? -11.910 12.938 42.171 1.00 26.54 ? 201  VAL A CG1   1 
ATOM   1666 C  CG2   . VAL A 1 219 ? -14.075 11.743 42.054 1.00 25.89 ? 201  VAL A CG2   1 
ATOM   1667 N  N     . ARG A 1 220 ? -10.106 10.203 43.524 1.00 27.68 ? 202  ARG A N     1 
ATOM   1668 C  CA    . ARG A 1 220 ? -8.735  10.300 44.004 1.00 27.89 ? 202  ARG A CA    1 
ATOM   1669 C  C     . ARG A 1 220 ? -7.864  9.267  43.213 1.00 27.35 ? 202  ARG A C     1 
ATOM   1670 O  O     . ARG A 1 220 ? -6.776  9.584  42.689 1.00 26.06 ? 202  ARG A O     1 
ATOM   1671 C  CB    . ARG A 1 220 ? -8.826  10.069 45.524 1.00 27.43 ? 202  ARG A CB    1 
ATOM   1672 C  CG    . ARG A 1 220 ? -7.699  10.475 46.334 1.00 32.38 ? 202  ARG A CG    1 
ATOM   1673 C  CD    . ARG A 1 220 ? -7.639  11.953 46.644 1.00 32.38 ? 202  ARG A CD    1 
ATOM   1674 N  NE    . ARG A 1 220 ? -7.081  12.759 45.563 1.00 31.10 ? 202  ARG A NE    1 
ATOM   1675 C  CZ    . ARG A 1 220 ? -5.873  12.598 45.019 1.00 31.71 ? 202  ARG A CZ    1 
ATOM   1676 N  NH1   . ARG A 1 220 ? -5.076  11.644 45.428 1.00 28.97 ? 202  ARG A NH1   1 
ATOM   1677 N  NH2   . ARG A 1 220 ? -5.452  13.421 44.061 1.00 29.85 ? 202  ARG A NH2   1 
ATOM   1678 N  N     . ASP A 1 221 ? -8.379  8.046  43.065 1.00 27.27 ? 203  ASP A N     1 
ATOM   1679 C  CA    . ASP A 1 221 ? -7.677  7.023  42.297 1.00 27.24 ? 203  ASP A CA    1 
ATOM   1680 C  C     . ASP A 1 221 ? -7.554  7.405  40.844 1.00 26.69 ? 203  ASP A C     1 
ATOM   1681 O  O     . ASP A 1 221 ? -6.531  7.164  40.240 1.00 27.55 ? 203  ASP A O     1 
ATOM   1682 C  CB    . ASP A 1 221 ? -8.397  5.679  42.351 1.00 28.06 ? 203  ASP A CB    1 
ATOM   1683 C  CG    . ASP A 1 221 ? -8.396  5.022  43.745 1.00 31.99 ? 203  ASP A CG    1 
ATOM   1684 O  OD1   . ASP A 1 221 ? -7.634  5.398  44.684 1.00 34.35 ? 203  ASP A OD1   1 
ATOM   1685 O  OD2   . ASP A 1 221 ? -9.198  4.079  43.888 1.00 38.10 ? 203  ASP A OD2   1 
ATOM   1686 N  N     . ALA A 1 222 ? -8.630  7.893  40.240 1.00 25.80 ? 204  ALA A N     1 
ATOM   1687 C  CA    . ALA A 1 222 ? -8.593  8.370  38.841 1.00 24.53 ? 204  ALA A CA    1 
ATOM   1688 C  C     . ALA A 1 222 ? -7.535  9.471  38.635 1.00 24.34 ? 204  ALA A C     1 
ATOM   1689 O  O     . ALA A 1 222 ? -6.801  9.420  37.645 1.00 22.83 ? 204  ALA A O     1 
ATOM   1690 C  CB    . ALA A 1 222 ? -9.988  8.881  38.386 1.00 23.55 ? 204  ALA A CB    1 
ATOM   1691 N  N     . VAL A 1 223 ? -7.510  10.497 39.516 1.00 24.09 ? 205  VAL A N     1 
ATOM   1692 C  CA    . VAL A 1 223 ? -6.453  11.527 39.472 1.00 24.51 ? 205  VAL A CA    1 
ATOM   1693 C  C     . VAL A 1 223 ? -5.069  10.910 39.556 1.00 24.39 ? 205  VAL A C     1 
ATOM   1694 O  O     . VAL A 1 223 ? -4.196  11.224 38.799 1.00 25.57 ? 205  VAL A O     1 
ATOM   1695 C  CB    . VAL A 1 223 ? -6.610  12.600 40.578 1.00 25.47 ? 205  VAL A CB    1 
ATOM   1696 C  CG1   . VAL A 1 223 ? -5.396  13.541 40.572 1.00 20.86 ? 205  VAL A CG1   1 
ATOM   1697 C  CG2   . VAL A 1 223 ? -7.963  13.411 40.374 1.00 21.71 ? 205  VAL A CG2   1 
ATOM   1698 N  N     . ASP A 1 224 ? -4.883  9.989  40.472 1.00 25.83 ? 206  ASP A N     1 
ATOM   1699 C  CA    . ASP A 1 224 ? -3.600  9.322  40.633 1.00 26.88 ? 206  ASP A CA    1 
ATOM   1700 C  C     . ASP A 1 224 ? -3.213  8.602  39.323 1.00 27.60 ? 206  ASP A C     1 
ATOM   1701 O  O     . ASP A 1 224 ? -2.063  8.699  38.874 1.00 27.89 ? 206  ASP A O     1 
ATOM   1702 C  CB    . ASP A 1 224 ? -3.674  8.327  41.793 1.00 26.47 ? 206  ASP A CB    1 
ATOM   1703 C  CG    . ASP A 1 224 ? -3.538  8.992  43.154 1.00 30.15 ? 206  ASP A CG    1 
ATOM   1704 O  OD1   . ASP A 1 224 ? -3.184  10.193 43.244 1.00 31.46 ? 206  ASP A OD1   1 
ATOM   1705 O  OD2   . ASP A 1 224 ? -3.805  8.301  44.167 1.00 33.43 ? 206  ASP A OD2   1 
ATOM   1706 N  N     . TRP A 1 225 ? -4.171  7.860  38.750 1.00 26.97 ? 207  TRP A N     1 
ATOM   1707 C  CA    . TRP A 1 225 ? -3.995  7.096  37.529 1.00 26.93 ? 207  TRP A CA    1 
ATOM   1708 C  C     . TRP A 1 225 ? -3.595  8.031  36.381 1.00 27.48 ? 207  TRP A C     1 
ATOM   1709 O  O     . TRP A 1 225 ? -2.652  7.759  35.666 1.00 28.85 ? 207  TRP A O     1 
ATOM   1710 C  CB    . TRP A 1 225 ? -5.311  6.332  37.177 1.00 27.22 ? 207  TRP A CB    1 
ATOM   1711 C  CG    . TRP A 1 225 ? -5.170  5.428  35.977 1.00 26.84 ? 207  TRP A CG    1 
ATOM   1712 C  CD1   . TRP A 1 225 ? -4.831  4.101  35.981 1.00 27.02 ? 207  TRP A CD1   1 
ATOM   1713 C  CD2   . TRP A 1 225 ? -5.341  5.798  34.615 1.00 24.95 ? 207  TRP A CD2   1 
ATOM   1714 N  NE1   . TRP A 1 225 ? -4.776  3.628  34.699 1.00 26.48 ? 207  TRP A NE1   1 
ATOM   1715 C  CE2   . TRP A 1 225 ? -5.079  4.650  33.836 1.00 27.71 ? 207  TRP A CE2   1 
ATOM   1716 C  CE3   . TRP A 1 225 ? -5.694  6.992  33.968 1.00 23.14 ? 207  TRP A CE3   1 
ATOM   1717 C  CZ2   . TRP A 1 225 ? -5.144  4.665  32.431 1.00 26.71 ? 207  TRP A CZ2   1 
ATOM   1718 C  CZ3   . TRP A 1 225 ? -5.762  7.008  32.588 1.00 27.58 ? 207  TRP A CZ3   1 
ATOM   1719 C  CH2   . TRP A 1 225 ? -5.495  5.843  31.826 1.00 24.95 ? 207  TRP A CH2   1 
ATOM   1720 N  N     . VAL A 1 226 ? -4.328  9.113  36.174 1.00 27.38 ? 208  VAL A N     1 
ATOM   1721 C  CA    . VAL A 1 226 ? -4.004  10.103 35.138 1.00 27.65 ? 208  VAL A CA    1 
ATOM   1722 C  C     . VAL A 1 226 ? -2.534  10.641 35.206 1.00 29.00 ? 208  VAL A C     1 
ATOM   1723 O  O     . VAL A 1 226 ? -1.911  10.856 34.172 1.00 30.61 ? 208  VAL A O     1 
ATOM   1724 C  CB    . VAL A 1 226 ? -5.023  11.272 35.245 1.00 27.00 ? 208  VAL A CB    1 
ATOM   1725 C  CG1   . VAL A 1 226 ? -4.491  12.534 34.684 1.00 26.44 ? 208  VAL A CG1   1 
ATOM   1726 C  CG2   . VAL A 1 226 ? -6.363  10.887 34.597 1.00 26.41 ? 208  VAL A CG2   1 
ATOM   1727 N  N     . HIS A 1 227 ? -2.019  10.903 36.412 1.00 29.78 ? 209  HIS A N     1 
ATOM   1728 C  CA    . HIS A 1 227 ? -0.636  11.322 36.632 1.00 30.51 ? 209  HIS A CA    1 
ATOM   1729 C  C     . HIS A 1 227 ? 0.317   10.160 36.470 1.00 31.59 ? 209  HIS A C     1 
ATOM   1730 O  O     . HIS A 1 227 ? 1.363   10.326 35.886 1.00 32.69 ? 209  HIS A O     1 
ATOM   1731 C  CB    . HIS A 1 227 ? -0.418  11.910 38.044 1.00 29.96 ? 209  HIS A CB    1 
ATOM   1732 C  CG    . HIS A 1 227 ? -0.903  13.315 38.206 1.00 27.67 ? 209  HIS A CG    1 
ATOM   1733 N  ND1   . HIS A 1 227 ? -2.216  13.620 38.515 1.00 28.97 ? 209  HIS A ND1   1 
ATOM   1734 C  CD2   . HIS A 1 227 ? -0.255  14.498 38.119 1.00 23.87 ? 209  HIS A CD2   1 
ATOM   1735 C  CE1   . HIS A 1 227 ? -2.355  14.936 38.603 1.00 25.31 ? 209  HIS A CE1   1 
ATOM   1736 N  NE2   . HIS A 1 227 ? -1.177  15.489 38.361 1.00 24.92 ? 209  HIS A NE2   1 
ATOM   1737 N  N     . TYR A 1 228 ? -0.026  8.972  36.943 1.00 32.71 ? 210  TYR A N     1 
ATOM   1738 C  CA    . TYR A 1 228 ? 0.974   7.915  36.889 1.00 33.94 ? 210  TYR A CA    1 
ATOM   1739 C  C     . TYR A 1 228 ? 0.886   7.050  35.634 1.00 34.49 ? 210  TYR A C     1 
ATOM   1740 O  O     . TYR A 1 228 ? 1.892   6.555  35.173 1.00 34.81 ? 210  TYR A O     1 
ATOM   1741 C  CB    . TYR A 1 228 ? 0.949   7.042  38.138 1.00 34.86 ? 210  TYR A CB    1 
ATOM   1742 C  CG    . TYR A 1 228 ? 1.208   7.792  39.415 1.00 37.71 ? 210  TYR A CG    1 
ATOM   1743 C  CD1   . TYR A 1 228 ? 0.405   7.592  40.521 1.00 38.78 ? 210  TYR A CD1   1 
ATOM   1744 C  CD2   . TYR A 1 228 ? 2.259   8.712  39.521 1.00 41.53 ? 210  TYR A CD2   1 
ATOM   1745 C  CE1   . TYR A 1 228 ? 0.630   8.246  41.692 1.00 39.30 ? 210  TYR A CE1   1 
ATOM   1746 C  CE2   . TYR A 1 228 ? 2.471   9.425  40.706 1.00 41.26 ? 210  TYR A CE2   1 
ATOM   1747 C  CZ    . TYR A 1 228 ? 1.647   9.165  41.790 1.00 41.61 ? 210  TYR A CZ    1 
ATOM   1748 O  OH    . TYR A 1 228 ? 1.827   9.814  43.007 1.00 42.83 ? 210  TYR A OH    1 
ATOM   1749 N  N     . LYS A 1 229 ? -0.304  6.885  35.071 1.00 33.75 ? 211  LYS A N     1 
ATOM   1750 C  CA    . LYS A 1 229 ? -0.493  5.882  34.048 1.00 34.54 ? 211  LYS A CA    1 
ATOM   1751 C  C     . LYS A 1 229 ? -1.238  6.389  32.818 1.00 34.34 ? 211  LYS A C     1 
ATOM   1752 O  O     . LYS A 1 229 ? -1.328  5.671  31.827 1.00 35.08 ? 211  LYS A O     1 
ATOM   1753 C  CB    . LYS A 1 229 ? -1.250  4.703  34.625 1.00 34.35 ? 211  LYS A CB    1 
ATOM   1754 C  CG    . LYS A 1 229 ? -0.375  3.756  35.397 1.00 38.80 ? 211  LYS A CG    1 
ATOM   1755 C  CD    . LYS A 1 229 ? -1.251  2.890  36.273 1.00 45.79 ? 211  LYS A CD    1 
ATOM   1756 C  CE    . LYS A 1 229 ? -0.425  2.125  37.319 1.00 51.69 ? 211  LYS A CE    1 
ATOM   1757 N  NZ    . LYS A 1 229 ? -1.278  1.046  38.022 1.00 53.48 ? 211  LYS A NZ    1 
ATOM   1758 N  N     . GLY A 1 230 ? -1.791  7.591  32.884 1.00 32.21 ? 212  GLY A N     1 
ATOM   1759 C  CA    . GLY A 1 230 ? -2.510  8.091  31.778 1.00 31.82 ? 212  GLY A CA    1 
ATOM   1760 C  C     . GLY A 1 230 ? -1.693  9.074  31.008 1.00 32.42 ? 212  GLY A C     1 
ATOM   1761 O  O     . GLY A 1 230 ? -0.438  9.040  30.993 1.00 32.94 ? 212  GLY A O     1 
ATOM   1762 N  N     . SER A 1 231 ? -2.404  10.005 30.411 1.00 31.83 ? 213  SER A N     1 
ATOM   1763 C  CA    . SER A 1 231 ? -1.838  10.740 29.314 1.00 33.04 ? 213  SER A CA    1 
ATOM   1764 C  C     . SER A 1 231 ? -1.595  12.218 29.632 1.00 32.10 ? 213  SER A C     1 
ATOM   1765 O  O     . SER A 1 231 ? -1.299  13.022 28.727 1.00 33.67 ? 213  SER A O     1 
ATOM   1766 C  CB    . SER A 1 231 ? -2.755  10.537 28.080 1.00 33.25 ? 213  SER A CB    1 
ATOM   1767 O  OG    . SER A 1 231 ? -3.826  11.464 28.067 1.00 35.25 ? 213  SER A OG    1 
ATOM   1768 N  N     . LEU A 1 232 ? -1.706  12.581 30.915 1.00 30.32 ? 214  LEU A N     1 
ATOM   1769 C  CA    . LEU A 1 232 ? -1.510  13.991 31.329 1.00 29.38 ? 214  LEU A CA    1 
ATOM   1770 C  C     . LEU A 1 232 ? -0.089  14.493 31.002 1.00 28.53 ? 214  LEU A C     1 
ATOM   1771 O  O     . LEU A 1 232 ? 0.045   15.583 30.485 1.00 28.34 ? 214  LEU A O     1 
ATOM   1772 C  CB    . LEU A 1 232 ? -1.845  14.210 32.803 1.00 27.04 ? 214  LEU A CB    1 
ATOM   1773 C  CG    . LEU A 1 232 ? -1.613  15.613 33.395 1.00 28.60 ? 214  LEU A CG    1 
ATOM   1774 C  CD1   . LEU A 1 232 ? -2.481  16.652 32.720 1.00 24.93 ? 214  LEU A CD1   1 
ATOM   1775 C  CD2   . LEU A 1 232 ? -1.895  15.643 34.889 1.00 29.30 ? 214  LEU A CD2   1 
ATOM   1776 N  N     . LYS A 1 233 ? 0.916   13.712 31.397 1.00 28.38 ? 215  LYS A N     1 
ATOM   1777 C  CA    . LYS A 1 233 ? 2.328   13.999 31.139 1.00 30.59 ? 215  LYS A CA    1 
ATOM   1778 C  C     . LYS A 1 233 ? 2.712   14.103 29.663 1.00 30.81 ? 215  LYS A C     1 
ATOM   1779 O  O     . LYS A 1 233 ? 3.230   15.118 29.241 1.00 29.37 ? 215  LYS A O     1 
ATOM   1780 C  CB    . LYS A 1 233 ? 3.225   13.031 31.916 1.00 30.21 ? 215  LYS A CB    1 
ATOM   1781 C  CG    . LYS A 1 233 ? 3.352   13.456 33.428 1.00 30.65 ? 215  LYS A CG    1 
ATOM   1782 C  CD    . LYS A 1 233 ? 4.138   12.454 34.276 1.00 31.33 ? 215  LYS A CD    1 
ATOM   1783 C  CE    . LYS A 1 233 ? 4.608   13.076 35.606 1.00 35.22 ? 215  LYS A CE    1 
ATOM   1784 N  NZ    . LYS A 1 233 ? 3.480   13.687 36.340 1.00 37.51 ? 215  LYS A NZ    1 
ATOM   1785 N  N     . GLU A 1 234 ? 2.396   13.067 28.895 1.00 33.20 ? 216  GLU A N     1 
ATOM   1786 C  CA    . GLU A 1 234 ? 2.512   13.090 27.423 1.00 36.50 ? 216  GLU A CA    1 
ATOM   1787 C  C     . GLU A 1 234 ? 1.809   14.317 26.778 1.00 34.05 ? 216  GLU A C     1 
ATOM   1788 O  O     . GLU A 1 234 ? 2.392   15.033 25.974 1.00 34.04 ? 216  GLU A O     1 
ATOM   1789 C  CB    . GLU A 1 234 ? 2.020   11.744 26.856 1.00 35.90 ? 216  GLU A CB    1 
ATOM   1790 C  CG    . GLU A 1 234 ? 1.900   11.708 25.328 1.00 42.84 ? 216  GLU A CG    1 
ATOM   1791 C  CD    . GLU A 1 234 ? 1.027   10.510 24.793 1.00 44.12 ? 216  GLU A CD    1 
ATOM   1792 O  OE1   . GLU A 1 234 ? -0.246  10.496 24.992 1.00 49.24 ? 216  GLU A OE1   1 
ATOM   1793 O  OE2   . GLU A 1 234 ? 1.636   9.609  24.133 1.00 53.22 ? 216  GLU A OE2   1 
ATOM   1794 N  N     . LYS A 1 235 ? 0.585   14.635 27.189 1.00 34.24 ? 217  LYS A N     1 
ATOM   1795 C  CA    . LYS A 1 235 ? -0.117  15.779 26.567 1.00 33.61 ? 217  LYS A CA    1 
ATOM   1796 C  C     . LYS A 1 235 ? 0.429   17.139 26.973 1.00 32.46 ? 217  LYS A C     1 
ATOM   1797 O  O     . LYS A 1 235 ? 0.342   18.095 26.203 1.00 31.89 ? 217  LYS A O     1 
ATOM   1798 C  CB    . LYS A 1 235 ? -1.625  15.717 26.801 1.00 33.94 ? 217  LYS A CB    1 
ATOM   1799 C  CG    . LYS A 1 235 ? -2.313  14.566 26.070 1.00 36.96 ? 217  LYS A CG    1 
ATOM   1800 C  CD    . LYS A 1 235 ? -3.804  14.632 26.347 1.00 42.32 ? 217  LYS A CD    1 
ATOM   1801 C  CE    . LYS A 1 235 ? -4.526  13.370 25.897 1.00 48.96 ? 217  LYS A CE    1 
ATOM   1802 N  NZ    . LYS A 1 235 ? -3.969  12.967 24.588 1.00 52.12 ? 217  LYS A NZ    1 
ATOM   1803 N  N     . THR A 1 236 ? 0.976   17.245 28.189 1.00 31.15 ? 218  THR A N     1 
ATOM   1804 C  CA    . THR A 1 236 ? 1.618   18.514 28.632 1.00 29.18 ? 218  THR A CA    1 
ATOM   1805 C  C     . THR A 1 236 ? 2.889   18.803 27.831 1.00 28.80 ? 218  THR A C     1 
ATOM   1806 O  O     . THR A 1 236 ? 3.100   19.891 27.357 1.00 27.89 ? 218  THR A O     1 
ATOM   1807 C  CB    . THR A 1 236 ? 1.983   18.401 30.108 1.00 28.63 ? 218  THR A CB    1 
ATOM   1808 O  OG1   . THR A 1 236 ? 0.800   18.061 30.845 1.00 28.53 ? 218  THR A OG1   1 
ATOM   1809 C  CG2   . THR A 1 236 ? 2.713   19.668 30.638 1.00 23.41 ? 218  THR A CG2   1 
ATOM   1810 N  N     . VAL A 1 237 ? 3.752   17.821 27.754 1.00 29.91 ? 219  VAL A N     1 
ATOM   1811 C  CA    . VAL A 1 237 ? 5.048   17.939 27.088 1.00 33.42 ? 219  VAL A CA    1 
ATOM   1812 C  C     . VAL A 1 237 ? 4.947   18.126 25.545 1.00 35.40 ? 219  VAL A C     1 
ATOM   1813 O  O     . VAL A 1 237 ? 5.837   18.689 24.917 1.00 36.65 ? 219  VAL A O     1 
ATOM   1814 C  CB    . VAL A 1 237 ? 5.863   16.692 27.367 1.00 33.40 ? 219  VAL A CB    1 
ATOM   1815 C  CG1   . VAL A 1 237 ? 6.971   16.619 26.339 1.00 37.31 ? 219  VAL A CG1   1 
ATOM   1816 C  CG2   . VAL A 1 237 ? 6.387   16.735 28.776 1.00 31.25 ? 219  VAL A CG2   1 
ATOM   1817 N  N     . GLU A 1 238 ? 3.847   17.696 24.937 1.00 37.32 ? 220  GLU A N     1 
ATOM   1818 C  CA    . GLU A 1 238 ? 3.686   17.913 23.528 1.00 39.47 ? 220  GLU A CA    1 
ATOM   1819 C  C     . GLU A 1 238 ? 3.151   19.298 23.245 1.00 38.63 ? 220  GLU A C     1 
ATOM   1820 O  O     . GLU A 1 238 ? 3.025   19.694 22.091 1.00 39.15 ? 220  GLU A O     1 
ATOM   1821 C  CB    . GLU A 1 238 ? 2.844   16.805 22.896 1.00 39.40 ? 220  GLU A CB    1 
ATOM   1822 C  CG    . GLU A 1 238 ? 1.351   16.903 23.159 1.00 44.81 ? 220  GLU A CG    1 
ATOM   1823 C  CD    . GLU A 1 238 ? 0.549   15.635 22.720 1.00 45.12 ? 220  GLU A CD    1 
ATOM   1824 O  OE1   . GLU A 1 238 ? 1.131   14.501 22.717 1.00 51.10 ? 220  GLU A OE1   1 
ATOM   1825 O  OE2   . GLU A 1 238 ? -0.666  15.806 22.401 1.00 48.84 ? 220  GLU A OE2   1 
ATOM   1826 N  N     . ASN A 1 239 ? 2.824   20.064 24.276 1.00 37.60 ? 221  ASN A N     1 
ATOM   1827 C  CA    . ASN A 1 239 ? 2.388   21.451 24.020 1.00 36.13 ? 221  ASN A CA    1 
ATOM   1828 C  C     . ASN A 1 239 ? 2.770   22.331 25.184 1.00 34.10 ? 221  ASN A C     1 
ATOM   1829 O  O     . ASN A 1 239 ? 1.948   22.911 25.872 1.00 32.82 ? 221  ASN A O     1 
ATOM   1830 C  CB    . ASN A 1 239 ? 0.892   21.562 23.620 1.00 36.66 ? 221  ASN A CB    1 
ATOM   1831 C  CG    . ASN A 1 239 ? 0.562   22.882 22.879 1.00 37.87 ? 221  ASN A CG    1 
ATOM   1832 O  OD1   . ASN A 1 239 ? 1.382   23.838 22.773 1.00 40.63 ? 221  ASN A OD1   1 
ATOM   1833 N  ND2   . ASN A 1 239 ? -0.656  22.949 22.384 1.00 37.28 ? 221  ASN A ND2   1 
ATOM   1834 N  N     . LEU A 1 240 ? 4.077   22.453 25.353 1.00 33.62 ? 222  LEU A N     1 
ATOM   1835 C  CA    . LEU A 1 240 ? 4.626   23.139 26.489 1.00 32.58 ? 222  LEU A CA    1 
ATOM   1836 C  C     . LEU A 1 240 ? 4.272   24.595 26.553 1.00 32.27 ? 222  LEU A C     1 
ATOM   1837 O  O     . LEU A 1 240 ? 4.078   25.122 27.643 1.00 31.24 ? 222  LEU A O     1 
ATOM   1838 C  CB    . LEU A 1 240 ? 6.120   22.908 26.568 1.00 32.90 ? 222  LEU A CB    1 
ATOM   1839 C  CG    . LEU A 1 240 ? 6.571   21.515 26.980 1.00 32.69 ? 222  LEU A CG    1 
ATOM   1840 C  CD1   . LEU A 1 240 ? 8.035   21.426 26.671 1.00 37.88 ? 222  LEU A CD1   1 
ATOM   1841 C  CD2   . LEU A 1 240 ? 6.340   21.167 28.398 1.00 30.65 ? 222  LEU A CD2   1 
ATOM   1842 N  N     . GLU A 1 241 ? 4.173   25.283 25.418 1.00 32.60 ? 223  GLU A N     1 
ATOM   1843 C  CA    . GLU A 1 241 ? 3.820   26.699 25.483 1.00 33.35 ? 223  GLU A CA    1 
ATOM   1844 C  C     . GLU A 1 241 ? 2.374   26.915 25.970 1.00 32.47 ? 223  GLU A C     1 
ATOM   1845 O  O     . GLU A 1 241 ? 2.035   27.939 26.603 1.00 30.50 ? 223  GLU A O     1 
ATOM   1846 C  CB    . GLU A 1 241 ? 4.020   27.340 24.133 1.00 34.68 ? 223  GLU A CB    1 
ATOM   1847 C  CG    . GLU A 1 241 ? 5.510   27.374 23.707 1.00 44.01 ? 223  GLU A CG    1 
ATOM   1848 C  CD    . GLU A 1 241 ? 5.989   26.094 22.933 1.00 52.76 ? 223  GLU A CD    1 
ATOM   1849 O  OE1   . GLU A 1 241 ? 5.181   25.119 22.717 1.00 52.29 ? 223  GLU A OE1   1 
ATOM   1850 O  OE2   . GLU A 1 241 ? 7.209   26.093 22.541 1.00 56.69 ? 223  GLU A OE2   1 
ATOM   1851 N  N     . LYS A 1 242 ? 1.531   25.935 25.681 1.00 31.48 ? 224  LYS A N     1 
ATOM   1852 C  CA    . LYS A 1 242 ? 0.136   26.012 26.085 1.00 32.83 ? 224  LYS A CA    1 
ATOM   1853 C  C     . LYS A 1 242 ? -0.034  25.851 27.621 1.00 32.14 ? 224  LYS A C     1 
ATOM   1854 O  O     . LYS A 1 242 ? -0.873  26.487 28.210 1.00 31.74 ? 224  LYS A O     1 
ATOM   1855 C  CB    . LYS A 1 242 ? -0.679  24.916 25.387 1.00 32.01 ? 224  LYS A CB    1 
ATOM   1856 C  CG    . LYS A 1 242 ? -2.147  25.059 25.661 1.00 32.97 ? 224  LYS A CG    1 
ATOM   1857 C  CD    . LYS A 1 242 ? -2.980  24.045 24.904 1.00 31.10 ? 224  LYS A CD    1 
ATOM   1858 C  CE    . LYS A 1 242 ? -4.419  24.358 25.240 1.00 36.68 ? 224  LYS A CE    1 
ATOM   1859 N  NZ    . LYS A 1 242 ? -5.282  23.252 24.824 1.00 35.08 ? 224  LYS A NZ    1 
ATOM   1860 N  N     . TYR A 1 243 ? 0.798   24.992 28.216 1.00 32.02 ? 225  TYR A N     1 
ATOM   1861 C  CA    . TYR A 1 243 ? 0.613   24.478 29.554 1.00 30.29 ? 225  TYR A CA    1 
ATOM   1862 C  C     . TYR A 1 243 ? 1.556   25.044 30.603 1.00 30.42 ? 225  TYR A C     1 
ATOM   1863 O  O     . TYR A 1 243 ? 1.207   25.011 31.772 1.00 30.84 ? 225  TYR A O     1 
ATOM   1864 C  CB    . TYR A 1 243 ? 0.684   22.955 29.510 1.00 29.41 ? 225  TYR A CB    1 
ATOM   1865 C  CG    . TYR A 1 243 ? -0.580  22.413 28.836 1.00 29.02 ? 225  TYR A CG    1 
ATOM   1866 C  CD1   . TYR A 1 243 ? -1.865  22.780 29.311 1.00 26.62 ? 225  TYR A CD1   1 
ATOM   1867 C  CD2   . TYR A 1 243 ? -0.507  21.549 27.747 1.00 22.40 ? 225  TYR A CD2   1 
ATOM   1868 C  CE1   . TYR A 1 243 ? -3.051  22.317 28.688 1.00 24.26 ? 225  TYR A CE1   1 
ATOM   1869 C  CE2   . TYR A 1 243 ? -1.687  21.052 27.140 1.00 24.33 ? 225  TYR A CE2   1 
ATOM   1870 C  CZ    . TYR A 1 243 ? -2.928  21.467 27.604 1.00 27.25 ? 225  TYR A CZ    1 
ATOM   1871 O  OH    . TYR A 1 243 ? -4.054  20.994 26.993 1.00 34.09 ? 225  TYR A OH    1 
ATOM   1872 N  N     . VAL A 1 244 ? 2.699   25.625 30.223 1.00 28.70 ? 226  VAL A N     1 
ATOM   1873 C  CA    . VAL A 1 244 ? 3.729   25.946 31.229 1.00 28.07 ? 226  VAL A CA    1 
ATOM   1874 C  C     . VAL A 1 244 ? 4.285   27.371 31.069 1.00 28.95 ? 226  VAL A C     1 
ATOM   1875 O  O     . VAL A 1 244 ? 4.817   27.688 30.020 1.00 29.84 ? 226  VAL A O     1 
ATOM   1876 C  CB    . VAL A 1 244 ? 4.906   24.901 31.189 1.00 26.95 ? 226  VAL A CB    1 
ATOM   1877 C  CG1   . VAL A 1 244 ? 5.887   25.090 32.345 1.00 27.11 ? 226  VAL A CG1   1 
ATOM   1878 C  CG2   . VAL A 1 244 ? 4.382   23.519 31.205 1.00 26.20 ? 226  VAL A CG2   1 
ATOM   1879 N  N     . VAL A 1 245 ? 4.132   28.221 32.090 1.00 29.23 ? 227  VAL A N     1 
ATOM   1880 C  CA    . VAL A 1 245 ? 4.819   29.566 32.189 1.00 29.40 ? 227  VAL A CA    1 
ATOM   1881 C  C     . VAL A 1 245 ? 6.355   29.425 32.056 1.00 30.48 ? 227  VAL A C     1 
ATOM   1882 O  O     . VAL A 1 245 ? 6.963   28.605 32.727 1.00 30.05 ? 227  VAL A O     1 
ATOM   1883 C  CB    . VAL A 1 245 ? 4.475   30.293 33.510 1.00 28.24 ? 227  VAL A CB    1 
ATOM   1884 C  CG1   . VAL A 1 245 ? 5.293   31.592 33.686 1.00 29.78 ? 227  VAL A CG1   1 
ATOM   1885 C  CG2   . VAL A 1 245 ? 2.978   30.557 33.610 1.00 27.89 ? 227  VAL A CG2   1 
ATOM   1886 N  N     . LYS A 1 246 ? 6.952   30.219 31.168 1.00 31.84 ? 228  LYS A N     1 
ATOM   1887 C  CA    . LYS A 1 246 ? 8.379   30.227 30.940 1.00 33.47 ? 228  LYS A CA    1 
ATOM   1888 C  C     . LYS A 1 246 ? 8.886   31.683 31.052 1.00 34.02 ? 228  LYS A C     1 
ATOM   1889 O  O     . LYS A 1 246 ? 8.201   32.607 30.613 1.00 35.24 ? 228  LYS A O     1 
ATOM   1890 C  CB    . LYS A 1 246 ? 8.620   29.678 29.543 1.00 33.85 ? 228  LYS A CB    1 
ATOM   1891 C  CG    . LYS A 1 246 ? 9.982   29.695 29.073 1.00 31.77 ? 228  LYS A CG    1 
ATOM   1892 C  CD    . LYS A 1 246 ? 10.088  28.711 27.986 1.00 33.82 ? 228  LYS A CD    1 
ATOM   1893 C  CE    . LYS A 1 246 ? 10.942  29.211 26.860 1.00 33.65 ? 228  LYS A CE    1 
ATOM   1894 N  NZ    . LYS A 1 246 ? 11.583  28.017 26.277 1.00 35.02 ? 228  LYS A NZ    1 
ATOM   1895 N  N     . ASP A 1 247 ? 10.087  31.865 31.590 1.00 34.07 ? 229  ASP A N     1 
ATOM   1896 C  CA    . ASP A 1 247 ? 10.587  33.172 32.101 1.00 35.45 ? 229  ASP A CA    1 
ATOM   1897 C  C     . ASP A 1 247 ? 12.100  33.187 31.956 1.00 34.92 ? 229  ASP A C     1 
ATOM   1898 O  O     . ASP A 1 247 ? 12.756  32.403 32.593 1.00 35.68 ? 229  ASP A O     1 
ATOM   1899 C  CB    . ASP A 1 247 ? 10.278  33.327 33.616 1.00 35.20 ? 229  ASP A CB    1 
ATOM   1900 C  CG    . ASP A 1 247 ? 10.673  34.715 34.187 1.00 40.43 ? 229  ASP A CG    1 
ATOM   1901 O  OD1   . ASP A 1 247 ? 11.448  35.488 33.551 1.00 43.13 ? 229  ASP A OD1   1 
ATOM   1902 O  OD2   . ASP A 1 247 ? 10.176  35.043 35.292 1.00 42.19 ? 229  ASP A OD2   1 
ATOM   1903 N  N     . GLY A 1 248 ? 12.643  34.113 31.158 1.00 35.01 ? 230  GLY A N     1 
ATOM   1904 C  CA    . GLY A 1 248 ? 14.051  34.204 30.901 1.00 32.63 ? 230  GLY A CA    1 
ATOM   1905 C  C     . GLY A 1 248 ? 14.790  34.716 32.099 1.00 32.70 ? 230  GLY A C     1 
ATOM   1906 O  O     . GLY A 1 248 ? 16.014  34.659 32.089 1.00 32.87 ? 230  GLY A O     1 
ATOM   1907 N  N     . LYS A 1 249 ? 14.085  35.229 33.117 1.00 32.33 ? 231  LYS A N     1 
ATOM   1908 C  CA    . LYS A 1 249 ? 14.762  35.636 34.389 1.00 32.45 ? 231  LYS A CA    1 
ATOM   1909 C  C     . LYS A 1 249 ? 15.116  34.494 35.367 1.00 32.48 ? 231  LYS A C     1 
ATOM   1910 O  O     . LYS A 1 249 ? 15.976  34.682 36.267 1.00 33.34 ? 231  LYS A O     1 
ATOM   1911 C  CB    . LYS A 1 249 ? 14.025  36.723 35.143 1.00 31.93 ? 231  LYS A CB    1 
ATOM   1912 C  CG    . LYS A 1 249 ? 13.905  38.026 34.386 1.00 33.84 ? 231  LYS A CG    1 
ATOM   1913 C  CD    . LYS A 1 249 ? 12.947  39.003 35.073 1.00 32.90 ? 231  LYS A CD    1 
ATOM   1914 C  CE    . LYS A 1 249 ? 11.594  38.371 35.370 1.00 33.84 ? 231  LYS A CE    1 
ATOM   1915 N  NZ    . LYS A 1 249 ? 10.740  38.227 34.120 1.00 36.22 ? 231  LYS A NZ    1 
ATOM   1916 N  N     . LEU A 1 250 ? 14.551  33.301 35.156 1.00 32.17 ? 232  LEU A N     1 
ATOM   1917 C  CA    . LEU A 1 250 ? 14.930  32.095 35.953 1.00 31.53 ? 232  LEU A CA    1 
ATOM   1918 C  C     . LEU A 1 250 ? 16.429  31.730 35.934 1.00 30.96 ? 232  LEU A C     1 
ATOM   1919 O  O     . LEU A 1 250 ? 17.029  31.633 36.972 1.00 31.68 ? 232  LEU A O     1 
ATOM   1920 C  CB    . LEU A 1 250 ? 14.013  30.875 35.638 1.00 32.34 ? 232  LEU A CB    1 
ATOM   1921 C  CG    . LEU A 1 250 ? 14.559  29.499 36.114 1.00 32.18 ? 232  LEU A CG    1 
ATOM   1922 C  CD1   . LEU A 1 250 ? 14.615  29.452 37.656 1.00 34.50 ? 232  LEU A CD1   1 
ATOM   1923 C  CD2   . LEU A 1 250 ? 13.772  28.325 35.621 1.00 32.22 ? 232  LEU A CD2   1 
ATOM   1924 N  N     . PRO A 1 251 ? 17.066  31.552 34.753 1.00 31.60 ? 233  PRO A N     1 
ATOM   1925 C  CA    . PRO A 1 251 ? 18.487  31.218 34.807 1.00 31.04 ? 233  PRO A CA    1 
ATOM   1926 C  C     . PRO A 1 251 ? 19.324  32.319 35.414 1.00 30.61 ? 233  PRO A C     1 
ATOM   1927 O  O     . PRO A 1 251 ? 20.382  32.041 35.981 1.00 30.98 ? 233  PRO A O     1 
ATOM   1928 C  CB    . PRO A 1 251 ? 18.856  31.022 33.325 1.00 31.45 ? 233  PRO A CB    1 
ATOM   1929 C  CG    . PRO A 1 251 ? 17.617  30.811 32.641 1.00 30.66 ? 233  PRO A CG    1 
ATOM   1930 C  CD    . PRO A 1 251 ? 16.580  31.554 33.361 1.00 31.95 ? 233  PRO A CD    1 
ATOM   1931 N  N     . LEU A 1 252 ? 18.879  33.564 35.255 1.00 30.86 ? 234  LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 252 ? 19.568  34.732 35.903 1.00 31.63 ? 234  LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 252 ? 19.543  34.578 37.440 1.00 30.36 ? 234  LEU A C     1 
ATOM   1934 O  O     . LEU A 1 252 ? 20.610  34.559 38.077 1.00 30.22 ? 234  LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 252 ? 18.925  36.088 35.496 1.00 30.00 ? 234  LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 252 ? 19.511  37.361 36.115 1.00 31.42 ? 234  LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 252 ? 21.010  37.593 35.827 1.00 28.95 ? 234  LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 252 ? 18.719  38.544 35.613 1.00 32.63 ? 234  LEU A CD2   1 
ATOM   1939 N  N     . LEU A 1 253 ? 18.334  34.455 38.019 1.00 30.39 ? 235  LEU A N     1 
ATOM   1940 C  CA    . LEU A 1 253 ? 18.211  34.183 39.501 1.00 30.41 ? 235  LEU A CA    1 
ATOM   1941 C  C     . LEU A 1 253 ? 19.053  33.000 39.968 1.00 30.28 ? 235  LEU A C     1 
ATOM   1942 O  O     . LEU A 1 253 ? 19.852  33.149 40.901 1.00 31.42 ? 235  LEU A O     1 
ATOM   1943 C  CB    . LEU A 1 253 ? 16.764  33.993 39.957 1.00 31.49 ? 235  LEU A CB    1 
ATOM   1944 C  CG    . LEU A 1 253 ? 16.581  33.853 41.484 1.00 31.73 ? 235  LEU A CG    1 
ATOM   1945 C  CD1   . LEU A 1 253 ? 17.151  35.077 42.314 1.00 27.92 ? 235  LEU A CD1   1 
ATOM   1946 C  CD2   . LEU A 1 253 ? 15.103  33.716 41.754 1.00 29.48 ? 235  LEU A CD2   1 
ATOM   1947 N  N     . LEU A 1 254 ? 18.972  31.866 39.263 1.00 28.99 ? 236  LEU A N     1 
ATOM   1948 C  CA    . LEU A 1 254 ? 19.689  30.711 39.711 1.00 29.67 ? 236  LEU A CA    1 
ATOM   1949 C  C     . LEU A 1 254 ? 21.174  30.858 39.654 1.00 29.95 ? 236  LEU A C     1 
ATOM   1950 O  O     . LEU A 1 254 ? 21.868  30.305 40.511 1.00 29.12 ? 236  LEU A O     1 
ATOM   1951 C  CB    . LEU A 1 254 ? 19.288  29.441 38.926 1.00 30.47 ? 236  LEU A CB    1 
ATOM   1952 C  CG    . LEU A 1 254 ? 17.894  28.851 39.138 1.00 30.94 ? 236  LEU A CG    1 
ATOM   1953 C  CD1   . LEU A 1 254 ? 17.787  27.588 38.329 1.00 35.05 ? 236  LEU A CD1   1 
ATOM   1954 C  CD2   . LEU A 1 254 ? 17.558  28.546 40.530 1.00 28.61 ? 236  LEU A CD2   1 
ATOM   1955 N  N     . SER A 1 255 ? 21.691  31.532 38.619 1.00 30.39 ? 237  SER A N     1 
ATOM   1956 C  CA    . SER A 1 255 ? 23.156  31.722 38.539 1.00 31.14 ? 237  SER A CA    1 
ATOM   1957 C  C     . SER A 1 255 ? 23.625  32.686 39.610 1.00 31.02 ? 237  SER A C     1 
ATOM   1958 O  O     . SER A 1 255 ? 24.746  32.577 40.069 1.00 31.48 ? 237  SER A O     1 
ATOM   1959 C  CB    . SER A 1 255 ? 23.637  32.218 37.147 1.00 31.59 ? 237  SER A CB    1 
ATOM   1960 O  OG    . SER A 1 255 ? 22.989  33.444 36.806 1.00 33.30 ? 237  SER A OG    1 
ATOM   1961 N  N     . ARG A 1 256 ? 22.792  33.671 39.964 1.00 32.01 ? 238  ARG A N     1 
ATOM   1962 C  CA    . ARG A 1 256 ? 23.142  34.610 41.039 1.00 32.64 ? 238  ARG A CA    1 
ATOM   1963 C  C     . ARG A 1 256 ? 23.174  33.887 42.364 1.00 33.33 ? 238  ARG A C     1 
ATOM   1964 O  O     . ARG A 1 256 ? 24.156  34.034 43.118 1.00 33.94 ? 238  ARG A O     1 
ATOM   1965 C  CB    . ARG A 1 256 ? 22.192  35.799 41.073 1.00 33.16 ? 238  ARG A CB    1 
ATOM   1966 C  CG    . ARG A 1 256 ? 22.435  36.751 39.870 1.00 36.79 ? 238  ARG A CG    1 
ATOM   1967 C  CD    . ARG A 1 256 ? 21.380  37.822 39.756 1.00 41.94 ? 238  ARG A CD    1 
ATOM   1968 N  NE    . ARG A 1 256 ? 21.312  38.542 41.021 1.00 50.84 ? 238  ARG A NE    1 
ATOM   1969 C  CZ    . ARG A 1 256 ? 22.019  39.644 41.302 1.00 53.36 ? 238  ARG A CZ    1 
ATOM   1970 N  NH1   . ARG A 1 256 ? 22.811  40.193 40.378 1.00 51.39 ? 238  ARG A NH1   1 
ATOM   1971 N  NH2   . ARG A 1 256 ? 21.910  40.205 42.501 1.00 52.71 ? 238  ARG A NH2   1 
ATOM   1972 N  N     . MET A 1 257 ? 22.160  33.048 42.620 1.00 33.52 ? 239  MET A N     1 
ATOM   1973 C  CA    . MET A 1 257 ? 22.201  32.167 43.810 1.00 34.51 ? 239  MET A CA    1 
ATOM   1974 C  C     . MET A 1 257 ? 23.460  31.335 43.918 1.00 35.73 ? 239  MET A C     1 
ATOM   1975 O  O     . MET A 1 257 ? 24.042  31.232 45.000 1.00 36.42 ? 239  MET A O     1 
ATOM   1976 C  CB    . MET A 1 257 ? 20.965  31.294 43.942 1.00 33.43 ? 239  MET A CB    1 
ATOM   1977 C  CG    . MET A 1 257 ? 19.720  32.118 44.225 1.00 30.95 ? 239  MET A CG    1 
ATOM   1978 S  SD    . MET A 1 257 ? 18.287  31.079 44.015 1.00 33.96 ? 239  MET A SD    1 
ATOM   1979 C  CE    . MET A 1 257 ? 16.955  31.964 44.881 1.00 34.46 ? 239  MET A CE    1 
ATOM   1980 N  N     . LYS A 1 258 ? 23.907  30.787 42.797 1.00 37.34 ? 240  LYS A N     1 
ATOM   1981 C  CA    . LYS A 1 258 ? 25.082  29.915 42.759 1.00 39.10 ? 240  LYS A CA    1 
ATOM   1982 C  C     . LYS A 1 258 ? 26.371  30.649 43.107 1.00 40.71 ? 240  LYS A C     1 
ATOM   1983 O  O     . LYS A 1 258 ? 27.296  30.031 43.630 1.00 41.21 ? 240  LYS A O     1 
ATOM   1984 C  CB    . LYS A 1 258 ? 25.174  29.222 41.408 1.00 38.88 ? 240  LYS A CB    1 
ATOM   1985 C  CG    . LYS A 1 258 ? 25.968  27.929 41.354 1.00 41.71 ? 240  LYS A CG    1 
ATOM   1986 C  CD    . LYS A 1 258 ? 25.085  26.682 41.549 1.00 45.37 ? 240  LYS A CD    1 
ATOM   1987 C  CE    . LYS A 1 258 ? 25.473  25.564 40.579 1.00 45.27 ? 240  LYS A CE    1 
ATOM   1988 N  NZ    . LYS A 1 258 ? 26.948  25.356 40.506 1.00 44.53 ? 240  LYS A NZ    1 
ATOM   1989 N  N     . GLU A 1 259 ? 26.421  31.966 42.872 1.00 42.59 ? 241  GLU A N     1 
ATOM   1990 C  CA    . GLU A 1 259 ? 27.582  32.792 43.246 1.00 44.75 ? 241  GLU A CA    1 
ATOM   1991 C  C     . GLU A 1 259 ? 27.790  32.893 44.764 1.00 43.78 ? 241  GLU A C     1 
ATOM   1992 O  O     . GLU A 1 259 ? 28.919  33.049 45.261 1.00 44.56 ? 241  GLU A O     1 
ATOM   1993 C  CB    . GLU A 1 259 ? 27.435  34.204 42.680 1.00 44.76 ? 241  GLU A CB    1 
ATOM   1994 C  CG    . GLU A 1 259 ? 27.600  34.347 41.135 1.00 47.80 ? 241  GLU A CG    1 
ATOM   1995 C  CD    . GLU A 1 259 ? 26.842  35.587 40.547 1.00 50.97 ? 241  GLU A CD    1 
ATOM   1996 O  OE1   . GLU A 1 259 ? 26.698  36.659 41.253 1.00 58.44 ? 241  GLU A OE1   1 
ATOM   1997 O  OE2   . GLU A 1 259 ? 26.393  35.502 39.352 1.00 57.70 ? 241  GLU A OE2   1 
ATOM   1998 N  N     . VAL A 1 260 ? 26.698  32.842 45.513 1.00 42.52 ? 242  VAL A N     1 
ATOM   1999 C  CA    . VAL A 1 260 ? 26.782  32.896 46.977 1.00 40.83 ? 242  VAL A CA    1 
ATOM   2000 C  C     . VAL A 1 260 ? 26.479  31.602 47.726 1.00 40.25 ? 242  VAL A C     1 
ATOM   2001 O  O     . VAL A 1 260 ? 26.816  31.488 48.887 1.00 40.66 ? 242  VAL A O     1 
ATOM   2002 C  CB    . VAL A 1 260 ? 25.935  34.024 47.559 1.00 41.32 ? 242  VAL A CB    1 
ATOM   2003 C  CG1   . VAL A 1 260 ? 26.508  35.346 47.080 1.00 41.46 ? 242  VAL A CG1   1 
ATOM   2004 C  CG2   . VAL A 1 260 ? 24.405  33.865 47.231 1.00 39.44 ? 242  VAL A CG2   1 
ATOM   2005 N  N     . GLY A 1 261 ? 25.870  30.613 47.075 1.00 38.96 ? 243  GLY A N     1 
ATOM   2006 C  CA    . GLY A 1 261 ? 25.659  29.338 47.740 1.00 37.11 ? 243  GLY A CA    1 
ATOM   2007 C  C     . GLY A 1 261 ? 25.502  28.131 46.839 1.00 35.96 ? 243  GLY A C     1 
ATOM   2008 O  O     . GLY A 1 261 ? 25.861  28.146 45.652 1.00 36.52 ? 243  GLY A O     1 
ATOM   2009 N  N     . LYS A 1 262 ? 24.968  27.065 47.408 1.00 33.48 ? 244  LYS A N     1 
ATOM   2010 C  CA    . LYS A 1 262 ? 24.687  25.906 46.648 1.00 31.21 ? 244  LYS A CA    1 
ATOM   2011 C  C     . LYS A 1 262 ? 23.214  25.935 46.247 1.00 29.88 ? 244  LYS A C     1 
ATOM   2012 O  O     . LYS A 1 262 ? 22.410  26.621 46.902 1.00 30.09 ? 244  LYS A O     1 
ATOM   2013 C  CB    . LYS A 1 262 ? 25.069  24.701 47.466 1.00 32.96 ? 244  LYS A CB    1 
ATOM   2014 C  CG    . LYS A 1 262 ? 26.543  24.724 47.694 1.00 32.87 ? 244  LYS A CG    1 
ATOM   2015 C  CD    . LYS A 1 262 ? 27.045  23.406 48.016 1.00 40.02 ? 244  LYS A CD    1 
ATOM   2016 C  CE    . LYS A 1 262 ? 28.411  23.560 48.738 1.00 45.55 ? 244  LYS A CE    1 
ATOM   2017 N  NZ    . LYS A 1 262 ? 28.858  22.229 49.346 1.00 47.20 ? 244  LYS A NZ    1 
ATOM   2018 N  N     . VAL A 1 263 ? 22.883  25.290 45.122 1.00 26.73 ? 245  VAL A N     1 
ATOM   2019 C  CA    . VAL A 1 263 ? 21.511  25.240 44.620 1.00 25.04 ? 245  VAL A CA    1 
ATOM   2020 C  C     . VAL A 1 263 ? 21.128  23.799 44.407 1.00 24.42 ? 245  VAL A C     1 
ATOM   2021 O  O     . VAL A 1 263 ? 21.933  23.046 43.898 1.00 24.63 ? 245  VAL A O     1 
ATOM   2022 C  CB    . VAL A 1 263 ? 21.319  26.054 43.329 1.00 24.45 ? 245  VAL A CB    1 
ATOM   2023 C  CG1   . VAL A 1 263 ? 19.833  26.058 42.904 1.00 22.01 ? 245  VAL A CG1   1 
ATOM   2024 C  CG2   . VAL A 1 263 ? 21.892  27.478 43.527 1.00 25.18 ? 245  VAL A CG2   1 
ATOM   2025 N  N     . PHE A 1 264 ? 19.924  23.404 44.823 1.00 22.43 ? 246  PHE A N     1 
ATOM   2026 C  CA    . PHE A 1 264 ? 19.521  21.989 44.641 1.00 22.57 ? 246  PHE A CA    1 
ATOM   2027 C  C     . PHE A 1 264 ? 18.060  21.923 44.167 1.00 21.71 ? 246  PHE A C     1 
ATOM   2028 O  O     . PHE A 1 264 ? 17.292  22.864 44.369 1.00 21.48 ? 246  PHE A O     1 
ATOM   2029 C  CB    . PHE A 1 264 ? 19.813  21.057 45.871 1.00 21.69 ? 246  PHE A CB    1 
ATOM   2030 C  CG    . PHE A 1 264 ? 18.958  21.321 47.083 1.00 22.45 ? 246  PHE A CG    1 
ATOM   2031 C  CD1   . PHE A 1 264 ? 17.701  20.730 47.217 1.00 24.55 ? 246  PHE A CD1   1 
ATOM   2032 C  CD2   . PHE A 1 264 ? 19.397  22.188 48.096 1.00 24.04 ? 246  PHE A CD2   1 
ATOM   2033 C  CE1   . PHE A 1 264 ? 16.847  20.972 48.368 1.00 22.27 ? 246  PHE A CE1   1 
ATOM   2034 C  CE2   . PHE A 1 264 ? 18.594  22.408 49.250 1.00 22.93 ? 246  PHE A CE2   1 
ATOM   2035 C  CZ    . PHE A 1 264 ? 17.284  21.813 49.345 1.00 23.24 ? 246  PHE A CZ    1 
ATOM   2036 N  N     . LEU A 1 265 ? 17.738  20.819 43.520 1.00 20.88 ? 247  LEU A N     1 
ATOM   2037 C  CA    . LEU A 1 265 ? 16.411  20.537 43.048 1.00 22.34 ? 247  LEU A CA    1 
ATOM   2038 C  C     . LEU A 1 265 ? 15.956  19.280 43.803 1.00 23.06 ? 247  LEU A C     1 
ATOM   2039 O  O     . LEU A 1 265 ? 16.674  18.267 43.844 1.00 23.22 ? 247  LEU A O     1 
ATOM   2040 C  CB    . LEU A 1 265 ? 16.413  20.234 41.515 1.00 21.29 ? 247  LEU A CB    1 
ATOM   2041 C  CG    . LEU A 1 265 ? 15.056  20.099 40.820 1.00 21.94 ? 247  LEU A CG    1 
ATOM   2042 C  CD1   . LEU A 1 265 ? 14.367  21.445 40.904 1.00 24.27 ? 247  LEU A CD1   1 
ATOM   2043 C  CD2   . LEU A 1 265 ? 15.076  19.620 39.320 1.00 21.34 ? 247  LEU A CD2   1 
ATOM   2044 N  N     . ALA A 1 266 ? 14.757  19.335 44.352 1.00 23.79 ? 248  ALA A N     1 
ATOM   2045 C  CA    . ALA A 1 266 ? 14.164  18.136 44.927 1.00 26.18 ? 248  ALA A CA    1 
ATOM   2046 C  C     . ALA A 1 266 ? 12.731  18.062 44.455 1.00 25.68 ? 248  ALA A C     1 
ATOM   2047 O  O     . ALA A 1 266 ? 11.985  18.927 44.799 1.00 27.76 ? 248  ALA A O     1 
ATOM   2048 C  CB    . ALA A 1 266 ? 14.194  18.195 46.447 1.00 25.69 ? 248  ALA A CB    1 
ATOM   2049 N  N     . THR A 1 267 ? 12.362  17.036 43.684 1.00 25.36 ? 249  THR A N     1 
ATOM   2050 C  CA    . THR A 1 267 ? 11.002  16.927 43.116 1.00 23.80 ? 249  THR A CA    1 
ATOM   2051 C  C     . THR A 1 267 ? 10.427  15.536 43.391 1.00 23.59 ? 249  THR A C     1 
ATOM   2052 O  O     . THR A 1 267 ? 11.155  14.526 43.416 1.00 23.70 ? 249  THR A O     1 
ATOM   2053 C  CB    . THR A 1 267 ? 10.985  17.212 41.536 1.00 24.17 ? 249  THR A CB    1 
ATOM   2054 O  OG1   . THR A 1 267 ? 9.712   16.860 40.942 1.00 18.33 ? 249  THR A OG1   1 
ATOM   2055 C  CG2   . THR A 1 267 ? 12.092  16.435 40.815 1.00 22.59 ? 249  THR A CG2   1 
ATOM   2056 N  N     . ASN A 1 268 ? 9.109   15.471 43.526 1.00 23.00 ? 250  ASN A N     1 
ATOM   2057 C  CA    . ASN A 1 268 ? 8.426   14.195 43.531 1.00 23.33 ? 250  ASN A CA    1 
ATOM   2058 C  C     . ASN A 1 268 ? 8.358   13.560 42.171 1.00 24.06 ? 250  ASN A C     1 
ATOM   2059 O  O     . ASN A 1 268 ? 8.126   12.350 42.101 1.00 24.74 ? 250  ASN A O     1 
ATOM   2060 C  CB    . ASN A 1 268 ? 7.022   14.285 44.199 1.00 23.39 ? 250  ASN A CB    1 
ATOM   2061 C  CG    . ASN A 1 268 ? 7.104   14.324 45.754 1.00 25.75 ? 250  ASN A CG    1 
ATOM   2062 O  OD1   . ASN A 1 268 ? 8.172   14.478 46.319 1.00 25.86 ? 250  ASN A OD1   1 
ATOM   2063 N  ND2   . ASN A 1 268 ? 5.980   14.152 46.422 1.00 21.10 ? 250  ASN A ND2   1 
ATOM   2064 N  N     . SER A 1 269 ? 8.528   14.321 41.070 1.00 25.38 ? 251  SER A N     1 
ATOM   2065 C  CA    . SER A 1 269 ? 8.530   13.688 39.701 1.00 26.30 ? 251  SER A CA    1 
ATOM   2066 C  C     . SER A 1 269 ? 9.726   12.772 39.450 1.00 25.48 ? 251  SER A C     1 
ATOM   2067 O  O     . SER A 1 269 ? 10.747  12.838 40.137 1.00 24.82 ? 251  SER A O     1 
ATOM   2068 C  CB    . SER A 1 269 ? 8.526   14.670 38.538 1.00 26.58 ? 251  SER A CB    1 
ATOM   2069 O  OG    . SER A 1 269 ? 7.617   15.684 38.759 1.00 32.57 ? 251  SER A OG    1 
ATOM   2070 N  N     . ASP A 1 270 ? 9.548   11.928 38.437 1.00 25.01 ? 252  ASP A N     1 
ATOM   2071 C  CA    . ASP A 1 270 ? 10.575  11.090 37.859 1.00 26.45 ? 252  ASP A CA    1 
ATOM   2072 C  C     . ASP A 1 270 ? 11.557  11.927 36.995 1.00 25.22 ? 252  ASP A C     1 
ATOM   2073 O  O     . ASP A 1 270 ? 11.283  13.094 36.601 1.00 24.00 ? 252  ASP A O     1 
ATOM   2074 C  CB    . ASP A 1 270 ? 9.890   9.982  37.022 1.00 27.72 ? 252  ASP A CB    1 
ATOM   2075 C  CG    . ASP A 1 270 ? 9.043   10.558 35.882 1.00 33.84 ? 252  ASP A CG    1 
ATOM   2076 O  OD1   . ASP A 1 270 ? 9.610   10.807 34.807 1.00 39.41 ? 252  ASP A OD1   1 
ATOM   2077 O  OD2   . ASP A 1 270 ? 7.814   10.844 36.066 1.00 44.65 ? 252  ASP A OD2   1 
ATOM   2078 N  N     . TYR A 1 271 ? 12.718  11.345 36.726 1.00 25.57 ? 253  TYR A N     1 
ATOM   2079 C  CA    . TYR A 1 271 ? 13.716  12.032 35.887 1.00 25.55 ? 253  TYR A CA    1 
ATOM   2080 C  C     . TYR A 1 271 ? 13.288  12.463 34.450 1.00 25.78 ? 253  TYR A C     1 
ATOM   2081 O  O     . TYR A 1 271 ? 13.528  13.610 34.008 1.00 25.81 ? 253  TYR A O     1 
ATOM   2082 C  CB    . TYR A 1 271 ? 14.974  11.203 35.766 1.00 25.88 ? 253  TYR A CB    1 
ATOM   2083 C  CG    . TYR A 1 271 ? 16.087  12.010 35.110 1.00 27.99 ? 253  TYR A CG    1 
ATOM   2084 C  CD1   . TYR A 1 271 ? 16.655  13.125 35.760 1.00 26.31 ? 253  TYR A CD1   1 
ATOM   2085 C  CD2   . TYR A 1 271 ? 16.527  11.707 33.831 1.00 28.50 ? 253  TYR A CD2   1 
ATOM   2086 C  CE1   . TYR A 1 271 ? 17.654  13.876 35.159 1.00 26.87 ? 253  TYR A CE1   1 
ATOM   2087 C  CE2   . TYR A 1 271 ? 17.514  12.480 33.231 1.00 27.10 ? 253  TYR A CE2   1 
ATOM   2088 C  CZ    . TYR A 1 271 ? 18.062  13.545 33.903 1.00 26.12 ? 253  TYR A CZ    1 
ATOM   2089 O  OH    . TYR A 1 271 ? 19.031  14.298 33.283 1.00 28.65 ? 253  TYR A OH    1 
ATOM   2090 N  N     . LYS A 1 272 ? 12.688  11.540 33.717 1.00 26.15 ? 254  LYS A N     1 
ATOM   2091 C  CA    . LYS A 1 272 ? 12.252  11.803 32.343 1.00 27.99 ? 254  LYS A CA    1 
ATOM   2092 C  C     . LYS A 1 272 ? 11.310  12.980 32.247 1.00 25.81 ? 254  LYS A C     1 
ATOM   2093 O  O     . LYS A 1 272 ? 11.458  13.834 31.402 1.00 27.82 ? 254  LYS A O     1 
ATOM   2094 C  CB    . LYS A 1 272 ? 11.608  10.558 31.731 1.00 28.19 ? 254  LYS A CB    1 
ATOM   2095 C  CG    . LYS A 1 272 ? 12.644  9.585  31.208 1.00 36.06 ? 254  LYS A CG    1 
ATOM   2096 C  CD    . LYS A 1 272 ? 11.940  8.350  30.576 1.00 41.40 ? 254  LYS A CD    1 
ATOM   2097 C  CE    . LYS A 1 272 ? 12.868  7.164  30.276 1.00 42.49 ? 254  LYS A CE    1 
ATOM   2098 N  NZ    . LYS A 1 272 ? 12.141  6.167  29.307 1.00 45.52 ? 254  LYS A NZ    1 
ATOM   2099 N  N     . TYR A 1 273 ? 10.331  13.046 33.100 1.00 24.85 ? 255  TYR A N     1 
ATOM   2100 C  CA    . TYR A 1 273 ? 9.431   14.211 33.067 1.00 25.02 ? 255  TYR A CA    1 
ATOM   2101 C  C     . TYR A 1 273 ? 10.133  15.513 33.509 1.00 25.03 ? 255  TYR A C     1 
ATOM   2102 O  O     . TYR A 1 273 ? 9.929   16.589 32.919 1.00 25.57 ? 255  TYR A O     1 
ATOM   2103 C  CB    . TYR A 1 273 ? 8.230   13.934 33.930 1.00 23.86 ? 255  TYR A CB    1 
ATOM   2104 C  CG    . TYR A 1 273 ? 7.219   15.039 33.885 1.00 26.45 ? 255  TYR A CG    1 
ATOM   2105 C  CD1   . TYR A 1 273 ? 6.414   15.202 32.778 1.00 23.75 ? 255  TYR A CD1   1 
ATOM   2106 C  CD2   . TYR A 1 273 ? 7.072   15.933 34.954 1.00 25.40 ? 255  TYR A CD2   1 
ATOM   2107 C  CE1   . TYR A 1 273 ? 5.459   16.224 32.725 1.00 25.18 ? 255  TYR A CE1   1 
ATOM   2108 C  CE2   . TYR A 1 273 ? 6.107   16.950 34.909 1.00 26.06 ? 255  TYR A CE2   1 
ATOM   2109 C  CZ    . TYR A 1 273 ? 5.294   17.054 33.783 1.00 25.36 ? 255  TYR A CZ    1 
ATOM   2110 O  OH    . TYR A 1 273 ? 4.346   18.046 33.683 1.00 27.70 ? 255  TYR A OH    1 
ATOM   2111 N  N     . THR A 1 274 ? 11.010  15.406 34.512 1.00 25.34 ? 256  THR A N     1 
ATOM   2112 C  CA    . THR A 1 274 ? 11.745  16.575 35.002 1.00 25.47 ? 256  THR A CA    1 
ATOM   2113 C  C     . THR A 1 274 ? 12.678  17.081 33.917 1.00 25.36 ? 256  THR A C     1 
ATOM   2114 O  O     . THR A 1 274 ? 12.829  18.288 33.722 1.00 26.16 ? 256  THR A O     1 
ATOM   2115 C  CB    . THR A 1 274 ? 12.612  16.179 36.239 1.00 26.23 ? 256  THR A CB    1 
ATOM   2116 O  OG1   . THR A 1 274 ? 11.771  15.629 37.231 1.00 26.94 ? 256  THR A OG1   1 
ATOM   2117 C  CG2   . THR A 1 274 ? 13.453  17.352 36.817 1.00 24.51 ? 256  THR A CG2   1 
ATOM   2118 N  N     . ASP A 1 275 ? 13.388  16.166 33.273 1.00 26.38 ? 257  ASP A N     1 
ATOM   2119 C  CA    . ASP A 1 275 ? 14.262  16.561 32.136 1.00 26.54 ? 257  ASP A CA    1 
ATOM   2120 C  C     . ASP A 1 275 ? 13.507  17.332 31.002 1.00 26.31 ? 257  ASP A C     1 
ATOM   2121 O  O     . ASP A 1 275 ? 13.944  18.423 30.630 1.00 27.32 ? 257  ASP A O     1 
ATOM   2122 C  CB    . ASP A 1 275 ? 15.066  15.394 31.640 1.00 24.67 ? 257  ASP A CB    1 
ATOM   2123 C  CG    . ASP A 1 275 ? 16.196  15.803 30.698 1.00 28.65 ? 257  ASP A CG    1 
ATOM   2124 O  OD1   . ASP A 1 275 ? 16.685  16.973 30.710 1.00 29.57 ? 257  ASP A OD1   1 
ATOM   2125 O  OD2   . ASP A 1 275 ? 16.648  14.911 29.938 1.00 31.90 ? 257  ASP A OD2   1 
ATOM   2126 N  N     . LYS A 1 276 ? 12.361  16.830 30.542 1.00 25.42 ? 258  LYS A N     1 
ATOM   2127 C  CA    . LYS A 1 276 ? 11.500  17.556 29.606 1.00 26.31 ? 258  LYS A CA    1 
ATOM   2128 C  C     . LYS A 1 276 ? 11.029  18.936 30.063 1.00 25.88 ? 258  LYS A C     1 
ATOM   2129 O  O     . LYS A 1 276 ? 11.038  19.865 29.282 1.00 25.40 ? 258  LYS A O     1 
ATOM   2130 C  CB    . LYS A 1 276 ? 10.218  16.781 29.285 1.00 28.55 ? 258  LYS A CB    1 
ATOM   2131 C  CG    . LYS A 1 276 ? 10.417  15.341 28.696 1.00 34.21 ? 258  LYS A CG    1 
ATOM   2132 C  CD    . LYS A 1 276 ? 10.622  15.264 27.177 1.00 41.63 ? 258  LYS A CD    1 
ATOM   2133 C  CE    . LYS A 1 276 ? 10.153  13.853 26.605 1.00 42.85 ? 258  LYS A CE    1 
ATOM   2134 N  NZ    . LYS A 1 276 ? 9.770   12.796 27.688 1.00 43.10 ? 258  LYS A NZ    1 
ATOM   2135 N  N     . ILE A 1 277 ? 10.542  19.069 31.295 1.00 24.65 ? 259  ILE A N     1 
ATOM   2136 C  CA    . ILE A 1 277 ? 10.045  20.361 31.774 1.00 23.93 ? 259  ILE A CA    1 
ATOM   2137 C  C     . ILE A 1 277 ? 11.156  21.320 32.001 1.00 24.03 ? 259  ILE A C     1 
ATOM   2138 O  O     . ILE A 1 277 ? 11.042  22.501 31.591 1.00 24.12 ? 259  ILE A O     1 
ATOM   2139 C  CB    . ILE A 1 277 ? 9.255   20.222 33.124 1.00 24.97 ? 259  ILE A CB    1 
ATOM   2140 C  CG1   . ILE A 1 277 ? 7.932   19.435 32.920 1.00 24.84 ? 259  ILE A CG1   1 
ATOM   2141 C  CG2   . ILE A 1 277 ? 9.018   21.573 33.762 1.00 22.98 ? 259  ILE A CG2   1 
ATOM   2142 C  CD1   . ILE A 1 277 ? 6.975   20.038 31.875 1.00 25.29 ? 259  ILE A CD1   1 
ATOM   2143 N  N     . MET A 1 278 ? 12.227  20.848 32.659 1.00 23.09 ? 260  MET A N     1 
ATOM   2144 C  CA    . MET A 1 278 ? 13.371  21.707 32.931 1.00 23.93 ? 260  MET A CA    1 
ATOM   2145 C  C     . MET A 1 278 ? 14.115  22.176 31.644 1.00 24.44 ? 260  MET A C     1 
ATOM   2146 O  O     . MET A 1 278 ? 14.496  23.340 31.538 1.00 23.30 ? 260  MET A O     1 
ATOM   2147 C  CB    . MET A 1 278 ? 14.361  21.029 33.887 1.00 24.12 ? 260  MET A CB    1 
ATOM   2148 C  CG    . MET A 1 278 ? 13.786  20.739 35.297 1.00 24.72 ? 260  MET A CG    1 
ATOM   2149 S  SD    . MET A 1 278 ? 13.417  22.248 36.235 1.00 29.77 ? 260  MET A SD    1 
ATOM   2150 C  CE    . MET A 1 278 ? 15.103  22.811 36.583 1.00 26.27 ? 260  MET A CE    1 
ATOM   2151 N  N     . THR A 1 279 ? 14.347  21.262 30.700 1.00 25.02 ? 261  THR A N     1 
ATOM   2152 C  CA    . THR A 1 279 ? 14.871  21.659 29.393 1.00 25.88 ? 261  THR A CA    1 
ATOM   2153 C  C     . THR A 1 279 ? 14.024  22.789 28.806 1.00 26.00 ? 261  THR A C     1 
ATOM   2154 O  O     . THR A 1 279 ? 14.562  23.813 28.409 1.00 26.83 ? 261  THR A O     1 
ATOM   2155 C  CB    . THR A 1 279 ? 14.884  20.497 28.486 1.00 25.38 ? 261  THR A CB    1 
ATOM   2156 O  OG1   . THR A 1 279 ? 15.790  19.553 29.052 1.00 27.32 ? 261  THR A OG1   1 
ATOM   2157 C  CG2   . THR A 1 279 ? 15.397  20.895 27.108 1.00 26.30 ? 261  THR A CG2   1 
ATOM   2158 N  N     . TYR A 1 280 ? 12.706  22.614 28.795 1.00 26.79 ? 262  TYR A N     1 
ATOM   2159 C  CA    . TYR A 1 280 ? 11.793  23.671 28.332 1.00 27.66 ? 262  TYR A CA    1 
ATOM   2160 C  C     . TYR A 1 280 ? 11.979  24.990 29.092 1.00 28.49 ? 262  TYR A C     1 
ATOM   2161 O  O     . TYR A 1 280 ? 12.058  26.039 28.474 1.00 28.83 ? 262  TYR A O     1 
ATOM   2162 C  CB    . TYR A 1 280 ? 10.334  23.209 28.447 1.00 28.42 ? 262  TYR A CB    1 
ATOM   2163 C  CG    . TYR A 1 280 ? 9.320   24.319 28.215 1.00 29.91 ? 262  TYR A CG    1 
ATOM   2164 C  CD1   . TYR A 1 280 ? 9.031   24.784 26.929 1.00 32.82 ? 262  TYR A CD1   1 
ATOM   2165 C  CD2   . TYR A 1 280 ? 8.664   24.919 29.287 1.00 29.15 ? 262  TYR A CD2   1 
ATOM   2166 C  CE1   . TYR A 1 280 ? 8.058   25.838 26.720 1.00 33.82 ? 262  TYR A CE1   1 
ATOM   2167 C  CE2   . TYR A 1 280 ? 7.725   25.941 29.089 1.00 32.59 ? 262  TYR A CE2   1 
ATOM   2168 C  CZ    . TYR A 1 280 ? 7.432   26.379 27.822 1.00 32.76 ? 262  TYR A CZ    1 
ATOM   2169 O  OH    . TYR A 1 280 ? 6.518   27.383 27.694 1.00 35.49 ? 262  TYR A OH    1 
ATOM   2170 N  N     . LEU A 1 281 ? 12.025  24.938 30.435 1.00 28.69 ? 263  LEU A N     1 
ATOM   2171 C  CA    . LEU A 1 281 ? 12.199  26.156 31.249 1.00 28.39 ? 263  LEU A CA    1 
ATOM   2172 C  C     . LEU A 1 281 ? 13.461  26.981 30.947 1.00 27.64 ? 263  LEU A C     1 
ATOM   2173 O  O     . LEU A 1 281 ? 13.514  28.191 31.211 1.00 27.61 ? 263  LEU A O     1 
ATOM   2174 C  CB    . LEU A 1 281 ? 12.149  25.811 32.741 1.00 28.08 ? 263  LEU A CB    1 
ATOM   2175 C  CG    . LEU A 1 281 ? 10.779  25.333 33.261 1.00 28.13 ? 263  LEU A CG    1 
ATOM   2176 C  CD1   . LEU A 1 281 ? 10.925  25.094 34.761 1.00 25.76 ? 263  LEU A CD1   1 
ATOM   2177 C  CD2   . LEU A 1 281 ? 9.711   26.354 32.927 1.00 24.81 ? 263  LEU A CD2   1 
ATOM   2178 N  N     . PHE A 1 282 ? 14.476  26.310 30.443 1.00 26.76 ? 264  PHE A N     1 
ATOM   2179 C  CA    . PHE A 1 282 ? 15.759  26.948 30.155 1.00 28.31 ? 264  PHE A CA    1 
ATOM   2180 C  C     . PHE A 1 282 ? 15.954  27.142 28.657 1.00 28.88 ? 264  PHE A C     1 
ATOM   2181 O  O     . PHE A 1 282 ? 17.058  27.442 28.197 1.00 29.36 ? 264  PHE A O     1 
ATOM   2182 C  CB    . PHE A 1 282 ? 16.901  26.089 30.732 1.00 27.50 ? 264  PHE A CB    1 
ATOM   2183 C  CG    . PHE A 1 282 ? 17.047  26.218 32.219 1.00 29.11 ? 264  PHE A CG    1 
ATOM   2184 C  CD1   . PHE A 1 282 ? 18.012  27.053 32.769 1.00 28.70 ? 264  PHE A CD1   1 
ATOM   2185 C  CD2   . PHE A 1 282 ? 16.197  25.509 33.088 1.00 30.48 ? 264  PHE A CD2   1 
ATOM   2186 C  CE1   . PHE A 1 282 ? 18.124  27.195 34.163 1.00 28.55 ? 264  PHE A CE1   1 
ATOM   2187 C  CE2   . PHE A 1 282 ? 16.307  25.640 34.477 1.00 26.60 ? 264  PHE A CE2   1 
ATOM   2188 C  CZ    . PHE A 1 282 ? 17.280  26.483 34.998 1.00 29.44 ? 264  PHE A CZ    1 
ATOM   2189 N  N     . ASP A 1 283 ? 14.897  26.920 27.876 1.00 30.36 ? 265  ASP A N     1 
ATOM   2190 C  CA    . ASP A 1 283 ? 15.066  26.906 26.444 1.00 32.39 ? 265  ASP A CA    1 
ATOM   2191 C  C     . ASP A 1 283 ? 14.994  28.322 25.850 1.00 30.72 ? 265  ASP A C     1 
ATOM   2192 O  O     . ASP A 1 283 ? 13.974  28.770 25.422 1.00 30.68 ? 265  ASP A O     1 
ATOM   2193 C  CB    . ASP A 1 283 ? 14.082  25.966 25.775 1.00 32.86 ? 265  ASP A CB    1 
ATOM   2194 C  CG    . ASP A 1 283 ? 14.254  25.943 24.249 1.00 37.97 ? 265  ASP A CG    1 
ATOM   2195 O  OD1   . ASP A 1 283 ? 15.416  26.085 23.777 1.00 42.86 ? 265  ASP A OD1   1 
ATOM   2196 O  OD2   . ASP A 1 283 ? 13.222  25.776 23.530 1.00 45.95 ? 265  ASP A OD2   1 
ATOM   2197 N  N     . PHE A 1 284 ? 16.115  28.994 25.871 1.00 30.93 ? 266  PHE A N     1 
ATOM   2198 C  CA    . PHE A 1 284 ? 16.272  30.374 25.465 1.00 31.56 ? 266  PHE A CA    1 
ATOM   2199 C  C     . PHE A 1 284 ? 17.532  30.322 24.654 1.00 32.28 ? 266  PHE A C     1 
ATOM   2200 O  O     . PHE A 1 284 ? 18.348  29.417 24.856 1.00 31.18 ? 266  PHE A O     1 
ATOM   2201 C  CB    . PHE A 1 284 ? 16.469  31.299 26.692 1.00 31.11 ? 266  PHE A CB    1 
ATOM   2202 C  CG    . PHE A 1 284 ? 15.222  31.465 27.508 1.00 31.52 ? 266  PHE A CG    1 
ATOM   2203 C  CD1   . PHE A 1 284 ? 14.234  32.355 27.109 1.00 31.96 ? 266  PHE A CD1   1 
ATOM   2204 C  CD2   . PHE A 1 284 ? 15.010  30.706 28.634 1.00 29.94 ? 266  PHE A CD2   1 
ATOM   2205 C  CE1   . PHE A 1 284 ? 13.049  32.455 27.809 1.00 29.76 ? 266  PHE A CE1   1 
ATOM   2206 C  CE2   . PHE A 1 284 ? 13.842  30.812 29.329 1.00 31.08 ? 266  PHE A CE2   1 
ATOM   2207 C  CZ    . PHE A 1 284 ? 12.847  31.668 28.889 1.00 29.69 ? 266  PHE A CZ    1 
ATOM   2208 N  N     . PRO A 1 285 ? 17.702  31.271 23.709 1.00 34.16 ? 267  PRO A N     1 
ATOM   2209 C  CA    . PRO A 1 285 ? 18.948  31.205 22.923 1.00 34.86 ? 267  PRO A CA    1 
ATOM   2210 C  C     . PRO A 1 285 ? 20.110  31.863 23.636 1.00 35.36 ? 267  PRO A C     1 
ATOM   2211 O  O     . PRO A 1 285 ? 20.948  32.491 22.991 1.00 37.53 ? 267  PRO A O     1 
ATOM   2212 C  CB    . PRO A 1 285 ? 18.596  31.992 21.658 1.00 35.15 ? 267  PRO A CB    1 
ATOM   2213 C  CG    . PRO A 1 285 ? 17.625  33.024 22.159 1.00 35.90 ? 267  PRO A CG    1 
ATOM   2214 C  CD    . PRO A 1 285 ? 16.823  32.374 23.269 1.00 33.68 ? 267  PRO A CD    1 
ATOM   2215 N  N     . HIS A 1 286 ? 20.160  31.718 24.954 1.00 34.70 ? 268  HIS A N     1 
ATOM   2216 C  CA    . HIS A 1 286 ? 21.155  32.343 25.821 1.00 32.10 ? 268  HIS A CA    1 
ATOM   2217 C  C     . HIS A 1 286 ? 21.087  31.620 27.164 1.00 31.42 ? 268  HIS A C     1 
ATOM   2218 O  O     . HIS A 1 286 ? 20.148  30.804 27.385 1.00 30.23 ? 268  HIS A O     1 
ATOM   2219 C  CB    . HIS A 1 286 ? 20.913  33.849 25.944 1.00 32.90 ? 268  HIS A CB    1 
ATOM   2220 C  CG    . HIS A 1 286 ? 19.584  34.219 26.549 1.00 32.43 ? 268  HIS A CG    1 
ATOM   2221 N  ND1   . HIS A 1 286 ? 19.307  34.064 27.891 1.00 31.18 ? 268  HIS A ND1   1 
ATOM   2222 C  CD2   . HIS A 1 286 ? 18.477  34.775 25.997 1.00 29.88 ? 268  HIS A CD2   1 
ATOM   2223 C  CE1   . HIS A 1 286 ? 18.072  34.473 28.134 1.00 31.59 ? 268  HIS A CE1   1 
ATOM   2224 N  NE2   . HIS A 1 286 ? 17.550  34.911 27.000 1.00 32.27 ? 268  HIS A NE2   1 
ATOM   2225 N  N     . GLY A 1 287 ? 22.128  31.830 27.991 1.00 29.97 ? 269  GLY A N     1 
ATOM   2226 C  CA    . GLY A 1 287 ? 22.189  31.345 29.371 1.00 29.75 ? 269  GLY A CA    1 
ATOM   2227 C  C     . GLY A 1 287 ? 21.640  32.400 30.339 1.00 28.47 ? 269  GLY A C     1 
ATOM   2228 O  O     . GLY A 1 287 ? 20.566  32.978 30.102 1.00 27.93 ? 269  GLY A O     1 
ATOM   2229 N  N     . PRO A 1 288 ? 22.369  32.677 31.423 1.00 28.11 ? 270  PRO A N     1 
ATOM   2230 C  CA    . PRO A 1 288 ? 21.813  33.535 32.498 1.00 28.51 ? 270  PRO A CA    1 
ATOM   2231 C  C     . PRO A 1 288 ? 21.221  34.812 31.956 1.00 29.87 ? 270  PRO A C     1 
ATOM   2232 O  O     . PRO A 1 288 ? 20.069  35.126 32.284 1.00 32.04 ? 270  PRO A O     1 
ATOM   2233 C  CB    . PRO A 1 288 ? 22.990  33.791 33.431 1.00 26.69 ? 270  PRO A CB    1 
ATOM   2234 C  CG    . PRO A 1 288 ? 23.804  32.671 33.312 1.00 29.43 ? 270  PRO A CG    1 
ATOM   2235 C  CD    . PRO A 1 288 ? 23.680  32.153 31.788 1.00 28.07 ? 270  PRO A CD    1 
ATOM   2236 N  N     A LYS A 1 289 ? 21.961  35.539 31.121 0.50 30.14 ? 271  LYS A N     1 
ATOM   2237 N  N     B LYS A 1 289 ? 21.959  35.516 31.101 0.50 30.47 ? 271  LYS A N     1 
ATOM   2238 C  CA    A LYS A 1 289 ? 21.450  36.807 30.528 0.50 30.30 ? 271  LYS A CA    1 
ATOM   2239 C  CA    B LYS A 1 289 ? 21.466  36.778 30.497 0.50 30.76 ? 271  LYS A CA    1 
ATOM   2240 C  C     A LYS A 1 289 ? 21.632  36.872 28.989 0.50 29.36 ? 271  LYS A C     1 
ATOM   2241 C  C     B LYS A 1 289 ? 21.583  36.808 28.954 0.50 29.68 ? 271  LYS A C     1 
ATOM   2242 O  O     A LYS A 1 289 ? 22.484  36.177 28.452 0.50 28.73 ? 271  LYS A O     1 
ATOM   2243 O  O     B LYS A 1 289 ? 22.334  36.027 28.379 0.50 29.00 ? 271  LYS A O     1 
ATOM   2244 C  CB    A LYS A 1 289 ? 22.100  38.006 31.235 0.50 30.13 ? 271  LYS A CB    1 
ATOM   2245 C  CB    B LYS A 1 289 ? 22.228  37.949 31.105 0.50 31.50 ? 271  LYS A CB    1 
ATOM   2246 C  CG    A LYS A 1 289 ? 23.350  37.630 32.048 0.50 31.41 ? 271  LYS A CG    1 
ATOM   2247 C  CG    B LYS A 1 289 ? 23.736  37.787 30.982 0.50 32.87 ? 271  LYS A CG    1 
ATOM   2248 C  CD    A LYS A 1 289 ? 24.231  38.831 32.441 0.50 30.96 ? 271  LYS A CD    1 
ATOM   2249 C  CD    B LYS A 1 289 ? 24.481  39.031 31.478 0.50 37.53 ? 271  LYS A CD    1 
ATOM   2250 C  CE    A LYS A 1 289 ? 25.516  38.931 31.501 0.50 33.60 ? 271  LYS A CE    1 
ATOM   2251 C  CE    B LYS A 1 289 ? 26.033  38.834 31.359 0.50 36.94 ? 271  LYS A CE    1 
ATOM   2252 N  NZ    A LYS A 1 289 ? 26.178  37.647 30.942 0.50 21.91 ? 271  LYS A NZ    1 
ATOM   2253 N  NZ    B LYS A 1 289 ? 26.804  40.001 31.871 0.50 34.19 ? 271  LYS A NZ    1 
ATOM   2254 N  N     . PRO A 1 290 ? 20.822  37.696 28.278 1.00 29.21 ? 272  PRO A N     1 
ATOM   2255 C  CA    . PRO A 1 290 ? 21.065  37.839 26.840 1.00 28.40 ? 272  PRO A CA    1 
ATOM   2256 C  C     . PRO A 1 290 ? 22.535  38.071 26.485 1.00 27.04 ? 272  PRO A C     1 
ATOM   2257 O  O     . PRO A 1 290 ? 23.256  38.891 27.118 1.00 25.83 ? 272  PRO A O     1 
ATOM   2258 C  CB    . PRO A 1 290 ? 20.160  39.026 26.446 1.00 28.90 ? 272  PRO A CB    1 
ATOM   2259 C  CG    . PRO A 1 290 ? 18.984  38.908 27.415 1.00 28.77 ? 272  PRO A CG    1 
ATOM   2260 C  CD    . PRO A 1 290 ? 19.693  38.572 28.705 1.00 29.78 ? 272  PRO A CD    1 
ATOM   2261 N  N     . GLY A 1 291 ? 22.961  37.304 25.485 1.00 27.01 ? 273  GLY A N     1 
ATOM   2262 C  CA    . GLY A 1 291 ? 24.300  37.366 24.968 1.00 26.99 ? 273  GLY A CA    1 
ATOM   2263 C  C     . GLY A 1 291 ? 25.189  36.237 25.439 1.00 28.04 ? 273  GLY A C     1 
ATOM   2264 O  O     . GLY A 1 291 ? 26.212  35.972 24.787 1.00 27.99 ? 273  GLY A O     1 
ATOM   2265 N  N     . SER A 1 292 ? 24.793  35.553 26.538 1.00 26.59 ? 274  SER A N     1 
ATOM   2266 C  CA    . SER A 1 292 ? 25.616  34.494 27.141 1.00 25.93 ? 274  SER A CA    1 
ATOM   2267 C  C     . SER A 1 292 ? 25.288  33.190 26.500 1.00 25.57 ? 274  SER A C     1 
ATOM   2268 O  O     . SER A 1 292 ? 24.167  33.004 26.092 1.00 26.02 ? 274  SER A O     1 
ATOM   2269 C  CB    . SER A 1 292 ? 25.354  34.423 28.658 1.00 26.21 ? 274  SER A CB    1 
ATOM   2270 O  OG    . SER A 1 292 ? 24.031  33.916 28.886 1.00 25.71 ? 274  SER A OG    1 
ATOM   2271 N  N     . SER A 1 293 ? 26.245  32.270 26.398 1.00 26.16 ? 275  SER A N     1 
ATOM   2272 C  CA    . SER A 1 293 ? 25.943  30.946 25.861 1.00 26.61 ? 275  SER A CA    1 
ATOM   2273 C  C     . SER A 1 293 ? 24.901  30.247 26.732 1.00 27.81 ? 275  SER A C     1 
ATOM   2274 O  O     . SER A 1 293 ? 25.046  30.241 27.976 1.00 27.29 ? 275  SER A O     1 
ATOM   2275 C  CB    . SER A 1 293 ? 27.188  30.025 25.930 1.00 26.80 ? 275  SER A CB    1 
ATOM   2276 O  OG    . SER A 1 293 ? 28.278  30.537 25.192 1.00 30.03 ? 275  SER A OG    1 
ATOM   2277 N  N     . HIS A 1 294 ? 23.944  29.558 26.078 1.00 27.04 ? 276  HIS A N     1 
ATOM   2278 C  CA    . HIS A 1 294 ? 23.041  28.678 26.729 1.00 26.31 ? 276  HIS A CA    1 
ATOM   2279 C  C     . HIS A 1 294 ? 23.785  27.561 27.468 1.00 27.58 ? 276  HIS A C     1 
ATOM   2280 O  O     . HIS A 1 294 ? 24.780  26.993 26.964 1.00 27.46 ? 276  HIS A O     1 
ATOM   2281 C  CB    . HIS A 1 294 ? 22.158  28.041 25.695 1.00 26.86 ? 276  HIS A CB    1 
ATOM   2282 C  CG    . HIS A 1 294 ? 21.126  27.120 26.260 1.00 24.60 ? 276  HIS A CG    1 
ATOM   2283 N  ND1   . HIS A 1 294 ? 21.336  25.765 26.395 1.00 24.45 ? 276  HIS A ND1   1 
ATOM   2284 C  CD2   . HIS A 1 294 ? 19.851  27.355 26.677 1.00 23.84 ? 276  HIS A CD2   1 
ATOM   2285 C  CE1   . HIS A 1 294 ? 20.239  25.201 26.880 1.00 29.75 ? 276  HIS A CE1   1 
ATOM   2286 N  NE2   . HIS A 1 294 ? 19.320  26.149 27.068 1.00 27.75 ? 276  HIS A NE2   1 
ATOM   2287 N  N     . ARG A 1 295 ? 23.312  27.220 28.671 1.00 27.05 ? 277  ARG A N     1 
ATOM   2288 C  CA    . ARG A 1 295 ? 23.831  25.972 29.288 1.00 27.33 ? 277  ARG A CA    1 
ATOM   2289 C  C     . ARG A 1 295 ? 22.687  25.057 29.719 1.00 26.26 ? 277  ARG A C     1 
ATOM   2290 O  O     . ARG A 1 295 ? 21.542  25.540 29.910 1.00 26.35 ? 277  ARG A O     1 
ATOM   2291 C  CB    . ARG A 1 295 ? 24.854  26.263 30.419 1.00 29.25 ? 277  ARG A CB    1 
ATOM   2292 C  CG    . ARG A 1 295 ? 24.890  27.729 30.988 1.00 28.25 ? 277  ARG A CG    1 
ATOM   2293 C  CD    . ARG A 1 295 ? 25.969  27.761 31.971 1.00 31.37 ? 277  ARG A CD    1 
ATOM   2294 N  NE    . ARG A 1 295 ? 25.887  28.829 32.945 1.00 37.47 ? 277  ARG A NE    1 
ATOM   2295 C  CZ    . ARG A 1 295 ? 25.571  28.688 34.252 1.00 38.19 ? 277  ARG A CZ    1 
ATOM   2296 N  NH1   . ARG A 1 295 ? 25.204  27.509 34.825 1.00 34.44 ? 277  ARG A NH1   1 
ATOM   2297 N  NH2   . ARG A 1 295 ? 25.585  29.787 34.996 1.00 37.23 ? 277  ARG A NH2   1 
ATOM   2298 N  N     . PRO A 1 296 ? 22.978  23.742 29.824 1.00 25.57 ? 278  PRO A N     1 
ATOM   2299 C  CA    . PRO A 1 296 ? 21.977  22.721 30.148 1.00 24.48 ? 278  PRO A CA    1 
ATOM   2300 C  C     . PRO A 1 296 ? 21.406  23.117 31.536 1.00 25.19 ? 278  PRO A C     1 
ATOM   2301 O  O     . PRO A 1 296 ? 22.161  23.611 32.409 1.00 25.82 ? 278  PRO A O     1 
ATOM   2302 C  CB    . PRO A 1 296 ? 22.793  21.450 30.269 1.00 24.78 ? 278  PRO A CB    1 
ATOM   2303 C  CG    . PRO A 1 296 ? 24.151  21.733 29.689 1.00 26.00 ? 278  PRO A CG    1 
ATOM   2304 C  CD    . PRO A 1 296 ? 24.358  23.204 29.724 1.00 24.95 ? 278  PRO A CD    1 
ATOM   2305 N  N     . TRP A 1 297 ? 20.105  22.936 31.739 1.00 24.13 ? 279  TRP A N     1 
ATOM   2306 C  CA    . TRP A 1 297 ? 19.480  23.109 33.059 1.00 23.06 ? 279  TRP A CA    1 
ATOM   2307 C  C     . TRP A 1 297 ? 20.223  22.449 34.223 1.00 23.55 ? 279  TRP A C     1 
ATOM   2308 O  O     . TRP A 1 297 ? 20.391  23.091 35.276 1.00 22.76 ? 279  TRP A O     1 
ATOM   2309 C  CB    . TRP A 1 297 ? 17.993  22.726 33.029 1.00 22.47 ? 279  TRP A CB    1 
ATOM   2310 C  CG    . TRP A 1 297 ? 17.710  21.261 32.997 1.00 22.03 ? 279  TRP A CG    1 
ATOM   2311 C  CD1   . TRP A 1 297 ? 17.452  20.510 31.892 1.00 21.80 ? 279  TRP A CD1   1 
ATOM   2312 C  CD2   . TRP A 1 297 ? 17.637  20.357 34.132 1.00 22.57 ? 279  TRP A CD2   1 
ATOM   2313 N  NE1   . TRP A 1 297 ? 17.272  19.168 32.242 1.00 21.88 ? 279  TRP A NE1   1 
ATOM   2314 C  CE2   . TRP A 1 297 ? 17.332  19.056 33.610 1.00 23.60 ? 279  TRP A CE2   1 
ATOM   2315 C  CE3   . TRP A 1 297 ? 17.763  20.525 35.544 1.00 20.64 ? 279  TRP A CE3   1 
ATOM   2316 C  CZ2   . TRP A 1 297 ? 17.179  17.911 34.446 1.00 22.94 ? 279  TRP A CZ2   1 
ATOM   2317 C  CZ3   . TRP A 1 297 ? 17.609  19.413 36.375 1.00 21.16 ? 279  TRP A CZ3   1 
ATOM   2318 C  CH2   . TRP A 1 297 ? 17.328  18.095 35.813 1.00 24.13 ? 279  TRP A CH2   1 
ATOM   2319 N  N     . GLN A 1 298 ? 20.757  21.234 34.005 1.00 23.47 ? 280  GLN A N     1 
ATOM   2320 C  CA    . GLN A 1 298 ? 21.462  20.515 35.062 1.00 23.69 ? 280  GLN A CA    1 
ATOM   2321 C  C     . GLN A 1 298 ? 22.652  21.309 35.633 1.00 24.63 ? 280  GLN A C     1 
ATOM   2322 O  O     . GLN A 1 298 ? 22.952  21.159 36.818 1.00 25.35 ? 280  GLN A O     1 
ATOM   2323 C  CB    . GLN A 1 298 ? 21.934  19.114 34.650 1.00 22.18 ? 280  GLN A CB    1 
ATOM   2324 C  CG    . GLN A 1 298 ? 20.833  18.116 34.271 1.00 23.07 ? 280  GLN A CG    1 
ATOM   2325 C  CD    . GLN A 1 298 ? 20.562  18.114 32.782 1.00 24.76 ? 280  GLN A CD    1 
ATOM   2326 O  OE1   . GLN A 1 298 ? 20.701  19.137 32.118 1.00 25.29 ? 280  GLN A OE1   1 
ATOM   2327 N  NE2   . GLN A 1 298 ? 20.099  16.985 32.260 1.00 24.16 ? 280  GLN A NE2   1 
ATOM   2328 N  N     . SER A 1 299 ? 23.299  22.161 34.827 1.00 24.24 ? 281  SER A N     1 
ATOM   2329 C  CA    . SER A 1 299 ? 24.533  22.884 35.257 1.00 23.60 ? 281  SER A CA    1 
ATOM   2330 C  C     . SER A 1 299 ? 24.201  23.936 36.326 1.00 23.30 ? 281  SER A C     1 
ATOM   2331 O  O     . SER A 1 299 ? 25.063  24.412 37.075 1.00 24.91 ? 281  SER A O     1 
ATOM   2332 C  CB    . SER A 1 299 ? 25.256  23.535 34.061 1.00 23.42 ? 281  SER A CB    1 
ATOM   2333 O  OG    . SER A 1 299 ? 24.473  24.606 33.489 1.00 24.75 ? 281  SER A OG    1 
ATOM   2334 N  N     . TYR A 1 300 ? 22.937  24.267 36.465 1.00 23.32 ? 282  TYR A N     1 
ATOM   2335 C  CA    . TYR A 1 300 ? 22.564  25.252 37.465 1.00 23.76 ? 282  TYR A CA    1 
ATOM   2336 C  C     . TYR A 1 300 ? 22.402  24.731 38.924 1.00 25.37 ? 282  TYR A C     1 
ATOM   2337 O  O     . TYR A 1 300 ? 22.144  25.542 39.868 1.00 26.48 ? 282  TYR A O     1 
ATOM   2338 C  CB    . TYR A 1 300 ? 21.254  25.886 37.016 1.00 23.33 ? 282  TYR A CB    1 
ATOM   2339 C  CG    . TYR A 1 300 ? 21.396  26.765 35.843 1.00 23.31 ? 282  TYR A CG    1 
ATOM   2340 C  CD1   . TYR A 1 300 ? 21.615  28.129 36.003 1.00 23.18 ? 282  TYR A CD1   1 
ATOM   2341 C  CD2   . TYR A 1 300 ? 21.327  26.235 34.532 1.00 24.85 ? 282  TYR A CD2   1 
ATOM   2342 C  CE1   . TYR A 1 300 ? 21.741  28.957 34.919 1.00 23.18 ? 282  TYR A CE1   1 
ATOM   2343 C  CE2   . TYR A 1 300 ? 21.444  27.064 33.410 1.00 22.03 ? 282  TYR A CE2   1 
ATOM   2344 C  CZ    . TYR A 1 300 ? 21.678  28.394 33.598 1.00 24.30 ? 282  TYR A CZ    1 
ATOM   2345 O  OH    . TYR A 1 300 ? 21.822  29.197 32.502 1.00 23.98 ? 282  TYR A OH    1 
ATOM   2346 N  N     . PHE A 1 301 ? 22.498  23.406 39.105 1.00 25.56 ? 283  PHE A N     1 
ATOM   2347 C  CA    . PHE A 1 301 ? 22.260  22.747 40.390 1.00 25.36 ? 283  PHE A CA    1 
ATOM   2348 C  C     . PHE A 1 301 ? 23.472  21.981 40.868 1.00 25.94 ? 283  PHE A C     1 
ATOM   2349 O  O     . PHE A 1 301 ? 24.050  21.238 40.111 1.00 26.27 ? 283  PHE A O     1 
ATOM   2350 C  CB    . PHE A 1 301 ? 21.079  21.794 40.269 1.00 24.34 ? 283  PHE A CB    1 
ATOM   2351 C  CG    . PHE A 1 301 ? 19.803  22.482 39.909 1.00 24.93 ? 283  PHE A CG    1 
ATOM   2352 C  CD1   . PHE A 1 301 ? 18.972  23.024 40.892 1.00 25.09 ? 283  PHE A CD1   1 
ATOM   2353 C  CD2   . PHE A 1 301 ? 19.440  22.641 38.572 1.00 23.38 ? 283  PHE A CD2   1 
ATOM   2354 C  CE1   . PHE A 1 301 ? 17.794  23.727 40.513 1.00 22.97 ? 283  PHE A CE1   1 
ATOM   2355 C  CE2   . PHE A 1 301 ? 18.280  23.302 38.194 1.00 21.53 ? 283  PHE A CE2   1 
ATOM   2356 C  CZ    . PHE A 1 301 ? 17.451  23.851 39.144 1.00 22.66 ? 283  PHE A CZ    1 
ATOM   2357 N  N     . ASP A 1 302 ? 23.852  22.170 42.132 1.00 26.31 ? 284  ASP A N     1 
ATOM   2358 C  CA    . ASP A 1 302 ? 24.863  21.321 42.801 1.00 27.18 ? 284  ASP A CA    1 
ATOM   2359 C  C     . ASP A 1 302 ? 24.388  19.912 43.120 1.00 27.17 ? 284  ASP A C     1 
ATOM   2360 O  O     . ASP A 1 302 ? 25.188  18.972 43.309 1.00 28.72 ? 284  ASP A O     1 
ATOM   2361 C  CB    . ASP A 1 302 ? 25.326  22.030 44.051 1.00 26.47 ? 284  ASP A CB    1 
ATOM   2362 C  CG    . ASP A 1 302 ? 26.003  23.353 43.698 1.00 31.13 ? 284  ASP A CG    1 
ATOM   2363 O  OD1   . ASP A 1 302 ? 27.058  23.296 43.020 1.00 32.76 ? 284  ASP A OD1   1 
ATOM   2364 O  OD2   . ASP A 1 302 ? 25.475  24.437 44.002 1.00 33.94 ? 284  ASP A OD2   1 
ATOM   2365 N  N     . LEU A 1 303 ? 23.080  19.760 43.160 1.00 26.16 ? 285  LEU A N     1 
ATOM   2366 C  CA    . LEU A 1 303 ? 22.478  18.503 43.554 1.00 25.84 ? 285  LEU A CA    1 
ATOM   2367 C  C     . LEU A 1 303 ? 21.092  18.445 42.946 1.00 23.56 ? 285  LEU A C     1 
ATOM   2368 O  O     . LEU A 1 303 ? 20.346  19.377 43.081 1.00 23.28 ? 285  LEU A O     1 
ATOM   2369 C  CB    . LEU A 1 303 ? 22.429  18.357 45.096 1.00 25.67 ? 285  LEU A CB    1 
ATOM   2370 C  CG    . LEU A 1 303 ? 21.985  16.971 45.646 1.00 27.90 ? 285  LEU A CG    1 
ATOM   2371 C  CD1   . LEU A 1 303 ? 22.588  16.818 47.047 1.00 31.44 ? 285  LEU A CD1   1 
ATOM   2372 C  CD2   . LEU A 1 303 ? 20.467  16.904 45.748 1.00 25.17 ? 285  LEU A CD2   1 
ATOM   2373 N  N     . ILE A 1 304 ? 20.794  17.351 42.256 1.00 22.97 ? 286  ILE A N     1 
ATOM   2374 C  CA    . ILE A 1 304 ? 19.483  17.130 41.632 1.00 23.27 ? 286  ILE A CA    1 
ATOM   2375 C  C     . ILE A 1 304 ? 18.885  15.876 42.205 1.00 24.05 ? 286  ILE A C     1 
ATOM   2376 O  O     . ILE A 1 304 ? 19.507  14.822 42.171 1.00 25.52 ? 286  ILE A O     1 
ATOM   2377 C  CB    . ILE A 1 304 ? 19.581  17.000 40.118 1.00 22.14 ? 286  ILE A CB    1 
ATOM   2378 C  CG1   . ILE A 1 304 ? 20.114  18.323 39.542 1.00 22.51 ? 286  ILE A CG1   1 
ATOM   2379 C  CG2   . ILE A 1 304 ? 18.183  16.672 39.478 1.00 21.25 ? 286  ILE A CG2   1 
ATOM   2380 C  CD1   . ILE A 1 304 ? 20.562  18.226 38.110 1.00 17.92 ? 286  ILE A CD1   1 
ATOM   2381 N  N     . LEU A 1 305 ? 17.692  15.980 42.760 1.00 25.12 ? 287  LEU A N     1 
ATOM   2382 C  CA    . LEU A 1 305 ? 17.085  14.785 43.390 1.00 26.30 ? 287  LEU A CA    1 
ATOM   2383 C  C     . LEU A 1 305 ? 15.638  14.599 42.894 1.00 25.25 ? 287  LEU A C     1 
ATOM   2384 O  O     . LEU A 1 305 ? 14.828  15.510 43.010 1.00 26.14 ? 287  LEU A O     1 
ATOM   2385 C  CB    . LEU A 1 305 ? 17.202  14.880 44.917 1.00 26.13 ? 287  LEU A CB    1 
ATOM   2386 C  CG    . LEU A 1 305 ? 16.769  13.627 45.695 1.00 30.32 ? 287  LEU A CG    1 
ATOM   2387 C  CD1   . LEU A 1 305 ? 17.683  13.434 46.914 1.00 30.81 ? 287  LEU A CD1   1 
ATOM   2388 C  CD2   . LEU A 1 305 ? 15.263  13.644 46.046 1.00 28.35 ? 287  LEU A CD2   1 
ATOM   2389 N  N     . VAL A 1 306 ? 15.342  13.431 42.313 1.00 25.10 ? 288  VAL A N     1 
ATOM   2390 C  CA    . VAL A 1 306 ? 14.018  13.120 41.773 1.00 23.26 ? 288  VAL A CA    1 
ATOM   2391 C  C     . VAL A 1 306 ? 13.369  12.031 42.651 1.00 24.05 ? 288  VAL A C     1 
ATOM   2392 O  O     . VAL A 1 306 ? 14.006  11.512 43.600 1.00 23.17 ? 288  VAL A O     1 
ATOM   2393 C  CB    . VAL A 1 306 ? 14.098  12.749 40.206 1.00 23.96 ? 288  VAL A CB    1 
ATOM   2394 C  CG1   . VAL A 1 306 ? 14.641  13.938 39.382 1.00 20.30 ? 288  VAL A CG1   1 
ATOM   2395 C  CG2   . VAL A 1 306 ? 14.965  11.486 39.958 1.00 21.96 ? 288  VAL A CG2   1 
ATOM   2396 N  N     . ASP A 1 307 ? 12.095  11.705 42.388 1.00 25.51 ? 289  ASP A N     1 
ATOM   2397 C  CA    . ASP A 1 307 ? 11.335  10.662 43.155 1.00 25.29 ? 289  ASP A CA    1 
ATOM   2398 C  C     . ASP A 1 307 ? 11.511  10.811 44.678 1.00 25.67 ? 289  ASP A C     1 
ATOM   2399 O  O     . ASP A 1 307 ? 11.699  9.814  45.412 1.00 26.17 ? 289  ASP A O     1 
ATOM   2400 C  CB    . ASP A 1 307 ? 11.745  9.237  42.759 1.00 24.74 ? 289  ASP A CB    1 
ATOM   2401 C  CG    . ASP A 1 307 ? 11.843  9.018  41.245 1.00 28.48 ? 289  ASP A CG    1 
ATOM   2402 O  OD1   . ASP A 1 307 ? 10.797  9.190  40.515 1.00 27.67 ? 289  ASP A OD1   1 
ATOM   2403 O  OD2   . ASP A 1 307 ? 12.970  8.606  40.788 1.00 26.67 ? 289  ASP A OD2   1 
ATOM   2404 N  N     . ALA A 1 308 ? 11.436  12.058 45.142 1.00 25.95 ? 290  ALA A N     1 
ATOM   2405 C  CA    . ALA A 1 308 ? 11.766  12.453 46.509 1.00 25.58 ? 290  ALA A CA    1 
ATOM   2406 C  C     . ALA A 1 308 ? 10.833  11.836 47.526 1.00 26.77 ? 290  ALA A C     1 
ATOM   2407 O  O     . ALA A 1 308 ? 11.249  11.563 48.634 1.00 25.97 ? 290  ALA A O     1 
ATOM   2408 C  CB    . ALA A 1 308 ? 11.717  14.006 46.646 1.00 24.14 ? 290  ALA A CB    1 
ATOM   2409 N  N     A ARG A 1 309 ? 9.570   11.667 47.121 0.50 27.06 ? 291  ARG A N     1 
ATOM   2410 N  N     B ARG A 1 309 ? 9.571   11.630 47.146 0.50 27.01 ? 291  ARG A N     1 
ATOM   2411 C  CA    A ARG A 1 309 ? 8.480   11.203 47.973 0.50 27.84 ? 291  ARG A CA    1 
ATOM   2412 C  CA    B ARG A 1 309 ? 8.551   11.174 48.078 0.50 27.81 ? 291  ARG A CA    1 
ATOM   2413 C  C     A ARG A 1 309 ? 8.218   12.076 49.217 0.50 27.58 ? 291  ARG A C     1 
ATOM   2414 C  C     B ARG A 1 309 ? 8.424   12.098 49.304 0.50 27.46 ? 291  ARG A C     1 
ATOM   2415 O  O     A ARG A 1 309 ? 7.923   11.543 50.290 0.50 27.80 ? 291  ARG A O     1 
ATOM   2416 O  O     B ARG A 1 309 ? 8.448   11.630 50.448 0.50 27.62 ? 291  ARG A O     1 
ATOM   2417 C  CB    A ARG A 1 309 ? 8.625   9.706  48.320 0.50 27.80 ? 291  ARG A CB    1 
ATOM   2418 C  CB    B ARG A 1 309 ? 8.787   9.712  48.491 0.50 27.75 ? 291  ARG A CB    1 
ATOM   2419 C  CG    A ARG A 1 309 ? 8.480   8.825  47.095 0.50 29.67 ? 291  ARG A CG    1 
ATOM   2420 C  CG    B ARG A 1 309 ? 8.274   8.723  47.486 0.50 29.80 ? 291  ARG A CG    1 
ATOM   2421 C  CD    A ARG A 1 309 ? 8.168   7.370  47.409 0.50 33.07 ? 291  ARG A CD    1 
ATOM   2422 C  CD    B ARG A 1 309 ? 9.055   7.422  47.532 0.50 33.36 ? 291  ARG A CD    1 
ATOM   2423 N  NE    A ARG A 1 309 ? 7.042   7.237  48.337 0.50 33.47 ? 291  ARG A NE    1 
ATOM   2424 N  NE    B ARG A 1 309 ? 10.210  7.439  46.641 0.50 37.64 ? 291  ARG A NE    1 
ATOM   2425 C  CZ    A ARG A 1 309 ? 6.768   6.135  49.013 0.50 33.33 ? 291  ARG A CZ    1 
ATOM   2426 C  CZ    B ARG A 1 309 ? 10.350  6.670  45.561 0.50 37.87 ? 291  ARG A CZ    1 
ATOM   2427 N  NH1   A ARG A 1 309 ? 7.510   5.042  48.870 0.50 33.13 ? 291  ARG A NH1   1 
ATOM   2428 N  NH1   B ARG A 1 309 ? 9.418   5.800  45.218 0.50 37.17 ? 291  ARG A NH1   1 
ATOM   2429 N  NH2   A ARG A 1 309 ? 5.740   6.136  49.834 0.50 35.38 ? 291  ARG A NH2   1 
ATOM   2430 N  NH2   B ARG A 1 309 ? 11.445  6.762  44.838 0.50 38.01 ? 291  ARG A NH2   1 
ATOM   2431 N  N     . LYS A 1 310 ? 8.302   13.400 49.050 1.00 26.36 ? 292  LYS A N     1 
ATOM   2432 C  CA    . LYS A 1 310 ? 7.893   14.337 50.069 1.00 26.78 ? 292  LYS A CA    1 
ATOM   2433 C  C     . LYS A 1 310 ? 6.403   14.065 50.355 1.00 27.89 ? 292  LYS A C     1 
ATOM   2434 O  O     . LYS A 1 310 ? 5.666   13.746 49.419 1.00 29.57 ? 292  LYS A O     1 
ATOM   2435 C  CB    . LYS A 1 310 ? 8.122   15.779 49.630 1.00 25.46 ? 292  LYS A CB    1 
ATOM   2436 C  CG    . LYS A 1 310 ? 9.558   16.043 49.203 1.00 26.10 ? 292  LYS A CG    1 
ATOM   2437 C  CD    . LYS A 1 310 ? 9.883   17.456 48.729 1.00 27.04 ? 292  LYS A CD    1 
ATOM   2438 C  CE    . LYS A 1 310 ? 8.798   18.123 47.898 1.00 29.96 ? 292  LYS A CE    1 
ATOM   2439 N  NZ    . LYS A 1 310 ? 8.575   17.507 46.639 1.00 31.10 ? 292  LYS A NZ    1 
ATOM   2440 N  N     . PRO A 1 311 ? 5.947   14.146 51.640 1.00 27.88 ? 293  PRO A N     1 
ATOM   2441 C  CA    . PRO A 1 311 ? 6.626   14.531 52.908 1.00 27.60 ? 293  PRO A CA    1 
ATOM   2442 C  C     . PRO A 1 311 ? 7.503   13.492 53.620 1.00 27.96 ? 293  PRO A C     1 
ATOM   2443 O  O     . PRO A 1 311 ? 8.378   13.871 54.396 1.00 28.76 ? 293  PRO A O     1 
ATOM   2444 C  CB    . PRO A 1 311 ? 5.465   14.987 53.818 1.00 26.87 ? 293  PRO A CB    1 
ATOM   2445 C  CG    . PRO A 1 311 ? 4.253   14.171 53.345 1.00 26.82 ? 293  PRO A CG    1 
ATOM   2446 C  CD    . PRO A 1 311 ? 4.500   13.881 51.839 1.00 28.27 ? 293  PRO A CD    1 
ATOM   2447 N  N     . LEU A 1 312 ? 7.279   12.206 53.363 1.00 28.93 ? 294  LEU A N     1 
ATOM   2448 C  CA    . LEU A 1 312 ? 8.141   11.136 53.884 1.00 28.54 ? 294  LEU A CA    1 
ATOM   2449 C  C     . LEU A 1 312 ? 9.659   11.436 53.813 1.00 29.57 ? 294  LEU A C     1 
ATOM   2450 O  O     . LEU A 1 312 ? 10.439  11.037 54.713 1.00 30.00 ? 294  LEU A O     1 
ATOM   2451 C  CB    . LEU A 1 312 ? 7.782   9.786  53.197 1.00 28.35 ? 294  LEU A CB    1 
ATOM   2452 C  CG    . LEU A 1 312 ? 8.709   8.578  53.488 1.00 31.45 ? 294  LEU A CG    1 
ATOM   2453 C  CD1   . LEU A 1 312 ? 8.487   8.032  54.921 1.00 31.14 ? 294  LEU A CD1   1 
ATOM   2454 C  CD2   . LEU A 1 312 ? 8.618   7.390  52.430 1.00 27.86 ? 294  LEU A CD2   1 
ATOM   2455 N  N     . PHE A 1 313 ? 10.080  12.105 52.727 1.00 28.32 ? 295  PHE A N     1 
ATOM   2456 C  CA    . PHE A 1 313 ? 11.470  12.583 52.526 1.00 26.68 ? 295  PHE A CA    1 
ATOM   2457 C  C     . PHE A 1 313 ? 12.004  13.364 53.718 1.00 26.52 ? 295  PHE A C     1 
ATOM   2458 O  O     . PHE A 1 313 ? 13.210  13.347 54.023 1.00 25.84 ? 295  PHE A O     1 
ATOM   2459 C  CB    . PHE A 1 313 ? 11.462  13.492 51.287 1.00 25.91 ? 295  PHE A CB    1 
ATOM   2460 C  CG    . PHE A 1 313 ? 12.785  14.119 50.948 1.00 25.99 ? 295  PHE A CG    1 
ATOM   2461 C  CD1   . PHE A 1 313 ? 13.771  13.393 50.281 1.00 26.41 ? 295  PHE A CD1   1 
ATOM   2462 C  CD2   . PHE A 1 313 ? 13.017  15.465 51.210 1.00 25.46 ? 295  PHE A CD2   1 
ATOM   2463 C  CE1   . PHE A 1 313 ? 14.996  14.004 49.916 1.00 24.90 ? 295  PHE A CE1   1 
ATOM   2464 C  CE2   . PHE A 1 313 ? 14.244  16.057 50.877 1.00 22.03 ? 295  PHE A CE2   1 
ATOM   2465 C  CZ    . PHE A 1 313 ? 15.200  15.333 50.215 1.00 23.48 ? 295  PHE A CZ    1 
ATOM   2466 N  N     . PHE A 1 314 ? 11.111  14.064 54.399 1.00 27.22 ? 296  PHE A N     1 
ATOM   2467 C  CA    . PHE A 1 314 ? 11.527  14.862 55.545 1.00 29.74 ? 296  PHE A CA    1 
ATOM   2468 C  C     . PHE A 1 314 ? 11.532  14.079 56.878 1.00 31.69 ? 296  PHE A C     1 
ATOM   2469 O  O     . PHE A 1 314 ? 11.875  14.669 57.901 1.00 33.68 ? 296  PHE A O     1 
ATOM   2470 C  CB    . PHE A 1 314 ? 10.679  16.136 55.660 1.00 27.35 ? 296  PHE A CB    1 
ATOM   2471 C  CG    . PHE A 1 314 ? 10.910  17.092 54.542 1.00 25.10 ? 296  PHE A CG    1 
ATOM   2472 C  CD1   . PHE A 1 314 ? 12.128  17.769 54.418 1.00 21.05 ? 296  PHE A CD1   1 
ATOM   2473 C  CD2   . PHE A 1 314 ? 9.930   17.303 53.587 1.00 22.64 ? 296  PHE A CD2   1 
ATOM   2474 C  CE1   . PHE A 1 314 ? 12.323  18.668 53.395 1.00 17.69 ? 296  PHE A CE1   1 
ATOM   2475 C  CE2   . PHE A 1 314 ? 10.154  18.170 52.553 1.00 23.22 ? 296  PHE A CE2   1 
ATOM   2476 C  CZ    . PHE A 1 314 ? 11.335  18.846 52.442 1.00 19.06 ? 296  PHE A CZ    1 
ATOM   2477 N  N     . GLY A 1 315 ? 11.085  12.814 56.841 1.00 31.99 ? 297  GLY A N     1 
ATOM   2478 C  CA    . GLY A 1 315 ? 11.223  11.843 57.916 1.00 34.07 ? 297  GLY A CA    1 
ATOM   2479 C  C     . GLY A 1 315 ? 12.247  10.763 57.572 1.00 35.42 ? 297  GLY A C     1 
ATOM   2480 O  O     . GLY A 1 315 ? 13.437  11.065 57.350 1.00 35.73 ? 297  GLY A O     1 
ATOM   2481 N  N     A GLU A 1 316 ? 11.843  9.495  57.522 0.50 35.72 ? 298  GLU A N     1 
ATOM   2482 N  N     B GLU A 1 316 ? 11.763  9.528  57.489 0.50 35.38 ? 298  GLU A N     1 
ATOM   2483 C  CA    A GLU A 1 316 ? 12.864  8.450  57.270 0.50 36.32 ? 298  GLU A CA    1 
ATOM   2484 C  CA    B GLU A 1 316 ? 12.603  8.356  57.228 0.50 35.66 ? 298  GLU A CA    1 
ATOM   2485 C  C     A GLU A 1 316 ? 13.255  8.268  55.774 0.50 35.70 ? 298  GLU A C     1 
ATOM   2486 C  C     B GLU A 1 316 ? 13.281  8.404  55.837 0.50 35.37 ? 298  GLU A C     1 
ATOM   2487 O  O     A GLU A 1 316 ? 14.183  7.501  55.457 0.50 35.92 ? 298  GLU A O     1 
ATOM   2488 O  O     B GLU A 1 316 ? 14.414  7.935  55.655 0.50 35.59 ? 298  GLU A O     1 
ATOM   2489 C  CB    A GLU A 1 316 ? 12.556  7.109  57.987 0.50 36.07 ? 298  GLU A CB    1 
ATOM   2490 C  CB    B GLU A 1 316 ? 11.748  7.085  57.317 0.50 35.46 ? 298  GLU A CB    1 
ATOM   2491 C  CG    A GLU A 1 316 ? 11.534  6.179  57.330 0.50 38.02 ? 298  GLU A CG    1 
ATOM   2492 C  CG    B GLU A 1 316 ? 10.812  6.971  58.526 0.50 38.02 ? 298  GLU A CG    1 
ATOM   2493 C  CD    A GLU A 1 316 ? 11.676  4.702  57.776 0.50 38.70 ? 298  GLU A CD    1 
ATOM   2494 C  CD    B GLU A 1 316 ? 9.451   7.654  58.332 0.50 40.29 ? 298  GLU A CD    1 
ATOM   2495 O  OE1   A GLU A 1 316 ? 12.229  4.438  58.868 0.50 39.81 ? 298  GLU A OE1   1 
ATOM   2496 O  OE1   B GLU A 1 316 ? 9.406   8.910  58.316 0.50 39.93 ? 298  GLU A OE1   1 
ATOM   2497 O  OE2   A GLU A 1 316 ? 11.244  3.794  57.019 0.50 42.84 ? 298  GLU A OE2   1 
ATOM   2498 O  OE2   B GLU A 1 316 ? 8.428   6.925  58.213 0.50 40.26 ? 298  GLU A OE2   1 
ATOM   2499 N  N     . GLY A 1 317 ? 12.551  8.972  54.875 1.00 34.72 ? 299  GLY A N     1 
ATOM   2500 C  CA    . GLY A 1 317 ? 12.875  8.954  53.486 1.00 33.18 ? 299  GLY A CA    1 
ATOM   2501 C  C     . GLY A 1 317 ? 12.738  7.560  52.953 1.00 33.12 ? 299  GLY A C     1 
ATOM   2502 O  O     . GLY A 1 317 ? 11.996  6.726  53.500 1.00 33.32 ? 299  GLY A O     1 
ATOM   2503 N  N     . THR A 1 318 ? 13.517  7.298  51.907 1.00 32.59 ? 300  THR A N     1 
ATOM   2504 C  CA    . THR A 1 318 ? 13.623  5.968  51.286 1.00 31.78 ? 300  THR A CA    1 
ATOM   2505 C  C     . THR A 1 318 ? 15.073  5.812  50.935 1.00 30.76 ? 300  THR A C     1 
ATOM   2506 O  O     . THR A 1 318 ? 15.889  6.687  51.164 1.00 30.33 ? 300  THR A O     1 
ATOM   2507 C  CB    . THR A 1 318 ? 12.715  5.831  50.034 1.00 32.95 ? 300  THR A CB    1 
ATOM   2508 O  OG1   . THR A 1 318 ? 13.045  6.846  49.049 1.00 33.94 ? 300  THR A OG1   1 
ATOM   2509 C  CG2   . THR A 1 318 ? 11.232  6.033  50.440 1.00 32.75 ? 300  THR A CG2   1 
ATOM   2510 N  N     . VAL A 1 319 ? 15.402  4.690  50.387 1.00 30.29 ? 301  VAL A N     1 
ATOM   2511 C  CA    . VAL A 1 319 ? 16.763  4.396  50.025 1.00 30.73 ? 301  VAL A CA    1 
ATOM   2512 C  C     . VAL A 1 319 ? 17.232  5.348  48.882 1.00 30.17 ? 301  VAL A C     1 
ATOM   2513 O  O     . VAL A 1 319 ? 16.502  5.576  47.874 1.00 28.69 ? 301  VAL A O     1 
ATOM   2514 C  CB    . VAL A 1 319 ? 16.780  2.866  49.771 1.00 31.96 ? 301  VAL A CB    1 
ATOM   2515 C  CG1   . VAL A 1 319 ? 17.368  2.441  48.463 1.00 31.84 ? 301  VAL A CG1   1 
ATOM   2516 C  CG2   . VAL A 1 319 ? 17.333  2.145  51.023 1.00 32.78 ? 301  VAL A CG2   1 
ATOM   2517 N  N     . LEU A 1 320 ? 18.407  5.952  49.105 1.00 28.59 ? 302  LEU A N     1 
ATOM   2518 C  CA    . LEU A 1 320 ? 19.089  6.735  48.110 1.00 28.23 ? 302  LEU A CA    1 
ATOM   2519 C  C     . LEU A 1 320 ? 19.486  5.875  46.872 1.00 28.07 ? 302  LEU A C     1 
ATOM   2520 O  O     . LEU A 1 320 ? 20.257  4.931  46.992 1.00 28.09 ? 302  LEU A O     1 
ATOM   2521 C  CB    . LEU A 1 320 ? 20.305  7.454  48.698 1.00 27.34 ? 302  LEU A CB    1 
ATOM   2522 C  CG    . LEU A 1 320 ? 20.875  8.550  47.762 1.00 27.51 ? 302  LEU A CG    1 
ATOM   2523 C  CD1   . LEU A 1 320 ? 19.847  9.631  47.352 1.00 23.75 ? 302  LEU A CD1   1 
ATOM   2524 C  CD2   . LEU A 1 320 ? 22.176  9.212  48.285 1.00 27.70 ? 302  LEU A CD2   1 
ATOM   2525 N  N     . ARG A 1 321 ? 18.903  6.206  45.711 1.00 26.88 ? 303  ARG A N     1 
ATOM   2526 C  CA    . ARG A 1 321 ? 19.261  5.576  44.434 1.00 26.45 ? 303  ARG A CA    1 
ATOM   2527 C  C     . ARG A 1 321 ? 19.927  6.604  43.517 1.00 26.49 ? 303  ARG A C     1 
ATOM   2528 O  O     . ARG A 1 321 ? 19.829  7.822  43.740 1.00 24.59 ? 303  ARG A O     1 
ATOM   2529 C  CB    . ARG A 1 321 ? 18.027  5.058  43.711 1.00 25.87 ? 303  ARG A CB    1 
ATOM   2530 C  CG    . ARG A 1 321 ? 17.076  4.152  44.506 1.00 26.63 ? 303  ARG A CG    1 
ATOM   2531 C  CD    . ARG A 1 321 ? 17.796  2.843  44.859 1.00 27.31 ? 303  ARG A CD    1 
ATOM   2532 N  NE    . ARG A 1 321 ? 17.839  1.971  43.720 1.00 29.82 ? 303  ARG A NE    1 
ATOM   2533 C  CZ    . ARG A 1 321 ? 16.753  1.456  43.149 1.00 30.27 ? 303  ARG A CZ    1 
ATOM   2534 N  NH1   . ARG A 1 321 ? 15.537  1.728  43.645 1.00 30.56 ? 303  ARG A NH1   1 
ATOM   2535 N  NH2   . ARG A 1 321 ? 16.889  0.668  42.091 1.00 28.76 ? 303  ARG A NH2   1 
ATOM   2536 N  N     . GLN A 1 322 ? 20.567  6.087  42.477 1.00 27.30 ? 304  GLN A N     1 
ATOM   2537 C  CA    . GLN A 1 322 ? 21.234  6.872  41.473 1.00 28.49 ? 304  GLN A CA    1 
ATOM   2538 C  C     . GLN A 1 322 ? 20.513  6.675  40.133 1.00 29.49 ? 304  GLN A C     1 
ATOM   2539 O  O     . GLN A 1 322 ? 20.264  5.529  39.732 1.00 29.33 ? 304  GLN A O     1 
ATOM   2540 C  CB    . GLN A 1 322 ? 22.649  6.344  41.321 1.00 29.24 ? 304  GLN A CB    1 
ATOM   2541 C  CG    . GLN A 1 322 ? 23.451  7.159  40.375 1.00 32.71 ? 304  GLN A CG    1 
ATOM   2542 C  CD    . GLN A 1 322 ? 24.815  6.623  40.036 1.00 37.16 ? 304  GLN A CD    1 
ATOM   2543 O  OE1   . GLN A 1 322 ? 25.312  5.676  40.639 1.00 39.63 ? 304  GLN A OE1   1 
ATOM   2544 N  NE2   . GLN A 1 322 ? 25.442  7.252  39.032 1.00 37.44 ? 304  GLN A NE2   1 
ATOM   2545 N  N     . VAL A 1 323 ? 20.180  7.770  39.442 1.00 29.32 ? 305  VAL A N     1 
ATOM   2546 C  CA    . VAL A 1 323 ? 19.561  7.650  38.111 1.00 31.06 ? 305  VAL A CA    1 
ATOM   2547 C  C     . VAL A 1 323 ? 20.624  7.406  37.028 1.00 31.95 ? 305  VAL A C     1 
ATOM   2548 O  O     . VAL A 1 323 ? 21.667  8.068  36.960 1.00 30.62 ? 305  VAL A O     1 
ATOM   2549 C  CB    . VAL A 1 323 ? 18.790  8.929  37.727 1.00 30.81 ? 305  VAL A CB    1 
ATOM   2550 C  CG1   . VAL A 1 323 ? 18.392  8.922  36.268 1.00 30.37 ? 305  VAL A CG1   1 
ATOM   2551 C  CG2   . VAL A 1 323 ? 17.625  9.158  38.661 1.00 29.24 ? 305  VAL A CG2   1 
ATOM   2552 N  N     . ASP A 1 324 ? 20.337  6.449  36.175 1.00 34.49 ? 306  ASP A N     1 
ATOM   2553 C  CA    . ASP A 1 324 ? 21.037  6.335  34.898 1.00 37.16 ? 306  ASP A CA    1 
ATOM   2554 C  C     . ASP A 1 324 ? 20.457  7.345  33.880 1.00 37.62 ? 306  ASP A C     1 
ATOM   2555 O  O     . ASP A 1 324 ? 19.404  7.114  33.300 1.00 37.30 ? 306  ASP A O     1 
ATOM   2556 C  CB    . ASP A 1 324 ? 20.865  4.938  34.353 1.00 37.24 ? 306  ASP A CB    1 
ATOM   2557 C  CG    . ASP A 1 324 ? 21.837  4.655  33.211 1.00 43.32 ? 306  ASP A CG    1 
ATOM   2558 O  OD1   . ASP A 1 324 ? 21.907  5.545  32.307 1.00 45.23 ? 306  ASP A OD1   1 
ATOM   2559 O  OD2   . ASP A 1 324 ? 22.551  3.592  33.271 1.00 43.40 ? 306  ASP A OD2   1 
ATOM   2560 N  N     . THR A 1 325 ? 21.135  8.478  33.682 1.00 39.54 ? 307  THR A N     1 
ATOM   2561 C  CA    . THR A 1 325 ? 20.587  9.528  32.821 1.00 40.48 ? 307  THR A CA    1 
ATOM   2562 C  C     . THR A 1 325 ? 20.539  9.175  31.304 1.00 42.23 ? 307  THR A C     1 
ATOM   2563 O  O     . THR A 1 325 ? 19.658  9.693  30.605 1.00 42.28 ? 307  THR A O     1 
ATOM   2564 C  CB    . THR A 1 325 ? 21.203  10.894 33.101 1.00 40.34 ? 307  THR A CB    1 
ATOM   2565 O  OG1   . THR A 1 325 ? 22.593  10.846 32.834 1.00 43.22 ? 307  THR A OG1   1 
ATOM   2566 C  CG2   . THR A 1 325 ? 21.017  11.311 34.566 1.00 36.77 ? 307  THR A CG2   1 
ATOM   2567 N  N     . LYS A 1 326 ? 21.384  8.247  30.814 1.00 43.76 ? 308  LYS A N     1 
ATOM   2568 C  CA    . LYS A 1 326 ? 21.218  7.728  29.419 1.00 46.27 ? 308  LYS A CA    1 
ATOM   2569 C  C     . LYS A 1 326 ? 19.805  7.144  29.164 1.00 45.82 ? 308  LYS A C     1 
ATOM   2570 O  O     . LYS A 1 326 ? 19.188  7.420  28.127 1.00 45.98 ? 308  LYS A O     1 
ATOM   2571 C  CB    . LYS A 1 326 ? 22.233  6.634  29.046 1.00 47.06 ? 308  LYS A CB    1 
ATOM   2572 C  CG    . LYS A 1 326 ? 23.718  6.967  29.232 1.00 53.45 ? 308  LYS A CG    1 
ATOM   2573 C  CD    . LYS A 1 326 ? 24.607  6.394  28.075 1.00 57.81 ? 308  LYS A CD    1 
ATOM   2574 C  CE    . LYS A 1 326 ? 24.659  7.391  26.851 1.00 60.77 ? 308  LYS A CE    1 
ATOM   2575 N  NZ    . LYS A 1 326 ? 25.475  6.927  25.648 1.00 58.54 ? 308  LYS A NZ    1 
ATOM   2576 N  N     . THR A 1 327 ? 19.310  6.323  30.103 1.00 44.81 ? 309  THR A N     1 
ATOM   2577 C  CA    . THR A 1 327 ? 18.094  5.554  29.870 1.00 44.06 ? 309  THR A CA    1 
ATOM   2578 C  C     . THR A 1 327 ? 16.890  6.078  30.627 1.00 42.85 ? 309  THR A C     1 
ATOM   2579 O  O     . THR A 1 327 ? 15.763  5.770  30.248 1.00 42.94 ? 309  THR A O     1 
ATOM   2580 C  CB    . THR A 1 327 ? 18.264  4.115  30.266 1.00 44.05 ? 309  THR A CB    1 
ATOM   2581 O  OG1   . THR A 1 327 ? 18.416  4.064  31.685 1.00 46.44 ? 309  THR A OG1   1 
ATOM   2582 C  CG2   . THR A 1 327 ? 19.493  3.516  29.616 1.00 44.20 ? 309  THR A CG2   1 
ATOM   2583 N  N     . GLY A 1 328 ? 17.123  6.824  31.715 1.00 41.49 ? 310  GLY A N     1 
ATOM   2584 C  CA    . GLY A 1 328 ? 16.026  7.295  32.553 1.00 40.38 ? 310  GLY A CA    1 
ATOM   2585 C  C     . GLY A 1 328 ? 15.579  6.308  33.633 1.00 39.70 ? 310  GLY A C     1 
ATOM   2586 O  O     . GLY A 1 328 ? 14.627  6.576  34.388 1.00 40.96 ? 310  GLY A O     1 
ATOM   2587 N  N     . LYS A 1 329 ? 16.277  5.193  33.735 1.00 38.37 ? 311  LYS A N     1 
ATOM   2588 C  CA    . LYS A 1 329 ? 16.013  4.184  34.742 1.00 38.12 ? 311  LYS A CA    1 
ATOM   2589 C  C     . LYS A 1 329 ? 16.985  4.341  35.912 1.00 36.63 ? 311  LYS A C     1 
ATOM   2590 O  O     . LYS A 1 329 ? 18.080  4.850  35.744 1.00 36.75 ? 311  LYS A O     1 
ATOM   2591 C  CB    . LYS A 1 329 ? 16.242  2.796  34.130 1.00 38.04 ? 311  LYS A CB    1 
ATOM   2592 C  CG    . LYS A 1 329 ? 15.254  2.454  33.038 1.00 40.59 ? 311  LYS A CG    1 
ATOM   2593 C  CD    . LYS A 1 329 ? 15.709  1.213  32.283 1.00 45.00 ? 311  LYS A CD    1 
ATOM   2594 C  CE    . LYS A 1 329 ? 14.836  1.052  31.028 1.00 49.36 ? 311  LYS A CE    1 
ATOM   2595 N  NZ    . LYS A 1 329 ? 15.359  -0.043 30.167 1.00 50.73 ? 311  LYS A NZ    1 
ATOM   2596 N  N     . LEU A 1 330 ? 16.598  3.794  37.061 1.00 35.17 ? 312  LEU A N     1 
ATOM   2597 C  CA    . LEU A 1 330 ? 17.465  3.638  38.221 1.00 33.64 ? 312  LEU A CA    1 
ATOM   2598 C  C     . LEU A 1 330 ? 18.499  2.566  38.027 1.00 33.37 ? 312  LEU A C     1 
ATOM   2599 O  O     . LEU A 1 330 ? 18.214  1.556  37.434 1.00 34.51 ? 312  LEU A O     1 
ATOM   2600 C  CB    . LEU A 1 330 ? 16.626  3.340  39.461 1.00 32.74 ? 312  LEU A CB    1 
ATOM   2601 C  CG    . LEU A 1 330 ? 15.545  4.372  39.762 1.00 31.43 ? 312  LEU A CG    1 
ATOM   2602 C  CD1   . LEU A 1 330 ? 14.896  4.029  41.076 1.00 33.52 ? 312  LEU A CD1   1 
ATOM   2603 C  CD2   . LEU A 1 330 ? 16.082  5.819  39.753 1.00 25.14 ? 312  LEU A CD2   1 
ATOM   2604 N  N     . LYS A 1 331 ? 19.716  2.815  38.463 1.00 33.06 ? 313  LYS A N     1 
ATOM   2605 C  CA    . LYS A 1 331 ? 20.685  1.757  38.592 1.00 34.33 ? 313  LYS A CA    1 
ATOM   2606 C  C     . LYS A 1 331 ? 20.225  0.888  39.753 1.00 35.56 ? 313  LYS A C     1 
ATOM   2607 O  O     . LYS A 1 331 ? 19.476  1.357  40.672 1.00 36.56 ? 313  LYS A O     1 
ATOM   2608 C  CB    . LYS A 1 331 ? 22.066  2.304  38.890 1.00 33.01 ? 313  LYS A CB    1 
ATOM   2609 C  CG    . LYS A 1 331 ? 22.444  3.432  37.971 1.00 36.52 ? 313  LYS A CG    1 
ATOM   2610 C  CD    . LYS A 1 331 ? 23.914  3.534  37.882 1.00 41.15 ? 313  LYS A CD    1 
ATOM   2611 C  CE    . LYS A 1 331 ? 24.288  4.477  36.764 1.00 48.36 ? 313  LYS A CE    1 
ATOM   2612 N  NZ    . LYS A 1 331 ? 25.701  4.963  36.922 1.00 52.53 ? 313  LYS A NZ    1 
ATOM   2613 N  N     . ILE A 1 332 ? 20.669  -0.367 39.718 1.00 35.42 ? 314  ILE A N     1 
ATOM   2614 C  CA    . ILE A 1 332 ? 20.244  -1.356 40.664 1.00 35.47 ? 314  ILE A CA    1 
ATOM   2615 C  C     . ILE A 1 332 ? 21.089  -1.166 41.949 1.00 35.76 ? 314  ILE A C     1 
ATOM   2616 O  O     . ILE A 1 332 ? 22.318  -1.037 41.878 1.00 36.85 ? 314  ILE A O     1 
ATOM   2617 C  CB    . ILE A 1 332 ? 20.299  -2.792 40.039 1.00 36.16 ? 314  ILE A CB    1 
ATOM   2618 C  CG1   . ILE A 1 332 ? 19.440  -2.888 38.754 1.00 33.25 ? 314  ILE A CG1   1 
ATOM   2619 C  CG2   . ILE A 1 332 ? 19.824  -3.873 41.044 1.00 36.42 ? 314  ILE A CG2   1 
ATOM   2620 C  CD1   . ILE A 1 332 ? 17.983  -2.385 38.894 1.00 30.54 ? 314  ILE A CD1   1 
ATOM   2621 N  N     . GLY A 1 333 ? 20.400  -1.064 43.097 1.00 34.38 ? 315  GLY A N     1 
ATOM   2622 C  CA    . GLY A 1 333 ? 21.024  -0.967 44.387 1.00 34.05 ? 315  GLY A CA    1 
ATOM   2623 C  C     . GLY A 1 333 ? 21.022  0.436  44.962 1.00 33.79 ? 315  GLY A C     1 
ATOM   2624 O  O     . GLY A 1 333 ? 20.590  1.392  44.308 1.00 33.74 ? 315  GLY A O     1 
ATOM   2625 N  N     . THR A 1 334 ? 21.529  0.535  46.181 1.00 32.46 ? 316  THR A N     1 
ATOM   2626 C  CA    . THR A 1 334 ? 21.596  1.775  46.944 1.00 33.00 ? 316  THR A CA    1 
ATOM   2627 C  C     . THR A 1 334 ? 22.902  2.429  46.668 1.00 33.25 ? 316  THR A C     1 
ATOM   2628 O  O     . THR A 1 334 ? 23.961  1.776  46.737 1.00 31.82 ? 316  THR A O     1 
ATOM   2629 C  CB    . THR A 1 334 ? 21.534  1.527  48.488 1.00 32.06 ? 316  THR A CB    1 
ATOM   2630 O  OG1   . THR A 1 334 ? 20.285  0.925  48.808 1.00 34.73 ? 316  THR A OG1   1 
ATOM   2631 C  CG2   . THR A 1 334 ? 21.709  2.838  49.329 1.00 32.05 ? 316  THR A CG2   1 
ATOM   2632 N  N     . TYR A 1 335 ? 22.825  3.733  46.417 1.00 34.33 ? 317  TYR A N     1 
ATOM   2633 C  CA    . TYR A 1 335 ? 24.020  4.496  46.158 1.00 35.74 ? 317  TYR A CA    1 
ATOM   2634 C  C     . TYR A 1 335 ? 24.763  4.875  47.445 1.00 36.73 ? 317  TYR A C     1 
ATOM   2635 O  O     . TYR A 1 335 ? 24.201  5.485  48.358 1.00 35.66 ? 317  TYR A O     1 
ATOM   2636 C  CB    . TYR A 1 335 ? 23.715  5.713  45.291 1.00 36.56 ? 317  TYR A CB    1 
ATOM   2637 C  CG    . TYR A 1 335 ? 24.939  6.483  44.930 1.00 37.32 ? 317  TYR A CG    1 
ATOM   2638 C  CD1   . TYR A 1 335 ? 25.760  6.070  43.865 1.00 38.09 ? 317  TYR A CD1   1 
ATOM   2639 C  CD2   . TYR A 1 335 ? 25.278  7.630  45.633 1.00 35.17 ? 317  TYR A CD2   1 
ATOM   2640 C  CE1   . TYR A 1 335 ? 26.904  6.796  43.521 1.00 41.28 ? 317  TYR A CE1   1 
ATOM   2641 C  CE2   . TYR A 1 335 ? 26.426  8.364  45.313 1.00 40.08 ? 317  TYR A CE2   1 
ATOM   2642 C  CZ    . TYR A 1 335 ? 27.231  7.940  44.247 1.00 40.43 ? 317  TYR A CZ    1 
ATOM   2643 O  OH    . TYR A 1 335 ? 28.351  8.654  43.920 1.00 41.28 ? 317  TYR A OH    1 
ATOM   2644 N  N     . THR A 1 336 ? 26.046  4.516  47.477 1.00 37.70 ? 318  THR A N     1 
ATOM   2645 C  CA    . THR A 1 336 ? 26.880  4.611  48.699 1.00 40.31 ? 318  THR A CA    1 
ATOM   2646 C  C     . THR A 1 336 ? 28.035  5.620  48.488 1.00 41.89 ? 318  THR A C     1 
ATOM   2647 O  O     . THR A 1 336 ? 28.827  5.835  49.389 1.00 42.40 ? 318  THR A O     1 
ATOM   2648 C  CB    . THR A 1 336 ? 27.487  3.214  49.062 1.00 39.85 ? 318  THR A CB    1 
ATOM   2649 O  OG1   . THR A 1 336 ? 28.229  2.736  47.923 1.00 38.91 ? 318  THR A OG1   1 
ATOM   2650 C  CG2   . THR A 1 336 ? 26.343  2.139  49.423 1.00 39.43 ? 318  THR A CG2   1 
ATOM   2651 N  N     . GLY A 1 337 ? 28.142  6.180  47.271 1.00 43.43 ? 319  GLY A N     1 
ATOM   2652 C  CA    . GLY A 1 337 ? 29.219  7.116  46.896 1.00 44.19 ? 319  GLY A CA    1 
ATOM   2653 C  C     . GLY A 1 337 ? 29.037  8.559  47.366 1.00 45.04 ? 319  GLY A C     1 
ATOM   2654 O  O     . GLY A 1 337 ? 28.082  8.895  48.122 1.00 45.37 ? 319  GLY A O     1 
ATOM   2655 N  N     . PRO A 1 338 ? 29.974  9.438  46.962 1.00 45.50 ? 320  PRO A N     1 
ATOM   2656 C  CA    . PRO A 1 338 ? 29.886  10.818 47.419 1.00 44.73 ? 320  PRO A CA    1 
ATOM   2657 C  C     . PRO A 1 338 ? 29.126  11.621 46.374 1.00 44.41 ? 320  PRO A C     1 
ATOM   2658 O  O     . PRO A 1 338 ? 28.725  11.086 45.341 1.00 43.87 ? 320  PRO A O     1 
ATOM   2659 C  CB    . PRO A 1 338 ? 31.375  11.242 47.436 1.00 45.17 ? 320  PRO A CB    1 
ATOM   2660 C  CG    . PRO A 1 338 ? 31.924  10.590 46.146 1.00 44.72 ? 320  PRO A CG    1 
ATOM   2661 C  CD    . PRO A 1 338 ? 31.172  9.220  46.089 1.00 46.05 ? 320  PRO A CD    1 
ATOM   2662 N  N     . LEU A 1 339 ? 28.957  12.908 46.613 1.00 45.00 ? 321  LEU A N     1 
ATOM   2663 C  CA    . LEU A 1 339 ? 28.433  13.782 45.572 1.00 45.74 ? 321  LEU A CA    1 
ATOM   2664 C  C     . LEU A 1 339 ? 29.437  13.877 44.422 1.00 46.27 ? 321  LEU A C     1 
ATOM   2665 O  O     . LEU A 1 339 ? 30.591  14.225 44.648 1.00 45.98 ? 321  LEU A O     1 
ATOM   2666 C  CB    . LEU A 1 339 ? 28.151  15.168 46.170 1.00 45.65 ? 321  LEU A CB    1 
ATOM   2667 C  CG    . LEU A 1 339 ? 27.463  16.198 45.298 1.00 45.81 ? 321  LEU A CG    1 
ATOM   2668 C  CD1   . LEU A 1 339 ? 26.021  15.823 45.086 1.00 42.55 ? 321  LEU A CD1   1 
ATOM   2669 C  CD2   . LEU A 1 339 ? 27.598  17.540 46.005 1.00 47.91 ? 321  LEU A CD2   1 
ATOM   2670 N  N     . GLN A 1 340 ? 29.029  13.537 43.203 1.00 46.84 ? 322  GLN A N     1 
ATOM   2671 C  CA    . GLN A 1 340 ? 29.919  13.749 42.072 1.00 48.45 ? 322  GLN A CA    1 
ATOM   2672 C  C     . GLN A 1 340 ? 29.279  14.612 41.013 1.00 47.28 ? 322  GLN A C     1 
ATOM   2673 O  O     . GLN A 1 340 ? 28.062  14.652 40.894 1.00 46.53 ? 322  GLN A O     1 
ATOM   2674 C  CB    . GLN A 1 340 ? 30.373  12.452 41.398 1.00 48.58 ? 322  GLN A CB    1 
ATOM   2675 C  CG    . GLN A 1 340 ? 30.160  11.142 42.137 1.00 51.36 ? 322  GLN A CG    1 
ATOM   2676 C  CD    . GLN A 1 340 ? 30.392  9.919  41.188 1.00 52.58 ? 322  GLN A CD    1 
ATOM   2677 O  OE1   . GLN A 1 340 ? 31.116  10.027 40.172 1.00 54.87 ? 322  GLN A OE1   1 
ATOM   2678 N  NE2   . GLN A 1 340 ? 29.780  8.754  41.532 1.00 56.32 ? 322  GLN A NE2   1 
ATOM   2679 N  N     . HIS A 1 341 ? 30.113  15.257 40.202 1.00 47.26 ? 323  HIS A N     1 
ATOM   2680 C  CA    . HIS A 1 341 ? 29.586  16.108 39.143 1.00 47.41 ? 323  HIS A CA    1 
ATOM   2681 C  C     . HIS A 1 341 ? 28.680  15.317 38.195 1.00 45.23 ? 323  HIS A C     1 
ATOM   2682 O  O     . HIS A 1 341 ? 29.032  14.248 37.760 1.00 45.44 ? 323  HIS A O     1 
ATOM   2683 C  CB    . HIS A 1 341 ? 30.684  16.854 38.330 1.00 48.25 ? 323  HIS A CB    1 
ATOM   2684 C  CG    . HIS A 1 341 ? 30.096  17.639 37.192 1.00 52.94 ? 323  HIS A CG    1 
ATOM   2685 N  ND1   . HIS A 1 341 ? 29.492  18.873 37.375 1.00 54.83 ? 323  HIS A ND1   1 
ATOM   2686 C  CD2   . HIS A 1 341 ? 29.884  17.302 35.889 1.00 55.76 ? 323  HIS A CD2   1 
ATOM   2687 C  CE1   . HIS A 1 341 ? 28.980  19.282 36.223 1.00 56.89 ? 323  HIS A CE1   1 
ATOM   2688 N  NE2   . HIS A 1 341 ? 29.193  18.343 35.309 1.00 55.91 ? 323  HIS A NE2   1 
ATOM   2689 N  N     . GLY A 1 342 ? 27.507  15.831 37.884 1.00 43.85 ? 324  GLY A N     1 
ATOM   2690 C  CA    . GLY A 1 342 ? 26.697  15.174 36.866 1.00 42.04 ? 324  GLY A CA    1 
ATOM   2691 C  C     . GLY A 1 342 ? 25.848  13.975 37.274 1.00 40.77 ? 324  GLY A C     1 
ATOM   2692 O  O     . GLY A 1 342 ? 25.160  13.391 36.447 1.00 41.56 ? 324  GLY A O     1 
ATOM   2693 N  N     . ILE A 1 343 ? 25.892  13.596 38.540 1.00 39.35 ? 325  ILE A N     1 
ATOM   2694 C  CA    . ILE A 1 343 ? 25.081  12.480 39.047 1.00 37.10 ? 325  ILE A CA    1 
ATOM   2695 C  C     . ILE A 1 343 ? 23.642  12.925 39.397 1.00 34.95 ? 325  ILE A C     1 
ATOM   2696 O  O     . ILE A 1 343 ? 23.421  14.033 39.858 1.00 34.18 ? 325  ILE A O     1 
ATOM   2697 C  CB    . ILE A 1 343 ? 25.757  11.869 40.246 1.00 36.80 ? 325  ILE A CB    1 
ATOM   2698 C  CG1   . ILE A 1 343 ? 25.071  10.596 40.674 1.00 37.57 ? 325  ILE A CG1   1 
ATOM   2699 C  CG2   . ILE A 1 343 ? 25.724  12.834 41.399 1.00 39.49 ? 325  ILE A CG2   1 
ATOM   2700 C  CD1   . ILE A 1 343 ? 25.814  9.953  41.758 1.00 44.76 ? 325  ILE A CD1   1 
ATOM   2701 N  N     . VAL A 1 344 ? 22.651  12.070 39.143 1.00 32.46 ? 326  VAL A N     1 
ATOM   2702 C  CA    . VAL A 1 344 ? 21.292  12.427 39.492 1.00 30.09 ? 326  VAL A CA    1 
ATOM   2703 C  C     . VAL A 1 344 ? 20.764  11.366 40.476 1.00 29.78 ? 326  VAL A C     1 
ATOM   2704 O  O     . VAL A 1 344 ? 20.813  10.143 40.214 1.00 29.22 ? 326  VAL A O     1 
ATOM   2705 C  CB    . VAL A 1 344 ? 20.402  12.586 38.272 1.00 29.25 ? 326  VAL A CB    1 
ATOM   2706 C  CG1   . VAL A 1 344 ? 18.941  12.819 38.672 1.00 26.34 ? 326  VAL A CG1   1 
ATOM   2707 C  CG2   . VAL A 1 344 ? 20.911  13.709 37.443 1.00 29.25 ? 326  VAL A CG2   1 
ATOM   2708 N  N     . TYR A 1 345 ? 20.251  11.855 41.598 1.00 28.43 ? 327  TYR A N     1 
ATOM   2709 C  CA    . TYR A 1 345 ? 19.713  10.964 42.619 1.00 26.88 ? 327  TYR A CA    1 
ATOM   2710 C  C     . TYR A 1 345 ? 18.218  10.771 42.600 1.00 24.25 ? 327  TYR A C     1 
ATOM   2711 O  O     . TYR A 1 345 ? 17.439  11.634 42.176 1.00 23.06 ? 327  TYR A O     1 
ATOM   2712 C  CB    . TYR A 1 345 ? 19.994  11.538 43.960 1.00 28.11 ? 327  TYR A CB    1 
ATOM   2713 C  CG    . TYR A 1 345 ? 21.411  11.758 44.236 1.00 32.12 ? 327  TYR A CG    1 
ATOM   2714 C  CD1   . TYR A 1 345 ? 22.248  10.689 44.523 1.00 31.93 ? 327  TYR A CD1   1 
ATOM   2715 C  CD2   . TYR A 1 345 ? 21.923  13.029 44.259 1.00 35.64 ? 327  TYR A CD2   1 
ATOM   2716 C  CE1   . TYR A 1 345 ? 23.551  10.862 44.838 1.00 32.98 ? 327  TYR A CE1   1 
ATOM   2717 C  CE2   . TYR A 1 345 ? 23.280  13.236 44.564 1.00 40.97 ? 327  TYR A CE2   1 
ATOM   2718 C  CZ    . TYR A 1 345 ? 24.078  12.127 44.862 1.00 37.54 ? 327  TYR A CZ    1 
ATOM   2719 O  OH    . TYR A 1 345 ? 25.387  12.303 45.218 1.00 36.14 ? 327  TYR A OH    1 
ATOM   2720 N  N     . SER A 1 346 ? 17.823  9.670  43.209 1.00 22.35 ? 328  SER A N     1 
ATOM   2721 C  CA    . SER A 1 346 ? 16.445  9.378  43.387 1.00 22.85 ? 328  SER A CA    1 
ATOM   2722 C  C     . SER A 1 346 ? 16.171  8.869  44.810 1.00 23.43 ? 328  SER A C     1 
ATOM   2723 O  O     . SER A 1 346 ? 16.912  8.020  45.352 1.00 24.23 ? 328  SER A O     1 
ATOM   2724 C  CB    . SER A 1 346 ? 16.060  8.331  42.330 1.00 21.46 ? 328  SER A CB    1 
ATOM   2725 O  OG    . SER A 1 346 ? 14.765  7.834  42.526 1.00 23.37 ? 328  SER A OG    1 
ATOM   2726 N  N     . GLY A 1 347 ? 15.077  9.355  45.384 1.00 24.28 ? 329  GLY A N     1 
ATOM   2727 C  CA    . GLY A 1 347 ? 14.647  8.934  46.714 1.00 24.49 ? 329  GLY A CA    1 
ATOM   2728 C  C     . GLY A 1 347 ? 15.440  9.629  47.778 1.00 24.70 ? 329  GLY A C     1 
ATOM   2729 O  O     . GLY A 1 347 ? 15.554  10.869 47.769 1.00 25.51 ? 329  GLY A O     1 
ATOM   2730 N  N     . GLY A 1 348 ? 15.958  8.862  48.731 1.00 25.54 ? 330  GLY A N     1 
ATOM   2731 C  CA    . GLY A 1 348 ? 16.804  9.451  49.852 1.00 25.88 ? 330  GLY A CA    1 
ATOM   2732 C  C     . GLY A 1 348 ? 15.950  10.139 50.920 1.00 26.03 ? 330  GLY A C     1 
ATOM   2733 O  O     . GLY A 1 348 ? 14.748  9.906  51.018 1.00 25.58 ? 330  GLY A O     1 
ATOM   2734 N  N     . SER A 1 349 ? 16.560  11.026 51.688 1.00 27.63 ? 331  SER A N     1 
ATOM   2735 C  CA    . SER A 1 349 ? 15.863  11.744 52.749 1.00 28.49 ? 331  SER A CA    1 
ATOM   2736 C  C     . SER A 1 349 ? 16.439  13.138 52.778 1.00 28.72 ? 331  SER A C     1 
ATOM   2737 O  O     . SER A 1 349 ? 17.443  13.415 52.109 1.00 29.61 ? 331  SER A O     1 
ATOM   2738 C  CB    . SER A 1 349 ? 16.106  11.031 54.090 1.00 28.87 ? 331  SER A CB    1 
ATOM   2739 O  OG    . SER A 1 349 ? 17.397  11.380 54.574 1.00 31.94 ? 331  SER A OG    1 
ATOM   2740 N  N     . SER A 1 350 ? 15.818  14.041 53.523 1.00 29.19 ? 332  SER A N     1 
ATOM   2741 C  CA    . SER A 1 350 ? 16.381  15.401 53.643 1.00 31.05 ? 332  SER A CA    1 
ATOM   2742 C  C     . SER A 1 350 ? 17.781  15.418 54.206 1.00 31.27 ? 332  SER A C     1 
ATOM   2743 O  O     . SER A 1 350 ? 18.515  16.321 53.874 1.00 31.06 ? 332  SER A O     1 
ATOM   2744 C  CB    . SER A 1 350 ? 15.488  16.355 54.444 1.00 29.49 ? 332  SER A CB    1 
ATOM   2745 O  OG    . SER A 1 350 ? 15.185  15.730 55.680 1.00 33.34 ? 332  SER A OG    1 
ATOM   2746 N  N     . ASP A 1 351 ? 18.146  14.403 55.010 1.00 34.47 ? 333  ASP A N     1 
ATOM   2747 C  CA    . ASP A 1 351 ? 19.500  14.269 55.602 1.00 37.42 ? 333  ASP A CA    1 
ATOM   2748 C  C     . ASP A 1 351 ? 20.580  14.033 54.546 1.00 38.22 ? 333  ASP A C     1 
ATOM   2749 O  O     . ASP A 1 351 ? 21.722  14.412 54.721 1.00 38.67 ? 333  ASP A O     1 
ATOM   2750 C  CB    . ASP A 1 351 ? 19.551  13.146 56.664 1.00 38.29 ? 333  ASP A CB    1 
ATOM   2751 C  CG    . ASP A 1 351 ? 18.805  13.517 57.976 1.00 43.85 ? 333  ASP A CG    1 
ATOM   2752 O  OD1   . ASP A 1 351 ? 18.625  14.717 58.300 1.00 49.99 ? 333  ASP A OD1   1 
ATOM   2753 O  OD2   . ASP A 1 351 ? 18.371  12.602 58.705 1.00 51.36 ? 333  ASP A OD2   1 
ATOM   2754 N  N     . THR A 1 352 ? 20.199  13.398 53.448 1.00 39.06 ? 334  THR A N     1 
ATOM   2755 C  CA    . THR A 1 352 ? 21.072  13.192 52.321 1.00 40.65 ? 334  THR A CA    1 
ATOM   2756 C  C     . THR A 1 352 ? 21.532  14.541 51.758 1.00 40.63 ? 334  THR A C     1 
ATOM   2757 O  O     . THR A 1 352 ? 22.736  14.757 51.496 1.00 41.99 ? 334  THR A O     1 
ATOM   2758 C  CB    . THR A 1 352 ? 20.306  12.345 51.237 1.00 41.82 ? 334  THR A CB    1 
ATOM   2759 O  OG1   . THR A 1 352 ? 20.307  10.957 51.643 1.00 45.31 ? 334  THR A OG1   1 
ATOM   2760 C  CG2   . THR A 1 352 ? 20.945  12.528 49.828 1.00 42.27 ? 334  THR A CG2   1 
ATOM   2761 N  N     . ILE A 1 353 ? 20.593  15.460 51.591 1.00 39.44 ? 335  ILE A N     1 
ATOM   2762 C  CA    . ILE A 1 353 ? 20.915  16.810 51.155 1.00 39.79 ? 335  ILE A CA    1 
ATOM   2763 C  C     . ILE A 1 353 ? 21.821  17.599 52.107 1.00 39.63 ? 335  ILE A C     1 
ATOM   2764 O  O     . ILE A 1 353 ? 22.809  18.204 51.692 1.00 38.78 ? 335  ILE A O     1 
ATOM   2765 C  CB    . ILE A 1 353 ? 19.617  17.614 50.817 1.00 40.26 ? 335  ILE A CB    1 
ATOM   2766 C  CG1   . ILE A 1 353 ? 19.010  17.026 49.532 1.00 39.33 ? 335  ILE A CG1   1 
ATOM   2767 C  CG2   . ILE A 1 353 ? 19.942  19.113 50.795 1.00 40.24 ? 335  ILE A CG2   1 
ATOM   2768 C  CD1   . ILE A 1 353 ? 17.632  17.443 49.128 1.00 39.90 ? 335  ILE A CD1   1 
ATOM   2769 N  N     . CYS A 1 354 ? 21.497  17.583 53.388 1.00 40.58 ? 336  CYS A N     1 
ATOM   2770 C  CA    . CYS A 1 354 ? 22.359  18.210 54.379 1.00 42.15 ? 336  CYS A CA    1 
ATOM   2771 C  C     . CYS A 1 354 ? 23.743  17.636 54.396 1.00 42.12 ? 336  CYS A C     1 
ATOM   2772 O  O     . CYS A 1 354 ? 24.703  18.403 54.478 1.00 43.25 ? 336  CYS A O     1 
ATOM   2773 C  CB    . CYS A 1 354 ? 21.763  18.092 55.767 1.00 43.02 ? 336  CYS A CB    1 
ATOM   2774 S  SG    . CYS A 1 354 ? 20.261  18.973 55.823 1.00 46.29 ? 336  CYS A SG    1 
ATOM   2775 N  N     . ASP A 1 355 ? 23.856  16.312 54.336 1.00 41.35 ? 337  ASP A N     1 
ATOM   2776 C  CA    . ASP A 1 355 ? 25.162  15.675 54.375 1.00 42.33 ? 337  ASP A CA    1 
ATOM   2777 C  C     . ASP A 1 355 ? 25.977  15.932 53.089 1.00 41.92 ? 337  ASP A C     1 
ATOM   2778 O  O     . ASP A 1 355 ? 27.116  16.367 53.177 1.00 42.83 ? 337  ASP A O     1 
ATOM   2779 C  CB    . ASP A 1 355 ? 25.034  14.173 54.682 1.00 43.25 ? 337  ASP A CB    1 
ATOM   2780 C  CG    . ASP A 1 355 ? 24.476  13.884 56.146 1.00 48.50 ? 337  ASP A CG    1 
ATOM   2781 O  OD1   . ASP A 1 355 ? 24.524  14.783 57.070 1.00 52.63 ? 337  ASP A OD1   1 
ATOM   2782 O  OD2   . ASP A 1 355 ? 23.999  12.726 56.366 1.00 53.00 ? 337  ASP A OD2   1 
ATOM   2783 N  N     . LEU A 1 356 ? 25.390  15.709 51.908 1.00 40.34 ? 338  LEU A N     1 
ATOM   2784 C  CA    . LEU A 1 356 ? 26.108  15.926 50.621 1.00 38.70 ? 338  LEU A CA    1 
ATOM   2785 C  C     . LEU A 1 356 ? 26.426  17.377 50.307 1.00 37.93 ? 338  LEU A C     1 
ATOM   2786 O  O     . LEU A 1 356 ? 27.463  17.661 49.678 1.00 38.19 ? 338  LEU A O     1 
ATOM   2787 C  CB    . LEU A 1 356 ? 25.391  15.279 49.451 1.00 38.15 ? 338  LEU A CB    1 
ATOM   2788 C  CG    . LEU A 1 356 ? 25.135  13.777 49.619 1.00 38.11 ? 338  LEU A CG    1 
ATOM   2789 C  CD1   . LEU A 1 356 ? 24.225  13.308 48.498 1.00 35.34 ? 338  LEU A CD1   1 
ATOM   2790 C  CD2   . LEU A 1 356 ? 26.470  12.977 49.683 1.00 36.75 ? 338  LEU A CD2   1 
ATOM   2791 N  N     . LEU A 1 357 ? 25.603  18.298 50.791 1.00 36.60 ? 339  LEU A N     1 
ATOM   2792 C  CA    . LEU A 1 357 ? 25.903  19.700 50.608 1.00 36.14 ? 339  LEU A CA    1 
ATOM   2793 C  C     . LEU A 1 357 ? 26.582  20.340 51.802 1.00 36.79 ? 339  LEU A C     1 
ATOM   2794 O  O     . LEU A 1 357 ? 26.826  21.527 51.765 1.00 37.96 ? 339  LEU A O     1 
ATOM   2795 C  CB    . LEU A 1 357 ? 24.639  20.505 50.248 1.00 35.58 ? 339  LEU A CB    1 
ATOM   2796 C  CG    . LEU A 1 357 ? 23.942  20.166 48.940 1.00 35.65 ? 339  LEU A CG    1 
ATOM   2797 C  CD1   . LEU A 1 357 ? 22.857  21.134 48.760 1.00 34.58 ? 339  LEU A CD1   1 
ATOM   2798 C  CD2   . LEU A 1 357 ? 24.885  20.232 47.737 1.00 35.08 ? 339  LEU A CD2   1 
ATOM   2799 N  N     . GLY A 1 358 ? 26.864  19.589 52.870 1.00 37.88 ? 340  GLY A N     1 
ATOM   2800 C  CA    . GLY A 1 358 ? 27.466  20.166 54.070 1.00 37.72 ? 340  GLY A CA    1 
ATOM   2801 C  C     . GLY A 1 358 ? 26.654  21.253 54.710 1.00 38.95 ? 340  GLY A C     1 
ATOM   2802 O  O     . GLY A 1 358 ? 27.227  22.226 55.161 1.00 40.08 ? 340  GLY A O     1 
ATOM   2803 N  N     . ALA A 1 359 ? 25.318  21.148 54.721 1.00 38.66 ? 341  ALA A N     1 
ATOM   2804 C  CA    . ALA A 1 359 ? 24.488  22.187 55.369 1.00 38.93 ? 341  ALA A CA    1 
ATOM   2805 C  C     . ALA A 1 359 ? 23.771  21.750 56.676 1.00 39.74 ? 341  ALA A C     1 
ATOM   2806 O  O     . ALA A 1 359 ? 23.527  20.560 56.942 1.00 41.04 ? 341  ALA A O     1 
ATOM   2807 C  CB    . ALA A 1 359 ? 23.469  22.779 54.387 1.00 38.02 ? 341  ALA A CB    1 
ATOM   2808 N  N     . LYS A 1 360 ? 23.458  22.735 57.500 1.00 40.06 ? 342  LYS A N     1 
ATOM   2809 C  CA    . LYS A 1 360 ? 22.581  22.559 58.652 1.00 40.07 ? 342  LYS A CA    1 
ATOM   2810 C  C     . LYS A 1 360 ? 21.259  23.100 58.134 1.00 38.54 ? 342  LYS A C     1 
ATOM   2811 O  O     . LYS A 1 360 ? 21.265  23.979 57.244 1.00 40.03 ? 342  LYS A O     1 
ATOM   2812 C  CB    . LYS A 1 360 ? 23.068  23.468 59.790 1.00 40.41 ? 342  LYS A CB    1 
ATOM   2813 C  CG    . LYS A 1 360 ? 24.091  22.865 60.745 1.00 45.85 ? 342  LYS A CG    1 
ATOM   2814 C  CD    . LYS A 1 360 ? 25.390  22.405 60.102 1.00 54.21 ? 342  LYS A CD    1 
ATOM   2815 C  CE    . LYS A 1 360 ? 25.758  20.921 60.476 1.00 57.50 ? 342  LYS A CE    1 
ATOM   2816 N  NZ    . LYS A 1 360 ? 26.612  20.293 59.366 1.00 61.23 ? 342  LYS A NZ    1 
ATOM   2817 N  N     . GLY A 1 361 ? 20.148  22.653 58.707 1.00 35.88 ? 343  GLY A N     1 
ATOM   2818 C  CA    . GLY A 1 361 ? 18.831  23.153 58.351 1.00 32.90 ? 343  GLY A CA    1 
ATOM   2819 C  C     . GLY A 1 361 ? 18.665  24.633 58.148 1.00 32.40 ? 343  GLY A C     1 
ATOM   2820 O  O     . GLY A 1 361 ? 18.047  25.061 57.195 1.00 31.73 ? 343  GLY A O     1 
ATOM   2821 N  N     . LYS A 1 362 ? 19.210  25.446 59.037 1.00 32.51 ? 344  LYS A N     1 
ATOM   2822 C  CA    . LYS A 1 362 ? 18.960  26.873 59.007 1.00 32.76 ? 344  LYS A CA    1 
ATOM   2823 C  C     . LYS A 1 362 ? 19.765  27.661 57.947 1.00 32.87 ? 344  LYS A C     1 
ATOM   2824 O  O     . LYS A 1 362 ? 19.561  28.880 57.761 1.00 32.77 ? 344  LYS A O     1 
ATOM   2825 C  CB    . LYS A 1 362 ? 19.197  27.441 60.403 1.00 33.59 ? 344  LYS A CB    1 
ATOM   2826 C  CG    . LYS A 1 362 ? 17.986  27.341 61.331 1.00 35.54 ? 344  LYS A CG    1 
ATOM   2827 C  CD    . LYS A 1 362 ? 18.426  27.488 62.818 1.00 37.48 ? 344  LYS A CD    1 
ATOM   2828 C  CE    . LYS A 1 362 ? 17.290  27.054 63.751 1.00 36.47 ? 344  LYS A CE    1 
ATOM   2829 N  NZ    . LYS A 1 362 ? 17.747  26.896 65.143 1.00 31.69 ? 344  LYS A NZ    1 
ATOM   2830 N  N     . ASP A 1 363 ? 20.716  26.950 57.328 1.00 33.22 ? 345  ASP A N     1 
ATOM   2831 C  CA    . ASP A 1 363 ? 21.536  27.389 56.217 1.00 33.41 ? 345  ASP A CA    1 
ATOM   2832 C  C     . ASP A 1 363 ? 20.749  27.200 54.914 1.00 31.96 ? 345  ASP A C     1 
ATOM   2833 O  O     . ASP A 1 363 ? 21.261  27.560 53.872 1.00 32.32 ? 345  ASP A O     1 
ATOM   2834 C  CB    . ASP A 1 363 ? 22.686  26.393 56.019 1.00 33.83 ? 345  ASP A CB    1 
ATOM   2835 C  CG    . ASP A 1 363 ? 23.725  26.425 57.126 1.00 40.33 ? 345  ASP A CG    1 
ATOM   2836 O  OD1   . ASP A 1 363 ? 24.004  27.529 57.708 1.00 42.91 ? 345  ASP A OD1   1 
ATOM   2837 O  OD2   . ASP A 1 363 ? 24.283  25.306 57.388 1.00 44.28 ? 345  ASP A OD2   1 
ATOM   2838 N  N     . ILE A 1 364 ? 19.598  26.530 54.966 1.00 29.39 ? 346  ILE A N     1 
ATOM   2839 C  CA    . ILE A 1 364 ? 18.872  26.075 53.765 1.00 27.03 ? 346  ILE A CA    1 
ATOM   2840 C  C     . ILE A 1 364 ? 17.643  26.924 53.618 1.00 27.07 ? 346  ILE A C     1 
ATOM   2841 O  O     . ILE A 1 364 ? 16.869  27.067 54.583 1.00 27.16 ? 346  ILE A O     1 
ATOM   2842 C  CB    . ILE A 1 364 ? 18.490  24.582 53.866 1.00 26.95 ? 346  ILE A CB    1 
ATOM   2843 C  CG1   . ILE A 1 364 ? 19.751  23.706 53.897 1.00 25.15 ? 346  ILE A CG1   1 
ATOM   2844 C  CG2   . ILE A 1 364 ? 17.547  24.166 52.784 1.00 24.95 ? 346  ILE A CG2   1 
ATOM   2845 C  CD1   . ILE A 1 364 ? 19.518  22.181 54.300 1.00 23.92 ? 346  ILE A CD1   1 
ATOM   2846 N  N     . LEU A 1 365 ? 17.472  27.545 52.449 1.00 25.39 ? 347  LEU A N     1 
ATOM   2847 C  CA    . LEU A 1 365 ? 16.167  28.116 52.101 1.00 24.79 ? 347  LEU A CA    1 
ATOM   2848 C  C     . LEU A 1 365 ? 15.541  27.186 51.072 1.00 26.04 ? 347  LEU A C     1 
ATOM   2849 O  O     . LEU A 1 365 ? 16.067  27.055 49.958 1.00 25.99 ? 347  LEU A O     1 
ATOM   2850 C  CB    . LEU A 1 365 ? 16.272  29.532 51.536 1.00 24.66 ? 347  LEU A CB    1 
ATOM   2851 C  CG    . LEU A 1 365 ? 14.934  30.199 51.141 1.00 25.28 ? 347  LEU A CG    1 
ATOM   2852 C  CD1   . LEU A 1 365 ? 14.022  30.279 52.331 1.00 24.32 ? 347  LEU A CD1   1 
ATOM   2853 C  CD2   . LEU A 1 365 ? 15.208  31.587 50.580 1.00 24.67 ? 347  LEU A CD2   1 
ATOM   2854 N  N     . TYR A 1 366 ? 14.448  26.523 51.476 1.00 25.52 ? 348  TYR A N     1 
ATOM   2855 C  CA    . TYR A 1 366 ? 13.665  25.661 50.625 1.00 25.14 ? 348  TYR A CA    1 
ATOM   2856 C  C     . TYR A 1 366 ? 12.387  26.373 50.096 1.00 24.64 ? 348  TYR A C     1 
ATOM   2857 O  O     . TYR A 1 366 ? 11.567  26.900 50.877 1.00 23.25 ? 348  TYR A O     1 
ATOM   2858 C  CB    . TYR A 1 366 ? 13.370  24.333 51.302 1.00 24.91 ? 348  TYR A CB    1 
ATOM   2859 C  CG    . TYR A 1 366 ? 12.691  23.365 50.387 1.00 25.85 ? 348  TYR A CG    1 
ATOM   2860 C  CD1   . TYR A 1 366 ? 13.324  22.895 49.230 1.00 23.64 ? 348  TYR A CD1   1 
ATOM   2861 C  CD2   . TYR A 1 366 ? 11.391  22.920 50.674 1.00 24.32 ? 348  TYR A CD2   1 
ATOM   2862 C  CE1   . TYR A 1 366 ? 12.664  22.011 48.378 1.00 26.72 ? 348  TYR A CE1   1 
ATOM   2863 C  CE2   . TYR A 1 366 ? 10.718  22.079 49.835 1.00 27.33 ? 348  TYR A CE2   1 
ATOM   2864 C  CZ    . TYR A 1 366 ? 11.345  21.630 48.683 1.00 29.03 ? 348  TYR A CZ    1 
ATOM   2865 O  OH    . TYR A 1 366 ? 10.638  20.757 47.868 1.00 31.30 ? 348  TYR A OH    1 
ATOM   2866 N  N     . ILE A 1 367 ? 12.304  26.431 48.749 1.00 24.51 ? 349  ILE A N     1 
ATOM   2867 C  CA    . ILE A 1 367 ? 11.254  27.169 47.969 1.00 23.38 ? 349  ILE A CA    1 
ATOM   2868 C  C     . ILE A 1 367 ? 10.278  26.136 47.373 1.00 22.23 ? 349  ILE A C     1 
ATOM   2869 O  O     . ILE A 1 367 ? 10.705  25.285 46.598 1.00 23.04 ? 349  ILE A O     1 
ATOM   2870 C  CB    . ILE A 1 367 ? 11.908  28.016 46.863 1.00 24.53 ? 349  ILE A CB    1 
ATOM   2871 C  CG1   . ILE A 1 367 ? 12.971  28.923 47.503 1.00 23.81 ? 349  ILE A CG1   1 
ATOM   2872 C  CG2   . ILE A 1 367 ? 10.813  28.858 46.126 1.00 21.81 ? 349  ILE A CG2   1 
ATOM   2873 C  CD1   . ILE A 1 367 ? 14.120  29.295 46.664 1.00 25.33 ? 349  ILE A CD1   1 
ATOM   2874 N  N     . GLY A 1 368 ? 9.009   26.145 47.771 1.00 20.92 ? 350  GLY A N     1 
ATOM   2875 C  CA    . GLY A 1 368 ? 8.069   25.092 47.349 1.00 20.56 ? 350  GLY A CA    1 
ATOM   2876 C  C     . GLY A 1 368 ? 6.671   25.680 47.308 1.00 22.00 ? 350  GLY A C     1 
ATOM   2877 O  O     . GLY A 1 368 ? 6.489   26.800 47.727 1.00 22.60 ? 350  GLY A O     1 
ATOM   2878 N  N     . ASP A 1 369 ? 5.688   24.940 46.793 1.00 22.41 ? 351  ASP A N     1 
ATOM   2879 C  CA    . ASP A 1 369 ? 4.312   25.420 46.636 1.00 23.07 ? 351  ASP A CA    1 
ATOM   2880 C  C     . ASP A 1 369 ? 3.374   24.607 47.545 1.00 24.38 ? 351  ASP A C     1 
ATOM   2881 O  O     . ASP A 1 369 ? 2.227   24.932 47.669 1.00 23.17 ? 351  ASP A O     1 
ATOM   2882 C  CB    . ASP A 1 369 ? 3.814   25.171 45.193 1.00 22.66 ? 351  ASP A CB    1 
ATOM   2883 C  CG    . ASP A 1 369 ? 3.879   23.660 44.791 1.00 24.21 ? 351  ASP A CG    1 
ATOM   2884 O  OD1   . ASP A 1 369 ? 4.996   23.068 44.689 1.00 21.44 ? 351  ASP A OD1   1 
ATOM   2885 O  OD2   . ASP A 1 369 ? 2.803   23.036 44.589 1.00 26.18 ? 351  ASP A OD2   1 
ATOM   2886 N  N     . HIS A 1 370 ? 3.869   23.511 48.120 1.00 25.63 ? 352  HIS A N     1 
ATOM   2887 C  CA    . HIS A 1 370 ? 3.005   22.605 48.886 1.00 27.32 ? 352  HIS A CA    1 
ATOM   2888 C  C     . HIS A 1 370 ? 3.151   22.916 50.378 1.00 27.09 ? 352  HIS A C     1 
ATOM   2889 O  O     . HIS A 1 370 ? 4.197   22.707 50.974 1.00 26.60 ? 352  HIS A O     1 
ATOM   2890 C  CB    . HIS A 1 370 ? 3.335   21.114 48.582 1.00 27.87 ? 352  HIS A CB    1 
ATOM   2891 C  CG    . HIS A 1 370 ? 2.292   20.172 49.091 1.00 27.80 ? 352  HIS A CG    1 
ATOM   2892 N  ND1   . HIS A 1 370 ? 2.011   18.974 48.483 1.00 29.08 ? 352  HIS A ND1   1 
ATOM   2893 C  CD2   . HIS A 1 370 ? 1.381   20.307 50.085 1.00 28.64 ? 352  HIS A CD2   1 
ATOM   2894 C  CE1   . HIS A 1 370 ? 1.027   18.367 49.131 1.00 29.30 ? 352  HIS A CE1   1 
ATOM   2895 N  NE2   . HIS A 1 370 ? 0.613   19.169 50.099 1.00 30.73 ? 352  HIS A NE2   1 
ATOM   2896 N  N     . ILE A 1 371 ? 2.078   23.435 50.950 1.00 28.18 ? 353  ILE A N     1 
ATOM   2897 C  CA    . ILE A 1 371 ? 2.044   23.926 52.281 1.00 28.78 ? 353  ILE A CA    1 
ATOM   2898 C  C     . ILE A 1 371 ? 2.392   22.859 53.313 1.00 30.41 ? 353  ILE A C     1 
ATOM   2899 O  O     . ILE A 1 371 ? 3.033   23.148 54.335 1.00 30.23 ? 353  ILE A O     1 
ATOM   2900 C  CB    . ILE A 1 371 ? 0.719   24.640 52.546 1.00 28.77 ? 353  ILE A CB    1 
ATOM   2901 C  CG1   . ILE A 1 371 ? 0.796   25.507 53.791 1.00 30.04 ? 353  ILE A CG1   1 
ATOM   2902 C  CG2   . ILE A 1 371 ? -0.498  23.652 52.523 1.00 30.44 ? 353  ILE A CG2   1 
ATOM   2903 C  CD1   . ILE A 1 371 ? 1.858   26.486 53.777 1.00 32.49 ? 353  ILE A CD1   1 
ATOM   2904 N  N     . PHE A 1 372 ? 2.020   21.629 53.003 1.00 30.13 ? 354  PHE A N     1 
ATOM   2905 C  CA    . PHE A 1 372 ? 2.240   20.539 53.858 1.00 31.31 ? 354  PHE A CA    1 
ATOM   2906 C  C     . PHE A 1 372 ? 3.561   19.871 53.481 1.00 32.43 ? 354  PHE A C     1 
ATOM   2907 O  O     . PHE A 1 372 ? 4.535   19.900 54.283 1.00 32.85 ? 354  PHE A O     1 
ATOM   2908 C  CB    . PHE A 1 372 ? 1.061   19.555 53.798 1.00 32.01 ? 354  PHE A CB    1 
ATOM   2909 C  CG    . PHE A 1 372 ? 1.163   18.438 54.798 1.00 35.07 ? 354  PHE A CG    1 
ATOM   2910 C  CD1   . PHE A 1 372 ? 0.855   18.659 56.159 1.00 39.69 ? 354  PHE A CD1   1 
ATOM   2911 C  CD2   . PHE A 1 372 ? 1.576   17.166 54.405 1.00 40.05 ? 354  PHE A CD2   1 
ATOM   2912 C  CE1   . PHE A 1 372 ? 0.987   17.636 57.109 1.00 38.96 ? 354  PHE A CE1   1 
ATOM   2913 C  CE2   . PHE A 1 372 ? 1.732   16.131 55.341 1.00 39.48 ? 354  PHE A CE2   1 
ATOM   2914 C  CZ    . PHE A 1 372 ? 1.444   16.371 56.709 1.00 38.19 ? 354  PHE A CZ    1 
ATOM   2915 N  N     . GLY A 1 373 ? 3.591   19.280 52.274 1.00 31.38 ? 355  GLY A N     1 
ATOM   2916 C  CA    . GLY A 1 373 ? 4.683   18.443 51.802 1.00 30.96 ? 355  GLY A CA    1 
ATOM   2917 C  C     . GLY A 1 373 ? 5.986   19.160 51.634 1.00 31.69 ? 355  GLY A C     1 
ATOM   2918 O  O     . GLY A 1 373 ? 7.045   18.565 51.845 1.00 34.06 ? 355  GLY A O     1 
ATOM   2919 N  N     . ASP A 1 374 ? 5.944   20.446 51.323 1.00 30.38 ? 356  ASP A N     1 
ATOM   2920 C  CA    . ASP A 1 374 ? 7.195   21.173 51.169 1.00 30.27 ? 356  ASP A CA    1 
ATOM   2921 C  C     . ASP A 1 374 ? 7.533   21.999 52.425 1.00 29.65 ? 356  ASP A C     1 
ATOM   2922 O  O     . ASP A 1 374 ? 8.701   22.046 52.867 1.00 31.42 ? 356  ASP A O     1 
ATOM   2923 C  CB    . ASP A 1 374 ? 7.203   22.143 49.926 1.00 28.86 ? 356  ASP A CB    1 
ATOM   2924 C  CG    . ASP A 1 374 ? 7.103   21.421 48.569 1.00 28.93 ? 356  ASP A CG    1 
ATOM   2925 O  OD1   . ASP A 1 374 ? 7.733   20.387 48.379 1.00 28.26 ? 356  ASP A OD1   1 
ATOM   2926 O  OD2   . ASP A 1 374 ? 6.404   21.913 47.654 1.00 29.26 ? 356  ASP A OD2   1 
ATOM   2927 N  N     . ILE A 1 375 ? 6.561   22.746 52.910 1.00 27.97 ? 357  ILE A N     1 
ATOM   2928 C  CA    . ILE A 1 375 ? 6.825   23.861 53.814 1.00 27.00 ? 357  ILE A CA    1 
ATOM   2929 C  C     . ILE A 1 375 ? 6.741   23.425 55.301 1.00 27.33 ? 357  ILE A C     1 
ATOM   2930 O  O     . ILE A 1 375 ? 7.773   23.440 56.007 1.00 25.28 ? 357  ILE A O     1 
ATOM   2931 C  CB    . ILE A 1 375 ? 5.928   25.086 53.475 1.00 26.52 ? 357  ILE A CB    1 
ATOM   2932 C  CG1   . ILE A 1 375 ? 6.267   25.637 52.063 1.00 28.02 ? 357  ILE A CG1   1 
ATOM   2933 C  CG2   . ILE A 1 375 ? 6.118   26.155 54.454 1.00 24.73 ? 357  ILE A CG2   1 
ATOM   2934 C  CD1   . ILE A 1 375 ? 7.760   25.896 51.791 1.00 25.35 ? 357  ILE A CD1   1 
ATOM   2935 N  N     . LEU A 1 376 ? 5.541   23.002 55.739 1.00 26.85 ? 358  LEU A N     1 
ATOM   2936 C  CA    . LEU A 1 376 ? 5.298   22.485 57.097 1.00 27.09 ? 358  LEU A CA    1 
ATOM   2937 C  C     . LEU A 1 376 ? 6.302   21.419 57.576 1.00 26.43 ? 358  LEU A C     1 
ATOM   2938 O  O     . LEU A 1 376 ? 6.899   21.529 58.633 1.00 26.53 ? 358  LEU A O     1 
ATOM   2939 C  CB    . LEU A 1 376 ? 3.887   21.909 57.203 1.00 27.15 ? 358  LEU A CB    1 
ATOM   2940 C  CG    . LEU A 1 376 ? 3.412   21.556 58.603 1.00 28.82 ? 358  LEU A CG    1 
ATOM   2941 C  CD1   . LEU A 1 376 ? 1.916   21.820 58.709 1.00 29.82 ? 358  LEU A CD1   1 
ATOM   2942 C  CD2   . LEU A 1 376 ? 3.716   20.081 58.876 1.00 26.95 ? 358  LEU A CD2   1 
ATOM   2943 N  N     . LYS A 1 377 ? 6.467   20.390 56.795 1.00 26.07 ? 359  LYS A N     1 
ATOM   2944 C  CA    . LYS A 1 377 ? 7.348   19.302 57.162 1.00 26.33 ? 359  LYS A CA    1 
ATOM   2945 C  C     . LYS A 1 377 ? 8.835   19.647 57.136 1.00 25.30 ? 359  LYS A C     1 
ATOM   2946 O  O     . LYS A 1 377 ? 9.584   19.166 57.956 1.00 26.05 ? 359  LYS A O     1 
ATOM   2947 C  CB    . LYS A 1 377 ? 7.061   18.118 56.240 1.00 27.25 ? 359  LYS A CB    1 
ATOM   2948 C  CG    . LYS A 1 377 ? 5.761   17.387 56.582 1.00 32.73 ? 359  LYS A CG    1 
ATOM   2949 C  CD    . LYS A 1 377 ? 6.009   16.487 57.788 1.00 39.57 ? 359  LYS A CD    1 
ATOM   2950 C  CE    . LYS A 1 377 ? 4.670   15.903 58.285 1.00 46.40 ? 359  LYS A CE    1 
ATOM   2951 N  NZ    . LYS A 1 377 ? 4.851   15.335 59.675 1.00 48.57 ? 359  LYS A NZ    1 
ATOM   2952 N  N     . SER A 1 378 ? 9.302   20.433 56.188 1.00 23.20 ? 360  SER A N     1 
ATOM   2953 C  CA    . SER A 1 378 ? 10.742  20.798 56.243 1.00 23.17 ? 360  SER A CA    1 
ATOM   2954 C  C     . SER A 1 378 ? 10.951  21.714 57.472 1.00 23.46 ? 360  SER A C     1 
ATOM   2955 O  O     . SER A 1 378 ? 12.005  21.667 58.137 1.00 23.04 ? 360  SER A O     1 
ATOM   2956 C  CB    . SER A 1 378 ? 11.215  21.496 54.972 1.00 20.60 ? 360  SER A CB    1 
ATOM   2957 O  OG    . SER A 1 378 ? 10.545  22.748 54.813 1.00 21.22 ? 360  SER A OG    1 
ATOM   2958 N  N     . LYS A 1 379 ? 9.973   22.572 57.758 1.00 23.75 ? 361  LYS A N     1 
ATOM   2959 C  CA    . LYS A 1 379 ? 10.109  23.473 58.914 1.00 25.61 ? 361  LYS A CA    1 
ATOM   2960 C  C     . LYS A 1 379 ? 10.056  22.632 60.213 1.00 26.06 ? 361  LYS A C     1 
ATOM   2961 O  O     . LYS A 1 379 ? 10.991  22.684 60.975 1.00 25.24 ? 361  LYS A O     1 
ATOM   2962 C  CB    . LYS A 1 379 ? 9.032   24.540 58.935 1.00 26.33 ? 361  LYS A CB    1 
ATOM   2963 C  CG    . LYS A 1 379 ? 9.119   25.488 60.105 1.00 28.60 ? 361  LYS A CG    1 
ATOM   2964 C  CD    . LYS A 1 379 ? 10.456  26.161 60.002 1.00 28.78 ? 361  LYS A CD    1 
ATOM   2965 C  CE    . LYS A 1 379 ? 10.413  27.556 59.490 1.00 28.57 ? 361  LYS A CE    1 
ATOM   2966 N  NZ    . LYS A 1 379 ? 11.769  28.202 59.849 1.00 26.79 ? 361  LYS A NZ    1 
ATOM   2967 N  N     . LYS A 1 380 ? 9.016   21.809 60.399 1.00 26.08 ? 362  LYS A N     1 
ATOM   2968 C  CA    . LYS A 1 380 ? 8.832   21.101 61.674 1.00 28.78 ? 362  LYS A CA    1 
ATOM   2969 C  C     . LYS A 1 380 ? 9.816   19.966 61.979 1.00 28.49 ? 362  LYS A C     1 
ATOM   2970 O  O     . LYS A 1 380 ? 10.084  19.678 63.133 1.00 28.32 ? 362  LYS A O     1 
ATOM   2971 C  CB    . LYS A 1 380 ? 7.415   20.509 61.800 1.00 28.67 ? 362  LYS A CB    1 
ATOM   2972 C  CG    . LYS A 1 380 ? 6.346   21.550 61.971 1.00 33.77 ? 362  LYS A CG    1 
ATOM   2973 C  CD    . LYS A 1 380 ? 4.988   20.868 62.126 1.00 40.14 ? 362  LYS A CD    1 
ATOM   2974 C  CE    . LYS A 1 380 ? 4.775   20.369 63.546 1.00 45.20 ? 362  LYS A CE    1 
ATOM   2975 N  NZ    . LYS A 1 380 ? 3.459   19.631 63.697 1.00 48.55 ? 362  LYS A NZ    1 
ATOM   2976 N  N     . ARG A 1 381 ? 10.248  19.257 60.954 1.00 28.22 ? 363  ARG A N     1 
ATOM   2977 C  CA    . ARG A 1 381 ? 11.019  18.067 61.168 1.00 28.06 ? 363  ARG A CA    1 
ATOM   2978 C  C     . ARG A 1 381 ? 12.512  18.407 61.097 1.00 27.82 ? 363  ARG A C     1 
ATOM   2979 O  O     . ARG A 1 381 ? 13.330  17.646 61.578 1.00 27.11 ? 363  ARG A O     1 
ATOM   2980 C  CB    . ARG A 1 381 ? 10.663  17.033 60.113 1.00 28.90 ? 363  ARG A CB    1 
ATOM   2981 C  CG    . ARG A 1 381 ? 9.199   16.437 60.159 1.00 31.13 ? 363  ARG A CG    1 
ATOM   2982 C  CD    . ARG A 1 381 ? 9.158   15.262 61.165 1.00 41.75 ? 363  ARG A CD    1 
ATOM   2983 N  NE    . ARG A 1 381 ? 10.474  14.652 61.080 1.00 49.09 ? 363  ARG A NE    1 
ATOM   2984 C  CZ    . ARG A 1 381 ? 10.831  13.452 61.525 1.00 55.88 ? 363  ARG A CZ    1 
ATOM   2985 N  NH1   . ARG A 1 381 ? 9.936   12.694 62.163 1.00 55.41 ? 363  ARG A NH1   1 
ATOM   2986 N  NH2   . ARG A 1 381 ? 12.111  13.026 61.320 1.00 55.03 ? 363  ARG A NH2   1 
ATOM   2987 N  N     . GLN A 1 382 ? 12.884  19.533 60.471 1.00 27.03 ? 364  GLN A N     1 
ATOM   2988 C  CA    . GLN A 1 382 ? 14.288  19.707 60.119 1.00 26.93 ? 364  GLN A CA    1 
ATOM   2989 C  C     . GLN A 1 382 ? 14.778  21.112 60.409 1.00 25.85 ? 364  GLN A C     1 
ATOM   2990 O  O     . GLN A 1 382 ? 15.958  21.378 60.386 1.00 27.77 ? 364  GLN A O     1 
ATOM   2991 C  CB    . GLN A 1 382 ? 14.531  19.297 58.623 1.00 27.35 ? 364  GLN A CB    1 
ATOM   2992 C  CG    . GLN A 1 382 ? 14.106  17.821 58.194 1.00 29.74 ? 364  GLN A CG    1 
ATOM   2993 C  CD    . GLN A 1 382 ? 14.933  16.751 58.958 1.00 35.98 ? 364  GLN A CD    1 
ATOM   2994 O  OE1   . GLN A 1 382 ? 16.038  17.048 59.376 1.00 38.57 ? 364  GLN A OE1   1 
ATOM   2995 N  NE2   . GLN A 1 382 ? 14.383  15.530 59.172 1.00 35.02 ? 364  GLN A NE2   1 
ATOM   2996 N  N     . GLY A 1 383 ? 13.889  22.039 60.647 1.00 25.71 ? 365  GLY A N     1 
ATOM   2997 C  CA    . GLY A 1 383 ? 14.337  23.385 60.962 1.00 25.71 ? 365  GLY A CA    1 
ATOM   2998 C  C     . GLY A 1 383 ? 14.870  24.162 59.770 1.00 27.05 ? 365  GLY A C     1 
ATOM   2999 O  O     . GLY A 1 383 ? 15.674  25.127 59.954 1.00 27.87 ? 365  GLY A O     1 
ATOM   3000 N  N     . TRP A 1 384 ? 14.429  23.785 58.547 1.00 26.17 ? 366  TRP A N     1 
ATOM   3001 C  CA    . TRP A 1 384 ? 14.825  24.495 57.301 1.00 24.02 ? 366  TRP A CA    1 
ATOM   3002 C  C     . TRP A 1 384 ? 14.118  25.845 57.248 1.00 23.78 ? 366  TRP A C     1 
ATOM   3003 O  O     . TRP A 1 384 ? 13.041  26.001 57.790 1.00 24.77 ? 366  TRP A O     1 
ATOM   3004 C  CB    . TRP A 1 384 ? 14.450  23.673 56.083 1.00 23.75 ? 366  TRP A CB    1 
ATOM   3005 C  CG    . TRP A 1 384 ? 15.261  22.457 55.828 1.00 24.70 ? 366  TRP A CG    1 
ATOM   3006 C  CD1   . TRP A 1 384 ? 16.118  21.827 56.690 1.00 25.70 ? 366  TRP A CD1   1 
ATOM   3007 C  CD2   . TRP A 1 384 ? 15.279  21.675 54.602 1.00 24.67 ? 366  TRP A CD2   1 
ATOM   3008 N  NE1   . TRP A 1 384 ? 16.703  20.737 56.071 1.00 23.92 ? 366  TRP A NE1   1 
ATOM   3009 C  CE2   . TRP A 1 384 ? 16.195  20.611 54.799 1.00 22.93 ? 366  TRP A CE2   1 
ATOM   3010 C  CE3   . TRP A 1 384 ? 14.649  21.813 53.333 1.00 23.50 ? 366  TRP A CE3   1 
ATOM   3011 C  CZ2   . TRP A 1 384 ? 16.501  19.677 53.773 1.00 23.18 ? 366  TRP A CZ2   1 
ATOM   3012 C  CZ3   . TRP A 1 384 ? 14.940  20.875 52.327 1.00 24.59 ? 366  TRP A CZ3   1 
ATOM   3013 C  CH2   . TRP A 1 384 ? 15.859  19.822 52.561 1.00 23.57 ? 366  TRP A CH2   1 
ATOM   3014 N  N     . ARG A 1 385 ? 14.716  26.839 56.623 1.00 23.11 ? 367  ARG A N     1 
ATOM   3015 C  CA    . ARG A 1 385 ? 13.988  28.067 56.305 1.00 22.89 ? 367  ARG A CA    1 
ATOM   3016 C  C     . ARG A 1 385 ? 13.095  27.832 55.071 1.00 23.48 ? 367  ARG A C     1 
ATOM   3017 O  O     . ARG A 1 385 ? 13.339  26.945 54.263 1.00 23.58 ? 367  ARG A O     1 
ATOM   3018 C  CB    . ARG A 1 385 ? 14.944  29.268 56.144 1.00 22.38 ? 367  ARG A CB    1 
ATOM   3019 C  CG    . ARG A 1 385 ? 16.051  29.386 57.227 1.00 21.52 ? 367  ARG A CG    1 
ATOM   3020 C  CD    . ARG A 1 385 ? 15.524  29.473 58.697 1.00 23.88 ? 367  ARG A CD    1 
ATOM   3021 N  NE    . ARG A 1 385 ? 14.490  30.511 58.883 1.00 22.98 ? 367  ARG A NE    1 
ATOM   3022 C  CZ    . ARG A 1 385 ? 14.744  31.766 59.244 1.00 26.24 ? 367  ARG A CZ    1 
ATOM   3023 N  NH1   . ARG A 1 385 ? 16.002  32.120 59.483 1.00 25.29 ? 367  ARG A NH1   1 
ATOM   3024 N  NH2   . ARG A 1 385 ? 13.762  32.675 59.365 1.00 22.02 ? 367  ARG A NH2   1 
ATOM   3025 N  N     . THR A 1 386 ? 12.013  28.578 54.952 1.00 23.66 ? 368  THR A N     1 
ATOM   3026 C  CA    . THR A 1 386 ? 10.973  28.180 54.021 1.00 22.85 ? 368  THR A CA    1 
ATOM   3027 C  C     . THR A 1 386 ? 10.506  29.399 53.220 1.00 23.09 ? 368  THR A C     1 
ATOM   3028 O  O     . THR A 1 386 ? 10.407  30.526 53.748 1.00 23.19 ? 368  THR A O     1 
ATOM   3029 C  CB    . THR A 1 386 ? 9.792   27.538 54.749 1.00 22.72 ? 368  THR A CB    1 
ATOM   3030 O  OG1   . THR A 1 386 ? 9.296   28.460 55.736 1.00 26.22 ? 368  THR A OG1   1 
ATOM   3031 C  CG2   . THR A 1 386 ? 10.163  26.215 55.426 1.00 20.08 ? 368  THR A CG2   1 
ATOM   3032 N  N     . PHE A 1 387 ? 10.227  29.156 51.933 1.00 23.40 ? 369  PHE A N     1 
ATOM   3033 C  CA    . PHE A 1 387 ? 9.660   30.161 51.023 1.00 22.40 ? 369  PHE A CA    1 
ATOM   3034 C  C     . PHE A 1 387 ? 8.514   29.474 50.320 1.00 22.21 ? 369  PHE A C     1 
ATOM   3035 O  O     . PHE A 1 387 ? 8.734   28.511 49.600 1.00 21.99 ? 369  PHE A O     1 
ATOM   3036 C  CB    . PHE A 1 387 ? 10.739  30.656 50.028 1.00 22.51 ? 369  PHE A CB    1 
ATOM   3037 C  CG    . PHE A 1 387 ? 10.272  31.763 49.096 1.00 23.52 ? 369  PHE A CG    1 
ATOM   3038 C  CD1   . PHE A 1 387 ? 10.905  32.963 49.093 1.00 21.44 ? 369  PHE A CD1   1 
ATOM   3039 C  CD2   . PHE A 1 387 ? 9.213   31.575 48.194 1.00 23.44 ? 369  PHE A CD2   1 
ATOM   3040 C  CE1   . PHE A 1 387 ? 10.477  33.991 48.258 1.00 23.20 ? 369  PHE A CE1   1 
ATOM   3041 C  CE2   . PHE A 1 387 ? 8.810   32.603 47.344 1.00 25.57 ? 369  PHE A CE2   1 
ATOM   3042 C  CZ    . PHE A 1 387 ? 9.436   33.810 47.401 1.00 23.22 ? 369  PHE A CZ    1 
ATOM   3043 N  N     . LEU A 1 388 ? 7.282   29.960 50.548 1.00 22.48 ? 370  LEU A N     1 
ATOM   3044 C  CA    . LEU A 1 388 ? 6.116   29.429 49.909 1.00 22.39 ? 370  LEU A CA    1 
ATOM   3045 C  C     . LEU A 1 388 ? 5.743   30.313 48.715 1.00 23.61 ? 370  LEU A C     1 
ATOM   3046 O  O     . LEU A 1 388 ? 5.502   31.540 48.842 1.00 23.34 ? 370  LEU A O     1 
ATOM   3047 C  CB    . LEU A 1 388 ? 4.928   29.315 50.900 1.00 22.53 ? 370  LEU A CB    1 
ATOM   3048 C  CG    . LEU A 1 388 ? 3.649   28.712 50.316 1.00 21.17 ? 370  LEU A CG    1 
ATOM   3049 C  CD1   . LEU A 1 388 ? 3.825   27.136 50.090 1.00 15.43 ? 370  LEU A CD1   1 
ATOM   3050 C  CD2   . LEU A 1 388 ? 2.432   29.034 51.248 1.00 23.51 ? 370  LEU A CD2   1 
ATOM   3051 N  N     . VAL A 1 389 ? 5.666   29.651 47.562 1.00 23.11 ? 371  VAL A N     1 
ATOM   3052 C  CA    . VAL A 1 389 ? 5.203   30.214 46.332 1.00 22.95 ? 371  VAL A CA    1 
ATOM   3053 C  C     . VAL A 1 389 ? 3.685   30.032 46.330 1.00 22.19 ? 371  VAL A C     1 
ATOM   3054 O  O     . VAL A 1 389 ? 3.179   28.959 46.614 1.00 22.20 ? 371  VAL A O     1 
ATOM   3055 C  CB    . VAL A 1 389 ? 5.909   29.457 45.098 1.00 23.98 ? 371  VAL A CB    1 
ATOM   3056 C  CG1   . VAL A 1 389 ? 5.217   29.831 43.802 1.00 23.72 ? 371  VAL A CG1   1 
ATOM   3057 C  CG2   . VAL A 1 389 ? 7.446   29.844 44.972 1.00 20.34 ? 371  VAL A CG2   1 
ATOM   3058 N  N     . ILE A 1 390 ? 2.940   31.079 46.066 1.00 22.68 ? 372  ILE A N     1 
ATOM   3059 C  CA    . ILE A 1 390 ? 1.460   30.971 46.031 1.00 22.74 ? 372  ILE A CA    1 
ATOM   3060 C  C     . ILE A 1 390 ? 0.945   31.562 44.710 1.00 25.26 ? 372  ILE A C     1 
ATOM   3061 O  O     . ILE A 1 390 ? 0.691   32.765 44.675 1.00 24.75 ? 372  ILE A O     1 
ATOM   3062 C  CB    . ILE A 1 390 ? 0.815   31.761 47.185 1.00 22.91 ? 372  ILE A CB    1 
ATOM   3063 C  CG1   . ILE A 1 390 ? 1.439   31.351 48.557 1.00 21.67 ? 372  ILE A CG1   1 
ATOM   3064 C  CG2   . ILE A 1 390 ? -0.715  31.581 47.198 1.00 21.00 ? 372  ILE A CG2   1 
ATOM   3065 C  CD1   . ILE A 1 390 ? 0.945   32.174 49.766 1.00 20.00 ? 372  ILE A CD1   1 
ATOM   3066 N  N     . PRO A 1 391 ? 0.826   30.733 43.623 1.00 27.01 ? 373  PRO A N     1 
ATOM   3067 C  CA    . PRO A 1 391 ? 0.570   31.305 42.270 1.00 28.30 ? 373  PRO A CA    1 
ATOM   3068 C  C     . PRO A 1 391 ? -0.678  32.215 42.232 1.00 29.43 ? 373  PRO A C     1 
ATOM   3069 O  O     . PRO A 1 391 ? -0.607  33.323 41.708 1.00 28.59 ? 373  PRO A O     1 
ATOM   3070 C  CB    . PRO A 1 391 ? 0.487   30.054 41.378 1.00 29.04 ? 373  PRO A CB    1 
ATOM   3071 C  CG    . PRO A 1 391 ? 1.525   28.999 42.143 1.00 28.82 ? 373  PRO A CG    1 
ATOM   3072 C  CD    . PRO A 1 391 ? 0.995   29.254 43.573 1.00 27.07 ? 373  PRO A CD    1 
ATOM   3073 N  N     . GLU A 1 392 ? -1.748  31.813 42.921 1.00 30.75 ? 374  GLU A N     1 
ATOM   3074 C  CA    . GLU A 1 392 ? -2.984  32.627 42.979 1.00 31.36 ? 374  GLU A CA    1 
ATOM   3075 C  C     . GLU A 1 392 ? -2.771  33.976 43.584 1.00 32.85 ? 374  GLU A C     1 
ATOM   3076 O  O     . GLU A 1 392 ? -3.658  34.823 43.475 1.00 33.73 ? 374  GLU A O     1 
ATOM   3077 C  CB    . GLU A 1 392 ? -4.103  31.972 43.800 1.00 30.59 ? 374  GLU A CB    1 
ATOM   3078 C  CG    . GLU A 1 392 ? -4.425  30.579 43.403 1.00 30.21 ? 374  GLU A CG    1 
ATOM   3079 C  CD    . GLU A 1 392 ? -3.747  29.567 44.297 1.00 28.49 ? 374  GLU A CD    1 
ATOM   3080 O  OE1   . GLU A 1 392 ? -2.516  29.665 44.509 1.00 26.55 ? 374  GLU A OE1   1 
ATOM   3081 O  OE2   . GLU A 1 392 ? -4.459  28.672 44.775 1.00 28.07 ? 374  GLU A OE2   1 
ATOM   3082 N  N     . LEU A 1 393 ? -1.639  34.187 44.266 1.00 34.14 ? 375  LEU A N     1 
ATOM   3083 C  CA    . LEU A 1 393 ? -1.387  35.485 44.878 1.00 35.09 ? 375  LEU A CA    1 
ATOM   3084 C  C     . LEU A 1 393 ? -1.290  36.556 43.783 1.00 37.84 ? 375  LEU A C     1 
ATOM   3085 O  O     . LEU A 1 393 ? -1.746  37.647 44.004 1.00 37.67 ? 375  LEU A O     1 
ATOM   3086 C  CB    . LEU A 1 393 ? -0.155  35.469 45.807 1.00 34.71 ? 375  LEU A CB    1 
ATOM   3087 C  CG    . LEU A 1 393 ? 0.132   36.614 46.807 1.00 33.95 ? 375  LEU A CG    1 
ATOM   3088 C  CD1   . LEU A 1 393 ? -1.058  36.942 47.739 1.00 27.19 ? 375  LEU A CD1   1 
ATOM   3089 C  CD2   . LEU A 1 393 ? 1.398   36.311 47.631 1.00 33.32 ? 375  LEU A CD2   1 
ATOM   3090 N  N     . ALA A 1 394 ? -0.718  36.212 42.609 1.00 40.56 ? 376  ALA A N     1 
ATOM   3091 C  CA    . ALA A 1 394 ? -0.661  37.112 41.463 1.00 43.57 ? 376  ALA A CA    1 
ATOM   3092 C  C     . ALA A 1 394 ? -2.024  37.809 41.235 1.00 45.39 ? 376  ALA A C     1 
ATOM   3093 O  O     . ALA A 1 394 ? -2.085  39.047 41.209 1.00 47.28 ? 376  ALA A O     1 
ATOM   3094 C  CB    . ALA A 1 394 ? -0.148  36.375 40.199 1.00 43.19 ? 376  ALA A CB    1 
ATOM   3095 N  N     . GLN A 1 395 ? -3.115  37.035 41.194 1.00 46.57 ? 377  GLN A N     1 
ATOM   3096 C  CA    . GLN A 1 395 ? -4.480  37.596 41.105 1.00 46.70 ? 377  GLN A CA    1 
ATOM   3097 C  C     . GLN A 1 395 ? -5.169  38.099 42.385 1.00 46.22 ? 377  GLN A C     1 
ATOM   3098 O  O     . GLN A 1 395 ? -5.908  39.067 42.308 1.00 48.56 ? 377  GLN A O     1 
ATOM   3099 C  CB    . GLN A 1 395 ? -5.447  36.658 40.338 1.00 47.59 ? 377  GLN A CB    1 
ATOM   3100 C  CG    . GLN A 1 395 ? -6.793  37.337 39.871 1.00 48.80 ? 377  GLN A CG    1 
ATOM   3101 C  CD    . GLN A 1 395 ? -6.610  38.598 38.968 1.00 56.24 ? 377  GLN A CD    1 
ATOM   3102 O  OE1   . GLN A 1 395 ? -5.489  38.971 38.561 1.00 59.49 ? 377  GLN A OE1   1 
ATOM   3103 N  NE2   . GLN A 1 395 ? -7.726  39.266 38.676 1.00 58.54 ? 377  GLN A NE2   1 
ATOM   3104 N  N     . GLU A 1 396 ? -4.997  37.439 43.527 1.00 44.35 ? 378  GLU A N     1 
ATOM   3105 C  CA    . GLU A 1 396 ? -5.617  37.860 44.792 1.00 42.52 ? 378  GLU A CA    1 
ATOM   3106 C  C     . GLU A 1 396 ? -5.139  39.231 45.315 1.00 41.94 ? 378  GLU A C     1 
ATOM   3107 O  O     . GLU A 1 396 ? -5.861  39.888 46.084 1.00 40.87 ? 378  GLU A O     1 
ATOM   3108 C  CB    . GLU A 1 396 ? -5.332  36.822 45.885 1.00 42.54 ? 378  GLU A CB    1 
ATOM   3109 C  CG    . GLU A 1 396 ? -5.956  35.443 45.635 1.00 42.86 ? 378  GLU A CG    1 
ATOM   3110 C  CD    . GLU A 1 396 ? -6.946  34.994 46.731 1.00 43.53 ? 378  GLU A CD    1 
ATOM   3111 O  OE1   . GLU A 1 396 ? -7.087  35.677 47.776 1.00 43.53 ? 378  GLU A OE1   1 
ATOM   3112 O  OE2   . GLU A 1 396 ? -7.584  33.934 46.550 1.00 43.10 ? 378  GLU A OE2   1 
ATOM   3113 N  N     . LEU A 1 397 ? -3.892  39.596 44.991 1.00 41.08 ? 379  LEU A N     1 
ATOM   3114 C  CA    . LEU A 1 397 ? -3.392  40.914 45.259 1.00 41.98 ? 379  LEU A CA    1 
ATOM   3115 C  C     . LEU A 1 397 ? -4.191  41.933 44.441 1.00 43.63 ? 379  LEU A C     1 
ATOM   3116 O  O     . LEU A 1 397 ? -4.598  42.964 45.002 1.00 43.11 ? 379  LEU A O     1 
ATOM   3117 C  CB    . LEU A 1 397 ? -1.905  41.037 44.949 1.00 40.89 ? 379  LEU A CB    1 
ATOM   3118 C  CG    . LEU A 1 397 ? -1.020  40.391 46.000 1.00 39.15 ? 379  LEU A CG    1 
ATOM   3119 C  CD1   . LEU A 1 397 ? 0.418   40.284 45.479 1.00 37.12 ? 379  LEU A CD1   1 
ATOM   3120 C  CD2   . LEU A 1 397 ? -1.127  41.173 47.315 1.00 36.07 ? 379  LEU A CD2   1 
ATOM   3121 N  N     A HIS A 1 398 ? -4.413  41.645 43.155 0.50 43.89 ? 380  HIS A N     1 
ATOM   3122 N  N     B HIS A 1 398 ? -4.418  41.663 43.141 0.50 43.83 ? 380  HIS A N     1 
ATOM   3123 C  CA    A HIS A 1 398 ? -5.168  42.566 42.317 0.50 44.61 ? 380  HIS A CA    1 
ATOM   3124 C  CA    B HIS A 1 398 ? -5.247  42.562 42.309 0.50 44.56 ? 380  HIS A CA    1 
ATOM   3125 C  C     A HIS A 1 398 ? -6.612  42.775 42.832 0.50 44.50 ? 380  HIS A C     1 
ATOM   3126 C  C     B HIS A 1 398 ? -6.572  42.800 43.005 0.50 44.33 ? 380  HIS A C     1 
ATOM   3127 O  O     A HIS A 1 398 ? -7.102  43.895 42.803 0.50 44.08 ? 380  HIS A O     1 
ATOM   3128 O  O     B HIS A 1 398 ? -6.954  43.929 43.249 0.50 43.71 ? 380  HIS A O     1 
ATOM   3129 C  CB    A HIS A 1 398 ? -5.092  42.181 40.827 0.50 44.76 ? 380  HIS A CB    1 
ATOM   3130 C  CB    B HIS A 1 398 ? -5.501  42.005 40.894 0.50 44.62 ? 380  HIS A CB    1 
ATOM   3131 C  CG    A HIS A 1 398 ? -3.820  42.616 40.149 0.50 45.20 ? 380  HIS A CG    1 
ATOM   3132 C  CG    B HIS A 1 398 ? -6.487  42.806 40.080 0.50 45.68 ? 380  HIS A CG    1 
ATOM   3133 N  ND1   A HIS A 1 398 ? -3.583  43.921 39.771 0.50 47.14 ? 380  HIS A ND1   1 
ATOM   3134 N  ND1   B HIS A 1 398 ? -6.124  43.911 39.329 0.50 46.62 ? 380  HIS A ND1   1 
ATOM   3135 C  CD2   A HIS A 1 398 ? -2.720  41.916 39.777 0.50 45.86 ? 380  HIS A CD2   1 
ATOM   3136 C  CD2   B HIS A 1 398 ? -7.817  42.636 39.871 0.50 46.11 ? 380  HIS A CD2   1 
ATOM   3137 C  CE1   A HIS A 1 398 ? -2.395  44.004 39.195 0.50 46.79 ? 380  HIS A CE1   1 
ATOM   3138 C  CE1   B HIS A 1 398 ? -7.190  44.390 38.710 0.50 46.52 ? 380  HIS A CE1   1 
ATOM   3139 N  NE2   A HIS A 1 398 ? -1.848  42.802 39.193 0.50 44.64 ? 380  HIS A NE2   1 
ATOM   3140 N  NE2   B HIS A 1 398 ? -8.229  43.633 39.019 0.50 45.04 ? 380  HIS A NE2   1 
ATOM   3141 N  N     . VAL A 1 399 ? -7.259  41.715 43.330 1.00 44.75 ? 381  VAL A N     1 
ATOM   3142 C  CA    . VAL A 1 399 ? -8.605  41.808 43.912 1.00 45.13 ? 381  VAL A CA    1 
ATOM   3143 C  C     . VAL A 1 399 ? -8.597  42.523 45.235 1.00 46.27 ? 381  VAL A C     1 
ATOM   3144 O  O     . VAL A 1 399 ? -9.547  43.239 45.559 1.00 47.57 ? 381  VAL A O     1 
ATOM   3145 C  CB    . VAL A 1 399 ? -9.289  40.434 44.112 1.00 44.27 ? 381  VAL A CB    1 
ATOM   3146 C  CG1   . VAL A 1 399 ? -10.691 40.628 44.647 1.00 43.66 ? 381  VAL A CG1   1 
ATOM   3147 C  CG2   . VAL A 1 399 ? -9.378  39.687 42.818 1.00 45.02 ? 381  VAL A CG2   1 
ATOM   3148 N  N     . TRP A 1 400 ? -7.539  42.321 46.025 1.00 48.04 ? 382  TRP A N     1 
ATOM   3149 C  CA    . TRP A 1 400 ? -7.454  42.902 47.370 1.00 48.49 ? 382  TRP A CA    1 
ATOM   3150 C  C     . TRP A 1 400 ? -7.276  44.420 47.247 1.00 50.92 ? 382  TRP A C     1 
ATOM   3151 O  O     . TRP A 1 400 ? -7.791  45.157 48.066 1.00 50.54 ? 382  TRP A O     1 
ATOM   3152 C  CB    . TRP A 1 400 ? -6.333  42.237 48.196 1.00 46.51 ? 382  TRP A CB    1 
ATOM   3153 C  CG    . TRP A 1 400 ? -6.141  42.814 49.582 1.00 44.14 ? 382  TRP A CG    1 
ATOM   3154 C  CD1   . TRP A 1 400 ? -5.240  43.800 49.949 1.00 42.02 ? 382  TRP A CD1   1 
ATOM   3155 C  CD2   . TRP A 1 400 ? -6.866  42.480 50.765 1.00 41.27 ? 382  TRP A CD2   1 
ATOM   3156 N  NE1   . TRP A 1 400 ? -5.379  44.093 51.271 1.00 40.31 ? 382  TRP A NE1   1 
ATOM   3157 C  CE2   . TRP A 1 400 ? -6.366  43.303 51.805 1.00 40.93 ? 382  TRP A CE2   1 
ATOM   3158 C  CE3   . TRP A 1 400 ? -7.900  41.572 51.052 1.00 41.43 ? 382  TRP A CE3   1 
ATOM   3159 C  CZ2   . TRP A 1 400 ? -6.857  43.245 53.105 1.00 40.92 ? 382  TRP A CZ2   1 
ATOM   3160 C  CZ3   . TRP A 1 400 ? -8.384  41.505 52.342 1.00 42.48 ? 382  TRP A CZ3   1 
ATOM   3161 C  CH2   . TRP A 1 400 ? -7.844  42.332 53.367 1.00 43.16 ? 382  TRP A CH2   1 
ATOM   3162 N  N     . THR A 1 401 ? -6.548  44.877 46.227 1.00 54.96 ? 383  THR A N     1 
ATOM   3163 C  CA    . THR A 1 401 ? -6.305  46.324 46.034 1.00 59.14 ? 383  THR A CA    1 
ATOM   3164 C  C     . THR A 1 401 ? -7.599  47.052 45.643 1.00 61.49 ? 383  THR A C     1 
ATOM   3165 O  O     . THR A 1 401 ? -8.103  47.880 46.432 1.00 61.75 ? 383  THR A O     1 
ATOM   3166 C  CB    . THR A 1 401 ? -5.055  46.673 45.119 1.00 59.52 ? 383  THR A CB    1 
ATOM   3167 O  OG1   . THR A 1 401 ? -4.972  48.086 44.910 1.00 61.18 ? 383  THR A OG1   1 
ATOM   3168 C  CG2   . THR A 1 401 ? -5.092  46.028 43.730 1.00 60.55 ? 383  THR A CG2   1 
ATOM   3169 N  N     . ASP A 1 402 ? -8.171  46.700 44.488 1.00 64.42 ? 384  ASP A N     1 
ATOM   3170 C  CA    . ASP A 1 402 ? -9.471  47.276 44.065 1.00 68.19 ? 384  ASP A CA    1 
ATOM   3171 C  C     . ASP A 1 402 ? -10.717 46.631 44.676 1.00 69.90 ? 384  ASP A C     1 
ATOM   3172 O  O     . ASP A 1 402 ? -11.711 46.439 43.989 1.00 70.41 ? 384  ASP A O     1 
ATOM   3173 C  CB    . ASP A 1 402 ? -9.609  47.431 42.528 1.00 68.79 ? 384  ASP A CB    1 
ATOM   3174 C  CG    . ASP A 1 402 ? -9.170  46.178 41.738 1.00 71.00 ? 384  ASP A CG    1 
ATOM   3175 O  OD1   . ASP A 1 402 ? -9.856  45.119 41.821 1.00 73.25 ? 384  ASP A OD1   1 
ATOM   3176 O  OD2   . ASP A 1 402 ? -8.150  46.276 40.999 1.00 72.74 ? 384  ASP A OD2   1 
ATOM   3177 N  N     . LYS A 1 403 ? -10.648 46.300 45.962 1.00 72.41 ? 385  LYS A N     1 
ATOM   3178 C  CA    . LYS A 1 403 ? -11.831 46.010 46.787 1.00 75.30 ? 385  LYS A CA    1 
ATOM   3179 C  C     . LYS A 1 403 ? -11.410 46.355 48.197 1.00 76.58 ? 385  LYS A C     1 
ATOM   3180 O  O     . LYS A 1 403 ? -11.846 45.707 49.154 1.00 77.10 ? 385  LYS A O     1 
ATOM   3181 C  CB    . LYS A 1 403 ? -12.290 44.523 46.749 1.00 76.40 ? 385  LYS A CB    1 
ATOM   3182 C  CG    . LYS A 1 403 ? -12.560 43.851 45.372 1.00 77.20 ? 385  LYS A CG    1 
ATOM   3183 C  CD    . LYS A 1 403 ? -13.778 44.380 44.621 1.00 78.71 ? 385  LYS A CD    1 
ATOM   3184 C  CE    . LYS A 1 403 ? -13.705 43.914 43.150 1.00 79.48 ? 385  LYS A CE    1 
ATOM   3185 N  NZ    . LYS A 1 403 ? -14.550 44.757 42.222 1.00 80.92 ? 385  LYS A NZ    1 
ATOM   3186 N  N     . SER A 1 404 ? -10.509 47.338 48.303 1.00 78.43 ? 386  SER A N     1 
ATOM   3187 C  CA    . SER A 1 404 ? -10.001 47.865 49.587 1.00 79.96 ? 386  SER A CA    1 
ATOM   3188 C  C     . SER A 1 404 ? -11.129 48.455 50.409 1.00 80.73 ? 386  SER A C     1 
ATOM   3189 O  O     . SER A 1 404 ? -11.356 48.085 51.579 1.00 80.42 ? 386  SER A O     1 
ATOM   3190 C  CB    . SER A 1 404 ? -8.953  48.961 49.343 1.00 79.97 ? 386  SER A CB    1 
ATOM   3191 O  OG    . SER A 1 404 ? -7.651  48.465 49.594 1.00 80.83 ? 386  SER A OG    1 
ATOM   3192 N  N     . SER A 1 405 ? -11.818 49.386 49.751 1.00 81.71 ? 387  SER A N     1 
ATOM   3193 C  CA    . SER A 1 405 ? -12.975 50.083 50.280 1.00 82.64 ? 387  SER A CA    1 
ATOM   3194 C  C     . SER A 1 405 ? -14.135 49.120 50.611 1.00 82.71 ? 387  SER A C     1 
ATOM   3195 O  O     . SER A 1 405 ? -15.064 49.491 51.331 1.00 82.81 ? 387  SER A O     1 
ATOM   3196 C  CB    . SER A 1 405 ? -13.411 51.152 49.263 1.00 82.88 ? 387  SER A CB    1 
ATOM   3197 O  OG    . SER A 1 405 ? -13.454 50.589 47.952 1.00 83.20 ? 387  SER A OG    1 
ATOM   3198 N  N     . LEU A 1 406 ? -14.077 47.896 50.084 1.00 83.03 ? 388  LEU A N     1 
ATOM   3199 C  CA    . LEU A 1 406 ? -15.027 46.826 50.459 1.00 83.43 ? 388  LEU A CA    1 
ATOM   3200 C  C     . LEU A 1 406 ? -14.594 46.046 51.731 1.00 83.52 ? 388  LEU A C     1 
ATOM   3201 O  O     . LEU A 1 406 ? -15.450 45.739 52.587 1.00 83.08 ? 388  LEU A O     1 
ATOM   3202 C  CB    . LEU A 1 406 ? -15.275 45.869 49.277 1.00 83.73 ? 388  LEU A CB    1 
ATOM   3203 C  CG    . LEU A 1 406 ? -16.676 45.292 49.018 1.00 83.66 ? 388  LEU A CG    1 
ATOM   3204 C  CD1   . LEU A 1 406 ? -16.791 44.767 47.573 1.00 83.69 ? 388  LEU A CD1   1 
ATOM   3205 C  CD2   . LEU A 1 406 ? -17.037 44.208 50.039 1.00 83.46 ? 388  LEU A CD2   1 
ATOM   3206 N  N     . PHE A 1 407 ? -13.291 45.728 51.848 1.00 83.52 ? 389  PHE A N     1 
ATOM   3207 C  CA    . PHE A 1 407 ? -12.757 45.139 53.091 1.00 83.94 ? 389  PHE A CA    1 
ATOM   3208 C  C     . PHE A 1 407 ? -12.811 46.139 54.244 1.00 84.63 ? 389  PHE A C     1 
ATOM   3209 O  O     . PHE A 1 407 ? -13.188 45.786 55.388 1.00 83.69 ? 389  PHE A O     1 
ATOM   3210 C  CB    . PHE A 1 407 ? -11.319 44.604 52.947 1.00 83.41 ? 389  PHE A CB    1 
ATOM   3211 C  CG    . PHE A 1 407 ? -10.747 44.049 54.250 1.00 82.54 ? 389  PHE A CG    1 
ATOM   3212 C  CD1   . PHE A 1 407 ? -11.255 42.880 54.815 1.00 82.18 ? 389  PHE A CD1   1 
ATOM   3213 C  CD2   . PHE A 1 407 ? -9.714  44.699 54.912 1.00 81.58 ? 389  PHE A CD2   1 
ATOM   3214 C  CE1   . PHE A 1 407 ? -10.741 42.376 56.016 1.00 81.72 ? 389  PHE A CE1   1 
ATOM   3215 C  CE2   . PHE A 1 407 ? -9.195  44.189 56.103 1.00 80.65 ? 389  PHE A CE2   1 
ATOM   3216 C  CZ    . PHE A 1 407 ? -9.718  43.040 56.661 1.00 81.11 ? 389  PHE A CZ    1 
ATOM   3217 N  N     . GLU A 1 408 ? -12.415 47.376 53.921 1.00 85.60 ? 390  GLU A N     1 
ATOM   3218 C  CA    . GLU A 1 408 ? -12.382 48.463 54.884 1.00 87.17 ? 390  GLU A CA    1 
ATOM   3219 C  C     . GLU A 1 408 ? -13.772 48.787 55.407 1.00 87.09 ? 390  GLU A C     1 
ATOM   3220 O  O     . GLU A 1 408 ? -13.936 49.026 56.612 1.00 87.41 ? 390  GLU A O     1 
ATOM   3221 C  CB    . GLU A 1 408 ? -11.705 49.696 54.303 1.00 87.14 ? 390  GLU A CB    1 
ATOM   3222 C  CG    . GLU A 1 408 ? -10.215 49.775 54.646 1.00 88.91 ? 390  GLU A CG    1 
ATOM   3223 C  CD    . GLU A 1 408 ? -9.537  50.999 54.030 1.00 88.95 ? 390  GLU A CD    1 
ATOM   3224 O  OE1   . GLU A 1 408 ? -9.081  51.880 54.802 1.00 90.00 ? 390  GLU A OE1   1 
ATOM   3225 O  OE2   . GLU A 1 408 ? -9.473  51.079 52.771 1.00 91.75 ? 390  GLU A OE2   1 
ATOM   3226 N  N     . GLU A 1 409 ? -14.768 48.747 54.520 1.00 86.93 ? 391  GLU A N     1 
ATOM   3227 C  CA    . GLU A 1 409 ? -16.163 48.842 54.953 1.00 87.13 ? 391  GLU A CA    1 
ATOM   3228 C  C     . GLU A 1 409 ? -16.521 47.772 56.007 1.00 87.14 ? 391  GLU A C     1 
ATOM   3229 O  O     . GLU A 1 409 ? -17.049 48.108 57.080 1.00 86.79 ? 391  GLU A O     1 
ATOM   3230 C  CB    . GLU A 1 409 ? -17.137 48.788 53.772 1.00 87.16 ? 391  GLU A CB    1 
ATOM   3231 C  CG    . GLU A 1 409 ? -18.543 49.299 54.138 1.00 87.63 ? 391  GLU A CG    1 
ATOM   3232 C  CD    . GLU A 1 409 ? -19.595 49.063 53.062 1.00 87.25 ? 391  GLU A CD    1 
ATOM   3233 O  OE1   . GLU A 1 409 ? -19.366 49.438 51.883 1.00 87.75 ? 391  GLU A OE1   1 
ATOM   3234 O  OE2   . GLU A 1 409 ? -20.669 48.527 53.416 1.00 87.26 ? 391  GLU A OE2   1 
ATOM   3235 N  N     . LEU A 1 410 ? -16.216 46.501 55.704 1.00 87.19 ? 392  LEU A N     1 
ATOM   3236 C  CA    . LEU A 1 410 ? -16.436 45.401 56.659 1.00 87.17 ? 392  LEU A CA    1 
ATOM   3237 C  C     . LEU A 1 410 ? -15.685 45.656 57.971 1.00 87.16 ? 392  LEU A C     1 
ATOM   3238 O  O     . LEU A 1 410 ? -16.212 45.422 59.049 1.00 86.54 ? 392  LEU A O     1 
ATOM   3239 C  CB    . LEU A 1 410 ? -16.063 44.029 56.052 1.00 87.17 ? 392  LEU A CB    1 
ATOM   3240 C  CG    . LEU A 1 410 ? -15.967 42.765 56.937 1.00 86.72 ? 392  LEU A CG    1 
ATOM   3241 C  CD1   . LEU A 1 410 ? -17.285 42.390 57.583 1.00 85.92 ? 392  LEU A CD1   1 
ATOM   3242 C  CD2   . LEU A 1 410 ? -15.439 41.597 56.141 1.00 86.73 ? 392  LEU A CD2   1 
ATOM   3243 N  N     . GLN A 1 411 ? -14.468 46.170 57.850 1.00 87.59 ? 393  GLN A N     1 
ATOM   3244 C  CA    . GLN A 1 411 ? -13.623 46.433 58.998 1.00 88.44 ? 393  GLN A CA    1 
ATOM   3245 C  C     . GLN A 1 411 ? -14.237 47.408 59.998 1.00 88.98 ? 393  GLN A C     1 
ATOM   3246 O  O     . GLN A 1 411 ? -14.150 47.187 61.229 1.00 89.06 ? 393  GLN A O     1 
ATOM   3247 C  CB    . GLN A 1 411 ? -12.275 46.954 58.537 1.00 88.25 ? 393  GLN A CB    1 
ATOM   3248 C  CG    . GLN A 1 411 ? -11.270 45.864 58.398 1.00 88.49 ? 393  GLN A CG    1 
ATOM   3249 C  CD    . GLN A 1 411 ? -9.849  46.371 58.540 1.00 88.52 ? 393  GLN A CD    1 
ATOM   3250 O  OE1   . GLN A 1 411 ? -9.526  47.491 58.126 1.00 89.11 ? 393  GLN A OE1   1 
ATOM   3251 N  NE2   . GLN A 1 411 ? -8.985  45.544 59.120 1.00 87.68 ? 393  GLN A NE2   1 
ATOM   3252 N  N     . SER A 1 412 ? -14.843 48.475 59.463 1.00 89.10 ? 394  SER A N     1 
ATOM   3253 C  CA    . SER A 1 412 ? -15.495 49.515 60.273 1.00 89.27 ? 394  SER A CA    1 
ATOM   3254 C  C     . SER A 1 412 ? -16.624 48.918 61.113 1.00 89.36 ? 394  SER A C     1 
ATOM   3255 O  O     . SER A 1 412 ? -16.554 48.926 62.352 1.00 89.60 ? 394  SER A O     1 
ATOM   3256 C  CB    . SER A 1 412 ? -16.030 50.646 59.382 1.00 89.29 ? 394  SER A CB    1 
ATOM   3257 O  OG    . SER A 1 412 ? -14.982 51.288 58.674 1.00 88.67 ? 394  SER A OG    1 
ATOM   3258 N  N     . LEU A 1 413 ? -17.631 48.369 60.426 1.00 89.16 ? 395  LEU A N     1 
ATOM   3259 C  CA    . LEU A 1 413 ? -18.791 47.711 61.045 1.00 89.13 ? 395  LEU A CA    1 
ATOM   3260 C  C     . LEU A 1 413 ? -18.477 46.940 62.334 1.00 89.29 ? 395  LEU A C     1 
ATOM   3261 O  O     . LEU A 1 413 ? -19.172 47.081 63.335 1.00 89.36 ? 395  LEU A O     1 
ATOM   3262 C  CB    . LEU A 1 413 ? -19.474 46.787 60.026 1.00 89.09 ? 395  LEU A CB    1 
ATOM   3263 C  CG    . LEU A 1 413 ? -20.325 47.463 58.941 1.00 89.47 ? 395  LEU A CG    1 
ATOM   3264 C  CD1   . LEU A 1 413 ? -20.129 46.844 57.558 1.00 89.66 ? 395  LEU A CD1   1 
ATOM   3265 C  CD2   . LEU A 1 413 ? -21.802 47.455 59.333 1.00 89.48 ? 395  LEU A CD2   1 
ATOM   3266 N  N     . ASP A 1 414 ? -17.419 46.137 62.315 1.00 89.74 ? 396  ASP A N     1 
ATOM   3267 C  CA    . ASP A 1 414 ? -17.094 45.281 63.456 1.00 90.20 ? 396  ASP A CA    1 
ATOM   3268 C  C     . ASP A 1 414 ? -16.721 46.121 64.674 1.00 89.96 ? 396  ASP A C     1 
ATOM   3269 O  O     . ASP A 1 414 ? -16.374 47.299 64.537 1.00 89.90 ? 396  ASP A O     1 
ATOM   3270 C  CB    . ASP A 1 414 ? -15.958 44.308 63.090 1.00 90.53 ? 396  ASP A CB    1 
ATOM   3271 C  CG    . ASP A 1 414 ? -16.297 43.414 61.881 1.00 91.03 ? 396  ASP A CG    1 
ATOM   3272 O  OD1   . ASP A 1 414 ? -17.037 42.409 62.051 1.00 90.36 ? 396  ASP A OD1   1 
ATOM   3273 O  OD2   . ASP A 1 414 ? -15.792 43.706 60.768 1.00 91.71 ? 396  ASP A OD2   1 
ATOM   3274 N  N     . ARG A 1 439 ? -25.327 41.540 60.316 1.00 84.02 ? 421  ARG A N     1 
ATOM   3275 C  CA    . ARG A 1 439 ? -26.455 41.582 59.381 1.00 84.53 ? 421  ARG A CA    1 
ATOM   3276 C  C     . ARG A 1 439 ? -26.036 42.198 58.045 1.00 83.91 ? 421  ARG A C     1 
ATOM   3277 O  O     . ARG A 1 439 ? -26.204 41.598 56.965 1.00 84.13 ? 421  ARG A O     1 
ATOM   3278 C  CB    . ARG A 1 439 ? -27.611 42.422 59.954 1.00 84.77 ? 421  ARG A CB    1 
ATOM   3279 C  CG    . ARG A 1 439 ? -27.646 42.629 61.503 1.00 86.19 ? 421  ARG A CG    1 
ATOM   3280 C  CD    . ARG A 1 439 ? -28.972 43.295 61.986 1.00 86.06 ? 421  ARG A CD    1 
ATOM   3281 N  NE    . ARG A 1 439 ? -30.053 43.128 60.998 1.00 90.63 ? 421  ARG A NE    1 
ATOM   3282 C  CZ    . ARG A 1 439 ? -30.564 41.958 60.570 1.00 91.65 ? 421  ARG A CZ    1 
ATOM   3283 N  NH1   . ARG A 1 439 ? -30.116 40.787 61.034 1.00 91.20 ? 421  ARG A NH1   1 
ATOM   3284 N  NH2   . ARG A 1 439 ? -31.533 41.955 59.653 1.00 90.59 ? 421  ARG A NH2   1 
ATOM   3285 N  N     . ARG A 1 440 ? -25.528 43.429 58.133 1.00 82.98 ? 422  ARG A N     1 
ATOM   3286 C  CA    . ARG A 1 440 ? -24.855 44.102 57.024 1.00 81.86 ? 422  ARG A CA    1 
ATOM   3287 C  C     . ARG A 1 440 ? -23.459 43.465 56.869 1.00 80.72 ? 422  ARG A C     1 
ATOM   3288 O  O     . ARG A 1 440 ? -22.915 43.396 55.757 1.00 80.66 ? 422  ARG A O     1 
ATOM   3289 C  CB    . ARG A 1 440 ? -24.759 45.619 57.303 1.00 82.04 ? 422  ARG A CB    1 
ATOM   3290 C  CG    . ARG A 1 440 ? -23.806 46.434 56.398 1.00 82.40 ? 422  ARG A CG    1 
ATOM   3291 C  CD    . ARG A 1 440 ? -24.451 46.840 55.070 1.00 83.33 ? 422  ARG A CD    1 
ATOM   3292 N  NE    . ARG A 1 440 ? -23.540 47.533 54.142 1.00 83.53 ? 422  ARG A NE    1 
ATOM   3293 C  CZ    . ARG A 1 440 ? -23.620 47.437 52.807 1.00 85.21 ? 422  ARG A CZ    1 
ATOM   3294 N  NH1   . ARG A 1 440 ? -24.545 46.661 52.236 1.00 86.18 ? 422  ARG A NH1   1 
ATOM   3295 N  NH2   . ARG A 1 440 ? -22.768 48.095 52.023 1.00 84.11 ? 422  ARG A NH2   1 
ATOM   3296 N  N     . ILE A 1 441 ? -22.918 42.989 57.998 1.00 78.75 ? 423  ILE A N     1 
ATOM   3297 C  CA    . ILE A 1 441 ? -21.671 42.212 58.072 1.00 76.71 ? 423  ILE A CA    1 
ATOM   3298 C  C     . ILE A 1 441 ? -21.760 40.929 57.224 1.00 76.06 ? 423  ILE A C     1 
ATOM   3299 O  O     . ILE A 1 441 ? -20.818 40.625 56.473 1.00 75.82 ? 423  ILE A O     1 
ATOM   3300 C  CB    . ILE A 1 441 ? -21.267 41.896 59.563 1.00 76.79 ? 423  ILE A CB    1 
ATOM   3301 C  CG1   . ILE A 1 441 ? -20.901 43.195 60.326 1.00 76.62 ? 423  ILE A CG1   1 
ATOM   3302 C  CG2   . ILE A 1 441 ? -20.137 40.857 59.633 1.00 76.40 ? 423  ILE A CG2   1 
ATOM   3303 C  CD1   . ILE A 1 441 ? -20.640 43.033 61.841 1.00 75.69 ? 423  ILE A CD1   1 
ATOM   3304 N  N     . LYS A 1 442 ? -22.885 40.205 57.315 1.00 74.65 ? 424  LYS A N     1 
ATOM   3305 C  CA    . LYS A 1 442 ? -23.103 39.022 56.467 1.00 73.53 ? 424  LYS A CA    1 
ATOM   3306 C  C     . LYS A 1 442 ? -23.184 39.382 54.975 1.00 72.24 ? 424  LYS A C     1 
ATOM   3307 O  O     . LYS A 1 442 ? -22.643 38.641 54.110 1.00 71.83 ? 424  LYS A O     1 
ATOM   3308 C  CB    . LYS A 1 442 ? -24.320 38.180 56.909 1.00 74.04 ? 424  LYS A CB    1 
ATOM   3309 C  CG    . LYS A 1 442 ? -24.001 37.017 57.887 1.00 75.21 ? 424  LYS A CG    1 
ATOM   3310 C  CD    . LYS A 1 442 ? -24.620 37.208 59.286 1.00 76.99 ? 424  LYS A CD    1 
ATOM   3311 C  CE    . LYS A 1 442 ? -24.042 38.453 60.010 1.00 79.40 ? 424  LYS A CE    1 
ATOM   3312 N  NZ    . LYS A 1 442 ? -24.656 38.769 61.352 1.00 77.77 ? 424  LYS A NZ    1 
ATOM   3313 N  N     . LYS A 1 443 ? -23.811 40.523 54.670 1.00 70.37 ? 425  LYS A N     1 
ATOM   3314 C  CA    . LYS A 1 443 ? -23.960 40.943 53.264 1.00 68.89 ? 425  LYS A CA    1 
ATOM   3315 C  C     . LYS A 1 443 ? -22.621 41.389 52.664 1.00 67.14 ? 425  LYS A C     1 
ATOM   3316 O  O     . LYS A 1 443 ? -22.261 40.965 51.560 1.00 67.51 ? 425  LYS A O     1 
ATOM   3317 C  CB    . LYS A 1 443 ? -25.095 41.977 53.074 1.00 69.61 ? 425  LYS A CB    1 
ATOM   3318 C  CG    . LYS A 1 443 ? -25.585 42.195 51.613 1.00 70.17 ? 425  LYS A CG    1 
ATOM   3319 C  CD    . LYS A 1 443 ? -24.958 43.468 51.009 1.00 72.21 ? 425  LYS A CD    1 
ATOM   3320 C  CE    . LYS A 1 443 ? -25.741 44.049 49.818 1.00 72.35 ? 425  LYS A CE    1 
ATOM   3321 N  NZ    . LYS A 1 443 ? -25.531 43.286 48.532 1.00 73.00 ? 425  LYS A NZ    1 
ATOM   3322 N  N     . VAL A 1 444 ? -21.885 42.225 53.396 1.00 64.95 ? 426  VAL A N     1 
ATOM   3323 C  CA    . VAL A 1 444 ? -20.522 42.665 53.003 1.00 62.77 ? 426  VAL A CA    1 
ATOM   3324 C  C     . VAL A 1 444 ? -19.542 41.495 52.718 1.00 60.73 ? 426  VAL A C     1 
ATOM   3325 O  O     . VAL A 1 444 ? -18.873 41.472 51.657 1.00 59.10 ? 426  VAL A O     1 
ATOM   3326 C  CB    . VAL A 1 444 ? -19.870 43.571 54.092 1.00 62.95 ? 426  VAL A CB    1 
ATOM   3327 C  CG1   . VAL A 1 444 ? -18.540 44.167 53.584 1.00 62.84 ? 426  VAL A CG1   1 
ATOM   3328 C  CG2   . VAL A 1 444 ? -20.821 44.670 54.515 1.00 63.42 ? 426  VAL A CG2   1 
ATOM   3329 N  N     . THR A 1 445 ? -19.457 40.577 53.692 1.00 58.48 ? 427  THR A N     1 
ATOM   3330 C  CA    . THR A 1 445 ? -18.752 39.304 53.565 1.00 57.63 ? 427  THR A CA    1 
ATOM   3331 C  C     . THR A 1 445 ? -19.045 38.645 52.192 1.00 57.35 ? 427  THR A C     1 
ATOM   3332 O  O     . THR A 1 445 ? -18.101 38.405 51.390 1.00 56.33 ? 427  THR A O     1 
ATOM   3333 C  CB    . THR A 1 445 ? -19.077 38.348 54.782 1.00 57.77 ? 427  THR A CB    1 
ATOM   3334 O  OG1   . THR A 1 445 ? -18.770 39.008 56.029 1.00 57.03 ? 427  THR A OG1   1 
ATOM   3335 C  CG2   . THR A 1 445 ? -18.296 37.029 54.706 1.00 56.41 ? 427  THR A CG2   1 
ATOM   3336 N  N     . HIS A 1 446 ? -20.341 38.434 51.901 1.00 57.03 ? 428  HIS A N     1 
ATOM   3337 C  CA    . HIS A 1 446 ? -20.777 37.822 50.643 1.00 56.77 ? 428  HIS A CA    1 
ATOM   3338 C  C     . HIS A 1 446 ? -20.237 38.486 49.400 1.00 56.40 ? 428  HIS A C     1 
ATOM   3339 O  O     . HIS A 1 446 ? -19.551 37.830 48.616 1.00 56.65 ? 428  HIS A O     1 
ATOM   3340 C  CB    . HIS A 1 446 ? -22.289 37.634 50.530 1.00 57.70 ? 428  HIS A CB    1 
ATOM   3341 C  CG    . HIS A 1 446 ? -22.684 36.787 49.356 1.00 59.35 ? 428  HIS A CG    1 
ATOM   3342 N  ND1   . HIS A 1 446 ? -23.107 37.327 48.155 1.00 62.11 ? 428  HIS A ND1   1 
ATOM   3343 C  CD2   . HIS A 1 446 ? -22.649 35.442 49.171 1.00 59.88 ? 428  HIS A CD2   1 
ATOM   3344 C  CE1   . HIS A 1 446 ? -23.351 36.349 47.296 1.00 60.92 ? 428  HIS A CE1   1 
ATOM   3345 N  NE2   . HIS A 1 446 ? -23.077 35.198 47.886 1.00 59.09 ? 428  HIS A NE2   1 
ATOM   3346 N  N     . ASP A 1 447 ? -20.494 39.774 49.208 1.00 56.06 ? 429  ASP A N     1 
ATOM   3347 C  CA    . ASP A 1 447 ? -19.975 40.440 47.984 1.00 56.20 ? 429  ASP A CA    1 
ATOM   3348 C  C     . ASP A 1 447 ? -18.455 40.681 47.980 1.00 54.69 ? 429  ASP A C     1 
ATOM   3349 O  O     . ASP A 1 447 ? -17.866 40.956 46.944 1.00 55.10 ? 429  ASP A O     1 
ATOM   3350 C  CB    . ASP A 1 447 ? -20.714 41.752 47.665 1.00 57.47 ? 429  ASP A CB    1 
ATOM   3351 C  CG    . ASP A 1 447 ? -22.242 41.603 47.658 1.00 60.12 ? 429  ASP A CG    1 
ATOM   3352 O  OD1   . ASP A 1 447 ? -22.800 40.792 46.848 1.00 62.68 ? 429  ASP A OD1   1 
ATOM   3353 O  OD2   . ASP A 1 447 ? -22.868 42.331 48.470 1.00 63.15 ? 429  ASP A OD2   1 
ATOM   3354 N  N     . MET A 1 448 ? -17.821 40.610 49.142 1.00 53.42 ? 430  MET A N     1 
ATOM   3355 C  CA    . MET A 1 448 ? -16.370 40.586 49.192 1.00 52.04 ? 430  MET A CA    1 
ATOM   3356 C  C     . MET A 1 448 ? -15.936 39.247 48.618 1.00 48.31 ? 430  MET A C     1 
ATOM   3357 O  O     . MET A 1 448 ? -15.226 39.206 47.642 1.00 46.67 ? 430  MET A O     1 
ATOM   3358 C  CB    . MET A 1 448 ? -15.854 40.754 50.626 1.00 51.62 ? 430  MET A CB    1 
ATOM   3359 C  CG    . MET A 1 448 ? -14.402 41.233 50.675 1.00 55.04 ? 430  MET A CG    1 
ATOM   3360 S  SD    . MET A 1 448 ? -13.615 41.033 52.294 1.00 59.22 ? 430  MET A SD    1 
ATOM   3361 C  CE    . MET A 1 448 ? -12.440 39.693 51.963 1.00 60.83 ? 430  MET A CE    1 
ATOM   3362 N  N     . ASP A 1 449 ? -16.411 38.159 49.224 1.00 45.79 ? 431  ASP A N     1 
ATOM   3363 C  CA    . ASP A 1 449 ? -16.019 36.809 48.836 1.00 44.04 ? 431  ASP A CA    1 
ATOM   3364 C  C     . ASP A 1 449 ? -16.255 36.507 47.349 1.00 43.22 ? 431  ASP A C     1 
ATOM   3365 O  O     . ASP A 1 449 ? -15.343 35.977 46.663 1.00 42.78 ? 431  ASP A O     1 
ATOM   3366 C  CB    . ASP A 1 449 ? -16.687 35.805 49.748 1.00 43.12 ? 431  ASP A CB    1 
ATOM   3367 C  CG    . ASP A 1 449 ? -16.163 35.890 51.195 1.00 45.02 ? 431  ASP A CG    1 
ATOM   3368 O  OD1   . ASP A 1 449 ? -15.151 36.621 51.480 1.00 43.77 ? 431  ASP A OD1   1 
ATOM   3369 O  OD2   . ASP A 1 449 ? -16.769 35.205 52.060 1.00 46.99 ? 431  ASP A OD2   1 
ATOM   3370 N  N     . MET A 1 450 ? -17.408 36.942 46.834 1.00 41.97 ? 432  MET A N     1 
ATOM   3371 C  CA    . MET A 1 450 ? -17.776 36.680 45.430 1.00 41.95 ? 432  MET A CA    1 
ATOM   3372 C  C     . MET A 1 450 ? -16.828 37.165 44.349 1.00 41.21 ? 432  MET A C     1 
ATOM   3373 O  O     . MET A 1 450 ? -16.722 36.525 43.287 1.00 41.60 ? 432  MET A O     1 
ATOM   3374 C  CB    . MET A 1 450 ? -19.214 37.081 45.134 1.00 41.97 ? 432  MET A CB    1 
ATOM   3375 C  CG    . MET A 1 450 ? -20.245 36.212 45.870 1.00 43.07 ? 432  MET A CG    1 
ATOM   3376 S  SD    . MET A 1 450 ? -20.106 34.374 45.708 1.00 47.93 ? 432  MET A SD    1 
ATOM   3377 C  CE    . MET A 1 450 ? -18.944 33.961 47.073 1.00 45.30 ? 432  MET A CE    1 
ATOM   3378 N  N     . CYS A 1 451 ? -16.121 38.270 44.606 1.00 40.25 ? 433  CYS A N     1 
ATOM   3379 C  CA    . CYS A 1 451 ? -15.130 38.772 43.652 1.00 39.63 ? 433  CYS A CA    1 
ATOM   3380 C  C     . CYS A 1 451 ? -14.011 37.823 43.404 1.00 38.37 ? 433  CYS A C     1 
ATOM   3381 O  O     . CYS A 1 451 ? -13.304 37.952 42.400 1.00 37.86 ? 433  CYS A O     1 
ATOM   3382 C  CB    . CYS A 1 451 ? -14.502 40.053 44.139 1.00 40.44 ? 433  CYS A CB    1 
ATOM   3383 S  SG    . CYS A 1 451 ? -15.689 41.343 44.369 1.00 48.22 ? 433  CYS A SG    1 
ATOM   3384 N  N     . TYR A 1 452 ? -13.811 36.874 44.328 1.00 38.19 ? 434  TYR A N     1 
ATOM   3385 C  CA    . TYR A 1 452 ? -12.712 35.903 44.181 1.00 37.38 ? 434  TYR A CA    1 
ATOM   3386 C  C     . TYR A 1 452 ? -13.188 34.636 43.491 1.00 37.11 ? 434  TYR A C     1 
ATOM   3387 O  O     . TYR A 1 452 ? -12.368 33.927 42.913 1.00 38.90 ? 434  TYR A O     1 
ATOM   3388 C  CB    . TYR A 1 452 ? -12.119 35.506 45.526 1.00 37.06 ? 434  TYR A CB    1 
ATOM   3389 C  CG    . TYR A 1 452 ? -11.457 36.599 46.251 1.00 35.87 ? 434  TYR A CG    1 
ATOM   3390 C  CD1   . TYR A 1 452 ? -10.075 36.846 46.066 1.00 36.90 ? 434  TYR A CD1   1 
ATOM   3391 C  CD2   . TYR A 1 452 ? -12.180 37.401 47.126 1.00 34.53 ? 434  TYR A CD2   1 
ATOM   3392 C  CE1   . TYR A 1 452 ? -9.435  37.877 46.746 1.00 35.74 ? 434  TYR A CE1   1 
ATOM   3393 C  CE2   . TYR A 1 452 ? -11.563 38.439 47.815 1.00 37.11 ? 434  TYR A CE2   1 
ATOM   3394 C  CZ    . TYR A 1 452 ? -10.189 38.670 47.627 1.00 37.87 ? 434  TYR A CZ    1 
ATOM   3395 O  OH    . TYR A 1 452 ? -9.560  39.702 48.317 1.00 40.77 ? 434  TYR A OH    1 
ATOM   3396 N  N     . GLY A 1 453 ? -14.488 34.343 43.571 1.00 35.14 ? 435  GLY A N     1 
ATOM   3397 C  CA    . GLY A 1 453 ? -14.981 33.069 43.090 1.00 33.93 ? 435  GLY A CA    1 
ATOM   3398 C  C     . GLY A 1 453 ? -16.066 32.624 44.022 1.00 33.51 ? 435  GLY A C     1 
ATOM   3399 O  O     . GLY A 1 453 ? -16.317 33.295 45.024 1.00 33.33 ? 435  GLY A O     1 
ATOM   3400 N  N     . MET A 1 454 ? -16.688 31.487 43.710 1.00 32.66 ? 436  MET A N     1 
ATOM   3401 C  CA    . MET A 1 454 ? -17.822 30.997 44.474 1.00 33.07 ? 436  MET A CA    1 
ATOM   3402 C  C     . MET A 1 454 ? -17.422 30.493 45.838 1.00 32.54 ? 436  MET A C     1 
ATOM   3403 O  O     . MET A 1 454 ? -18.209 30.522 46.784 1.00 32.21 ? 436  MET A O     1 
ATOM   3404 C  CB    . MET A 1 454 ? -18.535 29.893 43.686 1.00 33.82 ? 436  MET A CB    1 
ATOM   3405 C  CG    . MET A 1 454 ? -19.073 30.424 42.345 1.00 33.86 ? 436  MET A CG    1 
ATOM   3406 S  SD    . MET A 1 454 ? -20.570 31.433 42.701 1.00 37.45 ? 436  MET A SD    1 
ATOM   3407 C  CE    . MET A 1 454 ? -21.862 30.157 42.613 1.00 34.47 ? 436  MET A CE    1 
ATOM   3408 N  N     . MET A 1 455 ? -16.169 30.072 45.947 1.00 32.82 ? 437  MET A N     1 
ATOM   3409 C  CA    . MET A 1 455 ? -15.623 29.599 47.245 1.00 32.67 ? 437  MET A CA    1 
ATOM   3410 C  C     . MET A 1 455 ? -14.702 30.650 47.886 1.00 31.32 ? 437  MET A C     1 
ATOM   3411 O  O     . MET A 1 455 ? -13.915 30.313 48.745 1.00 30.79 ? 437  MET A O     1 
ATOM   3412 C  CB    . MET A 1 455 ? -14.861 28.286 47.049 1.00 32.45 ? 437  MET A CB    1 
ATOM   3413 C  CG    . MET A 1 455 ? -15.803 27.153 46.731 1.00 35.84 ? 437  MET A CG    1 
ATOM   3414 S  SD    . MET A 1 455 ? -16.795 26.762 48.205 1.00 42.31 ? 437  MET A SD    1 
ATOM   3415 C  CE    . MET A 1 455 ? -17.826 25.468 47.596 1.00 32.92 ? 437  MET A CE    1 
ATOM   3416 N  N     . GLY A 1 456 ? -14.763 31.892 47.407 1.00 30.12 ? 438  GLY A N     1 
ATOM   3417 C  CA    . GLY A 1 456 ? -14.110 33.025 48.073 1.00 27.07 ? 438  GLY A CA    1 
ATOM   3418 C  C     . GLY A 1 456 ? -12.614 32.979 47.948 1.00 26.40 ? 438  GLY A C     1 
ATOM   3419 O  O     . GLY A 1 456 ? -12.051 32.140 47.234 1.00 25.38 ? 438  GLY A O     1 
ATOM   3420 N  N     . SER A 1 457 ? -11.967 33.926 48.618 1.00 24.83 ? 439  SER A N     1 
ATOM   3421 C  CA    . SER A 1 457 ? -10.559 33.997 48.700 1.00 24.46 ? 439  SER A CA    1 
ATOM   3422 C  C     . SER A 1 457 ? -9.909  32.771 49.380 1.00 24.59 ? 439  SER A C     1 
ATOM   3423 O  O     . SER A 1 457 ? -10.463 32.149 50.320 1.00 25.02 ? 439  SER A O     1 
ATOM   3424 C  CB    . SER A 1 457 ? -10.229 35.206 49.538 1.00 24.35 ? 439  SER A CB    1 
ATOM   3425 O  OG    . SER A 1 457 ? -8.819  35.298 49.636 1.00 23.79 ? 439  SER A OG    1 
ATOM   3426 N  N     . LEU A 1 458 ? -8.715  32.491 48.923 1.00 23.35 ? 440  LEU A N     1 
ATOM   3427 C  CA    . LEU A 1 458 ? -7.853  31.471 49.435 1.00 23.70 ? 440  LEU A CA    1 
ATOM   3428 C  C     . LEU A 1 458 ? -7.528  31.768 50.908 1.00 23.09 ? 440  LEU A C     1 
ATOM   3429 O  O     . LEU A 1 458 ? -7.381  30.858 51.687 1.00 22.46 ? 440  LEU A O     1 
ATOM   3430 C  CB    . LEU A 1 458 ? -6.571  31.542 48.596 1.00 24.01 ? 440  LEU A CB    1 
ATOM   3431 C  CG    . LEU A 1 458 ? -5.389  30.666 48.929 1.00 25.15 ? 440  LEU A CG    1 
ATOM   3432 C  CD1   . LEU A 1 458 ? -5.706  29.188 48.810 1.00 27.24 ? 440  LEU A CD1   1 
ATOM   3433 C  CD2   . LEU A 1 458 ? -4.280  31.035 48.002 1.00 29.21 ? 440  LEU A CD2   1 
ATOM   3434 N  N     . PHE A 1 459 ? -7.508  33.045 51.282 1.00 23.63 ? 441  PHE A N     1 
ATOM   3435 C  CA    . PHE A 1 459 ? -7.007  33.502 52.609 1.00 24.72 ? 441  PHE A CA    1 
ATOM   3436 C  C     . PHE A 1 459 ? -8.004  33.845 53.711 1.00 26.02 ? 441  PHE A C     1 
ATOM   3437 O  O     . PHE A 1 459 ? -7.606  33.920 54.887 1.00 26.09 ? 441  PHE A O     1 
ATOM   3438 C  CB    . PHE A 1 459 ? -6.097  34.678 52.448 1.00 22.71 ? 441  PHE A CB    1 
ATOM   3439 C  CG    . PHE A 1 459 ? -4.923  34.413 51.528 1.00 23.54 ? 441  PHE A CG    1 
ATOM   3440 C  CD1   . PHE A 1 459 ? -3.886  33.614 51.943 1.00 22.08 ? 441  PHE A CD1   1 
ATOM   3441 C  CD2   . PHE A 1 459 ? -4.878  35.010 50.234 1.00 24.38 ? 441  PHE A CD2   1 
ATOM   3442 C  CE1   . PHE A 1 459 ? -2.767  33.392 51.140 1.00 24.41 ? 441  PHE A CE1   1 
ATOM   3443 C  CE2   . PHE A 1 459 ? -3.802  34.791 49.391 1.00 26.04 ? 441  PHE A CE2   1 
ATOM   3444 C  CZ    . PHE A 1 459 ? -2.710  33.991 49.854 1.00 25.86 ? 441  PHE A CZ    1 
ATOM   3445 N  N     . ARG A 1 460 ? -9.259  34.031 53.331 1.00 26.27 ? 442  ARG A N     1 
ATOM   3446 C  CA    . ARG A 1 460 ? -10.319 34.489 54.219 1.00 28.96 ? 442  ARG A CA    1 
ATOM   3447 C  C     . ARG A 1 460 ? -11.719 34.359 53.580 1.00 30.86 ? 442  ARG A C     1 
ATOM   3448 O  O     . ARG A 1 460 ? -11.843 34.216 52.387 1.00 31.70 ? 442  ARG A O     1 
ATOM   3449 C  CB    . ARG A 1 460 ? -10.130 35.961 54.611 1.00 29.31 ? 442  ARG A CB    1 
ATOM   3450 C  CG    . ARG A 1 460 ? -9.901  36.931 53.468 1.00 29.12 ? 442  ARG A CG    1 
ATOM   3451 C  CD    . ARG A 1 460 ? -9.590  38.356 53.991 1.00 28.46 ? 442  ARG A CD    1 
ATOM   3452 N  NE    . ARG A 1 460 ? -8.473  38.480 54.937 1.00 31.78 ? 442  ARG A NE    1 
ATOM   3453 C  CZ    . ARG A 1 460 ? -8.609  38.606 56.268 1.00 33.43 ? 442  ARG A CZ    1 
ATOM   3454 N  NH1   . ARG A 1 460 ? -7.539  38.732 57.057 1.00 35.34 ? 442  ARG A NH1   1 
ATOM   3455 N  NH2   . ARG A 1 460 ? -9.802  38.592 56.818 1.00 33.86 ? 442  ARG A NH2   1 
ATOM   3456 N  N     . SER A 1 461 ? -12.733 34.312 54.431 1.00 32.87 ? 443  SER A N     1 
ATOM   3457 C  CA    . SER A 1 461 ? -14.100 34.629 54.128 1.00 32.89 ? 443  SER A CA    1 
ATOM   3458 C  C     . SER A 1 461 ? -14.381 35.841 54.987 1.00 33.28 ? 443  SER A C     1 
ATOM   3459 O  O     . SER A 1 461 ? -14.489 35.739 56.180 1.00 33.92 ? 443  SER A O     1 
ATOM   3460 C  CB    . SER A 1 461 ? -14.980 33.445 54.489 1.00 33.24 ? 443  SER A CB    1 
ATOM   3461 O  OG    . SER A 1 461 ? -16.353 33.783 54.446 1.00 35.58 ? 443  SER A OG    1 
ATOM   3462 N  N     . GLY A 1 462 ? -14.392 37.025 54.388 1.00 34.78 ? 444  GLY A N     1 
ATOM   3463 C  CA    . GLY A 1 462 ? -14.687 38.234 55.145 1.00 34.33 ? 444  GLY A CA    1 
ATOM   3464 C  C     . GLY A 1 462 ? -13.561 38.535 56.120 1.00 35.82 ? 444  GLY A C     1 
ATOM   3465 O  O     . GLY A 1 462 ? -12.354 38.684 55.715 1.00 36.34 ? 444  GLY A O     1 
ATOM   3466 N  N     . SER A 1 463 ? -13.924 38.583 57.405 1.00 34.91 ? 445  SER A N     1 
ATOM   3467 C  CA    . SER A 1 463 ? -12.982 38.908 58.466 1.00 34.54 ? 445  SER A CA    1 
ATOM   3468 C  C     . SER A 1 463 ? -12.385 37.653 59.161 1.00 33.26 ? 445  SER A C     1 
ATOM   3469 O  O     . SER A 1 463 ? -11.635 37.753 60.133 1.00 33.38 ? 445  SER A O     1 
ATOM   3470 C  CB    . SER A 1 463 ? -13.674 39.848 59.453 1.00 34.33 ? 445  SER A CB    1 
ATOM   3471 O  OG    . SER A 1 463 ? -14.408 39.075 60.395 1.00 40.02 ? 445  SER A OG    1 
ATOM   3472 N  N     A ARG A 1 464 ? -12.703 36.475 58.636 0.50 32.69 ? 446  ARG A N     1 
ATOM   3473 N  N     B ARG A 1 464 ? -12.797 36.477 58.692 0.50 32.46 ? 446  ARG A N     1 
ATOM   3474 C  CA    A ARG A 1 464 ? -12.211 35.234 59.207 0.50 31.39 ? 446  ARG A CA    1 
ATOM   3475 C  CA    B ARG A 1 464 ? -12.255 35.216 59.161 0.50 31.00 ? 446  ARG A CA    1 
ATOM   3476 C  C     A ARG A 1 464 ? -11.184 34.527 58.317 0.50 30.83 ? 446  ARG A C     1 
ATOM   3477 C  C     B ARG A 1 464 ? -11.097 34.787 58.235 0.50 30.36 ? 446  ARG A C     1 
ATOM   3478 O  O     A ARG A 1 464 ? -11.515 34.040 57.226 0.50 30.65 ? 446  ARG A O     1 
ATOM   3479 O  O     B ARG A 1 464 ? -11.242 34.782 57.024 0.50 29.94 ? 446  ARG A O     1 
ATOM   3480 C  CB    A ARG A 1 464 ? -13.380 34.306 59.513 0.50 31.59 ? 446  ARG A CB    1 
ATOM   3481 C  CB    B ARG A 1 464 ? -13.349 34.122 59.189 0.50 31.13 ? 446  ARG A CB    1 
ATOM   3482 C  CG    A ARG A 1 464 ? -14.438 34.987 60.325 0.50 30.98 ? 446  ARG A CG    1 
ATOM   3483 C  CG    B ARG A 1 464 ? -14.633 34.425 60.001 0.50 30.02 ? 446  ARG A CG    1 
ATOM   3484 C  CD    A ARG A 1 464 ? -15.571 34.104 60.542 0.50 30.36 ? 446  ARG A CD    1 
ATOM   3485 C  CD    B ARG A 1 464 ? -15.644 35.311 59.217 0.50 31.90 ? 446  ARG A CD    1 
ATOM   3486 N  NE    A ARG A 1 464 ? -15.295 33.218 61.653 0.50 35.87 ? 446  ARG A NE    1 
ATOM   3487 N  NE    B ARG A 1 464 ? -16.383 34.649 58.130 0.50 29.00 ? 446  ARG A NE    1 
ATOM   3488 C  CZ    A ARG A 1 464 ? -16.136 32.277 62.079 0.50 36.82 ? 446  ARG A CZ    1 
ATOM   3489 C  CZ    B ARG A 1 464 ? -17.293 33.680 58.312 0.50 31.30 ? 446  ARG A CZ    1 
ATOM   3490 N  NH1   A ARG A 1 464 ? -17.302 32.097 61.467 0.50 35.43 ? 446  ARG A NH1   1 
ATOM   3491 N  NH1   B ARG A 1 464 ? -17.571 33.234 59.537 0.50 27.08 ? 446  ARG A NH1   1 
ATOM   3492 N  NH2   A ARG A 1 464 ? -15.803 31.519 63.106 0.50 37.53 ? 446  ARG A NH2   1 
ATOM   3493 N  NH2   B ARG A 1 464 ? -17.909 33.121 57.252 0.50 32.19 ? 446  ARG A NH2   1 
ATOM   3494 N  N     . GLN A 1 465 ? -9.949  34.449 58.813 1.00 29.82 ? 447  GLN A N     1 
ATOM   3495 C  CA    . GLN A 1 465 ? -8.879  33.782 58.093 1.00 28.12 ? 447  GLN A CA    1 
ATOM   3496 C  C     . GLN A 1 465 ? -9.142  32.281 57.926 1.00 27.17 ? 447  GLN A C     1 
ATOM   3497 O  O     . GLN A 1 465 ? -9.726  31.615 58.788 1.00 25.34 ? 447  GLN A O     1 
ATOM   3498 C  CB    . GLN A 1 465 ? -7.554  34.018 58.811 1.00 28.41 ? 447  GLN A CB    1 
ATOM   3499 C  CG    . GLN A 1 465 ? -7.098  35.429 58.713 1.00 29.66 ? 447  GLN A CG    1 
ATOM   3500 C  CD    . GLN A 1 465 ? -5.717  35.579 59.221 1.00 35.32 ? 447  GLN A CD    1 
ATOM   3501 O  OE1   . GLN A 1 465 ? -5.459  35.262 60.374 1.00 40.79 ? 447  GLN A OE1   1 
ATOM   3502 N  NE2   . GLN A 1 465 ? -4.797  36.042 58.375 1.00 31.13 ? 447  GLN A NE2   1 
ATOM   3503 N  N     . THR A 1 466 ? -8.719  31.750 56.791 1.00 26.26 ? 448  THR A N     1 
ATOM   3504 C  CA    . THR A 1 466 ? -8.852  30.321 56.546 1.00 24.64 ? 448  THR A CA    1 
ATOM   3505 C  C     . THR A 1 466 ? -7.736  29.552 57.229 1.00 23.83 ? 448  THR A C     1 
ATOM   3506 O  O     . THR A 1 466 ? -6.684  30.137 57.578 1.00 24.37 ? 448  THR A O     1 
ATOM   3507 C  CB    . THR A 1 466 ? -8.775  30.016 55.032 1.00 24.03 ? 448  THR A CB    1 
ATOM   3508 O  OG1   . THR A 1 466 ? -7.559  30.550 54.497 1.00 24.71 ? 448  THR A OG1   1 
ATOM   3509 C  CG2   . THR A 1 466 ? -9.963  30.593 54.295 1.00 24.45 ? 448  THR A CG2   1 
ATOM   3510 N  N     . LEU A 1 467 ? -7.923  28.243 57.351 1.00 23.13 ? 449  LEU A N     1 
ATOM   3511 C  CA    . LEU A 1 467 ? -6.866  27.347 57.718 1.00 24.21 ? 449  LEU A CA    1 
ATOM   3512 C  C     . LEU A 1 467 ? -5.586  27.590 56.912 1.00 24.01 ? 449  LEU A C     1 
ATOM   3513 O  O     . LEU A 1 467 ? -4.483  27.616 57.453 1.00 26.28 ? 449  LEU A O     1 
ATOM   3514 C  CB    . LEU A 1 467 ? -7.350  25.906 57.558 1.00 23.10 ? 449  LEU A CB    1 
ATOM   3515 C  CG    . LEU A 1 467 ? -6.316  24.804 57.719 1.00 27.13 ? 449  LEU A CG    1 
ATOM   3516 C  CD1   . LEU A 1 467 ? -5.731  24.703 59.249 1.00 28.52 ? 449  LEU A CD1   1 
ATOM   3517 C  CD2   . LEU A 1 467 ? -6.891  23.480 57.304 1.00 20.48 ? 449  LEU A CD2   1 
ATOM   3518 N  N     . PHE A 1 468 ? -5.732  27.769 55.605 1.00 24.50 ? 450  PHE A N     1 
ATOM   3519 C  CA    . PHE A 1 468 ? -4.605  27.859 54.723 1.00 22.56 ? 450  PHE A CA    1 
ATOM   3520 C  C     . PHE A 1 468 ? -3.836  29.118 55.064 1.00 22.90 ? 450  PHE A C     1 
ATOM   3521 O  O     . PHE A 1 468 ? -2.638  29.038 55.261 1.00 24.03 ? 450  PHE A O     1 
ATOM   3522 C  CB    . PHE A 1 468 ? -5.077  27.850 53.235 1.00 24.42 ? 450  PHE A CB    1 
ATOM   3523 C  CG    . PHE A 1 468 ? -3.940  27.975 52.251 1.00 18.90 ? 450  PHE A CG    1 
ATOM   3524 C  CD1   . PHE A 1 468 ? -3.314  26.854 51.757 1.00 21.81 ? 450  PHE A CD1   1 
ATOM   3525 C  CD2   . PHE A 1 468 ? -3.503  29.219 51.846 1.00 19.75 ? 450  PHE A CD2   1 
ATOM   3526 C  CE1   . PHE A 1 468 ? -2.210  26.985 50.848 1.00 23.73 ? 450  PHE A CE1   1 
ATOM   3527 C  CE2   . PHE A 1 468 ? -2.370  29.365 50.994 1.00 18.70 ? 450  PHE A CE2   1 
ATOM   3528 C  CZ    . PHE A 1 468 ? -1.762  28.254 50.492 1.00 20.75 ? 450  PHE A CZ    1 
ATOM   3529 N  N     . ALA A 1 469 ? -4.508  30.272 55.193 1.00 22.28 ? 451  ALA A N     1 
ATOM   3530 C  CA    . ALA A 1 469 ? -3.837  31.489 55.691 1.00 22.52 ? 451  ALA A CA    1 
ATOM   3531 C  C     . ALA A 1 469 ? -3.032  31.340 57.013 1.00 23.58 ? 451  ALA A C     1 
ATOM   3532 O  O     . ALA A 1 469 ? -1.880  31.793 57.108 1.00 24.20 ? 451  ALA A O     1 
ATOM   3533 C  CB    . ALA A 1 469 ? -4.821  32.646 55.802 1.00 20.95 ? 451  ALA A CB    1 
ATOM   3534 N  N     A SER A 1 470 ? -3.640  30.755 58.049 0.50 24.34 ? 452  SER A N     1 
ATOM   3535 N  N     B SER A 1 470 ? -3.660  30.723 58.007 0.50 24.25 ? 452  SER A N     1 
ATOM   3536 C  CA    A SER A 1 470 ? -2.907  30.516 59.312 0.50 24.88 ? 452  SER A CA    1 
ATOM   3537 C  CA    B SER A 1 470 ? -3.026  30.436 59.295 0.50 24.65 ? 452  SER A CA    1 
ATOM   3538 C  C     A SER A 1 470 ? -1.663  29.639 59.132 0.50 24.54 ? 452  SER A C     1 
ATOM   3539 C  C     B SER A 1 470 ? -1.750  29.586 59.195 0.50 24.43 ? 452  SER A C     1 
ATOM   3540 O  O     A SER A 1 470 ? -0.615  29.944 59.707 0.50 23.98 ? 452  SER A O     1 
ATOM   3541 O  O     B SER A 1 470 ? -0.759  29.879 59.868 0.50 23.92 ? 452  SER A O     1 
ATOM   3542 C  CB    A SER A 1 470 ? -3.804  29.963 60.439 0.50 25.40 ? 452  SER A CB    1 
ATOM   3543 C  CB    B SER A 1 470 ? -4.061  29.839 60.259 0.50 25.09 ? 452  SER A CB    1 
ATOM   3544 O  OG    A SER A 1 470 ? -4.199  28.645 60.175 0.50 24.64 ? 452  SER A OG    1 
ATOM   3545 O  OG    B SER A 1 470 ? -5.116  30.787 60.385 0.50 22.84 ? 452  SER A OG    1 
ATOM   3546 N  N     . GLN A 1 471 ? -1.757  28.586 58.314 1.00 24.06 ? 453  GLN A N     1 
ATOM   3547 C  CA    . GLN A 1 471 ? -0.555  27.754 58.070 1.00 23.11 ? 453  GLN A CA    1 
ATOM   3548 C  C     . GLN A 1 471 ? 0.507   28.447 57.241 1.00 22.65 ? 453  GLN A C     1 
ATOM   3549 O  O     . GLN A 1 471 ? 1.682   28.223 57.426 1.00 21.61 ? 453  GLN A O     1 
ATOM   3550 C  CB    . GLN A 1 471 ? -0.919  26.451 57.374 1.00 24.69 ? 453  GLN A CB    1 
ATOM   3551 C  CG    . GLN A 1 471 ? -1.884  25.551 58.095 1.00 24.97 ? 453  GLN A CG    1 
ATOM   3552 C  CD    . GLN A 1 471 ? -2.246  24.417 57.181 1.00 33.16 ? 453  GLN A CD    1 
ATOM   3553 O  OE1   . GLN A 1 471 ? -2.338  24.593 55.969 1.00 39.55 ? 453  GLN A OE1   1 
ATOM   3554 N  NE2   . GLN A 1 471 ? -2.464  23.262 57.732 1.00 34.71 ? 453  GLN A NE2   1 
ATOM   3555 N  N     . VAL A 1 472 ? 0.097   29.273 56.287 1.00 22.46 ? 454  VAL A N     1 
ATOM   3556 C  CA    . VAL A 1 472 ? 1.067   30.167 55.660 1.00 20.95 ? 454  VAL A CA    1 
ATOM   3557 C  C     . VAL A 1 472 ? 1.782   31.001 56.705 1.00 21.93 ? 454  VAL A C     1 
ATOM   3558 O  O     . VAL A 1 472 ? 3.023   30.977 56.758 1.00 23.22 ? 454  VAL A O     1 
ATOM   3559 C  CB    . VAL A 1 472 ? 0.435   31.137 54.640 1.00 19.94 ? 454  VAL A CB    1 
ATOM   3560 C  CG1   . VAL A 1 472 ? 1.496   32.118 54.198 1.00 19.25 ? 454  VAL A CG1   1 
ATOM   3561 C  CG2   . VAL A 1 472 ? -0.185  30.377 53.421 1.00 14.89 ? 454  VAL A CG2   1 
ATOM   3562 N  N     . MET A 1 473 ? 1.027   31.724 57.532 1.00 22.18 ? 455  MET A N     1 
ATOM   3563 C  CA    . MET A 1 473 ? 1.625   32.578 58.560 1.00 25.84 ? 455  MET A CA    1 
ATOM   3564 C  C     . MET A 1 473 ? 2.493   31.806 59.552 1.00 25.41 ? 455  MET A C     1 
ATOM   3565 O  O     . MET A 1 473 ? 3.587   32.285 59.929 1.00 25.87 ? 455  MET A O     1 
ATOM   3566 C  CB    . MET A 1 473 ? 0.557   33.348 59.316 1.00 26.05 ? 455  MET A CB    1 
ATOM   3567 C  CG    . MET A 1 473 ? -0.115  34.439 58.513 1.00 27.18 ? 455  MET A CG    1 
ATOM   3568 S  SD    . MET A 1 473 ? -1.450  35.113 59.534 1.00 33.35 ? 455  MET A SD    1 
ATOM   3569 C  CE    . MET A 1 473 ? -0.611  36.420 60.413 1.00 35.47 ? 455  MET A CE    1 
ATOM   3570 N  N     A ARG A 1 474 ? 2.007   30.617 59.938 0.50 25.16 ? 456  ARG A N     1 
ATOM   3571 N  N     B ARG A 1 474 ? 2.048   30.609 59.928 0.50 25.18 ? 456  ARG A N     1 
ATOM   3572 C  CA    A ARG A 1 474 ? 2.677   29.694 60.849 0.50 25.84 ? 456  ARG A CA    1 
ATOM   3573 C  CA    B ARG A 1 474 ? 2.782   29.786 60.861 0.50 25.74 ? 456  ARG A CA    1 
ATOM   3574 C  C     A ARG A 1 474 ? 3.990   29.068 60.302 0.50 25.60 ? 456  ARG A C     1 
ATOM   3575 C  C     B ARG A 1 474 ? 4.036   29.069 60.296 0.50 25.56 ? 456  ARG A C     1 
ATOM   3576 O  O     A ARG A 1 474 ? 5.007   29.086 60.982 0.50 25.62 ? 456  ARG A O     1 
ATOM   3577 O  O     B ARG A 1 474 ? 5.057   29.008 60.967 0.50 25.54 ? 456  ARG A O     1 
ATOM   3578 C  CB    A ARG A 1 474 ? 1.688   28.600 61.302 0.50 25.31 ? 456  ARG A CB    1 
ATOM   3579 C  CB    B ARG A 1 474 ? 1.837   28.791 61.516 0.50 25.58 ? 456  ARG A CB    1 
ATOM   3580 C  CG    A ARG A 1 474 ? 2.100   27.792 62.558 0.50 28.17 ? 456  ARG A CG    1 
ATOM   3581 C  CG    B ARG A 1 474 ? 2.337   28.268 62.851 0.50 28.77 ? 456  ARG A CG    1 
ATOM   3582 C  CD    A ARG A 1 474 ? 0.903   27.052 63.265 0.50 27.07 ? 456  ARG A CD    1 
ATOM   3583 C  CD    B ARG A 1 474 ? 1.361   27.249 63.393 0.50 31.63 ? 456  ARG A CD    1 
ATOM   3584 N  NE    A ARG A 1 474 ? -0.251  27.928 63.507 0.50 29.46 ? 456  ARG A NE    1 
ATOM   3585 N  NE    B ARG A 1 474 ? 1.977   26.433 64.412 0.50 33.96 ? 456  ARG A NE    1 
ATOM   3586 C  CZ    A ARG A 1 474 ? -0.278  28.929 64.401 0.50 30.49 ? 456  ARG A CZ    1 
ATOM   3587 C  CZ    B ARG A 1 474 ? 1.367   25.424 65.024 0.50 34.88 ? 456  ARG A CZ    1 
ATOM   3588 N  NH1   A ARG A 1 474 ? 0.787   29.212 65.158 0.50 29.49 ? 456  ARG A NH1   1 
ATOM   3589 N  NH1   B ARG A 1 474 ? 0.116   25.105 64.696 0.50 33.13 ? 456  ARG A NH1   1 
ATOM   3590 N  NH2   A ARG A 1 474 ? -1.374  29.663 64.537 0.50 26.66 ? 456  ARG A NH2   1 
ATOM   3591 N  NH2   B ARG A 1 474 ? 2.017   24.741 65.959 0.50 32.59 ? 456  ARG A NH2   1 
ATOM   3592 N  N     . TYR A 1 475 ? 3.951   28.500 59.101 1.00 25.05 ? 457  TYR A N     1 
ATOM   3593 C  CA    . TYR A 1 475 ? 5.092   27.758 58.539 1.00 24.92 ? 457  TYR A CA    1 
ATOM   3594 C  C     . TYR A 1 475 ? 5.963   28.383 57.455 1.00 23.99 ? 457  TYR A C     1 
ATOM   3595 O  O     . TYR A 1 475 ? 7.068   27.914 57.247 1.00 24.29 ? 457  TYR A O     1 
ATOM   3596 C  CB    . TYR A 1 475 ? 4.634   26.386 58.064 1.00 26.02 ? 457  TYR A CB    1 
ATOM   3597 C  CG    . TYR A 1 475 ? 4.055   25.648 59.195 1.00 26.93 ? 457  TYR A CG    1 
ATOM   3598 C  CD1   . TYR A 1 475 ? 4.872   25.175 60.242 1.00 29.62 ? 457  TYR A CD1   1 
ATOM   3599 C  CD2   . TYR A 1 475 ? 2.686   25.495 59.291 1.00 27.99 ? 457  TYR A CD2   1 
ATOM   3600 C  CE1   . TYR A 1 475 ? 4.311   24.533 61.366 1.00 30.83 ? 457  TYR A CE1   1 
ATOM   3601 C  CE2   . TYR A 1 475 ? 2.105   24.860 60.366 1.00 29.21 ? 457  TYR A CE2   1 
ATOM   3602 C  CZ    . TYR A 1 475 ? 2.907   24.372 61.389 1.00 31.52 ? 457  TYR A CZ    1 
ATOM   3603 O  OH    . TYR A 1 475 ? 2.287   23.741 62.422 1.00 34.70 ? 457  TYR A OH    1 
ATOM   3604 N  N     . ALA A 1 476 ? 5.469   29.392 56.746 1.00 23.09 ? 458  ALA A N     1 
ATOM   3605 C  CA    . ALA A 1 476 ? 6.249   29.961 55.645 1.00 23.15 ? 458  ALA A CA    1 
ATOM   3606 C  C     . ALA A 1 476 ? 6.921   31.213 56.166 1.00 22.85 ? 458  ALA A C     1 
ATOM   3607 O  O     . ALA A 1 476 ? 6.232   32.167 56.489 1.00 23.37 ? 458  ALA A O     1 
ATOM   3608 C  CB    . ALA A 1 476 ? 5.317   30.276 54.461 1.00 21.91 ? 458  ALA A CB    1 
ATOM   3609 N  N     . ASP A 1 477 ? 8.254   31.208 56.279 1.00 23.71 ? 459  ASP A N     1 
ATOM   3610 C  CA    . ASP A 1 477 ? 9.003   32.368 56.778 1.00 24.58 ? 459  ASP A CA    1 
ATOM   3611 C  C     . ASP A 1 477 ? 8.806   33.470 55.819 1.00 25.39 ? 459  ASP A C     1 
ATOM   3612 O  O     . ASP A 1 477 ? 8.598   34.617 56.216 1.00 26.37 ? 459  ASP A O     1 
ATOM   3613 C  CB    . ASP A 1 477 ? 10.509  32.067 56.874 1.00 25.01 ? 459  ASP A CB    1 
ATOM   3614 C  CG    . ASP A 1 477 ? 10.800  30.921 57.856 1.00 27.78 ? 459  ASP A CG    1 
ATOM   3615 O  OD1   . ASP A 1 477 ? 9.967   30.744 58.784 1.00 33.39 ? 459  ASP A OD1   1 
ATOM   3616 O  OD2   . ASP A 1 477 ? 11.782  30.165 57.685 1.00 27.11 ? 459  ASP A OD2   1 
ATOM   3617 N  N     . LEU A 1 478 ? 8.853   33.100 54.525 1.00 25.45 ? 460  LEU A N     1 
ATOM   3618 C  CA    . LEU A 1 478 ? 8.666   34.026 53.398 1.00 23.68 ? 460  LEU A CA    1 
ATOM   3619 C  C     . LEU A 1 478 ? 7.664   33.459 52.395 1.00 21.36 ? 460  LEU A C     1 
ATOM   3620 O  O     . LEU A 1 478 ? 7.481   32.256 52.296 1.00 20.18 ? 460  LEU A O     1 
ATOM   3621 C  CB    . LEU A 1 478 ? 10.003  34.228 52.685 1.00 24.82 ? 460  LEU A CB    1 
ATOM   3622 C  CG    . LEU A 1 478 ? 11.280  34.633 53.413 1.00 25.44 ? 460  LEU A CG    1 
ATOM   3623 C  CD1   . LEU A 1 478 ? 12.437  34.395 52.380 1.00 25.45 ? 460  LEU A CD1   1 
ATOM   3624 C  CD2   . LEU A 1 478 ? 11.203  36.127 53.886 1.00 19.83 ? 460  LEU A CD2   1 
ATOM   3625 N  N     . TYR A 1 479 ? 6.990   34.339 51.662 1.00 21.15 ? 461  TYR A N     1 
ATOM   3626 C  CA    . TYR A 1 479 ? 6.033   33.920 50.669 1.00 21.83 ? 461  TYR A CA    1 
ATOM   3627 C  C     . TYR A 1 479 ? 5.831   34.974 49.590 1.00 23.06 ? 461  TYR A C     1 
ATOM   3628 O  O     . TYR A 1 479 ? 6.068   36.189 49.811 1.00 24.38 ? 461  TYR A O     1 
ATOM   3629 C  CB    . TYR A 1 479 ? 4.730   33.408 51.270 1.00 21.28 ? 461  TYR A CB    1 
ATOM   3630 C  CG    . TYR A 1 479 ? 3.823   34.458 51.773 1.00 22.25 ? 461  TYR A CG    1 
ATOM   3631 C  CD1   . TYR A 1 479 ? 2.851   34.986 50.954 1.00 21.34 ? 461  TYR A CD1   1 
ATOM   3632 C  CD2   . TYR A 1 479 ? 3.940   34.969 53.099 1.00 22.06 ? 461  TYR A CD2   1 
ATOM   3633 C  CE1   . TYR A 1 479 ? 1.949   35.983 51.399 1.00 23.66 ? 461  TYR A CE1   1 
ATOM   3634 C  CE2   . TYR A 1 479 ? 3.039   35.974 53.579 1.00 23.58 ? 461  TYR A CE2   1 
ATOM   3635 C  CZ    . TYR A 1 479 ? 2.046   36.463 52.732 1.00 26.51 ? 461  TYR A CZ    1 
ATOM   3636 O  OH    . TYR A 1 479 ? 1.149   37.410 53.156 1.00 24.70 ? 461  TYR A OH    1 
ATOM   3637 N  N     . ALA A 1 480 ? 5.432   34.531 48.405 1.00 23.11 ? 462  ALA A N     1 
ATOM   3638 C  CA    . ALA A 1 480 ? 5.331   35.474 47.253 1.00 24.94 ? 462  ALA A CA    1 
ATOM   3639 C  C     . ALA A 1 480 ? 4.532   34.817 46.204 1.00 25.12 ? 462  ALA A C     1 
ATOM   3640 O  O     . ALA A 1 480 ? 4.343   33.581 46.236 1.00 25.39 ? 462  ALA A O     1 
ATOM   3641 C  CB    . ALA A 1 480 ? 6.735   35.823 46.674 1.00 24.19 ? 462  ALA A CB    1 
ATOM   3642 N  N     . ALA A 1 481 ? 4.070   35.632 45.245 1.00 26.25 ? 463  ALA A N     1 
ATOM   3643 C  CA    . ALA A 1 481 ? 3.363   35.095 44.075 1.00 25.25 ? 463  ALA A CA    1 
ATOM   3644 C  C     . ALA A 1 481 ? 4.313   34.221 43.244 1.00 25.43 ? 463  ALA A C     1 
ATOM   3645 O  O     . ALA A 1 481 ? 3.871   33.266 42.589 1.00 24.86 ? 463  ALA A O     1 
ATOM   3646 C  CB    . ALA A 1 481 ? 2.783   36.188 43.272 1.00 26.59 ? 463  ALA A CB    1 
ATOM   3647 N  N     . SER A 1 482 ? 5.619   34.487 43.320 1.00 24.49 ? 464  SER A N     1 
ATOM   3648 C  CA    . SER A 1 482 ? 6.581   33.706 42.528 1.00 25.89 ? 464  SER A CA    1 
ATOM   3649 C  C     . SER A 1 482 ? 7.905   33.709 43.240 1.00 25.96 ? 464  SER A C     1 
ATOM   3650 O  O     . SER A 1 482 ? 8.204   34.675 43.880 1.00 26.88 ? 464  SER A O     1 
ATOM   3651 C  CB    . SER A 1 482 ? 6.751   34.367 41.144 1.00 25.57 ? 464  SER A CB    1 
ATOM   3652 O  OG    . SER A 1 482 ? 7.849   33.830 40.432 1.00 28.12 ? 464  SER A OG    1 
ATOM   3653 N  N     . PHE A 1 483 ? 8.731   32.676 43.110 1.00 27.89 ? 465  PHE A N     1 
ATOM   3654 C  CA    . PHE A 1 483 ? 10.098  32.758 43.718 1.00 30.53 ? 465  PHE A CA    1 
ATOM   3655 C  C     . PHE A 1 483 ? 10.995  33.775 42.947 1.00 30.00 ? 465  PHE A C     1 
ATOM   3656 O  O     . PHE A 1 483 ? 12.043  34.217 43.434 1.00 30.41 ? 465  PHE A O     1 
ATOM   3657 C  CB    . PHE A 1 483 ? 10.775  31.381 43.698 1.00 31.25 ? 465  PHE A CB    1 
ATOM   3658 C  CG    . PHE A 1 483 ? 11.134  30.983 42.350 1.00 34.81 ? 465  PHE A CG    1 
ATOM   3659 C  CD1   . PHE A 1 483 ? 12.357  31.412 41.803 1.00 37.24 ? 465  PHE A CD1   1 
ATOM   3660 C  CD2   . PHE A 1 483 ? 10.202  30.374 41.543 1.00 38.46 ? 465  PHE A CD2   1 
ATOM   3661 C  CE1   . PHE A 1 483 ? 12.693  31.154 40.502 1.00 36.91 ? 465  PHE A CE1   1 
ATOM   3662 C  CE2   . PHE A 1 483 ? 10.511  30.109 40.192 1.00 42.35 ? 465  PHE A CE2   1 
ATOM   3663 C  CZ    . PHE A 1 483 ? 11.766  30.511 39.678 1.00 40.13 ? 465  PHE A CZ    1 
ATOM   3664 N  N     . ILE A 1 484 ? 10.614  34.115 41.727 1.00 29.17 ? 466  ILE A N     1 
ATOM   3665 C  CA    . ILE A 1 484 ? 11.434  35.060 40.943 1.00 30.20 ? 466  ILE A CA    1 
ATOM   3666 C  C     . ILE A 1 484 ? 11.553  36.400 41.679 1.00 30.33 ? 466  ILE A C     1 
ATOM   3667 O  O     . ILE A 1 484 ? 12.542  37.136 41.471 1.00 30.16 ? 466  ILE A O     1 
ATOM   3668 C  CB    . ILE A 1 484 ? 10.916  35.288 39.467 1.00 29.10 ? 466  ILE A CB    1 
ATOM   3669 C  CG1   . ILE A 1 484 ? 12.068  35.744 38.558 1.00 29.06 ? 466  ILE A CG1   1 
ATOM   3670 C  CG2   . ILE A 1 484 ? 9.847   36.303 39.450 1.00 30.01 ? 466  ILE A CG2   1 
ATOM   3671 C  CD1   . ILE A 1 484 ? 13.111  34.612 38.203 1.00 28.53 ? 466  ILE A CD1   1 
ATOM   3672 N  N     . ASN A 1 485 ? 10.566  36.698 42.542 1.00 29.25 ? 467  ASN A N     1 
ATOM   3673 C  CA    . ASN A 1 485 ? 10.574  37.936 43.346 1.00 29.50 ? 467  ASN A CA    1 
ATOM   3674 C  C     . ASN A 1 485 ? 11.838  38.123 44.184 1.00 29.61 ? 467  ASN A C     1 
ATOM   3675 O  O     . ASN A 1 485 ? 12.235  39.233 44.401 1.00 31.05 ? 467  ASN A O     1 
ATOM   3676 C  CB    . ASN A 1 485 ? 9.304   38.080 44.164 1.00 28.12 ? 467  ASN A CB    1 
ATOM   3677 C  CG    . ASN A 1 485 ? 8.071   38.328 43.277 1.00 30.51 ? 467  ASN A CG    1 
ATOM   3678 O  OD1   . ASN A 1 485 ? 8.200   38.503 42.070 1.00 32.34 ? 467  ASN A OD1   1 
ATOM   3679 N  ND2   . ASN A 1 485 ? 6.888   38.392 43.883 1.00 29.52 ? 467  ASN A ND2   1 
ATOM   3680 N  N     . LEU A 1 486 ? 12.500  37.044 44.572 1.00 29.67 ? 468  LEU A N     1 
ATOM   3681 C  CA    . LEU A 1 486 ? 13.841  37.107 45.144 1.00 31.32 ? 468  LEU A CA    1 
ATOM   3682 C  C     . LEU A 1 486 ? 14.887  37.850 44.329 1.00 32.14 ? 468  LEU A C     1 
ATOM   3683 O  O     . LEU A 1 486 ? 15.861  38.355 44.896 1.00 31.65 ? 468  LEU A O     1 
ATOM   3684 C  CB    . LEU A 1 486 ? 14.366  35.697 45.483 1.00 30.73 ? 468  LEU A CB    1 
ATOM   3685 C  CG    . LEU A 1 486 ? 13.630  34.952 46.623 1.00 32.14 ? 468  LEU A CG    1 
ATOM   3686 C  CD1   . LEU A 1 486 ? 14.081  33.462 46.651 1.00 31.25 ? 468  LEU A CD1   1 
ATOM   3687 C  CD2   . LEU A 1 486 ? 13.879  35.671 47.952 1.00 28.92 ? 468  LEU A CD2   1 
ATOM   3688 N  N     . LEU A 1 487 ? 14.704  37.884 43.003 1.00 33.48 ? 469  LEU A N     1 
ATOM   3689 C  CA    . LEU A 1 487 ? 15.673  38.531 42.096 1.00 34.61 ? 469  LEU A CA    1 
ATOM   3690 C  C     . LEU A 1 487 ? 15.806  40.000 42.420 1.00 35.49 ? 469  LEU A C     1 
ATOM   3691 O  O     . LEU A 1 487 ? 16.874  40.565 42.184 1.00 35.28 ? 469  LEU A O     1 
ATOM   3692 C  CB    . LEU A 1 487 ? 15.260  38.375 40.611 1.00 34.29 ? 469  LEU A CB    1 
ATOM   3693 C  CG    . LEU A 1 487 ? 16.241  38.856 39.527 1.00 32.39 ? 469  LEU A CG    1 
ATOM   3694 C  CD1   . LEU A 1 487 ? 17.592  38.082 39.456 1.00 28.22 ? 469  LEU A CD1   1 
ATOM   3695 C  CD2   . LEU A 1 487 ? 15.533  38.848 38.215 1.00 31.49 ? 469  LEU A CD2   1 
ATOM   3696 N  N     . TYR A 1 488 ? 14.735  40.592 42.984 1.00 36.02 ? 470  TYR A N     1 
ATOM   3697 C  CA    . TYR A 1 488 ? 14.666  42.028 43.224 1.00 36.85 ? 470  TYR A CA    1 
ATOM   3698 C  C     . TYR A 1 488 ? 15.162  42.447 44.589 1.00 36.79 ? 470  TYR A C     1 
ATOM   3699 O  O     . TYR A 1 488 ? 14.984  43.597 44.970 1.00 37.92 ? 470  TYR A O     1 
ATOM   3700 C  CB    . TYR A 1 488 ? 13.246  42.599 42.965 1.00 37.95 ? 470  TYR A CB    1 
ATOM   3701 C  CG    . TYR A 1 488 ? 12.657  42.020 41.720 1.00 38.56 ? 470  TYR A CG    1 
ATOM   3702 C  CD1   . TYR A 1 488 ? 13.416  41.979 40.551 1.00 41.27 ? 470  TYR A CD1   1 
ATOM   3703 C  CD2   . TYR A 1 488 ? 11.388  41.462 41.713 1.00 36.62 ? 470  TYR A CD2   1 
ATOM   3704 C  CE1   . TYR A 1 488 ? 12.948  41.376 39.411 1.00 41.22 ? 470  TYR A CE1   1 
ATOM   3705 C  CE2   . TYR A 1 488 ? 10.898  40.883 40.586 1.00 39.07 ? 470  TYR A CE2   1 
ATOM   3706 C  CZ    . TYR A 1 488 ? 11.697  40.841 39.419 1.00 40.22 ? 470  TYR A CZ    1 
ATOM   3707 O  OH    . TYR A 1 488 ? 11.269  40.276 38.256 1.00 39.61 ? 470  TYR A OH    1 
ATOM   3708 N  N     . TYR A 1 489 ? 15.805  41.541 45.316 1.00 36.26 ? 471  TYR A N     1 
ATOM   3709 C  CA    . TYR A 1 489 ? 16.318  41.861 46.640 1.00 35.08 ? 471  TYR A CA    1 
ATOM   3710 C  C     . TYR A 1 489 ? 17.807  41.574 46.570 1.00 37.05 ? 471  TYR A C     1 
ATOM   3711 O  O     . TYR A 1 489 ? 18.184  40.646 45.897 1.00 37.29 ? 471  TYR A O     1 
ATOM   3712 C  CB    . TYR A 1 489 ? 15.590  41.035 47.711 1.00 32.60 ? 471  TYR A CB    1 
ATOM   3713 C  CG    . TYR A 1 489 ? 14.133  41.446 47.912 1.00 29.95 ? 471  TYR A CG    1 
ATOM   3714 C  CD1   . TYR A 1 489 ? 13.793  42.399 48.860 1.00 26.22 ? 471  TYR A CD1   1 
ATOM   3715 C  CD2   . TYR A 1 489 ? 13.113  40.900 47.139 1.00 26.10 ? 471  TYR A CD2   1 
ATOM   3716 C  CE1   . TYR A 1 489 ? 12.493  42.792 49.062 1.00 27.44 ? 471  TYR A CE1   1 
ATOM   3717 C  CE2   . TYR A 1 489 ? 11.808  41.274 47.322 1.00 27.36 ? 471  TYR A CE2   1 
ATOM   3718 C  CZ    . TYR A 1 489 ? 11.499  42.216 48.312 1.00 28.60 ? 471  TYR A CZ    1 
ATOM   3719 O  OH    . TYR A 1 489 ? 10.212  42.598 48.538 1.00 26.77 ? 471  TYR A OH    1 
ATOM   3720 N  N     . PRO A 1 490 ? 18.659  42.421 47.196 1.00 39.54 ? 472  PRO A N     1 
ATOM   3721 C  CA    . PRO A 1 490 ? 20.125  42.235 47.141 1.00 41.32 ? 472  PRO A CA    1 
ATOM   3722 C  C     . PRO A 1 490 ? 20.606  40.971 47.806 1.00 44.27 ? 472  PRO A C     1 
ATOM   3723 O  O     . PRO A 1 490 ? 19.867  40.321 48.551 1.00 45.07 ? 472  PRO A O     1 
ATOM   3724 C  CB    . PRO A 1 490 ? 20.683  43.453 47.883 1.00 40.85 ? 472  PRO A CB    1 
ATOM   3725 C  CG    . PRO A 1 490 ? 19.522  43.965 48.726 1.00 40.52 ? 472  PRO A CG    1 
ATOM   3726 C  CD    . PRO A 1 490 ? 18.274  43.642 47.945 1.00 38.73 ? 472  PRO A CD    1 
ATOM   3727 N  N     . PHE A 1 491 ? 21.861  40.637 47.548 1.00 47.98 ? 473  PHE A N     1 
ATOM   3728 C  CA    . PHE A 1 491 ? 22.448  39.382 48.038 1.00 51.53 ? 473  PHE A CA    1 
ATOM   3729 C  C     . PHE A 1 491 ? 22.228  39.105 49.585 1.00 51.23 ? 473  PHE A C     1 
ATOM   3730 O  O     . PHE A 1 491 ? 21.968  37.955 50.001 1.00 52.42 ? 473  PHE A O     1 
ATOM   3731 C  CB    . PHE A 1 491 ? 23.965  39.323 47.633 1.00 53.99 ? 473  PHE A CB    1 
ATOM   3732 C  CG    . PHE A 1 491 ? 24.223  38.865 46.169 1.00 57.11 ? 473  PHE A CG    1 
ATOM   3733 C  CD1   . PHE A 1 491 ? 23.570  37.725 45.627 1.00 60.30 ? 473  PHE A CD1   1 
ATOM   3734 C  CD2   . PHE A 1 491 ? 25.140  39.557 45.346 1.00 59.93 ? 473  PHE A CD2   1 
ATOM   3735 C  CE1   . PHE A 1 491 ? 23.820  37.291 44.266 1.00 59.37 ? 473  PHE A CE1   1 
ATOM   3736 C  CE2   . PHE A 1 491 ? 25.386  39.143 43.992 1.00 59.18 ? 473  PHE A CE2   1 
ATOM   3737 C  CZ    . PHE A 1 491 ? 24.723  37.999 43.462 1.00 58.04 ? 473  PHE A CZ    1 
ATOM   3738 N  N     . SER A 1 492 ? 22.335  40.151 50.407 1.00 49.22 ? 474  SER A N     1 
ATOM   3739 C  CA    . SER A 1 492 ? 22.388  40.003 51.858 1.00 47.76 ? 474  SER A CA    1 
ATOM   3740 C  C     . SER A 1 492 ? 21.255  40.771 52.558 1.00 45.25 ? 474  SER A C     1 
ATOM   3741 O  O     . SER A 1 492 ? 21.375  41.187 53.720 1.00 43.56 ? 474  SER A O     1 
ATOM   3742 C  CB    . SER A 1 492 ? 23.730  40.543 52.343 1.00 48.78 ? 474  SER A CB    1 
ATOM   3743 O  OG    . SER A 1 492 ? 24.780  39.632 52.007 1.00 52.90 ? 474  SER A OG    1 
ATOM   3744 N  N     . TYR A 1 493 ? 20.164  40.965 51.834 1.00 41.87 ? 475  TYR A N     1 
ATOM   3745 C  CA    . TYR A 1 493 ? 18.984  41.561 52.411 1.00 40.22 ? 475  TYR A CA    1 
ATOM   3746 C  C     . TYR A 1 493 ? 18.546  40.865 53.755 1.00 40.11 ? 475  TYR A C     1 
ATOM   3747 O  O     . TYR A 1 493 ? 18.611  39.627 53.898 1.00 39.38 ? 475  TYR A O     1 
ATOM   3748 C  CB    . TYR A 1 493 ? 17.891  41.540 51.360 1.00 38.09 ? 475  TYR A CB    1 
ATOM   3749 C  CG    . TYR A 1 493 ? 16.759  42.440 51.656 1.00 36.67 ? 475  TYR A CG    1 
ATOM   3750 C  CD1   . TYR A 1 493 ? 16.830  43.823 51.396 1.00 36.33 ? 475  TYR A CD1   1 
ATOM   3751 C  CD2   . TYR A 1 493 ? 15.570  41.926 52.180 1.00 33.30 ? 475  TYR A CD2   1 
ATOM   3752 C  CE1   . TYR A 1 493 ? 15.691  44.679 51.676 1.00 33.51 ? 475  TYR A CE1   1 
ATOM   3753 C  CE2   . TYR A 1 493 ? 14.484  42.750 52.465 1.00 31.04 ? 475  TYR A CE2   1 
ATOM   3754 C  CZ    . TYR A 1 493 ? 14.550  44.097 52.221 1.00 34.48 ? 475  TYR A CZ    1 
ATOM   3755 O  OH    . TYR A 1 493 ? 13.436  44.825 52.510 1.00 37.43 ? 475  TYR A OH    1 
ATOM   3756 N  N     . LEU A 1 494 ? 18.155  41.673 54.737 1.00 39.77 ? 476  LEU A N     1 
ATOM   3757 C  CA    . LEU A 1 494 ? 17.500  41.159 55.940 1.00 39.83 ? 476  LEU A CA    1 
ATOM   3758 C  C     . LEU A 1 494 ? 16.025  41.372 55.802 1.00 38.85 ? 476  LEU A C     1 
ATOM   3759 O  O     . LEU A 1 494 ? 15.559  42.513 55.903 1.00 38.50 ? 476  LEU A O     1 
ATOM   3760 C  CB    . LEU A 1 494 ? 17.965  41.874 57.226 1.00 40.01 ? 476  LEU A CB    1 
ATOM   3761 C  CG    . LEU A 1 494 ? 17.357  41.427 58.605 1.00 40.19 ? 476  LEU A CG    1 
ATOM   3762 C  CD1   . LEU A 1 494 ? 17.209  39.916 58.860 1.00 32.85 ? 476  LEU A CD1   1 
ATOM   3763 C  CD2   . LEU A 1 494 ? 18.186  42.031 59.731 1.00 41.36 ? 476  LEU A CD2   1 
ATOM   3764 N  N     . PHE A 1 495 ? 15.285  40.284 55.595 1.00 37.10 ? 477  PHE A N     1 
ATOM   3765 C  CA    . PHE A 1 495 ? 13.813  40.380 55.599 1.00 36.20 ? 477  PHE A CA    1 
ATOM   3766 C  C     . PHE A 1 495 ? 13.401  40.484 57.085 1.00 37.13 ? 477  PHE A C     1 
ATOM   3767 O  O     . PHE A 1 495 ? 13.843  39.650 57.907 1.00 37.73 ? 477  PHE A O     1 
ATOM   3768 C  CB    . PHE A 1 495 ? 13.201  39.135 54.954 1.00 34.47 ? 477  PHE A CB    1 
ATOM   3769 C  CG    . PHE A 1 495 ? 13.490  38.983 53.480 1.00 30.84 ? 477  PHE A CG    1 
ATOM   3770 C  CD1   . PHE A 1 495 ? 12.692  39.632 52.519 1.00 29.05 ? 477  PHE A CD1   1 
ATOM   3771 C  CD2   . PHE A 1 495 ? 14.516  38.170 53.046 1.00 28.50 ? 477  PHE A CD2   1 
ATOM   3772 C  CE1   . PHE A 1 495 ? 12.941  39.492 51.170 1.00 30.47 ? 477  PHE A CE1   1 
ATOM   3773 C  CE2   . PHE A 1 495 ? 14.787  38.031 51.656 1.00 31.53 ? 477  PHE A CE2   1 
ATOM   3774 C  CZ    . PHE A 1 495 ? 13.985  38.687 50.724 1.00 30.50 ? 477  PHE A CZ    1 
ATOM   3775 N  N     A ARG A 1 496 ? 12.545  41.467 57.381 0.50 37.60 ? 478  ARG A N     1 
ATOM   3776 N  N     B ARG A 1 496 ? 12.630  41.510 57.452 0.50 37.79 ? 478  ARG A N     1 
ATOM   3777 C  CA    A ARG A 1 496 ? 12.143  41.844 58.738 0.50 38.09 ? 478  ARG A CA    1 
ATOM   3778 C  CA    B ARG A 1 496 ? 12.232  41.718 58.856 0.50 38.45 ? 478  ARG A CA    1 
ATOM   3779 C  C     A ARG A 1 496 ? 10.648  41.600 59.006 0.50 37.90 ? 478  ARG A C     1 
ATOM   3780 C  C     B ARG A 1 496 ? 10.722  41.666 59.080 0.50 38.12 ? 478  ARG A C     1 
ATOM   3781 O  O     A ARG A 1 496 ? 9.803   42.035 58.230 0.50 37.87 ? 478  ARG A O     1 
ATOM   3782 O  O     B ARG A 1 496 ? 9.952   42.283 58.352 0.50 38.04 ? 478  ARG A O     1 
ATOM   3783 C  CB    A ARG A 1 496 ? 12.406  43.343 58.964 0.50 38.16 ? 478  ARG A CB    1 
ATOM   3784 C  CB    B ARG A 1 496 ? 12.761  43.052 59.418 0.50 38.60 ? 478  ARG A CB    1 
ATOM   3785 C  CG    A ARG A 1 496 ? 13.873  43.812 58.983 0.50 38.58 ? 478  ARG A CG    1 
ATOM   3786 C  CG    B ARG A 1 496 ? 13.909  42.953 60.444 0.50 40.52 ? 478  ARG A CG    1 
ATOM   3787 C  CD    A ARG A 1 496 ? 13.944  45.363 58.947 0.50 39.04 ? 478  ARG A CD    1 
ATOM   3788 C  CD    B ARG A 1 496 ? 13.822  44.022 61.602 0.50 39.19 ? 478  ARG A CD    1 
ATOM   3789 N  NE    A ARG A 1 496 ? 13.991  45.882 57.574 0.50 39.47 ? 478  ARG A NE    1 
ATOM   3790 N  NE    B ARG A 1 496 ? 12.728  44.988 61.437 0.50 39.88 ? 478  ARG A NE    1 
ATOM   3791 C  CZ    A ARG A 1 496 ? 13.008  46.539 56.949 0.50 42.85 ? 478  ARG A CZ    1 
ATOM   3792 C  CZ    B ARG A 1 496 ? 11.661  45.069 62.241 0.50 39.46 ? 478  ARG A CZ    1 
ATOM   3793 N  NH1   A ARG A 1 496 ? 11.855  46.795 57.554 0.50 42.96 ? 478  ARG A NH1   1 
ATOM   3794 N  NH1   B ARG A 1 496 ? 11.542  44.261 63.290 0.50 39.32 ? 478  ARG A NH1   1 
ATOM   3795 N  NH2   A ARG A 1 496 ? 13.178  46.948 55.691 0.50 43.03 ? 478  ARG A NH2   1 
ATOM   3796 N  NH2   B ARG A 1 496 ? 10.703  45.955 61.995 0.50 37.11 ? 478  ARG A NH2   1 
ATOM   3797 N  N     . ALA A 1 497 ? 10.316  40.941 60.118 1.00 37.64 ? 479  ALA A N     1 
ATOM   3798 C  CA    . ALA A 1 497 ? 8.946   40.982 60.610 1.00 36.99 ? 479  ALA A CA    1 
ATOM   3799 C  C     . ALA A 1 497 ? 9.042   41.616 62.018 1.00 37.22 ? 479  ALA A C     1 
ATOM   3800 O  O     . ALA A 1 497 ? 10.025  41.396 62.702 1.00 38.14 ? 479  ALA A O     1 
ATOM   3801 C  CB    . ALA A 1 497 ? 8.377   39.610 60.662 1.00 35.32 ? 479  ALA A CB    1 
ATOM   3802 N  N     . ALA A 1 498 ? 8.054   42.411 62.430 1.00 37.99 ? 480  ALA A N     1 
ATOM   3803 C  CA    . ALA A 1 498 ? 7.936   42.961 63.809 1.00 39.61 ? 480  ALA A CA    1 
ATOM   3804 C  C     . ALA A 1 498 ? 7.950   41.820 64.832 1.00 40.66 ? 480  ALA A C     1 
ATOM   3805 O  O     . ALA A 1 498 ? 7.249   40.826 64.609 1.00 41.67 ? 480  ALA A O     1 
ATOM   3806 C  CB    . ALA A 1 498 ? 6.614   43.773 63.960 1.00 38.78 ? 480  ALA A CB    1 
ATOM   3807 N  N     . HIS A 1 499 ? 8.747   41.939 65.915 1.00 42.08 ? 481  HIS A N     1 
ATOM   3808 C  CA    . HIS A 1 499 ? 8.675   40.973 67.050 1.00 42.63 ? 481  HIS A CA    1 
ATOM   3809 C  C     . HIS A 1 499 ? 7.237   40.927 67.544 1.00 41.77 ? 481  HIS A C     1 
ATOM   3810 O  O     . HIS A 1 499 ? 6.516   41.944 67.557 1.00 41.54 ? 481  HIS A O     1 
ATOM   3811 C  CB    . HIS A 1 499 ? 9.569   41.325 68.265 1.00 43.78 ? 481  HIS A CB    1 
ATOM   3812 C  CG    . HIS A 1 499 ? 11.046  41.388 67.984 1.00 47.57 ? 481  HIS A CG    1 
ATOM   3813 N  ND1   . HIS A 1 499 ? 11.704  40.483 67.168 1.00 50.40 ? 481  HIS A ND1   1 
ATOM   3814 C  CD2   . HIS A 1 499 ? 12.003  42.241 68.450 1.00 50.05 ? 481  HIS A CD2   1 
ATOM   3815 C  CE1   . HIS A 1 499 ? 12.991  40.795 67.116 1.00 51.47 ? 481  HIS A CE1   1 
ATOM   3816 N  NE2   . HIS A 1 499 ? 13.202  41.849 67.896 1.00 50.97 ? 481  HIS A NE2   1 
ATOM   3817 N  N     . VAL A 1 500 ? 6.844   39.722 67.941 1.00 41.21 ? 482  VAL A N     1 
ATOM   3818 C  CA    . VAL A 1 500 ? 5.502   39.393 68.419 1.00 38.62 ? 482  VAL A CA    1 
ATOM   3819 C  C     . VAL A 1 500 ? 5.464   39.567 69.936 1.00 37.06 ? 482  VAL A C     1 
ATOM   3820 O  O     . VAL A 1 500 ? 6.474   39.291 70.658 1.00 36.64 ? 482  VAL A O     1 
ATOM   3821 C  CB    . VAL A 1 500 ? 5.090   37.951 67.947 1.00 39.26 ? 482  VAL A CB    1 
ATOM   3822 C  CG1   . VAL A 1 500 ? 3.676   37.598 68.422 1.00 39.36 ? 482  VAL A CG1   1 
ATOM   3823 C  CG2   . VAL A 1 500 ? 5.162   37.881 66.414 1.00 38.11 ? 482  VAL A CG2   1 
ATOM   3824 N  N     . LEU A 1 501 ? 4.313   40.067 70.389 1.00 34.56 ? 483  LEU A N     1 
ATOM   3825 C  CA    . LEU A 1 501 ? 3.981   40.325 71.806 1.00 32.76 ? 483  LEU A CA    1 
ATOM   3826 C  C     . LEU A 1 501 ? 2.616   39.697 72.211 1.00 31.51 ? 483  LEU A C     1 
ATOM   3827 O  O     . LEU A 1 501 ? 1.604   39.893 71.547 1.00 31.05 ? 483  LEU A O     1 
ATOM   3828 C  CB    . LEU A 1 501 ? 3.942   41.861 72.114 1.00 32.55 ? 483  LEU A CB    1 
ATOM   3829 C  CG    . LEU A 1 501 ? 5.180   42.763 72.251 1.00 32.91 ? 483  LEU A CG    1 
ATOM   3830 C  CD1   . LEU A 1 501 ? 4.769   44.106 72.775 1.00 35.05 ? 483  LEU A CD1   1 
ATOM   3831 C  CD2   . LEU A 1 501 ? 6.217   42.222 73.188 1.00 33.61 ? 483  LEU A CD2   1 
ATOM   3832 N  N     . MET A 1 502 ? 2.598   38.975 73.320 1.00 29.92 ? 484  MET A N     1 
ATOM   3833 C  CA    . MET A 1 502 ? 1.347   38.547 73.961 1.00 29.64 ? 484  MET A CA    1 
ATOM   3834 C  C     . MET A 1 502 ? 0.534   39.746 74.397 1.00 28.48 ? 484  MET A C     1 
ATOM   3835 O  O     . MET A 1 502 ? 1.112   40.825 74.634 1.00 29.32 ? 484  MET A O     1 
ATOM   3836 C  CB    . MET A 1 502 ? 1.671   37.666 75.172 1.00 29.10 ? 484  MET A CB    1 
ATOM   3837 C  CG    . MET A 1 502 ? 2.408   36.374 74.742 1.00 28.77 ? 484  MET A CG    1 
ATOM   3838 S  SD    . MET A 1 502 ? 2.562   35.198 76.050 1.00 31.82 ? 484  MET A SD    1 
ATOM   3839 C  CE    . MET A 1 502 ? 0.841   34.752 76.259 1.00 34.96 ? 484  MET A CE    1 
ATOM   3840 N  N     . PRO A 1 503 ? -0.783  39.583 74.486 1.00 26.70 ? 485  PRO A N     1 
ATOM   3841 C  CA    . PRO A 1 503 ? -1.712  40.583 74.998 1.00 27.48 ? 485  PRO A CA    1 
ATOM   3842 C  C     . PRO A 1 503 ? -1.291  41.261 76.338 1.00 28.89 ? 485  PRO A C     1 
ATOM   3843 O  O     . PRO A 1 503 ? -1.399  42.485 76.476 1.00 28.43 ? 485  PRO A O     1 
ATOM   3844 C  CB    . PRO A 1 503 ? -3.008  39.808 75.138 1.00 26.63 ? 485  PRO A CB    1 
ATOM   3845 C  CG    . PRO A 1 503 ? -2.916  38.866 73.922 1.00 25.48 ? 485  PRO A CG    1 
ATOM   3846 C  CD    . PRO A 1 503 ? -1.488  38.370 74.020 1.00 27.02 ? 485  PRO A CD    1 
ATOM   3847 N  N     . HIS A 1 504 ? -0.761  40.502 77.286 1.00 28.96 ? 486  HIS A N     1 
ATOM   3848 C  CA    . HIS A 1 504 ? -0.351  41.116 78.541 1.00 29.79 ? 486  HIS A CA    1 
ATOM   3849 C  C     . HIS A 1 504 ? 0.984   41.838 78.404 1.00 31.71 ? 486  HIS A C     1 
ATOM   3850 O  O     . HIS A 1 504 ? 1.359   42.582 79.303 1.00 31.74 ? 486  HIS A O     1 
ATOM   3851 C  CB    . HIS A 1 504 ? -0.274  40.072 79.665 1.00 28.19 ? 486  HIS A CB    1 
ATOM   3852 C  CG    . HIS A 1 504 ? 0.938   39.211 79.571 1.00 26.39 ? 486  HIS A CG    1 
ATOM   3853 N  ND1   . HIS A 1 504 ? 0.943   38.015 78.889 1.00 24.93 ? 486  HIS A ND1   1 
ATOM   3854 C  CD2   . HIS A 1 504 ? 2.191   39.372 80.069 1.00 22.92 ? 486  HIS A CD2   1 
ATOM   3855 C  CE1   . HIS A 1 504 ? 2.162   37.499 78.933 1.00 22.04 ? 486  HIS A CE1   1 
ATOM   3856 N  NE2   . HIS A 1 504 ? 2.930   38.298 79.647 1.00 20.48 ? 486  HIS A NE2   1 
ATOM   3857 N  N     . GLU A 1 505 ? 1.721   41.604 77.316 1.00 33.81 ? 487  GLU A N     1 
ATOM   3858 C  CA    . GLU A 1 505 ? 3.013   42.277 77.129 1.00 37.12 ? 487  GLU A CA    1 
ATOM   3859 C  C     . GLU A 1 505 ? 2.873   43.643 76.400 1.00 40.59 ? 487  GLU A C     1 
ATOM   3860 O  O     . GLU A 1 505 ? 3.853   44.368 76.293 1.00 41.79 ? 487  GLU A O     1 
ATOM   3861 C  CB    . GLU A 1 505 ? 3.992   41.394 76.360 1.00 36.08 ? 487  GLU A CB    1 
ATOM   3862 C  CG    . GLU A 1 505 ? 4.457   40.158 77.124 1.00 34.79 ? 487  GLU A CG    1 
ATOM   3863 C  CD    . GLU A 1 505 ? 5.154   39.166 76.226 1.00 36.05 ? 487  GLU A CD    1 
ATOM   3864 O  OE1   . GLU A 1 505 ? 4.900   39.198 74.981 1.00 39.32 ? 487  GLU A OE1   1 
ATOM   3865 O  OE2   . GLU A 1 505 ? 5.948   38.340 76.745 1.00 34.39 ? 487  GLU A OE2   1 
ATOM   3866 N  N     . SER A 1 506 ? 1.671   43.973 75.910 1.00 44.25 ? 488  SER A N     1 
ATOM   3867 C  CA    . SER A 1 506 ? 1.448   45.069 74.939 1.00 47.53 ? 488  SER A CA    1 
ATOM   3868 C  C     . SER A 1 506 ? 1.264   46.429 75.620 1.00 49.21 ? 488  SER A C     1 
ATOM   3869 O  O     . SER A 1 506 ? 0.774   46.485 76.765 1.00 51.81 ? 488  SER A O     1 
ATOM   3870 C  CB    . SER A 1 506 ? 0.229   44.761 74.073 1.00 47.81 ? 488  SER A CB    1 
ATOM   3871 O  OG    . SER A 1 506 ? 0.456   43.564 73.331 1.00 49.21 ? 488  SER A OG    1 
HETATM 3872 C  C3    . DG2 B 2 .   ? 0.272   20.448 66.570 0.50 51.49 ? 1489 DG2 A C3    1 
HETATM 3873 C  C4    . DG2 B 2 .   ? -0.547  20.541 65.282 0.50 52.27 ? 1489 DG2 A C4    1 
HETATM 3874 O  O2    . DG2 B 2 .   ? 1.499   21.162 66.390 0.50 51.11 ? 1489 DG2 A O2    1 
HETATM 3875 O  O5    . DG2 B 2 .   ? -0.508  21.848 64.674 0.50 52.20 ? 1489 DG2 A O5    1 
HETATM 3876 O  O7    . DG2 B 2 .   ? -0.433  22.232 67.975 0.50 50.28 ? 1489 DG2 A O7    1 
HETATM 3877 O  O8    . DG2 B 2 .   ? -1.320  20.259 68.303 0.50 49.37 ? 1489 DG2 A O8    1 
HETATM 3878 O  O9    . DG2 B 2 .   ? 3.013   19.167 66.647 0.50 49.73 ? 1489 DG2 A O9    1 
HETATM 3879 O  O10   . DG2 B 2 .   ? 3.894   21.483 66.131 0.50 51.80 ? 1489 DG2 A O10   1 
HETATM 3880 O  O11   . DG2 B 2 .   ? 2.875   21.000 68.402 0.50 52.17 ? 1489 DG2 A O11   1 
HETATM 3881 P  P1    . DG2 B 2 .   ? 2.918   20.644 66.931 0.50 50.69 ? 1489 DG2 A P1    1 
HETATM 3882 C  C7    . DG2 B 2 .   ? -0.545  21.020 67.694 0.50 49.90 ? 1489 DG2 A C7    1 
HETATM 3883 P  P6    . DG2 B 2 .   ? -1.308  22.079 63.284 0.50 52.14 ? 1489 DG2 A P6    1 
HETATM 3884 O  O15   . DG2 B 2 .   ? -1.154  20.731 62.596 0.50 50.65 ? 1489 DG2 A O15   1 
HETATM 3885 O  O14   . DG2 B 2 .   ? -2.693  22.380 63.790 0.50 49.91 ? 1489 DG2 A O14   1 
HETATM 3886 O  O13   . DG2 B 2 .   ? -0.638  23.237 62.533 0.50 50.63 ? 1489 DG2 A O13   1 
HETATM 3887 C  C1    . GOL C 3 .   ? 23.980  17.798 39.383 1.00 57.67 ? 1490 GOL A C1    1 
HETATM 3888 O  O1    . GOL C 3 .   ? 24.333  17.017 38.258 1.00 58.93 ? 1490 GOL A O1    1 
HETATM 3889 C  C2    . GOL C 3 .   ? 24.922  17.462 40.521 1.00 58.26 ? 1490 GOL A C2    1 
HETATM 3890 O  O2    . GOL C 3 .   ? 26.253  17.591 40.026 1.00 59.86 ? 1490 GOL A O2    1 
HETATM 3891 C  C3    . GOL C 3 .   ? 24.626  16.117 41.257 1.00 57.27 ? 1490 GOL A C3    1 
HETATM 3892 O  O3    . GOL C 3 .   ? 23.271  15.776 41.643 1.00 47.98 ? 1490 GOL A O3    1 
HETATM 3893 P  P     . IMP D 4 .   ? 6.811   18.244 42.919 1.00 36.30 ? 1491 IMP A P     1 
HETATM 3894 O  O1P   . IMP D 4 .   ? 7.855   18.633 41.822 1.00 29.20 ? 1491 IMP A O1P   1 
HETATM 3895 O  O2P   . IMP D 4 .   ? 5.903   19.434 43.161 1.00 27.42 ? 1491 IMP A O2P   1 
HETATM 3896 O  O3P   . IMP D 4 .   ? 7.649   17.828 44.102 1.00 30.85 ? 1491 IMP A O3P   1 
HETATM 3897 O  "O5'" . IMP D 4 .   ? 5.784   17.021 42.597 1.00 33.48 ? 1491 IMP A "O5'" 1 
HETATM 3898 C  "C5'" . IMP D 4 .   ? 5.220   16.946 41.339 1.00 30.74 ? 1491 IMP A "C5'" 1 
HETATM 3899 C  "C4'" . IMP D 4 .   ? 4.836   15.543 40.936 1.00 30.07 ? 1491 IMP A "C4'" 1 
HETATM 3900 O  "O4'" . IMP D 4 .   ? 3.790   15.072 41.750 1.00 30.63 ? 1491 IMP A "O4'" 1 
HETATM 3901 C  "C3'" . IMP D 4 .   ? 4.307   15.601 39.514 1.00 29.92 ? 1491 IMP A "C3'" 1 
HETATM 3902 O  "O3'" . IMP D 4 .   ? 5.045   14.645 38.779 1.00 34.88 ? 1491 IMP A "O3'" 1 
HETATM 3903 C  "C2'" . IMP D 4 .   ? 2.834   15.195 39.638 1.00 32.78 ? 1491 IMP A "C2'" 1 
HETATM 3904 O  "O2'" . IMP D 4 .   ? 2.395   14.229 38.705 1.00 38.42 ? 1491 IMP A "O2'" 1 
HETATM 3905 C  "C1'" . IMP D 4 .   ? 2.758   14.509 40.965 1.00 28.28 ? 1491 IMP A "C1'" 1 
HETATM 3906 N  N9    . IMP D 4 .   ? 1.422   14.714 41.554 1.00 27.69 ? 1491 IMP A N9    1 
HETATM 3907 C  C8    . IMP D 4 .   ? 0.917   15.863 42.122 1.00 28.40 ? 1491 IMP A C8    1 
HETATM 3908 N  N7    . IMP D 4 .   ? -0.329  15.618 42.576 1.00 26.82 ? 1491 IMP A N7    1 
HETATM 3909 C  C5    . IMP D 4 .   ? -0.626  14.309 42.376 1.00 25.86 ? 1491 IMP A C5    1 
HETATM 3910 C  C6    . IMP D 4 .   ? -1.750  13.524 42.663 1.00 27.19 ? 1491 IMP A C6    1 
HETATM 3911 O  O6    . IMP D 4 .   ? -2.749  13.965 43.275 1.00 28.21 ? 1491 IMP A O6    1 
HETATM 3912 N  N1    . IMP D 4 .   ? -1.741  12.191 42.306 1.00 27.38 ? 1491 IMP A N1    1 
HETATM 3913 C  C2    . IMP D 4 .   ? -0.640  11.634 41.703 1.00 26.98 ? 1491 IMP A C2    1 
HETATM 3914 N  N3    . IMP D 4 .   ? 0.467   12.407 41.418 1.00 25.16 ? 1491 IMP A N3    1 
HETATM 3915 C  C4    . IMP D 4 .   ? 0.474   13.734 41.741 1.00 27.64 ? 1491 IMP A C4    1 
HETATM 3916 MG MG    . MG  E 5 .   ? 5.444   21.211 43.749 1.00 22.58 ? 1492 MG  A MG    1 
HETATM 3917 O  O     . HOH F 6 .   ? 5.482   37.551 39.045 1.00 34.88 ? 2001 HOH A O     1 
HETATM 3918 O  O     . HOH F 6 .   ? -2.177  31.736 31.285 1.00 36.12 ? 2002 HOH A O     1 
HETATM 3919 O  O     . HOH F 6 .   ? -5.934  32.418 31.222 1.00 49.09 ? 2003 HOH A O     1 
HETATM 3920 O  O     . HOH F 6 .   ? 6.260   35.940 36.985 1.00 39.34 ? 2004 HOH A O     1 
HETATM 3921 O  O     . HOH F 6 .   ? 4.223   42.060 29.932 1.00 46.46 ? 2005 HOH A O     1 
HETATM 3922 O  O     . HOH F 6 .   ? -0.763  41.611 33.838 1.00 42.52 ? 2006 HOH A O     1 
HETATM 3923 O  O     . HOH F 6 .   ? 5.766   37.405 24.533 1.00 46.57 ? 2007 HOH A O     1 
HETATM 3924 O  O     . HOH F 6 .   ? 13.808  45.687 37.517 1.00 44.44 ? 2008 HOH A O     1 
HETATM 3925 O  O     . HOH F 6 .   ? -30.731 4.053  51.502 1.00 54.99 ? 2009 HOH A O     1 
HETATM 3926 O  O     . HOH F 6 .   ? 8.620   41.143 35.640 1.00 48.54 ? 2010 HOH A O     1 
HETATM 3927 O  O     . HOH F 6 .   ? -8.952  6.824  30.400 1.00 25.04 ? 2011 HOH A O     1 
HETATM 3928 O  O     . HOH F 6 .   ? -7.686  15.763 26.202 1.00 61.42 ? 2012 HOH A O     1 
HETATM 3929 O  O     . HOH F 6 .   ? 14.953  19.514 23.290 1.00 47.94 ? 2013 HOH A O     1 
HETATM 3930 O  O     . HOH F 6 .   ? 4.256   38.680 45.519 1.00 34.31 ? 2014 HOH A O     1 
HETATM 3931 O  O     . HOH F 6 .   ? 7.871   42.600 52.557 1.00 34.79 ? 2015 HOH A O     1 
HETATM 3932 O  O     . HOH F 6 .   ? -18.773 6.970  54.986 1.00 43.41 ? 2016 HOH A O     1 
HETATM 3933 O  O     . HOH F 6 .   ? 6.226   41.751 54.510 1.00 22.22 ? 2017 HOH A O     1 
HETATM 3934 O  O     . HOH F 6 .   ? 6.063   37.020 63.251 1.00 42.40 ? 2018 HOH A O     1 
HETATM 3935 O  O     . HOH F 6 .   ? 2.728   37.089 59.761 1.00 30.15 ? 2019 HOH A O     1 
HETATM 3936 O  O     . HOH F 6 .   ? 5.703   33.538 64.005 1.00 46.11 ? 2020 HOH A O     1 
HETATM 3937 O  O     . HOH F 6 .   ? 10.624  37.448 63.393 1.00 38.30 ? 2021 HOH A O     1 
HETATM 3938 O  O     . HOH F 6 .   ? 17.758  34.850 60.081 1.00 31.24 ? 2022 HOH A O     1 
HETATM 3939 O  O     . HOH F 6 .   ? 18.898  33.589 57.802 1.00 52.21 ? 2023 HOH A O     1 
HETATM 3940 O  O     . HOH F 6 .   ? -27.603 26.353 42.130 1.00 55.78 ? 2024 HOH A O     1 
HETATM 3941 O  O     . HOH F 6 .   ? 23.161  33.930 50.724 1.00 35.95 ? 2025 HOH A O     1 
HETATM 3942 O  O     . HOH F 6 .   ? 27.553  27.013 50.643 1.00 53.74 ? 2026 HOH A O     1 
HETATM 3943 O  O     . HOH F 6 .   ? -1.079  10.840 46.214 1.00 50.87 ? 2027 HOH A O     1 
HETATM 3944 O  O     . HOH F 6 .   ? 2.351   18.443 44.700 1.00 30.24 ? 2028 HOH A O     1 
HETATM 3945 O  O     . HOH F 6 .   ? -1.135  16.429 47.716 1.00 45.80 ? 2029 HOH A O     1 
HETATM 3946 O  O     . HOH F 6 .   ? -4.209  19.345 37.008 1.00 34.71 ? 2030 HOH A O     1 
HETATM 3947 O  O     . HOH F 6 .   ? 7.061   30.387 41.278 1.00 34.85 ? 2031 HOH A O     1 
HETATM 3948 O  O     . HOH F 6 .   ? -25.181 17.630 35.743 1.00 45.68 ? 2032 HOH A O     1 
HETATM 3949 O  O     . HOH F 6 .   ? -21.680 20.183 35.941 1.00 34.76 ? 2033 HOH A O     1 
HETATM 3950 O  O     . HOH F 6 .   ? -7.501  30.757 36.595 1.00 35.09 ? 2034 HOH A O     1 
HETATM 3951 O  O     . HOH F 6 .   ? -7.077  22.862 28.350 1.00 45.24 ? 2035 HOH A O     1 
HETATM 3952 O  O     . HOH F 6 .   ? -3.586  30.198 29.679 1.00 42.15 ? 2036 HOH A O     1 
HETATM 3953 O  O     . HOH F 6 .   ? -27.361 7.266  57.382 1.00 44.00 ? 2037 HOH A O     1 
HETATM 3954 O  O     . HOH F 6 .   ? -26.800 2.410  53.201 1.00 45.87 ? 2038 HOH A O     1 
HETATM 3955 O  O     . HOH F 6 .   ? 1.694   17.355 33.566 1.00 21.55 ? 2039 HOH A O     1 
HETATM 3956 O  O     . HOH F 6 .   ? 2.754   17.471 36.416 1.00 37.66 ? 2040 HOH A O     1 
HETATM 3957 O  O     . HOH F 6 .   ? -2.631  25.552 36.490 1.00 24.56 ? 2041 HOH A O     1 
HETATM 3958 O  O     . HOH F 6 .   ? -9.139  25.256 28.759 1.00 47.64 ? 2042 HOH A O     1 
HETATM 3959 O  O     . HOH F 6 .   ? -5.682  8.739  49.240 1.00 51.16 ? 2043 HOH A O     1 
HETATM 3960 O  O     . HOH F 6 .   ? -15.385 15.758 28.100 0.50 16.52 ? 2044 HOH A O     1 
HETATM 3961 O  O     . HOH F 6 .   ? -2.232  4.797  39.527 1.00 42.16 ? 2045 HOH A O     1 
HETATM 3962 O  O     . HOH F 6 .   ? 1.098   12.359 45.549 1.00 49.94 ? 2046 HOH A O     1 
HETATM 3963 O  O     . HOH F 6 .   ? 5.563   10.481 45.453 1.00 38.86 ? 2047 HOH A O     1 
HETATM 3964 O  O     . HOH F 6 .   ? -4.749  7.480  28.457 1.00 45.76 ? 2048 HOH A O     1 
HETATM 3965 O  O     . HOH F 6 .   ? -7.867  9.626  30.767 1.00 25.03 ? 2049 HOH A O     1 
HETATM 3966 O  O     . HOH F 6 .   ? -13.856 7.207  28.749 1.00 33.62 ? 2050 HOH A O     1 
HETATM 3967 O  O     . HOH F 6 .   ? -8.748  4.995  38.316 1.00 28.27 ? 2051 HOH A O     1 
HETATM 3968 O  O     . HOH F 6 .   ? -7.049  3.149  39.456 1.00 41.95 ? 2052 HOH A O     1 
HETATM 3969 O  O     . HOH F 6 .   ? -5.983  17.342 24.789 1.00 43.81 ? 2053 HOH A O     1 
HETATM 3970 O  O     . HOH F 6 .   ? 7.370   30.905 36.834 1.00 53.28 ? 2054 HOH A O     1 
HETATM 3971 O  O     . HOH F 6 .   ? -8.847  4.301  31.466 1.00 30.94 ? 2055 HOH A O     1 
HETATM 3972 O  O     . HOH F 6 .   ? -20.036 4.493  31.141 1.00 45.37 ? 2056 HOH A O     1 
HETATM 3973 O  O     . HOH F 6 .   ? -24.059 5.842  31.130 1.00 43.06 ? 2057 HOH A O     1 
HETATM 3974 O  O     . HOH F 6 .   ? 13.433  18.001 25.777 1.00 37.56 ? 2058 HOH A O     1 
HETATM 3975 O  O     . HOH F 6 .   ? 11.989  21.987 25.064 1.00 40.34 ? 2059 HOH A O     1 
HETATM 3976 O  O     . HOH F 6 .   ? -12.851 20.773 31.168 1.00 42.17 ? 2060 HOH A O     1 
HETATM 3977 O  O     . HOH F 6 .   ? -8.743  26.703 38.107 1.00 28.62 ? 2061 HOH A O     1 
HETATM 3978 O  O     . HOH F 6 .   ? -13.454 24.533 30.608 1.00 40.31 ? 2062 HOH A O     1 
HETATM 3979 O  O     . HOH F 6 .   ? 14.840  22.026 24.022 1.00 46.81 ? 2063 HOH A O     1 
HETATM 3980 O  O     . HOH F 6 .   ? -18.099 30.872 34.293 1.00 42.88 ? 2064 HOH A O     1 
HETATM 3981 O  O     . HOH F 6 .   ? -9.321  31.512 34.797 1.00 42.04 ? 2065 HOH A O     1 
HETATM 3982 O  O     . HOH F 6 .   ? -12.231 30.787 41.583 1.00 29.45 ? 2066 HOH A O     1 
HETATM 3983 O  O     . HOH F 6 .   ? -12.819 27.694 33.317 1.00 27.76 ? 2067 HOH A O     1 
HETATM 3984 O  O     . HOH F 6 .   ? -9.219  31.003 39.019 1.00 43.29 ? 2068 HOH A O     1 
HETATM 3985 O  O     . HOH F 6 .   ? 28.726  28.822 29.336 1.00 40.90 ? 2069 HOH A O     1 
HETATM 3986 O  O     . HOH F 6 .   ? -13.858 30.059 43.974 1.00 29.45 ? 2070 HOH A O     1 
HETATM 3987 O  O     . HOH F 6 .   ? -9.863  23.036 47.086 1.00 24.20 ? 2071 HOH A O     1 
HETATM 3988 O  O     . HOH F 6 .   ? -10.490 25.590 54.268 1.00 26.91 ? 2072 HOH A O     1 
HETATM 3989 O  O     . HOH F 6 .   ? -6.760  24.573 53.853 1.00 25.57 ? 2073 HOH A O     1 
HETATM 3990 O  O     . HOH F 6 .   ? -20.113 8.516  52.952 1.00 24.25 ? 2074 HOH A O     1 
HETATM 3991 O  O     . HOH F 6 .   ? -16.460 8.882  55.789 1.00 35.07 ? 2075 HOH A O     1 
HETATM 3992 O  O     . HOH F 6 .   ? -25.289 14.838 53.056 1.00 34.20 ? 2076 HOH A O     1 
HETATM 3993 O  O     . HOH F 6 .   ? -24.084 9.487  59.695 1.00 44.54 ? 2077 HOH A O     1 
HETATM 3994 O  O     . HOH F 6 .   ? -15.572 32.419 51.229 1.00 40.14 ? 2078 HOH A O     1 
HETATM 3995 O  O     . HOH F 6 .   ? -7.973  30.546 60.937 1.00 35.80 ? 2079 HOH A O     1 
HETATM 3996 O  O     . HOH F 6 .   ? -7.596  22.866 65.241 1.00 44.48 ? 2080 HOH A O     1 
HETATM 3997 O  O     . HOH F 6 .   ? -11.017 24.074 67.330 1.00 40.94 ? 2081 HOH A O     1 
HETATM 3998 O  O     . HOH F 6 .   ? -13.439 26.019 67.434 1.00 37.52 ? 2082 HOH A O     1 
HETATM 3999 O  O     . HOH F 6 .   ? -26.795 19.406 45.436 1.00 45.44 ? 2083 HOH A O     1 
HETATM 4000 O  O     . HOH F 6 .   ? -19.555 20.904 46.865 1.00 29.64 ? 2084 HOH A O     1 
HETATM 4001 O  O     . HOH F 6 .   ? -20.356 18.575 47.173 1.00 22.21 ? 2085 HOH A O     1 
HETATM 4002 O  O     . HOH F 6 .   ? -25.902 20.897 43.460 1.00 34.72 ? 2086 HOH A O     1 
HETATM 4003 O  O     . HOH F 6 .   ? -24.680 27.349 42.136 1.00 52.98 ? 2087 HOH A O     1 
HETATM 4004 O  O     . HOH F 6 .   ? -26.456 28.358 46.322 1.00 44.85 ? 2088 HOH A O     1 
HETATM 4005 O  O     . HOH F 6 .   ? -22.158 28.186 53.173 1.00 32.99 ? 2089 HOH A O     1 
HETATM 4006 O  O     . HOH F 6 .   ? -22.106 27.984 56.485 1.00 51.98 ? 2090 HOH A O     1 
HETATM 4007 O  O     . HOH F 6 .   ? 17.314  17.528 63.527 1.00 53.15 ? 2091 HOH A O     1 
HETATM 4008 O  O     . HOH F 6 .   ? -29.646 26.422 53.827 1.00 44.03 ? 2092 HOH A O     1 
HETATM 4009 O  O     . HOH F 6 .   ? -20.576 16.474 61.825 1.00 34.45 ? 2093 HOH A O     1 
HETATM 4010 O  O     . HOH F 6 .   ? -22.209 25.682 68.546 1.00 57.18 ? 2094 HOH A O     1 
HETATM 4011 O  O     . HOH F 6 .   ? -20.195 20.256 64.314 1.00 29.13 ? 2095 HOH A O     1 
HETATM 4012 O  O     . HOH F 6 .   ? -10.597 20.770 63.988 1.00 54.74 ? 2096 HOH A O     1 
HETATM 4013 O  O     . HOH F 6 .   ? -14.873 13.762 63.374 1.00 35.34 ? 2097 HOH A O     1 
HETATM 4014 O  O     . HOH F 6 .   ? -15.820 16.409 63.143 1.00 26.71 ? 2098 HOH A O     1 
HETATM 4015 O  O     . HOH F 6 .   ? -12.370 11.187 65.568 1.00 49.94 ? 2099 HOH A O     1 
HETATM 4016 O  O     . HOH F 6 .   ? -7.600  18.616 64.929 1.00 55.18 ? 2100 HOH A O     1 
HETATM 4017 O  O     . HOH F 6 .   ? -5.529  17.555 62.477 1.00 49.70 ? 2101 HOH A O     1 
HETATM 4018 O  O     . HOH F 6 .   ? -13.646 8.625  60.831 1.00 56.58 ? 2102 HOH A O     1 
HETATM 4019 O  O     . HOH F 6 .   ? -3.081  11.951 49.045 1.00 54.62 ? 2103 HOH A O     1 
HETATM 4020 O  O     . HOH F 6 .   ? -5.861  15.640 53.990 1.00 36.61 ? 2104 HOH A O     1 
HETATM 4021 O  O     . HOH F 6 .   ? -4.202  16.252 52.164 1.00 42.09 ? 2105 HOH A O     1 
HETATM 4022 O  O     . HOH F 6 .   ? -7.058  22.716 45.458 1.00 29.17 ? 2106 HOH A O     1 
HETATM 4023 O  O     . HOH F 6 .   ? -0.678  17.430 44.745 1.00 45.12 ? 2107 HOH A O     1 
HETATM 4024 O  O     . HOH F 6 .   ? 1.369   32.324 63.117 1.00 44.77 ? 2108 HOH A O     1 
HETATM 4025 O  O     . HOH F 6 .   ? -3.963  21.657 38.414 1.00 21.47 ? 2109 HOH A O     1 
HETATM 4026 O  O     . HOH F 6 .   ? -7.452  17.021 40.989 1.00 23.34 ? 2110 HOH A O     1 
HETATM 4027 O  O     . HOH F 6 .   ? -4.160  17.223 38.673 1.00 34.16 ? 2111 HOH A O     1 
HETATM 4028 O  O     . HOH F 6 .   ? -3.236  17.520 49.147 1.00 50.18 ? 2112 HOH A O     1 
HETATM 4029 O  O     . HOH F 6 .   ? -19.868 25.094 37.254 1.00 27.88 ? 2113 HOH A O     1 
HETATM 4030 O  O     . HOH F 6 .   ? -23.176 18.573 37.442 1.00 29.23 ? 2114 HOH A O     1 
HETATM 4031 O  O     . HOH F 6 .   ? -27.353 17.688 37.103 1.00 42.23 ? 2115 HOH A O     1 
HETATM 4032 O  O     . HOH F 6 .   ? -28.280 15.431 36.950 1.00 41.12 ? 2116 HOH A O     1 
HETATM 4033 O  O     . HOH F 6 .   ? -30.674 11.392 43.173 1.00 49.37 ? 2117 HOH A O     1 
HETATM 4034 O  O     . HOH F 6 .   ? -27.799 14.753 47.611 1.00 53.93 ? 2118 HOH A O     1 
HETATM 4035 O  O     . HOH F 6 .   ? -32.601 12.398 41.981 1.00 54.81 ? 2119 HOH A O     1 
HETATM 4036 O  O     . HOH F 6 .   ? -30.082 11.744 34.393 1.00 49.46 ? 2120 HOH A O     1 
HETATM 4037 O  O     . HOH F 6 .   ? -27.755 4.403  36.189 1.00 52.30 ? 2121 HOH A O     1 
HETATM 4038 O  O     . HOH F 6 .   ? -26.946 7.105  54.685 1.00 42.10 ? 2122 HOH A O     1 
HETATM 4039 O  O     . HOH F 6 .   ? -20.331 2.674  48.760 1.00 36.52 ? 2123 HOH A O     1 
HETATM 4040 O  O     . HOH F 6 .   ? -10.393 10.081 53.534 1.00 51.53 ? 2124 HOH A O     1 
HETATM 4041 O  O     . HOH F 6 .   ? -7.910  8.721  50.205 1.00 46.89 ? 2125 HOH A O     1 
HETATM 4042 O  O     . HOH F 6 .   ? -11.004 5.449  39.753 1.00 25.83 ? 2126 HOH A O     1 
HETATM 4043 O  O     . HOH F 6 .   ? -11.401 3.593  41.541 1.00 42.82 ? 2127 HOH A O     1 
HETATM 4044 O  O     . HOH F 6 .   ? -5.182  4.843  40.718 1.00 42.79 ? 2128 HOH A O     1 
HETATM 4045 O  O     . HOH F 6 .   ? -4.310  5.416  43.676 1.00 41.13 ? 2129 HOH A O     1 
HETATM 4046 O  O     . HOH F 6 .   ? -5.624  7.228  45.656 1.00 35.77 ? 2130 HOH A O     1 
HETATM 4047 O  O     . HOH F 6 .   ? -3.901  0.624  34.943 1.00 46.76 ? 2131 HOH A O     1 
HETATM 4048 O  O     . HOH F 6 .   ? 2.589   9.503  33.629 1.00 38.55 ? 2132 HOH A O     1 
HETATM 4049 O  O     . HOH F 6 .   ? 3.949   11.898 43.536 1.00 38.81 ? 2133 HOH A O     1 
HETATM 4050 O  O     . HOH F 6 .   ? 1.552   10.643 30.161 1.00 33.80 ? 2134 HOH A O     1 
HETATM 4051 O  O     . HOH F 6 .   ? 1.653   7.503  32.199 1.00 52.27 ? 2135 HOH A O     1 
HETATM 4052 O  O     . HOH F 6 .   ? -5.355  9.680  29.969 1.00 33.04 ? 2136 HOH A O     1 
HETATM 4053 O  O     . HOH F 6 .   ? 0.698   11.286 32.794 1.00 25.31 ? 2137 HOH A O     1 
HETATM 4054 O  O     . HOH F 6 .   ? 4.555   13.643 24.464 1.00 38.65 ? 2138 HOH A O     1 
HETATM 4055 O  O     . HOH F 6 .   ? -1.501  18.542 24.155 1.00 31.66 ? 2139 HOH A O     1 
HETATM 4056 O  O     . HOH F 6 .   ? 5.973   21.122 23.641 1.00 45.32 ? 2140 HOH A O     1 
HETATM 4057 O  O     . HOH F 6 .   ? 1.228   26.594 21.877 1.00 42.20 ? 2141 HOH A O     1 
HETATM 4058 O  O     . HOH F 6 .   ? -2.136  20.554 22.686 1.00 43.40 ? 2142 HOH A O     1 
HETATM 4059 O  O     . HOH F 6 .   ? -2.114  28.572 27.545 1.00 34.85 ? 2143 HOH A O     1 
HETATM 4060 O  O     . HOH F 6 .   ? -3.748  19.027 25.336 1.00 38.78 ? 2144 HOH A O     1 
HETATM 4061 O  O     . HOH F 6 .   ? 7.167   28.263 35.334 1.00 22.08 ? 2145 HOH A O     1 
HETATM 4062 O  O     . HOH F 6 .   ? 8.680   37.126 36.112 1.00 35.70 ? 2146 HOH A O     1 
HETATM 4063 O  O     . HOH F 6 .   ? 25.232  35.802 37.285 1.00 52.23 ? 2147 HOH A O     1 
HETATM 4064 O  O     . HOH F 6 .   ? 27.384  26.766 44.057 1.00 44.68 ? 2148 HOH A O     1 
HETATM 4065 O  O     . HOH F 6 .   ? 5.102   11.673 41.234 1.00 48.90 ? 2149 HOH A O     1 
HETATM 4066 O  O     . HOH F 6 .   ? 3.287   13.714 44.857 1.00 31.01 ? 2150 HOH A O     1 
HETATM 4067 O  O     . HOH F 6 .   ? 8.130   10.902 44.530 1.00 21.85 ? 2151 HOH A O     1 
HETATM 4068 O  O     . HOH F 6 .   ? 19.274  13.977 30.633 1.00 34.54 ? 2152 HOH A O     1 
HETATM 4069 O  O     . HOH F 6 .   ? 13.024  12.854 28.782 1.00 39.70 ? 2153 HOH A O     1 
HETATM 4070 O  O     . HOH F 6 .   ? 16.322  16.680 26.898 1.00 44.82 ? 2154 HOH A O     1 
HETATM 4071 O  O     . HOH F 6 .   ? 18.946  16.766 29.321 1.00 34.28 ? 2155 HOH A O     1 
HETATM 4072 O  O     . HOH F 6 .   ? 11.568  19.718 26.581 1.00 27.63 ? 2156 HOH A O     1 
HETATM 4073 O  O     . HOH F 6 .   ? 8.023   12.103 30.318 1.00 49.03 ? 2157 HOH A O     1 
HETATM 4074 O  O     . HOH F 6 .   ? 17.250  24.153 27.716 1.00 21.51 ? 2158 HOH A O     1 
HETATM 4075 O  O     . HOH F 6 .   ? 6.048   29.780 26.190 1.00 60.84 ? 2159 HOH A O     1 
HETATM 4076 O  O     . HOH F 6 .   ? 11.803  29.788 32.680 1.00 28.75 ? 2160 HOH A O     1 
HETATM 4077 O  O     . HOH F 6 .   ? 18.732  29.168 29.451 1.00 18.20 ? 2161 HOH A O     1 
HETATM 4078 O  O     . HOH F 6 .   ? 17.289  23.523 24.950 1.00 32.98 ? 2162 HOH A O     1 
HETATM 4079 O  O     . HOH F 6 .   ? 15.724  28.853 22.206 1.00 47.21 ? 2163 HOH A O     1 
HETATM 4080 O  O     . HOH F 6 .   ? 18.186  26.016 23.437 1.00 47.81 ? 2164 HOH A O     1 
HETATM 4081 O  O     . HOH F 6 .   ? 19.694  27.627 22.812 1.00 47.44 ? 2165 HOH A O     1 
HETATM 4082 O  O     . HOH F 6 .   ? 18.247  36.343 31.846 1.00 41.49 ? 2166 HOH A O     1 
HETATM 4083 O  O     . HOH F 6 .   ? 26.374  42.501 30.947 1.00 38.62 ? 2167 HOH A O     1 
HETATM 4084 O  O     . HOH F 6 .   ? 22.724  41.004 28.938 1.00 34.33 ? 2168 HOH A O     1 
HETATM 4085 O  O     . HOH F 6 .   ? 30.953  29.336 25.620 1.00 29.97 ? 2169 HOH A O     1 
HETATM 4086 O  O     . HOH F 6 .   ? 26.973  30.926 29.703 1.00 29.91 ? 2170 HOH A O     1 
HETATM 4087 O  O     . HOH F 6 .   ? 24.515  29.037 23.191 1.00 33.62 ? 2171 HOH A O     1 
HETATM 4088 O  O     . HOH F 6 .   ? 23.594  23.964 25.895 1.00 40.23 ? 2172 HOH A O     1 
HETATM 4089 O  O     . HOH F 6 .   ? 27.322  26.467 27.609 1.00 43.58 ? 2173 HOH A O     1 
HETATM 4090 O  O     . HOH F 6 .   ? 21.004  28.157 30.136 1.00 19.14 ? 2174 HOH A O     1 
HETATM 4091 O  O     . HOH F 6 .   ? 26.834  31.373 33.515 1.00 47.63 ? 2175 HOH A O     1 
HETATM 4092 O  O     . HOH F 6 .   ? 24.896  28.776 37.540 1.00 35.86 ? 2176 HOH A O     1 
HETATM 4093 O  O     . HOH F 6 .   ? 18.727  22.403 29.260 1.00 22.07 ? 2177 HOH A O     1 
HETATM 4094 O  O     . HOH F 6 .   ? 19.629  19.284 29.024 1.00 46.56 ? 2178 HOH A O     1 
HETATM 4095 O  O     . HOH F 6 .   ? 22.907  27.917 39.358 1.00 34.05 ? 2179 HOH A O     1 
HETATM 4096 O  O     . HOH F 6 .   ? 26.269  20.645 37.799 1.00 49.30 ? 2180 HOH A O     1 
HETATM 4097 O  O     . HOH F 6 .   ? 28.722  21.207 45.334 1.00 47.37 ? 2181 HOH A O     1 
HETATM 4098 O  O     . HOH F 6 .   ? 11.146  6.948  38.959 1.00 44.21 ? 2182 HOH A O     1 
HETATM 4099 O  O     . HOH F 6 .   ? 13.472  8.779  37.988 1.00 27.66 ? 2183 HOH A O     1 
HETATM 4100 O  O     . HOH F 6 .   ? 8.342   9.880  40.820 1.00 27.33 ? 2184 HOH A O     1 
HETATM 4101 O  O     . HOH F 6 .   ? 11.912  7.370  45.835 0.50 16.96 ? 2185 HOH A O     1 
HETATM 4102 O  O     . HOH F 6 .   ? 13.775  6.108  44.292 1.00 23.20 ? 2186 HOH A O     1 
HETATM 4103 O  O     . HOH F 6 .   ? 5.230   8.481  49.913 1.00 49.66 ? 2187 HOH A O     1 
HETATM 4104 O  O     . HOH F 6 .   ? 8.097   8.531  43.504 1.00 37.24 ? 2188 HOH A O     1 
HETATM 4105 O  O     . HOH F 6 .   ? 4.606   10.756 48.288 1.00 44.11 ? 2189 HOH A O     1 
HETATM 4106 O  O     . HOH F 6 .   ? 5.173   10.712 51.582 1.00 40.54 ? 2190 HOH A O     1 
HETATM 4107 O  O     . HOH F 6 .   ? 8.531   9.790  58.840 0.50 29.34 ? 2191 HOH A O     1 
HETATM 4108 O  O     . HOH F 6 .   ? 13.267  2.443  50.567 1.00 38.24 ? 2192 HOH A O     1 
HETATM 4109 O  O     . HOH F 6 .   ? 14.197  5.035  46.644 1.00 30.26 ? 2193 HOH A O     1 
HETATM 4110 O  O     . HOH F 6 .   ? 19.965  5.315  51.616 1.00 33.00 ? 2194 HOH A O     1 
HETATM 4111 O  O     . HOH F 6 .   ? 15.154  -0.504 40.180 1.00 40.70 ? 2195 HOH A O     1 
HETATM 4112 O  O     . HOH F 6 .   ? 14.082  2.422  45.987 1.00 34.02 ? 2196 HOH A O     1 
HETATM 4113 O  O     . HOH F 6 .   ? 27.813  4.455  40.288 1.00 44.43 ? 2197 HOH A O     1 
HETATM 4114 O  O     . HOH F 6 .   ? 23.328  9.651  37.929 1.00 30.67 ? 2198 HOH A O     1 
HETATM 4115 O  O     . HOH F 6 .   ? 24.224  8.473  34.618 1.00 48.09 ? 2199 HOH A O     1 
HETATM 4116 O  O     . HOH F 6 .   ? 16.344  10.078 30.535 1.00 51.38 ? 2200 HOH A O     1 
HETATM 4117 O  O     . HOH F 6 .   ? 12.987  6.597  37.247 1.00 44.55 ? 2201 HOH A O     1 
HETATM 4118 O  O     . HOH F 6 .   ? 12.477  8.359  34.654 1.00 36.26 ? 2202 HOH A O     1 
HETATM 4119 O  O     . HOH F 6 .   ? 19.525  0.541  35.428 1.00 43.07 ? 2203 HOH A O     1 
HETATM 4120 O  O     . HOH F 6 .   ? 14.075  2.190  37.071 1.00 40.04 ? 2204 HOH A O     1 
HETATM 4121 O  O     . HOH F 6 .   ? 22.915  -0.958 37.692 1.00 35.27 ? 2205 HOH A O     1 
HETATM 4122 O  O     . HOH F 6 .   ? 17.667  -1.479 43.854 1.00 45.72 ? 2206 HOH A O     1 
HETATM 4123 O  O     . HOH F 6 .   ? 20.729  3.212  42.303 1.00 26.70 ? 2207 HOH A O     1 
HETATM 4124 O  O     . HOH F 6 .   ? 30.769  3.661  48.289 1.00 51.61 ? 2208 HOH A O     1 
HETATM 4125 O  O     . HOH F 6 .   ? 32.040  6.126  48.649 1.00 58.99 ? 2209 HOH A O     1 
HETATM 4126 O  O     . HOH F 6 .   ? 29.754  14.528 48.890 1.00 48.81 ? 2210 HOH A O     1 
HETATM 4127 O  O     . HOH F 6 .   ? 12.462  9.422  49.740 1.00 24.50 ? 2211 HOH A O     1 
HETATM 4128 O  O     . HOH F 6 .   ? 15.199  13.133 56.591 1.00 32.56 ? 2212 HOH A O     1 
HETATM 4129 O  O     . HOH F 6 .   ? 24.682  17.836 57.402 1.00 49.07 ? 2213 HOH A O     1 
HETATM 4130 O  O     . HOH F 6 .   ? 18.561  30.810 58.646 1.00 37.41 ? 2214 HOH A O     1 
HETATM 4131 O  O     . HOH F 6 .   ? 3.280   20.771 43.511 1.00 22.11 ? 2215 HOH A O     1 
HETATM 4132 O  O     . HOH F 6 .   ? 0.197   23.624 45.118 1.00 36.67 ? 2216 HOH A O     1 
HETATM 4133 O  O     . HOH F 6 .   ? 5.075   17.262 47.995 1.00 48.66 ? 2217 HOH A O     1 
HETATM 4134 O  O     . HOH F 6 .   ? 5.667   20.403 45.831 1.00 14.80 ? 2218 HOH A O     1 
HETATM 4135 O  O     . HOH F 6 .   ? 14.095  27.310 61.044 1.00 41.58 ? 2219 HOH A O     1 
HETATM 4136 O  O     . HOH F 6 .   ? 14.482  12.403 60.775 1.00 53.50 ? 2220 HOH A O     1 
HETATM 4137 O  O     . HOH F 6 .   ? 17.923  19.927 61.796 1.00 51.55 ? 2221 HOH A O     1 
HETATM 4138 O  O     . HOH F 6 .   ? 17.572  16.880 57.325 1.00 40.19 ? 2222 HOH A O     1 
HETATM 4139 O  O     . HOH F 6 .   ? 18.280  18.919 58.126 1.00 34.60 ? 2223 HOH A O     1 
HETATM 4140 O  O     . HOH F 6 .   ? 1.215   27.523 47.574 1.00 30.13 ? 2224 HOH A O     1 
HETATM 4141 O  O     . HOH F 6 .   ? -7.028  29.240 45.049 1.00 26.39 ? 2225 HOH A O     1 
HETATM 4142 O  O     . HOH F 6 .   ? -7.623  31.857 44.936 1.00 36.29 ? 2226 HOH A O     1 
HETATM 4143 O  O     . HOH F 6 .   ? -9.101  44.798 49.994 1.00 45.33 ? 2227 HOH A O     1 
HETATM 4144 O  O     . HOH F 6 .   ? -10.803 42.817 40.789 1.00 48.43 ? 2228 HOH A O     1 
HETATM 4145 O  O     . HOH F 6 .   ? -16.770 45.699 67.570 1.00 48.35 ? 2229 HOH A O     1 
HETATM 4146 O  O     . HOH F 6 .   ? -19.401 34.283 51.862 1.00 44.32 ? 2230 HOH A O     1 
HETATM 4147 O  O     . HOH F 6 .   ? -18.266 34.460 42.647 1.00 33.87 ? 2231 HOH A O     1 
HETATM 4148 O  O     . HOH F 6 .   ? -10.817 37.140 40.777 1.00 48.19 ? 2232 HOH A O     1 
HETATM 4149 O  O     . HOH F 6 .   ? -12.931 33.007 40.088 1.00 37.91 ? 2233 HOH A O     1 
HETATM 4150 O  O     . HOH F 6 .   ? -9.809  32.156 43.906 1.00 47.36 ? 2234 HOH A O     1 
HETATM 4151 O  O     . HOH F 6 .   ? -17.956 31.652 49.463 1.00 37.03 ? 2235 HOH A O     1 
HETATM 4152 O  O     . HOH F 6 .   ? -8.512  28.381 51.630 1.00 24.27 ? 2236 HOH A O     1 
HETATM 4153 O  O     . HOH F 6 .   ? -9.922  34.497 61.850 1.00 31.53 ? 2237 HOH A O     1 
HETATM 4154 O  O     . HOH F 6 .   ? -7.713  35.222 62.499 1.00 32.11 ? 2238 HOH A O     1 
HETATM 4155 O  O     . HOH F 6 .   ? -8.138  26.748 53.974 1.00 24.35 ? 2239 HOH A O     1 
HETATM 4156 O  O     . HOH F 6 .   ? -0.927  31.230 62.202 1.00 30.04 ? 2240 HOH A O     1 
HETATM 4157 O  O     . HOH F 6 .   ? -2.326  26.521 61.530 1.00 45.40 ? 2241 HOH A O     1 
HETATM 4158 O  O     . HOH F 6 .   ? 4.537   26.475 65.195 1.00 57.10 ? 2242 HOH A O     1 
HETATM 4159 O  O     . HOH F 6 .   ? -4.157  29.206 64.711 1.00 51.74 ? 2243 HOH A O     1 
HETATM 4160 O  O     . HOH F 6 .   ? 4.410   31.352 40.652 1.00 28.04 ? 2244 HOH A O     1 
HETATM 4161 O  O     . HOH F 6 .   ? 7.225   39.188 39.706 1.00 39.07 ? 2245 HOH A O     1 
HETATM 4162 O  O     . HOH F 6 .   ? 19.011  41.055 43.408 1.00 50.91 ? 2246 HOH A O     1 
HETATM 4163 O  O     . HOH F 6 .   ? 8.968   39.326 37.682 1.00 34.74 ? 2247 HOH A O     1 
HETATM 4164 O  O     . HOH F 6 .   ? 21.179  39.123 55.591 1.00 28.82 ? 2248 HOH A O     1 
HETATM 4165 O  O     . HOH F 6 .   ? 11.578  43.014 55.200 1.00 37.65 ? 2249 HOH A O     1 
HETATM 4166 O  O     . HOH F 6 .   ? 12.174  42.973 63.811 0.50 26.38 ? 2250 HOH A O     1 
HETATM 4167 O  O     . HOH F 6 .   ? 8.255   37.865 64.050 1.00 47.67 ? 2251 HOH A O     1 
HETATM 4168 O  O     . HOH F 6 .   ? 10.286  44.849 66.482 1.00 50.98 ? 2252 HOH A O     1 
HETATM 4169 O  O     . HOH F 6 .   ? 9.061   38.915 70.927 1.00 37.45 ? 2253 HOH A O     1 
HETATM 4170 O  O     . HOH F 6 .   ? 6.014   36.178 74.879 1.00 23.32 ? 2254 HOH A O     1 
HETATM 4171 O  O     . HOH F 6 .   ? 5.790   38.091 79.419 1.00 30.38 ? 2255 HOH A O     1 
HETATM 4172 O  O     . HOH F 6 .   ? 23.695  16.140 35.832 1.00 45.82 ? 2256 HOH A O     1 
HETATM 4173 O  O     . HOH F 6 .   ? 5.418   17.930 45.546 1.00 41.30 ? 2257 HOH A O     1 
HETATM 4174 O  O     . HOH F 6 .   ? -2.753  15.118 46.240 1.00 42.87 ? 2258 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -17 ?   ?   ?   A . n 
A 1 2   SER 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   HIS 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  SER 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  GLY 12  -6  ?   ?   ?   A . n 
A 1 13  LEU 13  -5  ?   ?   ?   A . n 
A 1 14  VAL 14  -4  ?   ?   ?   A . n 
A 1 15  PRO 15  -3  ?   ?   ?   A . n 
A 1 16  ARG 16  -2  ?   ?   ?   A . n 
A 1 17  GLY 17  -1  ?   ?   ?   A . n 
A 1 18  SER 18  0   ?   ?   ?   A . n 
A 1 19  MET 19  1   ?   ?   ?   A . n 
A 1 20  SER 20  2   ?   ?   ?   A . n 
A 1 21  THR 21  3   3   THR THR A . n 
A 1 22  SER 22  4   4   SER SER A . n 
A 1 23  TRP 23  5   5   TRP TRP A . n 
A 1 24  SER 24  6   6   SER SER A . n 
A 1 25  ASP 25  7   7   ASP ASP A . n 
A 1 26  ARG 26  8   8   ARG ARG A . n 
A 1 27  LEU 27  9   9   LEU LEU A . n 
A 1 28  GLN 28  10  10  GLN GLN A . n 
A 1 29  ASN 29  11  11  ASN ASN A . n 
A 1 30  ALA 30  12  12  ALA ALA A . n 
A 1 31  ALA 31  13  13  ALA ALA A . n 
A 1 32  ASP 32  14  14  ASP ASP A . n 
A 1 33  MET 33  15  15  MET MET A . n 
A 1 34  PRO 34  16  16  PRO PRO A . n 
A 1 35  ALA 35  17  17  ALA ALA A . n 
A 1 36  ASN 36  18  18  ASN ASN A . n 
A 1 37  MET 37  19  19  MET MET A . n 
A 1 38  ASP 38  20  20  ASP ASP A . n 
A 1 39  LYS 39  21  21  LYS LYS A . n 
A 1 40  HIS 40  22  22  HIS HIS A . n 
A 1 41  ALA 41  23  23  ALA ALA A . n 
A 1 42  LEU 42  24  24  LEU LEU A . n 
A 1 43  LYS 43  25  25  LYS LYS A . n 
A 1 44  LYS 44  26  26  LYS LYS A . n 
A 1 45  TYR 45  27  27  TYR TYR A . n 
A 1 46  ARG 46  28  28  ARG ARG A . n 
A 1 47  ARG 47  29  29  ARG ARG A . n 
A 1 48  GLU 48  30  30  GLU GLU A . n 
A 1 49  ALA 49  31  31  ALA ALA A . n 
A 1 50  TYR 50  32  32  TYR TYR A . n 
A 1 51  HIS 51  33  33  HIS HIS A . n 
A 1 52  ARG 52  34  34  ARG ARG A . n 
A 1 53  VAL 53  35  35  VAL VAL A . n 
A 1 54  PHE 54  36  36  PHE PHE A . n 
A 1 55  VAL 55  37  37  VAL VAL A . n 
A 1 56  ASN 56  38  38  ASN ASN A . n 
A 1 57  ARG 57  39  39  ARG ARG A . n 
A 1 58  SER 58  40  40  SER SER A . n 
A 1 59  LEU 59  41  41  LEU LEU A . n 
A 1 60  ALA 60  42  42  ALA ALA A . n 
A 1 61  MET 61  43  43  MET MET A . n 
A 1 62  GLU 62  44  44  GLU GLU A . n 
A 1 63  LYS 63  45  45  LYS LYS A . n 
A 1 64  ILE 64  46  46  ILE ILE A . n 
A 1 65  LYS 65  47  47  LYS LYS A . n 
A 1 66  CYS 66  48  48  CYS CYS A . n 
A 1 67  PHE 67  49  49  PHE PHE A . n 
A 1 68  GLY 68  50  50  GLY GLY A . n 
A 1 69  PHE 69  51  51  PHE PHE A . n 
A 1 70  ASN 70  52  52  ASN ASN A . n 
A 1 71  MET 71  53  53  MET MET A . n 
A 1 72  ASP 72  54  54  ASP ASP A . n 
A 1 73  TYR 73  55  55  TYR TYR A . n 
A 1 74  THR 74  56  56  THR THR A . n 
A 1 75  LEU 75  57  57  LEU LEU A . n 
A 1 76  ALA 76  58  58  ALA ALA A . n 
A 1 77  VAL 77  59  59  VAL VAL A . n 
A 1 78  TYR 78  60  60  TYR TYR A . n 
A 1 79  LYS 79  61  61  LYS LYS A . n 
A 1 80  SER 80  62  62  SER SER A . n 
A 1 81  PRO 81  63  63  PRO PRO A . n 
A 1 82  GLU 82  64  64  GLU GLU A . n 
A 1 83  TYR 83  65  65  TYR TYR A . n 
A 1 84  GLU 84  66  66  GLU GLU A . n 
A 1 85  SER 85  67  67  SER SER A . n 
A 1 86  LEU 86  68  68  LEU LEU A . n 
A 1 87  GLY 87  69  69  GLY GLY A . n 
A 1 88  PHE 88  70  70  PHE PHE A . n 
A 1 89  GLU 89  71  71  GLU GLU A . n 
A 1 90  LEU 90  72  72  LEU LEU A . n 
A 1 91  THR 91  73  73  THR THR A . n 
A 1 92  VAL 92  74  74  VAL VAL A . n 
A 1 93  GLU 93  75  75  GLU GLU A . n 
A 1 94  ARG 94  76  76  ARG ARG A . n 
A 1 95  LEU 95  77  77  LEU LEU A . n 
A 1 96  VAL 96  78  78  VAL VAL A . n 
A 1 97  SER 97  79  79  SER SER A . n 
A 1 98  ILE 98  80  80  ILE ILE A . n 
A 1 99  GLY 99  81  81  GLY GLY A . n 
A 1 100 TYR 100 82  82  TYR TYR A . n 
A 1 101 PRO 101 83  83  PRO PRO A . n 
A 1 102 GLN 102 84  84  GLN GLN A . n 
A 1 103 GLU 103 85  85  GLU GLU A . n 
A 1 104 LEU 104 86  86  LEU LEU A . n 
A 1 105 LEU 105 87  87  LEU LEU A . n 
A 1 106 SER 106 88  88  SER SER A . n 
A 1 107 PHE 107 89  89  PHE PHE A . n 
A 1 108 ALA 108 90  90  ALA ALA A . n 
A 1 109 TYR 109 91  91  TYR TYR A . n 
A 1 110 ASP 110 92  92  ASP ASP A . n 
A 1 111 SER 111 93  93  SER SER A . n 
A 1 112 THR 112 94  94  THR THR A . n 
A 1 113 PHE 113 95  95  PHE PHE A . n 
A 1 114 PRO 114 96  96  PRO PRO A . n 
A 1 115 THR 115 97  97  THR THR A . n 
A 1 116 ARG 116 98  98  ARG ARG A . n 
A 1 117 GLY 117 99  99  GLY GLY A . n 
A 1 118 LEU 118 100 100 LEU LEU A . n 
A 1 119 VAL 119 101 101 VAL VAL A . n 
A 1 120 PHE 120 102 102 PHE PHE A . n 
A 1 121 ASP 121 103 103 ASP ASP A . n 
A 1 122 THR 122 104 104 THR THR A . n 
A 1 123 LEU 123 105 105 LEU LEU A . n 
A 1 124 TYR 124 106 106 TYR TYR A . n 
A 1 125 GLY 125 107 107 GLY GLY A . n 
A 1 126 ASN 126 108 108 ASN ASN A . n 
A 1 127 LEU 127 109 109 LEU LEU A . n 
A 1 128 LEU 128 110 110 LEU LEU A . n 
A 1 129 LYS 129 111 111 LYS LYS A . n 
A 1 130 VAL 130 112 112 VAL VAL A . n 
A 1 131 ASP 131 113 113 ASP ASP A . n 
A 1 132 ALA 132 114 114 ALA ALA A . n 
A 1 133 TYR 133 115 115 TYR TYR A . n 
A 1 134 GLY 134 116 116 GLY GLY A . n 
A 1 135 ASN 135 117 117 ASN ASN A . n 
A 1 136 LEU 136 118 118 LEU LEU A . n 
A 1 137 LEU 137 119 119 LEU LEU A . n 
A 1 138 VAL 138 120 120 VAL VAL A . n 
A 1 139 CYS 139 121 121 CYS CYS A . n 
A 1 140 ALA 140 122 122 ALA ALA A . n 
A 1 141 HIS 141 123 123 HIS HIS A . n 
A 1 142 GLY 142 124 124 GLY GLY A . n 
A 1 143 PHE 143 125 125 PHE PHE A . n 
A 1 144 ASN 144 126 126 ASN ASN A . n 
A 1 145 PHE 145 127 127 PHE PHE A . n 
A 1 146 ILE 146 128 128 ILE ILE A . n 
A 1 147 ARG 147 129 129 ARG ARG A . n 
A 1 148 GLY 148 130 130 GLY GLY A . n 
A 1 149 PRO 149 131 131 PRO PRO A . n 
A 1 150 GLU 150 132 132 GLU GLU A . n 
A 1 151 THR 151 133 133 THR THR A . n 
A 1 152 ARG 152 134 134 ARG ARG A . n 
A 1 153 GLU 153 135 135 GLU GLU A . n 
A 1 154 GLN 154 136 136 GLN GLN A . n 
A 1 155 TYR 155 137 137 TYR TYR A . n 
A 1 156 PRO 156 138 138 PRO PRO A . n 
A 1 157 ASN 157 139 139 ASN ASN A . n 
A 1 158 LYS 158 140 140 LYS LYS A . n 
A 1 159 PHE 159 141 141 PHE PHE A . n 
A 1 160 ILE 160 142 142 ILE ILE A . n 
A 1 161 GLN 161 143 143 GLN GLN A . n 
A 1 162 ARG 162 144 144 ARG ARG A . n 
A 1 163 ASP 163 145 145 ASP ASP A . n 
A 1 164 ASP 164 146 146 ASP ASP A . n 
A 1 165 THR 165 147 147 THR THR A . n 
A 1 166 GLU 166 148 148 GLU GLU A . n 
A 1 167 ARG 167 149 149 ARG ARG A . n 
A 1 168 PHE 168 150 150 PHE PHE A . n 
A 1 169 TYR 169 151 151 TYR TYR A . n 
A 1 170 ILE 170 152 152 ILE ILE A . n 
A 1 171 LEU 171 153 153 LEU LEU A . n 
A 1 172 ASN 172 154 154 ASN ASN A . n 
A 1 173 THR 173 155 155 THR THR A . n 
A 1 174 LEU 174 156 156 LEU LEU A . n 
A 1 175 PHE 175 157 157 PHE PHE A . n 
A 1 176 ASN 176 158 158 ASN ASN A . n 
A 1 177 LEU 177 159 159 LEU LEU A . n 
A 1 178 PRO 178 160 160 PRO PRO A . n 
A 1 179 GLU 179 161 161 GLU GLU A . n 
A 1 180 THR 180 162 162 THR THR A . n 
A 1 181 TYR 181 163 163 TYR TYR A . n 
A 1 182 LEU 182 164 164 LEU LEU A . n 
A 1 183 LEU 183 165 165 LEU LEU A . n 
A 1 184 ALA 184 166 166 ALA ALA A . n 
A 1 185 CYS 185 167 167 CYS CYS A . n 
A 1 186 LEU 186 168 168 LEU LEU A . n 
A 1 187 VAL 187 169 169 VAL VAL A . n 
A 1 188 ASP 188 170 170 ASP ASP A . n 
A 1 189 PHE 189 171 171 PHE PHE A . n 
A 1 190 PHE 190 172 172 PHE PHE A . n 
A 1 191 THR 191 173 173 THR THR A . n 
A 1 192 ASN 192 174 174 ASN ASN A . n 
A 1 193 CYS 193 175 175 CYS CYS A . n 
A 1 194 PRO 194 176 176 PRO PRO A . n 
A 1 195 ARG 195 177 177 ARG ARG A . n 
A 1 196 TYR 196 178 178 TYR TYR A . n 
A 1 197 THR 197 179 179 THR THR A . n 
A 1 198 SER 198 180 180 SER SER A . n 
A 1 199 CYS 199 181 181 CYS CYS A . n 
A 1 200 GLU 200 182 182 GLU GLU A . n 
A 1 201 THR 201 183 183 THR THR A . n 
A 1 202 GLY 202 184 184 GLY GLY A . n 
A 1 203 PHE 203 185 185 PHE PHE A . n 
A 1 204 LYS 204 186 186 LYS LYS A . n 
A 1 205 ASP 205 187 187 ASP ASP A . n 
A 1 206 GLY 206 188 188 GLY GLY A . n 
A 1 207 ASP 207 189 189 ASP ASP A . n 
A 1 208 LEU 208 190 190 LEU LEU A . n 
A 1 209 PHE 209 191 191 PHE PHE A . n 
A 1 210 MET 210 192 192 MET MET A . n 
A 1 211 SER 211 193 193 SER SER A . n 
A 1 212 TYR 212 194 194 TYR TYR A . n 
A 1 213 ARG 213 195 195 ARG ARG A . n 
A 1 214 SER 214 196 196 SER SER A . n 
A 1 215 MET 215 197 197 MET MET A . n 
A 1 216 PHE 216 198 198 PHE PHE A . n 
A 1 217 GLN 217 199 199 GLN GLN A . n 
A 1 218 ASP 218 200 200 ASP ASP A . n 
A 1 219 VAL 219 201 201 VAL VAL A . n 
A 1 220 ARG 220 202 202 ARG ARG A . n 
A 1 221 ASP 221 203 203 ASP ASP A . n 
A 1 222 ALA 222 204 204 ALA ALA A . n 
A 1 223 VAL 223 205 205 VAL VAL A . n 
A 1 224 ASP 224 206 206 ASP ASP A . n 
A 1 225 TRP 225 207 207 TRP TRP A . n 
A 1 226 VAL 226 208 208 VAL VAL A . n 
A 1 227 HIS 227 209 209 HIS HIS A . n 
A 1 228 TYR 228 210 210 TYR TYR A . n 
A 1 229 LYS 229 211 211 LYS LYS A . n 
A 1 230 GLY 230 212 212 GLY GLY A . n 
A 1 231 SER 231 213 213 SER SER A . n 
A 1 232 LEU 232 214 214 LEU LEU A . n 
A 1 233 LYS 233 215 215 LYS LYS A . n 
A 1 234 GLU 234 216 216 GLU GLU A . n 
A 1 235 LYS 235 217 217 LYS LYS A . n 
A 1 236 THR 236 218 218 THR THR A . n 
A 1 237 VAL 237 219 219 VAL VAL A . n 
A 1 238 GLU 238 220 220 GLU GLU A . n 
A 1 239 ASN 239 221 221 ASN ASN A . n 
A 1 240 LEU 240 222 222 LEU LEU A . n 
A 1 241 GLU 241 223 223 GLU GLU A . n 
A 1 242 LYS 242 224 224 LYS LYS A . n 
A 1 243 TYR 243 225 225 TYR TYR A . n 
A 1 244 VAL 244 226 226 VAL VAL A . n 
A 1 245 VAL 245 227 227 VAL VAL A . n 
A 1 246 LYS 246 228 228 LYS LYS A . n 
A 1 247 ASP 247 229 229 ASP ASP A . n 
A 1 248 GLY 248 230 230 GLY GLY A . n 
A 1 249 LYS 249 231 231 LYS LYS A . n 
A 1 250 LEU 250 232 232 LEU LEU A . n 
A 1 251 PRO 251 233 233 PRO PRO A . n 
A 1 252 LEU 252 234 234 LEU LEU A . n 
A 1 253 LEU 253 235 235 LEU LEU A . n 
A 1 254 LEU 254 236 236 LEU LEU A . n 
A 1 255 SER 255 237 237 SER SER A . n 
A 1 256 ARG 256 238 238 ARG ARG A . n 
A 1 257 MET 257 239 239 MET MET A . n 
A 1 258 LYS 258 240 240 LYS LYS A . n 
A 1 259 GLU 259 241 241 GLU GLU A . n 
A 1 260 VAL 260 242 242 VAL VAL A . n 
A 1 261 GLY 261 243 243 GLY GLY A . n 
A 1 262 LYS 262 244 244 LYS LYS A . n 
A 1 263 VAL 263 245 245 VAL VAL A . n 
A 1 264 PHE 264 246 246 PHE PHE A . n 
A 1 265 LEU 265 247 247 LEU LEU A . n 
A 1 266 ALA 266 248 248 ALA ALA A . n 
A 1 267 THR 267 249 249 THR THR A . n 
A 1 268 ASN 268 250 250 ASN ASN A . n 
A 1 269 SER 269 251 251 SER SER A . n 
A 1 270 ASP 270 252 252 ASP ASP A . n 
A 1 271 TYR 271 253 253 TYR TYR A . n 
A 1 272 LYS 272 254 254 LYS LYS A . n 
A 1 273 TYR 273 255 255 TYR TYR A . n 
A 1 274 THR 274 256 256 THR THR A . n 
A 1 275 ASP 275 257 257 ASP ASP A . n 
A 1 276 LYS 276 258 258 LYS LYS A . n 
A 1 277 ILE 277 259 259 ILE ILE A . n 
A 1 278 MET 278 260 260 MET MET A . n 
A 1 279 THR 279 261 261 THR THR A . n 
A 1 280 TYR 280 262 262 TYR TYR A . n 
A 1 281 LEU 281 263 263 LEU LEU A . n 
A 1 282 PHE 282 264 264 PHE PHE A . n 
A 1 283 ASP 283 265 265 ASP ASP A . n 
A 1 284 PHE 284 266 266 PHE PHE A . n 
A 1 285 PRO 285 267 267 PRO PRO A . n 
A 1 286 HIS 286 268 268 HIS HIS A . n 
A 1 287 GLY 287 269 269 GLY GLY A . n 
A 1 288 PRO 288 270 270 PRO PRO A . n 
A 1 289 LYS 289 271 271 LYS LYS A . n 
A 1 290 PRO 290 272 272 PRO PRO A . n 
A 1 291 GLY 291 273 273 GLY GLY A . n 
A 1 292 SER 292 274 274 SER SER A . n 
A 1 293 SER 293 275 275 SER SER A . n 
A 1 294 HIS 294 276 276 HIS HIS A . n 
A 1 295 ARG 295 277 277 ARG ARG A . n 
A 1 296 PRO 296 278 278 PRO PRO A . n 
A 1 297 TRP 297 279 279 TRP TRP A . n 
A 1 298 GLN 298 280 280 GLN GLN A . n 
A 1 299 SER 299 281 281 SER SER A . n 
A 1 300 TYR 300 282 282 TYR TYR A . n 
A 1 301 PHE 301 283 283 PHE PHE A . n 
A 1 302 ASP 302 284 284 ASP ASP A . n 
A 1 303 LEU 303 285 285 LEU LEU A . n 
A 1 304 ILE 304 286 286 ILE ILE A . n 
A 1 305 LEU 305 287 287 LEU LEU A . n 
A 1 306 VAL 306 288 288 VAL VAL A . n 
A 1 307 ASP 307 289 289 ASP ASP A . n 
A 1 308 ALA 308 290 290 ALA ALA A . n 
A 1 309 ARG 309 291 291 ARG ARG A . n 
A 1 310 LYS 310 292 292 LYS LYS A . n 
A 1 311 PRO 311 293 293 PRO PRO A . n 
A 1 312 LEU 312 294 294 LEU LEU A . n 
A 1 313 PHE 313 295 295 PHE PHE A . n 
A 1 314 PHE 314 296 296 PHE PHE A . n 
A 1 315 GLY 315 297 297 GLY GLY A . n 
A 1 316 GLU 316 298 298 GLU GLU A . n 
A 1 317 GLY 317 299 299 GLY GLY A . n 
A 1 318 THR 318 300 300 THR THR A . n 
A 1 319 VAL 319 301 301 VAL VAL A . n 
A 1 320 LEU 320 302 302 LEU LEU A . n 
A 1 321 ARG 321 303 303 ARG ARG A . n 
A 1 322 GLN 322 304 304 GLN GLN A . n 
A 1 323 VAL 323 305 305 VAL VAL A . n 
A 1 324 ASP 324 306 306 ASP ASP A . n 
A 1 325 THR 325 307 307 THR THR A . n 
A 1 326 LYS 326 308 308 LYS LYS A . n 
A 1 327 THR 327 309 309 THR THR A . n 
A 1 328 GLY 328 310 310 GLY GLY A . n 
A 1 329 LYS 329 311 311 LYS LYS A . n 
A 1 330 LEU 330 312 312 LEU LEU A . n 
A 1 331 LYS 331 313 313 LYS LYS A . n 
A 1 332 ILE 332 314 314 ILE ILE A . n 
A 1 333 GLY 333 315 315 GLY GLY A . n 
A 1 334 THR 334 316 316 THR THR A . n 
A 1 335 TYR 335 317 317 TYR TYR A . n 
A 1 336 THR 336 318 318 THR THR A . n 
A 1 337 GLY 337 319 319 GLY GLY A . n 
A 1 338 PRO 338 320 320 PRO PRO A . n 
A 1 339 LEU 339 321 321 LEU LEU A . n 
A 1 340 GLN 340 322 322 GLN GLN A . n 
A 1 341 HIS 341 323 323 HIS HIS A . n 
A 1 342 GLY 342 324 324 GLY GLY A . n 
A 1 343 ILE 343 325 325 ILE ILE A . n 
A 1 344 VAL 344 326 326 VAL VAL A . n 
A 1 345 TYR 345 327 327 TYR TYR A . n 
A 1 346 SER 346 328 328 SER SER A . n 
A 1 347 GLY 347 329 329 GLY GLY A . n 
A 1 348 GLY 348 330 330 GLY GLY A . n 
A 1 349 SER 349 331 331 SER SER A . n 
A 1 350 SER 350 332 332 SER SER A . n 
A 1 351 ASP 351 333 333 ASP ASP A . n 
A 1 352 THR 352 334 334 THR THR A . n 
A 1 353 ILE 353 335 335 ILE ILE A . n 
A 1 354 CYS 354 336 336 CYS CYS A . n 
A 1 355 ASP 355 337 337 ASP ASP A . n 
A 1 356 LEU 356 338 338 LEU LEU A . n 
A 1 357 LEU 357 339 339 LEU LEU A . n 
A 1 358 GLY 358 340 340 GLY GLY A . n 
A 1 359 ALA 359 341 341 ALA ALA A . n 
A 1 360 LYS 360 342 342 LYS LYS A . n 
A 1 361 GLY 361 343 343 GLY GLY A . n 
A 1 362 LYS 362 344 344 LYS LYS A . n 
A 1 363 ASP 363 345 345 ASP ASP A . n 
A 1 364 ILE 364 346 346 ILE ILE A . n 
A 1 365 LEU 365 347 347 LEU LEU A . n 
A 1 366 TYR 366 348 348 TYR TYR A . n 
A 1 367 ILE 367 349 349 ILE ILE A . n 
A 1 368 GLY 368 350 350 GLY GLY A . n 
A 1 369 ASP 369 351 351 ASP ASP A . n 
A 1 370 HIS 370 352 352 HIS HIS A . n 
A 1 371 ILE 371 353 353 ILE ILE A . n 
A 1 372 PHE 372 354 354 PHE PHE A . n 
A 1 373 GLY 373 355 355 GLY GLY A . n 
A 1 374 ASP 374 356 356 ASP ASP A . n 
A 1 375 ILE 375 357 357 ILE ILE A . n 
A 1 376 LEU 376 358 358 LEU LEU A . n 
A 1 377 LYS 377 359 359 LYS LYS A . n 
A 1 378 SER 378 360 360 SER SER A . n 
A 1 379 LYS 379 361 361 LYS LYS A . n 
A 1 380 LYS 380 362 362 LYS LYS A . n 
A 1 381 ARG 381 363 363 ARG ARG A . n 
A 1 382 GLN 382 364 364 GLN GLN A . n 
A 1 383 GLY 383 365 365 GLY GLY A . n 
A 1 384 TRP 384 366 366 TRP TRP A . n 
A 1 385 ARG 385 367 367 ARG ARG A . n 
A 1 386 THR 386 368 368 THR THR A . n 
A 1 387 PHE 387 369 369 PHE PHE A . n 
A 1 388 LEU 388 370 370 LEU LEU A . n 
A 1 389 VAL 389 371 371 VAL VAL A . n 
A 1 390 ILE 390 372 372 ILE ILE A . n 
A 1 391 PRO 391 373 373 PRO PRO A . n 
A 1 392 GLU 392 374 374 GLU GLU A . n 
A 1 393 LEU 393 375 375 LEU LEU A . n 
A 1 394 ALA 394 376 376 ALA ALA A . n 
A 1 395 GLN 395 377 377 GLN GLN A . n 
A 1 396 GLU 396 378 378 GLU GLU A . n 
A 1 397 LEU 397 379 379 LEU LEU A . n 
A 1 398 HIS 398 380 380 HIS HIS A . n 
A 1 399 VAL 399 381 381 VAL VAL A . n 
A 1 400 TRP 400 382 382 TRP TRP A . n 
A 1 401 THR 401 383 383 THR THR A . n 
A 1 402 ASP 402 384 384 ASP ASP A . n 
A 1 403 LYS 403 385 385 LYS LYS A . n 
A 1 404 SER 404 386 386 SER SER A . n 
A 1 405 SER 405 387 387 SER SER A . n 
A 1 406 LEU 406 388 388 LEU LEU A . n 
A 1 407 PHE 407 389 389 PHE PHE A . n 
A 1 408 GLU 408 390 390 GLU GLU A . n 
A 1 409 GLU 409 391 391 GLU GLU A . n 
A 1 410 LEU 410 392 392 LEU LEU A . n 
A 1 411 GLN 411 393 393 GLN GLN A . n 
A 1 412 SER 412 394 394 SER SER A . n 
A 1 413 LEU 413 395 395 LEU LEU A . n 
A 1 414 ASP 414 396 396 ASP ASP A . n 
A 1 415 ILE 415 397 ?   ?   ?   A . n 
A 1 416 PHE 416 398 ?   ?   ?   A . n 
A 1 417 LEU 417 399 ?   ?   ?   A . n 
A 1 418 ALA 418 400 ?   ?   ?   A . n 
A 1 419 GLU 419 401 ?   ?   ?   A . n 
A 1 420 LEU 420 402 ?   ?   ?   A . n 
A 1 421 TYR 421 403 ?   ?   ?   A . n 
A 1 422 LYS 422 404 ?   ?   ?   A . n 
A 1 423 HIS 423 405 ?   ?   ?   A . n 
A 1 424 LEU 424 406 ?   ?   ?   A . n 
A 1 425 ASP 425 407 ?   ?   ?   A . n 
A 1 426 SER 426 408 ?   ?   ?   A . n 
A 1 427 SER 427 409 ?   ?   ?   A . n 
A 1 428 SER 428 410 ?   ?   ?   A . n 
A 1 429 ASN 429 411 ?   ?   ?   A . n 
A 1 430 GLU 430 412 ?   ?   ?   A . n 
A 1 431 ARG 431 413 ?   ?   ?   A . n 
A 1 432 PRO 432 414 ?   ?   ?   A . n 
A 1 433 ASP 433 415 ?   ?   ?   A . n 
A 1 434 ILE 434 416 ?   ?   ?   A . n 
A 1 435 SER 435 417 ?   ?   ?   A . n 
A 1 436 SER 436 418 ?   ?   ?   A . n 
A 1 437 ILE 437 419 ?   ?   ?   A . n 
A 1 438 GLN 438 420 ?   ?   ?   A . n 
A 1 439 ARG 439 421 421 ARG ARG A . n 
A 1 440 ARG 440 422 422 ARG ARG A . n 
A 1 441 ILE 441 423 423 ILE ILE A . n 
A 1 442 LYS 442 424 424 LYS LYS A . n 
A 1 443 LYS 443 425 425 LYS LYS A . n 
A 1 444 VAL 444 426 426 VAL VAL A . n 
A 1 445 THR 445 427 427 THR THR A . n 
A 1 446 HIS 446 428 428 HIS HIS A . n 
A 1 447 ASP 447 429 429 ASP ASP A . n 
A 1 448 MET 448 430 430 MET MET A . n 
A 1 449 ASP 449 431 431 ASP ASP A . n 
A 1 450 MET 450 432 432 MET MET A . n 
A 1 451 CYS 451 433 433 CYS CYS A . n 
A 1 452 TYR 452 434 434 TYR TYR A . n 
A 1 453 GLY 453 435 435 GLY GLY A . n 
A 1 454 MET 454 436 436 MET MET A . n 
A 1 455 MET 455 437 437 MET MET A . n 
A 1 456 GLY 456 438 438 GLY GLY A . n 
A 1 457 SER 457 439 439 SER SER A . n 
A 1 458 LEU 458 440 440 LEU LEU A . n 
A 1 459 PHE 459 441 441 PHE PHE A . n 
A 1 460 ARG 460 442 442 ARG ARG A . n 
A 1 461 SER 461 443 443 SER SER A . n 
A 1 462 GLY 462 444 444 GLY GLY A . n 
A 1 463 SER 463 445 445 SER SER A . n 
A 1 464 ARG 464 446 446 ARG ARG A . n 
A 1 465 GLN 465 447 447 GLN GLN A . n 
A 1 466 THR 466 448 448 THR THR A . n 
A 1 467 LEU 467 449 449 LEU LEU A . n 
A 1 468 PHE 468 450 450 PHE PHE A . n 
A 1 469 ALA 469 451 451 ALA ALA A . n 
A 1 470 SER 470 452 452 SER SER A . n 
A 1 471 GLN 471 453 453 GLN GLN A . n 
A 1 472 VAL 472 454 454 VAL VAL A . n 
A 1 473 MET 473 455 455 MET MET A . n 
A 1 474 ARG 474 456 456 ARG ARG A . n 
A 1 475 TYR 475 457 457 TYR TYR A . n 
A 1 476 ALA 476 458 458 ALA ALA A . n 
A 1 477 ASP 477 459 459 ASP ASP A . n 
A 1 478 LEU 478 460 460 LEU LEU A . n 
A 1 479 TYR 479 461 461 TYR TYR A . n 
A 1 480 ALA 480 462 462 ALA ALA A . n 
A 1 481 ALA 481 463 463 ALA ALA A . n 
A 1 482 SER 482 464 464 SER SER A . n 
A 1 483 PHE 483 465 465 PHE PHE A . n 
A 1 484 ILE 484 466 466 ILE ILE A . n 
A 1 485 ASN 485 467 467 ASN ASN A . n 
A 1 486 LEU 486 468 468 LEU LEU A . n 
A 1 487 LEU 487 469 469 LEU LEU A . n 
A 1 488 TYR 488 470 470 TYR TYR A . n 
A 1 489 TYR 489 471 471 TYR TYR A . n 
A 1 490 PRO 490 472 472 PRO PRO A . n 
A 1 491 PHE 491 473 473 PHE PHE A . n 
A 1 492 SER 492 474 474 SER SER A . n 
A 1 493 TYR 493 475 475 TYR TYR A . n 
A 1 494 LEU 494 476 476 LEU LEU A . n 
A 1 495 PHE 495 477 477 PHE PHE A . n 
A 1 496 ARG 496 478 478 ARG ARG A . n 
A 1 497 ALA 497 479 479 ALA ALA A . n 
A 1 498 ALA 498 480 480 ALA ALA A . n 
A 1 499 HIS 499 481 481 HIS HIS A . n 
A 1 500 VAL 500 482 482 VAL VAL A . n 
A 1 501 LEU 501 483 483 LEU LEU A . n 
A 1 502 MET 502 484 484 MET MET A . n 
A 1 503 PRO 503 485 485 PRO PRO A . n 
A 1 504 HIS 504 486 486 HIS HIS A . n 
A 1 505 GLU 505 487 487 GLU GLU A . n 
A 1 506 SER 506 488 488 SER SER A . n 
A 1 507 THR 507 489 ?   ?   ?   A . n 
A 1 508 VAL 508 490 ?   ?   ?   A . n 
A 1 509 GLU 509 491 ?   ?   ?   A . n 
A 1 510 HIS 510 492 ?   ?   ?   A . n 
A 1 511 THR 511 493 ?   ?   ?   A . n 
A 1 512 HIS 512 494 ?   ?   ?   A . n 
A 1 513 VAL 513 495 ?   ?   ?   A . n 
A 1 514 ASP 514 496 ?   ?   ?   A . n 
A 1 515 ILE 515 497 ?   ?   ?   A . n 
A 1 516 ASN 516 498 ?   ?   ?   A . n 
A 1 517 GLU 517 499 ?   ?   ?   A . n 
A 1 518 MET 518 500 ?   ?   ?   A . n 
A 1 519 GLU 519 501 ?   ?   ?   A . n 
A 1 520 SER 520 502 ?   ?   ?   A . n 
A 1 521 PRO 521 503 ?   ?   ?   A . n 
A 1 522 LEU 522 504 ?   ?   ?   A . n 
A 1 523 ALA 523 505 ?   ?   ?   A . n 
A 1 524 THR 524 506 ?   ?   ?   A . n 
A 1 525 ARG 525 507 ?   ?   ?   A . n 
A 1 526 ASN 526 508 ?   ?   ?   A . n 
A 1 527 ARG 527 509 ?   ?   ?   A . n 
A 1 528 THR 528 510 ?   ?   ?   A . n 
A 1 529 SER 529 511 ?   ?   ?   A . n 
A 1 530 VAL 530 512 ?   ?   ?   A . n 
A 1 531 ASP 531 513 ?   ?   ?   A . n 
A 1 532 PHE 532 514 ?   ?   ?   A . n 
A 1 533 LYS 533 515 ?   ?   ?   A . n 
A 1 534 ASP 534 516 ?   ?   ?   A . n 
A 1 535 THR 535 517 ?   ?   ?   A . n 
A 1 536 ASP 536 518 ?   ?   ?   A . n 
A 1 537 TYR 537 519 ?   ?   ?   A . n 
A 1 538 LYS 538 520 ?   ?   ?   A . n 
A 1 539 ARG 539 521 ?   ?   ?   A . n 
A 1 540 HIS 540 522 ?   ?   ?   A . n 
A 1 541 GLN 541 523 ?   ?   ?   A . n 
A 1 542 LEU 542 524 ?   ?   ?   A . n 
A 1 543 THR 543 525 ?   ?   ?   A . n 
A 1 544 ARG 544 526 ?   ?   ?   A . n 
A 1 545 SER 545 527 ?   ?   ?   A . n 
A 1 546 ILE 546 528 ?   ?   ?   A . n 
A 1 547 SER 547 529 ?   ?   ?   A . n 
A 1 548 GLU 548 530 ?   ?   ?   A . n 
A 1 549 ILE 549 531 ?   ?   ?   A . n 
A 1 550 LYS 550 532 ?   ?   ?   A . n 
A 1 551 PRO 551 533 ?   ?   ?   A . n 
A 1 552 PRO 552 534 ?   ?   ?   A . n 
A 1 553 ASN 553 535 ?   ?   ?   A . n 
A 1 554 LEU 554 536 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DG2 1   1489 1489 DG2 DG2 A . 
C 3 GOL 1   1490 1490 GOL GOL A . 
D 4 IMP 1   1491 1491 IMP IMP A . 
E 5 MG  1   1492 1492 MG  MG  A . 
F 6 HOH 1   2001 2001 HOH HOH A . 
F 6 HOH 2   2002 2002 HOH HOH A . 
F 6 HOH 3   2003 2003 HOH HOH A . 
F 6 HOH 4   2004 2004 HOH HOH A . 
F 6 HOH 5   2005 2005 HOH HOH A . 
F 6 HOH 6   2006 2006 HOH HOH A . 
F 6 HOH 7   2007 2007 HOH HOH A . 
F 6 HOH 8   2008 2008 HOH HOH A . 
F 6 HOH 9   2009 2009 HOH HOH A . 
F 6 HOH 10  2010 2010 HOH HOH A . 
F 6 HOH 11  2011 2011 HOH HOH A . 
F 6 HOH 12  2012 2012 HOH HOH A . 
F 6 HOH 13  2013 2013 HOH HOH A . 
F 6 HOH 14  2014 2014 HOH HOH A . 
F 6 HOH 15  2015 2015 HOH HOH A . 
F 6 HOH 16  2016 2016 HOH HOH A . 
F 6 HOH 17  2017 2017 HOH HOH A . 
F 6 HOH 18  2018 2018 HOH HOH A . 
F 6 HOH 19  2019 2019 HOH HOH A . 
F 6 HOH 20  2020 2020 HOH HOH A . 
F 6 HOH 21  2021 2021 HOH HOH A . 
F 6 HOH 22  2022 2022 HOH HOH A . 
F 6 HOH 23  2023 2023 HOH HOH A . 
F 6 HOH 24  2024 2024 HOH HOH A . 
F 6 HOH 25  2025 2025 HOH HOH A . 
F 6 HOH 26  2026 2026 HOH HOH A . 
F 6 HOH 27  2027 2027 HOH HOH A . 
F 6 HOH 28  2028 2028 HOH HOH A . 
F 6 HOH 29  2029 2029 HOH HOH A . 
F 6 HOH 30  2030 2030 HOH HOH A . 
F 6 HOH 31  2031 2031 HOH HOH A . 
F 6 HOH 32  2032 2032 HOH HOH A . 
F 6 HOH 33  2033 2033 HOH HOH A . 
F 6 HOH 34  2034 2034 HOH HOH A . 
F 6 HOH 35  2035 2035 HOH HOH A . 
F 6 HOH 36  2036 2036 HOH HOH A . 
F 6 HOH 37  2037 2037 HOH HOH A . 
F 6 HOH 38  2038 2038 HOH HOH A . 
F 6 HOH 39  2039 2039 HOH HOH A . 
F 6 HOH 40  2040 2040 HOH HOH A . 
F 6 HOH 41  2041 2041 HOH HOH A . 
F 6 HOH 42  2042 2042 HOH HOH A . 
F 6 HOH 43  2043 2043 HOH HOH A . 
F 6 HOH 44  2044 2044 HOH HOH A . 
F 6 HOH 45  2045 2045 HOH HOH A . 
F 6 HOH 46  2046 2046 HOH HOH A . 
F 6 HOH 47  2047 2047 HOH HOH A . 
F 6 HOH 48  2048 2048 HOH HOH A . 
F 6 HOH 49  2049 2049 HOH HOH A . 
F 6 HOH 50  2050 2050 HOH HOH A . 
F 6 HOH 51  2051 2051 HOH HOH A . 
F 6 HOH 52  2052 2052 HOH HOH A . 
F 6 HOH 53  2053 2053 HOH HOH A . 
F 6 HOH 54  2054 2054 HOH HOH A . 
F 6 HOH 55  2055 2055 HOH HOH A . 
F 6 HOH 56  2056 2056 HOH HOH A . 
F 6 HOH 57  2057 2057 HOH HOH A . 
F 6 HOH 58  2058 2058 HOH HOH A . 
F 6 HOH 59  2059 2059 HOH HOH A . 
F 6 HOH 60  2060 2060 HOH HOH A . 
F 6 HOH 61  2061 2061 HOH HOH A . 
F 6 HOH 62  2062 2062 HOH HOH A . 
F 6 HOH 63  2063 2063 HOH HOH A . 
F 6 HOH 64  2064 2064 HOH HOH A . 
F 6 HOH 65  2065 2065 HOH HOH A . 
F 6 HOH 66  2066 2066 HOH HOH A . 
F 6 HOH 67  2067 2067 HOH HOH A . 
F 6 HOH 68  2068 2068 HOH HOH A . 
F 6 HOH 69  2069 2069 HOH HOH A . 
F 6 HOH 70  2070 2070 HOH HOH A . 
F 6 HOH 71  2071 2071 HOH HOH A . 
F 6 HOH 72  2072 2072 HOH HOH A . 
F 6 HOH 73  2073 2073 HOH HOH A . 
F 6 HOH 74  2074 2074 HOH HOH A . 
F 6 HOH 75  2075 2075 HOH HOH A . 
F 6 HOH 76  2076 2076 HOH HOH A . 
F 6 HOH 77  2077 2077 HOH HOH A . 
F 6 HOH 78  2078 2078 HOH HOH A . 
F 6 HOH 79  2079 2079 HOH HOH A . 
F 6 HOH 80  2080 2080 HOH HOH A . 
F 6 HOH 81  2081 2081 HOH HOH A . 
F 6 HOH 82  2082 2082 HOH HOH A . 
F 6 HOH 83  2083 2083 HOH HOH A . 
F 6 HOH 84  2084 2084 HOH HOH A . 
F 6 HOH 85  2085 2085 HOH HOH A . 
F 6 HOH 86  2086 2086 HOH HOH A . 
F 6 HOH 87  2087 2087 HOH HOH A . 
F 6 HOH 88  2088 2088 HOH HOH A . 
F 6 HOH 89  2089 2089 HOH HOH A . 
F 6 HOH 90  2090 2090 HOH HOH A . 
F 6 HOH 91  2091 2091 HOH HOH A . 
F 6 HOH 92  2092 2092 HOH HOH A . 
F 6 HOH 93  2093 2093 HOH HOH A . 
F 6 HOH 94  2094 2094 HOH HOH A . 
F 6 HOH 95  2095 2095 HOH HOH A . 
F 6 HOH 96  2096 2096 HOH HOH A . 
F 6 HOH 97  2097 2097 HOH HOH A . 
F 6 HOH 98  2098 2098 HOH HOH A . 
F 6 HOH 99  2099 2099 HOH HOH A . 
F 6 HOH 100 2100 2100 HOH HOH A . 
F 6 HOH 101 2101 2101 HOH HOH A . 
F 6 HOH 102 2102 2102 HOH HOH A . 
F 6 HOH 103 2103 2103 HOH HOH A . 
F 6 HOH 104 2104 2104 HOH HOH A . 
F 6 HOH 105 2105 2105 HOH HOH A . 
F 6 HOH 106 2106 2106 HOH HOH A . 
F 6 HOH 107 2107 2107 HOH HOH A . 
F 6 HOH 108 2108 2108 HOH HOH A . 
F 6 HOH 109 2109 2109 HOH HOH A . 
F 6 HOH 110 2110 2110 HOH HOH A . 
F 6 HOH 111 2111 2111 HOH HOH A . 
F 6 HOH 112 2112 2112 HOH HOH A . 
F 6 HOH 113 2113 2113 HOH HOH A . 
F 6 HOH 114 2114 2114 HOH HOH A . 
F 6 HOH 115 2115 2115 HOH HOH A . 
F 6 HOH 116 2116 2116 HOH HOH A . 
F 6 HOH 117 2117 2117 HOH HOH A . 
F 6 HOH 118 2118 2118 HOH HOH A . 
F 6 HOH 119 2119 2119 HOH HOH A . 
F 6 HOH 120 2120 2120 HOH HOH A . 
F 6 HOH 121 2121 2121 HOH HOH A . 
F 6 HOH 122 2122 2122 HOH HOH A . 
F 6 HOH 123 2123 2123 HOH HOH A . 
F 6 HOH 124 2124 2124 HOH HOH A . 
F 6 HOH 125 2125 2125 HOH HOH A . 
F 6 HOH 126 2126 2126 HOH HOH A . 
F 6 HOH 127 2127 2127 HOH HOH A . 
F 6 HOH 128 2128 2128 HOH HOH A . 
F 6 HOH 129 2129 2129 HOH HOH A . 
F 6 HOH 130 2130 2130 HOH HOH A . 
F 6 HOH 131 2131 2131 HOH HOH A . 
F 6 HOH 132 2132 2132 HOH HOH A . 
F 6 HOH 133 2133 2133 HOH HOH A . 
F 6 HOH 134 2134 2134 HOH HOH A . 
F 6 HOH 135 2135 2135 HOH HOH A . 
F 6 HOH 136 2136 2136 HOH HOH A . 
F 6 HOH 137 2137 2137 HOH HOH A . 
F 6 HOH 138 2138 2138 HOH HOH A . 
F 6 HOH 139 2139 2139 HOH HOH A . 
F 6 HOH 140 2140 2140 HOH HOH A . 
F 6 HOH 141 2141 2141 HOH HOH A . 
F 6 HOH 142 2142 2142 HOH HOH A . 
F 6 HOH 143 2143 2143 HOH HOH A . 
F 6 HOH 144 2144 2144 HOH HOH A . 
F 6 HOH 145 2145 2145 HOH HOH A . 
F 6 HOH 146 2146 2146 HOH HOH A . 
F 6 HOH 147 2147 2147 HOH HOH A . 
F 6 HOH 148 2148 2148 HOH HOH A . 
F 6 HOH 149 2149 2149 HOH HOH A . 
F 6 HOH 150 2150 2150 HOH HOH A . 
F 6 HOH 151 2151 2151 HOH HOH A . 
F 6 HOH 152 2152 2152 HOH HOH A . 
F 6 HOH 153 2153 2153 HOH HOH A . 
F 6 HOH 154 2154 2154 HOH HOH A . 
F 6 HOH 155 2155 2155 HOH HOH A . 
F 6 HOH 156 2156 2156 HOH HOH A . 
F 6 HOH 157 2157 2157 HOH HOH A . 
F 6 HOH 158 2158 2158 HOH HOH A . 
F 6 HOH 159 2159 2159 HOH HOH A . 
F 6 HOH 160 2160 2160 HOH HOH A . 
F 6 HOH 161 2161 2161 HOH HOH A . 
F 6 HOH 162 2162 2162 HOH HOH A . 
F 6 HOH 163 2163 2163 HOH HOH A . 
F 6 HOH 164 2164 2164 HOH HOH A . 
F 6 HOH 165 2165 2165 HOH HOH A . 
F 6 HOH 166 2166 2166 HOH HOH A . 
F 6 HOH 167 2167 2167 HOH HOH A . 
F 6 HOH 168 2168 2168 HOH HOH A . 
F 6 HOH 169 2169 2169 HOH HOH A . 
F 6 HOH 170 2170 2170 HOH HOH A . 
F 6 HOH 171 2171 2171 HOH HOH A . 
F 6 HOH 172 2172 2172 HOH HOH A . 
F 6 HOH 173 2173 2173 HOH HOH A . 
F 6 HOH 174 2174 2174 HOH HOH A . 
F 6 HOH 175 2175 2175 HOH HOH A . 
F 6 HOH 176 2176 2176 HOH HOH A . 
F 6 HOH 177 2177 2177 HOH HOH A . 
F 6 HOH 178 2178 2178 HOH HOH A . 
F 6 HOH 179 2179 2179 HOH HOH A . 
F 6 HOH 180 2180 2180 HOH HOH A . 
F 6 HOH 181 2181 2181 HOH HOH A . 
F 6 HOH 182 2182 2182 HOH HOH A . 
F 6 HOH 183 2183 2183 HOH HOH A . 
F 6 HOH 184 2184 2184 HOH HOH A . 
F 6 HOH 185 2185 2185 HOH HOH A . 
F 6 HOH 186 2186 2186 HOH HOH A . 
F 6 HOH 187 2187 2187 HOH HOH A . 
F 6 HOH 188 2188 2188 HOH HOH A . 
F 6 HOH 189 2189 2189 HOH HOH A . 
F 6 HOH 190 2190 2190 HOH HOH A . 
F 6 HOH 191 2191 2191 HOH HOH A . 
F 6 HOH 192 2192 2192 HOH HOH A . 
F 6 HOH 193 2193 2193 HOH HOH A . 
F 6 HOH 194 2194 2194 HOH HOH A . 
F 6 HOH 195 2195 2195 HOH HOH A . 
F 6 HOH 196 2196 2196 HOH HOH A . 
F 6 HOH 197 2197 2197 HOH HOH A . 
F 6 HOH 198 2198 2198 HOH HOH A . 
F 6 HOH 199 2199 2199 HOH HOH A . 
F 6 HOH 200 2200 2200 HOH HOH A . 
F 6 HOH 201 2201 2201 HOH HOH A . 
F 6 HOH 202 2202 2202 HOH HOH A . 
F 6 HOH 203 2203 2203 HOH HOH A . 
F 6 HOH 204 2204 2204 HOH HOH A . 
F 6 HOH 205 2205 2205 HOH HOH A . 
F 6 HOH 206 2206 2206 HOH HOH A . 
F 6 HOH 207 2207 2207 HOH HOH A . 
F 6 HOH 208 2208 2208 HOH HOH A . 
F 6 HOH 209 2209 2209 HOH HOH A . 
F 6 HOH 210 2210 2210 HOH HOH A . 
F 6 HOH 211 2211 2211 HOH HOH A . 
F 6 HOH 212 2212 2212 HOH HOH A . 
F 6 HOH 213 2213 2213 HOH HOH A . 
F 6 HOH 214 2214 2214 HOH HOH A . 
F 6 HOH 215 2215 2215 HOH HOH A . 
F 6 HOH 216 2216 2216 HOH HOH A . 
F 6 HOH 217 2217 2217 HOH HOH A . 
F 6 HOH 218 2218 2218 HOH HOH A . 
F 6 HOH 219 2219 2219 HOH HOH A . 
F 6 HOH 220 2220 2220 HOH HOH A . 
F 6 HOH 221 2221 2221 HOH HOH A . 
F 6 HOH 222 2222 2222 HOH HOH A . 
F 6 HOH 223 2223 2223 HOH HOH A . 
F 6 HOH 224 2224 2224 HOH HOH A . 
F 6 HOH 225 2225 2225 HOH HOH A . 
F 6 HOH 226 2226 2226 HOH HOH A . 
F 6 HOH 227 2227 2227 HOH HOH A . 
F 6 HOH 228 2228 2228 HOH HOH A . 
F 6 HOH 229 2229 2229 HOH HOH A . 
F 6 HOH 230 2230 2230 HOH HOH A . 
F 6 HOH 231 2231 2231 HOH HOH A . 
F 6 HOH 232 2232 2232 HOH HOH A . 
F 6 HOH 233 2233 2233 HOH HOH A . 
F 6 HOH 234 2234 2234 HOH HOH A . 
F 6 HOH 235 2235 2235 HOH HOH A . 
F 6 HOH 236 2236 2236 HOH HOH A . 
F 6 HOH 237 2237 2237 HOH HOH A . 
F 6 HOH 238 2238 2238 HOH HOH A . 
F 6 HOH 239 2239 2239 HOH HOH A . 
F 6 HOH 240 2240 2240 HOH HOH A . 
F 6 HOH 241 2241 2241 HOH HOH A . 
F 6 HOH 242 2242 2242 HOH HOH A . 
F 6 HOH 243 2243 2243 HOH HOH A . 
F 6 HOH 244 2244 2244 HOH HOH A . 
F 6 HOH 245 2245 2245 HOH HOH A . 
F 6 HOH 246 2246 2246 HOH HOH A . 
F 6 HOH 247 2247 2247 HOH HOH A . 
F 6 HOH 248 2248 2248 HOH HOH A . 
F 6 HOH 249 2249 2249 HOH HOH A . 
F 6 HOH 250 2250 2250 HOH HOH A . 
F 6 HOH 251 2251 2251 HOH HOH A . 
F 6 HOH 252 2252 2252 HOH HOH A . 
F 6 HOH 253 2253 2253 HOH HOH A . 
F 6 HOH 254 2254 2254 HOH HOH A . 
F 6 HOH 255 2255 2255 HOH HOH A . 
F 6 HOH 256 2256 2256 HOH HOH A . 
F 6 HOH 257 2257 2257 HOH HOH A . 
F 6 HOH 258 2258 2258 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 15620  ? 
1 MORE         -101.8 ? 
1 'SSA (A^2)'  74170  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.6100000000 
3 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.6100000000 
4 'crystal symmetry operation' 2_555 -x,-y,z   -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2P ? D IMP .   ? A IMP 1491 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 171.5 ? 
2  O2P ? D IMP .   ? A IMP 1491 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? F HOH .   ? A HOH 2218 ? 1_555 85.8  ? 
3  OD1 ? A ASP 369 ? A ASP 351  ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? F HOH .   ? A HOH 2218 ? 1_555 85.7  ? 
4  O2P ? D IMP .   ? A IMP 1491 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 ND2 ? A ASN 70  ? A ASN 52   ? 1_555 96.4  ? 
5  OD1 ? A ASP 369 ? A ASP 351  ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 ND2 ? A ASN 70  ? A ASN 52   ? 1_555 81.9  ? 
6  O   ? F HOH .   ? A HOH 2218 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 ND2 ? A ASN 70  ? A ASN 52   ? 1_555 84.0  ? 
7  O2P ? D IMP .   ? A IMP 1491 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? A ASP 72  ? A ASP 54   ? 1_555 105.5 ? 
8  OD1 ? A ASP 369 ? A ASP 351  ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? A ASP 72  ? A ASP 54   ? 1_555 82.9  ? 
9  O   ? F HOH .   ? A HOH 2218 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? A ASP 72  ? A ASP 54   ? 1_555 167.9 ? 
10 ND2 ? A ASN 70  ? A ASN 52   ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? A ASP 72  ? A ASP 54   ? 1_555 90.3  ? 
11 O2P ? D IMP .   ? A IMP 1491 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? F HOH .   ? A HOH 2215 ? 1_555 91.0  ? 
12 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? F HOH .   ? A HOH 2215 ? 1_555 90.9  ? 
13 O   ? F HOH .   ? A HOH 2218 ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? F HOH .   ? A HOH 2215 ? 1_555 97.2  ? 
14 ND2 ? A ASN 70  ? A ASN 52   ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? F HOH .   ? A HOH 2215 ? 1_555 172.6 ? 
15 O   ? A ASP 72  ? A ASP 54   ? 1_555 MG ? E MG . ? A MG 1492 ? 1_555 O   ? F HOH .   ? A HOH 2215 ? 1_555 87.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-16 
2 'Structure model' 1 1 2016-07-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description' 
2 2 'Structure model' Other                     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2XCV 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ASP 52 TO ASN' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A CYS 48 ? ? SG  A CYS 48 ? ? 1.688 1.812 -0.124 0.016 N 
2 1 CZ A TYR 60 ? ? CE2 A TYR 60 ? ? 1.465 1.381 0.084  0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 28  ? ? CZ A ARG 28  ? ? NH1 A ARG 28  ? ? 123.35 120.30 3.05  0.50 N 
2 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH1 A ARG 277 ? ? 124.07 120.30 3.77  0.50 N 
3 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH2 A ARG 277 ? ? 116.94 120.30 -3.36 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 53  ? ? -98.54  -69.30 
2 1 THR A 56  ? ? -121.20 -73.90 
3 1 PRO A 267 ? ? -83.28  36.77  
4 1 PHE A 354 ? ? -93.39  -66.28 
5 1 ILE A 357 ? ? -92.80  -63.91 
6 1 ASP A 384 ? ? -81.63  40.27  
7 1 LYS A 385 ? ? -153.04 30.69  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2013 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.82 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -17 ? A GLY 1   
2  1 Y 1 A SER -16 ? A SER 2   
3  1 Y 1 A SER -15 ? A SER 3   
4  1 Y 1 A HIS -14 ? A HIS 4   
5  1 Y 1 A HIS -13 ? A HIS 5   
6  1 Y 1 A HIS -12 ? A HIS 6   
7  1 Y 1 A HIS -11 ? A HIS 7   
8  1 Y 1 A HIS -10 ? A HIS 8   
9  1 Y 1 A HIS -9  ? A HIS 9   
10 1 Y 1 A SER -8  ? A SER 10  
11 1 Y 1 A SER -7  ? A SER 11  
12 1 Y 1 A GLY -6  ? A GLY 12  
13 1 Y 1 A LEU -5  ? A LEU 13  
14 1 Y 1 A VAL -4  ? A VAL 14  
15 1 Y 1 A PRO -3  ? A PRO 15  
16 1 Y 1 A ARG -2  ? A ARG 16  
17 1 Y 1 A GLY -1  ? A GLY 17  
18 1 Y 1 A SER 0   ? A SER 18  
19 1 Y 1 A MET 1   ? A MET 19  
20 1 Y 1 A SER 2   ? A SER 20  
21 1 Y 1 A ILE 397 ? A ILE 415 
22 1 Y 1 A PHE 398 ? A PHE 416 
23 1 Y 1 A LEU 399 ? A LEU 417 
24 1 Y 1 A ALA 400 ? A ALA 418 
25 1 Y 1 A GLU 401 ? A GLU 419 
26 1 Y 1 A LEU 402 ? A LEU 420 
27 1 Y 1 A TYR 403 ? A TYR 421 
28 1 Y 1 A LYS 404 ? A LYS 422 
29 1 Y 1 A HIS 405 ? A HIS 423 
30 1 Y 1 A LEU 406 ? A LEU 424 
31 1 Y 1 A ASP 407 ? A ASP 425 
32 1 Y 1 A SER 408 ? A SER 426 
33 1 Y 1 A SER 409 ? A SER 427 
34 1 Y 1 A SER 410 ? A SER 428 
35 1 Y 1 A ASN 411 ? A ASN 429 
36 1 Y 1 A GLU 412 ? A GLU 430 
37 1 Y 1 A ARG 413 ? A ARG 431 
38 1 Y 1 A PRO 414 ? A PRO 432 
39 1 Y 1 A ASP 415 ? A ASP 433 
40 1 Y 1 A ILE 416 ? A ILE 434 
41 1 Y 1 A SER 417 ? A SER 435 
42 1 Y 1 A SER 418 ? A SER 436 
43 1 Y 1 A ILE 419 ? A ILE 437 
44 1 Y 1 A GLN 420 ? A GLN 438 
45 1 Y 1 A THR 489 ? A THR 507 
46 1 Y 1 A VAL 490 ? A VAL 508 
47 1 Y 1 A GLU 491 ? A GLU 509 
48 1 Y 1 A HIS 492 ? A HIS 510 
49 1 Y 1 A THR 493 ? A THR 511 
50 1 Y 1 A HIS 494 ? A HIS 512 
51 1 Y 1 A VAL 495 ? A VAL 513 
52 1 Y 1 A ASP 496 ? A ASP 514 
53 1 Y 1 A ILE 497 ? A ILE 515 
54 1 Y 1 A ASN 498 ? A ASN 516 
55 1 Y 1 A GLU 499 ? A GLU 517 
56 1 Y 1 A MET 500 ? A MET 518 
57 1 Y 1 A GLU 501 ? A GLU 519 
58 1 Y 1 A SER 502 ? A SER 520 
59 1 Y 1 A PRO 503 ? A PRO 521 
60 1 Y 1 A LEU 504 ? A LEU 522 
61 1 Y 1 A ALA 505 ? A ALA 523 
62 1 Y 1 A THR 506 ? A THR 524 
63 1 Y 1 A ARG 507 ? A ARG 525 
64 1 Y 1 A ASN 508 ? A ASN 526 
65 1 Y 1 A ARG 509 ? A ARG 527 
66 1 Y 1 A THR 510 ? A THR 528 
67 1 Y 1 A SER 511 ? A SER 529 
68 1 Y 1 A VAL 512 ? A VAL 530 
69 1 Y 1 A ASP 513 ? A ASP 531 
70 1 Y 1 A PHE 514 ? A PHE 532 
71 1 Y 1 A LYS 515 ? A LYS 533 
72 1 Y 1 A ASP 516 ? A ASP 534 
73 1 Y 1 A THR 517 ? A THR 535 
74 1 Y 1 A ASP 518 ? A ASP 536 
75 1 Y 1 A TYR 519 ? A TYR 537 
76 1 Y 1 A LYS 520 ? A LYS 538 
77 1 Y 1 A ARG 521 ? A ARG 539 
78 1 Y 1 A HIS 522 ? A HIS 540 
79 1 Y 1 A GLN 523 ? A GLN 541 
80 1 Y 1 A LEU 524 ? A LEU 542 
81 1 Y 1 A THR 525 ? A THR 543 
82 1 Y 1 A ARG 526 ? A ARG 544 
83 1 Y 1 A SER 527 ? A SER 545 
84 1 Y 1 A ILE 528 ? A ILE 546 
85 1 Y 1 A SER 529 ? A SER 547 
86 1 Y 1 A GLU 530 ? A GLU 548 
87 1 Y 1 A ILE 531 ? A ILE 549 
88 1 Y 1 A LYS 532 ? A LYS 550 
89 1 Y 1 A PRO 533 ? A PRO 551 
90 1 Y 1 A PRO 534 ? A PRO 552 
91 1 Y 1 A ASN 535 ? A ASN 553 
92 1 Y 1 A LEU 536 ? A LEU 554 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2R)-2,3-diphosphoglyceric acid' DG2 
3 GLYCEROL                          GOL 
4 'INOSINIC ACID'                   IMP 
5 'MAGNESIUM ION'                   MG  
6 water                             HOH 
#