data_2XCW
# 
_entry.id   2XCW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XCW         
PDBE  EBI-43736    
WWPDB D_1290043736 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2XCV unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND 2,3- BISPHOSPHOGLYCERATE
;
PDB 2JC9 unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH ADENOSINE
;
PDB 2XJE unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH URIDINE 5'-MONOPHOSPHATE AND ADENOSINE TRIPHOSPHATE
;
PDB 2XJD unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INORGANIC PHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2XJF unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II WITH A COVALENTLY MODIFIED ASN52
;
PDB 2J2C unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II (NT5C2, CN-II)
;
PDB 2XJB unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH DEOXYGUANOSINE MONOPHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2JCM unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH BERYLLIUM TRIFLUORIDE
;
PDB 2XJC unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH GUANOSINE MONOPHOSPHATE AND DIADENOSINE TETRAPHOSPHATE
;
PDB 2XCX unspecified 
;CRYSTAL STRUCTURE OF THE APOFORM OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XCW 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wallden, K.'  1 
'Nordlund, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                684 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21396942 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2011.02.059 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wallden, K.'  1 
primary 'Nordlund, P.' 2 
# 
_cell.entry_id           2XCW 
_cell.length_a           91.560 
_cell.length_b           127.440 
_cell.length_c           130.440 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XCW 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE
;
63956.750 1   3.1.3.5 YES 'RESIDUES 1-536' ? 
2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"        507.181   1   ?       ?   ?                ? 
3 non-polymer syn 'INOSINIC ACID'                    348.206   1   ?       ?   ?                ? 
4 non-polymer syn GLYCEROL                           92.094    6   ?       ?   ?                ? 
5 non-polymer syn 'MAGNESIUM ION'                    24.305    2   ?       ?   ?                ? 
6 water       nat water                              18.015    409 ?       ?   ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CYTOSOLIC 5'-NUCLEOTIDASE II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  MET n 
1 20  SER n 
1 21  THR n 
1 22  SER n 
1 23  TRP n 
1 24  SER n 
1 25  ASP n 
1 26  ARG n 
1 27  LEU n 
1 28  GLN n 
1 29  ASN n 
1 30  ALA n 
1 31  ALA n 
1 32  ASP n 
1 33  MET n 
1 34  PRO n 
1 35  ALA n 
1 36  ASN n 
1 37  MET n 
1 38  ASP n 
1 39  LYS n 
1 40  HIS n 
1 41  ALA n 
1 42  LEU n 
1 43  LYS n 
1 44  LYS n 
1 45  TYR n 
1 46  ARG n 
1 47  ARG n 
1 48  GLU n 
1 49  ALA n 
1 50  TYR n 
1 51  HIS n 
1 52  ARG n 
1 53  VAL n 
1 54  PHE n 
1 55  VAL n 
1 56  ASN n 
1 57  ARG n 
1 58  SER n 
1 59  LEU n 
1 60  ALA n 
1 61  MET n 
1 62  GLU n 
1 63  LYS n 
1 64  ILE n 
1 65  LYS n 
1 66  CYS n 
1 67  PHE n 
1 68  GLY n 
1 69  PHE n 
1 70  ASN n 
1 71  MET n 
1 72  ASP n 
1 73  TYR n 
1 74  THR n 
1 75  LEU n 
1 76  ALA n 
1 77  VAL n 
1 78  TYR n 
1 79  LYS n 
1 80  SER n 
1 81  PRO n 
1 82  GLU n 
1 83  TYR n 
1 84  GLU n 
1 85  SER n 
1 86  LEU n 
1 87  GLY n 
1 88  PHE n 
1 89  GLU n 
1 90  LEU n 
1 91  THR n 
1 92  VAL n 
1 93  GLU n 
1 94  ARG n 
1 95  LEU n 
1 96  VAL n 
1 97  SER n 
1 98  ILE n 
1 99  GLY n 
1 100 TYR n 
1 101 PRO n 
1 102 GLN n 
1 103 GLU n 
1 104 LEU n 
1 105 LEU n 
1 106 SER n 
1 107 PHE n 
1 108 ALA n 
1 109 TYR n 
1 110 ASP n 
1 111 SER n 
1 112 THR n 
1 113 PHE n 
1 114 PRO n 
1 115 THR n 
1 116 ARG n 
1 117 GLY n 
1 118 LEU n 
1 119 VAL n 
1 120 PHE n 
1 121 ASP n 
1 122 THR n 
1 123 LEU n 
1 124 TYR n 
1 125 GLY n 
1 126 ASN n 
1 127 LEU n 
1 128 LEU n 
1 129 LYS n 
1 130 VAL n 
1 131 ASP n 
1 132 ALA n 
1 133 TYR n 
1 134 GLY n 
1 135 ASN n 
1 136 LEU n 
1 137 LEU n 
1 138 VAL n 
1 139 CYS n 
1 140 ALA n 
1 141 HIS n 
1 142 GLY n 
1 143 PHE n 
1 144 ASN n 
1 145 PHE n 
1 146 ILE n 
1 147 ARG n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 THR n 
1 152 ARG n 
1 153 GLU n 
1 154 GLN n 
1 155 TYR n 
1 156 PRO n 
1 157 ASN n 
1 158 LYS n 
1 159 PHE n 
1 160 ILE n 
1 161 GLN n 
1 162 ARG n 
1 163 ASP n 
1 164 ASP n 
1 165 THR n 
1 166 GLU n 
1 167 ARG n 
1 168 PHE n 
1 169 TYR n 
1 170 ILE n 
1 171 LEU n 
1 172 ASN n 
1 173 THR n 
1 174 LEU n 
1 175 PHE n 
1 176 ASN n 
1 177 LEU n 
1 178 PRO n 
1 179 GLU n 
1 180 THR n 
1 181 TYR n 
1 182 LEU n 
1 183 LEU n 
1 184 ALA n 
1 185 CYS n 
1 186 LEU n 
1 187 VAL n 
1 188 ASP n 
1 189 PHE n 
1 190 PHE n 
1 191 THR n 
1 192 ASN n 
1 193 CYS n 
1 194 PRO n 
1 195 ARG n 
1 196 TYR n 
1 197 THR n 
1 198 SER n 
1 199 CYS n 
1 200 GLU n 
1 201 THR n 
1 202 GLY n 
1 203 PHE n 
1 204 LYS n 
1 205 ASP n 
1 206 GLY n 
1 207 ASP n 
1 208 LEU n 
1 209 PHE n 
1 210 MET n 
1 211 SER n 
1 212 TYR n 
1 213 ARG n 
1 214 SER n 
1 215 MET n 
1 216 PHE n 
1 217 GLN n 
1 218 ASP n 
1 219 VAL n 
1 220 ARG n 
1 221 ASP n 
1 222 ALA n 
1 223 VAL n 
1 224 ASP n 
1 225 TRP n 
1 226 VAL n 
1 227 HIS n 
1 228 TYR n 
1 229 LYS n 
1 230 GLY n 
1 231 SER n 
1 232 LEU n 
1 233 LYS n 
1 234 GLU n 
1 235 LYS n 
1 236 THR n 
1 237 VAL n 
1 238 GLU n 
1 239 ASN n 
1 240 LEU n 
1 241 GLU n 
1 242 LYS n 
1 243 TYR n 
1 244 VAL n 
1 245 VAL n 
1 246 LYS n 
1 247 ASP n 
1 248 GLY n 
1 249 LYS n 
1 250 LEU n 
1 251 PRO n 
1 252 LEU n 
1 253 LEU n 
1 254 LEU n 
1 255 SER n 
1 256 ARG n 
1 257 MET n 
1 258 LYS n 
1 259 GLU n 
1 260 VAL n 
1 261 GLY n 
1 262 LYS n 
1 263 VAL n 
1 264 PHE n 
1 265 LEU n 
1 266 ALA n 
1 267 THR n 
1 268 ASN n 
1 269 SER n 
1 270 ASP n 
1 271 TYR n 
1 272 LYS n 
1 273 TYR n 
1 274 THR n 
1 275 ASP n 
1 276 LYS n 
1 277 ILE n 
1 278 MET n 
1 279 THR n 
1 280 TYR n 
1 281 LEU n 
1 282 PHE n 
1 283 ASP n 
1 284 PHE n 
1 285 PRO n 
1 286 HIS n 
1 287 GLY n 
1 288 PRO n 
1 289 LYS n 
1 290 PRO n 
1 291 GLY n 
1 292 SER n 
1 293 SER n 
1 294 HIS n 
1 295 ARG n 
1 296 PRO n 
1 297 TRP n 
1 298 GLN n 
1 299 SER n 
1 300 TYR n 
1 301 PHE n 
1 302 ASP n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 VAL n 
1 307 ASP n 
1 308 ALA n 
1 309 ARG n 
1 310 LYS n 
1 311 PRO n 
1 312 LEU n 
1 313 PHE n 
1 314 PHE n 
1 315 GLY n 
1 316 GLU n 
1 317 GLY n 
1 318 THR n 
1 319 VAL n 
1 320 LEU n 
1 321 ARG n 
1 322 GLN n 
1 323 VAL n 
1 324 ASP n 
1 325 THR n 
1 326 LYS n 
1 327 THR n 
1 328 GLY n 
1 329 LYS n 
1 330 LEU n 
1 331 LYS n 
1 332 ILE n 
1 333 GLY n 
1 334 THR n 
1 335 TYR n 
1 336 THR n 
1 337 GLY n 
1 338 PRO n 
1 339 LEU n 
1 340 GLN n 
1 341 HIS n 
1 342 GLY n 
1 343 ILE n 
1 344 VAL n 
1 345 TYR n 
1 346 SER n 
1 347 GLY n 
1 348 GLY n 
1 349 SER n 
1 350 SER n 
1 351 ASP n 
1 352 THR n 
1 353 ILE n 
1 354 CYS n 
1 355 ASP n 
1 356 LEU n 
1 357 LEU n 
1 358 GLY n 
1 359 ALA n 
1 360 LYS n 
1 361 GLY n 
1 362 LYS n 
1 363 ASP n 
1 364 ILE n 
1 365 LEU n 
1 366 TYR n 
1 367 ILE n 
1 368 GLY n 
1 369 ASP n 
1 370 HIS n 
1 371 ILE n 
1 372 PHE n 
1 373 GLY n 
1 374 ASP n 
1 375 ILE n 
1 376 LEU n 
1 377 LYS n 
1 378 SER n 
1 379 LYS n 
1 380 LYS n 
1 381 ARG n 
1 382 GLN n 
1 383 GLY n 
1 384 TRP n 
1 385 ARG n 
1 386 THR n 
1 387 PHE n 
1 388 LEU n 
1 389 VAL n 
1 390 ILE n 
1 391 PRO n 
1 392 GLU n 
1 393 LEU n 
1 394 ALA n 
1 395 GLN n 
1 396 GLU n 
1 397 LEU n 
1 398 HIS n 
1 399 VAL n 
1 400 TRP n 
1 401 THR n 
1 402 ASP n 
1 403 LYS n 
1 404 SER n 
1 405 SER n 
1 406 LEU n 
1 407 PHE n 
1 408 GLU n 
1 409 GLU n 
1 410 LEU n 
1 411 GLN n 
1 412 SER n 
1 413 LEU n 
1 414 ASP n 
1 415 ILE n 
1 416 PHE n 
1 417 LEU n 
1 418 ALA n 
1 419 GLU n 
1 420 LEU n 
1 421 TYR n 
1 422 LYS n 
1 423 HIS n 
1 424 LEU n 
1 425 ASP n 
1 426 SER n 
1 427 SER n 
1 428 SER n 
1 429 ASN n 
1 430 GLU n 
1 431 ARG n 
1 432 PRO n 
1 433 ASP n 
1 434 ILE n 
1 435 SER n 
1 436 SER n 
1 437 ILE n 
1 438 GLN n 
1 439 ARG n 
1 440 ARG n 
1 441 ILE n 
1 442 LYS n 
1 443 LYS n 
1 444 VAL n 
1 445 THR n 
1 446 HIS n 
1 447 ASP n 
1 448 MET n 
1 449 ASP n 
1 450 MET n 
1 451 CYS n 
1 452 TYR n 
1 453 GLY n 
1 454 MET n 
1 455 MET n 
1 456 GLY n 
1 457 SER n 
1 458 LEU n 
1 459 PHE n 
1 460 ARG n 
1 461 SER n 
1 462 GLY n 
1 463 SER n 
1 464 ARG n 
1 465 GLN n 
1 466 THR n 
1 467 LEU n 
1 468 PHE n 
1 469 ALA n 
1 470 SER n 
1 471 GLN n 
1 472 VAL n 
1 473 MET n 
1 474 ARG n 
1 475 TYR n 
1 476 ALA n 
1 477 ASP n 
1 478 LEU n 
1 479 TYR n 
1 480 ALA n 
1 481 ALA n 
1 482 SER n 
1 483 PHE n 
1 484 ILE n 
1 485 ASN n 
1 486 LEU n 
1 487 LEU n 
1 488 TYR n 
1 489 TYR n 
1 490 PRO n 
1 491 PHE n 
1 492 SER n 
1 493 TYR n 
1 494 LEU n 
1 495 PHE n 
1 496 ARG n 
1 497 ALA n 
1 498 ALA n 
1 499 HIS n 
1 500 VAL n 
1 501 LEU n 
1 502 MET n 
1 503 PRO n 
1 504 HIS n 
1 505 GLU n 
1 506 SER n 
1 507 THR n 
1 508 VAL n 
1 509 GLU n 
1 510 HIS n 
1 511 THR n 
1 512 HIS n 
1 513 VAL n 
1 514 ASP n 
1 515 ILE n 
1 516 ASN n 
1 517 GLU n 
1 518 MET n 
1 519 GLU n 
1 520 SER n 
1 521 PRO n 
1 522 LEU n 
1 523 ALA n 
1 524 THR n 
1 525 ARG n 
1 526 ASN n 
1 527 ARG n 
1 528 THR n 
1 529 SER n 
1 530 VAL n 
1 531 ASP n 
1 532 PHE n 
1 533 LYS n 
1 534 ASP n 
1 535 THR n 
1 536 ASP n 
1 537 TYR n 
1 538 LYS n 
1 539 ARG n 
1 540 HIS n 
1 541 GLN n 
1 542 LEU n 
1 543 THR n 
1 544 ARG n 
1 545 SER n 
1 546 ILE n 
1 547 SER n 
1 548 GLU n 
1 549 ILE n 
1 550 LYS n 
1 551 PRO n 
1 552 PRO n 
1 553 ASN n 
1 554 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3-PRARE2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               P28A-LIC 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    5NTC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P49902 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XCW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 554 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49902 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  536 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       536 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XCW GLY A 1  ? UNP P49902 ?   ?  'expression tag'      -17 1  
1 2XCW SER A 2  ? UNP P49902 ?   ?  'expression tag'      -16 2  
1 2XCW SER A 3  ? UNP P49902 ?   ?  'expression tag'      -15 3  
1 2XCW HIS A 4  ? UNP P49902 ?   ?  'expression tag'      -14 4  
1 2XCW HIS A 5  ? UNP P49902 ?   ?  'expression tag'      -13 5  
1 2XCW HIS A 6  ? UNP P49902 ?   ?  'expression tag'      -12 6  
1 2XCW HIS A 7  ? UNP P49902 ?   ?  'expression tag'      -11 7  
1 2XCW HIS A 8  ? UNP P49902 ?   ?  'expression tag'      -10 8  
1 2XCW HIS A 9  ? UNP P49902 ?   ?  'expression tag'      -9  9  
1 2XCW SER A 10 ? UNP P49902 ?   ?  'expression tag'      -8  10 
1 2XCW SER A 11 ? UNP P49902 ?   ?  'expression tag'      -7  11 
1 2XCW GLY A 12 ? UNP P49902 ?   ?  'expression tag'      -6  12 
1 2XCW LEU A 13 ? UNP P49902 ?   ?  'expression tag'      -5  13 
1 2XCW VAL A 14 ? UNP P49902 ?   ?  'expression tag'      -4  14 
1 2XCW PRO A 15 ? UNP P49902 ?   ?  'expression tag'      -3  15 
1 2XCW ARG A 16 ? UNP P49902 ?   ?  'expression tag'      -2  16 
1 2XCW GLY A 17 ? UNP P49902 ?   ?  'expression tag'      -1  17 
1 2XCW SER A 18 ? UNP P49902 ?   ?  'expression tag'      0   18 
1 2XCW ASN A 70 ? UNP P49902 ASP 52 'engineered mutation' 52  19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                               'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ?                               'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ?                               'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                    'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                   ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                               'C6 H13 N O2'       131.173 
IMP non-polymer         n 'INOSINIC ACID'             ?                               'C10 H13 N4 O8 P'   348.206 
LEU 'L-peptide linking' y LEUCINE                     ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2XCW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2008-01-30 
_diffrn_detector.details                'DYNAMICALLY BENDABLE' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0081 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.0081 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XCW 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   60260 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.41 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.48 
_reflns_shell.pdbx_redundancy        5.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XCW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     57151 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    99.93 
_refine.ls_R_factor_obs                          0.16814 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16676 
_refine.ls_R_factor_R_free                       0.19357 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3046 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.957 
_refine.B_iso_mean                               33.823 
_refine.aniso_B[1][1]                            0.94 
_refine.aniso_B[2][2]                            -0.11 
_refine.aniso_B[3][3]                            -0.83 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2JCM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.108 
_refine.pdbx_overall_ESU_R_Free                  0.104 
_refine.overall_SU_ML                            0.075 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.815 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3828 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         92 
_refine_hist.number_atoms_solvent             409 
_refine_hist.number_atoms_total               4329 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 4099 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2840 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.557  1.981  ? 5549 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.953  3.000  ? 6871 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.937  5.000  ? 486  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.278 23.073 ? 192  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.123 15.000 ? 697  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.228 15.000 ? 27   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.096  0.200  ? 582  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 4506 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 909  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.204  0.200  ? 797  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.194  0.200  ? 2971 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.183  0.200  ? 1972 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.085  0.200  ? 2120 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.164  0.200  ? 336  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.218  0.200  ? 23   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.312  0.200  ? 46   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.133  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.087  1.500  ? 3095 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.257  2.000  ? 3863 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.316  3.000  ? 2049 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.133  4.500  ? 1686 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             4159 
_refine_ls_shell.R_factor_R_work                  0.248 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.282 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             222 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XCW 
_struct.title                     
;Crystal structure of the D52N variant of cytosolic 5'-nucleotidase II in complex with inosine monophosphate and ATP
;
_struct.pdbx_descriptor           
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE (E.C.3.1.3.5)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XCW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;CN-II, GMP-IMP SPECIFIC NUCLEOTIDASE, HIGH KM 5-PRIME NUCLEOTIDASE, HYDROLASE, METAL-BINDING, NT5C2, NUCLEOTIDE METABOLISM, NUCLEOTIDE-BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 22  ? ASP A 32  ? SER A 4   ASP A 14  1 ? 11 
HELX_P HELX_P2  2  ASP A 38  ? ARG A 46  ? ASP A 20  ARG A 28  1 ? 9  
HELX_P HELX_P3  3  ARG A 47  ? ARG A 52  ? ARG A 29  ARG A 34  5 ? 6  
HELX_P HELX_P4  4  GLU A 62  ? ILE A 64  ? GLU A 44  ILE A 46  5 ? 3  
HELX_P HELX_P5  5  PRO A 81  ? ILE A 98  ? PRO A 63  ILE A 80  1 ? 18 
HELX_P HELX_P6  6  PRO A 101 ? PHE A 107 ? PRO A 83  PHE A 89  5 ? 7  
HELX_P HELX_P7  7  ARG A 147 ? TYR A 155 ? ARG A 129 TYR A 137 1 ? 9  
HELX_P HELX_P8  8  THR A 173 ? PHE A 175 ? THR A 155 PHE A 157 5 ? 3  
HELX_P HELX_P9  9  ASN A 176 ? CYS A 193 ? ASN A 158 CYS A 175 1 ? 18 
HELX_P HELX_P10 10 TYR A 212 ? LYS A 229 ? TYR A 194 LYS A 211 1 ? 18 
HELX_P HELX_P11 11 SER A 231 ? GLU A 238 ? SER A 213 GLU A 220 1 ? 8  
HELX_P HELX_P12 12 ASN A 239 ? VAL A 244 ? ASN A 221 VAL A 226 1 ? 6  
HELX_P HELX_P13 13 LYS A 249 ? GLY A 261 ? LYS A 231 GLY A 243 1 ? 13 
HELX_P HELX_P14 14 ASP A 270 ? PHE A 282 ? ASP A 252 PHE A 264 1 ? 13 
HELX_P HELX_P15 15 PRO A 296 ? PHE A 301 ? PRO A 278 PHE A 283 5 ? 6  
HELX_P HELX_P16 16 PRO A 311 ? GLY A 315 ? PRO A 293 GLY A 297 5 ? 5  
HELX_P HELX_P17 17 SER A 349 ? GLY A 358 ? SER A 331 GLY A 340 1 ? 10 
HELX_P HELX_P18 18 LYS A 360 ? LYS A 362 ? LYS A 342 LYS A 344 5 ? 3  
HELX_P HELX_P19 19 ASP A 374 ? GLY A 383 ? ASP A 356 GLY A 365 1 ? 10 
HELX_P HELX_P20 20 GLU A 392 ? LYS A 403 ? GLU A 374 LYS A 385 1 ? 12 
HELX_P HELX_P21 21 LYS A 403 ? LEU A 417 ? LYS A 385 LEU A 399 1 ? 15 
HELX_P HELX_P22 22 SER A 435 ? CYS A 451 ? SER A 417 CYS A 433 1 ? 17 
HELX_P HELX_P23 23 THR A 466 ? ALA A 476 ? THR A 448 ALA A 458 1 ? 11 
HELX_P HELX_P24 24 SER A 482 ? TYR A 489 ? SER A 464 TYR A 471 5 ? 8  
HELX_P HELX_P25 25 MET A 502 ? SER A 506 ? MET A 484 SER A 488 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ATP . O3G ? ? ? 1_555 J MG  .   MG  ? ? A ATP 1489 A MG  1497 1_555 ? ? ? ? ? ? ? 1.924 ? 
metalc2  metalc ? ? B ATP . O3G ? ? ? 1_555 J MG  .   MG  ? ? A ATP 1489 A MG  1497 3_556 ? ? ? ? ? ? ? 1.979 ? 
metalc3  metalc ? ? B ATP . O1B ? ? ? 1_555 J MG  .   MG  ? ? A ATP 1489 A MG  1497 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc4  metalc ? ? B ATP . O1B ? ? ? 1_555 J MG  .   MG  ? ? A ATP 1489 A MG  1497 3_556 ? ? ? ? ? ? ? 2.017 ? 
metalc5  metalc ? ? C IMP . O3P ? ? ? 1_555 K MG  .   MG  ? ? A IMP 1490 A MG  1498 1_555 ? ? ? ? ? ? ? 1.957 ? 
metalc6  metalc ? ? J MG  . MG  ? ? ? 1_555 L HOH .   O   ? ? A MG  1497 A HOH 2396 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc7  metalc ? ? J MG  . MG  ? ? ? 1_555 L HOH .   O   ? ? A MG  1497 A HOH 2396 3_556 ? ? ? ? ? ? ? 2.060 ? 
metalc8  metalc ? ? K MG  . MG  ? ? ? 1_555 L HOH .   O   ? ? A MG  1498 A HOH 2332 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc9  metalc ? ? K MG  . MG  ? ? ? 1_555 A ASP 72  O   A ? A MG  1498 A ASP 54   1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc10 metalc ? ? K MG  . MG  ? ? ? 1_555 A ASP 72  O   B ? A MG  1498 A ASP 54   1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc11 metalc ? ? K MG  . MG  ? ? ? 1_555 A ASN 70  OD1 ? ? A MG  1498 A ASN 52   1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc12 metalc ? ? K MG  . MG  ? ? ? 1_555 A ASP 369 OD1 ? ? A MG  1498 A ASP 351  1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc13 metalc ? ? K MG  . MG  ? ? ? 1_555 L HOH .   O   ? ? A MG  1498 A HOH 2331 1_555 ? ? ? ? ? ? ? 2.133 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 80  A . ? SER 62  A PRO 81  A ? PRO 63  A 1 3.73 
2 LYS 310 A . ? LYS 292 A PRO 311 A ? PRO 293 A 1 5.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 9 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 3 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
AA 8 9 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 54  ? VAL A 55  ? PHE A 36  VAL A 37  
AA 2 LEU A 478 ? ALA A 480 ? LEU A 460 ALA A 462 
AA 3 ARG A 385 ? VAL A 389 ? ARG A 367 VAL A 371 
AA 4 ILE A 364 ? GLY A 368 ? ILE A 346 GLY A 350 
AA 5 CYS A 66  ? PHE A 69  ? CYS A 48  PHE A 51  
AA 6 LYS A 262 ? ALA A 266 ? LYS A 244 ALA A 248 
AA 7 LEU A 303 ? VAL A 306 ? LEU A 285 VAL A 288 
AA 8 TYR A 345 ? GLY A 347 ? TYR A 327 GLY A 329 
AA 9 LEU A 320 ? GLN A 322 ? LEU A 302 GLN A 304 
AB 1 LEU A 59  ? ALA A 60  ? LEU A 41  ALA A 42  
AB 2 LEU A 494 ? PHE A 495 ? LEU A 476 PHE A 477 
AC 1 ASN A 144 ? PHE A 145 ? ASN A 126 PHE A 127 
AC 2 LEU A 136 ? HIS A 141 ? LEU A 118 HIS A 123 
AC 3 ASN A 126 ? VAL A 130 ? ASN A 108 VAL A 112 
AC 4 VAL A 119 ? ASP A 121 ? VAL A 101 ASP A 103 
AC 5 PHE A 168 ? ILE A 170 ? PHE A 150 ILE A 152 
AD 1 THR A 197 ? CYS A 199 ? THR A 179 CYS A 181 
AD 2 GLY A 202 ? ASP A 205 ? GLY A 184 ASP A 187 
AD 3 LEU A 208 ? SER A 211 ? LEU A 190 SER A 193 
AE 1 ARG A 460 ? SER A 461 ? ARG A 442 SER A 443 
AE 2 ARG A 464 ? GLN A 465 ? ARG A 446 GLN A 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N PHE A 54  ? N PHE A 36  O TYR A 479 ? O TYR A 461 
AA 2 3 N LEU A 478 ? N LEU A 460 O THR A 386 ? O THR A 368 
AA 3 4 N ARG A 385 ? N ARG A 367 O ILE A 364 ? O ILE A 346 
AA 4 5 N LEU A 365 ? N LEU A 347 O CYS A 66  ? O CYS A 48  
AA 5 6 N PHE A 67  ? N PHE A 49  O LYS A 262 ? O LYS A 244 
AA 6 7 N LEU A 265 ? N LEU A 247 O LEU A 303 ? O LEU A 285 
AA 7 8 N VAL A 306 ? N VAL A 288 O TYR A 345 ? O TYR A 327 
AA 8 9 N SER A 346 ? N SER A 328 O ARG A 321 ? O ARG A 303 
AB 1 2 N LEU A 59  ? N LEU A 41  O PHE A 495 ? O PHE A 477 
AC 1 2 N ASN A 144 ? N ASN A 126 O HIS A 141 ? O HIS A 123 
AC 2 3 N ALA A 140 ? N ALA A 122 O LEU A 127 ? O LEU A 109 
AC 3 4 N LEU A 128 ? N LEU A 110 O VAL A 119 ? O VAL A 101 
AC 4 5 N PHE A 120 ? N PHE A 102 O TYR A 169 ? O TYR A 151 
AD 1 2 N CYS A 199 ? N CYS A 181 O GLY A 202 ? O GLY A 184 
AD 2 3 N ASP A 205 ? N ASP A 187 O LEU A 208 ? O LEU A 190 
AE 1 2 N SER A 461 ? N SER A 443 O ARG A 464 ? O ARG A 446 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE ATP A 1489' 
AC2 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE IMP A 1490' 
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 1491' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 1492' 
AC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 1493' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 1494' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 1495' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 1496' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 1497'  
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 1498'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 29 ARG A 162 ? ARG A 144  . ? 1_555 ? 
2   AC1 29 ASP A 163 ? ASP A 145  . ? 1_555 ? 
3   AC1 29 THR A 165 ? THR A 147  . ? 1_555 ? 
4   AC1 29 ILE A 170 ? ILE A 152  . ? 1_555 ? 
5   AC1 29 ASN A 172 ? ASN A 154  . ? 1_555 ? 
6   AC1 29 PHE A 372 ? PHE A 354  . ? 1_555 ? 
7   AC1 29 LYS A 380 ? LYS A 362  . ? 3_556 ? 
8   AC1 29 GLN A 471 ? GLN A 453  . ? 1_555 ? 
9   AC1 29 ARG A 474 ? ARG A 456  . ? 3_556 ? 
10  AC1 29 ARG A 474 ? ARG A 456  . ? 1_555 ? 
11  AC1 29 TYR A 475 ? TYR A 457  . ? 3_556 ? 
12  AC1 29 GOL H .   ? GOL A 1495 . ? 1_555 ? 
13  AC1 29 MG  J .   ? MG  A 1497 . ? 3_556 ? 
14  AC1 29 MG  J .   ? MG  A 1497 . ? 1_555 ? 
15  AC1 29 HOH L .   ? HOH A 2154 . ? 1_555 ? 
16  AC1 29 HOH L .   ? HOH A 2386 . ? 1_555 ? 
17  AC1 29 HOH L .   ? HOH A 2387 . ? 1_555 ? 
18  AC1 29 HOH L .   ? HOH A 2388 . ? 1_555 ? 
19  AC1 29 HOH L .   ? HOH A 2389 . ? 1_555 ? 
20  AC1 29 HOH L .   ? HOH A 2390 . ? 3_556 ? 
21  AC1 29 HOH L .   ? HOH A 2390 . ? 1_555 ? 
22  AC1 29 HOH L .   ? HOH A 2391 . ? 1_555 ? 
23  AC1 29 HOH L .   ? HOH A 2392 . ? 1_555 ? 
24  AC1 29 HOH L .   ? HOH A 2393 . ? 1_555 ? 
25  AC1 29 HOH L .   ? HOH A 2394 . ? 1_555 ? 
26  AC1 29 HOH L .   ? HOH A 2395 . ? 1_555 ? 
27  AC1 29 HOH L .   ? HOH A 2396 . ? 3_556 ? 
28  AC1 29 HOH L .   ? HOH A 2396 . ? 1_555 ? 
29  AC1 29 HOH L .   ? HOH A 2397 . ? 1_555 ? 
30  AC2 22 ASN A 70  ? ASN A 52   . ? 1_555 ? 
31  AC2 22 MET A 71  ? MET A 53   . ? 1_555 ? 
32  AC2 22 ASP A 72  ? ASP A 54   . ? 1_555 ? 
33  AC2 22 PHE A 175 ? PHE A 157  . ? 1_555 ? 
34  AC2 22 ARG A 220 ? ARG A 202  . ? 1_555 ? 
35  AC2 22 ASP A 224 ? ASP A 206  . ? 1_555 ? 
36  AC2 22 HIS A 227 ? HIS A 209  . ? 1_555 ? 
37  AC2 22 TYR A 228 ? TYR A 210  . ? 1_555 ? 
38  AC2 22 LYS A 233 ? LYS A 215  . ? 1_555 ? 
39  AC2 22 THR A 267 ? THR A 249  . ? 1_555 ? 
40  AC2 22 ASN A 268 ? ASN A 250  . ? 1_555 ? 
41  AC2 22 SER A 269 ? SER A 251  . ? 1_555 ? 
42  AC2 22 LYS A 310 ? LYS A 292  . ? 1_555 ? 
43  AC2 22 MG  K .   ? MG  A 1498 . ? 1_555 ? 
44  AC2 22 HOH L .   ? HOH A 2170 . ? 1_555 ? 
45  AC2 22 HOH L .   ? HOH A 2214 . ? 1_555 ? 
46  AC2 22 HOH L .   ? HOH A 2283 . ? 1_555 ? 
47  AC2 22 HOH L .   ? HOH A 2331 . ? 1_555 ? 
48  AC2 22 HOH L .   ? HOH A 2332 . ? 1_555 ? 
49  AC2 22 HOH L .   ? HOH A 2398 . ? 1_555 ? 
50  AC2 22 HOH L .   ? HOH A 2399 . ? 1_555 ? 
51  AC2 22 HOH L .   ? HOH A 2400 . ? 1_555 ? 
52  AC3 9  PHE A 301 ? PHE A 283  . ? 1_555 ? 
53  AC3 9  ASP A 302 ? ASP A 284  . ? 1_555 ? 
54  AC3 9  LEU A 339 ? LEU A 321  . ? 1_555 ? 
55  AC3 9  GLN A 340 ? GLN A 322  . ? 1_555 ? 
56  AC3 9  HIS A 341 ? HIS A 323  . ? 1_555 ? 
57  AC3 9  GLY A 342 ? GLY A 324  . ? 1_555 ? 
58  AC3 9  ILE A 343 ? ILE A 325  . ? 1_555 ? 
59  AC3 9  HOH L .   ? HOH A 2274 . ? 1_555 ? 
60  AC3 9  HOH L .   ? HOH A 2401 . ? 1_555 ? 
61  AC4 6  PHE A 216 ? PHE A 198  . ? 1_555 ? 
62  AC4 6  GLN A 217 ? GLN A 199  . ? 1_555 ? 
63  AC4 6  ARG A 220 ? ARG A 202  . ? 1_555 ? 
64  AC4 6  ASP A 224 ? ASP A 206  . ? 1_555 ? 
65  AC4 6  HOH L .   ? HOH A 2402 . ? 1_555 ? 
66  AC4 6  HOH L .   ? HOH A 2403 . ? 1_555 ? 
67  AC5 8  PRO A 114 ? PRO A 96   . ? 1_555 ? 
68  AC5 8  THR A 115 ? THR A 97   . ? 1_555 ? 
69  AC5 8  GLU A 392 ? GLU A 374  . ? 1_555 ? 
70  AC5 8  GLU A 396 ? GLU A 378  . ? 1_555 ? 
71  AC5 8  TYR A 452 ? TYR A 434  . ? 1_555 ? 
72  AC5 8  HOH L .   ? HOH A 2344 . ? 1_555 ? 
73  AC5 8  HOH L .   ? HOH A 2404 . ? 1_555 ? 
74  AC5 8  HOH L .   ? HOH A 2405 . ? 1_555 ? 
75  AC6 7  ASP A 275 ? ASP A 257  . ? 1_555 ? 
76  AC6 7  THR A 279 ? THR A 261  . ? 1_555 ? 
77  AC6 7  PRO A 296 ? PRO A 278  . ? 1_555 ? 
78  AC6 7  TRP A 297 ? TRP A 279  . ? 1_555 ? 
79  AC6 7  GLN A 298 ? GLN A 280  . ? 1_555 ? 
80  AC6 7  HOH L .   ? HOH A 2240 . ? 1_555 ? 
81  AC6 7  HOH L .   ? HOH A 2406 . ? 1_555 ? 
82  AC7 9  TYR A 169 ? TYR A 151  . ? 1_555 ? 
83  AC7 9  ILE A 170 ? ILE A 152  . ? 1_555 ? 
84  AC7 9  LEU A 171 ? LEU A 153  . ? 1_555 ? 
85  AC7 9  ASN A 172 ? ASN A 154  . ? 1_555 ? 
86  AC7 9  ASN A 176 ? ASN A 158  . ? 1_555 ? 
87  AC7 9  HIS A 370 ? HIS A 352  . ? 1_555 ? 
88  AC7 9  ATP B .   ? ATP A 1489 . ? 1_555 ? 
89  AC7 9  HOH L .   ? HOH A 2407 . ? 1_555 ? 
90  AC7 9  HOH L .   ? HOH A 2409 . ? 1_555 ? 
91  AC8 6  ASP A 270 ? ASP A 252  . ? 1_555 ? 
92  AC8 6  TYR A 271 ? TYR A 253  . ? 1_555 ? 
93  AC8 6  VAL A 306 ? VAL A 288  . ? 1_555 ? 
94  AC8 6  ASP A 307 ? ASP A 289  . ? 1_555 ? 
95  AC8 6  GLY A 328 ? GLY A 310  . ? 1_555 ? 
96  AC8 6  LEU A 330 ? LEU A 312  . ? 1_555 ? 
97  AC9 4  ATP B .   ? ATP A 1489 . ? 1_555 ? 
98  AC9 4  ATP B .   ? ATP A 1489 . ? 3_556 ? 
99  AC9 4  HOH L .   ? HOH A 2396 . ? 3_556 ? 
100 AC9 4  HOH L .   ? HOH A 2396 . ? 1_555 ? 
101 BC1 6  ASN A 70  ? ASN A 52   . ? 1_555 ? 
102 BC1 6  ASP A 72  ? ASP A 54   . ? 1_555 ? 
103 BC1 6  ASP A 369 ? ASP A 351  . ? 1_555 ? 
104 BC1 6  IMP C .   ? IMP A 1490 . ? 1_555 ? 
105 BC1 6  HOH L .   ? HOH A 2331 . ? 1_555 ? 
106 BC1 6  HOH L .   ? HOH A 2332 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XCW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XCW 
_atom_sites.fract_transf_matrix[1][1]   0.010922 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007847 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007666 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 21  ? -8.215  37.475 32.803 1.00 58.15  ? 3    THR A N     1 
ATOM   2    C  CA    . THR A 1 21  ? -6.794  37.555 33.250 1.00 55.30  ? 3    THR A CA    1 
ATOM   3    C  C     . THR A 1 21  ? -6.599  36.647 34.469 1.00 52.45  ? 3    THR A C     1 
ATOM   4    O  O     . THR A 1 21  ? -6.768  37.073 35.624 1.00 54.06  ? 3    THR A O     1 
ATOM   5    C  CB    . THR A 1 21  ? -6.360  38.997 33.622 1.00 57.38  ? 3    THR A CB    1 
ATOM   6    O  OG1   . THR A 1 21  ? -6.624  39.891 32.530 1.00 62.38  ? 3    THR A OG1   1 
ATOM   7    C  CG2   . THR A 1 21  ? -4.883  39.039 33.946 1.00 54.98  ? 3    THR A CG2   1 
ATOM   8    N  N     . SER A 1 22  ? -6.255  35.391 34.206 1.00 49.06  ? 4    SER A N     1 
ATOM   9    C  CA    . SER A 1 22  ? -5.942  34.436 35.273 1.00 45.82  ? 4    SER A CA    1 
ATOM   10   C  C     . SER A 1 22  ? -4.638  34.816 35.977 1.00 43.83  ? 4    SER A C     1 
ATOM   11   O  O     . SER A 1 22  ? -3.824  35.596 35.454 1.00 43.16  ? 4    SER A O     1 
ATOM   12   C  CB    . SER A 1 22  ? -5.820  33.035 34.683 1.00 44.27  ? 4    SER A CB    1 
ATOM   13   O  OG    . SER A 1 22  ? -4.574  32.851 34.040 1.00 43.01  ? 4    SER A OG    1 
ATOM   14   N  N     . TRP A 1 23  ? -4.402  34.228 37.143 1.00 42.30  ? 5    TRP A N     1 
ATOM   15   C  CA    . TRP A 1 23  ? -3.122  34.442 37.827 1.00 40.53  ? 5    TRP A CA    1 
ATOM   16   C  C     . TRP A 1 23  ? -1.930  34.053 36.970 1.00 39.20  ? 5    TRP A C     1 
ATOM   17   O  O     . TRP A 1 23  ? -0.857  34.640 37.104 1.00 38.00  ? 5    TRP A O     1 
ATOM   18   C  CB    . TRP A 1 23  ? -3.051  33.689 39.152 1.00 40.74  ? 5    TRP A CB    1 
ATOM   19   C  CG    . TRP A 1 23  ? -3.516  32.239 39.123 1.00 39.92  ? 5    TRP A CG    1 
ATOM   20   C  CD1   . TRP A 1 23  ? -4.763  31.774 39.437 1.00 40.15  ? 5    TRP A CD1   1 
ATOM   21   C  CD2   . TRP A 1 23  ? -2.723  31.086 38.822 1.00 38.97  ? 5    TRP A CD2   1 
ATOM   22   N  NE1   . TRP A 1 23  ? -4.803  30.412 39.339 1.00 39.24  ? 5    TRP A NE1   1 
ATOM   23   C  CE2   . TRP A 1 23  ? -3.561  29.956 38.976 1.00 39.60  ? 5    TRP A CE2   1 
ATOM   24   C  CE3   . TRP A 1 23  ? -1.375  30.892 38.442 1.00 38.27  ? 5    TRP A CE3   1 
ATOM   25   C  CZ2   . TRP A 1 23  ? -3.104  28.648 38.744 1.00 39.05  ? 5    TRP A CZ2   1 
ATOM   26   C  CZ3   . TRP A 1 23  ? -0.920  29.587 38.219 1.00 37.25  ? 5    TRP A CZ3   1 
ATOM   27   C  CH2   . TRP A 1 23  ? -1.782  28.493 38.368 1.00 37.22  ? 5    TRP A CH2   1 
ATOM   28   N  N     . SER A 1 24  ? -2.102  33.063 36.094 1.00 37.54  ? 6    SER A N     1 
ATOM   29   C  CA    . SER A 1 24  ? -0.976  32.607 35.305 1.00 36.49  ? 6    SER A CA    1 
ATOM   30   C  C     . SER A 1 24  ? -0.706  33.547 34.133 1.00 37.64  ? 6    SER A C     1 
ATOM   31   O  O     . SER A 1 24  ? 0.425   33.579 33.649 1.00 37.48  ? 6    SER A O     1 
ATOM   32   C  CB    . SER A 1 24  ? -1.172  31.174 34.816 1.00 36.09  ? 6    SER A CB    1 
ATOM   33   O  OG    . SER A 1 24  ? -2.136  31.125 33.823 1.00 31.58  ? 6    SER A OG    1 
ATOM   34   N  N     . ASP A 1 25  ? -1.746  34.260 33.674 1.00 39.07  ? 7    ASP A N     1 
ATOM   35   C  CA    . ASP A 1 25  ? -1.617  35.369 32.689 1.00 41.64  ? 7    ASP A CA    1 
ATOM   36   C  C     . ASP A 1 25  ? -0.736  36.490 33.270 1.00 42.18  ? 7    ASP A C     1 
ATOM   37   O  O     . ASP A 1 25  ? 0.209   36.960 32.619 1.00 42.96  ? 7    ASP A O     1 
ATOM   38   C  CB    . ASP A 1 25  ? -2.984  35.976 32.354 1.00 43.93  ? 7    ASP A CB    1 
ATOM   39   C  CG    . ASP A 1 25  ? -3.845  35.077 31.459 1.00 46.08  ? 7    ASP A CG    1 
ATOM   40   O  OD1   . ASP A 1 25  ? -3.346  34.067 30.934 1.00 45.22  ? 7    ASP A OD1   1 
ATOM   41   O  OD2   . ASP A 1 25  ? -5.038  35.408 31.268 1.00 50.75  ? 7    ASP A OD2   1 
ATOM   42   N  N     . ARG A 1 26  ? -1.066  36.911 34.489 1.00 41.72  ? 8    ARG A N     1 
ATOM   43   C  CA    . ARG A 1 26  ? -0.238  37.856 35.258 1.00 41.86  ? 8    ARG A CA    1 
ATOM   44   C  C     . ARG A 1 26  ? 1.215   37.385 35.384 1.00 40.29  ? 8    ARG A C     1 
ATOM   45   O  O     . ARG A 1 26  ? 2.170   38.166 35.196 1.00 40.14  ? 8    ARG A O     1 
ATOM   46   C  CB    . ARG A 1 26  ? -0.795  38.024 36.678 1.00 42.89  ? 8    ARG A CB    1 
ATOM   47   C  CG    . ARG A 1 26  ? -2.237  38.501 36.765 1.00 46.31  ? 8    ARG A CG    1 
ATOM   48   C  CD    . ARG A 1 26  ? -2.360  39.969 36.430 1.00 52.56  ? 8    ARG A CD    1 
ATOM   49   N  NE    . ARG A 1 26  ? -3.734  40.421 36.649 1.00 55.76  ? 8    ARG A NE    1 
ATOM   50   C  CZ    . ARG A 1 26  ? -4.199  41.628 36.355 1.00 59.71  ? 8    ARG A CZ    1 
ATOM   51   N  NH1   . ARG A 1 26  ? -3.413  42.542 35.791 1.00 61.34  ? 8    ARG A NH1   1 
ATOM   52   N  NH2   . ARG A 1 26  ? -5.477  41.908 36.606 1.00 62.23  ? 8    ARG A NH2   1 
ATOM   53   N  N     . LEU A 1 27  ? 1.380   36.112 35.741 1.00 37.91  ? 9    LEU A N     1 
ATOM   54   C  CA    . LEU A 1 27  ? 2.714   35.530 35.887 1.00 37.06  ? 9    LEU A CA    1 
ATOM   55   C  C     . LEU A 1 27  ? 3.496   35.501 34.556 1.00 37.96  ? 9    LEU A C     1 
ATOM   56   O  O     . LEU A 1 27  ? 4.699   35.830 34.512 1.00 37.06  ? 9    LEU A O     1 
ATOM   57   C  CB    . LEU A 1 27  ? 2.620   34.124 36.480 1.00 36.29  ? 9    LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 27  ? 2.239   33.979 37.967 1.00 36.19  ? 9    LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 27  ? 2.121   32.513 38.289 1.00 34.88  ? 9    LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 27  ? 3.224   34.668 38.933 1.00 35.60  ? 9    LEU A CD2   1 
ATOM   61   N  N     . GLN A 1 28  ? 2.825   35.129 33.471 1.00 39.11  ? 10   GLN A N     1 
ATOM   62   C  CA    . GLN A 1 28  ? 3.492   35.085 32.154 1.00 40.74  ? 10   GLN A CA    1 
ATOM   63   C  C     . GLN A 1 28  ? 3.801   36.504 31.624 1.00 43.02  ? 10   GLN A C     1 
ATOM   64   O  O     . GLN A 1 28  ? 4.795   36.710 30.903 1.00 44.58  ? 10   GLN A O     1 
ATOM   65   C  CB    . GLN A 1 28  ? 2.650   34.286 31.149 1.00 42.09  ? 10   GLN A CB    1 
ATOM   66   C  CG    . GLN A 1 28  ? 3.349   34.000 29.795 1.00 44.45  ? 10   GLN A CG    1 
ATOM   67   C  CD    . GLN A 1 28  ? 4.710   33.289 29.927 1.00 45.31  ? 10   GLN A CD    1 
ATOM   68   O  OE1   . GLN A 1 28  ? 4.773   32.079 30.155 1.00 45.55  ? 10   GLN A OE1   1 
ATOM   69   N  NE2   . GLN A 1 28  ? 5.799   34.043 29.762 1.00 43.05  ? 10   GLN A NE2   1 
ATOM   70   N  N     . ASN A 1 29  ? 2.940   37.469 31.948 1.00 43.31  ? 11   ASN A N     1 
ATOM   71   C  CA    . ASN A 1 29  ? 3.167   38.866 31.549 1.00 45.51  ? 11   ASN A CA    1 
ATOM   72   C  C     . ASN A 1 29  ? 4.445   39.373 32.210 1.00 44.34  ? 11   ASN A C     1 
ATOM   73   O  O     . ASN A 1 29  ? 5.325   39.971 31.558 1.00 44.91  ? 11   ASN A O     1 
ATOM   74   C  CB    . ASN A 1 29  ? 1.968   39.749 31.925 1.00 46.73  ? 11   ASN A CB    1 
ATOM   75   C  CG    . ASN A 1 29  ? 0.754   39.506 31.026 1.00 50.80  ? 11   ASN A CG    1 
ATOM   76   O  OD1   . ASN A 1 29  ? 0.857   38.892 29.956 1.00 54.34  ? 11   ASN A OD1   1 
ATOM   77   N  ND2   . ASN A 1 29  ? -0.407  40.003 31.455 1.00 53.73  ? 11   ASN A ND2   1 
ATOM   78   N  N     . ALA A 1 30  ? 4.564   39.091 33.502 1.00 42.13  ? 12   ALA A N     1 
ATOM   79   C  CA    . ALA A 1 30  ? 5.790   39.429 34.230 1.00 42.06  ? 12   ALA A CA    1 
ATOM   80   C  C     . ALA A 1 30  ? 6.994   38.624 33.700 1.00 41.85  ? 12   ALA A C     1 
ATOM   81   O  O     . ALA A 1 30  ? 8.100   39.172 33.582 1.00 42.17  ? 12   ALA A O     1 
ATOM   82   C  CB    . ALA A 1 30  ? 5.599   39.279 35.748 1.00 39.90  ? 12   ALA A CB    1 
ATOM   83   N  N     . ALA A 1 31  ? 6.758   37.357 33.335 1.00 41.62  ? 13   ALA A N     1 
ATOM   84   C  CA    . ALA A 1 31  ? 7.806   36.462 32.792 1.00 42.86  ? 13   ALA A CA    1 
ATOM   85   C  C     . ALA A 1 31  ? 8.417   36.974 31.473 1.00 45.75  ? 13   ALA A C     1 
ATOM   86   O  O     . ALA A 1 31  ? 9.607   36.767 31.210 1.00 46.70  ? 13   ALA A O     1 
ATOM   87   C  CB    . ALA A 1 31  ? 7.255   35.019 32.605 1.00 41.61  ? 13   ALA A CB    1 
ATOM   88   N  N     . ASP A 1 32  ? 7.612   37.651 30.659 1.00 47.91  ? 14   ASP A N     1 
ATOM   89   C  CA    . ASP A 1 32  ? 8.045   38.092 29.340 1.00 51.99  ? 14   ASP A CA    1 
ATOM   90   C  C     . ASP A 1 32  ? 8.971   39.299 29.415 1.00 53.71  ? 14   ASP A C     1 
ATOM   91   O  O     . ASP A 1 32  ? 9.604   39.667 28.415 1.00 55.66  ? 14   ASP A O     1 
ATOM   92   C  CB    . ASP A 1 32  ? 6.840   38.459 28.469 1.00 54.10  ? 14   ASP A CB    1 
ATOM   93   C  CG    . ASP A 1 32  ? 5.959   37.273 28.149 1.00 54.83  ? 14   ASP A CG    1 
ATOM   94   O  OD1   . ASP A 1 32  ? 6.423   36.114 28.273 1.00 53.46  ? 14   ASP A OD1   1 
ATOM   95   O  OD2   . ASP A 1 32  ? 4.791   37.512 27.758 1.00 58.74  ? 14   ASP A OD2   1 
ATOM   96   N  N     . MET A 1 33  ? 9.046   39.922 30.587 1.00 52.53  ? 15   MET A N     1 
ATOM   97   C  CA    . MET A 1 33  ? 9.930   41.080 30.759 1.00 54.72  ? 15   MET A CA    1 
ATOM   98   C  C     . MET A 1 33  ? 11.381  40.689 31.043 1.00 53.45  ? 15   MET A C     1 
ATOM   99   O  O     . MET A 1 33  ? 11.656  39.772 31.842 1.00 50.82  ? 15   MET A O     1 
ATOM   100  C  CB    . MET A 1 33  ? 9.426   41.976 31.874 1.00 53.90  ? 15   MET A CB    1 
ATOM   101  C  CG    . MET A 1 33  ? 8.162   42.718 31.500 1.00 58.12  ? 15   MET A CG    1 
ATOM   102  S  SD    . MET A 1 33  ? 7.424   43.332 33.023 1.00 60.99  ? 15   MET A SD    1 
ATOM   103  C  CE    . MET A 1 33  ? 8.229   44.966 33.171 1.00 62.34  ? 15   MET A CE    1 
ATOM   104  N  N     . PRO A 1 34  ? 12.317  41.401 30.400 1.00 55.01  ? 16   PRO A N     1 
ATOM   105  C  CA    . PRO A 1 34  ? 13.718  41.214 30.730 1.00 54.54  ? 16   PRO A CA    1 
ATOM   106  C  C     . PRO A 1 34  ? 14.030  41.850 32.075 1.00 51.82  ? 16   PRO A C     1 
ATOM   107  O  O     . PRO A 1 34  ? 13.317  42.753 32.511 1.00 51.34  ? 16   PRO A O     1 
ATOM   108  C  CB    . PRO A 1 34  ? 14.440  41.941 29.598 1.00 58.52  ? 16   PRO A CB    1 
ATOM   109  C  CG    . PRO A 1 34  ? 13.493  43.032 29.195 1.00 60.31  ? 16   PRO A CG    1 
ATOM   110  C  CD    . PRO A 1 34  ? 12.123  42.428 29.357 1.00 58.76  ? 16   PRO A CD    1 
ATOM   111  N  N     . ALA A 1 35  ? 15.070  41.353 32.737 1.00 50.65  ? 17   ALA A N     1 
ATOM   112  C  CA    . ALA A 1 35  ? 15.519  41.899 34.013 1.00 48.94  ? 17   ALA A CA    1 
ATOM   113  C  C     . ALA A 1 35  ? 16.338  43.154 33.771 1.00 50.15  ? 17   ALA A C     1 
ATOM   114  O  O     . ALA A 1 35  ? 17.325  43.130 33.028 1.00 52.18  ? 17   ALA A O     1 
ATOM   115  C  CB    . ALA A 1 35  ? 16.353  40.876 34.781 1.00 47.93  ? 17   ALA A CB    1 
ATOM   116  N  N     . ASN A 1 36  ? 15.915  44.247 34.390 1.00 49.42  ? 18   ASN A N     1 
ATOM   117  C  CA    . ASN A 1 36  ? 16.728  45.439 34.489 1.00 50.56  ? 18   ASN A CA    1 
ATOM   118  C  C     . ASN A 1 36  ? 17.359  45.341 35.865 1.00 49.06  ? 18   ASN A C     1 
ATOM   119  O  O     . ASN A 1 36  ? 16.671  45.500 36.882 1.00 47.52  ? 18   ASN A O     1 
ATOM   120  C  CB    . ASN A 1 36  ? 15.897  46.721 34.344 1.00 51.64  ? 18   ASN A CB    1 
ATOM   121  C  CG    . ASN A 1 36  ? 16.740  47.987 34.495 1.00 53.38  ? 18   ASN A CG    1 
ATOM   122  O  OD1   . ASN A 1 36  ? 17.946  47.920 34.759 1.00 52.34  ? 18   ASN A OD1   1 
ATOM   123  N  ND2   . ASN A 1 36  ? 16.108  49.153 34.324 1.00 55.00  ? 18   ASN A ND2   1 
ATOM   124  N  N     . MET A 1 37  ? 18.656  45.047 35.890 1.00 49.26  ? 19   MET A N     1 
ATOM   125  C  CA    . MET A 1 37  ? 19.364  44.804 37.142 1.00 49.18  ? 19   MET A CA    1 
ATOM   126  C  C     . MET A 1 37  ? 20.019  46.063 37.708 1.00 50.08  ? 19   MET A C     1 
ATOM   127  O  O     . MET A 1 37  ? 20.787  45.978 38.669 1.00 50.34  ? 19   MET A O     1 
ATOM   128  C  CB    . MET A 1 37  ? 20.402  43.686 36.961 1.00 50.22  ? 19   MET A CB    1 
ATOM   129  C  CG    . MET A 1 37  ? 19.774  42.309 36.691 1.00 48.09  ? 19   MET A CG    1 
ATOM   130  S  SD    . MET A 1 37  ? 18.689  41.676 38.003 1.00 46.89  ? 19   MET A SD    1 
ATOM   131  C  CE    . MET A 1 37  ? 19.908  40.989 39.163 1.00 46.99  ? 19   MET A CE    1 
ATOM   132  N  N     . ASP A 1 38  ? 19.711  47.225 37.129 1.00 51.08  ? 20   ASP A N     1 
ATOM   133  C  CA    . ASP A 1 38  ? 20.125  48.497 37.716 1.00 52.68  ? 20   ASP A CA    1 
ATOM   134  C  C     . ASP A 1 38  ? 19.554  48.521 39.133 1.00 51.82  ? 20   ASP A C     1 
ATOM   135  O  O     . ASP A 1 38  ? 18.385  48.180 39.334 1.00 50.74  ? 20   ASP A O     1 
ATOM   136  C  CB    . ASP A 1 38  ? 19.655  49.689 36.860 1.00 54.32  ? 20   ASP A CB    1 
ATOM   137  C  CG    . ASP A 1 38  ? 19.970  51.035 37.497 1.00 55.29  ? 20   ASP A CG    1 
ATOM   138  O  OD1   . ASP A 1 38  ? 20.793  51.797 36.955 1.00 56.84  ? 20   ASP A OD1   1 
ATOM   139  O  OD2   . ASP A 1 38  ? 19.394  51.336 38.556 1.00 56.41  ? 20   ASP A OD2   1 
ATOM   140  N  N     . LYS A 1 39  ? 20.385  48.857 40.120 1.00 53.16  ? 21   LYS A N     1 
ATOM   141  C  CA    . LYS A 1 39  ? 19.992  48.672 41.531 1.00 53.52  ? 21   LYS A CA    1 
ATOM   142  C  C     . LYS A 1 39  ? 18.790  49.539 41.930 1.00 53.69  ? 21   LYS A C     1 
ATOM   143  O  O     . LYS A 1 39  ? 17.965  49.126 42.760 1.00 52.82  ? 21   LYS A O     1 
ATOM   144  C  CB    . LYS A 1 39  ? 21.174  48.907 42.485 1.00 55.50  ? 21   LYS A CB    1 
ATOM   145  C  CG    . LYS A 1 39  ? 22.204  47.753 42.476 1.00 57.11  ? 21   LYS A CG    1 
ATOM   146  C  CD    . LYS A 1 39  ? 23.097  47.758 43.759 1.00 58.29  ? 21   LYS A CD    1 
ATOM   147  C  CE    . LYS A 1 39  ? 24.450  47.061 43.543 1.00 60.67  ? 21   LYS A CE    1 
ATOM   148  N  NZ    . LYS A 1 39  ? 24.431  46.008 42.470 1.00 60.75  ? 21   LYS A NZ    1 
ATOM   149  N  N     . HIS A 1 40  ? 18.695  50.720 41.315 1.00 54.68  ? 22   HIS A N     1 
ATOM   150  C  CA    . HIS A 1 40  ? 17.539  51.601 41.492 1.00 55.99  ? 22   HIS A CA    1 
ATOM   151  C  C     . HIS A 1 40  ? 16.268  51.060 40.827 1.00 54.25  ? 22   HIS A C     1 
ATOM   152  O  O     . HIS A 1 40  ? 15.163  51.176 41.385 1.00 54.30  ? 22   HIS A O     1 
ATOM   153  C  CB    . HIS A 1 40  ? 17.857  52.998 40.974 1.00 58.65  ? 22   HIS A CB    1 
ATOM   154  C  CG    . HIS A 1 40  ? 18.874  53.719 41.803 1.00 62.34  ? 22   HIS A CG    1 
ATOM   155  N  ND1   . HIS A 1 40  ? 19.960  54.366 41.255 1.00 65.75  ? 22   HIS A ND1   1 
ATOM   156  C  CD2   . HIS A 1 40  ? 18.972  53.887 43.144 1.00 64.79  ? 22   HIS A CD2   1 
ATOM   157  C  CE1   . HIS A 1 40  ? 20.676  54.913 42.222 1.00 68.18  ? 22   HIS A CE1   1 
ATOM   158  N  NE2   . HIS A 1 40  ? 20.101  54.633 43.379 1.00 67.53  ? 22   HIS A NE2   1 
ATOM   159  N  N     . ALA A 1 41  ? 16.421  50.474 39.643 1.00 52.97  ? 23   ALA A N     1 
ATOM   160  C  CA    . ALA A 1 41  ? 15.305  49.804 38.983 1.00 52.43  ? 23   ALA A CA    1 
ATOM   161  C  C     . ALA A 1 41  ? 14.766  48.649 39.860 1.00 50.10  ? 23   ALA A C     1 
ATOM   162  O  O     . ALA A 1 41  ? 13.544  48.493 39.991 1.00 49.13  ? 23   ALA A O     1 
ATOM   163  C  CB    . ALA A 1 41  ? 15.704  49.303 37.587 1.00 51.93  ? 23   ALA A CB    1 
ATOM   164  N  N     . LEU A 1 42  ? 15.675  47.873 40.463 1.00 49.20  ? 24   LEU A N     1 
ATOM   165  C  CA    . LEU A 1 42  ? 15.297  46.715 41.306 1.00 48.81  ? 24   LEU A CA    1 
ATOM   166  C  C     . LEU A 1 42  ? 14.524  47.156 42.547 1.00 49.95  ? 24   LEU A C     1 
ATOM   167  O  O     . LEU A 1 42  ? 13.488  46.586 42.876 1.00 48.87  ? 24   LEU A O     1 
ATOM   168  C  CB    . LEU A 1 42  ? 16.537  45.914 41.731 1.00 48.41  ? 24   LEU A CB    1 
ATOM   169  C  CG    . LEU A 1 42  ? 17.210  45.140 40.588 1.00 48.24  ? 24   LEU A CG    1 
ATOM   170  C  CD1   . LEU A 1 42  ? 18.581  44.599 41.004 1.00 48.54  ? 24   LEU A CD1   1 
ATOM   171  C  CD2   . LEU A 1 42  ? 16.303  44.031 40.113 1.00 46.09  ? 24   LEU A CD2   1 
ATOM   172  N  N     . LYS A 1 43  ? 15.034  48.192 43.213 1.00 52.24  ? 25   LYS A N     1 
ATOM   173  C  CA    . LYS A 1 43  ? 14.389  48.719 44.407 1.00 54.46  ? 25   LYS A CA    1 
ATOM   174  C  C     . LYS A 1 43  ? 12.975  49.194 44.092 1.00 55.51  ? 25   LYS A C     1 
ATOM   175  O  O     . LYS A 1 43  ? 12.041  48.951 44.874 1.00 56.37  ? 25   LYS A O     1 
ATOM   176  C  CB    . LYS A 1 43  ? 15.198  49.857 45.026 1.00 56.70  ? 25   LYS A CB    1 
ATOM   177  C  CG    . LYS A 1 43  ? 14.722  50.200 46.430 1.00 59.18  ? 25   LYS A CG    1 
ATOM   178  C  CD    . LYS A 1 43  ? 15.680  51.130 47.156 1.00 61.83  ? 25   LYS A CD    1 
ATOM   179  C  CE    . LYS A 1 43  ? 15.464  51.079 48.673 1.00 65.04  ? 25   LYS A CE    1 
ATOM   180  N  NZ    . LYS A 1 43  ? 16.640  51.662 49.385 1.00 67.12  ? 25   LYS A NZ    1 
ATOM   181  N  N     . LYS A 1 44  ? 12.826  49.847 42.942 1.00 55.90  ? 26   LYS A N     1 
ATOM   182  C  CA    . LYS A 1 44  ? 11.541  50.386 42.519 1.00 57.74  ? 26   LYS A CA    1 
ATOM   183  C  C     . LYS A 1 44  ? 10.542  49.288 42.134 1.00 55.87  ? 26   LYS A C     1 
ATOM   184  O  O     . LYS A 1 44  ? 9.356   49.378 42.438 1.00 56.48  ? 26   LYS A O     1 
ATOM   185  C  CB    . LYS A 1 44  ? 11.745  51.336 41.340 1.00 59.31  ? 26   LYS A CB    1 
ATOM   186  C  CG    . LYS A 1 44  ? 10.517  52.162 41.003 1.00 62.48  ? 26   LYS A CG    1 
ATOM   187  C  CD    . LYS A 1 44  ? 10.654  52.857 39.642 1.00 64.71  ? 26   LYS A CD    1 
ATOM   188  C  CE    . LYS A 1 44  ? 9.285   53.163 39.013 1.00 67.52  ? 26   LYS A CE    1 
ATOM   189  N  NZ    . LYS A 1 44  ? 9.419   54.164 37.909 1.00 72.09  ? 26   LYS A NZ    1 
ATOM   190  N  N     . TYR A 1 45  ? 11.028  48.260 41.453 1.00 53.53  ? 27   TYR A N     1 
ATOM   191  C  CA    . TYR A 1 45  ? 10.177  47.146 41.034 1.00 52.41  ? 27   TYR A CA    1 
ATOM   192  C  C     . TYR A 1 45  ? 9.548   46.416 42.220 1.00 51.77  ? 27   TYR A C     1 
ATOM   193  O  O     . TYR A 1 45  ? 8.343   46.155 42.226 1.00 51.79  ? 27   TYR A O     1 
ATOM   194  C  CB    . TYR A 1 45  ? 10.997  46.127 40.233 1.00 51.47  ? 27   TYR A CB    1 
ATOM   195  C  CG    . TYR A 1 45  ? 10.217  45.388 39.180 1.00 51.12  ? 27   TYR A CG    1 
ATOM   196  C  CD1   . TYR A 1 45  ? 9.597   46.078 38.139 1.00 53.85  ? 27   TYR A CD1   1 
ATOM   197  C  CD2   . TYR A 1 45  ? 10.136  44.004 39.192 1.00 50.95  ? 27   TYR A CD2   1 
ATOM   198  C  CE1   . TYR A 1 45  ? 8.893   45.406 37.145 1.00 53.31  ? 27   TYR A CE1   1 
ATOM   199  C  CE2   . TYR A 1 45  ? 9.435   43.318 38.205 1.00 49.73  ? 27   TYR A CE2   1 
ATOM   200  C  CZ    . TYR A 1 45  ? 8.820   44.027 37.177 1.00 52.42  ? 27   TYR A CZ    1 
ATOM   201  O  OH    . TYR A 1 45  ? 8.116   43.353 36.188 1.00 52.57  ? 27   TYR A OH    1 
ATOM   202  N  N     . ARG A 1 46  ? 10.384  46.090 43.206 1.00 51.29  ? 28   ARG A N     1 
ATOM   203  C  CA    . ARG A 1 46  ? 9.957   45.317 44.375 1.00 51.60  ? 28   ARG A CA    1 
ATOM   204  C  C     . ARG A 1 46  ? 9.075   46.135 45.305 1.00 54.69  ? 28   ARG A C     1 
ATOM   205  O  O     . ARG A 1 46  ? 8.559   45.589 46.281 1.00 56.78  ? 28   ARG A O     1 
ATOM   206  C  CB    . ARG A 1 46  ? 11.159  44.733 45.144 1.00 50.97  ? 28   ARG A CB    1 
ATOM   207  C  CG    . ARG A 1 46  ? 12.029  45.743 45.901 1.00 52.00  ? 28   ARG A CG    1 
ATOM   208  C  CD    . ARG A 1 46  ? 13.187  45.051 46.584 1.00 51.32  ? 28   ARG A CD    1 
ATOM   209  N  NE    . ARG A 1 46  ? 14.007  45.919 47.431 1.00 51.46  ? 28   ARG A NE    1 
ATOM   210  C  CZ    . ARG A 1 46  ? 15.279  46.278 47.195 1.00 52.25  ? 28   ARG A CZ    1 
ATOM   211  N  NH1   . ARG A 1 46  ? 15.953  45.877 46.115 1.00 49.26  ? 28   ARG A NH1   1 
ATOM   212  N  NH2   . ARG A 1 46  ? 15.899  47.087 48.048 1.00 54.80  ? 28   ARG A NH2   1 
ATOM   213  N  N     . ARG A 1 47  ? 8.910   47.429 45.023 1.00 56.87  ? 29   ARG A N     1 
ATOM   214  C  CA    . ARG A 1 47  ? 7.843   48.213 45.644 1.00 60.00  ? 29   ARG A CA    1 
ATOM   215  C  C     . ARG A 1 47  ? 6.484   47.574 45.368 1.00 59.16  ? 29   ARG A C     1 
ATOM   216  O  O     . ARG A 1 47  ? 5.649   47.466 46.279 1.00 60.94  ? 29   ARG A O     1 
ATOM   217  C  CB    . ARG A 1 47  ? 7.804   49.666 45.130 1.00 63.25  ? 29   ARG A CB    1 
ATOM   218  C  CG    . ARG A 1 47  ? 8.887   50.622 45.656 1.00 68.45  ? 29   ARG A CG    1 
ATOM   219  C  CD    . ARG A 1 47  ? 9.045   50.566 47.188 1.00 75.93  ? 29   ARG A CD    1 
ATOM   220  N  NE    . ARG A 1 47  ? 10.092  49.606 47.580 1.00 76.37  ? 29   ARG A NE    1 
ATOM   221  C  CZ    . ARG A 1 47  ? 11.352  49.924 47.902 1.00 78.67  ? 29   ARG A CZ    1 
ATOM   222  N  NH1   . ARG A 1 47  ? 11.764  51.195 47.917 1.00 81.65  ? 29   ARG A NH1   1 
ATOM   223  N  NH2   . ARG A 1 47  ? 12.212  48.962 48.232 1.00 77.27  ? 29   ARG A NH2   1 
ATOM   224  N  N     . GLU A 1 48  ? 6.258   47.168 44.118 1.00 56.09  ? 30   GLU A N     1 
ATOM   225  C  CA    . GLU A 1 48  ? 4.944   46.668 43.720 1.00 55.99  ? 30   GLU A CA    1 
ATOM   226  C  C     . GLU A 1 48  ? 4.653   45.328 44.372 1.00 53.00  ? 30   GLU A C     1 
ATOM   227  O  O     . GLU A 1 48  ? 5.518   44.456 44.393 1.00 49.95  ? 30   GLU A O     1 
ATOM   228  C  CB    . GLU A 1 48  ? 4.843   46.523 42.211 1.00 54.75  ? 30   GLU A CB    1 
ATOM   229  C  CG    . GLU A 1 48  ? 4.756   47.842 41.473 1.00 58.99  ? 30   GLU A CG    1 
ATOM   230  C  CD    . GLU A 1 48  ? 4.850   47.617 39.980 1.00 59.02  ? 30   GLU A CD    1 
ATOM   231  O  OE1   . GLU A 1 48  ? 3.825   47.182 39.379 1.00 62.73  ? 30   GLU A OE1   1 
ATOM   232  O  OE2   . GLU A 1 48  ? 5.966   47.825 39.434 1.00 62.14  ? 30   GLU A OE2   1 
ATOM   233  N  N     . ALA A 1 49  ? 3.434   45.177 44.883 1.00 53.39  ? 31   ALA A N     1 
ATOM   234  C  CA    . ALA A 1 49  ? 3.070   44.014 45.689 1.00 52.84  ? 31   ALA A CA    1 
ATOM   235  C  C     . ALA A 1 49  ? 3.302   42.736 44.918 1.00 48.51  ? 31   ALA A C     1 
ATOM   236  O  O     . ALA A 1 49  ? 3.786   41.761 45.470 1.00 46.47  ? 31   ALA A O     1 
ATOM   237  C  CB    . ALA A 1 49  ? 1.617   44.115 46.169 1.00 54.59  ? 31   ALA A CB    1 
ATOM   238  N  N     . TYR A 1 50  ? 2.994   42.778 43.622 1.00 47.55  ? 32   TYR A N     1 
ATOM   239  C  CA    . TYR A 1 50  ? 3.179   41.658 42.670 1.00 45.98  ? 32   TYR A CA    1 
ATOM   240  C  C     . TYR A 1 50  ? 4.616   41.112 42.635 1.00 43.77  ? 32   TYR A C     1 
ATOM   241  O  O     . TYR A 1 50  ? 4.828   39.930 42.433 1.00 41.28  ? 32   TYR A O     1 
ATOM   242  C  CB    . TYR A 1 50  ? 2.702   42.097 41.234 1.00 46.91  ? 32   TYR A CB    1 
ATOM   243  C  CG    . TYR A 1 50  ? 1.526   43.050 41.358 1.00 51.07  ? 32   TYR A CG    1 
ATOM   244  C  CD1   . TYR A 1 50  ? 0.298   42.592 41.865 1.00 53.23  ? 32   TYR A CD1   1 
ATOM   245  C  CD2   . TYR A 1 50  ? 1.663   44.432 41.106 1.00 54.38  ? 32   TYR A CD2   1 
ATOM   246  C  CE1   . TYR A 1 50  ? -0.795  43.468 42.072 1.00 56.13  ? 32   TYR A CE1   1 
ATOM   247  C  CE2   . TYR A 1 50  ? 0.565   45.327 41.307 1.00 57.36  ? 32   TYR A CE2   1 
ATOM   248  C  CZ    . TYR A 1 50  ? -0.665  44.827 41.790 1.00 59.05  ? 32   TYR A CZ    1 
ATOM   249  O  OH    . TYR A 1 50  ? -1.769  45.659 42.006 1.00 62.60  ? 32   TYR A OH    1 
ATOM   250  N  N     . HIS A 1 51  ? 5.588   41.990 42.844 1.00 28.44  ? 33   HIS A N     1 
ATOM   251  C  CA    . HIS A 1 51  ? 7.024   41.690 42.698 1.00 28.85  ? 33   HIS A CA    1 
ATOM   252  C  C     . HIS A 1 51  ? 7.750   41.629 44.031 1.00 28.85  ? 33   HIS A C     1 
ATOM   253  O  O     . HIS A 1 51  ? 8.975   41.486 44.097 1.00 28.33  ? 33   HIS A O     1 
ATOM   254  C  CB    . HIS A 1 51  ? 7.669   42.732 41.791 1.00 31.22  ? 33   HIS A CB    1 
ATOM   255  C  CG    . HIS A 1 51  ? 6.997   42.819 40.457 1.00 32.84  ? 33   HIS A CG    1 
ATOM   256  N  ND1   . HIS A 1 51  ? 6.553   44.004 39.912 1.00 36.85  ? 33   HIS A ND1   1 
ATOM   257  C  CD2   . HIS A 1 51  ? 6.622   41.844 39.600 1.00 31.50  ? 33   HIS A CD2   1 
ATOM   258  C  CE1   . HIS A 1 51  ? 5.963   43.755 38.758 1.00 33.52  ? 33   HIS A CE1   1 
ATOM   259  N  NE2   . HIS A 1 51  ? 5.989   42.452 38.547 1.00 36.84  ? 33   HIS A NE2   1 
ATOM   260  N  N     . ARG A 1 52  ? 6.959   41.673 45.090 1.00 28.46  ? 34   ARG A N     1 
ATOM   261  C  CA    . ARG A 1 52  ? 7.468   41.731 46.431 1.00 28.97  ? 34   ARG A CA    1 
ATOM   262  C  C     . ARG A 1 52  ? 7.618   40.333 47.040 1.00 26.86  ? 34   ARG A C     1 
ATOM   263  O  O     . ARG A 1 52  ? 6.992   39.392 46.592 1.00 25.88  ? 34   ARG A O     1 
ATOM   264  C  CB    . ARG A 1 52  ? 6.481   42.582 47.212 1.00 30.46  ? 34   ARG A CB    1 
ATOM   265  C  CG    . ARG A 1 52  ? 6.881   42.909 48.520 1.00 34.47  ? 34   ARG A CG    1 
ATOM   266  C  CD    . ARG A 1 52  ? 6.424   44.289 48.929 1.00 39.42  ? 34   ARG A CD    1 
ATOM   267  N  NE    . ARG A 1 52  ? 6.428   44.222 50.383 1.00 43.63  ? 34   ARG A NE    1 
ATOM   268  C  CZ    . ARG A 1 52  ? 5.559   44.823 51.184 1.00 46.10  ? 34   ARG A CZ    1 
ATOM   269  N  NH1   . ARG A 1 52  ? 4.583   45.585 50.692 1.00 48.14  ? 34   ARG A NH1   1 
ATOM   270  N  NH2   . ARG A 1 52  ? 5.662   44.650 52.489 1.00 46.31  ? 34   ARG A NH2   1 
ATOM   271  N  N     . VAL A 1 53  ? 8.524   40.216 48.018 1.00 26.76  ? 35   VAL A N     1 
ATOM   272  C  CA    . VAL A 1 53  ? 8.632   39.042 48.876 1.00 24.42  ? 35   VAL A CA    1 
ATOM   273  C  C     . VAL A 1 53  ? 8.085   39.469 50.247 1.00 24.49  ? 35   VAL A C     1 
ATOM   274  O  O     . VAL A 1 53  ? 8.507   40.475 50.808 1.00 24.32  ? 35   VAL A O     1 
ATOM   275  C  CB    . VAL A 1 53  ? 10.090  38.507 48.974 1.00 23.55  ? 35   VAL A CB    1 
ATOM   276  C  CG1   . VAL A 1 53  ? 10.242  37.435 50.099 1.00 21.99  ? 35   VAL A CG1   1 
ATOM   277  C  CG2   . VAL A 1 53  ? 10.506  37.943 47.610 1.00 22.95  ? 35   VAL A CG2   1 
ATOM   278  N  N     . PHE A 1 54  ? 7.073   38.743 50.717 1.00 22.84  ? 36   PHE A N     1 
ATOM   279  C  CA    . PHE A 1 54  ? 6.411   39.027 51.977 1.00 22.42  ? 36   PHE A CA    1 
ATOM   280  C  C     . PHE A 1 54  ? 7.030   38.182 53.102 1.00 22.43  ? 36   PHE A C     1 
ATOM   281  O  O     . PHE A 1 54  ? 7.482   37.076 52.873 1.00 20.48  ? 36   PHE A O     1 
ATOM   282  C  CB    . PHE A 1 54  ? 4.923   38.745 51.840 1.00 22.50  ? 36   PHE A CB    1 
ATOM   283  C  CG    . PHE A 1 54  ? 4.273   39.642 50.848 1.00 22.07  ? 36   PHE A CG    1 
ATOM   284  C  CD1   . PHE A 1 54  ? 3.984   40.960 51.185 1.00 23.44  ? 36   PHE A CD1   1 
ATOM   285  C  CD2   . PHE A 1 54  ? 4.019   39.193 49.544 1.00 23.96  ? 36   PHE A CD2   1 
ATOM   286  C  CE1   . PHE A 1 54  ? 3.416   41.814 50.244 1.00 24.64  ? 36   PHE A CE1   1 
ATOM   287  C  CE2   . PHE A 1 54  ? 3.458   40.058 48.615 1.00 24.15  ? 36   PHE A CE2   1 
ATOM   288  C  CZ    . PHE A 1 54  ? 3.153   41.356 48.966 1.00 23.73  ? 36   PHE A CZ    1 
ATOM   289  N  N     . VAL A 1 55  ? 7.042   38.730 54.297 1.00 22.32  ? 37   VAL A N     1 
ATOM   290  C  CA    . VAL A 1 55  ? 7.881   38.209 55.380 1.00 22.55  ? 37   VAL A CA    1 
ATOM   291  C  C     . VAL A 1 55  ? 7.012   37.895 56.600 1.00 22.70  ? 37   VAL A C     1 
ATOM   292  O  O     . VAL A 1 55  ? 6.396   38.788 57.185 1.00 22.56  ? 37   VAL A O     1 
ATOM   293  C  CB    . VAL A 1 55  ? 8.992   39.210 55.727 1.00 23.71  ? 37   VAL A CB    1 
ATOM   294  C  CG1   . VAL A 1 55  ? 9.980   38.602 56.765 1.00 24.60  ? 37   VAL A CG1   1 
ATOM   295  C  CG2   . VAL A 1 55  ? 9.731   39.646 54.444 1.00 24.84  ? 37   VAL A CG2   1 
ATOM   296  N  N     . ASN A 1 56  ? 6.983   36.620 56.984 1.00 21.61  ? 38   ASN A N     1 
ATOM   297  C  CA    . ASN A 1 56  ? 6.350   36.219 58.224 1.00 21.85  ? 38   ASN A CA    1 
ATOM   298  C  C     . ASN A 1 56  ? 7.298   36.190 59.412 1.00 23.35  ? 38   ASN A C     1 
ATOM   299  O  O     . ASN A 1 56  ? 6.890   36.537 60.523 1.00 24.01  ? 38   ASN A O     1 
ATOM   300  C  CB    . ASN A 1 56  ? 5.676   34.850 58.077 1.00 21.26  ? 38   ASN A CB    1 
ATOM   301  C  CG    . ASN A 1 56  ? 4.490   34.882 57.171 1.00 20.28  ? 38   ASN A CG    1 
ATOM   302  O  OD1   . ASN A 1 56  ? 4.373   34.045 56.222 1.00 22.20  ? 38   ASN A OD1   1 
ATOM   303  N  ND2   . ASN A 1 56  ? 3.569   35.791 57.437 1.00 21.62  ? 38   ASN A ND2   1 
ATOM   304  N  N     . ARG A 1 57  ? 8.542   35.760 59.181 1.00 23.30  ? 39   ARG A N     1 
ATOM   305  C  CA    . ARG A 1 57  ? 9.593   35.789 60.207 1.00 25.56  ? 39   ARG A CA    1 
ATOM   306  C  C     . ARG A 1 57  ? 10.837  36.305 59.553 1.00 25.82  ? 39   ARG A C     1 
ATOM   307  O  O     . ARG A 1 57  ? 11.074  35.988 58.384 1.00 26.70  ? 39   ARG A O     1 
ATOM   308  C  CB    . ARG A 1 57  ? 9.838   34.393 60.808 1.00 24.68  ? 39   ARG A CB    1 
ATOM   309  C  CG    . ARG A 1 57  ? 8.809   34.003 61.896 1.00 26.88  ? 39   ARG A CG    1 
ATOM   310  C  CD    . ARG A 1 57  ? 8.795   32.499 62.122 1.00 26.37  ? 39   ARG A CD    1 
ATOM   311  N  NE    . ARG A 1 57  ? 8.418   31.782 60.894 1.00 27.51  ? 39   ARG A NE    1 
ATOM   312  C  CZ    . ARG A 1 57  ? 7.190   31.749 60.384 1.00 26.26  ? 39   ARG A CZ    1 
ATOM   313  N  NH1   . ARG A 1 57  ? 6.204   32.350 61.003 1.00 25.48  ? 39   ARG A NH1   1 
ATOM   314  N  NH2   . ARG A 1 57  ? 6.936   31.115 59.247 1.00 26.26  ? 39   ARG A NH2   1 
ATOM   315  N  N     . SER A 1 58  ? 11.615  37.083 60.309 1.00 27.84  ? 40   SER A N     1 
ATOM   316  C  CA    . SER A 1 58  ? 12.828  37.699 59.800 1.00 28.58  ? 40   SER A CA    1 
ATOM   317  C  C     . SER A 1 58  ? 13.794  36.638 59.263 1.00 28.34  ? 40   SER A C     1 
ATOM   318  O  O     . SER A 1 58  ? 13.906  35.530 59.820 1.00 26.54  ? 40   SER A O     1 
ATOM   319  C  CB    . SER A 1 58  ? 13.516  38.522 60.884 1.00 30.01  ? 40   SER A CB    1 
ATOM   320  O  OG    . SER A 1 58  ? 12.687  39.615 61.248 1.00 32.33  ? 40   SER A OG    1 
ATOM   321  N  N     . LEU A 1 59  ? 14.501  36.999 58.190 1.00 27.95  ? 41   LEU A N     1 
ATOM   322  C  CA    . LEU A 1 59  ? 15.430  36.093 57.543 1.00 27.54  ? 41   LEU A CA    1 
ATOM   323  C  C     . LEU A 1 59  ? 16.554  36.928 56.922 1.00 27.70  ? 41   LEU A C     1 
ATOM   324  O  O     . LEU A 1 59  ? 16.300  37.781 56.076 1.00 26.85  ? 41   LEU A O     1 
ATOM   325  C  CB    . LEU A 1 59  ? 14.697  35.270 56.487 1.00 25.69  ? 41   LEU A CB    1 
ATOM   326  C  CG    . LEU A 1 59  ? 15.410  34.121 55.765 1.00 26.43  ? 41   LEU A CG    1 
ATOM   327  C  CD1   . LEU A 1 59  ? 14.439  33.052 55.377 1.00 25.36  ? 41   LEU A CD1   1 
ATOM   328  C  CD2   . LEU A 1 59  ? 16.186  34.613 54.541 1.00 26.19  ? 41   LEU A CD2   1 
ATOM   329  N  N     . ALA A 1 60  ? 17.776  36.656 57.375 1.00 28.91  ? 42   ALA A N     1 
ATOM   330  C  CA    . ALA A 1 60  ? 18.977  37.303 56.895 1.00 29.82  ? 42   ALA A CA    1 
ATOM   331  C  C     . ALA A 1 60  ? 19.477  36.462 55.714 1.00 29.49  ? 42   ALA A C     1 
ATOM   332  O  O     . ALA A 1 60  ? 19.981  35.354 55.888 1.00 27.84  ? 42   ALA A O     1 
ATOM   333  C  CB    . ALA A 1 60  ? 20.022  37.379 58.021 1.00 30.59  ? 42   ALA A CB    1 
ATOM   334  N  N     . MET A 1 61  ? 19.325  36.980 54.502 1.00 30.43  ? 43   MET A N     1 
ATOM   335  C  CA    . MET A 1 61  ? 19.748  36.226 53.313 1.00 30.38  ? 43   MET A CA    1 
ATOM   336  C  C     . MET A 1 61  ? 21.232  35.868 53.293 1.00 31.43  ? 43   MET A C     1 
ATOM   337  O  O     . MET A 1 61  ? 21.586  34.826 52.744 1.00 29.78  ? 43   MET A O     1 
ATOM   338  C  CB    . MET A 1 61  ? 19.344  36.942 52.036 1.00 30.77  ? 43   MET A CB    1 
ATOM   339  C  CG    . MET A 1 61  ? 17.899  36.773 51.739 1.00 34.65  ? 43   MET A CG    1 
ATOM   340  S  SD    . MET A 1 61  ? 17.447  35.119 51.077 1.00 36.51  ? 43   MET A SD    1 
ATOM   341  C  CE    . MET A 1 61  ? 18.277  35.192 49.501 1.00 40.07  ? 43   MET A CE    1 
ATOM   342  N  N     . GLU A 1 62  ? 22.090  36.671 53.924 1.00 31.96  ? 44   GLU A N     1 
ATOM   343  C  CA    . GLU A 1 62  ? 23.524  36.323 53.995 1.00 35.32  ? 44   GLU A CA    1 
ATOM   344  C  C     . GLU A 1 62  ? 23.836  35.032 54.755 1.00 34.21  ? 44   GLU A C     1 
ATOM   345  O  O     . GLU A 1 62  ? 24.892  34.447 54.571 1.00 35.56  ? 44   GLU A O     1 
ATOM   346  C  CB    . GLU A 1 62  ? 24.362  37.471 54.567 1.00 37.04  ? 44   GLU A CB    1 
ATOM   347  C  CG    . GLU A 1 62  ? 24.211  37.665 56.042 1.00 41.74  ? 44   GLU A CG    1 
ATOM   348  C  CD    . GLU A 1 62  ? 25.109  38.762 56.610 1.00 44.93  ? 44   GLU A CD    1 
ATOM   349  O  OE1   . GLU A 1 62  ? 25.692  39.566 55.818 1.00 54.22  ? 44   GLU A OE1   1 
ATOM   350  O  OE2   . GLU A 1 62  ? 25.260  38.794 57.863 1.00 54.67  ? 44   GLU A OE2   1 
ATOM   351  N  N     . LYS A 1 63  ? 22.919  34.557 55.576 1.00 33.01  ? 45   LYS A N     1 
ATOM   352  C  CA    . LYS A 1 63  ? 23.130  33.327 56.303 1.00 33.78  ? 45   LYS A CA    1 
ATOM   353  C  C     . LYS A 1 63  ? 22.695  32.079 55.490 1.00 31.44  ? 45   LYS A C     1 
ATOM   354  O  O     . LYS A 1 63  ? 23.009  30.961 55.865 1.00 30.86  ? 45   LYS A O     1 
ATOM   355  C  CB    . LYS A 1 63  ? 22.359  33.381 57.626 1.00 34.54  ? 45   LYS A CB    1 
ATOM   356  C  CG    . LYS A 1 63  ? 22.902  34.370 58.687 1.00 37.94  ? 45   LYS A CG    1 
ATOM   357  C  CD    . LYS A 1 63  ? 22.022  34.271 59.961 1.00 38.59  ? 45   LYS A CD    1 
ATOM   358  C  CE    . LYS A 1 63  ? 22.734  34.656 61.267 1.00 45.30  ? 45   LYS A CE    1 
ATOM   359  N  NZ    . LYS A 1 63  ? 22.268  35.963 61.870 1.00 49.17  ? 45   LYS A NZ    1 
ATOM   360  N  N     . ILE A 1 64  ? 21.946  32.278 54.403 1.00 29.57  ? 46   ILE A N     1 
ATOM   361  C  CA    . ILE A 1 64  ? 21.539  31.169 53.536 1.00 28.67  ? 46   ILE A CA    1 
ATOM   362  C  C     . ILE A 1 64  ? 22.738  30.696 52.699 1.00 29.12  ? 46   ILE A C     1 
ATOM   363  O  O     . ILE A 1 64  ? 23.293  31.456 51.914 1.00 29.82  ? 46   ILE A O     1 
ATOM   364  C  CB    . ILE A 1 64  ? 20.378  31.564 52.622 1.00 27.30  ? 46   ILE A CB    1 
ATOM   365  C  CG1   . ILE A 1 64  ? 19.142  31.994 53.449 1.00 27.77  ? 46   ILE A CG1   1 
ATOM   366  C  CG2   . ILE A 1 64  ? 20.039  30.431 51.626 1.00 25.56  ? 46   ILE A CG2   1 
ATOM   367  C  CD1   . ILE A 1 64  ? 18.702  30.989 54.569 1.00 25.39  ? 46   ILE A CD1   1 
ATOM   368  N  N     . LYS A 1 65  ? 23.110  29.429 52.851 1.00 29.45  ? 47   LYS A N     1 
ATOM   369  C  CA    . LYS A 1 65  ? 24.189  28.838 52.085 1.00 30.19  ? 47   LYS A CA    1 
ATOM   370  C  C     . LYS A 1 65  ? 23.757  27.885 50.944 1.00 28.36  ? 47   LYS A C     1 
ATOM   371  O  O     . LYS A 1 65  ? 24.574  27.590 50.063 1.00 28.83  ? 47   LYS A O     1 
ATOM   372  C  CB    . LYS A 1 65  ? 25.144  28.112 53.025 1.00 32.25  ? 47   LYS A CB    1 
ATOM   373  C  CG    . LYS A 1 65  ? 25.489  28.852 54.304 1.00 36.63  ? 47   LYS A CG    1 
ATOM   374  C  CD    . LYS A 1 65  ? 26.327  30.100 54.026 1.00 41.01  ? 47   LYS A CD    1 
ATOM   375  C  CE    . LYS A 1 65  ? 26.441  31.000 55.253 1.00 42.61  ? 47   LYS A CE    1 
ATOM   376  N  NZ    . LYS A 1 65  ? 26.926  32.336 54.800 1.00 45.60  ? 47   LYS A NZ    1 
ATOM   377  N  N     . CYS A 1 66  ? 22.509  27.393 50.990 1.00 27.62  ? 48   CYS A N     1 
ATOM   378  C  CA    . CYS A 1 66  ? 21.925  26.487 50.014 1.00 27.03  ? 48   CYS A CA    1 
ATOM   379  C  C     . CYS A 1 66  ? 20.535  26.958 49.678 1.00 24.67  ? 48   CYS A C     1 
ATOM   380  O  O     . CYS A 1 66  ? 19.703  27.192 50.546 1.00 25.92  ? 48   CYS A O     1 
ATOM   381  C  CB    . CYS A 1 66  ? 21.777  25.032 50.493 1.00 27.57  ? 48   CYS A CB    1 
ATOM   382  S  SG    . CYS A 1 66  ? 23.216  24.306 51.065 1.00 37.30  ? 48   CYS A SG    1 
ATOM   383  N  N     . PHE A 1 67  ? 20.272  27.070 48.398 1.00 23.66  ? 49   PHE A N     1 
ATOM   384  C  CA    . PHE A 1 67  ? 18.924  27.346 47.916 1.00 21.60  ? 49   PHE A CA    1 
ATOM   385  C  C     . PHE A 1 67  ? 18.346  26.082 47.287 1.00 20.76  ? 49   PHE A C     1 
ATOM   386  O  O     . PHE A 1 67  ? 18.939  25.547 46.349 1.00 21.39  ? 49   PHE A O     1 
ATOM   387  C  CB    . PHE A 1 67  ? 19.007  28.432 46.869 1.00 22.87  ? 49   PHE A CB    1 
ATOM   388  C  CG    . PHE A 1 67  ? 19.607  29.715 47.395 1.00 24.41  ? 49   PHE A CG    1 
ATOM   389  C  CD1   . PHE A 1 67  ? 18.786  30.667 47.989 1.00 25.06  ? 49   PHE A CD1   1 
ATOM   390  C  CD2   . PHE A 1 67  ? 20.963  29.946 47.307 1.00 25.87  ? 49   PHE A CD2   1 
ATOM   391  C  CE1   . PHE A 1 67  ? 19.304  31.866 48.450 1.00 27.10  ? 49   PHE A CE1   1 
ATOM   392  C  CE2   . PHE A 1 67  ? 21.519  31.133 47.806 1.00 28.62  ? 49   PHE A CE2   1 
ATOM   393  C  CZ    . PHE A 1 67  ? 20.669  32.095 48.385 1.00 27.86  ? 49   PHE A CZ    1 
ATOM   394  N  N     . GLY A 1 68  ? 17.188  25.632 47.766 1.00 19.85  ? 50   GLY A N     1 
ATOM   395  C  CA    . GLY A 1 68  ? 16.576  24.381 47.308 1.00 20.06  ? 50   GLY A CA    1 
ATOM   396  C  C     . GLY A 1 68  ? 15.269  24.736 46.636 1.00 19.54  ? 50   GLY A C     1 
ATOM   397  O  O     . GLY A 1 68  ? 14.581  25.665 47.075 1.00 19.20  ? 50   GLY A O     1 
ATOM   398  N  N     . PHE A 1 69  ? 14.985  24.034 45.545 1.00 18.73  ? 51   PHE A N     1 
ATOM   399  C  CA    . PHE A 1 69  ? 13.820  24.257 44.725 1.00 20.19  ? 51   PHE A CA    1 
ATOM   400  C  C     . PHE A 1 69  ? 13.055  22.980 44.522 1.00 20.97  ? 51   PHE A C     1 
ATOM   401  O  O     . PHE A 1 69  ? 13.588  21.879 44.422 1.00 23.19  ? 51   PHE A O     1 
ATOM   402  C  CB    . PHE A 1 69  ? 14.194  24.801 43.326 1.00 21.01  ? 51   PHE A CB    1 
ATOM   403  C  CG    . PHE A 1 69  ? 14.687  26.203 43.322 1.00 21.68  ? 51   PHE A CG    1 
ATOM   404  C  CD1   . PHE A 1 69  ? 13.813  27.251 43.124 1.00 23.02  ? 51   PHE A CD1   1 
ATOM   405  C  CD2   . PHE A 1 69  ? 16.020  26.476 43.497 1.00 21.29  ? 51   PHE A CD2   1 
ATOM   406  C  CE1   . PHE A 1 69  ? 14.275  28.552 43.110 1.00 23.99  ? 51   PHE A CE1   1 
ATOM   407  C  CE2   . PHE A 1 69  ? 16.479  27.751 43.474 1.00 24.36  ? 51   PHE A CE2   1 
ATOM   408  C  CZ    . PHE A 1 69  ? 15.604  28.800 43.263 1.00 23.78  ? 51   PHE A CZ    1 
ATOM   409  N  N     . ASN A 1 70  ? 11.760  23.141 44.503 1.00 21.11  ? 52   ASN A N     1 
ATOM   410  C  CA    . ASN A 1 70  ? 10.871  22.140 44.021 1.00 21.35  ? 52   ASN A CA    1 
ATOM   411  C  C     . ASN A 1 70  ? 10.606  22.473 42.551 1.00 21.14  ? 52   ASN A C     1 
ATOM   412  O  O     . ASN A 1 70  ? 10.859  23.603 42.148 1.00 20.85  ? 52   ASN A O     1 
ATOM   413  C  CB    . ASN A 1 70  ? 9.643   22.316 44.869 1.00 23.14  ? 52   ASN A CB    1 
ATOM   414  C  CG    . ASN A 1 70  ? 8.585   21.472 44.472 1.00 25.33  ? 52   ASN A CG    1 
ATOM   415  O  OD1   . ASN A 1 70  ? 7.558   21.959 43.978 1.00 24.40  ? 52   ASN A OD1   1 
ATOM   416  N  ND2   . ASN A 1 70  ? 8.789   20.174 44.634 1.00 29.19  ? 52   ASN A ND2   1 
ATOM   417  N  N     . MET A 1 71  ? 10.156  21.509 41.758 1.00 21.38  ? 53   MET A N     1 
ATOM   418  C  CA    . MET A 1 71  ? 9.822   21.754 40.365 1.00 22.01  ? 53   MET A CA    1 
ATOM   419  C  C     . MET A 1 71  ? 8.384   22.185 40.102 1.00 21.86  ? 53   MET A C     1 
ATOM   420  O  O     . MET A 1 71  ? 8.105   23.332 39.737 1.00 20.73  ? 53   MET A O     1 
ATOM   421  C  CB    . MET A 1 71  ? 10.140  20.535 39.492 1.00 22.89  ? 53   MET A CB    1 
ATOM   422  C  CG    . MET A 1 71  ? 10.071  20.896 38.017 1.00 23.05  ? 53   MET A CG    1 
ATOM   423  S  SD    . MET A 1 71  ? 10.514  19.595 36.893 1.00 27.00  ? 53   MET A SD    1 
ATOM   424  C  CE    . MET A 1 71  ? 9.239   18.352 37.201 1.00 24.11  ? 53   MET A CE    1 
ATOM   425  N  N     A ASP A 1 72  ? 7.456   21.264 40.274 0.50 21.53  ? 54   ASP A N     1 
ATOM   426  N  N     B ASP A 1 72  ? 7.461   21.256 40.256 0.50 22.13  ? 54   ASP A N     1 
ATOM   427  C  CA    A ASP A 1 72  ? 6.078   21.550 39.835 0.50 21.45  ? 54   ASP A CA    1 
ATOM   428  C  CA    B ASP A 1 72  ? 6.084   21.498 39.780 0.50 22.41  ? 54   ASP A CA    1 
ATOM   429  C  C     A ASP A 1 72  ? 5.372   22.572 40.682 0.50 21.06  ? 54   ASP A C     1 
ATOM   430  C  C     B ASP A 1 72  ? 5.349   22.523 40.650 0.50 21.66  ? 54   ASP A C     1 
ATOM   431  O  O     A ASP A 1 72  ? 5.409   22.509 41.912 0.50 21.80  ? 54   ASP A O     1 
ATOM   432  O  O     B ASP A 1 72  ? 5.354   22.409 41.875 0.50 22.33  ? 54   ASP A O     1 
ATOM   433  C  CB    A ASP A 1 72  ? 5.272   20.275 39.714 0.50 21.40  ? 54   ASP A CB    1 
ATOM   434  C  CB    B ASP A 1 72  ? 5.347   20.169 39.674 0.50 23.35  ? 54   ASP A CB    1 
ATOM   435  C  CG    A ASP A 1 72  ? 5.451   19.632 38.374 0.50 20.97  ? 54   ASP A CG    1 
ATOM   436  C  CG    B ASP A 1 72  ? 6.003   19.225 38.677 0.50 25.75  ? 54   ASP A CG    1 
ATOM   437  O  OD1   A ASP A 1 72  ? 6.108   20.284 37.500 0.50 20.00  ? 54   ASP A OD1   1 
ATOM   438  O  OD1   B ASP A 1 72  ? 5.885   19.470 37.454 0.50 31.73  ? 54   ASP A OD1   1 
ATOM   439  O  OD2   A ASP A 1 72  ? 4.927   18.510 38.190 0.50 11.56  ? 54   ASP A OD2   1 
ATOM   440  O  OD2   B ASP A 1 72  ? 6.660   18.248 39.090 0.50 30.16  ? 54   ASP A OD2   1 
ATOM   441  N  N     . TYR A 1 73  ? 4.748   23.516 39.988 1.00 21.26  ? 55   TYR A N     1 
ATOM   442  C  CA    . TYR A 1 73  ? 4.148   24.712 40.576 1.00 21.75  ? 55   TYR A CA    1 
ATOM   443  C  C     . TYR A 1 73  ? 5.091   25.619 41.373 1.00 22.18  ? 55   TYR A C     1 
ATOM   444  O  O     . TYR A 1 73  ? 4.637   26.490 42.107 1.00 24.27  ? 55   TYR A O     1 
ATOM   445  C  CB    . TYR A 1 73  ? 2.865   24.364 41.338 1.00 21.23  ? 55   TYR A CB    1 
ATOM   446  C  CG    . TYR A 1 73  ? 1.697   24.130 40.409 1.00 19.47  ? 55   TYR A CG    1 
ATOM   447  C  CD1   . TYR A 1 73  ? 1.197   25.170 39.613 1.00 21.66  ? 55   TYR A CD1   1 
ATOM   448  C  CD2   . TYR A 1 73  ? 1.052   22.892 40.372 1.00 19.19  ? 55   TYR A CD2   1 
ATOM   449  C  CE1   . TYR A 1 73  ? 0.075   24.974 38.775 1.00 21.44  ? 55   TYR A CE1   1 
ATOM   450  C  CE2   . TYR A 1 73  ? -0.061  22.673 39.508 1.00 19.95  ? 55   TYR A CE2   1 
ATOM   451  C  CZ    . TYR A 1 73  ? -0.556  23.735 38.751 1.00 19.27  ? 55   TYR A CZ    1 
ATOM   452  O  OH    . TYR A 1 73  ? -1.652  23.523 37.908 1.00 21.89  ? 55   TYR A OH    1 
ATOM   453  N  N     . THR A 1 74  ? 6.402   25.424 41.179 1.00 21.65  ? 56   THR A N     1 
ATOM   454  C  CA    . THR A 1 74  ? 7.441   26.277 41.766 1.00 21.22  ? 56   THR A CA    1 
ATOM   455  C  C     . THR A 1 74  ? 8.279   26.801 40.614 1.00 21.68  ? 56   THR A C     1 
ATOM   456  O  O     . THR A 1 74  ? 8.068   27.929 40.195 1.00 22.25  ? 56   THR A O     1 
ATOM   457  C  CB    . THR A 1 74  ? 8.226   25.530 42.896 1.00 20.12  ? 56   THR A CB    1 
ATOM   458  O  OG1   . THR A 1 74  ? 7.308   25.151 43.938 1.00 19.90  ? 56   THR A OG1   1 
ATOM   459  C  CG2   . THR A 1 74  ? 9.256   26.417 43.499 1.00 21.47  ? 56   THR A CG2   1 
ATOM   460  N  N     . LEU A 1 75  ? 9.168   25.987 40.051 1.00 21.75  ? 57   LEU A N     1 
ATOM   461  C  CA    . LEU A 1 75  ? 9.896   26.356 38.830 1.00 22.78  ? 57   LEU A CA    1 
ATOM   462  C  C     . LEU A 1 75  ? 9.007   26.277 37.574 1.00 22.79  ? 57   LEU A C     1 
ATOM   463  O  O     . LEU A 1 75  ? 9.066   27.144 36.697 1.00 23.28  ? 57   LEU A O     1 
ATOM   464  C  CB    . LEU A 1 75  ? 11.133  25.473 38.656 1.00 23.44  ? 57   LEU A CB    1 
ATOM   465  C  CG    . LEU A 1 75  ? 12.251  25.684 39.700 1.00 25.05  ? 57   LEU A CG    1 
ATOM   466  C  CD1   . LEU A 1 75  ? 13.320  24.563 39.605 1.00 27.77  ? 57   LEU A CD1   1 
ATOM   467  C  CD2   . LEU A 1 75  ? 12.865  27.060 39.594 1.00 26.48  ? 57   LEU A CD2   1 
ATOM   468  N  N     . ALA A 1 76  ? 8.183   25.224 37.504 1.00 21.92  ? 58   ALA A N     1 
ATOM   469  C  CA    . ALA A 1 76  ? 7.297   24.963 36.389 1.00 21.71  ? 58   ALA A CA    1 
ATOM   470  C  C     . ALA A 1 76  ? 5.877   25.264 36.857 1.00 21.99  ? 58   ALA A C     1 
ATOM   471  O  O     . ALA A 1 76  ? 5.233   24.450 37.490 1.00 20.82  ? 58   ALA A O     1 
ATOM   472  C  CB    . ALA A 1 76  ? 7.405   23.496 35.944 1.00 21.71  ? 58   ALA A CB    1 
ATOM   473  N  N     . VAL A 1 77  ? 5.418   26.476 36.547 1.00 23.33  ? 59   VAL A N     1 
ATOM   474  C  CA    . VAL A 1 77  ? 4.091   26.916 36.895 1.00 22.31  ? 59   VAL A CA    1 
ATOM   475  C  C     . VAL A 1 77  ? 3.196   26.635 35.679 1.00 22.53  ? 59   VAL A C     1 
ATOM   476  O  O     . VAL A 1 77  ? 3.419   27.161 34.578 1.00 22.39  ? 59   VAL A O     1 
ATOM   477  C  CB    . VAL A 1 77  ? 4.062   28.404 37.366 1.00 23.24  ? 59   VAL A CB    1 
ATOM   478  C  CG1   . VAL A 1 77  ? 2.583   28.869 37.605 1.00 23.59  ? 59   VAL A CG1   1 
ATOM   479  C  CG2   . VAL A 1 77  ? 4.851   28.554 38.693 1.00 22.62  ? 59   VAL A CG2   1 
ATOM   480  N  N     . TYR A 1 78  ? 2.199   25.778 35.881 1.00 21.47  ? 60   TYR A N     1 
ATOM   481  C  CA    . TYR A 1 78  ? 1.330   25.374 34.785 1.00 21.91  ? 60   TYR A CA    1 
ATOM   482  C  C     . TYR A 1 78  ? 0.269   26.453 34.540 1.00 22.95  ? 60   TYR A C     1 
ATOM   483  O  O     . TYR A 1 78  ? -0.309  26.985 35.463 1.00 22.36  ? 60   TYR A O     1 
ATOM   484  C  CB    . TYR A 1 78  ? 0.688   24.019 35.066 1.00 22.03  ? 60   TYR A CB    1 
ATOM   485  C  CG    . TYR A 1 78  ? 1.732   22.927 35.174 1.00 20.89  ? 60   TYR A CG    1 
ATOM   486  C  CD1   . TYR A 1 78  ? 2.336   22.411 34.017 1.00 21.70  ? 60   TYR A CD1   1 
ATOM   487  C  CD2   . TYR A 1 78  ? 2.156   22.470 36.402 1.00 19.88  ? 60   TYR A CD2   1 
ATOM   488  C  CE1   . TYR A 1 78  ? 3.309   21.450 34.088 1.00 23.40  ? 60   TYR A CE1   1 
ATOM   489  C  CE2   . TYR A 1 78  ? 3.153   21.489 36.506 1.00 23.45  ? 60   TYR A CE2   1 
ATOM   490  C  CZ    . TYR A 1 78  ? 3.742   20.988 35.317 1.00 23.64  ? 60   TYR A CZ    1 
ATOM   491  O  OH    . TYR A 1 78  ? 4.757   20.040 35.378 1.00 25.67  ? 60   TYR A OH    1 
ATOM   492  N  N     . LYS A 1 79  ? 0.001   26.723 33.287 1.00 23.91  ? 61   LYS A N     1 
ATOM   493  C  CA    . LYS A 1 79  ? -0.935  27.782 32.893 1.00 24.64  ? 61   LYS A CA    1 
ATOM   494  C  C     . LYS A 1 79  ? -2.394  27.419 33.196 1.00 24.98  ? 61   LYS A C     1 
ATOM   495  O  O     . LYS A 1 79  ? -2.795  26.268 33.039 1.00 24.66  ? 61   LYS A O     1 
ATOM   496  C  CB    . LYS A 1 79  ? -0.738  28.078 31.431 1.00 25.82  ? 61   LYS A CB    1 
ATOM   497  C  CG    . LYS A 1 79  ? 0.518   28.883 31.162 1.00 26.34  ? 61   LYS A CG    1 
ATOM   498  C  CD    . LYS A 1 79  ? 0.806   29.000 29.708 1.00 28.31  ? 61   LYS A CD    1 
ATOM   499  C  CE    . LYS A 1 79  ? 1.960   29.917 29.467 1.00 28.55  ? 61   LYS A CE    1 
ATOM   500  N  NZ    . LYS A 1 79  ? 2.140   30.196 28.040 1.00 33.45  ? 61   LYS A NZ    1 
ATOM   501  N  N     . SER A 1 80  ? -3.159  28.435 33.609 1.00 24.97  ? 62   SER A N     1 
ATOM   502  C  CA    . SER A 1 80  ? -4.545  28.304 34.077 1.00 25.20  ? 62   SER A CA    1 
ATOM   503  C  C     . SER A 1 80  ? -5.467  29.148 33.190 1.00 25.49  ? 62   SER A C     1 
ATOM   504  O  O     . SER A 1 80  ? -5.131  30.285 32.871 1.00 25.20  ? 62   SER A O     1 
ATOM   505  C  CB    . SER A 1 80  ? -4.605  28.759 35.546 1.00 24.87  ? 62   SER A CB    1 
ATOM   506  O  OG    . SER A 1 80  ? -5.915  28.752 36.115 1.00 25.01  ? 62   SER A OG    1 
ATOM   507  N  N     . PRO A 1 81  ? -6.659  28.621 32.847 1.00 25.40  ? 63   PRO A N     1 
ATOM   508  C  CA    . PRO A 1 81  ? -7.191  27.330 33.314 1.00 24.16  ? 63   PRO A CA    1 
ATOM   509  C  C     . PRO A 1 81  ? -6.845  26.101 32.460 1.00 23.80  ? 63   PRO A C     1 
ATOM   510  O  O     . PRO A 1 81  ? -7.401  25.044 32.673 1.00 24.38  ? 63   PRO A O     1 
ATOM   511  C  CB    . PRO A 1 81  ? -8.704  27.580 33.273 1.00 25.69  ? 63   PRO A CB    1 
ATOM   512  C  CG    . PRO A 1 81  ? -8.869  28.455 32.057 1.00 27.75  ? 63   PRO A CG    1 
ATOM   513  C  CD    . PRO A 1 81  ? -7.634  29.337 32.011 1.00 26.41  ? 63   PRO A CD    1 
ATOM   514  N  N     . GLU A 1 82  ? -5.977  26.268 31.481 1.00 23.32  ? 64   GLU A N     1 
ATOM   515  C  CA    . GLU A 1 82  ? -5.717  25.238 30.491 1.00 23.70  ? 64   GLU A CA    1 
ATOM   516  C  C     . GLU A 1 82  ? -5.251  23.955 31.137 1.00 21.98  ? 64   GLU A C     1 
ATOM   517  O  O     . GLU A 1 82  ? -5.774  22.904 30.829 1.00 22.35  ? 64   GLU A O     1 
ATOM   518  C  CB    . GLU A 1 82  ? -4.684  25.714 29.491 1.00 24.90  ? 64   GLU A CB    1 
ATOM   519  C  CG    . GLU A 1 82  ? -5.232  26.652 28.438 1.00 28.97  ? 64   GLU A CG    1 
ATOM   520  C  CD    . GLU A 1 82  ? -5.235  28.107 28.872 1.00 32.56  ? 64   GLU A CD    1 
ATOM   521  O  OE1   . GLU A 1 82  ? -4.883  28.407 30.037 1.00 32.49  ? 64   GLU A OE1   1 
ATOM   522  O  OE2   . GLU A 1 82  ? -5.553  28.967 28.012 1.00 39.00  ? 64   GLU A OE2   1 
ATOM   523  N  N     . TYR A 1 83  ? -4.265  24.027 32.033 1.00 20.83  ? 65   TYR A N     1 
ATOM   524  C  CA    . TYR A 1 83  ? -3.714  22.784 32.656 1.00 20.54  ? 65   TYR A CA    1 
ATOM   525  C  C     . TYR A 1 83  ? -4.730  22.109 33.595 1.00 19.88  ? 65   TYR A C     1 
ATOM   526  O  O     . TYR A 1 83  ? -4.895  20.896 33.554 1.00 20.94  ? 65   TYR A O     1 
ATOM   527  C  CB    . TYR A 1 83  ? -2.427  23.064 33.406 1.00 20.05  ? 65   TYR A CB    1 
ATOM   528  C  CG    . TYR A 1 83  ? -1.720  21.829 33.903 1.00 19.12  ? 65   TYR A CG    1 
ATOM   529  C  CD1   . TYR A 1 83  ? -1.060  20.982 33.019 1.00 20.98  ? 65   TYR A CD1   1 
ATOM   530  C  CD2   . TYR A 1 83  ? -1.675  21.530 35.264 1.00 20.65  ? 65   TYR A CD2   1 
ATOM   531  C  CE1   . TYR A 1 83  ? -0.386  19.861 33.485 1.00 22.32  ? 65   TYR A CE1   1 
ATOM   532  C  CE2   . TYR A 1 83  ? -0.993  20.390 35.744 1.00 20.49  ? 65   TYR A CE2   1 
ATOM   533  C  CZ    . TYR A 1 83  ? -0.361  19.575 34.842 1.00 20.61  ? 65   TYR A CZ    1 
ATOM   534  O  OH    . TYR A 1 83  ? 0.299   18.462 35.315 1.00 21.59  ? 65   TYR A OH    1 
ATOM   535  N  N     . GLU A 1 84  ? -5.448  22.884 34.405 1.00 20.32  ? 66   GLU A N     1 
ATOM   536  C  CA    . GLU A 1 84  ? -6.512  22.322 35.252 1.00 20.50  ? 66   GLU A CA    1 
ATOM   537  C  C     . GLU A 1 84  ? -7.589  21.619 34.399 1.00 20.93  ? 66   GLU A C     1 
ATOM   538  O  O     . GLU A 1 84  ? -8.055  20.528 34.771 1.00 21.03  ? 66   GLU A O     1 
ATOM   539  C  CB    . GLU A 1 84  ? -7.184  23.391 36.125 1.00 21.47  ? 66   GLU A CB    1 
ATOM   540  C  CG    . GLU A 1 84  ? -6.275  24.069 37.122 1.00 23.13  ? 66   GLU A CG    1 
ATOM   541  C  CD    . GLU A 1 84  ? -5.784  25.401 36.601 1.00 26.87  ? 66   GLU A CD    1 
ATOM   542  O  OE1   . GLU A 1 84  ? -5.058  25.387 35.572 1.00 26.68  ? 66   GLU A OE1   1 
ATOM   543  O  OE2   . GLU A 1 84  ? -6.139  26.467 37.209 1.00 29.65  ? 66   GLU A OE2   1 
ATOM   544  N  N     A SER A 1 85  ? -7.990  22.269 33.302 0.50 22.20  ? 67   SER A N     1 
ATOM   545  N  N     B SER A 1 85  ? -7.989  22.251 33.292 0.50 22.13  ? 67   SER A N     1 
ATOM   546  C  CA    A SER A 1 85  ? -8.973  21.725 32.379 0.50 23.20  ? 67   SER A CA    1 
ATOM   547  C  CA    B SER A 1 85  ? -8.998  21.699 32.394 0.50 23.06  ? 67   SER A CA    1 
ATOM   548  C  C     A SER A 1 85  ? -8.502  20.367 31.855 0.50 23.35  ? 67   SER A C     1 
ATOM   549  C  C     B SER A 1 85  ? -8.535  20.396 31.736 0.50 23.42  ? 67   SER A C     1 
ATOM   550  O  O     A SER A 1 85  ? -9.254  19.402 31.871 0.50 23.02  ? 67   SER A O     1 
ATOM   551  O  O     B SER A 1 85  ? -9.338  19.503 31.506 0.50 23.42  ? 67   SER A O     1 
ATOM   552  C  CB    A SER A 1 85  ? -9.228  22.664 31.205 0.50 24.46  ? 67   SER A CB    1 
ATOM   553  C  CB    B SER A 1 85  ? -9.395  22.706 31.326 0.50 24.25  ? 67   SER A CB    1 
ATOM   554  O  OG    A SER A 1 85  ? -10.494 22.410 30.642 0.50 25.65  ? 67   SER A OG    1 
ATOM   555  O  OG    B SER A 1 85  ? -9.963  23.847 31.937 0.50 23.32  ? 67   SER A OG    1 
ATOM   556  N  N     . LEU A 1 86  ? -7.244  20.302 31.420 1.00 23.47  ? 68   LEU A N     1 
ATOM   557  C  CA    . LEU A 1 86  ? -6.657  19.058 30.931 1.00 23.17  ? 68   LEU A CA    1 
ATOM   558  C  C     . LEU A 1 86  ? -6.678  17.944 31.985 1.00 23.21  ? 68   LEU A C     1 
ATOM   559  O  O     . LEU A 1 86  ? -7.109  16.819 31.697 1.00 23.06  ? 68   LEU A O     1 
ATOM   560  C  CB    . LEU A 1 86  ? -5.233  19.295 30.422 1.00 23.65  ? 68   LEU A CB    1 
ATOM   561  C  CG    . LEU A 1 86  ? -4.511  18.045 29.881 1.00 24.25  ? 68   LEU A CG    1 
ATOM   562  C  CD1   . LEU A 1 86  ? -5.218  17.449 28.661 1.00 26.70  ? 68   LEU A CD1   1 
ATOM   563  C  CD2   . LEU A 1 86  ? -3.018  18.343 29.627 1.00 24.30  ? 68   LEU A CD2   1 
ATOM   564  N  N     . GLY A 1 87  ? -6.242  18.250 33.197 1.00 21.52  ? 69   GLY A N     1 
ATOM   565  C  CA    . GLY A 1 87  ? -6.349  17.310 34.279 1.00 21.89  ? 69   GLY A CA    1 
ATOM   566  C  C     . GLY A 1 87  ? -7.783  16.865 34.523 1.00 21.87  ? 69   GLY A C     1 
ATOM   567  O  O     . GLY A 1 87  ? -8.036  15.683 34.673 1.00 22.90  ? 69   GLY A O     1 
ATOM   568  N  N     . PHE A 1 88  ? -8.696  17.832 34.588 1.00 21.43  ? 70   PHE A N     1 
ATOM   569  C  CA    . PHE A 1 88  ? -10.129 17.555 34.764 1.00 22.41  ? 70   PHE A CA    1 
ATOM   570  C  C     . PHE A 1 88  ? -10.640 16.580 33.687 1.00 21.78  ? 70   PHE A C     1 
ATOM   571  O  O     . PHE A 1 88  ? -11.232 15.539 34.002 1.00 21.91  ? 70   PHE A O     1 
ATOM   572  C  CB    . PHE A 1 88  ? -10.919 18.861 34.772 1.00 22.34  ? 70   PHE A CB    1 
ATOM   573  C  CG    . PHE A 1 88  ? -12.402 18.692 34.998 1.00 20.96  ? 70   PHE A CG    1 
ATOM   574  C  CD1   . PHE A 1 88  ? -12.930 18.673 36.297 1.00 22.11  ? 70   PHE A CD1   1 
ATOM   575  C  CD2   . PHE A 1 88  ? -13.263 18.597 33.916 1.00 24.82  ? 70   PHE A CD2   1 
ATOM   576  C  CE1   . PHE A 1 88  ? -14.282 18.532 36.497 1.00 22.97  ? 70   PHE A CE1   1 
ATOM   577  C  CE2   . PHE A 1 88  ? -14.630 18.445 34.102 1.00 23.40  ? 70   PHE A CE2   1 
ATOM   578  C  CZ    . PHE A 1 88  ? -15.136 18.414 35.405 1.00 24.49  ? 70   PHE A CZ    1 
ATOM   579  N  N     A GLU A 1 89  ? -10.411 16.929 32.424 0.50 23.50  ? 71   GLU A N     1 
ATOM   580  N  N     B GLU A 1 89  ? -10.384 16.911 32.429 0.50 23.35  ? 71   GLU A N     1 
ATOM   581  C  CA    A GLU A 1 89  ? -10.857 16.114 31.284 0.50 24.33  ? 71   GLU A CA    1 
ATOM   582  C  CA    B GLU A 1 89  ? -10.870 16.112 31.299 0.50 24.54  ? 71   GLU A CA    1 
ATOM   583  C  C     A GLU A 1 89  ? -10.372 14.672 31.400 0.50 24.02  ? 71   GLU A C     1 
ATOM   584  C  C     B GLU A 1 89  ? -10.368 14.671 31.375 0.50 24.12  ? 71   GLU A C     1 
ATOM   585  O  O     A GLU A 1 89  ? -11.148 13.725 31.271 0.50 23.97  ? 71   GLU A O     1 
ATOM   586  O  O     B GLU A 1 89  ? -11.132 13.722 31.201 0.50 24.18  ? 71   GLU A O     1 
ATOM   587  C  CB    A GLU A 1 89  ? -10.377 16.728 29.970 0.50 25.02  ? 71   GLU A CB    1 
ATOM   588  C  CB    B GLU A 1 89  ? -10.465 16.756 29.979 0.50 25.26  ? 71   GLU A CB    1 
ATOM   589  C  CG    A GLU A 1 89  ? -10.736 15.922 28.722 0.50 27.28  ? 71   GLU A CG    1 
ATOM   590  C  CG    B GLU A 1 89  ? -11.021 18.156 29.784 0.50 27.45  ? 71   GLU A CG    1 
ATOM   591  C  CD    A GLU A 1 89  ? -10.470 16.694 27.434 0.50 28.63  ? 71   GLU A CD    1 
ATOM   592  C  CD    B GLU A 1 89  ? -10.615 18.758 28.447 0.50 28.87  ? 71   GLU A CD    1 
ATOM   593  O  OE1   A GLU A 1 89  ? -9.496  17.498 27.414 0.50 33.47  ? 71   GLU A OE1   1 
ATOM   594  O  OE1   B GLU A 1 89  ? -11.292 18.438 27.458 0.50 33.07  ? 71   GLU A OE1   1 
ATOM   595  O  OE2   A GLU A 1 89  ? -11.239 16.512 26.459 0.50 31.48  ? 71   GLU A OE2   1 
ATOM   596  O  OE2   B GLU A 1 89  ? -9.655  19.567 28.393 0.50 33.91  ? 71   GLU A OE2   1 
ATOM   597  N  N     . LEU A 1 90  ? -9.086  14.509 31.673 1.00 23.96  ? 72   LEU A N     1 
ATOM   598  C  CA    . LEU A 1 90  ? -8.483  13.165 31.757 1.00 23.17  ? 72   LEU A CA    1 
ATOM   599  C  C     . LEU A 1 90  ? -8.973  12.351 32.955 1.00 22.57  ? 72   LEU A C     1 
ATOM   600  O  O     . LEU A 1 90  ? -9.127  11.131 32.859 1.00 21.77  ? 72   LEU A O     1 
ATOM   601  C  CB    . LEU A 1 90  ? -6.978  13.296 31.762 1.00 23.09  ? 72   LEU A CB    1 
ATOM   602  C  CG    . LEU A 1 90  ? -6.353  13.806 30.453 1.00 23.69  ? 72   LEU A CG    1 
ATOM   603  C  CD1   . LEU A 1 90  ? -4.831  14.001 30.643 1.00 23.25  ? 72   LEU A CD1   1 
ATOM   604  C  CD2   . LEU A 1 90  ? -6.660  12.916 29.248 1.00 24.96  ? 72   LEU A CD2   1 
ATOM   605  N  N     . THR A 1 91  ? -9.244  13.032 34.068 1.00 22.36  ? 73   THR A N     1 
ATOM   606  C  CA    . THR A 1 91  ? -9.772  12.378 35.266 1.00 21.81  ? 73   THR A CA    1 
ATOM   607  C  C     . THR A 1 91  ? -11.219 11.932 35.004 1.00 21.96  ? 73   THR A C     1 
ATOM   608  O  O     . THR A 1 91  ? -11.570 10.797 35.297 1.00 21.00  ? 73   THR A O     1 
ATOM   609  C  CB    . THR A 1 91  ? -9.685  13.310 36.476 1.00 21.12  ? 73   THR A CB    1 
ATOM   610  O  OG1   . THR A 1 91  ? -8.303  13.699 36.674 1.00 21.05  ? 73   THR A OG1   1 
ATOM   611  C  CG2   . THR A 1 91  ? -10.217 12.601 37.768 1.00 20.28  ? 73   THR A CG2   1 
ATOM   612  N  N     . VAL A 1 92  ? -12.018 12.805 34.385 1.00 22.17  ? 74   VAL A N     1 
ATOM   613  C  CA    . VAL A 1 92  ? -13.368 12.424 33.934 1.00 23.36  ? 74   VAL A CA    1 
ATOM   614  C  C     . VAL A 1 92  ? -13.341 11.213 33.015 1.00 24.18  ? 74   VAL A C     1 
ATOM   615  O  O     . VAL A 1 92  ? -14.067 10.255 33.238 1.00 24.70  ? 74   VAL A O     1 
ATOM   616  C  CB    . VAL A 1 92  ? -14.144 13.569 33.310 1.00 23.96  ? 74   VAL A CB    1 
ATOM   617  C  CG1   . VAL A 1 92  ? -15.347 13.048 32.490 1.00 26.20  ? 74   VAL A CG1   1 
ATOM   618  C  CG2   . VAL A 1 92  ? -14.618 14.536 34.437 1.00 22.49  ? 74   VAL A CG2   1 
ATOM   619  N  N     A GLU A 1 93  ? -12.477 11.237 32.007 0.50 24.21  ? 75   GLU A N     1 
ATOM   620  N  N     B GLU A 1 93  ? -12.479 11.274 31.996 0.50 24.25  ? 75   GLU A N     1 
ATOM   621  C  CA    A GLU A 1 93  ? -12.432 10.147 31.048 0.50 25.31  ? 75   GLU A CA    1 
ATOM   622  C  CA    B GLU A 1 93  ? -12.326 10.194 31.026 0.50 25.08  ? 75   GLU A CA    1 
ATOM   623  C  C     A GLU A 1 93  ? -12.002 8.843  31.694 0.50 24.60  ? 75   GLU A C     1 
ATOM   624  C  C     B GLU A 1 93  ? -12.058 8.885  31.739 0.50 24.46  ? 75   GLU A C     1 
ATOM   625  O  O     A GLU A 1 93  ? -12.468 7.792  31.300 0.50 25.00  ? 75   GLU A O     1 
ATOM   626  O  O     B GLU A 1 93  ? -12.701 7.890  31.448 0.50 24.49  ? 75   GLU A O     1 
ATOM   627  C  CB    A GLU A 1 93  ? -11.556 10.510 29.848 0.50 25.41  ? 75   GLU A CB    1 
ATOM   628  C  CB    B GLU A 1 93  ? -11.215 10.515 30.006 0.50 25.28  ? 75   GLU A CB    1 
ATOM   629  C  CG    A GLU A 1 93  ? -12.167 11.602 28.994 0.50 26.88  ? 75   GLU A CG    1 
ATOM   630  C  CG    B GLU A 1 93  ? -10.747 9.311  29.168 0.50 26.89  ? 75   GLU A CG    1 
ATOM   631  C  CD    A GLU A 1 93  ? -11.273 12.066 27.852 0.50 28.35  ? 75   GLU A CD    1 
ATOM   632  C  CD    B GLU A 1 93  ? -9.705  9.643  28.108 0.50 27.10  ? 75   GLU A CD    1 
ATOM   633  O  OE1   A GLU A 1 93  ? -10.039 11.828 27.871 0.50 28.98  ? 75   GLU A OE1   1 
ATOM   634  O  OE1   B GLU A 1 93  ? -8.522  9.882  28.431 0.50 22.31  ? 75   GLU A OE1   1 
ATOM   635  O  OE2   A GLU A 1 93  ? -11.821 12.700 26.933 0.50 33.74  ? 75   GLU A OE2   1 
ATOM   636  O  OE2   B GLU A 1 93  ? -10.065 9.595  26.914 0.50 32.92  ? 75   GLU A OE2   1 
ATOM   637  N  N     . ARG A 1 94  ? -11.143 8.907  32.705 1.00 23.89  ? 76   ARG A N     1 
ATOM   638  C  CA    . ARG A 1 94  ? -10.779 7.704  33.494 1.00 24.10  ? 76   ARG A CA    1 
ATOM   639  C  C     . ARG A 1 94  ? -11.950 7.139  34.313 1.00 23.88  ? 76   ARG A C     1 
ATOM   640  O  O     . ARG A 1 94  ? -12.160 5.933  34.336 1.00 23.75  ? 76   ARG A O     1 
ATOM   641  C  CB    . ARG A 1 94  ? -9.576  7.997  34.434 1.00 22.95  ? 76   ARG A CB    1 
ATOM   642  C  CG    . ARG A 1 94  ? -9.181  6.880  35.412 1.00 23.76  ? 76   ARG A CG    1 
ATOM   643  C  CD    . ARG A 1 94  ? -8.830  5.558  34.744 1.00 28.79  ? 76   ARG A CD    1 
ATOM   644  N  NE    . ARG A 1 94  ? -8.486  4.534  35.725 1.00 26.54  ? 76   ARG A NE    1 
ATOM   645  C  CZ    . ARG A 1 94  ? -8.141  3.291  35.408 1.00 28.82  ? 76   ARG A CZ    1 
ATOM   646  N  NH1   . ARG A 1 94  ? -8.018  2.921  34.146 1.00 30.47  ? 76   ARG A NH1   1 
ATOM   647  N  NH2   . ARG A 1 94  ? -7.874  2.428  36.357 1.00 32.47  ? 76   ARG A NH2   1 
ATOM   648  N  N     . LEU A 1 95  ? -12.715 8.021  34.965 1.00 24.01  ? 77   LEU A N     1 
ATOM   649  C  CA    . LEU A 1 95  ? -13.906 7.599  35.693 1.00 24.23  ? 77   LEU A CA    1 
ATOM   650  C  C     . LEU A 1 95  ? -14.957 6.931  34.787 1.00 25.17  ? 77   LEU A C     1 
ATOM   651  O  O     . LEU A 1 95  ? -15.558 5.883  35.135 1.00 25.18  ? 77   LEU A O     1 
ATOM   652  C  CB    . LEU A 1 95  ? -14.500 8.779  36.444 1.00 23.41  ? 77   LEU A CB    1 
ATOM   653  C  CG    . LEU A 1 95  ? -13.733 9.282  37.697 1.00 23.40  ? 77   LEU A CG    1 
ATOM   654  C  CD1   . LEU A 1 95  ? -14.352 10.558 38.212 1.00 21.65  ? 77   LEU A CD1   1 
ATOM   655  C  CD2   . LEU A 1 95  ? -13.612 8.205  38.802 1.00 21.13  ? 77   LEU A CD2   1 
ATOM   656  N  N     . VAL A 1 96  ? -15.199 7.537  33.620 1.00 27.09  ? 78   VAL A N     1 
ATOM   657  C  CA    . VAL A 1 96  ? -16.089 6.964  32.639 1.00 27.48  ? 78   VAL A CA    1 
ATOM   658  C  C     . VAL A 1 96  ? -15.541 5.604  32.197 1.00 29.02  ? 78   VAL A C     1 
ATOM   659  O  O     . VAL A 1 96  ? -16.290 4.633  32.117 1.00 28.51  ? 78   VAL A O     1 
ATOM   660  C  CB    . VAL A 1 96  ? -16.384 7.891  31.441 1.00 27.70  ? 78   VAL A CB    1 
ATOM   661  C  CG1   . VAL A 1 96  ? -17.269 7.157  30.378 1.00 28.02  ? 78   VAL A CG1   1 
ATOM   662  C  CG2   . VAL A 1 96  ? -17.150 9.162  31.902 1.00 26.66  ? 78   VAL A CG2   1 
ATOM   663  N  N     . SER A 1 97  ? -14.242 5.514  31.940 1.00 29.38  ? 79   SER A N     1 
ATOM   664  C  CA    . SER A 1 97  ? -13.686 4.251  31.467 1.00 31.42  ? 79   SER A CA    1 
ATOM   665  C  C     . SER A 1 97  ? -13.819 3.102  32.500 1.00 31.15  ? 79   SER A C     1 
ATOM   666  O  O     . SER A 1 97  ? -13.977 1.951  32.105 1.00 33.07  ? 79   SER A O     1 
ATOM   667  C  CB    . SER A 1 97  ? -12.252 4.404  30.963 1.00 30.88  ? 79   SER A CB    1 
ATOM   668  O  OG    . SER A 1 97  ? -11.357 4.218  32.011 1.00 37.18  ? 79   SER A OG    1 
ATOM   669  N  N     . ILE A 1 98  ? -13.823 3.415  33.787 1.00 31.31  ? 80   ILE A N     1 
ATOM   670  C  CA    . ILE A 1 98  ? -14.036 2.396  34.817 1.00 31.90  ? 80   ILE A CA    1 
ATOM   671  C  C     . ILE A 1 98  ? -15.518 2.170  35.214 1.00 32.59  ? 80   ILE A C     1 
ATOM   672  O  O     . ILE A 1 98  ? -15.814 1.333  36.078 1.00 33.69  ? 80   ILE A O     1 
ATOM   673  C  CB    . ILE A 1 98  ? -13.168 2.643  36.096 1.00 31.45  ? 80   ILE A CB    1 
ATOM   674  C  CG1   . ILE A 1 98  ? -13.595 3.901  36.840 1.00 29.76  ? 80   ILE A CG1   1 
ATOM   675  C  CG2   . ILE A 1 98  ? -11.668 2.642  35.733 1.00 32.95  ? 80   ILE A CG2   1 
ATOM   676  C  CD1   . ILE A 1 98  ? -13.322 3.873  38.333 1.00 31.64  ? 80   ILE A CD1   1 
ATOM   677  N  N     . GLY A 1 99  ? -16.447 2.910  34.614 1.00 32.02  ? 81   GLY A N     1 
ATOM   678  C  CA    . GLY A 1 99  ? -17.863 2.581  34.751 1.00 32.17  ? 81   GLY A CA    1 
ATOM   679  C  C     . GLY A 1 99  ? -18.790 3.670  35.228 1.00 31.15  ? 81   GLY A C     1 
ATOM   680  O  O     . GLY A 1 99  ? -20.006 3.426  35.355 1.00 31.04  ? 81   GLY A O     1 
ATOM   681  N  N     . TYR A 1 100 ? -18.257 4.869  35.461 1.00 29.39  ? 82   TYR A N     1 
ATOM   682  C  CA    . TYR A 1 100 ? -19.099 6.016  35.810 1.00 28.99  ? 82   TYR A CA    1 
ATOM   683  C  C     . TYR A 1 100 ? -19.991 6.388  34.609 1.00 29.68  ? 82   TYR A C     1 
ATOM   684  O  O     . TYR A 1 100 ? -19.664 6.063  33.444 1.00 29.06  ? 82   TYR A O     1 
ATOM   685  C  CB    . TYR A 1 100 ? -18.275 7.206  36.331 1.00 28.13  ? 82   TYR A CB    1 
ATOM   686  C  CG    . TYR A 1 100 ? -17.954 7.101  37.812 1.00 27.81  ? 82   TYR A CG    1 
ATOM   687  C  CD1   . TYR A 1 100 ? -17.046 6.153  38.295 1.00 27.12  ? 82   TYR A CD1   1 
ATOM   688  C  CD2   . TYR A 1 100 ? -18.597 7.915  38.729 1.00 29.78  ? 82   TYR A CD2   1 
ATOM   689  C  CE1   . TYR A 1 100 ? -16.795 6.033  39.664 1.00 25.86  ? 82   TYR A CE1   1 
ATOM   690  C  CE2   . TYR A 1 100 ? -18.354 7.819  40.068 1.00 28.52  ? 82   TYR A CE2   1 
ATOM   691  C  CZ    . TYR A 1 100 ? -17.470 6.886  40.546 1.00 28.58  ? 82   TYR A CZ    1 
ATOM   692  O  OH    . TYR A 1 100 ? -17.261 6.856  41.903 1.00 29.11  ? 82   TYR A OH    1 
ATOM   693  N  N     . PRO A 1 101 ? -21.145 7.004  34.888 1.00 29.46  ? 83   PRO A N     1 
ATOM   694  C  CA    . PRO A 1 101 ? -22.083 7.281  33.795 1.00 31.27  ? 83   PRO A CA    1 
ATOM   695  C  C     . PRO A 1 101 ? -21.561 8.226  32.710 1.00 31.32  ? 83   PRO A C     1 
ATOM   696  O  O     . PRO A 1 101 ? -20.766 9.102  32.975 1.00 29.89  ? 83   PRO A O     1 
ATOM   697  C  CB    . PRO A 1 101 ? -23.292 7.915  34.498 1.00 31.79  ? 83   PRO A CB    1 
ATOM   698  C  CG    . PRO A 1 101 ? -22.978 8.012  35.918 1.00 29.67  ? 83   PRO A CG    1 
ATOM   699  C  CD    . PRO A 1 101 ? -21.647 7.420  36.209 1.00 29.19  ? 83   PRO A CD    1 
ATOM   700  N  N     . GLN A 1 102 ? -22.076 8.067  31.499 1.00 34.00  ? 84   GLN A N     1 
ATOM   701  C  CA    . GLN A 1 102 ? -21.640 8.844  30.352 1.00 34.67  ? 84   GLN A CA    1 
ATOM   702  C  C     . GLN A 1 102 ? -21.885 10.333 30.489 1.00 34.30  ? 84   GLN A C     1 
ATOM   703  O  O     . GLN A 1 102 ? -21.187 11.133 29.851 1.00 33.27  ? 84   GLN A O     1 
ATOM   704  C  CB    . GLN A 1 102 ? -22.353 8.335  29.096 1.00 38.20  ? 84   GLN A CB    1 
ATOM   705  C  CG    . GLN A 1 102 ? -21.954 6.920  28.674 1.00 42.48  ? 84   GLN A CG    1 
ATOM   706  C  CD    . GLN A 1 102 ? -20.556 6.840  28.068 1.00 48.99  ? 84   GLN A CD    1 
ATOM   707  O  OE1   . GLN A 1 102 ? -20.215 7.605  27.155 1.00 53.31  ? 84   GLN A OE1   1 
ATOM   708  N  NE2   . GLN A 1 102 ? -19.761 5.874  28.532 1.00 50.49  ? 84   GLN A NE2   1 
ATOM   709  N  N     . GLU A 1 103 ? -22.835 10.723 31.338 1.00 33.94  ? 85   GLU A N     1 
ATOM   710  C  CA    . GLU A 1 103 ? -23.135 12.144 31.539 1.00 34.29  ? 85   GLU A CA    1 
ATOM   711  C  C     . GLU A 1 103 ? -21.978 12.951 32.123 1.00 33.17  ? 85   GLU A C     1 
ATOM   712  O  O     . GLU A 1 103 ? -21.943 14.186 31.972 1.00 34.30  ? 85   GLU A O     1 
ATOM   713  C  CB    . GLU A 1 103 ? -24.350 12.352 32.426 1.00 34.92  ? 85   GLU A CB    1 
ATOM   714  C  CG    . GLU A 1 103 ? -25.640 11.897 31.809 1.00 38.82  ? 85   GLU A CG    1 
ATOM   715  C  CD    . GLU A 1 103 ? -26.043 10.493 32.253 1.00 43.10  ? 85   GLU A CD    1 
ATOM   716  O  OE1   . GLU A 1 103 ? -25.171 9.658  32.608 1.00 43.24  ? 85   GLU A OE1   1 
ATOM   717  O  OE2   . GLU A 1 103 ? -27.254 10.231 32.235 1.00 48.07  ? 85   GLU A OE2   1 
ATOM   718  N  N     . LEU A 1 104 ? -21.037 12.280 32.791 1.00 30.71  ? 86   LEU A N     1 
ATOM   719  C  CA    . LEU A 1 104 ? -19.786 12.928 33.206 1.00 29.24  ? 86   LEU A CA    1 
ATOM   720  C  C     . LEU A 1 104 ? -19.061 13.610 32.030 1.00 29.32  ? 86   LEU A C     1 
ATOM   721  O  O     . LEU A 1 104 ? -18.399 14.610 32.220 1.00 28.21  ? 86   LEU A O     1 
ATOM   722  C  CB    . LEU A 1 104 ? -18.831 11.912 33.822 1.00 28.14  ? 86   LEU A CB    1 
ATOM   723  C  CG    . LEU A 1 104 ? -18.922 11.747 35.329 1.00 28.32  ? 86   LEU A CG    1 
ATOM   724  C  CD1   . LEU A 1 104 ? -20.299 11.233 35.752 1.00 27.98  ? 86   LEU A CD1   1 
ATOM   725  C  CD2   . LEU A 1 104 ? -17.774 10.847 35.832 1.00 27.10  ? 86   LEU A CD2   1 
ATOM   726  N  N     . LEU A 1 105 ? -19.182 13.054 30.827 1.00 30.55  ? 87   LEU A N     1 
ATOM   727  C  CA    . LEU A 1 105 ? -18.566 13.661 29.647 1.00 31.66  ? 87   LEU A CA    1 
ATOM   728  C  C     . LEU A 1 105 ? -19.177 15.032 29.294 1.00 32.48  ? 87   LEU A C     1 
ATOM   729  O  O     . LEU A 1 105 ? -18.615 15.770 28.506 1.00 34.30  ? 87   LEU A O     1 
ATOM   730  C  CB    . LEU A 1 105 ? -18.629 12.708 28.453 1.00 32.85  ? 87   LEU A CB    1 
ATOM   731  C  CG    . LEU A 1 105 ? -18.006 11.311 28.649 1.00 30.94  ? 87   LEU A CG    1 
ATOM   732  C  CD1   . LEU A 1 105 ? -18.299 10.410 27.413 1.00 34.94  ? 87   LEU A CD1   1 
ATOM   733  C  CD2   . LEU A 1 105 ? -16.523 11.427 28.948 1.00 29.38  ? 87   LEU A CD2   1 
ATOM   734  N  N     . SER A 1 106 ? -20.308 15.385 29.878 1.00 32.73  ? 88   SER A N     1 
ATOM   735  C  CA    . SER A 1 106 ? -20.901 16.710 29.652 1.00 32.88  ? 88   SER A CA    1 
ATOM   736  C  C     . SER A 1 106 ? -20.267 17.771 30.597 1.00 31.82  ? 88   SER A C     1 
ATOM   737  O  O     . SER A 1 106 ? -20.462 18.979 30.397 1.00 32.13  ? 88   SER A O     1 
ATOM   738  C  CB    . SER A 1 106 ? -22.431 16.635 29.795 1.00 34.31  ? 88   SER A CB    1 
ATOM   739  O  OG    . SER A 1 106 ? -22.827 16.541 31.162 1.00 35.33  ? 88   SER A OG    1 
ATOM   740  N  N     . PHE A 1 107 ? -19.527 17.338 31.619 1.00 29.76  ? 89   PHE A N     1 
ATOM   741  C  CA    . PHE A 1 107 ? -18.883 18.271 32.558 1.00 27.87  ? 89   PHE A CA    1 
ATOM   742  C  C     . PHE A 1 107 ? -17.817 19.080 31.827 1.00 27.88  ? 89   PHE A C     1 
ATOM   743  O  O     . PHE A 1 107 ? -17.218 18.621 30.858 1.00 27.37  ? 89   PHE A O     1 
ATOM   744  C  CB    . PHE A 1 107 ? -18.223 17.602 33.773 1.00 26.27  ? 89   PHE A CB    1 
ATOM   745  C  CG    . PHE A 1 107 ? -19.151 16.808 34.677 1.00 27.53  ? 89   PHE A CG    1 
ATOM   746  C  CD1   . PHE A 1 107 ? -20.527 16.854 34.564 1.00 25.92  ? 89   PHE A CD1   1 
ATOM   747  C  CD2   . PHE A 1 107 ? -18.601 15.987 35.652 1.00 24.84  ? 89   PHE A CD2   1 
ATOM   748  C  CE1   . PHE A 1 107 ? -21.344 16.086 35.414 1.00 27.41  ? 89   PHE A CE1   1 
ATOM   749  C  CE2   . PHE A 1 107 ? -19.399 15.217 36.515 1.00 25.64  ? 89   PHE A CE2   1 
ATOM   750  C  CZ    . PHE A 1 107 ? -20.764 15.287 36.415 1.00 26.27  ? 89   PHE A CZ    1 
ATOM   751  N  N     . ALA A 1 108 ? -17.592 20.305 32.273 1.00 27.33  ? 90   ALA A N     1 
ATOM   752  C  CA    . ALA A 1 108 ? -16.524 21.129 31.706 1.00 26.93  ? 90   ALA A CA    1 
ATOM   753  C  C     . ALA A 1 108 ? -15.933 21.910 32.840 1.00 26.02  ? 90   ALA A C     1 
ATOM   754  O  O     . ALA A 1 108 ? -16.670 22.510 33.621 1.00 25.04  ? 90   ALA A O     1 
ATOM   755  C  CB    . ALA A 1 108 ? -17.102 22.066 30.608 1.00 27.63  ? 90   ALA A CB    1 
ATOM   756  N  N     . TYR A 1 109 ? -14.612 21.874 32.983 1.00 25.84  ? 91   TYR A N     1 
ATOM   757  C  CA    . TYR A 1 109 ? -13.952 22.582 34.066 1.00 24.52  ? 91   TYR A CA    1 
ATOM   758  C  C     . TYR A 1 109 ? -14.383 24.051 34.135 1.00 25.20  ? 91   TYR A C     1 
ATOM   759  O  O     . TYR A 1 109 ? -14.444 24.726 33.113 1.00 25.03  ? 91   TYR A O     1 
ATOM   760  C  CB    . TYR A 1 109 ? -12.422 22.492 33.931 1.00 25.52  ? 91   TYR A CB    1 
ATOM   761  C  CG    . TYR A 1 109 ? -11.706 23.079 35.120 1.00 23.98  ? 91   TYR A CG    1 
ATOM   762  C  CD1   . TYR A 1 109 ? -11.724 22.445 36.361 1.00 23.94  ? 91   TYR A CD1   1 
ATOM   763  C  CD2   . TYR A 1 109 ? -11.024 24.293 35.019 1.00 26.15  ? 91   TYR A CD2   1 
ATOM   764  C  CE1   . TYR A 1 109 ? -11.100 22.994 37.453 1.00 25.63  ? 91   TYR A CE1   1 
ATOM   765  C  CE2   . TYR A 1 109 ? -10.386 24.862 36.118 1.00 22.69  ? 91   TYR A CE2   1 
ATOM   766  C  CZ    . TYR A 1 109 ? -10.417 24.211 37.329 1.00 24.72  ? 91   TYR A CZ    1 
ATOM   767  O  OH    . TYR A 1 109 ? -9.775  24.783 38.414 1.00 25.19  ? 91   TYR A OH    1 
ATOM   768  N  N     . ASP A 1 110 ? -14.675 24.514 35.343 1.00 24.68  ? 92   ASP A N     1 
ATOM   769  C  CA    . ASP A 1 110 ? -14.965 25.907 35.605 1.00 25.76  ? 92   ASP A CA    1 
ATOM   770  C  C     . ASP A 1 110 ? -14.012 26.425 36.653 1.00 25.25  ? 92   ASP A C     1 
ATOM   771  O  O     . ASP A 1 110 ? -14.179 26.136 37.847 1.00 24.08  ? 92   ASP A O     1 
ATOM   772  C  CB    . ASP A 1 110 ? -16.408 26.071 36.109 1.00 27.61  ? 92   ASP A CB    1 
ATOM   773  C  CG    . ASP A 1 110 ? -16.869 27.532 36.073 1.00 29.09  ? 92   ASP A CG    1 
ATOM   774  O  OD1   . ASP A 1 110 ? -16.063 28.437 36.357 1.00 31.68  ? 92   ASP A OD1   1 
ATOM   775  O  OD2   . ASP A 1 110 ? -18.014 27.764 35.658 1.00 42.36  ? 92   ASP A OD2   1 
ATOM   776  N  N     . SER A 1 111 ? -13.059 27.247 36.213 1.00 24.76  ? 93   SER A N     1 
ATOM   777  C  CA    . SER A 1 111 ? -12.117 27.901 37.108 1.00 24.28  ? 93   SER A CA    1 
ATOM   778  C  C     . SER A 1 111 ? -12.727 28.859 38.151 1.00 24.44  ? 93   SER A C     1 
ATOM   779  O  O     . SER A 1 111 ? -12.074 29.155 39.151 1.00 24.50  ? 93   SER A O     1 
ATOM   780  C  CB    . SER A 1 111 ? -11.075 28.678 36.272 1.00 25.38  ? 93   SER A CB    1 
ATOM   781  O  OG    . SER A 1 111 ? -11.659 29.821 35.668 1.00 25.27  ? 93   SER A OG    1 
ATOM   782  N  N     . THR A 1 112 ? -13.971 29.280 37.968 1.00 24.21  ? 94   THR A N     1 
ATOM   783  C  CA    . THR A 1 112 ? -14.614 30.180 38.930 1.00 24.72  ? 94   THR A CA    1 
ATOM   784  C  C     . THR A 1 112 ? -15.156 29.521 40.189 1.00 23.99  ? 94   THR A C     1 
ATOM   785  O  O     . THR A 1 112 ? -15.454 30.219 41.156 1.00 25.12  ? 94   THR A O     1 
ATOM   786  C  CB    . THR A 1 112 ? -15.700 31.068 38.300 1.00 25.23  ? 94   THR A CB    1 
ATOM   787  O  OG1   . THR A 1 112 ? -16.893 30.321 37.946 1.00 25.18  ? 94   THR A OG1   1 
ATOM   788  C  CG2   . THR A 1 112 ? -15.138 31.810 37.115 1.00 27.60  ? 94   THR A CG2   1 
ATOM   789  N  N     . PHE A 1 113 ? -15.268 28.201 40.184 1.00 22.67  ? 95   PHE A N     1 
ATOM   790  C  CA    . PHE A 1 113 ? -15.728 27.487 41.362 1.00 23.12  ? 95   PHE A CA    1 
ATOM   791  C  C     . PHE A 1 113 ? -14.660 27.222 42.414 1.00 21.95  ? 95   PHE A C     1 
ATOM   792  O  O     . PHE A 1 113 ? -14.856 27.604 43.558 1.00 23.64  ? 95   PHE A O     1 
ATOM   793  C  CB    . PHE A 1 113 ? -16.446 26.191 40.988 1.00 22.00  ? 95   PHE A CB    1 
ATOM   794  C  CG    . PHE A 1 113 ? -16.940 25.443 42.167 1.00 19.91  ? 95   PHE A CG    1 
ATOM   795  C  CD1   . PHE A 1 113 ? -18.114 25.789 42.763 1.00 20.83  ? 95   PHE A CD1   1 
ATOM   796  C  CD2   . PHE A 1 113 ? -16.175 24.429 42.738 1.00 20.38  ? 95   PHE A CD2   1 
ATOM   797  C  CE1   . PHE A 1 113 ? -18.559 25.120 43.896 1.00 23.47  ? 95   PHE A CE1   1 
ATOM   798  C  CE2   . PHE A 1 113 ? -16.634 23.753 43.882 1.00 20.72  ? 95   PHE A CE2   1 
ATOM   799  C  CZ    . PHE A 1 113 ? -17.827 24.125 44.447 1.00 19.78  ? 95   PHE A CZ    1 
ATOM   800  N  N     . PRO A 1 114 ? -13.578 26.487 42.072 1.00 22.35  ? 96   PRO A N     1 
ATOM   801  C  CA    . PRO A 1 114 ? -12.764 26.024 43.189 1.00 22.55  ? 96   PRO A CA    1 
ATOM   802  C  C     . PRO A 1 114 ? -11.773 27.073 43.668 1.00 23.49  ? 96   PRO A C     1 
ATOM   803  O  O     . PRO A 1 114 ? -11.226 27.812 42.869 1.00 24.90  ? 96   PRO A O     1 
ATOM   804  C  CB    . PRO A 1 114 ? -12.012 24.815 42.627 1.00 21.84  ? 96   PRO A CB    1 
ATOM   805  C  CG    . PRO A 1 114 ? -11.911 25.096 41.134 1.00 23.26  ? 96   PRO A CG    1 
ATOM   806  C  CD    . PRO A 1 114 ? -13.095 25.961 40.772 1.00 22.98  ? 96   PRO A CD    1 
ATOM   807  N  N     . THR A 1 115 ? -11.633 27.145 44.983 1.00 23.58  ? 97   THR A N     1 
ATOM   808  C  CA    . THR A 1 115 ? -10.535 27.811 45.640 1.00 22.41  ? 97   THR A CA    1 
ATOM   809  C  C     . THR A 1 115 ? -9.690  26.726 46.245 1.00 21.77  ? 97   THR A C     1 
ATOM   810  O  O     . THR A 1 115 ? -10.201 25.699 46.618 1.00 20.50  ? 97   THR A O     1 
ATOM   811  C  CB    . THR A 1 115 ? -11.093 28.782 46.681 1.00 23.43  ? 97   THR A CB    1 
ATOM   812  O  OG1   . THR A 1 115 ? -11.819 29.806 45.969 1.00 22.57  ? 97   THR A OG1   1 
ATOM   813  C  CG2   . THR A 1 115 ? -10.003 29.446 47.489 1.00 23.11  ? 97   THR A CG2   1 
ATOM   814  N  N     . ARG A 1 116 ? -8.381  26.924 46.290 1.00 21.29  ? 98   ARG A N     1 
ATOM   815  C  CA    . ARG A 1 116 ? -7.495  25.990 46.915 1.00 21.31  ? 98   ARG A CA    1 
ATOM   816  C  C     . ARG A 1 116 ? -7.637  25.927 48.451 1.00 20.05  ? 98   ARG A C     1 
ATOM   817  O  O     . ARG A 1 116 ? -8.017  26.901 49.073 1.00 19.91  ? 98   ARG A O     1 
ATOM   818  C  CB    . ARG A 1 116 ? -6.060  26.361 46.531 1.00 22.68  ? 98   ARG A CB    1 
ATOM   819  C  CG    . ARG A 1 116 ? -5.083  25.319 46.800 1.00 23.49  ? 98   ARG A CG    1 
ATOM   820  C  CD    . ARG A 1 116 ? -3.915  25.417 45.827 1.00 23.93  ? 98   ARG A CD    1 
ATOM   821  N  NE    . ARG A 1 116 ? -3.176  26.670 45.865 1.00 24.17  ? 98   ARG A NE    1 
ATOM   822  C  CZ    . ARG A 1 116 ? -2.001  26.861 46.457 1.00 23.85  ? 98   ARG A CZ    1 
ATOM   823  N  NH1   . ARG A 1 116 ? -1.428  25.916 47.184 1.00 23.09  ? 98   ARG A NH1   1 
ATOM   824  N  NH2   . ARG A 1 116 ? -1.406  28.046 46.325 1.00 22.64  ? 98   ARG A NH2   1 
ATOM   825  N  N     . GLY A 1 117 ? -7.354  24.750 49.025 1.00 18.61  ? 99   GLY A N     1 
ATOM   826  C  CA    . GLY A 1 117 ? -7.288  24.548 50.467 1.00 19.11  ? 99   GLY A CA    1 
ATOM   827  C  C     . GLY A 1 117 ? -8.610  24.130 51.092 1.00 19.39  ? 99   GLY A C     1 
ATOM   828  O  O     . GLY A 1 117 ? -8.720  24.055 52.304 1.00 21.19  ? 99   GLY A O     1 
ATOM   829  N  N     . LEU A 1 118 ? -9.617  23.850 50.262 1.00 18.63  ? 100  LEU A N     1 
ATOM   830  C  CA    . LEU A 1 118 ? -10.888 23.318 50.773 1.00 19.44  ? 100  LEU A CA    1 
ATOM   831  C  C     . LEU A 1 118 ? -10.738 21.924 51.359 1.00 18.64  ? 100  LEU A C     1 
ATOM   832  O  O     . LEU A 1 118 ? -9.800  21.209 51.062 1.00 19.18  ? 100  LEU A O     1 
ATOM   833  C  CB    . LEU A 1 118 ? -11.940 23.334 49.669 1.00 19.59  ? 100  LEU A CB    1 
ATOM   834  C  CG    . LEU A 1 118 ? -12.245 24.730 49.142 1.00 19.16  ? 100  LEU A CG    1 
ATOM   835  C  CD1   . LEU A 1 118 ? -13.220 24.621 47.944 1.00 18.82  ? 100  LEU A CD1   1 
ATOM   836  C  CD2   . LEU A 1 118 ? -12.803 25.761 50.211 1.00 18.42  ? 100  LEU A CD2   1 
ATOM   837  N  N     . VAL A 1 119 ? -11.689 21.571 52.199 1.00 19.92  ? 101  VAL A N     1 
ATOM   838  C  CA    . VAL A 1 119 ? -11.756 20.270 52.843 1.00 19.67  ? 101  VAL A CA    1 
ATOM   839  C  C     . VAL A 1 119 ? -12.972 19.532 52.291 1.00 19.49  ? 101  VAL A C     1 
ATOM   840  O  O     . VAL A 1 119 ? -14.104 20.084 52.272 1.00 19.41  ? 101  VAL A O     1 
ATOM   841  C  CB    . VAL A 1 119 ? -11.851 20.422 54.369 1.00 19.49  ? 101  VAL A CB    1 
ATOM   842  C  CG1   . VAL A 1 119 ? -11.948 19.070 55.045 1.00 19.68  ? 101  VAL A CG1   1 
ATOM   843  C  CG2   . VAL A 1 119 ? -10.616 21.229 54.913 1.00 20.28  ? 101  VAL A CG2   1 
ATOM   844  N  N     . PHE A 1 120 ? -12.747 18.327 51.783 1.00 18.39  ? 102  PHE A N     1 
ATOM   845  C  CA    . PHE A 1 120 ? -13.841 17.484 51.435 1.00 18.43  ? 102  PHE A CA    1 
ATOM   846  C  C     . PHE A 1 120 ? -14.208 16.629 52.609 1.00 18.80  ? 102  PHE A C     1 
ATOM   847  O  O     . PHE A 1 120 ? -13.348 15.888 53.137 1.00 19.32  ? 102  PHE A O     1 
ATOM   848  C  CB    . PHE A 1 120 ? -13.583 16.619 50.184 1.00 18.49  ? 102  PHE A CB    1 
ATOM   849  C  CG    . PHE A 1 120 ? -14.844 15.951 49.653 1.00 18.28  ? 102  PHE A CG    1 
ATOM   850  C  CD1   . PHE A 1 120 ? -15.835 16.693 49.019 1.00 19.58  ? 102  PHE A CD1   1 
ATOM   851  C  CD2   . PHE A 1 120 ? -15.034 14.584 49.795 1.00 20.62  ? 102  PHE A CD2   1 
ATOM   852  C  CE1   . PHE A 1 120 ? -16.988 16.078 48.523 1.00 21.45  ? 102  PHE A CE1   1 
ATOM   853  C  CE2   . PHE A 1 120 ? -16.187 13.962 49.338 1.00 19.91  ? 102  PHE A CE2   1 
ATOM   854  C  CZ    . PHE A 1 120 ? -17.164 14.702 48.676 1.00 19.38  ? 102  PHE A CZ    1 
ATOM   855  N  N     . ASP A 1 121 ? -15.488 16.723 53.012 1.00 18.85  ? 103  ASP A N     1 
ATOM   856  C  CA    . ASP A 1 121 ? -16.069 15.863 54.045 1.00 18.81  ? 103  ASP A CA    1 
ATOM   857  C  C     . ASP A 1 121 ? -16.612 14.601 53.406 1.00 18.92  ? 103  ASP A C     1 
ATOM   858  O  O     . ASP A 1 121 ? -17.662 14.641 52.757 1.00 18.02  ? 103  ASP A O     1 
ATOM   859  C  CB    . ASP A 1 121 ? -17.185 16.615 54.804 1.00 19.97  ? 103  ASP A CB    1 
ATOM   860  C  CG    . ASP A 1 121 ? -17.830 15.792 55.912 1.00 20.85  ? 103  ASP A CG    1 
ATOM   861  O  OD1   . ASP A 1 121 ? -17.566 14.568 56.034 1.00 20.85  ? 103  ASP A OD1   1 
ATOM   862  O  OD2   . ASP A 1 121 ? -18.580 16.397 56.704 1.00 23.61  ? 103  ASP A OD2   1 
ATOM   863  N  N     . THR A 1 122 ? -15.894 13.491 53.577 1.00 19.29  ? 104  THR A N     1 
ATOM   864  C  CA    . THR A 1 122 ? -16.261 12.221 52.918 1.00 19.76  ? 104  THR A CA    1 
ATOM   865  C  C     . THR A 1 122 ? -17.503 11.536 53.484 1.00 21.30  ? 104  THR A C     1 
ATOM   866  O  O     . THR A 1 122 ? -18.026 10.583 52.849 1.00 22.73  ? 104  THR A O     1 
ATOM   867  C  CB    . THR A 1 122 ? -15.117 11.214 52.930 1.00 21.01  ? 104  THR A CB    1 
ATOM   868  O  OG1   . THR A 1 122 ? -14.811 10.865 54.284 1.00 21.17  ? 104  THR A OG1   1 
ATOM   869  C  CG2   . THR A 1 122 ? -13.881 11.745 52.190 1.00 19.19  ? 104  THR A CG2   1 
ATOM   870  N  N     . LEU A 1 123 ? -17.981 11.979 54.671 1.00 20.49  ? 105  LEU A N     1 
ATOM   871  C  CA    . LEU A 1 123 ? -19.145 11.392 55.293 1.00 21.28  ? 105  LEU A CA    1 
ATOM   872  C  C     . LEU A 1 123 ? -20.386 12.002 54.628 1.00 21.95  ? 105  LEU A C     1 
ATOM   873  O  O     . LEU A 1 123 ? -21.287 11.286 54.198 1.00 20.86  ? 105  LEU A O     1 
ATOM   874  C  CB    . LEU A 1 123 ? -19.177 11.678 56.803 1.00 21.01  ? 105  LEU A CB    1 
ATOM   875  C  CG    . LEU A 1 123 ? -20.312 11.029 57.609 1.00 22.57  ? 105  LEU A CG    1 
ATOM   876  C  CD1   . LEU A 1 123 ? -20.315 9.487  57.431 1.00 22.69  ? 105  LEU A CD1   1 
ATOM   877  C  CD2   . LEU A 1 123 ? -20.222 11.443 59.079 1.00 21.25  ? 105  LEU A CD2   1 
ATOM   878  N  N     . TYR A 1 124 ? -20.427 13.331 54.536 1.00 21.90  ? 106  TYR A N     1 
ATOM   879  C  CA    . TYR A 1 124 ? -21.644 14.013 54.021 1.00 22.31  ? 106  TYR A CA    1 
ATOM   880  C  C     . TYR A 1 124 ? -21.556 14.614 52.635 1.00 21.88  ? 106  TYR A C     1 
ATOM   881  O  O     . TYR A 1 124 ? -22.559 15.169 52.123 1.00 22.96  ? 106  TYR A O     1 
ATOM   882  C  CB    . TYR A 1 124 ? -22.058 15.110 54.997 1.00 24.30  ? 106  TYR A CB    1 
ATOM   883  C  CG    . TYR A 1 124 ? -22.448 14.616 56.355 1.00 25.46  ? 106  TYR A CG    1 
ATOM   884  C  CD1   . TYR A 1 124 ? -23.378 13.587 56.503 1.00 27.65  ? 106  TYR A CD1   1 
ATOM   885  C  CD2   . TYR A 1 124 ? -21.920 15.199 57.486 1.00 27.49  ? 106  TYR A CD2   1 
ATOM   886  C  CE1   . TYR A 1 124 ? -23.751 13.132 57.745 1.00 29.12  ? 106  TYR A CE1   1 
ATOM   887  C  CE2   . TYR A 1 124 ? -22.290 14.758 58.748 1.00 28.93  ? 106  TYR A CE2   1 
ATOM   888  C  CZ    . TYR A 1 124 ? -23.211 13.718 58.850 1.00 27.21  ? 106  TYR A CZ    1 
ATOM   889  O  OH    . TYR A 1 124 ? -23.585 13.259 60.063 1.00 29.39  ? 106  TYR A OH    1 
ATOM   890  N  N     . GLY A 1 125 ? -20.377 14.501 52.029 1.00 20.95  ? 107  GLY A N     1 
ATOM   891  C  CA    . GLY A 1 125 ? -20.133 14.915 50.670 1.00 20.83  ? 107  GLY A CA    1 
ATOM   892  C  C     . GLY A 1 125 ? -20.135 16.422 50.428 1.00 20.75  ? 107  GLY A C     1 
ATOM   893  O  O     . GLY A 1 125 ? -20.553 16.870 49.373 1.00 20.85  ? 107  GLY A O     1 
ATOM   894  N  N     . ASN A 1 126 ? -19.643 17.181 51.398 1.00 20.45  ? 108  ASN A N     1 
ATOM   895  C  CA    . ASN A 1 126 ? -19.587 18.639 51.326 1.00 20.47  ? 108  ASN A CA    1 
ATOM   896  C  C     . ASN A 1 126 ? -18.154 19.083 51.085 1.00 19.56  ? 108  ASN A C     1 
ATOM   897  O  O     . ASN A 1 126 ? -17.240 18.474 51.607 1.00 19.39  ? 108  ASN A O     1 
ATOM   898  C  CB    . ASN A 1 126 ? -20.095 19.241 52.659 1.00 20.66  ? 108  ASN A CB    1 
ATOM   899  C  CG    . ASN A 1 126 ? -21.532 18.904 52.930 1.00 23.13  ? 108  ASN A CG    1 
ATOM   900  O  OD1   . ASN A 1 126 ? -22.378 18.965 52.021 1.00 21.64  ? 108  ASN A OD1   1 
ATOM   901  N  ND2   . ASN A 1 126 ? -21.825 18.531 54.159 1.00 21.37  ? 108  ASN A ND2   1 
ATOM   902  N  N     . LEU A 1 127 ? -17.983 20.158 50.325 1.00 19.28  ? 109  LEU A N     1 
ATOM   903  C  CA    . LEU A 1 127 ? -16.756 20.939 50.315 1.00 19.36  ? 109  LEU A CA    1 
ATOM   904  C  C     . LEU A 1 127 ? -16.880 22.003 51.373 1.00 18.68  ? 109  LEU A C     1 
ATOM   905  O  O     . LEU A 1 127 ? -17.859 22.752 51.405 1.00 19.42  ? 109  LEU A O     1 
ATOM   906  C  CB    . LEU A 1 127 ? -16.472 21.561 48.934 1.00 19.61  ? 109  LEU A CB    1 
ATOM   907  C  CG    . LEU A 1 127 ? -15.863 20.619 47.904 1.00 22.22  ? 109  LEU A CG    1 
ATOM   908  C  CD1   . LEU A 1 127 ? -15.921 21.276 46.541 1.00 22.39  ? 109  LEU A CD1   1 
ATOM   909  C  CD2   . LEU A 1 127 ? -14.387 20.243 48.237 1.00 19.51  ? 109  LEU A CD2   1 
ATOM   910  N  N     . LEU A 1 128 ? -15.860 22.101 52.213 1.00 17.86  ? 110  LEU A N     1 
ATOM   911  C  CA    . LEU A 1 128 ? -15.831 23.050 53.326 1.00 19.32  ? 110  LEU A CA    1 
ATOM   912  C  C     . LEU A 1 128 ? -14.623 23.975 53.220 1.00 17.57  ? 110  LEU A C     1 
ATOM   913  O  O     . LEU A 1 128 ? -13.524 23.524 52.908 1.00 18.19  ? 110  LEU A O     1 
ATOM   914  C  CB    . LEU A 1 128 ? -15.753 22.308 54.662 1.00 18.85  ? 110  LEU A CB    1 
ATOM   915  C  CG    . LEU A 1 128 ? -16.803 21.192 54.889 1.00 21.09  ? 110  LEU A CG    1 
ATOM   916  C  CD1   . LEU A 1 128 ? -16.472 20.482 56.204 1.00 20.86  ? 110  LEU A CD1   1 
ATOM   917  C  CD2   . LEU A 1 128 ? -18.204 21.739 54.919 1.00 19.92  ? 110  LEU A CD2   1 
ATOM   918  N  N     . LYS A 1 129 ? -14.849 25.239 53.471 1.00 18.38  ? 111  LYS A N     1 
ATOM   919  C  CA    . LYS A 1 129 ? -13.797 26.222 53.730 1.00 19.39  ? 111  LYS A CA    1 
ATOM   920  C  C     . LYS A 1 129 ? -13.820 26.504 55.235 1.00 19.14  ? 111  LYS A C     1 
ATOM   921  O  O     . LYS A 1 129 ? -14.841 26.935 55.803 1.00 19.56  ? 111  LYS A O     1 
ATOM   922  C  CB    . LYS A 1 129 ? -14.042 27.485 52.941 1.00 20.12  ? 111  LYS A CB    1 
ATOM   923  C  CG    . LYS A 1 129 ? -12.830 28.374 52.855 1.00 20.96  ? 111  LYS A CG    1 
ATOM   924  C  CD    . LYS A 1 129 ? -13.368 29.666 52.231 1.00 23.91  ? 111  LYS A CD    1 
ATOM   925  C  CE    . LYS A 1 129 ? -12.323 30.587 51.810 1.00 26.12  ? 111  LYS A CE    1 
ATOM   926  N  NZ    . LYS A 1 129 ? -12.988 31.688 50.993 1.00 24.78  ? 111  LYS A NZ    1 
ATOM   927  N  N     . VAL A 1 130 ? -12.688 26.241 55.881 1.00 20.58  ? 112  VAL A N     1 
ATOM   928  C  CA    . VAL A 1 130 ? -12.598 26.283 57.341 1.00 20.02  ? 112  VAL A CA    1 
ATOM   929  C  C     . VAL A 1 130 ? -11.440 27.190 57.784 1.00 19.91  ? 112  VAL A C     1 
ATOM   930  O  O     . VAL A 1 130 ? -10.526 27.490 56.995 1.00 18.76  ? 112  VAL A O     1 
ATOM   931  C  CB    . VAL A 1 130 ? -12.433 24.875 57.984 1.00 20.06  ? 112  VAL A CB    1 
ATOM   932  C  CG1   . VAL A 1 130 ? -13.586 23.949 57.642 1.00 20.39  ? 112  VAL A CG1   1 
ATOM   933  C  CG2   . VAL A 1 130 ? -11.052 24.234 57.626 1.00 19.25  ? 112  VAL A CG2   1 
ATOM   934  N  N     . ASP A 1 131 ? -11.531 27.646 59.020 1.00 20.53  ? 113  ASP A N     1 
ATOM   935  C  CA    . ASP A 1 131 ? -10.400 28.335 59.637 1.00 21.82  ? 113  ASP A CA    1 
ATOM   936  C  C     . ASP A 1 131 ? -9.462  27.333 60.317 1.00 21.98  ? 113  ASP A C     1 
ATOM   937  O  O     . ASP A 1 131 ? -9.687  26.110 60.254 1.00 19.96  ? 113  ASP A O     1 
ATOM   938  C  CB    . ASP A 1 131 ? -10.849 29.462 60.536 1.00 22.78  ? 113  ASP A CB    1 
ATOM   939  C  CG    . ASP A 1 131 ? -11.497 28.998 61.810 1.00 25.78  ? 113  ASP A CG    1 
ATOM   940  O  OD1   . ASP A 1 131 ? -11.409 27.791 62.107 1.00 22.96  ? 113  ASP A OD1   1 
ATOM   941  O  OD2   . ASP A 1 131 ? -12.090 29.863 62.527 1.00 27.09  ? 113  ASP A OD2   1 
ATOM   942  N  N     . ALA A 1 132 ? -8.428  27.864 60.994 1.00 23.17  ? 114  ALA A N     1 
ATOM   943  C  CA    . ALA A 1 132 ? -7.386  27.048 61.593 1.00 23.65  ? 114  ALA A CA    1 
ATOM   944  C  C     . ALA A 1 132 ? -7.931  26.217 62.734 1.00 24.76  ? 114  ALA A C     1 
ATOM   945  O  O     . ALA A 1 132 ? -7.323  25.223 63.100 1.00 27.08  ? 114  ALA A O     1 
ATOM   946  C  CB    . ALA A 1 132 ? -6.214  27.940 62.074 1.00 24.61  ? 114  ALA A CB    1 
ATOM   947  N  N     . TYR A 1 133 ? -9.099  26.574 63.256 1.00 24.77  ? 115  TYR A N     1 
ATOM   948  C  CA    . TYR A 1 133 ? -9.731  25.899 64.392 1.00 24.30  ? 115  TYR A CA    1 
ATOM   949  C  C     . TYR A 1 133 ? -10.781 24.888 63.959 1.00 24.55  ? 115  TYR A C     1 
ATOM   950  O  O     . TYR A 1 133 ? -11.452 24.319 64.786 1.00 25.39  ? 115  TYR A O     1 
ATOM   951  C  CB    . TYR A 1 133 ? -10.340 26.966 65.312 1.00 24.68  ? 115  TYR A CB    1 
ATOM   952  C  CG    . TYR A 1 133 ? -9.236  27.824 65.839 1.00 24.56  ? 115  TYR A CG    1 
ATOM   953  C  CD1   . TYR A 1 133 ? -8.476  27.381 66.900 1.00 24.93  ? 115  TYR A CD1   1 
ATOM   954  C  CD2   . TYR A 1 133 ? -8.927  29.047 65.249 1.00 24.32  ? 115  TYR A CD2   1 
ATOM   955  C  CE1   . TYR A 1 133 ? -7.407  28.125 67.370 1.00 25.20  ? 115  TYR A CE1   1 
ATOM   956  C  CE2   . TYR A 1 133 ? -7.852  29.823 65.695 1.00 25.02  ? 115  TYR A CE2   1 
ATOM   957  C  CZ    . TYR A 1 133 ? -7.095  29.350 66.764 1.00 26.29  ? 115  TYR A CZ    1 
ATOM   958  O  OH    . TYR A 1 133 ? -6.040  30.066 67.240 1.00 23.57  ? 115  TYR A OH    1 
ATOM   959  N  N     . GLY A 1 134 ? -10.932 24.691 62.655 1.00 22.62  ? 116  GLY A N     1 
ATOM   960  C  CA    . GLY A 1 134 ? -11.933 23.780 62.117 1.00 23.20  ? 116  GLY A CA    1 
ATOM   961  C  C     . GLY A 1 134 ? -13.315 24.417 62.057 1.00 23.17  ? 116  GLY A C     1 
ATOM   962  O  O     . GLY A 1 134 ? -14.291 23.718 61.816 1.00 24.31  ? 116  GLY A O     1 
ATOM   963  N  N     . ASN A 1 135 ? -13.401 25.734 62.266 1.00 22.14  ? 117  ASN A N     1 
ATOM   964  C  CA    . ASN A 1 135 ? -14.684 26.426 62.171 1.00 22.30  ? 117  ASN A CA    1 
ATOM   965  C  C     . ASN A 1 135 ? -15.081 26.581 60.698 1.00 22.05  ? 117  ASN A C     1 
ATOM   966  O  O     . ASN A 1 135 ? -14.249 26.889 59.846 1.00 21.66  ? 117  ASN A O     1 
ATOM   967  C  CB    . ASN A 1 135 ? -14.655 27.799 62.840 1.00 23.90  ? 117  ASN A CB    1 
ATOM   968  C  CG    . ASN A 1 135 ? -14.341 27.732 64.327 1.00 23.93  ? 117  ASN A CG    1 
ATOM   969  O  OD1   . ASN A 1 135 ? -14.853 26.877 65.050 1.00 24.96  ? 117  ASN A OD1   1 
ATOM   970  N  ND2   . ASN A 1 135 ? -13.522 28.648 64.779 1.00 23.93  ? 117  ASN A ND2   1 
ATOM   971  N  N     . LEU A 1 136 ? -16.361 26.374 60.420 1.00 22.92  ? 118  LEU A N     1 
ATOM   972  C  CA    . LEU A 1 136 ? -16.905 26.441 59.056 1.00 23.30  ? 118  LEU A CA    1 
ATOM   973  C  C     . LEU A 1 136 ? -17.054 27.871 58.612 1.00 22.66  ? 118  LEU A C     1 
ATOM   974  O  O     . LEU A 1 136 ? -17.673 28.682 59.288 1.00 23.55  ? 118  LEU A O     1 
ATOM   975  C  CB    . LEU A 1 136 ? -18.269 25.749 58.969 1.00 24.37  ? 118  LEU A CB    1 
ATOM   976  C  CG    . LEU A 1 136 ? -18.339 24.287 58.507 1.00 28.13  ? 118  LEU A CG    1 
ATOM   977  C  CD1   . LEU A 1 136 ? -17.341 23.336 59.149 1.00 31.65  ? 118  LEU A CD1   1 
ATOM   978  C  CD2   . LEU A 1 136 ? -19.782 23.829 58.730 1.00 27.65  ? 118  LEU A CD2   1 
ATOM   979  N  N     . LEU A 1 137 ? -16.468 28.180 57.470 1.00 21.93  ? 119  LEU A N     1 
ATOM   980  C  CA    . LEU A 1 137 ? -16.656 29.454 56.837 1.00 21.47  ? 119  LEU A CA    1 
ATOM   981  C  C     . LEU A 1 137 ? -17.597 29.348 55.638 1.00 22.26  ? 119  LEU A C     1 
ATOM   982  O  O     . LEU A 1 137 ? -18.386 30.238 55.401 1.00 22.44  ? 119  LEU A O     1 
ATOM   983  C  CB    . LEU A 1 137 ? -15.331 30.012 56.411 1.00 20.24  ? 119  LEU A CB    1 
ATOM   984  C  CG    . LEU A 1 137 ? -14.261 30.098 57.518 1.00 21.80  ? 119  LEU A CG    1 
ATOM   985  C  CD1   . LEU A 1 137 ? -12.952 30.696 56.880 1.00 21.77  ? 119  LEU A CD1   1 
ATOM   986  C  CD2   . LEU A 1 137 ? -14.794 30.927 58.692 1.00 24.31  ? 119  LEU A CD2   1 
ATOM   987  N  N     . VAL A 1 138 ? -17.491 28.258 54.888 1.00 21.39  ? 120  VAL A N     1 
ATOM   988  C  CA    . VAL A 1 138 ? -18.333 28.012 53.711 1.00 22.68  ? 120  VAL A CA    1 
ATOM   989  C  C     . VAL A 1 138 ? -18.564 26.507 53.662 1.00 22.41  ? 120  VAL A C     1 
ATOM   990  O  O     . VAL A 1 138 ? -17.650 25.700 53.910 1.00 21.18  ? 120  VAL A O     1 
ATOM   991  C  CB    . VAL A 1 138 ? -17.653 28.460 52.376 1.00 22.54  ? 120  VAL A CB    1 
ATOM   992  C  CG1   . VAL A 1 138 ? -18.545 28.150 51.118 1.00 24.89  ? 120  VAL A CG1   1 
ATOM   993  C  CG2   . VAL A 1 138 ? -17.236 29.955 52.429 1.00 22.54  ? 120  VAL A CG2   1 
ATOM   994  N  N     . CYS A 1 139 ? -19.771 26.148 53.286 1.00 23.01  ? 121  CYS A N     1 
ATOM   995  C  CA    . CYS A 1 139 ? -20.166 24.763 53.108 1.00 23.38  ? 121  CYS A CA    1 
ATOM   996  C  C     . CYS A 1 139 ? -21.017 24.676 51.839 1.00 23.53  ? 121  CYS A C     1 
ATOM   997  O  O     . CYS A 1 139 ? -22.022 25.373 51.728 1.00 24.44  ? 121  CYS A O     1 
ATOM   998  C  CB    . CYS A 1 139 ? -20.995 24.285 54.302 1.00 24.65  ? 121  CYS A CB    1 
ATOM   999  S  SG    . CYS A 1 139 ? -21.637 22.584 54.067 1.00 27.97  ? 121  CYS A SG    1 
ATOM   1000 N  N     . ALA A 1 140 ? -20.576 23.868 50.885 1.00 23.00  ? 122  ALA A N     1 
ATOM   1001 C  CA    . ALA A 1 140 ? -21.302 23.610 49.631 1.00 22.20  ? 122  ALA A CA    1 
ATOM   1002 C  C     . ALA A 1 140 ? -21.475 22.103 49.441 1.00 21.25  ? 122  ALA A C     1 
ATOM   1003 O  O     . ALA A 1 140 ? -20.507 21.361 49.485 1.00 20.55  ? 122  ALA A O     1 
ATOM   1004 C  CB    . ALA A 1 140 ? -20.542 24.193 48.434 1.00 22.58  ? 122  ALA A CB    1 
ATOM   1005 N  N     . HIS A 1 141 ? -22.708 21.702 49.189 1.00 21.67  ? 123  HIS A N     1 
ATOM   1006 C  CA    . HIS A 1 141 ? -23.088 20.359 48.794 1.00 21.24  ? 123  HIS A CA    1 
ATOM   1007 C  C     . HIS A 1 141 ? -23.436 20.417 47.291 1.00 22.21  ? 123  HIS A C     1 
ATOM   1008 O  O     . HIS A 1 141 ? -24.448 21.008 46.908 1.00 23.33  ? 123  HIS A O     1 
ATOM   1009 C  CB    . HIS A 1 141 ? -24.269 19.899 49.627 1.00 22.41  ? 123  HIS A CB    1 
ATOM   1010 C  CG    . HIS A 1 141 ? -24.607 18.463 49.431 1.00 23.80  ? 123  HIS A CG    1 
ATOM   1011 N  ND1   . HIS A 1 141 ? -23.870 17.458 50.005 1.00 24.11  ? 123  HIS A ND1   1 
ATOM   1012 C  CD2   . HIS A 1 141 ? -25.563 17.855 48.682 1.00 27.72  ? 123  HIS A CD2   1 
ATOM   1013 C  CE1   . HIS A 1 141 ? -24.374 16.292 49.648 1.00 25.59  ? 123  HIS A CE1   1 
ATOM   1014 N  NE2   . HIS A 1 141 ? -25.395 16.501 48.843 1.00 25.42  ? 123  HIS A NE2   1 
ATOM   1015 N  N     . GLY A 1 142 ? -22.573 19.826 46.458 1.00 21.87  ? 124  GLY A N     1 
ATOM   1016 C  CA    . GLY A 1 142 ? -22.617 20.038 45.011 1.00 22.44  ? 124  GLY A CA    1 
ATOM   1017 C  C     . GLY A 1 142 ? -22.375 21.523 44.783 1.00 23.42  ? 124  GLY A C     1 
ATOM   1018 O  O     . GLY A 1 142 ? -21.357 22.067 45.238 1.00 22.20  ? 124  GLY A O     1 
ATOM   1019 N  N     . PHE A 1 143 ? -23.317 22.177 44.100 1.00 24.60  ? 125  PHE A N     1 
ATOM   1020 C  CA    . PHE A 1 143 ? -23.261 23.622 43.868 1.00 26.15  ? 125  PHE A CA    1 
ATOM   1021 C  C     . PHE A 1 143 ? -24.243 24.407 44.759 1.00 27.67  ? 125  PHE A C     1 
ATOM   1022 O  O     . PHE A 1 143 ? -24.520 25.583 44.504 1.00 29.85  ? 125  PHE A O     1 
ATOM   1023 C  CB    . PHE A 1 143 ? -23.492 23.910 42.376 1.00 26.72  ? 125  PHE A CB    1 
ATOM   1024 C  CG    . PHE A 1 143 ? -22.514 23.222 41.483 1.00 26.16  ? 125  PHE A CG    1 
ATOM   1025 C  CD1   . PHE A 1 143 ? -21.143 23.346 41.705 1.00 24.29  ? 125  PHE A CD1   1 
ATOM   1026 C  CD2   . PHE A 1 143 ? -22.940 22.432 40.443 1.00 24.70  ? 125  PHE A CD2   1 
ATOM   1027 C  CE1   . PHE A 1 143 ? -20.243 22.742 40.898 1.00 24.02  ? 125  PHE A CE1   1 
ATOM   1028 C  CE2   . PHE A 1 143 ? -22.005 21.780 39.636 1.00 27.52  ? 125  PHE A CE2   1 
ATOM   1029 C  CZ    . PHE A 1 143 ? -20.666 21.957 39.861 1.00 25.03  ? 125  PHE A CZ    1 
ATOM   1030 N  N     . ASN A 1 144 ? -24.756 23.748 45.793 1.00 28.24  ? 126  ASN A N     1 
ATOM   1031 C  CA    . ASN A 1 144 ? -25.693 24.341 46.728 1.00 29.60  ? 126  ASN A CA    1 
ATOM   1032 C  C     . ASN A 1 144 ? -24.915 24.788 47.954 1.00 29.22  ? 126  ASN A C     1 
ATOM   1033 O  O     . ASN A 1 144 ? -24.430 23.965 48.717 1.00 26.88  ? 126  ASN A O     1 
ATOM   1034 C  CB    . ASN A 1 144 ? -26.774 23.321 47.123 1.00 30.78  ? 126  ASN A CB    1 
ATOM   1035 C  CG    . ASN A 1 144 ? -27.831 23.892 48.096 1.00 34.49  ? 126  ASN A CG    1 
ATOM   1036 O  OD1   . ASN A 1 144 ? -28.226 25.071 48.022 1.00 41.48  ? 126  ASN A OD1   1 
ATOM   1037 N  ND2   . ASN A 1 144 ? -28.297 23.035 49.021 1.00 44.00  ? 126  ASN A ND2   1 
ATOM   1038 N  N     . PHE A 1 145 ? -24.787 26.102 48.109 1.00 29.70  ? 127  PHE A N     1 
ATOM   1039 C  CA    . PHE A 1 145 ? -24.157 26.697 49.298 1.00 30.73  ? 127  PHE A CA    1 
ATOM   1040 C  C     . PHE A 1 145 ? -25.143 26.735 50.461 1.00 31.93  ? 127  PHE A C     1 
ATOM   1041 O  O     . PHE A 1 145 ? -26.248 27.289 50.348 1.00 32.94  ? 127  PHE A O     1 
ATOM   1042 C  CB    . PHE A 1 145 ? -23.560 28.061 48.956 1.00 32.04  ? 127  PHE A CB    1 
ATOM   1043 C  CG    . PHE A 1 145 ? -22.402 27.944 48.029 1.00 30.66  ? 127  PHE A CG    1 
ATOM   1044 C  CD1   . PHE A 1 145 ? -22.592 27.567 46.678 1.00 32.47  ? 127  PHE A CD1   1 
ATOM   1045 C  CD2   . PHE A 1 145 ? -21.116 28.151 48.494 1.00 31.35  ? 127  PHE A CD2   1 
ATOM   1046 C  CE1   . PHE A 1 145 ? -21.520 27.435 45.783 1.00 32.86  ? 127  PHE A CE1   1 
ATOM   1047 C  CE2   . PHE A 1 145 ? -20.044 28.003 47.650 1.00 31.15  ? 127  PHE A CE2   1 
ATOM   1048 C  CZ    . PHE A 1 145 ? -20.228 27.643 46.278 1.00 32.44  ? 127  PHE A CZ    1 
ATOM   1049 N  N     . ILE A 1 146 ? -24.753 26.070 51.537 1.00 50.52  ? 128  ILE A N     1 
ATOM   1050 C  CA    . ILE A 1 146 ? -25.605 25.819 52.676 1.00 52.28  ? 128  ILE A CA    1 
ATOM   1051 C  C     . ILE A 1 146 ? -25.369 26.978 53.649 1.00 52.90  ? 128  ILE A C     1 
ATOM   1052 O  O     . ILE A 1 146 ? -24.242 27.266 53.991 1.00 49.63  ? 128  ILE A O     1 
ATOM   1053 C  CB    . ILE A 1 146 ? -25.245 24.455 53.361 1.00 47.80  ? 128  ILE A CB    1 
ATOM   1054 C  CG1   . ILE A 1 146 ? -25.208 23.299 52.342 1.00 46.95  ? 128  ILE A CG1   1 
ATOM   1055 C  CG2   . ILE A 1 146 ? -26.212 24.135 54.505 1.00 50.35  ? 128  ILE A CG2   1 
ATOM   1056 C  CD1   . ILE A 1 146 ? -26.420 23.209 51.409 1.00 49.25  ? 128  ILE A CD1   1 
ATOM   1057 N  N     . ARG A 1 147 ? -26.431 27.639 54.072 1.00 58.12  ? 129  ARG A N     1 
ATOM   1058 C  CA    . ARG A 1 147 ? -26.311 28.780 54.977 1.00 60.73  ? 129  ARG A CA    1 
ATOM   1059 C  C     . ARG A 1 147 ? -26.330 28.275 56.402 1.00 59.04  ? 129  ARG A C     1 
ATOM   1060 O  O     . ARG A 1 147 ? -26.779 27.158 56.661 1.00 58.22  ? 129  ARG A O     1 
ATOM   1061 C  CB    . ARG A 1 147 ? -27.442 29.759 54.755 1.00 67.21  ? 129  ARG A CB    1 
ATOM   1062 C  CG    . ARG A 1 147 ? -27.443 30.355 53.342 1.00 73.51  ? 129  ARG A CG    1 
ATOM   1063 C  CD    . ARG A 1 147 ? -26.502 31.581 53.192 1.00 76.23  ? 129  ARG A CD    1 
ATOM   1064 N  NE    . ARG A 1 147 ? -25.162 31.270 52.678 1.00 71.14  ? 129  ARG A NE    1 
ATOM   1065 C  CZ    . ARG A 1 147 ? -24.848 31.107 51.389 1.00 71.31  ? 129  ARG A CZ    1 
ATOM   1066 N  NH1   . ARG A 1 147 ? -25.766 31.174 50.423 1.00 75.15  ? 129  ARG A NH1   1 
ATOM   1067 N  NH2   . ARG A 1 147 ? -23.596 30.846 51.062 1.00 69.40  ? 129  ARG A NH2   1 
ATOM   1068 N  N     . GLY A 1 148 ? -25.850 29.102 57.328 1.00 59.67  ? 130  GLY A N     1 
ATOM   1069 C  CA    . GLY A 1 148 ? -25.557 28.659 58.703 1.00 57.14  ? 130  GLY A CA    1 
ATOM   1070 C  C     . GLY A 1 148 ? -26.566 27.746 59.399 1.00 58.13  ? 130  GLY A C     1 
ATOM   1071 O  O     . GLY A 1 148 ? -26.178 26.703 59.955 1.00 55.10  ? 130  GLY A O     1 
ATOM   1072 N  N     . PRO A 1 149 ? -27.855 28.133 59.417 1.00 62.41  ? 131  PRO A N     1 
ATOM   1073 C  CA    . PRO A 1 149 ? -28.830 27.278 60.135 1.00 63.36  ? 131  PRO A CA    1 
ATOM   1074 C  C     . PRO A 1 149 ? -28.941 25.850 59.591 1.00 60.88  ? 131  PRO A C     1 
ATOM   1075 O  O     . PRO A 1 149 ? -28.966 24.893 60.370 1.00 58.83  ? 131  PRO A O     1 
ATOM   1076 C  CB    . PRO A 1 149 ? -30.160 28.046 59.992 1.00 69.67  ? 131  PRO A CB    1 
ATOM   1077 C  CG    . PRO A 1 149 ? -29.743 29.478 59.725 1.00 71.76  ? 131  PRO A CG    1 
ATOM   1078 C  CD    . PRO A 1 149 ? -28.489 29.352 58.880 1.00 67.89  ? 131  PRO A CD    1 
ATOM   1079 N  N     . GLU A 1 150 ? -28.981 25.710 58.268 1.00 61.05  ? 132  GLU A N     1 
ATOM   1080 C  CA    . GLU A 1 150 ? -29.043 24.380 57.646 1.00 59.47  ? 132  GLU A CA    1 
ATOM   1081 C  C     . GLU A 1 150 ? -27.777 23.557 57.932 1.00 53.35  ? 132  GLU A C     1 
ATOM   1082 O  O     . GLU A 1 150 ? -27.868 22.341 58.098 1.00 52.37  ? 132  GLU A O     1 
ATOM   1083 C  CB    . GLU A 1 150 ? -29.300 24.463 56.132 1.00 61.45  ? 132  GLU A CB    1 
ATOM   1084 C  CG    . GLU A 1 150 ? -29.885 23.154 55.528 1.00 63.10  ? 132  GLU A CG    1 
ATOM   1085 C  CD    . GLU A 1 150 ? -29.740 23.038 53.999 1.00 64.68  ? 132  GLU A CD    1 
ATOM   1086 O  OE1   . GLU A 1 150 ? -30.178 23.955 53.262 1.00 66.83  ? 132  GLU A OE1   1 
ATOM   1087 O  OE2   . GLU A 1 150 ? -29.175 22.015 53.534 1.00 65.40  ? 132  GLU A OE2   1 
ATOM   1088 N  N     . THR A 1 151 ? -26.617 24.214 58.035 1.00 49.87  ? 133  THR A N     1 
ATOM   1089 C  CA    . THR A 1 151 ? -25.360 23.493 58.269 1.00 45.17  ? 133  THR A CA    1 
ATOM   1090 C  C     . THR A 1 151 ? -25.312 22.853 59.662 1.00 42.92  ? 133  THR A C     1 
ATOM   1091 O  O     . THR A 1 151 ? -24.642 21.857 59.863 1.00 38.30  ? 133  THR A O     1 
ATOM   1092 C  CB    . THR A 1 151 ? -24.090 24.381 58.079 1.00 43.87  ? 133  THR A CB    1 
ATOM   1093 O  OG1   . THR A 1 151 ? -23.918 25.234 59.219 1.00 47.24  ? 133  THR A OG1   1 
ATOM   1094 C  CG2   . THR A 1 151 ? -24.185 25.214 56.813 1.00 45.48  ? 133  THR A CG2   1 
ATOM   1095 N  N     . ARG A 1 152 ? -26.054 23.420 60.613 1.00 44.66  ? 134  ARG A N     1 
ATOM   1096 C  CA    . ARG A 1 152 ? -26.112 22.886 61.976 1.00 44.45  ? 134  ARG A CA    1 
ATOM   1097 C  C     . ARG A 1 152 ? -26.707 21.480 62.091 1.00 44.10  ? 134  ARG A C     1 
ATOM   1098 O  O     . ARG A 1 152 ? -26.443 20.763 63.029 1.00 43.17  ? 134  ARG A O     1 
ATOM   1099 C  CB    . ARG A 1 152 ? -26.866 23.859 62.896 1.00 47.52  ? 134  ARG A CB    1 
ATOM   1100 C  CG    . ARG A 1 152 ? -26.034 25.074 63.256 1.00 47.17  ? 134  ARG A CG    1 
ATOM   1101 C  CD    . ARG A 1 152 ? -26.511 25.679 64.529 1.00 51.61  ? 134  ARG A CD    1 
ATOM   1102 N  NE    . ARG A 1 152 ? -25.865 26.960 64.811 1.00 53.68  ? 134  ARG A NE    1 
ATOM   1103 C  CZ    . ARG A 1 152 ? -24.686 27.111 65.412 1.00 51.28  ? 134  ARG A CZ    1 
ATOM   1104 N  NH1   . ARG A 1 152 ? -23.971 26.058 65.816 1.00 48.48  ? 134  ARG A NH1   1 
ATOM   1105 N  NH2   . ARG A 1 152 ? -24.235 28.337 65.627 1.00 52.49  ? 134  ARG A NH2   1 
ATOM   1106 N  N     . GLU A 1 153 ? -27.487 21.065 61.116 1.00 45.99  ? 135  GLU A N     1 
ATOM   1107 C  CA    . GLU A 1 153 ? -28.007 19.702 61.106 1.00 46.62  ? 135  GLU A CA    1 
ATOM   1108 C  C     . GLU A 1 153 ? -26.816 18.715 61.041 1.00 42.70  ? 135  GLU A C     1 
ATOM   1109 O  O     . GLU A 1 153 ? -26.708 17.816 61.877 1.00 43.53  ? 135  GLU A O     1 
ATOM   1110 C  CB    . GLU A 1 153 ? -29.011 19.544 59.936 1.00 50.36  ? 135  GLU A CB    1 
ATOM   1111 C  CG    . GLU A 1 153 ? -30.226 20.524 60.032 1.00 55.98  ? 135  GLU A CG    1 
ATOM   1112 C  CD    . GLU A 1 153 ? -31.035 20.653 58.730 1.00 60.32  ? 135  GLU A CD    1 
ATOM   1113 O  OE1   . GLU A 1 153 ? -30.415 20.690 57.645 1.00 63.34  ? 135  GLU A OE1   1 
ATOM   1114 O  OE2   . GLU A 1 153 ? -32.289 20.741 58.795 1.00 69.13  ? 135  GLU A OE2   1 
ATOM   1115 N  N     . GLN A 1 154 ? -25.872 18.952 60.128 1.00 37.88  ? 136  GLN A N     1 
ATOM   1116 C  CA    . GLN A 1 154 ? -24.693 18.081 59.959 1.00 34.28  ? 136  GLN A CA    1 
ATOM   1117 C  C     . GLN A 1 154 ? -23.479 18.458 60.821 1.00 30.76  ? 136  GLN A C     1 
ATOM   1118 O  O     . GLN A 1 154 ? -22.608 17.615 61.058 1.00 30.53  ? 136  GLN A O     1 
ATOM   1119 C  CB    . GLN A 1 154 ? -24.277 18.027 58.484 1.00 32.39  ? 136  GLN A CB    1 
ATOM   1120 C  CG    . GLN A 1 154 ? -25.245 17.253 57.662 1.00 35.29  ? 136  GLN A CG    1 
ATOM   1121 C  CD    . GLN A 1 154 ? -24.947 17.177 56.185 1.00 34.22  ? 136  GLN A CD    1 
ATOM   1122 O  OE1   . GLN A 1 154 ? -24.217 17.985 55.631 1.00 31.11  ? 136  GLN A OE1   1 
ATOM   1123 N  NE2   . GLN A 1 154 ? -25.527 16.193 55.541 1.00 31.62  ? 136  GLN A NE2   1 
ATOM   1124 N  N     . TYR A 1 155 ? -23.400 19.723 61.233 1.00 28.98  ? 137  TYR A N     1 
ATOM   1125 C  CA    . TYR A 1 155 ? -22.232 20.279 61.947 1.00 27.79  ? 137  TYR A CA    1 
ATOM   1126 C  C     . TYR A 1 155 ? -22.779 21.071 63.119 1.00 28.45  ? 137  TYR A C     1 
ATOM   1127 O  O     . TYR A 1 155 ? -22.892 22.314 63.076 1.00 28.37  ? 137  TYR A O     1 
ATOM   1128 C  CB    . TYR A 1 155 ? -21.363 21.186 61.039 1.00 25.12  ? 137  TYR A CB    1 
ATOM   1129 C  CG    . TYR A 1 155 ? -20.942 20.534 59.742 1.00 23.76  ? 137  TYR A CG    1 
ATOM   1130 C  CD1   . TYR A 1 155 ? -19.837 19.679 59.707 1.00 22.44  ? 137  TYR A CD1   1 
ATOM   1131 C  CD2   . TYR A 1 155 ? -21.635 20.758 58.551 1.00 23.84  ? 137  TYR A CD2   1 
ATOM   1132 C  CE1   . TYR A 1 155 ? -19.453 19.075 58.555 1.00 21.80  ? 137  TYR A CE1   1 
ATOM   1133 C  CE2   . TYR A 1 155 ? -21.255 20.138 57.379 1.00 23.42  ? 137  TYR A CE2   1 
ATOM   1134 C  CZ    . TYR A 1 155 ? -20.140 19.287 57.396 1.00 21.99  ? 137  TYR A CZ    1 
ATOM   1135 O  OH    . TYR A 1 155 ? -19.735 18.627 56.278 1.00 21.62  ? 137  TYR A OH    1 
ATOM   1136 N  N     . PRO A 1 156 ? -23.205 20.364 64.146 1.00 31.21  ? 138  PRO A N     1 
ATOM   1137 C  CA    . PRO A 1 156 ? -23.930 21.055 65.212 1.00 32.52  ? 138  PRO A CA    1 
ATOM   1138 C  C     . PRO A 1 156 ? -23.165 22.157 65.939 1.00 31.59  ? 138  PRO A C     1 
ATOM   1139 O  O     . PRO A 1 156 ? -23.798 23.032 66.502 1.00 34.57  ? 138  PRO A O     1 
ATOM   1140 C  CB    . PRO A 1 156 ? -24.262 19.928 66.176 1.00 34.30  ? 138  PRO A CB    1 
ATOM   1141 C  CG    . PRO A 1 156 ? -24.270 18.750 65.364 1.00 35.30  ? 138  PRO A CG    1 
ATOM   1142 C  CD    . PRO A 1 156 ? -23.160 18.914 64.393 1.00 31.36  ? 138  PRO A CD    1 
ATOM   1143 N  N     . ASN A 1 157 ? -21.830 22.096 65.966 1.00 28.82  ? 139  ASN A N     1 
ATOM   1144 C  CA    . ASN A 1 157 ? -21.011 23.156 66.541 1.00 28.72  ? 139  ASN A CA    1 
ATOM   1145 C  C     . ASN A 1 157 ? -20.352 24.019 65.456 1.00 27.77  ? 139  ASN A C     1 
ATOM   1146 O  O     . ASN A 1 157 ? -19.420 24.785 65.721 1.00 26.55  ? 139  ASN A O     1 
ATOM   1147 C  CB    . ASN A 1 157 ? -19.965 22.543 67.493 1.00 28.04  ? 139  ASN A CB    1 
ATOM   1148 C  CG    . ASN A 1 157 ? -19.313 23.567 68.417 1.00 28.86  ? 139  ASN A CG    1 
ATOM   1149 O  OD1   . ASN A 1 157 ? -19.939 24.505 68.909 1.00 28.89  ? 139  ASN A OD1   1 
ATOM   1150 N  ND2   . ASN A 1 157 ? -18.022 23.386 68.650 1.00 29.61  ? 139  ASN A ND2   1 
ATOM   1151 N  N     . LYS A 1 158 ? -20.851 23.917 64.233 1.00 27.70  ? 140  LYS A N     1 
ATOM   1152 C  CA    . LYS A 1 158 ? -20.237 24.603 63.080 1.00 28.13  ? 140  LYS A CA    1 
ATOM   1153 C  C     . LYS A 1 158 ? -18.716 24.407 63.035 1.00 25.23  ? 140  LYS A C     1 
ATOM   1154 O  O     . LYS A 1 158 ? -17.946 25.338 62.788 1.00 23.77  ? 140  LYS A O     1 
ATOM   1155 C  CB    . LYS A 1 158 ? -20.607 26.090 63.086 1.00 31.39  ? 140  LYS A CB    1 
ATOM   1156 C  CG    . LYS A 1 158 ? -21.959 26.385 62.407 1.00 36.89  ? 140  LYS A CG    1 
ATOM   1157 C  CD    . LYS A 1 158 ? -22.114 27.890 62.098 1.00 38.93  ? 140  LYS A CD    1 
ATOM   1158 C  CE    . LYS A 1 158 ? -23.586 28.247 61.774 1.00 45.60  ? 140  LYS A CE    1 
ATOM   1159 N  NZ    . LYS A 1 158 ? -23.946 29.691 61.825 1.00 49.63  ? 140  LYS A NZ    1 
ATOM   1160 N  N     . PHE A 1 159 ? -18.317 23.154 63.195 1.00 24.67  ? 141  PHE A N     1 
ATOM   1161 C  CA    . PHE A 1 159 ? -16.957 22.812 63.477 1.00 23.68  ? 141  PHE A CA    1 
ATOM   1162 C  C     . PHE A 1 159 ? -16.647 21.420 62.960 1.00 21.57  ? 141  PHE A C     1 
ATOM   1163 O  O     . PHE A 1 159 ? -17.470 20.547 63.045 1.00 22.12  ? 141  PHE A O     1 
ATOM   1164 C  CB    . PHE A 1 159 ? -16.785 22.924 65.005 1.00 25.90  ? 141  PHE A CB    1 
ATOM   1165 C  CG    . PHE A 1 159 ? -15.642 22.161 65.581 1.00 24.83  ? 141  PHE A CG    1 
ATOM   1166 C  CD1   . PHE A 1 159 ? -14.385 22.716 65.632 1.00 28.43  ? 141  PHE A CD1   1 
ATOM   1167 C  CD2   . PHE A 1 159 ? -15.848 20.923 66.165 1.00 28.17  ? 141  PHE A CD2   1 
ATOM   1168 C  CE1   . PHE A 1 159 ? -13.333 22.028 66.198 1.00 28.62  ? 141  PHE A CE1   1 
ATOM   1169 C  CE2   . PHE A 1 159 ? -14.794 20.231 66.727 1.00 26.92  ? 141  PHE A CE2   1 
ATOM   1170 C  CZ    . PHE A 1 159 ? -13.547 20.784 66.743 1.00 26.43  ? 141  PHE A CZ    1 
ATOM   1171 N  N     . ILE A 1 160 ? -15.435 21.228 62.461 1.00 21.62  ? 142  ILE A N     1 
ATOM   1172 C  CA    . ILE A 1 160 ? -14.909 19.885 62.160 1.00 21.77  ? 142  ILE A CA    1 
ATOM   1173 C  C     . ILE A 1 160 ? -13.652 19.568 62.995 1.00 22.46  ? 142  ILE A C     1 
ATOM   1174 O  O     . ILE A 1 160 ? -12.865 20.458 63.344 1.00 22.06  ? 142  ILE A O     1 
ATOM   1175 C  CB    . ILE A 1 160 ? -14.611 19.681 60.659 1.00 21.38  ? 142  ILE A CB    1 
ATOM   1176 C  CG1   . ILE A 1 160 ? -13.439 20.576 60.176 1.00 23.20  ? 142  ILE A CG1   1 
ATOM   1177 C  CG2   . ILE A 1 160 ? -15.916 19.868 59.808 1.00 22.60  ? 142  ILE A CG2   1 
ATOM   1178 C  CD1   . ILE A 1 160 ? -12.876 20.260 58.811 1.00 20.82  ? 142  ILE A CD1   1 
ATOM   1179 N  N     . GLN A 1 161 ? -13.481 18.283 63.263 1.00 22.72  ? 143  GLN A N     1 
ATOM   1180 C  CA    . GLN A 1 161 ? -12.292 17.748 63.947 1.00 25.67  ? 143  GLN A CA    1 
ATOM   1181 C  C     . GLN A 1 161 ? -11.290 17.440 62.860 1.00 26.39  ? 143  GLN A C     1 
ATOM   1182 O  O     . GLN A 1 161 ? -11.386 16.448 62.121 1.00 26.11  ? 143  GLN A O     1 
ATOM   1183 C  CB    . GLN A 1 161 ? -12.628 16.500 64.735 1.00 27.14  ? 143  GLN A CB    1 
ATOM   1184 C  CG    . GLN A 1 161 ? -13.598 16.681 65.864 1.00 29.64  ? 143  GLN A CG    1 
ATOM   1185 C  CD    . GLN A 1 161 ? -13.908 15.374 66.547 1.00 31.33  ? 143  GLN A CD    1 
ATOM   1186 O  OE1   . GLN A 1 161 ? -13.875 15.266 67.777 1.00 36.75  ? 143  GLN A OE1   1 
ATOM   1187 N  NE2   . GLN A 1 161 ? -14.138 14.343 65.751 1.00 32.19  ? 143  GLN A NE2   1 
ATOM   1188 N  N     . ARG A 1 162 ? -10.336 18.349 62.733 1.00 28.73  ? 144  ARG A N     1 
ATOM   1189 C  CA    . ARG A 1 162 ? -9.257  18.220 61.780 1.00 29.65  ? 144  ARG A CA    1 
ATOM   1190 C  C     . ARG A 1 162 ? -8.394  16.965 61.967 1.00 31.21  ? 144  ARG A C     1 
ATOM   1191 O  O     . ARG A 1 162 ? -7.849  16.465 61.009 1.00 30.59  ? 144  ARG A O     1 
ATOM   1192 C  CB    . ARG A 1 162 ? -8.370  19.450 61.897 1.00 31.13  ? 144  ARG A CB    1 
ATOM   1193 C  CG    . ARG A 1 162 ? -8.983  20.634 61.188 1.00 32.42  ? 144  ARG A CG    1 
ATOM   1194 C  CD    . ARG A 1 162 ? -7.939  21.297 60.313 1.00 35.98  ? 144  ARG A CD    1 
ATOM   1195 N  NE    . ARG A 1 162 ? -7.180  22.133 61.151 1.00 34.07  ? 144  ARG A NE    1 
ATOM   1196 C  CZ    . ARG A 1 162 ? -5.863  22.239 61.255 1.00 35.50  ? 144  ARG A CZ    1 
ATOM   1197 N  NH1   . ARG A 1 162 ? -4.966  21.577 60.536 1.00 36.57  ? 144  ARG A NH1   1 
ATOM   1198 N  NH2   . ARG A 1 162 ? -5.454  23.102 62.141 1.00 35.40  ? 144  ARG A NH2   1 
ATOM   1199 N  N     . ASP A 1 163 ? -8.254  16.479 63.196 1.00 32.28  ? 145  ASP A N     1 
ATOM   1200 C  CA    . ASP A 1 163 ? -7.536  15.220 63.404 1.00 34.27  ? 145  ASP A CA    1 
ATOM   1201 C  C     . ASP A 1 163 ? -8.235  13.959 62.824 1.00 33.23  ? 145  ASP A C     1 
ATOM   1202 O  O     . ASP A 1 163 ? -7.639  12.877 62.813 1.00 34.30  ? 145  ASP A O     1 
ATOM   1203 C  CB    . ASP A 1 163 ? -7.143  15.036 64.851 1.00 37.50  ? 145  ASP A CB    1 
ATOM   1204 C  CG    . ASP A 1 163 ? -8.318  14.905 65.795 1.00 40.75  ? 145  ASP A CG    1 
ATOM   1205 O  OD1   . ASP A 1 163 ? -9.447  14.567 65.374 1.00 40.61  ? 145  ASP A OD1   1 
ATOM   1206 O  OD2   . ASP A 1 163 ? -8.061  15.115 67.011 1.00 48.06  ? 145  ASP A OD2   1 
ATOM   1207 N  N     . ASP A 1 164 ? -9.465  14.107 62.336 1.00 29.56  ? 146  ASP A N     1 
ATOM   1208 C  CA    . ASP A 1 164 ? -10.217 13.008 61.713 1.00 30.11  ? 146  ASP A CA    1 
ATOM   1209 C  C     . ASP A 1 164 ? -9.831  12.959 60.234 1.00 28.84  ? 146  ASP A C     1 
ATOM   1210 O  O     . ASP A 1 164 ? -10.598 13.277 59.308 1.00 26.08  ? 146  ASP A O     1 
ATOM   1211 C  CB    . ASP A 1 164 ? -11.728 13.171 61.917 1.00 27.85  ? 146  ASP A CB    1 
ATOM   1212 C  CG    . ASP A 1 164 ? -12.513 11.913 61.565 1.00 29.84  ? 146  ASP A CG    1 
ATOM   1213 O  OD1   . ASP A 1 164 ? -11.916 10.951 61.075 1.00 30.97  ? 146  ASP A OD1   1 
ATOM   1214 O  OD2   . ASP A 1 164 ? -13.740 11.890 61.792 1.00 31.48  ? 146  ASP A OD2   1 
ATOM   1215 N  N     . THR A 1 165 ? -8.607  12.527 60.015 1.00 31.05  ? 147  THR A N     1 
ATOM   1216 C  CA    . THR A 1 165 ? -8.043  12.572 58.679 1.00 31.79  ? 147  THR A CA    1 
ATOM   1217 C  C     . THR A 1 165 ? -8.641  11.494 57.770 1.00 33.25  ? 147  THR A C     1 
ATOM   1218 O  O     . THR A 1 165 ? -8.608  11.627 56.543 1.00 32.66  ? 147  THR A O     1 
ATOM   1219 C  CB    . THR A 1 165 ? -6.533  12.446 58.719 1.00 34.17  ? 147  THR A CB    1 
ATOM   1220 O  OG1   . THR A 1 165 ? -6.193  11.275 59.446 1.00 36.33  ? 147  THR A OG1   1 
ATOM   1221 C  CG2   . THR A 1 165 ? -5.902  13.676 59.374 1.00 33.49  ? 147  THR A CG2   1 
ATOM   1222 N  N     . GLU A 1 166 ? -9.232  10.454 58.335 1.00 35.24  ? 148  GLU A N     1 
ATOM   1223 C  CA    . GLU A 1 166 ? -9.937  9.496  57.490 1.00 37.43  ? 148  GLU A CA    1 
ATOM   1224 C  C     . GLU A 1 166 ? -11.242 10.124 56.908 1.00 34.38  ? 148  GLU A C     1 
ATOM   1225 O  O     . GLU A 1 166 ? -11.620 9.831  55.775 1.00 35.97  ? 148  GLU A O     1 
ATOM   1226 C  CB    . GLU A 1 166 ? -10.133 8.161  58.206 1.00 40.86  ? 148  GLU A CB    1 
ATOM   1227 C  CG    . GLU A 1 166 ? -8.887  7.230  58.018 1.00 48.81  ? 148  GLU A CG    1 
ATOM   1228 C  CD    . GLU A 1 166 ? -8.644  6.260  59.154 1.00 53.57  ? 148  GLU A CD    1 
ATOM   1229 O  OE1   . GLU A 1 166 ? -8.797  6.657  60.341 1.00 64.92  ? 148  GLU A OE1   1 
ATOM   1230 O  OE2   . GLU A 1 166 ? -8.265  5.093  58.884 1.00 62.90  ? 148  GLU A OE2   1 
ATOM   1231 N  N     . ARG A 1 167 ? -11.857 11.067 57.621 1.00 30.64  ? 149  ARG A N     1 
ATOM   1232 C  CA    . ARG A 1 167 ? -13.095 11.687 57.146 1.00 28.34  ? 149  ARG A CA    1 
ATOM   1233 C  C     . ARG A 1 167 ? -12.871 12.911 56.265 1.00 26.28  ? 149  ARG A C     1 
ATOM   1234 O  O     . ARG A 1 167 ? -13.581 13.093 55.282 1.00 26.31  ? 149  ARG A O     1 
ATOM   1235 C  CB    . ARG A 1 167 ? -14.007 12.046 58.332 1.00 27.77  ? 149  ARG A CB    1 
ATOM   1236 C  CG    . ARG A 1 167 ? -15.206 12.862 57.969 1.00 25.58  ? 149  ARG A CG    1 
ATOM   1237 C  CD    . ARG A 1 167 ? -16.159 12.983 59.128 1.00 27.06  ? 149  ARG A CD    1 
ATOM   1238 N  NE    . ARG A 1 167 ? -17.232 13.917 58.829 1.00 24.32  ? 149  ARG A NE    1 
ATOM   1239 C  CZ    . ARG A 1 167 ? -18.033 14.463 59.736 1.00 26.28  ? 149  ARG A CZ    1 
ATOM   1240 N  NH1   . ARG A 1 167 ? -17.913 14.152 61.045 1.00 26.73  ? 149  ARG A NH1   1 
ATOM   1241 N  NH2   . ARG A 1 167 ? -18.953 15.343 59.360 1.00 23.84  ? 149  ARG A NH2   1 
ATOM   1242 N  N     . PHE A 1 168 ? -11.905 13.748 56.630 1.00 24.84  ? 150  PHE A N     1 
ATOM   1243 C  CA    . PHE A 1 168 ? -11.686 15.064 56.024 1.00 24.08  ? 150  PHE A CA    1 
ATOM   1244 C  C     . PHE A 1 168 ? -10.387 15.094 55.238 1.00 24.45  ? 150  PHE A C     1 
ATOM   1245 O  O     . PHE A 1 168 ? -9.353  14.692 55.743 1.00 26.37  ? 150  PHE A O     1 
ATOM   1246 C  CB    . PHE A 1 168 ? -11.653 16.168 57.091 1.00 23.34  ? 150  PHE A CB    1 
ATOM   1247 C  CG    . PHE A 1 168 ? -12.923 16.260 57.951 1.00 23.04  ? 150  PHE A CG    1 
ATOM   1248 C  CD1   . PHE A 1 168 ? -14.132 16.760 57.400 1.00 22.70  ? 150  PHE A CD1   1 
ATOM   1249 C  CD2   . PHE A 1 168 ? -12.887 15.916 59.279 1.00 23.82  ? 150  PHE A CD2   1 
ATOM   1250 C  CE1   . PHE A 1 168 ? -15.236 16.853 58.143 1.00 23.22  ? 150  PHE A CE1   1 
ATOM   1251 C  CE2   . PHE A 1 168 ? -13.999 16.010 60.046 1.00 25.50  ? 150  PHE A CE2   1 
ATOM   1252 C  CZ    . PHE A 1 168 ? -15.180 16.485 59.502 1.00 25.04  ? 150  PHE A CZ    1 
ATOM   1253 N  N     . TYR A 1 169 ? -10.457 15.504 53.985 1.00 23.05  ? 151  TYR A N     1 
ATOM   1254 C  CA    . TYR A 1 169 ? -9.293  15.548 53.135 1.00 23.53  ? 151  TYR A CA    1 
ATOM   1255 C  C     . TYR A 1 169 ? -9.084  17.008 52.714 1.00 21.95  ? 151  TYR A C     1 
ATOM   1256 O  O     . TYR A 1 169 ? -9.966  17.606 52.152 1.00 20.15  ? 151  TYR A O     1 
ATOM   1257 C  CB    . TYR A 1 169 ? -9.490  14.689 51.906 1.00 24.46  ? 151  TYR A CB    1 
ATOM   1258 C  CG    . TYR A 1 169 ? -8.269  14.537 51.021 1.00 25.77  ? 151  TYR A CG    1 
ATOM   1259 C  CD1   . TYR A 1 169 ? -7.307  13.570 51.304 1.00 28.68  ? 151  TYR A CD1   1 
ATOM   1260 C  CD2   . TYR A 1 169 ? -8.081  15.336 49.888 1.00 24.81  ? 151  TYR A CD2   1 
ATOM   1261 C  CE1   . TYR A 1 169 ? -6.179  13.406 50.478 1.00 30.76  ? 151  TYR A CE1   1 
ATOM   1262 C  CE2   . TYR A 1 169 ? -6.955  15.180 49.054 1.00 27.44  ? 151  TYR A CE2   1 
ATOM   1263 C  CZ    . TYR A 1 169 ? -6.007  14.201 49.375 1.00 30.03  ? 151  TYR A CZ    1 
ATOM   1264 O  OH    . TYR A 1 169 ? -4.907  14.019 48.598 1.00 31.87  ? 151  TYR A OH    1 
ATOM   1265 N  N     . ILE A 1 170 ? -7.889  17.516 52.961 1.00 22.83  ? 152  ILE A N     1 
ATOM   1266 C  CA    . ILE A 1 170 ? -7.525  18.908 52.612 1.00 22.08  ? 152  ILE A CA    1 
ATOM   1267 C  C     . ILE A 1 170 ? -6.889  18.913 51.230 1.00 22.19  ? 152  ILE A C     1 
ATOM   1268 O  O     . ILE A 1 170 ? -5.926  18.203 50.961 1.00 20.05  ? 152  ILE A O     1 
ATOM   1269 C  CB    . ILE A 1 170 ? -6.580  19.545 53.664 1.00 23.29  ? 152  ILE A CB    1 
ATOM   1270 C  CG1   . ILE A 1 170 ? -7.191  19.463 55.075 1.00 24.49  ? 152  ILE A CG1   1 
ATOM   1271 C  CG2   . ILE A 1 170 ? -6.265  21.022 53.305 1.00 21.27  ? 152  ILE A CG2   1 
ATOM   1272 C  CD1   . ILE A 1 170 ? -6.188  19.811 56.145 1.00 25.41  ? 152  ILE A CD1   1 
ATOM   1273 N  N     . LEU A 1 171 ? -7.460  19.738 50.349 1.00 20.61  ? 153  LEU A N     1 
ATOM   1274 C  CA    . LEU A 1 171 ? -7.069  19.837 48.971 1.00 22.38  ? 153  LEU A CA    1 
ATOM   1275 C  C     . LEU A 1 171 ? -6.051  20.955 48.870 1.00 24.95  ? 153  LEU A C     1 
ATOM   1276 O  O     . LEU A 1 171 ? -6.381  22.103 48.521 1.00 28.32  ? 153  LEU A O     1 
ATOM   1277 C  CB    . LEU A 1 171 ? -8.332  20.070 48.126 1.00 22.15  ? 153  LEU A CB    1 
ATOM   1278 C  CG    . LEU A 1 171 ? -9.313  18.911 48.241 1.00 19.23  ? 153  LEU A CG    1 
ATOM   1279 C  CD1   . LEU A 1 171 ? -10.837 19.318 48.043 1.00 20.97  ? 153  LEU A CD1   1 
ATOM   1280 C  CD2   . LEU A 1 171 ? -8.903  17.802 47.231 1.00 22.43  ? 153  LEU A CD2   1 
ATOM   1281 N  N     . ASN A 1 172 ? -4.786  20.622 49.140 1.00 25.22  ? 154  ASN A N     1 
ATOM   1282 C  CA    . ASN A 1 172 ? -3.727  21.610 49.329 1.00 27.07  ? 154  ASN A CA    1 
ATOM   1283 C  C     . ASN A 1 172 ? -3.114  22.303 48.108 1.00 28.04  ? 154  ASN A C     1 
ATOM   1284 O  O     . ASN A 1 172 ? -2.601  23.414 48.238 1.00 28.33  ? 154  ASN A O     1 
ATOM   1285 C  CB    . ASN A 1 172 ? -2.545  20.976 50.095 1.00 28.29  ? 154  ASN A CB    1 
ATOM   1286 C  CG    . ASN A 1 172 ? -2.835  20.759 51.548 1.00 27.36  ? 154  ASN A CG    1 
ATOM   1287 O  OD1   . ASN A 1 172 ? -2.998  21.708 52.317 1.00 24.99  ? 154  ASN A OD1   1 
ATOM   1288 N  ND2   . ASN A 1 172 ? -2.791  19.509 51.969 1.00 26.57  ? 154  ASN A ND2   1 
ATOM   1289 N  N     . THR A 1 173 ? -3.050  21.617 46.972 1.00 20.49  ? 155  THR A N     1 
ATOM   1290 C  CA    . THR A 1 173 ? -2.253  22.100 45.856 1.00 21.41  ? 155  THR A CA    1 
ATOM   1291 C  C     . THR A 1 173 ? -3.054  22.497 44.668 1.00 20.61  ? 155  THR A C     1 
ATOM   1292 O  O     . THR A 1 173 ? -4.241  22.162 44.536 1.00 20.21  ? 155  THR A O     1 
ATOM   1293 C  CB    . THR A 1 173 ? -1.178  21.062 45.396 1.00 22.33  ? 155  THR A CB    1 
ATOM   1294 O  OG1   . THR A 1 173 ? -1.816  20.039 44.639 1.00 21.49  ? 155  THR A OG1   1 
ATOM   1295 C  CG2   . THR A 1 173 ? -0.495  20.460 46.605 1.00 24.22  ? 155  THR A CG2   1 
ATOM   1296 N  N     . LEU A 1 174 ? -2.396  23.226 43.763 1.00 20.72  ? 156  LEU A N     1 
ATOM   1297 C  CA    . LEU A 1 174 ? -3.004  23.531 42.474 1.00 19.92  ? 156  LEU A CA    1 
ATOM   1298 C  C     . LEU A 1 174 ? -3.337  22.248 41.631 1.00 19.90  ? 156  LEU A C     1 
ATOM   1299 O  O     . LEU A 1 174 ? -4.232  22.267 40.817 1.00 20.12  ? 156  LEU A O     1 
ATOM   1300 C  CB    . LEU A 1 174 ? -2.165  24.573 41.670 1.00 20.02  ? 156  LEU A CB    1 
ATOM   1301 C  CG    . LEU A 1 174 ? -2.132  25.965 42.330 1.00 21.35  ? 156  LEU A CG    1 
ATOM   1302 C  CD1   . LEU A 1 174 ? -1.044  26.877 41.803 1.00 24.28  ? 156  LEU A CD1   1 
ATOM   1303 C  CD2   . LEU A 1 174 ? -3.491  26.646 42.178 1.00 24.99  ? 156  LEU A CD2   1 
ATOM   1304 N  N     . PHE A 1 175 ? -2.627  21.153 41.849 1.00 19.19  ? 157  PHE A N     1 
ATOM   1305 C  CA    . PHE A 1 175 ? -2.973  19.847 41.259 1.00 19.00  ? 157  PHE A CA    1 
ATOM   1306 C  C     . PHE A 1 175 ? -4.352  19.340 41.701 1.00 19.55  ? 157  PHE A C     1 
ATOM   1307 O  O     . PHE A 1 175 ? -4.983  18.571 40.971 1.00 21.15  ? 157  PHE A O     1 
ATOM   1308 C  CB    . PHE A 1 175 ? -1.919  18.769 41.591 1.00 19.30  ? 157  PHE A CB    1 
ATOM   1309 C  CG    . PHE A 1 175 ? -0.598  18.947 40.845 1.00 18.41  ? 157  PHE A CG    1 
ATOM   1310 C  CD1   . PHE A 1 175 ? -0.532  18.767 39.488 1.00 19.34  ? 157  PHE A CD1   1 
ATOM   1311 C  CD2   . PHE A 1 175 ? 0.552   19.222 41.529 1.00 20.29  ? 157  PHE A CD2   1 
ATOM   1312 C  CE1   . PHE A 1 175 ? 0.681   18.878 38.824 1.00 18.14  ? 157  PHE A CE1   1 
ATOM   1313 C  CE2   . PHE A 1 175 ? 1.753   19.368 40.865 1.00 21.83  ? 157  PHE A CE2   1 
ATOM   1314 C  CZ    . PHE A 1 175 ? 1.791   19.180 39.514 1.00 19.38  ? 157  PHE A CZ    1 
ATOM   1315 N  N     . ASN A 1 176 ? -4.830  19.809 42.846 1.00 19.93  ? 158  ASN A N     1 
ATOM   1316 C  CA    . ASN A 1 176 ? -6.135  19.441 43.406 1.00 19.16  ? 158  ASN A CA    1 
ATOM   1317 C  C     . ASN A 1 176 ? -7.306  20.307 42.962 1.00 19.83  ? 158  ASN A C     1 
ATOM   1318 O  O     . ASN A 1 176 ? -8.428  20.033 43.357 1.00 18.96  ? 158  ASN A O     1 
ATOM   1319 C  CB    . ASN A 1 176 ? -6.117  19.518 44.956 1.00 19.37  ? 158  ASN A CB    1 
ATOM   1320 C  CG    . ASN A 1 176 ? -5.099  18.591 45.596 1.00 21.97  ? 158  ASN A CG    1 
ATOM   1321 O  OD1   . ASN A 1 176 ? -4.395  19.002 46.518 1.00 23.18  ? 158  ASN A OD1   1 
ATOM   1322 N  ND2   . ASN A 1 176 ? -5.040  17.343 45.146 1.00 24.56  ? 158  ASN A ND2   1 
ATOM   1323 N  N     . LEU A 1 177 ? -7.073  21.340 42.147 1.00 19.39  ? 159  LEU A N     1 
ATOM   1324 C  CA    . LEU A 1 177 ? -8.170  22.177 41.677 1.00 20.23  ? 159  LEU A CA    1 
ATOM   1325 C  C     . LEU A 1 177 ? -9.166  21.410 40.798 1.00 20.43  ? 159  LEU A C     1 
ATOM   1326 O  O     . LEU A 1 177 ? -10.370 21.516 41.013 1.00 20.74  ? 159  LEU A O     1 
ATOM   1327 C  CB    . LEU A 1 177 ? -7.667  23.452 41.009 1.00 21.33  ? 159  LEU A CB    1 
ATOM   1328 C  CG    . LEU A 1 177 ? -7.078  24.565 41.883 1.00 20.16  ? 159  LEU A CG    1 
ATOM   1329 C  CD1   . LEU A 1 177 ? -6.690  25.783 41.049 1.00 21.45  ? 159  LEU A CD1   1 
ATOM   1330 C  CD2   . LEU A 1 177 ? -8.061  24.959 42.994 1.00 20.63  ? 159  LEU A CD2   1 
ATOM   1331 N  N     . PRO A 1 178 ? -8.688  20.591 39.855 1.00 20.64  ? 160  PRO A N     1 
ATOM   1332 C  CA    . PRO A 1 178 ? -9.611  19.764 39.063 1.00 21.59  ? 160  PRO A CA    1 
ATOM   1333 C  C     . PRO A 1 178 ? -10.495 18.830 39.887 1.00 21.59  ? 160  PRO A C     1 
ATOM   1334 O  O     . PRO A 1 178 ? -11.723 18.832 39.689 1.00 20.88  ? 160  PRO A O     1 
ATOM   1335 C  CB    . PRO A 1 178 ? -8.690  18.983 38.128 1.00 22.19  ? 160  PRO A CB    1 
ATOM   1336 C  CG    . PRO A 1 178 ? -7.445  19.767 38.098 1.00 20.80  ? 160  PRO A CG    1 
ATOM   1337 C  CD    . PRO A 1 178 ? -7.288  20.419 39.409 1.00 20.51  ? 160  PRO A CD    1 
ATOM   1338 N  N     . GLU A 1 179 ? -9.919  18.097 40.841 1.00 21.79  ? 161  GLU A N     1 
ATOM   1339 C  CA    . GLU A 1 179 ? -10.755 17.231 41.689 1.00 21.87  ? 161  GLU A CA    1 
ATOM   1340 C  C     . GLU A 1 179 ? -11.679 17.985 42.615 1.00 20.65  ? 161  GLU A C     1 
ATOM   1341 O  O     . GLU A 1 179 ? -12.767 17.505 42.894 1.00 20.44  ? 161  GLU A O     1 
ATOM   1342 C  CB    . GLU A 1 179 ? -9.948  16.214 42.472 1.00 22.44  ? 161  GLU A CB    1 
ATOM   1343 C  CG    . GLU A 1 179 ? -9.085  16.798 43.567 1.00 23.20  ? 161  GLU A CG    1 
ATOM   1344 C  CD    . GLU A 1 179 ? -8.064  15.789 44.048 1.00 24.92  ? 161  GLU A CD    1 
ATOM   1345 O  OE1   . GLU A 1 179 ? -8.386  15.015 44.964 1.00 29.10  ? 161  GLU A OE1   1 
ATOM   1346 O  OE2   . GLU A 1 179 ? -6.926  15.800 43.504 1.00 26.81  ? 161  GLU A OE2   1 
ATOM   1347 N  N     . THR A 1 180 ? -11.266 19.157 43.085 1.00 19.43  ? 162  THR A N     1 
ATOM   1348 C  CA    . THR A 1 180 ? -12.152 20.032 43.861 1.00 19.40  ? 162  THR A CA    1 
ATOM   1349 C  C     . THR A 1 180 ? -13.446 20.290 43.077 1.00 19.83  ? 162  THR A C     1 
ATOM   1350 O  O     . THR A 1 180 ? -14.556 20.059 43.601 1.00 19.43  ? 162  THR A O     1 
ATOM   1351 C  CB    . THR A 1 180 ? -11.473 21.379 44.238 1.00 18.84  ? 162  THR A CB    1 
ATOM   1352 O  OG1   . THR A 1 180 ? -10.276 21.134 44.993 1.00 19.44  ? 162  THR A OG1   1 
ATOM   1353 C  CG2   . THR A 1 180 ? -12.416 22.271 45.092 1.00 19.86  ? 162  THR A CG2   1 
ATOM   1354 N  N     . TYR A 1 181 ? -13.308 20.745 41.827 1.00 19.17  ? 163  TYR A N     1 
ATOM   1355 C  CA    . TYR A 1 181 ? -14.473 20.997 40.986 1.00 20.23  ? 163  TYR A CA    1 
ATOM   1356 C  C     . TYR A 1 181 ? -15.228 19.701 40.663 1.00 19.85  ? 163  TYR A C     1 
ATOM   1357 O  O     . TYR A 1 181 ? -16.450 19.672 40.735 1.00 19.30  ? 163  TYR A O     1 
ATOM   1358 C  CB    . TYR A 1 181 ? -14.063 21.702 39.691 1.00 21.12  ? 163  TYR A CB    1 
ATOM   1359 C  CG    . TYR A 1 181 ? -15.237 22.076 38.827 1.00 20.03  ? 163  TYR A CG    1 
ATOM   1360 C  CD1   . TYR A 1 181 ? -16.271 22.917 39.312 1.00 22.52  ? 163  TYR A CD1   1 
ATOM   1361 C  CD2   . TYR A 1 181 ? -15.338 21.593 37.546 1.00 21.71  ? 163  TYR A CD2   1 
ATOM   1362 C  CE1   . TYR A 1 181 ? -17.342 23.238 38.537 1.00 21.87  ? 163  TYR A CE1   1 
ATOM   1363 C  CE2   . TYR A 1 181 ? -16.415 21.925 36.736 1.00 22.42  ? 163  TYR A CE2   1 
ATOM   1364 C  CZ    . TYR A 1 181 ? -17.421 22.737 37.229 1.00 22.34  ? 163  TYR A CZ    1 
ATOM   1365 O  OH    . TYR A 1 181 ? -18.519 23.087 36.453 1.00 25.77  ? 163  TYR A OH    1 
ATOM   1366 N  N     . LEU A 1 182 ? -14.487 18.639 40.337 1.00 20.33  ? 164  LEU A N     1 
ATOM   1367 C  CA    . LEU A 1 182 ? -15.102 17.355 39.982 1.00 20.12  ? 164  LEU A CA    1 
ATOM   1368 C  C     . LEU A 1 182 ? -15.941 16.770 41.122 1.00 20.05  ? 164  LEU A C     1 
ATOM   1369 O  O     . LEU A 1 182 ? -17.064 16.306 40.896 1.00 20.00  ? 164  LEU A O     1 
ATOM   1370 C  CB    . LEU A 1 182 ? -14.054 16.374 39.522 1.00 19.46  ? 164  LEU A CB    1 
ATOM   1371 C  CG    . LEU A 1 182 ? -14.490 14.996 39.037 1.00 21.16  ? 164  LEU A CG    1 
ATOM   1372 C  CD1   . LEU A 1 182 ? -15.542 15.062 37.921 1.00 22.25  ? 164  LEU A CD1   1 
ATOM   1373 C  CD2   . LEU A 1 182 ? -13.206 14.235 38.552 1.00 19.81  ? 164  LEU A CD2   1 
ATOM   1374 N  N     . LEU A 1 183 ? -15.423 16.839 42.346 1.00 19.85  ? 165  LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 183 ? -16.193 16.418 43.517 1.00 20.78  ? 165  LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 183 ? -17.559 17.110 43.554 1.00 21.20  ? 165  LEU A C     1 
ATOM   1377 O  O     . LEU A 1 183 ? -18.578 16.435 43.662 1.00 21.77  ? 165  LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 183 ? -15.404 16.622 44.802 1.00 20.01  ? 165  LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 183 ? -14.265 15.604 44.974 1.00 19.88  ? 165  LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 183 ? -13.285 16.058 46.049 1.00 20.41  ? 165  LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 183 ? -14.794 14.141 45.228 1.00 20.96  ? 165  LEU A CD2   1 
ATOM   1382 N  N     . ALA A 1 184 ? -17.568 18.442 43.442 1.00 21.58  ? 166  ALA A N     1 
ATOM   1383 C  CA    . ALA A 1 184 ? -18.798 19.226 43.398 1.00 21.23  ? 166  ALA A CA    1 
ATOM   1384 C  C     . ALA A 1 184 ? -19.744 18.834 42.195 1.00 21.54  ? 166  ALA A C     1 
ATOM   1385 O  O     . ALA A 1 184 ? -20.962 18.658 42.360 1.00 20.98  ? 166  ALA A O     1 
ATOM   1386 C  CB    . ALA A 1 184 ? -18.448 20.725 43.361 1.00 21.27  ? 166  ALA A CB    1 
ATOM   1387 N  N     . CYS A 1 185 ? -19.155 18.695 41.007 1.00 22.36  ? 167  CYS A N     1 
ATOM   1388 C  CA    . CYS A 1 185 ? -19.879 18.231 39.807 1.00 22.44  ? 167  CYS A CA    1 
ATOM   1389 C  C     . CYS A 1 185 ? -20.564 16.898 40.020 1.00 23.05  ? 167  CYS A C     1 
ATOM   1390 O  O     . CYS A 1 185 ? -21.708 16.727 39.601 1.00 23.69  ? 167  CYS A O     1 
ATOM   1391 C  CB    . CYS A 1 185 ? -18.934 18.055 38.614 1.00 22.57  ? 167  CYS A CB    1 
ATOM   1392 S  SG    . CYS A 1 185 ? -18.386 19.589 37.859 1.00 24.22  ? 167  CYS A SG    1 
ATOM   1393 N  N     . LEU A 1 186 ? -19.853 15.945 40.626 1.00 21.44  ? 168  LEU A N     1 
ATOM   1394 C  CA    . LEU A 1 186 ? -20.415 14.602 40.902 1.00 21.33  ? 168  LEU A CA    1 
ATOM   1395 C  C     . LEU A 1 186 ? -21.570 14.610 41.910 1.00 21.04  ? 168  LEU A C     1 
ATOM   1396 O  O     . LEU A 1 186 ? -22.637 14.043 41.651 1.00 21.08  ? 168  LEU A O     1 
ATOM   1397 C  CB    . LEU A 1 186 ? -19.291 13.642 41.338 1.00 21.15  ? 168  LEU A CB    1 
ATOM   1398 C  CG    . LEU A 1 186 ? -18.267 13.246 40.279 1.00 21.47  ? 168  LEU A CG    1 
ATOM   1399 C  CD1   . LEU A 1 186 ? -17.117 12.426 40.886 1.00 23.47  ? 168  LEU A CD1   1 
ATOM   1400 C  CD2   . LEU A 1 186 ? -18.895 12.498 39.090 1.00 22.49  ? 168  LEU A CD2   1 
ATOM   1401 N  N     . VAL A 1 187 ? -21.395 15.295 43.037 1.00 20.54  ? 169  VAL A N     1 
ATOM   1402 C  CA    . VAL A 1 187 ? -22.502 15.393 44.024 1.00 21.16  ? 169  VAL A CA    1 
ATOM   1403 C  C     . VAL A 1 187 ? -23.699 16.044 43.409 1.00 21.93  ? 169  VAL A C     1 
ATOM   1404 O  O     . VAL A 1 187 ? -24.838 15.571 43.591 1.00 23.44  ? 169  VAL A O     1 
ATOM   1405 C  CB    . VAL A 1 187 ? -22.048 16.146 45.280 1.00 20.18  ? 169  VAL A CB    1 
ATOM   1406 C  CG1   . VAL A 1 187 ? -23.221 16.357 46.250 1.00 18.99  ? 169  VAL A CG1   1 
ATOM   1407 C  CG2   . VAL A 1 187 ? -20.928 15.351 45.930 1.00 18.09  ? 169  VAL A CG2   1 
ATOM   1408 N  N     . ASP A 1 188 ? -23.459 17.104 42.636 1.00 22.30  ? 170  ASP A N     1 
ATOM   1409 C  CA    . ASP A 1 188 ? -24.531 17.766 41.887 1.00 23.66  ? 170  ASP A CA    1 
ATOM   1410 C  C     . ASP A 1 188 ? -25.227 16.808 40.907 1.00 24.33  ? 170  ASP A C     1 
ATOM   1411 O  O     . ASP A 1 188 ? -26.450 16.811 40.823 1.00 23.87  ? 170  ASP A O     1 
ATOM   1412 C  CB    . ASP A 1 188 ? -24.036 18.985 41.104 1.00 23.58  ? 170  ASP A CB    1 
ATOM   1413 C  CG    . ASP A 1 188 ? -25.138 19.647 40.275 1.00 26.69  ? 170  ASP A CG    1 
ATOM   1414 O  OD1   . ASP A 1 188 ? -26.099 20.216 40.845 1.00 28.96  ? 170  ASP A OD1   1 
ATOM   1415 O  OD2   . ASP A 1 188 ? -25.054 19.608 39.025 1.00 30.21  ? 170  ASP A OD2   1 
ATOM   1416 N  N     . PHE A 1 189 ? -24.438 16.045 40.153 1.00 23.35  ? 171  PHE A N     1 
ATOM   1417 C  CA    . PHE A 1 189 ? -24.990 15.146 39.152 1.00 24.89  ? 171  PHE A CA    1 
ATOM   1418 C  C     . PHE A 1 189 ? -25.892 14.087 39.788 1.00 24.72  ? 171  PHE A C     1 
ATOM   1419 O  O     . PHE A 1 189 ? -27.058 13.920 39.378 1.00 25.31  ? 171  PHE A O     1 
ATOM   1420 C  CB    . PHE A 1 189 ? -23.898 14.512 38.286 1.00 24.95  ? 171  PHE A CB    1 
ATOM   1421 C  CG    . PHE A 1 189 ? -24.409 13.420 37.419 1.00 27.02  ? 171  PHE A CG    1 
ATOM   1422 C  CD1   . PHE A 1 189 ? -25.192 13.722 36.313 1.00 29.43  ? 171  PHE A CD1   1 
ATOM   1423 C  CD2   . PHE A 1 189 ? -24.213 12.085 37.763 1.00 29.63  ? 171  PHE A CD2   1 
ATOM   1424 C  CE1   . PHE A 1 189 ? -25.744 12.715 35.529 1.00 32.90  ? 171  PHE A CE1   1 
ATOM   1425 C  CE2   . PHE A 1 189 ? -24.783 11.064 36.972 1.00 30.17  ? 171  PHE A CE2   1 
ATOM   1426 C  CZ    . PHE A 1 189 ? -25.516 11.376 35.875 1.00 31.69  ? 171  PHE A CZ    1 
ATOM   1427 N  N     . PHE A 1 190 ? -25.348 13.343 40.752 1.00 23.81  ? 172  PHE A N     1 
ATOM   1428 C  CA    . PHE A 1 190 ? -26.078 12.247 41.347 1.00 25.63  ? 172  PHE A CA    1 
ATOM   1429 C  C     . PHE A 1 190 ? -27.276 12.764 42.133 1.00 26.31  ? 172  PHE A C     1 
ATOM   1430 O  O     . PHE A 1 190 ? -28.329 12.135 42.133 1.00 27.11  ? 172  PHE A O     1 
ATOM   1431 C  CB    . PHE A 1 190 ? -25.170 11.407 42.234 1.00 24.72  ? 172  PHE A CB    1 
ATOM   1432 C  CG    . PHE A 1 190 ? -24.118 10.671 41.478 1.00 25.05  ? 172  PHE A CG    1 
ATOM   1433 C  CD1   . PHE A 1 190 ? -24.466 9.705  40.573 1.00 27.81  ? 172  PHE A CD1   1 
ATOM   1434 C  CD2   . PHE A 1 190 ? -22.787 10.933 41.691 1.00 24.43  ? 172  PHE A CD2   1 
ATOM   1435 C  CE1   . PHE A 1 190 ? -23.515 9.013  39.862 1.00 27.56  ? 172  PHE A CE1   1 
ATOM   1436 C  CE2   . PHE A 1 190 ? -21.811 10.253 40.977 1.00 24.43  ? 172  PHE A CE2   1 
ATOM   1437 C  CZ    . PHE A 1 190 ? -22.171 9.311  40.058 1.00 24.29  ? 172  PHE A CZ    1 
ATOM   1438 N  N     . THR A 1 191 ? -27.140 13.923 42.784 1.00 26.62  ? 173  THR A N     1 
ATOM   1439 C  CA    . THR A 1 191 ? -28.302 14.511 43.490 1.00 28.06  ? 173  THR A CA    1 
ATOM   1440 C  C     . THR A 1 191 ? -29.511 14.811 42.598 1.00 30.04  ? 173  THR A C     1 
ATOM   1441 O  O     . THR A 1 191 ? -30.679 14.599 42.990 1.00 31.34  ? 173  THR A O     1 
ATOM   1442 C  CB    . THR A 1 191 ? -27.895 15.789 44.246 1.00 27.98  ? 173  THR A CB    1 
ATOM   1443 O  OG1   . THR A 1 191 ? -26.921 15.423 45.198 1.00 28.31  ? 173  THR A OG1   1 
ATOM   1444 C  CG2   . THR A 1 191 ? -29.107 16.415 45.010 1.00 28.61  ? 173  THR A CG2   1 
ATOM   1445 N  N     . ASN A 1 192 ? -29.246 15.323 41.414 1.00 30.81  ? 174  ASN A N     1 
ATOM   1446 C  CA    . ASN A 1 192 ? -30.301 15.805 40.548 1.00 32.85  ? 174  ASN A CA    1 
ATOM   1447 C  C     . ASN A 1 192 ? -30.700 14.814 39.456 1.00 33.88  ? 174  ASN A C     1 
ATOM   1448 O  O     . ASN A 1 192 ? -31.580 15.107 38.677 1.00 35.44  ? 174  ASN A O     1 
ATOM   1449 C  CB    . ASN A 1 192 ? -29.900 17.151 39.949 1.00 33.25  ? 174  ASN A CB    1 
ATOM   1450 C  CG    . ASN A 1 192 ? -29.846 18.242 40.999 1.00 35.35  ? 174  ASN A CG    1 
ATOM   1451 O  OD1   . ASN A 1 192 ? -28.772 18.727 41.371 1.00 39.50  ? 174  ASN A OD1   1 
ATOM   1452 N  ND2   . ASN A 1 192 ? -31.001 18.608 41.513 1.00 36.92  ? 174  ASN A ND2   1 
ATOM   1453 N  N     . CYS A 1 193 ? -30.064 13.644 39.414 1.00 33.04  ? 175  CYS A N     1 
ATOM   1454 C  CA    . CYS A 1 193 ? -30.383 12.640 38.430 1.00 34.12  ? 175  CYS A CA    1 
ATOM   1455 C  C     . CYS A 1 193 ? -31.379 11.667 39.054 1.00 35.41  ? 175  CYS A C     1 
ATOM   1456 O  O     . CYS A 1 193 ? -31.087 11.041 40.081 1.00 33.95  ? 175  CYS A O     1 
ATOM   1457 C  CB    . CYS A 1 193 ? -29.150 11.873 37.980 1.00 33.48  ? 175  CYS A CB    1 
ATOM   1458 S  SG    . CYS A 1 193 ? -29.551 10.570 36.787 1.00 36.06  ? 175  CYS A SG    1 
ATOM   1459 N  N     . PRO A 1 194 ? -32.543 11.494 38.405 1.00 37.48  ? 176  PRO A N     1 
ATOM   1460 C  CA    . PRO A 1 194 ? -33.618 10.709 38.993 1.00 38.33  ? 176  PRO A CA    1 
ATOM   1461 C  C     . PRO A 1 194 ? -33.335 9.197  39.098 1.00 38.24  ? 176  PRO A C     1 
ATOM   1462 O  O     . PRO A 1 194 ? -34.051 8.509  39.813 1.00 39.24  ? 176  PRO A O     1 
ATOM   1463 C  CB    . PRO A 1 194 ? -34.809 11.000 38.076 1.00 40.75  ? 176  PRO A CB    1 
ATOM   1464 C  CG    . PRO A 1 194 ? -34.192 11.360 36.773 1.00 41.44  ? 176  PRO A CG    1 
ATOM   1465 C  CD    . PRO A 1 194 ? -32.898 12.028 37.077 1.00 39.29  ? 176  PRO A CD    1 
ATOM   1466 N  N     . ARG A 1 195 ? -32.292 8.697  38.436 1.00 38.16  ? 177  ARG A N     1 
ATOM   1467 C  CA    . ARG A 1 195 ? -31.855 7.291  38.593 1.00 38.68  ? 177  ARG A CA    1 
ATOM   1468 C  C     . ARG A 1 195 ? -31.364 6.963  40.024 1.00 36.91  ? 177  ARG A C     1 
ATOM   1469 O  O     . ARG A 1 195 ? -31.408 5.811  40.454 1.00 37.65  ? 177  ARG A O     1 
ATOM   1470 C  CB    . ARG A 1 195 ? -30.733 6.959  37.601 1.00 38.41  ? 177  ARG A CB    1 
ATOM   1471 C  CG    . ARG A 1 195 ? -31.104 7.207  36.143 1.00 42.42  ? 177  ARG A CG    1 
ATOM   1472 C  CD    . ARG A 1 195 ? -30.226 6.399  35.188 1.00 43.70  ? 177  ARG A CD    1 
ATOM   1473 N  NE    . ARG A 1 195 ? -28.811 6.760  35.294 1.00 43.98  ? 177  ARG A NE    1 
ATOM   1474 C  CZ    . ARG A 1 195 ? -28.218 7.714  34.569 1.00 44.97  ? 177  ARG A CZ    1 
ATOM   1475 N  NH1   . ARG A 1 195 ? -28.914 8.432  33.693 1.00 47.85  ? 177  ARG A NH1   1 
ATOM   1476 N  NH2   . ARG A 1 195 ? -26.927 7.959  34.732 1.00 44.05  ? 177  ARG A NH2   1 
ATOM   1477 N  N     . TYR A 1 196 ? -30.877 7.979  40.731 1.00 35.27  ? 178  TYR A N     1 
ATOM   1478 C  CA    . TYR A 1 196 ? -30.319 7.836  42.074 1.00 33.98  ? 178  TYR A CA    1 
ATOM   1479 C  C     . TYR A 1 196 ? -31.224 8.448  43.150 1.00 34.86  ? 178  TYR A C     1 
ATOM   1480 O  O     . TYR A 1 196 ? -31.931 9.428  42.899 1.00 34.55  ? 178  TYR A O     1 
ATOM   1481 C  CB    . TYR A 1 196 ? -28.959 8.523  42.096 1.00 33.49  ? 178  TYR A CB    1 
ATOM   1482 C  CG    . TYR A 1 196 ? -28.087 8.047  40.983 1.00 32.48  ? 178  TYR A CG    1 
ATOM   1483 C  CD1   . TYR A 1 196 ? -27.313 6.904  41.129 1.00 34.95  ? 178  TYR A CD1   1 
ATOM   1484 C  CD2   . TYR A 1 196 ? -28.057 8.717  39.761 1.00 34.22  ? 178  TYR A CD2   1 
ATOM   1485 C  CE1   . TYR A 1 196 ? -26.513 6.453  40.076 1.00 36.51  ? 178  TYR A CE1   1 
ATOM   1486 C  CE2   . TYR A 1 196 ? -27.270 8.278  38.701 1.00 34.44  ? 178  TYR A CE2   1 
ATOM   1487 C  CZ    . TYR A 1 196 ? -26.494 7.148  38.866 1.00 36.18  ? 178  TYR A CZ    1 
ATOM   1488 O  OH    . TYR A 1 196 ? -25.697 6.709  37.828 1.00 37.63  ? 178  TYR A OH    1 
ATOM   1489 N  N     . THR A 1 197 ? -31.214 7.840  44.331 1.00 34.19  ? 179  THR A N     1 
ATOM   1490 C  CA    . THR A 1 197 ? -31.893 8.346  45.508 1.00 34.15  ? 179  THR A CA    1 
ATOM   1491 C  C     . THR A 1 197 ? -30.789 8.864  46.425 1.00 33.10  ? 179  THR A C     1 
ATOM   1492 O  O     . THR A 1 197 ? -29.813 8.151  46.702 1.00 30.68  ? 179  THR A O     1 
ATOM   1493 C  CB    . THR A 1 197 ? -32.657 7.221  46.188 1.00 35.83  ? 179  THR A CB    1 
ATOM   1494 O  OG1   . THR A 1 197 ? -33.588 6.688  45.246 1.00 38.45  ? 179  THR A OG1   1 
ATOM   1495 C  CG2   . THR A 1 197 ? -33.420 7.698  47.426 1.00 36.23  ? 179  THR A CG2   1 
ATOM   1496 N  N     . SER A 1 198 ? -30.928 10.103 46.883 1.00 32.25  ? 180  SER A N     1 
ATOM   1497 C  CA    . SER A 1 198 ? -29.928 10.682 47.760 1.00 31.82  ? 180  SER A CA    1 
ATOM   1498 C  C     . SER A 1 198 ? -30.151 10.247 49.181 1.00 31.93  ? 180  SER A C     1 
ATOM   1499 O  O     . SER A 1 198 ? -31.266 10.249 49.659 1.00 33.02  ? 180  SER A O     1 
ATOM   1500 C  CB    . SER A 1 198 ? -29.992 12.200 47.705 1.00 32.73  ? 180  SER A CB    1 
ATOM   1501 O  OG    . SER A 1 198 ? -29.660 12.650 46.415 1.00 36.06  ? 180  SER A OG    1 
ATOM   1502 N  N     . CYS A 1 199 ? -29.075 9.919  49.878 1.00 30.47  ? 181  CYS A N     1 
ATOM   1503 C  CA    . CYS A 1 199 ? -29.144 9.571  51.283 1.00 31.28  ? 181  CYS A CA    1 
ATOM   1504 C  C     . CYS A 1 199 ? -28.161 10.484 51.999 1.00 29.54  ? 181  CYS A C     1 
ATOM   1505 O  O     . CYS A 1 199 ? -27.379 11.221 51.367 1.00 27.83  ? 181  CYS A O     1 
ATOM   1506 C  CB    . CYS A 1 199 ? -28.752 8.089  51.470 1.00 32.33  ? 181  CYS A CB    1 
ATOM   1507 S  SG    . CYS A 1 199 ? -29.793 6.978  50.404 1.00 42.65  ? 181  CYS A SG    1 
ATOM   1508 N  N     A GLU A 1 200 ? -28.135 10.457 53.323 0.50 29.98  ? 182  GLU A N     1 
ATOM   1509 N  N     B GLU A 1 200 ? -28.173 10.372 53.315 0.50 29.74  ? 182  GLU A N     1 
ATOM   1510 C  CA    A GLU A 1 200 ? -27.246 11.401 54.005 0.50 29.34  ? 182  GLU A CA    1 
ATOM   1511 C  CA    B GLU A 1 200 ? -27.310 11.168 54.165 0.50 29.56  ? 182  GLU A CA    1 
ATOM   1512 C  C     A GLU A 1 200 ? -25.768 11.119 53.668 0.50 27.49  ? 182  GLU A C     1 
ATOM   1513 C  C     B GLU A 1 200 ? -25.831 11.068 53.775 0.50 27.56  ? 182  GLU A C     1 
ATOM   1514 O  O     A GLU A 1 200 ? -24.980 12.054 53.525 0.50 27.44  ? 182  GLU A O     1 
ATOM   1515 O  O     B GLU A 1 200 ? -25.117 12.063 53.746 0.50 27.73  ? 182  GLU A O     1 
ATOM   1516 C  CB    A GLU A 1 200 ? -27.505 11.427 55.523 0.50 30.97  ? 182  GLU A CB    1 
ATOM   1517 C  CB    B GLU A 1 200 ? -27.533 10.710 55.609 0.50 31.03  ? 182  GLU A CB    1 
ATOM   1518 C  CG    A GLU A 1 200 ? -26.911 12.655 56.243 0.50 31.93  ? 182  GLU A CG    1 
ATOM   1519 C  CG    B GLU A 1 200 ? -26.442 11.068 56.572 0.50 31.50  ? 182  GLU A CG    1 
ATOM   1520 C  CD    A GLU A 1 200 ? -27.885 13.807 56.436 0.50 35.18  ? 182  GLU A CD    1 
ATOM   1521 C  CD    B GLU A 1 200 ? -26.989 11.306 57.940 0.50 33.14  ? 182  GLU A CD    1 
ATOM   1522 O  OE1   A GLU A 1 200 ? -28.858 13.925 55.655 0.50 36.74  ? 182  GLU A OE1   1 
ATOM   1523 O  OE1   B GLU A 1 200 ? -26.829 10.419 58.799 0.50 35.87  ? 182  GLU A OE1   1 
ATOM   1524 O  OE2   A GLU A 1 200 ? -27.667 14.606 57.373 0.50 31.71  ? 182  GLU A OE2   1 
ATOM   1525 O  OE2   B GLU A 1 200 ? -27.588 12.383 58.134 0.50 34.90  ? 182  GLU A OE2   1 
ATOM   1526 N  N     . THR A 1 201 ? -25.394 9.852  53.473 1.00 26.86  ? 183  THR A N     1 
ATOM   1527 C  CA    . THR A 1 201 ? -23.970 9.517  53.288 1.00 25.15  ? 183  THR A CA    1 
ATOM   1528 C  C     . THR A 1 201 ? -23.579 9.040  51.878 1.00 24.60  ? 183  THR A C     1 
ATOM   1529 O  O     . THR A 1 201 ? -22.408 8.634  51.652 1.00 21.66  ? 183  THR A O     1 
ATOM   1530 C  CB    . THR A 1 201 ? -23.496 8.472  54.310 1.00 25.37  ? 183  THR A CB    1 
ATOM   1531 O  OG1   . THR A 1 201 ? -24.105 7.211  54.025 1.00 25.03  ? 183  THR A OG1   1 
ATOM   1532 C  CG2   . THR A 1 201 ? -23.764 8.913  55.766 1.00 26.19  ? 183  THR A CG2   1 
ATOM   1533 N  N     . GLY A 1 202 ? -24.509 9.133  50.933 1.00 23.00  ? 184  GLY A N     1 
ATOM   1534 C  CA    . GLY A 1 202 ? -24.230 8.825  49.530 1.00 23.91  ? 184  GLY A CA    1 
ATOM   1535 C  C     . GLY A 1 202 ? -25.508 8.638  48.735 1.00 24.61  ? 184  GLY A C     1 
ATOM   1536 O  O     . GLY A 1 202 ? -26.526 9.205  49.095 1.00 24.49  ? 184  GLY A O     1 
ATOM   1537 N  N     . PHE A 1 203 ? -25.440 7.808  47.688 1.00 24.39  ? 185  PHE A N     1 
ATOM   1538 C  CA    . PHE A 1 203 ? -26.515 7.623  46.716 1.00 27.08  ? 185  PHE A CA    1 
ATOM   1539 C  C     . PHE A 1 203 ? -26.865 6.153  46.535 1.00 28.32  ? 185  PHE A C     1 
ATOM   1540 O  O     . PHE A 1 203 ? -25.990 5.294  46.464 1.00 26.55  ? 185  PHE A O     1 
ATOM   1541 C  CB    . PHE A 1 203 ? -26.117 8.225  45.353 1.00 26.69  ? 185  PHE A CB    1 
ATOM   1542 C  CG    . PHE A 1 203 ? -25.838 9.689  45.425 1.00 28.37  ? 185  PHE A CG    1 
ATOM   1543 C  CD1   . PHE A 1 203 ? -26.894 10.607 45.500 1.00 29.24  ? 185  PHE A CD1   1 
ATOM   1544 C  CD2   . PHE A 1 203 ? -24.526 10.159 45.490 1.00 28.11  ? 185  PHE A CD2   1 
ATOM   1545 C  CE1   . PHE A 1 203 ? -26.651 11.972 45.595 1.00 27.29  ? 185  PHE A CE1   1 
ATOM   1546 C  CE2   . PHE A 1 203 ? -24.264 11.522 45.609 1.00 28.23  ? 185  PHE A CE2   1 
ATOM   1547 C  CZ    . PHE A 1 203 ? -25.334 12.436 45.661 1.00 27.27  ? 185  PHE A CZ    1 
ATOM   1548 N  N     . LYS A 1 204 ? -28.152 5.890  46.432 1.00 30.10  ? 186  LYS A N     1 
ATOM   1549 C  CA    . LYS A 1 204 ? -28.666 4.562  46.137 1.00 33.45  ? 186  LYS A CA    1 
ATOM   1550 C  C     . LYS A 1 204 ? -29.026 4.490  44.640 1.00 34.89  ? 186  LYS A C     1 
ATOM   1551 O  O     . LYS A 1 204 ? -29.724 5.369  44.107 1.00 34.09  ? 186  LYS A O     1 
ATOM   1552 C  CB    . LYS A 1 204 ? -29.900 4.320  46.999 1.00 35.31  ? 186  LYS A CB    1 
ATOM   1553 C  CG    . LYS A 1 204 ? -30.248 2.891  47.255 1.00 39.02  ? 186  LYS A CG    1 
ATOM   1554 C  CD    . LYS A 1 204 ? -31.595 2.792  48.010 1.00 40.46  ? 186  LYS A CD    1 
ATOM   1555 C  CE    . LYS A 1 204 ? -32.163 1.344  48.034 1.00 44.60  ? 186  LYS A CE    1 
ATOM   1556 N  NZ    . LYS A 1 204 ? -32.507 0.820  46.665 1.00 47.86  ? 186  LYS A NZ    1 
ATOM   1557 N  N     . ASP A 1 205 ? -28.562 3.439  43.974 1.00 35.58  ? 187  ASP A N     1 
ATOM   1558 C  CA    . ASP A 1 205 ? -28.927 3.138  42.580 1.00 36.39  ? 187  ASP A CA    1 
ATOM   1559 C  C     . ASP A 1 205 ? -29.405 1.684  42.540 1.00 37.92  ? 187  ASP A C     1 
ATOM   1560 O  O     . ASP A 1 205 ? -28.631 0.777  42.275 1.00 38.30  ? 187  ASP A O     1 
ATOM   1561 C  CB    . ASP A 1 205 ? -27.701 3.359  41.678 1.00 36.47  ? 187  ASP A CB    1 
ATOM   1562 C  CG    . ASP A 1 205 ? -27.885 2.847  40.235 1.00 38.92  ? 187  ASP A CG    1 
ATOM   1563 O  OD1   . ASP A 1 205 ? -29.033 2.660  39.768 1.00 43.22  ? 187  ASP A OD1   1 
ATOM   1564 O  OD2   . ASP A 1 205 ? -26.831 2.634  39.569 1.00 44.97  ? 187  ASP A OD2   1 
ATOM   1565 N  N     . GLY A 1 206 ? -30.672 1.466  42.840 1.00 38.16  ? 188  GLY A N     1 
ATOM   1566 C  CA    . GLY A 1 206 ? -31.175 0.116  43.015 1.00 39.61  ? 188  GLY A CA    1 
ATOM   1567 C  C     . GLY A 1 206 ? -30.557 -0.646 44.189 1.00 38.93  ? 188  GLY A C     1 
ATOM   1568 O  O     . GLY A 1 206 ? -30.665 -0.229 45.342 1.00 37.13  ? 188  GLY A O     1 
ATOM   1569 N  N     . ASP A 1 207 ? -29.890 -1.761 43.870 1.00 39.92  ? 189  ASP A N     1 
ATOM   1570 C  CA    . ASP A 1 207 ? -29.160 -2.575 44.850 1.00 40.06  ? 189  ASP A CA    1 
ATOM   1571 C  C     . ASP A 1 207 ? -27.690 -2.158 44.931 1.00 38.36  ? 189  ASP A C     1 
ATOM   1572 O  O     . ASP A 1 207 ? -26.859 -2.954 45.349 1.00 40.02  ? 189  ASP A O     1 
ATOM   1573 C  CB    . ASP A 1 207 ? -29.177 -4.064 44.470 1.00 42.00  ? 189  ASP A CB    1 
ATOM   1574 C  CG    . ASP A 1 207 ? -30.542 -4.674 44.489 1.00 45.18  ? 189  ASP A CG    1 
ATOM   1575 O  OD1   . ASP A 1 207 ? -31.386 -4.332 45.355 1.00 47.90  ? 189  ASP A OD1   1 
ATOM   1576 O  OD2   . ASP A 1 207 ? -30.749 -5.562 43.647 1.00 48.88  ? 189  ASP A OD2   1 
ATOM   1577 N  N     . LEU A 1 208 ? -27.345 -0.975 44.442 1.00 36.20  ? 190  LEU A N     1 
ATOM   1578 C  CA    . LEU A 1 208 ? -26.008 -0.474 44.588 1.00 34.21  ? 190  LEU A CA    1 
ATOM   1579 C  C     . LEU A 1 208 ? -26.070 0.766  45.466 1.00 32.87  ? 190  LEU A C     1 
ATOM   1580 O  O     . LEU A 1 208 ? -26.941 1.619  45.270 1.00 32.35  ? 190  LEU A O     1 
ATOM   1581 C  CB    . LEU A 1 208 ? -25.373 -0.161 43.234 1.00 34.01  ? 190  LEU A CB    1 
ATOM   1582 C  CG    . LEU A 1 208 ? -25.259 -1.328 42.238 1.00 35.92  ? 190  LEU A CG    1 
ATOM   1583 C  CD1   . LEU A 1 208 ? -24.964 -0.791 40.842 1.00 36.90  ? 190  LEU A CD1   1 
ATOM   1584 C  CD2   . LEU A 1 208 ? -24.189 -2.307 42.683 1.00 35.28  ? 190  LEU A CD2   1 
ATOM   1585 N  N     . PHE A 1 209 ? -25.169 0.851  46.449 1.00 31.37  ? 191  PHE A N     1 
ATOM   1586 C  CA    . PHE A 1 209 ? -24.997 2.071  47.242 1.00 29.39  ? 191  PHE A CA    1 
ATOM   1587 C  C     . PHE A 1 209 ? -23.624 2.661  47.034 1.00 28.81  ? 191  PHE A C     1 
ATOM   1588 O  O     . PHE A 1 209 ? -22.613 1.998  47.263 1.00 26.67  ? 191  PHE A O     1 
ATOM   1589 C  CB    . PHE A 1 209 ? -25.203 1.803  48.732 1.00 29.96  ? 191  PHE A CB    1 
ATOM   1590 C  CG    . PHE A 1 209 ? -25.084 3.050  49.567 1.00 29.27  ? 191  PHE A CG    1 
ATOM   1591 C  CD1   . PHE A 1 209 ? -26.103 3.992  49.564 1.00 31.97  ? 191  PHE A CD1   1 
ATOM   1592 C  CD2   . PHE A 1 209 ? -23.952 3.304  50.304 1.00 29.59  ? 191  PHE A CD2   1 
ATOM   1593 C  CE1   . PHE A 1 209 ? -25.979 5.158  50.304 1.00 30.02  ? 191  PHE A CE1   1 
ATOM   1594 C  CE2   . PHE A 1 209 ? -23.835 4.468  51.044 1.00 28.85  ? 191  PHE A CE2   1 
ATOM   1595 C  CZ    . PHE A 1 209 ? -24.841 5.376  51.040 1.00 27.68  ? 191  PHE A CZ    1 
ATOM   1596 N  N     . MET A 1 210 ? -23.565 3.909  46.588 1.00 27.96  ? 192  MET A N     1 
ATOM   1597 C  CA    . MET A 1 210 ? -22.272 4.597  46.465 1.00 27.57  ? 192  MET A CA    1 
ATOM   1598 C  C     . MET A 1 210 ? -22.194 5.694  47.540 1.00 25.37  ? 192  MET A C     1 
ATOM   1599 O  O     . MET A 1 210 ? -22.971 6.655  47.506 1.00 25.22  ? 192  MET A O     1 
ATOM   1600 C  CB    . MET A 1 210 ? -22.167 5.242  45.092 1.00 27.36  ? 192  MET A CB    1 
ATOM   1601 C  CG    . MET A 1 210 ? -20.756 5.803  44.752 1.00 28.92  ? 192  MET A CG    1 
ATOM   1602 S  SD    . MET A 1 210 ? -20.765 6.955  43.343 1.00 40.06  ? 192  MET A SD    1 
ATOM   1603 C  CE    . MET A 1 210 ? -22.229 6.348  42.435 1.00 37.84  ? 192  MET A CE    1 
ATOM   1604 N  N     . SER A 1 211 ? -21.308 5.498  48.515 1.00 24.41  ? 193  SER A N     1 
ATOM   1605 C  CA    . SER A 1 211 ? -21.053 6.475  49.546 1.00 23.11  ? 193  SER A CA    1 
ATOM   1606 C  C     . SER A 1 211 ? -20.191 7.583  48.990 1.00 21.77  ? 193  SER A C     1 
ATOM   1607 O  O     . SER A 1 211 ? -19.398 7.390  48.044 1.00 20.39  ? 193  SER A O     1 
ATOM   1608 C  CB    . SER A 1 211 ? -20.392 5.809  50.759 1.00 24.17  ? 193  SER A CB    1 
ATOM   1609 O  OG    . SER A 1 211 ? -19.053 5.435  50.499 1.00 21.51  ? 193  SER A OG    1 
ATOM   1610 N  N     . TYR A 1 212 ? -20.343 8.759  49.571 1.00 20.85  ? 194  TYR A N     1 
ATOM   1611 C  CA    . TYR A 1 212 ? -19.466 9.870  49.219 1.00 21.17  ? 194  TYR A CA    1 
ATOM   1612 C  C     . TYR A 1 212 ? -18.018 9.495  49.424 1.00 20.65  ? 194  TYR A C     1 
ATOM   1613 O  O     . TYR A 1 212 ? -17.130 9.966  48.684 1.00 20.57  ? 194  TYR A O     1 
ATOM   1614 C  CB    . TYR A 1 212 ? -19.804 11.110 50.050 1.00 21.55  ? 194  TYR A CB    1 
ATOM   1615 C  CG    . TYR A 1 212 ? -21.175 11.687 49.752 1.00 20.60  ? 194  TYR A CG    1 
ATOM   1616 C  CD1   . TYR A 1 212 ? -21.467 12.194 48.504 1.00 26.04  ? 194  TYR A CD1   1 
ATOM   1617 C  CD2   . TYR A 1 212 ? -22.150 11.792 50.735 1.00 24.51  ? 194  TYR A CD2   1 
ATOM   1618 C  CE1   . TYR A 1 212 ? -22.692 12.775 48.231 1.00 25.22  ? 194  TYR A CE1   1 
ATOM   1619 C  CE2   . TYR A 1 212 ? -23.372 12.334 50.448 1.00 23.49  ? 194  TYR A CE2   1 
ATOM   1620 C  CZ    . TYR A 1 212 ? -23.633 12.819 49.183 1.00 24.32  ? 194  TYR A CZ    1 
ATOM   1621 O  OH    . TYR A 1 212 ? -24.834 13.403 48.865 1.00 26.78  ? 194  TYR A OH    1 
ATOM   1622 N  N     . ARG A 1 213 ? -17.765 8.675  50.431 1.00 21.64  ? 195  ARG A N     1 
ATOM   1623 C  CA    . ARG A 1 213 ? -16.394 8.270  50.720 1.00 22.81  ? 195  ARG A CA    1 
ATOM   1624 C  C     . ARG A 1 213 ? -15.805 7.418  49.599 1.00 22.56  ? 195  ARG A C     1 
ATOM   1625 O  O     . ARG A 1 213 ? -14.664 7.630  49.198 1.00 20.82  ? 195  ARG A O     1 
ATOM   1626 C  CB    . ARG A 1 213 ? -16.356 7.598  52.078 1.00 23.84  ? 195  ARG A CB    1 
ATOM   1627 C  CG    . ARG A 1 213 ? -15.093 6.931  52.466 1.00 27.80  ? 195  ARG A CG    1 
ATOM   1628 C  CD    . ARG A 1 213 ? -13.979 7.916  52.641 1.00 33.92  ? 195  ARG A CD    1 
ATOM   1629 N  NE    . ARG A 1 213 ? -12.692 7.246  52.949 1.00 37.63  ? 195  ARG A NE    1 
ATOM   1630 C  CZ    . ARG A 1 213 ? -11.746 6.979  52.034 1.00 40.29  ? 195  ARG A CZ    1 
ATOM   1631 N  NH1   . ARG A 1 213 ? -11.911 7.325  50.764 1.00 40.59  ? 195  ARG A NH1   1 
ATOM   1632 N  NH2   . ARG A 1 213 ? -10.631 6.386  52.394 1.00 43.18  ? 195  ARG A NH2   1 
ATOM   1633 N  N     . SER A 1 214 ? -16.583 6.462  49.092 1.00 24.18  ? 196  SER A N     1 
ATOM   1634 C  CA    . SER A 1 214 ? -16.134 5.636  47.986 1.00 25.20  ? 196  SER A CA    1 
ATOM   1635 C  C     . SER A 1 214 ? -16.063 6.447  46.685 1.00 24.54  ? 196  SER A C     1 
ATOM   1636 O  O     . SER A 1 214 ? -15.140 6.235  45.897 1.00 23.49  ? 196  SER A O     1 
ATOM   1637 C  CB    . SER A 1 214 ? -17.010 4.392  47.830 1.00 27.00  ? 196  SER A CB    1 
ATOM   1638 O  OG    . SER A 1 214 ? -18.215 4.769  47.232 1.00 32.15  ? 196  SER A OG    1 
ATOM   1639 N  N     . MET A 1 215 ? -16.982 7.395  46.473 1.00 23.54  ? 197  MET A N     1 
ATOM   1640 C  CA    . MET A 1 215 ? -16.871 8.298  45.316 1.00 23.81  ? 197  MET A CA    1 
ATOM   1641 C  C     . MET A 1 215 ? -15.571 9.126  45.401 1.00 22.32  ? 197  MET A C     1 
ATOM   1642 O  O     . MET A 1 215 ? -14.814 9.264  44.438 1.00 21.34  ? 197  MET A O     1 
ATOM   1643 C  CB    . MET A 1 215 ? -18.086 9.227  45.260 1.00 23.49  ? 197  MET A CB    1 
ATOM   1644 C  CG    . MET A 1 215 ? -18.368 9.905  43.951 1.00 25.69  ? 197  MET A CG    1 
ATOM   1645 S  SD    . MET A 1 215 ? -19.544 11.250 44.208 1.00 31.48  ? 197  MET A SD    1 
ATOM   1646 C  CE    . MET A 1 215 ? -18.461 12.393 45.037 1.00 32.28  ? 197  MET A CE    1 
ATOM   1647 N  N     . PHE A 1 216 ? -15.323 9.668  46.571 1.00 20.98  ? 198  PHE A N     1 
ATOM   1648 C  CA    . PHE A 1 216 ? -14.125 10.436 46.784 1.00 21.55  ? 198  PHE A CA    1 
ATOM   1649 C  C     . PHE A 1 216 ? -12.883 9.607  46.458 1.00 21.18  ? 198  PHE A C     1 
ATOM   1650 O  O     . PHE A 1 216 ? -11.956 10.113 45.818 1.00 21.85  ? 198  PHE A O     1 
ATOM   1651 C  CB    . PHE A 1 216 ? -14.042 10.930 48.216 1.00 21.55  ? 198  PHE A CB    1 
ATOM   1652 C  CG    . PHE A 1 216 ? -12.691 11.500 48.565 1.00 20.71  ? 198  PHE A CG    1 
ATOM   1653 C  CD1   . PHE A 1 216 ? -12.366 12.788 48.166 1.00 21.92  ? 198  PHE A CD1   1 
ATOM   1654 C  CD2   . PHE A 1 216 ? -11.766 10.754 49.270 1.00 23.33  ? 198  PHE A CD2   1 
ATOM   1655 C  CE1   . PHE A 1 216 ? -11.129 13.319 48.442 1.00 22.43  ? 198  PHE A CE1   1 
ATOM   1656 C  CE2   . PHE A 1 216 ? -10.520 11.265 49.543 1.00 22.07  ? 198  PHE A CE2   1 
ATOM   1657 C  CZ    . PHE A 1 216 ? -10.196 12.545 49.140 1.00 21.20  ? 198  PHE A CZ    1 
ATOM   1658 N  N     . GLN A 1 217 ? -12.839 8.370  46.964 1.00 22.51  ? 199  GLN A N     1 
ATOM   1659 C  CA    . GLN A 1 217 ? -11.719 7.464  46.720 1.00 23.45  ? 199  GLN A CA    1 
ATOM   1660 C  C     . GLN A 1 217 ? -11.542 7.167  45.209 1.00 22.96  ? 199  GLN A C     1 
ATOM   1661 O  O     . GLN A 1 217 ? -10.413 7.124  44.730 1.00 21.83  ? 199  GLN A O     1 
ATOM   1662 C  CB    . GLN A 1 217 ? -11.850 6.168  47.509 1.00 24.89  ? 199  GLN A CB    1 
ATOM   1663 C  CG    . GLN A 1 217 ? -10.513 5.370  47.606 1.00 28.60  ? 199  GLN A CG    1 
ATOM   1664 C  CD    . GLN A 1 217 ? -9.361  6.217  48.228 1.00 33.06  ? 199  GLN A CD    1 
ATOM   1665 O  OE1   . GLN A 1 217 ? -9.518  6.800  49.304 1.00 34.18  ? 199  GLN A OE1   1 
ATOM   1666 N  NE2   . GLN A 1 217 ? -8.234  6.294  47.541 1.00 32.59  ? 199  GLN A NE2   1 
ATOM   1667 N  N     . ASP A 1 218 ? -12.645 6.943  44.496 1.00 22.86  ? 200  ASP A N     1 
ATOM   1668 C  CA    . ASP A 1 218 ? -12.606 6.792  43.024 1.00 23.22  ? 200  ASP A CA    1 
ATOM   1669 C  C     . ASP A 1 218 ? -11.970 8.020  42.337 1.00 21.80  ? 200  ASP A C     1 
ATOM   1670 O  O     . ASP A 1 218 ? -11.173 7.856  41.413 1.00 22.20  ? 200  ASP A O     1 
ATOM   1671 C  CB    . ASP A 1 218 ? -14.020 6.538  42.440 1.00 22.77  ? 200  ASP A CB    1 
ATOM   1672 C  CG    . ASP A 1 218 ? -14.565 5.153  42.756 1.00 26.22  ? 200  ASP A CG    1 
ATOM   1673 O  OD1   . ASP A 1 218 ? -13.773 4.262  43.082 1.00 28.28  ? 200  ASP A OD1   1 
ATOM   1674 O  OD2   . ASP A 1 218 ? -15.800 4.937  42.632 1.00 28.42  ? 200  ASP A OD2   1 
ATOM   1675 N  N     . VAL A 1 219 ? -12.318 9.237  42.770 1.00 20.60  ? 201  VAL A N     1 
ATOM   1676 C  CA    . VAL A 1 219 ? -11.788 10.434 42.171 1.00 20.41  ? 201  VAL A CA    1 
ATOM   1677 C  C     . VAL A 1 219 ? -10.283 10.537 42.429 1.00 20.60  ? 201  VAL A C     1 
ATOM   1678 O  O     . VAL A 1 219 ? -9.516  10.825 41.529 1.00 19.73  ? 201  VAL A O     1 
ATOM   1679 C  CB    . VAL A 1 219 ? -12.513 11.675 42.689 1.00 20.64  ? 201  VAL A CB    1 
ATOM   1680 C  CG1   . VAL A 1 219 ? -11.772 12.938 42.261 1.00 21.21  ? 201  VAL A CG1   1 
ATOM   1681 C  CG2   . VAL A 1 219 ? -13.958 11.665 42.197 1.00 18.47  ? 201  VAL A CG2   1 
ATOM   1682 N  N     . ARG A 1 220 ? -9.899  10.321 43.685 1.00 20.42  ? 202  ARG A N     1 
ATOM   1683 C  CA    . ARG A 1 220 ? -8.512  10.386 44.130 1.00 21.98  ? 202  ARG A CA    1 
ATOM   1684 C  C     . ARG A 1 220 ? -7.655  9.337  43.343 1.00 21.79  ? 202  ARG A C     1 
ATOM   1685 O  O     . ARG A 1 220 ? -6.576  9.637  42.838 1.00 22.49  ? 202  ARG A O     1 
ATOM   1686 C  CB    . ARG A 1 220 ? -8.587  10.141 45.647 1.00 23.39  ? 202  ARG A CB    1 
ATOM   1687 C  CG    . ARG A 1 220 ? -7.493  10.560 46.487 1.00 29.69  ? 202  ARG A CG    1 
ATOM   1688 C  CD    . ARG A 1 220 ? -7.403  12.065 46.833 1.00 24.48  ? 202  ARG A CD    1 
ATOM   1689 N  NE    . ARG A 1 220 ? -6.913  12.833 45.701 1.00 23.86  ? 202  ARG A NE    1 
ATOM   1690 C  CZ    . ARG A 1 220 ? -5.750  12.641 45.094 1.00 24.50  ? 202  ARG A CZ    1 
ATOM   1691 N  NH1   . ARG A 1 220 ? -4.948  11.669 45.469 1.00 24.98  ? 202  ARG A NH1   1 
ATOM   1692 N  NH2   . ARG A 1 220 ? -5.419  13.389 44.044 1.00 23.65  ? 202  ARG A NH2   1 
ATOM   1693 N  N     . ASP A 1 221 ? -8.160  8.117  43.247 1.00 22.25  ? 203  ASP A N     1 
ATOM   1694 C  CA    . ASP A 1 221 ? -7.558  7.060  42.447 1.00 23.38  ? 203  ASP A CA    1 
ATOM   1695 C  C     . ASP A 1 221 ? -7.415  7.423  40.974 1.00 22.70  ? 203  ASP A C     1 
ATOM   1696 O  O     . ASP A 1 221 ? -6.417  7.071  40.342 1.00 22.91  ? 203  ASP A O     1 
ATOM   1697 C  CB    . ASP A 1 221 ? -8.355  5.748  42.565 1.00 23.86  ? 203  ASP A CB    1 
ATOM   1698 C  CG    . ASP A 1 221 ? -8.222  5.074  43.948 1.00 26.83  ? 203  ASP A CG    1 
ATOM   1699 O  OD1   . ASP A 1 221 ? -7.395  5.489  44.787 1.00 29.02  ? 203  ASP A OD1   1 
ATOM   1700 O  OD2   . ASP A 1 221 ? -8.989  4.140  44.208 1.00 29.41  ? 203  ASP A OD2   1 
ATOM   1701 N  N     . ALA A 1 222 ? -8.433  8.069  40.424 1.00 21.86  ? 204  ALA A N     1 
ATOM   1702 C  CA    . ALA A 1 222 ? -8.438  8.459  39.019 1.00 21.81  ? 204  ALA A CA    1 
ATOM   1703 C  C     . ALA A 1 222 ? -7.431  9.611  38.758 1.00 20.70  ? 204  ALA A C     1 
ATOM   1704 O  O     . ALA A 1 222 ? -6.741  9.571  37.755 1.00 21.40  ? 204  ALA A O     1 
ATOM   1705 C  CB    . ALA A 1 222 ? -9.865  8.850  38.550 1.00 20.22  ? 204  ALA A CB    1 
ATOM   1706 N  N     . VAL A 1 223 ? -7.317  10.596 39.669 1.00 20.40  ? 205  VAL A N     1 
ATOM   1707 C  CA    . VAL A 1 223 ? -6.297  11.636 39.548 1.00 20.28  ? 205  VAL A CA    1 
ATOM   1708 C  C     . VAL A 1 223 ? -4.882  11.003 39.586 1.00 21.34  ? 205  VAL A C     1 
ATOM   1709 O  O     . VAL A 1 223 ? -4.036  11.257 38.731 1.00 22.27  ? 205  VAL A O     1 
ATOM   1710 C  CB    . VAL A 1 223 ? -6.463  12.748 40.644 1.00 21.25  ? 205  VAL A CB    1 
ATOM   1711 C  CG1   . VAL A 1 223 ? -5.339  13.774 40.597 1.00 19.26  ? 205  VAL A CG1   1 
ATOM   1712 C  CG2   . VAL A 1 223 ? -7.849  13.457 40.471 1.00 18.23  ? 205  VAL A CG2   1 
ATOM   1713 N  N     . ASP A 1 224 ? -4.659  10.139 40.567 1.00 21.36  ? 206  ASP A N     1 
ATOM   1714 C  CA    . ASP A 1 224 ? -3.414  9.450  40.703 1.00 21.72  ? 206  ASP A CA    1 
ATOM   1715 C  C     . ASP A 1 224 ? -3.081  8.683  39.408 1.00 22.48  ? 206  ASP A C     1 
ATOM   1716 O  O     . ASP A 1 224 ? -1.975  8.758  38.919 1.00 23.34  ? 206  ASP A O     1 
ATOM   1717 C  CB    . ASP A 1 224 ? -3.457  8.499  41.896 1.00 22.32  ? 206  ASP A CB    1 
ATOM   1718 C  CG    . ASP A 1 224 ? -3.365  9.213  43.253 1.00 23.40  ? 206  ASP A CG    1 
ATOM   1719 O  OD1   . ASP A 1 224 ? -3.241  10.458 43.377 1.00 25.11  ? 206  ASP A OD1   1 
ATOM   1720 O  OD2   . ASP A 1 224 ? -3.462  8.482  44.229 1.00 24.77  ? 206  ASP A OD2   1 
ATOM   1721 N  N     . TRP A 1 225 ? -4.032  7.920  38.886 1.00 22.45  ? 207  TRP A N     1 
ATOM   1722 C  CA    . TRP A 1 225 ? -3.858  7.163  37.658 1.00 23.69  ? 207  TRP A CA    1 
ATOM   1723 C  C     . TRP A 1 225 ? -3.471  8.081  36.475 1.00 23.99  ? 207  TRP A C     1 
ATOM   1724 O  O     . TRP A 1 225 ? -2.518  7.787  35.747 1.00 25.90  ? 207  TRP A O     1 
ATOM   1725 C  CB    . TRP A 1 225 ? -5.144  6.380  37.359 1.00 24.76  ? 207  TRP A CB    1 
ATOM   1726 C  CG    . TRP A 1 225 ? -5.037  5.508  36.177 1.00 25.58  ? 207  TRP A CG    1 
ATOM   1727 C  CD1   . TRP A 1 225 ? -4.710  4.212  36.164 1.00 27.82  ? 207  TRP A CD1   1 
ATOM   1728 C  CD2   . TRP A 1 225 ? -5.266  5.884  34.820 1.00 26.25  ? 207  TRP A CD2   1 
ATOM   1729 N  NE1   . TRP A 1 225 ? -4.704  3.729  34.878 1.00 28.57  ? 207  TRP A NE1   1 
ATOM   1730 C  CE2   . TRP A 1 225 ? -5.058  4.747  34.036 1.00 27.45  ? 207  TRP A CE2   1 
ATOM   1731 C  CE3   . TRP A 1 225 ? -5.664  7.069  34.199 1.00 25.26  ? 207  TRP A CE3   1 
ATOM   1732 C  CZ2   . TRP A 1 225 ? -5.190  4.762  32.649 1.00 31.32  ? 207  TRP A CZ2   1 
ATOM   1733 C  CZ3   . TRP A 1 225 ? -5.778  7.084  32.819 1.00 25.63  ? 207  TRP A CZ3   1 
ATOM   1734 C  CH2   . TRP A 1 225 ? -5.544  5.958  32.069 1.00 28.50  ? 207  TRP A CH2   1 
ATOM   1735 N  N     . VAL A 1 226 ? -4.169  9.196  36.326 1.00 23.47  ? 208  VAL A N     1 
ATOM   1736 C  CA    . VAL A 1 226 ? -3.908  10.171 35.251 1.00 23.73  ? 208  VAL A CA    1 
ATOM   1737 C  C     . VAL A 1 226 ? -2.432  10.648 35.291 1.00 24.07  ? 208  VAL A C     1 
ATOM   1738 O  O     . VAL A 1 226 ? -1.770  10.731 34.251 1.00 23.53  ? 208  VAL A O     1 
ATOM   1739 C  CB    . VAL A 1 226 ? -4.924  11.334 35.325 1.00 23.82  ? 208  VAL A CB    1 
ATOM   1740 C  CG1   . VAL A 1 226 ? -4.405  12.615 34.649 1.00 24.23  ? 208  VAL A CG1   1 
ATOM   1741 C  CG2   . VAL A 1 226 ? -6.280  10.895 34.785 1.00 22.01  ? 208  VAL A CG2   1 
ATOM   1742 N  N     . HIS A 1 227 ? -1.924  10.876 36.508 1.00 24.19  ? 209  HIS A N     1 
ATOM   1743 C  CA    . HIS A 1 227 ? -0.567  11.345 36.729 1.00 24.56  ? 209  HIS A CA    1 
ATOM   1744 C  C     . HIS A 1 227 ? 0.477   10.236 36.501 1.00 26.84  ? 209  HIS A C     1 
ATOM   1745 O  O     . HIS A 1 227 ? 1.557   10.492 35.953 1.00 26.93  ? 209  HIS A O     1 
ATOM   1746 C  CB    . HIS A 1 227 ? -0.413  11.882 38.151 1.00 23.89  ? 209  HIS A CB    1 
ATOM   1747 C  CG    . HIS A 1 227 ? -0.836  13.308 38.281 1.00 24.98  ? 209  HIS A CG    1 
ATOM   1748 N  ND1   . HIS A 1 227 ? -2.152  13.689 38.422 1.00 26.25  ? 209  HIS A ND1   1 
ATOM   1749 C  CD2   . HIS A 1 227 ? -0.113  14.452 38.240 1.00 22.63  ? 209  HIS A CD2   1 
ATOM   1750 C  CE1   . HIS A 1 227 ? -2.216  15.014 38.473 1.00 21.44  ? 209  HIS A CE1   1 
ATOM   1751 N  NE2   . HIS A 1 227 ? -0.992  15.496 38.355 1.00 25.26  ? 209  HIS A NE2   1 
ATOM   1752 N  N     . TYR A 1 228 ? 0.163   9.037  36.964 1.00 27.69  ? 210  TYR A N     1 
ATOM   1753 C  CA    . TYR A 1 228 ? 1.127   7.938  36.985 1.00 30.17  ? 210  TYR A CA    1 
ATOM   1754 C  C     . TYR A 1 228 ? 1.072   7.029  35.762 1.00 31.43  ? 210  TYR A C     1 
ATOM   1755 O  O     . TYR A 1 228 ? 2.110   6.546  35.313 1.00 32.98  ? 210  TYR A O     1 
ATOM   1756 C  CB    . TYR A 1 228 ? 0.969   7.081  38.254 1.00 32.11  ? 210  TYR A CB    1 
ATOM   1757 C  CG    . TYR A 1 228 ? 1.228   7.814  39.558 1.00 33.12  ? 210  TYR A CG    1 
ATOM   1758 C  CD1   . TYR A 1 228 ? 0.384   7.635  40.661 1.00 32.57  ? 210  TYR A CD1   1 
ATOM   1759 C  CD2   . TYR A 1 228 ? 2.288   8.704  39.694 1.00 37.10  ? 210  TYR A CD2   1 
ATOM   1760 C  CE1   . TYR A 1 228 ? 0.599   8.300  41.877 1.00 33.96  ? 210  TYR A CE1   1 
ATOM   1761 C  CE2   . TYR A 1 228 ? 2.512   9.411  40.931 1.00 36.78  ? 210  TYR A CE2   1 
ATOM   1762 C  CZ    . TYR A 1 228 ? 1.660   9.175  42.012 1.00 37.02  ? 210  TYR A CZ    1 
ATOM   1763 O  OH    . TYR A 1 228 ? 1.855   9.830  43.221 1.00 36.36  ? 210  TYR A OH    1 
ATOM   1764 N  N     . LYS A 1 229 ? -0.120  6.743  35.283 1.00 30.90  ? 211  LYS A N     1 
ATOM   1765 C  CA    . LYS A 1 229 ? -0.344  5.763  34.231 1.00 33.04  ? 211  LYS A CA    1 
ATOM   1766 C  C     . LYS A 1 229 ? -1.086  6.326  33.013 1.00 32.03  ? 211  LYS A C     1 
ATOM   1767 O  O     . LYS A 1 229 ? -1.058  5.725  31.953 1.00 32.87  ? 211  LYS A O     1 
ATOM   1768 C  CB    . LYS A 1 229 ? -1.130  4.597  34.805 1.00 34.23  ? 211  LYS A CB    1 
ATOM   1769 C  CG    . LYS A 1 229 ? -0.360  3.827  35.858 1.00 36.97  ? 211  LYS A CG    1 
ATOM   1770 C  CD    . LYS A 1 229 ? -1.264  2.883  36.631 1.00 38.62  ? 211  LYS A CD    1 
ATOM   1771 C  CE    . LYS A 1 229 ? -0.449  1.757  37.277 1.00 43.52  ? 211  LYS A CE    1 
ATOM   1772 N  NZ    . LYS A 1 229 ? -1.310  0.642  37.865 1.00 46.19  ? 211  LYS A NZ    1 
ATOM   1773 N  N     . GLY A 1 230 ? -1.704  7.490  33.141 1.00 29.24  ? 212  GLY A N     1 
ATOM   1774 C  CA    . GLY A 1 230 ? -2.421  8.082  32.026 1.00 30.17  ? 212  GLY A CA    1 
ATOM   1775 C  C     . GLY A 1 230 ? -1.597  9.034  31.174 1.00 30.08  ? 212  GLY A C     1 
ATOM   1776 O  O     . GLY A 1 230 ? -0.368  8.944  31.127 1.00 31.64  ? 212  GLY A O     1 
ATOM   1777 N  N     . SER A 1 231 ? -2.293  9.949  30.491 1.00 28.90  ? 213  SER A N     1 
ATOM   1778 C  CA    . SER A 1 231 ? -1.688  10.695 29.423 1.00 29.98  ? 213  SER A CA    1 
ATOM   1779 C  C     . SER A 1 231 ? -1.395  12.169 29.779 1.00 27.57  ? 213  SER A C     1 
ATOM   1780 O  O     . SER A 1 231 ? -1.089  12.931 28.892 1.00 28.45  ? 213  SER A O     1 
ATOM   1781 C  CB    . SER A 1 231 ? -2.565  10.581 28.159 1.00 30.77  ? 213  SER A CB    1 
ATOM   1782 O  OG    . SER A 1 231 ? -3.756  11.317 28.357 1.00 31.98  ? 213  SER A OG    1 
ATOM   1783 N  N     . LEU A 1 232 ? -1.498  12.555 31.049 1.00 26.26  ? 214  LEU A N     1 
ATOM   1784 C  CA    . LEU A 1 232 ? -1.361  13.946 31.430 1.00 24.95  ? 214  LEU A CA    1 
ATOM   1785 C  C     . LEU A 1 232 ? 0.035   14.476 31.057 1.00 25.41  ? 214  LEU A C     1 
ATOM   1786 O  O     . LEU A 1 232 ? 0.151   15.522 30.418 1.00 24.36  ? 214  LEU A O     1 
ATOM   1787 C  CB    . LEU A 1 232 ? -1.623  14.141 32.926 1.00 23.85  ? 214  LEU A CB    1 
ATOM   1788 C  CG    . LEU A 1 232 ? -1.449  15.552 33.490 1.00 22.64  ? 214  LEU A CG    1 
ATOM   1789 C  CD1   . LEU A 1 232 ? -2.355  16.568 32.790 1.00 22.45  ? 214  LEU A CD1   1 
ATOM   1790 C  CD2   . LEU A 1 232 ? -1.726  15.582 35.011 1.00 24.18  ? 214  LEU A CD2   1 
ATOM   1791 N  N     . LYS A 1 233 ? 1.071   13.742 31.472 1.00 25.17  ? 215  LYS A N     1 
ATOM   1792 C  CA    . LYS A 1 233 ? 2.459   14.165 31.242 1.00 26.43  ? 215  LYS A CA    1 
ATOM   1793 C  C     . LYS A 1 233 ? 2.796   14.231 29.747 1.00 27.51  ? 215  LYS A C     1 
ATOM   1794 O  O     . LYS A 1 233 ? 3.400   15.186 29.283 1.00 26.71  ? 215  LYS A O     1 
ATOM   1795 C  CB    . LYS A 1 233 ? 3.416   13.246 31.992 1.00 25.83  ? 215  LYS A CB    1 
ATOM   1796 C  CG    . LYS A 1 233 ? 3.364   13.471 33.493 1.00 24.57  ? 215  LYS A CG    1 
ATOM   1797 C  CD    . LYS A 1 233 ? 4.352   12.537 34.210 1.00 28.84  ? 215  LYS A CD    1 
ATOM   1798 C  CE    . LYS A 1 233 ? 4.622   12.992 35.615 1.00 30.24  ? 215  LYS A CE    1 
ATOM   1799 N  NZ    . LYS A 1 233 ? 3.374   13.174 36.389 1.00 28.73  ? 215  LYS A NZ    1 
ATOM   1800 N  N     . GLU A 1 234 ? 2.378   13.212 29.015 1.00 28.95  ? 216  GLU A N     1 
ATOM   1801 C  CA    . GLU A 1 234 ? 2.584   13.145 27.575 1.00 31.41  ? 216  GLU A CA    1 
ATOM   1802 C  C     . GLU A 1 234 ? 1.908   14.328 26.836 1.00 30.64  ? 216  GLU A C     1 
ATOM   1803 O  O     . GLU A 1 234 ? 2.494   14.939 25.957 1.00 30.32  ? 216  GLU A O     1 
ATOM   1804 C  CB    . GLU A 1 234 ? 2.080   11.794 27.064 1.00 32.64  ? 216  GLU A CB    1 
ATOM   1805 C  CG    . GLU A 1 234 ? 2.090   11.676 25.580 1.00 36.55  ? 216  GLU A CG    1 
ATOM   1806 C  CD    . GLU A 1 234 ? 1.279   10.505 25.047 1.00 41.85  ? 216  GLU A CD    1 
ATOM   1807 O  OE1   . GLU A 1 234 ? 0.037   10.397 25.324 1.00 49.70  ? 216  GLU A OE1   1 
ATOM   1808 O  OE2   . GLU A 1 234 ? 1.892   9.712  24.310 1.00 52.57  ? 216  GLU A OE2   1 
ATOM   1809 N  N     . LYS A 1 235 ? 0.674   14.652 27.215 1.00 29.54  ? 217  LYS A N     1 
ATOM   1810 C  CA    . LYS A 1 235 ? -0.052  15.742 26.570 1.00 29.99  ? 217  LYS A CA    1 
ATOM   1811 C  C     . LYS A 1 235 ? 0.522   17.096 26.969 1.00 28.31  ? 217  LYS A C     1 
ATOM   1812 O  O     . LYS A 1 235 ? 0.509   18.037 26.175 1.00 28.77  ? 217  LYS A O     1 
ATOM   1813 C  CB    . LYS A 1 235 ? -1.558  15.637 26.833 1.00 29.93  ? 217  LYS A CB    1 
ATOM   1814 C  CG    . LYS A 1 235 ? -2.201  14.470 26.062 1.00 33.08  ? 217  LYS A CG    1 
ATOM   1815 C  CD    . LYS A 1 235 ? -3.584  14.162 26.593 1.00 33.68  ? 217  LYS A CD    1 
ATOM   1816 C  CE    . LYS A 1 235 ? -4.289  13.064 25.782 1.00 37.07  ? 217  LYS A CE    1 
ATOM   1817 N  NZ    . LYS A 1 235 ? -4.290  13.552 24.418 1.00 44.10  ? 217  LYS A NZ    1 
ATOM   1818 N  N     . THR A 1 236 ? 1.105   17.167 28.164 1.00 26.21  ? 218  THR A N     1 
ATOM   1819 C  CA    . THR A 1 236 ? 1.744   18.385 28.641 1.00 25.94  ? 218  THR A CA    1 
ATOM   1820 C  C     . THR A 1 236 ? 3.014   18.662 27.823 1.00 26.34  ? 218  THR A C     1 
ATOM   1821 O  O     . THR A 1 236 ? 3.208   19.753 27.279 1.00 27.06  ? 218  THR A O     1 
ATOM   1822 C  CB    . THR A 1 236 ? 2.096   18.268 30.135 1.00 23.92  ? 218  THR A CB    1 
ATOM   1823 O  OG1   . THR A 1 236 ? 0.894   18.037 30.898 1.00 24.17  ? 218  THR A OG1   1 
ATOM   1824 C  CG2   . THR A 1 236 ? 2.819   19.536 30.612 1.00 24.18  ? 218  THR A CG2   1 
ATOM   1825 N  N     . VAL A 1 237 ? 3.839   17.640 27.711 1.00 26.91  ? 219  VAL A N     1 
ATOM   1826 C  CA    . VAL A 1 237 ? 5.135   17.708 27.023 1.00 29.60  ? 219  VAL A CA    1 
ATOM   1827 C  C     . VAL A 1 237 ? 4.993   17.923 25.521 1.00 31.44  ? 219  VAL A C     1 
ATOM   1828 O  O     . VAL A 1 237 ? 5.850   18.538 24.892 1.00 32.37  ? 219  VAL A O     1 
ATOM   1829 C  CB    . VAL A 1 237 ? 5.956   16.448 27.337 1.00 29.94  ? 219  VAL A CB    1 
ATOM   1830 C  CG1   . VAL A 1 237 ? 7.057   16.271 26.328 1.00 35.73  ? 219  VAL A CG1   1 
ATOM   1831 C  CG2   . VAL A 1 237 ? 6.501   16.532 28.809 1.00 27.82  ? 219  VAL A CG2   1 
ATOM   1832 N  N     . GLU A 1 238 ? 3.898   17.466 24.945 1.00 32.95  ? 220  GLU A N     1 
ATOM   1833 C  CA    . GLU A 1 238 ? 3.670   17.730 23.524 1.00 36.47  ? 220  GLU A CA    1 
ATOM   1834 C  C     . GLU A 1 238 ? 3.168   19.154 23.218 1.00 35.92  ? 220  GLU A C     1 
ATOM   1835 O  O     . GLU A 1 238 ? 3.137   19.537 22.057 1.00 37.23  ? 220  GLU A O     1 
ATOM   1836 C  CB    . GLU A 1 238 ? 2.791   16.654 22.891 1.00 38.26  ? 220  GLU A CB    1 
ATOM   1837 C  CG    . GLU A 1 238 ? 1.365   16.717 23.234 1.00 40.83  ? 220  GLU A CG    1 
ATOM   1838 C  CD    . GLU A 1 238 ? 0.565   15.511 22.691 1.00 42.69  ? 220  GLU A CD    1 
ATOM   1839 O  OE1   . GLU A 1 238 ? 1.207   14.559 22.162 1.00 51.41  ? 220  GLU A OE1   1 
ATOM   1840 O  OE2   . GLU A 1 238 ? -0.688  15.517 22.803 1.00 45.85  ? 220  GLU A OE2   1 
ATOM   1841 N  N     . ASN A 1 239 ? 2.808   19.929 24.234 1.00 34.05  ? 221  ASN A N     1 
ATOM   1842 C  CA    . ASN A 1 239 ? 2.476   21.355 24.051 1.00 34.25  ? 221  ASN A CA    1 
ATOM   1843 C  C     . ASN A 1 239 ? 2.847   22.232 25.238 1.00 31.71  ? 221  ASN A C     1 
ATOM   1844 O  O     . ASN A 1 239 ? 1.991   22.799 25.921 1.00 30.04  ? 221  ASN A O     1 
ATOM   1845 C  CB    . ASN A 1 239 ? 1.003   21.565 23.716 1.00 35.50  ? 221  ASN A CB    1 
ATOM   1846 C  CG    . ASN A 1 239 ? 0.746   22.894 22.970 1.00 37.99  ? 221  ASN A CG    1 
ATOM   1847 O  OD1   . ASN A 1 239 ? 1.608   23.805 22.914 1.00 39.98  ? 221  ASN A OD1   1 
ATOM   1848 N  ND2   . ASN A 1 239 ? -0.445  23.005 22.404 1.00 38.63  ? 221  ASN A ND2   1 
ATOM   1849 N  N     . LEU A 1 240 ? 4.149   22.387 25.434 1.00 31.62  ? 222  LEU A N     1 
ATOM   1850 C  CA    . LEU A 1 240 ? 4.676   23.027 26.625 1.00 30.65  ? 222  LEU A CA    1 
ATOM   1851 C  C     . LEU A 1 240 ? 4.338   24.503 26.635 1.00 30.31  ? 222  LEU A C     1 
ATOM   1852 O  O     . LEU A 1 240 ? 4.132   25.068 27.664 1.00 28.99  ? 222  LEU A O     1 
ATOM   1853 C  CB    . LEU A 1 240 ? 6.188   22.809 26.690 1.00 31.97  ? 222  LEU A CB    1 
ATOM   1854 C  CG    . LEU A 1 240 ? 6.602   21.362 26.965 1.00 32.28  ? 222  LEU A CG    1 
ATOM   1855 C  CD1   . LEU A 1 240 ? 8.031   21.095 26.521 1.00 35.37  ? 222  LEU A CD1   1 
ATOM   1856 C  CD2   . LEU A 1 240 ? 6.403   21.074 28.402 1.00 30.18  ? 222  LEU A CD2   1 
ATOM   1857 N  N     . GLU A 1 241 ? 4.285   25.137 25.471 1.00 31.90  ? 223  GLU A N     1 
ATOM   1858 C  CA    . GLU A 1 241 ? 3.964   26.558 25.413 1.00 32.81  ? 223  GLU A CA    1 
ATOM   1859 C  C     . GLU A 1 241 ? 2.524   26.840 25.862 1.00 31.86  ? 223  GLU A C     1 
ATOM   1860 O  O     . GLU A 1 241 ? 2.231   27.874 26.473 1.00 31.70  ? 223  GLU A O     1 
ATOM   1861 C  CB    . GLU A 1 241 ? 4.214   27.091 24.001 1.00 35.57  ? 223  GLU A CB    1 
ATOM   1862 C  CG    . GLU A 1 241 ? 5.686   26.941 23.539 1.00 40.06  ? 223  GLU A CG    1 
ATOM   1863 C  CD    . GLU A 1 241 ? 5.915   25.711 22.627 1.00 47.70  ? 223  GLU A CD    1 
ATOM   1864 O  OE1   . GLU A 1 241 ? 5.469   24.563 22.971 1.00 45.00  ? 223  GLU A OE1   1 
ATOM   1865 O  OE2   . GLU A 1 241 ? 6.516   25.929 21.525 1.00 53.87  ? 223  GLU A OE2   1 
ATOM   1866 N  N     . LYS A 1 242 ? 1.635   25.900 25.574 1.00 31.00  ? 224  LYS A N     1 
ATOM   1867 C  CA    . LYS A 1 242 ? 0.243   25.969 26.039 1.00 30.14  ? 224  LYS A CA    1 
ATOM   1868 C  C     . LYS A 1 242 ? 0.093   25.807 27.547 1.00 27.65  ? 224  LYS A C     1 
ATOM   1869 O  O     . LYS A 1 242 ? -0.731  26.465 28.159 1.00 26.67  ? 224  LYS A O     1 
ATOM   1870 C  CB    . LYS A 1 242 ? -0.599  24.893 25.348 1.00 30.78  ? 224  LYS A CB    1 
ATOM   1871 C  CG    . LYS A 1 242 ? -2.044  24.884 25.773 1.00 31.85  ? 224  LYS A CG    1 
ATOM   1872 C  CD    . LYS A 1 242 ? -2.875  24.037 24.856 1.00 32.82  ? 224  LYS A CD    1 
ATOM   1873 C  CE    . LYS A 1 242 ? -4.289  24.028 25.389 1.00 35.21  ? 224  LYS A CE    1 
ATOM   1874 N  NZ    . LYS A 1 242 ? -5.159  23.320 24.457 1.00 41.24  ? 224  LYS A NZ    1 
ATOM   1875 N  N     . TYR A 1 243 ? 0.868   24.881 28.108 1.00 26.08  ? 225  TYR A N     1 
ATOM   1876 C  CA    . TYR A 1 243 ? 0.707   24.445 29.489 1.00 24.39  ? 225  TYR A CA    1 
ATOM   1877 C  C     . TYR A 1 243 ? 1.668   24.958 30.526 1.00 23.15  ? 225  TYR A C     1 
ATOM   1878 O  O     . TYR A 1 243 ? 1.325   24.874 31.707 1.00 21.17  ? 225  TYR A O     1 
ATOM   1879 C  CB    . TYR A 1 243 ? 0.705   22.933 29.547 1.00 23.94  ? 225  TYR A CB    1 
ATOM   1880 C  CG    . TYR A 1 243 ? -0.482  22.377 28.838 1.00 25.23  ? 225  TYR A CG    1 
ATOM   1881 C  CD1   . TYR A 1 243 ? -1.781  22.692 29.274 1.00 26.43  ? 225  TYR A CD1   1 
ATOM   1882 C  CD2   . TYR A 1 243 ? -0.345  21.548 27.760 1.00 26.38  ? 225  TYR A CD2   1 
ATOM   1883 C  CE1   . TYR A 1 243 ? -2.877  22.194 28.655 1.00 24.92  ? 225  TYR A CE1   1 
ATOM   1884 C  CE2   . TYR A 1 243 ? -1.483  21.053 27.096 1.00 27.38  ? 225  TYR A CE2   1 
ATOM   1885 C  CZ    . TYR A 1 243 ? -2.730  21.402 27.555 1.00 25.46  ? 225  TYR A CZ    1 
ATOM   1886 O  OH    . TYR A 1 243 ? -3.843  20.895 26.906 1.00 30.60  ? 225  TYR A OH    1 
ATOM   1887 N  N     . VAL A 1 244 ? 2.818   25.514 30.130 1.00 24.01  ? 226  VAL A N     1 
ATOM   1888 C  CA    . VAL A 1 244 ? 3.875   25.874 31.124 1.00 23.58  ? 226  VAL A CA    1 
ATOM   1889 C  C     . VAL A 1 244 ? 4.400   27.291 30.943 1.00 24.83  ? 226  VAL A C     1 
ATOM   1890 O  O     . VAL A 1 244 ? 4.750   27.665 29.863 1.00 25.86  ? 226  VAL A O     1 
ATOM   1891 C  CB    . VAL A 1 244 ? 5.060   24.877 31.086 1.00 23.51  ? 226  VAL A CB    1 
ATOM   1892 C  CG1   . VAL A 1 244 ? 6.016   25.100 32.289 1.00 23.45  ? 226  VAL A CG1   1 
ATOM   1893 C  CG2   . VAL A 1 244 ? 4.539   23.403 31.039 1.00 23.75  ? 226  VAL A CG2   1 
ATOM   1894 N  N     . VAL A 1 245 ? 4.435   28.067 32.020 1.00 25.15  ? 227  VAL A N     1 
ATOM   1895 C  CA    . VAL A 1 245 ? 4.993   29.426 32.053 1.00 26.55  ? 227  VAL A CA    1 
ATOM   1896 C  C     . VAL A 1 245 ? 6.525   29.325 31.919 1.00 27.65  ? 227  VAL A C     1 
ATOM   1897 O  O     . VAL A 1 245 ? 7.176   28.486 32.544 1.00 26.16  ? 227  VAL A O     1 
ATOM   1898 C  CB    . VAL A 1 245 ? 4.585   30.159 33.378 1.00 26.79  ? 227  VAL A CB    1 
ATOM   1899 C  CG1   . VAL A 1 245 ? 5.296   31.490 33.601 1.00 27.70  ? 227  VAL A CG1   1 
ATOM   1900 C  CG2   . VAL A 1 245 ? 3.069   30.368 33.464 1.00 26.83  ? 227  VAL A CG2   1 
ATOM   1901 N  N     . LYS A 1 246 ? 7.086   30.160 31.058 1.00 28.88  ? 228  LYS A N     1 
ATOM   1902 C  CA    . LYS A 1 246 ? 8.508   30.151 30.797 1.00 29.93  ? 228  LYS A CA    1 
ATOM   1903 C  C     . LYS A 1 246 ? 9.022   31.585 30.988 1.00 30.34  ? 228  LYS A C     1 
ATOM   1904 O  O     . LYS A 1 246 ? 8.400   32.526 30.522 1.00 32.09  ? 228  LYS A O     1 
ATOM   1905 C  CB    . LYS A 1 246 ? 8.716   29.673 29.370 1.00 31.47  ? 228  LYS A CB    1 
ATOM   1906 C  CG    . LYS A 1 246 ? 10.125  29.569 28.943 1.00 31.68  ? 228  LYS A CG    1 
ATOM   1907 C  CD    . LYS A 1 246 ? 10.204  28.718 27.763 1.00 33.51  ? 228  LYS A CD    1 
ATOM   1908 C  CE    . LYS A 1 246 ? 11.514  28.774 27.144 1.00 34.85  ? 228  LYS A CE    1 
ATOM   1909 N  NZ    . LYS A 1 246 ? 11.494  27.876 25.989 1.00 37.14  ? 228  LYS A NZ    1 
ATOM   1910 N  N     . ASP A 1 247 ? 10.180  31.727 31.611 1.00 30.20  ? 229  ASP A N     1 
ATOM   1911 C  CA    . ASP A 1 247 ? 10.712  33.043 32.051 1.00 31.21  ? 229  ASP A CA    1 
ATOM   1912 C  C     . ASP A 1 247 ? 12.198  33.090 31.884 1.00 31.36  ? 229  ASP A C     1 
ATOM   1913 O  O     . ASP A 1 247 ? 12.918  32.396 32.577 1.00 30.94  ? 229  ASP A O     1 
ATOM   1914 C  CB    . ASP A 1 247 ? 10.387  33.258 33.539 1.00 30.13  ? 229  ASP A CB    1 
ATOM   1915 C  CG    . ASP A 1 247 ? 10.776  34.668 34.072 1.00 33.22  ? 229  ASP A CG    1 
ATOM   1916 O  OD1   . ASP A 1 247 ? 11.494  35.452 33.402 1.00 35.95  ? 229  ASP A OD1   1 
ATOM   1917 O  OD2   . ASP A 1 247 ? 10.346  34.980 35.219 1.00 35.27  ? 229  ASP A OD2   1 
ATOM   1918 N  N     . GLY A 1 248 ? 12.676  33.999 31.048 1.00 28.62  ? 230  GLY A N     1 
ATOM   1919 C  CA    . GLY A 1 248 ? 14.104  34.139 30.774 1.00 28.80  ? 230  GLY A CA    1 
ATOM   1920 C  C     . GLY A 1 248 ? 14.916  34.505 31.993 1.00 29.77  ? 230  GLY A C     1 
ATOM   1921 O  O     . GLY A 1 248 ? 16.146  34.285 32.011 1.00 30.59  ? 230  GLY A O     1 
ATOM   1922 N  N     . LYS A 1 249 ? 14.229  35.059 32.993 1.00 29.57  ? 231  LYS A N     1 
ATOM   1923 C  CA    . LYS A 1 249 ? 14.864  35.459 34.239 1.00 31.01  ? 231  LYS A CA    1 
ATOM   1924 C  C     . LYS A 1 249 ? 15.184  34.318 35.175 1.00 29.77  ? 231  LYS A C     1 
ATOM   1925 O  O     . LYS A 1 249 ? 15.966  34.517 36.095 1.00 30.63  ? 231  LYS A O     1 
ATOM   1926 C  CB    . LYS A 1 249 ? 14.012  36.478 34.978 1.00 32.28  ? 231  LYS A CB    1 
ATOM   1927 C  CG    . LYS A 1 249 ? 13.933  37.791 34.232 1.00 34.40  ? 231  LYS A CG    1 
ATOM   1928 C  CD    . LYS A 1 249 ? 13.187  38.840 34.995 1.00 36.28  ? 231  LYS A CD    1 
ATOM   1929 C  CE    . LYS A 1 249 ? 11.718  38.525 35.131 1.00 39.04  ? 231  LYS A CE    1 
ATOM   1930 N  NZ    . LYS A 1 249 ? 11.088  38.133 33.842 1.00 37.68  ? 231  LYS A NZ    1 
ATOM   1931 N  N     . LEU A 1 250 ? 14.603  33.133 34.968 1.00 29.12  ? 232  LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 250 ? 14.962  31.953 35.800 1.00 27.76  ? 232  LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 250 ? 16.464  31.640 35.823 1.00 27.08  ? 232  LEU A C     1 
ATOM   1934 O  O     . LEU A 1 250 ? 17.063  31.552 36.889 1.00 25.90  ? 232  LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 250 ? 14.132  30.701 35.427 1.00 28.08  ? 232  LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 250 ? 14.660  29.361 36.039 1.00 27.07  ? 232  LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 250 ? 14.534  29.445 37.540 1.00 31.13  ? 232  LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 250 ? 13.989  28.146 35.538 1.00 27.36  ? 232  LEU A CD2   1 
ATOM   1939 N  N     . PRO A 1 251 ? 17.115  31.434 34.644 1.00 27.93  ? 233  PRO A N     1 
ATOM   1940 C  CA    . PRO A 1 251 ? 18.543  31.157 34.722 1.00 26.71  ? 233  PRO A CA    1 
ATOM   1941 C  C     . PRO A 1 251 ? 19.371  32.259 35.329 1.00 27.19  ? 233  PRO A C     1 
ATOM   1942 O  O     . PRO A 1 251 ? 20.458  31.995 35.841 1.00 27.10  ? 233  PRO A O     1 
ATOM   1943 C  CB    . PRO A 1 251 ? 18.949  30.895 33.269 1.00 28.12  ? 233  PRO A CB    1 
ATOM   1944 C  CG    . PRO A 1 251 ? 17.714  30.873 32.472 1.00 28.33  ? 233  PRO A CG    1 
ATOM   1945 C  CD    . PRO A 1 251 ? 16.563  31.232 33.296 1.00 28.34  ? 233  PRO A CD    1 
ATOM   1946 N  N     . LEU A 1 252 ? 18.912  33.499 35.200 1.00 27.07  ? 234  LEU A N     1 
ATOM   1947 C  CA    . LEU A 1 252 ? 19.627  34.637 35.758 1.00 27.16  ? 234  LEU A CA    1 
ATOM   1948 C  C     . LEU A 1 252 ? 19.620  34.491 37.294 1.00 26.87  ? 234  LEU A C     1 
ATOM   1949 O  O     . LEU A 1 252 ? 20.652  34.607 37.926 1.00 27.85  ? 234  LEU A O     1 
ATOM   1950 C  CB    . LEU A 1 252 ? 18.961  35.955 35.358 1.00 27.67  ? 234  LEU A CB    1 
ATOM   1951 C  CG    . LEU A 1 252 ? 19.554  37.241 35.917 1.00 29.32  ? 234  LEU A CG    1 
ATOM   1952 C  CD1   . LEU A 1 252 ? 21.031  37.324 35.564 1.00 33.03  ? 234  LEU A CD1   1 
ATOM   1953 C  CD2   . LEU A 1 252 ? 18.745  38.471 35.434 1.00 29.65  ? 234  LEU A CD2   1 
ATOM   1954 N  N     . LEU A 1 253 ? 18.451  34.237 37.871 1.00 26.39  ? 235  LEU A N     1 
ATOM   1955 C  CA    . LEU A 1 253 ? 18.336  34.177 39.347 1.00 27.02  ? 235  LEU A CA    1 
ATOM   1956 C  C     . LEU A 1 253 ? 19.166  33.000 39.891 1.00 25.68  ? 235  LEU A C     1 
ATOM   1957 O  O     . LEU A 1 253 ? 19.953  33.166 40.824 1.00 26.34  ? 235  LEU A O     1 
ATOM   1958 C  CB    . LEU A 1 253 ? 16.875  34.047 39.786 1.00 27.19  ? 235  LEU A CB    1 
ATOM   1959 C  CG    . LEU A 1 253 ? 16.653  33.928 41.312 1.00 27.42  ? 235  LEU A CG    1 
ATOM   1960 C  CD1   . LEU A 1 253 ? 17.291  35.125 42.030 1.00 26.13  ? 235  LEU A CD1   1 
ATOM   1961 C  CD2   . LEU A 1 253 ? 15.161  33.855 41.644 1.00 28.92  ? 235  LEU A CD2   1 
ATOM   1962 N  N     . LEU A 1 254 ? 19.041  31.848 39.249 1.00 24.76  ? 236  LEU A N     1 
ATOM   1963 C  CA    . LEU A 1 254 ? 19.747  30.650 39.684 1.00 25.48  ? 236  LEU A CA    1 
ATOM   1964 C  C     . LEU A 1 254 ? 21.223  30.819 39.563 1.00 25.47  ? 236  LEU A C     1 
ATOM   1965 O  O     . LEU A 1 254 ? 21.980  30.359 40.418 1.00 25.38  ? 236  LEU A O     1 
ATOM   1966 C  CB    . LEU A 1 254 ? 19.313  29.396 38.897 1.00 25.23  ? 236  LEU A CB    1 
ATOM   1967 C  CG    . LEU A 1 254 ? 17.905  28.852 39.193 1.00 28.05  ? 236  LEU A CG    1 
ATOM   1968 C  CD1   . LEU A 1 254 ? 17.768  27.422 38.625 1.00 28.58  ? 236  LEU A CD1   1 
ATOM   1969 C  CD2   . LEU A 1 254 ? 17.598  28.824 40.617 1.00 31.47  ? 236  LEU A CD2   1 
ATOM   1970 N  N     . SER A 1 255 ? 21.652  31.488 38.487 1.00 26.02  ? 237  SER A N     1 
ATOM   1971 C  CA    . SER A 1 255 ? 23.077  31.727 38.283 1.00 26.70  ? 237  SER A CA    1 
ATOM   1972 C  C     . SER A 1 255 ? 23.612  32.639 39.394 1.00 27.60  ? 237  SER A C     1 
ATOM   1973 O  O     . SER A 1 255 ? 24.716  32.435 39.895 1.00 28.21  ? 237  SER A O     1 
ATOM   1974 C  CB    . SER A 1 255 ? 23.344  32.311 36.875 1.00 27.16  ? 237  SER A CB    1 
ATOM   1975 O  OG    . SER A 1 255 ? 22.833  33.649 36.793 1.00 31.46  ? 237  SER A OG    1 
ATOM   1976 N  N     . ARG A 1 256 ? 22.811  33.615 39.815 1.00 28.37  ? 238  ARG A N     1 
ATOM   1977 C  CA    . ARG A 1 256 ? 23.206  34.505 40.902 1.00 30.18  ? 238  ARG A CA    1 
ATOM   1978 C  C     . ARG A 1 256 ? 23.271  33.809 42.271 1.00 29.98  ? 238  ARG A C     1 
ATOM   1979 O  O     . ARG A 1 256 ? 24.158  34.085 43.106 1.00 29.91  ? 238  ARG A O     1 
ATOM   1980 C  CB    . ARG A 1 256 ? 22.271  35.718 40.936 1.00 31.60  ? 238  ARG A CB    1 
ATOM   1981 C  CG    . ARG A 1 256 ? 22.513  36.687 39.755 1.00 32.64  ? 238  ARG A CG    1 
ATOM   1982 C  CD    . ARG A 1 256 ? 21.476  37.787 39.652 1.00 37.13  ? 238  ARG A CD    1 
ATOM   1983 N  NE    . ARG A 1 256 ? 21.422  38.539 40.892 1.00 43.32  ? 238  ARG A NE    1 
ATOM   1984 C  CZ    . ARG A 1 256 ? 22.210  39.572 41.182 1.00 47.17  ? 238  ARG A CZ    1 
ATOM   1985 N  NH1   . ARG A 1 256 ? 23.118  40.016 40.303 1.00 50.24  ? 238  ARG A NH1   1 
ATOM   1986 N  NH2   . ARG A 1 256 ? 22.086  40.169 42.356 1.00 50.22  ? 238  ARG A NH2   1 
ATOM   1987 N  N     . MET A 1 257 ? 22.308  32.931 42.525 1.00 28.83  ? 239  MET A N     1 
ATOM   1988 C  CA    . MET A 1 257 ? 22.314  32.147 43.752 1.00 30.17  ? 239  MET A CA    1 
ATOM   1989 C  C     . MET A 1 257 ? 23.543  31.256 43.830 1.00 31.00  ? 239  MET A C     1 
ATOM   1990 O  O     . MET A 1 257 ? 24.118  31.061 44.897 1.00 31.64  ? 239  MET A O     1 
ATOM   1991 C  CB    . MET A 1 257 ? 21.067  31.290 43.816 1.00 28.47  ? 239  MET A CB    1 
ATOM   1992 C  CG    . MET A 1 257 ? 19.818  32.058 44.152 1.00 28.07  ? 239  MET A CG    1 
ATOM   1993 S  SD    . MET A 1 257 ? 18.429  30.969 43.936 1.00 29.56  ? 239  MET A SD    1 
ATOM   1994 C  CE    . MET A 1 257 ? 17.093  31.950 44.662 1.00 29.79  ? 239  MET A CE    1 
ATOM   1995 N  N     . LYS A 1 258 ? 23.969  30.727 42.694 1.00 32.32  ? 240  LYS A N     1 
ATOM   1996 C  CA    . LYS A 1 258 ? 25.093  29.808 42.678 1.00 33.65  ? 240  LYS A CA    1 
ATOM   1997 C  C     . LYS A 1 258 ? 26.395  30.558 42.928 1.00 36.09  ? 240  LYS A C     1 
ATOM   1998 O  O     . LYS A 1 258 ? 27.362  29.972 43.404 1.00 37.10  ? 240  LYS A O     1 
ATOM   1999 C  CB    . LYS A 1 258 ? 25.095  28.962 41.390 1.00 33.58  ? 240  LYS A CB    1 
ATOM   2000 C  CG    . LYS A 1 258 ? 25.849  27.606 41.507 1.00 35.00  ? 240  LYS A CG    1 
ATOM   2001 C  CD    . LYS A 1 258 ? 25.091  26.384 40.960 1.00 35.66  ? 240  LYS A CD    1 
ATOM   2002 C  CE    . LYS A 1 258 ? 25.984  25.448 40.174 1.00 38.18  ? 240  LYS A CE    1 
ATOM   2003 N  NZ    . LYS A 1 258 ? 27.275  25.206 40.893 1.00 43.07  ? 240  LYS A NZ    1 
ATOM   2004 N  N     . GLU A 1 259 ? 26.400  31.876 42.708 1.00 37.70  ? 241  GLU A N     1 
ATOM   2005 C  CA    . GLU A 1 259 ? 27.549  32.706 43.043 1.00 40.03  ? 241  GLU A CA    1 
ATOM   2006 C  C     . GLU A 1 259 ? 27.781  32.815 44.552 1.00 40.82  ? 241  GLU A C     1 
ATOM   2007 O  O     . GLU A 1 259 ? 28.925  32.939 45.005 1.00 41.81  ? 241  GLU A O     1 
ATOM   2008 C  CB    . GLU A 1 259 ? 27.425  34.123 42.404 1.00 42.62  ? 241  GLU A CB    1 
ATOM   2009 C  CG    . GLU A 1 259 ? 27.288  34.128 40.868 1.00 43.89  ? 241  GLU A CG    1 
ATOM   2010 C  CD    . GLU A 1 259 ? 26.877  35.508 40.225 1.00 44.87  ? 241  GLU A CD    1 
ATOM   2011 O  OE1   . GLU A 1 259 ? 26.917  36.572 40.922 1.00 52.42  ? 241  GLU A OE1   1 
ATOM   2012 O  OE2   . GLU A 1 259 ? 26.503  35.503 39.001 1.00 46.81  ? 241  GLU A OE2   1 
ATOM   2013 N  N     . VAL A 1 260 ? 26.713  32.789 45.347 1.00 39.23  ? 242  VAL A N     1 
ATOM   2014 C  CA    . VAL A 1 260 ? 26.834  32.961 46.796 1.00 40.38  ? 242  VAL A CA    1 
ATOM   2015 C  C     . VAL A 1 260 ? 26.543  31.691 47.599 1.00 38.82  ? 242  VAL A C     1 
ATOM   2016 O  O     . VAL A 1 260 ? 26.695  31.683 48.804 1.00 39.89  ? 242  VAL A O     1 
ATOM   2017 C  CB    . VAL A 1 260 ? 25.914  34.090 47.329 1.00 41.47  ? 242  VAL A CB    1 
ATOM   2018 C  CG1   . VAL A 1 260 ? 26.265  35.425 46.668 1.00 44.15  ? 242  VAL A CG1   1 
ATOM   2019 C  CG2   . VAL A 1 260 ? 24.435  33.747 47.147 1.00 39.49  ? 242  VAL A CG2   1 
ATOM   2020 N  N     . GLY A 1 261 ? 26.097  30.626 46.938 1.00 36.09  ? 243  GLY A N     1 
ATOM   2021 C  CA    . GLY A 1 261 ? 25.751  29.408 47.641 1.00 34.77  ? 243  GLY A CA    1 
ATOM   2022 C  C     . GLY A 1 261 ? 25.550  28.249 46.706 1.00 32.04  ? 243  GLY A C     1 
ATOM   2023 O  O     . GLY A 1 261 ? 25.891  28.319 45.540 1.00 32.21  ? 243  GLY A O     1 
ATOM   2024 N  N     . LYS A 1 262 ? 25.008  27.178 47.252 1.00 28.72  ? 244  LYS A N     1 
ATOM   2025 C  CA    . LYS A 1 262 ? 24.757  25.972 46.531 1.00 26.16  ? 244  LYS A CA    1 
ATOM   2026 C  C     . LYS A 1 262 ? 23.265  25.988 46.169 1.00 24.71  ? 244  LYS A C     1 
ATOM   2027 O  O     . LYS A 1 262 ? 22.483  26.639 46.843 1.00 26.08  ? 244  LYS A O     1 
ATOM   2028 C  CB    . LYS A 1 262 ? 25.120  24.761 47.413 1.00 26.40  ? 244  LYS A CB    1 
ATOM   2029 C  CG    . LYS A 1 262 ? 26.663  24.596 47.536 1.00 27.57  ? 244  LYS A CG    1 
ATOM   2030 C  CD    . LYS A 1 262 ? 27.021  23.664 48.572 1.00 31.50  ? 244  LYS A CD    1 
ATOM   2031 C  CE    . LYS A 1 262 ? 28.538  23.589 48.719 1.00 32.79  ? 244  LYS A CE    1 
ATOM   2032 N  NZ    . LYS A 1 262 ? 28.859  22.481 49.669 1.00 37.93  ? 244  LYS A NZ    1 
ATOM   2033 N  N     . VAL A 1 263 ? 22.919  25.305 45.092 1.00 22.41  ? 245  VAL A N     1 
ATOM   2034 C  CA    . VAL A 1 263 ? 21.567  25.227 44.580 1.00 21.13  ? 245  VAL A CA    1 
ATOM   2035 C  C     . VAL A 1 263 ? 21.231  23.741 44.379 1.00 20.11  ? 245  VAL A C     1 
ATOM   2036 O  O     . VAL A 1 263 ? 22.027  22.976 43.818 1.00 21.91  ? 245  VAL A O     1 
ATOM   2037 C  CB    . VAL A 1 263 ? 21.446  26.014 43.275 1.00 20.42  ? 245  VAL A CB    1 
ATOM   2038 C  CG1   . VAL A 1 263 ? 20.033  25.884 42.688 1.00 18.51  ? 245  VAL A CG1   1 
ATOM   2039 C  CG2   . VAL A 1 263 ? 21.927  27.506 43.490 1.00 21.55  ? 245  VAL A CG2   1 
ATOM   2040 N  N     . PHE A 1 264 ? 20.070  23.340 44.861 1.00 20.00  ? 246  PHE A N     1 
ATOM   2041 C  CA    . PHE A 1 264 ? 19.586  21.965 44.671 1.00 18.93  ? 246  PHE A CA    1 
ATOM   2042 C  C     . PHE A 1 264 ? 18.141  21.936 44.188 1.00 18.76  ? 246  PHE A C     1 
ATOM   2043 O  O     . PHE A 1 264 ? 17.378  22.888 44.374 1.00 19.05  ? 246  PHE A O     1 
ATOM   2044 C  CB    . PHE A 1 264 ? 19.809  21.092 45.903 1.00 19.56  ? 246  PHE A CB    1 
ATOM   2045 C  CG    . PHE A 1 264 ? 18.948  21.407 47.102 1.00 18.99  ? 246  PHE A CG    1 
ATOM   2046 C  CD1   . PHE A 1 264 ? 17.717  20.787 47.276 1.00 22.03  ? 246  PHE A CD1   1 
ATOM   2047 C  CD2   . PHE A 1 264 ? 19.410  22.264 48.109 1.00 20.92  ? 246  PHE A CD2   1 
ATOM   2048 C  CE1   . PHE A 1 264 ? 16.955  20.993 48.425 1.00 19.89  ? 246  PHE A CE1   1 
ATOM   2049 C  CE2   . PHE A 1 264 ? 18.647  22.494 49.248 1.00 18.88  ? 246  PHE A CE2   1 
ATOM   2050 C  CZ    . PHE A 1 264 ? 17.423  21.844 49.420 1.00 18.77  ? 246  PHE A CZ    1 
ATOM   2051 N  N     . LEU A 1 265 ? 17.818  20.833 43.551 1.00 18.83  ? 247  LEU A N     1 
ATOM   2052 C  CA    . LEU A 1 265 ? 16.472  20.505 43.096 1.00 19.13  ? 247  LEU A CA    1 
ATOM   2053 C  C     . LEU A 1 265 ? 16.005  19.246 43.840 1.00 19.77  ? 247  LEU A C     1 
ATOM   2054 O  O     . LEU A 1 265 ? 16.723  18.252 43.935 1.00 20.48  ? 247  LEU A O     1 
ATOM   2055 C  CB    . LEU A 1 265 ? 16.461  20.229 41.581 1.00 19.17  ? 247  LEU A CB    1 
ATOM   2056 C  CG    . LEU A 1 265 ? 15.067  20.063 40.958 1.00 19.85  ? 247  LEU A CG    1 
ATOM   2057 C  CD1   . LEU A 1 265 ? 14.291  21.403 40.940 1.00 20.93  ? 247  LEU A CD1   1 
ATOM   2058 C  CD2   . LEU A 1 265 ? 15.194  19.459 39.554 1.00 21.60  ? 247  LEU A CD2   1 
ATOM   2059 N  N     . ALA A 1 266 ? 14.782  19.301 44.361 1.00 19.69  ? 248  ALA A N     1 
ATOM   2060 C  CA    . ALA A 1 266 ? 14.161  18.160 45.032 1.00 19.71  ? 248  ALA A CA    1 
ATOM   2061 C  C     . ALA A 1 266 ? 12.723  18.095 44.545 1.00 20.26  ? 248  ALA A C     1 
ATOM   2062 O  O     . ALA A 1 266 ? 11.935  18.992 44.840 1.00 23.60  ? 248  ALA A O     1 
ATOM   2063 C  CB    . ALA A 1 266 ? 14.243  18.322 46.586 1.00 21.01  ? 248  ALA A CB    1 
ATOM   2064 N  N     . THR A 1 267 ? 12.386  17.077 43.751 1.00 17.97  ? 249  THR A N     1 
ATOM   2065 C  CA    . THR A 1 267 ? 11.059  16.954 43.165 1.00 18.34  ? 249  THR A CA    1 
ATOM   2066 C  C     . THR A 1 267 ? 10.481  15.578 43.477 1.00 17.11  ? 249  THR A C     1 
ATOM   2067 O  O     . THR A 1 267 ? 11.188  14.591 43.462 1.00 16.28  ? 249  THR A O     1 
ATOM   2068 C  CB    . THR A 1 267 ? 11.069  17.206 41.599 1.00 18.09  ? 249  THR A CB    1 
ATOM   2069 O  OG1   . THR A 1 267 ? 9.780   16.933 41.033 1.00 19.64  ? 249  THR A OG1   1 
ATOM   2070 C  CG2   . THR A 1 267 ? 12.135  16.409 40.892 1.00 20.45  ? 249  THR A CG2   1 
ATOM   2071 N  N     . ASN A 1 268 ? 9.176   15.541 43.662 1.00 18.21  ? 250  ASN A N     1 
ATOM   2072 C  CA    . ASN A 1 268 ? 8.443   14.279 43.682 1.00 18.59  ? 250  ASN A CA    1 
ATOM   2073 C  C     . ASN A 1 268 ? 8.345   13.627 42.301 1.00 19.78  ? 250  ASN A C     1 
ATOM   2074 O  O     . ASN A 1 268 ? 8.081   12.446 42.220 1.00 19.54  ? 250  ASN A O     1 
ATOM   2075 C  CB    . ASN A 1 268 ? 7.017   14.422 44.306 1.00 19.45  ? 250  ASN A CB    1 
ATOM   2076 C  CG    . ASN A 1 268 ? 7.060   14.370 45.823 1.00 19.95  ? 250  ASN A CG    1 
ATOM   2077 O  OD1   . ASN A 1 268 ? 8.138   14.415 46.386 1.00 21.06  ? 250  ASN A OD1   1 
ATOM   2078 N  ND2   . ASN A 1 268 ? 5.905   14.248 46.481 1.00 18.74  ? 250  ASN A ND2   1 
ATOM   2079 N  N     A SER A 1 269 ? 8.621   14.381 41.246 0.50 19.38  ? 251  SER A N     1 
ATOM   2080 N  N     B SER A 1 269 ? 8.586   14.386 41.230 0.50 19.64  ? 251  SER A N     1 
ATOM   2081 C  CA    A SER A 1 269 ? 8.559   13.850 39.887 0.50 20.06  ? 251  SER A CA    1 
ATOM   2082 C  CA    B SER A 1 269 ? 8.565   13.829 39.862 0.50 20.50  ? 251  SER A CA    1 
ATOM   2083 C  C     A SER A 1 269 ? 9.723   12.906 39.532 0.50 19.90  ? 251  SER A C     1 
ATOM   2084 C  C     B SER A 1 269 ? 9.705   12.861 39.559 0.50 20.16  ? 251  SER A C     1 
ATOM   2085 O  O     A SER A 1 269 ? 10.744  12.877 40.203 0.50 20.05  ? 251  SER A O     1 
ATOM   2086 O  O     B SER A 1 269 ? 10.684  12.770 40.283 0.50 20.37  ? 251  SER A O     1 
ATOM   2087 C  CB    A SER A 1 269 ? 8.493   15.004 38.892 0.50 20.37  ? 251  SER A CB    1 
ATOM   2088 C  CB    B SER A 1 269 ? 8.577   14.935 38.800 0.50 20.97  ? 251  SER A CB    1 
ATOM   2089 O  OG    A SER A 1 269 ? 7.910   14.565 37.698 0.50 20.34  ? 251  SER A OG    1 
ATOM   2090 O  OG    B SER A 1 269 ? 7.366   15.647 38.807 0.50 22.94  ? 251  SER A OG    1 
ATOM   2091 N  N     . ASP A 1 270 ? 9.547   12.139 38.458 1.00 21.31  ? 252  ASP A N     1 
ATOM   2092 C  CA    . ASP A 1 270 ? 10.563  11.205 37.960 1.00 22.30  ? 252  ASP A CA    1 
ATOM   2093 C  C     . ASP A 1 270 ? 11.532  11.986 37.088 1.00 21.93  ? 252  ASP A C     1 
ATOM   2094 O  O     . ASP A 1 270 ? 11.249  13.137 36.641 1.00 21.16  ? 252  ASP A O     1 
ATOM   2095 C  CB    . ASP A 1 270 ? 9.906   10.107 37.103 1.00 24.81  ? 252  ASP A CB    1 
ATOM   2096 C  CG    . ASP A 1 270 ? 9.054   10.708 35.937 1.00 27.68  ? 252  ASP A CG    1 
ATOM   2097 O  OD1   . ASP A 1 270 ? 9.568   10.783 34.826 1.00 30.87  ? 252  ASP A OD1   1 
ATOM   2098 O  OD2   . ASP A 1 270 ? 7.902   11.209 36.154 1.00 38.04  ? 252  ASP A OD2   1 
ATOM   2099 N  N     . TYR A 1 271 ? 12.679  11.374 36.835 1.00 21.93  ? 253  TYR A N     1 
ATOM   2100 C  CA    . TYR A 1 271 ? 13.703  12.038 36.048 1.00 22.04  ? 253  TYR A CA    1 
ATOM   2101 C  C     . TYR A 1 271 ? 13.298  12.355 34.600 1.00 22.23  ? 253  TYR A C     1 
ATOM   2102 O  O     . TYR A 1 271 ? 13.587  13.436 34.116 1.00 21.83  ? 253  TYR A O     1 
ATOM   2103 C  CB    . TYR A 1 271 ? 15.043  11.256 36.072 1.00 22.34  ? 253  TYR A CB    1 
ATOM   2104 C  CG    . TYR A 1 271 ? 16.128  12.011 35.343 1.00 23.01  ? 253  TYR A CG    1 
ATOM   2105 C  CD1   . TYR A 1 271 ? 16.694  13.164 35.888 1.00 23.46  ? 253  TYR A CD1   1 
ATOM   2106 C  CD2   . TYR A 1 271 ? 16.524  11.639 34.062 1.00 24.92  ? 253  TYR A CD2   1 
ATOM   2107 C  CE1   . TYR A 1 271 ? 17.661  13.880 35.207 1.00 23.12  ? 253  TYR A CE1   1 
ATOM   2108 C  CE2   . TYR A 1 271 ? 17.466  12.356 33.381 1.00 22.36  ? 253  TYR A CE2   1 
ATOM   2109 C  CZ    . TYR A 1 271 ? 18.032  13.484 33.960 1.00 24.91  ? 253  TYR A CZ    1 
ATOM   2110 O  OH    . TYR A 1 271 ? 18.984  14.195 33.275 1.00 25.64  ? 253  TYR A OH    1 
ATOM   2111 N  N     . LYS A 1 272 ? 12.657  11.424 33.903 1.00 22.39  ? 254  LYS A N     1 
ATOM   2112 C  CA    . LYS A 1 272 ? 12.331  11.661 32.481 1.00 23.99  ? 254  LYS A CA    1 
ATOM   2113 C  C     . LYS A 1 272 ? 11.425  12.890 32.303 1.00 21.48  ? 254  LYS A C     1 
ATOM   2114 O  O     . LYS A 1 272 ? 11.655  13.726 31.433 1.00 22.28  ? 254  LYS A O     1 
ATOM   2115 C  CB    . LYS A 1 272 ? 11.672  10.452 31.868 1.00 25.39  ? 254  LYS A CB    1 
ATOM   2116 C  CG    . LYS A 1 272 ? 12.668  9.394  31.563 1.00 30.52  ? 254  LYS A CG    1 
ATOM   2117 C  CD    . LYS A 1 272 ? 12.075  8.230  30.798 1.00 34.12  ? 254  LYS A CD    1 
ATOM   2118 C  CE    . LYS A 1 272 ? 13.157  7.239  30.401 1.00 39.10  ? 254  LYS A CE    1 
ATOM   2119 N  NZ    . LYS A 1 272 ? 13.050  5.936  31.198 1.00 45.09  ? 254  LYS A NZ    1 
ATOM   2120 N  N     . TYR A 1 273 ? 10.432  13.011 33.167 1.00 20.41  ? 255  TYR A N     1 
ATOM   2121 C  CA    . TYR A 1 273 ? 9.541   14.171 33.123 1.00 21.41  ? 255  TYR A CA    1 
ATOM   2122 C  C     . TYR A 1 273 ? 10.259  15.460 33.553 1.00 20.65  ? 255  TYR A C     1 
ATOM   2123 O  O     . TYR A 1 273 ? 10.130  16.511 32.902 1.00 19.79  ? 255  TYR A O     1 
ATOM   2124 C  CB    . TYR A 1 273 ? 8.323   13.941 33.981 1.00 21.06  ? 255  TYR A CB    1 
ATOM   2125 C  CG    . TYR A 1 273 ? 7.313   15.065 33.898 1.00 20.59  ? 255  TYR A CG    1 
ATOM   2126 C  CD1   . TYR A 1 273 ? 6.550   15.254 32.745 1.00 23.46  ? 255  TYR A CD1   1 
ATOM   2127 C  CD2   . TYR A 1 273 ? 7.072   15.899 35.003 1.00 21.96  ? 255  TYR A CD2   1 
ATOM   2128 C  CE1   . TYR A 1 273 ? 5.582   16.259 32.658 1.00 22.94  ? 255  TYR A CE1   1 
ATOM   2129 C  CE2   . TYR A 1 273 ? 6.114   16.929 34.935 1.00 22.75  ? 255  TYR A CE2   1 
ATOM   2130 C  CZ    . TYR A 1 273 ? 5.377   17.107 33.762 1.00 23.76  ? 255  TYR A CZ    1 
ATOM   2131 O  OH    . TYR A 1 273 ? 4.419   18.116 33.651 1.00 23.74  ? 255  TYR A OH    1 
ATOM   2132 N  N     . THR A 1 274 ? 11.019  15.362 34.632 1.00 20.98  ? 256  THR A N     1 
ATOM   2133 C  CA    . THR A 1 274 ? 11.839  16.484 35.117 1.00 20.51  ? 256  THR A CA    1 
ATOM   2134 C  C     . THR A 1 274 ? 12.771  17.031 34.015 1.00 21.29  ? 256  THR A C     1 
ATOM   2135 O  O     . THR A 1 274 ? 12.879  18.246 33.825 1.00 20.42  ? 256  THR A O     1 
ATOM   2136 C  CB    . THR A 1 274 ? 12.676  16.065 36.374 1.00 21.12  ? 256  THR A CB    1 
ATOM   2137 O  OG1   . THR A 1 274 ? 11.791  15.674 37.418 1.00 22.47  ? 256  THR A OG1   1 
ATOM   2138 C  CG2   . THR A 1 274 ? 13.607  17.247 36.880 1.00 19.14  ? 256  THR A CG2   1 
ATOM   2139 N  N     . ASP A 1 275 ? 13.445  16.132 33.298 1.00 21.71  ? 257  ASP A N     1 
ATOM   2140 C  CA    . ASP A 1 275 ? 14.344  16.507 32.220 1.00 21.48  ? 257  ASP A CA    1 
ATOM   2141 C  C     . ASP A 1 275 ? 13.572  17.258 31.117 1.00 22.33  ? 257  ASP A C     1 
ATOM   2142 O  O     . ASP A 1 275 ? 14.025  18.312 30.655 1.00 21.65  ? 257  ASP A O     1 
ATOM   2143 C  CB    . ASP A 1 275 ? 15.036  15.272 31.680 1.00 22.33  ? 257  ASP A CB    1 
ATOM   2144 C  CG    . ASP A 1 275 ? 16.191  15.586 30.738 1.00 24.90  ? 257  ASP A CG    1 
ATOM   2145 O  OD1   . ASP A 1 275 ? 16.740  16.720 30.720 1.00 25.05  ? 257  ASP A OD1   1 
ATOM   2146 O  OD2   . ASP A 1 275 ? 16.569  14.649 30.017 1.00 28.36  ? 257  ASP A OD2   1 
ATOM   2147 N  N     . LYS A 1 276 ? 12.396  16.762 30.726 1.00 22.08  ? 258  LYS A N     1 
ATOM   2148 C  CA    . LYS A 1 276 ? 11.620  17.415 29.653 1.00 23.93  ? 258  LYS A CA    1 
ATOM   2149 C  C     . LYS A 1 276 ? 11.164  18.829 30.055 1.00 21.97  ? 258  LYS A C     1 
ATOM   2150 O  O     . LYS A 1 276 ? 11.304  19.788 29.296 1.00 20.80  ? 258  LYS A O     1 
ATOM   2151 C  CB    . LYS A 1 276 ? 10.430  16.551 29.233 1.00 24.55  ? 258  LYS A CB    1 
ATOM   2152 C  CG    . LYS A 1 276 ? 10.892  15.373 28.403 1.00 29.86  ? 258  LYS A CG    1 
ATOM   2153 C  CD    . LYS A 1 276 ? 9.764   14.613 27.753 1.00 35.20  ? 258  LYS A CD    1 
ATOM   2154 C  CE    . LYS A 1 276 ? 9.228   13.498 28.653 1.00 42.96  ? 258  LYS A CE    1 
ATOM   2155 N  NZ    . LYS A 1 276 ? 9.816   12.098 28.384 1.00 47.22  ? 258  LYS A NZ    1 
ATOM   2156 N  N     . ILE A 1 277 ? 10.650  18.939 31.272 1.00 21.80  ? 259  ILE A N     1 
ATOM   2157 C  CA    . ILE A 1 277 ? 10.197  20.230 31.827 1.00 22.13  ? 259  ILE A CA    1 
ATOM   2158 C  C     . ILE A 1 277 ? 11.322  21.222 32.046 1.00 22.38  ? 259  ILE A C     1 
ATOM   2159 O  O     . ILE A 1 277 ? 11.241  22.384 31.596 1.00 21.96  ? 259  ILE A O     1 
ATOM   2160 C  CB    . ILE A 1 277 ? 9.402   20.019 33.132 1.00 22.05  ? 259  ILE A CB    1 
ATOM   2161 C  CG1   . ILE A 1 277 ? 8.102   19.213 32.867 1.00 21.43  ? 259  ILE A CG1   1 
ATOM   2162 C  CG2   . ILE A 1 277 ? 9.086   21.357 33.830 1.00 22.13  ? 259  ILE A CG2   1 
ATOM   2163 C  CD1   . ILE A 1 277 ? 7.090   19.776 31.863 1.00 21.54  ? 259  ILE A CD1   1 
ATOM   2164 N  N     . MET A 1 278 ? 12.384  20.769 32.711 1.00 21.32  ? 260  MET A N     1 
ATOM   2165 C  CA    . MET A 1 278 ? 13.527  21.647 32.980 1.00 21.08  ? 260  MET A CA    1 
ATOM   2166 C  C     . MET A 1 278 ? 14.247  22.079 31.684 1.00 21.91  ? 260  MET A C     1 
ATOM   2167 O  O     . MET A 1 278 ? 14.652  23.238 31.567 1.00 22.40  ? 260  MET A O     1 
ATOM   2168 C  CB    . MET A 1 278 ? 14.493  20.989 33.945 1.00 18.96  ? 260  MET A CB    1 
ATOM   2169 C  CG    . MET A 1 278 ? 13.962  20.703 35.373 1.00 20.10  ? 260  MET A CG    1 
ATOM   2170 S  SD    . MET A 1 278 ? 13.522  22.185 36.278 1.00 23.84  ? 260  MET A SD    1 
ATOM   2171 C  CE    . MET A 1 278 ? 15.190  22.784 36.695 1.00 26.53  ? 260  MET A CE    1 
ATOM   2172 N  N     . THR A 1 279 ? 14.349  21.174 30.705 1.00 21.64  ? 261  THR A N     1 
ATOM   2173 C  CA    . THR A 1 279 ? 14.862  21.549 29.413 1.00 22.01  ? 261  THR A CA    1 
ATOM   2174 C  C     . THR A 1 279 ? 14.097  22.697 28.786 1.00 22.60  ? 261  THR A C     1 
ATOM   2175 O  O     . THR A 1 279 ? 14.681  23.658 28.249 1.00 23.61  ? 261  THR A O     1 
ATOM   2176 C  CB    . THR A 1 279 ? 14.980  20.348 28.467 1.00 22.42  ? 261  THR A CB    1 
ATOM   2177 O  OG1   . THR A 1 279 ? 15.832  19.374 29.095 1.00 21.94  ? 261  THR A OG1   1 
ATOM   2178 C  CG2   . THR A 1 279 ? 15.556  20.817 27.083 1.00 21.68  ? 261  THR A CG2   1 
ATOM   2179 N  N     . TYR A 1 280 ? 12.784  22.586 28.842 1.00 23.57  ? 262  TYR A N     1 
ATOM   2180 C  CA    . TYR A 1 280 ? 11.893  23.615 28.331 1.00 24.07  ? 262  TYR A CA    1 
ATOM   2181 C  C     . TYR A 1 280 ? 12.084  24.948 29.086 1.00 23.56  ? 262  TYR A C     1 
ATOM   2182 O  O     . TYR A 1 280 ? 12.223  25.967 28.453 1.00 24.54  ? 262  TYR A O     1 
ATOM   2183 C  CB    . TYR A 1 280 ? 10.430  23.141 28.384 1.00 24.80  ? 262  TYR A CB    1 
ATOM   2184 C  CG    . TYR A 1 280 ? 9.430   24.246 28.108 1.00 25.43  ? 262  TYR A CG    1 
ATOM   2185 C  CD1   . TYR A 1 280 ? 9.194   24.729 26.820 1.00 28.09  ? 262  TYR A CD1   1 
ATOM   2186 C  CD2   . TYR A 1 280 ? 8.725   24.812 29.169 1.00 28.14  ? 262  TYR A CD2   1 
ATOM   2187 C  CE1   . TYR A 1 280 ? 8.241   25.777 26.606 1.00 29.67  ? 262  TYR A CE1   1 
ATOM   2188 C  CE2   . TYR A 1 280 ? 7.804   25.823 28.964 1.00 26.94  ? 262  TYR A CE2   1 
ATOM   2189 C  CZ    . TYR A 1 280 ? 7.562   26.294 27.734 1.00 26.82  ? 262  TYR A CZ    1 
ATOM   2190 O  OH    . TYR A 1 280 ? 6.602   27.315 27.653 1.00 33.69  ? 262  TYR A OH    1 
ATOM   2191 N  N     . LEU A 1 281 ? 12.108  24.911 30.419 1.00 24.06  ? 263  LEU A N     1 
ATOM   2192 C  CA    . LEU A 1 281 ? 12.270  26.104 31.252 1.00 23.58  ? 263  LEU A CA    1 
ATOM   2193 C  C     . LEU A 1 281 ? 13.566  26.868 30.959 1.00 23.87  ? 263  LEU A C     1 
ATOM   2194 O  O     . LEU A 1 281 ? 13.624  28.096 31.171 1.00 25.05  ? 263  LEU A O     1 
ATOM   2195 C  CB    . LEU A 1 281 ? 12.190  25.726 32.747 1.00 22.73  ? 263  LEU A CB    1 
ATOM   2196 C  CG    . LEU A 1 281 ? 10.811  25.231 33.259 1.00 22.40  ? 263  LEU A CG    1 
ATOM   2197 C  CD1   . LEU A 1 281 ? 10.980  24.837 34.747 1.00 20.25  ? 263  LEU A CD1   1 
ATOM   2198 C  CD2   . LEU A 1 281 ? 9.748   26.293 32.977 1.00 22.38  ? 263  LEU A CD2   1 
ATOM   2199 N  N     . PHE A 1 282 ? 14.582  26.158 30.467 1.00 22.26  ? 264  PHE A N     1 
ATOM   2200 C  CA    . PHE A 1 282 ? 15.870  26.767 30.134 1.00 22.23  ? 264  PHE A CA    1 
ATOM   2201 C  C     . PHE A 1 282 ? 16.092  26.947 28.627 1.00 23.73  ? 264  PHE A C     1 
ATOM   2202 O  O     . PHE A 1 282 ? 17.169  27.363 28.192 1.00 24.49  ? 264  PHE A O     1 
ATOM   2203 C  CB    . PHE A 1 282 ? 16.989  25.948 30.752 1.00 21.51  ? 264  PHE A CB    1 
ATOM   2204 C  CG    . PHE A 1 282 ? 17.128  26.153 32.236 1.00 21.29  ? 264  PHE A CG    1 
ATOM   2205 C  CD1   . PHE A 1 282 ? 18.124  26.969 32.746 1.00 22.06  ? 264  PHE A CD1   1 
ATOM   2206 C  CD2   . PHE A 1 282 ? 16.247  25.538 33.119 1.00 22.55  ? 264  PHE A CD2   1 
ATOM   2207 C  CE1   . PHE A 1 282 ? 18.250  27.150 34.125 1.00 21.38  ? 264  PHE A CE1   1 
ATOM   2208 C  CE2   . PHE A 1 282 ? 16.372  25.704 34.482 1.00 22.01  ? 264  PHE A CE2   1 
ATOM   2209 C  CZ    . PHE A 1 282 ? 17.372  26.540 34.979 1.00 23.15  ? 264  PHE A CZ    1 
ATOM   2210 N  N     . ASP A 1 283 ? 15.074  26.674 27.818 1.00 24.78  ? 265  ASP A N     1 
ATOM   2211 C  CA    . ASP A 1 283 ? 15.262  26.743 26.370 1.00 25.58  ? 265  ASP A CA    1 
ATOM   2212 C  C     . ASP A 1 283 ? 15.102  28.176 25.857 1.00 26.77  ? 265  ASP A C     1 
ATOM   2213 O  O     . ASP A 1 283 ? 14.004  28.624 25.517 1.00 28.15  ? 265  ASP A O     1 
ATOM   2214 C  CB    . ASP A 1 283 ? 14.314  25.782 25.671 1.00 26.64  ? 265  ASP A CB    1 
ATOM   2215 C  CG    . ASP A 1 283 ? 14.433  25.845 24.160 1.00 30.20  ? 265  ASP A CG    1 
ATOM   2216 O  OD1   . ASP A 1 283 ? 15.571  26.036 23.618 1.00 31.51  ? 265  ASP A OD1   1 
ATOM   2217 O  OD2   . ASP A 1 283 ? 13.366  25.693 23.549 1.00 35.15  ? 265  ASP A OD2   1 
ATOM   2218 N  N     . PHE A 1 284 ? 16.216  28.890 25.863 1.00 26.14  ? 266  PHE A N     1 
ATOM   2219 C  CA    . PHE A 1 284 ? 16.344  30.238 25.325 1.00 27.48  ? 266  PHE A CA    1 
ATOM   2220 C  C     . PHE A 1 284 ? 17.621  30.173 24.504 1.00 27.66  ? 266  PHE A C     1 
ATOM   2221 O  O     . PHE A 1 284 ? 18.460  29.317 24.779 1.00 27.11  ? 266  PHE A O     1 
ATOM   2222 C  CB    . PHE A 1 284 ? 16.509  31.263 26.453 1.00 27.31  ? 266  PHE A CB    1 
ATOM   2223 C  CG    . PHE A 1 284 ? 15.325  31.345 27.347 1.00 27.68  ? 266  PHE A CG    1 
ATOM   2224 C  CD1   . PHE A 1 284 ? 14.239  32.133 27.001 1.00 29.08  ? 266  PHE A CD1   1 
ATOM   2225 C  CD2   . PHE A 1 284 ? 15.287  30.631 28.541 1.00 24.67  ? 266  PHE A CD2   1 
ATOM   2226 C  CE1   . PHE A 1 284 ? 13.124  32.172 27.837 1.00 28.85  ? 266  PHE A CE1   1 
ATOM   2227 C  CE2   . PHE A 1 284 ? 14.174  30.679 29.352 1.00 26.71  ? 266  PHE A CE2   1 
ATOM   2228 C  CZ    . PHE A 1 284 ? 13.111  31.441 28.992 1.00 25.81  ? 266  PHE A CZ    1 
ATOM   2229 N  N     . PRO A 1 285 ? 17.805  31.097 23.545 1.00 29.17  ? 267  PRO A N     1 
ATOM   2230 C  CA    . PRO A 1 285 ? 19.033  31.113 22.752 1.00 30.45  ? 267  PRO A CA    1 
ATOM   2231 C  C     . PRO A 1 285 ? 20.226  31.721 23.526 1.00 31.23  ? 267  PRO A C     1 
ATOM   2232 O  O     . PRO A 1 285 ? 21.130  32.305 22.908 1.00 35.20  ? 267  PRO A O     1 
ATOM   2233 C  CB    . PRO A 1 285 ? 18.648  31.983 21.552 1.00 31.42  ? 267  PRO A CB    1 
ATOM   2234 C  CG    . PRO A 1 285 ? 17.624  32.915 22.063 1.00 31.51  ? 267  PRO A CG    1 
ATOM   2235 C  CD    . PRO A 1 285 ? 16.887  32.187 23.161 1.00 30.52  ? 267  PRO A CD    1 
ATOM   2236 N  N     . HIS A 1 286 ? 20.212  31.609 24.839 1.00 29.12  ? 268  HIS A N     1 
ATOM   2237 C  CA    . HIS A 1 286 ? 21.249  32.167 25.712 1.00 29.33  ? 268  HIS A CA    1 
ATOM   2238 C  C     . HIS A 1 286 ? 21.220  31.463 27.064 1.00 27.91  ? 268  HIS A C     1 
ATOM   2239 O  O     . HIS A 1 286 ? 20.326  30.673 27.363 1.00 26.32  ? 268  HIS A O     1 
ATOM   2240 C  CB    . HIS A 1 286 ? 21.071  33.695 25.901 1.00 30.79  ? 268  HIS A CB    1 
ATOM   2241 C  CG    . HIS A 1 286 ? 19.777  34.080 26.535 1.00 31.34  ? 268  HIS A CG    1 
ATOM   2242 N  ND1   . HIS A 1 286 ? 19.477  33.790 27.848 1.00 34.65  ? 268  HIS A ND1   1 
ATOM   2243 C  CD2   . HIS A 1 286 ? 18.684  34.693 26.025 1.00 34.57  ? 268  HIS A CD2   1 
ATOM   2244 C  CE1   . HIS A 1 286 ? 18.261  34.224 28.126 1.00 34.28  ? 268  HIS A CE1   1 
ATOM   2245 N  NE2   . HIS A 1 286 ? 17.756  34.759 27.035 1.00 33.57  ? 268  HIS A NE2   1 
ATOM   2246 N  N     . GLY A 1 287 ? 22.211  31.761 27.882 1.00 28.06  ? 269  GLY A N     1 
ATOM   2247 C  CA    . GLY A 1 287 ? 22.305  31.228 29.209 1.00 27.69  ? 269  GLY A CA    1 
ATOM   2248 C  C     . GLY A 1 287 ? 21.614  32.195 30.178 1.00 28.51  ? 269  GLY A C     1 
ATOM   2249 O  O     . GLY A 1 287 ? 20.542  32.734 29.850 1.00 29.62  ? 269  GLY A O     1 
ATOM   2250 N  N     . PRO A 1 288 ? 22.266  32.493 31.311 1.00 28.22  ? 270  PRO A N     1 
ATOM   2251 C  CA    . PRO A 1 288 ? 21.722  33.384 32.349 1.00 28.98  ? 270  PRO A CA    1 
ATOM   2252 C  C     . PRO A 1 288 ? 21.230  34.710 31.828 1.00 30.78  ? 270  PRO A C     1 
ATOM   2253 O  O     . PRO A 1 288 ? 20.170  35.177 32.270 1.00 31.99  ? 270  PRO A O     1 
ATOM   2254 C  CB    . PRO A 1 288 ? 22.916  33.634 33.275 1.00 29.85  ? 270  PRO A CB    1 
ATOM   2255 C  CG    . PRO A 1 288 ? 23.705  32.474 33.207 1.00 30.44  ? 270  PRO A CG    1 
ATOM   2256 C  CD    . PRO A 1 288 ? 23.607  32.018 31.685 1.00 27.50  ? 270  PRO A CD    1 
ATOM   2257 N  N     . LYS A 1 289 ? 22.015  35.357 30.949 1.00 31.00  ? 271  LYS A N     1 
ATOM   2258 C  CA    . LYS A 1 289 ? 21.596  36.611 30.328 1.00 31.86  ? 271  LYS A CA    1 
ATOM   2259 C  C     . LYS A 1 289 ? 21.768  36.545 28.819 1.00 30.74  ? 271  LYS A C     1 
ATOM   2260 O  O     . LYS A 1 289 ? 22.537  35.725 28.308 1.00 27.87  ? 271  LYS A O     1 
ATOM   2261 C  CB    . LYS A 1 289 ? 22.329  37.823 30.898 1.00 34.46  ? 271  LYS A CB    1 
ATOM   2262 C  CG    . LYS A 1 289 ? 23.744  37.547 31.234 1.00 36.95  ? 271  LYS A CG    1 
ATOM   2263 C  CD    . LYS A 1 289 ? 24.525  38.769 31.728 1.00 39.09  ? 271  LYS A CD    1 
ATOM   2264 C  CE    . LYS A 1 289 ? 26.065  38.543 31.440 1.00 40.23  ? 271  LYS A CE    1 
ATOM   2265 N  NZ    . LYS A 1 289 ? 26.990  39.635 31.967 1.00 36.81  ? 271  LYS A NZ    1 
ATOM   2266 N  N     . PRO A 1 290 ? 21.014  37.384 28.099 1.00 30.86  ? 272  PRO A N     1 
ATOM   2267 C  CA    . PRO A 1 290 ? 21.193  37.545 26.680 1.00 30.38  ? 272  PRO A CA    1 
ATOM   2268 C  C     . PRO A 1 290 ? 22.654  37.792 26.318 1.00 29.83  ? 272  PRO A C     1 
ATOM   2269 O  O     . PRO A 1 290 ? 23.360  38.526 27.031 1.00 28.40  ? 272  PRO A O     1 
ATOM   2270 C  CB    . PRO A 1 290 ? 20.327  38.764 26.354 1.00 32.34  ? 272  PRO A CB    1 
ATOM   2271 C  CG    . PRO A 1 290 ? 19.304  38.770 27.386 1.00 31.90  ? 272  PRO A CG    1 
ATOM   2272 C  CD    . PRO A 1 290 ? 19.895  38.203 28.609 1.00 32.61  ? 272  PRO A CD    1 
ATOM   2273 N  N     . GLY A 1 291 ? 23.093  37.136 25.243 1.00 27.87  ? 273  GLY A N     1 
ATOM   2274 C  CA    . GLY A 1 291 ? 24.465  37.224 24.811 1.00 29.02  ? 273  GLY A CA    1 
ATOM   2275 C  C     . GLY A 1 291 ? 25.353  36.130 25.366 1.00 27.85  ? 273  GLY A C     1 
ATOM   2276 O  O     . GLY A 1 291 ? 26.410  35.886 24.809 1.00 28.56  ? 273  GLY A O     1 
ATOM   2277 N  N     . SER A 1 292 ? 24.916  35.462 26.447 1.00 26.04  ? 274  SER A N     1 
ATOM   2278 C  CA    . SER A 1 292 ? 25.707  34.398 27.067 1.00 25.32  ? 274  SER A CA    1 
ATOM   2279 C  C     . SER A 1 292 ? 25.404  33.034 26.449 1.00 24.90  ? 274  SER A C     1 
ATOM   2280 O  O     . SER A 1 292 ? 24.285  32.779 25.969 1.00 25.00  ? 274  SER A O     1 
ATOM   2281 C  CB    . SER A 1 292 ? 25.508  34.373 28.570 1.00 25.77  ? 274  SER A CB    1 
ATOM   2282 O  OG    . SER A 1 292 ? 24.251  33.864 28.926 1.00 23.73  ? 274  SER A OG    1 
ATOM   2283 N  N     . SER A 1 293 ? 26.408  32.163 26.419 1.00 23.79  ? 275  SER A N     1 
ATOM   2284 C  CA    . SER A 1 293 ? 26.166  30.799 25.923 1.00 23.78  ? 275  SER A CA    1 
ATOM   2285 C  C     . SER A 1 293 ? 25.089  30.067 26.714 1.00 23.44  ? 275  SER A C     1 
ATOM   2286 O  O     . SER A 1 293 ? 25.054  30.092 27.958 1.00 22.26  ? 275  SER A O     1 
ATOM   2287 C  CB    . SER A 1 293 ? 27.451  29.977 25.933 1.00 22.77  ? 275  SER A CB    1 
ATOM   2288 O  OG    . SER A 1 293 ? 28.337  30.460 24.971 1.00 24.40  ? 275  SER A OG    1 
ATOM   2289 N  N     . HIS A 1 294 ? 24.204  29.385 26.000 1.00 23.97  ? 276  HIS A N     1 
ATOM   2290 C  CA    . HIS A 1 294 ? 23.267  28.480 26.660 1.00 22.94  ? 276  HIS A CA    1 
ATOM   2291 C  C     . HIS A 1 294 ? 24.008  27.360 27.371 1.00 23.47  ? 276  HIS A C     1 
ATOM   2292 O  O     . HIS A 1 294 ? 25.012  26.826 26.853 1.00 23.61  ? 276  HIS A O     1 
ATOM   2293 C  CB    . HIS A 1 294 ? 22.334  27.873 25.649 1.00 24.06  ? 276  HIS A CB    1 
ATOM   2294 C  CG    . HIS A 1 294 ? 21.313  26.959 26.244 1.00 22.90  ? 276  HIS A CG    1 
ATOM   2295 N  ND1   . HIS A 1 294 ? 21.550  25.612 26.443 1.00 25.04  ? 276  HIS A ND1   1 
ATOM   2296 C  CD2   . HIS A 1 294 ? 20.057  27.195 26.690 1.00 23.59  ? 276  HIS A CD2   1 
ATOM   2297 C  CE1   . HIS A 1 294 ? 20.473  25.058 26.977 1.00 26.36  ? 276  HIS A CE1   1 
ATOM   2298 N  NE2   . HIS A 1 294 ? 19.560  25.999 27.162 1.00 24.98  ? 276  HIS A NE2   1 
ATOM   2299 N  N     . ARG A 1 295 ? 23.502  27.009 28.547 1.00 23.42  ? 277  ARG A N     1 
ATOM   2300 C  CA    . ARG A 1 295 ? 24.047  25.924 29.358 1.00 25.26  ? 277  ARG A CA    1 
ATOM   2301 C  C     . ARG A 1 295 ? 22.908  24.943 29.704 1.00 23.98  ? 277  ARG A C     1 
ATOM   2302 O  O     . ARG A 1 295 ? 21.753  25.385 29.917 1.00 22.37  ? 277  ARG A O     1 
ATOM   2303 C  CB    . ARG A 1 295 ? 24.507  26.478 30.695 1.00 25.25  ? 277  ARG A CB    1 
ATOM   2304 C  CG    . ARG A 1 295 ? 25.498  27.572 30.694 1.00 29.17  ? 277  ARG A CG    1 
ATOM   2305 C  CD    . ARG A 1 295 ? 26.164  27.516 32.041 1.00 32.73  ? 277  ARG A CD    1 
ATOM   2306 N  NE    . ARG A 1 295 ? 25.802  28.589 32.931 1.00 37.98  ? 277  ARG A NE    1 
ATOM   2307 C  CZ    . ARG A 1 295 ? 25.384  28.458 34.200 1.00 39.26  ? 277  ARG A CZ    1 
ATOM   2308 N  NH1   . ARG A 1 295 ? 25.192  27.256 34.831 1.00 35.53  ? 277  ARG A NH1   1 
ATOM   2309 N  NH2   . ARG A 1 295 ? 25.144  29.593 34.853 1.00 37.39  ? 277  ARG A NH2   1 
ATOM   2310 N  N     . PRO A 1 296 ? 23.223  23.658 29.843 1.00 24.11  ? 278  PRO A N     1 
ATOM   2311 C  CA    . PRO A 1 296 ? 22.168  22.722 30.217 1.00 24.06  ? 278  PRO A CA    1 
ATOM   2312 C  C     . PRO A 1 296 ? 21.565  23.022 31.577 1.00 21.43  ? 278  PRO A C     1 
ATOM   2313 O  O     . PRO A 1 296 ? 22.274  23.451 32.469 1.00 21.26  ? 278  PRO A O     1 
ATOM   2314 C  CB    . PRO A 1 296 ? 22.887  21.374 30.283 1.00 24.05  ? 278  PRO A CB    1 
ATOM   2315 C  CG    . PRO A 1 296 ? 24.076  21.546 29.597 1.00 27.65  ? 278  PRO A CG    1 
ATOM   2316 C  CD    . PRO A 1 296 ? 24.503  22.972 29.658 1.00 26.81  ? 278  PRO A CD    1 
ATOM   2317 N  N     . TRP A 1 297 ? 20.273  22.757 31.739 1.00 21.91  ? 279  TRP A N     1 
ATOM   2318 C  CA    . TRP A 1 297 ? 19.628  22.964 33.032 1.00 20.74  ? 279  TRP A CA    1 
ATOM   2319 C  C     . TRP A 1 297 ? 20.371  22.337 34.222 1.00 19.49  ? 279  TRP A C     1 
ATOM   2320 O  O     . TRP A 1 297 ? 20.409  22.929 35.317 1.00 18.35  ? 279  TRP A O     1 
ATOM   2321 C  CB    . TRP A 1 297 ? 18.148  22.549 32.985 1.00 20.82  ? 279  TRP A CB    1 
ATOM   2322 C  CG    . TRP A 1 297 ? 17.859  21.090 32.966 1.00 18.92  ? 279  TRP A CG    1 
ATOM   2323 C  CD1   . TRP A 1 297 ? 17.600  20.345 31.898 1.00 20.40  ? 279  TRP A CD1   1 
ATOM   2324 C  CD2   . TRP A 1 297 ? 17.728  20.217 34.119 1.00 20.74  ? 279  TRP A CD2   1 
ATOM   2325 N  NE1   . TRP A 1 297 ? 17.337  19.028 32.274 1.00 21.10  ? 279  TRP A NE1   1 
ATOM   2326 C  CE2   . TRP A 1 297 ? 17.392  18.942 33.637 1.00 20.33  ? 279  TRP A CE2   1 
ATOM   2327 C  CE3   . TRP A 1 297 ? 17.865  20.407 35.508 1.00 21.09  ? 279  TRP A CE3   1 
ATOM   2328 C  CZ2   . TRP A 1 297 ? 17.202  17.835 34.484 1.00 21.64  ? 279  TRP A CZ2   1 
ATOM   2329 C  CZ3   . TRP A 1 297 ? 17.682  19.319 36.349 1.00 18.64  ? 279  TRP A CZ3   1 
ATOM   2330 C  CH2   . TRP A 1 297 ? 17.375  18.042 35.825 1.00 19.90  ? 279  TRP A CH2   1 
ATOM   2331 N  N     . GLN A 1 298 ? 20.980  21.162 34.016 1.00 19.49  ? 280  GLN A N     1 
ATOM   2332 C  CA    . GLN A 1 298 ? 21.579  20.443 35.136 1.00 20.30  ? 280  GLN A CA    1 
ATOM   2333 C  C     . GLN A 1 298 ? 22.804  21.217 35.708 1.00 21.26  ? 280  GLN A C     1 
ATOM   2334 O  O     . GLN A 1 298 ? 23.139  21.100 36.893 1.00 21.22  ? 280  GLN A O     1 
ATOM   2335 C  CB    . GLN A 1 298 ? 21.971  19.029 34.744 1.00 21.94  ? 280  GLN A CB    1 
ATOM   2336 C  CG    . GLN A 1 298 ? 20.840  18.130 34.323 1.00 21.02  ? 280  GLN A CG    1 
ATOM   2337 C  CD    . GLN A 1 298 ? 20.619  18.050 32.822 1.00 24.52  ? 280  GLN A CD    1 
ATOM   2338 O  OE1   . GLN A 1 298 ? 20.865  18.999 32.088 1.00 24.08  ? 280  GLN A OE1   1 
ATOM   2339 N  NE2   . GLN A 1 298 ? 20.079  16.924 32.376 1.00 25.44  ? 280  GLN A NE2   1 
ATOM   2340 N  N     . SER A 1 299 ? 23.426  22.045 34.873 1.00 21.70  ? 281  SER A N     1 
ATOM   2341 C  CA    . SER A 1 299 ? 24.610  22.817 35.255 1.00 22.35  ? 281  SER A CA    1 
ATOM   2342 C  C     . SER A 1 299 ? 24.298  23.889 36.328 1.00 21.41  ? 281  SER A C     1 
ATOM   2343 O  O     . SER A 1 299 ? 25.195  24.416 36.965 1.00 22.05  ? 281  SER A O     1 
ATOM   2344 C  CB    . SER A 1 299 ? 25.235  23.480 34.034 1.00 22.60  ? 281  SER A CB    1 
ATOM   2345 O  OG    . SER A 1 299 ? 24.461  24.576 33.577 1.00 24.50  ? 281  SER A OG    1 
ATOM   2346 N  N     . TYR A 1 300 ? 23.027  24.213 36.498 1.00 20.59  ? 282  TYR A N     1 
ATOM   2347 C  CA    . TYR A 1 300 ? 22.587  25.225 37.446 1.00 21.52  ? 282  TYR A CA    1 
ATOM   2348 C  C     . TYR A 1 300 ? 22.456  24.651 38.864 1.00 22.08  ? 282  TYR A C     1 
ATOM   2349 O  O     . TYR A 1 300 ? 22.226  25.392 39.824 1.00 22.41  ? 282  TYR A O     1 
ATOM   2350 C  CB    . TYR A 1 300 ? 21.253  25.847 36.967 1.00 21.27  ? 282  TYR A CB    1 
ATOM   2351 C  CG    . TYR A 1 300 ? 21.432  26.733 35.757 1.00 20.87  ? 282  TYR A CG    1 
ATOM   2352 C  CD1   . TYR A 1 300 ? 21.662  28.092 35.901 1.00 22.35  ? 282  TYR A CD1   1 
ATOM   2353 C  CD2   . TYR A 1 300 ? 21.399  26.190 34.469 1.00 20.17  ? 282  TYR A CD2   1 
ATOM   2354 C  CE1   . TYR A 1 300 ? 21.849  28.899 34.775 1.00 22.67  ? 282  TYR A CE1   1 
ATOM   2355 C  CE2   . TYR A 1 300 ? 21.590  26.961 33.351 1.00 21.76  ? 282  TYR A CE2   1 
ATOM   2356 C  CZ    . TYR A 1 300 ? 21.802  28.323 33.498 1.00 21.23  ? 282  TYR A CZ    1 
ATOM   2357 O  OH    . TYR A 1 300 ? 21.976  29.098 32.377 1.00 25.20  ? 282  TYR A OH    1 
ATOM   2358 N  N     . PHE A 1 301 ? 22.645  23.330 39.007 1.00 22.19  ? 283  PHE A N     1 
ATOM   2359 C  CA    . PHE A 1 301 ? 22.394  22.666 40.304 1.00 21.37  ? 283  PHE A CA    1 
ATOM   2360 C  C     . PHE A 1 301 ? 23.625  21.917 40.795 1.00 21.79  ? 283  PHE A C     1 
ATOM   2361 O  O     . PHE A 1 301 ? 24.248  21.149 40.048 1.00 22.24  ? 283  PHE A O     1 
ATOM   2362 C  CB    . PHE A 1 301 ? 21.217  21.692 40.179 1.00 20.90  ? 283  PHE A CB    1 
ATOM   2363 C  CG    . PHE A 1 301 ? 19.936  22.375 39.853 1.00 18.84  ? 283  PHE A CG    1 
ATOM   2364 C  CD1   . PHE A 1 301 ? 19.137  22.862 40.856 1.00 20.84  ? 283  PHE A CD1   1 
ATOM   2365 C  CD2   . PHE A 1 301 ? 19.582  22.612 38.530 1.00 21.18  ? 283  PHE A CD2   1 
ATOM   2366 C  CE1   . PHE A 1 301 ? 17.969  23.581 40.554 1.00 20.96  ? 283  PHE A CE1   1 
ATOM   2367 C  CE2   . PHE A 1 301 ? 18.395  23.298 38.218 1.00 20.07  ? 283  PHE A CE2   1 
ATOM   2368 C  CZ    . PHE A 1 301 ? 17.609  23.789 39.209 1.00 20.56  ? 283  PHE A CZ    1 
ATOM   2369 N  N     . ASP A 1 302 ? 23.883  22.073 42.087 1.00 21.90  ? 284  ASP A N     1 
ATOM   2370 C  CA    . ASP A 1 302 ? 24.883  21.297 42.793 1.00 23.39  ? 284  ASP A CA    1 
ATOM   2371 C  C     . ASP A 1 302 ? 24.377  19.915 43.145 1.00 22.98  ? 284  ASP A C     1 
ATOM   2372 O  O     . ASP A 1 302 ? 25.174  19.017 43.302 1.00 25.36  ? 284  ASP A O     1 
ATOM   2373 C  CB    . ASP A 1 302 ? 25.299  22.055 44.036 1.00 24.62  ? 284  ASP A CB    1 
ATOM   2374 C  CG    . ASP A 1 302 ? 26.009  23.368 43.687 1.00 28.51  ? 284  ASP A CG    1 
ATOM   2375 O  OD1   . ASP A 1 302 ? 27.134  23.291 43.192 1.00 30.10  ? 284  ASP A OD1   1 
ATOM   2376 O  OD2   . ASP A 1 302 ? 25.422  24.461 43.801 1.00 27.13  ? 284  ASP A OD2   1 
ATOM   2377 N  N     . LEU A 1 303 ? 23.062  19.754 43.280 1.00 22.05  ? 285  LEU A N     1 
ATOM   2378 C  CA    . LEU A 1 303 ? 22.452  18.459 43.615 1.00 21.27  ? 285  LEU A CA    1 
ATOM   2379 C  C     . LEU A 1 303 ? 21.089  18.385 42.980 1.00 19.62  ? 285  LEU A C     1 
ATOM   2380 O  O     . LEU A 1 303 ? 20.327  19.296 43.094 1.00 19.71  ? 285  LEU A O     1 
ATOM   2381 C  CB    . LEU A 1 303 ? 22.386  18.301 45.128 1.00 21.31  ? 285  LEU A CB    1 
ATOM   2382 C  CG    . LEU A 1 303 ? 21.922  16.958 45.709 1.00 23.19  ? 285  LEU A CG    1 
ATOM   2383 C  CD1   . LEU A 1 303 ? 22.488  16.813 47.145 1.00 26.16  ? 285  LEU A CD1   1 
ATOM   2384 C  CD2   . LEU A 1 303 ? 20.443  16.928 45.760 1.00 22.81  ? 285  LEU A CD2   1 
ATOM   2385 N  N     . ILE A 1 304 ? 20.797  17.289 42.287 1.00 19.93  ? 286  ILE A N     1 
ATOM   2386 C  CA    . ILE A 1 304 ? 19.520  17.031 41.673 1.00 19.91  ? 286  ILE A CA    1 
ATOM   2387 C  C     . ILE A 1 304 ? 18.969  15.706 42.236 1.00 20.50  ? 286  ILE A C     1 
ATOM   2388 O  O     . ILE A 1 304 ? 19.653  14.650 42.192 1.00 21.85  ? 286  ILE A O     1 
ATOM   2389 C  CB    . ILE A 1 304 ? 19.637  16.884 40.136 1.00 19.90  ? 286  ILE A CB    1 
ATOM   2390 C  CG1   . ILE A 1 304 ? 20.276  18.148 39.511 1.00 19.95  ? 286  ILE A CG1   1 
ATOM   2391 C  CG2   . ILE A 1 304 ? 18.235  16.552 39.538 1.00 19.80  ? 286  ILE A CG2   1 
ATOM   2392 C  CD1   . ILE A 1 304 ? 20.648  17.984 38.047 1.00 19.10  ? 286  ILE A CD1   1 
ATOM   2393 N  N     . LEU A 1 305 ? 17.793  15.794 42.804 1.00 20.71  ? 287  LEU A N     1 
ATOM   2394 C  CA    . LEU A 1 305 ? 17.133  14.642 43.465 1.00 19.91  ? 287  LEU A CA    1 
ATOM   2395 C  C     . LEU A 1 305 ? 15.673  14.582 42.968 1.00 19.17  ? 287  LEU A C     1 
ATOM   2396 O  O     . LEU A 1 305 ? 14.890  15.516 43.101 1.00 17.95  ? 287  LEU A O     1 
ATOM   2397 C  CB    . LEU A 1 305 ? 17.255  14.743 44.964 1.00 21.55  ? 287  LEU A CB    1 
ATOM   2398 C  CG    . LEU A 1 305 ? 16.780  13.567 45.830 1.00 23.06  ? 287  LEU A CG    1 
ATOM   2399 C  CD1   . LEU A 1 305 ? 17.701  13.370 47.109 1.00 24.38  ? 287  LEU A CD1   1 
ATOM   2400 C  CD2   . LEU A 1 305 ? 15.308  13.762 46.166 1.00 22.25  ? 287  LEU A CD2   1 
ATOM   2401 N  N     . VAL A 1 306 ? 15.329  13.430 42.422 1.00 18.87  ? 288  VAL A N     1 
ATOM   2402 C  CA    . VAL A 1 306 ? 13.999  13.146 41.877 1.00 18.63  ? 288  VAL A CA    1 
ATOM   2403 C  C     . VAL A 1 306 ? 13.374  12.015 42.719 1.00 18.79  ? 288  VAL A C     1 
ATOM   2404 O  O     . VAL A 1 306 ? 14.013  11.430 43.601 1.00 19.24  ? 288  VAL A O     1 
ATOM   2405 C  CB    . VAL A 1 306 ? 14.080  12.782 40.382 1.00 18.44  ? 288  VAL A CB    1 
ATOM   2406 C  CG1   . VAL A 1 306 ? 14.647  14.022 39.537 1.00 18.21  ? 288  VAL A CG1   1 
ATOM   2407 C  CG2   . VAL A 1 306 ? 14.953  11.516 40.162 1.00 17.21  ? 288  VAL A CG2   1 
ATOM   2408 N  N     . ASP A 1 307 ? 12.091  11.760 42.486 1.00 19.13  ? 289  ASP A N     1 
ATOM   2409 C  CA    . ASP A 1 307 ? 11.320  10.755 43.239 1.00 19.13  ? 289  ASP A CA    1 
ATOM   2410 C  C     . ASP A 1 307 ? 11.454  10.994 44.757 1.00 20.00  ? 289  ASP A C     1 
ATOM   2411 O  O     . ASP A 1 307 ? 11.713  10.037 45.524 1.00 20.55  ? 289  ASP A O     1 
ATOM   2412 C  CB    . ASP A 1 307 ? 11.747  9.307  42.885 1.00 18.53  ? 289  ASP A CB    1 
ATOM   2413 C  CG    . ASP A 1 307 ? 11.826  9.045  41.364 1.00 22.30  ? 289  ASP A CG    1 
ATOM   2414 O  OD1   . ASP A 1 307 ? 10.807  9.278  40.650 1.00 24.25  ? 289  ASP A OD1   1 
ATOM   2415 O  OD2   . ASP A 1 307 ? 12.914  8.588  40.878 1.00 23.41  ? 289  ASP A OD2   1 
ATOM   2416 N  N     . ALA A 1 308 ? 11.323  12.258 45.194 1.00 20.21  ? 290  ALA A N     1 
ATOM   2417 C  CA    . ALA A 1 308 ? 11.728  12.601 46.551 1.00 18.13  ? 290  ALA A CA    1 
ATOM   2418 C  C     . ALA A 1 308 ? 10.814  11.988 47.590 1.00 18.68  ? 290  ALA A C     1 
ATOM   2419 O  O     . ALA A 1 308 ? 11.250  11.777 48.732 1.00 18.83  ? 290  ALA A O     1 
ATOM   2420 C  CB    . ALA A 1 308 ? 11.847  14.102 46.741 1.00 17.20  ? 290  ALA A CB    1 
ATOM   2421 N  N     . ARG A 1 309 ? 9.570   11.680 47.196 1.00 19.38  ? 291  ARG A N     1 
ATOM   2422 C  CA    . ARG A 1 309 ? 8.500   11.203 48.129 1.00 21.77  ? 291  ARG A CA    1 
ATOM   2423 C  C     . ARG A 1 309 ? 8.339   12.147 49.348 1.00 21.48  ? 291  ARG A C     1 
ATOM   2424 O  O     . ARG A 1 309 ? 8.270   11.705 50.501 1.00 21.50  ? 291  ARG A O     1 
ATOM   2425 C  CB    . ARG A 1 309 ? 8.772   9.775  48.612 1.00 24.04  ? 291  ARG A CB    1 
ATOM   2426 C  CG    . ARG A 1 309 ? 8.867   8.724  47.536 1.00 27.80  ? 291  ARG A CG    1 
ATOM   2427 C  CD    . ARG A 1 309 ? 7.547   8.060  47.258 1.00 38.29  ? 291  ARG A CD    1 
ATOM   2428 N  NE    . ARG A 1 309 ? 6.853   7.553  48.459 1.00 42.40  ? 291  ARG A NE    1 
ATOM   2429 C  CZ    . ARG A 1 309 ? 6.920   6.311  48.950 1.00 44.36  ? 291  ARG A CZ    1 
ATOM   2430 N  NH1   . ARG A 1 309 ? 7.643   5.340  48.378 1.00 46.00  ? 291  ARG A NH1   1 
ATOM   2431 N  NH2   . ARG A 1 309 ? 6.222   6.032  50.030 1.00 47.52  ? 291  ARG A NH2   1 
ATOM   2432 N  N     . LYS A 1 310 ? 8.282   13.448 49.081 1.00 20.01  ? 292  LYS A N     1 
ATOM   2433 C  CA    . LYS A 1 310 ? 7.874   14.413 50.098 1.00 21.43  ? 292  LYS A CA    1 
ATOM   2434 C  C     . LYS A 1 310 ? 6.413   14.179 50.398 1.00 22.59  ? 292  LYS A C     1 
ATOM   2435 O  O     . LYS A 1 310 ? 5.665   13.985 49.447 1.00 22.95  ? 292  LYS A O     1 
ATOM   2436 C  CB    . LYS A 1 310 ? 8.039   15.833 49.570 1.00 20.60  ? 292  LYS A CB    1 
ATOM   2437 C  CG    . LYS A 1 310 ? 9.493   16.218 49.401 1.00 22.30  ? 292  LYS A CG    1 
ATOM   2438 C  CD    . LYS A 1 310 ? 9.696   17.581 48.726 1.00 22.49  ? 292  LYS A CD    1 
ATOM   2439 C  CE    . LYS A 1 310 ? 9.456   17.543 47.230 1.00 24.94  ? 292  LYS A CE    1 
ATOM   2440 N  NZ    . LYS A 1 310 ? 8.082   17.967 46.902 1.00 28.68  ? 292  LYS A NZ    1 
ATOM   2441 N  N     . PRO A 1 311 ? 5.988   14.238 51.686 1.00 22.90  ? 293  PRO A N     1 
ATOM   2442 C  CA    . PRO A 1 311 ? 6.778   14.616 52.850 1.00 23.08  ? 293  PRO A CA    1 
ATOM   2443 C  C     . PRO A 1 311 ? 7.548   13.545 53.601 1.00 22.74  ? 293  PRO A C     1 
ATOM   2444 O  O     . PRO A 1 311 ? 8.284   13.918 54.519 1.00 23.19  ? 293  PRO A O     1 
ATOM   2445 C  CB    . PRO A 1 311 ? 5.723   15.217 53.796 1.00 24.06  ? 293  PRO A CB    1 
ATOM   2446 C  CG    . PRO A 1 311 ? 4.572   14.396 53.592 1.00 26.07  ? 293  PRO A CG    1 
ATOM   2447 C  CD    . PRO A 1 311 ? 4.579   14.044 52.076 1.00 26.08  ? 293  PRO A CD    1 
ATOM   2448 N  N     . LEU A 1 312 ? 7.371   12.260 53.262 1.00 23.31  ? 294  LEU A N     1 
ATOM   2449 C  CA    . LEU A 1 312 ? 8.184   11.159 53.859 1.00 23.83  ? 294  LEU A CA    1 
ATOM   2450 C  C     . LEU A 1 312 ? 9.714   11.468 53.796 1.00 22.68  ? 294  LEU A C     1 
ATOM   2451 O  O     . LEU A 1 312 ? 10.469  11.154 54.728 1.00 22.59  ? 294  LEU A O     1 
ATOM   2452 C  CB    . LEU A 1 312 ? 7.876   9.833  53.174 1.00 24.34  ? 294  LEU A CB    1 
ATOM   2453 C  CG    . LEU A 1 312 ? 8.727   8.591  53.473 1.00 25.16  ? 294  LEU A CG    1 
ATOM   2454 C  CD1   . LEU A 1 312 ? 8.618   8.214  54.951 1.00 25.28  ? 294  LEU A CD1   1 
ATOM   2455 C  CD2   . LEU A 1 312 ? 8.391   7.396  52.539 1.00 25.49  ? 294  LEU A CD2   1 
ATOM   2456 N  N     . PHE A 1 313 ? 10.122  12.085 52.699 1.00 21.37  ? 295  PHE A N     1 
ATOM   2457 C  CA    . PHE A 1 313 ? 11.466  12.673 52.517 1.00 20.33  ? 295  PHE A CA    1 
ATOM   2458 C  C     . PHE A 1 313 ? 12.035  13.390 53.754 1.00 21.57  ? 295  PHE A C     1 
ATOM   2459 O  O     . PHE A 1 313 ? 13.204  13.240 54.086 1.00 20.81  ? 295  PHE A O     1 
ATOM   2460 C  CB    . PHE A 1 313 ? 11.381  13.634 51.349 1.00 20.58  ? 295  PHE A CB    1 
ATOM   2461 C  CG    . PHE A 1 313 ? 12.696  14.183 50.910 1.00 18.67  ? 295  PHE A CG    1 
ATOM   2462 C  CD1   . PHE A 1 313 ? 13.654  13.377 50.250 1.00 18.70  ? 295  PHE A CD1   1 
ATOM   2463 C  CD2   . PHE A 1 313 ? 13.015  15.495 51.187 1.00 22.35  ? 295  PHE A CD2   1 
ATOM   2464 C  CE1   . PHE A 1 313 ? 14.909  13.922 49.860 1.00 18.52  ? 295  PHE A CE1   1 
ATOM   2465 C  CE2   . PHE A 1 313 ? 14.252  16.033 50.833 1.00 20.68  ? 295  PHE A CE2   1 
ATOM   2466 C  CZ    . PHE A 1 313 ? 15.216  15.218 50.182 1.00 21.09  ? 295  PHE A CZ    1 
ATOM   2467 N  N     . PHE A 1 314 ? 11.197  14.151 54.446 1.00 23.34  ? 296  PHE A N     1 
ATOM   2468 C  CA    . PHE A 1 314 ? 11.610  14.903 55.623 1.00 24.82  ? 296  PHE A CA    1 
ATOM   2469 C  C     . PHE A 1 314 ? 11.569  14.091 56.913 1.00 26.87  ? 296  PHE A C     1 
ATOM   2470 O  O     . PHE A 1 314 ? 11.986  14.583 57.969 1.00 28.66  ? 296  PHE A O     1 
ATOM   2471 C  CB    . PHE A 1 314 ? 10.774  16.185 55.741 1.00 25.61  ? 296  PHE A CB    1 
ATOM   2472 C  CG    . PHE A 1 314 ? 10.952  17.114 54.595 1.00 22.21  ? 296  PHE A CG    1 
ATOM   2473 C  CD1   . PHE A 1 314 ? 12.152  17.817 54.441 1.00 22.78  ? 296  PHE A CD1   1 
ATOM   2474 C  CD2   . PHE A 1 314 ? 9.936   17.335 53.673 1.00 22.66  ? 296  PHE A CD2   1 
ATOM   2475 C  CE1   . PHE A 1 314 ? 12.346  18.660 53.389 1.00 22.28  ? 296  PHE A CE1   1 
ATOM   2476 C  CE2   . PHE A 1 314 ? 10.141  18.209 52.586 1.00 22.61  ? 296  PHE A CE2   1 
ATOM   2477 C  CZ    . PHE A 1 314 ? 11.358  18.867 52.454 1.00 22.85  ? 296  PHE A CZ    1 
ATOM   2478 N  N     . GLY A 1 315 ? 11.110  12.837 56.831 1.00 27.50  ? 297  GLY A N     1 
ATOM   2479 C  CA    . GLY A 1 315 ? 11.294  11.852 57.926 1.00 30.11  ? 297  GLY A CA    1 
ATOM   2480 C  C     . GLY A 1 315 ? 12.323  10.787 57.554 1.00 29.82  ? 297  GLY A C     1 
ATOM   2481 O  O     . GLY A 1 315 ? 13.472  11.095 57.209 1.00 30.23  ? 297  GLY A O     1 
ATOM   2482 N  N     . GLU A 1 316 ? 11.905  9.533  57.579 1.00 31.06  ? 298  GLU A N     1 
ATOM   2483 C  CA    . GLU A 1 316 ? 12.774  8.376  57.232 1.00 31.93  ? 298  GLU A CA    1 
ATOM   2484 C  C     . GLU A 1 316 ? 13.270  8.381  55.759 1.00 28.60  ? 298  GLU A C     1 
ATOM   2485 O  O     . GLU A 1 316 ? 14.320  7.832  55.417 1.00 27.60  ? 298  GLU A O     1 
ATOM   2486 C  CB    . GLU A 1 316 ? 12.025  7.034  57.582 1.00 34.70  ? 298  GLU A CB    1 
ATOM   2487 C  CG    . GLU A 1 316 ? 10.595  6.944  56.919 1.00 38.44  ? 298  GLU A CG    1 
ATOM   2488 C  CD    . GLU A 1 316 ? 9.561   5.949  57.526 1.00 42.26  ? 298  GLU A CD    1 
ATOM   2489 O  OE1   . GLU A 1 316 ? 9.640   4.721  57.174 1.00 50.50  ? 298  GLU A OE1   1 
ATOM   2490 O  OE2   . GLU A 1 316 ? 8.620   6.405  58.257 1.00 46.78  ? 298  GLU A OE2   1 
ATOM   2491 N  N     . GLY A 1 317 ? 12.521  9.033  54.889 1.00 26.18  ? 299  GLY A N     1 
ATOM   2492 C  CA    . GLY A 1 317 ? 12.793  9.003  53.472 1.00 24.79  ? 299  GLY A CA    1 
ATOM   2493 C  C     . GLY A 1 317 ? 12.678  7.610  52.922 1.00 24.98  ? 299  GLY A C     1 
ATOM   2494 O  O     . GLY A 1 317 ? 11.994  6.752  53.474 1.00 25.66  ? 299  GLY A O     1 
ATOM   2495 N  N     . THR A 1 318 ? 13.382  7.390  51.825 1.00 24.06  ? 300  THR A N     1 
ATOM   2496 C  CA    . THR A 1 318 ? 13.517  6.072  51.231 1.00 25.30  ? 300  THR A CA    1 
ATOM   2497 C  C     . THR A 1 318 ? 14.987  5.844  50.907 1.00 24.60  ? 300  THR A C     1 
ATOM   2498 O  O     . THR A 1 318 ? 15.830  6.726  51.045 1.00 23.67  ? 300  THR A O     1 
ATOM   2499 C  CB    . THR A 1 318 ? 12.650  5.909  49.925 1.00 25.34  ? 300  THR A CB    1 
ATOM   2500 O  OG1   . THR A 1 318 ? 13.050  6.896  48.960 1.00 26.13  ? 300  THR A OG1   1 
ATOM   2501 C  CG2   . THR A 1 318 ? 11.150  6.063  50.260 1.00 26.83  ? 300  THR A CG2   1 
ATOM   2502 N  N     . VAL A 1 319 ? 15.302  4.637  50.487 1.00 25.71  ? 301  VAL A N     1 
ATOM   2503 C  CA    . VAL A 1 319 ? 16.674  4.315  50.109 1.00 26.19  ? 301  VAL A CA    1 
ATOM   2504 C  C     . VAL A 1 319 ? 17.184  5.261  49.020 1.00 23.71  ? 301  VAL A C     1 
ATOM   2505 O  O     . VAL A 1 319 ? 16.447  5.617  48.111 1.00 22.96  ? 301  VAL A O     1 
ATOM   2506 C  CB    . VAL A 1 319 ? 16.701  2.835  49.727 1.00 28.15  ? 301  VAL A CB    1 
ATOM   2507 C  CG1   . VAL A 1 319 ? 17.621  2.557  48.654 1.00 31.11  ? 301  VAL A CG1   1 
ATOM   2508 C  CG2   . VAL A 1 319 ? 16.895  2.019  51.020 1.00 31.55  ? 301  VAL A CG2   1 
ATOM   2509 N  N     . LEU A 1 320 ? 18.417  5.744  49.176 1.00 23.47  ? 302  LEU A N     1 
ATOM   2510 C  CA    . LEU A 1 320 ? 19.046  6.576  48.165 1.00 23.04  ? 302  LEU A CA    1 
ATOM   2511 C  C     . LEU A 1 320 ? 19.451  5.737  46.932 1.00 23.03  ? 302  LEU A C     1 
ATOM   2512 O  O     . LEU A 1 320 ? 20.188  4.739  47.046 1.00 23.61  ? 302  LEU A O     1 
ATOM   2513 C  CB    . LEU A 1 320 ? 20.278  7.294  48.713 1.00 23.19  ? 302  LEU A CB    1 
ATOM   2514 C  CG    . LEU A 1 320 ? 20.878  8.366  47.791 1.00 23.11  ? 302  LEU A CG    1 
ATOM   2515 C  CD1   . LEU A 1 320 ? 19.907  9.569  47.573 1.00 23.74  ? 302  LEU A CD1   1 
ATOM   2516 C  CD2   . LEU A 1 320 ? 22.256  8.805  48.368 1.00 25.64  ? 302  LEU A CD2   1 
ATOM   2517 N  N     . ARG A 1 321 ? 18.969  6.165  45.773 1.00 22.10  ? 303  ARG A N     1 
ATOM   2518 C  CA    . ARG A 1 321 ? 19.249  5.520  44.478 1.00 22.17  ? 303  ARG A CA    1 
ATOM   2519 C  C     . ARG A 1 321 ? 19.944  6.478  43.551 1.00 21.87  ? 303  ARG A C     1 
ATOM   2520 O  O     . ARG A 1 321 ? 19.912  7.693  43.778 1.00 20.39  ? 303  ARG A O     1 
ATOM   2521 C  CB    . ARG A 1 321 ? 17.922  5.092  43.830 1.00 22.53  ? 303  ARG A CB    1 
ATOM   2522 C  CG    . ARG A 1 321 ? 17.052  4.157  44.693 1.00 25.08  ? 303  ARG A CG    1 
ATOM   2523 C  CD    . ARG A 1 321 ? 17.636  2.780  44.939 1.00 25.18  ? 303  ARG A CD    1 
ATOM   2524 N  NE    . ARG A 1 321 ? 17.712  1.995  43.727 1.00 25.44  ? 303  ARG A NE    1 
ATOM   2525 C  CZ    . ARG A 1 321 ? 16.687  1.393  43.137 1.00 29.69  ? 303  ARG A CZ    1 
ATOM   2526 N  NH1   . ARG A 1 321 ? 15.462  1.477  43.643 1.00 30.44  ? 303  ARG A NH1   1 
ATOM   2527 N  NH2   . ARG A 1 321 ? 16.876  0.707  42.024 1.00 31.74  ? 303  ARG A NH2   1 
ATOM   2528 N  N     . GLN A 1 322 ? 20.593  5.936  42.515 1.00 22.03  ? 304  GLN A N     1 
ATOM   2529 C  CA    . GLN A 1 322 ? 21.212  6.720  41.500 1.00 22.72  ? 304  GLN A CA    1 
ATOM   2530 C  C     . GLN A 1 322 ? 20.456  6.517  40.191 1.00 22.96  ? 304  GLN A C     1 
ATOM   2531 O  O     . GLN A 1 322 ? 20.094  5.375  39.823 1.00 24.01  ? 304  GLN A O     1 
ATOM   2532 C  CB    . GLN A 1 322 ? 22.669  6.323  41.345 1.00 24.80  ? 304  GLN A CB    1 
ATOM   2533 C  CG    . GLN A 1 322 ? 23.343  7.035  40.232 1.00 25.74  ? 304  GLN A CG    1 
ATOM   2534 C  CD    . GLN A 1 322 ? 24.775  6.679  40.043 1.00 27.75  ? 304  GLN A CD    1 
ATOM   2535 O  OE1   . GLN A 1 322 ? 25.298  5.749  40.639 1.00 33.21  ? 304  GLN A OE1   1 
ATOM   2536 N  NE2   . GLN A 1 322 ? 25.426  7.422  39.162 1.00 30.57  ? 304  GLN A NE2   1 
ATOM   2537 N  N     . VAL A 1 323 ? 20.151  7.611  39.513 1.00 22.63  ? 305  VAL A N     1 
ATOM   2538 C  CA    . VAL A 1 323 ? 19.504  7.539  38.202 1.00 24.40  ? 305  VAL A CA    1 
ATOM   2539 C  C     . VAL A 1 323 ? 20.563  7.300  37.119 1.00 26.41  ? 305  VAL A C     1 
ATOM   2540 O  O     . VAL A 1 323 ? 21.592  7.984  37.038 1.00 26.50  ? 305  VAL A O     1 
ATOM   2541 C  CB    . VAL A 1 323 ? 18.662  8.828  37.846 1.00 23.59  ? 305  VAL A CB    1 
ATOM   2542 C  CG1   . VAL A 1 323 ? 18.056  8.730  36.407 1.00 24.89  ? 305  VAL A CG1   1 
ATOM   2543 C  CG2   . VAL A 1 323 ? 17.592  9.081  38.881 1.00 21.84  ? 305  VAL A CG2   1 
ATOM   2544 N  N     . ASP A 1 324 ? 20.307  6.336  36.248 1.00 29.10  ? 306  ASP A N     1 
ATOM   2545 C  CA    . ASP A 1 324 ? 21.073  6.239  35.021 1.00 31.87  ? 306  ASP A CA    1 
ATOM   2546 C  C     . ASP A 1 324 ? 20.481  7.247  34.031 1.00 33.56  ? 306  ASP A C     1 
ATOM   2547 O  O     . ASP A 1 324 ? 19.415  7.025  33.476 1.00 34.23  ? 306  ASP A O     1 
ATOM   2548 C  CB    . ASP A 1 324 ? 20.996  4.833  34.456 1.00 34.07  ? 306  ASP A CB    1 
ATOM   2549 C  CG    . ASP A 1 324 ? 21.749  4.683  33.141 1.00 38.37  ? 306  ASP A CG    1 
ATOM   2550 O  OD1   . ASP A 1 324 ? 21.903  5.682  32.390 1.00 40.84  ? 306  ASP A OD1   1 
ATOM   2551 O  OD2   . ASP A 1 324 ? 22.155  3.536  32.843 1.00 42.72  ? 306  ASP A OD2   1 
ATOM   2552 N  N     . THR A 1 325 ? 21.165  8.363  33.796 1.00 35.28  ? 307  THR A N     1 
ATOM   2553 C  CA    . THR A 1 325 ? 20.540  9.484  33.057 1.00 36.22  ? 307  THR A CA    1 
ATOM   2554 C  C     . THR A 1 325 ? 20.439  9.276  31.540 1.00 40.42  ? 307  THR A C     1 
ATOM   2555 O  O     . THR A 1 325 ? 19.708  10.000 30.859 1.00 42.80  ? 307  THR A O     1 
ATOM   2556 C  CB    . THR A 1 325 ? 21.251  10.798 33.371 1.00 36.45  ? 307  THR A CB    1 
ATOM   2557 O  OG1   . THR A 1 325 ? 22.645  10.671 33.054 1.00 38.24  ? 307  THR A OG1   1 
ATOM   2558 C  CG2   . THR A 1 325 ? 21.068  11.152 34.843 1.00 33.13  ? 307  THR A CG2   1 
ATOM   2559 N  N     . LYS A 1 326 ? 21.164  8.296  31.016 1.00 41.74  ? 308  LYS A N     1 
ATOM   2560 C  CA    . LYS A 1 326 ? 21.006  7.877  29.632 1.00 45.44  ? 308  LYS A CA    1 
ATOM   2561 C  C     . LYS A 1 326 ? 19.673  7.158  29.368 1.00 45.45  ? 308  LYS A C     1 
ATOM   2562 O  O     . LYS A 1 326 ? 19.027  7.402  28.353 1.00 48.25  ? 308  LYS A O     1 
ATOM   2563 C  CB    . LYS A 1 326 ? 22.115  6.908  29.260 1.00 47.19  ? 308  LYS A CB    1 
ATOM   2564 C  CG    . LYS A 1 326 ? 23.511  7.490  29.322 1.00 50.53  ? 308  LYS A CG    1 
ATOM   2565 C  CD    . LYS A 1 326 ? 24.509  6.511  28.683 1.00 52.52  ? 308  LYS A CD    1 
ATOM   2566 C  CE    . LYS A 1 326 ? 25.718  7.221  28.071 1.00 56.97  ? 308  LYS A CE    1 
ATOM   2567 N  NZ    . LYS A 1 326 ? 26.441  6.277  27.169 1.00 60.95  ? 308  LYS A NZ    1 
ATOM   2568 N  N     . THR A 1 327 ? 19.296  6.244  30.271 1.00 43.54  ? 309  THR A N     1 
ATOM   2569 C  CA    . THR A 1 327 ? 18.102  5.416  30.104 1.00 43.35  ? 309  THR A CA    1 
ATOM   2570 C  C     . THR A 1 327 ? 16.916  5.981  30.852 1.00 41.77  ? 309  THR A C     1 
ATOM   2571 O  O     . THR A 1 327 ? 15.783  5.694  30.495 1.00 44.19  ? 309  THR A O     1 
ATOM   2572 C  CB    . THR A 1 327 ? 18.349  3.977  30.571 1.00 42.77  ? 309  THR A CB    1 
ATOM   2573 O  OG1   . THR A 1 327 ? 18.565  3.958  31.984 1.00 40.48  ? 309  THR A OG1   1 
ATOM   2574 C  CG2   . THR A 1 327 ? 19.567  3.389  29.875 1.00 43.57  ? 309  THR A CG2   1 
ATOM   2575 N  N     . GLY A 1 328 ? 17.176  6.771  31.890 1.00 37.98  ? 310  GLY A N     1 
ATOM   2576 C  CA    . GLY A 1 328 ? 16.132  7.271  32.767 1.00 36.51  ? 310  GLY A CA    1 
ATOM   2577 C  C     . GLY A 1 328 ? 15.672  6.246  33.804 1.00 34.59  ? 310  GLY A C     1 
ATOM   2578 O  O     . GLY A 1 328 ? 14.745  6.524  34.582 1.00 35.28  ? 310  GLY A O     1 
ATOM   2579 N  N     . LYS A 1 329 ? 16.325  5.088  33.823 1.00 34.33  ? 311  LYS A N     1 
ATOM   2580 C  CA    . LYS A 1 329 ? 16.070  4.053  34.808 1.00 33.30  ? 311  LYS A CA    1 
ATOM   2581 C  C     . LYS A 1 329 ? 16.977  4.223  36.014 1.00 31.19  ? 311  LYS A C     1 
ATOM   2582 O  O     . LYS A 1 329 ? 18.098  4.768  35.906 1.00 30.84  ? 311  LYS A O     1 
ATOM   2583 C  CB    . LYS A 1 329 ? 16.309  2.677  34.207 1.00 34.93  ? 311  LYS A CB    1 
ATOM   2584 C  CG    . LYS A 1 329 ? 15.479  2.409  33.006 1.00 38.09  ? 311  LYS A CG    1 
ATOM   2585 C  CD    . LYS A 1 329 ? 15.780  1.046  32.398 1.00 40.75  ? 311  LYS A CD    1 
ATOM   2586 C  CE    . LYS A 1 329 ? 14.928  0.860  31.152 1.00 44.56  ? 311  LYS A CE    1 
ATOM   2587 N  NZ    . LYS A 1 329 ? 15.318  -0.317 30.362 1.00 47.44  ? 311  LYS A NZ    1 
ATOM   2588 N  N     . LEU A 1 330 ? 16.515  3.712  37.152 1.00 29.25  ? 312  LEU A N     1 
ATOM   2589 C  CA    . LEU A 1 330 ? 17.361  3.640  38.342 1.00 27.92  ? 312  LEU A CA    1 
ATOM   2590 C  C     . LEU A 1 330 ? 18.405  2.530  38.173 1.00 28.74  ? 312  LEU A C     1 
ATOM   2591 O  O     . LEU A 1 330 ? 18.109  1.454  37.625 1.00 30.13  ? 312  LEU A O     1 
ATOM   2592 C  CB    . LEU A 1 330 ? 16.524  3.413  39.591 1.00 27.95  ? 312  LEU A CB    1 
ATOM   2593 C  CG    . LEU A 1 330 ? 15.427  4.449  39.846 1.00 26.61  ? 312  LEU A CG    1 
ATOM   2594 C  CD1   . LEU A 1 330 ? 14.720  4.182  41.175 1.00 30.25  ? 312  LEU A CD1   1 
ATOM   2595 C  CD2   . LEU A 1 330 ? 15.968  5.885  39.785 1.00 24.72  ? 312  LEU A CD2   1 
ATOM   2596 N  N     . LYS A 1 331 ? 19.627  2.799  38.624 1.00 27.60  ? 313  LYS A N     1 
ATOM   2597 C  CA    . LYS A 1 331 ? 20.634  1.752  38.729 1.00 29.28  ? 313  LYS A CA    1 
ATOM   2598 C  C     . LYS A 1 331 ? 20.166  0.836  39.847 1.00 28.36  ? 313  LYS A C     1 
ATOM   2599 O  O     . LYS A 1 331 ? 19.444  1.267  40.736 1.00 26.98  ? 313  LYS A O     1 
ATOM   2600 C  CB    . LYS A 1 331 ? 22.019  2.316  39.043 1.00 29.12  ? 313  LYS A CB    1 
ATOM   2601 C  CG    . LYS A 1 331 ? 22.469  3.346  38.071 1.00 30.79  ? 313  LYS A CG    1 
ATOM   2602 C  CD    . LYS A 1 331 ? 23.933  3.614  38.127 1.00 33.72  ? 313  LYS A CD    1 
ATOM   2603 C  CE    . LYS A 1 331 ? 24.290  4.637  37.069 1.00 37.29  ? 313  LYS A CE    1 
ATOM   2604 N  NZ    . LYS A 1 331 ? 25.760  4.727  36.790 1.00 39.94  ? 313  LYS A NZ    1 
ATOM   2605 N  N     . ILE A 1 332 ? 20.558  -0.435 39.786 1.00 29.70  ? 314  ILE A N     1 
ATOM   2606 C  CA    . ILE A 1 332 ? 20.132  -1.385 40.791 1.00 30.31  ? 314  ILE A CA    1 
ATOM   2607 C  C     . ILE A 1 332 ? 21.045  -1.239 42.025 1.00 29.43  ? 314  ILE A C     1 
ATOM   2608 O  O     . ILE A 1 332 ? 22.258  -1.175 41.898 1.00 30.24  ? 314  ILE A O     1 
ATOM   2609 C  CB    . ILE A 1 332 ? 20.135  -2.843 40.245 1.00 31.98  ? 314  ILE A CB    1 
ATOM   2610 C  CG1   . ILE A 1 332 ? 19.311  -2.943 38.946 1.00 33.64  ? 314  ILE A CG1   1 
ATOM   2611 C  CG2   . ILE A 1 332 ? 19.575  -3.836 41.334 1.00 32.92  ? 314  ILE A CG2   1 
ATOM   2612 C  CD1   . ILE A 1 332 ? 17.905  -2.413 39.034 1.00 31.21  ? 314  ILE A CD1   1 
ATOM   2613 N  N     . GLY A 1 333 ? 20.439  -1.173 43.192 1.00 29.25  ? 315  GLY A N     1 
ATOM   2614 C  CA    . GLY A 1 333 ? 21.160  -1.103 44.454 1.00 29.96  ? 315  GLY A CA    1 
ATOM   2615 C  C     . GLY A 1 333 ? 21.066  0.269  45.089 1.00 27.82  ? 315  GLY A C     1 
ATOM   2616 O  O     . GLY A 1 333 ? 20.717  1.248  44.427 1.00 26.61  ? 315  GLY A O     1 
ATOM   2617 N  N     . THR A 1 334 ? 21.340  0.331  46.388 1.00 27.95  ? 316  THR A N     1 
ATOM   2618 C  CA    . THR A 1 334 ? 21.427  1.613  47.105 1.00 27.64  ? 316  THR A CA    1 
ATOM   2619 C  C     . THR A 1 334 ? 22.771  2.294  46.764 1.00 27.39  ? 316  THR A C     1 
ATOM   2620 O  O     . THR A 1 334 ? 23.817  1.654  46.811 1.00 27.73  ? 316  THR A O     1 
ATOM   2621 C  CB    . THR A 1 334 ? 21.353  1.402  48.637 1.00 28.31  ? 316  THR A CB    1 
ATOM   2622 O  OG1   . THR A 1 334 ? 20.115  0.754  48.955 1.00 32.95  ? 316  THR A OG1   1 
ATOM   2623 C  CG2   . THR A 1 334 ? 21.443  2.723  49.390 1.00 27.78  ? 316  THR A CG2   1 
ATOM   2624 N  N     . TYR A 1 335 ? 22.725  3.587  46.447 1.00 27.03  ? 317  TYR A N     1 
ATOM   2625 C  CA    . TYR A 1 335 ? 23.943  4.367  46.195 1.00 28.88  ? 317  TYR A CA    1 
ATOM   2626 C  C     . TYR A 1 335 ? 24.638  4.782  47.480 1.00 29.98  ? 317  TYR A C     1 
ATOM   2627 O  O     . TYR A 1 335 ? 24.059  5.488  48.297 1.00 29.84  ? 317  TYR A O     1 
ATOM   2628 C  CB    . TYR A 1 335 ? 23.630  5.634  45.398 1.00 28.35  ? 317  TYR A CB    1 
ATOM   2629 C  CG    . TYR A 1 335 ? 24.866  6.389  44.994 1.00 29.66  ? 317  TYR A CG    1 
ATOM   2630 C  CD1   . TYR A 1 335 ? 25.676  5.937  43.951 1.00 31.94  ? 317  TYR A CD1   1 
ATOM   2631 C  CD2   . TYR A 1 335 ? 25.227  7.549  45.655 1.00 30.13  ? 317  TYR A CD2   1 
ATOM   2632 C  CE1   . TYR A 1 335 ? 26.811  6.630  43.582 1.00 34.20  ? 317  TYR A CE1   1 
ATOM   2633 C  CE2   . TYR A 1 335 ? 26.366  8.250  45.301 1.00 32.84  ? 317  TYR A CE2   1 
ATOM   2634 C  CZ    . TYR A 1 335 ? 27.146  7.807  44.268 1.00 34.26  ? 317  TYR A CZ    1 
ATOM   2635 O  OH    . TYR A 1 335 ? 28.269  8.525  43.930 1.00 36.76  ? 317  TYR A OH    1 
ATOM   2636 N  N     . THR A 1 336 ? 25.895  4.386  47.602 1.00 32.85  ? 318  THR A N     1 
ATOM   2637 C  CA    . THR A 1 336 ? 26.682  4.533  48.803 1.00 35.85  ? 318  THR A CA    1 
ATOM   2638 C  C     . THR A 1 336 ? 27.869  5.499  48.599 1.00 38.36  ? 318  THR A C     1 
ATOM   2639 O  O     . THR A 1 336 ? 28.688  5.655  49.507 1.00 40.64  ? 318  THR A O     1 
ATOM   2640 C  CB    . THR A 1 336 ? 27.270  3.154  49.220 1.00 38.39  ? 318  THR A CB    1 
ATOM   2641 O  OG1   . THR A 1 336 ? 28.064  2.628  48.148 1.00 39.74  ? 318  THR A OG1   1 
ATOM   2642 C  CG2   . THR A 1 336 ? 26.109  2.121  49.597 1.00 37.72  ? 318  THR A CG2   1 
ATOM   2643 N  N     . GLY A 1 337 ? 27.969  6.094  47.400 1.00 37.62  ? 319  GLY A N     1 
ATOM   2644 C  CA    . GLY A 1 337 ? 29.132  6.908  46.991 1.00 39.47  ? 319  GLY A CA    1 
ATOM   2645 C  C     . GLY A 1 337 ? 28.975  8.395  47.324 1.00 38.96  ? 319  GLY A C     1 
ATOM   2646 O  O     . GLY A 1 337 ? 27.978  8.811  47.937 1.00 36.36  ? 319  GLY A O     1 
ATOM   2647 N  N     . PRO A 1 338 ? 29.976  9.209  46.943 1.00 40.86  ? 320  PRO A N     1 
ATOM   2648 C  CA    . PRO A 1 338 ? 29.967  10.645 47.248 1.00 41.47  ? 320  PRO A CA    1 
ATOM   2649 C  C     . PRO A 1 338 ? 29.146  11.461 46.222 1.00 39.68  ? 320  PRO A C     1 
ATOM   2650 O  O     . PRO A 1 338 ? 28.620  10.902 45.244 1.00 38.19  ? 320  PRO A O     1 
ATOM   2651 C  CB    . PRO A 1 338 ? 31.457  11.009 47.187 1.00 45.14  ? 320  PRO A CB    1 
ATOM   2652 C  CG    . PRO A 1 338 ? 31.983  10.131 46.115 1.00 46.17  ? 320  PRO A CG    1 
ATOM   2653 C  CD    . PRO A 1 338 ? 31.173  8.829  46.169 1.00 43.33  ? 320  PRO A CD    1 
ATOM   2654 N  N     . LEU A 1 339 ? 29.013  12.757 46.465 1.00 39.97  ? 321  LEU A N     1 
ATOM   2655 C  CA    . LEU A 1 339 ? 28.415  13.667 45.497 1.00 39.65  ? 321  LEU A CA    1 
ATOM   2656 C  C     . LEU A 1 339 ? 29.399  13.785 44.363 1.00 42.33  ? 321  LEU A C     1 
ATOM   2657 O  O     . LEU A 1 339 ? 30.546  14.106 44.603 1.00 45.46  ? 321  LEU A O     1 
ATOM   2658 C  CB    . LEU A 1 339 ? 28.174  15.062 46.125 1.00 40.01  ? 321  LEU A CB    1 
ATOM   2659 C  CG    . LEU A 1 339 ? 27.366  16.107 45.327 1.00 38.78  ? 321  LEU A CG    1 
ATOM   2660 C  CD1   . LEU A 1 339 ? 26.008  15.638 44.966 1.00 33.48  ? 321  LEU A CD1   1 
ATOM   2661 C  CD2   . LEU A 1 339 ? 27.230  17.392 46.119 1.00 41.19  ? 321  LEU A CD2   1 
ATOM   2662 N  N     . GLN A 1 340 ? 28.984  13.479 43.141 1.00 42.11  ? 322  GLN A N     1 
ATOM   2663 C  CA    . GLN A 1 340 ? 29.895  13.608 41.989 1.00 45.22  ? 322  GLN A CA    1 
ATOM   2664 C  C     . GLN A 1 340 ? 29.246  14.462 40.946 1.00 44.38  ? 322  GLN A C     1 
ATOM   2665 O  O     . GLN A 1 340 ? 28.041  14.461 40.806 1.00 41.56  ? 322  GLN A O     1 
ATOM   2666 C  CB    . GLN A 1 340 ? 30.240  12.272 41.324 1.00 45.93  ? 322  GLN A CB    1 
ATOM   2667 C  CG    . GLN A 1 340 ? 30.259  11.047 42.226 1.00 47.09  ? 322  GLN A CG    1 
ATOM   2668 C  CD    . GLN A 1 340 ? 30.539  9.776  41.437 1.00 48.00  ? 322  GLN A CD    1 
ATOM   2669 O  OE1   . GLN A 1 340 ? 31.459  9.739  40.599 1.00 47.87  ? 322  GLN A OE1   1 
ATOM   2670 N  NE2   . GLN A 1 340 ? 29.728  8.722  41.684 1.00 47.16  ? 322  GLN A NE2   1 
ATOM   2671 N  N     . HIS A 1 341 ? 30.064  15.144 40.164 1.00 47.84  ? 323  HIS A N     1 
ATOM   2672 C  CA    . HIS A 1 341 ? 29.546  15.940 39.079 1.00 47.81  ? 323  HIS A CA    1 
ATOM   2673 C  C     . HIS A 1 341 ? 28.715  15.069 38.149 1.00 45.42  ? 323  HIS A C     1 
ATOM   2674 O  O     . HIS A 1 341 ? 29.142  13.978 37.729 1.00 45.30  ? 323  HIS A O     1 
ATOM   2675 C  CB    . HIS A 1 341 ? 30.661  16.587 38.280 1.00 52.84  ? 323  HIS A CB    1 
ATOM   2676 C  CG    . HIS A 1 341 ? 30.155  17.388 37.123 1.00 55.44  ? 323  HIS A CG    1 
ATOM   2677 N  ND1   . HIS A 1 341 ? 29.351  18.497 37.287 1.00 57.72  ? 323  HIS A ND1   1 
ATOM   2678 C  CD2   . HIS A 1 341 ? 30.307  17.224 35.786 1.00 61.03  ? 323  HIS A CD2   1 
ATOM   2679 C  CE1   . HIS A 1 341 ? 29.049  18.998 36.101 1.00 60.30  ? 323  HIS A CE1   1 
ATOM   2680 N  NE2   . HIS A 1 341 ? 29.618  18.245 35.173 1.00 62.49  ? 323  HIS A NE2   1 
ATOM   2681 N  N     . GLY A 1 342 ? 27.528  15.554 37.825 1.00 42.61  ? 324  GLY A N     1 
ATOM   2682 C  CA    . GLY A 1 342 ? 26.694  14.864 36.875 1.00 41.69  ? 324  GLY A CA    1 
ATOM   2683 C  C     . GLY A 1 342 ? 25.798  13.804 37.473 1.00 38.31  ? 324  GLY A C     1 
ATOM   2684 O  O     . GLY A 1 342 ? 24.935  13.315 36.790 1.00 38.79  ? 324  GLY A O     1 
ATOM   2685 N  N     . ILE A 1 343 ? 25.963  13.451 38.747 1.00 36.33  ? 325  ILE A N     1 
ATOM   2686 C  CA    . ILE A 1 343 ? 25.139  12.435 39.342 1.00 33.78  ? 325  ILE A CA    1 
ATOM   2687 C  C     . ILE A 1 343 ? 23.719  12.987 39.584 1.00 30.53  ? 325  ILE A C     1 
ATOM   2688 O  O     . ILE A 1 343 ? 23.552  14.168 39.856 1.00 30.29  ? 325  ILE A O     1 
ATOM   2689 C  CB    . ILE A 1 343 ? 25.762  11.905 40.653 1.00 33.90  ? 325  ILE A CB    1 
ATOM   2690 C  CG1   . ILE A 1 343 ? 25.000  10.687 41.148 1.00 33.97  ? 325  ILE A CG1   1 
ATOM   2691 C  CG2   . ILE A 1 343 ? 25.786  13.019 41.719 1.00 36.50  ? 325  ILE A CG2   1 
ATOM   2692 C  CD1   . ILE A 1 343 ? 25.670  9.964  42.267 1.00 35.12  ? 325  ILE A CD1   1 
ATOM   2693 N  N     . VAL A 1 344 ? 22.714  12.131 39.416 1.00 28.39  ? 326  VAL A N     1 
ATOM   2694 C  CA    . VAL A 1 344 ? 21.336  12.466 39.690 1.00 26.18  ? 326  VAL A CA    1 
ATOM   2695 C  C     . VAL A 1 344 ? 20.824  11.411 40.650 1.00 24.50  ? 326  VAL A C     1 
ATOM   2696 O  O     . VAL A 1 344 ? 21.002  10.206 40.413 1.00 24.04  ? 326  VAL A O     1 
ATOM   2697 C  CB    . VAL A 1 344 ? 20.447  12.498 38.431 1.00 26.10  ? 326  VAL A CB    1 
ATOM   2698 C  CG1   . VAL A 1 344 ? 18.976  12.734 38.851 1.00 25.43  ? 326  VAL A CG1   1 
ATOM   2699 C  CG2   . VAL A 1 344 ? 20.910  13.609 37.477 1.00 28.38  ? 326  VAL A CG2   1 
ATOM   2700 N  N     . TYR A 1 345 ? 20.250  11.870 41.753 1.00 22.62  ? 327  TYR A N     1 
ATOM   2701 C  CA    . TYR A 1 345 ? 19.796  11.005 42.834 1.00 22.10  ? 327  TYR A CA    1 
ATOM   2702 C  C     . TYR A 1 345 ? 18.292  10.812 42.764 1.00 20.60  ? 327  TYR A C     1 
ATOM   2703 O  O     . TYR A 1 345 ? 17.578  11.661 42.259 1.00 20.21  ? 327  TYR A O     1 
ATOM   2704 C  CB    . TYR A 1 345 ? 20.129  11.612 44.201 1.00 23.68  ? 327  TYR A CB    1 
ATOM   2705 C  CG    . TYR A 1 345 ? 21.568  11.799 44.489 1.00 25.37  ? 327  TYR A CG    1 
ATOM   2706 C  CD1   . TYR A 1 345 ? 22.373  10.718 44.778 1.00 28.17  ? 327  TYR A CD1   1 
ATOM   2707 C  CD2   . TYR A 1 345 ? 22.141  13.057 44.478 1.00 27.33  ? 327  TYR A CD2   1 
ATOM   2708 C  CE1   . TYR A 1 345 ? 23.707  10.873 45.061 1.00 26.93  ? 327  TYR A CE1   1 
ATOM   2709 C  CE2   . TYR A 1 345 ? 23.499  13.213 44.742 1.00 30.85  ? 327  TYR A CE2   1 
ATOM   2710 C  CZ    . TYR A 1 345 ? 24.261  12.102 45.057 1.00 30.50  ? 327  TYR A CZ    1 
ATOM   2711 O  OH    . TYR A 1 345 ? 25.596  12.202 45.329 1.00 33.65  ? 327  TYR A OH    1 
ATOM   2712 N  N     . SER A 1 346 ? 17.839  9.725  43.379 1.00 20.40  ? 328  SER A N     1 
ATOM   2713 C  CA    . SER A 1 346 ? 16.422  9.394  43.482 1.00 20.56  ? 328  SER A CA    1 
ATOM   2714 C  C     . SER A 1 346 ? 16.143  8.881  44.892 1.00 19.34  ? 328  SER A C     1 
ATOM   2715 O  O     . SER A 1 346 ? 16.879  8.058  45.430 1.00 20.35  ? 328  SER A O     1 
ATOM   2716 C  CB    . SER A 1 346 ? 16.062  8.361  42.415 1.00 21.02  ? 328  SER A CB    1 
ATOM   2717 O  OG    . SER A 1 346 ? 14.843  7.676  42.672 1.00 22.68  ? 328  SER A OG    1 
ATOM   2718 N  N     . GLY A 1 347 ? 15.085  9.380  45.514 1.00 19.48  ? 329  GLY A N     1 
ATOM   2719 C  CA    . GLY A 1 347 ? 14.718  8.902  46.819 1.00 20.07  ? 329  GLY A CA    1 
ATOM   2720 C  C     . GLY A 1 347 ? 15.502  9.614  47.895 1.00 20.62  ? 329  GLY A C     1 
ATOM   2721 O  O     . GLY A 1 347 ? 15.628  10.835 47.884 1.00 22.43  ? 329  GLY A O     1 
ATOM   2722 N  N     . GLY A 1 348 ? 16.040  8.856  48.828 1.00 20.57  ? 330  GLY A N     1 
ATOM   2723 C  CA    . GLY A 1 348 ? 16.806  9.442  49.916 1.00 21.93  ? 330  GLY A CA    1 
ATOM   2724 C  C     . GLY A 1 348 ? 15.919  10.172 50.907 1.00 22.40  ? 330  GLY A C     1 
ATOM   2725 O  O     . GLY A 1 348 ? 14.720  9.889  51.016 1.00 23.14  ? 330  GLY A O     1 
ATOM   2726 N  N     . SER A 1 349 ? 16.522  11.128 51.603 1.00 23.47  ? 331  SER A N     1 
ATOM   2727 C  CA    . SER A 1 349 ? 15.884  11.890 52.681 1.00 22.45  ? 331  SER A CA    1 
ATOM   2728 C  C     . SER A 1 349 ? 16.452  13.288 52.675 1.00 22.84  ? 331  SER A C     1 
ATOM   2729 O  O     . SER A 1 349 ? 17.491  13.539 52.024 1.00 23.17  ? 331  SER A O     1 
ATOM   2730 C  CB    . SER A 1 349 ? 16.107  11.213 54.039 1.00 24.49  ? 331  SER A CB    1 
ATOM   2731 O  OG    . SER A 1 349 ? 17.433  11.355 54.531 1.00 26.57  ? 331  SER A OG    1 
ATOM   2732 N  N     . SER A 1 350 ? 15.849  14.181 53.443 1.00 21.79  ? 332  SER A N     1 
ATOM   2733 C  CA    . SER A 1 350 ? 16.387  15.534 53.591 1.00 22.91  ? 332  SER A CA    1 
ATOM   2734 C  C     . SER A 1 350 ? 17.802  15.512 54.148 1.00 23.79  ? 332  SER A C     1 
ATOM   2735 O  O     . SER A 1 350 ? 18.607  16.404 53.863 1.00 24.48  ? 332  SER A O     1 
ATOM   2736 C  CB    . SER A 1 350 ? 15.480  16.388 54.489 1.00 23.22  ? 332  SER A CB    1 
ATOM   2737 O  OG    . SER A 1 350 ? 15.315  15.833 55.783 1.00 25.98  ? 332  SER A OG    1 
ATOM   2738 N  N     . ASP A 1 351 ? 18.115  14.502 54.953 1.00 29.26  ? 333  ASP A N     1 
ATOM   2739 C  CA    . ASP A 1 351 ? 19.472  14.338 55.468 1.00 31.63  ? 333  ASP A CA    1 
ATOM   2740 C  C     . ASP A 1 351 ? 20.520  14.079 54.375 1.00 32.80  ? 333  ASP A C     1 
ATOM   2741 O  O     . ASP A 1 351 ? 21.689  14.372 54.565 1.00 32.57  ? 333  ASP A O     1 
ATOM   2742 C  CB    . ASP A 1 351 ? 19.539  13.230 56.508 1.00 34.73  ? 333  ASP A CB    1 
ATOM   2743 C  CG    . ASP A 1 351 ? 18.891  13.633 57.854 1.00 36.73  ? 333  ASP A CG    1 
ATOM   2744 O  OD1   . ASP A 1 351 ? 18.679  14.834 58.124 1.00 39.91  ? 333  ASP A OD1   1 
ATOM   2745 O  OD2   . ASP A 1 351 ? 18.586  12.726 58.636 1.00 44.38  ? 333  ASP A OD2   1 
ATOM   2746 N  N     . THR A 1 352 ? 20.101  13.506 53.253 1.00 33.33  ? 334  THR A N     1 
ATOM   2747 C  CA    . THR A 1 352 ? 20.965  13.338 52.087 1.00 34.87  ? 334  THR A CA    1 
ATOM   2748 C  C     . THR A 1 352 ? 21.489  14.676 51.589 1.00 33.15  ? 334  THR A C     1 
ATOM   2749 O  O     . THR A 1 352 ? 22.671  14.847 51.350 1.00 34.19  ? 334  THR A O     1 
ATOM   2750 C  CB    . THR A 1 352 ? 20.217  12.696 50.892 1.00 35.81  ? 334  THR A CB    1 
ATOM   2751 O  OG1   . THR A 1 352 ? 19.614  11.452 51.295 1.00 37.59  ? 334  THR A OG1   1 
ATOM   2752 C  CG2   . THR A 1 352 ? 21.203  12.463 49.692 1.00 37.48  ? 334  THR A CG2   1 
ATOM   2753 N  N     . ILE A 1 353 ? 20.589  15.618 51.442 1.00 32.44  ? 335  ILE A N     1 
ATOM   2754 C  CA    . ILE A 1 353 ? 20.950  16.949 50.985 1.00 32.43  ? 335  ILE A CA    1 
ATOM   2755 C  C     . ILE A 1 353 ? 21.872  17.642 51.981 1.00 32.10  ? 335  ILE A C     1 
ATOM   2756 O  O     . ILE A 1 353 ? 22.926  18.172 51.616 1.00 32.79  ? 335  ILE A O     1 
ATOM   2757 C  CB    . ILE A 1 353 ? 19.663  17.766 50.693 1.00 30.76  ? 335  ILE A CB    1 
ATOM   2758 C  CG1   . ILE A 1 353 ? 18.945  17.105 49.496 1.00 32.78  ? 335  ILE A CG1   1 
ATOM   2759 C  CG2   . ILE A 1 353 ? 19.994  19.256 50.410 1.00 30.23  ? 335  ILE A CG2   1 
ATOM   2760 C  CD1   . ILE A 1 353 ? 17.642  17.621 49.166 1.00 31.51  ? 335  ILE A CD1   1 
ATOM   2761 N  N     . CYS A 1 354 ? 21.522  17.567 53.254 1.00 32.22  ? 336  CYS A N     1 
ATOM   2762 C  CA    . CYS A 1 354 ? 22.317  18.210 54.268 1.00 32.74  ? 336  CYS A CA    1 
ATOM   2763 C  C     . CYS A 1 354 ? 23.713  17.663 54.313 1.00 33.93  ? 336  CYS A C     1 
ATOM   2764 O  O     . CYS A 1 354 ? 24.670  18.410 54.368 1.00 34.12  ? 336  CYS A O     1 
ATOM   2765 C  CB    . CYS A 1 354 ? 21.666  18.031 55.629 1.00 33.61  ? 336  CYS A CB    1 
ATOM   2766 S  SG    . CYS A 1 354 ? 20.233  19.039 55.741 1.00 37.23  ? 336  CYS A SG    1 
ATOM   2767 N  N     . ASP A 1 355 ? 23.834  16.351 54.281 1.00 34.88  ? 337  ASP A N     1 
ATOM   2768 C  CA    . ASP A 1 355 ? 25.116  15.732 54.358 1.00 37.74  ? 337  ASP A CA    1 
ATOM   2769 C  C     . ASP A 1 355 ? 25.984  16.000 53.123 1.00 37.87  ? 337  ASP A C     1 
ATOM   2770 O  O     . ASP A 1 355 ? 27.174  16.328 53.254 1.00 39.07  ? 337  ASP A O     1 
ATOM   2771 C  CB    . ASP A 1 355 ? 24.944  14.225 54.556 1.00 40.78  ? 337  ASP A CB    1 
ATOM   2772 C  CG    . ASP A 1 355 ? 24.418  13.859 55.957 1.00 45.35  ? 337  ASP A CG    1 
ATOM   2773 O  OD1   . ASP A 1 355 ? 24.124  14.764 56.806 1.00 50.22  ? 337  ASP A OD1   1 
ATOM   2774 O  OD2   . ASP A 1 355 ? 24.274  12.637 56.200 1.00 53.45  ? 337  ASP A OD2   1 
ATOM   2775 N  N     . LEU A 1 356 ? 25.413  15.802 51.939 1.00 36.73  ? 338  LEU A N     1 
ATOM   2776 C  CA    . LEU A 1 356 ? 26.143  15.972 50.672 1.00 37.66  ? 338  LEU A CA    1 
ATOM   2777 C  C     . LEU A 1 356 ? 26.525  17.431 50.350 1.00 36.28  ? 338  LEU A C     1 
ATOM   2778 O  O     . LEU A 1 356 ? 27.546  17.680 49.689 1.00 37.43  ? 338  LEU A O     1 
ATOM   2779 C  CB    . LEU A 1 356 ? 25.340  15.360 49.515 1.00 38.15  ? 338  LEU A CB    1 
ATOM   2780 C  CG    . LEU A 1 356 ? 25.292  13.814 49.484 1.00 39.26  ? 338  LEU A CG    1 
ATOM   2781 C  CD1   . LEU A 1 356 ? 24.357  13.347 48.384 1.00 39.24  ? 338  LEU A CD1   1 
ATOM   2782 C  CD2   . LEU A 1 356 ? 26.673  13.161 49.355 1.00 42.55  ? 338  LEU A CD2   1 
ATOM   2783 N  N     . LEU A 1 357 ? 25.702  18.378 50.775 1.00 33.41  ? 339  LEU A N     1 
ATOM   2784 C  CA    . LEU A 1 357 ? 26.001  19.792 50.612 1.00 33.69  ? 339  LEU A CA    1 
ATOM   2785 C  C     . LEU A 1 357 ? 26.640  20.435 51.850 1.00 34.81  ? 339  LEU A C     1 
ATOM   2786 O  O     . LEU A 1 357 ? 27.032  21.604 51.799 1.00 35.14  ? 339  LEU A O     1 
ATOM   2787 C  CB    . LEU A 1 357 ? 24.740  20.557 50.221 1.00 31.03  ? 339  LEU A CB    1 
ATOM   2788 C  CG    . LEU A 1 357 ? 24.064  20.158 48.909 1.00 29.24  ? 339  LEU A CG    1 
ATOM   2789 C  CD1   . LEU A 1 357 ? 22.972  21.170 48.593 1.00 28.49  ? 339  LEU A CD1   1 
ATOM   2790 C  CD2   . LEU A 1 357 ? 25.040  20.086 47.785 1.00 28.93  ? 339  LEU A CD2   1 
ATOM   2791 N  N     . GLY A 1 358 ? 26.735  19.686 52.951 1.00 35.54  ? 340  GLY A N     1 
ATOM   2792 C  CA    . GLY A 1 358 ? 27.350  20.177 54.186 1.00 36.40  ? 340  GLY A CA    1 
ATOM   2793 C  C     . GLY A 1 358 ? 26.595  21.327 54.806 1.00 35.13  ? 340  GLY A C     1 
ATOM   2794 O  O     . GLY A 1 358 ? 27.198  22.288 55.272 1.00 36.14  ? 340  GLY A O     1 
ATOM   2795 N  N     . ALA A 1 359 ? 25.268  21.241 54.801 1.00 33.90  ? 341  ALA A N     1 
ATOM   2796 C  CA    . ALA A 1 359 ? 24.403  22.273 55.325 1.00 32.70  ? 341  ALA A CA    1 
ATOM   2797 C  C     . ALA A 1 359 ? 23.723  21.770 56.617 1.00 33.06  ? 341  ALA A C     1 
ATOM   2798 O  O     . ALA A 1 359 ? 23.506  20.564 56.801 1.00 34.25  ? 341  ALA A O     1 
ATOM   2799 C  CB    . ALA A 1 359 ? 23.347  22.613 54.306 1.00 31.46  ? 341  ALA A CB    1 
ATOM   2800 N  N     . LYS A 1 360 ? 23.430  22.700 57.510 1.00 32.02  ? 342  LYS A N     1 
ATOM   2801 C  CA    . LYS A 1 360 ? 22.497  22.479 58.590 1.00 32.35  ? 342  LYS A CA    1 
ATOM   2802 C  C     . LYS A 1 360 ? 21.193  23.098 58.046 1.00 30.27  ? 342  LYS A C     1 
ATOM   2803 O  O     . LYS A 1 360 ? 21.241  23.907 57.111 1.00 31.69  ? 342  LYS A O     1 
ATOM   2804 C  CB    . LYS A 1 360 ? 22.961  23.213 59.856 1.00 33.86  ? 342  LYS A CB    1 
ATOM   2805 C  CG    . LYS A 1 360 ? 24.412  23.002 60.266 1.00 38.19  ? 342  LYS A CG    1 
ATOM   2806 C  CD    . LYS A 1 360 ? 24.761  21.506 60.558 1.00 44.21  ? 342  LYS A CD    1 
ATOM   2807 C  CE    . LYS A 1 360 ? 26.299  21.212 60.460 1.00 46.36  ? 342  LYS A CE    1 
ATOM   2808 N  NZ    . LYS A 1 360 ? 26.840  21.299 59.036 1.00 50.96  ? 342  LYS A NZ    1 
ATOM   2809 N  N     . GLY A 1 361 ? 20.052  22.761 58.639 1.00 29.45  ? 343  GLY A N     1 
ATOM   2810 C  CA    . GLY A 1 361 ? 18.755  23.277 58.190 1.00 26.97  ? 343  GLY A CA    1 
ATOM   2811 C  C     . GLY A 1 361 ? 18.588  24.783 58.044 1.00 25.22  ? 343  GLY A C     1 
ATOM   2812 O  O     . GLY A 1 361 ? 18.016  25.267 57.071 1.00 23.31  ? 343  GLY A O     1 
ATOM   2813 N  N     . LYS A 1 362 ? 19.071  25.543 58.997 1.00 24.96  ? 344  LYS A N     1 
ATOM   2814 C  CA    . LYS A 1 362 ? 18.957  27.004 58.927 1.00 25.70  ? 344  LYS A CA    1 
ATOM   2815 C  C     . LYS A 1 362 ? 19.818  27.694 57.860 1.00 25.86  ? 344  LYS A C     1 
ATOM   2816 O  O     . LYS A 1 362 ? 19.654  28.906 57.618 1.00 27.76  ? 344  LYS A O     1 
ATOM   2817 C  CB    . LYS A 1 362 ? 19.179  27.612 60.289 1.00 26.84  ? 344  LYS A CB    1 
ATOM   2818 C  CG    . LYS A 1 362 ? 17.981  27.364 61.220 1.00 25.12  ? 344  LYS A CG    1 
ATOM   2819 C  CD    . LYS A 1 362 ? 18.345  27.492 62.688 1.00 28.12  ? 344  LYS A CD    1 
ATOM   2820 C  CE    . LYS A 1 362 ? 17.201  27.060 63.537 1.00 28.16  ? 344  LYS A CE    1 
ATOM   2821 N  NZ    . LYS A 1 362 ? 17.567  26.969 64.969 1.00 25.55  ? 344  LYS A NZ    1 
ATOM   2822 N  N     . ASP A 1 363 ? 20.724  26.936 57.251 1.00 27.26  ? 345  ASP A N     1 
ATOM   2823 C  CA    . ASP A 1 363 ? 21.542  27.379 56.107 1.00 27.52  ? 345  ASP A CA    1 
ATOM   2824 C  C     . ASP A 1 363 ? 20.773  27.172 54.800 1.00 25.22  ? 345  ASP A C     1 
ATOM   2825 O  O     . ASP A 1 363 ? 21.256  27.535 53.712 1.00 26.11  ? 345  ASP A O     1 
ATOM   2826 C  CB    . ASP A 1 363 ? 22.770  26.470 55.897 1.00 29.39  ? 345  ASP A CB    1 
ATOM   2827 C  CG    . ASP A 1 363 ? 23.750  26.452 57.022 1.00 35.78  ? 345  ASP A CG    1 
ATOM   2828 O  OD1   . ASP A 1 363 ? 23.923  27.465 57.785 1.00 38.17  ? 345  ASP A OD1   1 
ATOM   2829 O  OD2   . ASP A 1 363 ? 24.439  25.391 57.086 1.00 39.75  ? 345  ASP A OD2   1 
ATOM   2830 N  N     . ILE A 1 364 ? 19.635  26.490 54.867 1.00 24.14  ? 346  ILE A N     1 
ATOM   2831 C  CA    . ILE A 1 364 ? 18.875  26.132 53.666 1.00 22.89  ? 346  ILE A CA    1 
ATOM   2832 C  C     . ILE A 1 364 ? 17.611  26.961 53.568 1.00 21.91  ? 346  ILE A C     1 
ATOM   2833 O  O     . ILE A 1 364 ? 16.831  27.006 54.512 1.00 22.01  ? 346  ILE A O     1 
ATOM   2834 C  CB    . ILE A 1 364 ? 18.473  24.647 53.690 1.00 22.67  ? 346  ILE A CB    1 
ATOM   2835 C  CG1   . ILE A 1 364 ? 19.734  23.770 53.726 1.00 23.46  ? 346  ILE A CG1   1 
ATOM   2836 C  CG2   . ILE A 1 364 ? 17.519  24.299 52.488 1.00 20.39  ? 346  ILE A CG2   1 
ATOM   2837 C  CD1   . ILE A 1 364 ? 19.468  22.352 54.153 1.00 25.20  ? 346  ILE A CD1   1 
ATOM   2838 N  N     . LEU A 1 365 ? 17.420  27.595 52.420 1.00 22.00  ? 347  LEU A N     1 
ATOM   2839 C  CA    . LEU A 1 365 ? 16.119  28.160 52.034 1.00 20.94  ? 347  LEU A CA    1 
ATOM   2840 C  C     . LEU A 1 365 ? 15.494  27.223 51.000 1.00 19.32  ? 347  LEU A C     1 
ATOM   2841 O  O     . LEU A 1 365 ? 15.985  27.073 49.903 1.00 19.48  ? 347  LEU A O     1 
ATOM   2842 C  CB    . LEU A 1 365 ? 16.277  29.586 51.475 1.00 22.27  ? 347  LEU A CB    1 
ATOM   2843 C  CG    . LEU A 1 365 ? 14.938  30.291 51.152 1.00 20.69  ? 347  LEU A CG    1 
ATOM   2844 C  CD1   . LEU A 1 365 ? 14.016  30.387 52.399 1.00 20.36  ? 347  LEU A CD1   1 
ATOM   2845 C  CD2   . LEU A 1 365 ? 15.160  31.615 50.495 1.00 22.62  ? 347  LEU A CD2   1 
ATOM   2846 N  N     . TYR A 1 366 ? 14.419  26.549 51.391 1.00 20.32  ? 348  TYR A N     1 
ATOM   2847 C  CA    . TYR A 1 366 ? 13.708  25.663 50.499 1.00 19.94  ? 348  TYR A CA    1 
ATOM   2848 C  C     . TYR A 1 366 ? 12.438  26.363 49.962 1.00 19.73  ? 348  TYR A C     1 
ATOM   2849 O  O     . TYR A 1 366 ? 11.630  26.889 50.731 1.00 20.07  ? 348  TYR A O     1 
ATOM   2850 C  CB    . TYR A 1 366 ? 13.336  24.373 51.214 1.00 19.87  ? 348  TYR A CB    1 
ATOM   2851 C  CG    . TYR A 1 366 ? 12.701  23.376 50.301 1.00 20.66  ? 348  TYR A CG    1 
ATOM   2852 C  CD1   . TYR A 1 366 ? 13.353  22.959 49.151 1.00 21.76  ? 348  TYR A CD1   1 
ATOM   2853 C  CD2   . TYR A 1 366 ? 11.441  22.872 50.555 1.00 22.83  ? 348  TYR A CD2   1 
ATOM   2854 C  CE1   . TYR A 1 366 ? 12.807  22.047 48.306 1.00 22.29  ? 348  TYR A CE1   1 
ATOM   2855 C  CE2   . TYR A 1 366 ? 10.865  21.962 49.670 1.00 23.82  ? 348  TYR A CE2   1 
ATOM   2856 C  CZ    . TYR A 1 366 ? 11.538  21.572 48.550 1.00 23.54  ? 348  TYR A CZ    1 
ATOM   2857 O  OH    . TYR A 1 366 ? 11.001  20.656 47.661 1.00 26.61  ? 348  TYR A OH    1 
ATOM   2858 N  N     . ILE A 1 367 ? 12.310  26.335 48.643 1.00 19.97  ? 349  ILE A N     1 
ATOM   2859 C  CA    . ILE A 1 367 ? 11.324  27.109 47.905 1.00 19.73  ? 349  ILE A CA    1 
ATOM   2860 C  C     . ILE A 1 367 ? 10.351  26.126 47.321 1.00 19.00  ? 349  ILE A C     1 
ATOM   2861 O  O     . ILE A 1 367 ? 10.713  25.341 46.466 1.00 18.99  ? 349  ILE A O     1 
ATOM   2862 C  CB    . ILE A 1 367 ? 12.017  27.950 46.789 1.00 20.94  ? 349  ILE A CB    1 
ATOM   2863 C  CG1   . ILE A 1 367 ? 13.080  28.860 47.427 1.00 21.12  ? 349  ILE A CG1   1 
ATOM   2864 C  CG2   . ILE A 1 367 ? 10.988  28.751 45.966 1.00 21.09  ? 349  ILE A CG2   1 
ATOM   2865 C  CD1   . ILE A 1 367 ? 14.116  29.364 46.500 1.00 22.35  ? 349  ILE A CD1   1 
ATOM   2866 N  N     . GLY A 1 368 ? 9.110   26.155 47.800 1.00 19.11  ? 350  GLY A N     1 
ATOM   2867 C  CA    . GLY A 1 368 ? 8.113   25.239 47.258 1.00 20.46  ? 350  GLY A CA    1 
ATOM   2868 C  C     . GLY A 1 368 ? 6.707   25.802 47.314 1.00 19.98  ? 350  GLY A C     1 
ATOM   2869 O  O     . GLY A 1 368 ? 6.483   26.934 47.782 1.00 20.80  ? 350  GLY A O     1 
ATOM   2870 N  N     . ASP A 1 369 ? 5.788   25.004 46.790 1.00 20.01  ? 351  ASP A N     1 
ATOM   2871 C  CA    . ASP A 1 369 ? 4.361   25.379 46.613 1.00 20.57  ? 351  ASP A CA    1 
ATOM   2872 C  C     . ASP A 1 369 ? 3.426   24.548 47.474 1.00 20.14  ? 351  ASP A C     1 
ATOM   2873 O  O     . ASP A 1 369 ? 2.268   24.905 47.574 1.00 19.62  ? 351  ASP A O     1 
ATOM   2874 C  CB    . ASP A 1 369 ? 3.900   25.235 45.165 1.00 20.64  ? 351  ASP A CB    1 
ATOM   2875 C  CG    . ASP A 1 369 ? 3.902   23.781 44.701 1.00 22.36  ? 351  ASP A CG    1 
ATOM   2876 O  OD1   . ASP A 1 369 ? 5.009   23.203 44.565 1.00 22.39  ? 351  ASP A OD1   1 
ATOM   2877 O  OD2   . ASP A 1 369 ? 2.833   23.173 44.551 1.00 22.15  ? 351  ASP A OD2   1 
ATOM   2878 N  N     . HIS A 1 370 ? 3.900   23.431 48.061 1.00 20.38  ? 352  HIS A N     1 
ATOM   2879 C  CA    . HIS A 1 370 ? 3.006   22.531 48.792 1.00 20.54  ? 352  HIS A CA    1 
ATOM   2880 C  C     . HIS A 1 370 ? 3.154   22.919 50.266 1.00 20.56  ? 352  HIS A C     1 
ATOM   2881 O  O     . HIS A 1 370 ? 4.186   22.655 50.914 1.00 19.51  ? 352  HIS A O     1 
ATOM   2882 C  CB    . HIS A 1 370 ? 3.342   21.060 48.564 1.00 21.23  ? 352  HIS A CB    1 
ATOM   2883 C  CG    . HIS A 1 370 ? 2.292   20.101 49.036 1.00 21.65  ? 352  HIS A CG    1 
ATOM   2884 N  ND1   . HIS A 1 370 ? 1.964   18.964 48.343 1.00 25.04  ? 352  HIS A ND1   1 
ATOM   2885 C  CD2   . HIS A 1 370 ? 1.449   20.144 50.095 1.00 18.14  ? 352  HIS A CD2   1 
ATOM   2886 C  CE1   . HIS A 1 370 ? 0.988   18.328 48.970 1.00 18.33  ? 352  HIS A CE1   1 
ATOM   2887 N  NE2   . HIS A 1 370 ? 0.656   19.033 50.034 1.00 23.99  ? 352  HIS A NE2   1 
ATOM   2888 N  N     . ILE A 1 371 ? 2.098   23.496 50.800 1.00 20.00  ? 353  ILE A N     1 
ATOM   2889 C  CA    . ILE A 1 371 ? 2.103   24.036 52.129 1.00 19.86  ? 353  ILE A CA    1 
ATOM   2890 C  C     . ILE A 1 371 ? 2.407   22.946 53.175 1.00 20.10  ? 353  ILE A C     1 
ATOM   2891 O  O     . ILE A 1 371 ? 3.084   23.232 54.182 1.00 21.98  ? 353  ILE A O     1 
ATOM   2892 C  CB    . ILE A 1 371 ? 0.796   24.810 52.445 1.00 20.55  ? 353  ILE A CB    1 
ATOM   2893 C  CG1   . ILE A 1 371 ? 0.880   25.567 53.791 1.00 22.35  ? 353  ILE A CG1   1 
ATOM   2894 C  CG2   . ILE A 1 371 ? -0.410  23.874 52.447 1.00 20.92  ? 353  ILE A CG2   1 
ATOM   2895 C  CD1   . ILE A 1 371 ? 2.147   26.428 54.019 1.00 22.02  ? 353  ILE A CD1   1 
ATOM   2896 N  N     . PHE A 1 372 ? 1.921   21.741 52.939 1.00 21.31  ? 354  PHE A N     1 
ATOM   2897 C  CA    . PHE A 1 372 ? 2.126   20.635 53.845 1.00 22.04  ? 354  PHE A CA    1 
ATOM   2898 C  C     . PHE A 1 372 ? 3.441   19.920 53.537 1.00 22.18  ? 354  PHE A C     1 
ATOM   2899 O  O     . PHE A 1 372 ? 4.338   19.841 54.411 1.00 24.01  ? 354  PHE A O     1 
ATOM   2900 C  CB    . PHE A 1 372 ? 0.929   19.680 53.826 1.00 23.18  ? 354  PHE A CB    1 
ATOM   2901 C  CG    . PHE A 1 372 ? 1.027   18.569 54.819 1.00 23.82  ? 354  PHE A CG    1 
ATOM   2902 C  CD1   . PHE A 1 372 ? 0.932   18.827 56.193 1.00 24.90  ? 354  PHE A CD1   1 
ATOM   2903 C  CD2   . PHE A 1 372 ? 1.181   17.254 54.402 1.00 26.59  ? 354  PHE A CD2   1 
ATOM   2904 C  CE1   . PHE A 1 372 ? 1.023   17.776 57.159 1.00 26.06  ? 354  PHE A CE1   1 
ATOM   2905 C  CE2   . PHE A 1 372 ? 1.279   16.223 55.342 1.00 26.94  ? 354  PHE A CE2   1 
ATOM   2906 C  CZ    . PHE A 1 372 ? 1.213   16.498 56.732 1.00 26.35  ? 354  PHE A CZ    1 
ATOM   2907 N  N     . GLY A 1 373 ? 3.570   19.419 52.311 1.00 22.38  ? 355  GLY A N     1 
ATOM   2908 C  CA    . GLY A 1 373 ? 4.656   18.532 51.948 1.00 23.56  ? 355  GLY A CA    1 
ATOM   2909 C  C     . GLY A 1 373 ? 6.000   19.160 51.709 1.00 23.05  ? 355  GLY A C     1 
ATOM   2910 O  O     . GLY A 1 373 ? 7.029   18.489 51.840 1.00 24.95  ? 355  GLY A O     1 
ATOM   2911 N  N     . ASP A 1 374 ? 6.007   20.432 51.343 1.00 22.34  ? 356  ASP A N     1 
ATOM   2912 C  CA    . ASP A 1 374 ? 7.235   21.194 51.183 1.00 22.20  ? 356  ASP A CA    1 
ATOM   2913 C  C     . ASP A 1 374 ? 7.561   22.046 52.419 1.00 21.98  ? 356  ASP A C     1 
ATOM   2914 O  O     . ASP A 1 374 ? 8.692   22.043 52.898 1.00 23.37  ? 356  ASP A O     1 
ATOM   2915 C  CB    . ASP A 1 374 ? 7.170   22.165 49.989 1.00 21.48  ? 356  ASP A CB    1 
ATOM   2916 C  CG    . ASP A 1 374 ? 7.099   21.463 48.649 1.00 22.68  ? 356  ASP A CG    1 
ATOM   2917 O  OD1   . ASP A 1 374 ? 7.675   20.377 48.487 1.00 24.33  ? 356  ASP A OD1   1 
ATOM   2918 O  OD2   . ASP A 1 374 ? 6.499   22.027 47.717 1.00 21.49  ? 356  ASP A OD2   1 
ATOM   2919 N  N     . ILE A 1 375 ? 6.595   22.825 52.892 1.00 20.86  ? 357  ILE A N     1 
ATOM   2920 C  CA    . ILE A 1 375 ? 6.877   23.911 53.805 1.00 19.90  ? 357  ILE A CA    1 
ATOM   2921 C  C     . ILE A 1 375 ? 6.705   23.526 55.284 1.00 20.07  ? 357  ILE A C     1 
ATOM   2922 O  O     . ILE A 1 375 ? 7.655   23.593 56.091 1.00 18.67  ? 357  ILE A O     1 
ATOM   2923 C  CB    . ILE A 1 375 ? 6.011   25.163 53.421 1.00 20.09  ? 357  ILE A CB    1 
ATOM   2924 C  CG1   . ILE A 1 375 ? 6.311   25.566 51.968 1.00 20.87  ? 357  ILE A CG1   1 
ATOM   2925 C  CG2   . ILE A 1 375 ? 6.242   26.338 54.426 1.00 20.25  ? 357  ILE A CG2   1 
ATOM   2926 C  CD1   . ILE A 1 375 ? 7.774   25.942 51.606 1.00 19.60  ? 357  ILE A CD1   1 
ATOM   2927 N  N     . LEU A 1 376 ? 5.508   23.114 55.670 1.00 19.68  ? 358  LEU A N     1 
ATOM   2928 C  CA    . LEU A 1 376 ? 5.274   22.702 57.026 1.00 20.84  ? 358  LEU A CA    1 
ATOM   2929 C  C     . LEU A 1 376 ? 6.236   21.587 57.454 1.00 21.25  ? 358  LEU A C     1 
ATOM   2930 O  O     . LEU A 1 376 ? 6.834   21.651 58.522 1.00 21.25  ? 358  LEU A O     1 
ATOM   2931 C  CB    . LEU A 1 376 ? 3.821   22.261 57.209 1.00 21.17  ? 358  LEU A CB    1 
ATOM   2932 C  CG    . LEU A 1 376 ? 3.332   21.781 58.589 1.00 23.40  ? 358  LEU A CG    1 
ATOM   2933 C  CD1   . LEU A 1 376 ? 1.822   21.938 58.715 1.00 25.77  ? 358  LEU A CD1   1 
ATOM   2934 C  CD2   . LEU A 1 376 ? 3.754   20.329 58.910 1.00 24.15  ? 358  LEU A CD2   1 
ATOM   2935 N  N     . LYS A 1 377 ? 6.373   20.553 56.636 1.00 20.81  ? 359  LYS A N     1 
ATOM   2936 C  CA    . LYS A 1 377 ? 7.199   19.389 57.059 1.00 22.52  ? 359  LYS A CA    1 
ATOM   2937 C  C     . LYS A 1 377 ? 8.705   19.729 57.101 1.00 21.49  ? 359  LYS A C     1 
ATOM   2938 O  O     . LYS A 1 377 ? 9.400   19.312 58.000 1.00 22.34  ? 359  LYS A O     1 
ATOM   2939 C  CB    . LYS A 1 377 ? 6.899   18.167 56.178 1.00 23.08  ? 359  LYS A CB    1 
ATOM   2940 C  CG    . LYS A 1 377 ? 5.548   17.543 56.530 1.00 25.81  ? 359  LYS A CG    1 
ATOM   2941 C  CD    . LYS A 1 377 ? 5.600   16.885 57.880 1.00 29.45  ? 359  LYS A CD    1 
ATOM   2942 C  CE    . LYS A 1 377 ? 4.212   16.372 58.255 1.00 32.69  ? 359  LYS A CE    1 
ATOM   2943 N  NZ    . LYS A 1 377 ? 4.227   15.615 59.523 1.00 36.18  ? 359  LYS A NZ    1 
ATOM   2944 N  N     . SER A 1 378 ? 9.193   20.520 56.178 1.00 21.22  ? 360  SER A N     1 
ATOM   2945 C  CA    . SER A 1 378 ? 10.646  20.865 56.212 1.00 21.46  ? 360  SER A CA    1 
ATOM   2946 C  C     . SER A 1 378 ? 10.928  21.782 57.412 1.00 21.39  ? 360  SER A C     1 
ATOM   2947 O  O     . SER A 1 378 ? 11.981  21.662 58.060 1.00 22.21  ? 360  SER A O     1 
ATOM   2948 C  CB    . SER A 1 378 ? 11.148  21.511 54.932 1.00 22.04  ? 360  SER A CB    1 
ATOM   2949 O  OG    . SER A 1 378 ? 10.515  22.761 54.669 1.00 20.56  ? 360  SER A OG    1 
ATOM   2950 N  N     . LYS A 1 379 ? 9.975   22.668 57.732 1.00 20.22  ? 361  LYS A N     1 
ATOM   2951 C  CA    . LYS A 1 379 ? 10.118  23.557 58.890 1.00 21.12  ? 361  LYS A CA    1 
ATOM   2952 C  C     . LYS A 1 379 ? 10.085  22.750 60.178 1.00 21.59  ? 361  LYS A C     1 
ATOM   2953 O  O     . LYS A 1 379 ? 11.004  22.846 60.993 1.00 20.85  ? 361  LYS A O     1 
ATOM   2954 C  CB    . LYS A 1 379 ? 8.994   24.627 58.918 1.00 20.87  ? 361  LYS A CB    1 
ATOM   2955 C  CG    . LYS A 1 379 ? 8.942   25.548 60.172 1.00 22.65  ? 361  LYS A CG    1 
ATOM   2956 C  CD    . LYS A 1 379 ? 10.214  26.321 60.351 1.00 23.85  ? 361  LYS A CD    1 
ATOM   2957 C  CE    . LYS A 1 379 ? 10.469  27.308 59.230 1.00 24.87  ? 361  LYS A CE    1 
ATOM   2958 N  NZ    . LYS A 1 379 ? 11.633  28.232 59.573 1.00 26.57  ? 361  LYS A NZ    1 
ATOM   2959 N  N     . LYS A 1 380 ? 9.015   21.971 60.379 1.00 21.99  ? 362  LYS A N     1 
ATOM   2960 C  CA    . LYS A 1 380 ? 8.829   21.264 61.641 1.00 24.03  ? 362  LYS A CA    1 
ATOM   2961 C  C     . LYS A 1 380 ? 9.786   20.082 61.862 1.00 23.56  ? 362  LYS A C     1 
ATOM   2962 O  O     . LYS A 1 380 ? 10.220  19.841 62.955 1.00 22.91  ? 362  LYS A O     1 
ATOM   2963 C  CB    . LYS A 1 380 ? 7.391   20.764 61.775 1.00 25.32  ? 362  LYS A CB    1 
ATOM   2964 C  CG    . LYS A 1 380 ? 6.387   21.875 61.978 1.00 27.26  ? 362  LYS A CG    1 
ATOM   2965 C  CD    . LYS A 1 380 ? 4.964   21.303 62.197 1.00 29.58  ? 362  LYS A CD    1 
ATOM   2966 C  CE    . LYS A 1 380 ? 4.894   20.459 63.402 1.00 36.51  ? 362  LYS A CE    1 
ATOM   2967 N  NZ    . LYS A 1 380 ? 3.510   20.494 63.966 1.00 41.83  ? 362  LYS A NZ    1 
ATOM   2968 N  N     . ARG A 1 381 ? 10.127  19.363 60.806 1.00 22.90  ? 363  ARG A N     1 
ATOM   2969 C  CA    . ARG A 1 381 ? 10.902  18.162 60.971 1.00 25.36  ? 363  ARG A CA    1 
ATOM   2970 C  C     . ARG A 1 381 ? 12.382  18.485 60.968 1.00 23.87  ? 363  ARG A C     1 
ATOM   2971 O  O     . ARG A 1 381 ? 13.143  17.777 61.564 1.00 24.22  ? 363  ARG A O     1 
ATOM   2972 C  CB    . ARG A 1 381 ? 10.580  17.152 59.857 1.00 26.17  ? 363  ARG A CB    1 
ATOM   2973 C  CG    . ARG A 1 381 ? 9.160   16.579 59.866 1.00 29.83  ? 363  ARG A CG    1 
ATOM   2974 C  CD    . ARG A 1 381 ? 8.986   15.290 60.569 1.00 39.84  ? 363  ARG A CD    1 
ATOM   2975 N  NE    . ARG A 1 381 ? 10.265  14.772 61.002 1.00 44.41  ? 363  ARG A NE    1 
ATOM   2976 C  CZ    . ARG A 1 381 ? 10.529  13.526 61.321 1.00 50.95  ? 363  ARG A CZ    1 
ATOM   2977 N  NH1   . ARG A 1 381 ? 9.574   12.594 61.386 1.00 53.81  ? 363  ARG A NH1   1 
ATOM   2978 N  NH2   . ARG A 1 381 ? 11.791  13.232 61.627 1.00 54.14  ? 363  ARG A NH2   1 
ATOM   2979 N  N     . GLN A 1 382 ? 12.791  19.547 60.274 1.00 22.91  ? 364  GLN A N     1 
ATOM   2980 C  CA    . GLN A 1 382 ? 14.197  19.764 60.029 1.00 23.64  ? 364  GLN A CA    1 
ATOM   2981 C  C     . GLN A 1 382 ? 14.669  21.180 60.291 1.00 23.49  ? 364  GLN A C     1 
ATOM   2982 O  O     . GLN A 1 382 ? 15.866  21.427 60.218 1.00 23.26  ? 364  GLN A O     1 
ATOM   2983 C  CB    . GLN A 1 382 ? 14.573  19.366 58.582 1.00 22.83  ? 364  GLN A CB    1 
ATOM   2984 C  CG    . GLN A 1 382 ? 14.221  17.922 58.223 1.00 24.21  ? 364  GLN A CG    1 
ATOM   2985 C  CD    . GLN A 1 382 ? 14.986  16.895 59.078 1.00 27.88  ? 364  GLN A CD    1 
ATOM   2986 O  OE1   . GLN A 1 382 ? 16.020  17.220 59.668 1.00 28.05  ? 364  GLN A OE1   1 
ATOM   2987 N  NE2   . GLN A 1 382 ? 14.464  15.674 59.180 1.00 28.23  ? 364  GLN A NE2   1 
ATOM   2988 N  N     . GLY A 1 383 ? 13.769  22.101 60.598 1.00 21.39  ? 365  GLY A N     1 
ATOM   2989 C  CA    . GLY A 1 383 ? 14.221  23.469 60.862 1.00 22.78  ? 365  GLY A CA    1 
ATOM   2990 C  C     . GLY A 1 383 ? 14.840  24.148 59.660 1.00 21.92  ? 365  GLY A C     1 
ATOM   2991 O  O     . GLY A 1 383 ? 15.745  24.998 59.801 1.00 23.17  ? 365  GLY A O     1 
ATOM   2992 N  N     . TRP A 1 384 ? 14.339  23.808 58.480 1.00 19.93  ? 366  TRP A N     1 
ATOM   2993 C  CA    . TRP A 1 384 ? 14.715  24.499 57.254 1.00 20.18  ? 366  TRP A CA    1 
ATOM   2994 C  C     . TRP A 1 384 ? 14.055  25.880 57.225 1.00 19.63  ? 366  TRP A C     1 
ATOM   2995 O  O     . TRP A 1 384 ? 12.998  26.078 57.821 1.00 20.10  ? 366  TRP A O     1 
ATOM   2996 C  CB    . TRP A 1 384 ? 14.309  23.686 56.020 1.00 19.75  ? 366  TRP A CB    1 
ATOM   2997 C  CG    . TRP A 1 384 ? 15.198  22.479 55.754 1.00 20.52  ? 366  TRP A CG    1 
ATOM   2998 C  CD1   . TRP A 1 384 ? 16.049  21.848 56.629 1.00 21.63  ? 366  TRP A CD1   1 
ATOM   2999 C  CD2   . TRP A 1 384 ? 15.255  21.738 54.533 1.00 19.93  ? 366  TRP A CD2   1 
ATOM   3000 N  NE1   . TRP A 1 384 ? 16.673  20.787 55.992 1.00 22.17  ? 366  TRP A NE1   1 
ATOM   3001 C  CE2   . TRP A 1 384 ? 16.207  20.708 54.704 1.00 21.57  ? 366  TRP A CE2   1 
ATOM   3002 C  CE3   . TRP A 1 384 ? 14.606  21.873 53.285 1.00 19.65  ? 366  TRP A CE3   1 
ATOM   3003 C  CZ2   . TRP A 1 384 ? 16.513  19.813 53.698 1.00 21.57  ? 366  TRP A CZ2   1 
ATOM   3004 C  CZ3   . TRP A 1 384 ? 14.900  20.986 52.298 1.00 22.80  ? 366  TRP A CZ3   1 
ATOM   3005 C  CH2   . TRP A 1 384 ? 15.878  19.975 52.488 1.00 21.54  ? 366  TRP A CH2   1 
ATOM   3006 N  N     . ARG A 1 385 ? 14.714  26.838 56.591 1.00 20.70  ? 367  ARG A N     1 
ATOM   3007 C  CA    . ARG A 1 385 ? 14.063  28.100 56.219 1.00 20.18  ? 367  ARG A CA    1 
ATOM   3008 C  C     . ARG A 1 385 ? 13.220  27.852 54.967 1.00 20.52  ? 367  ARG A C     1 
ATOM   3009 O  O     . ARG A 1 385 ? 13.536  27.018 54.126 1.00 19.11  ? 367  ARG A O     1 
ATOM   3010 C  CB    . ARG A 1 385 ? 15.056  29.268 56.001 1.00 21.72  ? 367  ARG A CB    1 
ATOM   3011 C  CG    . ARG A 1 385 ? 16.114  29.464 57.051 1.00 22.07  ? 367  ARG A CG    1 
ATOM   3012 C  CD    . ARG A 1 385 ? 15.569  29.606 58.457 1.00 25.24  ? 367  ARG A CD    1 
ATOM   3013 N  NE    . ARG A 1 385 ? 14.514  30.631 58.608 1.00 24.83  ? 367  ARG A NE    1 
ATOM   3014 C  CZ    . ARG A 1 385 ? 14.731  31.894 58.973 1.00 26.65  ? 367  ARG A CZ    1 
ATOM   3015 N  NH1   . ARG A 1 385 ? 15.959  32.347 59.190 1.00 27.23  ? 367  ARG A NH1   1 
ATOM   3016 N  NH2   . ARG A 1 385 ? 13.709  32.735 59.106 1.00 27.90  ? 367  ARG A NH2   1 
ATOM   3017 N  N     . THR A 1 386 ? 12.092  28.552 54.899 1.00 19.41  ? 368  THR A N     1 
ATOM   3018 C  CA    . THR A 1 386 ? 11.050  28.227 53.937 1.00 18.82  ? 368  THR A CA    1 
ATOM   3019 C  C     . THR A 1 386 ? 10.571  29.478 53.176 1.00 17.89  ? 368  THR A C     1 
ATOM   3020 O  O     . THR A 1 386 ? 10.433  30.573 53.744 1.00 18.91  ? 368  THR A O     1 
ATOM   3021 C  CB    . THR A 1 386 ? 9.835   27.603 54.628 1.00 18.88  ? 368  THR A CB    1 
ATOM   3022 O  OG1   . THR A 1 386 ? 9.389   28.466 55.706 1.00 19.43  ? 368  THR A OG1   1 
ATOM   3023 C  CG2   . THR A 1 386 ? 10.116  26.173 55.171 1.00 16.96  ? 368  THR A CG2   1 
ATOM   3024 N  N     . PHE A 1 387 ? 10.305  29.245 51.903 1.00 18.36  ? 369  PHE A N     1 
ATOM   3025 C  CA    . PHE A 1 387 ? 9.726   30.234 50.985 1.00 18.89  ? 369  PHE A CA    1 
ATOM   3026 C  C     . PHE A 1 387 ? 8.583   29.526 50.260 1.00 18.41  ? 369  PHE A C     1 
ATOM   3027 O  O     . PHE A 1 387 ? 8.797   28.582 49.490 1.00 17.29  ? 369  PHE A O     1 
ATOM   3028 C  CB    . PHE A 1 387 ? 10.804  30.721 50.025 1.00 20.07  ? 369  PHE A CB    1 
ATOM   3029 C  CG    . PHE A 1 387 ? 10.373  31.832 49.071 1.00 19.56  ? 369  PHE A CG    1 
ATOM   3030 C  CD1   . PHE A 1 387 ? 11.021  33.032 49.085 1.00 22.51  ? 369  PHE A CD1   1 
ATOM   3031 C  CD2   . PHE A 1 387 ? 9.373   31.624 48.118 1.00 20.76  ? 369  PHE A CD2   1 
ATOM   3032 C  CE1   . PHE A 1 387 ? 10.671  34.054 48.172 1.00 24.59  ? 369  PHE A CE1   1 
ATOM   3033 C  CE2   . PHE A 1 387 ? 9.005   32.625 47.218 1.00 21.84  ? 369  PHE A CE2   1 
ATOM   3034 C  CZ    . PHE A 1 387 ? 9.644   33.831 47.249 1.00 22.83  ? 369  PHE A CZ    1 
ATOM   3035 N  N     . LEU A 1 388 ? 7.358   30.031 50.465 1.00 19.00  ? 370  LEU A N     1 
ATOM   3036 C  CA    . LEU A 1 388 ? 6.179   29.482 49.828 1.00 17.88  ? 370  LEU A CA    1 
ATOM   3037 C  C     . LEU A 1 388 ? 5.805   30.293 48.614 1.00 18.65  ? 370  LEU A C     1 
ATOM   3038 O  O     . LEU A 1 388 ? 5.573   31.499 48.728 1.00 19.73  ? 370  LEU A O     1 
ATOM   3039 C  CB    . LEU A 1 388 ? 4.999   29.460 50.797 1.00 17.92  ? 370  LEU A CB    1 
ATOM   3040 C  CG    . LEU A 1 388 ? 3.750   28.834 50.201 1.00 18.25  ? 370  LEU A CG    1 
ATOM   3041 C  CD1   . LEU A 1 388 ? 3.908   27.312 49.956 1.00 18.40  ? 370  LEU A CD1   1 
ATOM   3042 C  CD2   . LEU A 1 388 ? 2.595   29.195 51.169 1.00 19.01  ? 370  LEU A CD2   1 
ATOM   3043 N  N     . VAL A 1 389 ? 5.677   29.621 47.467 1.00 18.88  ? 371  VAL A N     1 
ATOM   3044 C  CA    . VAL A 1 389 ? 5.246   30.240 46.207 1.00 20.53  ? 371  VAL A CA    1 
ATOM   3045 C  C     . VAL A 1 389 ? 3.746   30.071 46.205 1.00 20.51  ? 371  VAL A C     1 
ATOM   3046 O  O     . VAL A 1 389 ? 3.242   28.967 46.424 1.00 20.76  ? 371  VAL A O     1 
ATOM   3047 C  CB    . VAL A 1 389 ? 5.925   29.550 44.953 1.00 21.80  ? 371  VAL A CB    1 
ATOM   3048 C  CG1   . VAL A 1 389 ? 5.315   30.051 43.660 1.00 26.03  ? 371  VAL A CG1   1 
ATOM   3049 C  CG2   . VAL A 1 389 ? 7.481   29.814 44.940 1.00 23.69  ? 371  VAL A CG2   1 
ATOM   3050 N  N     . ILE A 1 390 ? 3.009   31.160 45.971 1.00 20.66  ? 372  ILE A N     1 
ATOM   3051 C  CA    . ILE A 1 390 ? 1.526   31.091 45.963 1.00 20.69  ? 372  ILE A CA    1 
ATOM   3052 C  C     . ILE A 1 390 ? 1.101   31.687 44.636 1.00 21.52  ? 372  ILE A C     1 
ATOM   3053 O  O     . ILE A 1 390 ? 0.925   32.897 44.531 1.00 22.95  ? 372  ILE A O     1 
ATOM   3054 C  CB    . ILE A 1 390 ? 0.850   31.856 47.133 1.00 20.59  ? 372  ILE A CB    1 
ATOM   3055 C  CG1   . ILE A 1 390 ? 1.460   31.465 48.492 1.00 20.24  ? 372  ILE A CG1   1 
ATOM   3056 C  CG2   . ILE A 1 390 ? -0.680  31.629 47.134 1.00 20.66  ? 372  ILE A CG2   1 
ATOM   3057 C  CD1   . ILE A 1 390 ? 0.827   32.248 49.734 1.00 20.25  ? 372  ILE A CD1   1 
ATOM   3058 N  N     . PRO A 1 391 ? 1.019   30.848 43.589 1.00 23.80  ? 373  PRO A N     1 
ATOM   3059 C  CA    . PRO A 1 391 ? 0.718   31.389 42.257 1.00 25.52  ? 373  PRO A CA    1 
ATOM   3060 C  C     . PRO A 1 391 ? -0.516  32.292 42.127 1.00 26.44  ? 373  PRO A C     1 
ATOM   3061 O  O     . PRO A 1 391 ? -0.454  33.287 41.408 1.00 26.94  ? 373  PRO A O     1 
ATOM   3062 C  CB    . PRO A 1 391 ? 0.626   30.133 41.384 1.00 25.85  ? 373  PRO A CB    1 
ATOM   3063 C  CG    . PRO A 1 391 ? 1.561   29.169 42.043 1.00 26.24  ? 373  PRO A CG    1 
ATOM   3064 C  CD    . PRO A 1 391 ? 1.279   29.387 43.534 1.00 22.67  ? 373  PRO A CD    1 
ATOM   3065 N  N     . GLU A 1 392 ? -1.603  31.977 42.832 1.00 26.26  ? 374  GLU A N     1 
ATOM   3066 C  CA    . GLU A 1 392 ? -2.826  32.792 42.812 1.00 28.52  ? 374  GLU A CA    1 
ATOM   3067 C  C     . GLU A 1 392 ? -2.680  34.174 43.417 1.00 29.10  ? 374  GLU A C     1 
ATOM   3068 O  O     . GLU A 1 392 ? -3.569  34.987 43.242 1.00 29.97  ? 374  GLU A O     1 
ATOM   3069 C  CB    . GLU A 1 392 ? -3.979  32.130 43.568 1.00 28.38  ? 374  GLU A CB    1 
ATOM   3070 C  CG    . GLU A 1 392 ? -4.301  30.733 43.146 1.00 30.57  ? 374  GLU A CG    1 
ATOM   3071 C  CD    . GLU A 1 392 ? -3.676  29.707 44.088 1.00 28.30  ? 374  GLU A CD    1 
ATOM   3072 O  OE1   . GLU A 1 392 ? -2.459  29.805 44.348 1.00 22.82  ? 374  GLU A OE1   1 
ATOM   3073 O  OE2   . GLU A 1 392 ? -4.418  28.820 44.577 1.00 26.95  ? 374  GLU A OE2   1 
ATOM   3074 N  N     . LEU A 1 393 ? -1.599  34.419 44.174 1.00 29.55  ? 375  LEU A N     1 
ATOM   3075 C  CA    . LEU A 1 393 ? -1.365  35.705 44.812 1.00 30.94  ? 375  LEU A CA    1 
ATOM   3076 C  C     . LEU A 1 393 ? -1.309  36.810 43.759 1.00 34.21  ? 375  LEU A C     1 
ATOM   3077 O  O     . LEU A 1 393 ? -1.795  37.897 43.992 1.00 35.87  ? 375  LEU A O     1 
ATOM   3078 C  CB    . LEU A 1 393 ? -0.079  35.664 45.641 1.00 30.14  ? 375  LEU A CB    1 
ATOM   3079 C  CG    . LEU A 1 393 ? 0.151   36.713 46.710 1.00 30.99  ? 375  LEU A CG    1 
ATOM   3080 C  CD1   . LEU A 1 393 ? -1.049  36.899 47.682 1.00 29.26  ? 375  LEU A CD1   1 
ATOM   3081 C  CD2   . LEU A 1 393 ? 1.437   36.380 47.456 1.00 28.71  ? 375  LEU A CD2   1 
ATOM   3082 N  N     . ALA A 1 394 ? -0.751  36.481 42.586 1.00 35.36  ? 376  ALA A N     1 
ATOM   3083 C  CA    . ALA A 1 394 ? -0.651  37.386 41.459 1.00 38.32  ? 376  ALA A CA    1 
ATOM   3084 C  C     . ALA A 1 394 ? -2.018  38.051 41.247 1.00 40.51  ? 376  ALA A C     1 
ATOM   3085 O  O     . ALA A 1 394 ? -2.139  39.258 41.352 1.00 43.97  ? 376  ALA A O     1 
ATOM   3086 C  CB    . ALA A 1 394 ? -0.172  36.589 40.201 1.00 39.10  ? 376  ALA A CB    1 
ATOM   3087 N  N     . GLN A 1 395 ? -3.060  37.247 41.072 1.00 40.11  ? 377  GLN A N     1 
ATOM   3088 C  CA    . GLN A 1 395 ? -4.419  37.768 40.953 1.00 41.49  ? 377  GLN A CA    1 
ATOM   3089 C  C     . GLN A 1 395 ? -5.130  38.169 42.265 1.00 40.89  ? 377  GLN A C     1 
ATOM   3090 O  O     . GLN A 1 395 ? -5.886  39.127 42.258 1.00 43.72  ? 377  GLN A O     1 
ATOM   3091 C  CB    . GLN A 1 395 ? -5.293  36.790 40.153 1.00 42.74  ? 377  GLN A CB    1 
ATOM   3092 C  CG    . GLN A 1 395 ? -6.579  37.417 39.509 1.00 46.15  ? 377  GLN A CG    1 
ATOM   3093 C  CD    . GLN A 1 395 ? -6.365  38.774 38.823 1.00 51.43  ? 377  GLN A CD    1 
ATOM   3094 O  OE1   . GLN A 1 395 ? -5.259  39.122 38.389 1.00 54.60  ? 377  GLN A OE1   1 
ATOM   3095 N  NE2   . GLN A 1 395 ? -7.443  39.544 38.715 1.00 55.06  ? 377  GLN A NE2   1 
ATOM   3096 N  N     . GLU A 1 396 ? -4.897  37.478 43.380 1.00 37.61  ? 378  GLU A N     1 
ATOM   3097 C  CA    . GLU A 1 396 ? -5.518  37.850 44.675 1.00 37.24  ? 378  GLU A CA    1 
ATOM   3098 C  C     . GLU A 1 396 ? -5.106  39.259 45.163 1.00 38.43  ? 378  GLU A C     1 
ATOM   3099 O  O     . GLU A 1 396 ? -5.899  39.946 45.816 1.00 38.65  ? 378  GLU A O     1 
ATOM   3100 C  CB    . GLU A 1 396 ? -5.151  36.840 45.759 1.00 35.16  ? 378  GLU A CB    1 
ATOM   3101 C  CG    . GLU A 1 396 ? -5.782  35.444 45.598 1.00 33.31  ? 378  GLU A CG    1 
ATOM   3102 C  CD    . GLU A 1 396 ? -6.868  35.108 46.643 1.00 32.53  ? 378  GLU A CD    1 
ATOM   3103 O  OE1   . GLU A 1 396 ? -7.084  35.887 47.587 1.00 32.63  ? 378  GLU A OE1   1 
ATOM   3104 O  OE2   . GLU A 1 396 ? -7.532  34.061 46.493 1.00 29.76  ? 378  GLU A OE2   1 
ATOM   3105 N  N     . LEU A 1 397 ? -3.862  39.651 44.872 1.00 37.52  ? 379  LEU A N     1 
ATOM   3106 C  CA    . LEU A 1 397 ? -3.393  41.022 45.141 1.00 40.19  ? 379  LEU A CA    1 
ATOM   3107 C  C     . LEU A 1 397 ? -4.159  42.048 44.312 1.00 43.03  ? 379  LEU A C     1 
ATOM   3108 O  O     . LEU A 1 397 ? -4.566  43.089 44.844 1.00 46.82  ? 379  LEU A O     1 
ATOM   3109 C  CB    . LEU A 1 397 ? -1.886  41.163 44.906 1.00 39.03  ? 379  LEU A CB    1 
ATOM   3110 C  CG    . LEU A 1 397 ? -1.004  40.485 45.940 1.00 38.04  ? 379  LEU A CG    1 
ATOM   3111 C  CD1   . LEU A 1 397 ? 0.434   40.286 45.416 1.00 36.90  ? 379  LEU A CD1   1 
ATOM   3112 C  CD2   . LEU A 1 397 ? -1.041  41.306 47.192 1.00 39.55  ? 379  LEU A CD2   1 
ATOM   3113 N  N     A HIS A 1 398 ? -4.367  41.772 43.024 0.50 43.83  ? 380  HIS A N     1 
ATOM   3114 N  N     B HIS A 1 398 ? -4.372  41.768 43.022 0.50 43.70  ? 380  HIS A N     1 
ATOM   3115 C  CA    A HIS A 1 398 ? -5.129  42.697 42.184 0.50 46.16  ? 380  HIS A CA    1 
ATOM   3116 C  CA    B HIS A 1 398 ? -5.178  42.659 42.177 0.50 46.05  ? 380  HIS A CA    1 
ATOM   3117 C  C     A HIS A 1 398 ? -6.551  42.915 42.731 0.50 47.19  ? 380  HIS A C     1 
ATOM   3118 C  C     B HIS A 1 398 ? -6.532  42.919 42.803 0.50 47.03  ? 380  HIS A C     1 
ATOM   3119 O  O     A HIS A 1 398 ? -7.013  44.052 42.786 0.50 49.20  ? 380  HIS A O     1 
ATOM   3120 O  O     B HIS A 1 398 ? -6.944  44.066 42.955 0.50 48.91  ? 380  HIS A O     1 
ATOM   3121 C  CB    A HIS A 1 398 ? -5.134  42.269 40.697 0.50 46.97  ? 380  HIS A CB    1 
ATOM   3122 C  CB    B HIS A 1 398 ? -5.391  42.090 40.766 0.50 46.61  ? 380  HIS A CB    1 
ATOM   3123 C  CG    A HIS A 1 398 ? -3.882  42.653 39.949 0.50 47.46  ? 380  HIS A CG    1 
ATOM   3124 C  CG    B HIS A 1 398 ? -6.420  42.832 39.964 0.50 49.93  ? 380  HIS A CG    1 
ATOM   3125 N  ND1   A HIS A 1 398 ? -3.676  43.917 39.439 0.50 50.61  ? 380  HIS A ND1   1 
ATOM   3126 N  ND1   B HIS A 1 398 ? -6.176  44.063 39.392 0.50 52.77  ? 380  HIS A ND1   1 
ATOM   3127 C  CD2   A HIS A 1 398 ? -2.772  41.940 39.637 0.50 45.32  ? 380  HIS A CD2   1 
ATOM   3128 C  CD2   B HIS A 1 398 ? -7.701  42.522 39.651 0.50 50.97  ? 380  HIS A CD2   1 
ATOM   3129 C  CE1   A HIS A 1 398 ? -2.495  43.965 38.846 0.50 50.38  ? 380  HIS A CE1   1 
ATOM   3130 C  CE1   B HIS A 1 398 ? -7.258  44.474 38.757 0.50 54.74  ? 380  HIS A CE1   1 
ATOM   3131 N  NE2   A HIS A 1 398 ? -1.923  42.779 38.958 0.50 46.10  ? 380  HIS A NE2   1 
ATOM   3132 N  NE2   B HIS A 1 398 ? -8.197  43.558 38.898 0.50 53.47  ? 380  HIS A NE2   1 
ATOM   3133 N  N     . VAL A 1 399 ? -7.230  41.839 43.138 1.00 45.27  ? 381  VAL A N     1 
ATOM   3134 C  CA    . VAL A 1 399 ? -8.555  41.930 43.774 1.00 46.46  ? 381  VAL A CA    1 
ATOM   3135 C  C     . VAL A 1 399 ? -8.485  42.611 45.144 1.00 46.64  ? 381  VAL A C     1 
ATOM   3136 O  O     . VAL A 1 399 ? -9.320  43.448 45.451 1.00 49.73  ? 381  VAL A O     1 
ATOM   3137 C  CB    . VAL A 1 399 ? -9.210  40.527 43.971 1.00 44.08  ? 381  VAL A CB    1 
ATOM   3138 C  CG1   . VAL A 1 399 ? -10.536 40.646 44.670 1.00 43.49  ? 381  VAL A CG1   1 
ATOM   3139 C  CG2   . VAL A 1 399 ? -9.369  39.789 42.640 1.00 45.17  ? 381  VAL A CG2   1 
ATOM   3140 N  N     . TRP A 1 400 ? -7.491  42.255 45.962 1.00 45.64  ? 382  TRP A N     1 
ATOM   3141 C  CA    . TRP A 1 400 ? -7.348  42.839 47.313 1.00 46.41  ? 382  TRP A CA    1 
ATOM   3142 C  C     . TRP A 1 400 ? -7.280  44.373 47.213 1.00 49.94  ? 382  TRP A C     1 
ATOM   3143 O  O     . TRP A 1 400 ? -7.931  45.080 47.990 1.00 50.84  ? 382  TRP A O     1 
ATOM   3144 C  CB    . TRP A 1 400 ? -6.119  42.273 48.053 1.00 44.59  ? 382  TRP A CB    1 
ATOM   3145 C  CG    . TRP A 1 400 ? -5.936  42.856 49.442 1.00 44.36  ? 382  TRP A CG    1 
ATOM   3146 C  CD1   . TRP A 1 400 ? -5.070  43.847 49.806 1.00 46.32  ? 382  TRP A CD1   1 
ATOM   3147 C  CD2   . TRP A 1 400 ? -6.671  42.517 50.618 1.00 45.31  ? 382  TRP A CD2   1 
ATOM   3148 N  NE1   . TRP A 1 400 ? -5.217  44.143 51.138 1.00 46.70  ? 382  TRP A NE1   1 
ATOM   3149 C  CE2   . TRP A 1 400 ? -6.189  43.336 51.665 1.00 47.06  ? 382  TRP A CE2   1 
ATOM   3150 C  CE3   . TRP A 1 400 ? -7.675  41.582 50.901 1.00 45.35  ? 382  TRP A CE3   1 
ATOM   3151 C  CZ2   . TRP A 1 400 ? -6.688  43.262 52.962 1.00 47.05  ? 382  TRP A CZ2   1 
ATOM   3152 C  CZ3   . TRP A 1 400 ? -8.168  41.513 52.195 1.00 45.42  ? 382  TRP A CZ3   1 
ATOM   3153 C  CH2   . TRP A 1 400 ? -7.676  42.348 53.205 1.00 46.74  ? 382  TRP A CH2   1 
ATOM   3154 N  N     . THR A 1 401 ? -6.515  44.867 46.236 1.00 51.54  ? 383  THR A N     1 
ATOM   3155 C  CA    . THR A 1 401 ? -6.332  46.320 46.034 1.00 55.78  ? 383  THR A CA    1 
ATOM   3156 C  C     . THR A 1 401 ? -7.541  46.960 45.348 1.00 59.54  ? 383  THR A C     1 
ATOM   3157 O  O     . THR A 1 401 ? -8.088  47.954 45.834 1.00 63.20  ? 383  THR A O     1 
ATOM   3158 C  CB    . THR A 1 401 ? -5.001  46.663 45.261 1.00 55.85  ? 383  THR A CB    1 
ATOM   3159 O  OG1   . THR A 1 401 ? -4.873  48.084 45.113 1.00 61.47  ? 383  THR A OG1   1 
ATOM   3160 C  CG2   . THR A 1 401 ? -4.967  46.078 43.876 1.00 57.39  ? 383  THR A CG2   1 
ATOM   3161 N  N     . ASP A 1 402 ? -7.963  46.392 44.224 1.00 59.81  ? 384  ASP A N     1 
ATOM   3162 C  CA    . ASP A 1 402 ? -9.105  46.892 43.465 1.00 62.63  ? 384  ASP A CA    1 
ATOM   3163 C  C     . ASP A 1 402 ? -10.383 46.949 44.311 1.00 63.65  ? 384  ASP A C     1 
ATOM   3164 O  O     . ASP A 1 402 ? -11.211 47.820 44.117 1.00 66.77  ? 384  ASP A O     1 
ATOM   3165 C  CB    . ASP A 1 402 ? -9.303  46.015 42.220 1.00 62.31  ? 384  ASP A CB    1 
ATOM   3166 C  CG    . ASP A 1 402 ? -10.597 46.292 41.497 1.00 66.58  ? 384  ASP A CG    1 
ATOM   3167 O  OD1   . ASP A 1 402 ? -10.754 47.390 40.910 1.00 74.65  ? 384  ASP A OD1   1 
ATOM   3168 O  OD2   . ASP A 1 402 ? -11.468 45.392 41.504 1.00 70.76  ? 384  ASP A OD2   1 
ATOM   3169 N  N     . LYS A 1 403 ? -10.525 46.047 45.271 1.00 61.11  ? 385  LYS A N     1 
ATOM   3170 C  CA    . LYS A 1 403 ? -11.745 45.966 46.086 1.00 62.31  ? 385  LYS A CA    1 
ATOM   3171 C  C     . LYS A 1 403 ? -11.488 46.233 47.575 1.00 61.76  ? 385  LYS A C     1 
ATOM   3172 O  O     . LYS A 1 403 ? -12.270 45.819 48.413 1.00 62.26  ? 385  LYS A O     1 
ATOM   3173 C  CB    . LYS A 1 403 ? -12.400 44.573 45.914 1.00 61.16  ? 385  LYS A CB    1 
ATOM   3174 C  CG    . LYS A 1 403 ? -12.922 44.281 44.501 1.00 62.61  ? 385  LYS A CG    1 
ATOM   3175 C  CD    . LYS A 1 403 ? -14.208 45.014 44.246 1.00 67.02  ? 385  LYS A CD    1 
ATOM   3176 C  CE    . LYS A 1 403 ? -14.597 45.003 42.775 1.00 68.34  ? 385  LYS A CE    1 
ATOM   3177 N  NZ    . LYS A 1 403 ? -15.861 45.748 42.564 1.00 73.02  ? 385  LYS A NZ    1 
ATOM   3178 N  N     . SER A 1 404 ? -10.408 46.930 47.909 1.00 71.03  ? 386  SER A N     1 
ATOM   3179 C  CA    . SER A 1 404 ? -10.084 47.227 49.314 1.00 69.84  ? 386  SER A CA    1 
ATOM   3180 C  C     . SER A 1 404 ? -11.212 47.954 50.068 1.00 71.76  ? 386  SER A C     1 
ATOM   3181 O  O     . SER A 1 404 ? -11.317 47.842 51.291 1.00 70.13  ? 386  SER A O     1 
ATOM   3182 C  CB    . SER A 1 404 ? -8.797  48.060 49.387 1.00 72.58  ? 386  SER A CB    1 
ATOM   3183 O  OG    . SER A 1 404 ? -8.925  49.253 48.628 1.00 77.69  ? 386  SER A OG    1 
ATOM   3184 N  N     . SER A 1 405 ? -12.037 48.701 49.329 1.00 75.14  ? 387  SER A N     1 
ATOM   3185 C  CA    . SER A 1 405 ? -13.166 49.448 49.892 1.00 77.67  ? 387  SER A CA    1 
ATOM   3186 C  C     . SER A 1 405 ? -14.190 48.554 50.588 1.00 73.98  ? 387  SER A C     1 
ATOM   3187 O  O     . SER A 1 405 ? -14.724 48.920 51.633 1.00 74.15  ? 387  SER A O     1 
ATOM   3188 C  CB    . SER A 1 405 ? -13.862 50.258 48.788 1.00 83.22  ? 387  SER A CB    1 
ATOM   3189 O  OG    . SER A 1 405 ? -14.273 49.407 47.725 1.00 82.87  ? 387  SER A OG    1 
ATOM   3190 N  N     . LEU A 1 406 ? -14.467 47.392 49.997 1.00 70.64  ? 388  LEU A N     1 
ATOM   3191 C  CA    . LEU A 1 406 ? -15.385 46.410 50.594 1.00 68.36  ? 388  LEU A CA    1 
ATOM   3192 C  C     . LEU A 1 406 ? -14.852 45.875 51.932 1.00 64.78  ? 388  LEU A C     1 
ATOM   3193 O  O     . LEU A 1 406 ? -15.611 45.756 52.906 1.00 64.67  ? 388  LEU A O     1 
ATOM   3194 C  CB    . LEU A 1 406 ? -15.655 45.241 49.625 1.00 66.48  ? 388  LEU A CB    1 
ATOM   3195 C  CG    . LEU A 1 406 ? -16.713 45.435 48.530 1.00 70.92  ? 388  LEU A CG    1 
ATOM   3196 C  CD1   . LEU A 1 406 ? -16.315 46.517 47.515 1.00 75.04  ? 388  LEU A CD1   1 
ATOM   3197 C  CD2   . LEU A 1 406 ? -16.979 44.116 47.818 1.00 68.74  ? 388  LEU A CD2   1 
ATOM   3198 N  N     . PHE A 1 407 ? -13.554 45.542 51.971 1.00 61.99  ? 389  PHE A N     1 
ATOM   3199 C  CA    . PHE A 1 407 ? -12.916 45.060 53.207 1.00 59.67  ? 389  PHE A CA    1 
ATOM   3200 C  C     . PHE A 1 407 ? -12.909 46.163 54.268 1.00 62.30  ? 389  PHE A C     1 
ATOM   3201 O  O     . PHE A 1 407 ? -13.238 45.923 55.435 1.00 61.07  ? 389  PHE A O     1 
ATOM   3202 C  CB    . PHE A 1 407 ? -11.482 44.552 52.956 1.00 57.17  ? 389  PHE A CB    1 
ATOM   3203 C  CG    . PHE A 1 407 ? -10.853 43.900 54.179 1.00 55.74  ? 389  PHE A CG    1 
ATOM   3204 C  CD1   . PHE A 1 407 ? -11.277 42.652 54.617 1.00 53.65  ? 389  PHE A CD1   1 
ATOM   3205 C  CD2   . PHE A 1 407 ? -9.861  44.545 54.906 1.00 57.88  ? 389  PHE A CD2   1 
ATOM   3206 C  CE1   . PHE A 1 407 ? -10.717 42.073 55.753 1.00 53.85  ? 389  PHE A CE1   1 
ATOM   3207 C  CE2   . PHE A 1 407 ? -9.301  43.956 56.042 1.00 56.85  ? 389  PHE A CE2   1 
ATOM   3208 C  CZ    . PHE A 1 407 ? -9.732  42.737 56.461 1.00 53.83  ? 389  PHE A CZ    1 
ATOM   3209 N  N     . GLU A 1 408 ? -12.539 47.371 53.839 1.00 65.33  ? 390  GLU A N     1 
ATOM   3210 C  CA    . GLU A 1 408 ? -12.512 48.528 54.725 1.00 69.28  ? 390  GLU A CA    1 
ATOM   3211 C  C     . GLU A 1 408 ? -13.882 48.716 55.390 1.00 70.36  ? 390  GLU A C     1 
ATOM   3212 O  O     . GLU A 1 408 ? -13.961 48.887 56.614 1.00 70.68  ? 390  GLU A O     1 
ATOM   3213 C  CB    . GLU A 1 408 ? -12.082 49.785 53.959 1.00 73.33  ? 390  GLU A CB    1 
ATOM   3214 C  CG    . GLU A 1 408 ? -10.592 49.830 53.624 1.00 74.17  ? 390  GLU A CG    1 
ATOM   3215 C  CD    . GLU A 1 408 ? -10.227 50.962 52.653 1.00 79.73  ? 390  GLU A CD    1 
ATOM   3216 O  OE1   . GLU A 1 408 ? -9.467  50.696 51.683 1.00 81.82  ? 390  GLU A OE1   1 
ATOM   3217 O  OE2   . GLU A 1 408 ? -10.701 52.112 52.849 1.00 85.20  ? 390  GLU A OE2   1 
ATOM   3218 N  N     . GLU A 1 409 ? -14.948 48.643 54.582 1.00 70.99  ? 391  GLU A N     1 
ATOM   3219 C  CA    . GLU A 1 409 ? -16.325 48.681 55.087 1.00 72.61  ? 391  GLU A CA    1 
ATOM   3220 C  C     . GLU A 1 409 ? -16.553 47.606 56.134 1.00 69.90  ? 391  GLU A C     1 
ATOM   3221 O  O     . GLU A 1 409 ? -17.046 47.894 57.223 1.00 70.77  ? 391  GLU A O     1 
ATOM   3222 C  CB    . GLU A 1 409 ? -17.350 48.511 53.953 1.00 74.26  ? 391  GLU A CB    1 
ATOM   3223 C  CG    . GLU A 1 409 ? -18.821 48.496 54.440 1.00 76.55  ? 391  GLU A CG    1 
ATOM   3224 C  CD    . GLU A 1 409 ? -19.851 48.775 53.341 1.00 80.63  ? 391  GLU A CD    1 
ATOM   3225 O  OE1   . GLU A 1 409 ? -19.490 48.775 52.145 1.00 81.78  ? 391  GLU A OE1   1 
ATOM   3226 O  OE2   . GLU A 1 409 ? -21.036 48.999 53.682 1.00 84.21  ? 391  GLU A OE2   1 
ATOM   3227 N  N     . LEU A 1 410 ? -16.185 46.366 55.798 1.00 66.87  ? 392  LEU A N     1 
ATOM   3228 C  CA    . LEU A 1 410 ? -16.304 45.239 56.728 1.00 65.04  ? 392  LEU A CA    1 
ATOM   3229 C  C     . LEU A 1 410 ? -15.573 45.508 58.056 1.00 65.20  ? 392  LEU A C     1 
ATOM   3230 O  O     . LEU A 1 410 ? -16.109 45.248 59.135 1.00 65.83  ? 392  LEU A O     1 
ATOM   3231 C  CB    . LEU A 1 410 ? -15.772 43.960 56.062 1.00 62.10  ? 392  LEU A CB    1 
ATOM   3232 C  CG    . LEU A 1 410 ? -15.939 42.615 56.769 1.00 60.56  ? 392  LEU A CG    1 
ATOM   3233 C  CD1   . LEU A 1 410 ? -17.390 42.386 57.155 1.00 63.87  ? 392  LEU A CD1   1 
ATOM   3234 C  CD2   . LEU A 1 410 ? -15.432 41.512 55.846 1.00 57.64  ? 392  LEU A CD2   1 
ATOM   3235 N  N     . GLN A 1 411 ? -14.357 46.037 57.972 1.00 65.10  ? 393  GLN A N     1 
ATOM   3236 C  CA    . GLN A 1 411 ? -13.589 46.377 59.172 1.00 67.16  ? 393  GLN A CA    1 
ATOM   3237 C  C     . GLN A 1 411 ? -14.329 47.399 60.037 1.00 70.63  ? 393  GLN A C     1 
ATOM   3238 O  O     . GLN A 1 411 ? -14.408 47.251 61.263 1.00 71.60  ? 393  GLN A O     1 
ATOM   3239 C  CB    . GLN A 1 411 ? -12.228 46.967 58.800 1.00 67.79  ? 393  GLN A CB    1 
ATOM   3240 C  CG    . GLN A 1 411 ? -11.237 46.003 58.186 1.00 65.24  ? 393  GLN A CG    1 
ATOM   3241 C  CD    . GLN A 1 411 ? -9.926  46.700 57.845 1.00 66.92  ? 393  GLN A CD    1 
ATOM   3242 O  OE1   . GLN A 1 411 ? -9.909  47.702 57.114 1.00 69.88  ? 393  GLN A OE1   1 
ATOM   3243 N  NE2   . GLN A 1 411 ? -8.824  46.183 58.379 1.00 66.81  ? 393  GLN A NE2   1 
ATOM   3244 N  N     . SER A 1 412 ? -14.848 48.438 59.381 1.00 72.54  ? 394  SER A N     1 
ATOM   3245 C  CA    . SER A 1 412 ? -15.603 49.500 60.054 1.00 76.13  ? 394  SER A CA    1 
ATOM   3246 C  C     . SER A 1 412 ? -16.872 48.956 60.711 1.00 76.31  ? 394  SER A C     1 
ATOM   3247 O  O     . SER A 1 412 ? -17.162 49.289 61.858 1.00 78.09  ? 394  SER A O     1 
ATOM   3248 C  CB    . SER A 1 412 ? -15.966 50.612 59.061 1.00 78.67  ? 394  SER A CB    1 
ATOM   3249 O  OG    . SER A 1 412 ? -14.807 51.258 58.562 1.00 79.99  ? 394  SER A OG    1 
ATOM   3250 N  N     . LEU A 1 413 ? -17.613 48.119 59.977 1.00 74.94  ? 395  LEU A N     1 
ATOM   3251 C  CA    . LEU A 1 413 ? -18.831 47.475 60.485 1.00 75.91  ? 395  LEU A CA    1 
ATOM   3252 C  C     . LEU A 1 413 ? -18.543 46.677 61.752 1.00 75.71  ? 395  LEU A C     1 
ATOM   3253 O  O     . LEU A 1 413 ? -19.265 46.798 62.743 1.00 77.28  ? 395  LEU A O     1 
ATOM   3254 C  CB    . LEU A 1 413 ? -19.440 46.542 59.427 1.00 74.54  ? 395  LEU A CB    1 
ATOM   3255 C  CG    . LEU A 1 413 ? -20.391 47.168 58.405 1.00 77.09  ? 395  LEU A CG    1 
ATOM   3256 C  CD1   . LEU A 1 413 ? -20.524 46.287 57.168 1.00 75.69  ? 395  LEU A CD1   1 
ATOM   3257 C  CD2   . LEU A 1 413 ? -21.754 47.422 59.033 1.00 80.07  ? 395  LEU A CD2   1 
ATOM   3258 N  N     . ASP A 1 414 ? -17.490 45.853 61.695 1.00 73.96  ? 396  ASP A N     1 
ATOM   3259 C  CA    . ASP A 1 414 ? -17.061 45.019 62.836 1.00 74.78  ? 396  ASP A CA    1 
ATOM   3260 C  C     . ASP A 1 414 ? -16.747 45.877 64.076 1.00 77.68  ? 396  ASP A C     1 
ATOM   3261 O  O     . ASP A 1 414 ? -17.061 45.492 65.205 1.00 79.76  ? 396  ASP A O     1 
ATOM   3262 C  CB    . ASP A 1 414 ? -15.833 44.156 62.455 1.00 72.32  ? 396  ASP A CB    1 
ATOM   3263 C  CG    . ASP A 1 414 ? -16.177 42.981 61.507 1.00 71.08  ? 396  ASP A CG    1 
ATOM   3264 O  OD1   . ASP A 1 414 ? -17.342 42.517 61.482 1.00 72.46  ? 396  ASP A OD1   1 
ATOM   3265 O  OD2   . ASP A 1 414 ? -15.255 42.505 60.795 1.00 69.96  ? 396  ASP A OD2   1 
ATOM   3266 N  N     . ILE A 1 415 ? -16.132 47.036 63.846 1.00 78.71  ? 397  ILE A N     1 
ATOM   3267 C  CA    . ILE A 1 415 ? -15.832 48.011 64.906 1.00 82.26  ? 397  ILE A CA    1 
ATOM   3268 C  C     . ILE A 1 415 ? -17.112 48.637 65.478 1.00 84.90  ? 397  ILE A C     1 
ATOM   3269 O  O     . ILE A 1 415 ? -17.285 48.735 66.708 1.00 87.58  ? 397  ILE A O     1 
ATOM   3270 C  CB    . ILE A 1 415 ? -14.922 49.157 64.370 1.00 83.21  ? 397  ILE A CB    1 
ATOM   3271 C  CG1   . ILE A 1 415 ? -13.552 48.614 63.932 1.00 81.81  ? 397  ILE A CG1   1 
ATOM   3272 C  CG2   . ILE A 1 415 ? -14.742 50.241 65.424 1.00 86.81  ? 397  ILE A CG2   1 
ATOM   3273 C  CD1   . ILE A 1 415 ? -12.911 49.419 62.810 1.00 81.63  ? 397  ILE A CD1   1 
ATOM   3274 N  N     . PHE A 1 416 ? -17.982 49.073 64.563 1.00 84.56  ? 398  PHE A N     1 
ATOM   3275 C  CA    . PHE A 1 416 ? -19.290 49.667 64.884 1.00 86.91  ? 398  PHE A CA    1 
ATOM   3276 C  C     . PHE A 1 416 ? -20.172 48.669 65.637 1.00 87.65  ? 398  PHE A C     1 
ATOM   3277 O  O     . PHE A 1 416 ? -20.945 49.063 66.507 1.00 90.51  ? 398  PHE A O     1 
ATOM   3278 C  CB    . PHE A 1 416 ? -19.978 50.131 63.585 1.00 86.95  ? 398  PHE A CB    1 
ATOM   3279 C  CG    . PHE A 1 416 ? -21.260 50.911 63.796 1.00 90.18  ? 398  PHE A CG    1 
ATOM   3280 C  CD1   . PHE A 1 416 ? -21.243 52.153 64.416 1.00 93.12  ? 398  PHE A CD1   1 
ATOM   3281 C  CD2   . PHE A 1 416 ? -22.479 50.415 63.334 1.00 91.12  ? 398  PHE A CD2   1 
ATOM   3282 C  CE1   . PHE A 1 416 ? -22.422 52.875 64.596 1.00 96.08  ? 398  PHE A CE1   1 
ATOM   3283 C  CE2   . PHE A 1 416 ? -23.660 51.133 63.508 1.00 94.30  ? 398  PHE A CE2   1 
ATOM   3284 C  CZ    . PHE A 1 416 ? -23.631 52.362 64.139 1.00 96.74  ? 398  PHE A CZ    1 
ATOM   3285 N  N     . LEU A 1 417 ? -20.024 47.381 65.312 1.00 85.53  ? 399  LEU A N     1 
ATOM   3286 C  CA    . LEU A 1 417 ? -20.684 46.277 66.041 1.00 86.79  ? 399  LEU A CA    1 
ATOM   3287 C  C     . LEU A 1 417 ? -20.305 46.210 67.555 1.00 89.16  ? 399  LEU A C     1 
ATOM   3288 O  O     . LEU A 1 417 ? -20.845 45.383 68.294 1.00 91.33  ? 399  LEU A O     1 
ATOM   3289 C  CB    . LEU A 1 417 ? -20.386 44.934 65.332 1.00 84.42  ? 399  LEU A CB    1 
ATOM   3290 C  CG    . LEU A 1 417 ? -21.242 43.683 65.598 1.00 86.39  ? 399  LEU A CG    1 
ATOM   3291 C  CD1   . LEU A 1 417 ? -22.658 43.851 65.056 1.00 88.59  ? 399  LEU A CD1   1 
ATOM   3292 C  CD2   . LEU A 1 417 ? -20.578 42.437 64.986 1.00 83.57  ? 399  LEU A CD2   1 
ATOM   3293 N  N     . ALA A 1 418 ? -19.375 47.060 68.000 1.00 89.28  ? 400  ALA A N     1 
ATOM   3294 C  CA    . ALA A 1 418 ? -19.150 47.303 69.425 1.00 92.80  ? 400  ALA A CA    1 
ATOM   3295 C  C     . ALA A 1 418 ? -18.781 48.766 69.648 1.00 93.84  ? 400  ALA A C     1 
ATOM   3296 O  O     . ALA A 1 418 ? -19.637 49.581 69.993 1.00 95.45  ? 400  ALA A O     1 
ATOM   3297 C  CB    . ALA A 1 418 ? -18.064 46.386 69.966 1.00 93.05  ? 400  ALA A CB    1 
ATOM   3298 N  N     . SER A 1 435 ? -29.206 42.614 65.021 1.00 104.96 ? 417  SER A N     1 
ATOM   3299 C  CA    . SER A 1 435 ? -29.188 43.955 64.448 1.00 103.31 ? 417  SER A CA    1 
ATOM   3300 C  C     . SER A 1 435 ? -29.090 43.901 62.920 1.00 101.50 ? 417  SER A C     1 
ATOM   3301 O  O     . SER A 1 435 ? -28.713 42.874 62.340 1.00 99.93  ? 417  SER A O     1 
ATOM   3302 C  CB    . SER A 1 435 ? -28.017 44.764 65.020 1.00 99.52  ? 417  SER A CB    1 
ATOM   3303 O  OG    . SER A 1 435 ? -26.787 44.363 64.426 1.00 94.81  ? 417  SER A OG    1 
ATOM   3304 N  N     . SER A 1 436 ? -29.430 45.016 62.276 1.00 102.13 ? 418  SER A N     1 
ATOM   3305 C  CA    . SER A 1 436 ? -29.321 45.132 60.820 1.00 101.09 ? 418  SER A CA    1 
ATOM   3306 C  C     . SER A 1 436 ? -27.860 45.259 60.359 1.00 95.15  ? 418  SER A C     1 
ATOM   3307 O  O     . SER A 1 436 ? -27.552 44.961 59.203 1.00 93.71  ? 418  SER A O     1 
ATOM   3308 C  CB    . SER A 1 436 ? -30.142 46.321 60.306 1.00 104.81 ? 418  SER A CB    1 
ATOM   3309 O  OG    . SER A 1 436 ? -29.577 47.554 60.713 1.00 103.23 ? 418  SER A OG    1 
ATOM   3310 N  N     . ILE A 1 437 ? -26.980 45.712 61.257 1.00 92.12  ? 419  ILE A N     1 
ATOM   3311 C  CA    . ILE A 1 437 ? -25.532 45.783 60.989 1.00 87.09  ? 419  ILE A CA    1 
ATOM   3312 C  C     . ILE A 1 437 ? -24.946 44.386 60.746 1.00 84.24  ? 419  ILE A C     1 
ATOM   3313 O  O     . ILE A 1 437 ? -24.111 44.196 59.859 1.00 80.75  ? 419  ILE A O     1 
ATOM   3314 C  CB    . ILE A 1 437 ? -24.774 46.483 62.159 1.00 85.92  ? 419  ILE A CB    1 
ATOM   3315 C  CG1   . ILE A 1 437 ? -25.172 47.965 62.250 1.00 88.20  ? 419  ILE A CG1   1 
ATOM   3316 C  CG2   . ILE A 1 437 ? -23.262 46.346 62.008 1.00 81.72  ? 419  ILE A CG2   1 
ATOM   3317 C  CD1   . ILE A 1 437 ? -25.072 48.742 60.936 1.00 88.09  ? 419  ILE A CD1   1 
ATOM   3318 N  N     . GLN A 1 438 ? -25.412 43.416 61.528 1.00 85.87  ? 420  GLN A N     1 
ATOM   3319 C  CA    . GLN A 1 438 ? -24.958 42.035 61.416 1.00 84.21  ? 420  GLN A CA    1 
ATOM   3320 C  C     . GLN A 1 438 ? -25.324 41.389 60.064 1.00 84.28  ? 420  GLN A C     1 
ATOM   3321 O  O     . GLN A 1 438 ? -24.556 40.585 59.521 1.00 81.31  ? 420  GLN A O     1 
ATOM   3322 C  CB    . GLN A 1 438 ? -25.524 41.215 62.574 1.00 87.55  ? 420  GLN A CB    1 
ATOM   3323 C  CG    . GLN A 1 438 ? -24.660 40.035 62.953 1.00 86.20  ? 420  GLN A CG    1 
ATOM   3324 C  CD    . GLN A 1 438 ? -25.247 39.212 64.087 1.00 90.96  ? 420  GLN A CD    1 
ATOM   3325 O  OE1   . GLN A 1 438 ? -26.013 39.720 64.915 1.00 93.55  ? 420  GLN A OE1   1 
ATOM   3326 N  NE2   . GLN A 1 438 ? -24.884 37.929 64.133 1.00 91.32  ? 420  GLN A NE2   1 
ATOM   3327 N  N     . ARG A 1 439 ? -26.487 41.745 59.527 1.00 88.01  ? 421  ARG A N     1 
ATOM   3328 C  CA    . ARG A 1 439 ? -26.917 41.278 58.203 1.00 89.30  ? 421  ARG A CA    1 
ATOM   3329 C  C     . ARG A 1 439 ? -26.188 42.030 57.077 1.00 86.07  ? 421  ARG A C     1 
ATOM   3330 O  O     . ARG A 1 439 ? -26.058 41.517 55.958 1.00 85.05  ? 421  ARG A O     1 
ATOM   3331 C  CB    . ARG A 1 439 ? -28.432 41.437 58.047 1.00 95.72  ? 421  ARG A CB    1 
ATOM   3332 C  CG    . ARG A 1 439 ? -29.249 40.659 59.082 1.00 100.48 ? 421  ARG A CG    1 
ATOM   3333 C  CD    . ARG A 1 439 ? -30.757 40.664 58.778 1.00 107.89 ? 421  ARG A CD    1 
ATOM   3334 N  NE    . ARG A 1 439 ? -31.454 41.815 59.364 1.00 111.79 ? 421  ARG A NE    1 
ATOM   3335 C  CZ    . ARG A 1 439 ? -31.631 43.001 58.774 1.00 112.62 ? 421  ARG A CZ    1 
ATOM   3336 N  NH1   . ARG A 1 439 ? -31.158 43.244 57.552 1.00 111.72 ? 421  ARG A NH1   1 
ATOM   3337 N  NH2   . ARG A 1 439 ? -32.281 43.964 59.416 1.00 114.93 ? 421  ARG A NH2   1 
ATOM   3338 N  N     . ARG A 1 440 ? -25.732 43.248 57.377 1.00 84.62  ? 422  ARG A N     1 
ATOM   3339 C  CA    . ARG A 1 440 ? -24.860 44.016 56.477 1.00 81.98  ? 422  ARG A CA    1 
ATOM   3340 C  C     . ARG A 1 440 ? -23.456 43.403 56.403 1.00 76.36  ? 422  ARG A C     1 
ATOM   3341 O  O     . ARG A 1 440 ? -22.845 43.373 55.332 1.00 73.81  ? 422  ARG A O     1 
ATOM   3342 C  CB    . ARG A 1 440 ? -24.765 45.476 56.950 1.00 82.96  ? 422  ARG A CB    1 
ATOM   3343 C  CG    . ARG A 1 440 ? -23.899 46.385 56.079 1.00 81.79  ? 422  ARG A CG    1 
ATOM   3344 C  CD    . ARG A 1 440 ? -24.616 46.755 54.800 1.00 86.39  ? 422  ARG A CD    1 
ATOM   3345 N  NE    . ARG A 1 440 ? -23.695 46.992 53.693 1.00 84.97  ? 422  ARG A NE    1 
ATOM   3346 C  CZ    . ARG A 1 440 ? -24.055 47.075 52.409 1.00 89.02  ? 422  ARG A CZ    1 
ATOM   3347 N  NH1   . ARG A 1 440 ? -25.330 46.946 52.043 1.00 94.77  ? 422  ARG A NH1   1 
ATOM   3348 N  NH2   . ARG A 1 440 ? -23.133 47.289 51.475 1.00 87.97  ? 422  ARG A NH2   1 
ATOM   3349 N  N     . ILE A 1 441 ? -22.952 42.947 57.552 1.00 74.49  ? 423  ILE A N     1 
ATOM   3350 C  CA    . ILE A 1 441 ? -21.649 42.256 57.639 1.00 70.54  ? 423  ILE A CA    1 
ATOM   3351 C  C     . ILE A 1 441 ? -21.641 40.952 56.823 1.00 69.84  ? 423  ILE A C     1 
ATOM   3352 O  O     . ILE A 1 441 ? -20.637 40.621 56.174 1.00 66.31  ? 423  ILE A O     1 
ATOM   3353 C  CB    . ILE A 1 441 ? -21.265 41.926 59.105 1.00 70.00  ? 423  ILE A CB    1 
ATOM   3354 C  CG1   . ILE A 1 441 ? -20.875 43.197 59.868 1.00 70.24  ? 423  ILE A CG1   1 
ATOM   3355 C  CG2   . ILE A 1 441 ? -20.107 40.960 59.149 1.00 66.38  ? 423  ILE A CG2   1 
ATOM   3356 C  CD1   . ILE A 1 441 ? -20.617 42.977 61.355 1.00 70.94  ? 423  ILE A CD1   1 
ATOM   3357 N  N     . LYS A 1 442 ? -22.753 40.216 56.876 1.00 73.74  ? 424  LYS A N     1 
ATOM   3358 C  CA    . LYS A 1 442 ? -22.935 39.010 56.059 1.00 74.37  ? 424  LYS A CA    1 
ATOM   3359 C  C     . LYS A 1 442 ? -22.996 39.338 54.573 1.00 74.68  ? 424  LYS A C     1 
ATOM   3360 O  O     . LYS A 1 442 ? -22.362 38.663 53.748 1.00 71.59  ? 424  LYS A O     1 
ATOM   3361 C  CB    . LYS A 1 442 ? -24.195 38.259 56.478 1.00 79.23  ? 424  LYS A CB    1 
ATOM   3362 C  CG    . LYS A 1 442 ? -24.050 37.622 57.842 1.00 80.12  ? 424  LYS A CG    1 
ATOM   3363 C  CD    . LYS A 1 442 ? -25.263 36.786 58.216 1.00 86.14  ? 424  LYS A CD    1 
ATOM   3364 C  CE    . LYS A 1 442 ? -25.082 36.122 59.585 1.00 87.73  ? 424  LYS A CE    1 
ATOM   3365 N  NZ    . LYS A 1 442 ? -24.811 37.106 60.678 1.00 86.96  ? 424  LYS A NZ    1 
ATOM   3366 N  N     . LYS A 1 443 ? -23.746 40.384 54.248 1.00 78.31  ? 425  LYS A N     1 
ATOM   3367 C  CA    . LYS A 1 443 ? -23.911 40.819 52.867 1.00 80.56  ? 425  LYS A CA    1 
ATOM   3368 C  C     . LYS A 1 443 ? -22.594 41.320 52.258 1.00 77.18  ? 425  LYS A C     1 
ATOM   3369 O  O     . LYS A 1 443 ? -22.247 40.966 51.124 1.00 76.38  ? 425  LYS A O     1 
ATOM   3370 C  CB    . LYS A 1 443 ? -25.010 41.897 52.795 1.00 85.79  ? 425  LYS A CB    1 
ATOM   3371 C  CG    . LYS A 1 443 ? -25.484 42.227 51.398 1.00 88.98  ? 425  LYS A CG    1 
ATOM   3372 C  CD    . LYS A 1 443 ? -24.818 43.479 50.850 1.00 89.07  ? 425  LYS A CD    1 
ATOM   3373 C  CE    . LYS A 1 443 ? -25.535 43.981 49.593 1.00 95.15  ? 425  LYS A CE    1 
ATOM   3374 N  NZ    . LYS A 1 443 ? -25.240 43.121 48.406 1.00 94.58  ? 425  LYS A NZ    1 
ATOM   3375 N  N     . VAL A 1 444 ? -21.855 42.129 53.013 1.00 52.75  ? 426  VAL A N     1 
ATOM   3376 C  CA    . VAL A 1 444 ? -20.587 42.670 52.523 1.00 51.48  ? 426  VAL A CA    1 
ATOM   3377 C  C     . VAL A 1 444 ? -19.532 41.551 52.370 1.00 48.39  ? 426  VAL A C     1 
ATOM   3378 O  O     . VAL A 1 444 ? -18.812 41.518 51.362 1.00 47.37  ? 426  VAL A O     1 
ATOM   3379 C  CB    . VAL A 1 444 ? -20.064 43.816 53.426 1.00 52.71  ? 426  VAL A CB    1 
ATOM   3380 C  CG1   . VAL A 1 444 ? -18.557 44.004 53.243 1.00 49.92  ? 426  VAL A CG1   1 
ATOM   3381 C  CG2   . VAL A 1 444 ? -20.840 45.120 53.143 1.00 56.34  ? 426  VAL A CG2   1 
ATOM   3382 N  N     . THR A 1 445 ? -19.456 40.661 53.372 1.00 47.12  ? 427  THR A N     1 
ATOM   3383 C  CA    . THR A 1 445 ? -18.605 39.449 53.347 1.00 44.60  ? 427  THR A CA    1 
ATOM   3384 C  C     . THR A 1 445 ? -18.844 38.641 52.062 1.00 43.95  ? 427  THR A C     1 
ATOM   3385 O  O     . THR A 1 445 ? -17.906 38.263 51.358 1.00 41.15  ? 427  THR A O     1 
ATOM   3386 C  CB    . THR A 1 445 ? -18.896 38.558 54.607 1.00 44.27  ? 427  THR A CB    1 
ATOM   3387 O  OG1   . THR A 1 445 ? -18.502 39.250 55.803 1.00 44.87  ? 427  THR A OG1   1 
ATOM   3388 C  CG2   . THR A 1 445 ? -18.214 37.217 54.537 1.00 41.17  ? 427  THR A CG2   1 
ATOM   3389 N  N     . HIS A 1 446 ? -20.114 38.425 51.736 1.00 46.58  ? 428  HIS A N     1 
ATOM   3390 C  CA    . HIS A 1 446 ? -20.462 37.699 50.531 1.00 46.52  ? 428  HIS A CA    1 
ATOM   3391 C  C     . HIS A 1 446 ? -20.013 38.419 49.268 1.00 46.64  ? 428  HIS A C     1 
ATOM   3392 O  O     . HIS A 1 446 ? -19.454 37.798 48.372 1.00 44.00  ? 428  HIS A O     1 
ATOM   3393 C  CB    . HIS A 1 446 ? -21.963 37.462 50.446 1.00 49.24  ? 428  HIS A CB    1 
ATOM   3394 C  CG    . HIS A 1 446 ? -22.363 36.615 49.275 1.00 49.97  ? 428  HIS A CG    1 
ATOM   3395 N  ND1   . HIS A 1 446 ? -23.014 37.125 48.168 1.00 53.58  ? 428  HIS A ND1   1 
ATOM   3396 C  CD2   . HIS A 1 446 ? -22.172 35.297 49.028 1.00 49.53  ? 428  HIS A CD2   1 
ATOM   3397 C  CE1   . HIS A 1 446 ? -23.224 36.152 47.300 1.00 53.15  ? 428  HIS A CE1   1 
ATOM   3398 N  NE2   . HIS A 1 446 ? -22.718 35.035 47.797 1.00 52.38  ? 428  HIS A NE2   1 
ATOM   3399 N  N     . ASP A 1 447 ? -20.282 39.716 49.193 1.00 49.23  ? 429  ASP A N     1 
ATOM   3400 C  CA    . ASP A 1 447 ? -19.947 40.503 47.994 1.00 50.79  ? 429  ASP A CA    1 
ATOM   3401 C  C     . ASP A 1 447 ? -18.428 40.554 47.797 1.00 48.02  ? 429  ASP A C     1 
ATOM   3402 O  O     . ASP A 1 447 ? -17.929 40.452 46.675 1.00 46.69  ? 429  ASP A O     1 
ATOM   3403 C  CB    . ASP A 1 447 ? -20.535 41.930 48.073 1.00 54.45  ? 429  ASP A CB    1 
ATOM   3404 C  CG    . ASP A 1 447 ? -22.061 41.975 47.863 1.00 58.92  ? 429  ASP A CG    1 
ATOM   3405 O  OD1   . ASP A 1 447 ? -22.625 41.032 47.238 1.00 60.28  ? 429  ASP A OD1   1 
ATOM   3406 O  OD2   . ASP A 1 447 ? -22.691 42.985 48.305 1.00 62.76  ? 429  ASP A OD2   1 
ATOM   3407 N  N     . MET A 1 448 ? -17.698 40.678 48.903 1.00 47.12  ? 430  MET A N     1 
ATOM   3408 C  CA    . MET A 1 448 ? -16.245 40.618 48.886 1.00 45.14  ? 430  MET A CA    1 
ATOM   3409 C  C     . MET A 1 448 ? -15.788 39.244 48.379 1.00 41.62  ? 430  MET A C     1 
ATOM   3410 O  O     . MET A 1 448 ? -15.047 39.142 47.410 1.00 41.11  ? 430  MET A O     1 
ATOM   3411 C  CB    . MET A 1 448 ? -15.698 40.886 50.308 1.00 44.72  ? 430  MET A CB    1 
ATOM   3412 C  CG    . MET A 1 448 ? -14.169 41.016 50.386 1.00 44.13  ? 430  MET A CG    1 
ATOM   3413 S  SD    . MET A 1 448 ? -13.508 40.939 52.082 1.00 47.77  ? 430  MET A SD    1 
ATOM   3414 C  CE    . MET A 1 448 ? -12.077 39.869 51.837 1.00 40.75  ? 430  MET A CE    1 
ATOM   3415 N  N     . ASP A 1 449 ? -16.232 38.192 49.052 1.00 40.23  ? 431  ASP A N     1 
ATOM   3416 C  CA    . ASP A 1 449 ? -15.883 36.801 48.683 1.00 37.96  ? 431  ASP A CA    1 
ATOM   3417 C  C     . ASP A 1 449 ? -16.133 36.470 47.197 1.00 37.44  ? 431  ASP A C     1 
ATOM   3418 O  O     . ASP A 1 449 ? -15.280 35.860 46.538 1.00 34.19  ? 431  ASP A O     1 
ATOM   3419 C  CB    . ASP A 1 449 ? -16.665 35.832 49.564 1.00 37.95  ? 431  ASP A CB    1 
ATOM   3420 C  CG    . ASP A 1 449 ? -16.174 35.819 51.014 1.00 39.99  ? 431  ASP A CG    1 
ATOM   3421 O  OD1   . ASP A 1 449 ? -15.263 36.613 51.376 1.00 38.84  ? 431  ASP A OD1   1 
ATOM   3422 O  OD2   . ASP A 1 449 ? -16.711 34.996 51.792 1.00 42.44  ? 431  ASP A OD2   1 
ATOM   3423 N  N     . MET A 1 450 ? -17.281 36.912 46.673 1.00 39.06  ? 432  MET A N     1 
ATOM   3424 C  CA    . MET A 1 450 ? -17.658 36.599 45.298 1.00 40.87  ? 432  MET A CA    1 
ATOM   3425 C  C     . MET A 1 450 ? -16.700 37.168 44.254 1.00 40.90  ? 432  MET A C     1 
ATOM   3426 O  O     . MET A 1 450 ? -16.678 36.675 43.116 1.00 42.34  ? 432  MET A O     1 
ATOM   3427 C  CB    . MET A 1 450 ? -19.106 37.052 45.004 1.00 43.58  ? 432  MET A CB    1 
ATOM   3428 C  CG    . MET A 1 450 ? -20.171 36.160 45.637 1.00 44.53  ? 432  MET A CG    1 
ATOM   3429 S  SD    . MET A 1 450 ? -19.818 34.360 45.474 1.00 44.99  ? 432  MET A SD    1 
ATOM   3430 C  CE    . MET A 1 450 ? -18.878 33.924 46.958 1.00 44.06  ? 432  MET A CE    1 
ATOM   3431 N  N     . CYS A 1 451 ? -15.951 38.215 44.625 1.00 40.80  ? 433  CYS A N     1 
ATOM   3432 C  CA    . CYS A 1 451 ? -14.963 38.838 43.735 1.00 41.07  ? 433  CYS A CA    1 
ATOM   3433 C  C     . CYS A 1 451 ? -13.810 37.905 43.409 1.00 38.03  ? 433  CYS A C     1 
ATOM   3434 O  O     . CYS A 1 451 ? -13.118 38.095 42.388 1.00 37.94  ? 433  CYS A O     1 
ATOM   3435 C  CB    . CYS A 1 451 ? -14.359 40.084 44.372 1.00 41.58  ? 433  CYS A CB    1 
ATOM   3436 S  SG    . CYS A 1 451 ? -15.444 41.445 44.524 1.00 50.36  ? 433  CYS A SG    1 
ATOM   3437 N  N     . TYR A 1 452 ? -13.582 36.929 44.292 1.00 35.81  ? 434  TYR A N     1 
ATOM   3438 C  CA    . TYR A 1 452 ? -12.530 35.949 44.108 1.00 33.22  ? 434  TYR A CA    1 
ATOM   3439 C  C     . TYR A 1 452 ? -12.984 34.693 43.382 1.00 33.03  ? 434  TYR A C     1 
ATOM   3440 O  O     . TYR A 1 452 ? -12.132 34.004 42.817 1.00 34.82  ? 434  TYR A O     1 
ATOM   3441 C  CB    . TYR A 1 452 ? -11.934 35.538 45.450 1.00 31.52  ? 434  TYR A CB    1 
ATOM   3442 C  CG    . TYR A 1 452 ? -11.315 36.675 46.203 1.00 30.82  ? 434  TYR A CG    1 
ATOM   3443 C  CD1   . TYR A 1 452 ? -9.968  36.978 46.024 1.00 29.62  ? 434  TYR A CD1   1 
ATOM   3444 C  CD2   . TYR A 1 452 ? -12.059 37.443 47.087 1.00 33.22  ? 434  TYR A CD2   1 
ATOM   3445 C  CE1   . TYR A 1 452 ? -9.370  37.989 46.682 1.00 31.85  ? 434  TYR A CE1   1 
ATOM   3446 C  CE2   . TYR A 1 452 ? -11.462 38.495 47.779 1.00 34.83  ? 434  TYR A CE2   1 
ATOM   3447 C  CZ    . TYR A 1 452 ? -10.104 38.752 47.579 1.00 33.86  ? 434  TYR A CZ    1 
ATOM   3448 O  OH    . TYR A 1 452 ? -9.467  39.779 48.221 1.00 35.54  ? 434  TYR A OH    1 
ATOM   3449 N  N     . GLY A 1 453 ? -14.278 34.381 43.454 1.00 32.46  ? 435  GLY A N     1 
ATOM   3450 C  CA    . GLY A 1 453 ? -14.846 33.123 42.952 1.00 31.39  ? 435  GLY A CA    1 
ATOM   3451 C  C     . GLY A 1 453 ? -15.918 32.595 43.905 1.00 30.74  ? 435  GLY A C     1 
ATOM   3452 O  O     . GLY A 1 453 ? -16.102 33.128 45.021 1.00 30.16  ? 435  GLY A O     1 
ATOM   3453 N  N     . MET A 1 454 ? -16.563 31.511 43.511 1.00 28.46  ? 436  MET A N     1 
ATOM   3454 C  CA    . MET A 1 454 ? -17.643 30.942 44.294 1.00 29.52  ? 436  MET A CA    1 
ATOM   3455 C  C     . MET A 1 454 ? -17.228 30.468 45.692 1.00 27.62  ? 436  MET A C     1 
ATOM   3456 O  O     . MET A 1 454 ? -18.034 30.485 46.615 1.00 28.50  ? 436  MET A O     1 
ATOM   3457 C  CB    . MET A 1 454 ? -18.313 29.828 43.484 1.00 29.02  ? 436  MET A CB    1 
ATOM   3458 C  CG    . MET A 1 454 ? -19.014 30.365 42.270 1.00 32.77  ? 436  MET A CG    1 
ATOM   3459 S  SD    . MET A 1 454 ? -20.472 31.362 42.663 1.00 36.36  ? 436  MET A SD    1 
ATOM   3460 C  CE    . MET A 1 454 ? -21.854 30.230 42.371 1.00 36.87  ? 436  MET A CE    1 
ATOM   3461 N  N     . MET A 1 455 ? -15.960 30.107 45.850 1.00 26.76  ? 437  MET A N     1 
ATOM   3462 C  CA    . MET A 1 455 ? -15.450 29.614 47.138 1.00 26.78  ? 437  MET A CA    1 
ATOM   3463 C  C     . MET A 1 455 ? -14.560 30.647 47.816 1.00 25.48  ? 437  MET A C     1 
ATOM   3464 O  O     . MET A 1 455 ? -13.881 30.354 48.788 1.00 25.61  ? 437  MET A O     1 
ATOM   3465 C  CB    . MET A 1 455 ? -14.738 28.260 46.937 1.00 26.41  ? 437  MET A CB    1 
ATOM   3466 C  CG    . MET A 1 455 ? -15.715 27.152 46.688 1.00 29.47  ? 437  MET A CG    1 
ATOM   3467 S  SD    . MET A 1 455 ? -16.441 26.754 48.299 1.00 38.45  ? 437  MET A SD    1 
ATOM   3468 C  CE    . MET A 1 455 ? -17.841 25.903 47.788 1.00 31.06  ? 437  MET A CE    1 
ATOM   3469 N  N     . GLY A 1 456 ? -14.575 31.881 47.302 1.00 25.59  ? 438  GLY A N     1 
ATOM   3470 C  CA    . GLY A 1 456 ? -13.914 32.981 47.950 1.00 25.52  ? 438  GLY A CA    1 
ATOM   3471 C  C     . GLY A 1 456 ? -12.402 33.007 47.866 1.00 23.76  ? 438  GLY A C     1 
ATOM   3472 O  O     . GLY A 1 456 ? -11.781 32.239 47.130 1.00 23.07  ? 438  GLY A O     1 
ATOM   3473 N  N     . SER A 1 457 ? -11.823 33.944 48.597 1.00 23.52  ? 439  SER A N     1 
ATOM   3474 C  CA    . SER A 1 457 ? -10.402 34.039 48.707 1.00 24.01  ? 439  SER A CA    1 
ATOM   3475 C  C     . SER A 1 457 ? -9.788  32.785 49.355 1.00 22.29  ? 439  SER A C     1 
ATOM   3476 O  O     . SER A 1 457 ? -10.322 32.191 50.304 1.00 22.54  ? 439  SER A O     1 
ATOM   3477 C  CB    . SER A 1 457 ? -9.989  35.287 49.516 1.00 23.80  ? 439  SER A CB    1 
ATOM   3478 O  OG    . SER A 1 457 ? -8.577  35.366 49.690 1.00 24.04  ? 439  SER A OG    1 
ATOM   3479 N  N     . LEU A 1 458 ? -8.617  32.451 48.842 1.00 22.85  ? 440  LEU A N     1 
ATOM   3480 C  CA    . LEU A 1 458 ? -7.727  31.452 49.412 1.00 23.23  ? 440  LEU A CA    1 
ATOM   3481 C  C     . LEU A 1 458 ? -7.447  31.754 50.890 1.00 22.23  ? 440  LEU A C     1 
ATOM   3482 O  O     . LEU A 1 458 ? -7.289  30.847 51.715 1.00 21.78  ? 440  LEU A O     1 
ATOM   3483 C  CB    . LEU A 1 458 ? -6.421  31.582 48.593 1.00 23.81  ? 440  LEU A CB    1 
ATOM   3484 C  CG    . LEU A 1 458 ? -5.219  30.687 48.834 1.00 23.30  ? 440  LEU A CG    1 
ATOM   3485 C  CD1   . LEU A 1 458 ? -5.640  29.198 48.883 1.00 23.25  ? 440  LEU A CD1   1 
ATOM   3486 C  CD2   . LEU A 1 458 ? -4.205  30.961 47.732 1.00 26.14  ? 440  LEU A CD2   1 
ATOM   3487 N  N     . PHE A 1 459 ? -7.353  33.048 51.201 1.00 21.86  ? 441  PHE A N     1 
ATOM   3488 C  CA    . PHE A 1 459 ? -6.845  33.544 52.494 1.00 21.99  ? 441  PHE A CA    1 
ATOM   3489 C  C     . PHE A 1 459 ? -7.879  33.894 53.560 1.00 22.13  ? 441  PHE A C     1 
ATOM   3490 O  O     . PHE A 1 459 ? -7.540  34.046 54.747 1.00 22.20  ? 441  PHE A O     1 
ATOM   3491 C  CB    . PHE A 1 459 ? -5.948  34.745 52.271 1.00 22.21  ? 441  PHE A CB    1 
ATOM   3492 C  CG    . PHE A 1 459 ? -4.769  34.466 51.384 1.00 22.14  ? 441  PHE A CG    1 
ATOM   3493 C  CD1   . PHE A 1 459 ? -3.757  33.628 51.808 1.00 22.61  ? 441  PHE A CD1   1 
ATOM   3494 C  CD2   . PHE A 1 459 ? -4.673  35.039 50.126 1.00 23.30  ? 441  PHE A CD2   1 
ATOM   3495 C  CE1   . PHE A 1 459 ? -2.664  33.371 50.987 1.00 23.43  ? 441  PHE A CE1   1 
ATOM   3496 C  CE2   . PHE A 1 459 ? -3.596  34.800 49.312 1.00 22.59  ? 441  PHE A CE2   1 
ATOM   3497 C  CZ    . PHE A 1 459 ? -2.586  33.980 49.739 1.00 23.74  ? 441  PHE A CZ    1 
ATOM   3498 N  N     . ARG A 1 460 ? -9.125  34.062 53.158 1.00 23.49  ? 442  ARG A N     1 
ATOM   3499 C  CA    . ARG A 1 460 ? -10.163 34.520 54.085 1.00 24.90  ? 442  ARG A CA    1 
ATOM   3500 C  C     . ARG A 1 460 ? -11.588 34.396 53.531 1.00 26.42  ? 442  ARG A C     1 
ATOM   3501 O  O     . ARG A 1 460 ? -11.780 34.231 52.330 1.00 26.37  ? 442  ARG A O     1 
ATOM   3502 C  CB    . ARG A 1 460 ? -9.894  35.963 54.538 1.00 26.18  ? 442  ARG A CB    1 
ATOM   3503 C  CG    . ARG A 1 460 ? -9.597  36.960 53.392 1.00 27.35  ? 442  ARG A CG    1 
ATOM   3504 C  CD    . ARG A 1 460 ? -9.485  38.369 53.913 1.00 28.42  ? 442  ARG A CD    1 
ATOM   3505 N  NE    . ARG A 1 460 ? -8.368  38.541 54.836 1.00 30.54  ? 442  ARG A NE    1 
ATOM   3506 C  CZ    . ARG A 1 460 ? -8.483  38.702 56.149 1.00 30.07  ? 442  ARG A CZ    1 
ATOM   3507 N  NH1   . ARG A 1 460 ? -7.392  38.881 56.879 1.00 30.98  ? 442  ARG A NH1   1 
ATOM   3508 N  NH2   . ARG A 1 460 ? -9.666  38.678 56.736 1.00 30.22  ? 442  ARG A NH2   1 
ATOM   3509 N  N     . SER A 1 461 ? -12.563 34.442 54.434 1.00 27.22  ? 443  SER A N     1 
ATOM   3510 C  CA    . SER A 1 461 ? -13.968 34.703 54.112 1.00 29.70  ? 443  SER A CA    1 
ATOM   3511 C  C     . SER A 1 461 ? -14.303 35.929 54.981 1.00 30.70  ? 443  SER A C     1 
ATOM   3512 O  O     . SER A 1 461 ? -14.323 35.870 56.213 1.00 30.81  ? 443  SER A O     1 
ATOM   3513 C  CB    . SER A 1 461 ? -14.854 33.481 54.408 1.00 30.58  ? 443  SER A CB    1 
ATOM   3514 O  OG    . SER A 1 461 ? -16.248 33.779 54.345 1.00 33.77  ? 443  SER A OG    1 
ATOM   3515 N  N     . GLY A 1 462 ? -14.458 37.074 54.330 1.00 32.01  ? 444  GLY A N     1 
ATOM   3516 C  CA    . GLY A 1 462 ? -14.630 38.321 55.029 1.00 33.89  ? 444  GLY A CA    1 
ATOM   3517 C  C     . GLY A 1 462 ? -13.485 38.518 55.998 1.00 33.89  ? 444  GLY A C     1 
ATOM   3518 O  O     . GLY A 1 462 ? -12.311 38.458 55.599 1.00 32.89  ? 444  GLY A O     1 
ATOM   3519 N  N     . SER A 1 463 ? -13.807 38.691 57.270 1.00 34.88  ? 445  SER A N     1 
ATOM   3520 C  CA    . SER A 1 463 ? -12.789 38.938 58.288 1.00 34.57  ? 445  SER A CA    1 
ATOM   3521 C  C     . SER A 1 463 ? -12.197 37.686 58.951 1.00 33.14  ? 445  SER A C     1 
ATOM   3522 O  O     . SER A 1 463 ? -11.346 37.798 59.830 1.00 33.49  ? 445  SER A O     1 
ATOM   3523 C  CB    . SER A 1 463 ? -13.326 39.857 59.373 1.00 38.18  ? 445  SER A CB    1 
ATOM   3524 O  OG    . SER A 1 463 ? -14.291 39.202 60.185 1.00 41.56  ? 445  SER A OG    1 
ATOM   3525 N  N     A ARG A 1 464 ? -12.619 36.504 58.526 0.50 31.65  ? 446  ARG A N     1 
ATOM   3526 N  N     B ARG A 1 464 ? -12.650 36.506 58.517 0.50 31.29  ? 446  ARG A N     1 
ATOM   3527 C  CA    A ARG A 1 464 ? -12.108 35.285 59.132 0.50 30.25  ? 446  ARG A CA    1 
ATOM   3528 C  CA    B ARG A 1 464 ? -12.163 35.227 59.042 0.50 29.50  ? 446  ARG A CA    1 
ATOM   3529 C  C     A ARG A 1 464 ? -11.057 34.647 58.232 0.50 26.92  ? 446  ARG A C     1 
ATOM   3530 C  C     B ARG A 1 464 ? -11.017 34.718 58.180 0.50 26.48  ? 446  ARG A C     1 
ATOM   3531 O  O     A ARG A 1 464 ? -11.315 34.349 57.058 0.50 26.60  ? 446  ARG A O     1 
ATOM   3532 O  O     B ARG A 1 464 ? -11.176 34.555 56.970 0.50 25.95  ? 446  ARG A O     1 
ATOM   3533 C  CB    A ARG A 1 464 ? -13.278 34.350 59.429 0.50 31.12  ? 446  ARG A CB    1 
ATOM   3534 C  CB    B ARG A 1 464 ? -13.294 34.181 59.024 0.50 29.78  ? 446  ARG A CB    1 
ATOM   3535 C  CG    A ARG A 1 464 ? -14.329 35.052 60.262 0.50 34.05  ? 446  ARG A CG    1 
ATOM   3536 C  CG    B ARG A 1 464 ? -14.534 34.546 59.842 0.50 31.18  ? 446  ARG A CG    1 
ATOM   3537 C  CD    A ARG A 1 464 ? -15.390 34.134 60.748 0.50 36.34  ? 446  ARG A CD    1 
ATOM   3538 C  CD    B ARG A 1 464 ? -15.597 35.346 59.064 0.50 33.13  ? 446  ARG A CD    1 
ATOM   3539 N  NE    A ARG A 1 464 ? -14.840 33.083 61.595 0.50 38.19  ? 446  ARG A NE    1 
ATOM   3540 N  NE    B ARG A 1 464 ? -16.177 34.651 57.902 0.50 31.60  ? 446  ARG A NE    1 
ATOM   3541 C  CZ    A ARG A 1 464 ? -15.572 32.119 62.138 0.50 38.57  ? 446  ARG A CZ    1 
ATOM   3542 C  CZ    B ARG A 1 464 ? -17.085 33.676 57.984 0.50 33.18  ? 446  ARG A CZ    1 
ATOM   3543 N  NH1   A ARG A 1 464 ? -16.877 32.073 61.924 0.50 41.58  ? 446  ARG A NH1   1 
ATOM   3544 N  NH1   B ARG A 1 464 ? -17.532 33.247 59.170 0.50 32.47  ? 446  ARG A NH1   1 
ATOM   3545 N  NH2   A ARG A 1 464 ? -14.994 31.198 62.874 0.50 38.51  ? 446  ARG A NH2   1 
ATOM   3546 N  NH2   B ARG A 1 464 ? -17.567 33.129 56.870 0.50 32.08  ? 446  ARG A NH2   1 
ATOM   3547 N  N     . GLN A 1 465 ? -9.858  34.448 58.772 1.00 25.18  ? 447  GLN A N     1 
ATOM   3548 C  CA    . GLN A 1 465 ? -8.790  33.871 58.004 1.00 23.87  ? 447  GLN A CA    1 
ATOM   3549 C  C     . GLN A 1 465 ? -8.996  32.371 57.840 1.00 22.44  ? 447  GLN A C     1 
ATOM   3550 O  O     . GLN A 1 465 ? -9.504  31.710 58.740 1.00 22.45  ? 447  GLN A O     1 
ATOM   3551 C  CB    . GLN A 1 465 ? -7.431  34.132 58.630 1.00 23.27  ? 447  GLN A CB    1 
ATOM   3552 C  CG    . GLN A 1 465 ? -7.086  35.573 58.801 1.00 26.39  ? 447  GLN A CG    1 
ATOM   3553 C  CD    . GLN A 1 465 ? -5.646  35.698 59.222 1.00 27.57  ? 447  GLN A CD    1 
ATOM   3554 O  OE1   . GLN A 1 465 ? -5.316  35.468 60.401 1.00 30.19  ? 447  GLN A OE1   1 
ATOM   3555 N  NE2   . GLN A 1 465 ? -4.776  36.043 58.277 1.00 27.71  ? 447  GLN A NE2   1 
ATOM   3556 N  N     . THR A 1 466 ? -8.558  31.844 56.704 1.00 20.77  ? 448  THR A N     1 
ATOM   3557 C  CA    . THR A 1 466 ? -8.685  30.427 56.418 1.00 20.02  ? 448  THR A CA    1 
ATOM   3558 C  C     . THR A 1 466 ? -7.535  29.634 57.081 1.00 19.31  ? 448  THR A C     1 
ATOM   3559 O  O     . THR A 1 466 ? -6.559  30.202 57.536 1.00 18.24  ? 448  THR A O     1 
ATOM   3560 C  CB    . THR A 1 466 ? -8.625  30.145 54.921 1.00 20.61  ? 448  THR A CB    1 
ATOM   3561 O  OG1   . THR A 1 466 ? -7.422  30.702 54.411 1.00 18.40  ? 448  THR A OG1   1 
ATOM   3562 C  CG2   . THR A 1 466 ? -9.890  30.690 54.116 1.00 18.91  ? 448  THR A CG2   1 
ATOM   3563 N  N     . LEU A 1 467 ? -7.711  28.323 57.164 1.00 20.09  ? 449  LEU A N     1 
ATOM   3564 C  CA    . LEU A 1 467 ? -6.666  27.391 57.575 1.00 20.22  ? 449  LEU A CA    1 
ATOM   3565 C  C     . LEU A 1 467 ? -5.395  27.604 56.721 1.00 19.79  ? 449  LEU A C     1 
ATOM   3566 O  O     . LEU A 1 467 ? -4.281  27.698 57.272 1.00 18.89  ? 449  LEU A O     1 
ATOM   3567 C  CB    . LEU A 1 467 ? -7.189  25.971 57.428 1.00 20.36  ? 449  LEU A CB    1 
ATOM   3568 C  CG    . LEU A 1 467 ? -6.147  24.842 57.550 1.00 21.49  ? 449  LEU A CG    1 
ATOM   3569 C  CD1   . LEU A 1 467 ? -5.535  24.870 58.981 1.00 20.40  ? 449  LEU A CD1   1 
ATOM   3570 C  CD2   . LEU A 1 467 ? -6.831  23.541 57.236 1.00 21.15  ? 449  LEU A CD2   1 
ATOM   3571 N  N     . PHE A 1 468 ? -5.565  27.752 55.395 1.00 20.10  ? 450  PHE A N     1 
ATOM   3572 C  CA    . PHE A 1 468 ? -4.415  27.924 54.515 1.00 19.71  ? 450  PHE A CA    1 
ATOM   3573 C  C     . PHE A 1 468 ? -3.649  29.200 54.910 1.00 20.35  ? 450  PHE A C     1 
ATOM   3574 O  O     . PHE A 1 468 ? -2.434  29.167 55.060 1.00 19.90  ? 450  PHE A O     1 
ATOM   3575 C  CB    . PHE A 1 468 ? -4.850  27.943 53.049 1.00 21.74  ? 450  PHE A CB    1 
ATOM   3576 C  CG    . PHE A 1 468 ? -3.717  28.067 52.087 1.00 20.27  ? 450  PHE A CG    1 
ATOM   3577 C  CD1   . PHE A 1 468 ? -3.077  26.943 51.600 1.00 24.35  ? 450  PHE A CD1   1 
ATOM   3578 C  CD2   . PHE A 1 468 ? -3.324  29.314 51.631 1.00 22.09  ? 450  PHE A CD2   1 
ATOM   3579 C  CE1   . PHE A 1 468 ? -2.009  27.064 50.719 1.00 24.25  ? 450  PHE A CE1   1 
ATOM   3580 C  CE2   . PHE A 1 468 ? -2.272  29.430 50.717 1.00 23.63  ? 450  PHE A CE2   1 
ATOM   3581 C  CZ    . PHE A 1 468 ? -1.613  28.337 50.293 1.00 21.71  ? 450  PHE A CZ    1 
ATOM   3582 N  N     . ALA A 1 469 ? -4.352  30.318 55.112 1.00 20.48  ? 451  ALA A N     1 
ATOM   3583 C  CA    . ALA A 1 469 ? -3.708  31.535 55.607 1.00 20.37  ? 451  ALA A CA    1 
ATOM   3584 C  C     . ALA A 1 469 ? -2.924  31.332 56.906 1.00 20.42  ? 451  ALA A C     1 
ATOM   3585 O  O     . ALA A 1 469 ? -1.787  31.820 57.045 1.00 19.93  ? 451  ALA A O     1 
ATOM   3586 C  CB    . ALA A 1 469 ? -4.731  32.662 55.788 1.00 21.81  ? 451  ALA A CB    1 
ATOM   3587 N  N     A SER A 1 470 ? -3.510  30.626 57.859 0.50 20.29  ? 452  SER A N     1 
ATOM   3588 N  N     B SER A 1 470 ? -3.544  30.645 57.863 0.50 20.48  ? 452  SER A N     1 
ATOM   3589 C  CA    A SER A 1 470 ? -2.852  30.425 59.154 0.50 20.75  ? 452  SER A CA    1 
ATOM   3590 C  CA    B SER A 1 470 ? -2.906  30.341 59.153 0.50 21.04  ? 452  SER A CA    1 
ATOM   3591 C  C     A SER A 1 470 ? -1.593  29.534 59.032 0.50 20.69  ? 452  SER A C     1 
ATOM   3592 C  C     B SER A 1 470 ? -1.575  29.620 58.926 0.50 20.76  ? 452  SER A C     1 
ATOM   3593 O  O     A SER A 1 470 ? -0.617  29.703 59.784 0.50 19.57  ? 452  SER A O     1 
ATOM   3594 O  O     B SER A 1 470 ? -0.546  29.993 59.488 0.50 19.78  ? 452  SER A O     1 
ATOM   3595 C  CB    A SER A 1 470 ? -3.851  29.864 60.139 0.50 21.89  ? 452  SER A CB    1 
ATOM   3596 C  CB    B SER A 1 470 ? -3.804  29.456 60.000 0.50 22.28  ? 452  SER A CB    1 
ATOM   3597 O  OG    A SER A 1 470 ? -4.977  30.736 60.245 0.50 22.63  ? 452  SER A OG    1 
ATOM   3598 O  OG    B SER A 1 470 ? -3.212  29.222 61.264 0.50 24.65  ? 452  SER A OG    1 
ATOM   3599 N  N     . GLN A 1 471 ? -1.630  28.582 58.097 1.00 19.36  ? 453  GLN A N     1 
ATOM   3600 C  CA    . GLN A 1 471 ? -0.469  27.721 57.827 1.00 20.17  ? 453  GLN A CA    1 
ATOM   3601 C  C     . GLN A 1 471 ? 0.625   28.452 57.074 1.00 19.33  ? 453  GLN A C     1 
ATOM   3602 O  O     . GLN A 1 471 ? 1.780   28.251 57.370 1.00 20.85  ? 453  GLN A O     1 
ATOM   3603 C  CB    . GLN A 1 471 ? -0.889  26.414 57.141 1.00 20.26  ? 453  GLN A CB    1 
ATOM   3604 C  CG    . GLN A 1 471 ? -1.731  25.567 58.053 1.00 19.80  ? 453  GLN A CG    1 
ATOM   3605 C  CD    . GLN A 1 471 ? -1.917  24.138 57.573 1.00 21.18  ? 453  GLN A CD    1 
ATOM   3606 O  OE1   . GLN A 1 471 ? -2.231  23.914 56.429 1.00 26.42  ? 453  GLN A OE1   1 
ATOM   3607 N  NE2   . GLN A 1 471 ? -1.747  23.178 58.466 1.00 21.16  ? 453  GLN A NE2   1 
ATOM   3608 N  N     . VAL A 1 472 ? 0.259   29.337 56.156 1.00 19.63  ? 454  VAL A N     1 
ATOM   3609 C  CA    . VAL A 1 472 ? 1.210   30.236 55.504 1.00 19.19  ? 454  VAL A CA    1 
ATOM   3610 C  C     . VAL A 1 472 ? 1.915   31.097 56.549 1.00 19.97  ? 454  VAL A C     1 
ATOM   3611 O  O     . VAL A 1 472 ? 3.127   31.080 56.611 1.00 18.60  ? 454  VAL A O     1 
ATOM   3612 C  CB    . VAL A 1 472 ? 0.607   31.115 54.395 1.00 18.71  ? 454  VAL A CB    1 
ATOM   3613 C  CG1   . VAL A 1 472 ? 1.682   32.139 53.873 1.00 18.99  ? 454  VAL A CG1   1 
ATOM   3614 C  CG2   . VAL A 1 472 ? 0.052   30.247 53.205 1.00 17.21  ? 454  VAL A CG2   1 
ATOM   3615 N  N     . MET A 1 473 ? 1.167   31.765 57.406 1.00 19.59  ? 455  MET A N     1 
ATOM   3616 C  CA    . MET A 1 473 ? 1.778   32.638 58.397 1.00 21.48  ? 455  MET A CA    1 
ATOM   3617 C  C     . MET A 1 473 ? 2.675   31.876 59.372 1.00 22.23  ? 455  MET A C     1 
ATOM   3618 O  O     . MET A 1 473 ? 3.730   32.373 59.732 1.00 22.55  ? 455  MET A O     1 
ATOM   3619 C  CB    . MET A 1 473 ? 0.709   33.388 59.163 1.00 22.78  ? 455  MET A CB    1 
ATOM   3620 C  CG    . MET A 1 473 ? -0.018  34.456 58.360 1.00 24.03  ? 455  MET A CG    1 
ATOM   3621 S  SD    . MET A 1 473 ? -1.288  35.267 59.362 1.00 27.68  ? 455  MET A SD    1 
ATOM   3622 C  CE    . MET A 1 473 ? -0.313  36.284 60.443 1.00 33.05  ? 455  MET A CE    1 
ATOM   3623 N  N     . ARG A 1 474 ? 2.266   30.660 59.776 1.00 20.63  ? 456  ARG A N     1 
ATOM   3624 C  CA    . ARG A 1 474 ? 3.017   29.872 60.738 1.00 22.50  ? 456  ARG A CA    1 
ATOM   3625 C  C     . ARG A 1 474 ? 4.306   29.209 60.223 1.00 20.87  ? 456  ARG A C     1 
ATOM   3626 O  O     . ARG A 1 474 ? 5.302   29.107 60.977 1.00 20.85  ? 456  ARG A O     1 
ATOM   3627 C  CB    . ARG A 1 474 ? 2.089   28.809 61.328 1.00 22.37  ? 456  ARG A CB    1 
ATOM   3628 C  CG    . ARG A 1 474 ? 2.660   28.019 62.445 1.00 27.37  ? 456  ARG A CG    1 
ATOM   3629 C  CD    . ARG A 1 474 ? 1.592   27.676 63.564 1.00 33.49  ? 456  ARG A CD    1 
ATOM   3630 N  NE    . ARG A 1 474 ? 0.236   27.687 62.999 1.00 37.41  ? 456  ARG A NE    1 
ATOM   3631 C  CZ    . ARG A 1 474 ? -0.596  26.652 63.021 1.00 41.76  ? 456  ARG A CZ    1 
ATOM   3632 N  NH1   . ARG A 1 474 ? -0.256  25.532 63.648 1.00 44.23  ? 456  ARG A NH1   1 
ATOM   3633 N  NH2   . ARG A 1 474 ? -1.793  26.756 62.442 1.00 39.04  ? 456  ARG A NH2   1 
ATOM   3634 N  N     . TYR A 1 475 ? 4.255   28.709 58.995 1.00 19.66  ? 457  TYR A N     1 
ATOM   3635 C  CA    . TYR A 1 475 ? 5.302   27.823 58.470 1.00 20.41  ? 457  TYR A CA    1 
ATOM   3636 C  C     . TYR A 1 475 ? 6.142   28.379 57.321 1.00 19.15  ? 457  TYR A C     1 
ATOM   3637 O  O     . TYR A 1 475 ? 7.232   27.863 57.139 1.00 19.17  ? 457  TYR A O     1 
ATOM   3638 C  CB    . TYR A 1 475 ? 4.701   26.453 58.054 1.00 20.99  ? 457  TYR A CB    1 
ATOM   3639 C  CG    . TYR A 1 475 ? 4.053   25.781 59.226 1.00 21.60  ? 457  TYR A CG    1 
ATOM   3640 C  CD1   . TYR A 1 475 ? 4.808   25.402 60.319 1.00 24.73  ? 457  TYR A CD1   1 
ATOM   3641 C  CD2   . TYR A 1 475 ? 2.680   25.564 59.259 1.00 23.85  ? 457  TYR A CD2   1 
ATOM   3642 C  CE1   . TYR A 1 475 ? 4.230   24.814 61.445 1.00 28.13  ? 457  TYR A CE1   1 
ATOM   3643 C  CE2   . TYR A 1 475 ? 2.068   24.970 60.401 1.00 26.72  ? 457  TYR A CE2   1 
ATOM   3644 C  CZ    . TYR A 1 475 ? 2.844   24.592 61.468 1.00 27.95  ? 457  TYR A CZ    1 
ATOM   3645 O  OH    . TYR A 1 475 ? 2.312   23.991 62.589 1.00 30.83  ? 457  TYR A OH    1 
ATOM   3646 N  N     . ALA A 1 476 ? 5.613   29.342 56.556 1.00 18.99  ? 458  ALA A N     1 
ATOM   3647 C  CA    . ALA A 1 476 ? 6.322   29.986 55.466 1.00 18.15  ? 458  ALA A CA    1 
ATOM   3648 C  C     . ALA A 1 476 ? 7.056   31.250 55.996 1.00 19.31  ? 458  ALA A C     1 
ATOM   3649 O  O     . ALA A 1 476 ? 6.438   32.254 56.334 1.00 20.55  ? 458  ALA A O     1 
ATOM   3650 C  CB    . ALA A 1 476 ? 5.397   30.364 54.319 1.00 17.71  ? 458  ALA A CB    1 
ATOM   3651 N  N     . ASP A 1 477 ? 8.359   31.175 56.103 1.00 19.47  ? 459  ASP A N     1 
ATOM   3652 C  CA    . ASP A 1 477 ? 9.165   32.346 56.582 1.00 20.55  ? 459  ASP A CA    1 
ATOM   3653 C  C     . ASP A 1 477 ? 8.964   33.508 55.629 1.00 19.81  ? 459  ASP A C     1 
ATOM   3654 O  O     . ASP A 1 477 ? 8.735   34.649 56.053 1.00 21.89  ? 459  ASP A O     1 
ATOM   3655 C  CB    . ASP A 1 477 ? 10.649  32.004 56.688 1.00 20.42  ? 459  ASP A CB    1 
ATOM   3656 C  CG    . ASP A 1 477 ? 10.928  30.905 57.718 1.00 24.09  ? 459  ASP A CG    1 
ATOM   3657 O  OD1   . ASP A 1 477 ? 10.152  30.796 58.668 1.00 23.90  ? 459  ASP A OD1   1 
ATOM   3658 O  OD2   . ASP A 1 477 ? 11.932  30.179 57.604 1.00 20.86  ? 459  ASP A OD2   1 
ATOM   3659 N  N     . LEU A 1 478 ? 9.103   33.193 54.352 1.00 19.85  ? 460  LEU A N     1 
ATOM   3660 C  CA    . LEU A 1 478 ? 8.800   34.086 53.248 1.00 20.94  ? 460  LEU A CA    1 
ATOM   3661 C  C     . LEU A 1 478 ? 7.719   33.501 52.332 1.00 19.80  ? 460  LEU A C     1 
ATOM   3662 O  O     . LEU A 1 478 ? 7.544   32.306 52.250 1.00 19.66  ? 460  LEU A O     1 
ATOM   3663 C  CB    . LEU A 1 478 ? 10.063  34.362 52.425 1.00 21.58  ? 460  LEU A CB    1 
ATOM   3664 C  CG    . LEU A 1 478 ? 11.328  34.780 53.218 1.00 23.37  ? 460  LEU A CG    1 
ATOM   3665 C  CD1   . LEU A 1 478 ? 12.603  34.763 52.312 1.00 23.75  ? 460  LEU A CD1   1 
ATOM   3666 C  CD2   . LEU A 1 478 ? 11.159  36.111 53.888 1.00 20.93  ? 460  LEU A CD2   1 
ATOM   3667 N  N     . TYR A 1 479 ? 7.026   34.388 51.622 1.00 20.29  ? 461  TYR A N     1 
ATOM   3668 C  CA    . TYR A 1 479 ? 6.136   34.003 50.554 1.00 20.38  ? 461  TYR A CA    1 
ATOM   3669 C  C     . TYR A 1 479 ? 5.984   35.058 49.474 1.00 20.50  ? 461  TYR A C     1 
ATOM   3670 O  O     . TYR A 1 479 ? 6.241   36.244 49.697 1.00 20.56  ? 461  TYR A O     1 
ATOM   3671 C  CB    . TYR A 1 479 ? 4.746   33.572 51.087 1.00 19.89  ? 461  TYR A CB    1 
ATOM   3672 C  CG    . TYR A 1 479 ? 3.839   34.650 51.598 1.00 19.14  ? 461  TYR A CG    1 
ATOM   3673 C  CD1   . TYR A 1 479 ? 2.856   35.203 50.786 1.00 17.59  ? 461  TYR A CD1   1 
ATOM   3674 C  CD2   . TYR A 1 479 ? 3.910   35.082 52.924 1.00 18.27  ? 461  TYR A CD2   1 
ATOM   3675 C  CE1   . TYR A 1 479 ? 2.014   36.216 51.284 1.00 19.73  ? 461  TYR A CE1   1 
ATOM   3676 C  CE2   . TYR A 1 479 ? 3.056   36.048 53.425 1.00 18.73  ? 461  TYR A CE2   1 
ATOM   3677 C  CZ    . TYR A 1 479 ? 2.096   36.599 52.599 1.00 19.95  ? 461  TYR A CZ    1 
ATOM   3678 O  OH    . TYR A 1 479 ? 1.232   37.551 53.090 1.00 21.97  ? 461  TYR A OH    1 
ATOM   3679 N  N     . ALA A 1 480 ? 5.561   34.615 48.304 1.00 20.44  ? 462  ALA A N     1 
ATOM   3680 C  CA    . ALA A 1 480 ? 5.424   35.505 47.143 1.00 21.80  ? 462  ALA A CA    1 
ATOM   3681 C  C     . ALA A 1 480 ? 4.593   34.822 46.077 1.00 21.89  ? 462  ALA A C     1 
ATOM   3682 O  O     . ALA A 1 480 ? 4.403   33.629 46.126 1.00 21.11  ? 462  ALA A O     1 
ATOM   3683 C  CB    . ALA A 1 480 ? 6.800   35.896 46.595 1.00 22.75  ? 462  ALA A CB    1 
ATOM   3684 N  N     . ALA A 1 481 ? 4.118   35.611 45.117 1.00 23.44  ? 463  ALA A N     1 
ATOM   3685 C  CA    . ALA A 1 481 ? 3.472   35.142 43.904 1.00 24.61  ? 463  ALA A CA    1 
ATOM   3686 C  C     . ALA A 1 481 ? 4.389   34.238 43.074 1.00 24.98  ? 463  ALA A C     1 
ATOM   3687 O  O     . ALA A 1 481 ? 3.923   33.329 42.411 1.00 26.53  ? 463  ALA A O     1 
ATOM   3688 C  CB    . ALA A 1 481 ? 2.999   36.349 43.042 1.00 25.54  ? 463  ALA A CB    1 
ATOM   3689 N  N     . SER A 1 482 ? 5.695   34.498 43.116 1.00 25.68  ? 464  SER A N     1 
ATOM   3690 C  CA    . SER A 1 482 ? 6.691   33.730 42.360 1.00 26.12  ? 464  SER A CA    1 
ATOM   3691 C  C     . SER A 1 482 ? 8.030   33.762 43.103 1.00 26.11  ? 464  SER A C     1 
ATOM   3692 O  O     . SER A 1 482 ? 8.397   34.785 43.673 1.00 26.07  ? 464  SER A O     1 
ATOM   3693 C  CB    . SER A 1 482 ? 6.892   34.354 40.974 1.00 27.42  ? 464  SER A CB    1 
ATOM   3694 O  OG    . SER A 1 482 ? 7.913   33.687 40.237 1.00 29.78  ? 464  SER A OG    1 
ATOM   3695 N  N     . PHE A 1 483 ? 8.795   32.676 43.024 1.00 26.34  ? 465  PHE A N     1 
ATOM   3696 C  CA    . PHE A 1 483 ? 10.173  32.669 43.571 1.00 27.03  ? 465  PHE A CA    1 
ATOM   3697 C  C     . PHE A 1 483 ? 11.056  33.733 42.852 1.00 26.92  ? 465  PHE A C     1 
ATOM   3698 O  O     . PHE A 1 483 ? 12.040  34.203 43.406 1.00 27.33  ? 465  PHE A O     1 
ATOM   3699 C  CB    . PHE A 1 483 ? 10.831  31.260 43.444 1.00 28.93  ? 465  PHE A CB    1 
ATOM   3700 C  CG    . PHE A 1 483 ? 11.204  30.929 42.094 1.00 32.08  ? 465  PHE A CG    1 
ATOM   3701 C  CD1   . PHE A 1 483 ? 12.444  31.321 41.584 1.00 34.62  ? 465  PHE A CD1   1 
ATOM   3702 C  CD2   . PHE A 1 483 ? 10.294  30.313 41.248 1.00 36.62  ? 465  PHE A CD2   1 
ATOM   3703 C  CE1   . PHE A 1 483 ? 12.787  31.062 40.292 1.00 36.76  ? 465  PHE A CE1   1 
ATOM   3704 C  CE2   . PHE A 1 483 ? 10.616  30.065 39.946 1.00 37.14  ? 465  PHE A CE2   1 
ATOM   3705 C  CZ    . PHE A 1 483 ? 11.878  30.447 39.448 1.00 39.39  ? 465  PHE A CZ    1 
ATOM   3706 N  N     . ILE A 1 484 ? 10.705  34.084 41.618 1.00 26.42  ? 466  ILE A N     1 
ATOM   3707 C  CA    . ILE A 1 484 ? 11.507  35.027 40.849 1.00 27.93  ? 466  ILE A CA    1 
ATOM   3708 C  C     . ILE A 1 484 ? 11.666  36.395 41.520 1.00 26.95  ? 466  ILE A C     1 
ATOM   3709 O  O     . ILE A 1 484 ? 12.625  37.120 41.234 1.00 26.88  ? 466  ILE A O     1 
ATOM   3710 C  CB    . ILE A 1 484 ? 10.997  35.197 39.384 1.00 28.63  ? 466  ILE A CB    1 
ATOM   3711 C  CG1   . ILE A 1 484 ? 12.140  35.686 38.473 1.00 32.73  ? 466  ILE A CG1   1 
ATOM   3712 C  CG2   . ILE A 1 484 ? 9.866   36.186 39.325 1.00 28.15  ? 466  ILE A CG2   1 
ATOM   3713 C  CD1   . ILE A 1 484 ? 13.189  34.580 38.089 1.00 35.57  ? 466  ILE A CD1   1 
ATOM   3714 N  N     . ASN A 1 485 ? 10.737  36.728 42.424 1.00 25.53  ? 467  ASN A N     1 
ATOM   3715 C  CA    . ASN A 1 485 ? 10.748  38.012 43.142 1.00 26.38  ? 467  ASN A CA    1 
ATOM   3716 C  C     . ASN A 1 485 ? 12.008  38.183 44.007 1.00 27.15  ? 467  ASN A C     1 
ATOM   3717 O  O     . ASN A 1 485 ? 12.398  39.311 44.305 1.00 29.21  ? 467  ASN A O     1 
ATOM   3718 C  CB    . ASN A 1 485 ? 9.459   38.177 43.979 1.00 25.18  ? 467  ASN A CB    1 
ATOM   3719 C  CG    . ASN A 1 485 ? 8.208   38.311 43.123 1.00 26.31  ? 467  ASN A CG    1 
ATOM   3720 O  OD1   . ASN A 1 485 ? 8.300   38.352 41.908 1.00 28.10  ? 467  ASN A OD1   1 
ATOM   3721 N  ND2   . ASN A 1 485 ? 7.026   38.433 43.763 1.00 23.21  ? 467  ASN A ND2   1 
ATOM   3722 N  N     . LEU A 1 486 ? 12.666  37.071 44.356 1.00 26.98  ? 468  LEU A N     1 
ATOM   3723 C  CA    . LEU A 1 486 ? 14.012  37.089 44.967 1.00 27.27  ? 468  LEU A CA    1 
ATOM   3724 C  C     . LEU A 1 486 ? 15.081  37.798 44.133 1.00 29.03  ? 468  LEU A C     1 
ATOM   3725 O  O     . LEU A 1 486 ? 16.034  38.308 44.696 1.00 30.10  ? 468  LEU A O     1 
ATOM   3726 C  CB    . LEU A 1 486 ? 14.475  35.658 45.332 1.00 27.40  ? 468  LEU A CB    1 
ATOM   3727 C  CG    . LEU A 1 486 ? 13.721  34.978 46.494 1.00 26.72  ? 468  LEU A CG    1 
ATOM   3728 C  CD1   . LEU A 1 486 ? 14.061  33.470 46.525 1.00 26.78  ? 468  LEU A CD1   1 
ATOM   3729 C  CD2   . LEU A 1 486 ? 13.980  35.667 47.861 1.00 25.61  ? 468  LEU A CD2   1 
ATOM   3730 N  N     . LEU A 1 487 ? 14.914  37.860 42.815 1.00 29.49  ? 469  LEU A N     1 
ATOM   3731 C  CA    . LEU A 1 487 ? 15.850  38.581 41.919 1.00 31.91  ? 469  LEU A CA    1 
ATOM   3732 C  C     . LEU A 1 487 ? 15.921  40.067 42.209 1.00 32.61  ? 469  LEU A C     1 
ATOM   3733 O  O     . LEU A 1 487 ? 16.939  40.734 41.919 1.00 34.67  ? 469  LEU A O     1 
ATOM   3734 C  CB    . LEU A 1 487 ? 15.417  38.376 40.472 1.00 32.77  ? 469  LEU A CB    1 
ATOM   3735 C  CG    . LEU A 1 487 ? 16.315  38.788 39.320 1.00 34.04  ? 469  LEU A CG    1 
ATOM   3736 C  CD1   . LEU A 1 487 ? 17.699  38.092 39.328 1.00 33.00  ? 469  LEU A CD1   1 
ATOM   3737 C  CD2   . LEU A 1 487 ? 15.516  38.518 38.024 1.00 36.00  ? 469  LEU A CD2   1 
ATOM   3738 N  N     . TYR A 1 488 ? 14.859  40.595 42.820 1.00 32.49  ? 470  TYR A N     1 
ATOM   3739 C  CA    . TYR A 1 488 ? 14.734  42.026 43.024 1.00 33.76  ? 470  TYR A CA    1 
ATOM   3740 C  C     . TYR A 1 488 ? 15.278  42.490 44.352 1.00 34.42  ? 470  TYR A C     1 
ATOM   3741 O  O     . TYR A 1 488 ? 15.130  43.664 44.680 1.00 35.74  ? 470  TYR A O     1 
ATOM   3742 C  CB    . TYR A 1 488 ? 13.268  42.459 42.827 1.00 33.74  ? 470  TYR A CB    1 
ATOM   3743 C  CG    . TYR A 1 488 ? 12.713  41.907 41.557 1.00 33.91  ? 470  TYR A CG    1 
ATOM   3744 C  CD1   . TYR A 1 488 ? 13.450  41.978 40.377 1.00 36.77  ? 470  TYR A CD1   1 
ATOM   3745 C  CD2   . TYR A 1 488 ? 11.485  41.246 41.526 1.00 32.36  ? 470  TYR A CD2   1 
ATOM   3746 C  CE1   . TYR A 1 488 ? 12.981  41.409 39.201 1.00 38.71  ? 470  TYR A CE1   1 
ATOM   3747 C  CE2   . TYR A 1 488 ? 11.012  40.689 40.358 1.00 34.64  ? 470  TYR A CE2   1 
ATOM   3748 C  CZ    . TYR A 1 488 ? 11.764  40.781 39.199 1.00 35.67  ? 470  TYR A CZ    1 
ATOM   3749 O  OH    . TYR A 1 488 ? 11.311  40.225 38.028 1.00 38.10  ? 470  TYR A OH    1 
ATOM   3750 N  N     . TYR A 1 489 ? 15.888  41.582 45.113 1.00 33.17  ? 471  TYR A N     1 
ATOM   3751 C  CA    . TYR A 1 489 ? 16.488  41.887 46.411 1.00 33.32  ? 471  TYR A CA    1 
ATOM   3752 C  C     . TYR A 1 489 ? 17.962  41.558 46.356 1.00 35.55  ? 471  TYR A C     1 
ATOM   3753 O  O     . TYR A 1 489 ? 18.345  40.582 45.743 1.00 36.75  ? 471  TYR A O     1 
ATOM   3754 C  CB    . TYR A 1 489 ? 15.825  41.078 47.535 1.00 29.89  ? 471  TYR A CB    1 
ATOM   3755 C  CG    . TYR A 1 489 ? 14.375  41.432 47.745 1.00 27.82  ? 471  TYR A CG    1 
ATOM   3756 C  CD1   . TYR A 1 489 ? 13.989  42.341 48.736 1.00 28.60  ? 471  TYR A CD1   1 
ATOM   3757 C  CD2   . TYR A 1 489 ? 13.390  40.887 46.939 1.00 26.25  ? 471  TYR A CD2   1 
ATOM   3758 C  CE1   . TYR A 1 489 ? 12.659  42.684 48.929 1.00 26.06  ? 471  TYR A CE1   1 
ATOM   3759 C  CE2   . TYR A 1 489 ? 12.067  41.233 47.097 1.00 25.32  ? 471  TYR A CE2   1 
ATOM   3760 C  CZ    . TYR A 1 489 ? 11.704  42.136 48.112 1.00 26.86  ? 471  TYR A CZ    1 
ATOM   3761 O  OH    . TYR A 1 489 ? 10.399  42.500 48.298 1.00 26.20  ? 471  TYR A OH    1 
ATOM   3762 N  N     . PRO A 1 490 ? 18.807  42.364 47.017 1.00 38.43  ? 472  PRO A N     1 
ATOM   3763 C  CA    . PRO A 1 490 ? 20.232  42.030 47.029 1.00 40.11  ? 472  PRO A CA    1 
ATOM   3764 C  C     . PRO A 1 490 ? 20.565  40.771 47.844 1.00 40.01  ? 472  PRO A C     1 
ATOM   3765 O  O     . PRO A 1 490 ? 19.814  40.343 48.698 1.00 37.93  ? 472  PRO A O     1 
ATOM   3766 C  CB    . PRO A 1 490 ? 20.877  43.275 47.636 1.00 41.54  ? 472  PRO A CB    1 
ATOM   3767 C  CG    . PRO A 1 490 ? 19.836  43.858 48.496 1.00 40.82  ? 472  PRO A CG    1 
ATOM   3768 C  CD    . PRO A 1 490 ? 18.518  43.587 47.786 1.00 39.04  ? 472  PRO A CD    1 
ATOM   3769 N  N     . PHE A 1 491 ? 21.718  40.207 47.532 1.00 43.39  ? 473  PHE A N     1 
ATOM   3770 C  CA    . PHE A 1 491 ? 22.340  39.048 48.215 1.00 43.97  ? 473  PHE A CA    1 
ATOM   3771 C  C     . PHE A 1 491 ? 22.299  39.048 49.769 1.00 43.84  ? 473  PHE A C     1 
ATOM   3772 O  O     . PHE A 1 491 ? 22.202  38.005 50.416 1.00 45.11  ? 473  PHE A O     1 
ATOM   3773 C  CB    . PHE A 1 491 ? 23.843  39.029 47.796 1.00 48.55  ? 473  PHE A CB    1 
ATOM   3774 C  CG    . PHE A 1 491 ? 24.092  38.734 46.322 1.00 50.62  ? 473  PHE A CG    1 
ATOM   3775 C  CD1   . PHE A 1 491 ? 23.559  37.578 45.715 1.00 52.76  ? 473  PHE A CD1   1 
ATOM   3776 C  CD2   . PHE A 1 491 ? 24.893  39.578 45.552 1.00 54.79  ? 473  PHE A CD2   1 
ATOM   3777 C  CE1   . PHE A 1 491 ? 23.822  37.289 44.349 1.00 52.61  ? 473  PHE A CE1   1 
ATOM   3778 C  CE2   . PHE A 1 491 ? 25.160  39.297 44.190 1.00 55.48  ? 473  PHE A CE2   1 
ATOM   3779 C  CZ    . PHE A 1 491 ? 24.620  38.153 43.593 1.00 54.37  ? 473  PHE A CZ    1 
ATOM   3780 N  N     . SER A 1 492 ? 22.418  40.210 50.375 1.00 43.33  ? 474  SER A N     1 
ATOM   3781 C  CA    . SER A 1 492 ? 22.551  40.270 51.823 1.00 42.33  ? 474  SER A CA    1 
ATOM   3782 C  C     . SER A 1 492 ? 21.359  40.965 52.448 1.00 39.85  ? 474  SER A C     1 
ATOM   3783 O  O     . SER A 1 492 ? 21.451  41.511 53.540 1.00 39.43  ? 474  SER A O     1 
ATOM   3784 C  CB    . SER A 1 492 ? 23.823  41.014 52.139 1.00 45.50  ? 474  SER A CB    1 
ATOM   3785 O  OG    . SER A 1 492 ? 24.843  40.531 51.281 1.00 50.67  ? 474  SER A OG    1 
ATOM   3786 N  N     . TYR A 1 493 ? 20.230  40.910 51.751 1.00 36.70  ? 475  TYR A N     1 
ATOM   3787 C  CA    . TYR A 1 493 ? 19.034  41.558 52.224 1.00 36.01  ? 475  TYR A CA    1 
ATOM   3788 C  C     . TYR A 1 493 ? 18.569  40.945 53.537 1.00 34.03  ? 475  TYR A C     1 
ATOM   3789 O  O     . TYR A 1 493 ? 18.530  39.709 53.683 1.00 33.07  ? 475  TYR A O     1 
ATOM   3790 C  CB    . TYR A 1 493 ? 17.918  41.451 51.195 1.00 34.30  ? 475  TYR A CB    1 
ATOM   3791 C  CG    . TYR A 1 493 ? 16.781  42.398 51.469 1.00 34.32  ? 475  TYR A CG    1 
ATOM   3792 C  CD1   . TYR A 1 493 ? 16.881  43.747 51.143 1.00 36.06  ? 475  TYR A CD1   1 
ATOM   3793 C  CD2   . TYR A 1 493 ? 15.598  41.952 52.059 1.00 32.88  ? 475  TYR A CD2   1 
ATOM   3794 C  CE1   . TYR A 1 493 ? 15.823  44.624 51.390 1.00 36.34  ? 475  TYR A CE1   1 
ATOM   3795 C  CE2   . TYR A 1 493 ? 14.551  42.820 52.307 1.00 31.51  ? 475  TYR A CE2   1 
ATOM   3796 C  CZ    . TYR A 1 493 ? 14.673  44.144 51.963 1.00 35.74  ? 475  TYR A CZ    1 
ATOM   3797 O  OH    . TYR A 1 493 ? 13.641  44.996 52.233 1.00 39.17  ? 475  TYR A OH    1 
ATOM   3798 N  N     . LEU A 1 494 ? 18.179  41.799 54.476 1.00 34.44  ? 476  LEU A N     1 
ATOM   3799 C  CA    . LEU A 1 494 ? 17.543  41.339 55.711 1.00 33.23  ? 476  LEU A CA    1 
ATOM   3800 C  C     . LEU A 1 494 ? 16.023  41.513 55.586 1.00 32.06  ? 476  LEU A C     1 
ATOM   3801 O  O     . LEU A 1 494 ? 15.509  42.623 55.664 1.00 33.31  ? 476  LEU A O     1 
ATOM   3802 C  CB    . LEU A 1 494 ? 18.064  42.073 56.945 1.00 35.04  ? 476  LEU A CB    1 
ATOM   3803 C  CG    . LEU A 1 494 ? 17.408  41.646 58.282 1.00 35.01  ? 476  LEU A CG    1 
ATOM   3804 C  CD1   . LEU A 1 494 ? 17.425  40.144 58.578 1.00 32.72  ? 476  LEU A CD1   1 
ATOM   3805 C  CD2   . LEU A 1 494 ? 18.037  42.385 59.434 1.00 37.31  ? 476  LEU A CD2   1 
ATOM   3806 N  N     . PHE A 1 495 ? 15.312  40.418 55.395 1.00 29.17  ? 477  PHE A N     1 
ATOM   3807 C  CA    . PHE A 1 495 ? 13.855  40.450 55.414 1.00 27.55  ? 477  PHE A CA    1 
ATOM   3808 C  C     . PHE A 1 495 ? 13.413  40.547 56.870 1.00 27.72  ? 477  PHE A C     1 
ATOM   3809 O  O     . PHE A 1 495 ? 13.858  39.728 57.698 1.00 28.29  ? 477  PHE A O     1 
ATOM   3810 C  CB    . PHE A 1 495 ? 13.284  39.200 54.802 1.00 26.49  ? 477  PHE A CB    1 
ATOM   3811 C  CG    . PHE A 1 495 ? 13.515  39.085 53.342 1.00 25.75  ? 477  PHE A CG    1 
ATOM   3812 C  CD1   . PHE A 1 495 ? 12.701  39.779 52.455 1.00 27.59  ? 477  PHE A CD1   1 
ATOM   3813 C  CD2   . PHE A 1 495 ? 14.515  38.286 52.840 1.00 26.01  ? 477  PHE A CD2   1 
ATOM   3814 C  CE1   . PHE A 1 495 ? 12.904  39.729 51.122 1.00 26.51  ? 477  PHE A CE1   1 
ATOM   3815 C  CE2   . PHE A 1 495 ? 14.701  38.191 51.475 1.00 28.12  ? 477  PHE A CE2   1 
ATOM   3816 C  CZ    . PHE A 1 495 ? 13.899  38.912 50.612 1.00 28.79  ? 477  PHE A CZ    1 
ATOM   3817 N  N     . ARG A 1 496 ? 12.587  41.533 57.201 1.00 51.62  ? 478  ARG A N     1 
ATOM   3818 C  CA    . ARG A 1 496 ? 12.205  41.747 58.584 1.00 51.49  ? 478  ARG A CA    1 
ATOM   3819 C  C     . ARG A 1 496 ? 10.706  41.633 58.780 1.00 47.23  ? 478  ARG A C     1 
ATOM   3820 O  O     . ARG A 1 496 ? 9.925   42.105 57.961 1.00 49.36  ? 478  ARG A O     1 
ATOM   3821 C  CB    . ARG A 1 496 ? 12.681  43.112 59.049 1.00 59.75  ? 478  ARG A CB    1 
ATOM   3822 C  CG    . ARG A 1 496 ? 14.179  43.277 58.918 1.00 66.10  ? 478  ARG A CG    1 
ATOM   3823 C  CD    . ARG A 1 496 ? 14.640  44.682 59.235 1.00 79.09  ? 478  ARG A CD    1 
ATOM   3824 N  NE    . ARG A 1 496 ? 14.486  45.528 58.054 1.00 89.06  ? 478  ARG A NE    1 
ATOM   3825 C  CZ    . ARG A 1 496 ? 13.666  46.573 57.942 1.00 96.85  ? 478  ARG A CZ    1 
ATOM   3826 N  NH1   . ARG A 1 496 ? 12.897  46.961 58.959 1.00 99.79  ? 478  ARG A NH1   1 
ATOM   3827 N  NH2   . ARG A 1 496 ? 13.632  47.251 56.794 1.00 105.08 ? 478  ARG A NH2   1 
ATOM   3828 N  N     . ALA A 1 497 ? 10.328  40.995 59.876 1.00 42.31  ? 479  ALA A N     1 
ATOM   3829 C  CA    . ALA A 1 497 ? 8.970   40.981 60.359 1.00 42.02  ? 479  ALA A CA    1 
ATOM   3830 C  C     . ALA A 1 497 ? 8.981   41.562 61.791 1.00 43.01  ? 479  ALA A C     1 
ATOM   3831 O  O     . ALA A 1 497 ? 9.956   41.389 62.510 1.00 42.05  ? 479  ALA A O     1 
ATOM   3832 C  CB    . ALA A 1 497 ? 8.452   39.563 60.359 1.00 35.01  ? 479  ALA A CB    1 
ATOM   3833 N  N     . ALA A 1 498 ? 7.902   42.227 62.209 1.00 46.55  ? 480  ALA A N     1 
ATOM   3834 C  CA    . ALA A 1 498 ? 7.815   42.789 63.567 1.00 48.27  ? 480  ALA A CA    1 
ATOM   3835 C  C     . ALA A 1 498 ? 7.807   41.669 64.581 1.00 43.29  ? 480  ALA A C     1 
ATOM   3836 O  O     . ALA A 1 498 ? 7.194   40.618 64.330 1.00 39.98  ? 480  ALA A O     1 
ATOM   3837 C  CB    . ALA A 1 498 ? 6.575   43.599 63.744 1.00 52.22  ? 480  ALA A CB    1 
ATOM   3838 N  N     . HIS A 1 499 ? 8.465   41.903 65.725 1.00 45.16  ? 481  HIS A N     1 
ATOM   3839 C  CA    . HIS A 1 499 ? 8.453   40.949 66.849 1.00 41.91  ? 481  HIS A CA    1 
ATOM   3840 C  C     . HIS A 1 499 ? 7.027   40.875 67.350 1.00 39.71  ? 481  HIS A C     1 
ATOM   3841 O  O     . HIS A 1 499 ? 6.311   41.882 67.413 1.00 42.08  ? 481  HIS A O     1 
ATOM   3842 C  CB    . HIS A 1 499 ? 9.364   41.345 68.035 1.00 45.39  ? 481  HIS A CB    1 
ATOM   3843 C  CG    . HIS A 1 499 ? 10.833  41.295 67.748 1.00 52.87  ? 481  HIS A CG    1 
ATOM   3844 N  ND1   . HIS A 1 499 ? 11.424  40.290 67.007 1.00 54.26  ? 481  HIS A ND1   1 
ATOM   3845 C  CD2   . HIS A 1 499 ? 11.836  42.124 68.125 1.00 60.32  ? 481  HIS A CD2   1 
ATOM   3846 C  CE1   . HIS A 1 499 ? 12.722  40.517 66.918 1.00 59.60  ? 481  HIS A CE1   1 
ATOM   3847 N  NE2   . HIS A 1 499 ? 13.000  41.620 67.594 1.00 66.93  ? 481  HIS A NE2   1 
ATOM   3848 N  N     . VAL A 1 500 ? 6.627   39.667 67.705 1.00 37.05  ? 482  VAL A N     1 
ATOM   3849 C  CA    . VAL A 1 500 ? 5.286   39.403 68.225 1.00 35.33  ? 482  VAL A CA    1 
ATOM   3850 C  C     . VAL A 1 500 ? 5.290   39.565 69.769 1.00 34.12  ? 482  VAL A C     1 
ATOM   3851 O  O     . VAL A 1 500 ? 6.297   39.212 70.457 1.00 34.29  ? 482  VAL A O     1 
ATOM   3852 C  CB    . VAL A 1 500 ? 4.794   38.002 67.741 1.00 35.08  ? 482  VAL A CB    1 
ATOM   3853 C  CG1   . VAL A 1 500 ? 3.499   37.563 68.474 1.00 34.60  ? 482  VAL A CG1   1 
ATOM   3854 C  CG2   . VAL A 1 500 ? 4.608   38.028 66.219 1.00 37.48  ? 482  VAL A CG2   1 
ATOM   3855 N  N     . LEU A 1 501 ? 4.199   40.165 70.275 1.00 33.76  ? 483  LEU A N     1 
ATOM   3856 C  CA    . LEU A 1 501 ? 3.939   40.355 71.720 1.00 32.20  ? 483  LEU A CA    1 
ATOM   3857 C  C     . LEU A 1 501 ? 2.618   39.706 72.114 1.00 30.33  ? 483  LEU A C     1 
ATOM   3858 O  O     . LEU A 1 501 ? 1.643   39.792 71.383 1.00 33.31  ? 483  LEU A O     1 
ATOM   3859 C  CB    . LEU A 1 501 ? 3.836   41.845 72.106 1.00 35.15  ? 483  LEU A CB    1 
ATOM   3860 C  CG    . LEU A 1 501 ? 5.065   42.756 71.960 1.00 39.52  ? 483  LEU A CG    1 
ATOM   3861 C  CD1   . LEU A 1 501 ? 4.765   44.153 72.492 1.00 44.95  ? 483  LEU A CD1   1 
ATOM   3862 C  CD2   . LEU A 1 501 ? 6.268   42.188 72.683 1.00 40.32  ? 483  LEU A CD2   1 
ATOM   3863 N  N     . MET A 1 502 ? 2.576   39.139 73.304 1.00 27.65  ? 484  MET A N     1 
ATOM   3864 C  CA    . MET A 1 502 ? 1.324   38.640 73.860 1.00 27.56  ? 484  MET A CA    1 
ATOM   3865 C  C     . MET A 1 502 ? 0.455   39.808 74.316 1.00 28.90  ? 484  MET A C     1 
ATOM   3866 O  O     . MET A 1 502 ? 0.970   40.903 74.536 1.00 28.97  ? 484  MET A O     1 
ATOM   3867 C  CB    . MET A 1 502 ? 1.612   37.734 75.055 1.00 25.88  ? 484  MET A CB    1 
ATOM   3868 C  CG    . MET A 1 502 ? 2.398   36.490 74.674 1.00 27.53  ? 484  MET A CG    1 
ATOM   3869 S  SD    . MET A 1 502 ? 2.530   35.287 75.965 1.00 28.12  ? 484  MET A SD    1 
ATOM   3870 C  CE    . MET A 1 502 ? 0.796   34.741 76.194 1.00 22.68  ? 484  MET A CE    1 
ATOM   3871 N  N     . PRO A 1 503 ? -0.869  39.596 74.409 1.00 31.02  ? 485  PRO A N     1 
ATOM   3872 C  CA    . PRO A 1 503 ? -1.780  40.616 74.926 1.00 34.20  ? 485  PRO A CA    1 
ATOM   3873 C  C     . PRO A 1 503 ? -1.358  41.288 76.267 1.00 31.52  ? 485  PRO A C     1 
ATOM   3874 O  O     . PRO A 1 503 ? -1.559  42.502 76.422 1.00 34.47  ? 485  PRO A O     1 
ATOM   3875 C  CB    . PRO A 1 503 ? -3.087  39.841 75.094 1.00 36.40  ? 485  PRO A CB    1 
ATOM   3876 C  CG    . PRO A 1 503 ? -3.032  38.812 74.030 1.00 38.50  ? 485  PRO A CG    1 
ATOM   3877 C  CD    . PRO A 1 503 ? -1.598  38.392 73.965 1.00 32.87  ? 485  PRO A CD    1 
ATOM   3878 N  N     . HIS A 1 504 ? -0.825  40.530 77.197 1.00 28.42  ? 486  HIS A N     1 
ATOM   3879 C  CA    . HIS A 1 504 ? -0.384  41.100 78.496 1.00 27.81  ? 486  HIS A CA    1 
ATOM   3880 C  C     . HIS A 1 504 ? 0.948   41.875 78.384 1.00 28.62  ? 486  HIS A C     1 
ATOM   3881 O  O     . HIS A 1 504 ? 1.317   42.601 79.285 1.00 29.78  ? 486  HIS A O     1 
ATOM   3882 C  CB    . HIS A 1 504 ? -0.301  40.046 79.592 1.00 25.78  ? 486  HIS A CB    1 
ATOM   3883 C  CG    . HIS A 1 504 ? 0.945   39.237 79.559 1.00 24.17  ? 486  HIS A CG    1 
ATOM   3884 N  ND1   . HIS A 1 504 ? 1.043   38.058 78.850 1.00 23.71  ? 486  HIS A ND1   1 
ATOM   3885 C  CD2   . HIS A 1 504 ? 2.158   39.450 80.099 1.00 22.39  ? 486  HIS A CD2   1 
ATOM   3886 C  CE1   . HIS A 1 504 ? 2.262   37.582 78.967 1.00 22.68  ? 486  HIS A CE1   1 
ATOM   3887 N  NE2   . HIS A 1 504 ? 2.954   38.390 79.746 1.00 24.58  ? 486  HIS A NE2   1 
ATOM   3888 N  N     . GLU A 1 505 ? 1.654   41.700 77.283 1.00 29.26  ? 487  GLU A N     1 
ATOM   3889 C  CA    . GLU A 1 505 ? 2.920   42.376 77.042 1.00 32.23  ? 487  GLU A CA    1 
ATOM   3890 C  C     . GLU A 1 505 ? 2.746   43.716 76.293 1.00 37.96  ? 487  GLU A C     1 
ATOM   3891 O  O     . GLU A 1 505 ? 3.716   44.420 76.103 1.00 41.54  ? 487  GLU A O     1 
ATOM   3892 C  CB    . GLU A 1 505 ? 3.844   41.476 76.238 1.00 30.33  ? 487  GLU A CB    1 
ATOM   3893 C  CG    . GLU A 1 505 ? 4.245   40.203 76.971 1.00 27.48  ? 487  GLU A CG    1 
ATOM   3894 C  CD    . GLU A 1 505 ? 5.045   39.260 76.104 1.00 27.92  ? 487  GLU A CD    1 
ATOM   3895 O  OE1   . GLU A 1 505 ? 4.907   39.315 74.843 1.00 26.27  ? 487  GLU A OE1   1 
ATOM   3896 O  OE2   . GLU A 1 505 ? 5.824   38.462 76.670 1.00 30.35  ? 487  GLU A OE2   1 
ATOM   3897 N  N     . SER A 1 506 ? 1.525   44.019 75.840 1.00 41.51  ? 488  SER A N     1 
ATOM   3898 C  CA    . SER A 1 506 ? 1.246   45.206 75.005 1.00 49.74  ? 488  SER A CA    1 
ATOM   3899 C  C     . SER A 1 506 ? 0.779   46.407 75.810 1.00 56.15  ? 488  SER A C     1 
ATOM   3900 O  O     . SER A 1 506 ? 0.746   46.362 77.050 1.00 56.12  ? 488  SER A O     1 
ATOM   3901 C  CB    . SER A 1 506 ? 0.223   44.851 73.926 1.00 51.71  ? 488  SER A CB    1 
ATOM   3902 O  OG    . SER A 1 506 ? 0.588   43.598 73.341 1.00 49.37  ? 488  SER A OG    1 
HETATM 3903 P  PG    . ATP B 2 .   ? -2.752  23.172 64.242 1.00 36.86  ? 1489 ATP A PG    1 
HETATM 3904 O  O1G   . ATP B 2 .   ? -3.737  23.647 65.310 1.00 34.98  ? 1489 ATP A O1G   1 
HETATM 3905 O  O2G   . ATP B 2 .   ? -2.870  23.728 62.810 1.00 37.56  ? 1489 ATP A O2G   1 
HETATM 3906 O  O3G   . ATP B 2 .   ? -1.313  23.187 64.713 1.00 34.50  ? 1489 ATP A O3G   1 
HETATM 3907 P  PB    . ATP B 2 .   ? -2.228  20.454 63.408 1.00 38.12  ? 1489 ATP A PB    1 
HETATM 3908 O  O1B   . ATP B 2 .   ? -0.995  20.374 64.276 1.00 38.47  ? 1489 ATP A O1B   1 
HETATM 3909 O  O2B   . ATP B 2 .   ? -2.047  20.573 61.951 1.00 38.96  ? 1489 ATP A O2B   1 
HETATM 3910 O  O3B   . ATP B 2 .   ? -3.206  21.622 63.936 1.00 35.86  ? 1489 ATP A O3B   1 
HETATM 3911 P  PA    . ATP B 2 .   ? -4.452  18.647 63.495 1.00 45.92  ? 1489 ATP A PA    1 
HETATM 3912 O  O1A   . ATP B 2 .   ? -4.754  17.615 64.597 1.00 47.72  ? 1489 ATP A O1A   1 
HETATM 3913 O  O2A   . ATP B 2 .   ? -5.434  19.799 63.334 1.00 43.93  ? 1489 ATP A O2A   1 
HETATM 3914 O  O3A   . ATP B 2 .   ? -2.936  19.072 63.759 1.00 37.74  ? 1489 ATP A O3A   1 
HETATM 3915 O  "O5'" . ATP B 2 .   ? -4.244  17.894 62.071 1.00 39.67  ? 1489 ATP A "O5'" 1 
HETATM 3916 C  "C5'" . ATP B 2 .   ? -4.482  16.505 61.942 1.00 37.53  ? 1489 ATP A "C5'" 1 
HETATM 3917 C  "C4'" . ATP B 2 .   ? -3.507  15.912 60.971 1.00 35.35  ? 1489 ATP A "C4'" 1 
HETATM 3918 O  "O4'" . ATP B 2 .   ? -3.522  16.640 59.714 1.00 34.42  ? 1489 ATP A "O4'" 1 
HETATM 3919 C  "C3'" . ATP B 2 .   ? -2.085  15.964 61.485 1.00 35.43  ? 1489 ATP A "C3'" 1 
HETATM 3920 O  "O3'" . ATP B 2 .   ? -1.472  14.713 61.185 1.00 37.21  ? 1489 ATP A "O3'" 1 
HETATM 3921 C  "C2'" . ATP B 2 .   ? -1.426  17.074 60.676 1.00 33.07  ? 1489 ATP A "C2'" 1 
HETATM 3922 O  "O2'" . ATP B 2 .   ? -0.039  16.910 60.401 1.00 36.06  ? 1489 ATP A "O2'" 1 
HETATM 3923 C  "C1'" . ATP B 2 .   ? -2.167  16.959 59.384 1.00 27.39  ? 1489 ATP A "C1'" 1 
HETATM 3924 N  N9    . ATP B 2 .   ? -2.169  18.218 58.592 1.00 26.36  ? 1489 ATP A N9    1 
HETATM 3925 C  C8    . ATP B 2 .   ? -2.047  19.487 59.030 1.00 24.91  ? 1489 ATP A C8    1 
HETATM 3926 N  N7    . ATP B 2 .   ? -2.147  20.339 57.990 1.00 24.33  ? 1489 ATP A N7    1 
HETATM 3927 C  C5    . ATP B 2 .   ? -2.360  19.588 56.893 1.00 25.45  ? 1489 ATP A C5    1 
HETATM 3928 C  C6    . ATP B 2 .   ? -2.556  19.862 55.474 1.00 24.14  ? 1489 ATP A C6    1 
HETATM 3929 N  N6    . ATP B 2 .   ? -2.498  21.164 55.114 1.00 23.46  ? 1489 ATP A N6    1 
HETATM 3930 N  N1    . ATP B 2 .   ? -2.723  18.822 54.627 1.00 23.38  ? 1489 ATP A N1    1 
HETATM 3931 C  C2    . ATP B 2 .   ? -2.739  17.542 55.049 1.00 25.18  ? 1489 ATP A C2    1 
HETATM 3932 N  N3    . ATP B 2 .   ? -2.550  17.216 56.343 1.00 22.62  ? 1489 ATP A N3    1 
HETATM 3933 C  C4    . ATP B 2 .   ? -2.378  18.185 57.279 1.00 24.06  ? 1489 ATP A C4    1 
HETATM 3934 P  P     . IMP C 3 .   ? 6.998   18.422 42.794 1.00 27.07  ? 1490 IMP A P     1 
HETATM 3935 O  O1P   . IMP C 3 .   ? 8.075   18.793 41.755 1.00 26.24  ? 1490 IMP A O1P   1 
HETATM 3936 O  O2P   . IMP C 3 .   ? 7.764   17.980 44.032 1.00 20.74  ? 1490 IMP A O2P   1 
HETATM 3937 O  O3P   . IMP C 3 .   ? 6.058   19.556 43.012 1.00 21.64  ? 1490 IMP A O3P   1 
HETATM 3938 O  "O5'" . IMP C 3 .   ? 6.195   17.090 42.337 1.00 28.78  ? 1490 IMP A "O5'" 1 
HETATM 3939 C  "C5'" . IMP C 3 .   ? 5.091   17.058 41.508 1.00 27.93  ? 1490 IMP A "C5'" 1 
HETATM 3940 C  "C4'" . IMP C 3 .   ? 4.851   15.635 41.035 1.00 26.40  ? 1490 IMP A "C4'" 1 
HETATM 3941 O  "O4'" . IMP C 3 .   ? 3.800   15.122 41.838 1.00 26.79  ? 1490 IMP A "O4'" 1 
HETATM 3942 C  "C3'" . IMP C 3 .   ? 4.412   15.545 39.589 1.00 26.75  ? 1490 IMP A "C3'" 1 
HETATM 3943 O  "O3'" . IMP C 3 .   ? 5.033   14.432 38.984 1.00 28.32  ? 1490 IMP A "O3'" 1 
HETATM 3944 C  "C2'" . IMP C 3 .   ? 2.934   15.224 39.707 1.00 26.89  ? 1490 IMP A "C2'" 1 
HETATM 3945 O  "O2'" . IMP C 3 .   ? 2.548   14.395 38.661 1.00 29.79  ? 1490 IMP A "O2'" 1 
HETATM 3946 C  "C1'" . IMP C 3 .   ? 2.804   14.541 41.049 1.00 25.88  ? 1490 IMP A "C1'" 1 
HETATM 3947 N  N9    . IMP C 3 .   ? 1.493   14.761 41.691 1.00 25.36  ? 1490 IMP A N9    1 
HETATM 3948 C  C8    . IMP C 3 .   ? 1.011   15.919 42.229 1.00 28.54  ? 1490 IMP A C8    1 
HETATM 3949 N  N7    . IMP C 3 .   ? -0.219  15.704 42.679 1.00 26.60  ? 1490 IMP A N7    1 
HETATM 3950 C  C5    . IMP C 3 .   ? -0.490  14.392 42.489 1.00 26.00  ? 1490 IMP A C5    1 
HETATM 3951 C  C6    . IMP C 3 .   ? -1.583  13.592 42.757 1.00 26.99  ? 1490 IMP A C6    1 
HETATM 3952 O  O6    . IMP C 3 .   ? -2.569  14.026 43.310 1.00 25.82  ? 1490 IMP A O6    1 
HETATM 3953 N  N1    . IMP C 3 .   ? -1.579  12.267 42.401 1.00 25.41  ? 1490 IMP A N1    1 
HETATM 3954 C  C2    . IMP C 3 .   ? -0.490  11.744 41.780 1.00 26.48  ? 1490 IMP A C2    1 
HETATM 3955 N  N3    . IMP C 3 .   ? 0.595   12.513 41.470 1.00 22.70  ? 1490 IMP A N3    1 
HETATM 3956 C  C4    . IMP C 3 .   ? 0.574   13.815 41.850 1.00 25.19  ? 1490 IMP A C4    1 
HETATM 3957 C  C1    . GOL D 4 .   ? 25.697  16.861 41.123 1.00 47.46  ? 1491 GOL A C1    1 
HETATM 3958 O  O1    . GOL D 4 .   ? 26.895  17.219 41.795 1.00 51.01  ? 1491 GOL A O1    1 
HETATM 3959 C  C2    . GOL D 4 .   ? 25.395  17.908 40.053 1.00 45.35  ? 1491 GOL A C2    1 
HETATM 3960 O  O2    . GOL D 4 .   ? 26.482  18.046 39.150 1.00 43.04  ? 1491 GOL A O2    1 
HETATM 3961 C  C3    . GOL D 4 .   ? 24.120  17.555 39.314 1.00 42.41  ? 1491 GOL A C3    1 
HETATM 3962 O  O3    . GOL D 4 .   ? 24.351  16.457 38.449 1.00 41.67  ? 1491 GOL A O3    1 
HETATM 3963 C  C1    . GOL E 4 .   ? -4.903  9.860  48.743 1.00 48.99  ? 1492 GOL A C1    1 
HETATM 3964 O  O1    . GOL E 4 .   ? -5.091  9.498  47.389 1.00 47.63  ? 1492 GOL A O1    1 
HETATM 3965 C  C2    . GOL E 4 .   ? -5.724  8.999  49.709 1.00 46.86  ? 1492 GOL A C2    1 
HETATM 3966 O  O2    . GOL E 4 .   ? -5.983  7.710  49.184 1.00 48.20  ? 1492 GOL A O2    1 
HETATM 3967 C  C3    . GOL E 4 .   ? -7.026  9.705  50.069 1.00 45.26  ? 1492 GOL A C3    1 
HETATM 3968 O  O3    . GOL E 4 .   ? -7.996  8.803  50.559 1.00 44.14  ? 1492 GOL A O3    1 
HETATM 3969 C  C1    . GOL F 4 .   ? -7.455  32.643 43.614 1.00 43.31  ? 1493 GOL A C1    1 
HETATM 3970 O  O1    . GOL F 4 .   ? -7.408  31.983 44.862 1.00 37.39  ? 1493 GOL A O1    1 
HETATM 3971 C  C2    . GOL F 4 .   ? -8.895  32.861 43.168 1.00 47.31  ? 1493 GOL A C2    1 
HETATM 3972 O  O2    . GOL F 4 .   ? -9.428  34.087 43.607 1.00 49.71  ? 1493 GOL A O2    1 
HETATM 3973 C  C3    . GOL F 4 .   ? -9.788  31.690 43.544 1.00 45.92  ? 1493 GOL A C3    1 
HETATM 3974 O  O3    . GOL F 4 .   ? -9.837  30.986 42.327 1.00 47.35  ? 1493 GOL A O3    1 
HETATM 3975 C  C1    . GOL G 4 .   ? 18.841  19.820 27.800 1.00 48.97  ? 1494 GOL A C1    1 
HETATM 3976 O  O1    . GOL G 4 .   ? 19.866  20.739 27.442 1.00 49.50  ? 1494 GOL A O1    1 
HETATM 3977 C  C2    . GOL G 4 .   ? 19.159  18.858 28.956 1.00 46.54  ? 1494 GOL A C2    1 
HETATM 3978 O  O2    . GOL G 4 .   ? 20.447  19.000 29.533 1.00 42.93  ? 1494 GOL A O2    1 
HETATM 3979 C  C3    . GOL G 4 .   ? 18.897  17.413 28.536 1.00 45.69  ? 1494 GOL A C3    1 
HETATM 3980 O  O3    . GOL G 4 .   ? 19.175  16.527 29.604 1.00 40.13  ? 1494 GOL A O3    1 
HETATM 3981 C  C1    . GOL H 4 .   ? -3.470  16.107 51.261 1.00 42.86  ? 1495 GOL A C1    1 
HETATM 3982 O  O1    . GOL H 4 .   ? -4.284  16.644 52.306 1.00 34.21  ? 1495 GOL A O1    1 
HETATM 3983 C  C2    . GOL H 4 .   ? -2.605  17.142 50.497 1.00 43.90  ? 1495 GOL A C2    1 
HETATM 3984 O  O2    . GOL H 4 .   ? -1.294  16.695 50.489 1.00 45.03  ? 1495 GOL A O2    1 
HETATM 3985 C  C3    . GOL H 4 .   ? -3.018  17.382 49.043 1.00 45.39  ? 1495 GOL A C3    1 
HETATM 3986 O  O3    . GOL H 4 .   ? -4.357  17.784 48.942 1.00 45.24  ? 1495 GOL A O3    1 
HETATM 3987 C  C1    . GOL I 4 .   ? 11.501  6.869  37.846 1.00 43.66  ? 1496 GOL A C1    1 
HETATM 3988 O  O1    . GOL I 4 .   ? 10.836  7.036  39.095 1.00 40.86  ? 1496 GOL A O1    1 
HETATM 3989 C  C2    . GOL I 4 .   ? 12.998  6.630  37.946 1.00 42.08  ? 1496 GOL A C2    1 
HETATM 3990 O  O2    . GOL I 4 .   ? 13.314  5.714  36.921 1.00 47.42  ? 1496 GOL A O2    1 
HETATM 3991 C  C3    . GOL I 4 .   ? 13.864  7.882  37.756 1.00 36.98  ? 1496 GOL A C3    1 
HETATM 3992 O  O3    . GOL I 4 .   ? 13.258  9.046  38.273 1.00 28.55  ? 1496 GOL A O3    1 
HETATM 3993 MG MG    . MG  J 5 .   ? -0.054  21.837 65.254 0.50 28.58  ? 1497 MG  A MG    1 
HETATM 3994 MG MG    . MG  K 5 .   ? 5.498   21.297 43.709 1.00 22.56  ? 1498 MG  A MG    1 
HETATM 3995 O  O     . HOH L 6 .   ? -1.623  14.274 53.731 1.00 54.65  ? 2001 HOH A O     1 
HETATM 3996 O  O     . HOH L 6 .   ? 0.984   13.622 52.439 1.00 45.41  ? 2002 HOH A O     1 
HETATM 3997 O  O     . HOH L 6 .   ? -6.953  33.409 38.151 1.00 41.38  ? 2003 HOH A O     1 
HETATM 3998 O  O     . HOH L 6 .   ? 5.427   37.392 38.803 1.00 33.91  ? 2004 HOH A O     1 
HETATM 3999 O  O     . HOH L 6 .   ? 6.995   41.937 27.110 1.00 58.25  ? 2005 HOH A O     1 
HETATM 4000 O  O     . HOH L 6 .   ? -3.911  33.013 28.518 1.00 43.78  ? 2006 HOH A O     1 
HETATM 4001 O  O     . HOH L 6 .   ? -1.638  31.999 31.277 1.00 33.70  ? 2007 HOH A O     1 
HETATM 4002 O  O     . HOH L 6 .   ? 1.910   40.811 35.307 1.00 41.50  ? 2008 HOH A O     1 
HETATM 4003 O  O     . HOH L 6 .   ? 12.507  47.690 36.251 1.00 43.96  ? 2009 HOH A O     1 
HETATM 4004 O  O     . HOH L 6 .   ? 6.436   35.890 36.614 1.00 32.16  ? 2010 HOH A O     1 
HETATM 4005 O  O     . HOH L 6 .   ? -26.170 0.734  52.242 1.00 50.75  ? 2011 HOH A O     1 
HETATM 4006 O  O     . HOH L 6 .   ? -0.287  41.333 33.781 1.00 43.17  ? 2012 HOH A O     1 
HETATM 4007 O  O     . HOH L 6 .   ? 4.862   41.356 29.496 1.00 59.55  ? 2013 HOH A O     1 
HETATM 4008 O  O     . HOH L 6 .   ? -4.196  3.720  28.991 1.00 57.71  ? 2014 HOH A O     1 
HETATM 4009 O  O     . HOH L 6 .   ? 11.025  35.620 29.302 1.00 36.93  ? 2015 HOH A O     1 
HETATM 4010 O  O     . HOH L 6 .   ? 12.710  37.736 30.038 1.00 54.03  ? 2016 HOH A O     1 
HETATM 4011 O  O     . HOH L 6 .   ? 11.752  44.818 32.108 1.00 56.28  ? 2017 HOH A O     1 
HETATM 4012 O  O     . HOH L 6 .   ? 11.552  42.583 35.138 1.00 42.40  ? 2018 HOH A O     1 
HETATM 4013 O  O     . HOH L 6 .   ? 13.917  45.626 37.577 1.00 48.14  ? 2019 HOH A O     1 
HETATM 4014 O  O     . HOH L 6 .   ? 19.095  48.296 32.341 1.00 49.68  ? 2020 HOH A O     1 
HETATM 4015 O  O     . HOH L 6 .   ? 16.890  51.821 34.630 1.00 44.98  ? 2021 HOH A O     1 
HETATM 4016 O  O     . HOH L 6 .   ? 21.717  44.042 40.526 1.00 51.69  ? 2022 HOH A O     1 
HETATM 4017 O  O     . HOH L 6 .   ? 23.290  50.300 36.866 1.00 43.24  ? 2023 HOH A O     1 
HETATM 4018 O  O     . HOH L 6 .   ? 7.825   30.854 36.191 1.00 45.86  ? 2024 HOH A O     1 
HETATM 4019 O  O     . HOH L 6 .   ? 11.840  49.401 37.978 1.00 42.06  ? 2025 HOH A O     1 
HETATM 4020 O  O     . HOH L 6 .   ? -26.584 2.899  53.533 1.00 54.21  ? 2026 HOH A O     1 
HETATM 4021 O  O     . HOH L 6 .   ? 9.015   41.010 35.546 1.00 38.82  ? 2027 HOH A O     1 
HETATM 4022 O  O     . HOH L 6 .   ? -8.915  6.846  30.658 1.00 30.03  ? 2028 HOH A O     1 
HETATM 4023 O  O     . HOH L 6 .   ? -14.468 4.974  28.048 1.00 46.66  ? 2029 HOH A O     1 
HETATM 4024 O  O     . HOH L 6 .   ? 9.574   46.118 48.491 1.00 43.35  ? 2030 HOH A O     1 
HETATM 4025 O  O     . HOH L 6 .   ? -6.817  3.128  29.722 1.00 48.25  ? 2031 HOH A O     1 
HETATM 4026 O  O     . HOH L 6 .   ? 14.270  48.327 50.615 1.00 60.77  ? 2032 HOH A O     1 
HETATM 4027 O  O     . HOH L 6 .   ? 15.156  22.256 24.174 1.00 53.51  ? 2033 HOH A O     1 
HETATM 4028 O  O     . HOH L 6 .   ? 4.160   45.073 36.752 1.00 52.65  ? 2034 HOH A O     1 
HETATM 4029 O  O     . HOH L 6 .   ? 3.424   38.456 40.351 1.00 47.70  ? 2035 HOH A O     1 
HETATM 4030 O  O     . HOH L 6 .   ? 27.596  24.013 31.206 1.00 47.39  ? 2036 HOH A O     1 
HETATM 4031 O  O     . HOH L 6 .   ? 4.413   38.535 45.531 1.00 22.24  ? 2037 HOH A O     1 
HETATM 4032 O  O     . HOH L 6 .   ? 8.184   42.523 52.286 1.00 35.18  ? 2038 HOH A O     1 
HETATM 4033 O  O     . HOH L 6 .   ? -19.226 6.914  54.753 1.00 42.26  ? 2039 HOH A O     1 
HETATM 4034 O  O     . HOH L 6 .   ? -16.474 9.273  58.811 1.00 33.93  ? 2040 HOH A O     1 
HETATM 4035 O  O     . HOH L 6 .   ? 5.463   40.671 58.689 1.00 47.59  ? 2041 HOH A O     1 
HETATM 4036 O  O     . HOH L 6 .   ? 6.299   41.541 54.406 1.00 21.95  ? 2042 HOH A O     1 
HETATM 4037 O  O     . HOH L 6 .   ? -27.167 19.096 51.985 1.00 52.95  ? 2043 HOH A O     1 
HETATM 4038 O  O     . HOH L 6 .   ? 2.713   37.044 59.649 1.00 29.67  ? 2044 HOH A O     1 
HETATM 4039 O  O     . HOH L 6 .   ? 6.390   36.779 63.222 1.00 45.12  ? 2045 HOH A O     1 
HETATM 4040 O  O     . HOH L 6 .   ? 6.017   33.690 63.514 1.00 36.35  ? 2046 HOH A O     1 
HETATM 4041 O  O     . HOH L 6 .   ? 13.481  34.868 62.390 1.00 37.81  ? 2047 HOH A O     1 
HETATM 4042 O  O     . HOH L 6 .   ? 10.650  37.552 63.060 1.00 29.60  ? 2048 HOH A O     1 
HETATM 4043 O  O     . HOH L 6 .   ? 18.832  33.598 57.781 1.00 39.67  ? 2049 HOH A O     1 
HETATM 4044 O  O     . HOH L 6 .   ? 17.893  34.975 59.991 1.00 34.52  ? 2050 HOH A O     1 
HETATM 4045 O  O     . HOH L 6 .   ? -28.059 27.086 44.543 1.00 55.61  ? 2051 HOH A O     1 
HETATM 4046 O  O     . HOH L 6 .   ? 21.410  39.149 55.328 1.00 31.37  ? 2052 HOH A O     1 
HETATM 4047 O  O     . HOH L 6 .   ? 27.376  26.603 50.483 1.00 48.72  ? 2053 HOH A O     1 
HETATM 4048 O  O     . HOH L 6 .   ? -17.215 16.478 65.716 1.00 45.73  ? 2054 HOH A O     1 
HETATM 4049 O  O     . HOH L 6 .   ? 3.031   17.519 36.600 1.00 28.30  ? 2055 HOH A O     1 
HETATM 4050 O  O     . HOH L 6 .   ? 2.410   18.453 44.608 1.00 20.46  ? 2056 HOH A O     1 
HETATM 4051 O  O     . HOH L 6 .   ? -21.751 20.325 35.958 1.00 33.28  ? 2057 HOH A O     1 
HETATM 4052 O  O     . HOH L 6 .   ? 7.186   30.519 41.015 1.00 28.08  ? 2058 HOH A O     1 
HETATM 4053 O  O     . HOH L 6 .   ? -24.779 17.479 35.759 1.00 44.38  ? 2059 HOH A O     1 
HETATM 4054 O  O     . HOH L 6 .   ? 7.286   28.283 35.168 1.00 25.34  ? 2060 HOH A O     1 
HETATM 4055 O  O     . HOH L 6 .   ? -0.228  30.675 26.510 1.00 49.75  ? 2061 HOH A O     1 
HETATM 4056 O  O     . HOH L 6 .   ? 0.097   32.724 29.540 1.00 40.59  ? 2062 HOH A O     1 
HETATM 4057 O  O     . HOH L 6 .   ? -7.509  30.805 36.418 1.00 39.31  ? 2063 HOH A O     1 
HETATM 4058 O  O     . HOH L 6 .   ? -5.809  32.283 31.205 1.00 45.86  ? 2064 HOH A O     1 
HETATM 4059 O  O     . HOH L 6 .   ? -32.375 9.256  53.547 1.00 51.69  ? 2065 HOH A O     1 
HETATM 4060 O  O     . HOH L 6 .   ? -28.218 5.033  53.626 1.00 52.11  ? 2066 HOH A O     1 
HETATM 4061 O  O     . HOH L 6 .   ? -3.317  30.426 29.603 1.00 34.38  ? 2067 HOH A O     1 
HETATM 4062 O  O     . HOH L 6 .   ? -6.656  22.415 28.188 1.00 34.63  ? 2068 HOH A O     1 
HETATM 4063 O  O     . HOH L 6 .   ? -6.486  31.251 28.607 1.00 34.43  ? 2069 HOH A O     1 
HETATM 4064 O  O     . HOH L 6 .   ? -4.497  27.864 25.224 1.00 50.75  ? 2070 HOH A O     1 
HETATM 4065 O  O     . HOH L 6 .   ? 1.865   17.246 33.519 1.00 21.97  ? 2071 HOH A O     1 
HETATM 4066 O  O     . HOH L 6 .   ? -4.181  19.353 36.743 1.00 27.04  ? 2072 HOH A O     1 
HETATM 4067 O  O     . HOH L 6 .   ? -2.574  25.603 36.473 1.00 21.67  ? 2073 HOH A O     1 
HETATM 4068 O  O     . HOH L 6 .   ? -12.740 20.598 31.028 1.00 30.05  ? 2074 HOH A O     1 
HETATM 4069 O  O     . HOH L 6 .   ? -11.547 25.955 31.577 1.00 42.55  ? 2075 HOH A O     1 
HETATM 4070 O  O     . HOH L 6 .   ? -2.319  4.558  39.599 1.00 38.67  ? 2076 HOH A O     1 
HETATM 4071 O  O     . HOH L 6 .   ? -7.685  15.847 26.909 1.00 55.76  ? 2077 HOH A O     1 
HETATM 4072 O  O     . HOH L 6 .   ? 4.968   8.834  35.271 1.00 55.61  ? 2078 HOH A O     1 
HETATM 4073 O  O     . HOH L 6 .   ? 4.359   9.937  30.393 1.00 40.80  ? 2079 HOH A O     1 
HETATM 4074 O  O     . HOH L 6 .   ? -4.794  7.158  28.683 1.00 39.88  ? 2080 HOH A O     1 
HETATM 4075 O  O     . HOH L 6 .   ? -0.782  19.826 19.687 1.00 68.46  ? 2081 HOH A O     1 
HETATM 4076 O  O     . HOH L 6 .   ? -13.458 7.170  28.957 1.00 37.07  ? 2082 HOH A O     1 
HETATM 4077 O  O     . HOH L 6 .   ? -9.182  13.654 26.526 1.00 61.80  ? 2083 HOH A O     1 
HETATM 4078 O  O     . HOH L 6 .   ? -7.894  9.603  30.988 1.00 25.24  ? 2084 HOH A O     1 
HETATM 4079 O  O     . HOH L 6 .   ? -6.114  -0.094 35.513 1.00 56.91  ? 2085 HOH A O     1 
HETATM 4080 O  O     . HOH L 6 .   ? -6.973  3.207  39.511 1.00 40.49  ? 2086 HOH A O     1 
HETATM 4081 O  O     . HOH L 6 .   ? -8.668  5.001  38.477 1.00 25.63  ? 2087 HOH A O     1 
HETATM 4082 O  O     . HOH L 6 .   ? 26.153  35.783 34.402 1.00 44.66  ? 2088 HOH A O     1 
HETATM 4083 O  O     . HOH L 6 .   ? -8.746  4.273  31.561 1.00 26.25  ? 2089 HOH A O     1 
HETATM 4084 O  O     . HOH L 6 .   ? -15.441 -0.292 37.779 1.00 32.63  ? 2090 HOH A O     1 
HETATM 4085 O  O     . HOH L 6 .   ? -22.333 3.991  36.309 1.00 43.56  ? 2091 HOH A O     1 
HETATM 4086 O  O     . HOH L 6 .   ? -19.583 4.572  31.540 1.00 42.81  ? 2092 HOH A O     1 
HETATM 4087 O  O     . HOH L 6 .   ? 8.174   8.468  43.708 1.00 35.21  ? 2093 HOH A O     1 
HETATM 4088 O  O     . HOH L 6 .   ? 1.500   14.693 47.268 1.00 55.76  ? 2094 HOH A O     1 
HETATM 4089 O  O     . HOH L 6 .   ? -24.001 6.062  31.272 1.00 39.54  ? 2095 HOH A O     1 
HETATM 4090 O  O     . HOH L 6 .   ? 13.508  17.974 25.870 1.00 37.49  ? 2096 HOH A O     1 
HETATM 4091 O  O     . HOH L 6 .   ? 12.230  22.009 25.158 1.00 35.71  ? 2097 HOH A O     1 
HETATM 4092 O  O     . HOH L 6 .   ? 17.555  23.245 25.178 1.00 33.54  ? 2098 HOH A O     1 
HETATM 4093 O  O     . HOH L 6 .   ? 22.381  29.136 21.568 1.00 53.66  ? 2099 HOH A O     1 
HETATM 4094 O  O     . HOH L 6 .   ? -17.527 18.865 28.108 1.00 47.78  ? 2100 HOH A O     1 
HETATM 4095 O  O     . HOH L 6 .   ? -8.576  26.947 38.061 1.00 26.16  ? 2101 HOH A O     1 
HETATM 4096 O  O     . HOH L 6 .   ? -13.549 24.271 30.627 1.00 39.89  ? 2102 HOH A O     1 
HETATM 4097 O  O     . HOH L 6 .   ? -18.135 30.906 34.126 1.00 40.45  ? 2103 HOH A O     1 
HETATM 4098 O  O     . HOH L 6 .   ? 28.874  28.388 29.248 1.00 38.20  ? 2104 HOH A O     1 
HETATM 4099 O  O     . HOH L 6 .   ? -9.156  31.278 34.641 1.00 44.56  ? 2105 HOH A O     1 
HETATM 4100 O  O     . HOH L 6 .   ? -9.542  28.433 40.235 1.00 36.25  ? 2106 HOH A O     1 
HETATM 4101 O  O     . HOH L 6 .   ? -13.160 30.135 33.296 1.00 69.10  ? 2107 HOH A O     1 
HETATM 4102 O  O     . HOH L 6 .   ? -12.604 27.585 33.344 1.00 32.02  ? 2108 HOH A O     1 
HETATM 4103 O  O     . HOH L 6 .   ? -11.302 32.079 37.563 1.00 30.95  ? 2109 HOH A O     1 
HETATM 4104 O  O     . HOH L 6 .   ? -8.929  30.863 38.854 1.00 39.71  ? 2110 HOH A O     1 
HETATM 4105 O  O     . HOH L 6 .   ? 24.448  18.230 31.366 1.00 46.51  ? 2111 HOH A O     1 
HETATM 4106 O  O     . HOH L 6 .   ? 27.579  21.061 31.797 1.00 50.83  ? 2112 HOH A O     1 
HETATM 4107 O  O     . HOH L 6 .   ? 25.944  19.147 35.413 1.00 45.76  ? 2113 HOH A O     1 
HETATM 4108 O  O     . HOH L 6 .   ? -9.507  23.055 47.166 1.00 21.34  ? 2114 HOH A O     1 
HETATM 4109 O  O     . HOH L 6 .   ? -13.583 30.170 44.018 1.00 23.73  ? 2115 HOH A O     1 
HETATM 4110 O  O     . HOH L 6 .   ? 5.435   12.754 56.970 1.00 53.58  ? 2116 HOH A O     1 
HETATM 4111 O  O     . HOH L 6 .   ? 7.322   10.701 57.602 1.00 61.85  ? 2117 HOH A O     1 
HETATM 4112 O  O     . HOH L 6 .   ? -6.487  24.709 53.832 1.00 23.26  ? 2118 HOH A O     1 
HETATM 4113 O  O     . HOH L 6 .   ? -10.332 25.535 54.109 1.00 20.42  ? 2119 HOH A O     1 
HETATM 4114 O  O     . HOH L 6 .   ? -19.741 8.573  52.870 1.00 19.09  ? 2120 HOH A O     1 
HETATM 4115 O  O     . HOH L 6 .   ? -16.199 9.160  55.938 1.00 30.07  ? 2121 HOH A O     1 
HETATM 4116 O  O     . HOH L 6 .   ? 12.771  1.633  34.860 1.00 45.59  ? 2122 HOH A O     1 
HETATM 4117 O  O     . HOH L 6 .   ? -25.025 14.864 52.943 1.00 31.62  ? 2123 HOH A O     1 
HETATM 4118 O  O     . HOH L 6 .   ? -20.017 18.492 47.099 1.00 21.17  ? 2124 HOH A O     1 
HETATM 4119 O  O     . HOH L 6 .   ? -25.092 18.878 52.824 1.00 48.83  ? 2125 HOH A O     1 
HETATM 4120 O  O     . HOH L 6 .   ? 29.800  11.839 50.715 1.00 44.54  ? 2126 HOH A O     1 
HETATM 4121 O  O     . HOH L 6 .   ? -15.298 32.738 51.050 1.00 26.20  ? 2127 HOH A O     1 
HETATM 4122 O  O     . HOH L 6 .   ? 12.037  4.353  43.180 1.00 34.67  ? 2128 HOH A O     1 
HETATM 4123 O  O     . HOH L 6 .   ? -7.982  22.520 65.151 1.00 38.93  ? 2129 HOH A O     1 
HETATM 4124 O  O     . HOH L 6 .   ? -4.142  27.807 65.305 1.00 56.66  ? 2130 HOH A O     1 
HETATM 4125 O  O     . HOH L 6 .   ? -10.945 24.473 67.261 1.00 38.70  ? 2131 HOH A O     1 
HETATM 4126 O  O     . HOH L 6 .   ? -13.488 26.267 67.310 1.00 26.65  ? 2132 HOH A O     1 
HETATM 4127 O  O     . HOH L 6 .   ? -12.377 30.410 66.979 1.00 53.31  ? 2133 HOH A O     1 
HETATM 4128 O  O     . HOH L 6 .   ? 19.032  31.166 61.343 1.00 43.70  ? 2134 HOH A O     1 
HETATM 4129 O  O     . HOH L 6 .   ? -20.692 31.127 54.076 1.00 49.87  ? 2135 HOH A O     1 
HETATM 4130 O  O     . HOH L 6 .   ? -26.376 19.189 45.412 1.00 41.18  ? 2136 HOH A O     1 
HETATM 4131 O  O     . HOH L 6 .   ? -27.441 15.906 51.765 1.00 48.92  ? 2137 HOH A O     1 
HETATM 4132 O  O     . HOH L 6 .   ? -19.290 21.076 46.902 1.00 20.73  ? 2138 HOH A O     1 
HETATM 4133 O  O     . HOH L 6 .   ? -27.896 19.943 47.806 1.00 50.56  ? 2139 HOH A O     1 
HETATM 4134 O  O     . HOH L 6 .   ? -26.322 28.212 46.280 1.00 31.81  ? 2140 HOH A O     1 
HETATM 4135 O  O     . HOH L 6 .   ? -22.018 28.157 52.802 1.00 35.46  ? 2141 HOH A O     1 
HETATM 4136 O  O     . HOH L 6 .   ? -29.259 26.582 53.444 1.00 43.17  ? 2142 HOH A O     1 
HETATM 4137 O  O     . HOH L 6 .   ? -28.830 18.593 56.703 1.00 48.79  ? 2143 HOH A O     1 
HETATM 4138 O  O     . HOH L 6 .   ? -20.285 16.675 61.715 1.00 28.06  ? 2144 HOH A O     1 
HETATM 4139 O  O     . HOH L 6 .   ? -24.713 20.797 55.842 1.00 38.33  ? 2145 HOH A O     1 
HETATM 4140 O  O     . HOH L 6 .   ? -22.067 26.145 68.307 1.00 36.36  ? 2146 HOH A O     1 
HETATM 4141 O  O     . HOH L 6 .   ? -17.972 17.960 62.200 1.00 30.27  ? 2147 HOH A O     1 
HETATM 4142 O  O     . HOH L 6 .   ? -19.931 20.423 64.457 1.00 22.68  ? 2148 HOH A O     1 
HETATM 4143 O  O     . HOH L 6 .   ? -10.495 20.690 64.739 1.00 27.08  ? 2149 HOH A O     1 
HETATM 4144 O  O     . HOH L 6 .   ? -12.658 11.737 65.774 1.00 53.61  ? 2150 HOH A O     1 
HETATM 4145 O  O     . HOH L 6 .   ? -15.744 16.546 63.014 1.00 25.12  ? 2151 HOH A O     1 
HETATM 4146 O  O     . HOH L 6 .   ? -14.983 13.933 63.222 1.00 27.72  ? 2152 HOH A O     1 
HETATM 4147 O  O     . HOH L 6 .   ? -7.897  17.405 58.732 1.00 47.43  ? 2153 HOH A O     1 
HETATM 4148 O  O     . HOH L 6 .   ? -5.419  19.206 59.561 1.00 30.92  ? 2154 HOH A O     1 
HETATM 4149 O  O     . HOH L 6 .   ? -10.335 11.745 64.970 1.00 50.40  ? 2155 HOH A O     1 
HETATM 4150 O  O     . HOH L 6 .   ? -4.785  12.959 63.111 1.00 43.38  ? 2156 HOH A O     1 
HETATM 4151 O  O     . HOH L 6 .   ? -13.590 8.842  60.363 1.00 42.07  ? 2157 HOH A O     1 
HETATM 4152 O  O     . HOH L 6 .   ? -9.609  9.531  61.197 1.00 38.63  ? 2158 HOH A O     1 
HETATM 4153 O  O     . HOH L 6 .   ? -16.977 10.937 61.885 1.00 47.79  ? 2159 HOH A O     1 
HETATM 4154 O  O     . HOH L 6 .   ? -6.025  9.313  57.652 1.00 45.92  ? 2160 HOH A O     1 
HETATM 4155 O  O     . HOH L 6 .   ? -9.642  11.501 53.689 1.00 41.49  ? 2161 HOH A O     1 
HETATM 4156 O  O     . HOH L 6 .   ? -20.591 14.046 62.911 1.00 53.10  ? 2162 HOH A O     1 
HETATM 4157 O  O     . HOH L 6 .   ? -7.620  15.797 57.240 1.00 45.18  ? 2163 HOH A O     1 
HETATM 4158 O  O     . HOH L 6 .   ? -6.781  13.490 55.141 1.00 47.78  ? 2164 HOH A O     1 
HETATM 4159 O  O     . HOH L 6 .   ? -3.161  12.401 49.394 1.00 42.28  ? 2165 HOH A O     1 
HETATM 4160 O  O     . HOH L 6 .   ? 0.856   33.031 62.924 1.00 49.34  ? 2166 HOH A O     1 
HETATM 4161 O  O     . HOH L 6 .   ? -0.041  24.106 48.942 1.00 24.47  ? 2167 HOH A O     1 
HETATM 4162 O  O     . HOH L 6 .   ? -3.900  24.110 53.836 1.00 25.53  ? 2168 HOH A O     1 
HETATM 4163 O  O     . HOH L 6 .   ? -6.868  22.698 45.409 1.00 39.16  ? 2169 HOH A O     1 
HETATM 4164 O  O     . HOH L 6 .   ? -0.479  17.709 44.796 1.00 23.23  ? 2170 HOH A O     1 
HETATM 4165 O  O     . HOH L 6 .   ? -3.692  21.717 38.250 1.00 21.62  ? 2171 HOH A O     1 
HETATM 4166 O  O     . HOH L 6 .   ? -7.239  17.092 41.028 1.00 21.50  ? 2172 HOH A O     1 
HETATM 4167 O  O     . HOH L 6 .   ? -4.045  17.256 38.666 1.00 25.66  ? 2173 HOH A O     1 
HETATM 4168 O  O     . HOH L 6 .   ? 19.122  46.780 51.089 1.00 52.84  ? 2174 HOH A O     1 
HETATM 4169 O  O     . HOH L 6 .   ? -19.841 25.269 37.270 1.00 25.95  ? 2175 HOH A O     1 
HETATM 4170 O  O     . HOH L 6 .   ? -19.473 21.263 34.614 1.00 28.74  ? 2176 HOH A O     1 
HETATM 4171 O  O     . HOH L 6 .   ? -22.858 18.421 37.703 1.00 25.18  ? 2177 HOH A O     1 
HETATM 4172 O  O     . HOH L 6 .   ? -25.539 21.739 37.393 1.00 44.38  ? 2178 HOH A O     1 
HETATM 4173 O  O     . HOH L 6 .   ? -25.816 20.968 43.368 1.00 26.87  ? 2179 HOH A O     1 
HETATM 4174 O  O     . HOH L 6 .   ? -27.135 18.008 37.501 1.00 43.80  ? 2180 HOH A O     1 
HETATM 4175 O  O     . HOH L 6 .   ? -27.438 21.775 39.283 1.00 50.08  ? 2181 HOH A O     1 
HETATM 4176 O  O     . HOH L 6 .   ? -28.083 15.484 37.364 1.00 31.23  ? 2182 HOH A O     1 
HETATM 4177 O  O     . HOH L 6 .   ? -27.303 14.913 47.748 1.00 34.05  ? 2183 HOH A O     1 
HETATM 4178 O  O     . HOH L 6 .   ? -32.027 14.167 45.342 1.00 44.66  ? 2184 HOH A O     1 
HETATM 4179 O  O     . HOH L 6 .   ? -33.360 17.450 41.289 1.00 54.04  ? 2185 HOH A O     1 
HETATM 4180 O  O     . HOH L 6 .   ? -28.359 4.430  36.906 1.00 52.01  ? 2186 HOH A O     1 
HETATM 4181 O  O     . HOH L 6 .   ? -30.445 11.508 43.624 1.00 46.30  ? 2187 HOH A O     1 
HETATM 4182 O  O     . HOH L 6 .   ? -34.713 10.378 42.450 1.00 60.60  ? 2188 HOH A O     1 
HETATM 4183 O  O     . HOH L 6 .   ? -33.338 11.470 46.035 1.00 43.76  ? 2189 HOH A O     1 
HETATM 4184 O  O     . HOH L 6 .   ? -30.202 8.845  54.616 1.00 36.43  ? 2190 HOH A O     1 
HETATM 4185 O  O     . HOH L 6 .   ? -27.086 7.618  57.148 1.00 53.55  ? 2191 HOH A O     1 
HETATM 4186 O  O     . HOH L 6 .   ? -24.448 9.719  59.403 1.00 57.26  ? 2192 HOH A O     1 
HETATM 4187 O  O     . HOH L 6 .   ? -22.398 5.280  54.720 1.00 38.65  ? 2193 HOH A O     1 
HETATM 4188 O  O     . HOH L 6 .   ? -26.731 7.263  54.279 1.00 35.49  ? 2194 HOH A O     1 
HETATM 4189 O  O     . HOH L 6 .   ? -29.147 -2.411 40.994 1.00 53.20  ? 2195 HOH A O     1 
HETATM 4190 O  O     . HOH L 6 .   ? -20.327 2.700  48.770 1.00 24.59  ? 2196 HOH A O     1 
HETATM 4191 O  O     . HOH L 6 .   ? -17.865 3.991  52.131 1.00 40.05  ? 2197 HOH A O     1 
HETATM 4192 O  O     . HOH L 6 .   ? -26.999 12.434 48.837 1.00 44.55  ? 2198 HOH A O     1 
HETATM 4193 O  O     . HOH L 6 .   ? -13.888 3.402  46.061 1.00 42.89  ? 2199 HOH A O     1 
HETATM 4194 O  O     . HOH L 6 .   ? -15.511 2.227  42.045 1.00 46.42  ? 2200 HOH A O     1 
HETATM 4195 O  O     . HOH L 6 .   ? -10.772 5.597  39.910 1.00 24.79  ? 2201 HOH A O     1 
HETATM 4196 O  O     . HOH L 6 .   ? -11.351 3.561  41.693 1.00 31.68  ? 2202 HOH A O     1 
HETATM 4197 O  O     . HOH L 6 .   ? -4.827  5.012  40.931 1.00 28.47  ? 2203 HOH A O     1 
HETATM 4198 O  O     . HOH L 6 .   ? -3.859  0.976  33.941 1.00 47.21  ? 2204 HOH A O     1 
HETATM 4199 O  O     . HOH L 6 .   ? 0.734   11.184 33.106 1.00 25.14  ? 2205 HOH A O     1 
HETATM 4200 O  O     . HOH L 6 .   ? 2.927   9.311  33.577 1.00 31.09  ? 2206 HOH A O     1 
HETATM 4201 O  O     . HOH L 6 .   ? 3.981   11.758 43.355 1.00 35.20  ? 2207 HOH A O     1 
HETATM 4202 O  O     . HOH L 6 .   ? 4.424   6.802  41.425 1.00 69.65  ? 2208 HOH A O     1 
HETATM 4203 O  O     . HOH L 6 .   ? 0.922   8.729  28.066 1.00 47.37  ? 2209 HOH A O     1 
HETATM 4204 O  O     . HOH L 6 .   ? -0.722  6.774  28.607 1.00 54.59  ? 2210 HOH A O     1 
HETATM 4205 O  O     . HOH L 6 .   ? 1.630   10.591 30.216 1.00 26.40  ? 2211 HOH A O     1 
HETATM 4206 O  O     . HOH L 6 .   ? 1.683   7.451  32.176 1.00 40.75  ? 2212 HOH A O     1 
HETATM 4207 O  O     . HOH L 6 .   ? -5.235  9.457  30.243 1.00 32.99  ? 2213 HOH A O     1 
HETATM 4208 O  O     . HOH L 6 .   ? 1.860   15.152 35.802 1.00 38.97  ? 2214 HOH A O     1 
HETATM 4209 O  O     . HOH L 6 .   ? 4.603   13.757 24.402 1.00 46.01  ? 2215 HOH A O     1 
HETATM 4210 O  O     . HOH L 6 .   ? -1.017  12.277 23.414 1.00 63.62  ? 2216 HOH A O     1 
HETATM 4211 O  O     . HOH L 6 .   ? -4.353  15.729 22.240 1.00 49.74  ? 2217 HOH A O     1 
HETATM 4212 O  O     . HOH L 6 .   ? -5.487  16.772 25.024 1.00 50.23  ? 2218 HOH A O     1 
HETATM 4213 O  O     . HOH L 6 .   ? -1.323  18.322 24.321 1.00 36.57  ? 2219 HOH A O     1 
HETATM 4214 O  O     . HOH L 6 .   ? 2.959   12.580 22.533 1.00 55.61  ? 2220 HOH A O     1 
HETATM 4215 O  O     . HOH L 6 .   ? -1.809  20.474 22.464 1.00 53.81  ? 2221 HOH A O     1 
HETATM 4216 O  O     . HOH L 6 .   ? 1.146   26.661 22.043 1.00 48.27  ? 2222 HOH A O     1 
HETATM 4217 O  O     . HOH L 6 .   ? 5.990   21.182 23.475 1.00 41.04  ? 2223 HOH A O     1 
HETATM 4218 O  O     . HOH L 6 .   ? -4.920  24.388 21.682 1.00 54.01  ? 2224 HOH A O     1 
HETATM 4219 O  O     . HOH L 6 .   ? -2.149  28.587 27.382 1.00 29.17  ? 2225 HOH A O     1 
HETATM 4220 O  O     . HOH L 6 .   ? -3.757  18.757 25.238 1.00 40.53  ? 2226 HOH A O     1 
HETATM 4221 O  O     . HOH L 6 .   ? 9.299   34.035 28.286 1.00 57.75  ? 2227 HOH A O     1 
HETATM 4222 O  O     . HOH L 6 .   ? 9.626   27.909 24.106 1.00 46.53  ? 2228 HOH A O     1 
HETATM 4223 O  O     . HOH L 6 .   ? 9.676   32.652 36.864 1.00 51.93  ? 2229 HOH A O     1 
HETATM 4224 O  O     . HOH L 6 .   ? 8.776   37.137 35.903 1.00 36.50  ? 2230 HOH A O     1 
HETATM 4225 O  O     . HOH L 6 .   ? 24.633  35.836 36.638 1.00 46.03  ? 2231 HOH A O     1 
HETATM 4226 O  O     . HOH L 6 .   ? 24.365  38.513 37.482 1.00 46.49  ? 2232 HOH A O     1 
HETATM 4227 O  O     . HOH L 6 .   ? 28.909  20.108 48.399 1.00 50.22  ? 2233 HOH A O     1 
HETATM 4228 O  O     . HOH L 6 .   ? 30.228  20.219 51.322 1.00 54.55  ? 2234 HOH A O     1 
HETATM 4229 O  O     . HOH L 6 .   ? 3.371   13.866 44.717 1.00 33.83  ? 2235 HOH A O     1 
HETATM 4230 O  O     . HOH L 6 .   ? 8.077   11.109 44.707 1.00 20.29  ? 2236 HOH A O     1 
HETATM 4231 O  O     . HOH L 6 .   ? 5.402   10.793 45.616 1.00 30.78  ? 2237 HOH A O     1 
HETATM 4232 O  O     . HOH L 6 .   ? 6.142   10.476 38.752 1.00 57.14  ? 2238 HOH A O     1 
HETATM 4233 O  O     . HOH L 6 .   ? 7.686   10.493 32.637 1.00 41.07  ? 2239 HOH A O     1 
HETATM 4234 O  O     . HOH L 6 .   ? 19.620  13.685 30.720 1.00 33.38  ? 2240 HOH A O     1 
HETATM 4235 O  O     . HOH L 6 .   ? 13.251  12.777 29.259 1.00 31.05  ? 2241 HOH A O     1 
HETATM 4236 O  O     . HOH L 6 .   ? 15.610  11.958 30.183 1.00 34.96  ? 2242 HOH A O     1 
HETATM 4237 O  O     . HOH L 6 .   ? 17.012  15.315 27.137 1.00 57.16  ? 2243 HOH A O     1 
HETATM 4238 O  O     . HOH L 6 .   ? 11.852  10.661 28.011 1.00 56.65  ? 2244 HOH A O     1 
HETATM 4239 O  O     . HOH L 6 .   ? 7.934   12.191 30.596 1.00 42.98  ? 2245 HOH A O     1 
HETATM 4240 O  O     . HOH L 6 .   ? 11.600  19.609 26.636 1.00 24.55  ? 2246 HOH A O     1 
HETATM 4241 O  O     . HOH L 6 .   ? 17.383  24.011 27.657 1.00 20.73  ? 2247 HOH A O     1 
HETATM 4242 O  O     . HOH L 6 .   ? 15.653  17.219 27.128 1.00 47.83  ? 2248 HOH A O     1 
HETATM 4243 O  O     . HOH L 6 .   ? 6.301   29.567 26.328 1.00 48.04  ? 2249 HOH A O     1 
HETATM 4244 O  O     . HOH L 6 .   ? 11.841  29.489 32.681 1.00 30.21  ? 2250 HOH A O     1 
HETATM 4245 O  O     . HOH L 6 .   ? 18.899  29.042 29.582 1.00 26.54  ? 2251 HOH A O     1 
HETATM 4246 O  O     . HOH L 6 .   ? 18.265  26.061 23.601 1.00 47.19  ? 2252 HOH A O     1 
HETATM 4247 O  O     . HOH L 6 .   ? 13.024  30.769 23.827 1.00 50.83  ? 2253 HOH A O     1 
HETATM 4248 O  O     . HOH L 6 .   ? 15.660  28.878 22.245 1.00 40.71  ? 2254 HOH A O     1 
HETATM 4249 O  O     . HOH L 6 .   ? 20.010  27.609 22.736 1.00 45.83  ? 2255 HOH A O     1 
HETATM 4250 O  O     . HOH L 6 .   ? 21.368  34.382 20.672 1.00 47.96  ? 2256 HOH A O     1 
HETATM 4251 O  O     . HOH L 6 .   ? 18.159  36.449 31.741 1.00 44.32  ? 2257 HOH A O     1 
HETATM 4252 O  O     . HOH L 6 .   ? 28.604  37.913 33.272 1.00 54.72  ? 2258 HOH A O     1 
HETATM 4253 O  O     . HOH L 6 .   ? 22.838  40.735 28.785 1.00 27.96  ? 2259 HOH A O     1 
HETATM 4254 O  O     . HOH L 6 .   ? 21.501  36.058 23.111 1.00 36.50  ? 2260 HOH A O     1 
HETATM 4255 O  O     . HOH L 6 .   ? 25.338  35.136 31.693 1.00 41.78  ? 2261 HOH A O     1 
HETATM 4256 O  O     . HOH L 6 .   ? 27.599  29.259 22.726 1.00 32.05  ? 2262 HOH A O     1 
HETATM 4257 O  O     . HOH L 6 .   ? 30.838  29.204 25.635 1.00 27.85  ? 2263 HOH A O     1 
HETATM 4258 O  O     . HOH L 6 .   ? 26.944  30.693 29.708 1.00 29.60  ? 2264 HOH A O     1 
HETATM 4259 O  O     . HOH L 6 .   ? 25.672  26.706 24.176 1.00 42.10  ? 2265 HOH A O     1 
HETATM 4260 O  O     . HOH L 6 .   ? 24.721  28.983 23.192 1.00 33.34  ? 2266 HOH A O     1 
HETATM 4261 O  O     . HOH L 6 .   ? 23.525  23.836 25.723 1.00 38.80  ? 2267 HOH A O     1 
HETATM 4262 O  O     . HOH L 6 .   ? 27.740  26.411 27.812 1.00 40.06  ? 2268 HOH A O     1 
HETATM 4263 O  O     . HOH L 6 .   ? 27.060  31.116 33.607 1.00 40.45  ? 2269 HOH A O     1 
HETATM 4264 O  O     . HOH L 6 .   ? 24.686  28.530 37.519 1.00 32.43  ? 2270 HOH A O     1 
HETATM 4265 O  O     . HOH L 6 .   ? 25.257  19.943 32.809 1.00 41.53  ? 2271 HOH A O     1 
HETATM 4266 O  O     . HOH L 6 .   ? 21.100  28.015 30.139 1.00 20.56  ? 2272 HOH A O     1 
HETATM 4267 O  O     . HOH L 6 .   ? 22.692  27.927 39.203 1.00 30.92  ? 2273 HOH A O     1 
HETATM 4268 O  O     . HOH L 6 .   ? 25.860  20.541 37.787 1.00 45.87  ? 2274 HOH A O     1 
HETATM 4269 O  O     . HOH L 6 .   ? 27.275  21.942 39.386 1.00 56.01  ? 2275 HOH A O     1 
HETATM 4270 O  O     . HOH L 6 .   ? 27.447  26.296 44.051 1.00 42.00  ? 2276 HOH A O     1 
HETATM 4271 O  O     . HOH L 6 .   ? 28.649  21.413 45.500 1.00 47.92  ? 2277 HOH A O     1 
HETATM 4272 O  O     . HOH L 6 .   ? 11.473  7.244  45.806 1.00 27.66  ? 2278 HOH A O     1 
HETATM 4273 O  O     . HOH L 6 .   ? 8.336   9.899  41.045 1.00 26.72  ? 2279 HOH A O     1 
HETATM 4274 O  O     . HOH L 6 .   ? 4.951   10.969 48.285 1.00 42.31  ? 2280 HOH A O     1 
HETATM 4275 O  O     . HOH L 6 .   ? 5.305   17.766 48.253 1.00 38.98  ? 2281 HOH A O     1 
HETATM 4276 O  O     . HOH L 6 .   ? 3.835   16.205 49.104 1.00 28.31  ? 2282 HOH A O     1 
HETATM 4277 O  O     . HOH L 6 .   ? 5.487   17.926 45.965 1.00 37.77  ? 2283 HOH A O     1 
HETATM 4278 O  O     . HOH L 6 .   ? 7.777   13.614 57.441 1.00 46.03  ? 2284 HOH A O     1 
HETATM 4279 O  O     . HOH L 6 .   ? 5.009   10.885 51.546 1.00 32.50  ? 2285 HOH A O     1 
HETATM 4280 O  O     . HOH L 6 .   ? 9.173   9.014  58.522 1.00 31.62  ? 2286 HOH A O     1 
HETATM 4281 O  O     . HOH L 6 .   ? 15.328  4.835  54.479 1.00 58.13  ? 2287 HOH A O     1 
HETATM 4282 O  O     . HOH L 6 .   ? 16.408  7.238  56.627 1.00 50.57  ? 2288 HOH A O     1 
HETATM 4283 O  O     . HOH L 6 .   ? 10.739  4.703  54.123 1.00 42.60  ? 2289 HOH A O     1 
HETATM 4284 O  O     . HOH L 6 .   ? 16.656  7.469  53.568 1.00 43.92  ? 2290 HOH A O     1 
HETATM 4285 O  O     . HOH L 6 .   ? 13.248  2.649  50.496 1.00 31.73  ? 2291 HOH A O     1 
HETATM 4286 O  O     . HOH L 6 .   ? 14.270  4.931  46.892 1.00 24.78  ? 2292 HOH A O     1 
HETATM 4287 O  O     . HOH L 6 .   ? 19.897  5.167  51.610 1.00 27.11  ? 2293 HOH A O     1 
HETATM 4288 O  O     . HOH L 6 .   ? 14.201  2.471  46.080 1.00 30.82  ? 2294 HOH A O     1 
HETATM 4289 O  O     . HOH L 6 .   ? 14.655  -0.513 40.240 1.00 33.11  ? 2295 HOH A O     1 
HETATM 4290 O  O     . HOH L 6 .   ? 27.575  4.356  40.458 1.00 45.83  ? 2296 HOH A O     1 
HETATM 4291 O  O     . HOH L 6 .   ? 23.444  9.687  37.912 1.00 23.39  ? 2297 HOH A O     1 
HETATM 4292 O  O     . HOH L 6 .   ? 24.207  7.925  34.572 1.00 43.54  ? 2298 HOH A O     1 
HETATM 4293 O  O     . HOH L 6 .   ? 16.578  9.834  30.892 1.00 38.03  ? 2299 HOH A O     1 
HETATM 4294 O  O     . HOH L 6 .   ? 19.614  1.869  32.900 1.00 41.98  ? 2300 HOH A O     1 
HETATM 4295 O  O     . HOH L 6 .   ? 12.635  8.525  34.721 1.00 33.67  ? 2301 HOH A O     1 
HETATM 4296 O  O     . HOH L 6 .   ? 19.324  0.699  35.386 1.00 38.62  ? 2302 HOH A O     1 
HETATM 4297 O  O     . HOH L 6 .   ? 14.028  2.231  37.087 1.00 38.60  ? 2303 HOH A O     1 
HETATM 4298 O  O     . HOH L 6 .   ? 22.779  -1.101 37.863 1.00 35.09  ? 2304 HOH A O     1 
HETATM 4299 O  O     . HOH L 6 .   ? 17.816  -1.597 44.034 1.00 34.30  ? 2305 HOH A O     1 
HETATM 4300 O  O     . HOH L 6 .   ? 20.655  3.113  42.484 1.00 24.04  ? 2306 HOH A O     1 
HETATM 4301 O  O     . HOH L 6 .   ? 18.327  -0.977 48.128 1.00 39.60  ? 2307 HOH A O     1 
HETATM 4302 O  O     . HOH L 6 .   ? 19.518  0.142  51.424 1.00 43.47  ? 2308 HOH A O     1 
HETATM 4303 O  O     . HOH L 6 .   ? 22.980  5.334  50.708 1.00 39.80  ? 2309 HOH A O     1 
HETATM 4304 O  O     . HOH L 6 .   ? 28.639  -0.025 47.678 1.00 39.34  ? 2310 HOH A O     1 
HETATM 4305 O  O     . HOH L 6 .   ? 30.558  3.315  47.836 1.00 48.08  ? 2311 HOH A O     1 
HETATM 4306 O  O     . HOH L 6 .   ? 30.043  13.778 48.864 1.00 38.86  ? 2312 HOH A O     1 
HETATM 4307 O  O     . HOH L 6 .   ? 29.692  6.158  41.206 1.00 60.04  ? 2313 HOH A O     1 
HETATM 4308 O  O     . HOH L 6 .   ? 23.020  15.540 41.996 1.00 31.14  ? 2314 HOH A O     1 
HETATM 4309 O  O     . HOH L 6 .   ? 13.749  6.066  44.382 1.00 22.17  ? 2315 HOH A O     1 
HETATM 4310 O  O     . HOH L 6 .   ? 12.464  9.553  49.712 1.00 24.14  ? 2316 HOH A O     1 
HETATM 4311 O  O     . HOH L 6 .   ? 18.739  9.210  53.738 1.00 40.06  ? 2317 HOH A O     1 
HETATM 4312 O  O     . HOH L 6 .   ? 15.213  13.265 56.717 1.00 29.87  ? 2318 HOH A O     1 
HETATM 4313 O  O     . HOH L 6 .   ? 17.537  16.855 57.044 1.00 32.55  ? 2319 HOH A O     1 
HETATM 4314 O  O     . HOH L 6 .   ? 16.005  13.254 59.502 1.00 52.91  ? 2320 HOH A O     1 
HETATM 4315 O  O     . HOH L 6 .   ? 20.962  9.933  52.172 1.00 49.72  ? 2321 HOH A O     1 
HETATM 4316 O  O     . HOH L 6 .   ? 21.940  15.877 58.461 1.00 59.16  ? 2322 HOH A O     1 
HETATM 4317 O  O     . HOH L 6 .   ? 29.744  15.972 49.591 1.00 39.05  ? 2323 HOH A O     1 
HETATM 4318 O  O     . HOH L 6 .   ? 26.538  24.591 52.463 1.00 56.70  ? 2324 HOH A O     1 
HETATM 4319 O  O     . HOH L 6 .   ? 25.365  18.993 57.562 1.00 53.09  ? 2325 HOH A O     1 
HETATM 4320 O  O     . HOH L 6 .   ? 20.121  20.367 60.166 1.00 38.23  ? 2326 HOH A O     1 
HETATM 4321 O  O     . HOH L 6 .   ? 18.591  31.076 58.692 1.00 29.34  ? 2327 HOH A O     1 
HETATM 4322 O  O     . HOH L 6 .   ? 24.401  26.825 60.613 1.00 51.20  ? 2328 HOH A O     1 
HETATM 4323 O  O     . HOH L 6 .   ? 26.637  24.228 57.812 1.00 67.42  ? 2329 HOH A O     1 
HETATM 4324 O  O     . HOH L 6 .   ? 0.309   24.228 44.676 1.00 25.78  ? 2330 HOH A O     1 
HETATM 4325 O  O     . HOH L 6 .   ? 3.428   20.802 43.571 1.00 20.24  ? 2331 HOH A O     1 
HETATM 4326 O  O     . HOH L 6 .   ? 5.697   20.507 45.690 1.00 20.21  ? 2332 HOH A O     1 
HETATM 4327 O  O     . HOH L 6 .   ? 4.245   17.803 61.429 1.00 53.18  ? 2333 HOH A O     1 
HETATM 4328 O  O     . HOH L 6 .   ? 6.134   13.287 59.276 1.00 46.12  ? 2334 HOH A O     1 
HETATM 4329 O  O     . HOH L 6 .   ? 10.612  29.573 62.023 1.00 38.15  ? 2335 HOH A O     1 
HETATM 4330 O  O     . HOH L 6 .   ? 9.316   17.704 64.466 1.00 35.95  ? 2336 HOH A O     1 
HETATM 4331 O  O     . HOH L 6 .   ? 14.391  12.380 61.156 1.00 39.44  ? 2337 HOH A O     1 
HETATM 4332 O  O     . HOH L 6 .   ? 17.910  20.227 61.470 1.00 39.79  ? 2338 HOH A O     1 
HETATM 4333 O  O     . HOH L 6 .   ? 14.227  27.299 60.867 1.00 24.10  ? 2339 HOH A O     1 
HETATM 4334 O  O     . HOH L 6 .   ? 18.155  19.317 58.303 1.00 39.98  ? 2340 HOH A O     1 
HETATM 4335 O  O     . HOH L 6 .   ? 14.707  29.639 62.019 1.00 35.22  ? 2341 HOH A O     1 
HETATM 4336 O  O     . HOH L 6 .   ? 12.046  31.445 61.050 1.00 41.35  ? 2342 HOH A O     1 
HETATM 4337 O  O     . HOH L 6 .   ? 1.288   27.476 47.370 1.00 22.24  ? 2343 HOH A O     1 
HETATM 4338 O  O     . HOH L 6 .   ? -7.076  29.258 44.903 1.00 20.10  ? 2344 HOH A O     1 
HETATM 4339 O  O     . HOH L 6 .   ? -9.027  44.417 50.077 1.00 45.77  ? 2345 HOH A O     1 
HETATM 4340 O  O     . HOH L 6 .   ? -10.473 43.222 40.926 1.00 56.63  ? 2346 HOH A O     1 
HETATM 4341 O  O     . HOH L 6 .   ? -16.838 38.825 57.795 1.00 39.52  ? 2347 HOH A O     1 
HETATM 4342 O  O     . HOH L 6 .   ? -19.139 40.667 44.288 1.00 43.76  ? 2348 HOH A O     1 
HETATM 4343 O  O     . HOH L 6 .   ? -13.019 35.843 50.374 1.00 35.48  ? 2349 HOH A O     1 
HETATM 4344 O  O     . HOH L 6 .   ? -19.261 34.416 51.704 1.00 53.83  ? 2350 HOH A O     1 
HETATM 4345 O  O     . HOH L 6 .   ? -16.082 36.806 40.285 1.00 48.01  ? 2351 HOH A O     1 
HETATM 4346 O  O     . HOH L 6 .   ? -18.498 39.477 42.093 1.00 58.05  ? 2352 HOH A O     1 
HETATM 4347 O  O     . HOH L 6 .   ? -10.909 36.866 40.884 1.00 51.64  ? 2353 HOH A O     1 
HETATM 4348 O  O     . HOH L 6 .   ? -12.538 32.982 39.962 1.00 30.99  ? 2354 HOH A O     1 
HETATM 4349 O  O     . HOH L 6 .   ? -10.767 41.986 49.137 1.00 53.55  ? 2355 HOH A O     1 
HETATM 4350 O  O     . HOH L 6 .   ? -17.468 31.697 49.346 1.00 32.79  ? 2356 HOH A O     1 
HETATM 4351 O  O     . HOH L 6 .   ? -20.738 31.195 46.853 1.00 44.71  ? 2357 HOH A O     1 
HETATM 4352 O  O     . HOH L 6 .   ? -8.397  38.026 50.427 1.00 44.14  ? 2358 HOH A O     1 
HETATM 4353 O  O     . HOH L 6 .   ? -8.339  28.335 51.482 1.00 21.17  ? 2359 HOH A O     1 
HETATM 4354 O  O     . HOH L 6 .   ? -17.730 29.593 61.921 1.00 36.79  ? 2360 HOH A O     1 
HETATM 4355 O  O     . HOH L 6 .   ? -9.621  34.795 61.649 1.00 33.94  ? 2361 HOH A O     1 
HETATM 4356 O  O     . HOH L 6 .   ? -5.779  36.201 55.587 1.00 23.03  ? 2362 HOH A O     1 
HETATM 4357 O  O     . HOH L 6 .   ? -8.000  26.948 53.923 1.00 16.94  ? 2363 HOH A O     1 
HETATM 4358 O  O     . HOH L 6 .   ? -7.560  30.533 60.655 1.00 24.71  ? 2364 HOH A O     1 
HETATM 4359 O  O     . HOH L 6 .   ? -1.051  31.342 61.808 1.00 39.57  ? 2365 HOH A O     1 
HETATM 4360 O  O     . HOH L 6 .   ? -3.793  33.098 61.628 1.00 46.59  ? 2366 HOH A O     1 
HETATM 4361 O  O     . HOH L 6 .   ? -5.966  31.645 62.704 1.00 48.92  ? 2367 HOH A O     1 
HETATM 4362 O  O     . HOH L 6 .   ? 4.463   31.436 40.592 1.00 28.14  ? 2368 HOH A O     1 
HETATM 4363 O  O     . HOH L 6 .   ? 6.144   31.979 37.661 1.00 47.75  ? 2369 HOH A O     1 
HETATM 4364 O  O     . HOH L 6 .   ? 7.567   39.149 39.607 1.00 32.48  ? 2370 HOH A O     1 
HETATM 4365 O  O     . HOH L 6 .   ? 19.251  41.287 43.214 1.00 45.38  ? 2371 HOH A O     1 
HETATM 4366 O  O     . HOH L 6 .   ? 9.114   39.248 37.575 1.00 33.64  ? 2372 HOH A O     1 
HETATM 4367 O  O     . HOH L 6 .   ? 9.765   44.268 50.185 1.00 49.98  ? 2373 HOH A O     1 
HETATM 4368 O  O     . HOH L 6 .   ? 21.855  44.319 51.399 1.00 56.85  ? 2374 HOH A O     1 
HETATM 4369 O  O     . HOH L 6 .   ? 18.353  44.790 54.217 1.00 41.99  ? 2375 HOH A O     1 
HETATM 4370 O  O     . HOH L 6 .   ? 16.146  45.367 55.324 1.00 48.67  ? 2376 HOH A O     1 
HETATM 4371 O  O     . HOH L 6 .   ? 11.677  43.255 54.967 1.00 36.01  ? 2377 HOH A O     1 
HETATM 4372 O  O     . HOH L 6 .   ? 8.403   37.986 64.143 1.00 47.46  ? 2378 HOH A O     1 
HETATM 4373 O  O     . HOH L 6 .   ? 5.968   42.553 60.385 1.00 43.56  ? 2379 HOH A O     1 
HETATM 4374 O  O     . HOH L 6 .   ? 9.651   44.589 66.276 1.00 47.53  ? 2380 HOH A O     1 
HETATM 4375 O  O     . HOH L 6 .   ? 8.958   39.137 70.757 1.00 44.59  ? 2381 HOH A O     1 
HETATM 4376 O  O     . HOH L 6 .   ? 8.561   37.672 67.125 1.00 42.14  ? 2382 HOH A O     1 
HETATM 4377 O  O     . HOH L 6 .   ? -0.959  39.111 70.477 1.00 38.93  ? 2383 HOH A O     1 
HETATM 4378 O  O     . HOH L 6 .   ? 2.493   41.454 68.540 1.00 45.98  ? 2384 HOH A O     1 
HETATM 4379 O  O     . HOH L 6 .   ? 5.784   38.223 79.278 1.00 27.11  ? 2385 HOH A O     1 
HETATM 4380 O  O     . HOH L 6 .   ? -1.127  23.580 61.220 1.00 39.52  ? 2386 HOH A O     1 
HETATM 4381 O  O     . HOH L 6 .   ? -5.056  25.755 65.347 1.00 38.24  ? 2387 HOH A O     1 
HETATM 4382 O  O     . HOH L 6 .   ? -5.784  21.657 64.997 1.00 43.25  ? 2388 HOH A O     1 
HETATM 4383 O  O     . HOH L 6 .   ? -2.012  14.549 56.524 1.00 36.56  ? 2389 HOH A O     1 
HETATM 4384 O  O     . HOH L 6 .   ? 0.406   17.932 64.747 0.50 35.78  ? 2390 HOH A O     1 
HETATM 4385 O  O     . HOH L 6 .   ? -7.176  18.396 65.595 1.00 52.63  ? 2391 HOH A O     1 
HETATM 4386 O  O     . HOH L 6 .   ? -3.294  15.433 65.479 1.00 58.71  ? 2392 HOH A O     1 
HETATM 4387 O  O     . HOH L 6 .   ? -0.794  13.577 58.558 1.00 50.20  ? 2393 HOH A O     1 
HETATM 4388 O  O     . HOH L 6 .   ? 1.686   18.264 61.648 1.00 52.34  ? 2394 HOH A O     1 
HETATM 4389 O  O     . HOH L 6 .   ? 0.211   20.127 61.866 1.00 40.56  ? 2395 HOH A O     1 
HETATM 4390 O  O     . HOH L 6 .   ? 1.081   21.766 63.402 1.00 33.76  ? 2396 HOH A O     1 
HETATM 4391 O  O     . HOH L 6 .   ? 1.339   14.623 59.764 1.00 46.60  ? 2397 HOH A O     1 
HETATM 4392 O  O     . HOH L 6 .   ? -2.817  15.273 46.040 1.00 34.64  ? 2398 HOH A O     1 
HETATM 4393 O  O     . HOH L 6 .   ? 5.131   11.890 40.491 1.00 46.70  ? 2399 HOH A O     1 
HETATM 4394 O  O     . HOH L 6 .   ? 4.000   16.418 44.351 1.00 44.45  ? 2400 HOH A O     1 
HETATM 4395 O  O     . HOH L 6 .   ? 23.680  16.270 35.924 1.00 43.48  ? 2401 HOH A O     1 
HETATM 4396 O  O     . HOH L 6 .   ? -5.595  7.510  45.661 1.00 38.07  ? 2402 HOH A O     1 
HETATM 4397 O  O     . HOH L 6 .   ? -2.408  9.814  46.761 1.00 56.66  ? 2403 HOH A O     1 
HETATM 4398 O  O     . HOH L 6 .   ? -11.996 30.782 41.471 1.00 27.95  ? 2404 HOH A O     1 
HETATM 4399 O  O     . HOH L 6 .   ? -8.369  28.971 42.330 1.00 34.83  ? 2405 HOH A O     1 
HETATM 4400 O  O     . HOH L 6 .   ? 18.833  22.310 29.342 1.00 20.16  ? 2406 HOH A O     1 
HETATM 4401 O  O     . HOH L 6 .   ? -5.759  15.807 54.363 1.00 28.41  ? 2407 HOH A O     1 
HETATM 4402 O  O     . HOH L 6 .   ? 1.637   15.992 51.284 1.00 47.52  ? 2408 HOH A O     1 
HETATM 4403 O  O     . HOH L 6 .   ? -0.925  16.561 47.218 1.00 53.43  ? 2409 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 21  ? 0.7301 0.7025 0.7770 0.1199  -0.1959 0.1190  3   THR A N   
2    C CA  . THR A 21  ? 0.7160 0.6756 0.7098 0.1085  -0.1663 0.1141  3   THR A CA  
3    C C   . THR A 21  ? 0.6698 0.6657 0.6573 0.1040  -0.1303 0.0825  3   THR A C   
4    O O   . THR A 21  ? 0.6707 0.6831 0.7003 0.1071  -0.1098 0.0539  3   THR A O   
5    C CB  . THR A 21  ? 0.7388 0.6702 0.7711 0.1152  -0.1655 0.1122  3   THR A CB  
6    O OG1 . THR A 21  ? 0.8094 0.7039 0.8568 0.1167  -0.2068 0.1481  3   THR A OG1 
7    C CG2 . THR A 21  ? 0.7320 0.6502 0.7069 0.1017  -0.1392 0.1104  3   THR A CG2 
8    N N   . SER A 22  ? 0.6393 0.6482 0.5764 0.0922  -0.1240 0.0873  4   SER A N   
9    C CA  . SER A 22  ? 0.5922 0.6295 0.5194 0.0824  -0.0988 0.0685  4   SER A CA  
10   C C   . SER A 22  ? 0.5784 0.6033 0.4838 0.0727  -0.0798 0.0644  4   SER A C   
11   O O   . SER A 22  ? 0.5861 0.5801 0.4737 0.0729  -0.0826 0.0764  4   SER A O   
12   C CB  . SER A 22  ? 0.5800 0.6281 0.4737 0.0730  -0.1020 0.0769  4   SER A CB  
13   O OG  . SER A 22  ? 0.5853 0.6122 0.4366 0.0622  -0.0978 0.0876  4   SER A OG  
14   N N   . TRP A 23  ? 0.5517 0.6005 0.4549 0.0598  -0.0630 0.0506  5   TRP A N   
15   C CA  . TRP A 23  ? 0.5396 0.5791 0.4213 0.0468  -0.0503 0.0502  5   TRP A CA  
16   C C   . TRP A 23  ? 0.5405 0.5569 0.3921 0.0434  -0.0543 0.0676  5   TRP A C   
17   O O   . TRP A 23  ? 0.5352 0.5330 0.3758 0.0387  -0.0474 0.0693  5   TRP A O   
18   C CB  . TRP A 23  ? 0.5340 0.6033 0.4107 0.0251  -0.0405 0.0413  5   TRP A CB  
19   C CG  . TRP A 23  ? 0.5174 0.6080 0.3916 0.0172  -0.0490 0.0497  5   TRP A CG  
20   C CD1 . TRP A 23  ? 0.5051 0.6245 0.3961 0.0145  -0.0479 0.0393  5   TRP A CD1 
21   C CD2 . TRP A 23  ? 0.5101 0.5958 0.3749 0.0096  -0.0588 0.0668  5   TRP A CD2 
22   N NE1 . TRP A 23  ? 0.4916 0.6219 0.3774 0.0053  -0.0580 0.0527  5   TRP A NE1 
23   C CE2 . TRP A 23  ? 0.5066 0.6162 0.3816 0.0027  -0.0655 0.0690  5   TRP A CE2 
24   C CE3 . TRP A 23  ? 0.5099 0.5746 0.3697 0.0070  -0.0615 0.0771  5   TRP A CE3 
25   C CZ2 . TRP A 23  ? 0.4963 0.6065 0.3809 -0.0050 -0.0773 0.0824  5   TRP A CZ2 
26   C CZ3 . TRP A 23  ? 0.4901 0.5585 0.3666 -0.0004 -0.0713 0.0862  5   TRP A CZ3 
27   C CH2 . TRP A 23  ? 0.4782 0.5675 0.3685 -0.0056 -0.0802 0.0894  5   TRP A CH2 
28   N N   . SER A 24  ? 0.5212 0.5413 0.3638 0.0433  -0.0625 0.0755  6   SER A N   
29   C CA  . SER A 24  ? 0.5190 0.5244 0.3430 0.0350  -0.0594 0.0811  6   SER A CA  
30   C C   . SER A 24  ? 0.5518 0.5289 0.3495 0.0359  -0.0618 0.0896  6   SER A C   
31   O O   . SER A 24  ? 0.5600 0.5229 0.3410 0.0246  -0.0518 0.0890  6   SER A O   
32   C CB  . SER A 24  ? 0.5061 0.5282 0.3369 0.0295  -0.0630 0.0790  6   SER A CB  
33   O OG  . SER A 24  ? 0.4524 0.4763 0.2712 0.0344  -0.0727 0.0816  6   SER A OG  
34   N N   . ASP A 25  ? 0.5718 0.5419 0.3707 0.0457  -0.0770 0.0982  7   ASP A N   
35   C CA  . ASP A 25  ? 0.6226 0.5609 0.3988 0.0428  -0.0888 0.1157  7   ASP A CA  
36   C C   . ASP A 25  ? 0.6347 0.5512 0.4168 0.0438  -0.0785 0.1148  7   ASP A C   
37   O O   . ASP A 25  ? 0.6629 0.5556 0.4140 0.0305  -0.0740 0.1239  7   ASP A O   
38   C CB  . ASP A 25  ? 0.6444 0.5793 0.4454 0.0556  -0.1156 0.1279  7   ASP A CB  
39   C CG  . ASP A 25  ? 0.6714 0.6215 0.4579 0.0506  -0.1323 0.1349  7   ASP A CG  
40   O OD1 . ASP A 25  ? 0.6687 0.6288 0.4205 0.0347  -0.1213 0.1292  7   ASP A OD1 
41   O OD2 . ASP A 25  ? 0.7191 0.6719 0.5374 0.0619  -0.1572 0.1438  7   ASP A OD2 
42   N N   . ARG A 26  ? 0.6124 0.5397 0.4333 0.0555  -0.0726 0.1005  8   ARG A N   
43   C CA  . ARG A 26  ? 0.6155 0.5289 0.4459 0.0543  -0.0594 0.0925  8   ARG A CA  
44   C C   . ARG A 26  ? 0.6054 0.5164 0.4090 0.0394  -0.0436 0.0906  8   ARG A C   
45   O O   . ARG A 26  ? 0.6153 0.5022 0.4076 0.0333  -0.0372 0.0945  8   ARG A O   
46   C CB  . ARG A 26  ? 0.6074 0.5461 0.4762 0.0588  -0.0487 0.0681  8   ARG A CB  
47   C CG  . ARG A 26  ? 0.6308 0.5793 0.5494 0.0735  -0.0583 0.0581  8   ARG A CG  
48   C CD  . ARG A 26  ? 0.7078 0.6250 0.6644 0.0846  -0.0690 0.0621  8   ARG A CD  
49   N NE  . ARG A 26  ? 0.7197 0.6501 0.7490 0.0996  -0.0779 0.0456  8   ARG A NE  
50   C CZ  . ARG A 26  ? 0.7564 0.6629 0.8494 0.1131  -0.0950 0.0476  8   ARG A CZ  
51   N NH1 . ARG A 26  ? 0.7946 0.6592 0.8768 0.1115  -0.1069 0.0707  8   ARG A NH1 
52   N NH2 . ARG A 26  ? 0.7545 0.6791 0.9311 0.1271  -0.1021 0.0266  8   ARG A NH2 
53   N N   . LEU A 27  ? 0.5669 0.5028 0.3706 0.0331  -0.0392 0.0844  9   LEU A N   
54   C CA  . LEU A 27  ? 0.5569 0.4933 0.3577 0.0201  -0.0291 0.0813  9   LEU A CA  
55   C C   . LEU A 27  ? 0.5818 0.5002 0.3602 0.0103  -0.0223 0.0844  9   LEU A C   
56   O O   . LEU A 27  ? 0.5746 0.4808 0.3526 0.0005  -0.0104 0.0802  9   LEU A O   
57   C CB  . LEU A 27  ? 0.5315 0.4957 0.3517 0.0148  -0.0333 0.0781  9   LEU A CB  
58   C CG  . LEU A 27  ? 0.5190 0.5048 0.3512 0.0091  -0.0373 0.0756  9   LEU A CG  
59   C CD1 . LEU A 27  ? 0.4895 0.4970 0.3390 0.0001  -0.0478 0.0811  9   LEU A CD1 
60   C CD2 . LEU A 27  ? 0.5134 0.4934 0.3457 -0.0023 -0.0324 0.0731  9   LEU A CD2 
61   N N   . GLN A 28  ? 0.6028 0.5222 0.3609 0.0079  -0.0285 0.0892  10  GLN A N   
62   C CA  . GLN A 28  ? 0.6382 0.5459 0.3637 -0.0122 -0.0184 0.0880  10  GLN A CA  
63   C C   . GLN A 28  ? 0.6890 0.5639 0.3816 -0.0202 -0.0206 0.1041  10  GLN A C   
64   O O   . GLN A 28  ? 0.7211 0.5845 0.3882 -0.0427 -0.0048 0.1000  10  GLN A O   
65   C CB  . GLN A 28  ? 0.6580 0.5786 0.3627 -0.0199 -0.0258 0.0881  10  GLN A CB  
66   C CG  . GLN A 28  ? 0.7012 0.6200 0.3677 -0.0516 -0.0090 0.0771  10  GLN A CG  
67   C CD  . GLN A 28  ? 0.6961 0.6272 0.3984 -0.0632 0.0197  0.0467  10  GLN A CD  
68   O OE1 . GLN A 28  ? 0.6761 0.6306 0.4240 -0.0601 0.0253  0.0267  10  GLN A OE1 
69   N NE2 . GLN A 28  ? 0.6766 0.5915 0.3676 -0.0775 0.0360  0.0431  10  GLN A NE2 
70   N N   . ASN A 29  ? 0.6951 0.5555 0.3950 -0.0046 -0.0399 0.1207  11  ASN A N   
71   C CA  . ASN A 29  ? 0.7401 0.5652 0.4238 -0.0104 -0.0483 0.1400  11  ASN A CA  
72   C C   . ASN A 29  ? 0.7247 0.5404 0.4194 -0.0138 -0.0276 0.1282  11  ASN A C   
73   O O   . ASN A 29  ? 0.7490 0.5424 0.4150 -0.0338 -0.0192 0.1352  11  ASN A O   
74   C CB  . ASN A 29  ? 0.7474 0.5614 0.4666 0.0110  -0.0738 0.1533  11  ASN A CB  
75   C CG  . ASN A 29  ? 0.8019 0.6172 0.5111 0.0104  -0.1024 0.1729  11  ASN A CG  
76   O OD1 . ASN A 29  ? 0.8626 0.6806 0.5215 -0.0123 -0.1046 0.1816  11  ASN A OD1 
77   N ND2 . ASN A 29  ? 0.8212 0.6369 0.5833 0.0325  -0.1238 0.1766  11  ASN A ND2 
78   N N   . ALA A 30  ? 0.6778 0.5124 0.4105 0.0007  -0.0198 0.1105  12  ALA A N   
79   C CA  . ALA A 30  ? 0.6737 0.5046 0.4198 -0.0043 -0.0034 0.0988  12  ALA A CA  
80   C C   . ALA A 30  ? 0.6709 0.5095 0.4098 -0.0230 0.0145  0.0877  12  ALA A C   
81   O O   . ALA A 30  ? 0.6804 0.5048 0.4171 -0.0353 0.0281  0.0836  12  ALA A O   
82   C CB  . ALA A 30  ? 0.6280 0.4802 0.4079 0.0065  -0.0033 0.0850  12  ALA A CB  
83   N N   . ALA A 31  ? 0.6587 0.5204 0.4023 -0.0261 0.0157  0.0796  13  ALA A N   
84   C CA  . ALA A 31  ? 0.6654 0.5398 0.4234 -0.0438 0.0349  0.0597  13  ALA A CA  
85   C C   . ALA A 31  ? 0.7215 0.5796 0.4371 -0.0710 0.0529  0.0568  13  ALA A C   
86   O O   . ALA A 31  ? 0.7255 0.5887 0.4600 -0.0886 0.0762  0.0353  13  ALA A O   
87   C CB  . ALA A 31  ? 0.6333 0.5350 0.4125 -0.0418 0.0315  0.0491  13  ALA A CB  
88   N N   . ASP A 32  ? 0.7730 0.6126 0.4349 -0.0784 0.0405  0.0790  14  ASP A N   
89   C CA  . ASP A 32  ? 0.8483 0.6734 0.4536 -0.1145 0.0527  0.0828  14  ASP A CA  
90   C C   . ASP A 32  ? 0.8827 0.6803 0.4779 -0.1255 0.0613  0.0909  14  ASP A C   
91   O O   . ASP A 32  ? 0.9262 0.7132 0.4756 -0.1626 0.0775  0.0906  14  ASP A O   
92   C CB  . ASP A 32  ? 0.8980 0.7089 0.4486 -0.1234 0.0256  0.1138  14  ASP A CB  
93   C CG  . ASP A 32  ? 0.8979 0.7365 0.4487 -0.1205 0.0194  0.1045  14  ASP A CG  
94   O OD1 . ASP A 32  ? 0.8598 0.7274 0.4441 -0.1219 0.0419  0.0708  14  ASP A OD1 
95   O OD2 . ASP A 32  ? 0.9587 0.7891 0.4841 -0.1172 -0.0106 0.1313  14  ASP A OD2 
96   N N   . MET A 33  ? 0.8580 0.6454 0.4923 -0.0982 0.0520  0.0963  15  MET A N   
97   C CA  . MET A 33  ? 0.8951 0.6565 0.5277 -0.1065 0.0598  0.1018  15  MET A CA  
98   C C   . MET A 33  ? 0.8624 0.6392 0.5292 -0.1176 0.0895  0.0710  15  MET A C   
99   O O   . MET A 33  ? 0.8026 0.6059 0.5225 -0.1025 0.0925  0.0507  15  MET A O   
100  C CB  . MET A 33  ? 0.8794 0.6253 0.5433 -0.0773 0.0403  0.1141  15  MET A CB  
101  C CG  . MET A 33  ? 0.9459 0.6685 0.5941 -0.0689 0.0105  0.1442  15  MET A CG  
102  S SD  . MET A 33  ? 0.9608 0.6850 0.6714 -0.0324 -0.0025 0.1369  15  MET A SD  
103  C CE  . MET A 33  ? 0.9877 0.6712 0.7097 -0.0395 -0.0001 0.1452  15  MET A CE  
104  N N   . PRO A 34  ? 0.8963 0.6559 0.5381 -0.1465 0.1084  0.0695  16  PRO A N   
105  C CA  . PRO A 34  ? 0.8709 0.6437 0.5577 -0.1556 0.1352  0.0395  16  PRO A CA  
106  C C   . PRO A 34  ? 0.8251 0.5889 0.5548 -0.1301 0.1231  0.0438  16  PRO A C   
107  O O   . PRO A 34  ? 0.8317 0.5726 0.5464 -0.1143 0.1025  0.0672  16  PRO A O   
108  C CB  . PRO A 34  ? 0.9441 0.6992 0.5802 -0.1984 0.1583  0.0401  16  PRO A CB  
109  C CG  . PRO A 34  ? 0.9998 0.7170 0.5748 -0.2010 0.1299  0.0851  16  PRO A CG  
110  C CD  . PRO A 34  ? 0.9772 0.7040 0.5515 -0.1751 0.1024  0.0984  16  PRO A CD  
111  N N   . ALA A 35  ? 0.7835 0.5674 0.5734 -0.1281 0.1344  0.0191  17  ALA A N   
112  C CA  . ALA A 35  ? 0.7510 0.5307 0.5778 -0.1126 0.1232  0.0207  17  ALA A CA  
113  C C   . ALA A 35  ? 0.7803 0.5332 0.5917 -0.1292 0.1375  0.0227  17  ALA A C   
114  O O   . ALA A 35  ? 0.8037 0.5591 0.6197 -0.1548 0.1637  0.0055  17  ALA A O   
115  C CB  . ALA A 35  ? 0.7034 0.5132 0.6045 -0.1087 0.1214  -0.0002 17  ALA A CB  
116  N N   . ASN A 36  ? 0.7835 0.5123 0.5818 -0.1168 0.1226  0.0400  18  ASN A N   
117  C CA  . ASN A 36  ? 0.8058 0.5099 0.6054 -0.1281 0.1319  0.0407  18  ASN A CA  
118  C C   . ASN A 36  ? 0.7634 0.4855 0.6153 -0.1171 0.1258  0.0249  18  ASN A C   
119  O O   . ASN A 36  ? 0.7403 0.4667 0.5985 -0.0998 0.1075  0.0285  18  ASN A O   
120  C CB  . ASN A 36  ? 0.8426 0.5084 0.6111 -0.1228 0.1172  0.0667  18  ASN A CB  
121  C CG  . ASN A 36  ? 0.8712 0.5089 0.6482 -0.1346 0.1255  0.0674  18  ASN A CG  
122  O OD1 . ASN A 36  ? 0.8457 0.4946 0.6483 -0.1464 0.1431  0.0477  18  ASN A OD1 
123  N ND2 . ASN A 36  ? 0.9080 0.5082 0.6735 -0.1316 0.1107  0.0902  18  ASN A ND2 
124  N N   . MET A 37  ? 0.7481 0.4839 0.6395 -0.1313 0.1407  0.0055  19  MET A N   
125  C CA  . MET A 37  ? 0.7225 0.4783 0.6678 -0.1264 0.1283  -0.0058 19  MET A CA  
126  C C   . MET A 37  ? 0.7389 0.4754 0.6886 -0.1328 0.1315  -0.0083 19  MET A C   
127  O O   . MET A 37  ? 0.7230 0.4751 0.7147 -0.1359 0.1216  -0.0179 19  MET A O   
128  C CB  . MET A 37  ? 0.7046 0.4889 0.7145 -0.1359 0.1355  -0.0264 19  MET A CB  
129  C CG  . MET A 37  ? 0.6651 0.4726 0.6896 -0.1276 0.1271  -0.0275 19  MET A CG  
130  S SD  . MET A 37  ? 0.6460 0.4687 0.6671 -0.1077 0.0872  -0.0067 19  MET A SD  
131  C CE  . MET A 37  ? 0.6093 0.4568 0.7196 -0.1152 0.0611  -0.0113 19  MET A CE  
132  N N   . ASP A 38  ? 0.7763 0.4782 0.6863 -0.1369 0.1413  0.0025  20  ASP A N   
133  C CA  . ASP A 38  ? 0.8015 0.4817 0.7183 -0.1405 0.1424  0.0001  20  ASP A CA  
134  C C   . ASP A 38  ? 0.7812 0.4772 0.7104 -0.1264 0.1220  -0.0054 20  ASP A C   
135  O O   . ASP A 38  ? 0.7711 0.4740 0.6828 -0.1122 0.1099  0.0014  20  ASP A O   
136  C CB  . ASP A 38  ? 0.8492 0.4858 0.7288 -0.1457 0.1479  0.0190  20  ASP A CB  
137  C CG  . ASP A 38  ? 0.8638 0.4755 0.7613 -0.1471 0.1478  0.0148  20  ASP A CG  
138  O OD1 . ASP A 38  ? 0.8919 0.4798 0.7879 -0.1663 0.1622  0.0174  20  ASP A OD1 
139  O OD2 . ASP A 38  ? 0.8703 0.4881 0.7848 -0.1324 0.1355  0.0055  20  ASP A OD2 
140  N N   . LYS A 39  ? 0.7854 0.4912 0.7433 -0.1352 0.1188  -0.0197 21  LYS A N   
141  C CA  . LYS A 39  ? 0.7802 0.5109 0.7425 -0.1344 0.0999  -0.0278 21  LYS A CA  
142  C C   . LYS A 39  ? 0.7934 0.5111 0.7353 -0.1250 0.1010  -0.0332 21  LYS A C   
143  O O   . LYS A 39  ? 0.7778 0.5195 0.7097 -0.1235 0.0902  -0.0392 21  LYS A O   
144  C CB  . LYS A 39  ? 0.7904 0.5350 0.7832 -0.1528 0.0933  -0.0408 21  LYS A CB  
145  C CG  . LYS A 39  ? 0.7880 0.5579 0.8240 -0.1611 0.0803  -0.0373 21  LYS A CG  
146  C CD  . LYS A 39  ? 0.7858 0.5778 0.8514 -0.1814 0.0571  -0.0430 21  LYS A CD  
147  C CE  . LYS A 39  ? 0.7876 0.5938 0.9238 -0.1896 0.0478  -0.0438 21  LYS A CE  
148  N NZ  . LYS A 39  ? 0.7769 0.5881 0.9431 -0.1776 0.0561  -0.0411 21  LYS A NZ  
149  N N   . HIS A 40  ? 0.8183 0.4985 0.7610 -0.1213 0.1136  -0.0318 22  HIS A N   
150  C CA  . HIS A 40  ? 0.8392 0.5019 0.7864 -0.1093 0.1136  -0.0380 22  HIS A CA  
151  C C   . HIS A 40  ? 0.8231 0.4842 0.7540 -0.0916 0.1049  -0.0210 22  HIS A C   
152  O O   . HIS A 40  ? 0.8166 0.4881 0.7586 -0.0815 0.1009  -0.0336 22  HIS A O   
153  C CB  . HIS A 40  ? 0.8814 0.4997 0.8474 -0.1116 0.1224  -0.0354 22  HIS A CB  
154  C CG  . HIS A 40  ? 0.9198 0.5399 0.9088 -0.1275 0.1315  -0.0589 22  HIS A CG  
155  N ND1 . HIS A 40  ? 0.9692 0.5629 0.9660 -0.1399 0.1412  -0.0523 22  HIS A ND1 
156  C CD2 . HIS A 40  ? 0.9374 0.5848 0.9395 -0.1379 0.1327  -0.0900 22  HIS A CD2 
157  C CE1 . HIS A 40  ? 0.9893 0.5924 1.0089 -0.1528 0.1465  -0.0780 22  HIS A CE1 
158  N NE2 . HIS A 40  ? 0.9697 0.6059 0.9900 -0.1535 0.1409  -0.1011 22  HIS A NE2 
159  N N   . ALA A 41  ? 0.8180 0.4693 0.7254 -0.0912 0.1040  0.0035  23  ALA A N   
160  C CA  . ALA A 41  ? 0.8168 0.4710 0.7042 -0.0781 0.0938  0.0203  23  ALA A CA  
161  C C   . ALA A 41  ? 0.7733 0.4709 0.6594 -0.0721 0.0862  0.0088  23  ALA A C   
162  O O   . ALA A 41  ? 0.7584 0.4634 0.6448 -0.0590 0.0784  0.0085  23  ALA A O   
163  C CB  . ALA A 41  ? 0.8249 0.4675 0.6809 -0.0881 0.0981  0.0425  23  ALA A CB  
164  N N   . LEU A 42  ? 0.7513 0.4763 0.6418 -0.0841 0.0857  0.0011  24  LEU A N   
165  C CA  . LEU A 42  ? 0.7342 0.4980 0.6225 -0.0856 0.0724  -0.0022 24  LEU A CA  
166  C C   . LEU A 42  ? 0.7432 0.5238 0.6308 -0.0898 0.0705  -0.0216 24  LEU A C   
167  O O   . LEU A 42  ? 0.7261 0.5273 0.6035 -0.0857 0.0646  -0.0232 24  LEU A O   
168  C CB  . LEU A 42  ? 0.7156 0.5004 0.6232 -0.1010 0.0642  -0.0019 24  LEU A CB  
169  C CG  . LEU A 42  ? 0.7095 0.4912 0.6321 -0.0996 0.0697  0.0067  24  LEU A CG  
170  C CD1 . LEU A 42  ? 0.6922 0.4911 0.6608 -0.1141 0.0620  0.0015  24  LEU A CD1 
171  C CD2 . LEU A 42  ? 0.6813 0.4766 0.5934 -0.0888 0.0624  0.0166  24  LEU A CD2 
172  N N   . LYS A 43  ? 0.7704 0.5441 0.6703 -0.1014 0.0789  -0.0406 25  LYS A N   
173  C CA  . LYS A 43  ? 0.7913 0.5847 0.6933 -0.1131 0.0845  -0.0699 25  LYS A CA  
174  C C   . LYS A 43  ? 0.8023 0.5864 0.7205 -0.0936 0.0922  -0.0802 25  LYS A C   
175  O O   . LYS A 43  ? 0.8039 0.6179 0.7200 -0.1005 0.0957  -0.1010 25  LYS A O   
176  C CB  . LYS A 43  ? 0.8171 0.6015 0.7356 -0.1292 0.0955  -0.0931 25  LYS A CB  
177  C CG  . LYS A 43  ? 0.8393 0.6561 0.7533 -0.1539 0.1037  -0.1306 25  LYS A CG  
178  C CD  . LYS A 43  ? 0.8699 0.6853 0.7940 -0.1772 0.1122  -0.1547 25  LYS A CD  
179  C CE  . LYS A 43  ? 0.9042 0.7650 0.8022 -0.2179 0.1159  -0.1883 25  LYS A CE  
180  N NZ  . LYS A 43  ? 0.9298 0.7948 0.8255 -0.2472 0.1150  -0.2023 25  LYS A NZ  
181  N N   . LYS A 44  ? 0.8144 0.5582 0.7513 -0.0733 0.0929  -0.0645 26  LYS A N   
182  C CA  . LYS A 44  ? 0.8323 0.5607 0.8007 -0.0534 0.0920  -0.0681 26  LYS A CA  
183  C C   . LYS A 44  ? 0.8085 0.5556 0.7586 -0.0415 0.0809  -0.0528 26  LYS A C   
184  O O   . LYS A 44  ? 0.8027 0.5634 0.7800 -0.0328 0.0824  -0.0705 26  LYS A O   
185  C CB  . LYS A 44  ? 0.8630 0.5395 0.8510 -0.0418 0.0860  -0.0439 26  LYS A CB  
186  C CG  . LYS A 44  ? 0.8922 0.5462 0.9356 -0.0230 0.0775  -0.0466 26  LYS A CG  
187  C CD  . LYS A 44  ? 0.9365 0.5368 0.9854 -0.0173 0.0594  -0.0052 26  LYS A CD  
188  C CE  . LYS A 44  ? 0.9633 0.5446 1.0575 0.0021  0.0359  0.0107  26  LYS A CE  
189  N NZ  . LYS A 44  ? 1.0343 0.5580 1.1467 0.0002  0.0124  0.0511  26  LYS A NZ  
190  N N   . TYR A 45  ? 0.7906 0.5400 0.7032 -0.0420 0.0719  -0.0243 27  TYR A N   
191  C CA  . TYR A 45  ? 0.7765 0.5434 0.6715 -0.0324 0.0615  -0.0099 27  TYR A CA  
192  C C   . TYR A 45  ? 0.7552 0.5662 0.6456 -0.0419 0.0628  -0.0303 27  TYR A C   
193  O O   . TYR A 45  ? 0.7477 0.5722 0.6480 -0.0321 0.0607  -0.0360 27  TYR A O   
194  C CB  . TYR A 45  ? 0.7746 0.5414 0.6395 -0.0368 0.0564  0.0144  27  TYR A CB  
195  C CG  . TYR A 45  ? 0.7762 0.5410 0.6250 -0.0253 0.0471  0.0344  27  TYR A CG  
196  C CD1 . TYR A 45  ? 0.8214 0.5547 0.6702 -0.0157 0.0400  0.0513  27  TYR A CD1 
197  C CD2 . TYR A 45  ? 0.7690 0.5618 0.6051 -0.0272 0.0416  0.0389  27  TYR A CD2 
198  C CE1 . TYR A 45  ? 0.8216 0.5544 0.6495 -0.0105 0.0288  0.0707  27  TYR A CE1 
199  C CE2 . TYR A 45  ? 0.7586 0.5511 0.5798 -0.0191 0.0347  0.0537  27  TYR A CE2 
200  C CZ  . TYR A 45  ? 0.8052 0.5689 0.6177 -0.0119 0.0289  0.0689  27  TYR A CZ  
201  O OH  . TYR A 45  ? 0.8135 0.5787 0.6053 -0.0089 0.0193  0.0844  27  TYR A OH  
202  N N   . ARG A 46  ? 0.7467 0.5804 0.6217 -0.0652 0.0640  -0.0392 28  ARG A N   
203  C CA  . ARG A 46  ? 0.7427 0.6189 0.5991 -0.0866 0.0609  -0.0514 28  ARG A CA  
204  C C   . ARG A 46  ? 0.7702 0.6650 0.6428 -0.0974 0.0795  -0.0921 28  ARG A C   
205  O O   . ARG A 46  ? 0.7907 0.7241 0.6424 -0.1220 0.0818  -0.1071 28  ARG A O   
206  C CB  . ARG A 46  ? 0.7357 0.6289 0.5720 -0.1146 0.0481  -0.0419 28  ARG A CB  
207  C CG  . ARG A 46  ? 0.7485 0.6387 0.5886 -0.1350 0.0567  -0.0624 28  ARG A CG  
208  C CD  . ARG A 46  ? 0.7389 0.6459 0.5650 -0.1629 0.0349  -0.0458 28  ARG A CD  
209  N NE  . ARG A 46  ? 0.7403 0.6504 0.5645 -0.1887 0.0394  -0.0651 28  ARG A NE  
210  C CZ  . ARG A 46  ? 0.7498 0.6415 0.5939 -0.1890 0.0348  -0.0579 28  ARG A CZ  
211  N NH1 . ARG A 46  ? 0.7108 0.5804 0.5805 -0.1670 0.0293  -0.0352 28  ARG A NH1 
212  N NH2 . ARG A 46  ? 0.7813 0.6791 0.6217 -0.2150 0.0391  -0.0785 28  ARG A NH2 
213  N N   . ARG A 47  ? 0.7927 0.6614 0.7068 -0.0834 0.0931  -0.1118 29  ARG A N   
214  C CA  . ARG A 47  ? 0.8128 0.6971 0.7697 -0.0858 0.1131  -0.1568 29  ARG A CA  
215  C C   . ARG A 47  ? 0.7922 0.6938 0.7618 -0.0715 0.1103  -0.1568 29  ARG A C   
216  O O   . ARG A 47  ? 0.7989 0.7398 0.7768 -0.0903 0.1273  -0.1942 29  ARG A O   
217  C CB  . ARG A 47  ? 0.8456 0.6902 0.8676 -0.0655 0.1204  -0.1708 29  ARG A CB  
218  C CG  . ARG A 47  ? 0.9130 0.7456 0.9422 -0.0827 0.1322  -0.1899 29  ARG A CG  
219  C CD  . ARG A 47  ? 1.0000 0.8803 1.0046 -0.1247 0.1518  -0.2338 29  ARG A CD  
220  N NE  . ARG A 47  ? 1.0237 0.9206 0.9575 -0.1497 0.1358  -0.2051 29  ARG A NE  
221  C CZ  . ARG A 47  ? 1.0608 0.9502 0.9781 -0.1675 0.1322  -0.2012 29  ARG A CZ  
222  N NH1 . ARG A 47  ? 1.0930 0.9588 1.0504 -0.1652 0.1472  -0.2258 29  ARG A NH1 
223  N NH2 . ARG A 47  ? 1.0539 0.9593 0.9228 -0.1886 0.1111  -0.1723 29  ARG A NH2 
224  N N   . GLU A 48  ? 0.7620 0.6369 0.7322 -0.0429 0.0907  -0.1181 30  GLU A N   
225  C CA  . GLU A 48  ? 0.7500 0.6369 0.7404 -0.0262 0.0849  -0.1164 30  GLU A CA  
226  C C   . GLU A 48  ? 0.7134 0.6434 0.6570 -0.0464 0.0843  -0.1148 30  GLU A C   
227  O O   . GLU A 48  ? 0.6901 0.6231 0.5847 -0.0585 0.0722  -0.0874 30  GLU A O   
228  C CB  . GLU A 48  ? 0.7467 0.5960 0.7375 0.0015  0.0614  -0.0730 30  GLU A CB  
229  C CG  . GLU A 48  ? 0.7973 0.6023 0.8419 0.0197  0.0539  -0.0678 30  GLU A CG  
230  C CD  . GLU A 48  ? 0.8175 0.5871 0.8378 0.0332  0.0285  -0.0184 30  GLU A CD  
231  O OE1 . GLU A 48  ? 0.8597 0.6326 0.8912 0.0466  0.0123  -0.0048 30  GLU A OE1 
232  O OE2 . GLU A 48  ? 0.8774 0.6198 0.8637 0.0256  0.0263  0.0043  30  GLU A OE2 
233  N N   . ALA A 49  ? 0.6994 0.6618 0.6674 -0.0510 0.0963  -0.1444 31  ALA A N   
234  C CA  . ALA A 49  ? 0.6924 0.6991 0.6160 -0.0791 0.0985  -0.1473 31  ALA A CA  
235  C C   . ALA A 49  ? 0.6532 0.6514 0.5388 -0.0678 0.0723  -0.0986 31  ALA A C   
236  O O   . ALA A 49  ? 0.6361 0.6535 0.4762 -0.0930 0.0624  -0.0817 31  ALA A O   
237  C CB  . ALA A 49  ? 0.6889 0.7309 0.6546 -0.0838 0.1189  -0.1898 31  ALA A CB  
238  N N   . TYR A 50  ? 0.6435 0.6114 0.5519 -0.0331 0.0589  -0.0758 32  TYR A N   
239  C CA  . TYR A 50  ? 0.6362 0.5940 0.5168 -0.0210 0.0379  -0.0362 32  TYR A CA  
240  C C   . TYR A 50  ? 0.6231 0.5708 0.4690 -0.0332 0.0285  -0.0121 32  TYR A C   
241  O O   . TYR A 50  ? 0.5945 0.5512 0.4228 -0.0371 0.0153  0.0088  32  TYR A O   
242  C CB  . TYR A 50  ? 0.6508 0.5746 0.5568 0.0106  0.0259  -0.0185 32  TYR A CB  
243  C CG  . TYR A 50  ? 0.6826 0.6082 0.6495 0.0238  0.0318  -0.0453 32  TYR A CG  
244  C CD1 . TYR A 50  ? 0.6899 0.6518 0.6807 0.0217  0.0384  -0.0680 32  TYR A CD1 
245  C CD2 . TYR A 50  ? 0.7200 0.6140 0.7322 0.0350  0.0325  -0.0531 32  TYR A CD2 
246  C CE1 . TYR A 50  ? 0.6985 0.6680 0.7662 0.0327  0.0471  -0.1022 32  TYR A CE1 
247  C CE2 . TYR A 50  ? 0.7293 0.6267 0.8233 0.0475  0.0368  -0.0837 32  TYR A CE2 
248  C CZ  . TYR A 50  ? 0.7271 0.6641 0.8525 0.0469  0.0452  -0.1107 32  TYR A CZ  
249  O OH  . TYR A 50  ? 0.7363 0.6819 0.9603 0.0590  0.0517  -0.1483 32  TYR A OH  
250  N N   . HIS A 51  ? 0.4766 0.2542 0.3499 -0.0460 0.0153  0.0522  33  HIS A N   
251  C CA  . HIS A 51  ? 0.4771 0.2675 0.3514 -0.0559 0.0186  0.0503  33  HIS A CA  
252  C C   . HIS A 51  ? 0.4719 0.2705 0.3537 -0.0611 0.0194  0.0409  33  HIS A C   
253  O O   . HIS A 51  ? 0.4606 0.2705 0.3454 -0.0696 0.0218  0.0384  33  HIS A O   
254  C CB  . HIS A 51  ? 0.5138 0.2910 0.3812 -0.0645 0.0224  0.0569  33  HIS A CB  
255  C CG  . HIS A 51  ? 0.5399 0.3097 0.3984 -0.0602 0.0212  0.0672  33  HIS A CG  
256  N ND1 . HIS A 51  ? 0.6003 0.3476 0.4520 -0.0605 0.0216  0.0751  33  HIS A ND1 
257  C CD2 . HIS A 51  ? 0.5199 0.3019 0.3751 -0.0551 0.0192  0.0707  33  HIS A CD2 
258  C CE1 . HIS A 51  ? 0.5607 0.3081 0.4049 -0.0559 0.0193  0.0838  33  HIS A CE1 
259  N NE2 . HIS A 51  ? 0.5952 0.3636 0.4410 -0.0529 0.0180  0.0808  33  HIS A NE2 
260  N N   . ARG A 52  ? 0.4671 0.2620 0.3521 -0.0557 0.0171  0.0356  34  ARG A N   
261  C CA  . ARG A 52  ? 0.4699 0.2706 0.3602 -0.0604 0.0173  0.0267  34  ARG A CA  
262  C C   . ARG A 52  ? 0.4338 0.2572 0.3297 -0.0570 0.0143  0.0227  34  ARG A C   
263  O O   . ARG A 52  ? 0.4190 0.2495 0.3150 -0.0491 0.0121  0.0257  34  ARG A O   
264  C CB  . ARG A 52  ? 0.4948 0.2782 0.3845 -0.0565 0.0171  0.0230  34  ARG A CB  
265  C CG  . ARG A 52  ? 0.5440 0.3289 0.4366 -0.0622 0.0179  0.0138  34  ARG A CG  
266  C CD  . ARG A 52  ? 0.6153 0.3766 0.5059 -0.0637 0.0206  0.0107  34  ARG A CD  
267  N NE  . ARG A 52  ? 0.6657 0.4332 0.5589 -0.0660 0.0203  0.0002  34  ARG A NE  
268  C CZ  . ARG A 52  ? 0.7011 0.4562 0.5943 -0.0624 0.0215  -0.0059 34  ARG A CZ  
269  N NH1 . ARG A 52  ? 0.7340 0.4687 0.6265 -0.0554 0.0229  -0.0023 34  ARG A NH1 
270  N NH2 . ARG A 52  ? 0.7005 0.4643 0.5947 -0.0656 0.0212  -0.0155 34  ARG A NH2 
271  N N   . VAL A 53  ? 0.4272 0.2618 0.3277 -0.0636 0.0143  0.0164  35  VAL A N   
272  C CA  . VAL A 53  ? 0.3893 0.2431 0.2953 -0.0606 0.0109  0.0125  35  VAL A CA  
273  C C   . VAL A 53  ? 0.3922 0.2408 0.2977 -0.0606 0.0098  0.0055  35  VAL A C   
274  O O   . VAL A 53  ? 0.3931 0.2336 0.2973 -0.0683 0.0117  0.0009  35  VAL A O   
275  C CB  . VAL A 53  ? 0.3697 0.2430 0.2819 -0.0677 0.0110  0.0111  35  VAL A CB  
276  C CG1 . VAL A 53  ? 0.3420 0.2336 0.2600 -0.0651 0.0068  0.0072  35  VAL A CG1 
277  C CG2 . VAL A 53  ? 0.3598 0.2395 0.2727 -0.0664 0.0128  0.0171  35  VAL A CG2 
278  N N   . PHE A 54  ? 0.3701 0.2220 0.2757 -0.0521 0.0072  0.0047  36  PHE A N   
279  C CA  . PHE A 54  ? 0.3663 0.2146 0.2708 -0.0512 0.0066  -0.0019 36  PHE A CA  
280  C C   . PHE A 54  ? 0.3590 0.2267 0.2665 -0.0543 0.0036  -0.0060 36  PHE A C   
281  O O   . PHE A 54  ? 0.3279 0.2109 0.2392 -0.0523 0.0012  -0.0026 36  PHE A O   
282  C CB  . PHE A 54  ? 0.3699 0.2117 0.2733 -0.0406 0.0059  -0.0002 36  PHE A CB  
283  C CG  . PHE A 54  ? 0.3715 0.1947 0.2725 -0.0372 0.0080  0.0042  36  PHE A CG  
284  C CD1 . PHE A 54  ? 0.3955 0.2004 0.2946 -0.0393 0.0109  0.0005  36  PHE A CD1 
285  C CD2 . PHE A 54  ? 0.3955 0.2192 0.2957 -0.0322 0.0070  0.0121  36  PHE A CD2 
286  C CE1 . PHE A 54  ? 0.4173 0.2041 0.3147 -0.0356 0.0124  0.0059  36  PHE A CE1 
287  C CE2 . PHE A 54  ? 0.4045 0.2114 0.3017 -0.0293 0.0082  0.0173  36  PHE A CE2 
288  C CZ  . PHE A 54  ? 0.4057 0.1941 0.3019 -0.0306 0.0106  0.0148  36  PHE A CZ  
289  N N   . VAL A 55  ? 0.3588 0.2250 0.2642 -0.0592 0.0038  -0.0133 37  VAL A N   
290  C CA  . VAL A 55  ? 0.3553 0.2394 0.2623 -0.0651 0.0007  -0.0171 37  VAL A CA  
291  C C   . VAL A 55  ? 0.3573 0.2442 0.2608 -0.0622 -0.0007 -0.0219 37  VAL A C   
292  O O   . VAL A 55  ? 0.3611 0.2357 0.2602 -0.0637 0.0021  -0.0282 37  VAL A O   
293  C CB  . VAL A 55  ? 0.3704 0.2535 0.2771 -0.0771 0.0022  -0.0221 37  VAL A CB  
294  C CG1 . VAL A 55  ? 0.3733 0.2785 0.2827 -0.0834 -0.0022 -0.0250 37  VAL A CG1 
295  C CG2 . VAL A 55  ? 0.3855 0.2634 0.2949 -0.0804 0.0048  -0.0172 37  VAL A CG2 
296  N N   . ASN A 56  ? 0.3376 0.2405 0.2430 -0.0583 -0.0046 -0.0189 38  ASN A N   
297  C CA  . ASN A 56  ? 0.3400 0.2488 0.2414 -0.0573 -0.0062 -0.0228 38  ASN A CA  
298  C C   . ASN A 56  ? 0.3548 0.2778 0.2544 -0.0663 -0.0093 -0.0269 38  ASN A C   
299  O O   . ASN A 56  ? 0.3655 0.2880 0.2588 -0.0698 -0.0088 -0.0335 38  ASN A O   
300  C CB  . ASN A 56  ? 0.3292 0.2461 0.2326 -0.0485 -0.0087 -0.0169 38  ASN A CB  
301  C CG  . ASN A 56  ? 0.3208 0.2251 0.2246 -0.0400 -0.0061 -0.0143 38  ASN A CG  
302  O OD1 . ASN A 56  ? 0.3428 0.2500 0.2505 -0.0342 -0.0072 -0.0079 38  ASN A OD1 
303  N ND2 . ASN A 56  ? 0.3433 0.2345 0.2438 -0.0390 -0.0026 -0.0193 38  ASN A ND2 
304  N N   . ARG A 57  ? 0.3478 0.2846 0.2530 -0.0700 -0.0126 -0.0233 39  ARG A N   
305  C CA  . ARG A 57  ? 0.3712 0.3237 0.2761 -0.0792 -0.0164 -0.0266 39  ARG A CA  
306  C C   . ARG A 57  ? 0.3714 0.3272 0.2825 -0.0858 -0.0159 -0.0262 39  ARG A C   
307  O O   . ARG A 57  ? 0.3808 0.3354 0.2982 -0.0814 -0.0147 -0.0204 39  ARG A O   
308  C CB  . ARG A 57  ? 0.3527 0.3247 0.2602 -0.0757 -0.0225 -0.0211 39  ARG A CB  
309  C CG  . ARG A 57  ? 0.3833 0.3556 0.2824 -0.0734 -0.0234 -0.0230 39  ARG A CG  
310  C CD  . ARG A 57  ? 0.3712 0.3573 0.2734 -0.0672 -0.0284 -0.0149 39  ARG A CD  
311  N NE  . ARG A 57  ? 0.3852 0.3658 0.2942 -0.0577 -0.0269 -0.0084 39  ARG A NE  
312  C CZ  . ARG A 57  ? 0.3746 0.3419 0.2812 -0.0511 -0.0231 -0.0083 39  ARG A CZ  
313  N NH1 . ARG A 57  ? 0.3703 0.3287 0.2692 -0.0520 -0.0202 -0.0140 39  ARG A NH1 
314  N NH2 . ARG A 57  ? 0.3739 0.3375 0.2862 -0.0437 -0.0222 -0.0029 39  ARG A NH2 
315  N N   . SER A 58  ? 0.3960 0.3566 0.3051 -0.0969 -0.0167 -0.0327 40  SER A N   
316  C CA  . SER A 58  ? 0.4022 0.3666 0.3172 -0.1053 -0.0159 -0.0335 40  SER A CA  
317  C C   . SER A 58  ? 0.3887 0.3732 0.3149 -0.1023 -0.0197 -0.0259 40  SER A C   
318  O O   . SER A 58  ? 0.3595 0.3602 0.2885 -0.0979 -0.0251 -0.0220 40  SER A O   
319  C CB  . SER A 58  ? 0.4195 0.3899 0.3307 -0.1184 -0.0172 -0.0421 40  SER A CB  
320  O OG  . SER A 58  ? 0.4590 0.4085 0.3609 -0.1214 -0.0123 -0.0502 40  SER A OG  
321  N N   . LEU A 59  ? 0.3822 0.3649 0.3148 -0.1049 -0.0165 -0.0239 41  LEU A N   
322  C CA  . LEU A 59  ? 0.3672 0.3678 0.3115 -0.1020 -0.0186 -0.0177 41  LEU A CA  
323  C C   . LEU A 59  ? 0.3664 0.3697 0.3164 -0.1120 -0.0154 -0.0196 41  LEU A C   
324  O O   . LEU A 59  ? 0.3629 0.3481 0.3091 -0.1142 -0.0096 -0.0201 41  LEU A O   
325  C CB  . LEU A 59  ? 0.3457 0.3390 0.2915 -0.0900 -0.0165 -0.0112 41  LEU A CB  
326  C CG  . LEU A 59  ? 0.3456 0.3553 0.3032 -0.0842 -0.0178 -0.0051 41  LEU A CG  
327  C CD1 . LEU A 59  ? 0.3342 0.3389 0.2907 -0.0721 -0.0181 -0.0002 41  LEU A CD1 
328  C CD2 . LEU A 59  ? 0.3411 0.3499 0.3041 -0.0884 -0.0127 -0.0042 41  LEU A CD2 
329  N N   . ALA A 60  ? 0.3708 0.3975 0.3302 -0.1180 -0.0195 -0.0201 42  ALA A N   
330  C CA  . ALA A 60  ? 0.3771 0.4119 0.3441 -0.1282 -0.0171 -0.0219 42  ALA A CA  
331  C C   . ALA A 60  ? 0.3658 0.4105 0.3442 -0.1213 -0.0151 -0.0154 42  ALA A C   
332  O O   . ALA A 60  ? 0.3346 0.3999 0.3234 -0.1155 -0.0196 -0.0117 42  ALA A O   
333  C CB  . ALA A 60  ? 0.3773 0.4352 0.3499 -0.1379 -0.0231 -0.0260 42  ALA A CB  
334  N N   . MET A 61  ? 0.3835 0.4132 0.3596 -0.1219 -0.0082 -0.0138 43  MET A N   
335  C CA  . MET A 61  ? 0.3771 0.4151 0.3622 -0.1160 -0.0053 -0.0085 43  MET A CA  
336  C C   . MET A 61  ? 0.3758 0.4416 0.3770 -0.1209 -0.0066 -0.0087 43  MET A C   
337  O O   . MET A 61  ? 0.3469 0.4263 0.3585 -0.1131 -0.0066 -0.0049 43  MET A O   
338  C CB  . MET A 61  ? 0.3913 0.4086 0.3692 -0.1172 0.0023  -0.0067 43  MET A CB  
339  C CG  . MET A 61  ? 0.4511 0.4474 0.4180 -0.1074 0.0030  -0.0040 43  MET A CG  
340  S SD  . MET A 61  ? 0.4702 0.4747 0.4421 -0.0924 0.0018  0.0018  43  MET A SD  
341  C CE  . MET A 61  ? 0.5122 0.5210 0.4892 -0.0955 0.0088  0.0044  43  MET A CE  
342  N N   . GLU A 62  ? 0.3782 0.4535 0.3825 -0.1335 -0.0079 -0.0135 44  GLU A N   
343  C CA  . GLU A 62  ? 0.4051 0.5102 0.4267 -0.1384 -0.0099 -0.0139 44  GLU A CA  
344  C C   . GLU A 62  ? 0.3795 0.5082 0.4122 -0.1295 -0.0180 -0.0109 44  GLU A C   
345  O O   . GLU A 62  ? 0.3828 0.5360 0.4322 -0.1288 -0.0192 -0.0094 44  GLU A O   
346  C CB  . GLU A 62  ? 0.4245 0.5357 0.4470 -0.1548 -0.0102 -0.0201 44  GLU A CB  
347  C CG  . GLU A 62  ? 0.4844 0.6000 0.5017 -0.1590 -0.0176 -0.0244 44  GLU A CG  
348  C CD  . GLU A 62  ? 0.5216 0.6452 0.5404 -0.1763 -0.0180 -0.0315 44  GLU A CD  
349  O OE1 . GLU A 62  ? 0.6396 0.7593 0.6613 -0.1859 -0.0114 -0.0333 44  GLU A OE1 
350  O OE2 . GLU A 62  ? 0.6416 0.7766 0.6588 -0.1809 -0.0250 -0.0354 44  GLU A OE2 
351  N N   . LYS A 63  ? 0.3695 0.4909 0.3937 -0.1224 -0.0231 -0.0096 45  LYS A N   
352  C CA  . LYS A 63  ? 0.3698 0.5108 0.4030 -0.1138 -0.0309 -0.0055 45  LYS A CA  
353  C C   . LYS A 63  ? 0.3392 0.4778 0.3776 -0.0990 -0.0291 0.0005  45  LYS A C   
354  O O   . LYS A 63  ? 0.3229 0.4778 0.3719 -0.0909 -0.0344 0.0047  45  LYS A O   
355  C CB  . LYS A 63  ? 0.3856 0.5207 0.4062 -0.1142 -0.0371 -0.0068 45  LYS A CB  
356  C CG  . LYS A 63  ? 0.4272 0.5704 0.4440 -0.1285 -0.0408 -0.0133 45  LYS A CG  
357  C CD  . LYS A 63  ? 0.4420 0.5793 0.4450 -0.1274 -0.0464 -0.0144 45  LYS A CD  
358  C CE  . LYS A 63  ? 0.5208 0.6771 0.5233 -0.1386 -0.0537 -0.0187 45  LYS A CE  
359  N NZ  . LYS A 63  ? 0.5807 0.7204 0.5673 -0.1505 -0.0510 -0.0281 45  LYS A NZ  
360  N N   . ILE A 64  ? 0.3252 0.4428 0.3557 -0.0957 -0.0218 0.0009  46  ILE A N   
361  C CA  . ILE A 64  ? 0.3135 0.4280 0.3480 -0.0832 -0.0193 0.0053  46  ILE A CA  
362  C C   . ILE A 64  ? 0.3066 0.4410 0.3589 -0.0824 -0.0160 0.0060  46  ILE A C   
363  O O   . ILE A 64  ? 0.3149 0.4494 0.3687 -0.0903 -0.0098 0.0035  46  ILE A O   
364  C CB  . ILE A 64  ? 0.3098 0.3975 0.3299 -0.0808 -0.0130 0.0054  46  ILE A CB  
365  C CG1 . ILE A 64  ? 0.3272 0.3963 0.3315 -0.0805 -0.0158 0.0044  46  ILE A CG1 
366  C CG2 . ILE A 64  ? 0.2870 0.3730 0.3112 -0.0693 -0.0100 0.0090  46  ILE A CG2 
367  C CD1 . ILE A 64  ? 0.2948 0.3705 0.2994 -0.0731 -0.0232 0.0069  46  ILE A CD1 
368  N N   . LYS A 65  ? 0.3010 0.4513 0.3668 -0.0726 -0.0196 0.0095  47  LYS A N   
369  C CA  . LYS A 65  ? 0.2976 0.4673 0.3821 -0.0697 -0.0162 0.0098  47  LYS A CA  
370  C C   . LYS A 65  ? 0.2765 0.4382 0.3630 -0.0588 -0.0103 0.0114  47  LYS A C   
371  O O   . LYS A 65  ? 0.2739 0.4482 0.3734 -0.0578 -0.0048 0.0100  47  LYS A O   
372  C CB  . LYS A 65  ? 0.3088 0.5055 0.4112 -0.0666 -0.0242 0.0121  47  LYS A CB  
373  C CG  . LYS A 65  ? 0.3620 0.5683 0.4616 -0.0764 -0.0317 0.0108  47  LYS A CG  
374  C CD  . LYS A 65  ? 0.4144 0.6278 0.5160 -0.0910 -0.0276 0.0054  47  LYS A CD  
375  C CE  . LYS A 65  ? 0.4360 0.6528 0.5300 -0.1025 -0.0340 0.0025  47  LYS A CE  
376  N NZ  . LYS A 65  ? 0.4760 0.6896 0.5669 -0.1172 -0.0279 -0.0033 47  LYS A NZ  
377  N N   . CYS A 66  ? 0.2775 0.4200 0.3519 -0.0512 -0.0115 0.0136  48  CYS A N   
378  C CA  . CYS A 66  ? 0.2735 0.4062 0.3472 -0.0415 -0.0067 0.0147  48  CYS A CA  
379  C C   . CYS A 66  ? 0.2592 0.3656 0.3124 -0.0419 -0.0045 0.0146  48  CYS A C   
380  O O   . CYS A 66  ? 0.2823 0.3779 0.3247 -0.0421 -0.0093 0.0158  48  CYS A O   
381  C CB  . CYS A 66  ? 0.2754 0.4135 0.3585 -0.0292 -0.0116 0.0184  48  CYS A CB  
382  S SG  . CYS A 66  ? 0.3805 0.5484 0.4883 -0.0256 -0.0163 0.0202  48  CYS A SG  
383  N N   . PHE A 67  ? 0.2513 0.3482 0.2994 -0.0418 0.0029  0.0133  49  PHE A N   
384  C CA  . PHE A 67  ? 0.2389 0.3123 0.2693 -0.0404 0.0049  0.0139  49  PHE A CA  
385  C C   . PHE A 67  ? 0.2293 0.2985 0.2611 -0.0299 0.0066  0.0148  49  PHE A C   
386  O O   . PHE A 67  ? 0.2317 0.3090 0.2719 -0.0276 0.0119  0.0131  49  PHE A O   
387  C CB  . PHE A 67  ? 0.2606 0.3257 0.2825 -0.0486 0.0117  0.0125  49  PHE A CB  
388  C CG  . PHE A 67  ? 0.2798 0.3472 0.3003 -0.0600 0.0110  0.0111  49  PHE A CG  
389  C CD1 . PHE A 67  ? 0.2983 0.3488 0.3052 -0.0642 0.0085  0.0112  49  PHE A CD1 
390  C CD2 . PHE A 67  ? 0.2877 0.3742 0.3210 -0.0665 0.0132  0.0092  49  PHE A CD2 
391  C CE1 . PHE A 67  ? 0.3247 0.3752 0.3298 -0.0752 0.0084  0.0091  49  PHE A CE1 
392  C CE2 . PHE A 67  ? 0.3223 0.4108 0.3544 -0.0782 0.0126  0.0074  49  PHE A CE2 
393  C CZ  . PHE A 67  ? 0.3240 0.3933 0.3413 -0.0826 0.0102  0.0072  49  PHE A CZ  
394  N N   . GLY A 68  ? 0.2247 0.2813 0.2483 -0.0242 0.0027  0.0167  50  GLY A N   
395  C CA  . GLY A 68  ? 0.2285 0.2803 0.2535 -0.0148 0.0037  0.0173  50  GLY A CA  
396  C C   . GLY A 68  ? 0.2338 0.2662 0.2423 -0.0149 0.0059  0.0173  50  GLY A C   
397  O O   . GLY A 68  ? 0.2368 0.2585 0.2341 -0.0190 0.0038  0.0181  50  GLY A O   
398  N N   . PHE A 69  ? 0.2250 0.2539 0.2327 -0.0107 0.0105  0.0158  51  PHE A N   
399  C CA  . PHE A 69  ? 0.2535 0.2667 0.2468 -0.0106 0.0126  0.0158  51  PHE A CA  
400  C C   . PHE A 69  ? 0.2649 0.2734 0.2586 -0.0027 0.0122  0.0153  51  PHE A C   
401  O O   . PHE A 69  ? 0.2865 0.3030 0.2917 0.0025  0.0135  0.0138  51  PHE A O   
402  C CB  . PHE A 69  ? 0.2657 0.2787 0.2540 -0.0155 0.0196  0.0141  51  PHE A CB  
403  C CG  . PHE A 69  ? 0.2758 0.2883 0.2597 -0.0245 0.0208  0.0151  51  PHE A CG  
404  C CD1 . PHE A 69  ? 0.3028 0.2998 0.2720 -0.0283 0.0202  0.0173  51  PHE A CD1 
405  C CD2 . PHE A 69  ? 0.2622 0.2895 0.2571 -0.0292 0.0227  0.0137  51  PHE A CD2 
406  C CE1 . PHE A 69  ? 0.3172 0.3116 0.2825 -0.0368 0.0217  0.0183  51  PHE A CE1 
407  C CE2 . PHE A 69  ? 0.3028 0.3289 0.2937 -0.0384 0.0242  0.0144  51  PHE A CE2 
408  C CZ  . PHE A 69  ? 0.3065 0.3150 0.2820 -0.0424 0.0239  0.0167  51  PHE A CZ  
409  N N   . ASN A 70  ? 0.2751 0.2701 0.2569 -0.0018 0.0103  0.0165  52  ASN A N   
410  C CA  . ASN A 70  ? 0.2812 0.2697 0.2602 0.0035  0.0109  0.0154  52  ASN A CA  
411  C C   . ASN A 70  ? 0.2832 0.2671 0.2528 0.0007  0.0160  0.0135  52  ASN A C   
412  O O   . ASN A 70  ? 0.2821 0.2647 0.2454 -0.0051 0.0177  0.0146  52  ASN A O   
413  C CB  . ASN A 70  ? 0.3097 0.2883 0.2811 0.0048  0.0057  0.0179  52  ASN A CB  
414  C CG  . ASN A 70  ? 0.3412 0.3125 0.3085 0.0088  0.0057  0.0171  52  ASN A CG  
415  O OD1 . ASN A 70  ? 0.3359 0.2985 0.2925 0.0076  0.0056  0.0173  52  ASN A OD1 
416  N ND2 . ASN A 70  ? 0.3860 0.3607 0.3622 0.0138  0.0058  0.0161  52  ASN A ND2 
417  N N   . MET A 71  ? 0.2874 0.2690 0.2558 0.0042  0.0185  0.0107  53  MET A N   
418  C CA  . MET A 71  ? 0.3002 0.2781 0.2579 0.0012  0.0228  0.0090  53  MET A CA  
419  C C   . MET A 71  ? 0.3068 0.2730 0.2507 0.0007  0.0196  0.0112  53  MET A C   
420  O O   . MET A 71  ? 0.2975 0.2587 0.2315 -0.0035 0.0192  0.0142  53  MET A O   
421  C CB  . MET A 71  ? 0.3081 0.2907 0.2708 0.0041  0.0279  0.0035  53  MET A CB  
422  C CG  . MET A 71  ? 0.3142 0.2961 0.2655 -0.0006 0.0332  0.0013  53  MET A CG  
423  S SD  . MET A 71  ? 0.3608 0.3487 0.3165 0.0014  0.0407  -0.0069 53  MET A SD  
424  C CE  . MET A 71  ? 0.3275 0.3058 0.2827 0.0073  0.0368  -0.0089 53  MET A CE  
425  N N   A ASP A 72  ? 0.3041 0.2660 0.2479 0.0051  0.0174  0.0100  54  ASP A N   
426  N N   B ASP A 72  ? 0.3117 0.2736 0.2554 0.0050  0.0174  0.0099  54  ASP A N   
427  C CA  A ASP A 72  ? 0.3100 0.2633 0.2418 0.0047  0.0148  0.0114  54  ASP A CA  
428  C CA  B ASP A 72  ? 0.3221 0.2756 0.2539 0.0047  0.0150  0.0112  54  ASP A CA  
429  C C   A ASP A 72  ? 0.3085 0.2556 0.2362 0.0042  0.0099  0.0159  54  ASP A C   
430  C C   B ASP A 72  ? 0.3162 0.2632 0.2438 0.0043  0.0099  0.0158  54  ASP A C   
431  O O   A ASP A 72  ? 0.3156 0.2630 0.2495 0.0061  0.0070  0.0170  54  ASP A O   
432  O O   B ASP A 72  ? 0.3224 0.2697 0.2563 0.0064  0.0070  0.0168  54  ASP A O   
433  C CB  A ASP A 72  ? 0.3097 0.2609 0.2427 0.0084  0.0142  0.0082  54  ASP A CB  
434  C CB  B ASP A 72  ? 0.3340 0.2857 0.2677 0.0085  0.0146  0.0077  54  ASP A CB  
435  C CG  A ASP A 72  ? 0.3045 0.2582 0.2340 0.0071  0.0191  0.0032  54  ASP A CG  
436  C CG  B ASP A 72  ? 0.3617 0.3182 0.2983 0.0086  0.0204  0.0020  54  ASP A CG  
437  O OD1 A ASP A 72  ? 0.2928 0.2500 0.2172 0.0030  0.0229  0.0031  54  ASP A OD1 
438  O OD1 B ASP A 72  ? 0.4405 0.3974 0.3675 0.0051  0.0234  0.0001  54  ASP A OD1 
439  O OD2 A ASP A 72  ? 0.1854 0.1373 0.1166 0.0094  0.0196  -0.0007 54  ASP A OD2 
440  O OD2 B ASP A 72  ? 0.4125 0.3725 0.3609 0.0122  0.0222  -0.0007 54  ASP A OD2 
441  N N   . TYR A 73  ? 0.3164 0.2579 0.2333 0.0017  0.0092  0.0186  55  TYR A N   
442  C CA  . TYR A 73  ? 0.3265 0.2608 0.2390 0.0011  0.0057  0.0227  55  TYR A CA  
443  C C   . TYR A 73  ? 0.3305 0.2653 0.2470 -0.0019 0.0061  0.0240  55  TYR A C   
444  O O   . TYR A 73  ? 0.3596 0.2882 0.2744 -0.0021 0.0034  0.0261  55  TYR A O   
445  C CB  . TYR A 73  ? 0.3210 0.2515 0.2341 0.0053  0.0013  0.0229  55  TYR A CB  
446  C CG  . TYR A 73  ? 0.3020 0.2301 0.2079 0.0065  -0.0001 0.0231  55  TYR A CG  
447  C CD1 . TYR A 73  ? 0.3343 0.2575 0.2310 0.0050  -0.0013 0.0269  55  TYR A CD1 
448  C CD2 . TYR A 73  ? 0.2968 0.2273 0.2052 0.0090  -0.0008 0.0200  55  TYR A CD2 
449  C CE1 . TYR A 73  ? 0.3339 0.2566 0.2241 0.0062  -0.0036 0.0277  55  TYR A CE1 
450  C CE2 . TYR A 73  ? 0.3089 0.2387 0.2106 0.0093  -0.0026 0.0198  55  TYR A CE2 
451  C CZ  . TYR A 73  ? 0.3042 0.2310 0.1971 0.0081  -0.0044 0.0238  55  TYR A CZ  
452  O OH  . TYR A 73  ? 0.3390 0.2670 0.2258 0.0085  -0.0071 0.0240  55  TYR A OH  
453  N N   . THR A 74  ? 0.3192 0.2619 0.2414 -0.0046 0.0098  0.0223  56  THR A N   
454  C CA  . THR A 74  ? 0.3115 0.2568 0.2378 -0.0089 0.0107  0.0231  56  THR A CA  
455  C C   . THR A 74  ? 0.3178 0.2656 0.2403 -0.0144 0.0157  0.0236  56  THR A C   
456  O O   . THR A 74  ? 0.3306 0.2704 0.2444 -0.0183 0.0160  0.0270  56  THR A O   
457  C CB  . THR A 74  ? 0.2901 0.2451 0.2291 -0.0070 0.0094  0.0210  56  THR A CB  
458  O OG1 . THR A 74  ? 0.2884 0.2396 0.2280 -0.0029 0.0048  0.0214  56  THR A OG1 
459  C CG2 . THR A 74  ? 0.3045 0.2637 0.2476 -0.0122 0.0097  0.0214  56  THR A CG2 
460  N N   . LEU A 75  ? 0.3132 0.2714 0.2417 -0.0146 0.0199  0.0204  57  LEU A N   
461  C CA  . LEU A 75  ? 0.3266 0.2885 0.2506 -0.0200 0.0257  0.0203  57  LEU A CA  
462  C C   . LEU A 75  ? 0.3332 0.2890 0.2439 -0.0201 0.0267  0.0213  57  LEU A C   
463  O O   . LEU A 75  ? 0.3441 0.2961 0.2445 -0.0254 0.0289  0.0247  57  LEU A O   
464  C CB  . LEU A 75  ? 0.3261 0.3024 0.2622 -0.0197 0.0306  0.0155  57  LEU A CB  
465  C CG  . LEU A 75  ? 0.3389 0.3246 0.2884 -0.0212 0.0299  0.0150  57  LEU A CG  
466  C CD1 . LEU A 75  ? 0.3632 0.3643 0.3277 -0.0182 0.0338  0.0103  57  LEU A CD1 
467  C CD2 . LEU A 75  ? 0.3587 0.3433 0.3041 -0.0297 0.0318  0.0176  57  LEU A CD2 
468  N N   . ALA A 76  ? 0.3222 0.2775 0.2331 -0.0146 0.0248  0.0188  58  ALA A N   
469  C CA  . ALA A 76  ? 0.3245 0.2763 0.2239 -0.0145 0.0250  0.0188  58  ALA A CA  
470  C C   . ALA A 76  ? 0.3330 0.2752 0.2273 -0.0110 0.0184  0.0224  58  ALA A C   
471  O O   . ALA A 76  ? 0.3165 0.2584 0.2160 -0.0062 0.0154  0.0201  58  ALA A O   
472  C CB  . ALA A 76  ? 0.3207 0.2793 0.2249 -0.0116 0.0281  0.0121  58  ALA A CB  
473  N N   . VAL A 77  ? 0.3558 0.2901 0.2405 -0.0136 0.0163  0.0281  59  VAL A N   
474  C CA  . VAL A 77  ? 0.3471 0.2729 0.2276 -0.0101 0.0105  0.0318  59  VAL A CA  
475  C C   . VAL A 77  ? 0.3535 0.2793 0.2233 -0.0100 0.0092  0.0329  59  VAL A C   
476  O O   . VAL A 77  ? 0.3554 0.2806 0.2148 -0.0144 0.0112  0.0361  59  VAL A O   
477  C CB  . VAL A 77  ? 0.3629 0.2791 0.2410 -0.0119 0.0087  0.0373  59  VAL A CB  
478  C CG1 . VAL A 77  ? 0.3713 0.2791 0.2459 -0.0072 0.0030  0.0409  59  VAL A CG1 
479  C CG2 . VAL A 77  ? 0.3509 0.2686 0.2398 -0.0123 0.0093  0.0349  59  VAL A CG2 
480  N N   . TYR A 78  ? 0.3389 0.2660 0.2108 -0.0056 0.0060  0.0303  60  TYR A N   
481  C CA  . TYR A 78  ? 0.3469 0.2760 0.2095 -0.0060 0.0043  0.0302  60  TYR A CA  
482  C C   . TYR A 78  ? 0.3648 0.2873 0.2198 -0.0047 -0.0013 0.0376  60  TYR A C   
483  O O   . TYR A 78  ? 0.3575 0.2746 0.2177 -0.0010 -0.0048 0.0400  60  TYR A O   
484  C CB  . TYR A 78  ? 0.3451 0.2784 0.2135 -0.0027 0.0031  0.0242  60  TYR A CB  
485  C CG  . TYR A 78  ? 0.3263 0.2650 0.2024 -0.0032 0.0087  0.0174  60  TYR A CG  
486  C CD1 . TYR A 78  ? 0.3366 0.2807 0.2073 -0.0069 0.0138  0.0132  60  TYR A CD1 
487  C CD2 . TYR A 78  ? 0.3093 0.2482 0.1979 0.0000  0.0090  0.0154  60  TYR A CD2 
488  C CE1 . TYR A 78  ? 0.3536 0.3026 0.2328 -0.0066 0.0193  0.0067  60  TYR A CE1 
489  C CE2 . TYR A 78  ? 0.3500 0.2940 0.2471 0.0004  0.0137  0.0100  60  TYR A CE2 
490  C CZ  . TYR A 78  ? 0.3520 0.3010 0.2451 -0.0026 0.0191  0.0054  60  TYR A CZ  
491  O OH  . TYR A 78  ? 0.3726 0.3268 0.2758 -0.0014 0.0244  -0.0004 60  TYR A OH  
492  N N   . LYS A 79  ? 0.3807 0.3042 0.2235 -0.0077 -0.0020 0.0410  61  LYS A N   
493  C CA  . LYS A 79  ? 0.3945 0.3120 0.2297 -0.0063 -0.0075 0.0493  61  LYS A CA  
494  C C   . LYS A 79  ? 0.3970 0.3164 0.2358 -0.0009 -0.0138 0.0490  61  LYS A C   
495  O O   . LYS A 79  ? 0.3899 0.3168 0.2304 -0.0007 -0.0140 0.0431  61  LYS A O   
496  C CB  . LYS A 79  ? 0.4138 0.3333 0.2340 -0.0117 -0.0066 0.0535  61  LYS A CB  
497  C CG  . LYS A 79  ? 0.4231 0.3386 0.2390 -0.0172 -0.0013 0.0568  61  LYS A CG  
498  C CD  . LYS A 79  ? 0.4520 0.3712 0.2523 -0.0236 0.0008  0.0599  61  LYS A CD  
499  C CE  . LYS A 79  ? 0.4581 0.3725 0.2540 -0.0296 0.0060  0.0642  61  LYS A CE  
500  N NZ  . LYS A 79  ? 0.5252 0.4422 0.3037 -0.0362 0.0076  0.0691  61  LYS A NZ  
501  N N   . SER A 80  ? 0.3985 0.3110 0.2391 0.0033  -0.0185 0.0553  62  SER A N   
502  C CA  . SER A 80  ? 0.3988 0.3133 0.2455 0.0091  -0.0242 0.0555  62  SER A CA  
503  C C   . SER A 80  ? 0.4055 0.3186 0.2444 0.0110  -0.0302 0.0641  62  SER A C   
504  O O   . SER A 80  ? 0.4066 0.3110 0.2400 0.0103  -0.0304 0.0715  62  SER A O   
505  C CB  . SER A 80  ? 0.3929 0.3009 0.2511 0.0133  -0.0238 0.0543  62  SER A CB  
506  O OG  . SER A 80  ? 0.3916 0.3015 0.2570 0.0191  -0.0284 0.0543  62  SER A OG  
507  N N   . PRO A 81  ? 0.4013 0.3229 0.2407 0.0135  -0.0355 0.0635  63  PRO A N   
508  C CA  . PRO A 81  ? 0.3801 0.3108 0.2271 0.0141  -0.0355 0.0551  63  PRO A CA  
509  C C   . PRO A 81  ? 0.3751 0.3142 0.2152 0.0083  -0.0329 0.0488  63  PRO A C   
510  O O   . PRO A 81  ? 0.3784 0.3243 0.2235 0.0083  -0.0335 0.0424  63  PRO A O   
511  C CB  . PRO A 81  ? 0.3965 0.3323 0.2474 0.0192  -0.0428 0.0586  63  PRO A CB  
512  C CG  . PRO A 81  ? 0.4267 0.3616 0.2659 0.0185  -0.0472 0.0679  63  PRO A CG  
513  C CD  . PRO A 81  ? 0.4157 0.3386 0.2491 0.0160  -0.0425 0.0721  63  PRO A CD  
514  N N   . GLU A 82  ? 0.3729 0.3115 0.2015 0.0031  -0.0300 0.0504  64  GLU A N   
515  C CA  . GLU A 82  ? 0.3779 0.3246 0.1981 -0.0026 -0.0275 0.0445  64  GLU A CA  
516  C C   . GLU A 82  ? 0.3524 0.3010 0.1816 -0.0033 -0.0222 0.0341  64  GLU A C   
517  O O   . GLU A 82  ? 0.3550 0.3103 0.1841 -0.0050 -0.0227 0.0278  64  GLU A O   
518  C CB  . GLU A 82  ? 0.3980 0.3431 0.2052 -0.0083 -0.0235 0.0476  64  GLU A CB  
519  C CG  . GLU A 82  ? 0.4537 0.3994 0.2475 -0.0095 -0.0292 0.0575  64  GLU A CG  
520  C CD  . GLU A 82  ? 0.5023 0.4369 0.2980 -0.0056 -0.0318 0.0679  64  GLU A CD  
521  O OE1 . GLU A 82  ? 0.5000 0.4271 0.3074 -0.0021 -0.0293 0.0666  64  GLU A OE1 
522  O OE2 . GLU A 82  ? 0.5882 0.5211 0.3728 -0.0065 -0.0361 0.0776  64  GLU A OE2 
523  N N   . TYR A 83  ? 0.3372 0.2800 0.1744 -0.0021 -0.0172 0.0324  65  TYR A N   
524  C CA  . TYR A 83  ? 0.3299 0.2742 0.1763 -0.0022 -0.0123 0.0236  65  TYR A CA  
525  C C   . TYR A 83  ? 0.3178 0.2631 0.1743 0.0016  -0.0155 0.0207  65  TYR A C   
526  O O   . TYR A 83  ? 0.3292 0.2778 0.1885 0.0003  -0.0139 0.0137  65  TYR A O   
527  C CB  . TYR A 83  ? 0.3231 0.2627 0.1760 -0.0017 -0.0072 0.0234  65  TYR A CB  
528  C CG  . TYR A 83  ? 0.3076 0.2491 0.1696 -0.0015 -0.0022 0.0155  65  TYR A CG  
529  C CD1 . TYR A 83  ? 0.3310 0.2768 0.1894 -0.0051 0.0030  0.0093  65  TYR A CD1 
530  C CD2 . TYR A 83  ? 0.3240 0.2627 0.1981 0.0023  -0.0026 0.0146  65  TYR A CD2 
531  C CE1 . TYR A 83  ? 0.3444 0.2909 0.2127 -0.0039 0.0076  0.0024  65  TYR A CE1 
532  C CE2 . TYR A 83  ? 0.3186 0.2585 0.2016 0.0031  0.0015  0.0086  65  TYR A CE2 
533  C CZ  . TYR A 83  ? 0.3198 0.2630 0.2004 0.0004  0.0065  0.0027  65  TYR A CZ  
534  O OH  . TYR A 83  ? 0.3286 0.2721 0.2195 0.0022  0.0104  -0.0028 65  TYR A OH  
535  N N   . GLU A 84  ? 0.3227 0.2651 0.1844 0.0059  -0.0198 0.0257  66  GLU A N   
536  C CA  . GLU A 84  ? 0.3212 0.2659 0.1919 0.0089  -0.0227 0.0233  66  GLU A CA  
537  C C   . GLU A 84  ? 0.3253 0.2782 0.1919 0.0067  -0.0263 0.0205  66  GLU A C   
538  O O   . GLU A 84  ? 0.3237 0.2795 0.1961 0.0059  -0.0258 0.0147  66  GLU A O   
539  C CB  . GLU A 84  ? 0.3327 0.2740 0.2089 0.0139  -0.0264 0.0288  66  GLU A CB  
540  C CG  . GLU A 84  ? 0.3548 0.2884 0.2356 0.0155  -0.0234 0.0305  66  GLU A CG  
541  C CD  . GLU A 84  ? 0.4064 0.3342 0.2805 0.0152  -0.0237 0.0369  66  GLU A CD  
542  O OE1 . GLU A 84  ? 0.4066 0.3351 0.2720 0.0112  -0.0216 0.0376  66  GLU A OE1 
543  O OE2 . GLU A 84  ? 0.4423 0.3645 0.3196 0.0187  -0.0257 0.0411  66  GLU A OE2 
544  N N   A SER A 85  ? 0.3434 0.2999 0.2001 0.0054  -0.0302 0.0251  67  SER A N   
545  N N   B SER A 85  ? 0.3425 0.2991 0.1992 0.0054  -0.0302 0.0250  67  SER A N   
546  C CA  A SER A 85  ? 0.3547 0.3207 0.2060 0.0026  -0.0344 0.0231  67  SER A CA  
547  C CA  B SER A 85  ? 0.3528 0.3190 0.2044 0.0026  -0.0345 0.0229  67  SER A CA  
548  C C   A SER A 85  ? 0.3569 0.3254 0.2049 -0.0030 -0.0296 0.0137  67  SER A C   
549  C C   B SER A 85  ? 0.3579 0.3271 0.2048 -0.0033 -0.0299 0.0139  67  SER A C   
550  O O   A SER A 85  ? 0.3499 0.3235 0.2012 -0.0049 -0.0308 0.0079  67  SER A O   
551  O O   B SER A 85  ? 0.3555 0.3309 0.2033 -0.0059 -0.0317 0.0085  67  SER A O   
552  C CB  A SER A 85  ? 0.3737 0.3430 0.2128 0.0015  -0.0391 0.0304  67  SER A CB  
553  C CB  B SER A 85  ? 0.3703 0.3399 0.2111 0.0023  -0.0399 0.0308  67  SER A CB  
554  O OG  A SER A 85  ? 0.3857 0.3656 0.2233 0.0008  -0.0457 0.0306  67  SER A OG  
555  O OG  B SER A 85  ? 0.3577 0.3240 0.2045 0.0086  -0.0442 0.0386  67  SER A OG  
556  N N   . LEU A 86  ? 0.3616 0.3263 0.2040 -0.0057 -0.0237 0.0117  68  LEU A N   
557  C CA  . LEU A 86  ? 0.3581 0.3240 0.1984 -0.0103 -0.0179 0.0022  68  LEU A CA  
558  C C   . LEU A 86  ? 0.3554 0.3177 0.2087 -0.0085 -0.0150 -0.0042 68  LEU A C   
559  O O   . LEU A 86  ? 0.3525 0.3173 0.2064 -0.0117 -0.0141 -0.0117 68  LEU A O   
560  C CB  . LEU A 86  ? 0.3669 0.3301 0.2015 -0.0125 -0.0114 0.0015  68  LEU A CB  
561  C CG  . LEU A 86  ? 0.3745 0.3388 0.2080 -0.0166 -0.0042 -0.0091 68  LEU A CG  
562  C CD1 . LEU A 86  ? 0.4069 0.3786 0.2288 -0.0226 -0.0058 -0.0146 68  LEU A CD1 
563  C CD2 . LEU A 86  ? 0.3764 0.3387 0.2081 -0.0176 0.0029  -0.0095 68  LEU A CD2 
564  N N   . GLY A 87  ? 0.3327 0.2890 0.1960 -0.0039 -0.0138 -0.0011 69  GLY A N   
565  C CA  . GLY A 87  ? 0.3347 0.2875 0.2096 -0.0020 -0.0121 -0.0050 69  GLY A CA  
566  C C   . GLY A 87  ? 0.3319 0.2888 0.2101 -0.0025 -0.0167 -0.0062 69  GLY A C   
567  O O   . GLY A 87  ? 0.3439 0.3000 0.2262 -0.0047 -0.0148 -0.0124 69  GLY A O   
568  N N   . PHE A 88  ? 0.3252 0.2864 0.2024 -0.0004 -0.0226 -0.0001 70  PHE A N   
569  C CA  . PHE A 88  ? 0.3342 0.3021 0.2153 -0.0008 -0.0274 -0.0008 70  PHE A CA  
570  C C   . PHE A 88  ? 0.3260 0.3003 0.2012 -0.0070 -0.0280 -0.0076 70  PHE A C   
571  O O   . PHE A 88  ? 0.3254 0.3008 0.2061 -0.0097 -0.0274 -0.0131 70  PHE A O   
572  C CB  . PHE A 88  ? 0.3318 0.3043 0.2126 0.0031  -0.0335 0.0070  70  PHE A CB  
573  C CG  . PHE A 88  ? 0.3092 0.2907 0.1963 0.0035  -0.0386 0.0068  70  PHE A CG  
574  C CD1 . PHE A 88  ? 0.3202 0.3010 0.2187 0.0067  -0.0383 0.0072  70  PHE A CD1 
575  C CD2 . PHE A 88  ? 0.3565 0.3486 0.2379 0.0003  -0.0437 0.0062  70  PHE A CD2 
576  C CE1 . PHE A 88  ? 0.3257 0.3162 0.2308 0.0067  -0.0424 0.0066  70  PHE A CE1 
577  C CE2 . PHE A 88  ? 0.3326 0.3352 0.2211 0.0004  -0.0485 0.0058  70  PHE A CE2 
578  C CZ  . PHE A 88  ? 0.3425 0.3444 0.2435 0.0038  -0.0476 0.0059  70  PHE A CZ  
579  N N   A GLU A 89  ? 0.3504 0.3288 0.2136 -0.0100 -0.0291 -0.0072 71  GLU A N   
580  N N   B GLU A 89  ? 0.3486 0.3268 0.2119 -0.0100 -0.0289 -0.0073 71  GLU A N   
581  C CA  A GLU A 89  ? 0.3612 0.3467 0.2163 -0.0168 -0.0299 -0.0140 71  GLU A CA  
582  C CA  B GLU A 89  ? 0.3639 0.3494 0.2191 -0.0167 -0.0299 -0.0140 71  GLU A CA  
583  C C   A GLU A 89  ? 0.3582 0.3379 0.2167 -0.0205 -0.0231 -0.0242 71  GLU A C   
584  C C   B GLU A 89  ? 0.3595 0.3392 0.2177 -0.0206 -0.0231 -0.0243 71  GLU A C   
585  O O   A GLU A 89  ? 0.3558 0.3388 0.2162 -0.0249 -0.0239 -0.0307 71  GLU A O   
586  O O   B GLU A 89  ? 0.3586 0.3418 0.2184 -0.0252 -0.0238 -0.0309 71  GLU A O   
587  C CB  A GLU A 89  ? 0.3738 0.3630 0.2138 -0.0197 -0.0305 -0.0118 71  GLU A CB  
588  C CB  B GLU A 89  ? 0.3766 0.3663 0.2168 -0.0196 -0.0310 -0.0115 71  GLU A CB  
589  C CG  A GLU A 89  ? 0.4034 0.4005 0.2327 -0.0276 -0.0309 -0.0196 71  GLU A CG  
590  C CG  B GLU A 89  ? 0.4040 0.3984 0.2407 -0.0158 -0.0383 -0.0005 71  GLU A CG  
591  C CD  A GLU A 89  ? 0.4239 0.4269 0.2368 -0.0308 -0.0331 -0.0154 71  GLU A CD  
592  C CD  B GLU A 89  ? 0.4261 0.4243 0.2465 -0.0194 -0.0395 0.0029  71  GLU A CD  
593  O OE1 A GLU A 89  ? 0.4884 0.4856 0.2977 -0.0282 -0.0301 -0.0099 71  GLU A OE1 
594  O OE1 B GLU A 89  ? 0.4789 0.4872 0.2903 -0.0246 -0.0435 0.0006  71  GLU A OE1 
595  O OE2 A GLU A 89  ? 0.4597 0.4734 0.2629 -0.0362 -0.0379 -0.0173 71  GLU A OE2 
596  O OE2 B GLU A 89  ? 0.4936 0.4852 0.3097 -0.0177 -0.0366 0.0082  71  GLU A OE2 
597  N N   . LEU A 90  ? 0.3597 0.3304 0.2200 -0.0186 -0.0166 -0.0257 72  LEU A N   
598  C CA  . LEU A 90  ? 0.3507 0.3145 0.2153 -0.0209 -0.0097 -0.0350 72  LEU A CA  
599  C C   . LEU A 90  ? 0.3406 0.2990 0.2180 -0.0193 -0.0094 -0.0363 72  LEU A C   
600  O O   . LEU A 90  ? 0.3308 0.2854 0.2108 -0.0231 -0.0062 -0.0443 72  LEU A O   
601  C CB  . LEU A 90  ? 0.3515 0.3091 0.2165 -0.0183 -0.0033 -0.0352 72  LEU A CB  
602  C CG  . LEU A 90  ? 0.3620 0.3245 0.2136 -0.0217 -0.0013 -0.0362 72  LEU A CG  
603  C CD1 . LEU A 90  ? 0.3570 0.3145 0.2120 -0.0187 0.0054  -0.0358 72  LEU A CD1 
604  C CD2 . LEU A 90  ? 0.3798 0.3466 0.2220 -0.0290 0.0008  -0.0462 72  LEU A CD2 
605  N N   . THR A 91  ? 0.3358 0.2934 0.2204 -0.0143 -0.0125 -0.0286 73  THR A N   
606  C CA  . THR A 91  ? 0.3265 0.2800 0.2220 -0.0132 -0.0124 -0.0286 73  THR A CA  
607  C C   . THR A 91  ? 0.3259 0.2870 0.2214 -0.0181 -0.0165 -0.0317 73  THR A C   
608  O O   . THR A 91  ? 0.3135 0.2707 0.2139 -0.0216 -0.0143 -0.0371 73  THR A O   
609  C CB  . THR A 91  ? 0.3163 0.2683 0.2179 -0.0072 -0.0144 -0.0202 73  THR A CB  
610  O OG1 . THR A 91  ? 0.3173 0.2634 0.2190 -0.0036 -0.0107 -0.0179 73  THR A OG1 
611  C CG2 . THR A 91  ? 0.3035 0.2518 0.2151 -0.0068 -0.0139 -0.0199 73  THR A CG2 
612  N N   . VAL A 92  ? 0.3266 0.2988 0.2167 -0.0186 -0.0225 -0.0284 74  VAL A N   
613  C CA  . VAL A 92  ? 0.3383 0.3211 0.2282 -0.0238 -0.0270 -0.0317 74  VAL A CA  
614  C C   . VAL A 92  ? 0.3508 0.3326 0.2352 -0.0316 -0.0240 -0.0421 74  VAL A C   
615  O O   . VAL A 92  ? 0.3556 0.3378 0.2451 -0.0364 -0.0235 -0.0475 74  VAL A O   
616  C CB  . VAL A 92  ? 0.3433 0.3389 0.2283 -0.0224 -0.0344 -0.0259 74  VAL A CB  
617  C CG1 . VAL A 92  ? 0.3682 0.3767 0.2507 -0.0293 -0.0392 -0.0309 74  VAL A CG1 
618  C CG2 . VAL A 92  ? 0.3210 0.3181 0.2154 -0.0155 -0.0374 -0.0177 74  VAL A CG2 
619  N N   A GLU A 93  ? 0.3552 0.3353 0.2295 -0.0332 -0.0212 -0.0453 75  GLU A N   
620  N N   B GLU A 93  ? 0.3556 0.3359 0.2297 -0.0331 -0.0213 -0.0451 75  GLU A N   
621  C CA  A GLU A 93  ? 0.3714 0.3509 0.2394 -0.0409 -0.0178 -0.0563 75  GLU A CA  
622  C CA  B GLU A 93  ? 0.3687 0.3478 0.2363 -0.0405 -0.0175 -0.0561 75  GLU A CA  
623  C C   A GLU A 93  ? 0.3640 0.3300 0.2406 -0.0419 -0.0108 -0.0631 75  GLU A C   
624  C C   B GLU A 93  ? 0.3620 0.3284 0.2389 -0.0418 -0.0112 -0.0626 75  GLU A C   
625  O O   A GLU A 93  ? 0.3696 0.3346 0.2457 -0.0488 -0.0091 -0.0721 75  GLU A O   
626  O O   B GLU A 93  ? 0.3622 0.3288 0.2395 -0.0486 -0.0104 -0.0707 75  GLU A O   
627  C CB  A GLU A 93  ? 0.3765 0.3577 0.2312 -0.0424 -0.0155 -0.0584 75  GLU A CB  
628  C CB  B GLU A 93  ? 0.3755 0.3536 0.2316 -0.0409 -0.0138 -0.0580 75  GLU A CB  
629  C CG  A GLU A 93  ? 0.3940 0.3891 0.2381 -0.0435 -0.0231 -0.0523 75  GLU A CG  
630  C CG  B GLU A 93  ? 0.3991 0.3725 0.2500 -0.0475 -0.0071 -0.0708 75  GLU A CG  
631  C CD  A GLU A 93  ? 0.4169 0.4137 0.2466 -0.0454 -0.0208 -0.0527 75  GLU A CD  
632  C CD  B GLU A 93  ? 0.4054 0.3799 0.2443 -0.0487 -0.0028 -0.0734 75  GLU A CD  
633  O OE1 A GLU A 93  ? 0.4280 0.4155 0.2576 -0.0439 -0.0131 -0.0559 75  GLU A OE1 
634  O OE1 B GLU A 93  ? 0.3460 0.3133 0.1883 -0.0435 0.0024  -0.0712 75  GLU A OE1 
635  O OE2 A GLU A 93  ? 0.4851 0.4934 0.3035 -0.0484 -0.0269 -0.0494 75  GLU A OE2 
636  O OE2 B GLU A 93  ? 0.4805 0.4640 0.3063 -0.0557 -0.0045 -0.0784 75  GLU A OE2 
637  N N   . ARG A 94  ? 0.3557 0.3113 0.2405 -0.0353 -0.0071 -0.0586 76  ARG A N   
638  C CA  . ARG A 94  ? 0.3597 0.3018 0.2542 -0.0351 -0.0015 -0.0627 76  ARG A CA  
639  C C   . ARG A 94  ? 0.3543 0.2964 0.2566 -0.0381 -0.0040 -0.0622 76  ARG A C   
640  O O   . ARG A 94  ? 0.3541 0.2885 0.2597 -0.0430 -0.0004 -0.0693 76  ARG A O   
641  C CB  . ARG A 94  ? 0.3458 0.2788 0.2473 -0.0270 0.0019  -0.0565 76  ARG A CB  
642  C CG  . ARG A 94  ? 0.3570 0.2763 0.2694 -0.0252 0.0065  -0.0578 76  ARG A CG  
643  C CD  . ARG A 94  ? 0.4237 0.3337 0.3365 -0.0293 0.0127  -0.0687 76  ARG A CD  
644  N NE  . ARG A 94  ? 0.3963 0.2920 0.3201 -0.0269 0.0165  -0.0683 76  ARG A NE  
645  C CZ  . ARG A 94  ? 0.4280 0.3118 0.3552 -0.0291 0.0225  -0.0768 76  ARG A CZ  
646  N NH1 . ARG A 94  ? 0.4509 0.3358 0.3712 -0.0338 0.0260  -0.0875 76  ARG A NH1 
647  N NH2 . ARG A 94  ? 0.4753 0.3457 0.4128 -0.0264 0.0251  -0.0745 76  ARG A NH2 
648  N N   . LEU A 95  ? 0.3522 0.3029 0.2574 -0.0355 -0.0096 -0.0542 77  LEU A N   
649  C CA  . LEU A 95  ? 0.3515 0.3053 0.2639 -0.0389 -0.0119 -0.0537 77  LEU A CA  
650  C C   . LEU A 95  ? 0.3618 0.3237 0.2707 -0.0482 -0.0140 -0.0620 77  LEU A C   
651  O O   . LEU A 95  ? 0.3615 0.3192 0.2758 -0.0541 -0.0120 -0.0667 77  LEU A O   
652  C CB  . LEU A 95  ? 0.3367 0.3000 0.2528 -0.0339 -0.0171 -0.0444 77  LEU A CB  
653  C CG  . LEU A 95  ? 0.3374 0.2928 0.2589 -0.0264 -0.0152 -0.0367 77  LEU A CG  
654  C CD1 . LEU A 95  ? 0.3112 0.2767 0.2349 -0.0219 -0.0201 -0.0293 77  LEU A CD1 
655  C CD2 . LEU A 95  ? 0.3099 0.2537 0.2392 -0.0276 -0.0110 -0.0370 77  LEU A CD2 
656  N N   . VAL A 96  ? 0.3852 0.3592 0.2847 -0.0503 -0.0181 -0.0635 78  VAL A N   
657  C CA  . VAL A 96  ? 0.3887 0.3721 0.2833 -0.0596 -0.0205 -0.0717 78  VAL A CA  
658  C C   . VAL A 96  ? 0.4134 0.3835 0.3057 -0.0657 -0.0133 -0.0831 78  VAL A C   
659  O O   . VAL A 96  ? 0.4062 0.3759 0.3011 -0.0738 -0.0126 -0.0904 78  VAL A O   
660  C CB  . VAL A 96  ? 0.3899 0.3890 0.2734 -0.0605 -0.0269 -0.0703 78  VAL A CB  
661  C CG1 . VAL A 96  ? 0.3925 0.4021 0.2698 -0.0716 -0.0295 -0.0802 78  VAL A CG1 
662  C CG2 . VAL A 96  ? 0.3709 0.3831 0.2589 -0.0546 -0.0345 -0.0595 78  VAL A CG2 
663  N N   . SER A 97  ? 0.4228 0.3820 0.3115 -0.0619 -0.0077 -0.0849 79  SER A N   
664  C CA  . SER A 97  ? 0.4533 0.3997 0.3407 -0.0668 -0.0002 -0.0963 79  SER A CA  
665  C C   . SER A 97  ? 0.4511 0.3823 0.3503 -0.0679 0.0042  -0.0981 79  SER A C   
666  O O   . SER A 97  ? 0.4780 0.4011 0.3773 -0.0751 0.0084  -0.1085 79  SER A O   
667  C CB  . SER A 97  ? 0.4505 0.3897 0.3329 -0.0620 0.0055  -0.0982 79  SER A CB  
668  O OG  . SER A 97  ? 0.5314 0.4571 0.4241 -0.0543 0.0098  -0.0934 79  SER A OG  
669  N N   . ILE A 98  ? 0.4512 0.3788 0.3597 -0.0618 0.0030  -0.0882 80  ILE A N   
670  C CA  . ILE A 98  ? 0.4598 0.3739 0.3783 -0.0633 0.0064  -0.0880 80  ILE A CA  
671  C C   . ILE A 98  ? 0.4644 0.3871 0.3868 -0.0706 0.0024  -0.0877 80  ILE A C   
672  O O   . ILE A 98  ? 0.4792 0.3915 0.4093 -0.0733 0.0051  -0.0870 80  ILE A O   
673  C CB  . ILE A 98  ? 0.4548 0.3588 0.3811 -0.0537 0.0082  -0.0779 80  ILE A CB  
674  C CG1 . ILE A 98  ? 0.4290 0.3454 0.3566 -0.0488 0.0023  -0.0670 80  ILE A CG1 
675  C CG2 . ILE A 98  ? 0.4773 0.3723 0.4023 -0.0473 0.0131  -0.0794 80  ILE A CG2 
676  C CD1 . ILE A 98  ? 0.4528 0.3610 0.3886 -0.0436 0.0033  -0.0581 80  ILE A CD1 
677  N N   . GLY A 99  ? 0.4523 0.3943 0.3701 -0.0739 -0.0041 -0.0876 81  GLY A N   
678  C CA  . GLY A 99  ? 0.4493 0.4018 0.3712 -0.0822 -0.0076 -0.0898 81  GLY A CA  
679  C C   . GLY A 99  ? 0.4290 0.3998 0.3548 -0.0792 -0.0145 -0.0813 81  GLY A C   
680  O O   . GLY A 99  ? 0.4222 0.4042 0.3529 -0.0861 -0.0174 -0.0831 81  GLY A O   
681  N N   . TYR A 100 ? 0.4059 0.3806 0.3302 -0.0695 -0.0170 -0.0726 82  TYR A N   
682  C CA  . TYR A 100 ? 0.3939 0.3858 0.3220 -0.0656 -0.0235 -0.0650 82  TYR A CA  
683  C C   . TYR A 100 ? 0.3979 0.4092 0.3208 -0.0704 -0.0303 -0.0686 82  TYR A C   
684  O O   . TYR A 100 ? 0.3933 0.4044 0.3064 -0.0750 -0.0301 -0.0755 82  TYR A O   
685  C CB  . TYR A 100 ? 0.3840 0.3734 0.3115 -0.0544 -0.0242 -0.0555 82  TYR A CB  
686  C CG  . TYR A 100 ? 0.3809 0.3596 0.3162 -0.0500 -0.0204 -0.0497 82  TYR A CG  
687  C CD1 . TYR A 100 ? 0.3779 0.3382 0.3143 -0.0502 -0.0141 -0.0513 82  TYR A CD1 
688  C CD2 . TYR A 100 ? 0.4006 0.3883 0.3426 -0.0460 -0.0231 -0.0429 82  TYR A CD2 
689  C CE1 . TYR A 100 ? 0.3627 0.3144 0.3054 -0.0468 -0.0114 -0.0452 82  TYR A CE1 
690  C CE2 . TYR A 100 ? 0.3856 0.3649 0.3332 -0.0431 -0.0197 -0.0380 82  TYR A CE2 
691  C CZ  . TYR A 100 ? 0.3922 0.3541 0.3397 -0.0437 -0.0143 -0.0386 82  TYR A CZ  
692  O OH  . TYR A 100 ? 0.3995 0.3548 0.3517 -0.0409 -0.0118 -0.0326 82  TYR A OH  
693  N N   . PRO A 101 ? 0.3869 0.4157 0.3167 -0.0701 -0.0361 -0.0645 83  PRO A N   
694  C CA  . PRO A 101 ? 0.4042 0.4533 0.3307 -0.0750 -0.0434 -0.0674 83  PRO A CA  
695  C C   . PRO A 101 ? 0.4069 0.4614 0.3217 -0.0705 -0.0479 -0.0644 83  PRO A C   
696  O O   . PRO A 101 ? 0.3918 0.4397 0.3043 -0.0615 -0.0473 -0.0571 83  PRO A O   
697  C CB  . PRO A 101 ? 0.4010 0.4672 0.3398 -0.0725 -0.0484 -0.0617 83  PRO A CB  
698  C CG  . PRO A 101 ? 0.3752 0.4302 0.3220 -0.0668 -0.0433 -0.0564 83  PRO A CG  
699  C CD  . PRO A 101 ? 0.3787 0.4103 0.3199 -0.0655 -0.0360 -0.0576 83  PRO A CD  
700  N N   . GLN A 102 ? 0.4389 0.5066 0.3462 -0.0775 -0.0528 -0.0697 84  GLN A N   
701  C CA  . GLN A 102 ? 0.4498 0.5235 0.3439 -0.0753 -0.0572 -0.0672 84  GLN A CA  
702  C C   . GLN A 102 ? 0.4409 0.5249 0.3375 -0.0653 -0.0640 -0.0551 84  GLN A C   
703  O O   . GLN A 102 ? 0.4319 0.5141 0.3181 -0.0608 -0.0656 -0.0501 84  GLN A O   
704  C CB  . GLN A 102 ? 0.4923 0.5811 0.3782 -0.0862 -0.0621 -0.0753 84  GLN A CB  
705  C CG  . GLN A 102 ? 0.5524 0.6293 0.4323 -0.0967 -0.0550 -0.0888 84  GLN A CG  
706  C CD  . GLN A 102 ? 0.6443 0.7059 0.5111 -0.0951 -0.0488 -0.0919 84  GLN A CD  
707  O OE1 . GLN A 102 ? 0.7008 0.7694 0.5554 -0.0933 -0.0525 -0.0886 84  GLN A OE1 
708  N NE2 . GLN A 102 ? 0.6693 0.7104 0.5386 -0.0963 -0.0393 -0.0984 84  GLN A NE2 
709  N N   . GLU A 103 ? 0.4283 0.5222 0.3389 -0.0616 -0.0672 -0.0502 85  GLU A N   
710  C CA  . GLU A 103 ? 0.4283 0.5312 0.3434 -0.0513 -0.0732 -0.0391 85  GLU A CA  
711  C C   . GLU A 103 ? 0.4205 0.5065 0.3333 -0.0417 -0.0689 -0.0321 85  GLU A C   
712  O O   . GLU A 103 ? 0.4338 0.5237 0.3456 -0.0337 -0.0735 -0.0232 85  GLU A O   
713  C CB  . GLU A 103 ? 0.4261 0.5425 0.3583 -0.0490 -0.0761 -0.0366 85  GLU A CB  
714  C CG  . GLU A 103 ? 0.4666 0.6051 0.4033 -0.0570 -0.0826 -0.0413 85  GLU A CG  
715  C CD  . GLU A 103 ? 0.5197 0.6559 0.4621 -0.0678 -0.0772 -0.0513 85  GLU A CD  
716  O OE1 . GLU A 103 ? 0.5298 0.6456 0.4675 -0.0710 -0.0689 -0.0562 85  GLU A OE1 
717  O OE2 . GLU A 103 ? 0.5730 0.7282 0.5253 -0.0730 -0.0815 -0.0540 85  GLU A OE2 
718  N N   . LEU A 104 ? 0.3956 0.4631 0.3079 -0.0423 -0.0603 -0.0356 86  LEU A N   
719  C CA  . LEU A 104 ? 0.3835 0.4354 0.2921 -0.0347 -0.0561 -0.0302 86  LEU A CA  
720  C C   . LEU A 104 ? 0.3895 0.4410 0.2837 -0.0334 -0.0584 -0.0273 86  LEU A C   
721  O O   . LEU A 104 ? 0.3781 0.4234 0.2703 -0.0262 -0.0582 -0.0200 86  LEU A O   
722  C CB  . LEU A 104 ? 0.3755 0.4093 0.2843 -0.0371 -0.0472 -0.0356 86  LEU A CB  
723  C CG  . LEU A 104 ? 0.3762 0.4032 0.2968 -0.0338 -0.0434 -0.0333 86  LEU A CG  
724  C CD1 . LEU A 104 ? 0.3645 0.4034 0.2952 -0.0387 -0.0455 -0.0360 86  LEU A CD1 
725  C CD2 . LEU A 104 ? 0.3674 0.3755 0.2868 -0.0348 -0.0354 -0.0367 86  LEU A CD2 
726  N N   . LEU A 105 ? 0.4063 0.4643 0.2902 -0.0412 -0.0603 -0.0333 87  LEU A N   
727  C CA  . LEU A 105 ? 0.4249 0.4843 0.2938 -0.0413 -0.0625 -0.0307 87  LEU A CA  
728  C C   . LEU A 105 ? 0.4314 0.5031 0.2996 -0.0352 -0.0716 -0.0197 87  LEU A C   
729  O O   . LEU A 105 ? 0.4587 0.5295 0.3150 -0.0336 -0.0735 -0.0145 87  LEU A O   
730  C CB  . LEU A 105 ? 0.4421 0.5067 0.2993 -0.0520 -0.0623 -0.0406 87  LEU A CB  
731  C CG  . LEU A 105 ? 0.4223 0.4735 0.2799 -0.0581 -0.0531 -0.0523 87  LEU A CG  
732  C CD1 . LEU A 105 ? 0.4742 0.5329 0.3205 -0.0695 -0.0536 -0.0633 87  LEU A CD1 
733  C CD2 . LEU A 105 ? 0.4094 0.4430 0.2641 -0.0531 -0.0452 -0.0512 87  LEU A CD2 
734  N N   . SER A 106 ? 0.4265 0.5093 0.3076 -0.0317 -0.0768 -0.0159 88  SER A N   
735  C CA  . SER A 106 ? 0.4243 0.5175 0.3075 -0.0242 -0.0852 -0.0050 88  SER A CA  
736  C C   . SER A 106 ? 0.4135 0.4933 0.3023 -0.0138 -0.0821 0.0032  88  SER A C   
737  O O   . SER A 106 ? 0.4163 0.4992 0.3052 -0.0068 -0.0875 0.0128  88  SER A O   
738  C CB  . SER A 106 ? 0.4315 0.5447 0.3275 -0.0247 -0.0923 -0.0051 88  SER A CB  
739  O OG  . SER A 106 ? 0.4396 0.5503 0.3523 -0.0207 -0.0885 -0.0059 88  SER A OG  
740  N N   . PHE A 107 ? 0.3908 0.4558 0.2842 -0.0130 -0.0737 -0.0005 89  PHE A N   
741  C CA  . PHE A 107 ? 0.3693 0.4220 0.2675 -0.0044 -0.0704 0.0059  89  PHE A CA  
742  C C   . PHE A 107 ? 0.3768 0.4207 0.2618 -0.0025 -0.0701 0.0115  89  PHE A C   
743  O O   . PHE A 107 ? 0.3751 0.4177 0.2472 -0.0084 -0.0688 0.0082  89  PHE A O   
744  C CB  . PHE A 107 ? 0.3515 0.3909 0.2559 -0.0047 -0.0620 0.0012  89  PHE A CB  
745  C CG  . PHE A 107 ? 0.3612 0.4064 0.2783 -0.0069 -0.0608 -0.0037 89  PHE A CG  
746  C CD1 . PHE A 107 ? 0.3324 0.3947 0.2577 -0.0075 -0.0667 -0.0036 89  PHE A CD1 
747  C CD2 . PHE A 107 ? 0.3297 0.3635 0.2507 -0.0088 -0.0536 -0.0081 89  PHE A CD2 
748  C CE1 . PHE A 107 ? 0.3455 0.4134 0.2825 -0.0107 -0.0647 -0.0084 89  PHE A CE1 
749  C CE2 . PHE A 107 ? 0.3350 0.3729 0.2665 -0.0118 -0.0518 -0.0120 89  PHE A CE2 
750  C CZ  . PHE A 107 ? 0.3346 0.3894 0.2741 -0.0130 -0.0570 -0.0123 89  PHE A CZ  
751  N N   . ALA A 108 ? 0.3709 0.4086 0.2588 0.0054  -0.0710 0.0198  90  ALA A N   
752  C CA  . ALA A 108 ? 0.3730 0.4008 0.2493 0.0070  -0.0699 0.0256  90  ALA A CA  
753  C C   . ALA A 108 ? 0.3635 0.3784 0.2468 0.0136  -0.0657 0.0293  90  ALA A C   
754  O O   . ALA A 108 ? 0.3465 0.3636 0.2413 0.0197  -0.0680 0.0325  90  ALA A O   
755  C CB  . ALA A 108 ? 0.3813 0.4181 0.2504 0.0089  -0.0786 0.0344  90  ALA A CB  
756  N N   . TYR A 109 ? 0.3674 0.3697 0.2448 0.0121  -0.0593 0.0281  91  TYR A N   
757  C CA  . TYR A 109 ? 0.3526 0.3430 0.2359 0.0172  -0.0552 0.0309  91  TYR A CA  
758  C C   . TYR A 109 ? 0.3610 0.3497 0.2470 0.0242  -0.0598 0.0400  91  TYR A C   
759  O O   . TYR A 109 ? 0.3612 0.3514 0.2385 0.0246  -0.0643 0.0465  91  TYR A O   
760  C CB  . TYR A 109 ? 0.3717 0.3511 0.2469 0.0142  -0.0489 0.0296  91  TYR A CB  
761  C CG  . TYR A 109 ? 0.3537 0.3221 0.2353 0.0182  -0.0447 0.0312  91  TYR A CG  
762  C CD1 . TYR A 109 ? 0.3505 0.3170 0.2420 0.0189  -0.0412 0.0263  91  TYR A CD1 
763  C CD2 . TYR A 109 ? 0.3855 0.3454 0.2628 0.0206  -0.0443 0.0377  91  TYR A CD2 
764  C CE1 . TYR A 109 ? 0.3732 0.3311 0.2697 0.0219  -0.0379 0.0276  91  TYR A CE1 
765  C CE2 . TYR A 109 ? 0.3428 0.2933 0.2259 0.0234  -0.0406 0.0384  91  TYR A CE2 
766  C CZ  . TYR A 109 ? 0.3657 0.3158 0.2580 0.0241  -0.0376 0.0332  91  TYR A CZ  
767  O OH  . TYR A 109 ? 0.3728 0.3147 0.2697 0.0261  -0.0344 0.0338  91  TYR A OH  
768  N N   . ASP A 110 ? 0.3517 0.3366 0.2493 0.0296  -0.0584 0.0404  92  ASP A N   
769  C CA  . ASP A 110 ? 0.3656 0.3457 0.2674 0.0369  -0.0611 0.0477  92  ASP A CA  
770  C C   . ASP A 110 ? 0.3630 0.3292 0.2671 0.0386  -0.0550 0.0471  92  ASP A C   
771  O O   . ASP A 110 ? 0.3453 0.3109 0.2587 0.0398  -0.0517 0.0425  92  ASP A O   
772  C CB  . ASP A 110 ? 0.3809 0.3717 0.2964 0.0423  -0.0652 0.0478  92  ASP A CB  
773  C CG  . ASP A 110 ? 0.3994 0.3866 0.3194 0.0506  -0.0693 0.0561  92  ASP A CG  
774  O OD1 . ASP A 110 ? 0.4379 0.4107 0.3551 0.0529  -0.0663 0.0596  92  ASP A OD1 
775  O OD2 . ASP A 110 ? 0.5615 0.5605 0.4877 0.0546  -0.0757 0.0594  92  ASP A OD2 
776  N N   . SER A 111 ? 0.3632 0.3187 0.2587 0.0382  -0.0538 0.0522  93  SER A N   
777  C CA  . SER A 111 ? 0.3610 0.3035 0.2581 0.0393  -0.0487 0.0522  93  SER A CA  
778  C C   . SER A 111 ? 0.3610 0.2988 0.2690 0.0461  -0.0489 0.0535  93  SER A C   
779  O O   . SER A 111 ? 0.3636 0.2929 0.2745 0.0461  -0.0441 0.0508  93  SER A O   
780  C CB  . SER A 111 ? 0.3819 0.3148 0.2675 0.0369  -0.0478 0.0581  93  SER A CB  
781  O OG  . SER A 111 ? 0.3821 0.3121 0.2660 0.0414  -0.0530 0.0668  93  SER A OG  
782  N N   . THR A 112 ? 0.3535 0.2980 0.2683 0.0518  -0.0540 0.0566  94  THR A N   
783  C CA  . THR A 112 ? 0.3573 0.2981 0.2837 0.0589  -0.0536 0.0568  94  THR A CA  
784  C C   . THR A 112 ? 0.3423 0.2899 0.2794 0.0593  -0.0502 0.0489  94  THR A C   
785  O O   . THR A 112 ? 0.3552 0.2984 0.3008 0.0639  -0.0478 0.0473  94  THR A O   
786  C CB  . THR A 112 ? 0.3609 0.3054 0.2925 0.0663  -0.0602 0.0640  94  THR A CB  
787  O OG1 . THR A 112 ? 0.3522 0.3146 0.2899 0.0672  -0.0651 0.0626  94  THR A OG1 
788  C CG2 . THR A 112 ? 0.3976 0.3337 0.3173 0.0657  -0.0634 0.0732  94  THR A CG2 
789  N N   . PHE A 113 ? 0.3225 0.2799 0.2589 0.0541  -0.0496 0.0439  95  PHE A N   
790  C CA  . PHE A 113 ? 0.3233 0.2867 0.2684 0.0533  -0.0461 0.0370  95  PHE A CA  
791  C C   . PHE A 113 ? 0.3123 0.2667 0.2548 0.0496  -0.0399 0.0329  95  PHE A C   
792  O O   . PHE A 113 ? 0.3324 0.2846 0.2813 0.0519  -0.0367 0.0301  95  PHE A O   
793  C CB  . PHE A 113 ? 0.3040 0.2813 0.2507 0.0492  -0.0482 0.0336  95  PHE A CB  
794  C CG  . PHE A 113 ? 0.2728 0.2560 0.2279 0.0475  -0.0444 0.0274  95  PHE A CG  
795  C CD1 . PHE A 113 ? 0.2775 0.2694 0.2445 0.0520  -0.0450 0.0261  95  PHE A CD1 
796  C CD2 . PHE A 113 ? 0.2814 0.2606 0.2324 0.0416  -0.0399 0.0233  95  PHE A CD2 
797  C CE1 . PHE A 113 ? 0.3069 0.3042 0.2806 0.0497  -0.0409 0.0206  95  PHE A CE1 
798  C CE2 . PHE A 113 ? 0.2819 0.2657 0.2396 0.0396  -0.0365 0.0186  95  PHE A CE2 
799  C CZ  . PHE A 113 ? 0.2635 0.2564 0.2318 0.0433  -0.0368 0.0173  95  PHE A CZ  
800  N N   . PRO A 114 ? 0.3216 0.2722 0.2555 0.0439  -0.0380 0.0320  96  PRO A N   
801  C CA  . PRO A 114 ? 0.3256 0.2715 0.2596 0.0407  -0.0329 0.0280  96  PRO A CA  
802  C C   . PRO A 114 ? 0.3425 0.2765 0.2736 0.0416  -0.0303 0.0295  96  PRO A C   
803  O O   . PRO A 114 ? 0.3644 0.2918 0.2898 0.0420  -0.0315 0.0338  96  PRO A O   
804  C CB  . PRO A 114 ? 0.3184 0.2654 0.2462 0.0351  -0.0320 0.0263  96  PRO A CB  
805  C CG  . PRO A 114 ? 0.3386 0.2861 0.2591 0.0348  -0.0353 0.0302  96  PRO A CG  
806  C CD  . PRO A 114 ? 0.3322 0.2841 0.2568 0.0400  -0.0400 0.0339  96  PRO A CD  
807  N N   . THR A 115 ? 0.3430 0.2750 0.2780 0.0413  -0.0269 0.0260  97  THR A N   
808  C CA  . THR A 115 ? 0.3324 0.2547 0.2643 0.0399  -0.0238 0.0256  97  THR A CA  
809  C C   . THR A 115 ? 0.3243 0.2486 0.2543 0.0349  -0.0214 0.0229  97  THR A C   
810  O O   . THR A 115 ? 0.3049 0.2362 0.2378 0.0337  -0.0212 0.0206  97  THR A O   
811  C CB  . THR A 115 ? 0.3445 0.2637 0.2821 0.0434  -0.0220 0.0233  97  THR A CB  
812  O OG1 . THR A 115 ? 0.3336 0.2499 0.2739 0.0490  -0.0246 0.0269  97  THR A OG1 
813  C CG2 . THR A 115 ? 0.3445 0.2546 0.2789 0.0408  -0.0187 0.0217  97  THR A CG2 
814  N N   . ARG A 116 ? 0.3217 0.2400 0.2472 0.0320  -0.0197 0.0236  98  ARG A N   
815  C CA  . ARG A 116 ? 0.3215 0.2418 0.2464 0.0282  -0.0179 0.0217  98  ARG A CA  
816  C C   . ARG A 116 ? 0.3040 0.2258 0.2318 0.0274  -0.0161 0.0187  98  ARG A C   
817  O O   . ARG A 116 ? 0.3029 0.2217 0.2320 0.0290  -0.0151 0.0173  98  ARG A O   
818  C CB  . ARG A 116 ? 0.3419 0.2571 0.2625 0.0255  -0.0167 0.0233  98  ARG A CB  
819  C CG  . ARG A 116 ? 0.3510 0.2694 0.2720 0.0225  -0.0155 0.0224  98  ARG A CG  
820  C CD  . ARG A 116 ? 0.3583 0.2750 0.2760 0.0204  -0.0145 0.0240  98  ARG A CD  
821  N NE  . ARG A 116 ? 0.3640 0.2748 0.2793 0.0188  -0.0136 0.0253  98  ARG A NE  
822  C CZ  . ARG A 116 ? 0.3597 0.2705 0.2759 0.0157  -0.0120 0.0246  98  ARG A CZ  
823  N NH1 . ARG A 116 ? 0.3470 0.2635 0.2669 0.0146  -0.0118 0.0232  98  ARG A NH1 
824  N NH2 . ARG A 116 ? 0.3472 0.2520 0.2609 0.0135  -0.0110 0.0257  98  ARG A NH2 
825  N N   . GLY A 117 ? 0.2841 0.2103 0.2126 0.0248  -0.0155 0.0179  99  GLY A N   
826  C CA  . GLY A 117 ? 0.2895 0.2177 0.2188 0.0229  -0.0140 0.0160  99  GLY A CA  
827  C C   . GLY A 117 ? 0.2901 0.2239 0.2227 0.0236  -0.0134 0.0141  99  GLY A C   
828  O O   . GLY A 117 ? 0.3123 0.2483 0.2446 0.0217  -0.0118 0.0125  99  GLY A O   
829  N N   . LEU A 118 ? 0.2784 0.2155 0.2139 0.0257  -0.0146 0.0142  100 LEU A N   
830  C CA  . LEU A 118 ? 0.2848 0.2290 0.2246 0.0256  -0.0139 0.0123  100 LEU A CA  
831  C C   . LEU A 118 ? 0.2741 0.2210 0.2133 0.0215  -0.0131 0.0127  100 LEU A C   
832  O O   . LEU A 118 ? 0.2828 0.2265 0.2196 0.0198  -0.0137 0.0147  100 LEU A O   
833  C CB  . LEU A 118 ? 0.2841 0.2327 0.2277 0.0284  -0.0161 0.0125  100 LEU A CB  
834  C CG  . LEU A 118 ? 0.2790 0.2248 0.2241 0.0332  -0.0174 0.0131  100 LEU A CG  
835  C CD1 . LEU A 118 ? 0.2716 0.2234 0.2200 0.0358  -0.0208 0.0145  100 LEU A CD1 
836  C CD2 . LEU A 118 ? 0.2684 0.2140 0.2174 0.0359  -0.0148 0.0102  100 LEU A CD2 
837  N N   . VAL A 119 ? 0.2875 0.2401 0.2293 0.0200  -0.0114 0.0111  101 VAL A N   
838  C CA  . VAL A 119 ? 0.2839 0.2386 0.2251 0.0157  -0.0103 0.0121  101 VAL A CA  
839  C C   . VAL A 119 ? 0.2779 0.2387 0.2240 0.0148  -0.0105 0.0109  101 VAL A C   
840  O O   . VAL A 119 ? 0.2730 0.2406 0.2239 0.0166  -0.0100 0.0084  101 VAL A O   
841  C CB  . VAL A 119 ? 0.2815 0.2387 0.2204 0.0131  -0.0077 0.0114  101 VAL A CB  
842  C CG1 . VAL A 119 ? 0.2839 0.2425 0.2215 0.0084  -0.0068 0.0138  101 VAL A CG1 
843  C CG2 . VAL A 119 ? 0.2948 0.2471 0.2287 0.0133  -0.0079 0.0119  101 VAL A CG2 
844  N N   . PHE A 120 ? 0.2648 0.2233 0.2105 0.0122  -0.0113 0.0122  102 PHE A N   
845  C CA  . PHE A 120 ? 0.2621 0.2261 0.2119 0.0096  -0.0111 0.0107  102 PHE A CA  
846  C C   . PHE A 120 ? 0.2664 0.2319 0.2161 0.0047  -0.0084 0.0116  102 PHE A C   
847  O O   . PHE A 120 ? 0.2763 0.2353 0.2224 0.0025  -0.0079 0.0148  102 PHE A O   
848  C CB  . PHE A 120 ? 0.2641 0.2247 0.2136 0.0085  -0.0129 0.0104  102 PHE A CB  
849  C CG  . PHE A 120 ? 0.2576 0.2255 0.2116 0.0054  -0.0133 0.0077  102 PHE A CG  
850  C CD1 . PHE A 120 ? 0.2695 0.2467 0.2277 0.0077  -0.0153 0.0057  102 PHE A CD1 
851  C CD2 . PHE A 120 ? 0.2877 0.2533 0.2425 0.0000  -0.0118 0.0074  102 PHE A CD2 
852  C CE1 . PHE A 120 ? 0.2887 0.2746 0.2518 0.0044  -0.0162 0.0030  102 PHE A CE1 
853  C CE2 . PHE A 120 ? 0.2749 0.2475 0.2340 -0.0040 -0.0120 0.0044  102 PHE A CE2 
854  C CZ  . PHE A 120 ? 0.2630 0.2468 0.2264 -0.0020 -0.0144 0.0019  102 PHE A CZ  
855  N N   . ASP A 121 ? 0.2623 0.2372 0.2166 0.0031  -0.0067 0.0092  103 ASP A N   
856  C CA  . ASP A 121 ? 0.2608 0.2388 0.2152 -0.0027 -0.0035 0.0099  103 ASP A CA  
857  C C   . ASP A 121 ? 0.2611 0.2392 0.2185 -0.0072 -0.0038 0.0096  103 ASP A C   
858  O O   . ASP A 121 ? 0.2449 0.2316 0.2083 -0.0077 -0.0044 0.0062  103 ASP A O   
859  C CB  . ASP A 121 ? 0.2704 0.2596 0.2289 -0.0026 -0.0006 0.0066  103 ASP A CB  
860  C CG  . ASP A 121 ? 0.2802 0.2740 0.2381 -0.0094 0.0034  0.0073  103 ASP A CG  
861  O OD1 . ASP A 121 ? 0.2832 0.2710 0.2380 -0.0145 0.0036  0.0108  103 ASP A OD1 
862  O OD2 . ASP A 121 ? 0.3113 0.3141 0.2715 -0.0098 0.0068  0.0044  103 ASP A OD2 
863  N N   . THR A 122 ? 0.2703 0.2387 0.2239 -0.0105 -0.0035 0.0130  104 THR A N   
864  C CA  . THR A 122 ? 0.2765 0.2417 0.2325 -0.0151 -0.0034 0.0122  104 THR A CA  
865  C C   . THR A 122 ? 0.2925 0.2646 0.2521 -0.0220 -0.0004 0.0112  104 THR A C   
866  O O   . THR A 122 ? 0.3099 0.2812 0.2726 -0.0267 -0.0003 0.0092  104 THR A O   
867  C CB  . THR A 122 ? 0.2981 0.2496 0.2505 -0.0159 -0.0035 0.0160  104 THR A CB  
868  O OG1 . THR A 122 ? 0.3025 0.2505 0.2512 -0.0184 -0.0017 0.0213  104 THR A OG1 
869  C CG2 . THR A 122 ? 0.2777 0.2235 0.2280 -0.0098 -0.0060 0.0162  104 THR A CG2 
870  N N   . LEU A 123 ? 0.2802 0.2592 0.2391 -0.0235 0.0023  0.0122  105 LEU A N   
871  C CA  . LEU A 123 ? 0.2865 0.2734 0.2486 -0.0306 0.0059  0.0114  105 LEU A CA  
872  C C   . LEU A 123 ? 0.2869 0.2891 0.2582 -0.0295 0.0055  0.0054  105 LEU A C   
873  O O   . LEU A 123 ? 0.2694 0.2772 0.2461 -0.0349 0.0061  0.0029  105 LEU A O   
874  C CB  . LEU A 123 ? 0.2838 0.2736 0.2410 -0.0328 0.0095  0.0141  105 LEU A CB  
875  C CG  . LEU A 123 ? 0.3001 0.2981 0.2593 -0.0413 0.0143  0.0140  105 LEU A CG  
876  C CD1 . LEU A 123 ? 0.3054 0.2932 0.2635 -0.0486 0.0148  0.0176  105 LEU A CD1 
877  C CD2 . LEU A 123 ? 0.2846 0.2858 0.2369 -0.0433 0.0179  0.0164  105 LEU A CD2 
878  N N   . TYR A 124 ? 0.2833 0.2921 0.2568 -0.0225 0.0043  0.0031  106 TYR A N   
879  C CA  . TYR A 124 ? 0.2798 0.3044 0.2634 -0.0202 0.0037  -0.0018 106 TYR A CA  
880  C C   . TYR A 124 ? 0.2730 0.2988 0.2597 -0.0140 -0.0016 -0.0034 106 TYR A C   
881  O O   . TYR A 124 ? 0.2790 0.3184 0.2747 -0.0115 -0.0033 -0.0066 106 TYR A O   
882  C CB  . TYR A 124 ? 0.3013 0.3346 0.2874 -0.0168 0.0070  -0.0037 106 TYR A CB  
883  C CG  . TYR A 124 ? 0.3156 0.3525 0.2994 -0.0237 0.0128  -0.0031 106 TYR A CG  
884  C CD1 . TYR A 124 ? 0.3395 0.3835 0.3275 -0.0320 0.0154  -0.0037 106 TYR A CD1 
885  C CD2 . TYR A 124 ? 0.3446 0.3785 0.3215 -0.0227 0.0158  -0.0021 106 TYR A CD2 
886  C CE1 . TYR A 124 ? 0.3580 0.4054 0.3429 -0.0391 0.0211  -0.0026 106 TYR A CE1 
887  C CE2 . TYR A 124 ? 0.3627 0.4007 0.3359 -0.0297 0.0212  -0.0013 106 TYR A CE2 
888  C CZ  . TYR A 124 ? 0.3374 0.3820 0.3145 -0.0378 0.0239  -0.0012 106 TYR A CZ  
889  O OH  . TYR A 124 ? 0.3651 0.4137 0.3378 -0.0454 0.0296  0.0002  106 TYR A OH  
890  N N   . GLY A 125 ? 0.2680 0.2806 0.2476 -0.0117 -0.0044 -0.0010 107 GLY A N   
891  C CA  . GLY A 125 ? 0.2666 0.2785 0.2464 -0.0073 -0.0091 -0.0018 107 GLY A CA  
892  C C   . GLY A 125 ? 0.2635 0.2793 0.2454 0.0010  -0.0113 -0.0018 107 GLY A C   
893  O O   . GLY A 125 ? 0.2616 0.2835 0.2471 0.0042  -0.0153 -0.0027 107 GLY A O   
894  N N   . ASN A 126 ? 0.2620 0.2737 0.2413 0.0041  -0.0088 -0.0007 108 ASN A N   
895  C CA  . ASN A 126 ? 0.2613 0.2740 0.2425 0.0116  -0.0099 -0.0009 108 ASN A CA  
896  C C   . ASN A 126 ? 0.2571 0.2562 0.2297 0.0145  -0.0114 0.0019  108 ASN A C   
897  O O   . ASN A 126 ? 0.2601 0.2507 0.2261 0.0112  -0.0098 0.0038  108 ASN A O   
898  C CB  . ASN A 126 ? 0.2606 0.2789 0.2452 0.0123  -0.0052 -0.0032 108 ASN A CB  
899  C CG  . ASN A 126 ? 0.2836 0.3173 0.2781 0.0097  -0.0031 -0.0065 108 ASN A CG  
900  O OD1 . ASN A 126 ? 0.2586 0.3023 0.2613 0.0116  -0.0063 -0.0077 108 ASN A OD1 
901  N ND2 . ASN A 126 ? 0.2603 0.2974 0.2541 0.0048  0.0022  -0.0078 108 ASN A ND2 
902  N N   . LEU A 127 ? 0.2540 0.2514 0.2271 0.0205  -0.0143 0.0027  109 LEU A N   
903  C CA  . LEU A 127 ? 0.2610 0.2471 0.2274 0.0235  -0.0146 0.0048  109 LEU A CA  
904  C C   . LEU A 127 ? 0.2518 0.2378 0.2201 0.0265  -0.0116 0.0030  109 LEU A C   
905  O O   . LEU A 127 ? 0.2562 0.2494 0.2322 0.0306  -0.0113 0.0010  109 LEU A O   
906  C CB  . LEU A 127 ? 0.2657 0.2488 0.2306 0.0276  -0.0190 0.0070  109 LEU A CB  
907  C CG  . LEU A 127 ? 0.3017 0.2813 0.2612 0.0243  -0.0211 0.0083  109 LEU A CG  
908  C CD1 . LEU A 127 ? 0.3041 0.2843 0.2623 0.0278  -0.0254 0.0102  109 LEU A CD1 
909  C CD2 . LEU A 127 ? 0.2735 0.2421 0.2258 0.0221  -0.0192 0.0097  109 LEU A CD2 
910  N N   . LEU A 128 ? 0.2463 0.2244 0.2080 0.0246  -0.0094 0.0036  110 LEU A N   
911  C CA  . LEU A 128 ? 0.2652 0.2423 0.2267 0.0260  -0.0059 0.0009  110 LEU A CA  
912  C C   . LEU A 128 ? 0.2486 0.2147 0.2043 0.0280  -0.0068 0.0022  110 LEU A C   
913  O O   . LEU A 128 ? 0.2605 0.2203 0.2103 0.0258  -0.0084 0.0051  110 LEU A O   
914  C CB  . LEU A 128 ? 0.2598 0.2392 0.2174 0.0201  -0.0023 0.0000  110 LEU A CB  
915  C CG  . LEU A 128 ? 0.2835 0.2726 0.2453 0.0159  -0.0008 -0.0006 110 LEU A CG  
916  C CD1 . LEU A 128 ? 0.2828 0.2716 0.2381 0.0096  0.0025  0.0003  110 LEU A CD1 
917  C CD2 . LEU A 128 ? 0.2616 0.2620 0.2333 0.0189  0.0011  -0.0047 110 LEU A CD2 
918  N N   . LYS A 129 ? 0.2587 0.2226 0.2170 0.0321  -0.0053 -0.0004 111 LYS A N   
919  C CA  . LYS A 129 ? 0.2767 0.2302 0.2297 0.0327  -0.0047 -0.0007 111 LYS A CA  
920  C C   . LYS A 129 ? 0.2737 0.2289 0.2245 0.0298  0.0000  -0.0055 111 LYS A C   
921  O O   . LYS A 129 ? 0.2753 0.2361 0.2318 0.0318  0.0033  -0.0100 111 LYS A O   
922  C CB  . LYS A 129 ? 0.2864 0.2345 0.2435 0.0390  -0.0060 -0.0004 111 LYS A CB  
923  C CG  . LYS A 129 ? 0.3031 0.2391 0.2542 0.0386  -0.0061 0.0006  111 LYS A CG  
924  C CD  . LYS A 129 ? 0.3406 0.2709 0.2972 0.0454  -0.0067 0.0008  111 LYS A CD  
925  C CE  . LYS A 129 ? 0.3745 0.2920 0.3260 0.0453  -0.0074 0.0030  111 LYS A CE  
926  N NZ  . LYS A 129 ? 0.3575 0.2693 0.3148 0.0525  -0.0090 0.0053  111 LYS A NZ  
927  N N   . VAL A 130 ? 0.2960 0.2472 0.2386 0.0249  0.0001  -0.0046 112 VAL A N   
928  C CA  . VAL A 130 ? 0.2895 0.2436 0.2275 0.0204  0.0039  -0.0083 112 VAL A CA  
929  C C   . VAL A 130 ? 0.2929 0.2389 0.2246 0.0185  0.0042  -0.0100 112 VAL A C   
930  O O   . VAL A 130 ? 0.2812 0.2200 0.2116 0.0195  0.0013  -0.0070 112 VAL A O   
931  C CB  . VAL A 130 ? 0.2896 0.2496 0.2230 0.0146  0.0035  -0.0051 112 VAL A CB  
932  C CG1 . VAL A 130 ? 0.2892 0.2569 0.2285 0.0149  0.0038  -0.0041 112 VAL A CG1 
933  C CG2 . VAL A 130 ? 0.2828 0.2376 0.2110 0.0123  -0.0004 0.0004  112 VAL A CG2 
934  N N   . ASP A 131 ? 0.3013 0.2494 0.2294 0.0154  0.0080  -0.0153 113 ASP A N   
935  C CA  . ASP A 131 ? 0.3219 0.2644 0.2428 0.0116  0.0082  -0.0175 113 ASP A CA  
936  C C   . ASP A 131 ? 0.3251 0.2721 0.2380 0.0052  0.0058  -0.0134 113 ASP A C   
937  O O   . ASP A 131 ? 0.2975 0.2500 0.2108 0.0042  0.0042  -0.0085 113 ASP A O   
938  C CB  . ASP A 131 ? 0.3347 0.2757 0.2550 0.0112  0.0134  -0.0261 113 ASP A CB  
939  C CG  . ASP A 131 ? 0.3707 0.3217 0.2872 0.0069  0.0175  -0.0300 113 ASP A CG  
940  O OD1 . ASP A 131 ? 0.3338 0.2919 0.2465 0.0030  0.0156  -0.0250 113 ASP A OD1 
941  O OD2 . ASP A 131 ? 0.3870 0.3382 0.3041 0.0071  0.0229  -0.0383 113 ASP A OD2 
942  N N   . ALA A 132 ? 0.3432 0.2879 0.2494 0.0007  0.0054  -0.0153 114 ALA A N   
943  C CA  . ALA A 132 ? 0.3499 0.2993 0.2495 -0.0048 0.0020  -0.0107 114 ALA A CA  
944  C C   . ALA A 132 ? 0.3627 0.3210 0.2569 -0.0091 0.0036  -0.0102 114 ALA A C   
945  O O   . ALA A 132 ? 0.3920 0.3546 0.2822 -0.0123 0.0002  -0.0041 114 ALA A O   
946  C CB  . ALA A 132 ? 0.3648 0.3113 0.2589 -0.0091 0.0012  -0.0138 114 ALA A CB  
947  N N   . TYR A 133 ? 0.3617 0.3231 0.2565 -0.0089 0.0087  -0.0161 115 TYR A N   
948  C CA  . TYR A 133 ? 0.3546 0.3251 0.2436 -0.0138 0.0114  -0.0165 115 TYR A CA  
949  C C   . TYR A 133 ? 0.3543 0.3289 0.2494 -0.0116 0.0122  -0.0128 115 TYR A C   
950  O O   . TYR A 133 ? 0.3637 0.3457 0.2551 -0.0156 0.0151  -0.0129 115 TYR A O   
951  C CB  . TYR A 133 ? 0.3598 0.3323 0.2457 -0.0158 0.0177  -0.0267 115 TYR A CB  
952  C CG  . TYR A 133 ? 0.3619 0.3309 0.2405 -0.0199 0.0167  -0.0305 115 TYR A CG  
953  C CD1 . TYR A 133 ? 0.3683 0.3437 0.2354 -0.0276 0.0145  -0.0282 115 TYR A CD1 
954  C CD2 . TYR A 133 ? 0.3606 0.3198 0.2436 -0.0165 0.0174  -0.0355 115 TYR A CD2 
955  C CE1 . TYR A 133 ? 0.3744 0.3481 0.2349 -0.0322 0.0128  -0.0315 115 TYR A CE1 
956  C CE2 . TYR A 133 ? 0.3728 0.3285 0.2493 -0.0213 0.0164  -0.0391 115 TYR A CE2 
957  C CZ  . TYR A 133 ? 0.3899 0.3537 0.2553 -0.0293 0.0140  -0.0374 115 TYR A CZ  
958  O OH  . TYR A 133 ? 0.3580 0.3205 0.2170 -0.0349 0.0125  -0.0411 115 TYR A OH  
959  N N   . GLY A 134 ? 0.3286 0.2987 0.2324 -0.0058 0.0097  -0.0098 116 GLY A N   
960  C CA  . GLY A 134 ? 0.3324 0.3063 0.2427 -0.0040 0.0102  -0.0070 116 GLY A CA  
961  C C   . GLY A 134 ? 0.3280 0.3065 0.2458 -0.0007 0.0150  -0.0137 116 GLY A C   
962  O O   . GLY A 134 ? 0.3386 0.3231 0.2619 -0.0004 0.0162  -0.0127 116 GLY A O   
963  N N   . ASN A 135 ? 0.3155 0.2913 0.2345 0.0019  0.0180  -0.0207 117 ASN A N   
964  C CA  . ASN A 135 ? 0.3130 0.2930 0.2414 0.0065  0.0226  -0.0272 117 ASN A CA  
965  C C   . ASN A 135 ? 0.3074 0.2840 0.2465 0.0140  0.0192  -0.0245 117 ASN A C   
966  O O   . ASN A 135 ? 0.3056 0.2733 0.2441 0.0166  0.0150  -0.0211 117 ASN A O   
967  C CB  . ASN A 135 ? 0.3349 0.3113 0.2620 0.0074  0.0272  -0.0358 117 ASN A CB  
968  C CG  . ASN A 135 ? 0.3376 0.3187 0.2530 -0.0007 0.0309  -0.0397 117 ASN A CG  
969  O OD1 . ASN A 135 ? 0.3486 0.3394 0.2604 -0.0057 0.0332  -0.0387 117 ASN A OD1 
970  N ND2 . ASN A 135 ? 0.3419 0.3163 0.2510 -0.0026 0.0315  -0.0441 117 ASN A ND2 
971  N N   . LEU A 136 ? 0.3123 0.2975 0.2610 0.0170  0.0211  -0.0261 118 LEU A N   
972  C CA  . LEU A 136 ? 0.3137 0.2989 0.2727 0.0237  0.0175  -0.0234 118 LEU A CA  
973  C C   . LEU A 136 ? 0.3056 0.2843 0.2711 0.0312  0.0179  -0.0270 118 LEU A C   
974  O O   . LEU A 136 ? 0.3146 0.2958 0.2845 0.0334  0.0231  -0.0338 118 LEU A O   
975  C CB  . LEU A 136 ? 0.3197 0.3183 0.2879 0.0238  0.0191  -0.0243 118 LEU A CB  
976  C CG  . LEU A 136 ? 0.3665 0.3692 0.3334 0.0193  0.0159  -0.0185 118 LEU A CG  
977  C CD1 . LEU A 136 ? 0.4166 0.4147 0.3714 0.0119  0.0152  -0.0143 118 LEU A CD1 
978  C CD2 . LEU A 136 ? 0.3523 0.3698 0.3286 0.0182  0.0193  -0.0215 118 LEU A CD2 
979  N N   . LEU A 137 ? 0.2992 0.2690 0.2649 0.0349  0.0129  -0.0222 119 LEU A N   
980  C CA  . LEU A 137 ? 0.2937 0.2562 0.2659 0.0424  0.0123  -0.0235 119 LEU A CA  
981  C C   . LEU A 137 ? 0.2982 0.2665 0.2810 0.0487  0.0085  -0.0198 119 LEU A C   
982  O O   . LEU A 137 ? 0.2970 0.2660 0.2897 0.0559  0.0093  -0.0220 119 LEU A O   
983  C CB  . LEU A 137 ? 0.2854 0.2338 0.2499 0.0417  0.0096  -0.0204 119 LEU A CB  
984  C CG  . LEU A 137 ? 0.3103 0.2539 0.2640 0.0348  0.0122  -0.0234 119 LEU A CG  
985  C CD1 . LEU A 137 ? 0.3162 0.2467 0.2643 0.0342  0.0091  -0.0199 119 LEU A CD1 
986  C CD2 . LEU A 137 ? 0.3412 0.2859 0.2966 0.0348  0.0187  -0.0323 119 LEU A CD2 
987  N N   . VAL A 138 ? 0.2865 0.2590 0.2672 0.0460  0.0041  -0.0144 120 VAL A N   
988  C CA  . VAL A 138 ? 0.2977 0.2773 0.2867 0.0504  -0.0003 -0.0110 120 VAL A CA  
989  C C   . VAL A 138 ? 0.2917 0.2807 0.2789 0.0442  -0.0014 -0.0093 120 VAL A C   
990  O O   . VAL A 138 ? 0.2809 0.2653 0.2586 0.0381  -0.0015 -0.0074 120 VAL A O   
991  C CB  . VAL A 138 ? 0.3005 0.2701 0.2861 0.0537  -0.0060 -0.0049 120 VAL A CB  
992  C CG1 . VAL A 138 ? 0.3248 0.3034 0.3176 0.0575  -0.0113 -0.0010 120 VAL A CG1 
993  C CG2 . VAL A 138 ? 0.3046 0.2613 0.2904 0.0588  -0.0048 -0.0056 120 VAL A CG2 
994  N N   . CYS A 139 ? 0.2918 0.2937 0.2889 0.0460  -0.0024 -0.0100 121 CYS A N   
995  C CA  . CYS A 139 ? 0.2934 0.3044 0.2905 0.0400  -0.0034 -0.0088 121 CYS A CA  
996  C C   . CYS A 139 ? 0.2896 0.3094 0.2951 0.0437  -0.0087 -0.0067 121 CYS A C   
997  O O   . CYS A 139 ? 0.2943 0.3230 0.3113 0.0497  -0.0089 -0.0085 121 CYS A O   
998  C CB  . CYS A 139 ? 0.3044 0.3265 0.3056 0.0359  0.0023  -0.0135 121 CYS A CB  
999  S SG  . CYS A 139 ? 0.3424 0.3754 0.3451 0.0279  0.0014  -0.0122 121 CYS A SG  
1000 N N   . ALA A 140 ? 0.2855 0.3029 0.2853 0.0404  -0.0130 -0.0030 122 ALA A N   
1001 C CA  . ALA A 140 ? 0.2706 0.2971 0.2759 0.0420  -0.0186 -0.0010 122 ALA A CA  
1002 C C   . ALA A 140 ? 0.2575 0.2894 0.2605 0.0337  -0.0189 -0.0016 122 ALA A C   
1003 O O   . ALA A 140 ? 0.2552 0.2773 0.2485 0.0288  -0.0181 -0.0004 122 ALA A O   
1004 C CB  . ALA A 140 ? 0.2807 0.2975 0.2797 0.0457  -0.0238 0.0039  122 ALA A CB  
1005 N N   . HIS A 141 ? 0.2543 0.3019 0.2672 0.0327  -0.0202 -0.0036 123 HIS A N   
1006 C CA  . HIS A 141 ? 0.2468 0.3009 0.2594 0.0249  -0.0213 -0.0046 123 HIS A CA  
1007 C C   . HIS A 141 ? 0.2564 0.3168 0.2707 0.0268  -0.0284 -0.0027 123 HIS A C   
1008 O O   . HIS A 141 ? 0.2624 0.3365 0.2874 0.0316  -0.0317 -0.0028 123 HIS A O   
1009 C CB  . HIS A 141 ? 0.2532 0.3222 0.2761 0.0212  -0.0173 -0.0086 123 HIS A CB  
1010 C CG  . HIS A 141 ? 0.2696 0.3431 0.2917 0.0117  -0.0171 -0.0100 123 HIS A CG  
1011 N ND1 . HIS A 141 ? 0.2803 0.3424 0.2932 0.0046  -0.0135 -0.0095 123 HIS A ND1 
1012 C CD2 . HIS A 141 ? 0.3122 0.3996 0.3414 0.0079  -0.0203 -0.0119 123 HIS A CD2 
1013 C CE1 . HIS A 141 ? 0.2968 0.3641 0.3113 -0.0031 -0.0139 -0.0111 123 HIS A CE1 
1014 N NE2 . HIS A 141 ? 0.2863 0.3691 0.3103 -0.0018 -0.0180 -0.0130 123 HIS A NE2 
1015 N N   . GLY A 142 ? 0.2587 0.3097 0.2624 0.0233  -0.0308 -0.0010 124 GLY A N   
1016 C CA  . GLY A 142 ? 0.2658 0.3199 0.2670 0.0251  -0.0375 0.0013  124 GLY A CA  
1017 C C   . GLY A 142 ? 0.2795 0.3292 0.2812 0.0345  -0.0399 0.0056  124 GLY A C   
1018 O O   . GLY A 142 ? 0.2709 0.3063 0.2661 0.0368  -0.0370 0.0072  124 GLY A O   
1019 N N   . PHE A 143 ? 0.2875 0.3496 0.2975 0.0397  -0.0453 0.0075  125 PHE A N   
1020 C CA  . PHE A 143 ? 0.3077 0.3658 0.3202 0.0493  -0.0479 0.0122  125 PHE A CA  
1021 C C   . PHE A 143 ? 0.3188 0.3858 0.3466 0.0560  -0.0456 0.0103  125 PHE A C   
1022 O O   . PHE A 143 ? 0.3446 0.4114 0.3783 0.0649  -0.0485 0.0139  125 PHE A O   
1023 C CB  . PHE A 143 ? 0.3139 0.3776 0.3237 0.0514  -0.0562 0.0172  125 PHE A CB  
1024 C CG  . PHE A 143 ? 0.3148 0.3700 0.3093 0.0450  -0.0575 0.0182  125 PHE A CG  
1025 C CD1 . PHE A 143 ? 0.3009 0.3379 0.2840 0.0438  -0.0535 0.0191  125 PHE A CD1 
1026 C CD2 . PHE A 143 ? 0.2936 0.3596 0.2852 0.0396  -0.0624 0.0174  125 PHE A CD2 
1027 C CE1 . PHE A 143 ? 0.3040 0.3341 0.2745 0.0384  -0.0540 0.0194  125 PHE A CE1 
1028 C CE2 . PHE A 143 ? 0.3369 0.3947 0.3142 0.0335  -0.0625 0.0170  125 PHE A CE2 
1029 C CZ  . PHE A 143 ? 0.3145 0.3545 0.2819 0.0334  -0.0582 0.0181  125 PHE A CZ  
1030 N N   . ASN A 144 ? 0.3215 0.3959 0.3556 0.0517  -0.0402 0.0048  126 ASN A N   
1031 C CA  . ASN A 144 ? 0.3305 0.4149 0.3791 0.0568  -0.0366 0.0015  126 ASN A CA  
1032 C C   . ASN A 144 ? 0.3322 0.4023 0.3758 0.0574  -0.0292 -0.0009 126 ASN A C   
1033 O O   . ASN A 144 ? 0.3065 0.3718 0.3429 0.0499  -0.0244 -0.0035 126 ASN A O   
1034 C CB  . ASN A 144 ? 0.3360 0.4391 0.3942 0.0505  -0.0346 -0.0034 126 ASN A CB  
1035 C CG  . ASN A 144 ? 0.3732 0.4895 0.4478 0.0553  -0.0299 -0.0077 126 ASN A CG  
1036 O OD1 . ASN A 144 ? 0.4576 0.5763 0.5420 0.0655  -0.0313 -0.0065 126 ASN A OD1 
1037 N ND2 . ASN A 144 ? 0.4897 0.6145 0.5676 0.0479  -0.0239 -0.0129 126 ASN A ND2 
1038 N N   . PHE A 145 ? 0.3396 0.4024 0.3865 0.0661  -0.0288 0.0004  127 PHE A N   
1039 C CA  . PHE A 145 ? 0.3579 0.4084 0.4013 0.0670  -0.0218 -0.0028 127 PHE A CA  
1040 C C   . PHE A 145 ? 0.3649 0.4280 0.4204 0.0675  -0.0155 -0.0095 127 PHE A C   
1041 O O   . PHE A 145 ? 0.3682 0.4444 0.4392 0.0744  -0.0163 -0.0109 127 PHE A O   
1042 C CB  . PHE A 145 ? 0.3802 0.4159 0.4214 0.0749  -0.0235 0.0007  127 PHE A CB  
1043 C CG  . PHE A 145 ? 0.3719 0.3942 0.3989 0.0722  -0.0278 0.0065  127 PHE A CG  
1044 C CD1 . PHE A 145 ? 0.3936 0.4216 0.4187 0.0719  -0.0351 0.0117  127 PHE A CD1 
1045 C CD2 . PHE A 145 ? 0.3902 0.3957 0.4052 0.0692  -0.0245 0.0064  127 PHE A CD2 
1046 C CE1 . PHE A 145 ? 0.4069 0.4234 0.4183 0.0689  -0.0383 0.0164  127 PHE A CE1 
1047 C CE2 . PHE A 145 ? 0.3953 0.3902 0.3982 0.0663  -0.0277 0.0112  127 PHE A CE2 
1048 C CZ  . PHE A 145 ? 0.4107 0.4106 0.4114 0.0662  -0.0343 0.0162  127 PHE A CZ  
1049 N N   . ILE A 146 ? 0.5918 0.8298 0.4980 0.2780  -0.0888 0.0401  128 ILE A N   
1050 C CA  . ILE A 146 ? 0.5776 0.8798 0.5292 0.2799  -0.0778 0.0224  128 ILE A CA  
1051 C C   . ILE A 146 ? 0.6223 0.8387 0.5488 0.3129  -0.0562 0.0262  128 ILE A C   
1052 O O   . ILE A 146 ? 0.6281 0.7419 0.5157 0.2922  -0.0436 0.0283  128 ILE A O   
1053 C CB  . ILE A 146 ? 0.5081 0.8256 0.4826 0.2139  -0.0692 0.0007  128 ILE A CB  
1054 C CG1 . ILE A 146 ? 0.4786 0.8453 0.4599 0.1733  -0.0837 -0.0043 128 ILE A CG1 
1055 C CG2 . ILE A 146 ? 0.5029 0.8909 0.5191 0.2092  -0.0564 -0.0190 128 ILE A CG2 
1056 C CD1 . ILE A 146 ? 0.4593 0.9456 0.4664 0.1911  -0.1032 -0.0045 128 ILE A CD1 
1057 N N   . ARG A 147 ? 0.6660 0.9288 0.6136 0.3631  -0.0506 0.0251  129 ARG A N   
1058 C CA  . ARG A 147 ? 0.7375 0.9142 0.6557 0.3969  -0.0255 0.0263  129 ARG A CA  
1059 C C   . ARG A 147 ? 0.7031 0.8922 0.6481 0.3591  -0.0053 0.0017  129 ARG A C   
1060 O O   . ARG A 147 ? 0.6473 0.9269 0.6379 0.3223  -0.0109 -0.0146 129 ARG A O   
1061 C CB  . ARG A 147 ? 0.8045 1.0196 0.7297 0.4767  -0.0259 0.0372  129 ARG A CB  
1062 C CG  . ARG A 147 ? 0.9043 1.0979 0.7909 0.5214  -0.0471 0.0670  129 ARG A CG  
1063 C CD  . ARG A 147 ? 1.0257 1.0473 0.8234 0.5427  -0.0294 0.0863  129 ARG A CD  
1064 N NE  . ARG A 147 ? 1.0028 0.9431 0.7570 0.4846  -0.0325 0.0902  129 ARG A NE  
1065 C CZ  . ARG A 147 ? 1.0138 0.9529 0.7429 0.4797  -0.0544 0.1077  129 ARG A CZ  
1066 N NH1 . ARG A 147 ? 1.0322 1.0506 0.7727 0.5267  -0.0795 0.1253  129 ARG A NH1 
1067 N NH2 . ARG A 147 ? 1.0256 0.8924 0.7189 0.4255  -0.0515 0.1063  129 ARG A NH2 
1068 N N   . GLY A 148 ? 0.7550 0.8483 0.6637 0.3646  0.0202  -0.0018 130 GLY A N   
1069 C CA  . GLY A 148 ? 0.7241 0.8059 0.6410 0.3193  0.0393  -0.0227 130 GLY A CA  
1070 C C   . GLY A 148 ? 0.6791 0.8747 0.6550 0.3012  0.0413  -0.0435 130 GLY A C   
1071 O O   . GLY A 148 ? 0.6338 0.8411 0.6185 0.2447  0.0412  -0.0543 130 GLY A O   
1072 N N   . PRO A 149 ? 0.6932 0.9719 0.7062 0.3491  0.0452  -0.0497 131 PRO A N   
1073 C CA  . PRO A 149 ? 0.6490 1.0418 0.7165 0.3241  0.0516  -0.0743 131 PRO A CA  
1074 C C   . PRO A 149 ? 0.5815 1.0544 0.6772 0.2716  0.0317  -0.0799 131 PRO A C   
1075 O O   . PRO A 149 ? 0.5456 1.0392 0.6505 0.2172  0.0413  -0.0973 131 PRO A O   
1076 C CB  . PRO A 149 ? 0.6868 1.1678 0.7925 0.3944  0.0562  -0.0780 131 PRO A CB  
1077 C CG  . PRO A 149 ? 0.7684 1.1354 0.8226 0.4562  0.0648  -0.0572 131 PRO A CG  
1078 C CD  . PRO A 149 ? 0.7670 1.0406 0.7719 0.4284  0.0470  -0.0359 131 PRO A CD  
1079 N N   . GLU A 150 ? 0.5709 1.0780 0.6709 0.2856  0.0066  -0.0653 132 GLU A N   
1080 C CA  . GLU A 150 ? 0.5237 1.0951 0.6409 0.2330  -0.0092 -0.0721 132 GLU A CA  
1081 C C   . GLU A 150 ? 0.4903 0.9659 0.5708 0.1747  -0.0058 -0.0703 132 GLU A C   
1082 O O   . GLU A 150 ? 0.4648 0.9720 0.5531 0.1217  -0.0036 -0.0838 132 GLU A O   
1083 C CB  . GLU A 150 ? 0.5292 1.1538 0.6519 0.2588  -0.0365 -0.0569 132 GLU A CB  
1084 C CG  . GLU A 150 ? 0.5038 1.2382 0.6556 0.2081  -0.0484 -0.0730 132 GLU A CG  
1085 C CD  . GLU A 150 ? 0.5201 1.2775 0.6598 0.2135  -0.0753 -0.0576 132 GLU A CD  
1086 O OE1 . GLU A 150 ? 0.5341 1.3280 0.6772 0.2742  -0.0920 -0.0401 132 GLU A OE1 
1087 O OE2 . GLU A 150 ? 0.5432 1.2770 0.6648 0.1579  -0.0784 -0.0624 132 GLU A OE2 
1088 N N   . THR A 151 ? 0.4989 0.8591 0.5369 0.1844  -0.0030 -0.0547 133 THR A N   
1089 C CA  . THR A 151 ? 0.4753 0.7577 0.4832 0.1375  -0.0021 -0.0516 133 THR A CA  
1090 C C   . THR A 151 ? 0.4506 0.7228 0.4574 0.0991  0.0154  -0.0662 133 THR A C   
1091 O O   . THR A 151 ? 0.4071 0.6491 0.3988 0.0582  0.0148  -0.0662 133 THR A O   
1092 C CB  . THR A 151 ? 0.5095 0.6844 0.4731 0.1517  -0.0022 -0.0349 133 THR A CB  
1093 O OG1 . THR A 151 ? 0.5757 0.6985 0.5207 0.1620  0.0175  -0.0393 133 THR A OG1 
1094 C CG2 . THR A 151 ? 0.5361 0.7044 0.4875 0.1935  -0.0154 -0.0186 133 THR A CG2 
1095 N N   . ARG A 152 ? 0.4602 0.7568 0.4798 0.1149  0.0323  -0.0781 134 ARG A N   
1096 C CA  . ARG A 152 ? 0.4621 0.7513 0.4754 0.0778  0.0504  -0.0925 134 ARG A CA  
1097 C C   . ARG A 152 ? 0.4326 0.7822 0.4607 0.0306  0.0523  -0.1063 134 ARG A C   
1098 O O   . ARG A 152 ? 0.4386 0.7571 0.4446 -0.0088 0.0635  -0.1116 134 ARG A O   
1099 C CB  . ARG A 152 ? 0.4918 0.7984 0.5155 0.1060  0.0716  -0.1055 134 ARG A CB  
1100 C CG  . ARG A 152 ? 0.5323 0.7424 0.5176 0.1308  0.0805  -0.0962 134 ARG A CG  
1101 C CD  . ARG A 152 ? 0.5921 0.7961 0.5726 0.1352  0.1079  -0.1133 134 ARG A CD  
1102 N NE  . ARG A 152 ? 0.6634 0.7742 0.6020 0.1595  0.1217  -0.1084 134 ARG A NE  
1103 C CZ  . ARG A 152 ? 0.6762 0.7039 0.5684 0.1276  0.1261  -0.1049 134 ARG A CZ  
1104 N NH1 . ARG A 152 ? 0.6444 0.6698 0.5277 0.0781  0.1151  -0.1018 134 ARG A NH1 
1105 N NH2 . ARG A 152 ? 0.7323 0.6792 0.5829 0.1459  0.1432  -0.1050 134 ARG A NH2 
1106 N N   . GLU A 153 ? 0.4193 0.8510 0.4773 0.0313  0.0420  -0.1119 135 GLU A N   
1107 C CA  . GLU A 153 ? 0.4101 0.8897 0.4716 -0.0222 0.0472  -0.1275 135 GLU A CA  
1108 C C   . GLU A 153 ? 0.4067 0.7918 0.4238 -0.0586 0.0440  -0.1152 135 GLU A C   
1109 O O   . GLU A 153 ? 0.4376 0.7891 0.4275 -0.1001 0.0583  -0.1212 135 GLU A O   
1110 C CB  . GLU A 153 ? 0.4067 1.0000 0.5067 -0.0156 0.0348  -0.1368 135 GLU A CB  
1111 C CG  . GLU A 153 ? 0.4256 1.1266 0.5748 0.0310  0.0370  -0.1478 135 GLU A CG  
1112 C CD  . GLU A 153 ? 0.4301 1.2453 0.6164 0.0556  0.0162  -0.1484 135 GLU A CD  
1113 O OE1 . GLU A 153 ? 0.4862 1.2657 0.6549 0.0664  -0.0041 -0.1298 135 GLU A OE1 
1114 O OE2 . GLU A 153 ? 0.4820 1.4295 0.7151 0.0647  0.0199  -0.1681 135 GLU A OE2 
1115 N N   . GLN A 154 ? 0.3660 0.7021 0.3714 -0.0390 0.0271  -0.0967 136 GLN A N   
1116 C CA  . GLN A 154 ? 0.3594 0.6141 0.3288 -0.0635 0.0240  -0.0851 136 GLN A CA  
1117 C C   . GLN A 154 ? 0.3524 0.5225 0.2938 -0.0547 0.0251  -0.0706 136 GLN A C   
1118 O O   . GLN A 154 ? 0.3784 0.4909 0.2908 -0.0747 0.0258  -0.0624 136 GLN A O   
1119 C CB  . GLN A 154 ? 0.3350 0.5894 0.3064 -0.0532 0.0075  -0.0764 136 GLN A CB  
1120 C CG  . GLN A 154 ? 0.3424 0.6706 0.3278 -0.0793 0.0072  -0.0917 136 GLN A CG  
1121 C CD  . GLN A 154 ? 0.3269 0.6625 0.3109 -0.0742 -0.0082 -0.0856 136 GLN A CD  
1122 O OE1 . GLN A 154 ? 0.3002 0.6016 0.2803 -0.0412 -0.0209 -0.0693 136 GLN A OE1 
1123 N NE2 . GLN A 154 ? 0.2805 0.6592 0.2619 -0.1127 -0.0046 -0.1008 136 GLN A NE2 
1124 N N   . TYR A 155 ? 0.3302 0.4936 0.2774 -0.0237 0.0256  -0.0675 137 TYR A N   
1125 C CA  . TYR A 155 ? 0.3473 0.4412 0.2673 -0.0181 0.0261  -0.0566 137 TYR A CA  
1126 C C   . TYR A 155 ? 0.3536 0.4544 0.2730 -0.0119 0.0418  -0.0667 137 TYR A C   
1127 O O   . TYR A 155 ? 0.3541 0.4477 0.2762 0.0191  0.0459  -0.0675 137 TYR A O   
1128 C CB  . TYR A 155 ? 0.3266 0.3868 0.2409 0.0088  0.0146  -0.0444 137 TYR A CB  
1129 C CG  . TYR A 155 ? 0.3081 0.3692 0.2256 0.0052  0.0013  -0.0373 137 TYR A CG  
1130 C CD1 . TYR A 155 ? 0.3101 0.3319 0.2105 -0.0133 -0.0027 -0.0300 137 TYR A CD1 
1131 C CD2 . TYR A 155 ? 0.2888 0.3924 0.2244 0.0220  -0.0071 -0.0380 137 TYR A CD2 
1132 C CE1 . TYR A 155 ? 0.3027 0.3216 0.2040 -0.0171 -0.0104 -0.0265 137 TYR A CE1 
1133 C CE2 . TYR A 155 ? 0.2844 0.3876 0.2178 0.0132  -0.0172 -0.0338 137 TYR A CE2 
1134 C CZ  . TYR A 155 ? 0.2878 0.3442 0.2036 -0.0077 -0.0168 -0.0294 137 TYR A CZ  
1135 O OH  . TYR A 155 ? 0.2864 0.3372 0.1979 -0.0173 -0.0223 -0.0280 137 TYR A OH  
1136 N N   . PRO A 156 ? 0.3881 0.4987 0.2989 -0.0414 0.0541  -0.0759 138 PRO A N   
1137 C CA  . PRO A 156 ? 0.3976 0.5267 0.3112 -0.0383 0.0727  -0.0903 138 PRO A CA  
1138 C C   . PRO A 156 ? 0.4130 0.4867 0.3006 -0.0265 0.0788  -0.0869 138 PRO A C   
1139 O O   . PRO A 156 ? 0.4455 0.5301 0.3377 -0.0116 0.0959  -0.0999 138 PRO A O   
1140 C CB  . PRO A 156 ? 0.4252 0.5581 0.3198 -0.0819 0.0842  -0.0978 138 PRO A CB  
1141 C CG  . PRO A 156 ? 0.4354 0.5754 0.3304 -0.1007 0.0755  -0.0934 138 PRO A CG  
1142 C CD  . PRO A 156 ? 0.3994 0.5004 0.2917 -0.0794 0.0558  -0.0751 138 PRO A CD  
1143 N N   . ASN A 157 ? 0.4057 0.4246 0.2648 -0.0354 0.0673  -0.0722 139 ASN A N   
1144 C CA  . ASN A 157 ? 0.4300 0.4011 0.2603 -0.0323 0.0731  -0.0715 139 ASN A CA  
1145 C C   . ASN A 157 ? 0.4282 0.3702 0.2567 -0.0072 0.0648  -0.0633 139 ASN A C   
1146 O O   . ASN A 157 ? 0.4377 0.3349 0.2361 -0.0130 0.0681  -0.0622 139 ASN A O   
1147 C CB  . ASN A 157 ? 0.4417 0.3855 0.2380 -0.0646 0.0671  -0.0632 139 ASN A CB  
1148 C CG  . ASN A 157 ? 0.4749 0.3847 0.2368 -0.0753 0.0775  -0.0692 139 ASN A CG  
1149 O OD1 . ASN A 157 ? 0.4805 0.3816 0.2356 -0.0694 0.0986  -0.0848 139 ASN A OD1 
1150 N ND2 . ASN A 157 ? 0.4976 0.3910 0.2365 -0.0917 0.0639  -0.0584 139 ASN A ND2 
1151 N N   . LYS A 158 ? 0.4095 0.3780 0.2652 0.0164  0.0555  -0.0590 140 LYS A N   
1152 C CA  . LYS A 158 ? 0.4277 0.3657 0.2756 0.0373  0.0467  -0.0491 140 LYS A CA  
1153 C C   . LYS A 158 ? 0.4111 0.3121 0.2354 0.0144  0.0372  -0.0405 140 LYS A C   
1154 O O   . LYS A 158 ? 0.4160 0.2734 0.2138 0.0164  0.0411  -0.0392 140 LYS A O   
1155 C CB  . LYS A 158 ? 0.4869 0.3893 0.3166 0.0682  0.0633  -0.0537 140 LYS A CB  
1156 C CG  . LYS A 158 ? 0.5310 0.4795 0.3909 0.1104  0.0639  -0.0547 140 LYS A CG  
1157 C CD  . LYS A 158 ? 0.5857 0.4775 0.4161 0.1524  0.0782  -0.0518 140 LYS A CD  
1158 C CE  . LYS A 158 ? 0.6398 0.5897 0.5030 0.2033  0.0816  -0.0542 140 LYS A CE  
1159 N NZ  . LYS A 158 ? 0.7213 0.6115 0.5528 0.2524  0.1030  -0.0533 140 LYS A NZ  
1160 N N   . PHE A 159 ? 0.3948 0.3151 0.2276 -0.0062 0.0260  -0.0351 141 PHE A N   
1161 C CA  . PHE A 159 ? 0.3936 0.2966 0.2095 -0.0248 0.0175  -0.0280 141 PHE A CA  
1162 C C   . PHE A 159 ? 0.3570 0.2755 0.1870 -0.0293 0.0042  -0.0184 141 PHE A C   
1163 O O   . PHE A 159 ? 0.3552 0.2904 0.1949 -0.0335 0.0060  -0.0195 141 PHE A O   
1164 C CB  . PHE A 159 ? 0.4315 0.3283 0.2242 -0.0454 0.0258  -0.0328 141 PHE A CB  
1165 C CG  . PHE A 159 ? 0.4209 0.3221 0.2003 -0.0630 0.0133  -0.0228 141 PHE A CG  
1166 C CD1 . PHE A 159 ? 0.4727 0.3701 0.2373 -0.0725 0.0082  -0.0221 141 PHE A CD1 
1167 C CD2 . PHE A 159 ? 0.4613 0.3714 0.2378 -0.0706 0.0084  -0.0146 141 PHE A CD2 
1168 C CE1 . PHE A 159 ? 0.4709 0.3889 0.2275 -0.0829 -0.0057 -0.0122 141 PHE A CE1 
1169 C CE2 . PHE A 159 ? 0.4501 0.3627 0.2100 -0.0776 -0.0044 -0.0014 141 PHE A CE2 
1170 C CZ  . PHE A 159 ? 0.4418 0.3660 0.1963 -0.0808 -0.0131 0.0002  141 PHE A CZ  
1171 N N   . ILE A 160 ? 0.3611 0.2722 0.1883 -0.0304 -0.0058 -0.0111 142 ILE A N   
1172 C CA  . ILE A 160 ? 0.3595 0.2750 0.1929 -0.0315 -0.0150 -0.0017 142 ILE A CA  
1173 C C   . ILE A 160 ? 0.3721 0.2898 0.1916 -0.0371 -0.0227 0.0068  142 ILE A C   
1174 O O   . ILE A 160 ? 0.3674 0.2925 0.1783 -0.0442 -0.0239 0.0034  142 ILE A O   
1175 C CB  . ILE A 160 ? 0.3493 0.2655 0.1976 -0.0219 -0.0200 -0.0006 142 ILE A CB  
1176 C CG1 . ILE A 160 ? 0.3748 0.2877 0.2190 -0.0213 -0.0230 -0.0017 142 ILE A CG1 
1177 C CG2 . ILE A 160 ? 0.3568 0.2841 0.2179 -0.0154 -0.0164 -0.0070 142 ILE A CG2 
1178 C CD1 . ILE A 160 ? 0.3408 0.2549 0.1953 -0.0162 -0.0268 -0.0010 142 ILE A CD1 
1179 N N   . GLN A 161 ? 0.3794 0.2909 0.1931 -0.0339 -0.0270 0.0178  143 GLN A N   
1180 C CA  . GLN A 161 ? 0.4177 0.3378 0.2197 -0.0283 -0.0378 0.0308  143 GLN A CA  
1181 C C   . GLN A 161 ? 0.4165 0.3481 0.2382 -0.0122 -0.0440 0.0333  143 GLN A C   
1182 O O   . GLN A 161 ? 0.4184 0.3294 0.2441 -0.0004 -0.0411 0.0375  143 GLN A O   
1183 C CB  . GLN A 161 ? 0.4539 0.3473 0.2299 -0.0265 -0.0367 0.0442  143 GLN A CB  
1184 C CG  . GLN A 161 ? 0.4966 0.3801 0.2494 -0.0466 -0.0282 0.0406  143 GLN A CG  
1185 C CD  . GLN A 161 ? 0.5431 0.3881 0.2593 -0.0489 -0.0244 0.0546  143 GLN A CD  
1186 O OE1 . GLN A 161 ? 0.6249 0.4633 0.3083 -0.0583 -0.0261 0.0630  143 GLN A OE1 
1187 N NE2 . GLN A 161 ? 0.5660 0.3780 0.2790 -0.0420 -0.0178 0.0578  143 GLN A NE2 
1188 N N   . ARG A 162 ? 0.4323 0.3962 0.2633 -0.0164 -0.0490 0.0274  144 ARG A N   
1189 C CA  . ARG A 162 ? 0.4292 0.4167 0.2805 -0.0057 -0.0531 0.0259  144 ARG A CA  
1190 C C   . ARG A 162 ? 0.4428 0.4444 0.2988 0.0203  -0.0617 0.0407  144 ARG A C   
1191 O O   . ARG A 162 ? 0.4277 0.4336 0.3011 0.0358  -0.0597 0.0396  144 ARG A O   
1192 C CB  . ARG A 162 ? 0.4353 0.4601 0.2875 -0.0243 -0.0545 0.0144  144 ARG A CB  
1193 C CG  . ARG A 162 ? 0.4643 0.4595 0.3082 -0.0405 -0.0423 0.0008  144 ARG A CG  
1194 C CD  . ARG A 162 ? 0.5006 0.5167 0.3496 -0.0521 -0.0392 -0.0102 144 ARG A CD  
1195 N NE  . ARG A 162 ? 0.4718 0.5173 0.3053 -0.0771 -0.0384 -0.0191 144 ARG A NE  
1196 C CZ  . ARG A 162 ? 0.4667 0.5728 0.3094 -0.0899 -0.0432 -0.0261 144 ARG A CZ  
1197 N NH1 . ARG A 162 ? 0.4556 0.6059 0.3279 -0.0759 -0.0487 -0.0257 144 ARG A NH1 
1198 N NH2 . ARG A 162 ? 0.4664 0.5929 0.2859 -0.1208 -0.0400 -0.0366 144 ARG A NH2 
1199 N N   . ASP A 163 ? 0.4611 0.4675 0.2980 0.0274  -0.0701 0.0551  145 ASP A N   
1200 C CA  . ASP A 163 ? 0.4876 0.4945 0.3202 0.0615  -0.0775 0.0740  145 ASP A CA  
1201 C C   . ASP A 163 ? 0.5038 0.4385 0.3204 0.0771  -0.0642 0.0811  145 ASP A C   
1202 O O   . ASP A 163 ? 0.5263 0.4433 0.3335 0.1103  -0.0649 0.0963  145 ASP A O   
1203 C CB  . ASP A 163 ? 0.5288 0.5590 0.3372 0.0677  -0.0920 0.0910  145 ASP A CB  
1204 C CG  . ASP A 163 ? 0.6000 0.5790 0.3693 0.0487  -0.0859 0.0964  145 ASP A CG  
1205 O OD1 . ASP A 163 ? 0.6206 0.5423 0.3801 0.0386  -0.0702 0.0910  145 ASP A OD1 
1206 O OD2 . ASP A 163 ? 0.6915 0.6960 0.4383 0.0417  -0.0972 0.1053  145 ASP A OD2 
1207 N N   . ASP A 164 ? 0.4721 0.3676 0.2833 0.0537  -0.0509 0.0693  146 ASP A N   
1208 C CA  . ASP A 164 ? 0.5061 0.3391 0.2988 0.0551  -0.0351 0.0696  146 ASP A CA  
1209 C C   . ASP A 164 ? 0.4794 0.3183 0.2982 0.0615  -0.0288 0.0576  146 ASP A C   
1210 O O   . ASP A 164 ? 0.4433 0.2767 0.2710 0.0414  -0.0209 0.0426  146 ASP A O   
1211 C CB  . ASP A 164 ? 0.4908 0.2991 0.2682 0.0235  -0.0247 0.0600  146 ASP A CB  
1212 C CG  . ASP A 164 ? 0.5477 0.2925 0.2937 0.0153  -0.0064 0.0595  146 ASP A CG  
1213 O OD1 . ASP A 164 ? 0.5791 0.2859 0.3118 0.0352  0.0005  0.0662  146 ASP A OD1 
1214 O OD2 . ASP A 164 ? 0.5768 0.3102 0.3093 -0.0131 0.0037  0.0503  146 ASP A OD2 
1215 N N   . THR A 165 ? 0.4979 0.3535 0.3284 0.0916  -0.0326 0.0644  147 THR A N   
1216 C CA  . THR A 165 ? 0.4934 0.3644 0.3502 0.0970  -0.0259 0.0513  147 THR A CA  
1217 C C   . THR A 165 ? 0.5412 0.3452 0.3770 0.0956  -0.0056 0.0459  147 THR A C   
1218 O O   . THR A 165 ? 0.5275 0.3358 0.3778 0.0860  0.0028  0.0306  147 THR A O   
1219 C CB  . THR A 165 ? 0.4982 0.4208 0.3791 0.1301  -0.0338 0.0566  147 THR A CB  
1220 O OG1 . THR A 165 ? 0.5447 0.4343 0.4012 0.1673  -0.0338 0.0776  147 THR A OG1 
1221 C CG2 . THR A 165 ? 0.4561 0.4575 0.3588 0.1178  -0.0513 0.0536  147 THR A CG2 
1222 N N   . GLU A 166 ? 0.6022 0.3401 0.3967 0.0985  0.0048  0.0565  148 GLU A N   
1223 C CA  . GLU A 166 ? 0.6621 0.3322 0.4277 0.0839  0.0283  0.0466  148 GLU A CA  
1224 C C   . GLU A 166 ? 0.6160 0.3023 0.3880 0.0387  0.0305  0.0280  148 GLU A C   
1225 O O   . GLU A 166 ? 0.6422 0.3137 0.4109 0.0210  0.0435  0.0125  148 GLU A O   
1226 C CB  . GLU A 166 ? 0.7541 0.3363 0.4622 0.0967  0.0439  0.0619  148 GLU A CB  
1227 C CG  . GLU A 166 ? 0.8695 0.4173 0.5678 0.1486  0.0524  0.0743  148 GLU A CG  
1228 C CD  . GLU A 166 ? 0.9701 0.4501 0.6152 0.1820  0.0557  0.1018  148 GLU A CD  
1229 O OE1 . GLU A 166 ? 1.1086 0.6120 0.7462 0.1799  0.0376  0.1173  148 GLU A OE1 
1230 O OE2 . GLU A 166 ? 1.1293 0.5266 0.7341 0.2128  0.0777  0.1093  148 GLU A OE2 
1231 N N   . ARG A 167 ? 0.5515 0.2771 0.3355 0.0231  0.0170  0.0288  149 ARG A N   
1232 C CA  . ARG A 167 ? 0.5108 0.2616 0.3042 -0.0093 0.0175  0.0135  149 ARG A CA  
1233 C C   . ARG A 167 ? 0.4553 0.2591 0.2840 -0.0094 0.0059  0.0051  149 ARG A C   
1234 O O   . ARG A 167 ? 0.4502 0.2664 0.2833 -0.0268 0.0088  -0.0070 149 ARG A O   
1235 C CB  . ARG A 167 ? 0.5031 0.2641 0.2878 -0.0241 0.0140  0.0165  149 ARG A CB  
1236 C CG  . ARG A 167 ? 0.4546 0.2593 0.2581 -0.0464 0.0118  0.0023  149 ARG A CG  
1237 C CD  . ARG A 167 ? 0.4745 0.2865 0.2672 -0.0620 0.0148  0.0016  149 ARG A CD  
1238 N NE  . ARG A 167 ? 0.4127 0.2797 0.2315 -0.0724 0.0114  -0.0113 149 ARG A NE  
1239 C CZ  . ARG A 167 ? 0.4273 0.3204 0.2507 -0.0795 0.0126  -0.0152 149 ARG A CZ  
1240 N NH1 . ARG A 167 ? 0.4499 0.3166 0.2489 -0.0845 0.0172  -0.0077 149 ARG A NH1 
1241 N NH2 . ARG A 167 ? 0.3697 0.3162 0.2200 -0.0787 0.0095  -0.0259 149 ARG A NH2 
1242 N N   . PHE A 168 ? 0.4205 0.2549 0.2682 0.0071  -0.0065 0.0113  150 PHE A N   
1243 C CA  . PHE A 168 ? 0.3914 0.2636 0.2598 0.0031  -0.0149 0.0046  150 PHE A CA  
1244 C C   . PHE A 168 ? 0.3874 0.2726 0.2690 0.0140  -0.0142 0.0013  150 PHE A C   
1245 O O   . PHE A 168 ? 0.4066 0.3011 0.2943 0.0324  -0.0158 0.0077  150 PHE A O   
1246 C CB  . PHE A 168 ? 0.3733 0.2685 0.2450 0.0023  -0.0244 0.0087  150 PHE A CB  
1247 C CG  . PHE A 168 ? 0.3748 0.2642 0.2364 -0.0079 -0.0229 0.0094  150 PHE A CG  
1248 C CD1 . PHE A 168 ? 0.3655 0.2654 0.2315 -0.0173 -0.0209 0.0010  150 PHE A CD1 
1249 C CD2 . PHE A 168 ? 0.3919 0.2734 0.2398 -0.0069 -0.0239 0.0178  150 PHE A CD2 
1250 C CE1 . PHE A 168 ? 0.3705 0.2782 0.2335 -0.0251 -0.0178 -0.0015 150 PHE A CE1 
1251 C CE2 . PHE A 168 ? 0.4171 0.2964 0.2554 -0.0195 -0.0195 0.0155  150 PHE A CE2 
1252 C CZ  . PHE A 168 ? 0.4024 0.2978 0.2511 -0.0287 -0.0154 0.0044  150 PHE A CZ  
1253 N N   . TYR A 169 ? 0.3669 0.2571 0.2518 0.0036  -0.0112 -0.0087 151 TYR A N   
1254 C CA  . TYR A 169 ? 0.3648 0.2691 0.2603 0.0081  -0.0068 -0.0155 151 TYR A CA  
1255 C C   . TYR A 169 ? 0.3378 0.2630 0.2330 -0.0058 -0.0121 -0.0204 151 TYR A C   
1256 O O   . TYR A 169 ? 0.3232 0.2372 0.2052 -0.0168 -0.0141 -0.0215 151 TYR A O   
1257 C CB  . TYR A 169 ? 0.3874 0.2674 0.2744 0.0021  0.0061  -0.0249 151 TYR A CB  
1258 C CG  . TYR A 169 ? 0.3960 0.2890 0.2939 0.0077  0.0156  -0.0347 151 TYR A CG  
1259 C CD1 . TYR A 169 ? 0.4298 0.3214 0.3386 0.0337  0.0244  -0.0336 151 TYR A CD1 
1260 C CD2 . TYR A 169 ? 0.3807 0.2867 0.2752 -0.0108 0.0172  -0.0449 151 TYR A CD2 
1261 C CE1 . TYR A 169 ? 0.4437 0.3571 0.3679 0.0416  0.0358  -0.0456 151 TYR A CE1 
1262 C CE2 . TYR A 169 ? 0.4057 0.3275 0.3096 -0.0101 0.0292  -0.0573 151 TYR A CE2 
1263 C CZ  . TYR A 169 ? 0.4292 0.3597 0.3522 0.0167  0.0390  -0.0590 151 TYR A CZ  
1264 O OH  . TYR A 169 ? 0.4393 0.3945 0.3772 0.0210  0.0529  -0.0734 151 TYR A OH  
1265 N N   . ILE A 170 ? 0.3355 0.2909 0.2413 -0.0050 -0.0129 -0.0236 152 ILE A N   
1266 C CA  . ILE A 170 ? 0.3270 0.2909 0.2210 -0.0246 -0.0124 -0.0303 152 ILE A CA  
1267 C C   . ILE A 170 ? 0.3282 0.2951 0.2197 -0.0353 -0.0024 -0.0419 152 ILE A C   
1268 O O   . ILE A 170 ? 0.2850 0.2795 0.1973 -0.0276 0.0042  -0.0493 152 ILE A O   
1269 C CB  . ILE A 170 ? 0.3280 0.3287 0.2283 -0.0302 -0.0158 -0.0322 152 ILE A CB  
1270 C CG1 . ILE A 170 ? 0.3451 0.3420 0.2435 -0.0217 -0.0247 -0.0211 152 ILE A CG1 
1271 C CG2 . ILE A 170 ? 0.3142 0.3062 0.1877 -0.0587 -0.0091 -0.0417 152 ILE A CG2 
1272 C CD1 . ILE A 170 ? 0.3387 0.3827 0.2440 -0.0273 -0.0297 -0.0230 152 ILE A CD1 
1273 N N   . LEU A 171 ? 0.3274 0.2652 0.1906 -0.0507 -0.0008 -0.0428 153 LEU A N   
1274 C CA  . LEU A 171 ? 0.3568 0.2879 0.2057 -0.0656 0.0085  -0.0523 153 LEU A CA  
1275 C C   . LEU A 171 ? 0.3919 0.3319 0.2244 -0.0884 0.0165  -0.0616 153 LEU A C   
1276 O O   . LEU A 171 ? 0.4611 0.3627 0.2523 -0.1037 0.0184  -0.0585 153 LEU A O   
1277 C CB  . LEU A 171 ? 0.3749 0.2713 0.1954 -0.0680 0.0033  -0.0449 153 LEU A CB  
1278 C CG  . LEU A 171 ? 0.3325 0.2300 0.1680 -0.0556 -0.0014 -0.0411 153 LEU A CG  
1279 C CD1 . LEU A 171 ? 0.3637 0.2514 0.1816 -0.0525 -0.0131 -0.0310 153 LEU A CD1 
1280 C CD2 . LEU A 171 ? 0.3715 0.2699 0.2110 -0.0624 0.0107  -0.0533 153 LEU A CD2 
1281 N N   . ASN A 172 ? 0.3687 0.3598 0.2298 -0.0911 0.0231  -0.0738 154 ASN A N   
1282 C CA  . ASN A 172 ? 0.3863 0.4047 0.2374 -0.1190 0.0316  -0.0868 154 ASN A CA  
1283 C C   . ASN A 172 ? 0.4135 0.4197 0.2323 -0.1530 0.0485  -0.1017 154 ASN A C   
1284 O O   . ASN A 172 ? 0.4299 0.4296 0.2170 -0.1854 0.0580  -0.1105 154 ASN A O   
1285 C CB  . ASN A 172 ? 0.3581 0.4591 0.2577 -0.1084 0.0306  -0.0958 154 ASN A CB  
1286 C CG  . ASN A 172 ? 0.3356 0.4525 0.2513 -0.0883 0.0153  -0.0828 154 ASN A CG  
1287 O OD1 . ASN A 172 ? 0.3165 0.4234 0.2096 -0.1066 0.0126  -0.0815 154 ASN A OD1 
1288 N ND2 . ASN A 172 ? 0.3065 0.4467 0.2562 -0.0522 0.0080  -0.0741 154 ASN A ND2 
1289 N N   . THR A 173 ? 0.2966 0.2898 0.1921 -0.0087 -0.0320 -0.0160 155 THR A N   
1290 C CA  . THR A 173 ? 0.3075 0.2967 0.2093 -0.0078 -0.0307 -0.0165 155 THR A CA  
1291 C C   . THR A 173 ? 0.3013 0.2774 0.2043 -0.0030 -0.0265 -0.0169 155 THR A C   
1292 O O   . THR A 173 ? 0.2984 0.2697 0.2000 0.0012  -0.0256 -0.0158 155 THR A O   
1293 C CB  . THR A 173 ? 0.3128 0.3114 0.2243 -0.0050 -0.0342 -0.0099 155 THR A CB  
1294 O OG1 . THR A 173 ? 0.3025 0.2960 0.2179 0.0018  -0.0330 -0.0066 155 THR A OG1 
1295 C CG2 . THR A 173 ? 0.3305 0.3458 0.2439 -0.0083 -0.0401 -0.0048 155 THR A CG2 
1296 N N   . LEU A 174 ? 0.3030 0.2752 0.2091 -0.0040 -0.0242 -0.0172 156 LEU A N   
1297 C CA  . LEU A 174 ? 0.2953 0.2594 0.2021 0.0002  -0.0214 -0.0142 156 LEU A CA  
1298 C C   . LEU A 174 ? 0.2938 0.2618 0.2007 0.0049  -0.0235 -0.0108 156 LEU A C   
1299 O O   . LEU A 174 ? 0.2981 0.2632 0.2031 0.0076  -0.0230 -0.0086 156 LEU A O   
1300 C CB  . LEU A 174 ? 0.2968 0.2573 0.2067 -0.0027 -0.0179 -0.0133 156 LEU A CB  
1301 C CG  . LEU A 174 ? 0.3154 0.2677 0.2279 -0.0076 -0.0134 -0.0179 156 LEU A CG  
1302 C CD1 . LEU A 174 ? 0.3516 0.3015 0.2694 -0.0125 -0.0096 -0.0178 156 LEU A CD1 
1303 C CD2 . LEU A 174 ? 0.3644 0.3057 0.2793 -0.0035 -0.0095 -0.0159 156 LEU A CD2 
1304 N N   . PHE A 175 ? 0.2809 0.2563 0.1919 0.0053  -0.0254 -0.0105 157 PHE A N   
1305 C CA  . PHE A 175 ? 0.2770 0.2541 0.1908 0.0087  -0.0253 -0.0099 157 PHE A CA  
1306 C C   . PHE A 175 ? 0.2856 0.2601 0.1972 0.0110  -0.0266 -0.0097 157 PHE A C   
1307 O O   . PHE A 175 ? 0.3056 0.2798 0.2181 0.0125  -0.0258 -0.0109 157 PHE A O   
1308 C CB  . PHE A 175 ? 0.2747 0.2590 0.1994 0.0096  -0.0255 -0.0084 157 PHE A CB  
1309 C CG  . PHE A 175 ? 0.2600 0.2484 0.1909 0.0082  -0.0226 -0.0093 157 PHE A CG  
1310 C CD1 . PHE A 175 ? 0.2729 0.2595 0.2025 0.0081  -0.0177 -0.0127 157 PHE A CD1 
1311 C CD2 . PHE A 175 ? 0.2788 0.2752 0.2169 0.0060  -0.0246 -0.0069 157 PHE A CD2 
1312 C CE1 . PHE A 175 ? 0.2541 0.2452 0.1900 0.0064  -0.0135 -0.0139 157 PHE A CE1 
1313 C CE2 . PHE A 175 ? 0.2939 0.2953 0.2402 0.0047  -0.0213 -0.0076 157 PHE A CE2 
1314 C CZ  . PHE A 175 ? 0.2645 0.2623 0.2097 0.0052  -0.0151 -0.0111 157 PHE A CZ  
1315 N N   . ASN A 176 ? 0.2916 0.2652 0.2003 0.0101  -0.0277 -0.0095 158 ASN A N   
1316 C CA  . ASN A 176 ? 0.2829 0.2548 0.1903 0.0117  -0.0279 -0.0092 158 ASN A CA  
1317 C C   . ASN A 176 ? 0.2937 0.2605 0.1993 0.0131  -0.0263 -0.0100 158 ASN A C   
1318 O O   . ASN A 176 ? 0.2824 0.2490 0.1892 0.0145  -0.0258 -0.0099 158 ASN A O   
1319 C CB  . ASN A 176 ? 0.2854 0.2609 0.1895 0.0090  -0.0286 -0.0090 158 ASN A CB  
1320 C CG  . ASN A 176 ? 0.3141 0.2986 0.2221 0.0081  -0.0317 -0.0041 158 ASN A CG  
1321 O OD1 . ASN A 176 ? 0.3282 0.3201 0.2325 0.0037  -0.0338 -0.0036 158 ASN A OD1 
1322 N ND2 . ASN A 176 ? 0.3437 0.3287 0.2607 0.0117  -0.0316 -0.0003 158 ASN A ND2 
1323 N N   . LEU A 177 ? 0.2894 0.2529 0.1946 0.0130  -0.0251 -0.0092 159 LEU A N   
1324 C CA  . LEU A 177 ? 0.3002 0.2605 0.2081 0.0154  -0.0238 -0.0064 159 LEU A CA  
1325 C C   . LEU A 177 ? 0.3003 0.2666 0.2093 0.0175  -0.0268 -0.0037 159 LEU A C   
1326 O O   . LEU A 177 ? 0.3023 0.2696 0.2162 0.0198  -0.0268 -0.0021 159 LEU A O   
1327 C CB  . LEU A 177 ? 0.3150 0.2707 0.2246 0.0149  -0.0215 -0.0032 159 LEU A CB  
1328 C CG  . LEU A 177 ? 0.3021 0.2499 0.2141 0.0119  -0.0168 -0.0073 159 LEU A CG  
1329 C CD1 . LEU A 177 ? 0.3188 0.2605 0.2358 0.0117  -0.0134 -0.0024 159 LEU A CD1 
1330 C CD2 . LEU A 177 ? 0.3082 0.2515 0.2243 0.0125  -0.0127 -0.0117 159 LEU A CD2 
1331 N N   . PRO A 178 ? 0.3023 0.2739 0.2078 0.0158  -0.0286 -0.0046 160 PRO A N   
1332 C CA  . PRO A 178 ? 0.3119 0.2910 0.2174 0.0151  -0.0311 -0.0050 160 PRO A CA  
1333 C C   . PRO A 178 ? 0.3101 0.2895 0.2208 0.0158  -0.0312 -0.0079 160 PRO A C   
1334 O O   . PRO A 178 ? 0.2980 0.2826 0.2126 0.0164  -0.0331 -0.0061 160 PRO A O   
1335 C CB  . PRO A 178 ? 0.3199 0.3027 0.2208 0.0116  -0.0301 -0.0094 160 PRO A CB  
1336 C CG  . PRO A 178 ? 0.3042 0.2831 0.2029 0.0114  -0.0280 -0.0077 160 PRO A CG  
1337 C CD  . PRO A 178 ? 0.3017 0.2736 0.2041 0.0134  -0.0274 -0.0065 160 PRO A CD  
1338 N N   . GLU A 179 ? 0.3134 0.2887 0.2257 0.0157  -0.0292 -0.0104 161 GLU A N   
1339 C CA  . GLU A 179 ? 0.3127 0.2880 0.2302 0.0160  -0.0284 -0.0110 161 GLU A CA  
1340 C C   . GLU A 179 ? 0.2971 0.2714 0.2159 0.0177  -0.0274 -0.0090 161 GLU A C   
1341 O O   . GLU A 179 ? 0.2919 0.2688 0.2159 0.0179  -0.0268 -0.0090 161 GLU A O   
1342 C CB  . GLU A 179 ? 0.3196 0.2927 0.2404 0.0157  -0.0267 -0.0108 161 GLU A CB  
1343 C CG  . GLU A 179 ? 0.3307 0.3030 0.2478 0.0158  -0.0269 -0.0078 161 GLU A CG  
1344 C CD  . GLU A 179 ? 0.3500 0.3240 0.2729 0.0160  -0.0268 -0.0044 161 GLU A CD  
1345 O OE1 . GLU A 179 ? 0.4011 0.3765 0.3279 0.0162  -0.0263 0.0001  161 GLU A OE1 
1346 O OE2 . GLU A 179 ? 0.3728 0.3477 0.2982 0.0161  -0.0269 -0.0048 161 GLU A OE2 
1347 N N   . THR A 180 ? 0.2841 0.2545 0.1997 0.0184  -0.0258 -0.0084 162 THR A N   
1348 C CA  . THR A 180 ? 0.2834 0.2515 0.2023 0.0197  -0.0222 -0.0088 162 THR A CA  
1349 C C   . THR A 180 ? 0.2843 0.2567 0.2124 0.0227  -0.0232 -0.0055 162 THR A C   
1350 O O   . THR A 180 ? 0.2760 0.2512 0.2109 0.0237  -0.0211 -0.0058 162 THR A O   
1351 C CB  . THR A 180 ? 0.2792 0.2410 0.1958 0.0188  -0.0188 -0.0108 162 THR A CB  
1352 O OG1 . THR A 180 ? 0.2893 0.2515 0.1979 0.0148  -0.0193 -0.0135 162 THR A OG1 
1353 C CG2 . THR A 180 ? 0.2914 0.2493 0.2140 0.0196  -0.0120 -0.0139 162 THR A CG2 
1354 N N   . TYR A 181 ? 0.2747 0.2501 0.2036 0.0237  -0.0266 -0.0013 163 TYR A N   
1355 C CA  . TYR A 181 ? 0.2821 0.2665 0.2201 0.0260  -0.0296 0.0046  163 TYR A CA  
1356 C C   . TYR A 181 ? 0.2735 0.2679 0.2128 0.0232  -0.0333 0.0023  163 TYR A C   
1357 O O   . TYR A 181 ? 0.2605 0.2623 0.2106 0.0246  -0.0339 0.0046  163 TYR A O   
1358 C CB  . TYR A 181 ? 0.2927 0.2813 0.2285 0.0264  -0.0333 0.0116  163 TYR A CB  
1359 C CG  . TYR A 181 ? 0.2711 0.2728 0.2172 0.0287  -0.0379 0.0212  163 TYR A CG  
1360 C CD1 . TYR A 181 ? 0.2968 0.2982 0.2607 0.0345  -0.0348 0.0271  163 TYR A CD1 
1361 C CD2 . TYR A 181 ? 0.2895 0.3062 0.2291 0.0247  -0.0449 0.0245  163 TYR A CD2 
1362 C CE1 . TYR A 181 ? 0.2791 0.2957 0.2561 0.0373  -0.0399 0.0383  163 TYR A CE1 
1363 C CE2 . TYR A 181 ? 0.2898 0.3237 0.2385 0.0257  -0.0510 0.0351  163 TYR A CE2 
1364 C CZ  . TYR A 181 ? 0.2818 0.3163 0.2506 0.0327  -0.0492 0.0434  163 TYR A CZ  
1365 O OH  . TYR A 181 ? 0.3141 0.3686 0.2964 0.0347  -0.0559 0.0567  163 TYR A OH  
1366 N N   . LEU A 182 ? 0.2823 0.2766 0.2135 0.0190  -0.0345 -0.0030 164 LEU A N   
1367 C CA  . LEU A 182 ? 0.2763 0.2779 0.2102 0.0149  -0.0361 -0.0075 164 LEU A CA  
1368 C C   . LEU A 182 ? 0.2734 0.2728 0.2156 0.0154  -0.0327 -0.0089 164 LEU A C   
1369 O O   . LEU A 182 ? 0.2669 0.2754 0.2176 0.0134  -0.0342 -0.0094 164 LEU A O   
1370 C CB  . LEU A 182 ? 0.2712 0.2695 0.1986 0.0108  -0.0350 -0.0140 164 LEU A CB  
1371 C CG  . LEU A 182 ? 0.2898 0.2930 0.2213 0.0049  -0.0343 -0.0216 164 LEU A CG  
1372 C CD1 . LEU A 182 ? 0.2979 0.3177 0.2297 0.0002  -0.0398 -0.0223 164 LEU A CD1 
1373 C CD2 . LEU A 182 ? 0.2759 0.2733 0.2035 0.0020  -0.0305 -0.0284 164 LEU A CD2 
1374 N N   . LEU A 183 ? 0.2748 0.2646 0.2146 0.0172  -0.0283 -0.0089 165 LEU A N   
1375 C CA  . LEU A 183 ? 0.2851 0.2741 0.2305 0.0172  -0.0240 -0.0088 165 LEU A CA  
1376 C C   . LEU A 183 ? 0.2846 0.2804 0.2406 0.0196  -0.0232 -0.0067 165 LEU A C   
1377 O O   . LEU A 183 ? 0.2867 0.2887 0.2519 0.0178  -0.0224 -0.0072 165 LEU A O   
1378 C CB  . LEU A 183 ? 0.2802 0.2619 0.2180 0.0176  -0.0202 -0.0082 165 LEU A CB  
1379 C CG  . LEU A 183 ? 0.2811 0.2593 0.2148 0.0157  -0.0209 -0.0074 165 LEU A CG  
1380 C CD1 . LEU A 183 ? 0.2915 0.2675 0.2163 0.0153  -0.0198 -0.0054 165 LEU A CD1 
1381 C CD2 . LEU A 183 ? 0.2917 0.2705 0.2341 0.0135  -0.0187 -0.0063 165 LEU A CD2 
1382 N N   . ALA A 184 ? 0.2892 0.2838 0.2470 0.0235  -0.0225 -0.0039 166 ALA A N   
1383 C CA  . ALA A 184 ? 0.2774 0.2785 0.2506 0.0274  -0.0209 -0.0001 166 ALA A CA  
1384 C C   . ALA A 184 ? 0.2726 0.2900 0.2559 0.0264  -0.0284 0.0042  166 ALA A C   
1385 O O   . ALA A 184 ? 0.2573 0.2845 0.2553 0.0269  -0.0276 0.0057  166 ALA A O   
1386 C CB  . ALA A 184 ? 0.2792 0.2737 0.2553 0.0320  -0.0180 0.0029  166 ALA A CB  
1387 N N   . CYS A 185 ? 0.2841 0.3065 0.2591 0.0239  -0.0353 0.0056  167 CYS A N   
1388 C CA  . CYS A 185 ? 0.2775 0.3185 0.2568 0.0198  -0.0433 0.0079  167 CYS A CA  
1389 C C   . CYS A 185 ? 0.2818 0.3284 0.2657 0.0138  -0.0428 0.0007  167 CYS A C   
1390 O O   . CYS A 185 ? 0.2801 0.3436 0.2764 0.0117  -0.0469 0.0029  167 CYS A O   
1391 C CB  . CYS A 185 ? 0.2830 0.3274 0.2472 0.0152  -0.0485 0.0066  167 CYS A CB  
1392 S SG  . CYS A 185 ? 0.3044 0.3500 0.2658 0.0202  -0.0515 0.0186  167 CYS A SG  
1393 N N   . LEU A 186 ? 0.2684 0.3020 0.2443 0.0108  -0.0380 -0.0069 168 LEU A N   
1394 C CA  . LEU A 186 ? 0.2642 0.2995 0.2467 0.0049  -0.0355 -0.0133 168 LEU A CA  
1395 C C   . LEU A 186 ? 0.2550 0.2929 0.2517 0.0069  -0.0310 -0.0107 168 LEU A C   
1396 O O   . LEU A 186 ? 0.2470 0.2975 0.2563 0.0025  -0.0325 -0.0124 168 LEU A O   
1397 C CB  . LEU A 186 ? 0.2698 0.2897 0.2442 0.0028  -0.0306 -0.0186 168 LEU A CB  
1398 C CG  . LEU A 186 ? 0.2775 0.2959 0.2423 -0.0011 -0.0326 -0.0243 168 LEU A CG  
1399 C CD1 . LEU A 186 ? 0.3088 0.3115 0.2714 -0.0006 -0.0266 -0.0267 168 LEU A CD1 
1400 C CD2 . LEU A 186 ? 0.2848 0.3169 0.2529 -0.0102 -0.0359 -0.0324 168 LEU A CD2 
1401 N N   . VAL A 187 ? 0.2524 0.2804 0.2477 0.0126  -0.0249 -0.0076 169 VAL A N   
1402 C CA  . VAL A 187 ? 0.2548 0.2861 0.2632 0.0141  -0.0186 -0.0061 169 VAL A CA  
1403 C C   . VAL A 187 ? 0.2529 0.3009 0.2793 0.0165  -0.0222 -0.0017 169 VAL A C   
1404 O O   . VAL A 187 ? 0.2632 0.3221 0.3052 0.0141  -0.0206 -0.0019 169 VAL A O   
1405 C CB  . VAL A 187 ? 0.2487 0.2681 0.2499 0.0181  -0.0106 -0.0057 169 VAL A CB  
1406 C CG1 . VAL A 187 ? 0.2277 0.2515 0.2422 0.0192  -0.0021 -0.0055 169 VAL A CG1 
1407 C CG2 . VAL A 187 ? 0.2313 0.2393 0.2168 0.0150  -0.0087 -0.0073 169 VAL A CG2 
1408 N N   . ASP A 188 ? 0.2563 0.3081 0.2828 0.0211  -0.0273 0.0037  170 ASP A N   
1409 C CA  . ASP A 188 ? 0.2607 0.3317 0.3066 0.0242  -0.0327 0.0119  170 ASP A CA  
1410 C C   . ASP A 188 ? 0.2605 0.3521 0.3117 0.0161  -0.0417 0.0107  170 ASP A C   
1411 O O   . ASP A 188 ? 0.2419 0.3514 0.3137 0.0160  -0.0435 0.0146  170 ASP A O   
1412 C CB  . ASP A 188 ? 0.2598 0.3317 0.3045 0.0298  -0.0373 0.0207  170 ASP A CB  
1413 C CG  . ASP A 188 ? 0.2839 0.3789 0.3514 0.0335  -0.0443 0.0333  170 ASP A CG  
1414 O OD1 . ASP A 188 ? 0.3032 0.4025 0.3945 0.0397  -0.0386 0.0381  170 ASP A OD1 
1415 O OD2 . ASP A 188 ? 0.3247 0.4359 0.3872 0.0300  -0.0554 0.0394  170 ASP A OD2 
1416 N N   . PHE A 189 ? 0.2543 0.3446 0.2882 0.0089  -0.0466 0.0045  171 PHE A N   
1417 C CA  . PHE A 189 ? 0.2665 0.3764 0.3028 -0.0012 -0.0542 0.0000  171 PHE A CA  
1418 C C   . PHE A 189 ? 0.2589 0.3714 0.3087 -0.0068 -0.0494 -0.0068 171 PHE A C   
1419 O O   . PHE A 189 ? 0.2533 0.3885 0.3199 -0.0111 -0.0544 -0.0051 171 PHE A O   
1420 C CB  . PHE A 189 ? 0.2758 0.3811 0.2912 -0.0086 -0.0571 -0.0085 171 PHE A CB  
1421 C CG  . PHE A 189 ? 0.2959 0.4181 0.3126 -0.0216 -0.0617 -0.0182 171 PHE A CG  
1422 C CD1 . PHE A 189 ? 0.3150 0.4671 0.3360 -0.0270 -0.0728 -0.0136 171 PHE A CD1 
1423 C CD2 . PHE A 189 ? 0.3332 0.4431 0.3496 -0.0290 -0.0544 -0.0314 171 PHE A CD2 
1424 C CE1 . PHE A 189 ? 0.3523 0.5233 0.3744 -0.0414 -0.0771 -0.0247 171 PHE A CE1 
1425 C CE2 . PHE A 189 ? 0.3334 0.4588 0.3540 -0.0427 -0.0571 -0.0430 171 PHE A CE2 
1426 C CZ  . PHE A 189 ? 0.3422 0.4979 0.3640 -0.0496 -0.0683 -0.0411 171 PHE A CZ  
1427 N N   . PHE A 190 ? 0.2566 0.3479 0.3002 -0.0075 -0.0400 -0.0132 172 PHE A N   
1428 C CA  . PHE A 190 ? 0.2756 0.3669 0.3313 -0.0136 -0.0342 -0.0187 172 PHE A CA  
1429 C C   . PHE A 190 ? 0.2746 0.3750 0.3499 -0.0089 -0.0302 -0.0123 172 PHE A C   
1430 O O   . PHE A 190 ? 0.2747 0.3885 0.3670 -0.0149 -0.0297 -0.0146 172 PHE A O   
1431 C CB  . PHE A 190 ? 0.2753 0.3427 0.3212 -0.0143 -0.0251 -0.0228 172 PHE A CB  
1432 C CG  . PHE A 190 ? 0.2864 0.3454 0.3201 -0.0196 -0.0266 -0.0305 172 PHE A CG  
1433 C CD1 . PHE A 190 ? 0.3164 0.3845 0.3557 -0.0306 -0.0286 -0.0406 172 PHE A CD1 
1434 C CD2 . PHE A 190 ? 0.2890 0.3319 0.3073 -0.0145 -0.0249 -0.0289 172 PHE A CD2 
1435 C CE1 . PHE A 190 ? 0.3191 0.3790 0.3491 -0.0361 -0.0275 -0.0500 172 PHE A CE1 
1436 C CE2 . PHE A 190 ? 0.2941 0.3297 0.3043 -0.0190 -0.0247 -0.0364 172 PHE A CE2 
1437 C CZ  . PHE A 190 ? 0.2879 0.3313 0.3039 -0.0295 -0.0253 -0.0473 172 PHE A CZ  
1438 N N   . THR A 191 ? 0.2808 0.3746 0.3560 0.0012  -0.0263 -0.0053 173 THR A N   
1439 C CA  . THR A 191 ? 0.2888 0.3917 0.3856 0.0062  -0.0205 -0.0004 173 THR A CA  
1440 C C   . THR A 191 ? 0.2965 0.4279 0.4171 0.0056  -0.0289 0.0054  173 THR A C   
1441 O O   . THR A 191 ? 0.3010 0.4455 0.4441 0.0044  -0.0251 0.0063  173 THR A O   
1442 C CB  . THR A 191 ? 0.2931 0.3833 0.3867 0.0162  -0.0134 0.0037  173 THR A CB  
1443 O OG1 . THR A 191 ? 0.3112 0.3803 0.3842 0.0150  -0.0061 -0.0013 173 THR A OG1 
1444 C CG2 . THR A 191 ? 0.2900 0.3885 0.4087 0.0214  -0.0043 0.0068  173 THR A CG2 
1445 N N   . ASN A 192 ? 0.3035 0.4467 0.4202 0.0062  -0.0404 0.0106  174 ASN A N   
1446 C CA  . ASN A 192 ? 0.3118 0.4854 0.4509 0.0069  -0.0502 0.0202  174 ASN A CA  
1447 C C   . ASN A 192 ? 0.3174 0.5144 0.4556 -0.0066 -0.0616 0.0150  174 ASN A C   
1448 O O   . ASN A 192 ? 0.3212 0.5485 0.4767 -0.0083 -0.0718 0.0234  174 ASN A O   
1449 C CB  . ASN A 192 ? 0.3160 0.4922 0.4550 0.0163  -0.0557 0.0330  174 ASN A CB  
1450 C CG  . ASN A 192 ? 0.3451 0.5033 0.4946 0.0288  -0.0432 0.0373  174 ASN A CG  
1451 O OD1 . ASN A 192 ? 0.4115 0.5463 0.5430 0.0328  -0.0378 0.0348  174 ASN A OD1 
1452 N ND2 . ASN A 192 ? 0.3513 0.5207 0.5309 0.0340  -0.0375 0.0423  174 ASN A ND2 
1453 N N   . CYS A 193 ? 0.3172 0.5012 0.4370 -0.0167 -0.0593 0.0013  175 CYS A N   
1454 C CA  . CYS A 193 ? 0.3250 0.5281 0.4433 -0.0315 -0.0673 -0.0080 175 CYS A CA  
1455 C C   . CYS A 193 ? 0.3332 0.5409 0.4712 -0.0388 -0.0609 -0.0150 175 CYS A C   
1456 O O   . CYS A 193 ? 0.3237 0.5069 0.4594 -0.0382 -0.0486 -0.0208 175 CYS A O   
1457 C CB  . CYS A 193 ? 0.3315 0.5170 0.4234 -0.0390 -0.0659 -0.0206 175 CYS A CB  
1458 S SG  . CYS A 193 ? 0.3574 0.5649 0.4480 -0.0600 -0.0724 -0.0370 175 CYS A SG  
1459 N N   . PRO A 194 ? 0.3417 0.5828 0.4995 -0.0468 -0.0697 -0.0139 176 PRO A N   
1460 C CA  . PRO A 194 ? 0.3421 0.5910 0.5234 -0.0534 -0.0637 -0.0189 176 PRO A CA  
1461 C C   . PRO A 194 ? 0.3485 0.5819 0.5228 -0.0675 -0.0563 -0.0366 176 PRO A C   
1462 O O   . PRO A 194 ? 0.3557 0.5873 0.5480 -0.0719 -0.0477 -0.0402 176 PRO A O   
1463 C CB  . PRO A 194 ? 0.3507 0.6437 0.5540 -0.0592 -0.0777 -0.0123 176 PRO A CB  
1464 C CG  . PRO A 194 ? 0.3614 0.6688 0.5442 -0.0632 -0.0916 -0.0106 176 PRO A CG  
1465 C CD  . PRO A 194 ? 0.3526 0.6285 0.5119 -0.0509 -0.0862 -0.0066 176 PRO A CD  
1466 N N   . ARG A 195 ? 0.3594 0.5803 0.5103 -0.0740 -0.0577 -0.0470 177 ARG A N   
1467 C CA  . ARG A 195 ? 0.3741 0.5743 0.5211 -0.0853 -0.0477 -0.0633 177 ARG A CA  
1468 C C   . ARG A 195 ? 0.3633 0.5290 0.5102 -0.0764 -0.0324 -0.0596 177 ARG A C   
1469 O O   . ARG A 195 ? 0.3747 0.5261 0.5298 -0.0842 -0.0223 -0.0678 177 ARG A O   
1470 C CB  . ARG A 195 ? 0.3811 0.5739 0.5043 -0.0920 -0.0505 -0.0747 177 ARG A CB  
1471 C CG  . ARG A 195 ? 0.4220 0.6503 0.5395 -0.1033 -0.0655 -0.0791 177 ARG A CG  
1472 C CD  . ARG A 195 ? 0.4467 0.6687 0.5451 -0.1168 -0.0637 -0.0981 177 ARG A CD  
1473 N NE  . ARG A 195 ? 0.4664 0.6614 0.5432 -0.1063 -0.0591 -0.0954 177 ARG A NE  
1474 C CZ  . ARG A 195 ? 0.4822 0.6868 0.5395 -0.1015 -0.0681 -0.0880 177 ARG A CZ  
1475 N NH1 . ARG A 195 ? 0.5070 0.7479 0.5634 -0.1053 -0.0829 -0.0801 177 ARG A NH1 
1476 N NH2 . ARG A 195 ? 0.4848 0.6640 0.5251 -0.0929 -0.0626 -0.0867 177 ARG A NH2 
1477 N N   . TYR A 196 ? 0.3495 0.5032 0.4873 -0.0612 -0.0306 -0.0471 178 TYR A N   
1478 C CA  . TYR A 196 ? 0.3443 0.4698 0.4771 -0.0532 -0.0181 -0.0422 178 TYR A CA  
1479 C C   . TYR A 196 ? 0.3487 0.4795 0.4964 -0.0457 -0.0122 -0.0323 178 TYR A C   
1480 O O   . TYR A 196 ? 0.3345 0.4854 0.4928 -0.0405 -0.0182 -0.0259 178 TYR A O   
1481 C CB  . TYR A 196 ? 0.3520 0.4599 0.4607 -0.0436 -0.0194 -0.0382 178 TYR A CB  
1482 C CG  . TYR A 196 ? 0.3447 0.4497 0.4398 -0.0504 -0.0244 -0.0480 178 TYR A CG  
1483 C CD1 . TYR A 196 ? 0.3841 0.4681 0.4758 -0.0555 -0.0162 -0.0561 178 TYR A CD1 
1484 C CD2 . TYR A 196 ? 0.3629 0.4873 0.4501 -0.0521 -0.0363 -0.0489 178 TYR A CD2 
1485 C CE1 . TYR A 196 ? 0.4082 0.4895 0.4894 -0.0623 -0.0185 -0.0674 178 TYR A CE1 
1486 C CE2 . TYR A 196 ? 0.3707 0.4943 0.4435 -0.0600 -0.0396 -0.0595 178 TYR A CE2 
1487 C CZ  . TYR A 196 ? 0.4010 0.5024 0.4711 -0.0651 -0.0299 -0.0701 178 TYR A CZ  
1488 O OH  . TYR A 196 ? 0.4241 0.5239 0.4818 -0.0729 -0.0306 -0.0825 178 TYR A OH  
1489 N N   . THR A 197 ? 0.3450 0.4589 0.4951 -0.0455 0.0003  -0.0305 179 THR A N   
1490 C CA  . THR A 197 ? 0.3409 0.4561 0.5004 -0.0393 0.0092  -0.0226 179 THR A CA  
1491 C C   . THR A 197 ? 0.3426 0.4359 0.4793 -0.0302 0.0148  -0.0171 179 THR A C   
1492 O O   . THR A 197 ? 0.3229 0.3972 0.4455 -0.0319 0.0179  -0.0174 179 THR A O   
1493 C CB  . THR A 197 ? 0.3570 0.4712 0.5333 -0.0480 0.0195  -0.0241 179 THR A CB  
1494 O OG1 . THR A 197 ? 0.3762 0.5116 0.5732 -0.0586 0.0134  -0.0314 179 THR A OG1 
1495 C CG2 . THR A 197 ? 0.3578 0.4753 0.5436 -0.0430 0.0306  -0.0169 179 THR A CG2 
1496 N N   . SER A 198 ? 0.3313 0.4279 0.4663 -0.0209 0.0165  -0.0121 180 SER A N   
1497 C CA  . SER A 198 ? 0.3389 0.4178 0.4522 -0.0141 0.0218  -0.0088 180 SER A CA  
1498 C C   . SER A 198 ? 0.3434 0.4151 0.4548 -0.0161 0.0351  -0.0056 180 SER A C   
1499 O O   . SER A 198 ? 0.3477 0.4303 0.4766 -0.0178 0.0425  -0.0050 180 SER A O   
1500 C CB  . SER A 198 ? 0.3486 0.4326 0.4624 -0.0047 0.0204  -0.0067 180 SER A CB  
1501 O OG  . SER A 198 ? 0.3889 0.4795 0.5016 -0.0026 0.0078  -0.0067 180 SER A OG  
1502 N N   . CYS A 199 ? 0.3374 0.3927 0.4277 -0.0161 0.0383  -0.0024 181 CYS A N   
1503 C CA  . CYS A 199 ? 0.3516 0.4020 0.4351 -0.0186 0.0502  0.0031  181 CYS A CA  
1504 C C   . CYS A 199 ? 0.3402 0.3829 0.3991 -0.0137 0.0517  0.0045  181 CYS A C   
1505 O O   . CYS A 199 ? 0.3231 0.3617 0.3726 -0.0087 0.0436  0.0015  181 CYS A O   
1506 C CB  . CYS A 199 ? 0.3681 0.4085 0.4517 -0.0251 0.0522  0.0085  181 CYS A CB  
1507 S SG  . CYS A 199 ? 0.4863 0.5345 0.5998 -0.0334 0.0500  0.0025  181 CYS A SG  
1508 N N   A GLU A 200 ? 0.3501 0.3918 0.3971 -0.0163 0.0619  0.0087  182 GLU A N   
1509 N N   B GLU A 200 ? 0.3467 0.3885 0.3947 -0.0166 0.0620  0.0090  182 GLU A N   
1510 C CA  A GLU A 200 ? 0.3513 0.3888 0.3746 -0.0138 0.0633  0.0075  182 GLU A CA  
1511 C CA  B GLU A 200 ? 0.3540 0.3917 0.3773 -0.0151 0.0646  0.0091  182 GLU A CA  
1512 C C   A GLU A 200 ? 0.3370 0.3641 0.3434 -0.0124 0.0532  0.0115  182 GLU A C   
1513 C C   B GLU A 200 ? 0.3378 0.3653 0.3442 -0.0130 0.0542  0.0120  182 GLU A C   
1514 O O   A GLU A 200 ? 0.3418 0.3655 0.3352 -0.0088 0.0490  0.0074  182 GLU A O   
1515 O O   B GLU A 200 ? 0.3453 0.3702 0.3383 -0.0095 0.0512  0.0076  182 GLU A O   
1516 C CB  A GLU A 200 ? 0.3747 0.4168 0.3852 -0.0191 0.0764  0.0102  182 GLU A CB  
1517 C CB  B GLU A 200 ? 0.3750 0.4165 0.3876 -0.0216 0.0764  0.0156  182 GLU A CB  
1518 C CG  A GLU A 200 ? 0.3941 0.4360 0.3831 -0.0185 0.0806  0.0036  182 GLU A CG  
1519 C CG  B GLU A 200 ? 0.3913 0.4310 0.3745 -0.0238 0.0772  0.0188  182 GLU A CG  
1520 C CD  A GLU A 200 ? 0.4293 0.4769 0.4305 -0.0162 0.0915  -0.0078 182 GLU A CD  
1521 C CD  B GLU A 200 ? 0.4127 0.4619 0.3845 -0.0302 0.0913  0.0186  182 GLU A CD  
1522 O OE1 A GLU A 200 ? 0.4385 0.4905 0.4669 -0.0117 0.0911  -0.0101 182 GLU A OE1 
1523 O OE1 B GLU A 200 ? 0.4496 0.5023 0.4109 -0.0365 0.0948  0.0309  182 GLU A OE1 
1524 O OE2 A GLU A 200 ? 0.3905 0.4393 0.3752 -0.0193 0.1009  -0.0148 182 GLU A OE2 
1525 O OE2 B GLU A 200 ? 0.4327 0.4861 0.4074 -0.0290 0.0995  0.0065  182 GLU A OE2 
1526 N N   . THR A 201 ? 0.3296 0.3513 0.3397 -0.0152 0.0501  0.0191  183 THR A N   
1527 C CA  . THR A 201 ? 0.3152 0.3279 0.3126 -0.0136 0.0425  0.0244  183 THR A CA  
1528 C C   . THR A 201 ? 0.3066 0.3126 0.3155 -0.0115 0.0339  0.0203  183 THR A C   
1529 O O   . THR A 201 ? 0.2740 0.2722 0.2769 -0.0100 0.0291  0.0244  183 THR A O   
1530 C CB  . THR A 201 ? 0.3206 0.3314 0.3119 -0.0176 0.0465  0.0389  183 THR A CB  
1531 O OG1 . THR A 201 ? 0.3106 0.3175 0.3231 -0.0208 0.0501  0.0433  183 THR A OG1 
1532 C CG2 . THR A 201 ? 0.3334 0.3539 0.3078 -0.0218 0.0550  0.0433  183 THR A CG2 
1533 N N   . GLY A 202 ? 0.2793 0.2903 0.3043 -0.0119 0.0321  0.0121  184 GLY A N   
1534 C CA  . GLY A 202 ? 0.2890 0.2976 0.3218 -0.0119 0.0241  0.0057  184 GLY A CA  
1535 C C   . GLY A 202 ? 0.2877 0.3072 0.3403 -0.0157 0.0232  -0.0012 184 GLY A C   
1536 O O   . GLY A 202 ? 0.2801 0.3101 0.3404 -0.0151 0.0267  -0.0015 184 GLY A O   
1537 N N   . PHE A 203 ? 0.2821 0.3002 0.3442 -0.0204 0.0193  -0.0071 185 PHE A N   
1538 C CA  . PHE A 203 ? 0.3059 0.3380 0.3850 -0.0261 0.0157  -0.0152 185 PHE A CA  
1539 C C   . PHE A 203 ? 0.3176 0.3454 0.4132 -0.0356 0.0210  -0.0193 185 PHE A C   
1540 O O   . PHE A 203 ? 0.3006 0.3133 0.3949 -0.0374 0.0239  -0.0197 185 PHE A O   
1541 C CB  . PHE A 203 ? 0.3008 0.3399 0.3733 -0.0252 0.0048  -0.0220 185 PHE A CB  
1542 C CG  . PHE A 203 ? 0.3249 0.3675 0.3855 -0.0162 0.0004  -0.0176 185 PHE A CG  
1543 C CD1 . PHE A 203 ? 0.3273 0.3850 0.3987 -0.0130 -0.0005 -0.0151 185 PHE A CD1 
1544 C CD2 . PHE A 203 ? 0.3319 0.3623 0.3739 -0.0110 -0.0015 -0.0156 185 PHE A CD2 
1545 C CE1 . PHE A 203 ? 0.3047 0.3630 0.3693 -0.0045 -0.0023 -0.0113 185 PHE A CE1 
1546 C CE2 . PHE A 203 ? 0.3360 0.3678 0.3689 -0.0036 -0.0039 -0.0124 185 PHE A CE2 
1547 C CZ  . PHE A 203 ? 0.3156 0.3602 0.3603 -0.0003 -0.0037 -0.0104 185 PHE A CZ  
1548 N N   . LYS A 204 ? 0.3293 0.3708 0.4434 -0.0418 0.0227  -0.0226 186 LYS A N   
1549 C CA  . LYS A 204 ? 0.3660 0.4058 0.4993 -0.0529 0.0278  -0.0291 186 LYS A CA  
1550 C C   . LYS A 204 ? 0.3770 0.4322 0.5165 -0.0611 0.0187  -0.0432 186 LYS A C   
1551 O O   . LYS A 204 ? 0.3590 0.4359 0.5002 -0.0601 0.0100  -0.0443 186 LYS A O   
1552 C CB  . LYS A 204 ? 0.3810 0.4291 0.5316 -0.0564 0.0359  -0.0243 186 LYS A CB  
1553 C CG  . LYS A 204 ? 0.4247 0.4636 0.5944 -0.0663 0.0460  -0.0255 186 LYS A CG  
1554 C CD  . LYS A 204 ? 0.4326 0.4841 0.6204 -0.0703 0.0535  -0.0212 186 LYS A CD  
1555 C CE  . LYS A 204 ? 0.4789 0.5243 0.6915 -0.0829 0.0632  -0.0248 186 LYS A CE  
1556 N NZ  . LYS A 204 ? 0.5125 0.5670 0.7391 -0.0945 0.0573  -0.0426 186 LYS A NZ  
1557 N N   . ASP A 205 ? 0.3875 0.4327 0.5315 -0.0696 0.0213  -0.0537 187 ASP A N   
1558 C CA  . ASP A 205 ? 0.3909 0.4516 0.5401 -0.0815 0.0147  -0.0700 187 ASP A CA  
1559 C C   . ASP A 205 ? 0.4051 0.4588 0.5770 -0.0952 0.0250  -0.0804 187 ASP A C   
1560 O O   . ASP A 205 ? 0.4153 0.4499 0.5898 -0.0996 0.0323  -0.0883 187 ASP A O   
1561 C CB  . ASP A 205 ? 0.4006 0.4547 0.5305 -0.0797 0.0096  -0.0766 187 ASP A CB  
1562 C CG  . ASP A 205 ? 0.4263 0.4942 0.5581 -0.0946 0.0052  -0.0960 187 ASP A CG  
1563 O OD1 . ASP A 205 ? 0.4690 0.5594 0.6137 -0.1057 0.0012  -0.1033 187 ASP A OD1 
1564 O OD2 . ASP A 205 ? 0.5104 0.5678 0.6303 -0.0959 0.0063  -0.1045 187 ASP A OD2 
1565 N N   . GLY A 206 ? 0.3969 0.4650 0.5880 -0.1017 0.0269  -0.0801 188 GLY A N   
1566 C CA  . GLY A 206 ? 0.4102 0.4693 0.6255 -0.1143 0.0388  -0.0877 188 GLY A CA  
1567 C C   . GLY A 206 ? 0.4097 0.4385 0.6308 -0.1086 0.0533  -0.0754 188 GLY A C   
1568 O O   . GLY A 206 ? 0.3892 0.4150 0.6065 -0.0991 0.0564  -0.0583 188 GLY A O   
1569 N N   . ASP A 207 ? 0.4261 0.4336 0.6572 -0.1150 0.0626  -0.0841 189 ASP A N   
1570 C CA  . ASP A 207 ? 0.4345 0.4132 0.6745 -0.1093 0.0760  -0.0705 189 ASP A CA  
1571 C C   . ASP A 207 ? 0.4245 0.3887 0.6443 -0.0962 0.0730  -0.0625 189 ASP A C   
1572 O O   . ASP A 207 ? 0.4498 0.3910 0.6796 -0.0929 0.0830  -0.0550 189 ASP A O   
1573 C CB  . ASP A 207 ? 0.4555 0.4162 0.7241 -0.1224 0.0901  -0.0834 189 ASP A CB  
1574 C CG  . ASP A 207 ? 0.4842 0.4554 0.7772 -0.1368 0.0957  -0.0910 189 ASP A CG  
1575 O OD1 . ASP A 207 ? 0.5140 0.4964 0.8097 -0.1342 0.0955  -0.0775 189 ASP A OD1 
1576 O OD2 . ASP A 207 ? 0.5261 0.4937 0.8374 -0.1519 0.1020  -0.1118 189 ASP A OD2 
1577 N N   . LEU A 208 ? 0.4008 0.3789 0.5958 -0.0896 0.0599  -0.0644 190 LEU A N   
1578 C CA  . LEU A 208 ? 0.3856 0.3527 0.5616 -0.0776 0.0566  -0.0562 190 LEU A CA  
1579 C C   . LEU A 208 ? 0.3718 0.3490 0.5279 -0.0661 0.0492  -0.0402 190 LEU A C   
1580 O O   . LEU A 208 ? 0.3604 0.3577 0.5110 -0.0668 0.0417  -0.0429 190 LEU A O   
1581 C CB  . LEU A 208 ? 0.3855 0.3573 0.5493 -0.0803 0.0496  -0.0729 190 LEU A CB  
1582 C CG  . LEU A 208 ? 0.4068 0.3699 0.5879 -0.0937 0.0581  -0.0936 190 LEU A CG  
1583 C CD1 . LEU A 208 ? 0.4203 0.3980 0.5838 -0.0991 0.0489  -0.1113 190 LEU A CD1 
1584 C CD2 . LEU A 208 ? 0.4033 0.3374 0.5996 -0.0891 0.0715  -0.0879 190 LEU A CD2 
1585 N N   . PHE A 209 ? 0.3599 0.3244 0.5074 -0.0562 0.0521  -0.0237 191 PHE A N   
1586 C CA  . PHE A 209 ? 0.3395 0.3122 0.4650 -0.0465 0.0459  -0.0117 191 PHE A CA  
1587 C C   . PHE A 209 ? 0.3402 0.3070 0.4473 -0.0381 0.0398  -0.0094 191 PHE A C   
1588 O O   . PHE A 209 ? 0.3167 0.2688 0.4279 -0.0352 0.0441  -0.0028 191 PHE A O   
1589 C CB  . PHE A 209 ? 0.3474 0.3163 0.4747 -0.0440 0.0537  0.0064  191 PHE A CB  
1590 C CG  . PHE A 209 ? 0.3432 0.3216 0.4474 -0.0364 0.0491  0.0151  191 PHE A CG  
1591 C CD1 . PHE A 209 ? 0.3731 0.3676 0.4739 -0.0367 0.0464  0.0098  191 PHE A CD1 
1592 C CD2 . PHE A 209 ? 0.3546 0.3270 0.4427 -0.0296 0.0479  0.0274  191 PHE A CD2 
1593 C CE1 . PHE A 209 ? 0.3525 0.3537 0.4343 -0.0304 0.0446  0.0150  191 PHE A CE1 
1594 C CE2 . PHE A 209 ? 0.3494 0.3308 0.4158 -0.0249 0.0447  0.0320  191 PHE A CE2 
1595 C CZ  . PHE A 209 ? 0.3314 0.3255 0.3950 -0.0254 0.0440  0.0249  191 PHE A CZ  
1596 N N   . MET A 210 ? 0.3315 0.3099 0.4208 -0.0340 0.0302  -0.0139 192 MET A N   
1597 C CA  . MET A 210 ? 0.3341 0.3079 0.4053 -0.0264 0.0246  -0.0111 192 MET A CA  
1598 C C   . MET A 210 ? 0.3102 0.2895 0.3643 -0.0194 0.0222  -0.0001 192 MET A C   
1599 O O   . MET A 210 ? 0.3060 0.2972 0.3550 -0.0185 0.0188  -0.0031 192 MET A O   
1600 C CB  . MET A 210 ? 0.3313 0.3136 0.3948 -0.0278 0.0162  -0.0244 192 MET A CB  
1601 C CG  . MET A 210 ? 0.3582 0.3346 0.4060 -0.0215 0.0118  -0.0236 192 MET A CG  
1602 S SD  . MET A 210 ? 0.4992 0.4898 0.5330 -0.0220 0.0011  -0.0340 192 MET A SD  
1603 C CE  . MET A 210 ? 0.4612 0.4665 0.5101 -0.0339 0.0003  -0.0464 192 MET A CE  
1604 N N   . SER A 211 ? 0.3028 0.2745 0.3503 -0.0154 0.0248  0.0125  193 SER A N   
1605 C CA  . SER A 211 ? 0.2907 0.2680 0.3196 -0.0110 0.0232  0.0208  193 SER A CA  
1606 C C   . SER A 211 ? 0.2784 0.2572 0.2915 -0.0062 0.0153  0.0155  193 SER A C   
1607 O O   . SER A 211 ? 0.2622 0.2356 0.2770 -0.0051 0.0117  0.0104  193 SER A O   
1608 C CB  . SER A 211 ? 0.3061 0.2791 0.3332 -0.0101 0.0275  0.0375  193 SER A CB  
1609 O OG  . SER A 211 ? 0.2747 0.2400 0.3027 -0.0065 0.0246  0.0422  193 SER A OG  
1610 N N   . TYR A 212 ? 0.2693 0.2550 0.2680 -0.0039 0.0140  0.0159  194 TYR A N   
1611 C CA  . TYR A 212 ? 0.2780 0.2640 0.2623 0.0003  0.0078  0.0123  194 TYR A CA  
1612 C C   . TYR A 212 ? 0.2754 0.2555 0.2537 0.0021  0.0054  0.0191  194 TYR A C   
1613 O O   . TYR A 212 ? 0.2769 0.2548 0.2500 0.0048  0.0003  0.0149  194 TYR A O   
1614 C CB  . TYR A 212 ? 0.2849 0.2770 0.2568 0.0014  0.0098  0.0116  194 TYR A CB  
1615 C CG  . TYR A 212 ? 0.2673 0.2662 0.2491 0.0015  0.0122  0.0052  194 TYR A CG  
1616 C CD1 . TYR A 212 ? 0.3328 0.3348 0.3219 0.0036  0.0066  -0.0010 194 TYR A CD1 
1617 C CD2 . TYR A 212 ? 0.3141 0.3187 0.2986 -0.0006 0.0203  0.0065  194 TYR A CD2 
1618 C CE1 . TYR A 212 ? 0.3152 0.3264 0.3165 0.0046  0.0078  -0.0040 194 TYR A CE1 
1619 C CE2 . TYR A 212 ? 0.2942 0.3064 0.2921 0.0003  0.0229  0.0016  194 TYR A CE2 
1620 C CZ  . TYR A 212 ? 0.3003 0.3161 0.3077 0.0034  0.0160  -0.0029 194 TYR A CZ  
1621 O OH  . TYR A 212 ? 0.3224 0.3488 0.3465 0.0052  0.0174  -0.0052 194 TYR A OH  
1622 N N   . ARG A 213 ? 0.2875 0.2670 0.2677 0.0009  0.0091  0.0310  195 ARG A N   
1623 C CA  . ARG A 213 ? 0.3037 0.2808 0.2821 0.0033  0.0064  0.0408  195 ARG A CA  
1624 C C   . ARG A 213 ? 0.2982 0.2655 0.2935 0.0051  0.0063  0.0374  195 ARG A C   
1625 O O   . ARG A 213 ? 0.2775 0.2433 0.2704 0.0082  0.0024  0.0371  195 ARG A O   
1626 C CB  . ARG A 213 ? 0.3154 0.2972 0.2933 0.0013  0.0099  0.0575  195 ARG A CB  
1627 C CG  . ARG A 213 ? 0.3638 0.3460 0.3467 0.0039  0.0073  0.0726  195 ARG A CG  
1628 C CD  . ARG A 213 ? 0.4443 0.4345 0.4101 0.0053  -0.0002 0.0721  195 ARG A CD  
1629 N NE  . ARG A 213 ? 0.4871 0.4807 0.4620 0.0085  -0.0037 0.0880  195 ARG A NE  
1630 C CZ  . ARG A 213 ? 0.5185 0.5052 0.5072 0.0133  -0.0056 0.0855  195 ARG A CZ  
1631 N NH1 . ARG A 213 ? 0.5246 0.5017 0.5158 0.0143  -0.0048 0.0678  195 ARG A NH1 
1632 N NH2 . ARG A 213 ? 0.5495 0.5411 0.5499 0.0167  -0.0082 0.1015  195 ARG A NH2 
1633 N N   . SER A 214 ? 0.3149 0.2760 0.3279 0.0022  0.0117  0.0333  196 SER A N   
1634 C CA  . SER A 214 ? 0.3255 0.2769 0.3550 0.0019  0.0140  0.0259  196 SER A CA  
1635 C C   . SER A 214 ? 0.3194 0.2734 0.3398 0.0013  0.0089  0.0099  196 SER A C   
1636 O O   . SER A 214 ? 0.3063 0.2554 0.3306 0.0025  0.0089  0.0049  196 SER A O   
1637 C CB  . SER A 214 ? 0.3434 0.2876 0.3948 -0.0031 0.0224  0.0238  196 SER A CB  
1638 O OG  . SER A 214 ? 0.4074 0.3579 0.4564 -0.0082 0.0212  0.0110  196 SER A OG  
1639 N N   . MET A 215 ? 0.3074 0.2701 0.3171 -0.0003 0.0050  0.0034  197 MET A N   
1640 C CA  . MET A 215 ? 0.3123 0.2799 0.3123 -0.0002 -0.0009 -0.0072 197 MET A CA  
1641 C C   . MET A 215 ? 0.2982 0.2650 0.2850 0.0048  -0.0050 -0.0037 197 MET A C   
1642 O O   . MET A 215 ? 0.2870 0.2523 0.2714 0.0050  -0.0069 -0.0097 197 MET A O   
1643 C CB  . MET A 215 ? 0.3064 0.2847 0.3015 -0.0011 -0.0041 -0.0102 197 MET A CB  
1644 C CG  . MET A 215 ? 0.3328 0.3193 0.3240 -0.0026 -0.0100 -0.0188 197 MET A CG  
1645 S SD  . MET A 215 ? 0.4028 0.4013 0.3918 0.0002  -0.0132 -0.0161 197 MET A SD  
1646 C CE  . MET A 215 ? 0.4203 0.4122 0.3938 0.0066  -0.0134 -0.0103 197 MET A CE  
1647 N N   . PHE A 216 ? 0.2835 0.2524 0.2612 0.0075  -0.0058 0.0054  198 PHE A N   
1648 C CA  . PHE A 216 ? 0.2943 0.2641 0.2606 0.0106  -0.0097 0.0085  198 PHE A CA  
1649 C C   . PHE A 216 ? 0.2881 0.2527 0.2638 0.0124  -0.0088 0.0115  198 PHE A C   
1650 O O   . PHE A 216 ? 0.2982 0.2628 0.2693 0.0140  -0.0116 0.0079  198 PHE A O   
1651 C CB  . PHE A 216 ? 0.2961 0.2711 0.2517 0.0107  -0.0098 0.0171  198 PHE A CB  
1652 C CG  . PHE A 216 ? 0.2876 0.2656 0.2337 0.0121  -0.0139 0.0210  198 PHE A CG  
1653 C CD1 . PHE A 216 ? 0.3063 0.2853 0.2413 0.0125  -0.0169 0.0138  198 PHE A CD1 
1654 C CD2 . PHE A 216 ? 0.3183 0.2991 0.2690 0.0128  -0.0147 0.0329  198 PHE A CD2 
1655 C CE1 . PHE A 216 ? 0.3140 0.2965 0.2418 0.0125  -0.0204 0.0161  198 PHE A CE1 
1656 C CE2 . PHE A 216 ? 0.3026 0.2893 0.2465 0.0134  -0.0194 0.0365  198 PHE A CE2 
1657 C CZ  . PHE A 216 ? 0.2953 0.2829 0.2273 0.0127  -0.0221 0.0271  198 PHE A CZ  
1658 N N   . GLN A 217 ? 0.3013 0.2616 0.2922 0.0125  -0.0041 0.0196  199 GLN A N   
1659 C CA  . GLN A 217 ? 0.3098 0.2644 0.3168 0.0152  -0.0012 0.0240  199 GLN A CA  
1660 C C   . GLN A 217 ? 0.3032 0.2514 0.3178 0.0135  0.0022  0.0087  199 GLN A C   
1661 O O   . GLN A 217 ? 0.2879 0.2344 0.3072 0.0161  0.0029  0.0075  199 GLN A O   
1662 C CB  . GLN A 217 ? 0.3231 0.2731 0.3495 0.0159  0.0047  0.0370  199 GLN A CB  
1663 C CG  . GLN A 217 ? 0.3647 0.3113 0.4108 0.0211  0.0072  0.0479  199 GLN A CG  
1664 C CD  . GLN A 217 ? 0.4212 0.3802 0.4547 0.0244  -0.0011 0.0578  199 GLN A CD  
1665 O OE1 . GLN A 217 ? 0.4371 0.4072 0.4543 0.0229  -0.0066 0.0670  199 GLN A OE1 
1666 N NE2 . GLN A 217 ? 0.4130 0.3713 0.4539 0.0275  -0.0014 0.0543  199 GLN A NE2 
1667 N N   . ASP A 218 ? 0.3019 0.2487 0.3179 0.0083  0.0045  -0.0028 200 ASP A N   
1668 C CA  . ASP A 218 ? 0.3065 0.2518 0.3239 0.0039  0.0068  -0.0192 200 ASP A CA  
1669 C C   . ASP A 218 ? 0.2923 0.2444 0.2914 0.0052  0.0004  -0.0233 200 ASP A C   
1670 O O   . ASP A 218 ? 0.2974 0.2476 0.2985 0.0041  0.0034  -0.0313 200 ASP A O   
1671 C CB  . ASP A 218 ? 0.2992 0.2481 0.3178 -0.0036 0.0075  -0.0300 200 ASP A CB  
1672 C CG  . ASP A 218 ? 0.3385 0.2785 0.3793 -0.0072 0.0164  -0.0304 200 ASP A CG  
1673 O OD1 . ASP A 218 ? 0.3624 0.2915 0.4205 -0.0042 0.0236  -0.0250 200 ASP A OD1 
1674 O OD2 . ASP A 218 ? 0.3640 0.3083 0.4077 -0.0133 0.0168  -0.0360 200 ASP A OD2 
1675 N N   . VAL A 219 ? 0.2802 0.2395 0.2631 0.0071  -0.0067 -0.0185 201 VAL A N   
1676 C CA  . VAL A 219 ? 0.2810 0.2453 0.2490 0.0082  -0.0118 -0.0208 201 VAL A CA  
1677 C C   . VAL A 219 ? 0.2840 0.2457 0.2531 0.0122  -0.0113 -0.0158 201 VAL A C   
1678 O O   . VAL A 219 ? 0.2737 0.2363 0.2396 0.0116  -0.0109 -0.0213 201 VAL A O   
1679 C CB  . VAL A 219 ? 0.2860 0.2562 0.2419 0.0097  -0.0171 -0.0165 201 VAL A CB  
1680 C CG1 . VAL A 219 ? 0.2965 0.2691 0.2403 0.0115  -0.0210 -0.0164 201 VAL A CG1 
1681 C CG2 . VAL A 219 ? 0.2560 0.2321 0.2137 0.0061  -0.0183 -0.0213 201 VAL A CG2 
1682 N N   . ARG A 220 ? 0.2804 0.2415 0.2540 0.0155  -0.0116 -0.0045 202 ARG A N   
1683 C CA  . ARG A 220 ? 0.2984 0.2613 0.2756 0.0190  -0.0127 0.0030  202 ARG A CA  
1684 C C   . ARG A 220 ? 0.2916 0.2488 0.2877 0.0202  -0.0059 -0.0007 202 ARG A C   
1685 O O   . ARG A 220 ? 0.2994 0.2585 0.2967 0.0215  -0.0055 -0.0027 202 ARG A O   
1686 C CB  . ARG A 220 ? 0.3144 0.2812 0.2931 0.0204  -0.0146 0.0168  202 ARG A CB  
1687 C CG  . ARG A 220 ? 0.3925 0.3677 0.3681 0.0220  -0.0192 0.0267  202 ARG A CG  
1688 C CD  . ARG A 220 ? 0.3312 0.3130 0.2859 0.0194  -0.0246 0.0234  202 ARG A CD  
1689 N NE  . ARG A 220 ? 0.3257 0.3049 0.2762 0.0193  -0.0249 0.0138  202 ARG A NE  
1690 C CZ  . ARG A 220 ? 0.3304 0.3104 0.2899 0.0210  -0.0242 0.0136  202 ARG A CZ  
1691 N NH1 . ARG A 220 ? 0.3300 0.3129 0.3065 0.0240  -0.0230 0.0226  202 ARG A NH1 
1692 N NH2 . ARG A 220 ? 0.3224 0.3005 0.2758 0.0200  -0.0237 0.0051  202 ARG A NH2 
1693 N N   . ASP A 221 ? 0.2942 0.2442 0.3070 0.0192  0.0009  -0.0024 203 ASP A N   
1694 C CA  . ASP A 221 ? 0.3042 0.2464 0.3378 0.0193  0.0104  -0.0095 203 ASP A CA  
1695 C C   . ASP A 221 ? 0.2984 0.2414 0.3226 0.0144  0.0130  -0.0268 203 ASP A C   
1696 O O   . ASP A 221 ? 0.2982 0.2387 0.3337 0.0153  0.0197  -0.0321 203 ASP A O   
1697 C CB  . ASP A 221 ? 0.3070 0.2395 0.3601 0.0171  0.0186  -0.0110 203 ASP A CB  
1698 C CG  . ASP A 221 ? 0.3397 0.2706 0.4092 0.0225  0.0190  0.0092  203 ASP A CG  
1699 O OD1 . ASP A 221 ? 0.3654 0.3045 0.4328 0.0276  0.0129  0.0241  203 ASP A OD1 
1700 O OD2 . ASP A 221 ? 0.3702 0.2934 0.4540 0.0206  0.0250  0.0107  203 ASP A OD2 
1701 N N   . ALA A 222 ? 0.2924 0.2403 0.2979 0.0090  0.0085  -0.0348 204 ALA A N   
1702 C CA  . ALA A 222 ? 0.2943 0.2469 0.2874 0.0030  0.0094  -0.0491 204 ALA A CA  
1703 C C   . ALA A 222 ? 0.2827 0.2411 0.2627 0.0056  0.0051  -0.0456 204 ALA A C   
1704 O O   . ALA A 222 ? 0.2915 0.2513 0.2704 0.0027  0.0102  -0.0546 204 ALA A O   
1705 C CB  . ALA A 222 ? 0.2763 0.2366 0.2553 -0.0033 0.0040  -0.0548 204 ALA A CB  
1706 N N   . VAL A 223 ? 0.2808 0.2424 0.2520 0.0102  -0.0028 -0.0337 205 VAL A N   
1707 C CA  . VAL A 223 ? 0.2808 0.2466 0.2434 0.0121  -0.0059 -0.0302 205 VAL A CA  
1708 C C   . VAL A 223 ? 0.2891 0.2529 0.2690 0.0153  0.0002  -0.0288 205 VAL A C   
1709 O O   . VAL A 223 ? 0.3004 0.2666 0.2792 0.0139  0.0038  -0.0345 205 VAL A O   
1710 C CB  . VAL A 223 ? 0.2954 0.2641 0.2477 0.0149  -0.0138 -0.0199 205 VAL A CB  
1711 C CG1 . VAL A 223 ? 0.2710 0.2432 0.2174 0.0157  -0.0160 -0.0172 205 VAL A CG1 
1712 C CG2 . VAL A 223 ? 0.2607 0.2315 0.2003 0.0127  -0.0180 -0.0215 205 VAL A CG2 
1713 N N   . ASP A 224 ? 0.2842 0.2450 0.2822 0.0197  0.0018  -0.0202 206 ASP A N   
1714 C CA  . ASP A 224 ? 0.2815 0.2420 0.3019 0.0240  0.0073  -0.0157 206 ASP A CA  
1715 C C   . ASP A 224 ? 0.2891 0.2438 0.3212 0.0213  0.0194  -0.0307 206 ASP A C   
1716 O O   . ASP A 224 ? 0.2965 0.2539 0.3366 0.0225  0.0242  -0.0332 206 ASP A O   
1717 C CB  . ASP A 224 ? 0.2832 0.2417 0.3234 0.0289  0.0075  -0.0019 206 ASP A CB  
1718 C CG  . ASP A 224 ? 0.2968 0.2653 0.3269 0.0308  -0.0034 0.0135  206 ASP A CG  
1719 O OD1 . ASP A 224 ? 0.3230 0.2983 0.3329 0.0285  -0.0104 0.0126  206 ASP A OD1 
1720 O OD2 . ASP A 224 ? 0.3095 0.2791 0.3525 0.0338  -0.0040 0.0265  206 ASP A OD2 
1721 N N   . TRP A 225 ? 0.2904 0.2382 0.3243 0.0166  0.0252  -0.0415 207 TRP A N   
1722 C CA  . TRP A 225 ? 0.3049 0.2478 0.3475 0.0112  0.0380  -0.0594 207 TRP A CA  
1723 C C   . TRP A 225 ? 0.3130 0.2644 0.3339 0.0056  0.0377  -0.0698 207 TRP A C   
1724 O O   . TRP A 225 ? 0.3340 0.2851 0.3648 0.0045  0.0480  -0.0785 207 TRP A O   
1725 C CB  . TRP A 225 ? 0.3201 0.2573 0.3632 0.0045  0.0418  -0.0702 207 TRP A CB  
1726 C CG  . TRP A 225 ? 0.3292 0.2614 0.3815 -0.0032 0.0561  -0.0912 207 TRP A CG  
1727 C CD1 . TRP A 225 ? 0.3513 0.2710 0.4348 -0.0024 0.0707  -0.0976 207 TRP A CD1 
1728 C CD2 . TRP A 225 ? 0.3421 0.2830 0.3724 -0.0140 0.0581  -0.1090 207 TRP A CD2 
1729 N NE1 . TRP A 225 ? 0.3615 0.2801 0.4440 -0.0129 0.0833  -0.1216 207 TRP A NE1 
1730 C CE2 . TRP A 225 ? 0.3541 0.2874 0.4017 -0.0207 0.0749  -0.1287 207 TRP A CE2 
1731 C CE3 . TRP A 225 ? 0.3354 0.2905 0.3338 -0.0191 0.0476  -0.1094 207 TRP A CE3 
1732 C CZ2 . TRP A 225 ? 0.4060 0.3477 0.4362 -0.0338 0.0812  -0.1503 207 TRP A CZ2 
1733 C CZ3 . TRP A 225 ? 0.3424 0.3066 0.3247 -0.0309 0.0527  -0.1273 207 TRP A CZ3 
1734 C CH2 . TRP A 225 ? 0.3761 0.3347 0.3720 -0.0387 0.0688  -0.1480 207 TRP A CH2 
1735 N N   . VAL A 226 ? 0.3128 0.2721 0.3068 0.0024  0.0270  -0.0674 208 VAL A N   
1736 C CA  . VAL A 226 ? 0.3202 0.2887 0.2926 -0.0029 0.0255  -0.0731 208 VAL A CA  
1737 C C   . VAL A 226 ? 0.3217 0.2922 0.3007 0.0015  0.0281  -0.0680 208 VAL A C   
1738 O O   . VAL A 226 ? 0.3148 0.2894 0.2899 -0.0030 0.0356  -0.0774 208 VAL A O   
1739 C CB  . VAL A 226 ? 0.3269 0.3024 0.2759 -0.0044 0.0129  -0.0660 208 VAL A CB  
1740 C CG1 . VAL A 226 ? 0.3354 0.3190 0.2665 -0.0062 0.0094  -0.0628 208 VAL A CG1 
1741 C CG2 . VAL A 226 ? 0.3052 0.2844 0.2466 -0.0116 0.0117  -0.0746 208 VAL A CG2 
1742 N N   . HIS A 227 ? 0.3199 0.2893 0.3099 0.0093  0.0224  -0.0537 209 HIS A N   
1743 C CA  . HIS A 227 ? 0.3202 0.2942 0.3188 0.0131  0.0229  -0.0471 209 HIS A CA  
1744 C C   . HIS A 227 ? 0.3402 0.3116 0.3681 0.0162  0.0356  -0.0515 209 HIS A C   
1745 O O   . HIS A 227 ? 0.3377 0.3142 0.3714 0.0159  0.0414  -0.0544 209 HIS A O   
1746 C CB  . HIS A 227 ? 0.3100 0.2871 0.3107 0.0185  0.0123  -0.0312 209 HIS A CB  
1747 C CG  . HIS A 227 ? 0.3306 0.3112 0.3072 0.0158  0.0030  -0.0278 209 HIS A CG  
1748 N ND1 . HIS A 227 ? 0.3530 0.3309 0.3136 0.0139  -0.0026 -0.0278 209 HIS A ND1 
1749 C CD2 . HIS A 227 ? 0.3017 0.2876 0.2706 0.0145  -0.0002 -0.0246 209 HIS A CD2 
1750 C CE1 . HIS A 227 ? 0.2962 0.2767 0.2418 0.0124  -0.0082 -0.0243 209 HIS A CE1 
1751 N NE2 . HIS A 227 ? 0.3418 0.3263 0.2915 0.0123  -0.0067 -0.0227 209 HIS A NE2 
1752 N N   . TYR A 228 ? 0.3464 0.3100 0.3956 0.0195  0.0405  -0.0508 210 TYR A N   
1753 C CA  . TYR A 228 ? 0.3672 0.3270 0.4521 0.0248  0.0528  -0.0510 210 TYR A CA  
1754 C C   . TYR A 228 ? 0.3827 0.3346 0.4767 0.0191  0.0700  -0.0721 210 TYR A C   
1755 O O   . TYR A 228 ? 0.3948 0.3461 0.5123 0.0212  0.0828  -0.0776 210 TYR A O   
1756 C CB  . TYR A 228 ? 0.3850 0.3405 0.4945 0.0325  0.0502  -0.0351 210 TYR A CB  
1757 C CG  . TYR A 228 ? 0.3959 0.3624 0.5002 0.0373  0.0350  -0.0145 210 TYR A CG  
1758 C CD1 . TYR A 228 ? 0.3905 0.3560 0.4909 0.0390  0.0266  -0.0023 210 TYR A CD1 
1759 C CD2 . TYR A 228 ? 0.4428 0.4219 0.5448 0.0385  0.0295  -0.0083 210 TYR A CD2 
1760 C CE1 . TYR A 228 ? 0.4067 0.3842 0.4995 0.0412  0.0135  0.0146  210 TYR A CE1 
1761 C CE2 . TYR A 228 ? 0.4371 0.4283 0.5322 0.0404  0.0154  0.0085  210 TYR A CE2 
1762 C CZ  . TYR A 228 ? 0.4419 0.4326 0.5319 0.0415  0.0078  0.0193  210 TYR A CZ  
1763 O OH  . TYR A 228 ? 0.4320 0.4363 0.5131 0.0413  -0.0048 0.0335  210 TYR A OH  
1764 N N   . LYS A 229 ? 0.3829 0.3296 0.4614 0.0115  0.0710  -0.0842 211 LYS A N   
1765 C CA  . LYS A 229 ? 0.4099 0.3492 0.4965 0.0036  0.0874  -0.1064 211 LYS A CA  
1766 C C   . LYS A 229 ? 0.4062 0.3538 0.4569 -0.0096 0.0861  -0.1232 211 LYS A C   
1767 O O   . LYS A 229 ? 0.4169 0.3635 0.4683 -0.0188 0.1000  -0.1443 211 LYS A O   
1768 C CB  . LYS A 229 ? 0.4221 0.3485 0.5301 0.0050  0.0919  -0.1064 211 LYS A CB  
1769 C CG  . LYS A 229 ? 0.4458 0.3647 0.5941 0.0174  0.0962  -0.0894 211 LYS A CG  
1770 C CD  . LYS A 229 ? 0.4650 0.3722 0.6303 0.0193  0.0970  -0.0831 211 LYS A CD  
1771 C CE  . LYS A 229 ? 0.5140 0.4113 0.7282 0.0299  0.1085  -0.0710 211 LYS A CE  
1772 N NZ  . LYS A 229 ? 0.5453 0.4280 0.7817 0.0306  0.1140  -0.0667 211 LYS A NZ  
1773 N N   . GLY A 230 ? 0.3778 0.3349 0.3984 -0.0110 0.0700  -0.1137 212 GLY A N   
1774 C CA  . GLY A 230 ? 0.3966 0.3649 0.3849 -0.0227 0.0667  -0.1247 212 GLY A CA  
1775 C C   . GLY A 230 ? 0.3977 0.3771 0.3681 -0.0261 0.0676  -0.1257 212 GLY A C   
1776 O O   . GLY A 230 ? 0.4128 0.3904 0.3990 -0.0220 0.0765  -0.1260 212 GLY A O   
1777 N N   . SER A 231 ? 0.3889 0.3811 0.3281 -0.0335 0.0584  -0.1247 213 SER A N   
1778 C CA  . SER A 231 ? 0.4051 0.4092 0.3246 -0.0400 0.0614  -0.1280 213 SER A CA  
1779 C C   . SER A 231 ? 0.3771 0.3860 0.2843 -0.0342 0.0493  -0.1082 213 SER A C   
1780 O O   . SER A 231 ? 0.3910 0.4107 0.2794 -0.0401 0.0499  -0.1075 213 SER A O   
1781 C CB  . SER A 231 ? 0.4190 0.4375 0.3127 -0.0551 0.0623  -0.1421 213 SER A CB  
1782 O OG  . SER A 231 ? 0.4374 0.4638 0.3139 -0.0553 0.0458  -0.1295 213 SER A OG  
1783 N N   . LEU A 232 ? 0.3597 0.3608 0.2774 -0.0239 0.0396  -0.0929 214 LEU A N   
1784 C CA  . LEU A 232 ? 0.3456 0.3495 0.2528 -0.0199 0.0292  -0.0767 214 LEU A CA  
1785 C C   . LEU A 232 ? 0.3495 0.3565 0.2596 -0.0199 0.0358  -0.0754 214 LEU A C   
1786 O O   . LEU A 232 ? 0.3395 0.3539 0.2322 -0.0238 0.0333  -0.0697 214 LEU A O   
1787 C CB  . LEU A 232 ? 0.3306 0.3260 0.2497 -0.0105 0.0201  -0.0643 214 LEU A CB  
1788 C CG  . LEU A 232 ? 0.3175 0.3134 0.2293 -0.0069 0.0112  -0.0502 214 LEU A CG  
1789 C CD1 . LEU A 232 ? 0.3200 0.3224 0.2104 -0.0111 0.0048  -0.0451 214 LEU A CD1 
1790 C CD2 . LEU A 232 ? 0.3357 0.3249 0.2581 0.0002  0.0040  -0.0415 214 LEU A CD2 
1791 N N   . LYS A 233 ? 0.3398 0.3418 0.2745 -0.0152 0.0444  -0.0791 215 LYS A N   
1792 C CA  . LYS A 233 ? 0.3516 0.3577 0.2949 -0.0145 0.0511  -0.0775 215 LYS A CA  
1793 C C   . LYS A 233 ? 0.3674 0.3824 0.2954 -0.0245 0.0623  -0.0892 215 LYS A C   
1794 O O   . LYS A 233 ? 0.3584 0.3801 0.2763 -0.0273 0.0628  -0.0837 215 LYS A O   
1795 C CB  . LYS A 233 ? 0.3343 0.3358 0.3114 -0.0069 0.0579  -0.0779 215 LYS A CB  
1796 C CG  . LYS A 233 ? 0.3155 0.3138 0.3043 0.0016  0.0457  -0.0627 215 LYS A CG  
1797 C CD  . LYS A 233 ? 0.3578 0.3557 0.3823 0.0092  0.0513  -0.0594 215 LYS A CD  
1798 C CE  . LYS A 233 ? 0.3715 0.3731 0.4044 0.0153  0.0387  -0.0428 215 LYS A CE  
1799 N NZ  . LYS A 233 ? 0.3593 0.3557 0.3767 0.0158  0.0274  -0.0372 215 LYS A NZ  
1800 N N   . GLU A 234 ? 0.3862 0.4017 0.3121 -0.0309 0.0717  -0.1057 216 GLU A N   
1801 C CA  . GLU A 234 ? 0.4197 0.4460 0.3278 -0.0428 0.0832  -0.1197 216 GLU A CA  
1802 C C   . GLU A 234 ? 0.4174 0.4565 0.2905 -0.0504 0.0730  -0.1105 216 GLU A C   
1803 O O   . GLU A 234 ? 0.4146 0.4641 0.2735 -0.0569 0.0784  -0.1099 216 GLU A O   
1804 C CB  . GLU A 234 ? 0.4346 0.4586 0.3471 -0.0497 0.0943  -0.1410 216 GLU A CB  
1805 C CG  . GLU A 234 ? 0.4873 0.5251 0.3764 -0.0650 0.1056  -0.1582 216 GLU A CG  
1806 C CD  . GLU A 234 ? 0.5553 0.5933 0.4416 -0.0752 0.1136  -0.1803 216 GLU A CD  
1807 O OE1 . GLU A 234 ? 0.6576 0.6960 0.5347 -0.0767 0.1016  -0.1775 216 GLU A OE1 
1808 O OE2 . GLU A 234 ? 0.6884 0.7269 0.5823 -0.0827 0.1332  -0.2018 216 GLU A OE2 
1809 N N   . LYS A 235 ? 0.4072 0.4462 0.2689 -0.0490 0.0587  -0.1015 217 LYS A N   
1810 C CA  . LYS A 235 ? 0.4179 0.4696 0.2519 -0.0546 0.0484  -0.0896 217 LYS A CA  
1811 C C   . LYS A 235 ? 0.3972 0.4463 0.2321 -0.0484 0.0426  -0.0706 217 LYS A C   
1812 O O   . LYS A 235 ? 0.4058 0.4656 0.2219 -0.0538 0.0406  -0.0610 217 LYS A O   
1813 C CB  . LYS A 235 ? 0.4189 0.4729 0.2454 -0.0547 0.0360  -0.0860 217 LYS A CB  
1814 C CG  . LYS A 235 ? 0.4585 0.5210 0.2771 -0.0659 0.0419  -0.1059 217 LYS A CG  
1815 C CD  . LYS A 235 ? 0.4660 0.5277 0.2862 -0.0644 0.0308  -0.1037 217 LYS A CD  
1816 C CE  . LYS A 235 ? 0.5081 0.5805 0.3199 -0.0779 0.0361  -0.1244 217 LYS A CE  
1817 N NZ  . LYS A 235 ? 0.5991 0.6946 0.3819 -0.0912 0.0364  -0.1259 217 LYS A NZ  
1818 N N   . THR A 236 ? 0.3675 0.4033 0.2251 -0.0382 0.0410  -0.0655 218 THR A N   
1819 C CA  . THR A 236 ? 0.3639 0.3963 0.2255 -0.0337 0.0370  -0.0509 218 THR A CA  
1820 C C   . THR A 236 ? 0.3669 0.4061 0.2278 -0.0390 0.0486  -0.0536 218 THR A C   
1821 O O   . THR A 236 ? 0.3784 0.4229 0.2268 -0.0427 0.0478  -0.0429 218 THR A O   
1822 C CB  . THR A 236 ? 0.3345 0.3550 0.2195 -0.0239 0.0326  -0.0472 218 THR A CB  
1823 O OG1 . THR A 236 ? 0.3397 0.3544 0.2242 -0.0197 0.0230  -0.0445 218 THR A OG1 
1824 C CG2 . THR A 236 ? 0.3371 0.3552 0.2265 -0.0217 0.0295  -0.0352 218 THR A CG2 
1825 N N   . VAL A 237 ? 0.3690 0.4081 0.2454 -0.0393 0.0606  -0.0676 219 VAL A N   
1826 C CA  . VAL A 237 ? 0.3991 0.4448 0.2808 -0.0436 0.0742  -0.0728 219 VAL A CA  
1827 C C   . VAL A 237 ? 0.4271 0.4867 0.2809 -0.0560 0.0816  -0.0776 219 VAL A C   
1828 O O   . VAL A 237 ? 0.4379 0.5047 0.2872 -0.0608 0.0892  -0.0745 219 VAL A O   
1829 C CB  . VAL A 237 ? 0.3950 0.4368 0.3057 -0.0395 0.0862  -0.0867 219 VAL A CB  
1830 C CG1 . VAL A 237 ? 0.4645 0.5152 0.3780 -0.0462 0.1038  -0.0973 219 VAL A CG1 
1831 C CG2 . VAL A 237 ? 0.3613 0.3953 0.3005 -0.0281 0.0786  -0.0763 219 VAL A CG2 
1832 N N   . GLU A 238 ? 0.4507 0.5163 0.2848 -0.0623 0.0787  -0.0841 220 GLU A N   
1833 C CA  . GLU A 238 ? 0.4995 0.5831 0.3031 -0.0758 0.0833  -0.0866 220 GLU A CA  
1834 C C   . GLU A 238 ? 0.4969 0.5881 0.2800 -0.0774 0.0713  -0.0633 220 GLU A C   
1835 O O   . GLU A 238 ? 0.5159 0.6242 0.2743 -0.0883 0.0746  -0.0603 220 GLU A O   
1836 C CB  . GLU A 238 ? 0.5241 0.6158 0.3140 -0.0850 0.0862  -0.1047 220 GLU A CB  
1837 C CG  . GLU A 238 ? 0.5594 0.6519 0.3402 -0.0834 0.0701  -0.0971 220 GLU A CG  
1838 C CD  . GLU A 238 ? 0.5833 0.6834 0.3552 -0.0935 0.0741  -0.1183 220 GLU A CD  
1839 O OE1 . GLU A 238 ? 0.6920 0.7927 0.4687 -0.1007 0.0915  -0.1408 220 GLU A OE1 
1840 O OE2 . GLU A 238 ? 0.6248 0.7301 0.3872 -0.0947 0.0611  -0.1133 220 GLU A OE2 
1841 N N   . ASN A 239 ? 0.4734 0.5527 0.2677 -0.0670 0.0586  -0.0469 221 ASN A N   
1842 C CA  . ASN A 239 ? 0.4785 0.5609 0.2618 -0.0667 0.0498  -0.0238 221 ASN A CA  
1843 C C   . ASN A 239 ? 0.4450 0.5102 0.2497 -0.0562 0.0446  -0.0117 221 ASN A C   
1844 O O   . ASN A 239 ? 0.4251 0.4827 0.2336 -0.0498 0.0334  -0.0004 221 ASN A O   
1845 C CB  . ASN A 239 ? 0.4969 0.5892 0.2626 -0.0687 0.0371  -0.0140 221 ASN A CB  
1846 C CG  . ASN A 239 ? 0.5299 0.6332 0.2802 -0.0722 0.0320  0.0100  221 ASN A CG  
1847 O OD1 . ASN A 239 ? 0.5550 0.6535 0.3104 -0.0714 0.0371  0.0210  221 ASN A OD1 
1848 N ND2 . ASN A 239 ? 0.5384 0.6575 0.2720 -0.0761 0.0220  0.0195  221 ASN A ND2 
1849 N N   . LEU A 240 ? 0.4404 0.5013 0.2596 -0.0556 0.0537  -0.0148 222 LEU A N   
1850 C CA  . LEU A 240 ? 0.4255 0.4723 0.2667 -0.0479 0.0501  -0.0084 222 LEU A CA  
1851 C C   . LEU A 240 ? 0.4240 0.4665 0.2611 -0.0475 0.0443  0.0112  222 LEU A C   
1852 O O   . LEU A 240 ? 0.4071 0.4372 0.2571 -0.0414 0.0378  0.0166  222 LEU A O   
1853 C CB  . LEU A 240 ? 0.4361 0.4841 0.2946 -0.0491 0.0616  -0.0164 222 LEU A CB  
1854 C CG  . LEU A 240 ? 0.4348 0.4836 0.3083 -0.0464 0.0679  -0.0341 222 LEU A CG  
1855 C CD1 . LEU A 240 ? 0.4669 0.5228 0.3542 -0.0498 0.0827  -0.0420 222 LEU A CD1 
1856 C CD2 . LEU A 240 ? 0.4052 0.4434 0.2980 -0.0371 0.0586  -0.0336 222 LEU A CD2 
1857 N N   . GLU A 241 ? 0.4464 0.4995 0.2661 -0.0545 0.0475  0.0221  223 GLU A N   
1858 C CA  . GLU A 241 ? 0.4597 0.5076 0.2792 -0.0536 0.0434  0.0434  223 GLU A CA  
1859 C C   . GLU A 241 ? 0.4497 0.4927 0.2683 -0.0472 0.0309  0.0530  223 GLU A C   
1860 O O   . GLU A 241 ? 0.4476 0.4779 0.2789 -0.0421 0.0273  0.0653  223 GLU A O   
1861 C CB  . GLU A 241 ? 0.4959 0.5591 0.2964 -0.0629 0.0497  0.0557  223 GLU A CB  
1862 C CG  . GLU A 241 ? 0.5501 0.6184 0.3535 -0.0697 0.0641  0.0470  223 GLU A CG  
1863 C CD  . GLU A 241 ? 0.6469 0.7323 0.4333 -0.0775 0.0725  0.0295  223 GLU A CD  
1864 O OE1 . GLU A 241 ? 0.6125 0.6975 0.3999 -0.0748 0.0698  0.0129  223 GLU A OE1 
1865 O OE2 . GLU A 241 ? 0.7252 0.8246 0.4969 -0.0874 0.0828  0.0327  223 GLU A OE2 
1866 N N   . LYS A 242 ? 0.4397 0.4927 0.2455 -0.0479 0.0256  0.0459  224 LYS A N   
1867 C CA  . LYS A 242 ? 0.4291 0.4798 0.2364 -0.0419 0.0141  0.0525  224 LYS A CA  
1868 C C   . LYS A 242 ? 0.3970 0.4293 0.2243 -0.0329 0.0105  0.0444  224 LYS A C   
1869 O O   . LYS A 242 ? 0.3845 0.4084 0.2205 -0.0269 0.0042  0.0540  224 LYS A O   
1870 C CB  . LYS A 242 ? 0.4374 0.5053 0.2267 -0.0469 0.0100  0.0441  224 LYS A CB  
1871 C CG  . LYS A 242 ? 0.4499 0.5184 0.2420 -0.0414 -0.0017 0.0504  224 LYS A CG  
1872 C CD  . LYS A 242 ? 0.4613 0.5519 0.2338 -0.0493 -0.0061 0.0452  224 LYS A CD  
1873 C CE  . LYS A 242 ? 0.4889 0.5802 0.2687 -0.0432 -0.0177 0.0514  224 LYS A CE  
1874 N NZ  . LYS A 242 ? 0.5632 0.6792 0.3245 -0.0523 -0.0234 0.0480  224 LYS A NZ  
1875 N N   . TYR A 243 ? 0.3760 0.4042 0.2109 -0.0325 0.0150  0.0271  225 TYR A N   
1876 C CA  . TYR A 243 ? 0.3535 0.3695 0.2039 -0.0256 0.0110  0.0188  225 TYR A CA  
1877 C C   . TYR A 243 ? 0.3357 0.3402 0.2035 -0.0231 0.0134  0.0172  225 TYR A C   
1878 O O   . TYR A 243 ? 0.3103 0.3062 0.1880 -0.0181 0.0085  0.0140  225 TYR A O   
1879 C CB  . TYR A 243 ? 0.3464 0.3668 0.1963 -0.0260 0.0126  0.0026  225 TYR A CB  
1880 C CG  . TYR A 243 ? 0.3643 0.3949 0.1992 -0.0288 0.0082  0.0016  225 TYR A CG  
1881 C CD1 . TYR A 243 ? 0.3802 0.4088 0.2153 -0.0243 -0.0014 0.0096  225 TYR A CD1 
1882 C CD2 . TYR A 243 ? 0.3789 0.4226 0.2007 -0.0366 0.0139  -0.0084 225 TYR A CD2 
1883 C CE1 . TYR A 243 ? 0.3609 0.4016 0.1844 -0.0276 -0.0065 0.0091  225 TYR A CE1 
1884 C CE2 . TYR A 243 ? 0.3924 0.4486 0.1994 -0.0414 0.0090  -0.0104 225 TYR A CE2 
1885 C CZ  . TYR A 243 ? 0.3679 0.4232 0.1765 -0.0367 -0.0020 -0.0007 225 TYR A CZ  
1886 O OH  . TYR A 243 ? 0.4320 0.5025 0.2279 -0.0422 -0.0076 -0.0026 225 TYR A OH  
1887 N N   . VAL A 244 ? 0.3451 0.3510 0.2164 -0.0275 0.0207  0.0193  226 VAL A N   
1888 C CA  . VAL A 244 ? 0.3358 0.3348 0.2252 -0.0270 0.0229  0.0154  226 VAL A CA  
1889 C C   . VAL A 244 ? 0.3519 0.3452 0.2463 -0.0308 0.0271  0.0256  226 VAL A C   
1890 O O   . VAL A 244 ? 0.3655 0.3647 0.2525 -0.0355 0.0331  0.0325  226 VAL A O   
1891 C CB  . VAL A 244 ? 0.3293 0.3367 0.2274 -0.0286 0.0289  0.0039  226 VAL A CB  
1892 C CG1 . VAL A 244 ? 0.3227 0.3275 0.2409 -0.0278 0.0278  0.0006  226 VAL A CG1 
1893 C CG2 . VAL A 244 ? 0.3319 0.3437 0.2266 -0.0255 0.0277  -0.0061 226 VAL A CG2 
1894 N N   . VAL A 245 ? 0.3554 0.3374 0.2626 -0.0297 0.0249  0.0259  227 VAL A N   
1895 C CA  . VAL A 245 ? 0.3727 0.3463 0.2898 -0.0342 0.0302  0.0328  227 VAL A CA  
1896 C C   . VAL A 245 ? 0.3809 0.3626 0.3072 -0.0403 0.0368  0.0271  227 VAL A C   
1897 O O   . VAL A 245 ? 0.3569 0.3461 0.2909 -0.0398 0.0350  0.0163  227 VAL A O   
1898 C CB  . VAL A 245 ? 0.3764 0.3360 0.3053 -0.0328 0.0271  0.0296  227 VAL A CB  
1899 C CG1 . VAL A 245 ? 0.3865 0.3362 0.3298 -0.0392 0.0341  0.0320  227 VAL A CG1 
1900 C CG2 . VAL A 245 ? 0.3813 0.3330 0.3052 -0.0265 0.0225  0.0363  227 VAL A CG2 
1901 N N   . LYS A 246 ? 0.3962 0.3778 0.3232 -0.0458 0.0448  0.0360  228 LYS A N   
1902 C CA  . LYS A 246 ? 0.4033 0.3937 0.3401 -0.0521 0.0525  0.0319  228 LYS A CA  
1903 C C   . LYS A 246 ? 0.4075 0.3873 0.3580 -0.0584 0.0582  0.0381  228 LYS A C   
1904 O O   . LYS A 246 ? 0.4342 0.4035 0.3815 -0.0585 0.0606  0.0513  228 LYS A O   
1905 C CB  . LYS A 246 ? 0.4236 0.4262 0.3459 -0.0545 0.0594  0.0360  228 LYS A CB  
1906 C CG  . LYS A 246 ? 0.4195 0.4327 0.3515 -0.0607 0.0694  0.0317  228 LYS A CG  
1907 C CD  . LYS A 246 ? 0.4433 0.4699 0.3599 -0.0624 0.0758  0.0295  228 LYS A CD  
1908 C CE  . LYS A 246 ? 0.4540 0.4911 0.3789 -0.0692 0.0882  0.0273  228 LYS A CE  
1909 N NZ  . LYS A 246 ? 0.4843 0.5348 0.3920 -0.0717 0.0959  0.0223  228 LYS A NZ  
1910 N N   . ASP A 247 ? 0.3985 0.3826 0.3663 -0.0639 0.0607  0.0295  229 ASP A N   
1911 C CA  . ASP A 247 ? 0.4092 0.3829 0.3936 -0.0717 0.0658  0.0308  229 ASP A CA  
1912 C C   . ASP A 247 ? 0.4020 0.3882 0.4011 -0.0798 0.0727  0.0265  229 ASP A C   
1913 O O   . ASP A 247 ? 0.3889 0.3886 0.3982 -0.0806 0.0685  0.0155  229 ASP A O   
1914 C CB  . ASP A 247 ? 0.3952 0.3613 0.3882 -0.0718 0.0585  0.0200  229 ASP A CB  
1915 C CG  . ASP A 247 ? 0.4330 0.3858 0.4433 -0.0813 0.0649  0.0180  229 ASP A CG  
1916 O OD1 . ASP A 247 ? 0.4653 0.4155 0.4851 -0.0882 0.0747  0.0245  229 ASP A OD1 
1917 O OD2 . ASP A 247 ? 0.4603 0.4050 0.4750 -0.0827 0.0608  0.0084  229 ASP A OD2 
1918 N N   . GLY A 248 ? 0.4355 0.3060 0.3460 0.0321  0.0714  0.0784  230 GLY A N   
1919 C CA  . GLY A 248 ? 0.4433 0.3050 0.3458 0.0185  0.0701  0.0709  230 GLY A CA  
1920 C C   . GLY A 248 ? 0.4669 0.3039 0.3602 0.0105  0.0743  0.0586  230 GLY A C   
1921 O O   . GLY A 248 ? 0.4779 0.3163 0.3682 -0.0027 0.0708  0.0513  230 GLY A O   
1922 N N   . LYS A 249 ? 0.4731 0.2890 0.3616 0.0181  0.0819  0.0573  231 LYS A N   
1923 C CA  . LYS A 249 ? 0.5045 0.2941 0.3795 0.0093  0.0861  0.0451  231 LYS A CA  
1924 C C   . LYS A 249 ? 0.4822 0.2884 0.3605 0.0026  0.0788  0.0337  231 LYS A C   
1925 O O   . LYS A 249 ? 0.5017 0.2932 0.3689 -0.0090 0.0792  0.0239  231 LYS A O   
1926 C CB  . LYS A 249 ? 0.5352 0.2917 0.3995 0.0202  0.0994  0.0470  231 LYS A CB  
1927 C CG  . LYS A 249 ? 0.5728 0.3035 0.4305 0.0252  0.1093  0.0578  231 LYS A CG  
1928 C CD  . LYS A 249 ? 0.6142 0.3055 0.4586 0.0366  0.1257  0.0592  231 LYS A CD  
1929 C CE  . LYS A 249 ? 0.6394 0.3464 0.4975 0.0579  0.1302  0.0696  231 LYS A CE  
1930 N NZ  . LYS A 249 ? 0.6026 0.3470 0.4819 0.0673  0.1232  0.0869  231 LYS A NZ  
1931 N N   . LEU A 250 ? 0.4594 0.2955 0.3516 0.0085  0.0721  0.0353  232 LEU A N   
1932 C CA  . LEU A 250 ? 0.4351 0.2878 0.3319 0.0026  0.0655  0.0259  232 LEU A CA  
1933 C C   . LEU A 250 ? 0.4249 0.2837 0.3203 -0.0127 0.0603  0.0197  232 LEU A C   
1934 O O   . LEU A 250 ? 0.4134 0.2675 0.3033 -0.0211 0.0592  0.0122  232 LEU A O   
1935 C CB  . LEU A 250 ? 0.4248 0.3063 0.3358 0.0097  0.0595  0.0292  232 LEU A CB  
1936 C CG  . LEU A 250 ? 0.4041 0.3033 0.3210 0.0033  0.0531  0.0210  232 LEU A CG  
1937 C CD1 . LEU A 250 ? 0.4611 0.3493 0.3725 0.0031  0.0558  0.0145  232 LEU A CD1 
1938 C CD2 . LEU A 250 ? 0.3964 0.3189 0.3242 0.0072  0.0478  0.0235  232 LEU A CD2 
1939 N N   . PRO A 251 ? 0.4295 0.3016 0.3302 -0.0165 0.0572  0.0240  233 PRO A N   
1940 C CA  . PRO A 251 ? 0.4107 0.2913 0.3128 -0.0295 0.0538  0.0206  233 PRO A CA  
1941 C C   . PRO A 251 ? 0.4278 0.2872 0.3182 -0.0418 0.0562  0.0179  233 PRO A C   
1942 O O   . PRO A 251 ? 0.4229 0.2918 0.3149 -0.0540 0.0524  0.0149  233 PRO A O   
1943 C CB  . PRO A 251 ? 0.4219 0.3169 0.3296 -0.0292 0.0529  0.0268  233 PRO A CB  
1944 C CG  . PRO A 251 ? 0.4236 0.3206 0.3321 -0.0179 0.0536  0.0326  233 PRO A CG  
1945 C CD  . PRO A 251 ? 0.4285 0.3134 0.3349 -0.0095 0.0561  0.0324  233 PRO A CD  
1946 N N   . LEU A 252 ? 0.4396 0.2709 0.3182 -0.0396 0.0629  0.0203  234 LEU A N   
1947 C CA  . LEU A 252 ? 0.4551 0.2591 0.3179 -0.0533 0.0664  0.0168  234 LEU A CA  
1948 C C   . LEU A 252 ? 0.4578 0.2529 0.3104 -0.0596 0.0654  0.0067  234 LEU A C   
1949 O O   . LEU A 252 ? 0.4721 0.2676 0.3183 -0.0767 0.0613  0.0022  234 LEU A O   
1950 C CB  . LEU A 252 ? 0.4768 0.2470 0.3275 -0.0468 0.0764  0.0216  234 LEU A CB  
1951 C CG  . LEU A 252 ? 0.5174 0.2496 0.3469 -0.0611 0.0825  0.0171  234 LEU A CG  
1952 C CD1 . LEU A 252 ? 0.5598 0.3039 0.3915 -0.0809 0.0760  0.0181  234 LEU A CD1 
1953 C CD2 . LEU A 252 ? 0.5369 0.2337 0.3561 -0.0500 0.0951  0.0240  234 LEU A CD2 
1954 N N   . LEU A 253 ? 0.4539 0.2435 0.3051 -0.0462 0.0691  0.0043  235 LEU A N   
1955 C CA  . LEU A 253 ? 0.4701 0.2482 0.3082 -0.0512 0.0699  -0.0052 235 LEU A CA  
1956 C C   . LEU A 253 ? 0.4385 0.2495 0.2875 -0.0606 0.0592  -0.0079 235 LEU A C   
1957 O O   . LEU A 253 ? 0.4520 0.2592 0.2896 -0.0766 0.0558  -0.0136 235 LEU A O   
1958 C CB  . LEU A 253 ? 0.4750 0.2454 0.3126 -0.0329 0.0769  -0.0050 235 LEU A CB  
1959 C CG  . LEU A 253 ? 0.4866 0.2456 0.3095 -0.0361 0.0791  -0.0145 235 LEU A CG  
1960 C CD1 . LEU A 253 ? 0.4930 0.2132 0.2865 -0.0524 0.0846  -0.0231 235 LEU A CD1 
1961 C CD2 . LEU A 253 ? 0.5071 0.2598 0.3318 -0.0161 0.0880  -0.0120 235 LEU A CD2 
1962 N N   . LEU A 254 ? 0.4095 0.2518 0.2795 -0.0518 0.0543  -0.0029 236 LEU A N   
1963 C CA  . LEU A 254 ? 0.4043 0.2770 0.2870 -0.0569 0.0465  -0.0033 236 LEU A CA  
1964 C C   . LEU A 254 ? 0.3997 0.2836 0.2845 -0.0733 0.0418  -0.0009 236 LEU A C   
1965 O O   . LEU A 254 ? 0.3924 0.2925 0.2795 -0.0835 0.0362  -0.0017 236 LEU A O   
1966 C CB  . LEU A 254 ? 0.3862 0.2842 0.2882 -0.0443 0.0445  0.0012  236 LEU A CB  
1967 C CG  . LEU A 254 ? 0.4209 0.3190 0.3258 -0.0303 0.0464  0.0003  236 LEU A CG  
1968 C CD1 . LEU A 254 ? 0.4136 0.3373 0.3351 -0.0239 0.0428  0.0031  236 LEU A CD1 
1969 C CD2 . LEU A 254 ? 0.4693 0.3605 0.3659 -0.0316 0.0470  -0.0052 236 LEU A CD2 
1970 N N   . SER A 255 ? 0.4085 0.2866 0.2936 -0.0762 0.0439  0.0037  237 SER A N   
1971 C CA  . SER A 255 ? 0.4116 0.3023 0.3005 -0.0923 0.0400  0.0081  237 SER A CA  
1972 C C   . SER A 255 ? 0.4355 0.3080 0.3052 -0.1118 0.0378  0.0027  237 SER A C   
1973 O O   . SER A 255 ? 0.4349 0.3280 0.3090 -0.1273 0.0310  0.0055  237 SER A O   
1974 C CB  . SER A 255 ? 0.4179 0.3044 0.3097 -0.0911 0.0437  0.0147  237 SER A CB  
1975 O OG  . SER A 255 ? 0.4906 0.3405 0.3641 -0.0930 0.0496  0.0125  237 SER A OG  
1976 N N   . ARG A 256 ? 0.4653 0.2995 0.3130 -0.1112 0.0441  -0.0043 238 ARG A N   
1977 C CA  . ARG A 256 ? 0.5050 0.3141 0.3277 -0.1306 0.0437  -0.0119 238 ARG A CA  
1978 C C   . ARG A 256 ? 0.4993 0.3222 0.3176 -0.1366 0.0377  -0.0172 238 ARG A C   
1979 O O   . ARG A 256 ? 0.5016 0.3270 0.3077 -0.1588 0.0313  -0.0196 238 ARG A O   
1980 C CB  . ARG A 256 ? 0.5477 0.3070 0.3461 -0.1254 0.0556  -0.0180 238 ARG A CB  
1981 C CG  . ARG A 256 ? 0.5671 0.3086 0.3645 -0.1269 0.0609  -0.0118 238 ARG A CG  
1982 C CD  . ARG A 256 ? 0.6462 0.3403 0.4243 -0.1161 0.0748  -0.0143 238 ARG A CD  
1983 N NE  . ARG A 256 ? 0.7481 0.4034 0.4945 -0.1288 0.0801  -0.0261 238 ARG A NE  
1984 C CZ  . ARG A 256 ? 0.8150 0.4397 0.5375 -0.1521 0.0816  -0.0310 238 ARG A CZ  
1985 N NH1 . ARG A 256 ? 0.8498 0.4800 0.5792 -0.1645 0.0782  -0.0237 238 ARG A NH1 
1986 N NH2 . ARG A 256 ? 0.8771 0.4643 0.5667 -0.1640 0.0870  -0.0434 238 ARG A NH2 
1987 N N   . MET A 257 ? 0.4787 0.3109 0.3058 -0.1182 0.0395  -0.0184 239 MET A N   
1988 C CA  . MET A 257 ? 0.4906 0.3393 0.3165 -0.1213 0.0341  -0.0216 239 MET A CA  
1989 C C   . MET A 257 ? 0.4798 0.3721 0.3260 -0.1314 0.0234  -0.0130 239 MET A C   
1990 O O   . MET A 257 ? 0.4856 0.3910 0.3254 -0.1457 0.0165  -0.0136 239 MET A O   
1991 C CB  . MET A 257 ? 0.4637 0.3179 0.3000 -0.0988 0.0382  -0.0219 239 MET A CB  
1992 C CG  . MET A 257 ? 0.4778 0.2944 0.2943 -0.0887 0.0491  -0.0289 239 MET A CG  
1993 S SD  . MET A 257 ? 0.4845 0.3176 0.3209 -0.0632 0.0522  -0.0250 239 MET A SD  
1994 C CE  . MET A 257 ? 0.5096 0.3009 0.3214 -0.0528 0.0663  -0.0314 239 MET A CE  
1995 N N   . LYS A 258 ? 0.4807 0.3963 0.3509 -0.1239 0.0227  -0.0040 240 LYS A N   
1996 C CA  . LYS A 258 ? 0.4760 0.4337 0.3687 -0.1289 0.0156  0.0064  240 LYS A CA  
1997 C C   . LYS A 258 ? 0.5061 0.4718 0.3932 -0.1539 0.0091  0.0107  240 LYS A C   
1998 O O   . LYS A 258 ? 0.5025 0.5037 0.4034 -0.1632 0.0016  0.0198  240 LYS A O   
1999 C CB  . LYS A 258 ? 0.4609 0.4372 0.3779 -0.1119 0.0194  0.0139  240 LYS A CB  
2000 C CG  . LYS A 258 ? 0.4569 0.4740 0.3988 -0.1074 0.0163  0.0241  240 LYS A CG  
2001 C CD  . LYS A 258 ? 0.4587 0.4817 0.4143 -0.0860 0.0216  0.0244  240 LYS A CD  
2002 C CE  . LYS A 258 ? 0.4737 0.5248 0.4521 -0.0795 0.0247  0.0353  240 LYS A CE  
2003 N NZ  . LYS A 258 ? 0.5205 0.6038 0.5120 -0.0906 0.0194  0.0468  240 LYS A NZ  
2004 N N   . GLU A 259 ? 0.5447 0.4772 0.4107 -0.1659 0.0119  0.0051  241 GLU A N   
2005 C CA  . GLU A 259 ? 0.5770 0.5115 0.4325 -0.1937 0.0053  0.0077  241 GLU A CA  
2006 C C   . GLU A 259 ? 0.5936 0.5282 0.4291 -0.2131 -0.0024 0.0023  241 GLU A C   
2007 O O   . GLU A 259 ? 0.5975 0.5567 0.4343 -0.2364 -0.0123 0.0093  241 GLU A O   
2008 C CB  . GLU A 259 ? 0.6307 0.5229 0.4658 -0.2018 0.0118  0.0024  241 GLU A CB  
2009 C CG  . GLU A 259 ? 0.6404 0.5341 0.4931 -0.1855 0.0186  0.0093  241 GLU A CG  
2010 C CD  . GLU A 259 ? 0.6751 0.5224 0.5073 -0.1880 0.0273  0.0047  241 GLU A CD  
2011 O OE1 . GLU A 259 ? 0.7922 0.6038 0.5957 -0.2060 0.0286  -0.0035 241 GLU A OE1 
2012 O OE2 . GLU A 259 ? 0.6962 0.5422 0.5403 -0.1716 0.0335  0.0099  241 GLU A OE2 
2013 N N   . VAL A 260 ? 0.5886 0.4975 0.4047 -0.2048 0.0020  -0.0092 242 VAL A N   
2014 C CA  . VAL A 260 ? 0.6133 0.5168 0.4043 -0.2234 -0.0040 -0.0161 242 VAL A CA  
2015 C C   . VAL A 260 ? 0.5785 0.5134 0.3830 -0.2120 -0.0081 -0.0126 242 VAL A C   
2016 O O   . VAL A 260 ? 0.5972 0.5351 0.3834 -0.2269 -0.0141 -0.0161 242 VAL A O   
2017 C CB  . VAL A 260 ? 0.6608 0.5043 0.4104 -0.2271 0.0059  -0.0332 242 VAL A CB  
2018 C CG1 . VAL A 260 ? 0.7124 0.5202 0.4447 -0.2414 0.0106  -0.0366 242 VAL A CG1 
2019 C CG2 . VAL A 260 ? 0.6415 0.4654 0.3937 -0.1967 0.0178  -0.0386 242 VAL A CG2 
2020 N N   . GLY A 261 ? 0.5271 0.4831 0.3612 -0.1865 -0.0046 -0.0058 243 GLY A N   
2021 C CA  . GLY A 261 ? 0.4974 0.4791 0.3446 -0.1745 -0.0070 -0.0021 243 GLY A CA  
2022 C C   . GLY A 261 ? 0.4435 0.4493 0.3245 -0.1507 -0.0034 0.0069  243 GLY A C   
2023 O O   . GLY A 261 ? 0.4394 0.4492 0.3351 -0.1457 -0.0006 0.0119  243 GLY A O   
2024 N N   . LYS A 262 ? 0.3933 0.4136 0.2842 -0.1373 -0.0030 0.0088  244 LYS A N   
2025 C CA  . LYS A 262 ? 0.3454 0.3847 0.2641 -0.1164 0.0009  0.0160  244 LYS A CA  
2026 C C   . LYS A 262 ? 0.3394 0.3488 0.2507 -0.0989 0.0094  0.0060  244 LYS A C   
2027 O O   . LYS A 262 ? 0.3731 0.3563 0.2617 -0.1009 0.0118  -0.0036 244 LYS A O   
2028 C CB  . LYS A 262 ? 0.3314 0.4055 0.2661 -0.1139 -0.0038 0.0260  244 LYS A CB  
2029 C CG  . LYS A 262 ? 0.3278 0.4409 0.2787 -0.1277 -0.0115 0.0413  244 LYS A CG  
2030 C CD  . LYS A 262 ? 0.3632 0.5087 0.3252 -0.1282 -0.0168 0.0521  244 LYS A CD  
2031 C CE  . LYS A 262 ? 0.3594 0.5476 0.3389 -0.1425 -0.0248 0.0700  244 LYS A CE  
2032 N NZ  . LYS A 262 ? 0.4068 0.6316 0.4027 -0.1385 -0.0289 0.0845  244 LYS A NZ  
2033 N N   . VAL A 263 ? 0.3027 0.3167 0.2320 -0.0828 0.0142  0.0092  245 VAL A N   
2034 C CA  . VAL A 263 ? 0.2943 0.2876 0.2209 -0.0673 0.0207  0.0030  245 VAL A CA  
2035 C C   . VAL A 263 ? 0.2683 0.2805 0.2151 -0.0532 0.0221  0.0081  245 VAL A C   
2036 O O   . VAL A 263 ? 0.2786 0.3109 0.2428 -0.0509 0.0222  0.0159  245 VAL A O   
2037 C CB  . VAL A 263 ? 0.2919 0.2681 0.2159 -0.0650 0.0248  0.0015  245 VAL A CB  
2038 C CG1 . VAL A 263 ? 0.2729 0.2340 0.1966 -0.0494 0.0304  -0.0020 245 VAL A CG1 
2039 C CG2 . VAL A 263 ? 0.3202 0.2750 0.2235 -0.0810 0.0241  -0.0028 245 VAL A CG2 
2040 N N   . PHE A 264 ? 0.2705 0.2750 0.2143 -0.0441 0.0244  0.0043  246 PHE A N   
2041 C CA  . PHE A 264 ? 0.2475 0.2644 0.2075 -0.0322 0.0263  0.0080  246 PHE A CA  
2042 C C   . PHE A 264 ? 0.2513 0.2528 0.2085 -0.0218 0.0302  0.0035  246 PHE A C   
2043 O O   . PHE A 264 ? 0.2655 0.2491 0.2093 -0.0213 0.0322  -0.0013 246 PHE A O   
2044 C CB  . PHE A 264 ? 0.2474 0.2824 0.2134 -0.0328 0.0237  0.0128  246 PHE A CB  
2045 C CG  . PHE A 264 ? 0.2481 0.2737 0.1996 -0.0337 0.0233  0.0078  246 PHE A CG  
2046 C CD1 . PHE A 264 ? 0.2870 0.3083 0.2416 -0.0229 0.0268  0.0065  246 PHE A CD1 
2047 C CD2 . PHE A 264 ? 0.2796 0.3018 0.2134 -0.0465 0.0198  0.0050  246 PHE A CD2 
2048 C CE1 . PHE A 264 ? 0.2660 0.2812 0.2085 -0.0224 0.0280  0.0034  246 PHE A CE1 
2049 C CE2 . PHE A 264 ? 0.2624 0.2747 0.1801 -0.0469 0.0212  0.0001  246 PHE A CE2 
2050 C CZ  . PHE A 264 ? 0.2602 0.2698 0.1832 -0.0337 0.0258  -0.0002 246 PHE A CZ  
2051 N N   . LEU A 265 ? 0.2457 0.2544 0.2155 -0.0140 0.0320  0.0062  247 LEU A N   
2052 C CA  . LEU A 265 ? 0.2515 0.2530 0.2222 -0.0061 0.0340  0.0043  247 LEU A CA  
2053 C C   . LEU A 265 ? 0.2533 0.2649 0.2331 -0.0017 0.0342  0.0069  247 LEU A C   
2054 O O   . LEU A 265 ? 0.2553 0.2778 0.2449 -0.0014 0.0348  0.0110  247 LEU A O   
2055 C CB  . LEU A 265 ? 0.2516 0.2508 0.2258 -0.0041 0.0355  0.0046  247 LEU A CB  
2056 C CG  . LEU A 265 ? 0.2622 0.2564 0.2356 0.0008  0.0356  0.0039  247 LEU A CG  
2057 C CD1 . LEU A 265 ? 0.2822 0.2659 0.2470 0.0027  0.0361  0.0035  247 LEU A CD1 
2058 C CD2 . LEU A 265 ? 0.2842 0.2780 0.2587 0.0002  0.0365  0.0038  247 LEU A CD2 
2059 N N   . ALA A 266 ? 0.2544 0.2622 0.2315 0.0024  0.0349  0.0059  248 ALA A N   
2060 C CA  . ALA A 266 ? 0.2489 0.2654 0.2344 0.0062  0.0353  0.0090  248 ALA A CA  
2061 C C   . ALA A 266 ? 0.2566 0.2696 0.2437 0.0107  0.0361  0.0092  248 ALA A C   
2062 O O   . ALA A 266 ? 0.3026 0.3104 0.2836 0.0138  0.0376  0.0087  248 ALA A O   
2063 C CB  . ALA A 266 ? 0.2655 0.2867 0.2459 0.0050  0.0350  0.0099  248 ALA A CB  
2064 N N   . THR A 267 ? 0.2242 0.2398 0.2187 0.0105  0.0357  0.0105  249 THR A N   
2065 C CA  . THR A 267 ? 0.2278 0.2446 0.2245 0.0116  0.0345  0.0123  249 THR A CA  
2066 C C   . THR A 267 ? 0.2074 0.2302 0.2125 0.0105  0.0345  0.0152  249 THR A C   
2067 O O   . THR A 267 ? 0.1967 0.2174 0.2046 0.0087  0.0362  0.0146  249 THR A O   
2068 C CB  . THR A 267 ? 0.2277 0.2395 0.2201 0.0083  0.0328  0.0107  249 THR A CB  
2069 O OG1 . THR A 267 ? 0.2444 0.2622 0.2398 0.0069  0.0299  0.0143  249 THR A OG1 
2070 C CG2 . THR A 267 ? 0.2597 0.2664 0.2507 0.0045  0.0343  0.0076  249 THR A CG2 
2071 N N   . ASN A 268 ? 0.2175 0.2474 0.2270 0.0117  0.0333  0.0193  250 ASN A N   
2072 C CA  . ASN A 268 ? 0.2181 0.2532 0.2350 0.0078  0.0323  0.0225  250 ASN A CA  
2073 C C   . ASN A 268 ? 0.2365 0.2656 0.2496 -0.0007 0.0297  0.0199  250 ASN A C   
2074 O O   . ASN A 268 ? 0.2338 0.2600 0.2487 -0.0065 0.0300  0.0201  250 ASN A O   
2075 C CB  . ASN A 268 ? 0.2219 0.2706 0.2466 0.0107  0.0317  0.0299  250 ASN A CB  
2076 C CG  . ASN A 268 ? 0.2259 0.2788 0.2534 0.0166  0.0357  0.0322  250 ASN A CG  
2077 O OD1 . ASN A 268 ? 0.2435 0.2906 0.2662 0.0179  0.0375  0.0286  250 ASN A OD1 
2078 N ND2 . ASN A 268 ? 0.2039 0.2690 0.2392 0.0196  0.0370  0.0393  250 ASN A ND2 
2079 N N   A SER A 269 ? 0.2354 0.2603 0.2408 -0.0021 0.0280  0.0171  251 SER A N   
2080 N N   B SER A 269 ? 0.2385 0.2636 0.2440 -0.0022 0.0279  0.0172  251 SER A N   
2081 C CA  A SER A 269 ? 0.2489 0.2672 0.2461 -0.0112 0.0257  0.0139  251 SER A CA  
2082 C CA  B SER A 269 ? 0.2546 0.2726 0.2517 -0.0114 0.0257  0.0138  251 SER A CA  
2083 C C   A SER A 269 ? 0.2546 0.2562 0.2451 -0.0136 0.0313  0.0074  251 SER A C   
2084 C C   B SER A 269 ? 0.2579 0.2595 0.2485 -0.0137 0.0313  0.0075  251 SER A C   
2085 O O   A SER A 269 ? 0.2563 0.2551 0.2504 -0.0073 0.0360  0.0069  251 SER A O   
2086 O O   B SER A 269 ? 0.2600 0.2590 0.2548 -0.0074 0.0361  0.0071  251 SER A O   
2087 C CB  A SER A 269 ? 0.2543 0.2747 0.2452 -0.0111 0.0227  0.0145  251 SER A CB  
2088 C CB  B SER A 269 ? 0.2625 0.2816 0.2524 -0.0118 0.0228  0.0138  251 SER A CB  
2089 O OG  A SER A 269 ? 0.2561 0.2773 0.2395 -0.0215 0.0181  0.0143  251 SER A OG  
2090 O OG  B SER A 269 ? 0.2803 0.3147 0.2764 -0.0100 0.0185  0.0219  251 SER A OG  
2091 N N   . ASP A 270 ? 0.2797 0.2707 0.2594 -0.0232 0.0311  0.0033  252 ASP A N   
2092 C CA  . ASP A 270 ? 0.3021 0.2729 0.2724 -0.0247 0.0392  -0.0029 252 ASP A CA  
2093 C C   . ASP A 270 ? 0.3016 0.2680 0.2638 -0.0219 0.0415  -0.0062 252 ASP A C   
2094 O O   . ASP A 270 ? 0.2891 0.2653 0.2497 -0.0220 0.0358  -0.0044 252 ASP A O   
2095 C CB  . ASP A 270 ? 0.3433 0.2996 0.2996 -0.0381 0.0391  -0.0075 252 ASP A CB  
2096 C CG  . ASP A 270 ? 0.3809 0.3448 0.3260 -0.0489 0.0300  -0.0079 252 ASP A CG  
2097 O OD1 . ASP A 270 ? 0.4308 0.3827 0.3595 -0.0530 0.0323  -0.0137 252 ASP A OD1 
2098 O OD2 . ASP A 270 ? 0.5022 0.4869 0.4562 -0.0518 0.0210  -0.0007 252 ASP A OD2 
2099 N N   . TYR A 271 ? 0.3078 0.2598 0.2655 -0.0186 0.0511  -0.0095 253 TYR A N   
2100 C CA  . TYR A 271 ? 0.3122 0.2614 0.2638 -0.0155 0.0547  -0.0113 253 TYR A CA  
2101 C C   . TYR A 271 ? 0.3228 0.2656 0.2561 -0.0244 0.0517  -0.0160 253 TYR A C   
2102 O O   . TYR A 271 ? 0.3158 0.2659 0.2476 -0.0229 0.0489  -0.0146 253 TYR A O   
2103 C CB  . TYR A 271 ? 0.3194 0.2570 0.2723 -0.0084 0.0676  -0.0115 253 TYR A CB  
2104 C CG  . TYR A 271 ? 0.3284 0.2677 0.2782 -0.0048 0.0715  -0.0113 253 TYR A CG  
2105 C CD1 . TYR A 271 ? 0.3242 0.2813 0.2858 -0.0004 0.0670  -0.0059 253 TYR A CD1 
2106 C CD2 . TYR A 271 ? 0.3641 0.2862 0.2964 -0.0074 0.0794  -0.0168 253 TYR A CD2 
2107 C CE1 . TYR A 271 ? 0.3198 0.2794 0.2792 0.0012  0.0701  -0.0048 253 TYR A CE1 
2108 C CE2 . TYR A 271 ? 0.3314 0.2569 0.2613 -0.0043 0.0832  -0.0156 253 TYR A CE2 
2109 C CZ  . TYR A 271 ? 0.3520 0.2975 0.2970 -0.0001 0.0781  -0.0090 253 TYR A CZ  
2110 O OH  . TYR A 271 ? 0.3604 0.3099 0.3039 0.0017  0.0818  -0.0068 253 TYR A OH  
2111 N N   . LYS A 272 ? 0.3347 0.2635 0.2526 -0.0350 0.0522  -0.0213 254 LYS A N   
2112 C CA  . LYS A 272 ? 0.3638 0.2870 0.2607 -0.0455 0.0490  -0.0257 254 LYS A CA  
2113 C C   . LYS A 272 ? 0.3224 0.2688 0.2249 -0.0480 0.0363  -0.0190 254 LYS A C   
2114 O O   . LYS A 272 ? 0.3340 0.2840 0.2287 -0.0486 0.0344  -0.0181 254 LYS A O   
2115 C CB  . LYS A 272 ? 0.3945 0.2988 0.2714 -0.0599 0.0501  -0.0327 254 LYS A CB  
2116 C CG  . LYS A 272 ? 0.4740 0.3484 0.3371 -0.0573 0.0660  -0.0404 254 LYS A CG  
2117 C CD  . LYS A 272 ? 0.5377 0.3854 0.3733 -0.0739 0.0688  -0.0498 254 LYS A CD  
2118 C CE  . LYS A 272 ? 0.6182 0.4304 0.4370 -0.0689 0.0886  -0.0577 254 LYS A CE  
2119 N NZ  . LYS A 272 ? 0.7002 0.4913 0.5219 -0.0682 0.0975  -0.0589 254 LYS A NZ  
2120 N N   . TYR A 273 ? 0.2987 0.2608 0.2159 -0.0478 0.0289  -0.0129 255 TYR A N   
2121 C CA  . TYR A 273 ? 0.3013 0.2855 0.2268 -0.0469 0.0193  -0.0041 255 TYR A CA  
2122 C C   . TYR A 273 ? 0.2864 0.2761 0.2221 -0.0340 0.0217  -0.0005 255 TYR A C   
2123 O O   . TYR A 273 ? 0.2740 0.2709 0.2071 -0.0330 0.0183  0.0040  255 TYR A O   
2124 C CB  . TYR A 273 ? 0.2869 0.2867 0.2264 -0.0483 0.0133  0.0027  255 TYR A CB  
2125 C CG  . TYR A 273 ? 0.2699 0.2933 0.2191 -0.0458 0.0054  0.0140  255 TYR A CG  
2126 C CD1 . TYR A 273 ? 0.3053 0.3404 0.2457 -0.0564 -0.0026 0.0190  255 TYR A CD1 
2127 C CD2 . TYR A 273 ? 0.2778 0.3121 0.2443 -0.0327 0.0068  0.0209  255 TYR A CD2 
2128 C CE1 . TYR A 273 ? 0.2865 0.3463 0.2387 -0.0524 -0.0089 0.0327  255 TYR A CE1 
2129 C CE2 . TYR A 273 ? 0.2783 0.3321 0.2542 -0.0279 0.0025  0.0328  255 TYR A CE2 
2130 C CZ  . TYR A 273 ? 0.2881 0.3559 0.2588 -0.0367 -0.0052 0.0398  255 TYR A CZ  
2131 O OH  . TYR A 273 ? 0.2765 0.3665 0.2590 -0.0303 -0.0086 0.0547  255 TYR A OH  
2132 N N   . THR A 274 ? 0.2886 0.2743 0.2344 -0.0254 0.0273  -0.0018 256 THR A N   
2133 C CA  . THR A 274 ? 0.2796 0.2676 0.2321 -0.0164 0.0297  0.0002  256 THR A CA  
2134 C C   . THR A 274 ? 0.2951 0.2765 0.2372 -0.0174 0.0327  -0.0019 256 THR A C   
2135 O O   . THR A 274 ? 0.2827 0.2678 0.2254 -0.0146 0.0310  0.0018  256 THR A O   
2136 C CB  . THR A 274 ? 0.2846 0.2706 0.2471 -0.0104 0.0349  -0.0009 256 THR A CB  
2137 O OG1 . THR A 274 ? 0.2963 0.2894 0.2679 -0.0090 0.0324  0.0019  256 THR A OG1 
2138 C CG2 . THR A 274 ? 0.2575 0.2459 0.2240 -0.0050 0.0362  0.0008  256 THR A CG2 
2139 N N   . ASP A 275 ? 0.3079 0.2776 0.2396 -0.0211 0.0385  -0.0074 257 ASP A N   
2140 C CA  . ASP A 275 ? 0.3106 0.2741 0.2315 -0.0218 0.0429  -0.0092 257 ASP A CA  
2141 C C   . ASP A 275 ? 0.3233 0.2919 0.2332 -0.0278 0.0362  -0.0064 257 ASP A C   
2142 O O   . ASP A 275 ? 0.3141 0.2855 0.2230 -0.0254 0.0363  -0.0029 257 ASP A O   
2143 C CB  . ASP A 275 ? 0.3304 0.2779 0.2401 -0.0237 0.0526  -0.0156 257 ASP A CB  
2144 C CG  . ASP A 275 ? 0.3678 0.3095 0.2687 -0.0217 0.0605  -0.0165 257 ASP A CG  
2145 O OD1 . ASP A 275 ? 0.3644 0.3154 0.2719 -0.0183 0.0590  -0.0117 257 ASP A OD1 
2146 O OD2 . ASP A 275 ? 0.4219 0.3476 0.3080 -0.0238 0.0695  -0.0222 257 ASP A OD2 
2147 N N   . LYS A 276 ? 0.3214 0.2934 0.2243 -0.0361 0.0298  -0.0062 258 LYS A N   
2148 C CA  . LYS A 276 ? 0.3447 0.3264 0.2380 -0.0426 0.0223  -0.0010 258 LYS A CA  
2149 C C   . LYS A 276 ? 0.3101 0.3066 0.2179 -0.0344 0.0177  0.0096  258 LYS A C   
2150 O O   . LYS A 276 ? 0.2957 0.2956 0.1991 -0.0334 0.0168  0.0148  258 LYS A O   
2151 C CB  . LYS A 276 ? 0.3542 0.3406 0.2381 -0.0555 0.0150  -0.0013 258 LYS A CB  
2152 C CG  . LYS A 276 ? 0.4363 0.4019 0.2963 -0.0660 0.0207  -0.0125 258 LYS A CG  
2153 C CD  . LYS A 276 ? 0.5085 0.4765 0.3525 -0.0837 0.0124  -0.0137 258 LYS A CD  
2154 C CE  . LYS A 276 ? 0.6065 0.5689 0.4568 -0.0879 0.0124  -0.0169 258 LYS A CE  
2155 N NZ  . LYS A 276 ? 0.6784 0.6083 0.5073 -0.0952 0.0231  -0.0305 258 LYS A NZ  
2156 N N   . ILE A 277 ? 0.3005 0.3033 0.2244 -0.0281 0.0165  0.0129  259 ILE A N   
2157 C CA  . ILE A 277 ? 0.2977 0.3090 0.2339 -0.0188 0.0153  0.0220  259 ILE A CA  
2158 C C   . ILE A 277 ? 0.3044 0.3048 0.2410 -0.0122 0.0213  0.0206  259 ILE A C   
2159 O O   . ILE A 277 ? 0.2992 0.3004 0.2349 -0.0087 0.0213  0.0274  259 ILE A O   
2160 C CB  . ILE A 277 ? 0.2896 0.3080 0.2402 -0.0136 0.0146  0.0247  259 ILE A CB  
2161 C CG1 . ILE A 277 ? 0.2759 0.3098 0.2286 -0.0213 0.0074  0.0296  259 ILE A CG1 
2162 C CG2 . ILE A 277 ? 0.2871 0.3070 0.2469 -0.0022 0.0173  0.0322  259 ILE A CG2 
2163 C CD1 . ILE A 277 ? 0.2713 0.3237 0.2233 -0.0248 0.0002  0.0416  259 ILE A CD1 
2164 N N   . MET A 278 ? 0.2936 0.2848 0.2317 -0.0113 0.0263  0.0131  260 MET A N   
2165 C CA  . MET A 278 ? 0.2929 0.2763 0.2318 -0.0081 0.0309  0.0123  260 MET A CA  
2166 C C   . MET A 278 ? 0.3079 0.2879 0.2368 -0.0115 0.0328  0.0132  260 MET A C   
2167 O O   . MET A 278 ? 0.3155 0.2915 0.2440 -0.0097 0.0343  0.0170  260 MET A O   
2168 C CB  . MET A 278 ? 0.2651 0.2457 0.2097 -0.0075 0.0347  0.0070  260 MET A CB  
2169 C CG  . MET A 278 ? 0.2754 0.2591 0.2291 -0.0040 0.0336  0.0066  260 MET A CG  
2170 S SD  . MET A 278 ? 0.3237 0.3032 0.2788 0.0010  0.0336  0.0102  260 MET A SD  
2171 C CE  . MET A 278 ? 0.3609 0.3336 0.3137 -0.0029 0.0367  0.0072  260 MET A CE  
2172 N N   . THR A 279 ? 0.3079 0.2875 0.2267 -0.0169 0.0334  0.0098  261 THR A N   
2173 C CA  . THR A 279 ? 0.3173 0.2947 0.2241 -0.0202 0.0354  0.0111  261 THR A CA  
2174 C C   . THR A 279 ? 0.3236 0.3070 0.2282 -0.0197 0.0305  0.0203  261 THR A C   
2175 O O   . THR A 279 ? 0.3382 0.3188 0.2399 -0.0186 0.0329  0.0247  261 THR A O   
2176 C CB  . THR A 279 ? 0.3294 0.3018 0.2208 -0.0269 0.0380  0.0048  261 THR A CB  
2177 O OG1 . THR A 279 ? 0.3244 0.2893 0.2200 -0.0244 0.0453  -0.0017 261 THR A OG1 
2178 C CG2 . THR A 279 ? 0.3258 0.2958 0.2021 -0.0302 0.0411  0.0065  261 THR A CG2 
2179 N N   . TYR A 280 ? 0.3317 0.3250 0.2389 -0.0202 0.0240  0.0251  262 TYR A N   
2180 C CA  . TYR A 280 ? 0.3342 0.3374 0.2430 -0.0176 0.0196  0.0373  262 TYR A CA  
2181 C C   . TYR A 280 ? 0.3269 0.3225 0.2457 -0.0079 0.0239  0.0426  262 TYR A C   
2182 O O   . TYR A 280 ? 0.3411 0.3344 0.2568 -0.0057 0.0255  0.0501  262 TYR A O   
2183 C CB  . TYR A 280 ? 0.3364 0.3563 0.2498 -0.0199 0.0119  0.0434  262 TYR A CB  
2184 C CG  . TYR A 280 ? 0.3370 0.3710 0.2583 -0.0136 0.0086  0.0597  262 TYR A CG  
2185 C CD1 . TYR A 280 ? 0.3701 0.4144 0.2828 -0.0174 0.0047  0.0694  262 TYR A CD1 
2186 C CD2 . TYR A 280 ? 0.3651 0.4019 0.3023 -0.0027 0.0108  0.0664  262 TYR A CD2 
2187 C CE1 . TYR A 280 ? 0.3816 0.4411 0.3047 -0.0093 0.0027  0.0878  262 TYR A CE1 
2188 C CE2 . TYR A 280 ? 0.3429 0.3916 0.2890 0.0059  0.0105  0.0832  262 TYR A CE2 
2189 C CZ  . TYR A 280 ? 0.3393 0.3998 0.2800 0.0033  0.0065  0.0944  262 TYR A CZ  
2190 O OH  . TYR A 280 ? 0.4177 0.4914 0.3709 0.0147  0.0077  0.1139  262 TYR A OH  
2191 N N   . LEU A 281 ? 0.3321 0.3217 0.2602 -0.0031 0.0265  0.0384  263 LEU A N   
2192 C CA  . LEU A 281 ? 0.3286 0.3059 0.2612 0.0042  0.0316  0.0411  263 LEU A CA  
2193 C C   . LEU A 281 ? 0.3389 0.3026 0.2652 0.0013  0.0362  0.0388  263 LEU A C   
2194 O O   . LEU A 281 ? 0.3585 0.3094 0.2838 0.0051  0.0404  0.0434  263 LEU A O   
2195 C CB  . LEU A 281 ? 0.3170 0.2902 0.2564 0.0071  0.0334  0.0348  263 LEU A CB  
2196 C CG  . LEU A 281 ? 0.3057 0.2916 0.2538 0.0118  0.0305  0.0393  263 LEU A CG  
2197 C CD1 . LEU A 281 ? 0.2790 0.2592 0.2313 0.0137  0.0332  0.0320  263 LEU A CD1 
2198 C CD2 . LEU A 281 ? 0.3028 0.2925 0.2550 0.0207  0.0321  0.0528  263 LEU A CD2 
2199 N N   . PHE A 282 ? 0.3195 0.2851 0.2413 -0.0055 0.0364  0.0327  264 PHE A N   
2200 C CA  . PHE A 282 ? 0.3230 0.2806 0.2410 -0.0093 0.0406  0.0320  264 PHE A CA  
2201 C C   . PHE A 282 ? 0.3437 0.3053 0.2528 -0.0122 0.0409  0.0371  264 PHE A C   
2202 O O   . PHE A 282 ? 0.3556 0.3132 0.2617 -0.0157 0.0448  0.0377  264 PHE A O   
2203 C CB  . PHE A 282 ? 0.3120 0.2712 0.2339 -0.0132 0.0426  0.0242  264 PHE A CB  
2204 C CG  . PHE A 282 ? 0.3089 0.2629 0.2371 -0.0126 0.0427  0.0208  264 PHE A CG  
2205 C CD1 . PHE A 282 ? 0.3213 0.2677 0.2492 -0.0175 0.0448  0.0206  264 PHE A CD1 
2206 C CD2 . PHE A 282 ? 0.3223 0.2793 0.2551 -0.0086 0.0404  0.0181  264 PHE A CD2 
2207 C CE1 . PHE A 282 ? 0.3138 0.2552 0.2435 -0.0194 0.0443  0.0168  264 PHE A CE1 
2208 C CE2 . PHE A 282 ? 0.3161 0.2684 0.2519 -0.0086 0.0408  0.0148  264 PHE A CE2 
2209 C CZ  . PHE A 282 ? 0.3343 0.2781 0.2671 -0.0143 0.0426  0.0138  264 PHE A CZ  
2210 N N   . ASP A 283 ? 0.3553 0.3265 0.2597 -0.0118 0.0365  0.0419  265 ASP A N   
2211 C CA  . ASP A 283 ? 0.3677 0.3438 0.2603 -0.0160 0.0363  0.0463  265 ASP A CA  
2212 C C   . ASP A 283 ? 0.3841 0.3569 0.2763 -0.0125 0.0375  0.0585  265 ASP A C   
2213 O O   . ASP A 283 ? 0.3984 0.3791 0.2919 -0.0086 0.0337  0.0690  265 ASP A O   
2214 C CB  . ASP A 283 ? 0.3798 0.3682 0.2640 -0.0204 0.0302  0.0461  265 ASP A CB  
2215 C CG  . ASP A 283 ? 0.4287 0.4224 0.2965 -0.0264 0.0294  0.0505  265 ASP A CG  
2216 O OD1 . ASP A 283 ? 0.4498 0.4366 0.3107 -0.0281 0.0358  0.0484  265 ASP A OD1 
2217 O OD2 . ASP A 283 ? 0.4888 0.4957 0.3509 -0.0299 0.0222  0.0569  265 ASP A OD2 
2218 N N   . PHE A 284 ? 0.3798 0.3417 0.2717 -0.0139 0.0431  0.0584  266 PHE A N   
2219 C CA  . PHE A 284 ? 0.3999 0.3543 0.2898 -0.0121 0.0462  0.0694  266 PHE A CA  
2220 C C   . PHE A 284 ? 0.4043 0.3592 0.2872 -0.0188 0.0502  0.0679  266 PHE A C   
2221 O O   . PHE A 284 ? 0.3964 0.3536 0.2802 -0.0226 0.0522  0.0586  266 PHE A O   
2222 C CB  . PHE A 284 ? 0.4020 0.3373 0.2985 -0.0090 0.0505  0.0695  266 PHE A CB  
2223 C CG  . PHE A 284 ? 0.4054 0.3382 0.3082 -0.0008 0.0493  0.0707  266 PHE A CG  
2224 C CD1 . PHE A 284 ? 0.4223 0.3554 0.3271 0.0080  0.0502  0.0841  266 PHE A CD1 
2225 C CD2 . PHE A 284 ? 0.3658 0.2978 0.2737 -0.0010 0.0482  0.0603  266 PHE A CD2 
2226 C CE1 . PHE A 284 ? 0.4169 0.3500 0.3294 0.0171  0.0507  0.0868  266 PHE A CE1 
2227 C CE2 . PHE A 284 ? 0.3900 0.3211 0.3037 0.0070  0.0481  0.0621  266 PHE A CE2 
2228 C CZ  . PHE A 284 ? 0.3776 0.3094 0.2938 0.0162  0.0497  0.0752  266 PHE A CZ  
2229 N N   . PRO A 285 ? 0.4259 0.3791 0.3031 -0.0194 0.0526  0.0785  267 PRO A N   
2230 C CA  . PRO A 285 ? 0.4437 0.3984 0.3148 -0.0253 0.0576  0.0787  267 PRO A CA  
2231 C C   . PRO A 285 ? 0.4545 0.3980 0.3340 -0.0295 0.0625  0.0766  267 PRO A C   
2232 O O   . PRO A 285 ? 0.5058 0.4483 0.3832 -0.0340 0.0671  0.0823  267 PRO A O   
2233 C CB  . PRO A 285 ? 0.4579 0.4152 0.3208 -0.0242 0.0577  0.0928  267 PRO A CB  
2234 C CG  . PRO A 285 ? 0.4594 0.4085 0.3293 -0.0169 0.0559  0.1014  267 PRO A CG  
2235 C CD  . PRO A 285 ? 0.4439 0.3943 0.3212 -0.0134 0.0518  0.0926  267 PRO A CD  
2236 N N   . HIS A 286 ? 0.4273 0.3639 0.3152 -0.0293 0.0612  0.0693  268 HIS A N   
2237 C CA  . HIS A 286 ? 0.4309 0.3583 0.3251 -0.0361 0.0638  0.0670  268 HIS A CA  
2238 C C   . HIS A 286 ? 0.4103 0.3386 0.3116 -0.0363 0.0610  0.0570  268 HIS A C   
2239 O O   . HIS A 286 ? 0.3883 0.3214 0.2905 -0.0302 0.0577  0.0523  268 HIS A O   
2240 C CB  . HIS A 286 ? 0.4579 0.3633 0.3489 -0.0374 0.0664  0.0741  268 HIS A CB  
2241 C CG  . HIS A 286 ? 0.4695 0.3616 0.3595 -0.0288 0.0655  0.0743  268 HIS A CG  
2242 N ND1 . HIS A 286 ? 0.5126 0.3982 0.4057 -0.0279 0.0639  0.0654  268 HIS A ND1 
2243 C CD2 . HIS A 286 ? 0.5132 0.3998 0.4004 -0.0197 0.0666  0.0841  268 HIS A CD2 
2244 C CE1 . HIS A 286 ? 0.5119 0.3870 0.4037 -0.0181 0.0652  0.0690  268 HIS A CE1 
2245 N NE2 . HIS A 286 ? 0.5030 0.3799 0.3927 -0.0126 0.0668  0.0811  268 HIS A NE2 
2246 N N   . GLY A 287 ? 0.4115 0.3367 0.3178 -0.0445 0.0617  0.0547  269 GLY A N   
2247 C CA  . GLY A 287 ? 0.4043 0.3313 0.3165 -0.0464 0.0588  0.0469  269 GLY A CA  
2248 C C   . GLY A 287 ? 0.4245 0.3283 0.3305 -0.0468 0.0583  0.0445  269 GLY A C   
2249 O O   . GLY A 287 ? 0.4446 0.3360 0.3450 -0.0388 0.0599  0.0480  269 GLY A O   
2250 N N   . PRO A 288 ? 0.4230 0.3204 0.3288 -0.0567 0.0570  0.0401  270 PRO A N   
2251 C CA  . PRO A 288 ? 0.4451 0.3159 0.3402 -0.0587 0.0583  0.0357  270 PRO A CA  
2252 C C   . PRO A 288 ? 0.4804 0.3242 0.3648 -0.0564 0.0644  0.0413  270 PRO A C   
2253 O O   . PRO A 288 ? 0.5048 0.3286 0.3822 -0.0477 0.0682  0.0402  270 PRO A O   
2254 C CB  . PRO A 288 ? 0.4567 0.3274 0.3502 -0.0758 0.0556  0.0323  270 PRO A CB  
2255 C CG  . PRO A 288 ? 0.4486 0.3512 0.3567 -0.0772 0.0517  0.0335  270 PRO A CG  
2256 C CD  . PRO A 288 ? 0.4049 0.3208 0.3193 -0.0674 0.0548  0.0399  270 PRO A CD  
2257 N N   . LYS A 289 ? 0.4842 0.3262 0.3675 -0.0637 0.0665  0.0483  271 LYS A N   
2258 C CA  . LYS A 289 ? 0.5066 0.3231 0.3807 -0.0608 0.0731  0.0560  271 LYS A CA  
2259 C C   . LYS A 289 ? 0.4852 0.3181 0.3646 -0.0569 0.0737  0.0666  271 LYS A C   
2260 O O   . LYS A 289 ? 0.4375 0.2965 0.3249 -0.0607 0.0705  0.0669  271 LYS A O   
2261 C CB  . LYS A 289 ? 0.5537 0.3405 0.4152 -0.0764 0.0769  0.0543  271 LYS A CB  
2262 C CG  . LYS A 289 ? 0.5782 0.3815 0.4443 -0.0949 0.0714  0.0517  271 LYS A CG  
2263 C CD  . LYS A 289 ? 0.6194 0.3943 0.4714 -0.1148 0.0738  0.0506  271 LYS A CD  
2264 C CE  . LYS A 289 ? 0.6206 0.4241 0.4839 -0.1326 0.0683  0.0559  271 LYS A CE  
2265 N NZ  . LYS A 289 ? 0.5887 0.3706 0.4392 -0.1575 0.0681  0.0554  271 LYS A NZ  
2266 N N   . PRO A 290 ? 0.4934 0.3113 0.3677 -0.0483 0.0789  0.0761  272 PRO A N   
2267 C CA  . PRO A 290 ? 0.4830 0.3128 0.3587 -0.0463 0.0800  0.0876  272 PRO A CA  
2268 C C   . PRO A 290 ? 0.4739 0.3088 0.3507 -0.0613 0.0807  0.0895  272 PRO A C   
2269 O O   . PRO A 290 ? 0.4636 0.2795 0.3359 -0.0743 0.0825  0.0866  272 PRO A O   
2270 C CB  . PRO A 290 ? 0.5185 0.3226 0.3875 -0.0374 0.0871  0.0984  272 PRO A CB  
2271 C CG  . PRO A 290 ? 0.5182 0.3080 0.3858 -0.0282 0.0888  0.0931  272 PRO A CG  
2272 C CD  . PRO A 290 ? 0.5275 0.3170 0.3945 -0.0382 0.0850  0.0780  272 PRO A CD  
2273 N N   . GLY A 291 ? 0.4389 0.2999 0.3203 -0.0605 0.0794  0.0942  273 GLY A N   
2274 C CA  . GLY A 291 ? 0.4484 0.3207 0.3336 -0.0725 0.0810  0.0980  273 GLY A CA  
2275 C C   . GLY A 291 ? 0.4222 0.3181 0.3177 -0.0782 0.0776  0.0905  273 GLY A C   
2276 O O   . GLY A 291 ? 0.4230 0.3375 0.3247 -0.0840 0.0798  0.0954  273 GLY A O   
2277 N N   . SER A 292 ? 0.3983 0.2947 0.2964 -0.0753 0.0733  0.0802  274 SER A N   
2278 C CA  . SER A 292 ? 0.3780 0.2971 0.2871 -0.0792 0.0705  0.0747  274 SER A CA  
2279 C C   . SER A 292 ? 0.3646 0.3043 0.2772 -0.0674 0.0711  0.0723  274 SER A C   
2280 O O   . SER A 292 ? 0.3697 0.3049 0.2752 -0.0573 0.0704  0.0709  274 SER A O   
2281 C CB  . SER A 292 ? 0.3869 0.2965 0.2959 -0.0837 0.0659  0.0658  274 SER A CB  
2282 O OG  . SER A 292 ? 0.3642 0.2677 0.2698 -0.0714 0.0641  0.0592  274 SER A OG  
2283 N N   . SER A 293 ? 0.3396 0.3018 0.2625 -0.0692 0.0731  0.0730  275 SER A N   
2284 C CA  . SER A 293 ? 0.3347 0.3107 0.2581 -0.0586 0.0757  0.0691  275 SER A CA  
2285 C C   . SER A 293 ? 0.3327 0.3033 0.2547 -0.0517 0.0708  0.0595  275 SER A C   
2286 O O   . SER A 293 ? 0.3168 0.2846 0.2445 -0.0549 0.0664  0.0552  275 SER A O   
2287 C CB  . SER A 293 ? 0.3099 0.3090 0.2464 -0.0597 0.0810  0.0725  275 SER A CB  
2288 O OG  . SER A 293 ? 0.3275 0.3346 0.2648 -0.0635 0.0873  0.0822  275 SER A OG  
2289 N N   . HIS A 294 ? 0.3426 0.3125 0.2558 -0.0434 0.0713  0.0563  276 HIS A N   
2290 C CA  . HIS A 294 ? 0.3300 0.2985 0.2432 -0.0376 0.0673  0.0480  276 HIS A CA  
2291 C C   . HIS A 294 ? 0.3289 0.3097 0.2531 -0.0366 0.0696  0.0441  276 HIS A C   
2292 O O   . HIS A 294 ? 0.3256 0.3179 0.2537 -0.0360 0.0767  0.0472  276 HIS A O   
2293 C CB  . HIS A 294 ? 0.3484 0.3167 0.2491 -0.0323 0.0672  0.0461  276 HIS A CB  
2294 C CG  . HIS A 294 ? 0.3340 0.3014 0.2345 -0.0281 0.0627  0.0387  276 HIS A CG  
2295 N ND1 . HIS A 294 ? 0.3590 0.3314 0.2611 -0.0259 0.0657  0.0321  276 HIS A ND1 
2296 C CD2 . HIS A 294 ? 0.3447 0.3072 0.2446 -0.0254 0.0564  0.0380  276 HIS A CD2 
2297 C CE1 . HIS A 294 ? 0.3766 0.3467 0.2782 -0.0236 0.0605  0.0271  276 HIS A CE1 
2298 N NE2 . HIS A 294 ? 0.3607 0.3266 0.2620 -0.0231 0.0546  0.0309  276 HIS A NE2 
2299 N N   . ARG A 295 ? 0.3271 0.3060 0.2566 -0.0353 0.0648  0.0386  277 ARG A N   
2300 C CA  . ARG A 295 ? 0.3427 0.3333 0.2835 -0.0332 0.0663  0.0362  277 ARG A CA  
2301 C C   . ARG A 295 ? 0.3294 0.3151 0.2668 -0.0268 0.0638  0.0286  277 ARG A C   
2302 O O   . ARG A 295 ? 0.3143 0.2901 0.2456 -0.0260 0.0582  0.0260  277 ARG A O   
2303 C CB  . ARG A 295 ? 0.3385 0.3323 0.2887 -0.0402 0.0613  0.0373  277 ARG A CB  
2304 C CG  . ARG A 295 ? 0.3862 0.3828 0.3392 -0.0507 0.0610  0.0441  277 ARG A CG  
2305 C CD  . ARG A 295 ? 0.4241 0.4320 0.3875 -0.0583 0.0566  0.0452  277 ARG A CD  
2306 N NE  . ARG A 295 ? 0.4991 0.4904 0.4536 -0.0676 0.0506  0.0415  277 ARG A NE  
2307 C CZ  . ARG A 295 ? 0.5172 0.5047 0.4699 -0.0696 0.0457  0.0359  277 ARG A CZ  
2308 N NH1 . ARG A 295 ? 0.4627 0.4633 0.4239 -0.0624 0.0448  0.0339  277 ARG A NH1 
2309 N NH2 . ARG A 295 ? 0.5044 0.4717 0.4444 -0.0791 0.0428  0.0323  277 ARG A NH2 
2310 N N   . PRO A 296 ? 0.3271 0.3195 0.2694 -0.0221 0.0685  0.0264  278 PRO A N   
2311 C CA  . PRO A 296 ? 0.3294 0.3161 0.2685 -0.0179 0.0661  0.0196  278 PRO A CA  
2312 C C   . PRO A 296 ? 0.2941 0.2802 0.2398 -0.0188 0.0586  0.0179  278 PRO A C   
2313 O O   . PRO A 296 ? 0.2868 0.2796 0.2415 -0.0223 0.0570  0.0208  278 PRO A O   
2314 C CB  . PRO A 296 ? 0.3254 0.3176 0.2706 -0.0126 0.0746  0.0193  278 PRO A CB  
2315 C CG  . PRO A 296 ? 0.3676 0.3673 0.3156 -0.0124 0.0825  0.0253  278 PRO A CG  
2316 C CD  . PRO A 296 ? 0.3540 0.3589 0.3056 -0.0195 0.0774  0.0311  278 PRO A CD  
2317 N N   . TRP A 297 ? 0.3041 0.2836 0.2446 -0.0165 0.0543  0.0136  279 TRP A N   
2318 C CA  . TRP A 297 ? 0.2879 0.2664 0.2336 -0.0160 0.0490  0.0120  279 TRP A CA  
2319 C C   . TRP A 297 ? 0.2652 0.2530 0.2224 -0.0159 0.0497  0.0123  279 TRP A C   
2320 O O   . TRP A 297 ? 0.2497 0.2380 0.2096 -0.0190 0.0460  0.0125  279 TRP A O   
2321 C CB  . TRP A 297 ? 0.2917 0.2665 0.2330 -0.0128 0.0454  0.0093  279 TRP A CB  
2322 C CG  . TRP A 297 ? 0.2666 0.2435 0.2087 -0.0111 0.0470  0.0055  279 TRP A CG  
2323 C CD1 . TRP A 297 ? 0.2898 0.2632 0.2222 -0.0124 0.0492  0.0031  279 TRP A CD1 
2324 C CD2 . TRP A 297 ? 0.2857 0.2660 0.2365 -0.0087 0.0468  0.0037  279 TRP A CD2 
2325 N NE1 . TRP A 297 ? 0.2988 0.2702 0.2327 -0.0115 0.0512  -0.0009 279 TRP A NE1 
2326 C CE2 . TRP A 297 ? 0.2831 0.2598 0.2297 -0.0084 0.0496  0.0003  279 TRP A CE2 
2327 C CE3 . TRP A 297 ? 0.2855 0.2705 0.2453 -0.0077 0.0447  0.0047  279 TRP A CE3 
2328 C CZ2 . TRP A 297 ? 0.2972 0.2746 0.2506 -0.0062 0.0510  -0.0011 279 TRP A CZ2 
2329 C CZ3 . TRP A 297 ? 0.2509 0.2398 0.2176 -0.0051 0.0453  0.0039  279 TRP A CZ3 
2330 C CH2 . TRP A 297 ? 0.2689 0.2539 0.2335 -0.0039 0.0488  0.0015  279 TRP A CH2 
2331 N N   . GLN A 298 ? 0.2611 0.2556 0.2239 -0.0126 0.0553  0.0130  280 GLN A N   
2332 C CA  . GLN A 298 ? 0.2633 0.2692 0.2388 -0.0109 0.0562  0.0157  280 GLN A CA  
2333 C C   . GLN A 298 ? 0.2681 0.2875 0.2522 -0.0170 0.0545  0.0225  280 GLN A C   
2334 O O   . GLN A 298 ? 0.2611 0.2915 0.2534 -0.0194 0.0511  0.0254  280 GLN A O   
2335 C CB  . GLN A 298 ? 0.2822 0.2897 0.2619 -0.0042 0.0650  0.0167  280 GLN A CB  
2336 C CG  . GLN A 298 ? 0.2785 0.2720 0.2484 -0.0016 0.0662  0.0097  280 GLN A CG  
2337 C CD  . GLN A 298 ? 0.3319 0.3134 0.2861 -0.0027 0.0705  0.0057  280 GLN A CD  
2338 O OE1 . GLN A 298 ? 0.3281 0.3101 0.2768 -0.0058 0.0694  0.0072  280 GLN A OE1 
2339 N NE2 . GLN A 298 ? 0.3508 0.3202 0.2957 -0.0017 0.0750  0.0003  280 GLN A NE2 
2340 N N   . SER A 299 ? 0.2747 0.2940 0.2558 -0.0213 0.0561  0.0253  281 SER A N   
2341 C CA  . SER A 299 ? 0.2761 0.3088 0.2645 -0.0299 0.0542  0.0325  281 SER A CA  
2342 C C   . SER A 299 ? 0.2686 0.2945 0.2503 -0.0397 0.0457  0.0295  281 SER A C   
2343 O O   . SER A 299 ? 0.2717 0.3087 0.2576 -0.0499 0.0421  0.0344  281 SER A O   
2344 C CB  . SER A 299 ? 0.2804 0.3124 0.2658 -0.0327 0.0584  0.0363  281 SER A CB  
2345 O OG  . SER A 299 ? 0.3155 0.3287 0.2866 -0.0363 0.0551  0.0317  281 SER A OG  
2346 N N   . TYR A 300 ? 0.2683 0.2755 0.2384 -0.0370 0.0433  0.0220  282 TYR A N   
2347 C CA  . TYR A 300 ? 0.2879 0.2821 0.2477 -0.0438 0.0386  0.0179  282 TYR A CA  
2348 C C   . TYR A 300 ? 0.2914 0.2934 0.2543 -0.0446 0.0350  0.0164  282 TYR A C   
2349 O O   . TYR A 300 ? 0.3026 0.2943 0.2547 -0.0515 0.0318  0.0126  282 TYR A O   
2350 C CB  . TYR A 300 ? 0.2961 0.2683 0.2439 -0.0380 0.0397  0.0131  282 TYR A CB  
2351 C CG  . TYR A 300 ? 0.2958 0.2590 0.2380 -0.0398 0.0423  0.0159  282 TYR A CG  
2352 C CD1 . TYR A 300 ? 0.3232 0.2704 0.2554 -0.0481 0.0424  0.0161  282 TYR A CD1 
2353 C CD2 . TYR A 300 ? 0.2842 0.2533 0.2291 -0.0341 0.0454  0.0184  282 TYR A CD2 
2354 C CE1 . TYR A 300 ? 0.3316 0.2706 0.2593 -0.0495 0.0452  0.0203  282 TYR A CE1 
2355 C CE2 . TYR A 300 ? 0.3082 0.2712 0.2475 -0.0358 0.0478  0.0221  282 TYR A CE2 
2356 C CZ  . TYR A 300 ? 0.3085 0.2573 0.2406 -0.0429 0.0476  0.0238  282 TYR A CZ  
2357 O OH  . TYR A 300 ? 0.3626 0.3051 0.2897 -0.0442 0.0504  0.0288  282 TYR A OH  
2358 N N   . PHE A 301 ? 0.2828 0.3015 0.2588 -0.0377 0.0365  0.0198  283 PHE A N   
2359 C CA  . PHE A 301 ? 0.2685 0.2954 0.2481 -0.0367 0.0336  0.0196  283 PHE A CA  
2360 C C   . PHE A 301 ? 0.2596 0.3133 0.2551 -0.0388 0.0331  0.0295  283 PHE A C   
2361 O O   . PHE A 301 ? 0.2572 0.3224 0.2653 -0.0324 0.0388  0.0358  283 PHE A O   
2362 C CB  . PHE A 301 ? 0.2642 0.2847 0.2451 -0.0252 0.0362  0.0158  283 PHE A CB  
2363 C CG  . PHE A 301 ? 0.2488 0.2495 0.2176 -0.0225 0.0360  0.0094  283 PHE A CG  
2364 C CD1 . PHE A 301 ? 0.2799 0.2715 0.2403 -0.0230 0.0340  0.0056  283 PHE A CD1 
2365 C CD2 . PHE A 301 ? 0.2825 0.2746 0.2475 -0.0194 0.0385  0.0085  283 PHE A CD2 
2366 C CE1 . PHE A 301 ? 0.2901 0.2649 0.2413 -0.0186 0.0355  0.0023  283 PHE A CE1 
2367 C CE2 . PHE A 301 ? 0.2761 0.2540 0.2323 -0.0163 0.0382  0.0058  283 PHE A CE2 
2368 C CZ  . PHE A 301 ? 0.2869 0.2567 0.2376 -0.0151 0.0372  0.0035  283 PHE A CZ  
2369 N N   . ASP A 302 ? 0.2581 0.3217 0.2522 -0.0468 0.0272  0.0314  284 ASP A N   
2370 C CA  . ASP A 302 ? 0.2616 0.3549 0.2720 -0.0484 0.0254  0.0431  284 ASP A CA  
2371 C C   . ASP A 302 ? 0.2512 0.3499 0.2719 -0.0352 0.0294  0.0455  284 ASP A C   
2372 O O   . ASP A 302 ? 0.2680 0.3893 0.3064 -0.0304 0.0322  0.0572  284 ASP A O   
2373 C CB  . ASP A 302 ? 0.2776 0.3791 0.2787 -0.0646 0.0164  0.0441  284 ASP A CB  
2374 C CG  . ASP A 302 ? 0.3315 0.4286 0.3232 -0.0804 0.0128  0.0434  284 ASP A CG  
2375 O OD1 . ASP A 302 ? 0.3391 0.4585 0.3459 -0.0839 0.0130  0.0543  284 ASP A OD1 
2376 O OD2 . ASP A 302 ? 0.3304 0.4000 0.3003 -0.0880 0.0113  0.0325  284 ASP A OD2 
2377 N N   . LEU A 303 ? 0.2495 0.3282 0.2602 -0.0294 0.0302  0.0360  285 LEU A N   
2378 C CA  . LEU A 303 ? 0.2363 0.3168 0.2551 -0.0185 0.0339  0.0375  285 LEU A CA  
2379 C C   . LEU A 303 ? 0.2264 0.2835 0.2358 -0.0123 0.0365  0.0275  285 LEU A C   
2380 O O   . LEU A 303 ? 0.2365 0.2797 0.2327 -0.0158 0.0335  0.0203  285 LEU A O   
2381 C CB  . LEU A 303 ? 0.2328 0.3257 0.2512 -0.0225 0.0284  0.0410  285 LEU A CB  
2382 C CG  . LEU A 303 ? 0.2513 0.3501 0.2799 -0.0126 0.0317  0.0457  285 LEU A CG  
2383 C CD1 . LEU A 303 ? 0.2795 0.4022 0.3122 -0.0184 0.0259  0.0551  285 LEU A CD1 
2384 C CD2 . LEU A 303 ? 0.2568 0.3351 0.2748 -0.0086 0.0324  0.0357  285 LEU A CD2 
2385 N N   . ILE A 304 ? 0.2296 0.2822 0.2453 -0.0035 0.0429  0.0279  286 ILE A N   
2386 C CA  . ILE A 304 ? 0.2379 0.2727 0.2459 0.0003  0.0444  0.0202  286 ILE A CA  
2387 C C   . ILE A 304 ? 0.2428 0.2785 0.2577 0.0061  0.0472  0.0223  286 ILE A C   
2388 O O   . ILE A 304 ? 0.2546 0.2957 0.2798 0.0113  0.0535  0.0286  286 ILE A O   
2389 C CB  . ILE A 304 ? 0.2425 0.2669 0.2467 0.0021  0.0496  0.0174  286 ILE A CB  
2390 C CG1 . ILE A 304 ? 0.2450 0.2693 0.2437 -0.0034 0.0478  0.0171  286 ILE A CG1 
2391 C CG2 . ILE A 304 ? 0.2491 0.2586 0.2445 0.0033  0.0492  0.0107  286 ILE A CG2 
2392 C CD1 . ILE A 304 ? 0.2375 0.2552 0.2328 -0.0016 0.0539  0.0163  286 ILE A CD1 
2393 N N   . LEU A 305 ? 0.2487 0.2795 0.2588 0.0058  0.0436  0.0186  287 LEU A N   
2394 C CA  . LEU A 305 ? 0.2362 0.2680 0.2524 0.0098  0.0454  0.0210  287 LEU A CA  
2395 C C   . LEU A 305 ? 0.2329 0.2529 0.2425 0.0093  0.0440  0.0152  287 LEU A C   
2396 O O   . LEU A 305 ? 0.2201 0.2385 0.2234 0.0078  0.0400  0.0123  287 LEU A O   
2397 C CB  . LEU A 305 ? 0.2513 0.2966 0.2709 0.0092  0.0420  0.0259  287 LEU A CB  
2398 C CG  . LEU A 305 ? 0.2662 0.3163 0.2938 0.0134  0.0441  0.0311  287 LEU A CG  
2399 C CD1 . LEU A 305 ? 0.2736 0.3439 0.3088 0.0133  0.0424  0.0410  287 LEU A CD1 
2400 C CD2 . LEU A 305 ? 0.2600 0.3037 0.2816 0.0130  0.0416  0.0265  287 LEU A CD2 
2401 N N   . VAL A 306 ? 0.2312 0.2433 0.2425 0.0103  0.0482  0.0147  288 VAL A N   
2402 C CA  . VAL A 306 ? 0.2326 0.2367 0.2386 0.0070  0.0462  0.0109  288 VAL A CA  
2403 C C   . VAL A 306 ? 0.2318 0.2372 0.2449 0.0080  0.0477  0.0145  288 VAL A C   
2404 O O   . VAL A 306 ? 0.2330 0.2439 0.2543 0.0122  0.0511  0.0199  288 VAL A O   
2405 C CB  . VAL A 306 ? 0.2378 0.2282 0.2345 0.0033  0.0492  0.0060  288 VAL A CB  
2406 C CG1 . VAL A 306 ? 0.2371 0.2278 0.2270 0.0024  0.0474  0.0036  288 VAL A CG1 
2407 C CG2 . VAL A 306 ? 0.2253 0.2052 0.2235 0.0062  0.0589  0.0068  288 VAL A CG2 
2408 N N   . ASP A 307 ? 0.2376 0.2408 0.2485 0.0036  0.0446  0.0133  289 ASP A N   
2409 C CA  . ASP A 307 ? 0.2348 0.2398 0.2524 0.0028  0.0455  0.0172  289 ASP A CA  
2410 C C   . ASP A 307 ? 0.2384 0.2573 0.2643 0.0088  0.0451  0.0232  289 ASP A C   
2411 O O   . ASP A 307 ? 0.2424 0.2627 0.2755 0.0113  0.0489  0.0284  289 ASP A O   
2412 C CB  . ASP A 307 ? 0.2328 0.2218 0.2495 0.0012  0.0530  0.0168  289 ASP A CB  
2413 C CG  . ASP A 307 ? 0.2913 0.2620 0.2941 -0.0055 0.0553  0.0092  289 ASP A CG  
2414 O OD1 . ASP A 307 ? 0.3186 0.2891 0.3138 -0.0143 0.0491  0.0060  289 ASP A OD1 
2415 O OD2 . ASP A 307 ? 0.3110 0.2687 0.3099 -0.0019 0.0638  0.0075  289 ASP A OD2 
2416 N N   . ALA A 308 ? 0.2896 0.2460 0.2325 -0.0301 -0.0112 0.0117  290 ALA A N   
2417 C CA  . ALA A 308 ? 0.2687 0.2121 0.2083 -0.0268 -0.0064 0.0166  290 ALA A CA  
2418 C C   . ALA A 308 ? 0.2721 0.2171 0.2208 -0.0268 0.0036  0.0144  290 ALA A C   
2419 O O   . ALA A 308 ? 0.2834 0.2120 0.2200 -0.0229 0.0100  0.0180  290 ALA A O   
2420 C CB  . ALA A 308 ? 0.2623 0.1977 0.1935 -0.0195 -0.0121 0.0213  290 ALA A CB  
2421 N N   . ARG A 309 ? 0.2671 0.2320 0.2372 -0.0305 0.0053  0.0082  291 ARG A N   
2422 C CA  . ARG A 309 ? 0.2894 0.2598 0.2780 -0.0323 0.0206  0.0063  291 ARG A CA  
2423 C C   . ARG A 309 ? 0.2944 0.2528 0.2691 -0.0194 0.0268  0.0130  291 ARG A C   
2424 O O   . ARG A 309 ? 0.3041 0.2450 0.2677 -0.0167 0.0432  0.0171  291 ARG A O   
2425 C CB  . ARG A 309 ? 0.3246 0.2773 0.3116 -0.0413 0.0369  0.0065  291 ARG A CB  
2426 C CG  . ARG A 309 ? 0.3667 0.3239 0.3655 -0.0543 0.0343  -0.0028 291 ARG A CG  
2427 C CD  . ARG A 309 ? 0.4794 0.4580 0.5175 -0.0680 0.0413  -0.0152 291 ARG A CD  
2428 N NE  . ARG A 309 ? 0.5300 0.4987 0.5824 -0.0720 0.0677  -0.0109 291 ARG A NE  
2429 C CZ  . ARG A 309 ? 0.5646 0.5054 0.6157 -0.0816 0.0905  -0.0092 291 ARG A CZ  
2430 N NH1 . ARG A 309 ? 0.5965 0.5161 0.6352 -0.0885 0.0896  -0.0131 291 ARG A NH1 
2431 N NH2 . ARG A 309 ? 0.6051 0.5349 0.6655 -0.0829 0.1180  -0.0026 291 ARG A NH2 
2432 N N   . LYS A 310 ? 0.2765 0.2384 0.2455 -0.0098 0.0150  0.0143  292 LYS A N   
2433 C CA  . LYS A 310 ? 0.3017 0.2527 0.2597 0.0034  0.0209  0.0171  292 LYS A CA  
2434 C C   . LYS A 310 ? 0.2982 0.2730 0.2873 0.0057  0.0355  0.0142  292 LYS A C   
2435 O O   . LYS A 310 ? 0.2806 0.2880 0.3032 0.0013  0.0287  0.0083  292 LYS A O   
2436 C CB  . LYS A 310 ? 0.2963 0.2422 0.2442 0.0128  0.0070  0.0187  292 LYS A CB  
2437 C CG  . LYS A 310 ? 0.3333 0.2557 0.2583 0.0084  -0.0028 0.0208  292 LYS A CG  
2438 C CD  . LYS A 310 ? 0.3427 0.2531 0.2588 0.0144  -0.0116 0.0239  292 LYS A CD  
2439 C CE  . LYS A 310 ? 0.3659 0.2924 0.2894 0.0141  -0.0185 0.0270  292 LYS A CE  
2440 N NZ  . LYS A 310 ? 0.4026 0.3486 0.3385 0.0284  -0.0214 0.0267  292 LYS A NZ  
2441 N N   . PRO A 311 ? 0.3103 0.2708 0.2892 0.0139  0.0552  0.0172  293 PRO A N   
2442 C CA  . PRO A 311 ? 0.3412 0.2626 0.2732 0.0240  0.0587  0.0214  293 PRO A CA  
2443 C C   . PRO A 311 ? 0.3546 0.2503 0.2590 0.0207  0.0675  0.0257  293 PRO A C   
2444 O O   . PRO A 311 ? 0.3843 0.2502 0.2466 0.0318  0.0634  0.0268  293 PRO A O   
2445 C CB  . PRO A 311 ? 0.3550 0.2736 0.2855 0.0392  0.0780  0.0221  293 PRO A CB  
2446 C CG  . PRO A 311 ? 0.3542 0.3048 0.3314 0.0310  0.0970  0.0213  293 PRO A CG  
2447 C CD  . PRO A 311 ? 0.3305 0.3153 0.3454 0.0163  0.0760  0.0152  293 PRO A CD  
2448 N N   . LEU A 312 ? 0.3522 0.2563 0.2771 0.0078  0.0785  0.0269  294 LEU A N   
2449 C CA  . LEU A 312 ? 0.3784 0.2530 0.2739 0.0076  0.0868  0.0331  294 LEU A CA  
2450 C C   . LEU A 312 ? 0.3782 0.2392 0.2445 0.0129  0.0616  0.0325  294 LEU A C   
2451 O O   . LEU A 312 ? 0.3990 0.2327 0.2268 0.0246  0.0613  0.0368  294 LEU A O   
2452 C CB  . LEU A 312 ? 0.3716 0.2555 0.2978 -0.0098 0.0984  0.0319  294 LEU A CB  
2453 C CG  . LEU A 312 ? 0.4010 0.2534 0.3016 -0.0100 0.1064  0.0385  294 LEU A CG  
2454 C CD1 . LEU A 312 ? 0.4296 0.2429 0.2881 0.0052  0.1311  0.0504  294 LEU A CD1 
2455 C CD2 . LEU A 312 ? 0.3907 0.2515 0.3265 -0.0302 0.1153  0.0328  294 LEU A CD2 
2456 N N   . PHE A 313 ? 0.3482 0.2294 0.2343 0.0054  0.0417  0.0271  295 PHE A N   
2457 C CA  . PHE A 313 ? 0.3411 0.2172 0.2142 0.0073  0.0201  0.0247  295 PHE A CA  
2458 C C   . PHE A 313 ? 0.3761 0.2293 0.2142 0.0211  0.0119  0.0225  295 PHE A C   
2459 O O   . PHE A 313 ? 0.3734 0.2195 0.1978 0.0248  -0.0019 0.0203  295 PHE A O   
2460 C CB  . PHE A 313 ? 0.3309 0.2251 0.2257 0.0005  0.0086  0.0215  295 PHE A CB  
2461 C CG  . PHE A 313 ? 0.3080 0.1998 0.2015 -0.0031 -0.0069 0.0196  295 PHE A CG  
2462 C CD1 . PHE A 313 ? 0.3029 0.2020 0.2057 -0.0100 -0.0097 0.0204  295 PHE A CD1 
2463 C CD2 . PHE A 313 ? 0.3610 0.2417 0.2467 -0.0002 -0.0162 0.0160  295 PHE A CD2 
2464 C CE1 . PHE A 313 ? 0.2972 0.1987 0.2077 -0.0142 -0.0202 0.0184  295 PHE A CE1 
2465 C CE2 . PHE A 313 ? 0.3378 0.2170 0.2310 -0.0071 -0.0274 0.0129  295 PHE A CE2 
2466 C CZ  . PHE A 313 ? 0.3334 0.2262 0.2420 -0.0143 -0.0287 0.0145  295 PHE A CZ  
2467 N N   . PHE A 314 ? 0.4066 0.2495 0.2308 0.0302  0.0194  0.0212  296 PHE A N   
2468 C CA  . PHE A 314 ? 0.4472 0.2641 0.2318 0.0444  0.0109  0.0155  296 PHE A CA  
2469 C C   . PHE A 314 ? 0.4966 0.2872 0.2374 0.0605  0.0231  0.0205  296 PHE A C   
2470 O O   . PHE A 314 ? 0.5420 0.3077 0.2393 0.0758  0.0132  0.0143  296 PHE A O   
2471 C CB  . PHE A 314 ? 0.4594 0.2708 0.2430 0.0499  0.0144  0.0110  296 PHE A CB  
2472 C CG  . PHE A 314 ? 0.4019 0.2270 0.2148 0.0393  0.0018  0.0079  296 PHE A CG  
2473 C CD1 . PHE A 314 ? 0.4127 0.2290 0.2236 0.0328  -0.0183 0.0001  296 PHE A CD1 
2474 C CD2 . PHE A 314 ? 0.3909 0.2367 0.2334 0.0369  0.0102  0.0125  296 PHE A CD2 
2475 C CE1 . PHE A 314 ? 0.3975 0.2184 0.2308 0.0233  -0.0240 0.0002  296 PHE A CE1 
2476 C CE2 . PHE A 314 ? 0.3833 0.2340 0.2419 0.0314  -0.0006 0.0124  296 PHE A CE2 
2477 C CZ  . PHE A 314 ? 0.3942 0.2285 0.2456 0.0242  -0.0148 0.0078  296 PHE A CZ  
2478 N N   . GLY A 315 ? 0.5019 0.2934 0.2496 0.0577  0.0444  0.0310  297 GLY A N   
2479 C CA  . GLY A 315 ? 0.5612 0.3204 0.2624 0.0738  0.0579  0.0399  297 GLY A CA  
2480 C C   . GLY A 315 ? 0.5561 0.3165 0.2604 0.0718  0.0482  0.0440  297 GLY A C   
2481 O O   . GLY A 315 ? 0.5539 0.3282 0.2666 0.0707  0.0200  0.0364  297 GLY A O   
2482 N N   . GLU A 316 ? 0.5771 0.3231 0.2798 0.0703  0.0739  0.0556  298 GLU A N   
2483 C CA  . GLU A 316 ? 0.5902 0.3300 0.2930 0.0712  0.0705  0.0611  298 GLU A CA  
2484 C C   . GLU A 316 ? 0.5182 0.2945 0.2741 0.0509  0.0545  0.0529  298 GLU A C   
2485 O O   . GLU A 316 ? 0.5037 0.2828 0.2620 0.0545  0.0421  0.0531  298 GLU A O   
2486 C CB  . GLU A 316 ? 0.6409 0.3475 0.3301 0.0717  0.1090  0.0756  298 GLU A CB  
2487 C CG  . GLU A 316 ? 0.6649 0.3904 0.4051 0.0466  0.1352  0.0731  298 GLU A CG  
2488 C CD  . GLU A 316 ? 0.7265 0.4194 0.4596 0.0439  0.1806  0.0853  298 GLU A CD  
2489 O OE1 . GLU A 316 ? 0.8342 0.5084 0.5761 0.0348  0.1967  0.0903  298 GLU A OE1 
2490 O OE2 . GLU A 316 ? 0.7883 0.4754 0.5137 0.0483  0.2029  0.0888  298 GLU A OE2 
2491 N N   . GLY A 317 ? 0.4654 0.2688 0.2604 0.0329  0.0551  0.0461  299 GLY A N   
2492 C CA  . GLY A 317 ? 0.4251 0.2565 0.2602 0.0159  0.0449  0.0398  299 GLY A CA  
2493 C C   . GLY A 317 ? 0.4263 0.2497 0.2729 0.0075  0.0608  0.0427  299 GLY A C   
2494 O O   . GLY A 317 ? 0.4459 0.2461 0.2828 0.0078  0.0850  0.0491  299 GLY A O   
2495 N N   . THR A 318 ? 0.4031 0.2418 0.2690 -0.0002 0.0496  0.0377  300 THR A N   
2496 C CA  . THR A 318 ? 0.4208 0.2474 0.2929 -0.0062 0.0617  0.0378  300 THR A CA  
2497 C C   . THR A 318 ? 0.4130 0.2416 0.2801 0.0038  0.0482  0.0384  300 THR A C   
2498 O O   . THR A 318 ? 0.3953 0.2406 0.2634 0.0110  0.0295  0.0371  300 THR A O   
2499 C CB  . THR A 318 ? 0.4036 0.2499 0.3094 -0.0275 0.0646  0.0267  300 THR A CB  
2500 O OG1 . THR A 318 ? 0.4002 0.2744 0.3181 -0.0304 0.0447  0.0210  300 THR A OG1 
2501 C CG2 . THR A 318 ? 0.4142 0.2673 0.3378 -0.0373 0.0781  0.0243  300 THR A CG2 
2502 N N   . VAL A 319 ? 0.4333 0.2447 0.2989 0.0040  0.0594  0.0392  301 VAL A N   
2503 C CA  . VAL A 319 ? 0.4376 0.2536 0.3040 0.0156  0.0502  0.0396  301 VAL A CA  
2504 C C   . VAL A 319 ? 0.3856 0.2371 0.2782 0.0063  0.0355  0.0317  301 VAL A C   
2505 O O   . VAL A 319 ? 0.3682 0.2309 0.2733 -0.0097 0.0368  0.0250  301 VAL A O   
2506 C CB  . VAL A 319 ? 0.4749 0.2604 0.3342 0.0163  0.0692  0.0405  301 VAL A CB  
2507 C CG1 . VAL A 319 ? 0.5039 0.3013 0.3767 0.0174  0.0654  0.0347  301 VAL A CG1 
2508 C CG2 . VAL A 319 ? 0.5428 0.2890 0.3670 0.0379  0.0804  0.0542  301 VAL A CG2 
2509 N N   . LEU A 320 ? 0.3737 0.2432 0.2748 0.0171  0.0214  0.0324  302 LEU A N   
2510 C CA  . LEU A 320 ? 0.3502 0.2481 0.2771 0.0084  0.0143  0.0273  302 LEU A CA  
2511 C C   . LEU A 320 ? 0.3486 0.2445 0.2818 0.0063  0.0270  0.0246  302 LEU A C   
2512 O O   . LEU A 320 ? 0.3599 0.2462 0.2908 0.0200  0.0330  0.0268  302 LEU A O   
2513 C CB  . LEU A 320 ? 0.3385 0.2593 0.2832 0.0175  -0.0021 0.0264  302 LEU A CB  
2514 C CG  . LEU A 320 ? 0.3186 0.2656 0.2940 0.0049  -0.0048 0.0224  302 LEU A CG  
2515 C CD1 . LEU A 320 ? 0.3295 0.2734 0.2991 -0.0095 -0.0069 0.0214  302 LEU A CD1 
2516 C CD2 . LEU A 320 ? 0.3314 0.3054 0.3374 0.0125  -0.0199 0.0182  302 LEU A CD2 
2517 N N   . ARG A 321 ? 0.3339 0.2359 0.2700 -0.0075 0.0305  0.0199  303 ARG A N   
2518 C CA  . ARG A 321 ? 0.3375 0.2345 0.2705 -0.0094 0.0422  0.0150  303 ARG A CA  
2519 C C   . ARG A 321 ? 0.3231 0.2398 0.2679 -0.0124 0.0430  0.0160  303 ARG A C   
2520 O O   . ARG A 321 ? 0.2964 0.2269 0.2513 -0.0178 0.0345  0.0193  303 ARG A O   
2521 C CB  . ARG A 321 ? 0.3523 0.2343 0.2694 -0.0215 0.0455  0.0065  303 ARG A CB  
2522 C CG  . ARG A 321 ? 0.3940 0.2537 0.3051 -0.0240 0.0510  0.0051  303 ARG A CG  
2523 C CD  . ARG A 321 ? 0.4081 0.2391 0.3095 -0.0137 0.0647  0.0063  303 ARG A CD  
2524 N NE  . ARG A 321 ? 0.4188 0.2357 0.3119 -0.0177 0.0736  -0.0049 303 ARG A NE  
2525 C CZ  . ARG A 321 ? 0.4799 0.2810 0.3673 -0.0328 0.0773  -0.0188 303 ARG A CZ  
2526 N NH1 . ARG A 321 ? 0.4856 0.2878 0.3831 -0.0467 0.0752  -0.0220 303 ARG A NH1 
2527 N NH2 . ARG A 321 ? 0.5155 0.3010 0.3894 -0.0342 0.0833  -0.0316 303 ARG A NH2 
2528 N N   . GLN A 322 ? 0.3274 0.2407 0.2688 -0.0084 0.0565  0.0137  304 GLN A N   
2529 C CA  . GLN A 322 ? 0.3307 0.2555 0.2770 -0.0107 0.0652  0.0163  304 GLN A CA  
2530 C C   . GLN A 322 ? 0.3520 0.2582 0.2622 -0.0142 0.0711  0.0102  304 GLN A C   
2531 O O   . GLN A 322 ? 0.3784 0.2651 0.2687 -0.0120 0.0751  0.0008  304 GLN A O   
2532 C CB  . GLN A 322 ? 0.3442 0.2825 0.3156 0.0001  0.0788  0.0187  304 GLN A CB  
2533 C CG  . GLN A 322 ? 0.3515 0.2980 0.3284 -0.0026 0.0961  0.0227  304 GLN A CG  
2534 C CD  . GLN A 322 ? 0.3589 0.3251 0.3702 0.0077  0.1134  0.0245  304 GLN A CD  
2535 O OE1 . GLN A 322 ? 0.4207 0.3932 0.4479 0.0209  0.1113  0.0220  304 GLN A OE1 
2536 N NE2 . GLN A 322 ? 0.3879 0.3628 0.4108 0.0034  0.1337  0.0299  304 GLN A NE2 
2537 N N   . VAL A 323 ? 0.3511 0.2596 0.2492 -0.0189 0.0700  0.0142  305 VAL A N   
2538 C CA  . VAL A 323 ? 0.3929 0.2847 0.2495 -0.0174 0.0722  0.0085  305 VAL A CA  
2539 C C   . VAL A 323 ? 0.4265 0.3090 0.2678 -0.0086 0.0959  0.0110  305 VAL A C   
2540 O O   . VAL A 323 ? 0.4173 0.3102 0.2795 -0.0075 0.1118  0.0222  305 VAL A O   
2541 C CB  . VAL A 323 ? 0.3882 0.2807 0.2275 -0.0198 0.0611  0.0140  305 VAL A CB  
2542 C CG1 . VAL A 323 ? 0.4275 0.3026 0.2155 -0.0124 0.0598  0.0075  305 VAL A CG1 
2543 C CG2 . VAL A 323 ? 0.3569 0.2600 0.2128 -0.0263 0.0412  0.0112  305 VAL A CG2 
2544 N N   . ASP A 324 ? 0.4795 0.3412 0.2850 -0.0029 0.1002  -0.0010 306 ASP A N   
2545 C CA  . ASP A 324 ? 0.5300 0.3762 0.3048 0.0080  0.1238  0.0007  306 ASP A CA  
2546 C C   . ASP A 324 ? 0.5704 0.4046 0.3000 0.0111  0.1207  0.0057  306 ASP A C   
2547 O O   . ASP A 324 ? 0.5964 0.4180 0.2863 0.0131  0.1023  -0.0068 306 ASP A O   
2548 C CB  . ASP A 324 ? 0.5758 0.3977 0.3210 0.0149  0.1287  -0.0166 306 ASP A CB  
2549 C CG  . ASP A 324 ? 0.6511 0.4519 0.3548 0.0294  0.1554  -0.0163 306 ASP A CG  
2550 O OD1 . ASP A 324 ? 0.6921 0.4892 0.3704 0.0339  0.1660  -0.0046 306 ASP A OD1 
2551 O OD2 . ASP A 324 ? 0.7165 0.4988 0.4079 0.0379  0.1681  -0.0277 306 ASP A OD2 
2552 N N   . THR A 325 ? 0.5894 0.4262 0.3250 0.0124  0.1386  0.0236  307 THR A N   
2553 C CA  . THR A 325 ? 0.6211 0.4419 0.3133 0.0174  0.1350  0.0331  307 THR A CA  
2554 C C   . THR A 325 ? 0.7105 0.4983 0.3270 0.0347  0.1466  0.0306  307 THR A C   
2555 O O   . THR A 325 ? 0.7631 0.5336 0.3296 0.0445  0.1366  0.0354  307 THR A O   
2556 C CB  . THR A 325 ? 0.6118 0.4382 0.3350 0.0110  0.1526  0.0535  307 THR A CB  
2557 O OG1 . THR A 325 ? 0.6265 0.4549 0.3715 0.0117  0.1883  0.0612  307 THR A OG1 
2558 C CG2 . THR A 325 ? 0.5408 0.3947 0.3233 -0.0036 0.1326  0.0525  307 THR A CG2 
2559 N N   . LYS A 326 ? 0.7354 0.5120 0.3385 0.0418  0.1670  0.0229  308 LYS A N   
2560 C CA  . LYS A 326 ? 0.8205 0.5621 0.3440 0.0599  0.1750  0.0149  308 LYS A CA  
2561 C C   . LYS A 326 ? 0.8353 0.5702 0.3214 0.0616  0.1363  -0.0110 308 LYS A C   
2562 O O   . LYS A 326 ? 0.9012 0.6141 0.3180 0.0763  0.1243  -0.0163 308 LYS A O   
2563 C CB  . LYS A 326 ? 0.8460 0.5774 0.3697 0.0674  0.2073  0.0103  308 LYS A CB  
2564 C CG  . LYS A 326 ? 0.8712 0.6133 0.4354 0.0672  0.2494  0.0322  308 LYS A CG  
2565 C CD  . LYS A 326 ? 0.9053 0.6337 0.4565 0.0814  0.2840  0.0266  308 LYS A CD  
2566 C CE  . LYS A 326 ? 0.9607 0.6855 0.5183 0.0882  0.3346  0.0486  308 LYS A CE  
2567 N NZ  . LYS A 326 ? 1.0314 0.7326 0.5516 0.1081  0.3689  0.0415  308 LYS A NZ  
2568 N N   . THR A 327 ? 0.7896 0.5427 0.3219 0.0471  0.1179  -0.0278 309 THR A N   
2569 C CA  . THR A 327 ? 0.7948 0.5443 0.3080 0.0428  0.0853  -0.0557 309 THR A CA  
2570 C C   . THR A 327 ? 0.7539 0.5323 0.3007 0.0309  0.0525  -0.0573 309 THR A C   
2571 O O   . THR A 327 ? 0.7895 0.5713 0.3181 0.0297  0.0227  -0.0783 309 THR A O   
2572 C CB  . THR A 327 ? 0.7809 0.5235 0.3206 0.0339  0.0905  -0.0737 309 THR A CB  
2573 O OG1 . THR A 327 ? 0.7198 0.4876 0.3304 0.0200  0.0918  -0.0631 309 THR A OG1 
2574 C CG2 . THR A 327 ? 0.8097 0.5250 0.3206 0.0487  0.1255  -0.0722 309 THR A CG2 
2575 N N   . GLY A 328 ? 0.6814 0.4821 0.2796 0.0226  0.0576  -0.0373 310 GLY A N   
2576 C CA  . GLY A 328 ? 0.6415 0.4689 0.2767 0.0121  0.0319  -0.0378 310 GLY A CA  
2577 C C   . GLY A 328 ? 0.5967 0.4375 0.2801 -0.0051 0.0227  -0.0527 310 GLY A C   
2578 O O   . GLY A 328 ? 0.5869 0.4499 0.3037 -0.0144 0.0048  -0.0548 310 GLY A O   
2579 N N   . LYS A 329 ? 0.5984 0.4222 0.2838 -0.0074 0.0383  -0.0614 311 LYS A N   
2580 C CA  . LYS A 329 ? 0.5720 0.3968 0.2965 -0.0212 0.0373  -0.0714 311 LYS A CA  
2581 C C   . LYS A 329 ? 0.5285 0.3627 0.2938 -0.0217 0.0530  -0.0516 311 LYS A C   
2582 O O   . LYS A 329 ? 0.5229 0.3599 0.2891 -0.0124 0.0695  -0.0358 311 LYS A O   
2583 C CB  . LYS A 329 ? 0.6109 0.4047 0.3115 -0.0205 0.0466  -0.0913 311 LYS A CB  
2584 C CG  . LYS A 329 ? 0.6694 0.4519 0.3260 -0.0195 0.0280  -0.1160 311 LYS A CG  
2585 C CD  . LYS A 329 ? 0.7250 0.4698 0.3535 -0.0187 0.0386  -0.1384 311 LYS A CD  
2586 C CE  . LYS A 329 ? 0.7930 0.5276 0.3723 -0.0167 0.0142  -0.1672 311 LYS A CE  
2587 N NZ  . LYS A 329 ? 0.8580 0.5491 0.3951 -0.0122 0.0253  -0.1905 311 LYS A NZ  
2588 N N   . LEU A 330 ? 0.4914 0.3297 0.2903 -0.0321 0.0487  -0.0537 312 LEU A N   
2589 C CA  . LEU A 330 ? 0.4630 0.3054 0.2923 -0.0289 0.0602  -0.0384 312 LEU A CA  
2590 C C   . LEU A 330 ? 0.4831 0.3030 0.3057 -0.0188 0.0797  -0.0404 312 LEU A C   
2591 O O   . LEU A 330 ? 0.5166 0.3092 0.3188 -0.0207 0.0842  -0.0568 312 LEU A O   
2592 C CB  . LEU A 330 ? 0.4534 0.2997 0.3089 -0.0389 0.0529  -0.0381 312 LEU A CB  
2593 C CG  . LEU A 330 ? 0.4248 0.2947 0.2916 -0.0467 0.0358  -0.0370 312 LEU A CG  
2594 C CD1 . LEU A 330 ? 0.4619 0.3332 0.3543 -0.0544 0.0360  -0.0346 312 LEU A CD1 
2595 C CD2 . LEU A 330 ? 0.3950 0.2826 0.2615 -0.0392 0.0323  -0.0217 312 LEU A CD2 
2596 N N   . LYS A 331 ? 0.4582 0.2901 0.3004 -0.0075 0.0907  -0.0255 313 LYS A N   
2597 C CA  . LYS A 331 ? 0.4836 0.2999 0.3291 0.0063  0.1080  -0.0251 313 LYS A CA  
2598 C C   . LYS A 331 ? 0.4755 0.2729 0.3290 0.0045  0.1054  -0.0262 313 LYS A C   
2599 O O   . LYS A 331 ? 0.4506 0.2577 0.3169 -0.0046 0.0930  -0.0217 313 LYS A O   
2600 C CB  . LYS A 331 ? 0.4619 0.3061 0.3384 0.0190  0.1167  -0.0105 313 LYS A CB  
2601 C CG  . LYS A 331 ? 0.4787 0.3391 0.3520 0.0180  0.1248  -0.0058 313 LYS A CG  
2602 C CD  . LYS A 331 ? 0.4952 0.3811 0.4051 0.0292  0.1410  0.0040  313 LYS A CD  
2603 C CE  . LYS A 331 ? 0.5403 0.4337 0.4427 0.0258  0.1563  0.0100  313 LYS A CE  
2604 N NZ  . LYS A 331 ? 0.5540 0.4701 0.4935 0.0360  0.1819  0.0170  313 LYS A NZ  
2605 N N   . ILE A 332 ? 0.5071 0.2722 0.3492 0.0146  0.1202  -0.0314 314 ILE A N   
2606 C CA  . ILE A 332 ? 0.5244 0.2601 0.3671 0.0145  0.1236  -0.0303 314 ILE A CA  
2607 C C   . ILE A 332 ? 0.5013 0.2522 0.3646 0.0339  0.1222  -0.0112 314 ILE A C   
2608 O O   . ILE A 332 ? 0.5014 0.2697 0.3777 0.0525  0.1271  -0.0050 314 ILE A O   
2609 C CB  . ILE A 332 ? 0.5708 0.2557 0.3886 0.0182  0.1414  -0.0440 314 ILE A CB  
2610 C CG1 . ILE A 332 ? 0.6034 0.2766 0.3982 0.0006  0.1373  -0.0677 314 ILE A CG1 
2611 C CG2 . ILE A 332 ? 0.5967 0.2412 0.4128 0.0158  0.1498  -0.0406 314 ILE A CG2 
2612 C CD1 . ILE A 332 ? 0.5643 0.2531 0.3685 -0.0243 0.1188  -0.0766 314 ILE A CD1 
2613 N N   . GLY A 333 ? 0.4997 0.2457 0.3659 0.0303  0.1153  -0.0034 315 GLY A N   
2614 C CA  . GLY A 333 ? 0.5031 0.2574 0.3779 0.0509  0.1100  0.0125  315 GLY A CA  
2615 C C   . GLY A 333 ? 0.4564 0.2512 0.3493 0.0451  0.0901  0.0186  315 GLY A C   
2616 O O   . GLY A 333 ? 0.4293 0.2494 0.3324 0.0286  0.0827  0.0131  315 GLY A O   
2617 N N   . THR A 334 ? 0.4586 0.2541 0.3495 0.0604  0.0815  0.0297  316 THR A N   
2618 C CA  . THR A 334 ? 0.4380 0.2687 0.3437 0.0585  0.0611  0.0333  316 THR A CA  
2619 C C   . THR A 334 ? 0.4083 0.2832 0.3490 0.0669  0.0508  0.0319  316 THR A C   
2620 O O   . THR A 334 ? 0.4074 0.2875 0.3587 0.0881  0.0533  0.0342  316 THR A O   
2621 C CB  . THR A 334 ? 0.4597 0.2727 0.3433 0.0762  0.0540  0.0437  316 THR A CB  
2622 O OG1 . THR A 334 ? 0.5418 0.3124 0.3978 0.0667  0.0706  0.0465  316 THR A OG1 
2623 C CG2 . THR A 334 ? 0.4388 0.2838 0.3327 0.0747  0.0315  0.0435  316 THR A CG2 
2624 N N   . TYR A 335 ? 0.3864 0.2923 0.3481 0.0506  0.0411  0.0282  317 TYR A N   
2625 C CA  . TYR A 335 ? 0.3821 0.3303 0.3850 0.0531  0.0343  0.0262  317 TYR A CA  
2626 C C   . TYR A 335 ? 0.3822 0.3541 0.4028 0.0669  0.0111  0.0267  317 TYR A C   
2627 O O   . TYR A 335 ? 0.3857 0.3546 0.3937 0.0611  -0.0036 0.0261  317 TYR A O   
2628 C CB  . TYR A 335 ? 0.3661 0.3299 0.3813 0.0303  0.0355  0.0232  317 TYR A CB  
2629 C CG  . TYR A 335 ? 0.3544 0.3564 0.4160 0.0283  0.0369  0.0216  317 TYR A CG  
2630 C CD1 . TYR A 335 ? 0.3750 0.3857 0.4530 0.0333  0.0577  0.0218  317 TYR A CD1 
2631 C CD2 . TYR A 335 ? 0.3421 0.3698 0.4329 0.0207  0.0201  0.0187  317 TYR A CD2 
2632 C CE1 . TYR A 335 ? 0.3745 0.4223 0.5025 0.0298  0.0645  0.0208  317 TYR A CE1 
2633 C CE2 . TYR A 335 ? 0.3469 0.4108 0.4899 0.0147  0.0238  0.0155  317 TYR A CE2 
2634 C CZ  . TYR A 335 ? 0.3540 0.4296 0.5183 0.0185  0.0474  0.0175  317 TYR A CZ  
2635 O OH  . TYR A 335 ? 0.3532 0.4668 0.5766 0.0104  0.0560  0.0147  317 TYR A OH  
2636 N N   . THR A 336 ? 0.3997 0.3977 0.4509 0.0862  0.0071  0.0260  318 THR A N   
2637 C CA  . THR A 336 ? 0.4238 0.4471 0.4914 0.1061  -0.0192 0.0238  318 THR A CA  
2638 C C   . THR A 336 ? 0.4131 0.4954 0.5490 0.0990  -0.0308 0.0137  318 THR A C   
2639 O O   . THR A 336 ? 0.4225 0.5371 0.5844 0.1151  -0.0570 0.0072  318 THR A O   
2640 C CB  . THR A 336 ? 0.4650 0.4751 0.5187 0.1410  -0.0178 0.0304  318 THR A CB  
2641 O OG1 . THR A 336 ? 0.4658 0.4922 0.5521 0.1459  0.0020  0.0294  318 THR A OG1 
2642 C CG2 . THR A 336 ? 0.5012 0.4448 0.4871 0.1478  -0.0033 0.0411  318 THR A CG2 
2643 N N   . GLY A 337 ? 0.3903 0.4851 0.5541 0.0761  -0.0104 0.0121  319 GLY A N   
2644 C CA  . GLY A 337 ? 0.3725 0.5196 0.6077 0.0661  -0.0097 0.0042  319 GLY A CA  
2645 C C   . GLY A 337 ? 0.3548 0.5149 0.6104 0.0409  -0.0242 -0.0038 319 GLY A C   
2646 O O   . GLY A 337 ? 0.3463 0.4767 0.5584 0.0347  -0.0370 -0.0035 319 GLY A O   
2647 N N   . PRO A 338 ? 0.3416 0.5448 0.6662 0.0262  -0.0198 -0.0117 320 PRO A N   
2648 C CA  . PRO A 338 ? 0.3374 0.5502 0.6882 0.0006  -0.0315 -0.0214 320 PRO A CA  
2649 C C   . PRO A 338 ? 0.3360 0.5121 0.6596 -0.0240 -0.0039 -0.0119 320 PRO A C   
2650 O O   . PRO A 338 ? 0.3389 0.4875 0.6247 -0.0208 0.0215  0.0004  320 PRO A O   
2651 C CB  . PRO A 338 ? 0.3317 0.6071 0.7763 -0.0051 -0.0334 -0.0340 320 PRO A CB  
2652 C CG  . PRO A 338 ? 0.3359 0.6214 0.7967 0.0059  -0.0002 -0.0237 320 PRO A CG  
2653 C CD  . PRO A 338 ? 0.3395 0.5826 0.7244 0.0317  0.0009  -0.0121 320 PRO A CD  
2654 N N   . LEU A 339 ? 0.3361 0.5086 0.6740 -0.0459 -0.0109 -0.0186 321 LEU A N   
2655 C CA  . LEU A 339 ? 0.3496 0.4891 0.6679 -0.0663 0.0152  -0.0088 321 LEU A CA  
2656 C C   . LEU A 339 ? 0.3601 0.5205 0.7277 -0.0762 0.0493  -0.0038 321 LEU A C   
2657 O O   . LEU A 339 ? 0.3605 0.5644 0.8024 -0.0849 0.0473  -0.0150 321 LEU A O   
2658 C CB  . LEU A 339 ? 0.3554 0.4830 0.6818 -0.0859 0.0004  -0.0184 321 LEU A CB  
2659 C CG  . LEU A 339 ? 0.3658 0.4487 0.6591 -0.1021 0.0228  -0.0070 321 LEU A CG  
2660 C CD1 . LEU A 339 ? 0.3359 0.3812 0.5550 -0.0888 0.0263  0.0061  321 LEU A CD1 
2661 C CD2 . LEU A 339 ? 0.3972 0.4668 0.7010 -0.1183 0.0061  -0.0193 321 LEU A CD2 
2662 N N   . GLN A 340 ? 0.3800 0.5118 0.7080 -0.0734 0.0806  0.0115  322 GLN A N   
2663 C CA  . GLN A 340 ? 0.4028 0.5473 0.7681 -0.0806 0.1200  0.0186  322 GLN A CA  
2664 C C   . GLN A 340 ? 0.4230 0.5204 0.7430 -0.0925 0.1479  0.0333  322 GLN A C   
2665 O O   . GLN A 340 ? 0.4233 0.4814 0.6744 -0.0864 0.1393  0.0395  322 GLN A O   
2666 C CB  . GLN A 340 ? 0.4127 0.5653 0.7671 -0.0589 0.1376  0.0237  322 GLN A CB  
2667 C CG  . GLN A 340 ? 0.4229 0.5931 0.7734 -0.0355 0.1091  0.0158  322 GLN A CG  
2668 C CD  . GLN A 340 ? 0.4415 0.6077 0.7744 -0.0143 0.1318  0.0212  322 GLN A CD  
2669 O OE1 . GLN A 340 ? 0.4208 0.6066 0.7914 -0.0140 0.1639  0.0243  322 GLN A OE1 
2670 N NE2 . GLN A 340 ? 0.4601 0.5969 0.7350 0.0030  0.1185  0.0219  322 GLN A NE2 
2671 N N   . HIS A 341 ? 0.4522 0.5539 0.8116 -0.1074 0.1837  0.0396  323 HIS A N   
2672 C CA  . HIS A 341 ? 0.4854 0.5363 0.7947 -0.1141 0.2152  0.0570  323 HIS A CA  
2673 C C   . HIS A 341 ? 0.4944 0.5118 0.7197 -0.0917 0.2236  0.0680  323 HIS A C   
2674 O O   . HIS A 341 ? 0.4878 0.5207 0.7128 -0.0766 0.2347  0.0669  323 HIS A O   
2675 C CB  . HIS A 341 ? 0.5291 0.5872 0.8913 -0.1304 0.2617  0.0649  323 HIS A CB  
2676 C CG  . HIS A 341 ? 0.6033 0.6005 0.9025 -0.1327 0.2979  0.0865  323 HIS A CG  
2677 N ND1 . HIS A 341 ? 0.6586 0.6122 0.9223 -0.1421 0.2899  0.0923  323 HIS A ND1 
2678 C CD2 . HIS A 341 ? 0.6981 0.6662 0.9547 -0.1223 0.3419  0.1045  323 HIS A CD2 
2679 C CE1 . HIS A 341 ? 0.7290 0.6298 0.9324 -0.1366 0.3265  0.1141  323 HIS A CE1 
2680 N NE2 . HIS A 341 ? 0.7572 0.6649 0.9524 -0.1248 0.3584  0.1218  323 HIS A NE2 
2681 N N   . GLY A 342 ? 0.4973 0.4691 0.6526 -0.0884 0.2172  0.0765  324 GLY A N   
2682 C CA  . GLY A 342 ? 0.5224 0.4627 0.5988 -0.0690 0.2221  0.0837  324 GLY A CA  
2683 C C   . GLY A 342 ? 0.4869 0.4336 0.5352 -0.0562 0.1865  0.0721  324 GLY A C   
2684 O O   . GLY A 342 ? 0.5221 0.4434 0.5083 -0.0435 0.1837  0.0738  324 GLY A O   
2685 N N   . ILE A 343 ? 0.4370 0.4151 0.5283 -0.0592 0.1592  0.0597  325 ILE A N   
2686 C CA  . ILE A 343 ? 0.4136 0.3918 0.4782 -0.0477 0.1320  0.0512  325 ILE A CA  
2687 C C   . ILE A 343 ? 0.3953 0.3483 0.4163 -0.0492 0.1116  0.0523  325 ILE A C   
2688 O O   . ILE A 343 ? 0.3928 0.3375 0.4208 -0.0590 0.1087  0.0560  325 ILE A O   
2689 C CB  . ILE A 343 ? 0.3865 0.4002 0.5013 -0.0458 0.1111  0.0403  325 ILE A CB  
2690 C CG1 . ILE A 343 ? 0.4010 0.4064 0.4834 -0.0322 0.0927  0.0348  325 ILE A CG1 
2691 C CG2 . ILE A 343 ? 0.4056 0.4296 0.5516 -0.0593 0.0912  0.0355  325 ILE A CG2 
2692 C CD1 . ILE A 343 ? 0.3950 0.4270 0.5122 -0.0224 0.0767  0.0277  325 ILE A CD1 
2693 N N   . VAL A 344 ? 0.3864 0.3268 0.3654 -0.0395 0.0999  0.0482  326 VAL A N   
2694 C CA  . VAL A 344 ? 0.3736 0.2997 0.3213 -0.0390 0.0800  0.0469  326 VAL A CA  
2695 C C   . VAL A 344 ? 0.3477 0.2832 0.2998 -0.0356 0.0615  0.0369  326 VAL A C   
2696 O O   . VAL A 344 ? 0.3440 0.2793 0.2901 -0.0294 0.0662  0.0318  326 VAL A O   
2697 C CB  . VAL A 344 ? 0.3988 0.3010 0.2920 -0.0312 0.0840  0.0502  326 VAL A CB  
2698 C CG1 . VAL A 344 ? 0.3975 0.2965 0.2723 -0.0294 0.0599  0.0459  326 VAL A CG1 
2699 C CG2 . VAL A 344 ? 0.4396 0.3221 0.3166 -0.0311 0.1063  0.0643  326 VAL A CG2 
2700 N N   . TYR A 345 ? 0.3199 0.2588 0.2806 -0.0387 0.0441  0.0348  327 TYR A N   
2701 C CA  . TYR A 345 ? 0.3112 0.2541 0.2744 -0.0350 0.0308  0.0284  327 TYR A CA  
2702 C C   . TYR A 345 ? 0.3042 0.2367 0.2417 -0.0348 0.0229  0.0253  327 TYR A C   
2703 O O   . TYR A 345 ? 0.3056 0.2332 0.2290 -0.0359 0.0199  0.0279  327 TYR A O   
2704 C CB  . TYR A 345 ? 0.3207 0.2728 0.3061 -0.0362 0.0177  0.0269  327 TYR A CB  
2705 C CG  . TYR A 345 ? 0.3234 0.2949 0.3457 -0.0371 0.0188  0.0254  327 TYR A CG  
2706 C CD1 . TYR A 345 ? 0.3494 0.3342 0.3867 -0.0273 0.0192  0.0229  327 TYR A CD1 
2707 C CD2 . TYR A 345 ? 0.3382 0.3154 0.3848 -0.0476 0.0196  0.0255  327 TYR A CD2 
2708 C CE1 . TYR A 345 ? 0.3103 0.3221 0.3906 -0.0262 0.0172  0.0195  327 TYR A CE1 
2709 C CE2 . TYR A 345 ? 0.3587 0.3615 0.4521 -0.0513 0.0197  0.0206  327 TYR A CE2 
2710 C CZ  . TYR A 345 ? 0.3409 0.3651 0.4529 -0.0395 0.0166  0.0171  327 TYR A CZ  
2711 O OH  . TYR A 345 ? 0.3516 0.4098 0.5173 -0.0405 0.0138  0.0105  327 TYR A OH  
2712 N N   . SER A 346 ? 0.3033 0.2330 0.2388 -0.0327 0.0202  0.0201  328 SER A N   
2713 C CA  . SER A 346 ? 0.3103 0.2358 0.2352 -0.0355 0.0149  0.0149  328 SER A CA  
2714 C C   . SER A 346 ? 0.2944 0.2153 0.2253 -0.0335 0.0139  0.0152  328 SER A C   
2715 O O   . SER A 346 ? 0.3091 0.2229 0.2413 -0.0277 0.0186  0.0166  328 SER A O   
2716 C CB  . SER A 346 ? 0.3229 0.2414 0.2342 -0.0376 0.0198  0.0061  328 SER A CB  
2717 O OG  . SER A 346 ? 0.3436 0.2605 0.2575 -0.0437 0.0167  -0.0027 328 SER A OG  
2718 N N   . GLY A 347 ? 0.2953 0.2181 0.2267 -0.0350 0.0093  0.0150  329 GLY A N   
2719 C CA  . GLY A 347 ? 0.3068 0.2198 0.2361 -0.0315 0.0133  0.0168  329 GLY A CA  
2720 C C   . GLY A 347 ? 0.3159 0.2267 0.2408 -0.0227 0.0060  0.0216  329 GLY A C   
2721 O O   . GLY A 347 ? 0.3355 0.2530 0.2638 -0.0234 -0.0025 0.0217  329 GLY A O   
2722 N N   . GLY A 348 ? 0.3227 0.2212 0.2377 -0.0131 0.0083  0.0246  330 GLY A N   
2723 C CA  . GLY A 348 ? 0.3427 0.2405 0.2501 -0.0022 -0.0039 0.0256  330 GLY A CA  
2724 C C   . GLY A 348 ? 0.3576 0.2454 0.2482 0.0013  -0.0053 0.0257  330 GLY A C   
2725 O O   . GLY A 348 ? 0.3712 0.2512 0.2566 -0.0016 0.0079  0.0277  330 GLY A O   
2726 N N   . SER A 349 ? 0.3723 0.2615 0.2578 0.0070  -0.0207 0.0216  331 SER A N   
2727 C CA  . SER A 349 ? 0.3722 0.2467 0.2339 0.0144  -0.0234 0.0196  331 SER A CA  
2728 C C   . SER A 349 ? 0.3715 0.2525 0.2436 0.0096  -0.0400 0.0107  331 SER A C   
2729 O O   . SER A 349 ? 0.3612 0.2588 0.2604 0.0014  -0.0488 0.0069  331 SER A O   
2730 C CB  . SER A 349 ? 0.4176 0.2707 0.2421 0.0336  -0.0244 0.0224  331 SER A CB  
2731 O OG  . SER A 349 ? 0.4424 0.3024 0.2646 0.0434  -0.0472 0.0158  331 SER A OG  
2732 N N   . SER A 350 ? 0.3702 0.2356 0.2219 0.0148  -0.0423 0.0065  332 SER A N   
2733 C CA  . SER A 350 ? 0.3834 0.2458 0.2412 0.0100  -0.0577 -0.0045 332 SER A CA  
2734 C C   . SER A 350 ? 0.3896 0.2606 0.2539 0.0124  -0.0796 -0.0154 332 SER A C   
2735 O O   . SER A 350 ? 0.3863 0.2657 0.2779 0.0003  -0.0914 -0.0255 332 SER A O   
2736 C CB  . SER A 350 ? 0.4059 0.2436 0.2326 0.0194  -0.0554 -0.0089 332 SER A CB  
2737 O OG  . SER A 350 ? 0.4605 0.2805 0.2460 0.0375  -0.0557 -0.0095 332 SER A OG  
2738 N N   . ASP A 351 ? 0.4052 0.3224 0.3843 0.0733  -0.0074 0.0250  333 ASP A N   
2739 C CA  . ASP A 351 ? 0.4214 0.3634 0.4169 0.0874  -0.0128 0.0307  333 ASP A CA  
2740 C C   . ASP A 351 ? 0.4240 0.3838 0.4383 0.1046  -0.0080 0.0111  333 ASP A C   
2741 O O   . ASP A 351 ? 0.4051 0.3998 0.4328 0.1127  -0.0086 0.0117  333 ASP A O   
2742 C CB  . ASP A 351 ? 0.4640 0.3856 0.4700 0.0966  -0.0254 0.0511  333 ASP A CB  
2743 C CG  . ASP A 351 ? 0.4953 0.4185 0.4819 0.0811  -0.0297 0.0741  333 ASP A CG  
2744 O OD1 . ASP A 351 ? 0.5338 0.4798 0.5027 0.0669  -0.0245 0.0720  333 ASP A OD1 
2745 O OD2 . ASP A 351 ? 0.5983 0.5000 0.5879 0.0834  -0.0384 0.0942  333 ASP A OD2 
2746 N N   . THR A 352 ? 0.4371 0.3762 0.4530 0.1104  -0.0033 -0.0071 334 THR A N   
2747 C CA  . THR A 352 ? 0.4452 0.4059 0.4739 0.1260  0.0042  -0.0297 334 THR A CA  
2748 C C   . THR A 352 ? 0.4112 0.4169 0.4312 0.1154  0.0154  -0.0342 334 THR A C   
2749 O O   . THR A 352 ? 0.4062 0.4502 0.4425 0.1255  0.0197  -0.0394 334 THR A O   
2750 C CB  . THR A 352 ? 0.4682 0.4009 0.4915 0.1296  0.0078  -0.0516 334 THR A CB  
2751 O OG1 . THR A 352 ? 0.5032 0.3881 0.5368 0.1360  -0.0037 -0.0474 334 THR A OG1 
2752 C CG2 . THR A 352 ? 0.4758 0.4374 0.5110 0.1487  0.0169  -0.0776 334 THR A CG2 
2753 N N   . ILE A 353 ? 0.4115 0.4126 0.4083 0.0946  0.0197  -0.0311 335 ILE A N   
2754 C CA  . ILE A 353 ? 0.4025 0.4388 0.3909 0.0815  0.0286  -0.0321 335 ILE A CA  
2755 C C   . ILE A 353 ? 0.3847 0.4512 0.3838 0.0773  0.0245  -0.0184 335 ILE A C   
2756 O O   . ILE A 353 ? 0.3759 0.4824 0.3876 0.0781  0.0301  -0.0214 335 ILE A O   
2757 C CB  . ILE A 353 ? 0.3957 0.4138 0.3592 0.0616  0.0311  -0.0302 335 ILE A CB  
2758 C CG1 . ILE A 353 ? 0.4309 0.4290 0.3856 0.0666  0.0348  -0.0470 335 ILE A CG1 
2759 C CG2 . ILE A 353 ? 0.3813 0.4296 0.3378 0.0459  0.0374  -0.0261 335 ILE A CG2 
2760 C CD1 . ILE A 353 ? 0.4280 0.4067 0.3625 0.0512  0.0349  -0.0462 335 ILE A CD1 
2761 N N   . CYS A 354 ? 0.3926 0.4433 0.3883 0.0730  0.0143  -0.0036 336 CYS A N   
2762 C CA  . CYS A 354 ? 0.3875 0.4660 0.3903 0.0684  0.0080  0.0075  336 CYS A CA  
2763 C C   . CYS A 354 ? 0.3829 0.4926 0.4136 0.0861  0.0053  0.0063  336 CYS A C   
2764 O O   . CYS A 354 ? 0.3680 0.5172 0.4111 0.0816  0.0062  0.0068  336 CYS A O   
2765 C CB  . CYS A 354 ? 0.4094 0.4672 0.4005 0.0636  -0.0026 0.0228  336 CYS A CB  
2766 S SG  . CYS A 354 ? 0.4714 0.5089 0.4345 0.0418  0.0013  0.0232  336 CYS A SG  
2767 N N   . ASP A 355 ? 0.3963 0.4885 0.4403 0.1065  0.0010  0.0046  337 ASP A N   
2768 C CA  . ASP A 355 ? 0.4131 0.5334 0.4872 0.1273  -0.0029 0.0031  337 ASP A CA  
2769 C C   . ASP A 355 ? 0.3965 0.5561 0.4863 0.1339  0.0106  -0.0147 337 ASP A C   
2770 O O   . ASP A 355 ? 0.3885 0.5948 0.5012 0.1383  0.0106  -0.0136 337 ASP A O   
2771 C CB  . ASP A 355 ? 0.4595 0.5440 0.5458 0.1488  -0.0117 0.0048  337 ASP A CB  
2772 C CG  . ASP A 355 ? 0.5294 0.5873 0.6064 0.1445  -0.0264 0.0290  337 ASP A CG  
2773 O OD1 . ASP A 355 ? 0.5940 0.6620 0.6521 0.1257  -0.0293 0.0415  337 ASP A OD1 
2774 O OD2 . ASP A 355 ? 0.6389 0.6646 0.7274 0.1600  -0.0354 0.0353  337 ASP A OD2 
2775 N N   . LEU A 356 ? 0.3908 0.5354 0.4693 0.1351  0.0216  -0.0310 338 LEU A N   
2776 C CA  . LEU A 356 ? 0.3861 0.5700 0.4747 0.1421  0.0364  -0.0486 338 LEU A CA  
2777 C C   . LEU A 356 ? 0.3566 0.5821 0.4396 0.1196  0.0458  -0.0431 338 LEU A C   
2778 O O   . LEU A 356 ? 0.3486 0.6238 0.4496 0.1241  0.0562  -0.0497 338 LEU A O   
2779 C CB  . LEU A 356 ? 0.4069 0.5629 0.4798 0.1486  0.0441  -0.0682 338 LEU A CB  
2780 C CG  . LEU A 356 ? 0.4268 0.5498 0.5153 0.1752  0.0367  -0.0810 338 LEU A CG  
2781 C CD1 . LEU A 356 ? 0.4429 0.5358 0.5123 0.1766  0.0421  -0.1017 338 LEU A CD1 
2782 C CD2 . LEU A 356 ? 0.4441 0.6040 0.5686 0.2030  0.0381  -0.0916 338 LEU A CD2 
2783 N N   . LEU A 357 ? 0.3346 0.5403 0.3947 0.0958  0.0426  -0.0313 339 LEU A N   
2784 C CA  . LEU A 357 ? 0.3291 0.5647 0.3862 0.0730  0.0478  -0.0238 339 LEU A CA  
2785 C C   . LEU A 357 ? 0.3326 0.5867 0.4035 0.0633  0.0364  -0.0103 339 LEU A C   
2786 O O   . LEU A 357 ? 0.3270 0.6066 0.4016 0.0440  0.0385  -0.0045 339 LEU A O   
2787 C CB  . LEU A 357 ? 0.3162 0.5202 0.3424 0.0535  0.0505  -0.0214 339 LEU A CB  
2788 C CG  . LEU A 357 ? 0.3038 0.4946 0.3126 0.0584  0.0608  -0.0344 339 LEU A CG  
2789 C CD1 . LEU A 357 ? 0.3102 0.4792 0.2931 0.0370  0.0616  -0.0280 339 LEU A CD1 
2790 C CD2 . LEU A 357 ? 0.2805 0.5178 0.3011 0.0664  0.0746  -0.0442 339 LEU A CD2 
2791 N N   . GLY A 358 ? 0.3437 0.5848 0.4219 0.0757  0.0232  -0.0047 340 GLY A N   
2792 C CA  . GLY A 358 ? 0.3443 0.6053 0.4333 0.0687  0.0101  0.0066  340 GLY A CA  
2793 C C   . GLY A 358 ? 0.3420 0.5848 0.4081 0.0443  0.0050  0.0128  340 GLY A C   
2794 O O   . GLY A 358 ? 0.3429 0.6122 0.4181 0.0297  -0.0004 0.0164  340 GLY A O   
2795 N N   . ALA A 359 ? 0.3503 0.5487 0.3889 0.0400  0.0063  0.0126  341 ALA A N   
2796 C CA  . ALA A 359 ? 0.3491 0.5275 0.3660 0.0202  0.0027  0.0155  341 ALA A CA  
2797 C C   . ALA A 359 ? 0.3669 0.5210 0.3683 0.0242  -0.0083 0.0229  341 ALA A C   
2798 O O   . ALA A 359 ? 0.3874 0.5249 0.3891 0.0398  -0.0106 0.0271  341 ALA A O   
2799 C CB  . ALA A 359 ? 0.3482 0.5004 0.3468 0.0123  0.0131  0.0103  341 ALA A CB  
2800 N N   . LYS A 360 ? 0.3580 0.5116 0.3470 0.0098  -0.0154 0.0245  342 LYS A N   
2801 C CA  . LYS A 360 ? 0.3770 0.5082 0.3439 0.0092  -0.0218 0.0300  342 LYS A CA  
2802 C C   . LYS A 360 ? 0.3665 0.4684 0.3150 -0.0018 -0.0133 0.0238  342 LYS A C   
2803 O O   . LYS A 360 ? 0.3824 0.4862 0.3353 -0.0109 -0.0069 0.0172  342 LYS A O   
2804 C CB  . LYS A 360 ? 0.3900 0.5432 0.3532 0.0011  -0.0343 0.0309  342 LYS A CB  
2805 C CG  . LYS A 360 ? 0.4242 0.6161 0.4106 0.0076  -0.0444 0.0348  342 LYS A CG  
2806 C CD  . LYS A 360 ? 0.4974 0.6900 0.4924 0.0291  -0.0491 0.0474  342 LYS A CD  
2807 C CE  . LYS A 360 ? 0.4996 0.7336 0.5281 0.0399  -0.0555 0.0490  342 LYS A CE  
2808 N NZ  . LYS A 360 ? 0.5459 0.7927 0.5977 0.0421  -0.0421 0.0395  342 LYS A NZ  
2809 N N   . GLY A 361 ? 0.3705 0.4487 0.2998 -0.0017 -0.0137 0.0276  343 GLY A N   
2810 C CA  . GLY A 361 ? 0.3522 0.4056 0.2670 -0.0102 -0.0067 0.0220  343 GLY A CA  
2811 C C   . GLY A 361 ? 0.3304 0.3857 0.2423 -0.0243 -0.0065 0.0126  343 GLY A C   
2812 O O   . GLY A 361 ? 0.3113 0.3525 0.2221 -0.0295 -0.0002 0.0082  343 GLY A O   
2813 N N   . LYS A 362 ? 0.3220 0.3934 0.2330 -0.0304 -0.0149 0.0091  344 LYS A N   
2814 C CA  . LYS A 362 ? 0.3320 0.4007 0.2436 -0.0439 -0.0172 -0.0012 344 LYS A CA  
2815 C C   . LYS A 362 ? 0.3244 0.4026 0.2554 -0.0525 -0.0153 -0.0018 344 LYS A C   
2816 O O   . LYS A 362 ? 0.3504 0.4199 0.2845 -0.0649 -0.0173 -0.0075 344 LYS A O   
2817 C CB  . LYS A 362 ? 0.3446 0.4264 0.2488 -0.0482 -0.0281 -0.0083 344 LYS A CB  
2818 C CG  . LYS A 362 ? 0.3341 0.4055 0.2149 -0.0438 -0.0269 -0.0102 344 LYS A CG  
2819 C CD  . LYS A 362 ? 0.3688 0.4623 0.2372 -0.0436 -0.0373 -0.0141 344 LYS A CD  
2820 C CE  . LYS A 362 ? 0.3784 0.4684 0.2231 -0.0386 -0.0332 -0.0120 344 LYS A CE  
2821 N NZ  . LYS A 362 ? 0.3422 0.4588 0.1698 -0.0368 -0.0427 -0.0123 344 LYS A NZ  
2822 N N   . ASP A 363 ? 0.3312 0.4280 0.2765 -0.0458 -0.0116 0.0046  345 ASP A N   
2823 C CA  . ASP A 363 ? 0.3232 0.4361 0.2865 -0.0527 -0.0061 0.0067  345 ASP A CA  
2824 C C   . ASP A 363 ? 0.3028 0.3974 0.2581 -0.0508 0.0053  0.0082  345 ASP A C   
2825 O O   . ASP A 363 ? 0.3066 0.4141 0.2712 -0.0567 0.0119  0.0113  345 ASP A O   
2826 C CB  . ASP A 363 ? 0.3296 0.4750 0.3119 -0.0420 -0.0043 0.0109  345 ASP A CB  
2827 C CG  . ASP A 363 ? 0.3973 0.5699 0.3922 -0.0411 -0.0162 0.0116  345 ASP A CG  
2828 O OD1 . ASP A 363 ? 0.4258 0.6030 0.4215 -0.0546 -0.0263 0.0073  345 ASP A OD1 
2829 O OD2 . ASP A 363 ? 0.4374 0.6290 0.4440 -0.0258 -0.0164 0.0156  345 ASP A OD2 
2830 N N   . ILE A 364 ? 0.3032 0.3723 0.2417 -0.0423 0.0077  0.0068  346 ILE A N   
2831 C CA  . ILE A 364 ? 0.2954 0.3486 0.2256 -0.0392 0.0164  0.0065  346 ILE A CA  
2832 C C   . ILE A 364 ? 0.2958 0.3232 0.2133 -0.0474 0.0153  0.0048  346 ILE A C   
2833 O O   . ILE A 364 ? 0.3046 0.3180 0.2136 -0.0465 0.0110  0.0021  346 ILE A O   
2834 C CB  . ILE A 364 ? 0.2979 0.3403 0.2232 -0.0240 0.0187  0.0057  346 ILE A CB  
2835 C CG1 . ILE A 364 ? 0.2945 0.3610 0.2360 -0.0122 0.0189  0.0067  346 ILE A CG1 
2836 C CG2 . ILE A 364 ? 0.2786 0.3024 0.1937 -0.0221 0.0253  0.0022  346 ILE A CG2 
2837 C CD1 . ILE A 364 ? 0.3215 0.3737 0.2624 0.0028  0.0165  0.0080  346 ILE A CD1 
2838 N N   . LEU A 365 ? 0.2984 0.3225 0.2149 -0.0544 0.0194  0.0072  347 LEU A N   
2839 C CA  . LEU A 365 ? 0.2970 0.2961 0.2026 -0.0583 0.0186  0.0067  347 LEU A CA  
2840 C C   . LEU A 365 ? 0.2817 0.2749 0.1777 -0.0505 0.0247  0.0059  347 LEU A C   
2841 O O   . LEU A 365 ? 0.2794 0.2859 0.1749 -0.0505 0.0303  0.0080  347 LEU A O   
2842 C CB  . LEU A 365 ? 0.3126 0.3096 0.2239 -0.0721 0.0159  0.0124  347 LEU A CB  
2843 C CG  . LEU A 365 ? 0.3039 0.2745 0.2076 -0.0745 0.0125  0.0126  347 LEU A CG  
2844 C CD1 . LEU A 365 ? 0.3061 0.2606 0.2069 -0.0696 0.0074  0.0027  347 LEU A CD1 
2845 C CD2 . LEU A 365 ? 0.3277 0.2932 0.2387 -0.0875 0.0087  0.0220  347 LEU A CD2 
2846 N N   . TYR A 366 ? 0.3025 0.2783 0.1911 -0.0443 0.0236  0.0019  348 TYR A N   
2847 C CA  . TYR A 366 ? 0.3031 0.2702 0.1842 -0.0385 0.0267  -0.0012 348 TYR A CA  
2848 C C   . TYR A 366 ? 0.3079 0.2599 0.1820 -0.0438 0.0241  -0.0004 348 TYR A C   
2849 O O   . TYR A 366 ? 0.3154 0.2565 0.1907 -0.0460 0.0202  -0.0009 348 TYR A O   
2850 C CB  . TYR A 366 ? 0.3052 0.2628 0.1870 -0.0299 0.0260  -0.0040 348 TYR A CB  
2851 C CG  . TYR A 366 ? 0.3202 0.2670 0.1977 -0.0248 0.0275  -0.0096 348 TYR A CG  
2852 C CD1 . TYR A 366 ? 0.3313 0.2885 0.2071 -0.0198 0.0315  -0.0153 348 TYR A CD1 
2853 C CD2 . TYR A 366 ? 0.3541 0.2833 0.2300 -0.0255 0.0248  -0.0105 348 TYR A CD2 
2854 C CE1 . TYR A 366 ? 0.3428 0.2903 0.2138 -0.0147 0.0314  -0.0244 348 TYR A CE1 
2855 C CE2 . TYR A 366 ? 0.3708 0.2895 0.2447 -0.0225 0.0241  -0.0176 348 TYR A CE2 
2856 C CZ  . TYR A 366 ? 0.3659 0.2922 0.2362 -0.0169 0.0267  -0.0258 348 TYR A CZ  
2857 O OH  . TYR A 366 ? 0.4093 0.3253 0.2765 -0.0133 0.0247  -0.0369 348 TYR A OH  
2858 N N   . ILE A 367 ? 0.3123 0.2675 0.1791 -0.0445 0.0260  0.0000  349 ILE A N   
2859 C CA  . ILE A 367 ? 0.3143 0.2605 0.1749 -0.0494 0.0221  0.0037  349 ILE A CA  
2860 C C   . ILE A 367 ? 0.3098 0.2488 0.1633 -0.0442 0.0211  -0.0033 349 ILE A C   
2861 O O   . ILE A 367 ? 0.3093 0.2566 0.1556 -0.0401 0.0243  -0.0088 349 ILE A O   
2862 C CB  . ILE A 367 ? 0.3266 0.2866 0.1824 -0.0565 0.0238  0.0132  349 ILE A CB  
2863 C CG1 . ILE A 367 ? 0.3224 0.2898 0.1901 -0.0641 0.0239  0.0201  349 ILE A CG1 
2864 C CG2 . ILE A 367 ? 0.3342 0.2844 0.1828 -0.0608 0.0176  0.0205  349 ILE A CG2 
2865 C CD1 . ILE A 367 ? 0.3309 0.3200 0.1984 -0.0719 0.0286  0.0306  349 ILE A CD1 
2866 N N   . GLY A 368 ? 0.3145 0.2401 0.1716 -0.0443 0.0164  -0.0049 350 GLY A N   
2867 C CA  . GLY A 368 ? 0.3345 0.2541 0.1886 -0.0419 0.0137  -0.0115 350 GLY A CA  
2868 C C   . GLY A 368 ? 0.3291 0.2420 0.1881 -0.0443 0.0075  -0.0098 350 GLY A C   
2869 O O   . GLY A 368 ? 0.3383 0.2491 0.2030 -0.0461 0.0054  -0.0046 350 GLY A O   
2870 N N   . ASP A 369 ? 0.3303 0.2407 0.1892 -0.0440 0.0037  -0.0157 351 ASP A N   
2871 C CA  . ASP A 369 ? 0.3353 0.2448 0.2013 -0.0458 -0.0034 -0.0151 351 ASP A CA  
2872 C C   . ASP A 369 ? 0.3260 0.2327 0.2065 -0.0470 -0.0030 -0.0188 351 ASP A C   
2873 O O   . ASP A 369 ? 0.3144 0.2254 0.2058 -0.0481 -0.0072 -0.0181 351 ASP A O   
2874 C CB  . ASP A 369 ? 0.3381 0.2526 0.1936 -0.0467 -0.0108 -0.0178 351 ASP A CB  
2875 C CG  . ASP A 369 ? 0.3619 0.2740 0.2135 -0.0464 -0.0113 -0.0303 351 ASP A CG  
2876 O OD1 . ASP A 369 ? 0.3651 0.2769 0.2085 -0.0431 -0.0054 -0.0352 351 ASP A OD1 
2877 O OD2 . ASP A 369 ? 0.3572 0.2673 0.2172 -0.0492 -0.0179 -0.0362 351 ASP A OD2 
2878 N N   . HIS A 370 ? 0.3303 0.2312 0.2128 -0.0470 0.0017  -0.0213 352 HIS A N   
2879 C CA  . HIS A 370 ? 0.3285 0.2266 0.2253 -0.0509 0.0018  -0.0212 352 HIS A CA  
2880 C C   . HIS A 370 ? 0.3254 0.2288 0.2271 -0.0502 0.0087  -0.0140 352 HIS A C   
2881 O O   . HIS A 370 ? 0.3147 0.2154 0.2111 -0.0477 0.0131  -0.0109 352 HIS A O   
2882 C CB  . HIS A 370 ? 0.3412 0.2264 0.2391 -0.0516 0.0007  -0.0262 352 HIS A CB  
2883 C CG  . HIS A 370 ? 0.3424 0.2226 0.2575 -0.0592 -0.0017 -0.0243 352 HIS A CG  
2884 N ND1 . HIS A 370 ? 0.3878 0.2549 0.3087 -0.0630 -0.0086 -0.0327 352 HIS A ND1 
2885 C CD2 . HIS A 370 ? 0.2905 0.1794 0.2193 -0.0648 0.0018  -0.0151 352 HIS A CD2 
2886 C CE1 . HIS A 370 ? 0.2969 0.1627 0.2368 -0.0724 -0.0099 -0.0266 352 HIS A CE1 
2887 N NE2 . HIS A 370 ? 0.3618 0.2434 0.3061 -0.0736 -0.0026 -0.0149 352 HIS A NE2 
2888 N N   . ILE A 371 ? 0.3112 0.2253 0.2234 -0.0517 0.0092  -0.0123 353 ILE A N   
2889 C CA  . ILE A 371 ? 0.3054 0.2295 0.2197 -0.0499 0.0157  -0.0092 353 ILE A CA  
2890 C C   . ILE A 371 ? 0.3083 0.2327 0.2228 -0.0531 0.0212  -0.0019 353 ILE A C   
2891 O O   . ILE A 371 ? 0.3327 0.2628 0.2397 -0.0504 0.0257  0.0010  353 ILE A O   
2892 C CB  . ILE A 371 ? 0.3044 0.2440 0.2324 -0.0488 0.0159  -0.0116 353 ILE A CB  
2893 C CG1 . ILE A 371 ? 0.3233 0.2756 0.2504 -0.0444 0.0228  -0.0133 353 ILE A CG1 
2894 C CG2 . ILE A 371 ? 0.3005 0.2496 0.2447 -0.0558 0.0160  -0.0089 353 ILE A CG2 
2895 C CD1 . ILE A 371 ? 0.3264 0.2699 0.2403 -0.0401 0.0219  -0.0165 353 ILE A CD1 
2896 N N   . PHE A 372 ? 0.3229 0.2407 0.2460 -0.0592 0.0195  0.0016  354 PHE A N   
2897 C CA  . PHE A 372 ? 0.3324 0.2466 0.2582 -0.0633 0.0228  0.0124  354 PHE A CA  
2898 C C   . PHE A 372 ? 0.3433 0.2385 0.2610 -0.0585 0.0199  0.0124  354 PHE A C   
2899 O O   . PHE A 372 ? 0.3682 0.2655 0.2787 -0.0547 0.0228  0.0195  354 PHE A O   
2900 C CB  . PHE A 372 ? 0.3407 0.2553 0.2847 -0.0739 0.0215  0.0180  354 PHE A CB  
2901 C CG  . PHE A 372 ? 0.3486 0.2590 0.2976 -0.0803 0.0245  0.0340  354 PHE A CG  
2902 C CD1 . PHE A 372 ? 0.3566 0.2886 0.3010 -0.0815 0.0333  0.0460  354 PHE A CD1 
2903 C CD2 . PHE A 372 ? 0.3890 0.2740 0.3472 -0.0852 0.0180  0.0374  354 PHE A CD2 
2904 C CE1 . PHE A 372 ? 0.3710 0.3011 0.3181 -0.0885 0.0357  0.0660  354 PHE A CE1 
2905 C CE2 . PHE A 372 ? 0.3938 0.2714 0.3584 -0.0916 0.0193  0.0562  354 PHE A CE2 
2906 C CZ  . PHE A 372 ? 0.3806 0.2819 0.3386 -0.0936 0.0283  0.0726  354 PHE A CZ  
2907 N N   . GLY A 373 ? 0.3504 0.2305 0.2694 -0.0575 0.0139  0.0032  355 GLY A N   
2908 C CA  . GLY A 373 ? 0.3720 0.2349 0.2881 -0.0516 0.0113  0.0004  355 GLY A CA  
2909 C C   . GLY A 373 ? 0.3680 0.2364 0.2715 -0.0421 0.0135  -0.0040 355 GLY A C   
2910 O O   . GLY A 373 ? 0.3943 0.2554 0.2982 -0.0353 0.0132  -0.0032 355 GLY A O   
2911 N N   . ASP A 374 ? 0.3573 0.2389 0.2526 -0.0417 0.0150  -0.0079 356 ASP A N   
2912 C CA  . ASP A 374 ? 0.3558 0.2459 0.2419 -0.0362 0.0174  -0.0096 356 ASP A CA  
2913 C C   . ASP A 374 ? 0.3498 0.2515 0.2340 -0.0368 0.0203  -0.0026 356 ASP A C   
2914 O O   . ASP A 374 ? 0.3662 0.2735 0.2484 -0.0329 0.0213  0.0000  356 ASP A O   
2915 C CB  . ASP A 374 ? 0.3472 0.2434 0.2257 -0.0370 0.0160  -0.0156 356 ASP A CB  
2916 C CG  . ASP A 374 ? 0.3656 0.2565 0.2398 -0.0352 0.0129  -0.0253 356 ASP A CG  
2917 O OD1 . ASP A 374 ? 0.3882 0.2717 0.2645 -0.0300 0.0131  -0.0308 356 ASP A OD1 
2918 O OD2 . ASP A 374 ? 0.3511 0.2461 0.2193 -0.0380 0.0095  -0.0283 356 ASP A OD2 
2919 N N   . ILE A 375 ? 0.3330 0.2408 0.2187 -0.0408 0.0210  -0.0019 357 ILE A N   
2920 C CA  . ILE A 375 ? 0.3184 0.2371 0.2007 -0.0404 0.0225  -0.0016 357 ILE A CA  
2921 C C   . ILE A 375 ? 0.3178 0.2459 0.1990 -0.0408 0.0257  0.0046  357 ILE A C   
2922 O O   . ILE A 375 ? 0.2996 0.2349 0.1750 -0.0386 0.0256  0.0073  357 ILE A O   
2923 C CB  . ILE A 375 ? 0.3193 0.2397 0.2044 -0.0416 0.0207  -0.0072 357 ILE A CB  
2924 C CG1 . ILE A 375 ? 0.3323 0.2459 0.2149 -0.0420 0.0168  -0.0090 357 ILE A CG1 
2925 C CG2 . ILE A 375 ? 0.3192 0.2474 0.2028 -0.0403 0.0210  -0.0112 357 ILE A CG2 
2926 C CD1 . ILE A 375 ? 0.3174 0.2329 0.1943 -0.0418 0.0170  -0.0077 357 ILE A CD1 
2927 N N   . LEU A 376 ? 0.3096 0.2415 0.1964 -0.0444 0.0284  0.0081  358 LEU A N   
2928 C CA  . LEU A 376 ? 0.3209 0.2662 0.2048 -0.0461 0.0328  0.0169  358 LEU A CA  
2929 C C   . LEU A 376 ? 0.3293 0.2683 0.2098 -0.0449 0.0310  0.0287  358 LEU A C   
2930 O O   . LEU A 376 ? 0.3283 0.2797 0.1995 -0.0430 0.0315  0.0345  358 LEU A O   
2931 C CB  . LEU A 376 ? 0.3190 0.2720 0.2133 -0.0522 0.0369  0.0216  358 LEU A CB  
2932 C CG  . LEU A 376 ? 0.3414 0.3146 0.2332 -0.0565 0.0437  0.0341  358 LEU A CG  
2933 C CD1 . LEU A 376 ? 0.3610 0.3525 0.2655 -0.0615 0.0496  0.0333  358 LEU A CD1 
2934 C CD2 . LEU A 376 ? 0.3544 0.3159 0.2472 -0.0610 0.0419  0.0526  358 LEU A CD2 
2935 N N   . LYS A 377 ? 0.3275 0.2473 0.2160 -0.0450 0.0276  0.0316  359 LYS A N   
2936 C CA  . LYS A 377 ? 0.3518 0.2622 0.2416 -0.0419 0.0245  0.0436  359 LYS A CA  
2937 C C   . LYS A 377 ? 0.3391 0.2543 0.2230 -0.0332 0.0216  0.0402  359 LYS A C   
2938 O O   . LYS A 377 ? 0.3489 0.2701 0.2298 -0.0299 0.0193  0.0510  359 LYS A O   
2939 C CB  . LYS A 377 ? 0.3627 0.2483 0.2658 -0.0432 0.0205  0.0441  359 LYS A CB  
2940 C CG  . LYS A 377 ? 0.3947 0.2780 0.3078 -0.0545 0.0221  0.0543  359 LYS A CG  
2941 C CD  . LYS A 377 ? 0.4394 0.3287 0.3511 -0.0579 0.0235  0.0763  359 LYS A CD  
2942 C CE  . LYS A 377 ? 0.4751 0.3688 0.3982 -0.0718 0.0270  0.0886  359 LYS A CE  
2943 N NZ  . LYS A 377 ? 0.5178 0.4176 0.4392 -0.0772 0.0284  0.1148  359 LYS A NZ  
2944 N N   . SER A 378 ? 0.3357 0.2519 0.2187 -0.0305 0.0213  0.0270  360 SER A N   
2945 C CA  . SER A 378 ? 0.3361 0.2619 0.2174 -0.0242 0.0191  0.0247  360 SER A CA  
2946 C C   . SER A 378 ? 0.3316 0.2770 0.2040 -0.0264 0.0185  0.0264  360 SER A C   
2947 O O   . SER A 378 ? 0.3385 0.2954 0.2099 -0.0222 0.0147  0.0310  360 SER A O   
2948 C CB  . SER A 378 ? 0.3427 0.2690 0.2257 -0.0230 0.0199  0.0131  360 SER A CB  
2949 O OG  . SER A 378 ? 0.3243 0.2540 0.2028 -0.0293 0.0212  0.0070  360 SER A OG  
2950 N N   . LYS A 379 ? 0.3169 0.2675 0.1838 -0.0317 0.0213  0.0212  361 LYS A N   
2951 C CA  . LYS A 379 ? 0.3254 0.2942 0.1827 -0.0330 0.0205  0.0179  361 LYS A CA  
2952 C C   . LYS A 379 ? 0.3302 0.3111 0.1789 -0.0322 0.0206  0.0314  361 LYS A C   
2953 O O   . LYS A 379 ? 0.3183 0.3138 0.1600 -0.0298 0.0158  0.0340  361 LYS A O   
2954 C CB  . LYS A 379 ? 0.3220 0.2929 0.1779 -0.0361 0.0239  0.0069  361 LYS A CB  
2955 C CG  . LYS A 379 ? 0.3418 0.3315 0.1872 -0.0358 0.0235  -0.0017 361 LYS A CG  
2956 C CD  . LYS A 379 ? 0.3561 0.3502 0.1999 -0.0358 0.0163  -0.0092 361 LYS A CD  
2957 C CE  . LYS A 379 ? 0.3703 0.3494 0.2252 -0.0384 0.0132  -0.0181 361 LYS A CE  
2958 N NZ  . LYS A 379 ? 0.3892 0.3749 0.2456 -0.0415 0.0055  -0.0262 361 LYS A NZ  
2959 N N   . LYS A 380 ? 0.3361 0.3134 0.1859 -0.0354 0.0253  0.0414  362 LYS A N   
2960 C CA  . LYS A 380 ? 0.3603 0.3520 0.2005 -0.0370 0.0264  0.0581  362 LYS A CA  
2961 C C   . LYS A 380 ? 0.3562 0.3399 0.1992 -0.0327 0.0197  0.0756  362 LYS A C   
2962 O O   . LYS A 380 ? 0.3462 0.3464 0.1778 -0.0314 0.0166  0.0879  362 LYS A O   
2963 C CB  . LYS A 380 ? 0.3751 0.3677 0.2193 -0.0442 0.0338  0.0666  362 LYS A CB  
2964 C CG  . LYS A 380 ? 0.3948 0.4052 0.2358 -0.0461 0.0408  0.0518  362 LYS A CG  
2965 C CD  . LYS A 380 ? 0.4187 0.4382 0.2672 -0.0538 0.0491  0.0623  362 LYS A CD  
2966 C CE  . LYS A 380 ? 0.5039 0.5413 0.3421 -0.0586 0.0524  0.0848  362 LYS A CE  
2967 N NZ  . LYS A 380 ? 0.5614 0.6260 0.4020 -0.0657 0.0638  0.0893  362 LYS A NZ  
2968 N N   . ARG A 381 ? 0.3508 0.3103 0.2091 -0.0292 0.0167  0.0756  363 ARG A N   
2969 C CA  . ARG A 381 ? 0.3832 0.3314 0.2489 -0.0229 0.0099  0.0912  363 ARG A CA  
2970 C C   . ARG A 381 ? 0.3603 0.3194 0.2272 -0.0134 0.0035  0.0856  363 ARG A C   
2971 O O   . ARG A 381 ? 0.3631 0.3252 0.2321 -0.0069 -0.0035 0.0998  363 ARG A O   
2972 C CB  . ARG A 381 ? 0.3979 0.3147 0.2816 -0.0218 0.0089  0.0904  363 ARG A CB  
2973 C CG  . ARG A 381 ? 0.4466 0.3514 0.3353 -0.0328 0.0129  0.0990  363 ARG A CG  
2974 C CD  . ARG A 381 ? 0.5755 0.4674 0.4709 -0.0358 0.0087  0.1243  363 ARG A CD  
2975 N NE  . ARG A 381 ? 0.6338 0.5234 0.5302 -0.0242 0.0002  0.1345  363 ARG A NE  
2976 C CZ  . ARG A 381 ? 0.7196 0.5885 0.6276 -0.0210 -0.0077 0.1549  363 ARG A CZ  
2977 N NH1 . ARG A 381 ? 0.7594 0.6066 0.6785 -0.0315 -0.0082 0.1708  363 ARG A NH1 
2978 N NH2 . ARG A 381 ? 0.7585 0.6295 0.6690 -0.0074 -0.0162 0.1607  363 ARG A NH2 
2979 N N   . GLN A 382 ? 0.3457 0.3115 0.2135 -0.0132 0.0052  0.0667  364 GLN A N   
2980 C CA  . GLN A 382 ? 0.3487 0.3255 0.2241 -0.0058 0.0000  0.0614  364 GLN A CA  
2981 C C   . GLN A 382 ? 0.3418 0.3403 0.2105 -0.0105 -0.0010 0.0489  364 GLN A C   
2982 O O   . GLN A 382 ? 0.3313 0.3444 0.2081 -0.0067 -0.0059 0.0459  364 GLN A O   
2983 C CB  . GLN A 382 ? 0.3382 0.2997 0.2294 0.0003  0.0020  0.0519  364 GLN A CB  
2984 C CG  . GLN A 382 ? 0.3609 0.2964 0.2624 0.0062  0.0007  0.0596  364 GLN A CG  
2985 C CD  . GLN A 382 ? 0.4050 0.3407 0.3138 0.0160  -0.0079 0.0769  364 GLN A CD  
2986 O OE1 . GLN A 382 ? 0.3993 0.3583 0.3083 0.0212  -0.0130 0.0799  364 GLN A OE1 
2987 N NE2 . GLN A 382 ? 0.4155 0.3254 0.3317 0.0179  -0.0110 0.0895  364 GLN A NE2 
2988 N N   . GLY A 383 ? 0.3182 0.3194 0.1753 -0.0185 0.0029  0.0411  365 GLY A N   
2989 C CA  . GLY A 383 ? 0.3320 0.3485 0.1852 -0.0231 0.0000  0.0274  365 GLY A CA  
2990 C C   . GLY A 383 ? 0.3181 0.3300 0.1850 -0.0252 0.0004  0.0174  365 GLY A C   
2991 O O   . GLY A 383 ? 0.3276 0.3537 0.1991 -0.0287 -0.0048 0.0106  365 GLY A O   
2992 N N   . TRP A 384 ? 0.2967 0.2908 0.1699 -0.0244 0.0063  0.0167  366 TRP A N   
2993 C CA  . TRP A 384 ? 0.2978 0.2892 0.1797 -0.0277 0.0084  0.0093  366 TRP A CA  
2994 C C   . TRP A 384 ? 0.2940 0.2802 0.1718 -0.0362 0.0082  0.0003  366 TRP A C   
2995 O O   . TRP A 384 ? 0.3045 0.2852 0.1740 -0.0370 0.0092  -0.0024 366 TRP A O   
2996 C CB  . TRP A 384 ? 0.2961 0.2723 0.1819 -0.0237 0.0137  0.0101  366 TRP A CB  
2997 C CG  . TRP A 384 ? 0.3017 0.2813 0.1969 -0.0134 0.0132  0.0143  366 TRP A CG  
2998 C CD1 . TRP A 384 ? 0.3101 0.3013 0.2105 -0.0064 0.0081  0.0216  366 TRP A CD1 
2999 C CD2 . TRP A 384 ? 0.2952 0.2661 0.1961 -0.0073 0.0172  0.0099  366 TRP A CD2 
3000 N NE1 . TRP A 384 ? 0.3136 0.3024 0.2262 0.0049  0.0087  0.0219  366 TRP A NE1 
3001 C CE2 . TRP A 384 ? 0.3101 0.2869 0.2224 0.0046  0.0147  0.0130  366 TRP A CE2 
3002 C CE3 . TRP A 384 ? 0.2963 0.2569 0.1934 -0.0100 0.0217  0.0026  366 TRP A CE3 
3003 C CZ2 . TRP A 384 ? 0.3092 0.2804 0.2299 0.0148  0.0175  0.0061  366 TRP A CZ2 
3004 C CZ3 . TRP A 384 ? 0.3357 0.2929 0.2375 -0.0014 0.0242  -0.0038 366 TRP A CZ3 
3005 C CH2 . TRP A 384 ? 0.3139 0.2764 0.2280 0.0114  0.0227  -0.0037 366 TRP A CH2 
3006 N N   . ARG A 385 ? 0.3037 0.2933 0.1895 -0.0423 0.0065  -0.0037 367 ARG A N   
3007 C CA  . ARG A 385 ? 0.3011 0.2783 0.1874 -0.0495 0.0054  -0.0102 367 ARG A CA  
3008 C C   . ARG A 385 ? 0.3107 0.2733 0.1958 -0.0484 0.0106  -0.0072 367 ARG A C   
3009 O O   . ARG A 385 ? 0.2917 0.2565 0.1779 -0.0449 0.0147  -0.0027 367 ARG A O   
3010 C CB  . ARG A 385 ? 0.3149 0.2982 0.2122 -0.0591 0.0001  -0.0124 367 ARG A CB  
3011 C CG  . ARG A 385 ? 0.3114 0.3137 0.2132 -0.0616 -0.0070 -0.0159 367 ARG A CG  
3012 C CD  . ARG A 385 ? 0.3553 0.3587 0.2450 -0.0586 -0.0116 -0.0251 367 ARG A CD  
3013 N NE  . ARG A 385 ? 0.3572 0.3426 0.2436 -0.0608 -0.0129 -0.0365 367 ARG A NE  
3014 C CZ  . ARG A 385 ? 0.3799 0.3598 0.2727 -0.0677 -0.0213 -0.0488 367 ARG A CZ  
3015 N NH1 . ARG A 385 ? 0.3798 0.3716 0.2831 -0.0762 -0.0294 -0.0506 367 ARG A NH1 
3016 N NH2 . ARG A 385 ? 0.4021 0.3642 0.2939 -0.0662 -0.0226 -0.0604 367 ARG A NH2 
3017 N N   . THR A 386 ? 0.3019 0.2508 0.1850 -0.0500 0.0098  -0.0115 368 THR A N   
3018 C CA  . THR A 386 ? 0.2988 0.2363 0.1799 -0.0480 0.0128  -0.0093 368 THR A CA  
3019 C C   . THR A 386 ? 0.2897 0.2153 0.1749 -0.0526 0.0090  -0.0097 368 THR A C   
3020 O O   . THR A 386 ? 0.3029 0.2225 0.1931 -0.0549 0.0040  -0.0154 368 THR A O   
3021 C CB  . THR A 386 ? 0.3017 0.2366 0.1790 -0.0435 0.0152  -0.0115 368 THR A CB  
3022 O OG1 . THR A 386 ? 0.3079 0.2454 0.1850 -0.0433 0.0132  -0.0194 368 THR A OG1 
3023 C CG2 . THR A 386 ? 0.2764 0.2175 0.1503 -0.0395 0.0182  -0.0059 368 THR A CG2 
3024 N N   . PHE A 387 ? 0.2975 0.2197 0.1804 -0.0531 0.0104  -0.0041 369 PHE A N   
3025 C CA  . PHE A 387 ? 0.3072 0.2185 0.1923 -0.0565 0.0058  0.0001  369 PHE A CA  
3026 C C   . PHE A 387 ? 0.3036 0.2120 0.1837 -0.0521 0.0066  0.0002  369 PHE A C   
3027 O O   . PHE A 387 ? 0.2898 0.2045 0.1626 -0.0510 0.0100  0.0016  369 PHE A O   
3028 C CB  . PHE A 387 ? 0.3200 0.2373 0.2051 -0.0643 0.0059  0.0100  369 PHE A CB  
3029 C CG  . PHE A 387 ? 0.3168 0.2226 0.2038 -0.0697 -0.0001 0.0198  369 PHE A CG  
3030 C CD1 . PHE A 387 ? 0.3530 0.2525 0.2498 -0.0790 -0.0052 0.0268  369 PHE A CD1 
3031 C CD2 . PHE A 387 ? 0.3356 0.2379 0.2153 -0.0662 -0.0019 0.0235  369 PHE A CD2 
3032 C CE1 . PHE A 387 ? 0.3827 0.2693 0.2824 -0.0846 -0.0120 0.0402  369 PHE A CE1 
3033 C CE2 . PHE A 387 ? 0.3521 0.2452 0.2327 -0.0705 -0.0090 0.0358  369 PHE A CE2 
3034 C CZ  . PHE A 387 ? 0.3642 0.2482 0.2548 -0.0794 -0.0139 0.0453  369 PHE A CZ  
3035 N N   . LEU A 388 ? 0.3119 0.2122 0.1979 -0.0491 0.0025  -0.0030 370 LEU A N   
3036 C CA  . LEU A 388 ? 0.2979 0.1981 0.1834 -0.0461 0.0011  -0.0032 370 LEU A CA  
3037 C C   . LEU A 388 ? 0.3097 0.2043 0.1945 -0.0477 -0.0061 0.0047  370 LEU A C   
3038 O O   . LEU A 388 ? 0.3238 0.2085 0.2175 -0.0473 -0.0122 0.0072  370 LEU A O   
3039 C CB  . LEU A 388 ? 0.2945 0.1964 0.1899 -0.0412 0.0016  -0.0105 370 LEU A CB  
3040 C CG  . LEU A 388 ? 0.2961 0.2019 0.1956 -0.0397 -0.0004 -0.0107 370 LEU A CG  
3041 C CD1 . LEU A 388 ? 0.2989 0.2083 0.1920 -0.0424 0.0036  -0.0109 370 LEU A CD1 
3042 C CD2 . LEU A 388 ? 0.2985 0.2112 0.2124 -0.0348 0.0005  -0.0173 370 LEU A CD2 
3043 N N   . VAL A 389 ? 0.3141 0.2146 0.1886 -0.0487 -0.0067 0.0079  371 VAL A N   
3044 C CA  . VAL A 389 ? 0.3369 0.2367 0.2063 -0.0502 -0.0145 0.0174  371 VAL A CA  
3045 C C   . VAL A 389 ? 0.3336 0.2334 0.2124 -0.0451 -0.0207 0.0127  371 VAL A C   
3046 O O   . VAL A 389 ? 0.3344 0.2401 0.2143 -0.0440 -0.0178 0.0040  371 VAL A O   
3047 C CB  . VAL A 389 ? 0.3553 0.2677 0.2053 -0.0533 -0.0117 0.0207  371 VAL A CB  
3048 C CG1 . VAL A 389 ? 0.4107 0.3270 0.2513 -0.0546 -0.0207 0.0308  371 VAL A CG1 
3049 C CG2 . VAL A 389 ? 0.3786 0.2979 0.2235 -0.0585 -0.0044 0.0267  371 VAL A CG2 
3050 N N   . ILE A 390 ? 0.3344 0.2276 0.2230 -0.0423 -0.0299 0.0190  372 ILE A N   
3051 C CA  . ILE A 390 ? 0.3284 0.2267 0.2309 -0.0362 -0.0366 0.0147  372 ILE A CA  
3052 C C   . ILE A 390 ? 0.3405 0.2395 0.2378 -0.0360 -0.0490 0.0275  372 ILE A C   
3053 O O   . ILE A 390 ? 0.3592 0.2469 0.2660 -0.0327 -0.0572 0.0370  372 ILE A O   
3054 C CB  . ILE A 390 ? 0.3212 0.2149 0.2461 -0.0286 -0.0369 0.0077  372 ILE A CB  
3055 C CG1 . ILE A 390 ? 0.3164 0.2111 0.2415 -0.0295 -0.0252 -0.0025 372 ILE A CG1 
3056 C CG2 . ILE A 390 ? 0.3117 0.2190 0.2543 -0.0223 -0.0417 0.0025  372 ILE A CG2 
3057 C CD1 . ILE A 390 ? 0.3102 0.2050 0.2541 -0.0208 -0.0241 -0.0134 372 ILE A CD1 
3058 N N   . PRO A 391 ? 0.3709 0.2821 0.2515 -0.0396 -0.0513 0.0280  373 PRO A N   
3059 C CA  . PRO A 391 ? 0.3946 0.3108 0.2642 -0.0401 -0.0635 0.0420  373 PRO A CA  
3060 C C   . PRO A 391 ? 0.4005 0.3146 0.2897 -0.0326 -0.0778 0.0491  373 PRO A C   
3061 O O   . PRO A 391 ? 0.4101 0.3181 0.2956 -0.0321 -0.0878 0.0670  373 PRO A O   
3062 C CB  . PRO A 391 ? 0.3996 0.3323 0.2501 -0.0436 -0.0637 0.0334  373 PRO A CB  
3063 C CG  . PRO A 391 ? 0.4070 0.3375 0.2525 -0.0463 -0.0492 0.0210  373 PRO A CG  
3064 C CD  . PRO A 391 ? 0.3572 0.2772 0.2269 -0.0431 -0.0439 0.0158  373 PRO A CD  
3065 N N   . GLU A 392 ? 0.3884 0.3089 0.3004 -0.0265 -0.0788 0.0367  374 GLU A N   
3066 C CA  . GLU A 392 ? 0.4080 0.3310 0.3447 -0.0166 -0.0917 0.0406  374 GLU A CA  
3067 C C   . GLU A 392 ? 0.4165 0.3187 0.3703 -0.0088 -0.0943 0.0465  374 GLU A C   
3068 O O   . GLU A 392 ? 0.4212 0.3220 0.3953 0.0013  -0.1069 0.0519  374 GLU A O   
3069 C CB  . GLU A 392 ? 0.3922 0.3326 0.3535 -0.0123 -0.0891 0.0250  374 GLU A CB  
3070 C CG  . GLU A 392 ? 0.4169 0.3747 0.3698 -0.0206 -0.0881 0.0165  374 GLU A CG  
3071 C CD  . GLU A 392 ? 0.3908 0.3454 0.3391 -0.0273 -0.0715 0.0049  374 GLU A CD  
3072 O OE1 . GLU A 392 ? 0.3319 0.2718 0.2635 -0.0299 -0.0626 0.0069  374 GLU A OE1 
3073 O OE2 . GLU A 392 ? 0.3641 0.3322 0.3278 -0.0305 -0.0682 -0.0045 374 GLU A OE2 
3074 N N   . LEU A 393 ? 0.4293 0.3155 0.3780 -0.0128 -0.0835 0.0436  375 LEU A N   
3075 C CA  . LEU A 393 ? 0.4490 0.3121 0.4144 -0.0069 -0.0867 0.0453  375 LEU A CA  
3076 C C   . LEU A 393 ? 0.4960 0.3428 0.4609 -0.0067 -0.1026 0.0686  375 LEU A C   
3077 O O   . LEU A 393 ? 0.5150 0.3444 0.5034 0.0035  -0.1130 0.0712  375 LEU A O   
3078 C CB  . LEU A 393 ? 0.4457 0.2978 0.4018 -0.0146 -0.0742 0.0391  375 LEU A CB  
3079 C CG  . LEU A 393 ? 0.4571 0.2886 0.4317 -0.0090 -0.0747 0.0302  375 LEU A CG  
3080 C CD1 . LEU A 393 ? 0.4243 0.2632 0.4243 0.0065  -0.0744 0.0111  375 LEU A CD1 
3081 C CD2 . LEU A 393 ? 0.4333 0.2625 0.3952 -0.0186 -0.0626 0.0234  375 LEU A CD2 
3082 N N   . ALA A 394 ? 0.5169 0.3714 0.4551 -0.0172 -0.1044 0.0854  376 ALA A N   
3083 C CA  . ALA A 394 ? 0.5599 0.4048 0.4913 -0.0198 -0.1187 0.1125  376 ALA A CA  
3084 C C   . ALA A 394 ? 0.5803 0.4225 0.5365 -0.0050 -0.1365 0.1172  376 ALA A C   
3085 O O   . ALA A 394 ? 0.6259 0.4427 0.6023 0.0014  -0.1477 0.1282  376 ALA A O   
3086 C CB  . ALA A 394 ? 0.5740 0.4422 0.4694 -0.0308 -0.1166 0.1240  376 ALA A CB  
3087 N N   . GLN A 395 ? 0.5654 0.4334 0.5251 0.0010  -0.1390 0.1062  377 GLN A N   
3088 C CA  . GLN A 395 ? 0.5717 0.4447 0.5598 0.0164  -0.1552 0.1077  377 GLN A CA  
3089 C C   . GLN A 395 ? 0.5533 0.4208 0.5796 0.0315  -0.1517 0.0867  377 GLN A C   
3090 O O   . GLN A 395 ? 0.5830 0.4409 0.6372 0.0464  -0.1659 0.0916  377 GLN A O   
3091 C CB  . GLN A 395 ? 0.5791 0.4864 0.5585 0.0156  -0.1617 0.1052  377 GLN A CB  
3092 C CG  . GLN A 395 ? 0.6114 0.5289 0.6134 0.0293  -0.1845 0.1171  377 GLN A CG  
3093 C CD  . GLN A 395 ? 0.6863 0.5784 0.6893 0.0338  -0.2017 0.1470  377 GLN A CD  
3094 O OE1 . GLN A 395 ? 0.7410 0.6153 0.7185 0.0221  -0.1989 0.1650  377 GLN A OE1 
3095 N NE2 . GLN A 395 ? 0.7217 0.6134 0.7569 0.0509  -0.2202 0.1538  377 GLN A NE2 
3096 N N   . GLU A 396 ? 0.5089 0.3835 0.5367 0.0291  -0.1335 0.0638  378 GLU A N   
3097 C CA  . GLU A 396 ? 0.4933 0.3684 0.5531 0.0432  -0.1279 0.0425  378 GLU A CA  
3098 C C   . GLU A 396 ? 0.5150 0.3540 0.5912 0.0520  -0.1339 0.0433  378 GLU A C   
3099 O O   . GLU A 396 ? 0.5078 0.3446 0.6161 0.0698  -0.1381 0.0299  378 GLU A O   
3100 C CB  . GLU A 396 ? 0.4650 0.3544 0.5164 0.0361  -0.1069 0.0222  378 GLU A CB  
3101 C CG  . GLU A 396 ? 0.4319 0.3551 0.4787 0.0295  -0.1008 0.0162  378 GLU A CG  
3102 C CD  . GLU A 396 ? 0.4032 0.3541 0.4787 0.0385  -0.0925 -0.0023 378 GLU A CD  
3103 O OE1 . GLU A 396 ? 0.3990 0.3460 0.4946 0.0513  -0.0888 -0.0143 378 GLU A OE1 
3104 O OE2 . GLU A 396 ? 0.3578 0.3361 0.4367 0.0324  -0.0899 -0.0053 378 GLU A OE2 
3105 N N   . LEU A 397 ? 0.5190 0.3314 0.5750 0.0392  -0.1338 0.0571  379 LEU A N   
3106 C CA  . LEU A 397 ? 0.5607 0.3336 0.6326 0.0436  -0.1431 0.0619  379 LEU A CA  
3107 C C   . LEU A 397 ? 0.5950 0.3515 0.6884 0.0559  -0.1657 0.0814  379 LEU A C   
3108 O O   . LEU A 397 ? 0.6405 0.3728 0.7656 0.0717  -0.1752 0.0730  379 LEU A O   
3109 C CB  . LEU A 397 ? 0.5607 0.3138 0.6085 0.0238  -0.1386 0.0760  379 LEU A CB  
3110 C CG  . LEU A 397 ? 0.5501 0.3108 0.5846 0.0149  -0.1197 0.0558  379 LEU A CG  
3111 C CD1 . LEU A 397 ? 0.5461 0.3020 0.5540 -0.0060 -0.1141 0.0729  379 LEU A CD1 
3112 C CD2 . LEU A 397 ? 0.5679 0.3082 0.6267 0.0254  -0.1199 0.0331  379 LEU A CD2 
3113 N N   A HIS A 398 ? 0.6064 0.3760 0.6831 0.0500  -0.1755 0.1066  380 HIS A N   
3114 N N   B HIS A 398 ? 0.6046 0.3744 0.6814 0.0500  -0.1755 0.1066  380 HIS A N   
3115 C CA  A HIS A 398 ? 0.6336 0.3908 0.7293 0.0620  -0.1990 0.1290  380 HIS A CA  
3116 C CA  B HIS A 398 ? 0.6317 0.3906 0.7275 0.0624  -0.1990 0.1285  380 HIS A CA  
3117 C C   A HIS A 398 ? 0.6289 0.3995 0.7646 0.0870  -0.2058 0.1095  380 HIS A C   
3118 C C   B HIS A 398 ? 0.6269 0.3969 0.7632 0.0872  -0.2050 0.1079  380 HIS A C   
3119 O O   A HIS A 398 ? 0.6525 0.3969 0.8200 0.1038  -0.2221 0.1141  380 HIS A O   
3120 O O   B HIS A 398 ? 0.6492 0.3917 0.8177 0.1039  -0.2200 0.1104  380 HIS A O   
3121 C CB  A HIS A 398 ? 0.6474 0.4241 0.7131 0.0511  -0.2083 0.1586  380 HIS A CB  
3122 C CB  B HIS A 398 ? 0.6392 0.4238 0.7079 0.0538  -0.2077 0.1536  380 HIS A CB  
3123 C CG  A HIS A 398 ? 0.6696 0.4266 0.7068 0.0317  -0.2092 0.1877  380 HIS A CG  
3124 C CG  B HIS A 398 ? 0.6749 0.4580 0.7643 0.0689  -0.2328 0.1741  380 HIS A CG  
3125 N ND1 A HIS A 398 ? 0.7174 0.4397 0.7658 0.0319  -0.2270 0.2175  380 HIS A ND1 
3126 N ND1 B HIS A 398 ? 0.7202 0.4674 0.8176 0.0707  -0.2514 0.2045  380 HIS A ND1 
3127 C CD2 A HIS A 398 ? 0.6506 0.4200 0.6513 0.0114  -0.1942 0.1922  380 HIS A CD2 
3128 C CD2 B HIS A 398 ? 0.6722 0.4859 0.7783 0.0829  -0.2436 0.1700  380 HIS A CD2 
3129 C CE1 A HIS A 398 ? 0.7261 0.4429 0.7452 0.0106  -0.2218 0.2406  380 HIS A CE1 
3130 C CE1 B HIS A 398 ? 0.7360 0.4909 0.8528 0.0866  -0.2730 0.2188  380 HIS A CE1 
3131 N NE2 A HIS A 398 ? 0.6716 0.4184 0.6618 -0.0011 -0.2014 0.2244  380 HIS A NE2 
3132 N NE2 B HIS A 398 ? 0.7038 0.5009 0.8267 0.0944  -0.2688 0.1974  380 HIS A NE2 
3133 N N   . VAL A 399 ? 0.5906 0.4020 0.7272 0.0895  -0.1936 0.0882  381 VAL A N   
3134 C CA  . VAL A 399 ? 0.5850 0.4191 0.7612 0.1117  -0.1957 0.0672  381 VAL A CA  
3135 C C   . VAL A 399 ? 0.5849 0.4006 0.7866 0.1254  -0.1869 0.0401  381 VAL A C   
3136 O O   . VAL A 399 ? 0.6129 0.4237 0.8530 0.1485  -0.1973 0.0308  381 VAL A O   
3137 C CB  . VAL A 399 ? 0.5397 0.4241 0.7111 0.1063  -0.1822 0.0516  381 VAL A CB  
3138 C CG1 . VAL A 399 ? 0.5080 0.4215 0.7228 0.1276  -0.1821 0.0310  381 VAL A CG1 
3139 C CG2 . VAL A 399 ? 0.5546 0.4598 0.7018 0.0938  -0.1921 0.0722  381 VAL A CG2 
3140 N N   . TRP A 400 ? 0.5820 0.3895 0.7628 0.1124  -0.1686 0.0260  382 TRP A N   
3141 C CA  . TRP A 400 ? 0.5903 0.3838 0.7894 0.1239  -0.1598 -0.0028 382 TRP A CA  
3142 C C   . TRP A 400 ? 0.6421 0.3876 0.8677 0.1380  -0.1794 0.0021  382 TRP A C   
3143 O O   . TRP A 400 ? 0.6437 0.3846 0.9033 0.1608  -0.1821 -0.0218 382 TRP A O   
3144 C CB  . TRP A 400 ? 0.5791 0.3681 0.7472 0.1052  -0.1412 -0.0130 382 TRP A CB  
3145 C CG  . TRP A 400 ? 0.5751 0.3528 0.7576 0.1160  -0.1333 -0.0440 382 TRP A CG  
3146 C CD1 . TRP A 400 ? 0.6133 0.3480 0.7987 0.1146  -0.1398 -0.0488 382 TRP A CD1 
3147 C CD2 . TRP A 400 ? 0.5710 0.3831 0.7673 0.1298  -0.1187 -0.0748 382 TRP A CD2 
3148 N NE1 . TRP A 400 ? 0.6123 0.3516 0.8106 0.1278  -0.1310 -0.0837 382 TRP A NE1 
3149 C CE2 . TRP A 400 ? 0.5986 0.3873 0.8021 0.1376  -0.1169 -0.0996 382 TRP A CE2 
3150 C CE3 . TRP A 400 ? 0.5524 0.4153 0.7554 0.1347  -0.1065 -0.0836 382 TRP A CE3 
3151 C CZ2 . TRP A 400 ? 0.5856 0.4026 0.7993 0.1519  -0.1027 -0.1333 382 TRP A CZ2 
3152 C CZ3 . TRP A 400 ? 0.5396 0.4311 0.7552 0.1474  -0.0915 -0.1139 382 TRP A CZ3 
3153 C CH2 . TRP A 400 ? 0.5623 0.4322 0.7812 0.1566  -0.0893 -0.1387 382 TRP A CH2 
3154 N N   . THR A 401 ? 0.6787 0.3900 0.8897 0.1245  -0.1930 0.0334  383 THR A N   
3155 C CA  . THR A 401 ? 0.7417 0.4004 0.9774 0.1334  -0.2138 0.0447  383 THR A CA  
3156 C C   . THR A 401 ? 0.7786 0.4361 1.0477 0.1560  -0.2358 0.0580  383 THR A C   
3157 O O   . THR A 401 ? 0.8197 0.4530 1.1284 0.1796  -0.2473 0.0430  383 THR A O   
3158 C CB  . THR A 401 ? 0.7630 0.3865 0.9724 0.1076  -0.2198 0.0776  383 THR A CB  
3159 O OG1 . THR A 401 ? 0.8428 0.4124 1.0806 0.1150  -0.2411 0.0899  383 THR A OG1 
3160 C CG2 . THR A 401 ? 0.7851 0.4294 0.9661 0.0934  -0.2246 0.1136  383 THR A CG2 
3161 N N   . ASP A 402 ? 0.7780 0.4623 1.0321 0.1502  -0.2427 0.0846  384 ASP A N   
3162 C CA  . ASP A 402 ? 0.8023 0.4922 1.0853 0.1703  -0.2654 0.1010  384 ASP A CA  
3163 C C   . ASP A 402 ? 0.7915 0.5093 1.1177 0.1996  -0.2631 0.0676  384 ASP A C   
3164 O O   . ASP A 402 ? 0.8217 0.5277 1.1874 0.2242  -0.2830 0.0712  384 ASP A O   
3165 C CB  . ASP A 402 ? 0.7966 0.5220 1.0489 0.1561  -0.2697 0.1288  384 ASP A CB  
3166 C CG  . ASP A 402 ? 0.8346 0.5799 1.1151 0.1765  -0.2920 0.1422  384 ASP A CG  
3167 O OD1 . ASP A 402 ? 0.9418 0.6529 1.2418 0.1877  -0.3164 0.1676  384 ASP A OD1 
3168 O OD2 . ASP A 402 ? 0.8691 0.6653 1.1541 0.1807  -0.2863 0.1286  384 ASP A OD2 
3169 N N   . LYS A 403 ? 0.7485 0.5043 1.0691 0.1976  -0.2389 0.0359  385 LYS A N   
3170 C CA  . LYS A 403 ? 0.7380 0.5323 1.0974 0.2229  -0.2326 0.0047  385 LYS A CA  
3171 C C   . LYS A 403 ? 0.7296 0.5175 1.0995 0.2322  -0.2148 -0.0348 385 LYS A C   
3172 O O   . LYS A 403 ? 0.7151 0.5471 1.1035 0.2453  -0.2000 -0.0629 385 LYS A O   
3173 C CB  . LYS A 403 ? 0.7061 0.5636 1.0539 0.2131  -0.2198 0.0026  385 LYS A CB  
3174 C CG  . LYS A 403 ? 0.7205 0.5951 1.0634 0.2083  -0.2391 0.0346  385 LYS A CG  
3175 C CD  . LYS A 403 ? 0.7551 0.6433 1.1482 0.2380  -0.2595 0.0354  385 LYS A CD  
3176 C CE  . LYS A 403 ? 0.7715 0.6668 1.1584 0.2347  -0.2847 0.0715  385 LYS A CE  
3177 N NZ  . LYS A 403 ? 0.8082 0.7181 1.2483 0.2660  -0.3064 0.0727  385 LYS A NZ  
3178 N N   . SER A 404 ? 1.1864 0.5831 0.9295 0.0978  -0.0347 0.0778  386 SER A N   
3179 C CA  . SER A 404 ? 1.1661 0.5514 0.9363 0.0456  -0.0295 0.0493  386 SER A CA  
3180 C C   . SER A 404 ? 1.2111 0.5827 0.9326 0.0963  -0.0198 0.0559  386 SER A C   
3181 O O   . SER A 404 ? 1.1655 0.5776 0.9215 0.0677  -0.0357 0.0365  386 SER A O   
3182 C CB  . SER A 404 ? 1.2503 0.5071 1.0002 -0.0087 0.0274  0.0211  386 SER A CB  
3183 O OG  . SER A 404 ? 1.4015 0.5058 1.0444 0.0392  0.0994  0.0415  386 SER A OG  
3184 N N   . SER A 405 ? 1.3034 0.6147 0.9368 0.1782  0.0067  0.0824  387 SER A N   
3185 C CA  . SER A 405 ? 1.3583 0.6540 0.9390 0.2374  0.0171  0.0887  387 SER A CA  
3186 C C   . SER A 405 ? 1.2326 0.6851 0.8932 0.2454  -0.0384 0.0792  387 SER A C   
3187 O O   . SER A 405 ? 1.2349 0.6901 0.8925 0.2468  -0.0338 0.0700  387 SER A O   
3188 C CB  . SER A 405 ? 1.4942 0.7086 0.9592 0.3404  0.0478  0.1183  387 SER A CB  
3189 O OG  . SER A 405 ? 1.4488 0.7630 0.9369 0.3865  0.0044  0.1271  387 SER A OG  
3190 N N   . LEU A 406 ? 1.1242 0.7016 0.8583 0.2496  -0.0831 0.0782  388 LEU A N   
3191 C CA  . LEU A 406 ? 1.0153 0.7394 0.8427 0.2474  -0.1219 0.0620  388 LEU A CA  
3192 C C   . LEU A 406 ? 0.9459 0.6889 0.8266 0.1707  -0.1271 0.0499  388 LEU A C   
3193 O O   . LEU A 406 ? 0.9232 0.7082 0.8256 0.1749  -0.1277 0.0411  388 LEU A O   
3194 C CB  . LEU A 406 ? 0.9228 0.7730 0.8303 0.2590  -0.1601 0.0545  388 LEU A CB  
3195 C CG  . LEU A 406 ? 0.9681 0.8731 0.8534 0.3568  -0.1744 0.0480  388 LEU A CG  
3196 C CD1 . LEU A 406 ? 1.1104 0.8799 0.8609 0.4173  -0.1460 0.0753  388 LEU A CD1 
3197 C CD2 . LEU A 406 ? 0.8522 0.9100 0.8496 0.3533  -0.2149 0.0241  388 LEU A CD2 
3198 N N   . PHE A 407 ? 0.9152 0.6277 0.8123 0.1076  -0.1303 0.0464  389 PHE A N   
3199 C CA  . PHE A 407 ? 0.8704 0.5968 0.8000 0.0492  -0.1402 0.0305  389 PHE A CA  
3200 C C   . PHE A 407 ? 0.9518 0.5957 0.8195 0.0515  -0.1131 0.0183  389 PHE A C   
3201 O O   . PHE A 407 ? 0.9243 0.5971 0.7990 0.0454  -0.1191 0.0103  389 PHE A O   
3202 C CB  . PHE A 407 ? 0.8317 0.5491 0.7915 -0.0097 -0.1534 0.0186  389 PHE A CB  
3203 C CG  . PHE A 407 ? 0.7940 0.5428 0.7812 -0.0522 -0.1736 -0.0015 389 PHE A CG  
3204 C CD1 . PHE A 407 ? 0.7220 0.5584 0.7580 -0.0554 -0.1955 0.0075  389 PHE A CD1 
3205 C CD2 . PHE A 407 ? 0.8503 0.5385 0.8105 -0.0819 -0.1661 -0.0348 389 PHE A CD2 
3206 C CE1 . PHE A 407 ? 0.7212 0.5696 0.7551 -0.0773 -0.2096 -0.0059 389 PHE A CE1 
3207 C CE2 . PHE A 407 ? 0.8220 0.5452 0.7928 -0.1028 -0.1914 -0.0584 389 PHE A CE2 
3208 C CZ  . PHE A 407 ? 0.7514 0.5470 0.7470 -0.0951 -0.2129 -0.0389 389 PHE A CZ  
3209 N N   . GLU A 408 ? 1.0486 0.5819 0.8517 0.0625  -0.0765 0.0165  390 GLU A N   
3210 C CA  . GLU A 408 ? 1.1458 0.5928 0.8938 0.0642  -0.0429 -0.0003 390 GLU A CA  
3211 C C   . GLU A 408 ? 1.1546 0.6351 0.8835 0.1128  -0.0443 0.0112  390 GLU A C   
3212 O O   . GLU A 408 ? 1.1608 0.6412 0.8836 0.1000  -0.0435 -0.0054 390 GLU A O   
3213 C CB  . GLU A 408 ? 1.2658 0.5757 0.9448 0.0770  0.0130  0.0006  390 GLU A CB  
3214 C CG  . GLU A 408 ? 1.2855 0.5429 0.9899 0.0145  0.0317  -0.0288 390 GLU A CG  
3215 C CD  . GLU A 408 ? 1.4302 0.5359 1.0631 0.0301  0.1044  -0.0218 390 GLU A CD  
3216 O OE1 . GLU A 408 ? 1.4622 0.5402 1.1064 0.0090  0.1177  -0.0195 390 GLU A OE1 
3217 O OE2 . GLU A 408 ? 1.5574 0.5624 1.1172 0.0658  0.1547  -0.0170 390 GLU A OE2 
3218 N N   . GLU A 409 ? 1.1521 0.6700 0.8752 0.1716  -0.0485 0.0334  391 GLU A N   
3219 C CA  . GLU A 409 ? 1.1530 0.7262 0.8798 0.2187  -0.0521 0.0350  391 GLU A CA  
3220 C C   . GLU A 409 ? 1.0652 0.7297 0.8608 0.1835  -0.0731 0.0244  391 GLU A C   
3221 O O   . GLU A 409 ? 1.0848 0.7409 0.8632 0.1882  -0.0608 0.0174  391 GLU A O   
3222 C CB  . GLU A 409 ? 1.1498 0.7860 0.8859 0.2879  -0.0652 0.0435  391 GLU A CB  
3223 C CG  . GLU A 409 ? 1.1443 0.8581 0.9064 0.3363  -0.0694 0.0300  391 GLU A CG  
3224 C CD  . GLU A 409 ? 1.1857 0.9453 0.9326 0.4271  -0.0800 0.0248  391 GLU A CD  
3225 O OE1 . GLU A 409 ? 1.2147 0.9595 0.9330 0.4566  -0.0889 0.0356  391 GLU A OE1 
3226 O OE2 . GLU A 409 ? 1.2083 1.0219 0.9692 0.4752  -0.0802 0.0055  391 GLU A OE2 
3227 N N   . LEU A 410 ? 0.9778 0.7193 0.8435 0.1513  -0.0986 0.0250  392 LEU A N   
3228 C CA  . LEU A 410 ? 0.9144 0.7229 0.8339 0.1204  -0.1070 0.0200  392 LEU A CA  
3229 C C   . LEU A 410 ? 0.9527 0.7014 0.8232 0.0918  -0.1014 0.0113  392 LEU A C   
3230 O O   . LEU A 410 ? 0.9592 0.7202 0.8220 0.0977  -0.0898 0.0099  392 LEU A O   
3231 C CB  . LEU A 410 ? 0.8306 0.7076 0.8213 0.0880  -0.1303 0.0229  392 LEU A CB  
3232 C CG  . LEU A 410 ? 0.7709 0.7116 0.8187 0.0622  -0.1286 0.0224  392 LEU A CG  
3233 C CD1 . LEU A 410 ? 0.7810 0.7765 0.8693 0.0908  -0.1019 0.0136  392 LEU A CD1 
3234 C CD2 . LEU A 410 ? 0.6899 0.6923 0.8079 0.0353  -0.1493 0.0246  392 LEU A CD2 
3235 N N   . GLN A 411 ? 0.9829 0.6689 0.8217 0.0642  -0.1068 -0.0010 393 GLN A N   
3236 C CA  . GLN A 411 ? 1.0363 0.6799 0.8354 0.0435  -0.1079 -0.0262 393 GLN A CA  
3237 C C   . GLN A 411 ? 1.1144 0.7106 0.8587 0.0734  -0.0822 -0.0321 393 GLN A C   
3238 O O   . GLN A 411 ? 1.1345 0.7340 0.8518 0.0774  -0.0834 -0.0424 393 GLN A O   
3239 C CB  . GLN A 411 ? 1.0644 0.6537 0.8576 0.0085  -0.1097 -0.0560 393 GLN A CB  
3240 C CG  . GLN A 411 ? 1.0009 0.6329 0.8452 -0.0278 -0.1380 -0.0610 393 GLN A CG  
3241 C CD  . GLN A 411 ? 1.0393 0.6152 0.8880 -0.0654 -0.1295 -0.1020 393 GLN A CD  
3242 O OE1 . GLN A 411 ? 1.1095 0.6085 0.9370 -0.0632 -0.0915 -0.1021 393 GLN A OE1 
3243 N NE2 . GLN A 411 ? 1.0181 0.6278 0.8924 -0.0962 -0.1591 -0.1417 393 GLN A NE2 
3244 N N   . SER A 412 ? 1.1641 0.7099 0.8823 0.1005  -0.0572 -0.0248 394 SER A N   
3245 C CA  . SER A 412 ? 1.2438 0.7390 0.9096 0.1327  -0.0297 -0.0289 394 SER A CA  
3246 C C   . SER A 412 ? 1.2205 0.7783 0.9007 0.1616  -0.0289 -0.0158 394 SER A C   
3247 O O   . SER A 412 ? 1.2613 0.7992 0.9066 0.1691  -0.0170 -0.0257 394 SER A O   
3248 C CB  . SER A 412 ? 1.3131 0.7370 0.9391 0.1683  0.0000  -0.0172 394 SER A CB  
3249 O OG  . SER A 412 ? 1.3645 0.7043 0.9705 0.1389  0.0201  -0.0329 394 SER A OG  
3250 N N   . LEU A 413 ? 1.1582 0.7933 0.8957 0.1768  -0.0373 -0.0003 395 LEU A N   
3251 C CA  . LEU A 413 ? 1.1345 0.8383 0.9115 0.1966  -0.0262 0.0011  395 LEU A CA  
3252 C C   . LEU A 413 ? 1.1335 0.8407 0.9025 0.1705  -0.0206 0.0004  395 LEU A C   
3253 O O   . LEU A 413 ? 1.1643 0.8621 0.9100 0.1869  0.0042  -0.0021 395 LEU A O   
3254 C CB  . LEU A 413 ? 1.0559 0.8567 0.9197 0.2059  -0.0366 0.0016  395 LEU A CB  
3255 C CG  . LEU A 413 ? 1.0746 0.9057 0.9490 0.2628  -0.0384 -0.0058 395 LEU A CG  
3256 C CD1 . LEU A 413 ? 0.9993 0.9236 0.9529 0.2689  -0.0613 -0.0130 395 LEU A CD1 
3257 C CD2 . LEU A 413 ? 1.0945 0.9620 0.9859 0.2991  -0.0158 -0.0237 395 LEU A CD2 
3258 N N   . ASP A 414 ? 1.1044 0.8208 0.8849 0.1364  -0.0418 0.0031  396 ASP A N   
3259 C CA  . ASP A 414 ? 1.1265 0.8365 0.8781 0.1248  -0.0392 0.0049  396 ASP A CA  
3260 C C   . ASP A 414 ? 1.2138 0.8594 0.8783 0.1388  -0.0360 -0.0112 396 ASP A C   
3261 O O   . ASP A 414 ? 1.2597 0.8912 0.8797 0.1562  -0.0169 -0.0067 396 ASP A O   
3262 C CB  . ASP A 414 ? 1.0836 0.8110 0.8533 0.0937  -0.0704 0.0052  396 ASP A CB  
3263 C CG  . ASP A 414 ? 1.0158 0.8129 0.8721 0.0793  -0.0682 0.0207  396 ASP A CG  
3264 O OD1 . ASP A 414 ? 1.0036 0.8417 0.9080 0.0914  -0.0364 0.0258  396 ASP A OD1 
3265 O OD2 . ASP A 414 ? 0.9859 0.8018 0.8705 0.0536  -0.0965 0.0205  396 ASP A OD2 
3266 N N   . ILE A 415 ? 1.2495 0.8518 0.8895 0.1328  -0.0483 -0.0329 397 ILE A N   
3267 C CA  . ILE A 415 ? 1.3349 0.8831 0.9076 0.1436  -0.0444 -0.0610 397 ILE A CA  
3268 C C   . ILE A 415 ? 1.3844 0.9124 0.9292 0.1767  -0.0107 -0.0515 397 ILE A C   
3269 O O   . ILE A 415 ? 1.4439 0.9512 0.9326 0.1955  -0.0008 -0.0602 397 ILE A O   
3270 C CB  . ILE A 415 ? 1.3629 0.8636 0.9352 0.1221  -0.0494 -0.0940 397 ILE A CB  
3271 C CG1 . ILE A 415 ? 1.3273 0.8490 0.9319 0.0859  -0.0809 -0.1167 397 ILE A CG1 
3272 C CG2 . ILE A 415 ? 1.4428 0.8940 0.9616 0.1319  -0.0384 -0.1325 397 ILE A CG2 
3273 C CD1 . ILE A 415 ? 1.3300 0.8085 0.9632 0.0583  -0.0690 -0.1328 397 ILE A CD1 
3274 N N   . PHE A 416 ? 1.3661 0.9014 0.9453 0.1899  0.0050  -0.0370 398 PHE A N   
3275 C CA  . PHE A 416 ? 1.4019 0.9310 0.9695 0.2251  0.0346  -0.0319 398 PHE A CA  
3276 C C   . PHE A 416 ? 1.3908 0.9634 0.9763 0.2346  0.0565  -0.0211 398 PHE A C   
3277 O O   . PHE A 416 ? 1.4440 0.9971 0.9977 0.2569  0.0836  -0.0247 398 PHE A O   
3278 C CB  . PHE A 416 ? 1.3852 0.9302 0.9883 0.2490  0.0382  -0.0232 398 PHE A CB  
3279 C CG  . PHE A 416 ? 1.4325 0.9723 1.0217 0.2935  0.0633  -0.0260 398 PHE A CG  
3280 C CD1 . PHE A 416 ? 1.5184 0.9800 1.0398 0.3079  0.0807  -0.0355 398 PHE A CD1 
3281 C CD2 . PHE A 416 ? 1.3963 1.0165 1.0495 0.3219  0.0699  -0.0274 398 PHE A CD2 
3282 C CE1 . PHE A 416 ? 1.5624 1.0190 1.0693 0.3520  0.1028  -0.0383 398 PHE A CE1 
3283 C CE2 . PHE A 416 ? 1.4366 1.0627 1.0835 0.3672  0.0894  -0.0384 398 PHE A CE2 
3284 C CZ  . PHE A 416 ? 1.5221 1.0628 1.0906 0.3835  0.1051  -0.0396 398 PHE A CZ  
3285 N N   . LEU A 417 ? 1.3305 0.9534 0.9660 0.2160  0.0523  -0.0092 399 LEU A N   
3286 C CA  . LEU A 417 ? 1.3340 0.9790 0.9844 0.2184  0.0887  0.0007  399 LEU A CA  
3287 C C   . LEU A 417 ? 1.4191 1.0001 0.9686 0.2319  0.1031  0.0038  399 LEU A C   
3288 O O   . LEU A 417 ? 1.4547 1.0254 0.9900 0.2415  0.1468  0.0164  399 LEU A O   
3289 C CB  . LEU A 417 ? 1.2634 0.9614 0.9829 0.1925  0.0842  0.0111  399 LEU A CB  
3290 C CG  . LEU A 417 ? 1.2583 0.9898 1.0342 0.1876  0.1374  0.0163  399 LEU A CG  
3291 C CD1 . LEU A 417 ? 1.2311 1.0314 1.1037 0.1982  0.1656  -0.0076 399 LEU A CD1 
3292 C CD2 . LEU A 417 ? 1.1956 0.9598 1.0198 0.1592  0.1280  0.0270  399 LEU A CD2 
3293 N N   . ALA A 418 ? 1.4585 0.9955 0.9383 0.2359  0.0713  -0.0128 400 ALA A N   
3294 C CA  . ALA A 418 ? 1.5537 1.0389 0.9333 0.2629  0.0788  -0.0221 400 ALA A CA  
3295 C C   . ALA A 418 ? 1.5890 1.0419 0.9345 0.2671  0.0589  -0.0548 400 ALA A C   
3296 O O   . ALA A 418 ? 1.6215 1.0521 0.9530 0.2842  0.0846  -0.0577 400 ALA A O   
3297 C CB  . ALA A 418 ? 1.5786 1.0550 0.9018 0.2697  0.0561  -0.0219 400 ALA A CB  
3298 N N   . SER A 435 ? 1.1546 1.2934 1.5400 0.2227  0.4138  -0.2196 417 SER A N   
3299 C CA  . SER A 435 ? 1.1430 1.3018 1.4804 0.2698  0.3386  -0.2201 417 SER A CA  
3300 C C   . SER A 435 ? 1.0572 1.3253 1.4741 0.2874  0.2755  -0.2473 417 SER A C   
3301 O O   . SER A 435 ? 0.9983 1.3126 1.4862 0.2558  0.2758  -0.2528 417 SER A O   
3302 C CB  . SER A 435 ? 1.1960 1.2243 1.3609 0.2756  0.3004  -0.1542 417 SER A CB  
3303 O OG  . SER A 435 ? 1.1529 1.1625 1.2868 0.2543  0.2560  -0.1210 417 SER A OG  
3304 N N   . SER A 436 ? 1.0612 1.3634 1.4559 0.3441  0.2242  -0.2630 418 SER A N   
3305 C CA  . SER A 436 ? 1.0057 1.3944 1.4409 0.3803  0.1618  -0.2833 418 SER A CA  
3306 C C   . SER A 436 ? 0.9933 1.2963 1.3256 0.3643  0.1163  -0.2198 418 SER A C   
3307 O O   . SER A 436 ? 0.9421 1.3058 1.3126 0.3759  0.0765  -0.2284 418 SER A O   
3308 C CB  . SER A 436 ? 1.0443 1.4766 1.4613 0.4616  0.1274  -0.3157 418 SER A CB  
3309 O OG  . SER A 436 ? 1.1215 1.4198 1.3810 0.4838  0.1114  -0.2599 418 SER A OG  
3310 N N   . ILE A 437 ? 1.0409 1.2103 1.2488 0.3404  0.1228  -0.1643 419 ILE A N   
3311 C CA  . ILE A 437 ? 1.0323 1.1214 1.1554 0.3158  0.0881  -0.1154 419 ILE A CA  
3312 C C   . ILE A 437 ? 0.9616 1.0879 1.1513 0.2655  0.0928  -0.1103 419 ILE A C   
3313 O O   . ILE A 437 ? 0.9165 1.0485 1.1030 0.2563  0.0543  -0.0956 419 ILE A O   
3314 C CB  . ILE A 437 ? 1.1036 1.0617 1.0992 0.3005  0.0975  -0.0770 419 ILE A CB  
3315 C CG1 . ILE A 437 ? 1.1735 1.0815 1.0962 0.3483  0.0912  -0.0787 419 ILE A CG1 
3316 C CG2 . ILE A 437 ? 1.0918 0.9860 1.0271 0.2666  0.0677  -0.0438 419 ILE A CG2 
3317 C CD1 . ILE A 437 ? 1.1777 1.0900 1.0792 0.3936  0.0544  -0.0787 419 ILE A CD1 
3318 N N   . GLN A 438 ? 0.9573 1.1009 1.2046 0.2349  0.1474  -0.1228 420 GLN A N   
3319 C CA  . GLN A 438 ? 0.9086 1.0748 1.2162 0.1895  0.1672  -0.1179 420 GLN A CA  
3320 C C   . GLN A 438 ? 0.8205 1.1179 1.2637 0.1903  0.1468  -0.1609 420 GLN A C   
3321 O O   . GLN A 438 ? 0.7698 1.0808 1.2387 0.1604  0.1309  -0.1474 420 GLN A O   
3322 C CB  . GLN A 438 ? 0.9534 1.0900 1.2833 0.1653  0.2492  -0.1233 420 GLN A CB  
3323 C CG  . GLN A 438 ? 0.9627 1.0442 1.2682 0.1267  0.2760  -0.0896 420 GLN A CG  
3324 C CD  . GLN A 438 ? 1.0399 1.0677 1.3485 0.1117  0.3730  -0.0899 420 GLN A CD  
3325 O OE1 . GLN A 438 ? 1.0929 1.0876 1.3739 0.1294  0.4144  -0.0995 420 GLN A OE1 
3326 N NE2 . GLN A 438 ? 1.0420 1.0501 1.3777 0.0811  0.4169  -0.0778 420 GLN A NE2 
3327 N N   . ARG A 439 ? 0.8047 1.2050 1.3344 0.2295  0.1442  -0.2179 421 ARG A N   
3328 C CA  . ARG A 439 ? 0.7314 1.2742 1.3876 0.2473  0.1149  -0.2727 421 ARG A CA  
3329 C C   . ARG A 439 ? 0.7197 1.2519 1.2988 0.2884  0.0391  -0.2466 421 ARG A C   
3330 O O   . ARG A 439 ? 0.6549 1.2741 1.3026 0.2961  0.0067  -0.2703 421 ARG A O   
3331 C CB  . ARG A 439 ? 0.7308 1.3997 1.5062 0.2871  0.1339  -0.3563 421 ARG A CB  
3332 C CG  . ARG A 439 ? 0.7553 1.4368 1.6258 0.2432  0.2248  -0.3934 421 ARG A CG  
3333 C CD  . ARG A 439 ? 0.7437 1.5818 1.7739 0.2760  0.2452  -0.4993 421 ARG A CD  
3334 N NE  . ARG A 439 ? 0.8230 1.6331 1.7913 0.3232  0.2449  -0.5054 421 ARG A NE  
3335 C CZ  . ARG A 439 ? 0.8505 1.6802 1.7485 0.4003  0.1766  -0.5071 421 ARG A CZ  
3336 N NH1 . ARG A 439 ? 0.8350 1.7058 1.7040 0.4449  0.1032  -0.5008 421 ARG A NH1 
3337 N NH2 . ARG A 439 ? 0.9081 1.7048 1.7538 0.4376  0.1868  -0.5125 421 ARG A NH2 
3338 N N   . ARG A 440 ? 0.7860 1.2063 1.2228 0.3155  0.0184  -0.2012 422 ARG A N   
3339 C CA  . ARG A 440 ? 0.8039 1.1675 1.1432 0.3455  -0.0324 -0.1656 422 ARG A CA  
3340 C C   . ARG A 440 ? 0.7637 1.0659 1.0717 0.2863  -0.0431 -0.1217 422 ARG A C   
3341 O O   . ARG A 440 ? 0.7313 1.0433 1.0299 0.2958  -0.0786 -0.1125 422 ARG A O   
3342 C CB  . ARG A 440 ? 0.9001 1.1476 1.1046 0.3818  -0.0330 -0.1352 422 ARG A CB  
3343 C CG  . ARG A 440 ? 0.9501 1.1120 1.0454 0.4131  -0.0644 -0.0998 422 ARG A CG  
3344 C CD  . ARG A 440 ? 0.9812 1.2161 1.0853 0.4986  -0.0941 -0.1288 422 ARG A CD  
3345 N NE  . ARG A 440 ? 1.0042 1.1847 1.0397 0.5159  -0.1186 -0.0987 422 ARG A NE  
3346 C CZ  . ARG A 440 ? 1.0361 1.2774 1.0689 0.5909  -0.1491 -0.1180 422 ARG A CZ  
3347 N NH1 . ARG A 440 ? 1.0397 1.4161 1.1449 0.6593  -0.1671 -0.1769 422 ARG A NH1 
3348 N NH2 . ARG A 440 ? 1.0720 1.2414 1.0288 0.6024  -0.1609 -0.0842 422 ARG A NH2 
3349 N N   . ILE A 441 ? 0.7702 1.0066 1.0535 0.2329  -0.0123 -0.0964 423 ILE A N   
3350 C CA  . ILE A 441 ? 0.7450 0.9322 1.0028 0.1807  -0.0220 -0.0625 423 ILE A CA  
3351 C C   . ILE A 441 ? 0.6648 0.9505 1.0382 0.1553  -0.0257 -0.0824 423 ILE A C   
3352 O O   . ILE A 441 ? 0.6267 0.9022 0.9906 0.1335  -0.0560 -0.0632 423 ILE A O   
3353 C CB  . ILE A 441 ? 0.7831 0.8908 0.9859 0.1470  0.0132  -0.0392 423 ILE A CB  
3354 C CG1 . ILE A 441 ? 0.8610 0.8655 0.9424 0.1636  0.0064  -0.0200 423 ILE A CG1 
3355 C CG2 . ILE A 441 ? 0.7469 0.8318 0.9434 0.1037  0.0040  -0.0161 423 ILE A CG2 
3356 C CD1 . ILE A 441 ? 0.9154 0.8493 0.9307 0.1482  0.0368  -0.0045 423 ILE A CD1 
3357 N N   . LYS A 442 ? 0.6435 1.0248 1.1336 0.1549  0.0102  -0.1269 424 LYS A N   
3358 C CA  . LYS A 442 ? 0.5702 1.0620 1.1935 0.1329  0.0138  -0.1621 424 LYS A CA  
3359 C C   . LYS A 442 ? 0.5349 1.1120 1.1906 0.1759  -0.0435 -0.1872 424 LYS A C   
3360 O O   . LYS A 442 ? 0.4707 1.0845 1.1651 0.1559  -0.0678 -0.1846 424 LYS A O   
3361 C CB  . LYS A 442 ? 0.5598 1.1363 1.3145 0.1222  0.0767  -0.2198 424 LYS A CB  
3362 C CG  . LYS A 442 ? 0.6136 1.0955 1.3351 0.0787  0.1471  -0.1906 424 LYS A CG  
3363 C CD  . LYS A 442 ? 0.6202 1.1719 1.4807 0.0597  0.2291  -0.2508 424 LYS A CD  
3364 C CE  . LYS A 442 ? 0.7010 1.1304 1.5019 0.0251  0.3121  -0.2126 424 LYS A CE  
3365 N NZ  . LYS A 442 ? 0.7862 1.0925 1.4253 0.0498  0.3069  -0.1626 424 LYS A NZ  
3366 N N   . LYS A 443 ? 0.5819 1.1836 1.2099 0.2417  -0.0638 -0.2097 425 LYS A N   
3367 C CA  . LYS A 443 ? 0.5865 1.2579 1.2165 0.3061  -0.1159 -0.2331 425 LYS A CA  
3368 C C   . LYS A 443 ? 0.6189 1.1854 1.1280 0.3059  -0.1510 -0.1732 425 LYS A C   
3369 O O   . LYS A 443 ? 0.5835 1.2011 1.1173 0.3199  -0.1836 -0.1807 425 LYS A O   
3370 C CB  . LYS A 443 ? 0.6518 1.3534 1.2544 0.3886  -0.1248 -0.2665 425 LYS A CB  
3371 C CG  . LYS A 443 ? 0.6560 1.4553 1.2697 0.4776  -0.1752 -0.3078 425 LYS A CG  
3372 C CD  . LYS A 443 ? 0.7596 1.4291 1.1956 0.5361  -0.2024 -0.2498 425 LYS A CD  
3373 C CE  . LYS A 443 ? 0.8150 1.5693 1.2309 0.6541  -0.2462 -0.2921 425 LYS A CE  
3374 N NZ  . LYS A 443 ? 0.7523 1.6062 1.2351 0.6624  -0.2817 -0.3179 425 LYS A NZ  
3375 N N   . VAL A 444 ? 0.4896 0.6144 0.9004 0.2287  -0.0635 -0.0862 426 VAL A N   
3376 C CA  . VAL A 444 ? 0.5055 0.5689 0.8816 0.2257  -0.0707 -0.0732 426 VAL A CA  
3377 C C   . VAL A 444 ? 0.4918 0.5407 0.8059 0.1966  -0.0685 -0.0632 426 VAL A C   
3378 O O   . VAL A 444 ? 0.4998 0.5160 0.7842 0.1895  -0.0831 -0.0407 426 VAL A O   
3379 C CB  . VAL A 444 ? 0.5276 0.5589 0.9161 0.2384  -0.0561 -0.0966 426 VAL A CB  
3380 C CG1 . VAL A 444 ? 0.5269 0.5030 0.8669 0.2244  -0.0568 -0.0881 426 VAL A CG1 
3381 C CG2 . VAL A 444 ? 0.5564 0.5797 1.0045 0.2702  -0.0654 -0.0978 426 VAL A CG2 
3382 N N   . THR A 445 ? 0.4732 0.5475 0.7697 0.1803  -0.0501 -0.0796 427 THR A N   
3383 C CA  . THR A 445 ? 0.4608 0.5279 0.7059 0.1539  -0.0470 -0.0713 427 THR A CA  
3384 C C   . THR A 445 ? 0.4550 0.5278 0.6868 0.1444  -0.0655 -0.0471 427 THR A C   
3385 O O   . THR A 445 ? 0.4425 0.4851 0.6360 0.1321  -0.0727 -0.0325 427 THR A O   
3386 C CB  . THR A 445 ? 0.4456 0.5510 0.6855 0.1397  -0.0269 -0.0893 427 THR A CB  
3387 O OG1 . THR A 445 ? 0.4542 0.5539 0.6967 0.1443  -0.0093 -0.1126 427 THR A OG1 
3388 C CG2 . THR A 445 ? 0.4227 0.5235 0.6180 0.1145  -0.0258 -0.0781 427 THR A CG2 
3389 N N   . HIS A 446 ? 0.4635 0.5774 0.7289 0.1502  -0.0732 -0.0445 428 HIS A N   
3390 C CA  . HIS A 446 ? 0.4624 0.5871 0.7179 0.1403  -0.0915 -0.0243 428 HIS A CA  
3391 C C   . HIS A 446 ? 0.4786 0.5688 0.7245 0.1481  -0.1119 -0.0026 428 HIS A C   
3392 O O   . HIS A 446 ? 0.4625 0.5375 0.6718 0.1324  -0.1213 0.0122  428 HIS A O   
3393 C CB  . HIS A 446 ? 0.4641 0.6439 0.7629 0.1458  -0.0971 -0.0261 428 HIS A CB  
3394 C CG  . HIS A 446 ? 0.4718 0.6679 0.7588 0.1318  -0.1154 -0.0082 428 HIS A CG  
3395 N ND1 . HIS A 446 ? 0.5062 0.7139 0.8158 0.1434  -0.1385 0.0089  428 HIS A ND1 
3396 C CD2 . HIS A 446 ? 0.4754 0.6768 0.7295 0.1062  -0.1144 -0.0052 428 HIS A CD2 
3397 C CE1 . HIS A 446 ? 0.5026 0.7254 0.7915 0.1241  -0.1506 0.0200  428 HIS A CE1 
3398 N NE2 . HIS A 446 ? 0.5056 0.7229 0.7617 0.1016  -0.1357 0.0105  428 HIS A NE2 
3399 N N   . ASP A 447 ? 0.5042 0.5827 0.7838 0.1717  -0.1183 -0.0009 429 ASP A N   
3400 C CA  . ASP A 447 ? 0.5364 0.5828 0.8105 0.1796  -0.1393 0.0234  429 ASP A CA  
3401 C C   . ASP A 447 ? 0.5347 0.5309 0.7591 0.1663  -0.1351 0.0292  429 ASP A C   
3402 O O   . ASP A 447 ? 0.5336 0.5117 0.7288 0.1569  -0.1494 0.0503  429 ASP A O   
3403 C CB  . ASP A 447 ? 0.5680 0.6074 0.8935 0.2093  -0.1462 0.0240  429 ASP A CB  
3404 C CG  . ASP A 447 ? 0.5896 0.6806 0.9684 0.2251  -0.1577 0.0264  429 ASP A CG  
3405 O OD1 . ASP A 447 ? 0.5974 0.7245 0.9684 0.2116  -0.1682 0.0365  429 ASP A OD1 
3406 O OD2 . ASP A 447 ? 0.6194 0.7149 1.0503 0.2513  -0.1565 0.0174  429 ASP A OD2 
3407 N N   . MET A 448 ? 0.5324 0.5108 0.7471 0.1640  -0.1151 0.0096  430 MET A N   
3408 C CA  . MET A 448 ? 0.5354 0.4737 0.7060 0.1500  -0.1089 0.0118  430 MET A CA  
3409 C C   . MET A 448 ? 0.5020 0.4483 0.6312 0.1267  -0.1094 0.0190  430 MET A C   
3410 O O   . MET A 448 ? 0.5132 0.4373 0.6116 0.1169  -0.1183 0.0350  430 MET A O   
3411 C CB  . MET A 448 ? 0.5330 0.4620 0.7041 0.1506  -0.0874 -0.0131 430 MET A CB  
3412 C CG  . MET A 448 ? 0.5519 0.4407 0.6841 0.1382  -0.0813 -0.0119 430 MET A CG  
3413 S SD  . MET A 448 ? 0.6003 0.4905 0.7241 0.1318  -0.0571 -0.0406 430 MET A SD  
3414 C CE  . MET A 448 ? 0.5342 0.4094 0.6049 0.1078  -0.0544 -0.0309 430 MET A CE  
3415 N N   . ASP A 449 ? 0.4736 0.4516 0.6033 0.1173  -0.0989 0.0064  431 ASP A N   
3416 C CA  . ASP A 449 ? 0.4540 0.4385 0.5499 0.0956  -0.0980 0.0104  431 ASP A CA  
3417 C C   . ASP A 449 ? 0.4504 0.4384 0.5337 0.0890  -0.1170 0.0291  431 ASP A C   
3418 O O   . ASP A 449 ? 0.4275 0.3977 0.4741 0.0741  -0.1183 0.0355  431 ASP A O   
3419 C CB  . ASP A 449 ? 0.4371 0.4591 0.5457 0.0883  -0.0870 -0.0028 431 ASP A CB  
3420 C CG  . ASP A 449 ? 0.4648 0.4844 0.5703 0.0867  -0.0670 -0.0200 431 ASP A CG  
3421 O OD1 . ASP A 449 ? 0.4631 0.4533 0.5595 0.0923  -0.0617 -0.0240 431 ASP A OD1 
3422 O OD2 . ASP A 449 ? 0.4841 0.5333 0.5953 0.0779  -0.0569 -0.0288 431 ASP A OD2 
3423 N N   . MET A 450 ? 0.4522 0.4650 0.5669 0.1003  -0.1316 0.0371  432 MET A N   
3424 C CA  . MET A 450 ? 0.4750 0.4991 0.5789 0.0927  -0.1513 0.0547  432 MET A CA  
3425 C C   . MET A 450 ? 0.4975 0.4862 0.5704 0.0899  -0.1617 0.0726  432 MET A C   
3426 O O   . MET A 450 ? 0.5219 0.5167 0.5702 0.0766  -0.1742 0.0846  432 MET A O   
3427 C CB  . MET A 450 ? 0.4817 0.5438 0.6304 0.1072  -0.1668 0.0614  432 MET A CB  
3428 C CG  . MET A 450 ? 0.4702 0.5785 0.6433 0.1018  -0.1601 0.0471  432 MET A CG  
3429 S SD  . MET A 450 ? 0.4880 0.6020 0.6196 0.0697  -0.1525 0.0401  432 MET A SD  
3430 C CE  . MET A 450 ? 0.4890 0.5802 0.6048 0.0643  -0.1249 0.0217  432 MET A CE  
3431 N N   . CYS A 451 ? 0.5072 0.4615 0.5815 0.1008  -0.1565 0.0738  433 CYS A N   
3432 C CA  . CYS A 451 ? 0.5319 0.4512 0.5775 0.0966  -0.1642 0.0912  433 CYS A CA  
3433 C C   . CYS A 451 ? 0.5136 0.4194 0.5121 0.0749  -0.1551 0.0879  433 CYS A C   
3434 O O   . CYS A 451 ? 0.5278 0.4168 0.4968 0.0657  -0.1626 0.1030  433 CYS A O   
3435 C CB  . CYS A 451 ? 0.5458 0.4297 0.6044 0.1102  -0.1577 0.0894  433 CYS A CB  
3436 S SG  . CYS A 451 ? 0.6382 0.5238 0.7515 0.1380  -0.1697 0.0961  433 CYS A SG  
3437 N N   . TYR A 452 ? 0.4848 0.3982 0.4778 0.0672  -0.1385 0.0688  434 TYR A N   
3438 C CA  . TYR A 452 ? 0.4682 0.3702 0.4238 0.0494  -0.1287 0.0634  434 TYR A CA  
3439 C C   . TYR A 452 ? 0.4631 0.3878 0.4040 0.0341  -0.1336 0.0620  434 TYR A C   
3440 O O   . TYR A 452 ? 0.5001 0.4138 0.4090 0.0198  -0.1294 0.0604  434 TYR A O   
3441 C CB  . TYR A 452 ? 0.4486 0.3436 0.4053 0.0486  -0.1094 0.0459  434 TYR A CB  
3442 C CG  . TYR A 452 ? 0.4445 0.3162 0.4103 0.0595  -0.1027 0.0431  434 TYR A CG  
3443 C CD1 . TYR A 452 ? 0.4470 0.2903 0.3882 0.0533  -0.0977 0.0462  434 TYR A CD1 
3444 C CD2 . TYR A 452 ? 0.4610 0.3404 0.4609 0.0750  -0.1005 0.0354  434 TYR A CD2 
3445 C CE1 . TYR A 452 ? 0.4800 0.3017 0.4284 0.0603  -0.0919 0.0426  434 TYR A CE1 
3446 C CE2 . TYR A 452 ? 0.4867 0.3424 0.4943 0.0834  -0.0937 0.0296  434 TYR A CE2 
3447 C CZ  . TYR A 452 ? 0.4932 0.3192 0.4740 0.0750  -0.0898 0.0335  434 TYR A CZ  
3448 O OH  . TYR A 452 ? 0.5204 0.3224 0.5075 0.0804  -0.0836 0.0272  434 TYR A OH  
3449 N N   . GLY A 453 ? 0.4369 0.3936 0.4028 0.0367  -0.1408 0.0602  435 GLY A N   
3450 C CA  . GLY A 453 ? 0.4183 0.3990 0.3754 0.0207  -0.1444 0.0552  435 GLY A CA  
3451 C C   . GLY A 453 ? 0.3896 0.3998 0.3784 0.0227  -0.1391 0.0441  435 GLY A C   
3452 O O   . GLY A 453 ? 0.3734 0.3854 0.3871 0.0358  -0.1300 0.0380  435 GLY A O   
3453 N N   . MET A 454 ? 0.3541 0.3872 0.3402 0.0075  -0.1430 0.0395  436 MET A N   
3454 C CA  . MET A 454 ? 0.3471 0.4121 0.3625 0.0055  -0.1389 0.0306  436 MET A CA  
3455 C C   . MET A 454 ? 0.3253 0.3806 0.3436 0.0043  -0.1183 0.0185  436 MET A C   
3456 O O   . MET A 454 ? 0.3184 0.3991 0.3655 0.0087  -0.1122 0.0125  436 MET A O   
3457 C CB  . MET A 454 ? 0.3355 0.4234 0.3436 -0.0146 -0.1478 0.0281  436 MET A CB  
3458 C CG  . MET A 454 ? 0.3739 0.4847 0.3865 -0.0128 -0.1702 0.0408  436 MET A CG  
3459 S SD  . MET A 454 ? 0.3863 0.5405 0.4547 0.0079  -0.1816 0.0480  436 MET A SD  
3460 C CE  . MET A 454 ? 0.3693 0.5753 0.4562 -0.0114 -0.1902 0.0415  436 MET A CE  
3461 N N   . MET A 455 ? 0.3354 0.3566 0.3246 -0.0012 -0.1079 0.0158  437 MET A N   
3462 C CA  . MET A 455 ? 0.3393 0.3507 0.3274 -0.0035 -0.0905 0.0075  437 MET A CA  
3463 C C   . MET A 455 ? 0.3307 0.3208 0.3167 0.0107  -0.0829 0.0075  437 MET A C   
3464 O O   . MET A 455 ? 0.3384 0.3172 0.3173 0.0086  -0.0701 0.0024  437 MET A O   
3465 C CB  . MET A 455 ? 0.3497 0.3419 0.3120 -0.0210 -0.0845 0.0037  437 MET A CB  
3466 C CG  . MET A 455 ? 0.3787 0.3924 0.3488 -0.0371 -0.0879 0.0000  437 MET A CG  
3467 S SD  . MET A 455 ? 0.4761 0.5131 0.4716 -0.0396 -0.0750 -0.0040 437 MET A SD  
3468 C CE  . MET A 455 ? 0.3656 0.4365 0.3779 -0.0562 -0.0834 -0.0063 437 MET A CE  
3469 N N   . GLY A 456 ? 0.3316 0.3162 0.3245 0.0243  -0.0920 0.0142  438 GLY A N   
3470 C CA  . GLY A 456 ? 0.3357 0.3015 0.3322 0.0376  -0.0858 0.0127  438 GLY A CA  
3471 C C   . GLY A 456 ? 0.3348 0.2665 0.3014 0.0331  -0.0798 0.0141  438 GLY A C   
3472 O O   . GLY A 456 ? 0.3381 0.2586 0.2799 0.0215  -0.0810 0.0171  438 GLY A O   
3473 N N   . SER A 457 ? 0.3352 0.2523 0.3063 0.0426  -0.0732 0.0105  439 SER A N   
3474 C CA  . SER A 457 ? 0.3582 0.2482 0.3059 0.0384  -0.0666 0.0106  439 SER A CA  
3475 C C   . SER A 457 ? 0.3409 0.2320 0.2739 0.0268  -0.0558 0.0049  439 SER A C   
3476 O O   . SER A 457 ? 0.3346 0.2439 0.2779 0.0243  -0.0490 -0.0015 439 SER A O   
3477 C CB  . SER A 457 ? 0.3564 0.2333 0.3147 0.0491  -0.0613 0.0051  439 SER A CB  
3478 O OG  . SER A 457 ? 0.3740 0.2286 0.3110 0.0433  -0.0548 0.0047  439 SER A OG  
3479 N N   . LEU A 458 ? 0.3622 0.2337 0.2721 0.0202  -0.0542 0.0082  440 LEU A N   
3480 C CA  . LEU A 458 ? 0.3730 0.2390 0.2706 0.0123  -0.0448 0.0048  440 LEU A CA  
3481 C C   . LEU A 458 ? 0.3562 0.2272 0.2613 0.0156  -0.0358 -0.0011 440 LEU A C   
3482 O O   . LEU A 458 ? 0.3486 0.2267 0.2520 0.0097  -0.0294 -0.0026 440 LEU A O   
3483 C CB  . LEU A 458 ? 0.3941 0.2391 0.2714 0.0092  -0.0447 0.0084  440 LEU A CB  
3484 C CG  . LEU A 458 ? 0.3945 0.2307 0.2600 0.0033  -0.0366 0.0063  440 LEU A CG  
3485 C CD1 . LEU A 458 ? 0.3916 0.2336 0.2583 -0.0037 -0.0348 0.0040  440 LEU A CD1 
3486 C CD2 . LEU A 458 ? 0.4408 0.2630 0.2895 0.0004  -0.0373 0.0090  440 LEU A CD2 
3487 N N   . PHE A 459 ? 0.3506 0.2167 0.2631 0.0240  -0.0358 -0.0042 441 PHE A N   
3488 C CA  . PHE A 459 ? 0.3509 0.2189 0.2658 0.0256  -0.0273 -0.0123 441 PHE A CA  
3489 C C   . PHE A 459 ? 0.3388 0.2291 0.2728 0.0305  -0.0224 -0.0224 441 PHE A C   
3490 O O   . PHE A 459 ? 0.3375 0.2361 0.2701 0.0284  -0.0141 -0.0308 441 PHE A O   
3491 C CB  . PHE A 459 ? 0.3622 0.2090 0.2727 0.0294  -0.0284 -0.0128 441 PHE A CB  
3492 C CG  . PHE A 459 ? 0.3734 0.2030 0.2649 0.0230  -0.0303 -0.0046 441 PHE A CG  
3493 C CD1 . PHE A 459 ? 0.3826 0.2136 0.2628 0.0161  -0.0247 -0.0046 441 PHE A CD1 
3494 C CD2 . PHE A 459 ? 0.3949 0.2094 0.2810 0.0239  -0.0377 0.0036  441 PHE A CD2 
3495 C CE1 . PHE A 459 ? 0.4015 0.2206 0.2681 0.0114  -0.0248 0.0007  441 PHE A CE1 
3496 C CE2 . PHE A 459 ? 0.3956 0.1987 0.2639 0.0168  -0.0374 0.0095  441 PHE A CE2 
3497 C CZ  . PHE A 459 ? 0.4120 0.2180 0.2719 0.0111  -0.0302 0.0066  441 PHE A CZ  
3498 N N   . ARG A 460 ? 0.3455 0.2490 0.2979 0.0365  -0.0271 -0.0227 442 ARG A N   
3499 C CA  . ARG A 460 ? 0.3476 0.2754 0.3230 0.0430  -0.0213 -0.0346 442 ARG A CA  
3500 C C   . ARG A 460 ? 0.3522 0.3014 0.3504 0.0482  -0.0277 -0.0326 442 ARG A C   
3501 O O   . ARG A 460 ? 0.3546 0.2963 0.3508 0.0484  -0.0390 -0.0218 442 ARG A O   
3502 C CB  . ARG A 460 ? 0.3644 0.2802 0.3501 0.0536  -0.0182 -0.0457 442 ARG A CB  
3503 C CG  . ARG A 460 ? 0.3882 0.2745 0.3767 0.0622  -0.0290 -0.0374 442 ARG A CG  
3504 C CD  . ARG A 460 ? 0.4012 0.2736 0.4051 0.0725  -0.0255 -0.0497 442 ARG A CD  
3505 N NE  . ARG A 460 ? 0.4364 0.3003 0.4237 0.0644  -0.0161 -0.0596 442 ARG A NE  
3506 C CZ  . ARG A 460 ? 0.4229 0.3045 0.4150 0.0631  -0.0045 -0.0780 442 ARG A CZ  
3507 N NH1 . ARG A 460 ? 0.4427 0.3171 0.4174 0.0541  0.0015  -0.0853 442 ARG A NH1 
3508 N NH2 . ARG A 460 ? 0.4083 0.3180 0.4218 0.0694  0.0013  -0.0895 442 ARG A NH2 
3509 N N   . SER A 461 ? 0.3451 0.3248 0.3644 0.0508  -0.0201 -0.0437 443 SER A N   
3510 C CA  . SER A 461 ? 0.3573 0.3629 0.4082 0.0599  -0.0248 -0.0459 443 SER A CA  
3511 C C   . SER A 461 ? 0.3592 0.3727 0.4345 0.0743  -0.0164 -0.0633 443 SER A C   
3512 O O   . SER A 461 ? 0.3545 0.3863 0.4298 0.0700  -0.0023 -0.0774 443 SER A O   
3513 C CB  . SER A 461 ? 0.3555 0.3950 0.4114 0.0475  -0.0213 -0.0449 443 SER A CB  
3514 O OG  . SER A 461 ? 0.3728 0.4463 0.4640 0.0560  -0.0233 -0.0502 443 SER A OG  
3515 N N   . GLY A 462 ? 0.3752 0.3716 0.4694 0.0906  -0.0251 -0.0622 444 GLY A N   
3516 C CA  . GLY A 462 ? 0.3918 0.3856 0.5102 0.1055  -0.0179 -0.0798 444 GLY A CA  
3517 C C   . GLY A 462 ? 0.4054 0.3827 0.4994 0.0972  -0.0058 -0.0914 444 GLY A C   
3518 O O   . GLY A 462 ? 0.4125 0.3589 0.4784 0.0895  -0.0103 -0.0812 444 GLY A O   
3519 N N   . SER A 463 ? 0.4066 0.4087 0.5101 0.0969  0.0096  -0.1128 445 SER A N   
3520 C CA  . SER A 463 ? 0.4133 0.4058 0.4942 0.0879  0.0207  -0.1260 445 SER A CA  
3521 C C   . SER A 463 ? 0.4011 0.4095 0.4484 0.0671  0.0265  -0.1195 445 SER A C   
3522 O O   . SER A 463 ? 0.4131 0.4191 0.4403 0.0581  0.0341  -0.1284 445 SER A O   
3523 C CB  . SER A 463 ? 0.4451 0.4556 0.5499 0.0968  0.0350  -0.1552 445 SER A CB  
3524 O OG  . SER A 463 ? 0.4685 0.5277 0.5828 0.0916  0.0467  -0.1651 445 SER A OG  
3525 N N   A ARG A 464 ? 0.3792 0.4025 0.4210 0.0590  0.0218  -0.1035 446 ARG A N   
3526 N N   B ARG A 464 ? 0.3741 0.3980 0.4166 0.0592  0.0218  -0.1036 446 ARG A N   
3527 C CA  A ARG A 464 ? 0.3668 0.4017 0.3807 0.0404  0.0262  -0.0948 446 ARG A CA  
3528 C CA  B ARG A 464 ? 0.3571 0.3920 0.3717 0.0405  0.0253  -0.0935 446 ARG A CA  
3529 C C   A ARG A 464 ? 0.3433 0.3463 0.3333 0.0343  0.0153  -0.0750 446 ARG A C   
3530 C C   B ARG A 464 ? 0.3384 0.3392 0.3285 0.0350  0.0148  -0.0750 446 ARG A C   
3531 O O   A ARG A 464 ? 0.3417 0.3330 0.3361 0.0374  0.0048  -0.0627 446 ARG A O   
3532 O O   B ARG A 464 ? 0.3354 0.3210 0.3295 0.0392  0.0039  -0.0632 446 ARG A O   
3533 C CB  A ARG A 464 ? 0.3613 0.4346 0.3864 0.0330  0.0308  -0.0926 446 ARG A CB  
3534 C CB  B ARG A 464 ? 0.3463 0.4137 0.3714 0.0334  0.0265  -0.0869 446 ARG A CB  
3535 C CG  A ARG A 464 ? 0.3775 0.4863 0.4299 0.0403  0.0431  -0.1146 446 ARG A CG  
3536 C CG  B ARG A 464 ? 0.3409 0.4506 0.3933 0.0374  0.0384  -0.1050 446 ARG A CG  
3537 C CD  A ARG A 464 ? 0.3890 0.5413 0.4503 0.0293  0.0504  -0.1134 446 ARG A CD  
3538 C CD  B ARG A 464 ? 0.3504 0.4666 0.4418 0.0564  0.0325  -0.1110 446 ARG A CD  
3539 N NE  A ARG A 464 ? 0.4198 0.5813 0.4498 0.0081  0.0563  -0.1038 446 ARG A NE  
3540 N NE  B ARG A 464 ? 0.3281 0.4452 0.4275 0.0554  0.0190  -0.0934 446 ARG A NE  
3541 C CZ  A ARG A 464 ? 0.4132 0.6092 0.4431 -0.0072 0.0631  -0.0984 446 ARG A CZ  
3542 C CZ  B ARG A 464 ? 0.3340 0.4849 0.4416 0.0443  0.0210  -0.0888 446 ARG A CZ  
3543 N NH1 A ARG A 464 ? 0.4306 0.6584 0.4909 -0.0041 0.0658  -0.1037 446 ARG A NH1 
3544 N NH1 B ARG A 464 ? 0.3126 0.4998 0.4211 0.0330  0.0362  -0.0981 446 ARG A NH1 
3545 N NH2 A ARG A 464 ? 0.4209 0.6203 0.4220 -0.0259 0.0664  -0.0861 446 ARG A NH2 
3546 N NH2 B ARG A 464 ? 0.3181 0.4682 0.4324 0.0427  0.0076  -0.0749 446 ARG A NH2 
3547 N N   . GLN A 465 ? 0.3331 0.3250 0.2985 0.0254  0.0178  -0.0727 447 GLN A N   
3548 C CA  . GLN A 465 ? 0.3320 0.2971 0.2781 0.0206  0.0095  -0.0566 447 GLN A CA  
3549 C C   . GLN A 465 ? 0.3138 0.2872 0.2518 0.0100  0.0075  -0.0420 447 GLN A C   
3550 O O   . GLN A 465 ? 0.3055 0.3045 0.2430 0.0012  0.0141  -0.0420 447 GLN A O   
3551 C CB  . GLN A 465 ? 0.3345 0.2885 0.2614 0.0151  0.0120  -0.0586 447 GLN A CB  
3552 C CG  . GLN A 465 ? 0.3762 0.3173 0.3092 0.0225  0.0140  -0.0737 447 GLN A CG  
3553 C CD  . GLN A 465 ? 0.4012 0.3317 0.3146 0.0145  0.0142  -0.0730 447 GLN A CD  
3554 O OE1 . GLN A 465 ? 0.4314 0.3824 0.3333 0.0053  0.0202  -0.0786 447 GLN A OE1 
3555 N NE2 . GLN A 465 ? 0.4140 0.3160 0.3228 0.0167  0.0073  -0.0654 447 GLN A NE2 
3556 N N   . THR A 466 ? 0.3024 0.2533 0.2333 0.0097  -0.0009 -0.0300 448 THR A N   
3557 C CA  . THR A 466 ? 0.2946 0.2464 0.2196 -0.0001 -0.0032 -0.0181 448 THR A CA  
3558 C C   . THR A 466 ? 0.2938 0.2389 0.2012 -0.0084 -0.0008 -0.0096 448 THR A C   
3559 O O   . THR A 466 ? 0.2850 0.2243 0.1836 -0.0066 0.0007  -0.0123 448 THR A O   
3560 C CB  . THR A 466 ? 0.3095 0.2407 0.2329 0.0021  -0.0123 -0.0117 448 THR A CB  
3561 O OG1 . THR A 466 ? 0.2934 0.2006 0.2051 0.0064  -0.0148 -0.0105 448 THR A OG1 
3562 C CG2 . THR A 466 ? 0.2784 0.2199 0.2202 0.0089  -0.0183 -0.0151 448 THR A CG2 
3563 N N   . LEU A 467 ? 0.3039 0.2508 0.2085 -0.0179 -0.0011 0.0010  449 LEU A N   
3564 C CA  . LEU A 467 ? 0.3131 0.2495 0.2057 -0.0240 -0.0016 0.0128  449 LEU A CA  
3565 C C   . LEU A 467 ? 0.3184 0.2289 0.2045 -0.0171 -0.0059 0.0136  449 LEU A C   
3566 O O   . LEU A 467 ? 0.3102 0.2186 0.1888 -0.0168 -0.0055 0.0169  449 LEU A O   
3567 C CB  . LEU A 467 ? 0.3148 0.2484 0.2104 -0.0337 -0.0028 0.0236  449 LEU A CB  
3568 C CG  . LEU A 467 ? 0.3375 0.2522 0.2267 -0.0374 -0.0052 0.0375  449 LEU A CG  
3569 C CD1 . LEU A 467 ? 0.3212 0.2520 0.2017 -0.0416 -0.0029 0.0460  449 LEU A CD1 
3570 C CD2 . LEU A 467 ? 0.3339 0.2403 0.2294 -0.0469 -0.0064 0.0453  449 LEU A CD2 
3571 N N   . PHE A 468 ? 0.3267 0.2217 0.2154 -0.0125 -0.0100 0.0102  450 PHE A N   
3572 C CA  . PHE A 468 ? 0.3310 0.2051 0.2127 -0.0080 -0.0124 0.0105  450 PHE A CA  
3573 C C   . PHE A 468 ? 0.3401 0.2151 0.2180 -0.0031 -0.0111 0.0052  450 PHE A C   
3574 O O   . PHE A 468 ? 0.3382 0.2073 0.2106 -0.0030 -0.0106 0.0079  450 PHE A O   
3575 C CB  . PHE A 468 ? 0.3606 0.2231 0.2423 -0.0065 -0.0169 0.0076  450 PHE A CB  
3576 C CG  . PHE A 468 ? 0.3509 0.1957 0.2236 -0.0041 -0.0177 0.0072  450 PHE A CG  
3577 C CD1 . PHE A 468 ? 0.4073 0.2403 0.2774 -0.0069 -0.0164 0.0090  450 PHE A CD1 
3578 C CD2 . PHE A 468 ? 0.3770 0.2170 0.2454 0.0004  -0.0193 0.0046  450 PHE A CD2 
3579 C CE1 . PHE A 468 ? 0.4123 0.2337 0.2752 -0.0050 -0.0151 0.0065  450 PHE A CE1 
3580 C CE2 . PHE A 468 ? 0.4038 0.2310 0.2630 0.0003  -0.0189 0.0048  450 PHE A CE2 
3581 C CZ  . PHE A 468 ? 0.3826 0.2032 0.2391 -0.0023 -0.0161 0.0049  450 PHE A CZ  
3582 N N   . ALA A 469 ? 0.3372 0.2201 0.2208 0.0009  -0.0105 -0.0030 451 ALA A N   
3583 C CA  . ALA A 469 ? 0.3368 0.2186 0.2184 0.0039  -0.0086 -0.0103 451 ALA A CA  
3584 C C   . ALA A 469 ? 0.3354 0.2304 0.2102 -0.0018 -0.0048 -0.0098 451 ALA A C   
3585 O O   . ALA A 469 ? 0.3329 0.2225 0.2019 -0.0026 -0.0051 -0.0111 451 ALA A O   
3586 C CB  . ALA A 469 ? 0.3490 0.2374 0.2425 0.0099  -0.0075 -0.0210 451 ALA A CB  
3587 N N   A SER A 470 ? 0.3272 0.2418 0.2020 -0.0073 -0.0019 -0.0070 452 SER A N   
3588 N N   B SER A 470 ? 0.3293 0.2443 0.2044 -0.0072 -0.0018 -0.0073 452 SER A N   
3589 C CA  A SER A 470 ? 0.3302 0.2620 0.1961 -0.0143 0.0003  -0.0044 452 SER A CA  
3590 C CA  B SER A 470 ? 0.3337 0.2659 0.1998 -0.0146 0.0003  -0.0037 452 SER A CA  
3591 C C   A SER A 470 ? 0.3340 0.2572 0.1949 -0.0160 -0.0042 0.0096  452 SER A C   
3592 C C   B SER A 470 ? 0.3354 0.2568 0.1967 -0.0153 -0.0043 0.0087  452 SER A C   
3593 O O   A SER A 470 ? 0.3186 0.2517 0.1732 -0.0194 -0.0053 0.0115  452 SER A O   
3594 O O   B SER A 470 ? 0.3227 0.2505 0.1784 -0.0174 -0.0053 0.0083  452 SER A O   
3595 C CB  A SER A 470 ? 0.3365 0.2931 0.2023 -0.0216 0.0047  -0.0025 452 SER A CB  
3596 C CB  B SER A 470 ? 0.3425 0.2960 0.2082 -0.0223 0.0034  0.0027  452 SER A CB  
3597 O OG  A SER A 470 ? 0.3389 0.3069 0.2140 -0.0181 0.0100  -0.0178 452 SER A OG  
3598 O OG  B SER A 470 ? 0.3697 0.3426 0.2240 -0.0308 0.0043  0.0082  452 SER A OG  
3599 N N   . GLN A 471 ? 0.3211 0.2279 0.1866 -0.0137 -0.0069 0.0181  453 GLN A N   
3600 C CA  . GLN A 471 ? 0.3345 0.2309 0.2010 -0.0124 -0.0102 0.0289  453 GLN A CA  
3601 C C   . GLN A 471 ? 0.3275 0.2132 0.1938 -0.0074 -0.0108 0.0231  453 GLN A C   
3602 O O   . GLN A 471 ? 0.3449 0.2349 0.2124 -0.0071 -0.0126 0.0284  453 GLN A O   
3603 C CB  . GLN A 471 ? 0.3385 0.2200 0.2114 -0.0124 -0.0113 0.0367  453 GLN A CB  
3604 C CG  . GLN A 471 ? 0.3287 0.2216 0.2021 -0.0202 -0.0110 0.0465  453 GLN A CG  
3605 C CD  . GLN A 471 ? 0.3496 0.2246 0.2307 -0.0221 -0.0128 0.0563  453 GLN A CD  
3606 O OE1 . GLN A 471 ? 0.4202 0.2786 0.3052 -0.0199 -0.0125 0.0493  453 GLN A OE1 
3607 N NE2 . GLN A 471 ? 0.3476 0.2259 0.2304 -0.0274 -0.0150 0.0727  453 GLN A NE2 
3608 N N   . VAL A 472 ? 0.3352 0.2098 0.2007 -0.0044 -0.0098 0.0135  454 VAL A N   
3609 C CA  . VAL A 472 ? 0.3333 0.1991 0.1967 -0.0026 -0.0097 0.0085  454 VAL A CA  
3610 C C   . VAL A 472 ? 0.3397 0.2188 0.2004 -0.0063 -0.0093 0.0042  454 VAL A C   
3611 O O   . VAL A 472 ? 0.3207 0.2038 0.1822 -0.0077 -0.0102 0.0069  454 VAL A O   
3612 C CB  . VAL A 472 ? 0.3326 0.1837 0.1945 -0.0001 -0.0102 0.0024  454 VAL A CB  
3613 C CG1 . VAL A 472 ? 0.3402 0.1828 0.1986 -0.0013 -0.0097 -0.0005 454 VAL A CG1 
3614 C CG2 . VAL A 472 ? 0.3172 0.1576 0.1790 0.0013  -0.0115 0.0056  454 VAL A CG2 
3615 N N   . MET A 473 ? 0.3322 0.2213 0.1910 -0.0085 -0.0077 -0.0035 455 MET A N   
3616 C CA  . MET A 473 ? 0.3532 0.2552 0.2078 -0.0139 -0.0067 -0.0115 455 MET A CA  
3617 C C   . MET A 473 ? 0.3569 0.2798 0.2078 -0.0194 -0.0096 -0.0022 455 MET A C   
3618 O O   . MET A 473 ? 0.3588 0.2900 0.2079 -0.0239 -0.0113 -0.0048 455 MET A O   
3619 C CB  . MET A 473 ? 0.3668 0.2776 0.2211 -0.0149 -0.0027 -0.0246 455 MET A CB  
3620 C CG  . MET A 473 ? 0.3866 0.2777 0.2486 -0.0084 -0.0014 -0.0347 455 MET A CG  
3621 S SD  . MET A 473 ? 0.4260 0.3314 0.2943 -0.0070 0.0050  -0.0529 455 MET A SD  
3622 C CE  . MET A 473 ? 0.4939 0.4071 0.3546 -0.0158 0.0080  -0.0685 455 MET A CE  
3623 N N   . ARG A 474 ? 0.3337 0.2653 0.1847 -0.0196 -0.0110 0.0102  456 ARG A N   
3624 C CA  . ARG A 474 ? 0.3515 0.3031 0.2002 -0.0242 -0.0157 0.0235  456 ARG A CA  
3625 C C   . ARG A 474 ? 0.3291 0.2759 0.1878 -0.0194 -0.0205 0.0347  456 ARG A C   
3626 O O   . ARG A 474 ? 0.3222 0.2888 0.1813 -0.0228 -0.0257 0.0418  456 ARG A O   
3627 C CB  . ARG A 474 ? 0.3480 0.3074 0.1944 -0.0272 -0.0158 0.0353  456 ARG A CB  
3628 C CG  . ARG A 474 ? 0.4056 0.3866 0.2477 -0.0333 -0.0218 0.0524  456 ARG A CG  
3629 C CD  . ARG A 474 ? 0.4800 0.4821 0.3102 -0.0437 -0.0193 0.0574  456 ARG A CD  
3630 N NE  . ARG A 474 ? 0.5323 0.5226 0.3664 -0.0419 -0.0124 0.0490  456 ARG A NE  
3631 C CZ  . ARG A 474 ? 0.5874 0.5750 0.4242 -0.0452 -0.0118 0.0613  456 ARG A CZ  
3632 N NH1 . ARG A 474 ? 0.6175 0.6105 0.4524 -0.0506 -0.0176 0.0839  456 ARG A NH1 
3633 N NH2 . ARG A 474 ? 0.5536 0.5339 0.3961 -0.0438 -0.0062 0.0519  456 ARG A NH2 
3634 N N   . TYR A 475 ? 0.3183 0.2428 0.1858 -0.0118 -0.0188 0.0361  457 TYR A N   
3635 C CA  . TYR A 475 ? 0.3249 0.2448 0.2057 -0.0054 -0.0213 0.0455  457 TYR A CA  
3636 C C   . TYR A 475 ? 0.3104 0.2208 0.1965 -0.0018 -0.0179 0.0366  457 TYR A C   
3637 O O   . TYR A 475 ? 0.3043 0.2207 0.2033 0.0026  -0.0193 0.0420  457 TYR A O   
3638 C CB  . TYR A 475 ? 0.3353 0.2388 0.2236 -0.0006 -0.0213 0.0549  457 TYR A CB  
3639 C CG  . TYR A 475 ? 0.3406 0.2552 0.2248 -0.0060 -0.0250 0.0680  457 TYR A CG  
3640 C CD1 . TYR A 475 ? 0.3728 0.3077 0.2590 -0.0082 -0.0318 0.0828  457 TYR A CD1 
3641 C CD2 . TYR A 475 ? 0.3733 0.2818 0.2512 -0.0105 -0.0221 0.0667  457 TYR A CD2 
3642 C CE1 . TYR A 475 ? 0.4141 0.3620 0.2929 -0.0158 -0.0356 0.0976  457 TYR A CE1 
3643 C CE2 . TYR A 475 ? 0.4067 0.3293 0.2791 -0.0184 -0.0243 0.0799  457 TYR A CE2 
3644 C CZ  . TYR A 475 ? 0.4166 0.3576 0.2879 -0.0215 -0.0309 0.0958  457 TYR A CZ  
3645 O OH  . TYR A 475 ? 0.4505 0.4070 0.3138 -0.0312 -0.0337 0.1117  457 TYR A OH  
3646 N N   . ALA A 476 ? 0.3154 0.2125 0.1935 -0.0036 -0.0137 0.0248  458 ALA A N   
3647 C CA  . ALA A 476 ? 0.3072 0.1960 0.1863 -0.0035 -0.0102 0.0180  458 ALA A CA  
3648 C C   . ALA A 476 ? 0.3190 0.2196 0.1950 -0.0110 -0.0110 0.0120  458 ALA A C   
3649 O O   . ALA A 476 ? 0.3391 0.2352 0.2065 -0.0155 -0.0107 0.0042  458 ALA A O   
3650 C CB  . ALA A 476 ? 0.3113 0.1791 0.1827 -0.0028 -0.0073 0.0120  458 ALA A CB  
3651 N N   . ASP A 477 ? 0.3127 0.2290 0.1979 -0.0123 -0.0119 0.0146  459 ASP A N   
3652 C CA  . ASP A 477 ? 0.3228 0.2518 0.2061 -0.0221 -0.0129 0.0080  459 ASP A CA  
3653 C C   . ASP A 477 ? 0.3229 0.2309 0.1989 -0.0270 -0.0083 -0.0006 459 ASP A C   
3654 O O   . ASP A 477 ? 0.3532 0.2559 0.2225 -0.0343 -0.0087 -0.0089 459 ASP A O   
3655 C CB  . ASP A 477 ? 0.3081 0.2611 0.2066 -0.0228 -0.0148 0.0129  459 ASP A CB  
3656 C CG  . ASP A 477 ? 0.3441 0.3192 0.2521 -0.0176 -0.0220 0.0252  459 ASP A CG  
3657 O OD1 . ASP A 477 ? 0.3441 0.3222 0.2417 -0.0198 -0.0259 0.0279  459 ASP A OD1 
3658 O OD2 . ASP A 477 ? 0.2916 0.2825 0.2183 -0.0117 -0.0240 0.0327  459 ASP A OD2 
3659 N N   . LEU A 478 ? 0.3267 0.2232 0.2044 -0.0235 -0.0041 0.0016  460 LEU A N   
3660 C CA  . LEU A 478 ? 0.3505 0.2258 0.2192 -0.0276 -0.0008 -0.0016 460 LEU A CA  
3661 C C   . LEU A 478 ? 0.3440 0.2019 0.2063 -0.0206 0.0002  0.0008  460 LEU A C   
3662 O O   . LEU A 478 ? 0.3394 0.2011 0.2064 -0.0136 0.0007  0.0036  460 LEU A O   
3663 C CB  . LEU A 478 ? 0.3547 0.2377 0.2277 -0.0343 0.0040  -0.0012 460 LEU A CB  
3664 C CG  . LEU A 478 ? 0.3660 0.2729 0.2493 -0.0425 0.0030  -0.0033 460 LEU A CG  
3665 C CD1 . LEU A 478 ? 0.3629 0.2844 0.2550 -0.0479 0.0094  -0.0025 460 LEU A CD1 
3666 C CD2 . LEU A 478 ? 0.3400 0.2386 0.2165 -0.0529 0.0001  -0.0097 460 LEU A CD2 
3667 N N   . TYR A 479 ? 0.3599 0.1984 0.2126 -0.0232 -0.0004 0.0001  461 TYR A N   
3668 C CA  . TYR A 479 ? 0.3679 0.1932 0.2131 -0.0194 -0.0007 0.0029  461 TYR A CA  
3669 C C   . TYR A 479 ? 0.3786 0.1874 0.2131 -0.0254 -0.0014 0.0063  461 TYR A C   
3670 O O   . TYR A 479 ? 0.3821 0.1825 0.2165 -0.0313 -0.0027 0.0063  461 TYR A O   
3671 C CB  . TYR A 479 ? 0.3626 0.1843 0.2090 -0.0122 -0.0047 0.0023  461 TYR A CB  
3672 C CG  . TYR A 479 ? 0.3561 0.1686 0.2027 -0.0114 -0.0084 -0.0006 461 TYR A CG  
3673 C CD1 . TYR A 479 ? 0.3426 0.1401 0.1857 -0.0091 -0.0121 0.0020  461 TYR A CD1 
3674 C CD2 . TYR A 479 ? 0.3405 0.1615 0.1922 -0.0124 -0.0083 -0.0068 461 TYR A CD2 
3675 C CE1 . TYR A 479 ? 0.3705 0.1594 0.2197 -0.0057 -0.0152 -0.0019 461 TYR A CE1 
3676 C CE2 . TYR A 479 ? 0.3479 0.1612 0.2026 -0.0106 -0.0097 -0.0134 461 TYR A CE2 
3677 C CZ  . TYR A 479 ? 0.3686 0.1650 0.2244 -0.0059 -0.0130 -0.0111 461 TYR A CZ  
3678 O OH  . TYR A 479 ? 0.3940 0.1827 0.2582 -0.0015 -0.0141 -0.0186 461 TYR A OH  
3679 N N   . ALA A 480 ? 0.3826 0.1864 0.2079 -0.0250 -0.0012 0.0097  462 ALA A N   
3680 C CA  . ALA A 480 ? 0.4085 0.1992 0.2206 -0.0321 -0.0032 0.0168  462 ALA A CA  
3681 C C   . ALA A 480 ? 0.4137 0.2030 0.2149 -0.0304 -0.0054 0.0192  462 ALA A C   
3682 O O   . ALA A 480 ? 0.4000 0.1978 0.2042 -0.0257 -0.0030 0.0134  462 ALA A O   
3683 C CB  . ALA A 480 ? 0.4197 0.2172 0.2275 -0.0432 0.0036  0.0184  462 ALA A CB  
3684 N N   . ALA A 481 ? 0.4414 0.2194 0.2298 -0.0354 -0.0109 0.0286  463 ALA A N   
3685 C CA  . ALA A 481 ? 0.4605 0.2406 0.2337 -0.0381 -0.0140 0.0324  463 ALA A CA  
3686 C C   . ALA A 481 ? 0.4640 0.2587 0.2263 -0.0453 -0.0039 0.0255  463 ALA A C   
3687 O O   . ALA A 481 ? 0.4843 0.2852 0.2386 -0.0456 -0.0035 0.0203  463 ALA A O   
3688 C CB  . ALA A 481 ? 0.4810 0.2476 0.2420 -0.0438 -0.0232 0.0480  463 ALA A CB  
3689 N N   . SER A 482 ? 0.4700 0.2718 0.2340 -0.0515 0.0048  0.0239  464 SER A N   
3690 C CA  . SER A 482 ? 0.4717 0.2911 0.2299 -0.0576 0.0168  0.0153  464 SER A CA  
3691 C C   . SER A 482 ? 0.4616 0.2932 0.2372 -0.0574 0.0252  0.0102  464 SER A C   
3692 O O   . SER A 482 ? 0.4612 0.2874 0.2418 -0.0613 0.0226  0.0168  464 SER A O   
3693 C CB  . SER A 482 ? 0.4955 0.3177 0.2285 -0.0727 0.0182  0.0237  464 SER A CB  
3694 O OG  . SER A 482 ? 0.5202 0.3634 0.2478 -0.0797 0.0322  0.0129  464 SER A OG  
3695 N N   . PHE A 483 ? 0.4555 0.3042 0.2413 -0.0537 0.0354  -0.0018 465 PHE A N   
3696 C CA  . PHE A 483 ? 0.4518 0.3188 0.2564 -0.0539 0.0433  -0.0060 465 PHE A CA  
3697 C C   . PHE A 483 ? 0.4510 0.3271 0.2446 -0.0705 0.0491  -0.0002 465 PHE A C   
3698 O O   . PHE A 483 ? 0.4476 0.3358 0.2550 -0.0746 0.0521  0.0005  465 PHE A O   
3699 C CB  . PHE A 483 ? 0.4644 0.3489 0.2858 -0.0451 0.0535  -0.0203 465 PHE A CB  
3700 C CG  . PHE A 483 ? 0.5048 0.4012 0.3130 -0.0529 0.0649  -0.0290 465 PHE A CG  
3701 C CD1 . PHE A 483 ? 0.5283 0.4482 0.3388 -0.0627 0.0764  -0.0318 465 PHE A CD1 
3702 C CD2 . PHE A 483 ? 0.5711 0.4584 0.3619 -0.0535 0.0645  -0.0350 465 PHE A CD2 
3703 C CE1 . PHE A 483 ? 0.5556 0.4905 0.3508 -0.0722 0.0886  -0.0411 465 PHE A CE1 
3704 C CE2 . PHE A 483 ? 0.5789 0.4798 0.3527 -0.0634 0.0755  -0.0447 465 PHE A CE2 
3705 C CZ  . PHE A 483 ? 0.5987 0.5242 0.3738 -0.0730 0.0884  -0.0480 465 PHE A CZ  
3706 N N   . ILE A 484 ? 0.4545 0.3267 0.2227 -0.0817 0.0502  0.0049  466 ILE A N   
3707 C CA  . ILE A 484 ? 0.4751 0.3562 0.2300 -0.0999 0.0562  0.0128  466 ILE A CA  
3708 C C   . ILE A 484 ? 0.4664 0.3321 0.2253 -0.1072 0.0488  0.0260  466 ILE A C   
3709 O O   . ILE A 484 ? 0.4627 0.3385 0.2200 -0.1224 0.0550  0.0309  466 ILE A O   
3710 C CB  . ILE A 484 ? 0.4953 0.3751 0.2175 -0.1126 0.0567  0.0195  466 ILE A CB  
3711 C CG1 . ILE A 484 ? 0.5439 0.4459 0.2539 -0.1324 0.0694  0.0223  466 ILE A CG1 
3712 C CG2 . ILE A 484 ? 0.5037 0.3549 0.2112 -0.1149 0.0406  0.0383  466 ILE A CG2 
3713 C CD1 . ILE A 484 ? 0.5642 0.5015 0.2856 -0.1311 0.0882  0.0008  466 ILE A CD1 
3714 N N   . ASN A 485 ? 0.4541 0.2963 0.2195 -0.0970 0.0364  0.0300  467 ASN A N   
3715 C CA  . ASN A 485 ? 0.4694 0.2926 0.2405 -0.1022 0.0292  0.0386  467 ASN A CA  
3716 C C   . ASN A 485 ? 0.4665 0.3076 0.2575 -0.1068 0.0352  0.0315  467 ASN A C   
3717 O O   . ASN A 485 ? 0.4955 0.3260 0.2885 -0.1183 0.0330  0.0372  467 ASN A O   
3718 C CB  . ASN A 485 ? 0.4600 0.2597 0.2369 -0.0883 0.0171  0.0393  467 ASN A CB  
3719 C CG  . ASN A 485 ? 0.4857 0.2682 0.2458 -0.0859 0.0086  0.0495  467 ASN A CG  
3720 O OD1 . ASN A 485 ? 0.5135 0.3001 0.2541 -0.0961 0.0106  0.0575  467 ASN A OD1 
3721 N ND2 . ASN A 485 ? 0.4493 0.2155 0.2170 -0.0733 -0.0012 0.0496  467 ASN A ND2 
3722 N N   . LEU A 486 ? 0.4500 0.3182 0.2568 -0.0985 0.0423  0.0195  468 LEU A N   
3723 C CA  . LEU A 486 ? 0.4380 0.3330 0.2653 -0.1035 0.0485  0.0135  468 LEU A CA  
3724 C C   . LEU A 486 ? 0.4568 0.3670 0.2791 -0.1239 0.0578  0.0179  468 LEU A C   
3725 O O   . LEU A 486 ? 0.4604 0.3856 0.2975 -0.1331 0.0596  0.0164  468 LEU A O   
3726 C CB  . LEU A 486 ? 0.4238 0.3455 0.2717 -0.0884 0.0537  0.0022  468 LEU A CB  
3727 C CG  . LEU A 486 ? 0.4146 0.3276 0.2731 -0.0711 0.0444  -0.0004 468 LEU A CG  
3728 C CD1 . LEU A 486 ? 0.4030 0.3352 0.2794 -0.0563 0.0496  -0.0085 468 LEU A CD1 
3729 C CD2 . LEU A 486 ? 0.3962 0.3110 0.2661 -0.0736 0.0365  0.0005  468 LEU A CD2 
3730 N N   . LEU A 487 ? 0.4706 0.3789 0.2710 -0.1329 0.0634  0.0236  469 LEU A N   
3731 C CA  . LEU A 487 ? 0.4996 0.4225 0.2904 -0.1556 0.0730  0.0303  469 LEU A CA  
3732 C C   . LEU A 487 ? 0.5179 0.4168 0.3045 -0.1721 0.0660  0.0438  469 LEU A C   
3733 O O   . LEU A 487 ? 0.5384 0.4521 0.3268 -0.1924 0.0733  0.0481  469 LEU A O   
3734 C CB  . LEU A 487 ? 0.5201 0.4427 0.2821 -0.1627 0.0781  0.0358  469 LEU A CB  
3735 C CG  . LEU A 487 ? 0.5336 0.4794 0.2805 -0.1862 0.0912  0.0414  469 LEU A CG  
3736 C CD1 . LEU A 487 ? 0.4968 0.4900 0.2672 -0.1875 0.1084  0.0246  469 LEU A CD1 
3737 C CD2 . LEU A 487 ? 0.5714 0.5119 0.2845 -0.1904 0.0916  0.0472  469 LEU A CD2 
3738 N N   . TYR A 488 ? 0.5295 0.3917 0.3133 -0.1639 0.0523  0.0492  470 TYR A N   
3739 C CA  . TYR A 488 ? 0.5574 0.3880 0.3375 -0.1774 0.0449  0.0612  470 TYR A CA  
3740 C C   . TYR A 488 ? 0.5578 0.3893 0.3604 -0.1790 0.0422  0.0514  470 TYR A C   
3741 O O   . TYR A 488 ? 0.5845 0.3862 0.3874 -0.1889 0.0359  0.0572  470 TYR A O   
3742 C CB  . TYR A 488 ? 0.5750 0.3653 0.3415 -0.1681 0.0320  0.0723  470 TYR A CB  
3743 C CG  . TYR A 488 ? 0.5833 0.3783 0.3267 -0.1670 0.0330  0.0809  470 TYR A CG  
3744 C CD1 . TYR A 488 ? 0.6192 0.4331 0.3448 -0.1861 0.0427  0.0894  470 TYR A CD1 
3745 C CD2 . TYR A 488 ? 0.5685 0.3541 0.3071 -0.1487 0.0254  0.0790  470 TYR A CD2 
3746 C CE1 . TYR A 488 ? 0.6487 0.4720 0.3502 -0.1871 0.0444  0.0946  470 TYR A CE1 
3747 C CE2 . TYR A 488 ? 0.6019 0.3957 0.3185 -0.1498 0.0261  0.0846  470 TYR A CE2 
3748 C CZ  . TYR A 488 ? 0.6153 0.4277 0.3123 -0.1691 0.0355  0.0920  470 TYR A CZ  
3749 O OH  . TYR A 488 ? 0.6507 0.4744 0.3226 -0.1723 0.0366  0.0957  470 TYR A OH  
3750 N N   . TYR A 489 ? 0.5246 0.3894 0.3464 -0.1695 0.0462  0.0368  471 TYR A N   
3751 C CA  . TYR A 489 ? 0.5163 0.3912 0.3585 -0.1719 0.0431  0.0267  471 TYR A CA  
3752 C C   . TYR A 489 ? 0.5238 0.4443 0.3827 -0.1826 0.0529  0.0215  471 TYR A C   
3753 O O   . TYR A 489 ? 0.5282 0.4773 0.3907 -0.1760 0.0615  0.0189  471 TYR A O   
3754 C CB  . TYR A 489 ? 0.4689 0.3459 0.3210 -0.1500 0.0360  0.0164  471 TYR A CB  
3755 C CG  . TYR A 489 ? 0.4596 0.2971 0.3003 -0.1393 0.0269  0.0190  471 TYR A CG  
3756 C CD1 . TYR A 489 ? 0.4755 0.2905 0.3206 -0.1414 0.0198  0.0135  471 TYR A CD1 
3757 C CD2 . TYR A 489 ? 0.4486 0.2732 0.2757 -0.1277 0.0259  0.0254  471 TYR A CD2 
3758 C CE1 . TYR A 489 ? 0.4564 0.2383 0.2956 -0.1302 0.0127  0.0142  471 TYR A CE1 
3759 C CE2 . TYR A 489 ? 0.4495 0.2424 0.2699 -0.1178 0.0173  0.0282  471 TYR A CE2 
3760 C CZ  . TYR A 489 ? 0.4734 0.2454 0.3016 -0.1181 0.0111  0.0225  471 TYR A CZ  
3761 O OH  . TYR A 489 ? 0.4751 0.2188 0.3015 -0.1068 0.0037  0.0235  471 TYR A OH  
3762 N N   . PRO A 490 ? 0.5530 0.4825 0.4248 -0.1993 0.0518  0.0182  472 PRO A N   
3763 C CA  . PRO A 490 ? 0.5506 0.5301 0.4432 -0.2089 0.0604  0.0129  472 PRO A CA  
3764 C C   . PRO A 490 ? 0.5293 0.5460 0.4449 -0.1885 0.0588  0.0024  472 PRO A C   
3765 O O   . PRO A 490 ? 0.5071 0.5112 0.4230 -0.1716 0.0497  -0.0013 472 PRO A O   
3766 C CB  . PRO A 490 ? 0.5679 0.5429 0.4674 -0.2327 0.0570  0.0117  472 PRO A CB  
3767 C CG  . PRO A 490 ? 0.5759 0.5081 0.4671 -0.2263 0.0451  0.0086  472 PRO A CG  
3768 C CD  . PRO A 490 ? 0.5721 0.4687 0.4425 -0.2101 0.0432  0.0171  472 PRO A CD  
3769 N N   . PHE A 491 ? 0.5497 0.6133 0.4858 -0.1910 0.0683  -0.0013 473 PHE A N   
3770 C CA  . PHE A 491 ? 0.5329 0.6391 0.4987 -0.1733 0.0673  -0.0089 473 PHE A CA  
3771 C C   . PHE A 491 ? 0.5253 0.6369 0.5034 -0.1674 0.0526  -0.0125 473 PHE A C   
3772 O O   . PHE A 491 ? 0.5315 0.6586 0.5240 -0.1469 0.0471  -0.0141 473 PHE A O   
3773 C CB  . PHE A 491 ? 0.5648 0.7238 0.5561 -0.1865 0.0786  -0.0122 473 PHE A CB  
3774 C CG  . PHE A 491 ? 0.5897 0.7597 0.5740 -0.1904 0.0957  -0.0121 473 PHE A CG  
3775 C CD1 . PHE A 491 ? 0.6191 0.7855 0.5999 -0.1686 0.1016  -0.0163 473 PHE A CD1 
3776 C CD2 . PHE A 491 ? 0.6379 0.8246 0.6192 -0.2175 0.1067  -0.0088 473 PHE A CD2 
3777 C CE1 . PHE A 491 ? 0.6151 0.7960 0.5878 -0.1739 0.1186  -0.0194 473 PHE A CE1 
3778 C CE2 . PHE A 491 ? 0.6443 0.8471 0.6167 -0.2233 0.1240  -0.0094 473 PHE A CE2 
3779 C CZ  . PHE A 491 ? 0.6326 0.8332 0.5999 -0.2013 0.1300  -0.0158 473 PHE A CZ  
3780 N N   . SER A 492 ? 0.5245 0.6247 0.4971 -0.1867 0.0464  -0.0137 474 SER A N   
3781 C CA  . SER A 492 ? 0.5038 0.6178 0.4869 -0.1858 0.0338  -0.0193 474 SER A CA  
3782 C C   . SER A 492 ? 0.4960 0.5627 0.4556 -0.1862 0.0255  -0.0220 474 SER A C   
3783 O O   . SER A 492 ? 0.4890 0.5590 0.4499 -0.1952 0.0169  -0.0294 474 SER A O   
3784 C CB  . SER A 492 ? 0.5263 0.6753 0.5272 -0.2100 0.0339  -0.0234 474 SER A CB  
3785 O OG  . SER A 492 ? 0.5714 0.7609 0.5931 -0.2116 0.0452  -0.0211 474 SER A OG  
3786 N N   . TYR A 493 ? 0.4765 0.5022 0.4157 -0.1759 0.0281  -0.0172 475 TYR A N   
3787 C CA  . TYR A 493 ? 0.4886 0.4701 0.4093 -0.1738 0.0215  -0.0200 475 TYR A CA  
3788 C C   . TYR A 493 ? 0.4590 0.4512 0.3828 -0.1598 0.0123  -0.0263 475 TYR A C   
3789 O O   . TYR A 493 ? 0.4369 0.4506 0.3688 -0.1419 0.0111  -0.0225 475 TYR A O   
3790 C CB  . TYR A 493 ? 0.4858 0.4294 0.3879 -0.1632 0.0248  -0.0120 475 TYR A CB  
3791 C CG  . TYR A 493 ? 0.5067 0.4034 0.3940 -0.1640 0.0193  -0.0139 475 TYR A CG  
3792 C CD1 . TYR A 493 ? 0.5404 0.4078 0.4220 -0.1829 0.0198  -0.0122 475 TYR A CD1 
3793 C CD2 . TYR A 493 ? 0.4955 0.3771 0.3769 -0.1457 0.0137  -0.0174 475 TYR A CD2 
3794 C CE1 . TYR A 493 ? 0.5617 0.3842 0.4349 -0.1810 0.0147  -0.0148 475 TYR A CE1 
3795 C CE2 . TYR A 493 ? 0.4942 0.3364 0.3667 -0.1446 0.0097  -0.0210 475 TYR A CE2 
3796 C CZ  . TYR A 493 ? 0.5587 0.3709 0.4284 -0.1609 0.0100  -0.0200 475 TYR A CZ  
3797 O OH  . TYR A 493 ? 0.6168 0.3889 0.4828 -0.1573 0.0060  -0.0246 475 TYR A OH  
3798 N N   . LEU A 494 ? 0.4722 0.4477 0.3889 -0.1682 0.0062  -0.0360 476 LEU A N   
3799 C CA  . LEU A 494 ? 0.4557 0.4379 0.3691 -0.1571 -0.0015 -0.0423 476 LEU A CA  
3800 C C   . LEU A 494 ? 0.4608 0.3995 0.3577 -0.1449 -0.0013 -0.0435 476 LEU A C   
3801 O O   . LEU A 494 ? 0.4902 0.3959 0.3795 -0.1532 -0.0011 -0.0514 476 LEU A O   
3802 C CB  . LEU A 494 ? 0.4721 0.4715 0.3878 -0.1742 -0.0078 -0.0558 476 LEU A CB  
3803 C CG  . LEU A 494 ? 0.4705 0.4811 0.3786 -0.1659 -0.0153 -0.0629 476 LEU A CG  
3804 C CD1 . LEU A 494 ? 0.4287 0.4710 0.3436 -0.1473 -0.0197 -0.0505 476 LEU A CD1 
3805 C CD2 . LEU A 494 ? 0.4921 0.5249 0.4005 -0.1861 -0.0212 -0.0780 476 LEU A CD2 
3806 N N   . PHE A 495 ? 0.4249 0.3641 0.3194 -0.1254 -0.0014 -0.0361 477 PHE A N   
3807 C CA  . PHE A 495 ? 0.4193 0.3262 0.3015 -0.1133 -0.0021 -0.0375 477 PHE A CA  
3808 C C   . PHE A 495 ? 0.4194 0.3357 0.2982 -0.1133 -0.0073 -0.0492 477 PHE A C   
3809 O O   . PHE A 495 ? 0.4134 0.3647 0.2967 -0.1109 -0.0116 -0.0474 477 PHE A O   
3810 C CB  . PHE A 495 ? 0.4057 0.3137 0.2870 -0.0953 -0.0007 -0.0270 477 PHE A CB  
3811 C CG  . PHE A 495 ? 0.4001 0.2983 0.2802 -0.0952 0.0053  -0.0182 477 PHE A CG  
3812 C CD1 . PHE A 495 ? 0.4391 0.3018 0.3074 -0.0959 0.0068  -0.0148 477 PHE A CD1 
3813 C CD2 . PHE A 495 ? 0.3903 0.3163 0.2814 -0.0941 0.0095  -0.0132 477 PHE A CD2 
3814 C CE1 . PHE A 495 ? 0.4293 0.2855 0.2923 -0.0986 0.0118  -0.0059 477 PHE A CE1 
3815 C CE2 . PHE A 495 ? 0.4204 0.3401 0.3077 -0.0957 0.0167  -0.0075 477 PHE A CE2 
3816 C CZ  . PHE A 495 ? 0.4458 0.3314 0.3166 -0.0991 0.0177  -0.0033 477 PHE A CZ  
3817 N N   . ARG A 496 ? 1.0530 0.4071 0.5012 -0.3702 0.3706  -0.1079 478 ARG A N   
3818 C CA  . ARG A 496 ? 1.0267 0.4238 0.5056 -0.3598 0.3583  -0.1114 478 ARG A CA  
3819 C C   . ARG A 496 ? 0.9861 0.3559 0.4526 -0.2502 0.3145  -0.0379 478 ARG A C   
3820 O O   . ARG A 496 ? 1.0899 0.3428 0.4429 -0.1813 0.3335  0.0101  478 ARG A O   
3821 C CB  . ARG A 496 ? 1.2314 0.4699 0.5690 -0.4472 0.4593  -0.1650 478 ARG A CB  
3822 C CG  . ARG A 496 ? 1.2776 0.6080 0.6261 -0.5891 0.5129  -0.2645 478 ARG A CG  
3823 C CD  . ARG A 496 ? 1.5709 0.7040 0.7302 -0.7205 0.6463  -0.3390 478 ARG A CD  
3824 N NE  . ARG A 496 ? 1.8861 0.6808 0.8171 -0.7256 0.7461  -0.3174 478 ARG A NE  
3825 C CZ  . ARG A 496 ? 2.1857 0.6233 0.8709 -0.6670 0.8372  -0.2672 478 ARG A CZ  
3826 N NH1 . ARG A 496 ? 2.2587 0.6304 0.9026 -0.6111 0.8404  -0.2374 478 ARG A NH1 
3827 N NH2 . ARG A 496 ? 2.4696 0.5995 0.9236 -0.6496 0.9355  -0.2429 478 ARG A NH2 
3828 N N   . ALA A 497 ? 0.8426 0.3478 0.4173 -0.2280 0.2598  -0.0329 479 ALA A N   
3829 C CA  . ALA A 497 ? 0.8364 0.3548 0.4055 -0.1482 0.2260  0.0164  479 ALA A CA  
3830 C C   . ALA A 497 ? 0.8528 0.3583 0.4229 -0.1626 0.2411  -0.0022 479 ALA A C   
3831 O O   . ALA A 497 ? 0.7909 0.3788 0.4279 -0.2284 0.2448  -0.0536 479 ALA A O   
3832 C CB  . ALA A 497 ? 0.6592 0.3326 0.3385 -0.1304 0.1603  0.0300  479 ALA A CB  
3833 N N   . ALA A 498 ? 0.9471 0.3816 0.4400 -0.0924 0.2499  0.0376  480 ALA A N   
3834 C CA  . ALA A 498 ? 0.9810 0.3885 0.4646 -0.1048 0.2675  0.0224  480 ALA A CA  
3835 C C   . ALA A 498 ? 0.7962 0.4028 0.4457 -0.1155 0.1957  0.0098  480 ALA A C   
3836 O O   . ALA A 498 ? 0.6949 0.4082 0.4161 -0.0805 0.1412  0.0349  480 ALA A O   
3837 C CB  . ALA A 498 ? 1.1072 0.4100 0.4671 0.0000  0.2891  0.0776  480 ALA A CB  
3838 N N   . HIS A 499 ? 0.7947 0.4427 0.4786 -0.1681 0.2093  -0.0341 481 HIS A N   
3839 C CA  . HIS A 499 ? 0.6581 0.4714 0.4629 -0.1527 0.1537  -0.0389 481 HIS A CA  
3840 C C   . HIS A 499 ? 0.6363 0.4347 0.4378 -0.0856 0.1229  0.0095  481 HIS A C   
3841 O O   . HIS A 499 ? 0.7332 0.4231 0.4425 -0.0530 0.1523  0.0319  481 HIS A O   
3842 C CB  . HIS A 499 ? 0.6618 0.5680 0.4947 -0.2108 0.1750  -0.0985 481 HIS A CB  
3843 C CG  . HIS A 499 ? 0.7057 0.7395 0.5635 -0.2828 0.2003  -0.1661 481 HIS A CG  
3844 N ND1 . HIS A 499 ? 0.6727 0.8053 0.5837 -0.2539 0.1728  -0.1608 481 HIS A ND1 
3845 C CD2 . HIS A 499 ? 0.7860 0.8921 0.6137 -0.3908 0.2585  -0.2509 481 HIS A CD2 
3846 C CE1 . HIS A 499 ? 0.6853 0.9697 0.6094 -0.3234 0.2037  -0.2335 481 HIS A CE1 
3847 N NE2 . HIS A 499 ? 0.7914 1.0817 0.6700 -0.4201 0.2566  -0.2970 481 HIS A NE2 
3848 N N   . VAL A 500 ? 0.5444 0.4426 0.4210 -0.0620 0.0768  0.0230  482 VAL A N   
3849 C CA  . VAL A 500 ? 0.5093 0.4405 0.3928 -0.0232 0.0498  0.0517  482 VAL A CA  
3850 C C   . VAL A 500 ? 0.4740 0.4324 0.3900 -0.0181 0.0431  0.0423  482 VAL A C   
3851 O O   . VAL A 500 ? 0.4452 0.4559 0.4019 -0.0338 0.0439  0.0153  482 VAL A O   
3852 C CB  . VAL A 500 ? 0.4803 0.4674 0.3853 -0.0347 0.0315  0.0552  482 VAL A CB  
3853 C CG1 . VAL A 500 ? 0.4498 0.5036 0.3614 -0.0306 0.0156  0.0604  482 VAL A CG1 
3854 C CG2 . VAL A 500 ? 0.5224 0.5098 0.3919 -0.0420 0.0373  0.0612  482 VAL A CG2 
3855 N N   . LEU A 501 ? 0.4817 0.4304 0.3707 0.0169  0.0386  0.0641  483 LEU A N   
3856 C CA  . LEU A 501 ? 0.4464 0.4169 0.3602 0.0256  0.0307  0.0602  483 LEU A CA  
3857 C C   . LEU A 501 ? 0.3896 0.4379 0.3248 0.0514  0.0008  0.0792  483 LEU A C   
3858 O O   . LEU A 501 ? 0.4194 0.5204 0.3256 0.0775  -0.0057 0.0957  483 LEU A O   
3859 C CB  . LEU A 501 ? 0.5472 0.4102 0.3782 0.0381  0.0725  0.0621  483 LEU A CB  
3860 C CG  . LEU A 501 ? 0.6576 0.4183 0.4255 -0.0280 0.1337  0.0197  483 LEU A CG  
3861 C CD1 . LEU A 501 ? 0.8285 0.4183 0.4612 -0.0254 0.2027  0.0189  483 LEU A CD1 
3862 C CD2 . LEU A 501 ? 0.5899 0.4912 0.4509 -0.0907 0.1200  -0.0339 483 LEU A CD2 
3863 N N   . MET A 502 ? 0.3327 0.4110 0.3068 0.0449  -0.0111 0.0710  484 MET A N   
3864 C CA  . MET A 502 ? 0.3077 0.4513 0.2880 0.0485  -0.0257 0.0763  484 MET A CA  
3865 C C   . MET A 502 ? 0.3233 0.4917 0.2829 0.0984  -0.0303 0.0950  484 MET A C   
3866 O O   . MET A 502 ? 0.3665 0.4441 0.2902 0.1206  -0.0089 0.1015  484 MET A O   
3867 C CB  . MET A 502 ? 0.2882 0.4120 0.2831 0.0385  -0.0226 0.0667  484 MET A CB  
3868 C CG  . MET A 502 ? 0.3405 0.4034 0.3020 0.0257  0.0016  0.0597  484 MET A CG  
3869 S SD  . MET A 502 ? 0.3937 0.3804 0.2941 0.0527  0.0321  0.0632  484 MET A SD  
3870 C CE  . MET A 502 ? 0.3416 0.3234 0.1967 -0.0232 0.0539  0.0438  484 MET A CE  
3871 N N   . PRO A 503 ? 0.3089 0.6018 0.2680 0.1122  -0.0449 0.0974  485 PRO A N   
3872 C CA  . PRO A 503 ? 0.3448 0.6839 0.2708 0.1873  -0.0472 0.1210  485 PRO A CA  
3873 C C   . PRO A 503 ? 0.3495 0.5737 0.2743 0.1989  -0.0359 0.1262  485 PRO A C   
3874 O O   . PRO A 503 ? 0.4405 0.5837 0.2856 0.2657  -0.0083 0.1510  485 PRO A O   
3875 C CB  . PRO A 503 ? 0.2931 0.8420 0.2481 0.1626  -0.0668 0.0983  485 PRO A CB  
3876 C CG  . PRO A 503 ? 0.2955 0.9099 0.2573 0.0865  -0.0620 0.0667  485 PRO A CG  
3877 C CD  . PRO A 503 ? 0.2889 0.7020 0.2581 0.0491  -0.0472 0.0680  485 PRO A CD  
3878 N N   . HIS A 504 ? 0.2959 0.5052 0.2789 0.1448  -0.0454 0.1041  486 HIS A N   
3879 C CA  . HIS A 504 ? 0.3061 0.4548 0.2959 0.1470  -0.0374 0.0990  486 HIS A CA  
3880 C C   . HIS A 504 ? 0.3581 0.4092 0.3202 0.1191  -0.0044 0.0796  486 HIS A C   
3881 O O   . HIS A 504 ? 0.3929 0.4024 0.3363 0.1023  0.0184  0.0618  486 HIS A O   
3882 C CB  . HIS A 504 ? 0.2507 0.4385 0.2905 0.1213  -0.0537 0.0847  486 HIS A CB  
3883 C CG  . HIS A 504 ? 0.2315 0.4014 0.2853 0.1034  -0.0485 0.0699  486 HIS A CG  
3884 N ND1 . HIS A 504 ? 0.2388 0.3902 0.2718 0.0892  -0.0399 0.0697  486 HIS A ND1 
3885 C CD2 . HIS A 504 ? 0.1965 0.3877 0.2667 0.1050  -0.0431 0.0509  486 HIS A CD2 
3886 C CE1 . HIS A 504 ? 0.2304 0.3731 0.2580 0.1095  -0.0306 0.0642  486 HIS A CE1 
3887 N NE2 . HIS A 504 ? 0.2230 0.4267 0.2842 0.1209  -0.0382 0.0496  486 HIS A NE2 
3888 N N   . GLU A 505 ? 0.3759 0.4062 0.3296 0.0974  0.0049  0.0720  487 GLU A N   
3889 C CA  . GLU A 505 ? 0.4448 0.4137 0.3661 0.0465  0.0453  0.0373  487 GLU A CA  
3890 C C   . GLU A 505 ? 0.6214 0.4155 0.4053 0.0574  0.1090  0.0482  487 GLU A C   
3891 O O   . GLU A 505 ? 0.7185 0.4225 0.4371 -0.0106 0.1674  0.0073  487 GLU A O   
3892 C CB  . GLU A 505 ? 0.3839 0.4163 0.3520 0.0217  0.0310  0.0217  487 GLU A CB  
3893 C CG  . GLU A 505 ? 0.2867 0.4335 0.3241 0.0377  -0.0017 0.0161  487 GLU A CG  
3894 C CD  . GLU A 505 ? 0.2784 0.4570 0.3252 0.0425  -0.0038 0.0128  487 GLU A CD  
3895 O OE1 . GLU A 505 ? 0.2847 0.4049 0.3084 0.0276  0.0034  0.0224  487 GLU A OE1 
3896 O OE2 . GLU A 505 ? 0.2755 0.5404 0.3372 0.0770  -0.0081 0.0043  487 GLU A OE2 
3897 N N   . SER A 506 ? 0.7001 0.4578 0.4192 0.1472  0.1077  0.0994  488 SER A N   
3898 C CA  . SER A 506 ? 0.9279 0.4958 0.4662 0.2106  0.1793  0.1302  488 SER A CA  
3899 C C   . SER A 506 ? 1.1177 0.5099 0.5057 0.2586  0.2482  0.1461  488 SER A C   
3900 O O   . SER A 506 ? 1.0825 0.5193 0.5306 0.2216  0.2339  0.1244  488 SER A O   
3901 C CB  . SER A 506 ? 0.9201 0.5966 0.4480 0.3135  0.1441  0.1791  488 SER A CB  
3902 O OG  . SER A 506 ? 0.7936 0.6241 0.4580 0.2495  0.0864  0.1563  488 SER A OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -17 ?   ?   ?   A . n 
A 1 2   SER 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   HIS 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  SER 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  GLY 12  -6  ?   ?   ?   A . n 
A 1 13  LEU 13  -5  ?   ?   ?   A . n 
A 1 14  VAL 14  -4  ?   ?   ?   A . n 
A 1 15  PRO 15  -3  ?   ?   ?   A . n 
A 1 16  ARG 16  -2  ?   ?   ?   A . n 
A 1 17  GLY 17  -1  ?   ?   ?   A . n 
A 1 18  SER 18  0   ?   ?   ?   A . n 
A 1 19  MET 19  1   ?   ?   ?   A . n 
A 1 20  SER 20  2   ?   ?   ?   A . n 
A 1 21  THR 21  3   3   THR THR A . n 
A 1 22  SER 22  4   4   SER SER A . n 
A 1 23  TRP 23  5   5   TRP TRP A . n 
A 1 24  SER 24  6   6   SER SER A . n 
A 1 25  ASP 25  7   7   ASP ASP A . n 
A 1 26  ARG 26  8   8   ARG ARG A . n 
A 1 27  LEU 27  9   9   LEU LEU A . n 
A 1 28  GLN 28  10  10  GLN GLN A . n 
A 1 29  ASN 29  11  11  ASN ASN A . n 
A 1 30  ALA 30  12  12  ALA ALA A . n 
A 1 31  ALA 31  13  13  ALA ALA A . n 
A 1 32  ASP 32  14  14  ASP ASP A . n 
A 1 33  MET 33  15  15  MET MET A . n 
A 1 34  PRO 34  16  16  PRO PRO A . n 
A 1 35  ALA 35  17  17  ALA ALA A . n 
A 1 36  ASN 36  18  18  ASN ASN A . n 
A 1 37  MET 37  19  19  MET MET A . n 
A 1 38  ASP 38  20  20  ASP ASP A . n 
A 1 39  LYS 39  21  21  LYS LYS A . n 
A 1 40  HIS 40  22  22  HIS HIS A . n 
A 1 41  ALA 41  23  23  ALA ALA A . n 
A 1 42  LEU 42  24  24  LEU LEU A . n 
A 1 43  LYS 43  25  25  LYS LYS A . n 
A 1 44  LYS 44  26  26  LYS LYS A . n 
A 1 45  TYR 45  27  27  TYR TYR A . n 
A 1 46  ARG 46  28  28  ARG ARG A . n 
A 1 47  ARG 47  29  29  ARG ARG A . n 
A 1 48  GLU 48  30  30  GLU GLU A . n 
A 1 49  ALA 49  31  31  ALA ALA A . n 
A 1 50  TYR 50  32  32  TYR TYR A . n 
A 1 51  HIS 51  33  33  HIS HIS A . n 
A 1 52  ARG 52  34  34  ARG ARG A . n 
A 1 53  VAL 53  35  35  VAL VAL A . n 
A 1 54  PHE 54  36  36  PHE PHE A . n 
A 1 55  VAL 55  37  37  VAL VAL A . n 
A 1 56  ASN 56  38  38  ASN ASN A . n 
A 1 57  ARG 57  39  39  ARG ARG A . n 
A 1 58  SER 58  40  40  SER SER A . n 
A 1 59  LEU 59  41  41  LEU LEU A . n 
A 1 60  ALA 60  42  42  ALA ALA A . n 
A 1 61  MET 61  43  43  MET MET A . n 
A 1 62  GLU 62  44  44  GLU GLU A . n 
A 1 63  LYS 63  45  45  LYS LYS A . n 
A 1 64  ILE 64  46  46  ILE ILE A . n 
A 1 65  LYS 65  47  47  LYS LYS A . n 
A 1 66  CYS 66  48  48  CYS CYS A . n 
A 1 67  PHE 67  49  49  PHE PHE A . n 
A 1 68  GLY 68  50  50  GLY GLY A . n 
A 1 69  PHE 69  51  51  PHE PHE A . n 
A 1 70  ASN 70  52  52  ASN ASN A . n 
A 1 71  MET 71  53  53  MET MET A . n 
A 1 72  ASP 72  54  54  ASP ASP A . n 
A 1 73  TYR 73  55  55  TYR TYR A . n 
A 1 74  THR 74  56  56  THR THR A . n 
A 1 75  LEU 75  57  57  LEU LEU A . n 
A 1 76  ALA 76  58  58  ALA ALA A . n 
A 1 77  VAL 77  59  59  VAL VAL A . n 
A 1 78  TYR 78  60  60  TYR TYR A . n 
A 1 79  LYS 79  61  61  LYS LYS A . n 
A 1 80  SER 80  62  62  SER SER A . n 
A 1 81  PRO 81  63  63  PRO PRO A . n 
A 1 82  GLU 82  64  64  GLU GLU A . n 
A 1 83  TYR 83  65  65  TYR TYR A . n 
A 1 84  GLU 84  66  66  GLU GLU A . n 
A 1 85  SER 85  67  67  SER SER A . n 
A 1 86  LEU 86  68  68  LEU LEU A . n 
A 1 87  GLY 87  69  69  GLY GLY A . n 
A 1 88  PHE 88  70  70  PHE PHE A . n 
A 1 89  GLU 89  71  71  GLU GLU A . n 
A 1 90  LEU 90  72  72  LEU LEU A . n 
A 1 91  THR 91  73  73  THR THR A . n 
A 1 92  VAL 92  74  74  VAL VAL A . n 
A 1 93  GLU 93  75  75  GLU GLU A . n 
A 1 94  ARG 94  76  76  ARG ARG A . n 
A 1 95  LEU 95  77  77  LEU LEU A . n 
A 1 96  VAL 96  78  78  VAL VAL A . n 
A 1 97  SER 97  79  79  SER SER A . n 
A 1 98  ILE 98  80  80  ILE ILE A . n 
A 1 99  GLY 99  81  81  GLY GLY A . n 
A 1 100 TYR 100 82  82  TYR TYR A . n 
A 1 101 PRO 101 83  83  PRO PRO A . n 
A 1 102 GLN 102 84  84  GLN GLN A . n 
A 1 103 GLU 103 85  85  GLU GLU A . n 
A 1 104 LEU 104 86  86  LEU LEU A . n 
A 1 105 LEU 105 87  87  LEU LEU A . n 
A 1 106 SER 106 88  88  SER SER A . n 
A 1 107 PHE 107 89  89  PHE PHE A . n 
A 1 108 ALA 108 90  90  ALA ALA A . n 
A 1 109 TYR 109 91  91  TYR TYR A . n 
A 1 110 ASP 110 92  92  ASP ASP A . n 
A 1 111 SER 111 93  93  SER SER A . n 
A 1 112 THR 112 94  94  THR THR A . n 
A 1 113 PHE 113 95  95  PHE PHE A . n 
A 1 114 PRO 114 96  96  PRO PRO A . n 
A 1 115 THR 115 97  97  THR THR A . n 
A 1 116 ARG 116 98  98  ARG ARG A . n 
A 1 117 GLY 117 99  99  GLY GLY A . n 
A 1 118 LEU 118 100 100 LEU LEU A . n 
A 1 119 VAL 119 101 101 VAL VAL A . n 
A 1 120 PHE 120 102 102 PHE PHE A . n 
A 1 121 ASP 121 103 103 ASP ASP A . n 
A 1 122 THR 122 104 104 THR THR A . n 
A 1 123 LEU 123 105 105 LEU LEU A . n 
A 1 124 TYR 124 106 106 TYR TYR A . n 
A 1 125 GLY 125 107 107 GLY GLY A . n 
A 1 126 ASN 126 108 108 ASN ASN A . n 
A 1 127 LEU 127 109 109 LEU LEU A . n 
A 1 128 LEU 128 110 110 LEU LEU A . n 
A 1 129 LYS 129 111 111 LYS LYS A . n 
A 1 130 VAL 130 112 112 VAL VAL A . n 
A 1 131 ASP 131 113 113 ASP ASP A . n 
A 1 132 ALA 132 114 114 ALA ALA A . n 
A 1 133 TYR 133 115 115 TYR TYR A . n 
A 1 134 GLY 134 116 116 GLY GLY A . n 
A 1 135 ASN 135 117 117 ASN ASN A . n 
A 1 136 LEU 136 118 118 LEU LEU A . n 
A 1 137 LEU 137 119 119 LEU LEU A . n 
A 1 138 VAL 138 120 120 VAL VAL A . n 
A 1 139 CYS 139 121 121 CYS CYS A . n 
A 1 140 ALA 140 122 122 ALA ALA A . n 
A 1 141 HIS 141 123 123 HIS HIS A . n 
A 1 142 GLY 142 124 124 GLY GLY A . n 
A 1 143 PHE 143 125 125 PHE PHE A . n 
A 1 144 ASN 144 126 126 ASN ASN A . n 
A 1 145 PHE 145 127 127 PHE PHE A . n 
A 1 146 ILE 146 128 128 ILE ILE A . n 
A 1 147 ARG 147 129 129 ARG ARG A . n 
A 1 148 GLY 148 130 130 GLY GLY A . n 
A 1 149 PRO 149 131 131 PRO PRO A . n 
A 1 150 GLU 150 132 132 GLU GLU A . n 
A 1 151 THR 151 133 133 THR THR A . n 
A 1 152 ARG 152 134 134 ARG ARG A . n 
A 1 153 GLU 153 135 135 GLU GLU A . n 
A 1 154 GLN 154 136 136 GLN GLN A . n 
A 1 155 TYR 155 137 137 TYR TYR A . n 
A 1 156 PRO 156 138 138 PRO PRO A . n 
A 1 157 ASN 157 139 139 ASN ASN A . n 
A 1 158 LYS 158 140 140 LYS LYS A . n 
A 1 159 PHE 159 141 141 PHE PHE A . n 
A 1 160 ILE 160 142 142 ILE ILE A . n 
A 1 161 GLN 161 143 143 GLN GLN A . n 
A 1 162 ARG 162 144 144 ARG ARG A . n 
A 1 163 ASP 163 145 145 ASP ASP A . n 
A 1 164 ASP 164 146 146 ASP ASP A . n 
A 1 165 THR 165 147 147 THR THR A . n 
A 1 166 GLU 166 148 148 GLU GLU A . n 
A 1 167 ARG 167 149 149 ARG ARG A . n 
A 1 168 PHE 168 150 150 PHE PHE A . n 
A 1 169 TYR 169 151 151 TYR TYR A . n 
A 1 170 ILE 170 152 152 ILE ILE A . n 
A 1 171 LEU 171 153 153 LEU LEU A . n 
A 1 172 ASN 172 154 154 ASN ASN A . n 
A 1 173 THR 173 155 155 THR THR A . n 
A 1 174 LEU 174 156 156 LEU LEU A . n 
A 1 175 PHE 175 157 157 PHE PHE A . n 
A 1 176 ASN 176 158 158 ASN ASN A . n 
A 1 177 LEU 177 159 159 LEU LEU A . n 
A 1 178 PRO 178 160 160 PRO PRO A . n 
A 1 179 GLU 179 161 161 GLU GLU A . n 
A 1 180 THR 180 162 162 THR THR A . n 
A 1 181 TYR 181 163 163 TYR TYR A . n 
A 1 182 LEU 182 164 164 LEU LEU A . n 
A 1 183 LEU 183 165 165 LEU LEU A . n 
A 1 184 ALA 184 166 166 ALA ALA A . n 
A 1 185 CYS 185 167 167 CYS CYS A . n 
A 1 186 LEU 186 168 168 LEU LEU A . n 
A 1 187 VAL 187 169 169 VAL VAL A . n 
A 1 188 ASP 188 170 170 ASP ASP A . n 
A 1 189 PHE 189 171 171 PHE PHE A . n 
A 1 190 PHE 190 172 172 PHE PHE A . n 
A 1 191 THR 191 173 173 THR THR A . n 
A 1 192 ASN 192 174 174 ASN ASN A . n 
A 1 193 CYS 193 175 175 CYS CYS A . n 
A 1 194 PRO 194 176 176 PRO PRO A . n 
A 1 195 ARG 195 177 177 ARG ARG A . n 
A 1 196 TYR 196 178 178 TYR TYR A . n 
A 1 197 THR 197 179 179 THR THR A . n 
A 1 198 SER 198 180 180 SER SER A . n 
A 1 199 CYS 199 181 181 CYS CYS A . n 
A 1 200 GLU 200 182 182 GLU GLU A . n 
A 1 201 THR 201 183 183 THR THR A . n 
A 1 202 GLY 202 184 184 GLY GLY A . n 
A 1 203 PHE 203 185 185 PHE PHE A . n 
A 1 204 LYS 204 186 186 LYS LYS A . n 
A 1 205 ASP 205 187 187 ASP ASP A . n 
A 1 206 GLY 206 188 188 GLY GLY A . n 
A 1 207 ASP 207 189 189 ASP ASP A . n 
A 1 208 LEU 208 190 190 LEU LEU A . n 
A 1 209 PHE 209 191 191 PHE PHE A . n 
A 1 210 MET 210 192 192 MET MET A . n 
A 1 211 SER 211 193 193 SER SER A . n 
A 1 212 TYR 212 194 194 TYR TYR A . n 
A 1 213 ARG 213 195 195 ARG ARG A . n 
A 1 214 SER 214 196 196 SER SER A . n 
A 1 215 MET 215 197 197 MET MET A . n 
A 1 216 PHE 216 198 198 PHE PHE A . n 
A 1 217 GLN 217 199 199 GLN GLN A . n 
A 1 218 ASP 218 200 200 ASP ASP A . n 
A 1 219 VAL 219 201 201 VAL VAL A . n 
A 1 220 ARG 220 202 202 ARG ARG A . n 
A 1 221 ASP 221 203 203 ASP ASP A . n 
A 1 222 ALA 222 204 204 ALA ALA A . n 
A 1 223 VAL 223 205 205 VAL VAL A . n 
A 1 224 ASP 224 206 206 ASP ASP A . n 
A 1 225 TRP 225 207 207 TRP TRP A . n 
A 1 226 VAL 226 208 208 VAL VAL A . n 
A 1 227 HIS 227 209 209 HIS HIS A . n 
A 1 228 TYR 228 210 210 TYR TYR A . n 
A 1 229 LYS 229 211 211 LYS LYS A . n 
A 1 230 GLY 230 212 212 GLY GLY A . n 
A 1 231 SER 231 213 213 SER SER A . n 
A 1 232 LEU 232 214 214 LEU LEU A . n 
A 1 233 LYS 233 215 215 LYS LYS A . n 
A 1 234 GLU 234 216 216 GLU GLU A . n 
A 1 235 LYS 235 217 217 LYS LYS A . n 
A 1 236 THR 236 218 218 THR THR A . n 
A 1 237 VAL 237 219 219 VAL VAL A . n 
A 1 238 GLU 238 220 220 GLU GLU A . n 
A 1 239 ASN 239 221 221 ASN ASN A . n 
A 1 240 LEU 240 222 222 LEU LEU A . n 
A 1 241 GLU 241 223 223 GLU GLU A . n 
A 1 242 LYS 242 224 224 LYS LYS A . n 
A 1 243 TYR 243 225 225 TYR TYR A . n 
A 1 244 VAL 244 226 226 VAL VAL A . n 
A 1 245 VAL 245 227 227 VAL VAL A . n 
A 1 246 LYS 246 228 228 LYS LYS A . n 
A 1 247 ASP 247 229 229 ASP ASP A . n 
A 1 248 GLY 248 230 230 GLY GLY A . n 
A 1 249 LYS 249 231 231 LYS LYS A . n 
A 1 250 LEU 250 232 232 LEU LEU A . n 
A 1 251 PRO 251 233 233 PRO PRO A . n 
A 1 252 LEU 252 234 234 LEU LEU A . n 
A 1 253 LEU 253 235 235 LEU LEU A . n 
A 1 254 LEU 254 236 236 LEU LEU A . n 
A 1 255 SER 255 237 237 SER SER A . n 
A 1 256 ARG 256 238 238 ARG ARG A . n 
A 1 257 MET 257 239 239 MET MET A . n 
A 1 258 LYS 258 240 240 LYS LYS A . n 
A 1 259 GLU 259 241 241 GLU GLU A . n 
A 1 260 VAL 260 242 242 VAL VAL A . n 
A 1 261 GLY 261 243 243 GLY GLY A . n 
A 1 262 LYS 262 244 244 LYS LYS A . n 
A 1 263 VAL 263 245 245 VAL VAL A . n 
A 1 264 PHE 264 246 246 PHE PHE A . n 
A 1 265 LEU 265 247 247 LEU LEU A . n 
A 1 266 ALA 266 248 248 ALA ALA A . n 
A 1 267 THR 267 249 249 THR THR A . n 
A 1 268 ASN 268 250 250 ASN ASN A . n 
A 1 269 SER 269 251 251 SER SER A . n 
A 1 270 ASP 270 252 252 ASP ASP A . n 
A 1 271 TYR 271 253 253 TYR TYR A . n 
A 1 272 LYS 272 254 254 LYS LYS A . n 
A 1 273 TYR 273 255 255 TYR TYR A . n 
A 1 274 THR 274 256 256 THR THR A . n 
A 1 275 ASP 275 257 257 ASP ASP A . n 
A 1 276 LYS 276 258 258 LYS LYS A . n 
A 1 277 ILE 277 259 259 ILE ILE A . n 
A 1 278 MET 278 260 260 MET MET A . n 
A 1 279 THR 279 261 261 THR THR A . n 
A 1 280 TYR 280 262 262 TYR TYR A . n 
A 1 281 LEU 281 263 263 LEU LEU A . n 
A 1 282 PHE 282 264 264 PHE PHE A . n 
A 1 283 ASP 283 265 265 ASP ASP A . n 
A 1 284 PHE 284 266 266 PHE PHE A . n 
A 1 285 PRO 285 267 267 PRO PRO A . n 
A 1 286 HIS 286 268 268 HIS HIS A . n 
A 1 287 GLY 287 269 269 GLY GLY A . n 
A 1 288 PRO 288 270 270 PRO PRO A . n 
A 1 289 LYS 289 271 271 LYS LYS A . n 
A 1 290 PRO 290 272 272 PRO PRO A . n 
A 1 291 GLY 291 273 273 GLY GLY A . n 
A 1 292 SER 292 274 274 SER SER A . n 
A 1 293 SER 293 275 275 SER SER A . n 
A 1 294 HIS 294 276 276 HIS HIS A . n 
A 1 295 ARG 295 277 277 ARG ARG A . n 
A 1 296 PRO 296 278 278 PRO PRO A . n 
A 1 297 TRP 297 279 279 TRP TRP A . n 
A 1 298 GLN 298 280 280 GLN GLN A . n 
A 1 299 SER 299 281 281 SER SER A . n 
A 1 300 TYR 300 282 282 TYR TYR A . n 
A 1 301 PHE 301 283 283 PHE PHE A . n 
A 1 302 ASP 302 284 284 ASP ASP A . n 
A 1 303 LEU 303 285 285 LEU LEU A . n 
A 1 304 ILE 304 286 286 ILE ILE A . n 
A 1 305 LEU 305 287 287 LEU LEU A . n 
A 1 306 VAL 306 288 288 VAL VAL A . n 
A 1 307 ASP 307 289 289 ASP ASP A . n 
A 1 308 ALA 308 290 290 ALA ALA A . n 
A 1 309 ARG 309 291 291 ARG ARG A . n 
A 1 310 LYS 310 292 292 LYS LYS A . n 
A 1 311 PRO 311 293 293 PRO PRO A . n 
A 1 312 LEU 312 294 294 LEU LEU A . n 
A 1 313 PHE 313 295 295 PHE PHE A . n 
A 1 314 PHE 314 296 296 PHE PHE A . n 
A 1 315 GLY 315 297 297 GLY GLY A . n 
A 1 316 GLU 316 298 298 GLU GLU A . n 
A 1 317 GLY 317 299 299 GLY GLY A . n 
A 1 318 THR 318 300 300 THR THR A . n 
A 1 319 VAL 319 301 301 VAL VAL A . n 
A 1 320 LEU 320 302 302 LEU LEU A . n 
A 1 321 ARG 321 303 303 ARG ARG A . n 
A 1 322 GLN 322 304 304 GLN GLN A . n 
A 1 323 VAL 323 305 305 VAL VAL A . n 
A 1 324 ASP 324 306 306 ASP ASP A . n 
A 1 325 THR 325 307 307 THR THR A . n 
A 1 326 LYS 326 308 308 LYS LYS A . n 
A 1 327 THR 327 309 309 THR THR A . n 
A 1 328 GLY 328 310 310 GLY GLY A . n 
A 1 329 LYS 329 311 311 LYS LYS A . n 
A 1 330 LEU 330 312 312 LEU LEU A . n 
A 1 331 LYS 331 313 313 LYS LYS A . n 
A 1 332 ILE 332 314 314 ILE ILE A . n 
A 1 333 GLY 333 315 315 GLY GLY A . n 
A 1 334 THR 334 316 316 THR THR A . n 
A 1 335 TYR 335 317 317 TYR TYR A . n 
A 1 336 THR 336 318 318 THR THR A . n 
A 1 337 GLY 337 319 319 GLY GLY A . n 
A 1 338 PRO 338 320 320 PRO PRO A . n 
A 1 339 LEU 339 321 321 LEU LEU A . n 
A 1 340 GLN 340 322 322 GLN GLN A . n 
A 1 341 HIS 341 323 323 HIS HIS A . n 
A 1 342 GLY 342 324 324 GLY GLY A . n 
A 1 343 ILE 343 325 325 ILE ILE A . n 
A 1 344 VAL 344 326 326 VAL VAL A . n 
A 1 345 TYR 345 327 327 TYR TYR A . n 
A 1 346 SER 346 328 328 SER SER A . n 
A 1 347 GLY 347 329 329 GLY GLY A . n 
A 1 348 GLY 348 330 330 GLY GLY A . n 
A 1 349 SER 349 331 331 SER SER A . n 
A 1 350 SER 350 332 332 SER SER A . n 
A 1 351 ASP 351 333 333 ASP ASP A . n 
A 1 352 THR 352 334 334 THR THR A . n 
A 1 353 ILE 353 335 335 ILE ILE A . n 
A 1 354 CYS 354 336 336 CYS CYS A . n 
A 1 355 ASP 355 337 337 ASP ASP A . n 
A 1 356 LEU 356 338 338 LEU LEU A . n 
A 1 357 LEU 357 339 339 LEU LEU A . n 
A 1 358 GLY 358 340 340 GLY GLY A . n 
A 1 359 ALA 359 341 341 ALA ALA A . n 
A 1 360 LYS 360 342 342 LYS LYS A . n 
A 1 361 GLY 361 343 343 GLY GLY A . n 
A 1 362 LYS 362 344 344 LYS LYS A . n 
A 1 363 ASP 363 345 345 ASP ASP A . n 
A 1 364 ILE 364 346 346 ILE ILE A . n 
A 1 365 LEU 365 347 347 LEU LEU A . n 
A 1 366 TYR 366 348 348 TYR TYR A . n 
A 1 367 ILE 367 349 349 ILE ILE A . n 
A 1 368 GLY 368 350 350 GLY GLY A . n 
A 1 369 ASP 369 351 351 ASP ASP A . n 
A 1 370 HIS 370 352 352 HIS HIS A . n 
A 1 371 ILE 371 353 353 ILE ILE A . n 
A 1 372 PHE 372 354 354 PHE PHE A . n 
A 1 373 GLY 373 355 355 GLY GLY A . n 
A 1 374 ASP 374 356 356 ASP ASP A . n 
A 1 375 ILE 375 357 357 ILE ILE A . n 
A 1 376 LEU 376 358 358 LEU LEU A . n 
A 1 377 LYS 377 359 359 LYS LYS A . n 
A 1 378 SER 378 360 360 SER SER A . n 
A 1 379 LYS 379 361 361 LYS LYS A . n 
A 1 380 LYS 380 362 362 LYS LYS A . n 
A 1 381 ARG 381 363 363 ARG ARG A . n 
A 1 382 GLN 382 364 364 GLN GLN A . n 
A 1 383 GLY 383 365 365 GLY GLY A . n 
A 1 384 TRP 384 366 366 TRP TRP A . n 
A 1 385 ARG 385 367 367 ARG ARG A . n 
A 1 386 THR 386 368 368 THR THR A . n 
A 1 387 PHE 387 369 369 PHE PHE A . n 
A 1 388 LEU 388 370 370 LEU LEU A . n 
A 1 389 VAL 389 371 371 VAL VAL A . n 
A 1 390 ILE 390 372 372 ILE ILE A . n 
A 1 391 PRO 391 373 373 PRO PRO A . n 
A 1 392 GLU 392 374 374 GLU GLU A . n 
A 1 393 LEU 393 375 375 LEU LEU A . n 
A 1 394 ALA 394 376 376 ALA ALA A . n 
A 1 395 GLN 395 377 377 GLN GLN A . n 
A 1 396 GLU 396 378 378 GLU GLU A . n 
A 1 397 LEU 397 379 379 LEU LEU A . n 
A 1 398 HIS 398 380 380 HIS HIS A . n 
A 1 399 VAL 399 381 381 VAL VAL A . n 
A 1 400 TRP 400 382 382 TRP TRP A . n 
A 1 401 THR 401 383 383 THR THR A . n 
A 1 402 ASP 402 384 384 ASP ASP A . n 
A 1 403 LYS 403 385 385 LYS LYS A . n 
A 1 404 SER 404 386 386 SER SER A . n 
A 1 405 SER 405 387 387 SER SER A . n 
A 1 406 LEU 406 388 388 LEU LEU A . n 
A 1 407 PHE 407 389 389 PHE PHE A . n 
A 1 408 GLU 408 390 390 GLU GLU A . n 
A 1 409 GLU 409 391 391 GLU GLU A . n 
A 1 410 LEU 410 392 392 LEU LEU A . n 
A 1 411 GLN 411 393 393 GLN GLN A . n 
A 1 412 SER 412 394 394 SER SER A . n 
A 1 413 LEU 413 395 395 LEU LEU A . n 
A 1 414 ASP 414 396 396 ASP ASP A . n 
A 1 415 ILE 415 397 397 ILE ILE A . n 
A 1 416 PHE 416 398 398 PHE PHE A . n 
A 1 417 LEU 417 399 399 LEU LEU A . n 
A 1 418 ALA 418 400 400 ALA ALA A . n 
A 1 419 GLU 419 401 ?   ?   ?   A . n 
A 1 420 LEU 420 402 ?   ?   ?   A . n 
A 1 421 TYR 421 403 ?   ?   ?   A . n 
A 1 422 LYS 422 404 ?   ?   ?   A . n 
A 1 423 HIS 423 405 ?   ?   ?   A . n 
A 1 424 LEU 424 406 ?   ?   ?   A . n 
A 1 425 ASP 425 407 ?   ?   ?   A . n 
A 1 426 SER 426 408 ?   ?   ?   A . n 
A 1 427 SER 427 409 ?   ?   ?   A . n 
A 1 428 SER 428 410 ?   ?   ?   A . n 
A 1 429 ASN 429 411 ?   ?   ?   A . n 
A 1 430 GLU 430 412 ?   ?   ?   A . n 
A 1 431 ARG 431 413 ?   ?   ?   A . n 
A 1 432 PRO 432 414 ?   ?   ?   A . n 
A 1 433 ASP 433 415 ?   ?   ?   A . n 
A 1 434 ILE 434 416 ?   ?   ?   A . n 
A 1 435 SER 435 417 417 SER SER A . n 
A 1 436 SER 436 418 418 SER SER A . n 
A 1 437 ILE 437 419 419 ILE ILE A . n 
A 1 438 GLN 438 420 420 GLN GLN A . n 
A 1 439 ARG 439 421 421 ARG ARG A . n 
A 1 440 ARG 440 422 422 ARG ARG A . n 
A 1 441 ILE 441 423 423 ILE ILE A . n 
A 1 442 LYS 442 424 424 LYS LYS A . n 
A 1 443 LYS 443 425 425 LYS LYS A . n 
A 1 444 VAL 444 426 426 VAL VAL A . n 
A 1 445 THR 445 427 427 THR THR A . n 
A 1 446 HIS 446 428 428 HIS HIS A . n 
A 1 447 ASP 447 429 429 ASP ASP A . n 
A 1 448 MET 448 430 430 MET MET A . n 
A 1 449 ASP 449 431 431 ASP ASP A . n 
A 1 450 MET 450 432 432 MET MET A . n 
A 1 451 CYS 451 433 433 CYS CYS A . n 
A 1 452 TYR 452 434 434 TYR TYR A . n 
A 1 453 GLY 453 435 435 GLY GLY A . n 
A 1 454 MET 454 436 436 MET MET A . n 
A 1 455 MET 455 437 437 MET MET A . n 
A 1 456 GLY 456 438 438 GLY GLY A . n 
A 1 457 SER 457 439 439 SER SER A . n 
A 1 458 LEU 458 440 440 LEU LEU A . n 
A 1 459 PHE 459 441 441 PHE PHE A . n 
A 1 460 ARG 460 442 442 ARG ARG A . n 
A 1 461 SER 461 443 443 SER SER A . n 
A 1 462 GLY 462 444 444 GLY GLY A . n 
A 1 463 SER 463 445 445 SER SER A . n 
A 1 464 ARG 464 446 446 ARG ARG A . n 
A 1 465 GLN 465 447 447 GLN GLN A . n 
A 1 466 THR 466 448 448 THR THR A . n 
A 1 467 LEU 467 449 449 LEU LEU A . n 
A 1 468 PHE 468 450 450 PHE PHE A . n 
A 1 469 ALA 469 451 451 ALA ALA A . n 
A 1 470 SER 470 452 452 SER SER A . n 
A 1 471 GLN 471 453 453 GLN GLN A . n 
A 1 472 VAL 472 454 454 VAL VAL A . n 
A 1 473 MET 473 455 455 MET MET A . n 
A 1 474 ARG 474 456 456 ARG ARG A . n 
A 1 475 TYR 475 457 457 TYR TYR A . n 
A 1 476 ALA 476 458 458 ALA ALA A . n 
A 1 477 ASP 477 459 459 ASP ASP A . n 
A 1 478 LEU 478 460 460 LEU LEU A . n 
A 1 479 TYR 479 461 461 TYR TYR A . n 
A 1 480 ALA 480 462 462 ALA ALA A . n 
A 1 481 ALA 481 463 463 ALA ALA A . n 
A 1 482 SER 482 464 464 SER SER A . n 
A 1 483 PHE 483 465 465 PHE PHE A . n 
A 1 484 ILE 484 466 466 ILE ILE A . n 
A 1 485 ASN 485 467 467 ASN ASN A . n 
A 1 486 LEU 486 468 468 LEU LEU A . n 
A 1 487 LEU 487 469 469 LEU LEU A . n 
A 1 488 TYR 488 470 470 TYR TYR A . n 
A 1 489 TYR 489 471 471 TYR TYR A . n 
A 1 490 PRO 490 472 472 PRO PRO A . n 
A 1 491 PHE 491 473 473 PHE PHE A . n 
A 1 492 SER 492 474 474 SER SER A . n 
A 1 493 TYR 493 475 475 TYR TYR A . n 
A 1 494 LEU 494 476 476 LEU LEU A . n 
A 1 495 PHE 495 477 477 PHE PHE A . n 
A 1 496 ARG 496 478 478 ARG ARG A . n 
A 1 497 ALA 497 479 479 ALA ALA A . n 
A 1 498 ALA 498 480 480 ALA ALA A . n 
A 1 499 HIS 499 481 481 HIS HIS A . n 
A 1 500 VAL 500 482 482 VAL VAL A . n 
A 1 501 LEU 501 483 483 LEU LEU A . n 
A 1 502 MET 502 484 484 MET MET A . n 
A 1 503 PRO 503 485 485 PRO PRO A . n 
A 1 504 HIS 504 486 486 HIS HIS A . n 
A 1 505 GLU 505 487 487 GLU GLU A . n 
A 1 506 SER 506 488 488 SER SER A . n 
A 1 507 THR 507 489 ?   ?   ?   A . n 
A 1 508 VAL 508 490 ?   ?   ?   A . n 
A 1 509 GLU 509 491 ?   ?   ?   A . n 
A 1 510 HIS 510 492 ?   ?   ?   A . n 
A 1 511 THR 511 493 ?   ?   ?   A . n 
A 1 512 HIS 512 494 ?   ?   ?   A . n 
A 1 513 VAL 513 495 ?   ?   ?   A . n 
A 1 514 ASP 514 496 ?   ?   ?   A . n 
A 1 515 ILE 515 497 ?   ?   ?   A . n 
A 1 516 ASN 516 498 ?   ?   ?   A . n 
A 1 517 GLU 517 499 ?   ?   ?   A . n 
A 1 518 MET 518 500 ?   ?   ?   A . n 
A 1 519 GLU 519 501 ?   ?   ?   A . n 
A 1 520 SER 520 502 ?   ?   ?   A . n 
A 1 521 PRO 521 503 ?   ?   ?   A . n 
A 1 522 LEU 522 504 ?   ?   ?   A . n 
A 1 523 ALA 523 505 ?   ?   ?   A . n 
A 1 524 THR 524 506 ?   ?   ?   A . n 
A 1 525 ARG 525 507 ?   ?   ?   A . n 
A 1 526 ASN 526 508 ?   ?   ?   A . n 
A 1 527 ARG 527 509 ?   ?   ?   A . n 
A 1 528 THR 528 510 ?   ?   ?   A . n 
A 1 529 SER 529 511 ?   ?   ?   A . n 
A 1 530 VAL 530 512 ?   ?   ?   A . n 
A 1 531 ASP 531 513 ?   ?   ?   A . n 
A 1 532 PHE 532 514 ?   ?   ?   A . n 
A 1 533 LYS 533 515 ?   ?   ?   A . n 
A 1 534 ASP 534 516 ?   ?   ?   A . n 
A 1 535 THR 535 517 ?   ?   ?   A . n 
A 1 536 ASP 536 518 ?   ?   ?   A . n 
A 1 537 TYR 537 519 ?   ?   ?   A . n 
A 1 538 LYS 538 520 ?   ?   ?   A . n 
A 1 539 ARG 539 521 ?   ?   ?   A . n 
A 1 540 HIS 540 522 ?   ?   ?   A . n 
A 1 541 GLN 541 523 ?   ?   ?   A . n 
A 1 542 LEU 542 524 ?   ?   ?   A . n 
A 1 543 THR 543 525 ?   ?   ?   A . n 
A 1 544 ARG 544 526 ?   ?   ?   A . n 
A 1 545 SER 545 527 ?   ?   ?   A . n 
A 1 546 ILE 546 528 ?   ?   ?   A . n 
A 1 547 SER 547 529 ?   ?   ?   A . n 
A 1 548 GLU 548 530 ?   ?   ?   A . n 
A 1 549 ILE 549 531 ?   ?   ?   A . n 
A 1 550 LYS 550 532 ?   ?   ?   A . n 
A 1 551 PRO 551 533 ?   ?   ?   A . n 
A 1 552 PRO 552 534 ?   ?   ?   A . n 
A 1 553 ASN 553 535 ?   ?   ?   A . n 
A 1 554 LEU 554 536 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ATP 1   1489 1489 ATP ATP A . 
C 3 IMP 1   1490 1490 IMP IMP A . 
D 4 GOL 1   1491 1491 GOL GOL A . 
E 4 GOL 1   1492 1492 GOL GOL A . 
F 4 GOL 1   1493 1493 GOL GOL A . 
G 4 GOL 1   1494 1494 GOL GOL A . 
H 4 GOL 1   1495 1495 GOL GOL A . 
I 4 GOL 1   1496 1496 GOL GOL A . 
J 5 MG  1   1497 1497 MG  MG  A . 
K 5 MG  1   1498 1498 MG  MG  A . 
L 6 HOH 1   2001 2001 HOH HOH A . 
L 6 HOH 2   2002 2002 HOH HOH A . 
L 6 HOH 3   2003 2003 HOH HOH A . 
L 6 HOH 4   2004 2004 HOH HOH A . 
L 6 HOH 5   2005 2005 HOH HOH A . 
L 6 HOH 6   2006 2006 HOH HOH A . 
L 6 HOH 7   2007 2007 HOH HOH A . 
L 6 HOH 8   2008 2008 HOH HOH A . 
L 6 HOH 9   2009 2009 HOH HOH A . 
L 6 HOH 10  2010 2010 HOH HOH A . 
L 6 HOH 11  2011 2011 HOH HOH A . 
L 6 HOH 12  2012 2012 HOH HOH A . 
L 6 HOH 13  2013 2013 HOH HOH A . 
L 6 HOH 14  2014 2014 HOH HOH A . 
L 6 HOH 15  2015 2015 HOH HOH A . 
L 6 HOH 16  2016 2016 HOH HOH A . 
L 6 HOH 17  2017 2017 HOH HOH A . 
L 6 HOH 18  2018 2018 HOH HOH A . 
L 6 HOH 19  2019 2019 HOH HOH A . 
L 6 HOH 20  2020 2020 HOH HOH A . 
L 6 HOH 21  2021 2021 HOH HOH A . 
L 6 HOH 22  2022 2022 HOH HOH A . 
L 6 HOH 23  2023 2023 HOH HOH A . 
L 6 HOH 24  2024 2024 HOH HOH A . 
L 6 HOH 25  2025 2025 HOH HOH A . 
L 6 HOH 26  2026 2026 HOH HOH A . 
L 6 HOH 27  2027 2027 HOH HOH A . 
L 6 HOH 28  2028 2028 HOH HOH A . 
L 6 HOH 29  2029 2029 HOH HOH A . 
L 6 HOH 30  2030 2030 HOH HOH A . 
L 6 HOH 31  2031 2031 HOH HOH A . 
L 6 HOH 32  2032 2032 HOH HOH A . 
L 6 HOH 33  2033 2033 HOH HOH A . 
L 6 HOH 34  2034 2034 HOH HOH A . 
L 6 HOH 35  2035 2035 HOH HOH A . 
L 6 HOH 36  2036 2036 HOH HOH A . 
L 6 HOH 37  2037 2037 HOH HOH A . 
L 6 HOH 38  2038 2038 HOH HOH A . 
L 6 HOH 39  2039 2039 HOH HOH A . 
L 6 HOH 40  2040 2040 HOH HOH A . 
L 6 HOH 41  2041 2041 HOH HOH A . 
L 6 HOH 42  2042 2042 HOH HOH A . 
L 6 HOH 43  2043 2043 HOH HOH A . 
L 6 HOH 44  2044 2044 HOH HOH A . 
L 6 HOH 45  2045 2045 HOH HOH A . 
L 6 HOH 46  2046 2046 HOH HOH A . 
L 6 HOH 47  2047 2047 HOH HOH A . 
L 6 HOH 48  2048 2048 HOH HOH A . 
L 6 HOH 49  2049 2049 HOH HOH A . 
L 6 HOH 50  2050 2050 HOH HOH A . 
L 6 HOH 51  2051 2051 HOH HOH A . 
L 6 HOH 52  2052 2052 HOH HOH A . 
L 6 HOH 53  2053 2053 HOH HOH A . 
L 6 HOH 54  2054 2054 HOH HOH A . 
L 6 HOH 55  2055 2055 HOH HOH A . 
L 6 HOH 56  2056 2056 HOH HOH A . 
L 6 HOH 57  2057 2057 HOH HOH A . 
L 6 HOH 58  2058 2058 HOH HOH A . 
L 6 HOH 59  2059 2059 HOH HOH A . 
L 6 HOH 60  2060 2060 HOH HOH A . 
L 6 HOH 61  2061 2061 HOH HOH A . 
L 6 HOH 62  2062 2062 HOH HOH A . 
L 6 HOH 63  2063 2063 HOH HOH A . 
L 6 HOH 64  2064 2064 HOH HOH A . 
L 6 HOH 65  2065 2065 HOH HOH A . 
L 6 HOH 66  2066 2066 HOH HOH A . 
L 6 HOH 67  2067 2067 HOH HOH A . 
L 6 HOH 68  2068 2068 HOH HOH A . 
L 6 HOH 69  2069 2069 HOH HOH A . 
L 6 HOH 70  2070 2070 HOH HOH A . 
L 6 HOH 71  2071 2071 HOH HOH A . 
L 6 HOH 72  2072 2072 HOH HOH A . 
L 6 HOH 73  2073 2073 HOH HOH A . 
L 6 HOH 74  2074 2074 HOH HOH A . 
L 6 HOH 75  2075 2075 HOH HOH A . 
L 6 HOH 76  2076 2076 HOH HOH A . 
L 6 HOH 77  2077 2077 HOH HOH A . 
L 6 HOH 78  2078 2078 HOH HOH A . 
L 6 HOH 79  2079 2079 HOH HOH A . 
L 6 HOH 80  2080 2080 HOH HOH A . 
L 6 HOH 81  2081 2081 HOH HOH A . 
L 6 HOH 82  2082 2082 HOH HOH A . 
L 6 HOH 83  2083 2083 HOH HOH A . 
L 6 HOH 84  2084 2084 HOH HOH A . 
L 6 HOH 85  2085 2085 HOH HOH A . 
L 6 HOH 86  2086 2086 HOH HOH A . 
L 6 HOH 87  2087 2087 HOH HOH A . 
L 6 HOH 88  2088 2088 HOH HOH A . 
L 6 HOH 89  2089 2089 HOH HOH A . 
L 6 HOH 90  2090 2090 HOH HOH A . 
L 6 HOH 91  2091 2091 HOH HOH A . 
L 6 HOH 92  2092 2092 HOH HOH A . 
L 6 HOH 93  2093 2093 HOH HOH A . 
L 6 HOH 94  2094 2094 HOH HOH A . 
L 6 HOH 95  2095 2095 HOH HOH A . 
L 6 HOH 96  2096 2096 HOH HOH A . 
L 6 HOH 97  2097 2097 HOH HOH A . 
L 6 HOH 98  2098 2098 HOH HOH A . 
L 6 HOH 99  2099 2099 HOH HOH A . 
L 6 HOH 100 2100 2100 HOH HOH A . 
L 6 HOH 101 2101 2101 HOH HOH A . 
L 6 HOH 102 2102 2102 HOH HOH A . 
L 6 HOH 103 2103 2103 HOH HOH A . 
L 6 HOH 104 2104 2104 HOH HOH A . 
L 6 HOH 105 2105 2105 HOH HOH A . 
L 6 HOH 106 2106 2106 HOH HOH A . 
L 6 HOH 107 2107 2107 HOH HOH A . 
L 6 HOH 108 2108 2108 HOH HOH A . 
L 6 HOH 109 2109 2109 HOH HOH A . 
L 6 HOH 110 2110 2110 HOH HOH A . 
L 6 HOH 111 2111 2111 HOH HOH A . 
L 6 HOH 112 2112 2112 HOH HOH A . 
L 6 HOH 113 2113 2113 HOH HOH A . 
L 6 HOH 114 2114 2114 HOH HOH A . 
L 6 HOH 115 2115 2115 HOH HOH A . 
L 6 HOH 116 2116 2116 HOH HOH A . 
L 6 HOH 117 2117 2117 HOH HOH A . 
L 6 HOH 118 2118 2118 HOH HOH A . 
L 6 HOH 119 2119 2119 HOH HOH A . 
L 6 HOH 120 2120 2120 HOH HOH A . 
L 6 HOH 121 2121 2121 HOH HOH A . 
L 6 HOH 122 2122 2122 HOH HOH A . 
L 6 HOH 123 2123 2123 HOH HOH A . 
L 6 HOH 124 2124 2124 HOH HOH A . 
L 6 HOH 125 2125 2125 HOH HOH A . 
L 6 HOH 126 2126 2126 HOH HOH A . 
L 6 HOH 127 2127 2127 HOH HOH A . 
L 6 HOH 128 2128 2128 HOH HOH A . 
L 6 HOH 129 2129 2129 HOH HOH A . 
L 6 HOH 130 2130 2130 HOH HOH A . 
L 6 HOH 131 2131 2131 HOH HOH A . 
L 6 HOH 132 2132 2132 HOH HOH A . 
L 6 HOH 133 2133 2133 HOH HOH A . 
L 6 HOH 134 2134 2134 HOH HOH A . 
L 6 HOH 135 2135 2135 HOH HOH A . 
L 6 HOH 136 2136 2136 HOH HOH A . 
L 6 HOH 137 2137 2137 HOH HOH A . 
L 6 HOH 138 2138 2138 HOH HOH A . 
L 6 HOH 139 2139 2139 HOH HOH A . 
L 6 HOH 140 2140 2140 HOH HOH A . 
L 6 HOH 141 2141 2141 HOH HOH A . 
L 6 HOH 142 2142 2142 HOH HOH A . 
L 6 HOH 143 2143 2143 HOH HOH A . 
L 6 HOH 144 2144 2144 HOH HOH A . 
L 6 HOH 145 2145 2145 HOH HOH A . 
L 6 HOH 146 2146 2146 HOH HOH A . 
L 6 HOH 147 2147 2147 HOH HOH A . 
L 6 HOH 148 2148 2148 HOH HOH A . 
L 6 HOH 149 2149 2149 HOH HOH A . 
L 6 HOH 150 2150 2150 HOH HOH A . 
L 6 HOH 151 2151 2151 HOH HOH A . 
L 6 HOH 152 2152 2152 HOH HOH A . 
L 6 HOH 153 2153 2153 HOH HOH A . 
L 6 HOH 154 2154 2154 HOH HOH A . 
L 6 HOH 155 2155 2155 HOH HOH A . 
L 6 HOH 156 2156 2156 HOH HOH A . 
L 6 HOH 157 2157 2157 HOH HOH A . 
L 6 HOH 158 2158 2158 HOH HOH A . 
L 6 HOH 159 2159 2159 HOH HOH A . 
L 6 HOH 160 2160 2160 HOH HOH A . 
L 6 HOH 161 2161 2161 HOH HOH A . 
L 6 HOH 162 2162 2162 HOH HOH A . 
L 6 HOH 163 2163 2163 HOH HOH A . 
L 6 HOH 164 2164 2164 HOH HOH A . 
L 6 HOH 165 2165 2165 HOH HOH A . 
L 6 HOH 166 2166 2166 HOH HOH A . 
L 6 HOH 167 2167 2167 HOH HOH A . 
L 6 HOH 168 2168 2168 HOH HOH A . 
L 6 HOH 169 2169 2169 HOH HOH A . 
L 6 HOH 170 2170 2170 HOH HOH A . 
L 6 HOH 171 2171 2171 HOH HOH A . 
L 6 HOH 172 2172 2172 HOH HOH A . 
L 6 HOH 173 2173 2173 HOH HOH A . 
L 6 HOH 174 2174 2174 HOH HOH A . 
L 6 HOH 175 2175 2175 HOH HOH A . 
L 6 HOH 176 2176 2176 HOH HOH A . 
L 6 HOH 177 2177 2177 HOH HOH A . 
L 6 HOH 178 2178 2178 HOH HOH A . 
L 6 HOH 179 2179 2179 HOH HOH A . 
L 6 HOH 180 2180 2180 HOH HOH A . 
L 6 HOH 181 2181 2181 HOH HOH A . 
L 6 HOH 182 2182 2182 HOH HOH A . 
L 6 HOH 183 2183 2183 HOH HOH A . 
L 6 HOH 184 2184 2184 HOH HOH A . 
L 6 HOH 185 2185 2185 HOH HOH A . 
L 6 HOH 186 2186 2186 HOH HOH A . 
L 6 HOH 187 2187 2187 HOH HOH A . 
L 6 HOH 188 2188 2188 HOH HOH A . 
L 6 HOH 189 2189 2189 HOH HOH A . 
L 6 HOH 190 2190 2190 HOH HOH A . 
L 6 HOH 191 2191 2191 HOH HOH A . 
L 6 HOH 192 2192 2192 HOH HOH A . 
L 6 HOH 193 2193 2193 HOH HOH A . 
L 6 HOH 194 2194 2194 HOH HOH A . 
L 6 HOH 195 2195 2195 HOH HOH A . 
L 6 HOH 196 2196 2196 HOH HOH A . 
L 6 HOH 197 2197 2197 HOH HOH A . 
L 6 HOH 198 2198 2198 HOH HOH A . 
L 6 HOH 199 2199 2199 HOH HOH A . 
L 6 HOH 200 2200 2200 HOH HOH A . 
L 6 HOH 201 2201 2201 HOH HOH A . 
L 6 HOH 202 2202 2202 HOH HOH A . 
L 6 HOH 203 2203 2203 HOH HOH A . 
L 6 HOH 204 2204 2204 HOH HOH A . 
L 6 HOH 205 2205 2205 HOH HOH A . 
L 6 HOH 206 2206 2206 HOH HOH A . 
L 6 HOH 207 2207 2207 HOH HOH A . 
L 6 HOH 208 2208 2208 HOH HOH A . 
L 6 HOH 209 2209 2209 HOH HOH A . 
L 6 HOH 210 2210 2210 HOH HOH A . 
L 6 HOH 211 2211 2211 HOH HOH A . 
L 6 HOH 212 2212 2212 HOH HOH A . 
L 6 HOH 213 2213 2213 HOH HOH A . 
L 6 HOH 214 2214 2214 HOH HOH A . 
L 6 HOH 215 2215 2215 HOH HOH A . 
L 6 HOH 216 2216 2216 HOH HOH A . 
L 6 HOH 217 2217 2217 HOH HOH A . 
L 6 HOH 218 2218 2218 HOH HOH A . 
L 6 HOH 219 2219 2219 HOH HOH A . 
L 6 HOH 220 2220 2220 HOH HOH A . 
L 6 HOH 221 2221 2221 HOH HOH A . 
L 6 HOH 222 2222 2222 HOH HOH A . 
L 6 HOH 223 2223 2223 HOH HOH A . 
L 6 HOH 224 2224 2224 HOH HOH A . 
L 6 HOH 225 2225 2225 HOH HOH A . 
L 6 HOH 226 2226 2226 HOH HOH A . 
L 6 HOH 227 2227 2227 HOH HOH A . 
L 6 HOH 228 2228 2228 HOH HOH A . 
L 6 HOH 229 2229 2229 HOH HOH A . 
L 6 HOH 230 2230 2230 HOH HOH A . 
L 6 HOH 231 2231 2231 HOH HOH A . 
L 6 HOH 232 2232 2232 HOH HOH A . 
L 6 HOH 233 2233 2233 HOH HOH A . 
L 6 HOH 234 2234 2234 HOH HOH A . 
L 6 HOH 235 2235 2235 HOH HOH A . 
L 6 HOH 236 2236 2236 HOH HOH A . 
L 6 HOH 237 2237 2237 HOH HOH A . 
L 6 HOH 238 2238 2238 HOH HOH A . 
L 6 HOH 239 2239 2239 HOH HOH A . 
L 6 HOH 240 2240 2240 HOH HOH A . 
L 6 HOH 241 2241 2241 HOH HOH A . 
L 6 HOH 242 2242 2242 HOH HOH A . 
L 6 HOH 243 2243 2243 HOH HOH A . 
L 6 HOH 244 2244 2244 HOH HOH A . 
L 6 HOH 245 2245 2245 HOH HOH A . 
L 6 HOH 246 2246 2246 HOH HOH A . 
L 6 HOH 247 2247 2247 HOH HOH A . 
L 6 HOH 248 2248 2248 HOH HOH A . 
L 6 HOH 249 2249 2249 HOH HOH A . 
L 6 HOH 250 2250 2250 HOH HOH A . 
L 6 HOH 251 2251 2251 HOH HOH A . 
L 6 HOH 252 2252 2252 HOH HOH A . 
L 6 HOH 253 2253 2253 HOH HOH A . 
L 6 HOH 254 2254 2254 HOH HOH A . 
L 6 HOH 255 2255 2255 HOH HOH A . 
L 6 HOH 256 2256 2256 HOH HOH A . 
L 6 HOH 257 2257 2257 HOH HOH A . 
L 6 HOH 258 2258 2258 HOH HOH A . 
L 6 HOH 259 2259 2259 HOH HOH A . 
L 6 HOH 260 2260 2260 HOH HOH A . 
L 6 HOH 261 2261 2261 HOH HOH A . 
L 6 HOH 262 2262 2262 HOH HOH A . 
L 6 HOH 263 2263 2263 HOH HOH A . 
L 6 HOH 264 2264 2264 HOH HOH A . 
L 6 HOH 265 2265 2265 HOH HOH A . 
L 6 HOH 266 2266 2266 HOH HOH A . 
L 6 HOH 267 2267 2267 HOH HOH A . 
L 6 HOH 268 2268 2268 HOH HOH A . 
L 6 HOH 269 2269 2269 HOH HOH A . 
L 6 HOH 270 2270 2270 HOH HOH A . 
L 6 HOH 271 2271 2271 HOH HOH A . 
L 6 HOH 272 2272 2272 HOH HOH A . 
L 6 HOH 273 2273 2273 HOH HOH A . 
L 6 HOH 274 2274 2274 HOH HOH A . 
L 6 HOH 275 2275 2275 HOH HOH A . 
L 6 HOH 276 2276 2276 HOH HOH A . 
L 6 HOH 277 2277 2277 HOH HOH A . 
L 6 HOH 278 2278 2278 HOH HOH A . 
L 6 HOH 279 2279 2279 HOH HOH A . 
L 6 HOH 280 2280 2280 HOH HOH A . 
L 6 HOH 281 2281 2281 HOH HOH A . 
L 6 HOH 282 2282 2282 HOH HOH A . 
L 6 HOH 283 2283 2283 HOH HOH A . 
L 6 HOH 284 2284 2284 HOH HOH A . 
L 6 HOH 285 2285 2285 HOH HOH A . 
L 6 HOH 286 2286 2286 HOH HOH A . 
L 6 HOH 287 2287 2287 HOH HOH A . 
L 6 HOH 288 2288 2288 HOH HOH A . 
L 6 HOH 289 2289 2289 HOH HOH A . 
L 6 HOH 290 2290 2290 HOH HOH A . 
L 6 HOH 291 2291 2291 HOH HOH A . 
L 6 HOH 292 2292 2292 HOH HOH A . 
L 6 HOH 293 2293 2293 HOH HOH A . 
L 6 HOH 294 2294 2294 HOH HOH A . 
L 6 HOH 295 2295 2295 HOH HOH A . 
L 6 HOH 296 2296 2296 HOH HOH A . 
L 6 HOH 297 2297 2297 HOH HOH A . 
L 6 HOH 298 2298 2298 HOH HOH A . 
L 6 HOH 299 2299 2299 HOH HOH A . 
L 6 HOH 300 2300 2300 HOH HOH A . 
L 6 HOH 301 2301 2301 HOH HOH A . 
L 6 HOH 302 2302 2302 HOH HOH A . 
L 6 HOH 303 2303 2303 HOH HOH A . 
L 6 HOH 304 2304 2304 HOH HOH A . 
L 6 HOH 305 2305 2305 HOH HOH A . 
L 6 HOH 306 2306 2306 HOH HOH A . 
L 6 HOH 307 2307 2307 HOH HOH A . 
L 6 HOH 308 2308 2308 HOH HOH A . 
L 6 HOH 309 2309 2309 HOH HOH A . 
L 6 HOH 310 2310 2310 HOH HOH A . 
L 6 HOH 311 2311 2311 HOH HOH A . 
L 6 HOH 312 2312 2312 HOH HOH A . 
L 6 HOH 313 2313 2313 HOH HOH A . 
L 6 HOH 314 2314 2314 HOH HOH A . 
L 6 HOH 315 2315 2315 HOH HOH A . 
L 6 HOH 316 2316 2316 HOH HOH A . 
L 6 HOH 317 2317 2317 HOH HOH A . 
L 6 HOH 318 2318 2318 HOH HOH A . 
L 6 HOH 319 2319 2319 HOH HOH A . 
L 6 HOH 320 2320 2320 HOH HOH A . 
L 6 HOH 321 2321 2321 HOH HOH A . 
L 6 HOH 322 2322 2322 HOH HOH A . 
L 6 HOH 323 2323 2323 HOH HOH A . 
L 6 HOH 324 2324 2324 HOH HOH A . 
L 6 HOH 325 2325 2325 HOH HOH A . 
L 6 HOH 326 2326 2326 HOH HOH A . 
L 6 HOH 327 2327 2327 HOH HOH A . 
L 6 HOH 328 2328 2328 HOH HOH A . 
L 6 HOH 329 2329 2329 HOH HOH A . 
L 6 HOH 330 2330 2330 HOH HOH A . 
L 6 HOH 331 2331 2331 HOH HOH A . 
L 6 HOH 332 2332 2332 HOH HOH A . 
L 6 HOH 333 2333 2333 HOH HOH A . 
L 6 HOH 334 2334 2334 HOH HOH A . 
L 6 HOH 335 2335 2335 HOH HOH A . 
L 6 HOH 336 2336 2336 HOH HOH A . 
L 6 HOH 337 2337 2337 HOH HOH A . 
L 6 HOH 338 2338 2338 HOH HOH A . 
L 6 HOH 339 2339 2339 HOH HOH A . 
L 6 HOH 340 2340 2340 HOH HOH A . 
L 6 HOH 341 2341 2341 HOH HOH A . 
L 6 HOH 342 2342 2342 HOH HOH A . 
L 6 HOH 343 2343 2343 HOH HOH A . 
L 6 HOH 344 2344 2344 HOH HOH A . 
L 6 HOH 345 2345 2345 HOH HOH A . 
L 6 HOH 346 2346 2346 HOH HOH A . 
L 6 HOH 347 2347 2347 HOH HOH A . 
L 6 HOH 348 2348 2348 HOH HOH A . 
L 6 HOH 349 2349 2349 HOH HOH A . 
L 6 HOH 350 2350 2350 HOH HOH A . 
L 6 HOH 351 2351 2351 HOH HOH A . 
L 6 HOH 352 2352 2352 HOH HOH A . 
L 6 HOH 353 2353 2353 HOH HOH A . 
L 6 HOH 354 2354 2354 HOH HOH A . 
L 6 HOH 355 2355 2355 HOH HOH A . 
L 6 HOH 356 2356 2356 HOH HOH A . 
L 6 HOH 357 2357 2357 HOH HOH A . 
L 6 HOH 358 2358 2358 HOH HOH A . 
L 6 HOH 359 2359 2359 HOH HOH A . 
L 6 HOH 360 2360 2360 HOH HOH A . 
L 6 HOH 361 2361 2361 HOH HOH A . 
L 6 HOH 362 2362 2362 HOH HOH A . 
L 6 HOH 363 2363 2363 HOH HOH A . 
L 6 HOH 364 2364 2364 HOH HOH A . 
L 6 HOH 365 2365 2365 HOH HOH A . 
L 6 HOH 366 2366 2366 HOH HOH A . 
L 6 HOH 367 2367 2367 HOH HOH A . 
L 6 HOH 368 2368 2368 HOH HOH A . 
L 6 HOH 369 2369 2369 HOH HOH A . 
L 6 HOH 370 2370 2370 HOH HOH A . 
L 6 HOH 371 2371 2371 HOH HOH A . 
L 6 HOH 372 2372 2372 HOH HOH A . 
L 6 HOH 373 2373 2373 HOH HOH A . 
L 6 HOH 374 2374 2374 HOH HOH A . 
L 6 HOH 375 2375 2375 HOH HOH A . 
L 6 HOH 376 2376 2376 HOH HOH A . 
L 6 HOH 377 2377 2377 HOH HOH A . 
L 6 HOH 378 2378 2378 HOH HOH A . 
L 6 HOH 379 2379 2379 HOH HOH A . 
L 6 HOH 380 2380 2380 HOH HOH A . 
L 6 HOH 381 2381 2381 HOH HOH A . 
L 6 HOH 382 2382 2382 HOH HOH A . 
L 6 HOH 383 2383 2383 HOH HOH A . 
L 6 HOH 384 2384 2384 HOH HOH A . 
L 6 HOH 385 2385 2385 HOH HOH A . 
L 6 HOH 386 2386 2386 HOH HOH A . 
L 6 HOH 387 2387 2387 HOH HOH A . 
L 6 HOH 388 2388 2388 HOH HOH A . 
L 6 HOH 389 2389 2389 HOH HOH A . 
L 6 HOH 390 2390 2390 HOH HOH A . 
L 6 HOH 391 2391 2391 HOH HOH A . 
L 6 HOH 392 2392 2392 HOH HOH A . 
L 6 HOH 393 2393 2393 HOH HOH A . 
L 6 HOH 394 2394 2394 HOH HOH A . 
L 6 HOH 395 2395 2395 HOH HOH A . 
L 6 HOH 396 2396 2396 HOH HOH A . 
L 6 HOH 397 2397 2397 HOH HOH A . 
L 6 HOH 398 2398 2398 HOH HOH A . 
L 6 HOH 399 2399 2399 HOH HOH A . 
L 6 HOH 400 2400 2400 HOH HOH A . 
L 6 HOH 401 2401 2401 HOH HOH A . 
L 6 HOH 402 2402 2402 HOH HOH A . 
L 6 HOH 403 2403 2403 HOH HOH A . 
L 6 HOH 404 2404 2404 HOH HOH A . 
L 6 HOH 405 2405 2405 HOH HOH A . 
L 6 HOH 406 2406 2406 HOH HOH A . 
L 6 HOH 407 2407 2407 HOH HOH A . 
L 6 HOH 408 2408 2408 HOH HOH A . 
L 6 HOH 409 2409 2409 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 25680  ? 
1 MORE         -177.3 ? 
1 'SSA (A^2)'  72420  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.4400000000 
3 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.4400000000 
4 'crystal symmetry operation' 2_555 -x,-y,z   -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    MG 
_pdbx_struct_special_symmetry.auth_seq_id     1497 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   J 
_pdbx_struct_special_symmetry.label_comp_id   MG 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O3G ? B ATP .   ? A ATP 1489 ? 1_555 0.0   ? 
2  O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O1B ? B ATP .   ? A ATP 1489 ? 1_555 93.9  ? 
3  O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O1B ? B ATP .   ? A ATP 1489 ? 1_555 93.9  ? 
4  O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O1B ? B ATP .   ? A ATP 1489 ? 1_555 93.9  ? 
5  O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O1B ? B ATP .   ? A ATP 1489 ? 1_555 93.9  ? 
6  O1B ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O1B ? B ATP .   ? A ATP 1489 ? 1_555 0.0   ? 
7  O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 1_555 97.2  ? 
8  O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 1_555 97.2  ? 
9  O1B ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 1_555 78.7  ? 
10 O1B ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 1_555 78.7  ? 
11 O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 3_556 86.6  ? 
12 O3G ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 3_556 86.6  ? 
13 O1B ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 3_556 99.4  ? 
14 O1B ? B ATP .   ? A ATP 1489 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 3_556 99.4  ? 
15 O   ? L HOH .   ? A HOH 2396 ? 1_555 MG ? J MG . ? A MG 1497 ? 1_555 O   ? L HOH .   ? A HOH 2396 ? 3_556 175.8 ? 
16 O3P ? C IMP .   ? A IMP 1490 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   ? L HOH .   ? A HOH 2332 ? 1_555 88.6  ? 
17 O3P ? C IMP .   ? A IMP 1490 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   A A ASP 72  ? A ASP 54   ? 1_555 102.3 ? 
18 O   ? L HOH .   ? A HOH 2332 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   A A ASP 72  ? A ASP 54   ? 1_555 167.4 ? 
19 O3P ? C IMP .   ? A IMP 1490 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   B A ASP 72  ? A ASP 54   ? 1_555 100.1 ? 
20 O   ? L HOH .   ? A HOH 2332 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   B A ASP 72  ? A ASP 54   ? 1_555 170.4 ? 
21 O   A A ASP 72  ? A ASP 54   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   B A ASP 72  ? A ASP 54   ? 1_555 3.1   ? 
22 O3P ? C IMP .   ? A IMP 1490 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 92.5  ? 
23 O   ? L HOH .   ? A HOH 2332 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 84.8  ? 
24 O   A A ASP 72  ? A ASP 54   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 88.4  ? 
25 O   B A ASP 72  ? A ASP 54   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 90.7  ? 
26 O3P ? C IMP .   ? A IMP 1490 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 175.9 ? 
27 O   ? L HOH .   ? A HOH 2332 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 88.8  ? 
28 O   A A ASP 72  ? A ASP 54   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 79.9  ? 
29 O   B A ASP 72  ? A ASP 54   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 82.3  ? 
30 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 84.1  ? 
31 O3P ? C IMP .   ? A IMP 1490 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   ? L HOH .   ? A HOH 2331 ? 1_555 92.8  ? 
32 O   ? L HOH .   ? A HOH 2332 ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   ? L HOH .   ? A HOH 2331 ? 1_555 93.7  ? 
33 O   A A ASP 72  ? A ASP 54   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   ? L HOH .   ? A HOH 2331 ? 1_555 92.1  ? 
34 O   B A ASP 72  ? A ASP 54   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   ? L HOH .   ? A HOH 2331 ? 1_555 90.0  ? 
35 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   ? L HOH .   ? A HOH 2331 ? 1_555 174.5 ? 
36 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 MG ? K MG . ? A MG 1498 ? 1_555 O   ? L HOH .   ? A HOH 2331 ? 1_555 90.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-16 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 7.9280   42.6000 37.9860 0.2912  0.1006  0.1095  -0.0056 0.0226  0.0588  8.0146 6.4030 1.3294  
5.5137  1.2587   1.6454  0.0699  -0.0769 0.7626  -0.3843 -0.0216 0.1374  -0.5534 -0.1363 -0.0484 
'X-RAY DIFFRACTION' 2  ? refined -6.4810  22.9050 44.1630 -0.0892 -0.1605 -0.1702 0.0227  -0.0182 0.0213  1.2691 0.8414 1.0723  
0.3994  -0.1630  0.0952  -0.0181 0.1062  0.0323  -0.0938 0.0027  0.0348  -0.0743 -0.0663 0.0155  
'X-RAY DIFFRACTION' 3  ? refined -17.0760 19.8690 58.8690 -0.0370 -0.0873 -0.1614 -0.0088 -0.0161 -0.0120 3.1888 3.1083 9.7636  
1.6913  -2.6573  1.3513  0.1028  -0.0232 0.0270  0.1582  -0.1868 0.2406  -0.0913 -0.5882 0.0839  
'X-RAY DIFFRACTION' 4  ? refined -12.5820 13.4070 39.8680 -0.0857 -0.1011 -0.1496 0.0052  -0.0250 -0.0273 3.3259 1.6228 1.2164  
0.9434  -0.9936  -0.2853 -0.1237 0.2370  -0.2617 -0.0967 0.0609  0.0547  0.0714  -0.1285 0.0627  
'X-RAY DIFFRACTION' 5  ? refined 18.0350  24.6810 35.7710 -0.0827 -0.1196 -0.1382 -0.0155 0.0408  0.0094  1.6676 1.5602 2.6131  
0.5269  -0.9358  -1.4427 0.0191  0.0578  0.1029  -0.0461 -0.0209 -0.0542 -0.2536 0.1047  0.0018  
'X-RAY DIFFRACTION' 6  ? refined 18.7420  8.8170  44.5010 -0.0708 -0.1398 -0.1212 -0.0252 0.0207  0.0203  3.2589 5.8906 4.3759  
-1.9783 -1.3963  0.9028  -0.1538 0.1159  -0.0512 -0.1285 0.0282  -0.3579 0.2048  0.2071  0.1256  
'X-RAY DIFFRACTION' 7  ? refined 7.8240   27.6170 51.2120 -0.0758 -0.1624 -0.1975 -0.0450 0.0127  -0.0070 4.5572 2.1378 2.8593  
-0.0264 0.9835   -0.0313 -0.0740 0.0223  0.1326  -0.0757 -0.0115 0.0715  -0.0649 0.1015  0.0855  
'X-RAY DIFFRACTION' 8  ? refined -19.6160 45.5030 58.2840 0.5837  0.4795  0.5370  0.2029  -0.0544 -0.0021 5.7274 7.7294 6.8398  
-5.6259 -5.7442  7.1841  0.3056  0.1578  -0.0789 0.6476  -0.4926 0.8937  -1.5934 -1.3040 0.1870  
'X-RAY DIFFRACTION' 9  ? refined -0.6800  35.0780 51.1170 -0.0096 -0.2103 -0.1508 0.0073  -0.0214 -0.0007 3.9725 1.9612 2.6269  
1.1841  0.0803   0.1540  -0.0444 -0.0647 0.3335  -0.1578 0.0071  0.1726  -0.2565 -0.0670 0.0373  
'X-RAY DIFFRACTION' 10 ? refined 5.1130   41.1670 70.2370 0.1536  0.0152  -0.0048 -0.0116 0.0807  0.0420  7.2742 1.9742 40.4551 
-2.1644 -16.8190 6.4484  0.7513  -0.0470 0.5583  -0.8656 0.4972  -0.4239 -2.5140 -0.0159 -1.2485 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 3   ? ? A 32  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 33  ? ? A 127 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 128 ? ? A 154 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 155 ? ? A 229 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 230 ? ? A 289 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 290 ? ? A 332 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 333 ? ? A 385 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 386 ? ? A 425 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 426 ? ? A 477 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 478 ? ? A 488 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2XCW 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ASP 52 TO ASN' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             48 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             48 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.710 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.102 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 144 ? ? CZ A ARG 144 ? ? NH1 A ARG 144 ? ? 126.12 120.30 5.82  0.50 N 
2 1 NE A ARG 144 ? ? CZ A ARG 144 ? ? NH2 A ARG 144 ? ? 114.73 120.30 -5.57 0.50 N 
3 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH1 A ARG 277 ? ? 124.35 120.30 4.05  0.50 N 
4 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH2 A ARG 277 ? ? 115.89 120.30 -4.41 0.50 N 
5 1 NE A ARG 363 ? ? CZ A ARG 363 ? ? NH2 A ARG 363 ? ? 117.13 120.30 -3.17 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 53  ? ? -89.29  -70.36 
2 1 MET A 53  ? ? -89.29  -71.32 
3 1 TYR A 55  ? ? 58.29   16.18  
4 1 THR A 56  ? ? -123.51 -76.95 
5 1 PRO A 267 ? ? -77.28  28.27  
6 1 LEU A 399 ? ? -59.47  -5.02  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2011 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.88 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -17 ? A GLY 1   
2  1 Y 1 A SER -16 ? A SER 2   
3  1 Y 1 A SER -15 ? A SER 3   
4  1 Y 1 A HIS -14 ? A HIS 4   
5  1 Y 1 A HIS -13 ? A HIS 5   
6  1 Y 1 A HIS -12 ? A HIS 6   
7  1 Y 1 A HIS -11 ? A HIS 7   
8  1 Y 1 A HIS -10 ? A HIS 8   
9  1 Y 1 A HIS -9  ? A HIS 9   
10 1 Y 1 A SER -8  ? A SER 10  
11 1 Y 1 A SER -7  ? A SER 11  
12 1 Y 1 A GLY -6  ? A GLY 12  
13 1 Y 1 A LEU -5  ? A LEU 13  
14 1 Y 1 A VAL -4  ? A VAL 14  
15 1 Y 1 A PRO -3  ? A PRO 15  
16 1 Y 1 A ARG -2  ? A ARG 16  
17 1 Y 1 A GLY -1  ? A GLY 17  
18 1 Y 1 A SER 0   ? A SER 18  
19 1 Y 1 A MET 1   ? A MET 19  
20 1 Y 1 A SER 2   ? A SER 20  
21 1 Y 1 A GLU 401 ? A GLU 419 
22 1 Y 1 A LEU 402 ? A LEU 420 
23 1 Y 1 A TYR 403 ? A TYR 421 
24 1 Y 1 A LYS 404 ? A LYS 422 
25 1 Y 1 A HIS 405 ? A HIS 423 
26 1 Y 1 A LEU 406 ? A LEU 424 
27 1 Y 1 A ASP 407 ? A ASP 425 
28 1 Y 1 A SER 408 ? A SER 426 
29 1 Y 1 A SER 409 ? A SER 427 
30 1 Y 1 A SER 410 ? A SER 428 
31 1 Y 1 A ASN 411 ? A ASN 429 
32 1 Y 1 A GLU 412 ? A GLU 430 
33 1 Y 1 A ARG 413 ? A ARG 431 
34 1 Y 1 A PRO 414 ? A PRO 432 
35 1 Y 1 A ASP 415 ? A ASP 433 
36 1 Y 1 A ILE 416 ? A ILE 434 
37 1 Y 1 A THR 489 ? A THR 507 
38 1 Y 1 A VAL 490 ? A VAL 508 
39 1 Y 1 A GLU 491 ? A GLU 509 
40 1 Y 1 A HIS 492 ? A HIS 510 
41 1 Y 1 A THR 493 ? A THR 511 
42 1 Y 1 A HIS 494 ? A HIS 512 
43 1 Y 1 A VAL 495 ? A VAL 513 
44 1 Y 1 A ASP 496 ? A ASP 514 
45 1 Y 1 A ILE 497 ? A ILE 515 
46 1 Y 1 A ASN 498 ? A ASN 516 
47 1 Y 1 A GLU 499 ? A GLU 517 
48 1 Y 1 A MET 500 ? A MET 518 
49 1 Y 1 A GLU 501 ? A GLU 519 
50 1 Y 1 A SER 502 ? A SER 520 
51 1 Y 1 A PRO 503 ? A PRO 521 
52 1 Y 1 A LEU 504 ? A LEU 522 
53 1 Y 1 A ALA 505 ? A ALA 523 
54 1 Y 1 A THR 506 ? A THR 524 
55 1 Y 1 A ARG 507 ? A ARG 525 
56 1 Y 1 A ASN 508 ? A ASN 526 
57 1 Y 1 A ARG 509 ? A ARG 527 
58 1 Y 1 A THR 510 ? A THR 528 
59 1 Y 1 A SER 511 ? A SER 529 
60 1 Y 1 A VAL 512 ? A VAL 530 
61 1 Y 1 A ASP 513 ? A ASP 531 
62 1 Y 1 A PHE 514 ? A PHE 532 
63 1 Y 1 A LYS 515 ? A LYS 533 
64 1 Y 1 A ASP 516 ? A ASP 534 
65 1 Y 1 A THR 517 ? A THR 535 
66 1 Y 1 A ASP 518 ? A ASP 536 
67 1 Y 1 A TYR 519 ? A TYR 537 
68 1 Y 1 A LYS 520 ? A LYS 538 
69 1 Y 1 A ARG 521 ? A ARG 539 
70 1 Y 1 A HIS 522 ? A HIS 540 
71 1 Y 1 A GLN 523 ? A GLN 541 
72 1 Y 1 A LEU 524 ? A LEU 542 
73 1 Y 1 A THR 525 ? A THR 543 
74 1 Y 1 A ARG 526 ? A ARG 544 
75 1 Y 1 A SER 527 ? A SER 545 
76 1 Y 1 A ILE 528 ? A ILE 546 
77 1 Y 1 A SER 529 ? A SER 547 
78 1 Y 1 A GLU 530 ? A GLU 548 
79 1 Y 1 A ILE 531 ? A ILE 549 
80 1 Y 1 A LYS 532 ? A LYS 550 
81 1 Y 1 A PRO 533 ? A PRO 551 
82 1 Y 1 A PRO 534 ? A PRO 552 
83 1 Y 1 A ASN 535 ? A ASN 553 
84 1 Y 1 A LEU 536 ? A LEU 554 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
3 'INOSINIC ACID'             IMP 
4 GLYCEROL                    GOL 
5 'MAGNESIUM ION'             MG  
6 water                       HOH 
#