data_2XDP
# 
_entry.id   2XDP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XDP         
PDBE  EBI-43857    
WWPDB D_1290043857 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XDP 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yue, W.W.'      1  
'Gileadi, C.'    2  
'Krojer, T.'     3  
'Weisbach, H.'   4  
'Ugochukwu, E.'  5  
'Daniel, M.'     6  
'Phillips, C.'   7  
'Chaikuad, A.'   8  
'von Delft, F.'  9  
'Allerston, C.'  10 
'Arrowsmith, C.' 11 
'Weigelt, J.'    12 
'Edwards, A.'    13 
'Bountra, C.'    14 
'Oppermann, U.'  15 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of the Tudor Domain of Human Jmjd2C' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yue, W.W.'      1  
primary 'Gileadi, C.'    2  
primary 'Krojer, T.'     3  
primary 'Weisbach, H.'   4  
primary 'Ugochukwu, E.'  5  
primary 'Daniel, M.'     6  
primary 'Phillips, C.'   7  
primary 'Chaikuad, A.'   8  
primary 'von Delft, F.'  9  
primary 'Allerston, C.'  10 
primary 'Arrowsmith, C.' 11 
primary 'Weigelt, J.'    12 
primary 'Edwards, A.'    13 
primary 'Bountra, C.'    14 
primary 'Oppermann, U.'  15 
# 
_cell.entry_id           2XDP 
_cell.length_a           52.815 
_cell.length_b           79.646 
_cell.length_c           81.614 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XDP 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'LYSINE-SPECIFIC DEMETHYLASE 4C' 14153.049 1   1.14.11.- ? 'TUDOR DOMAIN, RESIDUES 875-995' ? 
2 non-polymer syn 'SULFATE ION'                    96.063    1   ?         ? ?                                ? 
3 water       nat water                            18.015    186 ?         ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;JMJD2C, JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROTEIN 3C, JUMONJI DOMAIN-CONTAINING PROTEIN 2C, GENE AMPLIFIED IN SQUAMOUS CELL CARCINOMA 1 PROTEIN, GASC-1 PROTEIN
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMCEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKL
YGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMCEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKL
YGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   CYS n 
1 4   GLU n 
1 5   LYS n 
1 6   VAL n 
1 7   ILE n 
1 8   SER n 
1 9   VAL n 
1 10  GLY n 
1 11  GLN n 
1 12  THR n 
1 13  VAL n 
1 14  ILE n 
1 15  THR n 
1 16  LYS n 
1 17  HIS n 
1 18  ARG n 
1 19  ASN n 
1 20  THR n 
1 21  ARG n 
1 22  TYR n 
1 23  TYR n 
1 24  SER n 
1 25  CYS n 
1 26  ARG n 
1 27  VAL n 
1 28  MET n 
1 29  ALA n 
1 30  VAL n 
1 31  THR n 
1 32  SER n 
1 33  GLN n 
1 34  THR n 
1 35  PHE n 
1 36  TYR n 
1 37  GLU n 
1 38  VAL n 
1 39  MET n 
1 40  PHE n 
1 41  ASP n 
1 42  ASP n 
1 43  GLY n 
1 44  SER n 
1 45  PHE n 
1 46  SER n 
1 47  ARG n 
1 48  ASP n 
1 49  THR n 
1 50  PHE n 
1 51  PRO n 
1 52  GLU n 
1 53  ASP n 
1 54  ILE n 
1 55  VAL n 
1 56  SER n 
1 57  ARG n 
1 58  ASP n 
1 59  CYS n 
1 60  LEU n 
1 61  LYS n 
1 62  LEU n 
1 63  GLY n 
1 64  PRO n 
1 65  PRO n 
1 66  ALA n 
1 67  GLU n 
1 68  GLY n 
1 69  GLU n 
1 70  VAL n 
1 71  VAL n 
1 72  GLN n 
1 73  VAL n 
1 74  LYS n 
1 75  TRP n 
1 76  PRO n 
1 77  ASP n 
1 78  GLY n 
1 79  LYS n 
1 80  LEU n 
1 81  TYR n 
1 82  GLY n 
1 83  ALA n 
1 84  LYS n 
1 85  TYR n 
1 86  PHE n 
1 87  GLY n 
1 88  SER n 
1 89  ASN n 
1 90  ILE n 
1 91  ALA n 
1 92  HIS n 
1 93  MET n 
1 94  TYR n 
1 95  GLN n 
1 96  VAL n 
1 97  GLU n 
1 98  PHE n 
1 99  GLU n 
1 100 ASP n 
1 101 GLY n 
1 102 SER n 
1 103 GLN n 
1 104 ILE n 
1 105 ALA n 
1 106 MET n 
1 107 LYS n 
1 108 ARG n 
1 109 GLU n 
1 110 ASP n 
1 111 ILE n 
1 112 TYR n 
1 113 THR n 
1 114 LEU n 
1 115 ASP n 
1 116 GLU n 
1 117 GLU n 
1 118 LEU n 
1 119 PRO n 
1 120 LYS n 
1 121 ARG n 
1 122 VAL n 
1 123 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PNIC28-BSA4 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KDM4C_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q9H3R0 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XDP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 123 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9H3R0 
_struct_ref_seq.db_align_beg                  875 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  995 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       875 
_struct_ref_seq.pdbx_auth_seq_align_end       995 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XDP SER A 1 ? UNP Q9H3R0 ? ? 'expression tag' 873 1 
1 2XDP MET A 2 ? UNP Q9H3R0 ? ? 'expression tag' 874 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XDP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.04 
_exptl_crystal.density_percent_sol   59.51 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.2M (NH4)2SO4; 0.1M TRIS PH 8.5; 25% PEG 3350' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2010-01-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             0.9763 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XDP 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             18.58 
_reflns.d_resolution_high            1.56 
_reflns.number_obs                   24650 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.56 
_reflns_shell.d_res_low              1.64 
_reflns_shell.percent_possible_all   94.9 
_reflns_shell.Rmerge_I_obs           0.51 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.90 
_reflns_shell.pdbx_redundancy        3.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XDP 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     46098 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.15 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18.512 
_refine.ls_d_res_high                            1.560 
_refine.ls_percent_reflns_obs                    97.35 
_refine.ls_R_factor_obs                          0.1868 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1857 
_refine.ls_R_factor_R_free                       0.2064 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2355 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -9.3042 
_refine.aniso_B[2][2]                            10.2740 
_refine.aniso_B[3][3]                            -0.9698 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.370 
_refine.solvent_model_param_bsol                 50.375 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2GFA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.17 
_refine.pdbx_overall_phase_error                 22.61 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        947 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             186 
_refine_hist.number_atoms_total               1138 
_refine_hist.d_res_high                       1.560 
_refine_hist.d_res_low                        18.512 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 993  'X-RAY DIFFRACTION' ? 
f_angle_d          1.240  ? ? 1346 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.253 ? ? 375  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.100  ? ? 145  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 172  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.5601 1.5919  2065 0.3564 78.00  0.3197 . . 105 . . 
'X-RAY DIFFRACTION' . 1.5919 1.6265  2331 0.3064 87.00  0.3632 . . 120 . . 
'X-RAY DIFFRACTION' . 1.6265 1.6643  2585 0.2672 99.00  0.2371 . . 136 . . 
'X-RAY DIFFRACTION' . 1.6643 1.7059  2692 0.2354 100.00 0.3225 . . 136 . . 
'X-RAY DIFFRACTION' . 1.7059 1.7520  2602 0.2219 100.00 0.2210 . . 148 . . 
'X-RAY DIFFRACTION' . 1.7520 1.8035  2638 0.1985 99.00  0.2176 . . 138 . . 
'X-RAY DIFFRACTION' . 1.8035 1.8617  2624 0.1968 100.00 0.2310 . . 139 . . 
'X-RAY DIFFRACTION' . 1.8617 1.9282  2602 0.1791 100.00 0.2125 . . 142 . . 
'X-RAY DIFFRACTION' . 1.9282 2.0053  2650 0.1718 100.00 0.1946 . . 133 . . 
'X-RAY DIFFRACTION' . 2.0053 2.0964  2670 0.1782 100.00 0.2070 . . 155 . . 
'X-RAY DIFFRACTION' . 2.0964 2.2068  2592 0.1709 99.00  0.2009 . . 136 . . 
'X-RAY DIFFRACTION' . 2.2068 2.3448  2624 0.1729 99.00  0.2120 . . 137 . . 
'X-RAY DIFFRACTION' . 2.3448 2.5254  2655 0.1771 99.00  0.2036 . . 147 . . 
'X-RAY DIFFRACTION' . 2.5254 2.7788  2643 0.1754 100.00 0.1829 . . 113 . . 
'X-RAY DIFFRACTION' . 2.7788 3.1791  2578 0.1755 99.00  0.1977 . . 180 . . 
'X-RAY DIFFRACTION' . 3.1791 3.9987  2597 0.1668 99.00  0.1733 . . 153 . . 
'X-RAY DIFFRACTION' . 3.9987 18.5128 2595 0.1672 98.00  0.1790 . . 137 . . 
# 
_struct.entry_id                  2XDP 
_struct.title                     'Crystal structure of the tudor domain of human JMJD2C' 
_struct.pdbx_descriptor           'LYSINE-SPECIFIC DEMETHYLASE 4C (E.C.1.14.11.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XDP 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, HISTONE MODIFICATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 50  ? ASP A 53  ? PHE A 922 ASP A 925 5 ? 4 
HELX_P HELX_P2 2 ASP A 58  ? GLY A 63  ? ASP A 930 GLY A 935 1 ? 6 
HELX_P HELX_P3 3 GLU A 109 ? ILE A 111 ? GLU A 981 ILE A 983 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 45  ? THR A 49  ? PHE A 917 THR A 921 
AA 2 ARG A 26  ? PHE A 40  ? ARG A 898 PHE A 912 
AA 3 LEU A 80  ? GLU A 97  ? LEU A 952 GLU A 969 
AA 4 GLN A 103 ? LYS A 107 ? GLN A 975 LYS A 979 
AB 1 PHE A 45  ? THR A 49  ? PHE A 917 THR A 921 
AB 2 ARG A 26  ? PHE A 40  ? ARG A 898 PHE A 912 
AB 3 LEU A 80  ? GLU A 97  ? LEU A 952 GLU A 969 
AB 4 VAL A 70  ? LYS A 74  ? VAL A 942 LYS A 946 
AC 1 GLN A 103 ? LYS A 107 ? GLN A 975 LYS A 979 
AC 2 LEU A 80  ? GLU A 97  ? LEU A 952 GLU A 969 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 49  ? N THR A 921 O TYR A 36  ? O TYR A 908 
AA 2 3 N MET A 39  ? N MET A 911 O LYS A 84  ? O LYS A 956 
AA 3 4 N VAL A 96  ? N VAL A 968 O ILE A 104 ? O ILE A 976 
AB 1 2 N THR A 49  ? N THR A 921 O TYR A 36  ? O TYR A 908 
AB 2 3 N MET A 39  ? N MET A 911 O LYS A 84  ? O LYS A 956 
AB 3 4 N ALA A 83  ? N ALA A 955 O VAL A 71  ? O VAL A 943 
AC 1 2 N MET A 106 ? N MET A 978 O TYR A 94  ? O TYR A 966 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 A 1995' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 HIS A 92  ? HIS A 964  . ? 1_555 ? 
2 AC1 6 TYR A 94  ? TYR A 966  . ? 1_555 ? 
3 AC1 6 ARG A 108 ? ARG A 980  . ? 1_555 ? 
4 AC1 6 HOH C .   ? HOH A 2153 . ? 1_555 ? 
5 AC1 6 HOH C .   ? HOH A 2185 . ? 1_555 ? 
6 AC1 6 HOH C .   ? HOH A 2186 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XDP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XDP 
_atom_sites.fract_transf_matrix[1][1]   0.018934 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012556 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012253 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 4   ? 42.716 33.758 -2.060  1.00 58.76 ? 876  GLU A N   1 
ATOM   2    C CA  . GLU A 1 4   ? 43.869 34.648 -2.135  1.00 60.37 ? 876  GLU A CA  1 
ATOM   3    C C   . GLU A 1 4   ? 45.191 33.883 -2.031  1.00 55.39 ? 876  GLU A C   1 
ATOM   4    O O   . GLU A 1 4   ? 46.200 34.298 -2.603  1.00 60.74 ? 876  GLU A O   1 
ATOM   5    C CB  . GLU A 1 4   ? 43.796 35.713 -1.037  1.00 63.98 ? 876  GLU A CB  1 
ATOM   6    N N   . LYS A 1 5   ? 45.174 32.773 -1.295  1.00 62.44 ? 877  LYS A N   1 
ATOM   7    C CA  . LYS A 1 5   ? 46.373 31.972 -1.052  1.00 51.56 ? 877  LYS A CA  1 
ATOM   8    C C   . LYS A 1 5   ? 46.754 31.114 -2.254  1.00 37.26 ? 877  LYS A C   1 
ATOM   9    O O   . LYS A 1 5   ? 45.893 30.552 -2.936  1.00 33.07 ? 877  LYS A O   1 
ATOM   10   C CB  . LYS A 1 5   ? 46.168 31.066 0.153   1.00 54.07 ? 877  LYS A CB  1 
ATOM   11   C CG  . LYS A 1 5   ? 44.863 30.298 0.108   1.00 53.58 ? 877  LYS A CG  1 
ATOM   12   C CD  . LYS A 1 5   ? 43.861 30.877 1.099   1.00 57.73 ? 877  LYS A CD  1 
ATOM   13   C CE  . LYS A 1 5   ? 44.381 30.742 2.518   1.00 58.27 ? 877  LYS A CE  1 
ATOM   14   N NZ  . LYS A 1 5   ? 43.485 31.390 3.515   1.00 62.66 ? 877  LYS A NZ  1 
ATOM   15   N N   . VAL A 1 6   ? 48.051 31.004 -2.507  1.00 32.94 ? 878  VAL A N   1 
ATOM   16   C CA  . VAL A 1 6   ? 48.535 30.306 -3.688  1.00 34.71 ? 878  VAL A CA  1 
ATOM   17   C C   . VAL A 1 6   ? 48.620 28.799 -3.451  1.00 29.98 ? 878  VAL A C   1 
ATOM   18   O O   . VAL A 1 6   ? 49.141 28.354 -2.442  1.00 34.06 ? 878  VAL A O   1 
ATOM   19   C CB  . VAL A 1 6   ? 49.909 30.853 -4.113  1.00 42.18 ? 878  VAL A CB  1 
ATOM   20   C CG1 . VAL A 1 6   ? 50.448 30.092 -5.323  1.00 38.51 ? 878  VAL A CG1 1 
ATOM   21   C CG2 . VAL A 1 6   ? 49.794 32.343 -4.414  1.00 47.31 ? 878  VAL A CG2 1 
ATOM   22   N N   . ILE A 1 7   ? 48.074 28.025 -4.381  1.00 25.74 ? 879  ILE A N   1 
ATOM   23   C CA  . ILE A 1 7   ? 48.118 26.570 -4.315  1.00 20.97 ? 879  ILE A CA  1 
ATOM   24   C C   . ILE A 1 7   ? 49.148 26.047 -5.313  1.00 21.99 ? 879  ILE A C   1 
ATOM   25   O O   . ILE A 1 7   ? 49.100 26.387 -6.503  1.00 21.78 ? 879  ILE A O   1 
ATOM   26   C CB  . ILE A 1 7   ? 46.726 25.972 -4.680  1.00 20.04 ? 879  ILE A CB  1 
ATOM   27   C CG1 . ILE A 1 7   ? 45.642 26.562 -3.779  1.00 26.76 ? 879  ILE A CG1 1 
ATOM   28   C CG2 . ILE A 1 7   ? 46.777 24.449 -4.584  1.00 22.84 ? 879  ILE A CG2 1 
ATOM   29   C CD1 . ILE A 1 7   ? 45.805 26.193 -2.310  1.00 27.41 ? 879  ILE A CD1 1 
ATOM   30   N N   . SER A 1 8   ? 50.074 25.207 -4.837  1.00 20.77 ? 880  SER A N   1 
ATOM   31   C CA  . SER A 1 8   ? 51.219 24.790 -5.653  1.00 17.82 ? 880  SER A CA  1 
ATOM   32   C C   . SER A 1 8   ? 51.363 23.285 -5.763  1.00 14.59 ? 880  SER A C   1 
ATOM   33   O O   . SER A 1 8   ? 50.930 22.532 -4.875  1.00 18.07 ? 880  SER A O   1 
ATOM   34   C CB  . SER A 1 8   ? 52.531 25.353 -5.072  1.00 23.94 ? 880  SER A CB  1 
ATOM   35   O OG  . SER A 1 8   ? 52.432 26.752 -4.893  1.00 27.97 ? 880  SER A OG  1 
ATOM   36   N N   . VAL A 1 9   ? 52.044 22.846 -6.817  1.00 14.44 ? 881  VAL A N   1 
ATOM   37   C CA  . VAL A 1 9   ? 52.370 21.432 -6.959  1.00 14.60 ? 881  VAL A CA  1 
ATOM   38   C C   . VAL A 1 9   ? 53.105 20.915 -5.729  1.00 17.57 ? 881  VAL A C   1 
ATOM   39   O O   . VAL A 1 9   ? 54.017 21.585 -5.205  1.00 18.35 ? 881  VAL A O   1 
ATOM   40   C CB  . VAL A 1 9   ? 53.251 21.194 -8.214  1.00 13.06 ? 881  VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 9   ? 53.827 19.777 -8.194  1.00 17.49 ? 881  VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 9   ? 52.393 21.452 -9.457  1.00 16.14 ? 881  VAL A CG2 1 
ATOM   43   N N   . GLY A 1 10  ? 52.735 19.721 -5.280  1.00 16.99 ? 882  GLY A N   1 
ATOM   44   C CA  . GLY A 1 10  ? 53.392 19.078 -4.147  1.00 19.81 ? 882  GLY A CA  1 
ATOM   45   C C   . GLY A 1 10  ? 52.751 19.405 -2.802  1.00 22.03 ? 882  GLY A C   1 
ATOM   46   O O   . GLY A 1 10  ? 53.101 18.811 -1.783  1.00 21.65 ? 882  GLY A O   1 
ATOM   47   N N   . GLN A 1 11  ? 51.803 20.346 -2.785  1.00 18.15 ? 883  GLN A N   1 
ATOM   48   C CA  . GLN A 1 11  ? 51.162 20.733 -1.528  1.00 17.64 ? 883  GLN A CA  1 
ATOM   49   C C   . GLN A 1 11  ? 50.072 19.741 -1.122  1.00 17.90 ? 883  GLN A C   1 
ATOM   50   O O   . GLN A 1 11  ? 49.339 19.225 -1.978  1.00 20.29 ? 883  GLN A O   1 
ATOM   51   C CB  . GLN A 1 11  ? 50.493 22.102 -1.707  1.00 21.93 ? 883  GLN A CB  1 
ATOM   52   C CG  . GLN A 1 11  ? 49.930 22.766 -0.464  1.00 25.63 ? 883  GLN A CG  1 
ATOM   53   C CD  . GLN A 1 11  ? 49.470 24.196 -0.771  1.00 31.59 ? 883  GLN A CD  1 
ATOM   54   O OE1 . GLN A 1 11  ? 49.898 24.784 -1.795  1.00 35.13 ? 883  GLN A OE1 1 
ATOM   55   N NE2 . GLN A 1 11  ? 48.620 24.769 0.097   1.00 26.02 ? 883  GLN A NE2 1 
ATOM   56   N N   . THR A 1 12  ? 49.941 19.514 0.182   1.00 16.32 ? 884  THR A N   1 
ATOM   57   C CA  . THR A 1 12  ? 48.773 18.811 0.705   1.00 17.32 ? 884  THR A CA  1 
ATOM   58   C C   . THR A 1 12  ? 47.675 19.830 0.976   1.00 18.98 ? 884  THR A C   1 
ATOM   59   O O   . THR A 1 12  ? 47.889 20.842 1.654   1.00 20.06 ? 884  THR A O   1 
ATOM   60   C CB  . THR A 1 12  ? 49.108 18.040 2.005   1.00 19.12 ? 884  THR A CB  1 
ATOM   61   O OG1 . THR A 1 12  ? 50.153 17.092 1.732   1.00 21.83 ? 884  THR A OG1 1 
ATOM   62   C CG2 . THR A 1 12  ? 47.875 17.282 2.518   1.00 21.28 ? 884  THR A CG2 1 
ATOM   63   N N   . VAL A 1 13  ? 46.491 19.551 0.439   1.00 18.72 ? 885  VAL A N   1 
ATOM   64   C CA  . VAL A 1 13  ? 45.332 20.428 0.586   1.00 17.80 ? 885  VAL A CA  1 
ATOM   65   C C   . VAL A 1 13  ? 44.123 19.576 0.961   1.00 21.71 ? 885  VAL A C   1 
ATOM   66   O O   . VAL A 1 13  ? 44.181 18.338 0.918   1.00 21.21 ? 885  VAL A O   1 
ATOM   67   C CB  . VAL A 1 13  ? 45.034 21.182 -0.717  1.00 18.40 ? 885  VAL A CB  1 
ATOM   68   C CG1 . VAL A 1 13  ? 46.198 22.111 -1.079  1.00 21.62 ? 885  VAL A CG1 1 
ATOM   69   C CG2 . VAL A 1 13  ? 44.786 20.185 -1.858  1.00 20.03 ? 885  VAL A CG2 1 
ATOM   70   N N   . ILE A 1 14  ? 43.026 20.232 1.307   1.00 21.02 ? 886  ILE A N   1 
ATOM   71   C CA  . ILE A 1 14  ? 41.786 19.525 1.588   1.00 19.32 ? 886  ILE A CA  1 
ATOM   72   C C   . ILE A 1 14  ? 40.815 19.853 0.440   1.00 21.65 ? 886  ILE A C   1 
ATOM   73   O O   . ILE A 1 14  ? 40.689 21.016 0.044   1.00 23.25 ? 886  ILE A O   1 
ATOM   74   C CB  . ILE A 1 14  ? 41.156 19.973 2.925   1.00 20.08 ? 886  ILE A CB  1 
ATOM   75   C CG1 . ILE A 1 14  ? 42.069 19.649 4.113   1.00 26.40 ? 886  ILE A CG1 1 
ATOM   76   C CG2 . ILE A 1 14  ? 39.798 19.295 3.115   1.00 24.41 ? 886  ILE A CG2 1 
ATOM   77   C CD1 . ILE A 1 14  ? 42.530 18.226 4.154   1.00 27.98 ? 886  ILE A CD1 1 
ATOM   78   N N   . THR A 1 15  ? 40.157 18.842 -0.127  1.00 20.74 ? 887  THR A N   1 
ATOM   79   C CA  . THR A 1 15  ? 39.160 19.121 -1.174  1.00 21.80 ? 887  THR A CA  1 
ATOM   80   C C   . THR A 1 15  ? 37.754 18.793 -0.709  1.00 23.33 ? 887  THR A C   1 
ATOM   81   O O   . THR A 1 15  ? 37.544 17.891 0.107   1.00 24.78 ? 887  THR A O   1 
ATOM   82   C CB  . THR A 1 15  ? 39.448 18.385 -2.473  1.00 20.64 ? 887  THR A CB  1 
ATOM   83   O OG1 . THR A 1 15  ? 39.663 16.993 -2.205  1.00 23.72 ? 887  THR A OG1 1 
ATOM   84   C CG2 . THR A 1 15  ? 40.697 18.976 -3.151  1.00 26.11 ? 887  THR A CG2 1 
ATOM   85   N N   . LYS A 1 16  ? 36.805 19.560 -1.220  1.00 23.37 ? 888  LYS A N   1 
ATOM   86   C CA  . LYS A 1 16  ? 35.409 19.488 -0.819  1.00 23.51 ? 888  LYS A CA  1 
ATOM   87   C C   . LYS A 1 16  ? 34.626 18.806 -1.930  1.00 26.60 ? 888  LYS A C   1 
ATOM   88   O O   . LYS A 1 16  ? 34.834 19.093 -3.124  1.00 27.93 ? 888  LYS A O   1 
ATOM   89   C CB  . LYS A 1 16  ? 34.907 20.911 -0.618  1.00 30.80 ? 888  LYS A CB  1 
ATOM   90   C CG  . LYS A 1 16  ? 33.483 21.063 -0.138  1.00 37.66 ? 888  LYS A CG  1 
ATOM   91   C CD  . LYS A 1 16  ? 33.193 22.535 0.090   1.00 40.83 ? 888  LYS A CD  1 
ATOM   92   C CE  . LYS A 1 16  ? 33.213 23.327 -1.210  1.00 39.69 ? 888  LYS A CE  1 
ATOM   93   N NZ  . LYS A 1 16  ? 32.871 24.752 -0.959  1.00 42.47 ? 888  LYS A NZ  1 
ATOM   94   N N   . HIS A 1 17  ? 33.734 17.903 -1.543  1.00 25.20 ? 889  HIS A N   1 
ATOM   95   C CA  . HIS A 1 17  ? 32.944 17.147 -2.496  1.00 26.17 ? 889  HIS A CA  1 
ATOM   96   C C   . HIS A 1 17  ? 31.500 17.134 -2.062  1.00 26.17 ? 889  HIS A C   1 
ATOM   97   O O   . HIS A 1 17  ? 31.137 16.483 -1.072  1.00 30.04 ? 889  HIS A O   1 
ATOM   98   C CB  . HIS A 1 17  ? 33.516 15.735 -2.609  1.00 24.62 ? 889  HIS A CB  1 
ATOM   99   C CG  . HIS A 1 17  ? 34.956 15.730 -2.997  1.00 25.55 ? 889  HIS A CG  1 
ATOM   100  N ND1 . HIS A 1 17  ? 35.369 15.602 -4.307  1.00 27.41 ? 889  HIS A ND1 1 
ATOM   101  C CD2 . HIS A 1 17  ? 36.065 15.922 -2.257  1.00 27.96 ? 889  HIS A CD2 1 
ATOM   102  C CE1 . HIS A 1 17  ? 36.692 15.679 -4.347  1.00 25.77 ? 889  HIS A CE1 1 
ATOM   103  N NE2 . HIS A 1 17  ? 37.137 15.871 -3.118  1.00 28.26 ? 889  HIS A NE2 1 
ATOM   104  N N   . ARG A 1 18  ? 30.652 17.867 -2.790  1.00 35.78 ? 890  ARG A N   1 
ATOM   105  C CA  . ARG A 1 18  ? 29.255 17.983 -2.432  1.00 37.59 ? 890  ARG A CA  1 
ATOM   106  C C   . ARG A 1 18  ? 28.490 16.748 -2.908  1.00 33.45 ? 890  ARG A C   1 
ATOM   107  O O   . ARG A 1 18  ? 28.865 16.118 -3.912  1.00 39.84 ? 890  ARG A O   1 
ATOM   108  C CB  . ARG A 1 18  ? 28.638 19.241 -3.044  1.00 47.22 ? 890  ARG A CB  1 
ATOM   109  C CG  . ARG A 1 18  ? 29.188 20.551 -2.502  1.00 51.23 ? 890  ARG A CG  1 
ATOM   110  C CD  . ARG A 1 18  ? 28.757 21.703 -3.400  1.00 65.04 ? 890  ARG A CD  1 
ATOM   111  N NE  . ARG A 1 18  ? 29.498 22.933 -3.141  1.00 76.50 ? 890  ARG A NE  1 
ATOM   112  C CZ  . ARG A 1 18  ? 29.070 23.920 -2.362  1.00 82.53 ? 890  ARG A CZ  1 
ATOM   113  N NH1 . ARG A 1 18  ? 27.896 23.832 -1.753  1.00 83.62 ? 890  ARG A NH1 1 
ATOM   114  N NH2 . ARG A 1 18  ? 29.820 25.001 -2.191  1.00 87.74 ? 890  ARG A NH2 1 
ATOM   115  N N   . ASN A 1 19  ? 27.491 16.377 -2.129  1.00 32.35 ? 891  ASN A N   1 
ATOM   116  C CA  . ASN A 1 19  ? 26.553 15.312 -2.482  1.00 34.15 ? 891  ASN A CA  1 
ATOM   117  C C   . ASN A 1 19  ? 25.163 15.609 -1.940  1.00 33.77 ? 891  ASN A C   1 
ATOM   118  O O   . ASN A 1 19  ? 24.570 14.815 -1.209  1.00 34.24 ? 891  ASN A O   1 
ATOM   119  C CB  . ASN A 1 19  ? 27.052 13.959 -1.965  1.00 37.73 ? 891  ASN A CB  1 
ATOM   120  C CG  . ASN A 1 19  ? 26.334 12.779 -2.608  1.00 55.80 ? 891  ASN A CG  1 
ATOM   121  O OD1 . ASN A 1 19  ? 25.474 12.952 -3.479  1.00 58.82 ? 891  ASN A OD1 1 
ATOM   122  N ND2 . ASN A 1 19  ? 26.695 11.568 -2.184  1.00 58.76 ? 891  ASN A ND2 1 
ATOM   123  N N   . THR A 1 20  ? 24.642 16.777 -2.299  1.00 29.91 ? 892  THR A N   1 
ATOM   124  C CA  . THR A 1 20  ? 23.355 17.227 -1.815  1.00 29.87 ? 892  THR A CA  1 
ATOM   125  C C   . THR A 1 20  ? 22.237 16.453 -2.513  1.00 30.49 ? 892  THR A C   1 
ATOM   126  O O   . THR A 1 20  ? 22.301 16.206 -3.712  1.00 34.28 ? 892  THR A O   1 
ATOM   127  C CB  . THR A 1 20  ? 23.226 18.751 -1.990  1.00 33.98 ? 892  THR A CB  1 
ATOM   128  O OG1 . THR A 1 20  ? 24.326 19.386 -1.310  1.00 36.54 ? 892  THR A OG1 1 
ATOM   129  C CG2 . THR A 1 20  ? 21.904 19.257 -1.424  1.00 32.61 ? 892  THR A CG2 1 
ATOM   130  N N   . ARG A 1 21  ? 21.264 16.002 -1.727  1.00 27.25 ? 893  ARG A N   1 
ATOM   131  C CA  . ARG A 1 21  ? 20.120 15.254 -2.259  1.00 30.53 ? 893  ARG A CA  1 
ATOM   132  C C   . ARG A 1 21  ? 18.828 15.990 -1.963  1.00 30.40 ? 893  ARG A C   1 
ATOM   133  O O   . ARG A 1 21  ? 18.702 16.662 -0.939  1.00 26.12 ? 893  ARG A O   1 
ATOM   134  C CB  . ARG A 1 21  ? 20.061 13.846 -1.647  1.00 32.13 ? 893  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 21  ? 21.241 12.940 -2.004  1.00 37.04 ? 893  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 21  ? 21.291 12.643 -3.498  1.00 48.16 ? 893  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 21  ? 20.048 12.018 -3.953  1.00 60.01 ? 893  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 21  ? 19.761 10.728 -3.794  1.00 68.76 ? 893  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 21  ? 20.631 9.922  -3.197  1.00 75.67 ? 893  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 21  ? 18.607 10.242 -4.233  1.00 66.54 ? 893  ARG A NH2 1 
ATOM   141  N N   . TYR A 1 22  ? 17.842 15.833 -2.842  1.00 27.93 ? 894  TYR A N   1 
ATOM   142  C CA  . TYR A 1 22  ? 16.550 16.478 -2.666  1.00 28.58 ? 894  TYR A CA  1 
ATOM   143  C C   . TYR A 1 22  ? 15.447 15.431 -2.724  1.00 29.92 ? 894  TYR A C   1 
ATOM   144  O O   . TYR A 1 22  ? 15.513 14.489 -3.532  1.00 32.30 ? 894  TYR A O   1 
ATOM   145  C CB  . TYR A 1 22  ? 16.320 17.522 -3.755  1.00 32.42 ? 894  TYR A CB  1 
ATOM   146  C CG  . TYR A 1 22  ? 17.382 18.594 -3.794  1.00 32.67 ? 894  TYR A CG  1 
ATOM   147  C CD1 . TYR A 1 22  ? 17.211 19.783 -3.091  1.00 33.98 ? 894  TYR A CD1 1 
ATOM   148  C CD2 . TYR A 1 22  ? 18.552 18.421 -4.529  1.00 31.79 ? 894  TYR A CD2 1 
ATOM   149  C CE1 . TYR A 1 22  ? 18.170 20.766 -3.114  1.00 33.99 ? 894  TYR A CE1 1 
ATOM   150  C CE2 . TYR A 1 22  ? 19.510 19.401 -4.566  1.00 34.77 ? 894  TYR A CE2 1 
ATOM   151  C CZ  . TYR A 1 22  ? 19.324 20.573 -3.857  1.00 33.62 ? 894  TYR A CZ  1 
ATOM   152  O OH  . TYR A 1 22  ? 20.292 21.548 -3.891  1.00 40.97 ? 894  TYR A OH  1 
ATOM   153  N N   . TYR A 1 23  ? 14.424 15.593 -1.884  1.00 27.15 ? 895  TYR A N   1 
ATOM   154  C CA  . TYR A 1 23  ? 13.327 14.646 -1.862  1.00 25.91 ? 895  TYR A CA  1 
ATOM   155  C C   . TYR A 1 23  ? 12.003 15.359 -1.710  1.00 23.84 ? 895  TYR A C   1 
ATOM   156  O O   . TYR A 1 23  ? 11.891 16.347 -0.992  1.00 23.17 ? 895  TYR A O   1 
ATOM   157  C CB  . TYR A 1 23  ? 13.456 13.682 -0.682  1.00 26.55 ? 895  TYR A CB  1 
ATOM   158  C CG  . TYR A 1 23  ? 14.782 12.948 -0.669  1.00 29.78 ? 895  TYR A CG  1 
ATOM   159  C CD1 . TYR A 1 23  ? 14.984 11.833 -1.467  1.00 37.69 ? 895  TYR A CD1 1 
ATOM   160  C CD2 . TYR A 1 23  ? 15.812 13.375 0.148   1.00 31.22 ? 895  TYR A CD2 1 
ATOM   161  C CE1 . TYR A 1 23  ? 16.202 11.167 -1.467  1.00 37.36 ? 895  TYR A CE1 1 
ATOM   162  C CE2 . TYR A 1 23  ? 17.025 12.713 0.164   1.00 32.66 ? 895  TYR A CE2 1 
ATOM   163  C CZ  . TYR A 1 23  ? 17.203 11.615 -0.641  1.00 35.07 ? 895  TYR A CZ  1 
ATOM   164  O OH  . TYR A 1 23  ? 18.412 10.955 -0.627  1.00 40.06 ? 895  TYR A OH  1 
ATOM   165  N N   . SER A 1 24  ? 11.000 14.820 -2.375  1.00 25.27 ? 896  SER A N   1 
ATOM   166  C CA  A SER A 1 24  ? 9.643  15.300 -2.219  0.32 25.19 ? 896  SER A CA  1 
ATOM   167  C CA  B SER A 1 24  ? 9.640  15.303 -2.208  0.68 24.37 ? 896  SER A CA  1 
ATOM   168  C C   . SER A 1 24  ? 9.098  14.782 -0.891  1.00 27.27 ? 896  SER A C   1 
ATOM   169  O O   . SER A 1 24  ? 9.334  13.631 -0.534  1.00 28.66 ? 896  SER A O   1 
ATOM   170  C CB  A SER A 1 24  ? 8.791  14.792 -3.380  0.32 26.44 ? 896  SER A CB  1 
ATOM   171  C CB  B SER A 1 24  ? 8.763  14.810 -3.362  0.68 26.80 ? 896  SER A CB  1 
ATOM   172  O OG  A SER A 1 24  ? 7.481  15.294 -3.281  0.32 23.39 ? 896  SER A OG  1 
ATOM   173  O OG  B SER A 1 24  ? 9.175  15.417 -4.558  0.68 30.13 ? 896  SER A OG  1 
ATOM   174  N N   . CYS A 1 25  ? 8.360  15.616 -0.164  1.00 22.06 ? 897  CYS A N   1 
ATOM   175  C CA  A CYS A 1 25  ? 7.852  15.251 1.160   0.31 21.20 ? 897  CYS A CA  1 
ATOM   176  C CA  B CYS A 1 25  ? 7.820  15.174 1.105   0.69 19.70 ? 897  CYS A CA  1 
ATOM   177  C C   . CYS A 1 25  ? 6.582  15.978 1.457   1.00 21.46 ? 897  CYS A C   1 
ATOM   178  O O   . CYS A 1 25  ? 6.295  16.993 0.823   1.00 20.79 ? 897  CYS A O   1 
ATOM   179  C CB  A CYS A 1 25  ? 8.808  15.686 2.257   0.31 21.29 ? 897  CYS A CB  1 
ATOM   180  C CB  B CYS A 1 25  ? 8.874  15.303 2.212   0.69 20.56 ? 897  CYS A CB  1 
ATOM   181  S SG  A CYS A 1 25  ? 10.384 14.976 2.152   0.31 28.29 ? 897  CYS A SG  1 
ATOM   182  S SG  B CYS A 1 25  ? 9.666  16.924 2.305   0.69 20.17 ? 897  CYS A SG  1 
ATOM   183  N N   . ARG A 1 26  ? 5.860  15.488 2.458   1.00 21.07 ? 898  ARG A N   1 
ATOM   184  C CA  . ARG A 1 26  ? 4.610  16.100 2.878   1.00 17.63 ? 898  ARG A CA  1 
ATOM   185  C C   . ARG A 1 26  ? 4.765  16.731 4.258   1.00 16.10 ? 898  ARG A C   1 
ATOM   186  O O   . ARG A 1 26  ? 5.349  16.125 5.175   1.00 18.80 ? 898  ARG A O   1 
ATOM   187  C CB  . ARG A 1 26  ? 3.529  15.019 2.948   1.00 19.28 ? 898  ARG A CB  1 
ATOM   188  C CG  . ARG A 1 26  ? 2.188  15.544 3.311   1.00 22.37 ? 898  ARG A CG  1 
ATOM   189  C CD  . ARG A 1 26  ? 1.182  14.397 3.294   1.00 29.32 ? 898  ARG A CD  1 
ATOM   190  N NE  . ARG A 1 26  ? -0.171 14.883 3.103   1.00 33.11 ? 898  ARG A NE  1 
ATOM   191  C CZ  . ARG A 1 26  ? -1.230 14.382 3.726   1.00 34.75 ? 898  ARG A CZ  1 
ATOM   192  N NH1 . ARG A 1 26  ? -1.077 13.380 4.595   1.00 28.56 ? 898  ARG A NH1 1 
ATOM   193  N NH2 . ARG A 1 26  ? -2.437 14.883 3.478   1.00 34.60 ? 898  ARG A NH2 1 
ATOM   194  N N   . VAL A 1 27  ? 4.257  17.954 4.434   1.00 16.02 ? 899  VAL A N   1 
ATOM   195  C CA  . VAL A 1 27  ? 4.344  18.625 5.736   1.00 16.26 ? 899  VAL A CA  1 
ATOM   196  C C   . VAL A 1 27  ? 3.273  18.055 6.670   1.00 15.47 ? 899  VAL A C   1 
ATOM   197  O O   . VAL A 1 27  ? 2.077  18.163 6.387   1.00 17.34 ? 899  VAL A O   1 
ATOM   198  C CB  . VAL A 1 27  ? 4.199  20.163 5.601   1.00 16.91 ? 899  VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 27  ? 4.273  20.862 6.971   1.00 18.12 ? 899  VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 27  ? 5.318  20.710 4.681   1.00 17.65 ? 899  VAL A CG2 1 
ATOM   201  N N   . MET A 1 28  ? 3.724  17.437 7.761   1.00 16.11 ? 900  MET A N   1 
ATOM   202  C CA  . MET A 1 28  ? 2.811  16.766 8.707   1.00 15.80 ? 900  MET A CA  1 
ATOM   203  C C   . MET A 1 28  ? 2.453  17.639 9.901   1.00 15.82 ? 900  MET A C   1 
ATOM   204  O O   . MET A 1 28  ? 1.395  17.453 10.536  1.00 16.98 ? 900  MET A O   1 
ATOM   205  C CB  . MET A 1 28  ? 3.495  15.483 9.207   1.00 19.64 ? 900  MET A CB  1 
ATOM   206  C CG  . MET A 1 28  ? 3.979  14.553 8.090   1.00 21.97 ? 900  MET A CG  1 
ATOM   207  S SD  . MET A 1 28  ? 2.669  14.131 6.901   1.00 22.76 ? 900  MET A SD  1 
ATOM   208  C CE  . MET A 1 28  ? 1.690  13.057 7.958   1.00 24.61 ? 900  MET A CE  1 
ATOM   209  N N   . ALA A 1 29  ? 3.338  18.569 10.250  1.00 15.12 ? 901  ALA A N   1 
ATOM   210  C CA  . ALA A 1 29  ? 3.171  19.436 11.407  1.00 16.53 ? 901  ALA A CA  1 
ATOM   211  C C   . ALA A 1 29  ? 4.104  20.626 11.320  1.00 18.81 ? 901  ALA A C   1 
ATOM   212  O O   . ALA A 1 29  ? 5.185  20.535 10.726  1.00 17.57 ? 901  ALA A O   1 
ATOM   213  C CB  . ALA A 1 29  ? 3.416  18.643 12.717  1.00 16.43 ? 901  ALA A CB  1 
ATOM   214  N N   . VAL A 1 30  ? 3.687  21.742 11.891  1.00 17.12 ? 902  VAL A N   1 
ATOM   215  C CA  . VAL A 1 30  ? 4.546  22.907 12.074  1.00 19.39 ? 902  VAL A CA  1 
ATOM   216  C C   . VAL A 1 30  ? 4.614  23.217 13.557  1.00 22.35 ? 902  VAL A C   1 
ATOM   217  O O   . VAL A 1 30  ? 3.570  23.412 14.202  1.00 21.36 ? 902  VAL A O   1 
ATOM   218  C CB  . VAL A 1 30  ? 4.011  24.118 11.301  1.00 20.46 ? 902  VAL A CB  1 
ATOM   219  C CG1 . VAL A 1 30  ? 4.976  25.315 11.466  1.00 21.63 ? 902  VAL A CG1 1 
ATOM   220  C CG2 . VAL A 1 30  ? 3.842  23.777 9.830   1.00 19.91 ? 902  VAL A CG2 1 
ATOM   221  N N   . THR A 1 31  ? 5.818  23.220 14.133  1.00 17.60 ? 903  THR A N   1 
ATOM   222  C CA  . THR A 1 31  ? 5.941  23.476 15.564  1.00 19.25 ? 903  THR A CA  1 
ATOM   223  C C   . THR A 1 31  ? 6.856  24.660 15.863  1.00 23.49 ? 903  THR A C   1 
ATOM   224  O O   . THR A 1 31  ? 7.592  25.122 14.995  1.00 26.41 ? 903  THR A O   1 
ATOM   225  C CB  . THR A 1 31  ? 6.460  22.239 16.308  1.00 26.50 ? 903  THR A CB  1 
ATOM   226  O OG1 . THR A 1 31  ? 7.702  21.838 15.731  1.00 27.53 ? 903  THR A OG1 1 
ATOM   227  C CG2 . THR A 1 31  ? 5.461  21.079 16.178  1.00 29.94 ? 903  THR A CG2 1 
ATOM   228  N N   . SER A 1 32  ? 6.782  25.164 17.090  1.00 24.15 ? 904  SER A N   1 
ATOM   229  C CA  . SER A 1 32  ? 7.661  26.241 17.519  1.00 26.88 ? 904  SER A CA  1 
ATOM   230  C C   . SER A 1 32  ? 8.975  25.645 18.010  1.00 22.17 ? 904  SER A C   1 
ATOM   231  O O   . SER A 1 32  ? 8.996  24.552 18.592  1.00 26.51 ? 904  SER A O   1 
ATOM   232  C CB  . SER A 1 32  ? 7.016  27.051 18.646  1.00 33.55 ? 904  SER A CB  1 
ATOM   233  O OG  . SER A 1 32  ? 5.865  27.740 18.182  1.00 41.23 ? 904  SER A OG  1 
ATOM   234  N N   . GLN A 1 33  ? 10.061 26.371 17.792  1.00 20.80 ? 905  GLN A N   1 
ATOM   235  C CA  . GLN A 1 33  ? 11.406 25.926 18.180  1.00 22.26 ? 905  GLN A CA  1 
ATOM   236  C C   . GLN A 1 33  ? 12.247 27.133 18.532  1.00 18.98 ? 905  GLN A C   1 
ATOM   237  O O   . GLN A 1 33  ? 12.220 28.146 17.818  1.00 21.28 ? 905  GLN A O   1 
ATOM   238  C CB  . GLN A 1 33  ? 12.058 25.184 17.010  1.00 19.90 ? 905  GLN A CB  1 
ATOM   239  C CG  . GLN A 1 33  ? 13.574 24.949 17.157  1.00 22.42 ? 905  GLN A CG  1 
ATOM   240  C CD  . GLN A 1 33  ? 13.884 23.813 18.106  1.00 25.94 ? 905  GLN A CD  1 
ATOM   241  O OE1 . GLN A 1 33  ? 13.227 22.768 18.073  1.00 27.61 ? 905  GLN A OE1 1 
ATOM   242  N NE2 . GLN A 1 33  ? 14.873 24.020 18.980  1.00 20.39 ? 905  GLN A NE2 1 
ATOM   243  N N   . THR A 1 34  ? 12.979 27.025 19.643  1.00 17.76 ? 906  THR A N   1 
ATOM   244  C CA  . THR A 1 34  ? 13.939 28.045 20.042  1.00 17.76 ? 906  THR A CA  1 
ATOM   245  C C   . THR A 1 34  ? 15.232 27.845 19.268  1.00 17.17 ? 906  THR A C   1 
ATOM   246  O O   . THR A 1 34  ? 15.768 26.737 19.221  1.00 22.09 ? 906  THR A O   1 
ATOM   247  C CB  . THR A 1 34  ? 14.262 27.971 21.548  1.00 19.54 ? 906  THR A CB  1 
ATOM   248  O OG1 . THR A 1 34  ? 13.095 28.308 22.308  1.00 24.80 ? 906  THR A OG1 1 
ATOM   249  C CG2 . THR A 1 34  ? 15.370 28.959 21.889  1.00 21.40 ? 906  THR A CG2 1 
ATOM   250  N N   . PHE A 1 35  ? 15.712 28.913 18.640  1.00 18.11 ? 907  PHE A N   1 
ATOM   251  C CA  . PHE A 1 35  ? 16.970 28.875 17.906  1.00 20.50 ? 907  PHE A CA  1 
ATOM   252  C C   . PHE A 1 35  ? 17.929 29.881 18.520  1.00 20.53 ? 907  PHE A C   1 
ATOM   253  O O   . PHE A 1 35  ? 17.506 30.911 19.063  1.00 22.78 ? 907  PHE A O   1 
ATOM   254  C CB  . PHE A 1 35  ? 16.745 29.244 16.435  1.00 19.87 ? 907  PHE A CB  1 
ATOM   255  C CG  . PHE A 1 35  ? 16.025 28.179 15.629  1.00 22.88 ? 907  PHE A CG  1 
ATOM   256  C CD1 . PHE A 1 35  ? 16.705 27.064 15.170  1.00 27.14 ? 907  PHE A CD1 1 
ATOM   257  C CD2 . PHE A 1 35  ? 14.686 28.324 15.289  1.00 26.48 ? 907  PHE A CD2 1 
ATOM   258  C CE1 . PHE A 1 35  ? 16.065 26.101 14.422  1.00 24.45 ? 907  PHE A CE1 1 
ATOM   259  C CE2 . PHE A 1 35  ? 14.032 27.350 14.538  1.00 29.40 ? 907  PHE A CE2 1 
ATOM   260  C CZ  . PHE A 1 35  ? 14.725 26.238 14.105  1.00 28.85 ? 907  PHE A CZ  1 
ATOM   261  N N   . TYR A 1 36  ? 19.221 29.584 18.445  1.00 18.91 ? 908  TYR A N   1 
ATOM   262  C CA  . TYR A 1 36  ? 20.217 30.546 18.886  1.00 20.59 ? 908  TYR A CA  1 
ATOM   263  C C   . TYR A 1 36  ? 20.793 31.344 17.726  1.00 24.23 ? 908  TYR A C   1 
ATOM   264  O O   . TYR A 1 36  ? 20.860 30.883 16.580  1.00 23.06 ? 908  TYR A O   1 
ATOM   265  C CB  . TYR A 1 36  ? 21.341 29.835 19.621  1.00 20.56 ? 908  TYR A CB  1 
ATOM   266  C CG  . TYR A 1 36  ? 20.977 29.283 20.986  1.00 21.01 ? 908  TYR A CG  1 
ATOM   267  C CD1 . TYR A 1 36  ? 19.736 29.537 21.581  1.00 20.50 ? 908  TYR A CD1 1 
ATOM   268  C CD2 . TYR A 1 36  ? 21.892 28.498 21.682  1.00 20.14 ? 908  TYR A CD2 1 
ATOM   269  C CE1 . TYR A 1 36  ? 19.434 29.016 22.840  1.00 21.47 ? 908  TYR A CE1 1 
ATOM   270  C CE2 . TYR A 1 36  ? 21.608 27.972 22.920  1.00 21.34 ? 908  TYR A CE2 1 
ATOM   271  C CZ  . TYR A 1 36  ? 20.382 28.234 23.502  1.00 19.50 ? 908  TYR A CZ  1 
ATOM   272  O OH  . TYR A 1 36  ? 20.115 27.712 24.740  1.00 20.09 ? 908  TYR A OH  1 
ATOM   273  N N   . GLU A 1 37  ? 21.204 32.562 18.041  1.00 26.06 ? 909  GLU A N   1 
ATOM   274  C CA  . GLU A 1 37  ? 21.842 33.436 17.079  1.00 26.01 ? 909  GLU A CA  1 
ATOM   275  C C   . GLU A 1 37  ? 23.310 33.540 17.475  1.00 27.02 ? 909  GLU A C   1 
ATOM   276  O O   . GLU A 1 37  ? 23.632 33.961 18.584  1.00 26.23 ? 909  GLU A O   1 
ATOM   277  C CB  . GLU A 1 37  ? 21.147 34.798 17.091  1.00 24.74 ? 909  GLU A CB  1 
ATOM   278  C CG  . GLU A 1 37  ? 19.643 34.664 16.817  1.00 26.89 ? 909  GLU A CG  1 
ATOM   279  C CD  . GLU A 1 37  ? 18.908 35.986 16.725  1.00 34.65 ? 909  GLU A CD  1 
ATOM   280  O OE1 . GLU A 1 37  ? 19.543 37.058 16.820  1.00 32.62 ? 909  GLU A OE1 1 
ATOM   281  O OE2 . GLU A 1 37  ? 17.675 35.947 16.543  1.00 32.13 ? 909  GLU A OE2 1 
ATOM   282  N N   . VAL A 1 38  ? 24.190 33.116 16.579  1.00 24.51 ? 910  VAL A N   1 
ATOM   283  C CA  . VAL A 1 38  ? 25.626 33.157 16.861  1.00 28.16 ? 910  VAL A CA  1 
ATOM   284  C C   . VAL A 1 38  ? 26.419 33.785 15.724  1.00 30.07 ? 910  VAL A C   1 
ATOM   285  O O   . VAL A 1 38  ? 26.108 33.605 14.536  1.00 28.33 ? 910  VAL A O   1 
ATOM   286  C CB  . VAL A 1 38  ? 26.213 31.751 17.122  1.00 25.99 ? 910  VAL A CB  1 
ATOM   287  C CG1 . VAL A 1 38  ? 25.489 31.050 18.282  1.00 25.26 ? 910  VAL A CG1 1 
ATOM   288  C CG2 . VAL A 1 38  ? 26.158 30.908 15.864  1.00 29.15 ? 910  VAL A CG2 1 
ATOM   289  N N   . MET A 1 39  ? 27.437 34.536 16.110  1.00 28.77 ? 911  MET A N   1 
ATOM   290  C CA  A MET A 1 39  ? 28.414 35.092 15.184  0.53 31.01 ? 911  MET A CA  1 
ATOM   291  C CA  B MET A 1 39  ? 28.389 35.030 15.126  0.47 30.63 ? 911  MET A CA  1 
ATOM   292  C C   . MET A 1 39  ? 29.652 34.195 15.167  1.00 28.82 ? 911  MET A C   1 
ATOM   293  O O   . MET A 1 39  ? 30.352 34.111 16.181  1.00 29.96 ? 911  MET A O   1 
ATOM   294  C CB  A MET A 1 39  ? 28.809 36.492 15.659  0.53 33.09 ? 911  MET A CB  1 
ATOM   295  C CB  B MET A 1 39  ? 28.724 36.509 15.297  0.47 32.66 ? 911  MET A CB  1 
ATOM   296  C CG  A MET A 1 39  ? 29.900 37.144 14.831  0.53 30.86 ? 911  MET A CG  1 
ATOM   297  C CG  B MET A 1 39  ? 29.847 36.931 14.352  0.47 30.40 ? 911  MET A CG  1 
ATOM   298  S SD  A MET A 1 39  ? 29.282 37.602 13.209  0.53 36.88 ? 911  MET A SD  1 
ATOM   299  S SD  B MET A 1 39  ? 29.920 38.690 13.983  0.47 33.05 ? 911  MET A SD  1 
ATOM   300  C CE  A MET A 1 39  ? 28.239 39.006 13.605  0.53 41.06 ? 911  MET A CE  1 
ATOM   301  C CE  B MET A 1 39  ? 28.327 38.950 13.204  0.47 40.68 ? 911  MET A CE  1 
ATOM   302  N N   . PHE A 1 40  ? 29.917 33.540 14.048  1.00 30.00 ? 912  PHE A N   1 
ATOM   303  C CA  . PHE A 1 40  ? 31.099 32.692 13.936  1.00 33.61 ? 912  PHE A CA  1 
ATOM   304  C C   . PHE A 1 40  ? 32.349 33.552 13.844  1.00 40.90 ? 912  PHE A C   1 
ATOM   305  O O   . PHE A 1 40  ? 32.294 34.700 13.400  1.00 39.07 ? 912  PHE A O   1 
ATOM   306  C CB  . PHE A 1 40  ? 30.985 31.764 12.724  1.00 31.39 ? 912  PHE A CB  1 
ATOM   307  C CG  . PHE A 1 40  ? 29.930 30.706 12.873  1.00 27.60 ? 912  PHE A CG  1 
ATOM   308  C CD1 . PHE A 1 40  ? 30.194 29.539 13.571  1.00 30.28 ? 912  PHE A CD1 1 
ATOM   309  C CD2 . PHE A 1 40  ? 28.670 30.879 12.321  1.00 38.12 ? 912  PHE A CD2 1 
ATOM   310  C CE1 . PHE A 1 40  ? 29.219 28.560 13.717  1.00 31.75 ? 912  PHE A CE1 1 
ATOM   311  C CE2 . PHE A 1 40  ? 27.687 29.900 12.461  1.00 39.92 ? 912  PHE A CE2 1 
ATOM   312  C CZ  . PHE A 1 40  ? 27.964 28.742 13.159  1.00 34.88 ? 912  PHE A CZ  1 
ATOM   313  N N   . ASP A 1 41  ? 33.473 32.996 14.276  1.00 40.80 ? 913  ASP A N   1 
ATOM   314  C CA  . ASP A 1 41  ? 34.729 33.741 14.273  1.00 44.09 ? 913  ASP A CA  1 
ATOM   315  C C   . ASP A 1 41  ? 35.045 34.304 12.882  1.00 44.77 ? 913  ASP A C   1 
ATOM   316  O O   . ASP A 1 41  ? 35.788 35.280 12.757  1.00 44.43 ? 913  ASP A O   1 
ATOM   317  C CB  . ASP A 1 41  ? 35.879 32.869 14.788  1.00 43.56 ? 913  ASP A CB  1 
ATOM   318  C CG  . ASP A 1 41  ? 35.736 32.510 16.263  1.00 42.91 ? 913  ASP A CG  1 
ATOM   319  O OD1 . ASP A 1 41  ? 34.905 33.122 16.973  1.00 43.33 ? 913  ASP A OD1 1 
ATOM   320  O OD2 . ASP A 1 41  ? 36.471 31.614 16.725  1.00 44.15 ? 913  ASP A OD2 1 
ATOM   321  N N   . ASP A 1 42  ? 34.468 33.709 11.839  1.00 47.17 ? 914  ASP A N   1 
ATOM   322  C CA  . ASP A 1 42  ? 34.722 34.164 10.467  1.00 49.47 ? 914  ASP A CA  1 
ATOM   323  C C   . ASP A 1 42  ? 33.867 35.364 10.068  1.00 49.48 ? 914  ASP A C   1 
ATOM   324  O O   . ASP A 1 42  ? 33.999 35.881 8.959   1.00 49.16 ? 914  ASP A O   1 
ATOM   325  C CB  . ASP A 1 42  ? 34.517 33.024 9.459   1.00 52.25 ? 914  ASP A CB  1 
ATOM   326  C CG  . ASP A 1 42  ? 33.047 32.725 9.201   1.00 59.14 ? 914  ASP A CG  1 
ATOM   327  O OD1 . ASP A 1 42  ? 32.204 33.134 10.025  1.00 59.11 ? 914  ASP A OD1 1 
ATOM   328  O OD2 . ASP A 1 42  ? 32.732 32.081 8.176   1.00 61.28 ? 914  ASP A OD2 1 
ATOM   329  N N   . GLY A 1 43  ? 32.977 35.791 10.962  1.00 50.13 ? 915  GLY A N   1 
ATOM   330  C CA  . GLY A 1 43  ? 32.134 36.949 10.714  1.00 46.93 ? 915  GLY A CA  1 
ATOM   331  C C   . GLY A 1 43  ? 30.765 36.625 10.147  1.00 47.23 ? 915  GLY A C   1 
ATOM   332  O O   . GLY A 1 43  ? 29.902 37.497 10.045  1.00 49.41 ? 915  GLY A O   1 
ATOM   333  N N   . SER A 1 44  ? 30.560 35.367 9.773   1.00 46.95 ? 916  SER A N   1 
ATOM   334  C CA  . SER A 1 44  ? 29.251 34.907 9.323   1.00 46.27 ? 916  SER A CA  1 
ATOM   335  C C   . SER A 1 44  ? 28.281 34.802 10.507  1.00 47.01 ? 916  SER A C   1 
ATOM   336  O O   . SER A 1 44  ? 28.694 34.462 11.613  1.00 47.15 ? 916  SER A O   1 
ATOM   337  C CB  . SER A 1 44  ? 29.389 33.553 8.629   1.00 54.28 ? 916  SER A CB  1 
ATOM   338  O OG  . SER A 1 44  ? 28.125 33.061 8.230   1.00 64.43 ? 916  SER A OG  1 
ATOM   339  N N   . PHE A 1 45  ? 27.001 35.096 10.275  1.00 41.26 ? 917  PHE A N   1 
ATOM   340  C CA  . PHE A 1 45  ? 26.013 35.147 11.357  1.00 45.77 ? 917  PHE A CA  1 
ATOM   341  C C   . PHE A 1 45  ? 24.853 34.181 11.118  1.00 45.15 ? 917  PHE A C   1 
ATOM   342  O O   . PHE A 1 45  ? 24.196 34.230 10.080  1.00 49.21 ? 917  PHE A O   1 
ATOM   343  C CB  . PHE A 1 45  ? 25.492 36.580 11.525  1.00 48.51 ? 917  PHE A CB  1 
ATOM   344  C CG  . PHE A 1 45  ? 24.623 36.790 12.744  1.00 46.98 ? 917  PHE A CG  1 
ATOM   345  C CD1 . PHE A 1 45  ? 25.184 36.884 14.011  1.00 39.91 ? 917  PHE A CD1 1 
ATOM   346  C CD2 . PHE A 1 45  ? 23.247 36.926 12.615  1.00 45.76 ? 917  PHE A CD2 1 
ATOM   347  C CE1 . PHE A 1 45  ? 24.385 37.096 15.131  1.00 41.58 ? 917  PHE A CE1 1 
ATOM   348  C CE2 . PHE A 1 45  ? 22.442 37.142 13.730  1.00 42.76 ? 917  PHE A CE2 1 
ATOM   349  C CZ  . PHE A 1 45  ? 23.010 37.226 14.987  1.00 37.41 ? 917  PHE A CZ  1 
ATOM   350  N N   . SER A 1 46  ? 24.603 33.302 12.085  1.00 33.10 ? 918  SER A N   1 
ATOM   351  C CA  . SER A 1 46  ? 23.557 32.304 11.960  1.00 30.56 ? 918  SER A CA  1 
ATOM   352  C C   . SER A 1 46  ? 22.415 32.640 12.911  1.00 29.89 ? 918  SER A C   1 
ATOM   353  O O   . SER A 1 46  ? 22.657 32.972 14.071  1.00 30.58 ? 918  SER A O   1 
ATOM   354  C CB  . SER A 1 46  ? 24.098 30.912 12.310  1.00 30.14 ? 918  SER A CB  1 
ATOM   355  O OG  . SER A 1 46  ? 23.024 29.986 12.455  1.00 34.77 ? 918  SER A OG  1 
ATOM   356  N N   . ARG A 1 47  ? 21.178 32.547 12.429  1.00 28.71 ? 919  ARG A N   1 
ATOM   357  C CA  . ARG A 1 47  ? 20.024 32.770 13.290  1.00 30.70 ? 919  ARG A CA  1 
ATOM   358  C C   . ARG A 1 47  ? 19.219 31.494 13.510  1.00 28.90 ? 919  ARG A C   1 
ATOM   359  O O   . ARG A 1 47  ? 18.162 31.540 14.104  1.00 28.20 ? 919  ARG A O   1 
ATOM   360  C CB  . ARG A 1 47  ? 19.115 33.854 12.698  1.00 31.72 ? 919  ARG A CB  1 
ATOM   361  C CG  . ARG A 1 47  ? 19.737 35.238 12.691  1.00 33.06 ? 919  ARG A CG  1 
ATOM   362  C CD  . ARG A 1 47  ? 18.785 36.271 12.082  1.00 42.33 ? 919  ARG A CD  1 
ATOM   363  N NE  . ARG A 1 47  ? 19.295 37.631 12.262  1.00 47.79 ? 919  ARG A NE  1 
ATOM   364  C CZ  . ARG A 1 47  ? 20.159 38.219 11.439  1.00 55.58 ? 919  ARG A CZ  1 
ATOM   365  N NH1 . ARG A 1 47  ? 20.603 37.569 10.368  1.00 56.82 ? 919  ARG A NH1 1 
ATOM   366  N NH2 . ARG A 1 47  ? 20.575 39.457 11.681  1.00 53.27 ? 919  ARG A NH2 1 
ATOM   367  N N   . ASP A 1 48  ? 19.714 30.360 13.025  1.00 25.93 ? 920  ASP A N   1 
ATOM   368  C CA  . ASP A 1 48  ? 18.974 29.110 13.150  1.00 26.06 ? 920  ASP A CA  1 
ATOM   369  C C   . ASP A 1 48  ? 19.835 27.980 13.701  1.00 30.01 ? 920  ASP A C   1 
ATOM   370  O O   . ASP A 1 48  ? 19.716 26.826 13.297  1.00 27.55 ? 920  ASP A O   1 
ATOM   371  C CB  . ASP A 1 48  ? 18.252 28.709 11.832  1.00 31.53 ? 920  ASP A CB  1 
ATOM   372  C CG  . ASP A 1 48  ? 19.205 28.448 10.667  1.00 40.12 ? 920  ASP A CG  1 
ATOM   373  O OD1 . ASP A 1 48  ? 20.431 28.596 10.821  1.00 32.03 ? 920  ASP A OD1 1 
ATOM   374  O OD2 . ASP A 1 48  ? 18.708 28.104 9.564   1.00 44.42 ? 920  ASP A OD2 1 
ATOM   375  N N   . THR A 1 49  ? 20.691 28.324 14.651  1.00 25.02 ? 921  THR A N   1 
ATOM   376  C CA  . THR A 1 49  ? 21.489 27.328 15.354  1.00 23.89 ? 921  THR A CA  1 
ATOM   377  C C   . THR A 1 49  ? 20.642 26.623 16.424  1.00 22.77 ? 921  THR A C   1 
ATOM   378  O O   . THR A 1 49  ? 20.014 27.281 17.255  1.00 21.70 ? 921  THR A O   1 
ATOM   379  C CB  . THR A 1 49  ? 22.745 27.990 15.950  1.00 23.90 ? 921  THR A CB  1 
ATOM   380  O OG1 . THR A 1 49  ? 23.574 28.440 14.869  1.00 26.57 ? 921  THR A OG1 1 
ATOM   381  C CG2 . THR A 1 49  ? 23.537 27.010 16.838  1.00 21.66 ? 921  THR A CG2 1 
ATOM   382  N N   . PHE A 1 50  ? 20.638 25.288 16.429  1.00 19.22 ? 922  PHE A N   1 
ATOM   383  C CA  . PHE A 1 50  ? 19.945 24.568 17.499  1.00 18.63 ? 922  PHE A CA  1 
ATOM   384  C C   . PHE A 1 50  ? 20.647 24.706 18.842  1.00 15.48 ? 922  PHE A C   1 
ATOM   385  O O   . PHE A 1 50  ? 21.893 24.605 18.910  1.00 17.42 ? 922  PHE A O   1 
ATOM   386  C CB  . PHE A 1 50  ? 19.834 23.071 17.202  1.00 19.32 ? 922  PHE A CB  1 
ATOM   387  C CG  . PHE A 1 50  ? 18.950 22.732 16.036  1.00 18.98 ? 922  PHE A CG  1 
ATOM   388  C CD1 . PHE A 1 50  ? 17.581 22.939 16.106  1.00 16.78 ? 922  PHE A CD1 1 
ATOM   389  C CD2 . PHE A 1 50  ? 19.472 22.148 14.901  1.00 29.23 ? 922  PHE A CD2 1 
ATOM   390  C CE1 . PHE A 1 50  ? 16.767 22.599 15.031  1.00 18.53 ? 922  PHE A CE1 1 
ATOM   391  C CE2 . PHE A 1 50  ? 18.647 21.798 13.826  1.00 33.89 ? 922  PHE A CE2 1 
ATOM   392  C CZ  . PHE A 1 50  ? 17.288 22.036 13.901  1.00 28.01 ? 922  PHE A CZ  1 
ATOM   393  N N   . PRO A 1 51  ? 19.890 24.906 19.927  1.00 16.58 ? 923  PRO A N   1 
ATOM   394  C CA  . PRO A 1 51  ? 20.550 24.963 21.245  1.00 17.47 ? 923  PRO A CA  1 
ATOM   395  C C   . PRO A 1 51  ? 21.445 23.739 21.515  1.00 17.51 ? 923  PRO A C   1 
ATOM   396  O O   . PRO A 1 51  ? 22.550 23.900 22.083  1.00 17.76 ? 923  PRO A O   1 
ATOM   397  C CB  . PRO A 1 51  ? 19.369 24.993 22.227  1.00 17.72 ? 923  PRO A CB  1 
ATOM   398  C CG  . PRO A 1 51  ? 18.302 25.763 21.420  1.00 19.17 ? 923  PRO A CG  1 
ATOM   399  C CD  . PRO A 1 51  ? 18.448 25.253 20.007  1.00 14.75 ? 923  PRO A CD  1 
ATOM   400  N N   . GLU A 1 52  ? 21.034 22.552 21.070  1.00 17.90 ? 924  GLU A N   1 
ATOM   401  C CA  . GLU A 1 52  ? 21.855 21.351 21.337  1.00 17.33 ? 924  GLU A CA  1 
ATOM   402  C C   . GLU A 1 52  ? 23.154 21.301 20.545  1.00 18.59 ? 924  GLU A C   1 
ATOM   403  O O   . GLU A 1 52  ? 24.019 20.479 20.840  1.00 20.56 ? 924  GLU A O   1 
ATOM   404  C CB  . GLU A 1 52  ? 21.077 20.075 21.059  1.00 21.48 ? 924  GLU A CB  1 
ATOM   405  C CG  . GLU A 1 52  ? 20.479 20.022 19.676  1.00 24.42 ? 924  GLU A CG  1 
ATOM   406  C CD  . GLU A 1 52  ? 19.013 20.530 19.629  1.00 38.38 ? 924  GLU A CD  1 
ATOM   407  O OE1 . GLU A 1 52  ? 18.221 19.892 18.899  1.00 39.62 ? 924  GLU A OE1 1 
ATOM   408  O OE2 . GLU A 1 52  ? 18.651 21.557 20.292  1.00 21.22 ? 924  GLU A OE2 1 
ATOM   409  N N   . ASP A 1 53  ? 23.291 22.169 19.559  1.00 16.50 ? 925  ASP A N   1 
ATOM   410  C CA  . ASP A 1 53  ? 24.534 22.218 18.790  1.00 17.26 ? 925  ASP A CA  1 
ATOM   411  C C   . ASP A 1 53  ? 25.616 23.085 19.414  1.00 20.08 ? 925  ASP A C   1 
ATOM   412  O O   . ASP A 1 53  ? 26.739 23.135 18.899  1.00 19.24 ? 925  ASP A O   1 
ATOM   413  C CB  . ASP A 1 53  ? 24.247 22.584 17.338  1.00 19.79 ? 925  ASP A CB  1 
ATOM   414  C CG  . ASP A 1 53  ? 23.465 21.484 16.639  1.00 22.47 ? 925  ASP A CG  1 
ATOM   415  O OD1 . ASP A 1 53  ? 23.541 20.328 17.113  1.00 27.64 ? 925  ASP A OD1 1 
ATOM   416  O OD2 . ASP A 1 53  ? 22.801 21.751 15.628  1.00 26.06 ? 925  ASP A OD2 1 
ATOM   417  N N   . ILE A 1 54  ? 25.314 23.751 20.525  1.00 15.42 ? 926  ILE A N   1 
ATOM   418  C CA  . ILE A 1 54  ? 26.386 24.368 21.330  1.00 15.93 ? 926  ILE A CA  1 
ATOM   419  C C   . ILE A 1 54  ? 27.007 23.263 22.182  1.00 17.25 ? 926  ILE A C   1 
ATOM   420  O O   . ILE A 1 54  ? 26.324 22.652 23.023  1.00 19.27 ? 926  ILE A O   1 
ATOM   421  C CB  . ILE A 1 54  ? 25.837 25.393 22.322  1.00 22.20 ? 926  ILE A CB  1 
ATOM   422  C CG1 . ILE A 1 54  ? 25.105 26.525 21.617  1.00 24.20 ? 926  ILE A CG1 1 
ATOM   423  C CG2 . ILE A 1 54  ? 26.962 25.928 23.196  1.00 19.57 ? 926  ILE A CG2 1 
ATOM   424  C CD1 . ILE A 1 54  ? 25.855 27.150 20.494  1.00 23.91 ? 926  ILE A CD1 1 
ATOM   425  N N   . VAL A 1 55  ? 28.293 22.976 21.980  1.00 17.32 ? 927  VAL A N   1 
ATOM   426  C CA  . VAL A 1 55  ? 28.874 21.831 22.678  1.00 17.77 ? 927  VAL A CA  1 
ATOM   427  C C   . VAL A 1 55  ? 29.779 22.231 23.855  1.00 16.37 ? 927  VAL A C   1 
ATOM   428  O O   . VAL A 1 55  ? 30.120 21.376 24.665  1.00 21.03 ? 927  VAL A O   1 
ATOM   429  C CB  . VAL A 1 55  ? 29.651 20.886 21.754  1.00 24.62 ? 927  VAL A CB  1 
ATOM   430  C CG1 . VAL A 1 55  ? 28.715 20.259 20.725  1.00 31.26 ? 927  VAL A CG1 1 
ATOM   431  C CG2 . VAL A 1 55  ? 30.779 21.635 21.075  1.00 22.99 ? 927  VAL A CG2 1 
ATOM   432  N N   . SER A 1 56  ? 30.096 23.517 23.963  1.00 16.79 ? 928  SER A N   1 
ATOM   433  C CA  . SER A 1 56  ? 30.889 24.036 25.092  1.00 18.63 ? 928  SER A CA  1 
ATOM   434  C C   . SER A 1 56  ? 30.067 24.294 26.355  1.00 18.12 ? 928  SER A C   1 
ATOM   435  O O   . SER A 1 56  ? 30.610 24.555 27.424  1.00 18.52 ? 928  SER A O   1 
ATOM   436  C CB  . SER A 1 56  ? 31.613 25.329 24.658  1.00 20.93 ? 928  SER A CB  1 
ATOM   437  O OG  . SER A 1 56  ? 30.676 26.261 24.129  1.00 20.96 ? 928  SER A OG  1 
ATOM   438  N N   . ARG A 1 57  ? 28.744 24.246 26.225  1.00 16.44 ? 929  ARG A N   1 
ATOM   439  C CA  . ARG A 1 57  ? 27.832 24.440 27.358  1.00 16.20 ? 929  ARG A CA  1 
ATOM   440  C C   . ARG A 1 57  ? 26.647 23.576 27.019  1.00 18.80 ? 929  ARG A C   1 
ATOM   441  O O   . ARG A 1 57  ? 26.161 23.644 25.890  1.00 17.58 ? 929  ARG A O   1 
ATOM   442  C CB  . ARG A 1 57  ? 27.325 25.889 27.436  1.00 15.34 ? 929  ARG A CB  1 
ATOM   443  C CG  . ARG A 1 57  ? 26.358 26.173 28.571  1.00 17.32 ? 929  ARG A CG  1 
ATOM   444  C CD  . ARG A 1 57  ? 25.857 27.612 28.522  1.00 19.61 ? 929  ARG A CD  1 
ATOM   445  N NE  . ARG A 1 57  ? 24.852 27.880 29.550  1.00 17.55 ? 929  ARG A NE  1 
ATOM   446  C CZ  . ARG A 1 57  ? 25.111 28.405 30.740  1.00 20.11 ? 929  ARG A CZ  1 
ATOM   447  N NH1 . ARG A 1 57  ? 26.356 28.734 31.083  1.00 22.82 ? 929  ARG A NH1 1 
ATOM   448  N NH2 . ARG A 1 57  ? 24.108 28.601 31.591  1.00 21.12 ? 929  ARG A NH2 1 
ATOM   449  N N   . ASP A 1 58  ? 26.166 22.801 27.983  1.00 15.96 ? 930  ASP A N   1 
ATOM   450  C CA  . ASP A 1 58  ? 24.989 21.969 27.754  1.00 15.09 ? 930  ASP A CA  1 
ATOM   451  C C   . ASP A 1 58  ? 23.761 22.846 27.980  1.00 16.82 ? 930  ASP A C   1 
ATOM   452  O O   . ASP A 1 58  ? 23.293 22.991 29.130  1.00 17.15 ? 930  ASP A O   1 
ATOM   453  C CB  . ASP A 1 58  ? 25.007 20.794 28.718  1.00 17.10 ? 930  ASP A CB  1 
ATOM   454  C CG  . ASP A 1 58  ? 24.012 19.731 28.347  1.00 23.38 ? 930  ASP A CG  1 
ATOM   455  O OD1 . ASP A 1 58  ? 22.880 20.081 27.914  1.00 20.56 ? 930  ASP A OD1 1 
ATOM   456  O OD2 . ASP A 1 58  ? 24.385 18.544 28.483  1.00 29.83 ? 930  ASP A OD2 1 
ATOM   457  N N   . CYS A 1 59  ? 23.281 23.459 26.900  1.00 16.35 ? 931  CYS A N   1 
ATOM   458  C CA  . CYS A 1 59  ? 22.268 24.510 27.026  1.00 17.73 ? 931  CYS A CA  1 
ATOM   459  C C   . CYS A 1 59  ? 20.878 23.952 27.325  1.00 16.77 ? 931  CYS A C   1 
ATOM   460  O O   . CYS A 1 59  ? 20.071 24.629 27.961  1.00 19.65 ? 931  CYS A O   1 
ATOM   461  C CB  . CYS A 1 59  ? 22.239 25.406 25.785  1.00 17.12 ? 931  CYS A CB  1 
ATOM   462  S SG  . CYS A 1 59  ? 23.804 26.309 25.549  1.00 18.88 ? 931  CYS A SG  1 
ATOM   463  N N   . LEU A 1 60  ? 20.605 22.723 26.904  1.00 16.45 ? 932  LEU A N   1 
ATOM   464  C CA  . LEU A 1 60  ? 19.316 22.130 27.306  1.00 17.51 ? 932  LEU A CA  1 
ATOM   465  C C   . LEU A 1 60  ? 19.224 21.888 28.816  1.00 18.17 ? 932  LEU A C   1 
ATOM   466  O O   . LEU A 1 60  ? 18.119 21.905 29.392  1.00 20.49 ? 932  LEU A O   1 
ATOM   467  C CB  . LEU A 1 60  ? 19.063 20.829 26.557  1.00 19.18 ? 932  LEU A CB  1 
ATOM   468  C CG  . LEU A 1 60  ? 18.846 20.975 25.041  1.00 26.68 ? 932  LEU A CG  1 
ATOM   469  C CD1 . LEU A 1 60  ? 18.440 19.632 24.459  1.00 29.44 ? 932  LEU A CD1 1 
ATOM   470  C CD2 . LEU A 1 60  ? 17.815 22.055 24.715  1.00 30.30 ? 932  LEU A CD2 1 
ATOM   471  N N   . LYS A 1 61  ? 20.362 21.639 29.467  1.00 17.30 ? 933  LYS A N   1 
ATOM   472  C CA  . LYS A 1 61  ? 20.363 21.388 30.898  1.00 17.29 ? 933  LYS A CA  1 
ATOM   473  C C   . LYS A 1 61  ? 20.555 22.667 31.709  1.00 16.26 ? 933  LYS A C   1 
ATOM   474  O O   . LYS A 1 61  ? 19.952 22.808 32.793  1.00 19.68 ? 933  LYS A O   1 
ATOM   475  C CB  . LYS A 1 61  ? 21.486 20.395 31.259  1.00 18.23 ? 933  LYS A CB  1 
ATOM   476  C CG  . LYS A 1 61  ? 21.181 18.952 30.915  1.00 18.07 ? 933  LYS A CG  1 
ATOM   477  C CD  . LYS A 1 61  ? 22.305 18.027 31.381  1.00 18.28 ? 933  LYS A CD  1 
ATOM   478  C CE  . LYS A 1 61  ? 21.950 16.562 31.214  1.00 20.48 ? 933  LYS A CE  1 
ATOM   479  N NZ  . LYS A 1 61  ? 23.070 15.620 31.644  1.00 22.93 ? 933  LYS A NZ  1 
ATOM   480  N N   . LEU A 1 62  ? 21.400 23.581 31.221  1.00 16.86 ? 934  LEU A N   1 
ATOM   481  C CA  . LEU A 1 62  ? 21.819 24.757 32.011  1.00 14.45 ? 934  LEU A CA  1 
ATOM   482  C C   . LEU A 1 62  ? 21.297 26.099 31.508  1.00 19.12 ? 934  LEU A C   1 
ATOM   483  O O   . LEU A 1 62  ? 21.589 27.138 32.113  1.00 23.37 ? 934  LEU A O   1 
ATOM   484  C CB  . LEU A 1 62  ? 23.362 24.819 32.102  1.00 17.09 ? 934  LEU A CB  1 
ATOM   485  C CG  . LEU A 1 62  ? 24.007 23.574 32.699  1.00 15.23 ? 934  LEU A CG  1 
ATOM   486  C CD1 . LEU A 1 62  ? 25.538 23.716 32.755  1.00 17.39 ? 934  LEU A CD1 1 
ATOM   487  C CD2 . LEU A 1 62  ? 23.451 23.314 34.100  1.00 18.38 ? 934  LEU A CD2 1 
ATOM   488  N N   . GLY A 1 63  ? 20.513 26.075 30.437  1.00 19.37 ? 935  GLY A N   1 
ATOM   489  C CA  . GLY A 1 63  ? 20.023 27.300 29.816  1.00 23.38 ? 935  GLY A CA  1 
ATOM   490  C C   . GLY A 1 63  ? 21.049 27.904 28.875  1.00 24.09 ? 935  GLY A C   1 
ATOM   491  O O   . GLY A 1 63  ? 22.167 27.401 28.772  1.00 19.97 ? 935  GLY A O   1 
ATOM   492  N N   . PRO A 1 64  ? 20.684 28.992 28.185  1.00 21.40 ? 936  PRO A N   1 
ATOM   493  C CA  . PRO A 1 64  ? 21.574 29.583 27.178  1.00 19.95 ? 936  PRO A CA  1 
ATOM   494  C C   . PRO A 1 64  ? 22.848 30.151 27.765  1.00 21.40 ? 936  PRO A C   1 
ATOM   495  O O   . PRO A 1 64  ? 22.926 30.443 28.962  1.00 23.77 ? 936  PRO A O   1 
ATOM   496  C CB  . PRO A 1 64  ? 20.749 30.734 26.603  1.00 21.37 ? 936  PRO A CB  1 
ATOM   497  C CG  . PRO A 1 64  ? 19.686 31.007 27.648  1.00 25.90 ? 936  PRO A CG  1 
ATOM   498  C CD  . PRO A 1 64  ? 19.385 29.678 28.262  1.00 23.53 ? 936  PRO A CD  1 
ATOM   499  N N   . PRO A 1 65  ? 23.865 30.318 26.906  1.00 21.40 ? 937  PRO A N   1 
ATOM   500  C CA  . PRO A 1 65  ? 25.088 31.021 27.304  1.00 21.65 ? 937  PRO A CA  1 
ATOM   501  C C   . PRO A 1 65  ? 24.741 32.473 27.604  1.00 23.31 ? 937  PRO A C   1 
ATOM   502  O O   . PRO A 1 65  ? 23.632 32.934 27.288  1.00 25.16 ? 937  PRO A O   1 
ATOM   503  C CB  . PRO A 1 65  ? 25.960 30.964 26.037  1.00 22.52 ? 937  PRO A CB  1 
ATOM   504  C CG  . PRO A 1 65  ? 25.313 29.955 25.121  1.00 21.19 ? 937  PRO A CG  1 
ATOM   505  C CD  . PRO A 1 65  ? 23.829 30.061 25.459  1.00 20.80 ? 937  PRO A CD  1 
ATOM   506  N N   . ALA A 1 66  ? 25.675 33.201 28.201  1.00 25.97 ? 938  ALA A N   1 
ATOM   507  C CA  . ALA A 1 66  ? 25.477 34.635 28.362  1.00 26.70 ? 938  ALA A CA  1 
ATOM   508  C C   . ALA A 1 66  ? 25.651 35.309 27.006  1.00 26.45 ? 938  ALA A C   1 
ATOM   509  O O   . ALA A 1 66  ? 26.370 34.804 26.135  1.00 29.50 ? 938  ALA A O   1 
ATOM   510  C CB  . ALA A 1 66  ? 26.469 35.203 29.370  1.00 29.91 ? 938  ALA A CB  1 
ATOM   511  N N   . GLU A 1 67  ? 24.999 36.445 26.812  1.00 29.44 ? 939  GLU A N   1 
ATOM   512  C CA  . GLU A 1 67  ? 25.156 37.154 25.552  1.00 36.45 ? 939  GLU A CA  1 
ATOM   513  C C   . GLU A 1 67  ? 26.593 37.648 25.428  1.00 34.25 ? 939  GLU A C   1 
ATOM   514  O O   . GLU A 1 67  ? 27.167 38.182 26.374  1.00 36.03 ? 939  GLU A O   1 
ATOM   515  C CB  . GLU A 1 67  ? 24.136 38.286 25.425  1.00 36.51 ? 939  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 67  ? 22.695 37.780 25.462  1.00 42.35 ? 939  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 67  ? 21.702 38.775 24.903  1.00 55.90 ? 939  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 67  ? 20.804 39.208 25.651  1.00 59.20 ? 939  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 67  ? 21.820 39.122 23.711  1.00 63.98 ? 939  GLU A OE2 1 
ATOM   520  N N   . GLY A 1 68  ? 27.191 37.409 24.268  1.00 37.39 ? 940  GLY A N   1 
ATOM   521  C CA  . GLY A 1 68  ? 28.580 37.751 24.046  1.00 35.85 ? 940  GLY A CA  1 
ATOM   522  C C   . GLY A 1 68  ? 29.539 36.627 24.392  1.00 34.84 ? 940  GLY A C   1 
ATOM   523  O O   . GLY A 1 68  ? 30.734 36.723 24.118  1.00 36.95 ? 940  GLY A O   1 
ATOM   524  N N   . GLU A 1 69  ? 29.017 35.546 24.969  1.00 29.66 ? 941  GLU A N   1 
ATOM   525  C CA  . GLU A 1 69  ? 29.887 34.468 25.430  1.00 30.98 ? 941  GLU A CA  1 
ATOM   526  C C   . GLU A 1 69  ? 30.469 33.639 24.289  1.00 28.37 ? 941  GLU A C   1 
ATOM   527  O O   . GLU A 1 69  ? 29.788 33.362 23.301  1.00 28.21 ? 941  GLU A O   1 
ATOM   528  C CB  . GLU A 1 69  ? 29.161 33.570 26.423  1.00 34.78 ? 941  GLU A CB  1 
ATOM   529  C CG  . GLU A 1 69  ? 30.028 32.439 26.930  1.00 30.47 ? 941  GLU A CG  1 
ATOM   530  C CD  . GLU A 1 69  ? 29.387 31.685 28.086  1.00 40.45 ? 941  GLU A CD  1 
ATOM   531  O OE1 . GLU A 1 69  ? 28.232 31.995 28.430  1.00 33.68 ? 941  GLU A OE1 1 
ATOM   532  O OE2 . GLU A 1 69  ? 30.049 30.795 28.664  1.00 46.26 ? 941  GLU A OE2 1 
ATOM   533  N N   . VAL A 1 70  ? 31.749 33.290 24.413  1.00 29.86 ? 942  VAL A N   1 
ATOM   534  C CA  . VAL A 1 70  ? 32.408 32.412 23.463  1.00 25.21 ? 942  VAL A CA  1 
ATOM   535  C C   . VAL A 1 70  ? 31.856 30.998 23.564  1.00 29.46 ? 942  VAL A C   1 
ATOM   536  O O   . VAL A 1 70  ? 31.752 30.436 24.659  1.00 28.37 ? 942  VAL A O   1 
ATOM   537  C CB  . VAL A 1 70  ? 33.934 32.393 23.705  1.00 31.03 ? 942  VAL A CB  1 
ATOM   538  C CG1 . VAL A 1 70  ? 34.591 31.277 22.893  1.00 33.72 ? 942  VAL A CG1 1 
ATOM   539  C CG2 . VAL A 1 70  ? 34.521 33.741 23.352  1.00 34.40 ? 942  VAL A CG2 1 
ATOM   540  N N   . VAL A 1 71  ? 31.444 30.438 22.428  1.00 24.15 ? 943  VAL A N   1 
ATOM   541  C CA  . VAL A 1 71  ? 30.921 29.079 22.412  1.00 22.34 ? 943  VAL A CA  1 
ATOM   542  C C   . VAL A 1 71  ? 31.577 28.276 21.310  1.00 23.97 ? 943  VAL A C   1 
ATOM   543  O O   . VAL A 1 71  ? 32.175 28.845 20.392  1.00 26.38 ? 943  VAL A O   1 
ATOM   544  C CB  . VAL A 1 71  ? 29.400 29.041 22.181  1.00 20.41 ? 943  VAL A CB  1 
ATOM   545  C CG1 . VAL A 1 71  ? 28.641 29.680 23.358  1.00 24.75 ? 943  VAL A CG1 1 
ATOM   546  C CG2 . VAL A 1 71  ? 29.022 29.698 20.840  1.00 25.70 ? 943  VAL A CG2 1 
ATOM   547  N N   . GLN A 1 72  ? 31.517 26.957 21.442  1.00 19.27 ? 944  GLN A N   1 
ATOM   548  C CA  . GLN A 1 72  ? 31.916 26.059 20.359  1.00 22.14 ? 944  GLN A CA  1 
ATOM   549  C C   . GLN A 1 72  ? 30.642 25.438 19.803  1.00 21.06 ? 944  GLN A C   1 
ATOM   550  O O   . GLN A 1 72  ? 29.782 24.955 20.567  1.00 19.61 ? 944  GLN A O   1 
ATOM   551  C CB  . GLN A 1 72  ? 32.864 24.951 20.828  1.00 23.93 ? 944  GLN A CB  1 
ATOM   552  C CG  . GLN A 1 72  ? 34.057 25.426 21.639  1.00 33.69 ? 944  GLN A CG  1 
ATOM   553  N N   . VAL A 1 73  ? 30.524 25.463 18.480  1.00 20.54 ? 945  VAL A N   1 
ATOM   554  C CA  . VAL A 1 73  ? 29.337 24.996 17.778  1.00 20.89 ? 945  VAL A CA  1 
ATOM   555  C C   . VAL A 1 73  ? 29.660 23.783 16.912  1.00 26.87 ? 945  VAL A C   1 
ATOM   556  O O   . VAL A 1 73  ? 30.635 23.805 16.129  1.00 23.36 ? 945  VAL A O   1 
ATOM   557  C CB  . VAL A 1 73  ? 28.769 26.108 16.862  1.00 19.24 ? 945  VAL A CB  1 
ATOM   558  C CG1 . VAL A 1 73  ? 27.529 25.624 16.121  1.00 26.08 ? 945  VAL A CG1 1 
ATOM   559  C CG2 . VAL A 1 73  ? 28.493 27.378 17.666  1.00 27.55 ? 945  VAL A CG2 1 
ATOM   560  N N   . LYS A 1 74  ? 28.856 22.727 17.024  1.00 21.78 ? 946  LYS A N   1 
ATOM   561  C CA  . LYS A 1 74  ? 29.045 21.571 16.151  1.00 23.73 ? 946  LYS A CA  1 
ATOM   562  C C   . LYS A 1 74  ? 28.164 21.617 14.909  1.00 22.94 ? 946  LYS A C   1 
ATOM   563  O O   . LYS A 1 74  ? 26.967 21.945 14.953  1.00 23.17 ? 946  LYS A O   1 
ATOM   564  C CB  . LYS A 1 74  ? 28.861 20.232 16.872  1.00 28.82 ? 946  LYS A CB  1 
ATOM   565  C CG  . LYS A 1 74  ? 27.436 19.911 17.281  1.00 39.75 ? 946  LYS A CG  1 
ATOM   566  C CD  . LYS A 1 74  ? 27.341 18.487 17.836  1.00 47.43 ? 946  LYS A CD  1 
ATOM   567  C CE  . LYS A 1 74  ? 26.231 18.358 18.887  1.00 49.04 ? 946  LYS A CE  1 
ATOM   568  N NZ  . LYS A 1 74  ? 24.869 18.408 18.298  1.00 51.19 ? 946  LYS A NZ  1 
ATOM   569  N N   . TRP A 1 75  ? 28.786 21.270 13.791  1.00 23.57 ? 947  TRP A N   1 
ATOM   570  C CA  . TRP A 1 75  ? 28.092 21.184 12.522  1.00 22.38 ? 947  TRP A CA  1 
ATOM   571  C C   . TRP A 1 75  ? 27.717 19.706 12.346  1.00 27.47 ? 947  TRP A C   1 
ATOM   572  O O   . TRP A 1 75  ? 28.330 18.846 12.962  1.00 27.31 ? 947  TRP A O   1 
ATOM   573  C CB  . TRP A 1 75  ? 29.054 21.663 11.415  1.00 24.04 ? 947  TRP A CB  1 
ATOM   574  C CG  . TRP A 1 75  ? 28.391 21.959 10.125  1.00 26.38 ? 947  TRP A CG  1 
ATOM   575  C CD1 . TRP A 1 75  ? 28.531 21.282 8.946   1.00 26.58 ? 947  TRP A CD1 1 
ATOM   576  C CD2 . TRP A 1 75  ? 27.424 22.994 9.883   1.00 30.98 ? 947  TRP A CD2 1 
ATOM   577  N NE1 . TRP A 1 75  ? 27.731 21.851 7.975   1.00 30.21 ? 947  TRP A NE1 1 
ATOM   578  C CE2 . TRP A 1 75  ? 27.048 22.902 8.527   1.00 35.72 ? 947  TRP A CE2 1 
ATOM   579  C CE3 . TRP A 1 75  ? 26.866 24.003 10.679  1.00 35.07 ? 947  TRP A CE3 1 
ATOM   580  C CZ2 . TRP A 1 75  ? 26.115 23.773 7.956   1.00 40.06 ? 947  TRP A CZ2 1 
ATOM   581  C CZ3 . TRP A 1 75  ? 25.942 24.864 10.107  1.00 38.57 ? 947  TRP A CZ3 1 
ATOM   582  C CH2 . TRP A 1 75  ? 25.583 24.745 8.761   1.00 39.06 ? 947  TRP A CH2 1 
ATOM   583  N N   . PRO A 1 76  ? 26.714 19.386 11.509  1.00 31.05 ? 948  PRO A N   1 
ATOM   584  C CA  . PRO A 1 76  ? 26.299 17.972 11.532  1.00 29.97 ? 948  PRO A CA  1 
ATOM   585  C C   . PRO A 1 76  ? 27.369 16.947 11.146  1.00 34.50 ? 948  PRO A C   1 
ATOM   586  O O   . PRO A 1 76  ? 27.217 15.778 11.517  1.00 35.01 ? 948  PRO A O   1 
ATOM   587  C CB  . PRO A 1 76  ? 25.131 17.931 10.544  1.00 28.32 ? 948  PRO A CB  1 
ATOM   588  C CG  . PRO A 1 76  ? 24.560 19.322 10.619  1.00 37.05 ? 948  PRO A CG  1 
ATOM   589  C CD  . PRO A 1 76  ? 25.780 20.219 10.737  1.00 35.09 ? 948  PRO A CD  1 
ATOM   590  N N   . ASP A 1 77  ? 28.423 17.350 10.436  1.00 32.00 ? 949  ASP A N   1 
ATOM   591  C CA  . ASP A 1 77  ? 29.476 16.400 10.110  1.00 34.06 ? 949  ASP A CA  1 
ATOM   592  C C   . ASP A 1 77  ? 30.570 16.325 11.175  1.00 29.42 ? 949  ASP A C   1 
ATOM   593  O O   . ASP A 1 77  ? 31.620 15.706 10.962  1.00 32.73 ? 949  ASP A O   1 
ATOM   594  C CB  . ASP A 1 77  ? 30.066 16.687 8.723   1.00 33.82 ? 949  ASP A CB  1 
ATOM   595  C CG  . ASP A 1 77  ? 30.803 18.022 8.652   1.00 30.58 ? 949  ASP A CG  1 
ATOM   596  O OD1 . ASP A 1 77  ? 30.788 18.808 9.627   1.00 30.07 ? 949  ASP A OD1 1 
ATOM   597  O OD2 . ASP A 1 77  ? 31.388 18.294 7.584   1.00 30.16 ? 949  ASP A OD2 1 
ATOM   598  N N   . GLY A 1 78  ? 30.332 16.966 12.320  1.00 29.50 ? 950  GLY A N   1 
ATOM   599  C CA  . GLY A 1 78  ? 31.233 16.851 13.452  1.00 33.37 ? 950  GLY A CA  1 
ATOM   600  C C   . GLY A 1 78  ? 32.258 17.962 13.523  1.00 28.12 ? 950  GLY A C   1 
ATOM   601  O O   . GLY A 1 78  ? 32.981 18.078 14.515  1.00 30.23 ? 950  GLY A O   1 
ATOM   602  N N   . LYS A 1 79  ? 32.358 18.774 12.473  1.00 25.28 ? 951  LYS A N   1 
ATOM   603  C CA  . LYS A 1 79  ? 33.301 19.893 12.511  1.00 25.61 ? 951  LYS A CA  1 
ATOM   604  C C   . LYS A 1 79  ? 32.863 20.869 13.593  1.00 24.56 ? 951  LYS A C   1 
ATOM   605  O O   . LYS A 1 79  ? 31.662 21.143 13.758  1.00 25.27 ? 951  LYS A O   1 
ATOM   606  C CB  . LYS A 1 79  ? 33.370 20.624 11.177  1.00 25.09 ? 951  LYS A CB  1 
ATOM   607  C CG  . LYS A 1 79  ? 34.081 19.835 10.086  1.00 25.77 ? 951  LYS A CG  1 
ATOM   608  C CD  . LYS A 1 79  ? 34.468 20.724 8.900   1.00 27.11 ? 951  LYS A CD  1 
ATOM   609  C CE  . LYS A 1 79  ? 33.414 20.708 7.778   1.00 26.26 ? 951  LYS A CE  1 
ATOM   610  N NZ  . LYS A 1 79  ? 32.068 21.222 8.226   1.00 25.63 ? 951  LYS A NZ  1 
ATOM   611  N N   . LEU A 1 80  ? 33.842 21.415 14.299  1.00 23.92 ? 952  LEU A N   1 
ATOM   612  C CA  . LEU A 1 80  ? 33.583 22.324 15.397  1.00 23.60 ? 952  LEU A CA  1 
ATOM   613  C C   . LEU A 1 80  ? 34.083 23.713 15.048  1.00 22.03 ? 952  LEU A C   1 
ATOM   614  O O   . LEU A 1 80  ? 35.177 23.893 14.447  1.00 23.94 ? 952  LEU A O   1 
ATOM   615  C CB  . LEU A 1 80  ? 34.294 21.833 16.654  1.00 26.10 ? 952  LEU A CB  1 
ATOM   616  C CG  . LEU A 1 80  ? 33.869 20.471 17.201  1.00 29.28 ? 952  LEU A CG  1 
ATOM   617  C CD1 . LEU A 1 80  ? 34.795 20.091 18.379  1.00 32.13 ? 952  LEU A CD1 1 
ATOM   618  C CD2 . LEU A 1 80  ? 32.402 20.503 17.629  1.00 29.50 ? 952  LEU A CD2 1 
ATOM   619  N N   . TYR A 1 81  ? 33.301 24.701 15.460  1.00 21.47 ? 953  TYR A N   1 
ATOM   620  C CA  . TYR A 1 81  ? 33.559 26.095 15.133  1.00 21.70 ? 953  TYR A CA  1 
ATOM   621  C C   . TYR A 1 81  ? 33.457 26.996 16.341  1.00 24.83 ? 953  TYR A C   1 
ATOM   622  O O   . TYR A 1 81  ? 32.548 26.844 17.162  1.00 27.97 ? 953  TYR A O   1 
ATOM   623  C CB  . TYR A 1 81  ? 32.552 26.573 14.098  1.00 24.38 ? 953  TYR A CB  1 
ATOM   624  C CG  . TYR A 1 81  ? 32.640 25.834 12.783  1.00 23.42 ? 953  TYR A CG  1 
ATOM   625  C CD1 . TYR A 1 81  ? 33.434 26.317 11.749  1.00 26.21 ? 953  TYR A CD1 1 
ATOM   626  C CD2 . TYR A 1 81  ? 31.946 24.643 12.593  1.00 22.62 ? 953  TYR A CD2 1 
ATOM   627  C CE1 . TYR A 1 81  ? 33.517 25.641 10.541  1.00 27.50 ? 953  TYR A CE1 1 
ATOM   628  C CE2 . TYR A 1 81  ? 32.018 23.958 11.392  1.00 23.41 ? 953  TYR A CE2 1 
ATOM   629  C CZ  . TYR A 1 81  ? 32.818 24.458 10.381  1.00 26.25 ? 953  TYR A CZ  1 
ATOM   630  O OH  . TYR A 1 81  ? 32.889 23.775 9.200   1.00 27.33 ? 953  TYR A OH  1 
ATOM   631  N N   . GLY A 1 82  ? 34.362 27.963 16.431  1.00 23.89 ? 954  GLY A N   1 
ATOM   632  C CA  . GLY A 1 82  ? 34.252 28.979 17.459  1.00 24.02 ? 954  GLY A CA  1 
ATOM   633  C C   . GLY A 1 82  ? 33.237 30.026 17.034  1.00 27.57 ? 954  GLY A C   1 
ATOM   634  O O   . GLY A 1 82  ? 33.112 30.370 15.850  1.00 29.53 ? 954  GLY A O   1 
ATOM   635  N N   . ALA A 1 83  ? 32.493 30.531 18.005  1.00 25.61 ? 955  ALA A N   1 
ATOM   636  C CA  . ALA A 1 83  ? 31.492 31.553 17.745  1.00 24.91 ? 955  ALA A CA  1 
ATOM   637  C C   . ALA A 1 83  ? 31.257 32.327 19.034  1.00 27.80 ? 955  ALA A C   1 
ATOM   638  O O   . ALA A 1 83  ? 31.873 32.045 20.065  1.00 31.02 ? 955  ALA A O   1 
ATOM   639  C CB  . ALA A 1 83  ? 30.183 30.919 17.252  1.00 28.78 ? 955  ALA A CB  1 
ATOM   640  N N   . LYS A 1 84  ? 30.394 33.331 18.957  1.00 29.15 ? 956  LYS A N   1 
ATOM   641  C CA  . LYS A 1 84  ? 29.931 34.026 20.142  1.00 30.37 ? 956  LYS A CA  1 
ATOM   642  C C   . LYS A 1 84  ? 28.414 34.022 20.125  1.00 25.95 ? 956  LYS A C   1 
ATOM   643  O O   . LYS A 1 84  ? 27.795 34.251 19.078  1.00 29.96 ? 956  LYS A O   1 
ATOM   644  C CB  . LYS A 1 84  ? 30.455 35.460 20.174  1.00 36.01 ? 956  LYS A CB  1 
ATOM   645  C CG  . LYS A 1 84  ? 31.774 35.611 20.922  1.00 42.15 ? 956  LYS A CG  1 
ATOM   646  C CD  . LYS A 1 84  ? 32.395 36.976 20.693  1.00 42.88 ? 956  LYS A CD  1 
ATOM   647  C CE  . LYS A 1 84  ? 31.590 38.111 21.310  1.00 42.77 ? 956  LYS A CE  1 
ATOM   648  N NZ  . LYS A 1 84  ? 32.184 39.449 20.957  1.00 53.06 ? 956  LYS A NZ  1 
ATOM   649  N N   . TYR A 1 85  ? 27.822 33.753 21.284  1.00 26.28 ? 957  TYR A N   1 
ATOM   650  C CA  . TYR A 1 85  ? 26.372 33.695 21.411  1.00 25.38 ? 957  TYR A CA  1 
ATOM   651  C C   . TYR A 1 85  ? 25.769 35.079 21.583  1.00 28.94 ? 957  TYR A C   1 
ATOM   652  O O   . TYR A 1 85  ? 26.219 35.875 22.415  1.00 29.63 ? 957  TYR A O   1 
ATOM   653  C CB  . TYR A 1 85  ? 25.975 32.814 22.596  1.00 26.01 ? 957  TYR A CB  1 
ATOM   654  C CG  . TYR A 1 85  ? 24.494 32.860 22.925  1.00 22.83 ? 957  TYR A CG  1 
ATOM   655  C CD1 . TYR A 1 85  ? 23.567 32.121 22.183  1.00 25.70 ? 957  TYR A CD1 1 
ATOM   656  C CD2 . TYR A 1 85  ? 24.015 33.648 23.970  1.00 25.80 ? 957  TYR A CD2 1 
ATOM   657  C CE1 . TYR A 1 85  ? 22.201 32.153 22.479  1.00 24.32 ? 957  TYR A CE1 1 
ATOM   658  C CE2 . TYR A 1 85  ? 22.642 33.687 24.276  1.00 25.54 ? 957  TYR A CE2 1 
ATOM   659  C CZ  . TYR A 1 85  ? 21.747 32.933 23.523  1.00 24.42 ? 957  TYR A CZ  1 
ATOM   660  O OH  . TYR A 1 85  ? 20.392 32.967 23.808  1.00 24.13 ? 957  TYR A OH  1 
ATOM   661  N N   . PHE A 1 86  ? 24.744 35.384 20.794  1.00 27.78 ? 958  PHE A N   1 
ATOM   662  C CA  . PHE A 1 86  ? 24.180 36.723 20.878  1.00 31.27 ? 958  PHE A CA  1 
ATOM   663  C C   . PHE A 1 86  ? 22.684 36.819 21.084  1.00 27.62 ? 958  PHE A C   1 
ATOM   664  O O   . PHE A 1 86  ? 22.116 37.896 20.993  1.00 40.74 ? 958  PHE A O   1 
ATOM   665  C CB  . PHE A 1 86  ? 24.654 37.568 19.710  1.00 39.31 ? 958  PHE A CB  1 
ATOM   666  C CG  . PHE A 1 86  ? 26.097 37.958 19.830  1.00 44.46 ? 958  PHE A CG  1 
ATOM   667  C CD1 . PHE A 1 86  ? 26.580 38.443 21.034  1.00 53.98 ? 958  PHE A CD1 1 
ATOM   668  C CD2 . PHE A 1 86  ? 26.977 37.780 18.783  1.00 52.25 ? 958  PHE A CD2 1 
ATOM   669  C CE1 . PHE A 1 86  ? 27.912 38.806 21.180  1.00 54.53 ? 958  PHE A CE1 1 
ATOM   670  C CE2 . PHE A 1 86  ? 28.307 38.127 18.922  1.00 55.72 ? 958  PHE A CE2 1 
ATOM   671  C CZ  . PHE A 1 86  ? 28.774 38.643 20.126  1.00 56.30 ? 958  PHE A CZ  1 
ATOM   672  N N   . GLY A 1 87  ? 22.046 35.702 21.394  1.00 30.87 ? 959  GLY A N   1 
ATOM   673  C CA  . GLY A 1 87  ? 20.643 35.768 21.734  1.00 27.02 ? 959  GLY A CA  1 
ATOM   674  C C   . GLY A 1 87  ? 19.874 34.632 21.107  1.00 25.98 ? 959  GLY A C   1 
ATOM   675  O O   . GLY A 1 87  ? 20.467 33.750 20.484  1.00 25.82 ? 959  GLY A O   1 
ATOM   676  N N   . SER A 1 88  ? 18.553 34.666 21.256  1.00 24.11 ? 960  SER A N   1 
ATOM   677  C CA  . SER A 1 88  ? 17.719 33.579 20.770  1.00 21.89 ? 960  SER A CA  1 
ATOM   678  C C   . SER A 1 88  ? 16.459 34.122 20.116  1.00 26.07 ? 960  SER A C   1 
ATOM   679  O O   . SER A 1 88  ? 16.101 35.292 20.286  1.00 26.17 ? 960  SER A O   1 
ATOM   680  C CB  . SER A 1 88  ? 17.370 32.633 21.917  1.00 25.54 ? 960  SER A CB  1 
ATOM   681  O OG  . SER A 1 88  ? 16.530 33.266 22.865  1.00 28.15 ? 960  SER A OG  1 
ATOM   682  N N   . ASN A 1 89  ? 15.806 33.275 19.336  1.00 24.21 ? 961  ASN A N   1 
ATOM   683  C CA  . ASN A 1 89  ? 14.505 33.617 18.788  1.00 25.27 ? 961  ASN A CA  1 
ATOM   684  C C   . ASN A 1 89  ? 13.648 32.372 18.779  1.00 23.93 ? 961  ASN A C   1 
ATOM   685  O O   . ASN A 1 89  ? 14.142 31.261 19.000  1.00 24.39 ? 961  ASN A O   1 
ATOM   686  C CB  . ASN A 1 89  ? 14.624 34.191 17.371  1.00 28.32 ? 961  ASN A CB  1 
ATOM   687  C CG  . ASN A 1 89  ? 15.245 33.208 16.393  1.00 28.65 ? 961  ASN A CG  1 
ATOM   688  O OD1 . ASN A 1 89  ? 14.598 32.238 15.980  1.00 29.36 ? 961  ASN A OD1 1 
ATOM   689  N ND2 . ASN A 1 89  ? 16.497 33.454 16.009  1.00 30.04 ? 961  ASN A ND2 1 
ATOM   690  N N   . ILE A 1 90  ? 12.355 32.551 18.535  1.00 23.38 ? 962  ILE A N   1 
ATOM   691  C CA  . ILE A 1 90  ? 11.478 31.412 18.370  1.00 29.75 ? 962  ILE A CA  1 
ATOM   692  C C   . ILE A 1 90  ? 11.045 31.390 16.915  1.00 27.04 ? 962  ILE A C   1 
ATOM   693  O O   . ILE A 1 90  ? 10.586 32.412 16.381  1.00 28.62 ? 962  ILE A O   1 
ATOM   694  C CB  . ILE A 1 90  ? 10.245 31.520 19.281  1.00 28.06 ? 962  ILE A CB  1 
ATOM   695  C CG1 . ILE A 1 90  ? 10.678 31.480 20.752  1.00 34.06 ? 962  ILE A CG1 1 
ATOM   696  C CG2 . ILE A 1 90  ? 9.230  30.423 18.933  1.00 28.20 ? 962  ILE A CG2 1 
ATOM   697  C CD1 . ILE A 1 90  ? 9.530  31.708 21.727  1.00 41.39 ? 962  ILE A CD1 1 
ATOM   698  N N   . ALA A 1 91  ? 11.234 30.249 16.259  1.00 23.16 ? 963  ALA A N   1 
ATOM   699  C CA  . ALA A 1 91  ? 10.807 30.082 14.879  1.00 22.89 ? 963  ALA A CA  1 
ATOM   700  C C   . ALA A 1 91  ? 10.169 28.718 14.765  1.00 19.87 ? 963  ALA A C   1 
ATOM   701  O O   . ALA A 1 91  ? 9.704  28.170 15.766  1.00 25.94 ? 963  ALA A O   1 
ATOM   702  C CB  . ALA A 1 91  ? 11.974 30.233 13.902  1.00 31.68 ? 963  ALA A CB  1 
ATOM   703  N N   . HIS A 1 92  ? 10.073 28.192 13.558  1.00 23.92 ? 964  HIS A N   1 
ATOM   704  C CA  . HIS A 1 92  ? 9.353  26.943 13.391  1.00 24.48 ? 964  HIS A CA  1 
ATOM   705  C C   . HIS A 1 92  ? 10.210 25.800 12.905  1.00 27.57 ? 964  HIS A C   1 
ATOM   706  O O   . HIS A 1 92  ? 11.293 25.997 12.342  1.00 29.33 ? 964  HIS A O   1 
ATOM   707  C CB  . HIS A 1 92  ? 8.141  27.133 12.484  1.00 30.97 ? 964  HIS A CB  1 
ATOM   708  C CG  . HIS A 1 92  ? 7.153  28.120 13.015  1.00 35.20 ? 964  HIS A CG  1 
ATOM   709  N ND1 . HIS A 1 92  ? 7.116  29.430 12.592  1.00 46.50 ? 964  HIS A ND1 1 
ATOM   710  C CD2 . HIS A 1 92  ? 6.187  27.996 13.955  1.00 33.47 ? 964  HIS A CD2 1 
ATOM   711  C CE1 . HIS A 1 92  ? 6.155  30.068 13.237  1.00 51.28 ? 964  HIS A CE1 1 
ATOM   712  N NE2 . HIS A 1 92  ? 5.577  29.221 14.071  1.00 47.42 ? 964  HIS A NE2 1 
ATOM   713  N N   . MET A 1 93  ? 9.750  24.600 13.206  1.00 20.67 ? 965  MET A N   1 
ATOM   714  C CA  . MET A 1 93  ? 10.266 23.398 12.584  1.00 19.98 ? 965  MET A CA  1 
ATOM   715  C C   . MET A 1 93  ? 9.135  22.718 11.845  1.00 20.68 ? 965  MET A C   1 
ATOM   716  O O   . MET A 1 93  ? 7.963  22.822 12.236  1.00 20.62 ? 965  MET A O   1 
ATOM   717  C CB  . MET A 1 93  ? 10.847 22.447 13.632  1.00 22.05 ? 965  MET A CB  1 
ATOM   718  C CG  . MET A 1 93  ? 12.200 22.918 14.262  1.00 23.66 ? 965  MET A CG  1 
ATOM   719  S SD  . MET A 1 93  ? 13.548 22.895 13.046  1.00 23.14 ? 965  MET A SD  1 
ATOM   720  C CE  . MET A 1 93  ? 13.739 21.138 12.789  1.00 24.34 ? 965  MET A CE  1 
ATOM   721  N N   . TYR A 1 94  ? 9.465  22.020 10.772  1.00 15.88 ? 966  TYR A N   1 
ATOM   722  C CA  . TYR A 1 94  ? 8.467  21.411 9.914   1.00 16.98 ? 966  TYR A CA  1 
ATOM   723  C C   . TYR A 1 94  ? 8.693  19.917 9.901   1.00 17.74 ? 966  TYR A C   1 
ATOM   724  O O   . TYR A 1 94  ? 9.767  19.455 9.463   1.00 18.27 ? 966  TYR A O   1 
ATOM   725  C CB  . TYR A 1 94  ? 8.594  21.968 8.484   1.00 21.75 ? 966  TYR A CB  1 
ATOM   726  C CG  . TYR A 1 94  ? 8.336  23.454 8.445   1.00 21.62 ? 966  TYR A CG  1 
ATOM   727  C CD1 . TYR A 1 94  ? 7.076  23.945 8.084   1.00 19.92 ? 966  TYR A CD1 1 
ATOM   728  C CD2 . TYR A 1 94  ? 9.326  24.364 8.802   1.00 21.43 ? 966  TYR A CD2 1 
ATOM   729  C CE1 . TYR A 1 94  ? 6.809  25.300 8.092   1.00 24.15 ? 966  TYR A CE1 1 
ATOM   730  C CE2 . TYR A 1 94  ? 9.066  25.736 8.808   1.00 24.18 ? 966  TYR A CE2 1 
ATOM   731  C CZ  . TYR A 1 94  ? 7.805  26.192 8.452   1.00 26.12 ? 966  TYR A CZ  1 
ATOM   732  O OH  . TYR A 1 94  ? 7.538  27.542 8.453   1.00 29.06 ? 966  TYR A OH  1 
ATOM   733  N N   . GLN A 1 95  ? 7.726  19.167 10.419  1.00 16.55 ? 967  GLN A N   1 
ATOM   734  C CA  . GLN A 1 95  ? 7.835  17.718 10.408  1.00 15.95 ? 967  GLN A CA  1 
ATOM   735  C C   . GLN A 1 95  ? 7.411  17.264 9.034   1.00 17.44 ? 967  GLN A C   1 
ATOM   736  O O   . GLN A 1 95  ? 6.271  17.562 8.603   1.00 17.69 ? 967  GLN A O   1 
ATOM   737  C CB  . GLN A 1 95  ? 6.914  17.085 11.466  1.00 17.78 ? 967  GLN A CB  1 
ATOM   738  C CG  . GLN A 1 95  ? 7.016  15.556 11.579  1.00 20.04 ? 967  GLN A CG  1 
ATOM   739  C CD  . GLN A 1 95  ? 8.293  15.092 12.334  1.00 22.04 ? 967  GLN A CD  1 
ATOM   740  O OE1 . GLN A 1 95  ? 9.043  15.907 12.894  1.00 23.69 ? 967  GLN A OE1 1 
ATOM   741  N NE2 . GLN A 1 95  ? 8.527  13.779 12.356  1.00 28.53 ? 967  GLN A NE2 1 
ATOM   742  N N   . VAL A 1 96  ? 8.286  16.543 8.342   1.00 18.35 ? 968  VAL A N   1 
ATOM   743  C CA  . VAL A 1 96  ? 7.954  16.087 6.996   1.00 18.11 ? 968  VAL A CA  1 
ATOM   744  C C   . VAL A 1 96  ? 8.024  14.580 6.870   1.00 21.48 ? 968  VAL A C   1 
ATOM   745  O O   . VAL A 1 96  ? 8.805  13.914 7.569   1.00 24.57 ? 968  VAL A O   1 
ATOM   746  C CB  . VAL A 1 96  ? 8.877  16.741 5.942   1.00 18.32 ? 968  VAL A CB  1 
ATOM   747  C CG1 . VAL A 1 96  ? 8.789  18.287 6.065   1.00 20.49 ? 968  VAL A CG1 1 
ATOM   748  C CG2 . VAL A 1 96  ? 10.338 16.253 6.106   1.00 20.86 ? 968  VAL A CG2 1 
ATOM   749  N N   . GLU A 1 97  ? 7.220  14.052 5.952   1.00 19.90 ? 969  GLU A N   1 
ATOM   750  C CA  . GLU A 1 97  ? 7.174  12.624 5.674   1.00 19.27 ? 969  GLU A CA  1 
ATOM   751  C C   . GLU A 1 97  ? 7.568  12.302 4.241   1.00 24.13 ? 969  GLU A C   1 
ATOM   752  O O   . GLU A 1 97  ? 7.057  12.897 3.279   1.00 24.34 ? 969  GLU A O   1 
ATOM   753  C CB  . GLU A 1 97  ? 5.762  12.098 5.963   1.00 21.99 ? 969  GLU A CB  1 
ATOM   754  C CG  . GLU A 1 97  ? 5.555  10.630 5.629   1.00 23.82 ? 969  GLU A CG  1 
ATOM   755  C CD  . GLU A 1 97  ? 4.105  10.220 5.849   1.00 35.49 ? 969  GLU A CD  1 
ATOM   756  O OE1 . GLU A 1 97  ? 3.283  10.445 4.946   1.00 35.23 ? 969  GLU A OE1 1 
ATOM   757  O OE2 . GLU A 1 97  ? 3.797  9.698  6.933   1.00 32.78 ? 969  GLU A OE2 1 
ATOM   758  N N   . PHE A 1 98  ? 8.475  11.341 4.097   1.00 21.98 ? 970  PHE A N   1 
ATOM   759  C CA  . PHE A 1 98  ? 9.002  10.963 2.790   1.00 23.70 ? 970  PHE A CA  1 
ATOM   760  C C   . PHE A 1 98  ? 8.193  9.838  2.183   1.00 27.48 ? 970  PHE A C   1 
ATOM   761  O O   . PHE A 1 98  ? 7.305  9.272  2.839   1.00 28.95 ? 970  PHE A O   1 
ATOM   762  C CB  . PHE A 1 98  ? 10.468 10.582 2.940   1.00 25.53 ? 970  PHE A CB  1 
ATOM   763  C CG  . PHE A 1 98  ? 11.303 11.712 3.437   1.00 25.23 ? 970  PHE A CG  1 
ATOM   764  C CD1 . PHE A 1 98  ? 11.763 12.679 2.565   1.00 26.90 ? 970  PHE A CD1 1 
ATOM   765  C CD2 . PHE A 1 98  ? 11.586 11.838 4.778   1.00 28.89 ? 970  PHE A CD2 1 
ATOM   766  C CE1 . PHE A 1 98  ? 12.529 13.750 3.048   1.00 26.93 ? 970  PHE A CE1 1 
ATOM   767  C CE2 . PHE A 1 98  ? 12.344 12.893 5.260   1.00 32.92 ? 970  PHE A CE2 1 
ATOM   768  C CZ  . PHE A 1 98  ? 12.799 13.855 4.402   1.00 30.51 ? 970  PHE A CZ  1 
ATOM   769  N N   . GLU A 1 99  ? 8.486  9.528  0.926   1.00 33.31 ? 971  GLU A N   1 
ATOM   770  C CA  . GLU A 1 99  ? 7.707  8.538  0.187   1.00 39.64 ? 971  GLU A CA  1 
ATOM   771  C C   . GLU A 1 99  ? 7.760  7.148  0.808   1.00 37.98 ? 971  GLU A C   1 
ATOM   772  O O   . GLU A 1 99  ? 6.800  6.388  0.705   1.00 41.83 ? 971  GLU A O   1 
ATOM   773  C CB  . GLU A 1 99  ? 8.147  8.494  -1.272  1.00 44.58 ? 971  GLU A CB  1 
ATOM   774  C CG  . GLU A 1 99  ? 7.787  9.754  -2.040  1.00 55.19 ? 971  GLU A CG  1 
ATOM   775  C CD  . GLU A 1 99  ? 8.308  9.741  -3.465  1.00 69.34 ? 971  GLU A CD  1 
ATOM   776  O OE1 . GLU A 1 99  ? 8.934  8.733  -3.862  1.00 74.96 ? 971  GLU A OE1 1 
ATOM   777  O OE2 . GLU A 1 99  ? 8.092  10.741 -4.185  1.00 72.46 ? 971  GLU A OE2 1 
ATOM   778  N N   . ASP A 1 100 ? 8.866  6.824  1.471   1.00 39.63 ? 972  ASP A N   1 
ATOM   779  C CA  . ASP A 1 100 ? 8.989  5.524  2.127   1.00 43.52 ? 972  ASP A CA  1 
ATOM   780  C C   . ASP A 1 100 ? 8.352  5.491  3.519   1.00 40.99 ? 972  ASP A C   1 
ATOM   781  O O   . ASP A 1 100 ? 8.454  4.490  4.232   1.00 44.96 ? 972  ASP A O   1 
ATOM   782  C CB  . ASP A 1 100 ? 10.455 5.079  2.199   1.00 43.81 ? 972  ASP A CB  1 
ATOM   783  C CG  . ASP A 1 100 ? 11.310 5.978  3.087   1.00 43.65 ? 972  ASP A CG  1 
ATOM   784  O OD1 . ASP A 1 100 ? 10.781 6.939  3.688   1.00 39.56 ? 972  ASP A OD1 1 
ATOM   785  O OD2 . ASP A 1 100 ? 12.521 5.706  3.206   1.00 42.59 ? 972  ASP A OD2 1 
ATOM   786  N N   . GLY A 1 101 ? 7.702  6.583  3.909   1.00 35.96 ? 973  GLY A N   1 
ATOM   787  C CA  . GLY A 1 101 ? 7.050  6.649  5.206   1.00 34.58 ? 973  GLY A CA  1 
ATOM   788  C C   . GLY A 1 101 ? 7.923  7.165  6.347   1.00 33.65 ? 973  GLY A C   1 
ATOM   789  O O   . GLY A 1 101 ? 7.414  7.413  7.444   1.00 35.38 ? 973  GLY A O   1 
ATOM   790  N N   . SER A 1 102 ? 9.224  7.342  6.104   1.00 33.69 ? 974  SER A N   1 
ATOM   791  C CA  . SER A 1 102 ? 10.114 7.889  7.132   1.00 32.96 ? 974  SER A CA  1 
ATOM   792  C C   . SER A 1 102 ? 9.824  9.370  7.348   1.00 29.99 ? 974  SER A C   1 
ATOM   793  O O   . SER A 1 102 ? 9.214  10.013 6.501   1.00 28.38 ? 974  SER A O   1 
ATOM   794  C CB  . SER A 1 102 ? 11.595 7.686  6.775   1.00 30.24 ? 974  SER A CB  1 
ATOM   795  O OG  . SER A 1 102 ? 11.955 8.394  5.597   1.00 33.50 ? 974  SER A OG  1 
ATOM   796  N N   . GLN A 1 103 ? 10.232 9.901  8.496   1.00 26.28 ? 975  GLN A N   1 
ATOM   797  C CA  . GLN A 1 103 ? 9.996  11.311 8.792   1.00 25.31 ? 975  GLN A CA  1 
ATOM   798  C C   . GLN A 1 103 ? 11.211 11.970 9.417   1.00 28.03 ? 975  GLN A C   1 
ATOM   799  O O   . GLN A 1 103 ? 12.072 11.297 9.979   1.00 32.29 ? 975  GLN A O   1 
ATOM   800  C CB  . GLN A 1 103 ? 8.796  11.481 9.715   1.00 23.23 ? 975  GLN A CB  1 
ATOM   801  C CG  . GLN A 1 103 ? 7.498  10.926 9.122   1.00 25.33 ? 975  GLN A CG  1 
ATOM   802  C CD  . GLN A 1 103 ? 6.285  11.304 9.952   1.00 28.50 ? 975  GLN A CD  1 
ATOM   803  O OE1 . GLN A 1 103 ? 6.399  12.093 10.887  1.00 26.25 ? 975  GLN A OE1 1 
ATOM   804  N NE2 . GLN A 1 103 ? 5.119  10.738 9.616   1.00 31.49 ? 975  GLN A NE2 1 
ATOM   805  N N   . ILE A 1 104 ? 11.255 13.297 9.332   1.00 23.67 ? 976  ILE A N   1 
ATOM   806  C CA  . ILE A 1 104 ? 12.323 14.071 9.947   1.00 25.72 ? 976  ILE A CA  1 
ATOM   807  C C   . ILE A 1 104 ? 11.818 15.489 10.139  1.00 24.29 ? 976  ILE A C   1 
ATOM   808  O O   . ILE A 1 104 ? 10.912 15.931 9.419   1.00 24.22 ? 976  ILE A O   1 
ATOM   809  C CB  . ILE A 1 104 ? 13.591 14.056 9.071   1.00 26.90 ? 976  ILE A CB  1 
ATOM   810  C CG1 . ILE A 1 104 ? 14.825 14.482 9.864   1.00 36.71 ? 976  ILE A CG1 1 
ATOM   811  C CG2 . ILE A 1 104 ? 13.435 14.946 7.860   1.00 28.75 ? 976  ILE A CG2 1 
ATOM   812  C CD1 . ILE A 1 104 ? 16.100 14.219 9.098   1.00 40.65 ? 976  ILE A CD1 1 
ATOM   813  N N   . ALA A 1 105 ? 12.343 16.178 11.143  1.00 23.00 ? 977  ALA A N   1 
ATOM   814  C CA  . ALA A 1 105 ? 12.029 17.584 11.351  1.00 22.94 ? 977  ALA A CA  1 
ATOM   815  C C   . ALA A 1 105 ? 13.050 18.460 10.619  1.00 18.93 ? 977  ALA A C   1 
ATOM   816  O O   . ALA A 1 105 ? 14.286 18.271 10.751  1.00 22.77 ? 977  ALA A O   1 
ATOM   817  C CB  . ALA A 1 105 ? 12.005 17.901 12.835  1.00 32.67 ? 977  ALA A CB  1 
ATOM   818  N N   . MET A 1 106 ? 12.554 19.450 9.873   1.00 20.42 ? 978  MET A N   1 
ATOM   819  C CA  . MET A 1 106 ? 13.416 20.288 9.034   1.00 20.39 ? 978  MET A CA  1 
ATOM   820  C C   . MET A 1 106 ? 13.263 21.752 9.379   1.00 22.00 ? 978  MET A C   1 
ATOM   821  O O   . MET A 1 106 ? 12.169 22.207 9.695   1.00 20.59 ? 978  MET A O   1 
ATOM   822  C CB  . MET A 1 106 ? 13.026 20.177 7.561   1.00 28.79 ? 978  MET A CB  1 
ATOM   823  C CG  . MET A 1 106 ? 12.718 18.802 7.073   1.00 36.73 ? 978  MET A CG  1 
ATOM   824  S SD  . MET A 1 106 ? 14.199 18.099 6.364   1.00 30.96 ? 978  MET A SD  1 
ATOM   825  C CE  . MET A 1 106 ? 15.079 19.538 5.748   1.00 40.36 ? 978  MET A CE  1 
ATOM   826  N N   . LYS A 1 107 ? 14.363 22.482 9.277   1.00 20.90 ? 979  LYS A N   1 
ATOM   827  C CA  . LYS A 1 107 ? 14.391 23.943 9.371   1.00 21.77 ? 979  LYS A CA  1 
ATOM   828  C C   . LYS A 1 107 ? 13.823 24.570 8.109   1.00 22.82 ? 979  LYS A C   1 
ATOM   829  O O   . LYS A 1 107 ? 13.931 24.005 7.016   1.00 23.72 ? 979  LYS A O   1 
ATOM   830  C CB  . LYS A 1 107 ? 15.844 24.438 9.504   1.00 24.99 ? 979  LYS A CB  1 
ATOM   831  C CG  . LYS A 1 107 ? 16.570 23.949 10.720  1.00 31.21 ? 979  LYS A CG  1 
ATOM   832  C CD  . LYS A 1 107 ? 18.014 24.482 10.712  1.00 25.18 ? 979  LYS A CD  1 
ATOM   833  C CE  . LYS A 1 107 ? 18.729 24.142 11.997  1.00 37.53 ? 979  LYS A CE  1 
ATOM   834  N NZ  . LYS A 1 107 ? 20.204 24.382 11.931  1.00 43.84 ? 979  LYS A NZ  1 
ATOM   835  N N   . ARG A 1 108 ? 13.289 25.776 8.237   1.00 22.63 ? 980  ARG A N   1 
ATOM   836  C CA  . ARG A 1 108 ? 12.702 26.465 7.084   1.00 21.03 ? 980  ARG A CA  1 
ATOM   837  C C   . ARG A 1 108 ? 13.697 26.621 5.904   1.00 27.36 ? 980  ARG A C   1 
ATOM   838  O O   . ARG A 1 108 ? 13.311 26.509 4.729   1.00 27.27 ? 980  ARG A O   1 
ATOM   839  C CB  . ARG A 1 108 ? 12.176 27.835 7.507   1.00 24.59 ? 980  ARG A CB  1 
ATOM   840  C CG  . ARG A 1 108 ? 11.594 28.642 6.354   1.00 24.50 ? 980  ARG A CG  1 
ATOM   841  C CD  . ARG A 1 108 ? 10.299 27.982 5.875   1.00 27.42 ? 980  ARG A CD  1 
ATOM   842  N NE  . ARG A 1 108 ? 9.675  28.677 4.745   1.00 27.72 ? 980  ARG A NE  1 
ATOM   843  C CZ  . ARG A 1 108 ? 10.057 28.536 3.479   1.00 30.39 ? 980  ARG A CZ  1 
ATOM   844  N NH1 . ARG A 1 108 ? 11.075 27.737 3.171   1.00 29.34 ? 980  ARG A NH1 1 
ATOM   845  N NH2 . ARG A 1 108 ? 9.434  29.201 2.516   1.00 29.22 ? 980  ARG A NH2 1 
ATOM   846  N N   . GLU A 1 109 ? 14.967 26.861 6.230   1.00 26.17 ? 981  GLU A N   1 
ATOM   847  C CA  . GLU A 1 109 ? 15.974 27.104 5.201   1.00 28.19 ? 981  GLU A CA  1 
ATOM   848  C C   . GLU A 1 109 ? 16.168 25.902 4.266   1.00 29.92 ? 981  GLU A C   1 
ATOM   849  O O   . GLU A 1 109 ? 16.627 26.058 3.133   1.00 32.17 ? 981  GLU A O   1 
ATOM   850  C CB  . GLU A 1 109 ? 17.319 27.522 5.825   1.00 27.24 ? 981  GLU A CB  1 
ATOM   851  C CG  . GLU A 1 109 ? 18.357 27.919 4.786   1.00 45.86 ? 981  GLU A CG  1 
ATOM   852  N N   . ASP A 1 110 ? 15.833 24.710 4.749   1.00 25.55 ? 982  ASP A N   1 
ATOM   853  C CA  . ASP A 1 110 ? 16.036 23.484 3.986   1.00 24.71 ? 982  ASP A CA  1 
ATOM   854  C C   . ASP A 1 110 ? 14.793 23.022 3.214   1.00 22.86 ? 982  ASP A C   1 
ATOM   855  O O   . ASP A 1 110 ? 14.782 21.919 2.667   1.00 23.79 ? 982  ASP A O   1 
ATOM   856  C CB  . ASP A 1 110 ? 16.504 22.365 4.904   1.00 24.07 ? 982  ASP A CB  1 
ATOM   857  C CG  . ASP A 1 110 ? 17.932 22.592 5.418   1.00 29.08 ? 982  ASP A CG  1 
ATOM   858  O OD1 . ASP A 1 110 ? 18.703 23.311 4.742   1.00 29.42 ? 982  ASP A OD1 1 
ATOM   859  O OD2 . ASP A 1 110 ? 18.267 22.054 6.492   1.00 30.04 ? 982  ASP A OD2 1 
ATOM   860  N N   . ILE A 1 111 ? 13.749 23.849 3.210   1.00 24.43 ? 983  ILE A N   1 
ATOM   861  C CA  . ILE A 1 111 ? 12.466 23.540 2.539   1.00 21.83 ? 983  ILE A CA  1 
ATOM   862  C C   . ILE A 1 111 ? 12.234 24.439 1.336   1.00 24.63 ? 983  ILE A C   1 
ATOM   863  O O   . ILE A 1 111 ? 12.464 25.648 1.411   1.00 26.23 ? 983  ILE A O   1 
ATOM   864  C CB  . ILE A 1 111 ? 11.277 23.701 3.518   1.00 22.12 ? 983  ILE A CB  1 
ATOM   865  C CG1 . ILE A 1 111 ? 11.469 22.752 4.679   1.00 25.26 ? 983  ILE A CG1 1 
ATOM   866  C CG2 . ILE A 1 111 ? 9.944  23.390 2.830   1.00 23.99 ? 983  ILE A CG2 1 
ATOM   867  C CD1 . ILE A 1 111 ? 10.455 22.919 5.788   1.00 27.61 ? 983  ILE A CD1 1 
ATOM   868  N N   . TYR A 1 112 ? 11.739 23.837 0.252   1.00 21.64 ? 984  TYR A N   1 
ATOM   869  C CA  . TYR A 1 112 ? 11.466 24.522 -1.014  1.00 22.79 ? 984  TYR A CA  1 
ATOM   870  C C   . TYR A 1 112 ? 10.078 24.169 -1.486  1.00 24.16 ? 984  TYR A C   1 
ATOM   871  O O   . TYR A 1 112 ? 9.660  23.002 -1.387  1.00 21.81 ? 984  TYR A O   1 
ATOM   872  C CB  . TYR A 1 112 ? 12.492 24.102 -2.084  1.00 22.07 ? 984  TYR A CB  1 
ATOM   873  C CG  . TYR A 1 112 ? 13.900 24.472 -1.655  1.00 25.58 ? 984  TYR A CG  1 
ATOM   874  C CD1 . TYR A 1 112 ? 14.446 25.704 -1.990  1.00 30.79 ? 984  TYR A CD1 1 
ATOM   875  C CD2 . TYR A 1 112 ? 14.647 23.628 -0.828  1.00 26.35 ? 984  TYR A CD2 1 
ATOM   876  C CE1 . TYR A 1 112 ? 15.711 26.063 -1.561  1.00 31.04 ? 984  TYR A CE1 1 
ATOM   877  C CE2 . TYR A 1 112 ? 15.923 23.987 -0.384  1.00 31.10 ? 984  TYR A CE2 1 
ATOM   878  C CZ  . TYR A 1 112 ? 16.445 25.200 -0.759  1.00 30.98 ? 984  TYR A CZ  1 
ATOM   879  O OH  . TYR A 1 112 ? 17.700 25.554 -0.313  1.00 34.06 ? 984  TYR A OH  1 
ATOM   880  N N   . THR A 1 113 ? 9.339  25.164 -1.970  1.00 24.80 ? 985  THR A N   1 
ATOM   881  C CA  . THR A 1 113 ? 8.049  24.852 -2.562  1.00 21.10 ? 985  THR A CA  1 
ATOM   882  C C   . THR A 1 113 ? 8.292  24.187 -3.908  1.00 20.67 ? 985  THR A C   1 
ATOM   883  O O   . THR A 1 113 ? 9.386  24.191 -4.414  1.00 21.60 ? 985  THR A O   1 
ATOM   884  C CB  . THR A 1 113 ? 7.190  26.102 -2.823  1.00 25.90 ? 985  THR A CB  1 
ATOM   885  O OG1 . THR A 1 113 ? 7.759  26.851 -3.909  1.00 29.35 ? 985  THR A OG1 1 
ATOM   886  C CG2 . THR A 1 113 ? 7.114  26.963 -1.581  1.00 33.06 ? 985  THR A CG2 1 
ATOM   887  N N   . LEU A 1 114 ? 7.234  23.605 -4.460  1.00 20.32 ? 986  LEU A N   1 
ATOM   888  C CA  . LEU A 1 114 ? 7.347  22.930 -5.750  1.00 19.20 ? 986  LEU A CA  1 
ATOM   889  C C   . LEU A 1 114 ? 7.521  23.919 -6.890  1.00 20.95 ? 986  LEU A C   1 
ATOM   890  O O   . LEU A 1 114 ? 7.818  23.516 -8.023  1.00 22.27 ? 986  LEU A O   1 
ATOM   891  C CB  . LEU A 1 114 ? 6.100  22.083 -6.011  1.00 16.87 ? 986  LEU A CB  1 
ATOM   892  C CG  . LEU A 1 114 ? 5.847  20.949 -5.002  1.00 20.59 ? 986  LEU A CG  1 
ATOM   893  C CD1 . LEU A 1 114 ? 4.608  20.136 -5.359  1.00 18.83 ? 986  LEU A CD1 1 
ATOM   894  C CD2 . LEU A 1 114 ? 7.030  20.016 -4.949  1.00 25.33 ? 986  LEU A CD2 1 
ATOM   895  N N   . ASP A 1 115 ? 7.341  25.210 -6.602  1.00 23.63 ? 987  ASP A N   1 
ATOM   896  C CA  . ASP A 1 115 ? 7.510  26.249 -7.633  1.00 27.75 ? 987  ASP A CA  1 
ATOM   897  C C   . ASP A 1 115 ? 8.871  26.898 -7.717  1.00 32.45 ? 987  ASP A C   1 
ATOM   898  O O   . ASP A 1 115 ? 9.244  27.421 -8.766  1.00 39.79 ? 987  ASP A O   1 
ATOM   899  C CB  . ASP A 1 115 ? 6.471  27.345 -7.446  1.00 28.16 ? 987  ASP A CB  1 
ATOM   900  C CG  . ASP A 1 115 ? 5.134  26.914 -7.908  1.00 28.76 ? 987  ASP A CG  1 
ATOM   901  O OD1 . ASP A 1 115 ? 5.065  26.359 -9.029  1.00 28.29 ? 987  ASP A OD1 1 
ATOM   902  O OD2 . ASP A 1 115 ? 4.174  27.098 -7.141  1.00 28.07 ? 987  ASP A OD2 1 
ATOM   903  N N   . GLU A 1 116 ? 9.629  26.890 -6.635  1.00 27.27 ? 988  GLU A N   1 
ATOM   904  C CA  . GLU A 1 116 ? 10.907 27.596 -6.695  1.00 29.90 ? 988  GLU A CA  1 
ATOM   905  C C   . GLU A 1 116 ? 12.076 26.767 -7.219  1.00 33.55 ? 988  GLU A C   1 
ATOM   906  O O   . GLU A 1 116 ? 12.079 25.542 -7.132  1.00 34.97 ? 988  GLU A O   1 
ATOM   907  C CB  . GLU A 1 116 ? 11.255 28.224 -5.354  1.00 35.10 ? 988  GLU A CB  1 
ATOM   908  C CG  . GLU A 1 116 ? 11.426 27.264 -4.227  1.00 39.01 ? 988  GLU A CG  1 
ATOM   909  C CD  . GLU A 1 116 ? 11.648 28.011 -2.926  1.00 42.42 ? 988  GLU A CD  1 
ATOM   910  O OE1 . GLU A 1 116 ? 10.840 27.830 -1.998  1.00 34.29 ? 988  GLU A OE1 1 
ATOM   911  O OE2 . GLU A 1 116 ? 12.626 28.795 -2.854  1.00 49.42 ? 988  GLU A OE2 1 
ATOM   912  N N   . GLU A 1 117 ? 13.061 27.456 -7.770  1.00 34.71 ? 989  GLU A N   1 
ATOM   913  C CA  . GLU A 1 117 ? 14.268 26.794 -8.245  1.00 33.44 ? 989  GLU A CA  1 
ATOM   914  C C   . GLU A 1 117 ? 15.044 26.192 -7.095  1.00 35.92 ? 989  GLU A C   1 
ATOM   915  O O   . GLU A 1 117 ? 15.242 26.835 -6.073  1.00 34.79 ? 989  GLU A O   1 
ATOM   916  C CB  . GLU A 1 117 ? 15.174 27.796 -8.952  1.00 50.83 ? 989  GLU A CB  1 
ATOM   917  C CG  . GLU A 1 117 ? 14.656 28.244 -10.288 1.00 56.55 ? 989  GLU A CG  1 
ATOM   918  C CD  . GLU A 1 117 ? 15.768 28.405 -11.296 1.00 55.55 ? 989  GLU A CD  1 
ATOM   919  O OE1 . GLU A 1 117 ? 16.894 28.782 -10.894 1.00 52.09 ? 989  GLU A OE1 1 
ATOM   920  O OE2 . GLU A 1 117 ? 15.510 28.141 -12.485 1.00 56.64 ? 989  GLU A OE2 1 
ATOM   921  N N   . LEU A 1 118 ? 15.515 24.964 -7.267  1.00 30.37 ? 990  LEU A N   1 
ATOM   922  C CA  . LEU A 1 118 ? 16.373 24.370 -6.255  1.00 27.14 ? 990  LEU A CA  1 
ATOM   923  C C   . LEU A 1 118 ? 17.806 24.900 -6.439  1.00 37.53 ? 990  LEU A C   1 
ATOM   924  O O   . LEU A 1 118 ? 18.240 25.160 -7.566  1.00 35.66 ? 990  LEU A O   1 
ATOM   925  C CB  . LEU A 1 118 ? 16.307 22.843 -6.345  1.00 30.48 ? 990  LEU A CB  1 
ATOM   926  C CG  . LEU A 1 118 ? 14.931 22.211 -6.131  1.00 27.58 ? 990  LEU A CG  1 
ATOM   927  C CD1 . LEU A 1 118 ? 15.047 20.708 -6.345  1.00 27.18 ? 990  LEU A CD1 1 
ATOM   928  C CD2 . LEU A 1 118 ? 14.453 22.522 -4.711  1.00 26.30 ? 990  LEU A CD2 1 
ATOM   929  N N   . PRO A 1 119 ? 18.531 25.096 -5.334  1.00 35.38 ? 991  PRO A N   1 
ATOM   930  C CA  . PRO A 1 119 ? 19.828 25.782 -5.414  1.00 38.52 ? 991  PRO A CA  1 
ATOM   931  C C   . PRO A 1 119 ? 20.932 24.968 -6.088  1.00 38.41 ? 991  PRO A C   1 
ATOM   932  O O   . PRO A 1 119 ? 20.866 23.740 -6.169  1.00 34.44 ? 991  PRO A O   1 
ATOM   933  C CB  . PRO A 1 119 ? 20.184 26.030 -3.945  1.00 44.15 ? 991  PRO A CB  1 
ATOM   934  C CG  . PRO A 1 119 ? 19.415 24.990 -3.186  1.00 41.86 ? 991  PRO A CG  1 
ATOM   935  C CD  . PRO A 1 119 ? 18.147 24.776 -3.948  1.00 38.82 ? 991  PRO A CD  1 
ATOM   936  N N   . LYS A 1 120 ? 21.944 25.669 -6.594  1.00 36.46 ? 992  LYS A N   1 
ATOM   937  C CA  A LYS A 1 120 ? 23.137 25.011 -7.103  0.50 34.64 ? 992  LYS A CA  1 
ATOM   938  C CA  B LYS A 1 120 ? 23.128 25.014 -7.108  0.50 34.54 ? 992  LYS A CA  1 
ATOM   939  C C   . LYS A 1 120 ? 24.078 24.800 -5.931  1.00 37.15 ? 992  LYS A C   1 
ATOM   940  O O   . LYS A 1 120 ? 24.971 25.609 -5.681  1.00 39.82 ? 992  LYS A O   1 
ATOM   941  C CB  A LYS A 1 120 ? 23.848 25.872 -8.141  0.50 35.53 ? 992  LYS A CB  1 
ATOM   942  C CB  B LYS A 1 120 ? 23.783 25.874 -8.193  0.50 34.38 ? 992  LYS A CB  1 
ATOM   943  C CG  A LYS A 1 120 ? 22.950 26.685 -9.038  0.50 37.38 ? 992  LYS A CG  1 
ATOM   944  C CG  B LYS A 1 120 ? 22.969 25.999 -9.482  0.50 31.85 ? 992  LYS A CG  1 
ATOM   945  C CD  A LYS A 1 120 ? 23.780 27.698 -9.817  0.50 32.97 ? 992  LYS A CD  1 
ATOM   946  C CD  B LYS A 1 120 ? 23.486 27.141 -10.373 0.50 36.17 ? 992  LYS A CD  1 
ATOM   947  C CE  A LYS A 1 120 ? 22.903 28.817 -10.349 0.50 35.12 ? 992  LYS A CE  1 
ATOM   948  C CE  B LYS A 1 120 ? 22.925 28.509 -9.945  0.50 36.81 ? 992  LYS A CE  1 
ATOM   949  N NZ  A LYS A 1 120 ? 22.581 29.842 -9.316  0.50 36.19 ? 992  LYS A NZ  1 
ATOM   950  N NZ  B LYS A 1 120 ? 21.438 28.654 -10.147 0.50 30.19 ? 992  LYS A NZ  1 
ATOM   951  N N   . ARG A 1 121 ? 23.867 23.721 -5.194  1.00 40.70 ? 993  ARG A N   1 
ATOM   952  C CA  . ARG A 1 121 ? 24.636 23.469 -3.980  1.00 46.48 ? 993  ARG A CA  1 
ATOM   953  C C   . ARG A 1 121 ? 25.022 22.019 -3.960  1.00 55.55 ? 993  ARG A C   1 
ATOM   954  O O   . ARG A 1 121 ? 25.514 21.508 -2.957  1.00 52.29 ? 993  ARG A O   1 
ATOM   955  C CB  . ARG A 1 121 ? 23.764 23.701 -2.737  1.00 43.36 ? 993  ARG A CB  1 
ATOM   956  C CG  . ARG A 1 121 ? 23.325 25.130 -2.464  1.00 49.05 ? 993  ARG A CG  1 
ATOM   957  C CD  . ARG A 1 121 ? 22.417 25.205 -1.219  1.00 38.05 ? 993  ARG A CD  1 
ATOM   958  N N   . VAL A 1 122 ? 24.787 21.341 -5.070  1.00 40.15 ? 994  VAL A N   1 
ATOM   959  C CA  . VAL A 1 122 ? 24.530 19.921 -4.963  1.00 45.61 ? 994  VAL A CA  1 
ATOM   960  C C   . VAL A 1 122 ? 25.717 18.984 -5.020  1.00 40.42 ? 994  VAL A C   1 
ATOM   961  O O   . VAL A 1 122 ? 25.630 17.893 -4.473  1.00 30.67 ? 994  VAL A O   1 
ATOM   962  C CB  . VAL A 1 122 ? 23.452 19.478 -5.936  1.00 43.74 ? 994  VAL A CB  1 
ATOM   963  C CG1 . VAL A 1 122 ? 23.066 18.047 -5.629  1.00 46.16 ? 994  VAL A CG1 1 
ATOM   964  C CG2 . VAL A 1 122 ? 22.263 20.418 -5.805  1.00 24.09 ? 994  VAL A CG2 1 
HETATM 965  S S   . SO4 B 2 .   ? 9.976  29.903 10.176  0.53 35.82 ? 1995 SO4 A S   1 
HETATM 966  O O1  . SO4 B 2 .   ? 10.908 30.902 9.656   0.53 39.82 ? 1995 SO4 A O1  1 
HETATM 967  O O2  . SO4 B 2 .   ? 9.150  29.446 9.062   0.53 26.83 ? 1995 SO4 A O2  1 
HETATM 968  O O3  . SO4 B 2 .   ? 10.720 28.772 10.730  0.53 35.55 ? 1995 SO4 A O3  1 
HETATM 969  O O4  . SO4 B 2 .   ? 9.178  30.518 11.239  0.53 34.62 ? 1995 SO4 A O4  1 
HETATM 970  O O   . HOH C 3 .   ? 34.499 17.203 -7.914  1.00 58.58 ? 2001 HOH A O   1 
HETATM 971  O O   . HOH C 3 .   ? 29.965 18.719 -7.506  1.00 46.43 ? 2002 HOH A O   1 
HETATM 972  O O   . HOH C 3 .   ? 11.106 19.133 15.834  1.00 39.51 ? 2003 HOH A O   1 
HETATM 973  O O   . HOH C 3 .   ? 11.343 22.294 21.368  1.00 48.30 ? 2004 HOH A O   1 
HETATM 974  O O   . HOH C 3 .   ? 15.792 25.852 24.558  1.00 42.01 ? 2005 HOH A O   1 
HETATM 975  O O   . HOH C 3 .   ? 9.077  27.237 21.969  1.00 55.53 ? 2006 HOH A O   1 
HETATM 976  O O   . HOH C 3 .   ? 14.901 24.069 22.937  1.00 33.20 ? 2007 HOH A O   1 
HETATM 977  O O   . HOH C 3 .   ? 16.340 30.243 25.906  1.00 40.30 ? 2008 HOH A O   1 
HETATM 978  O O   . HOH C 3 .   ? 38.340 30.418 22.034  1.00 56.69 ? 2009 HOH A O   1 
HETATM 979  O O   . HOH C 3 .   ? 14.635 29.052 11.212  1.00 33.90 ? 2010 HOH A O   1 
HETATM 980  O O   . HOH C 3 .   ? 21.934 18.258 24.215  1.00 35.95 ? 2011 HOH A O   1 
HETATM 981  O O   . HOH C 3 .   ? 14.372 19.408 15.914  1.00 46.33 ? 2012 HOH A O   1 
HETATM 982  O O   . HOH C 3 .   ? 15.003 19.940 21.990  1.00 45.11 ? 2013 HOH A O   1 
HETATM 983  O O   . HOH C 3 .   ? 20.977 20.468 11.469  1.00 47.53 ? 2014 HOH A O   1 
HETATM 984  O O   . HOH C 3 .   ? 19.004 17.202 28.114  1.00 30.39 ? 2015 HOH A O   1 
HETATM 985  O O   . HOH C 3 .   ? 22.579 14.642 27.390  1.00 48.96 ? 2016 HOH A O   1 
HETATM 986  O O   . HOH C 3 .   ? 15.698 22.430 33.032  1.00 62.58 ? 2017 HOH A O   1 
HETATM 987  O O   . HOH C 3 .   ? 26.703 15.382 29.037  1.00 35.62 ? 2018 HOH A O   1 
HETATM 988  O O   . HOH C 3 .   ? 23.293 34.474 31.609  1.00 55.18 ? 2019 HOH A O   1 
HETATM 989  O O   . HOH C 3 .   ? 20.031 33.205 30.490  1.00 49.78 ? 2020 HOH A O   1 
HETATM 990  O O   . HOH C 3 .   ? 28.086 34.497 32.647  1.00 59.31 ? 2021 HOH A O   1 
HETATM 991  O O   . HOH C 3 .   ? 34.501 27.657 24.778  1.00 54.15 ? 2022 HOH A O   1 
HETATM 992  O O   . HOH C 3 .   ? 35.759 17.033 7.989   1.00 51.14 ? 2023 HOH A O   1 
HETATM 993  O O   . HOH C 3 .   ? 38.211 21.132 16.249  1.00 46.69 ? 2024 HOH A O   1 
HETATM 994  O O   . HOH C 3 .   ? 35.595 23.429 19.665  1.00 39.83 ? 2025 HOH A O   1 
HETATM 995  O O   . HOH C 3 .   ? 12.460 34.980 22.033  1.00 50.23 ? 2026 HOH A O   1 
HETATM 996  O O   . HOH C 3 .   ? 9.507  3.843  -1.107  1.00 55.88 ? 2027 HOH A O   1 
HETATM 997  O O   . HOH C 3 .   ? 11.162 5.860  -1.455  1.00 54.33 ? 2028 HOH A O   1 
HETATM 998  O O   . HOH C 3 .   ? 13.041 6.297  10.431  1.00 57.20 ? 2029 HOH A O   1 
HETATM 999  O O   . HOH C 3 .   ? 14.285 16.152 15.234  1.00 62.78 ? 2030 HOH A O   1 
HETATM 1000 O O   . HOH C 3 .   ? 18.158 20.806 10.638  1.00 48.88 ? 2031 HOH A O   1 
HETATM 1001 O O   . HOH C 3 .   ? 11.516 21.253 -8.023  1.00 30.01 ? 2032 HOH A O   1 
HETATM 1002 O O   . HOH C 3 .   ? 2.204  27.824 -11.019 1.00 52.24 ? 2033 HOH A O   1 
HETATM 1003 O O   . HOH C 3 .   ? 15.123 31.959 -8.413  1.00 55.96 ? 2034 HOH A O   1 
HETATM 1004 O O   . HOH C 3 .   ? 12.881 22.903 -9.891  1.00 60.86 ? 2035 HOH A O   1 
HETATM 1005 O O   . HOH C 3 .   ? 26.469 28.640 -8.951  1.00 45.97 ? 2036 HOH A O   1 
HETATM 1006 O O   . HOH C 3 .   ? 13.844 31.507 7.349   1.00 59.65 ? 2037 HOH A O   1 
HETATM 1007 O O   . HOH C 3 .   ? 31.830 18.892 -9.442  1.00 45.24 ? 2038 HOH A O   1 
HETATM 1008 O O   . HOH C 3 .   ? 20.079 16.594 22.960  1.00 47.83 ? 2039 HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? 13.923 20.396 24.511  1.00 44.90 ? 2040 HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? 18.097 15.906 25.917  1.00 58.57 ? 2041 HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? 34.534 22.302 21.440  1.00 41.17 ? 2042 HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? 41.660 31.670 6.307   1.00 52.75 ? 2043 HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? 44.283 30.636 6.881   1.00 49.52 ? 2044 HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? 51.642 27.535 -2.402  1.00 43.57 ? 2045 HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? 48.820 27.891 0.318   1.00 38.36 ? 2046 HOH A O   1 
HETATM 1016 O O   . HOH C 3 .   ? 49.880 32.051 -0.680  1.00 50.77 ? 2047 HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? 50.094 27.656 -8.645  1.00 40.29 ? 2048 HOH A O   1 
HETATM 1018 O O   . HOH C 3 .   ? 46.891 29.197 -6.730  1.00 38.59 ? 2049 HOH A O   1 
HETATM 1019 O O   . HOH C 3 .   ? 52.535 28.328 -7.495  1.00 41.22 ? 2050 HOH A O   1 
HETATM 1020 O O   . HOH C 3 .   ? 54.885 21.769 -2.496  1.00 30.55 ? 2051 HOH A O   1 
HETATM 1021 O O   . HOH C 3 .   ? 52.982 24.761 -8.684  1.00 26.11 ? 2052 HOH A O   1 
HETATM 1022 O O   . HOH C 3 .   ? 52.815 16.632 0.000   0.50 31.09 ? 2053 HOH A O   1 
HETATM 1023 O O   . HOH C 3 .   ? 47.771 23.384 2.423   1.00 20.98 ? 2054 HOH A O   1 
HETATM 1024 O O   . HOH C 3 .   ? 33.949 19.197 -5.774  1.00 29.94 ? 2055 HOH A O   1 
HETATM 1025 O O   . HOH C 3 .   ? 33.489 15.484 -6.431  1.00 44.00 ? 2056 HOH A O   1 
HETATM 1026 O O   . HOH C 3 .   ? 30.630 13.513 -1.254  1.00 48.93 ? 2057 HOH A O   1 
HETATM 1027 O O   . HOH C 3 .   ? 31.298 19.166 -5.264  1.00 34.59 ? 2058 HOH A O   1 
HETATM 1028 O O   . HOH C 3 .   ? 31.421 22.009 -4.584  1.00 35.12 ? 2059 HOH A O   1 
HETATM 1029 O O   . HOH C 3 .   ? 31.059 15.435 -5.387  1.00 46.15 ? 2060 HOH A O   1 
HETATM 1030 O O   . HOH C 3 .   ? 29.410 22.293 0.240   1.00 53.26 ? 2061 HOH A O   1 
HETATM 1031 O O   . HOH C 3 .   ? 24.134 12.228 -0.268  1.00 40.85 ? 2062 HOH A O   1 
HETATM 1032 O O   . HOH C 3 .   ? 20.844 16.151 -5.995  1.00 28.59 ? 2063 HOH A O   1 
HETATM 1033 O O   . HOH C 3 .   ? 26.407 18.105 0.000   0.50 21.97 ? 2064 HOH A O   1 
HETATM 1034 O O   . HOH C 3 .   ? 23.957 14.544 -5.177  1.00 56.59 ? 2065 HOH A O   1 
HETATM 1035 O O   . HOH C 3 .   ? 18.609 14.620 -5.372  1.00 30.65 ? 2066 HOH A O   1 
HETATM 1036 O O   . HOH C 3 .   ? 20.208 11.838 1.451   1.00 38.81 ? 2067 HOH A O   1 
HETATM 1037 O O   . HOH C 3 .   ? 6.719  15.614 -5.763  1.00 29.72 ? 2068 HOH A O   1 
HETATM 1038 O O   . HOH C 3 .   ? 10.427 11.158 -0.474  1.00 31.57 ? 2069 HOH A O   1 
HETATM 1039 O O   . HOH C 3 .   ? 11.670 12.517 -4.030  1.00 33.53 ? 2070 HOH A O   1 
HETATM 1040 O O   . HOH C 3 .   ? 5.962  13.200 -1.754  1.00 54.70 ? 2071 HOH A O   1 
HETATM 1041 O O   . HOH C 3 .   ? -4.852 14.015 4.622   1.00 34.14 ? 2072 HOH A O   1 
HETATM 1042 O O   . HOH C 3 .   ? 0.621  11.345 4.824   1.00 31.51 ? 2073 HOH A O   1 
HETATM 1043 O O   . HOH C 3 .   ? 0.993  21.564 13.091  1.00 20.71 ? 2074 HOH A O   1 
HETATM 1044 O O   . HOH C 3 .   ? 7.239  20.262 13.716  1.00 32.84 ? 2075 HOH A O   1 
HETATM 1045 O O   . HOH C 3 .   ? 10.291 21.813 17.218  1.00 44.33 ? 2076 HOH A O   1 
HETATM 1046 O O   . HOH C 3 .   ? 4.611  24.207 18.780  1.00 45.56 ? 2077 HOH A O   1 
HETATM 1047 O O   . HOH C 3 .   ? 8.208  23.292 20.656  1.00 57.97 ? 2078 HOH A O   1 
HETATM 1048 O O   . HOH C 3 .   ? 13.334 27.294 25.075  1.00 47.22 ? 2079 HOH A O   1 
HETATM 1049 O O   . HOH C 3 .   ? 12.921 30.706 23.536  1.00 44.25 ? 2080 HOH A O   1 
HETATM 1050 O O   . HOH C 3 .   ? 10.773 26.548 22.635  1.00 48.25 ? 2081 HOH A O   1 
HETATM 1051 O O   . HOH C 3 .   ? 12.580 24.759 21.540  1.00 26.64 ? 2082 HOH A O   1 
HETATM 1052 O O   . HOH C 3 .   ? 17.533 27.747 25.480  1.00 26.31 ? 2083 HOH A O   1 
HETATM 1053 O O   . HOH C 3 .   ? 15.725 37.915 17.842  1.00 55.81 ? 2084 HOH A O   1 
HETATM 1054 O O   . HOH C 3 .   ? 21.209 38.592 18.165  1.00 55.41 ? 2085 HOH A O   1 
HETATM 1055 O O   . HOH C 3 .   ? 18.949 39.492 14.888  1.00 54.73 ? 2086 HOH A O   1 
HETATM 1056 O O   . HOH C 3 .   ? 32.852 35.291 17.136  1.00 46.52 ? 2087 HOH A O   1 
HETATM 1057 O O   . HOH C 3 .   ? 34.739 32.655 19.783  1.00 45.14 ? 2088 HOH A O   1 
HETATM 1058 O O   . HOH C 3 .   ? 36.753 30.002 19.991  1.00 47.82 ? 2089 HOH A O   1 
HETATM 1059 O O   . HOH C 3 .   ? 38.079 29.986 15.829  1.00 57.67 ? 2090 HOH A O   1 
HETATM 1060 O O   . HOH C 3 .   ? 24.434 27.714 10.907  1.00 42.18 ? 2091 HOH A O   1 
HETATM 1061 O O   . HOH C 3 .   ? 20.534 32.282 9.709   1.00 39.54 ? 2092 HOH A O   1 
HETATM 1062 O O   . HOH C 3 .   ? 16.074 27.933 8.733   1.00 32.49 ? 2093 HOH A O   1 
HETATM 1063 O O   . HOH C 3 .   ? 24.840 26.672 13.227  1.00 34.91 ? 2094 HOH A O   1 
HETATM 1064 O O   . HOH C 3 .   ? 23.828 22.817 24.197  1.00 18.56 ? 2095 HOH A O   1 
HETATM 1065 O O   . HOH C 3 .   ? 15.617 19.891 18.209  1.00 50.06 ? 2096 HOH A O   1 
HETATM 1066 O O   . HOH C 3 .   ? 24.547 18.912 22.965  1.00 37.15 ? 2097 HOH A O   1 
HETATM 1067 O O   . HOH C 3 .   ? 16.085 22.228 21.096  1.00 26.25 ? 2098 HOH A O   1 
HETATM 1068 O O   . HOH C 3 .   ? 22.238 23.938 14.463  1.00 34.99 ? 2099 HOH A O   1 
HETATM 1069 O O   . HOH C 3 .   ? 22.437 20.334 13.645  1.00 40.39 ? 2100 HOH A O   1 
HETATM 1070 O O   . HOH C 3 .   ? 21.067 18.362 15.779  1.00 58.21 ? 2101 HOH A O   1 
HETATM 1071 O O   . HOH C 3 .   ? 26.193 20.253 24.830  1.00 35.62 ? 2102 HOH A O   1 
HETATM 1072 O O   . HOH C 3 .   ? 28.449 19.069 25.016  1.00 35.17 ? 2103 HOH A O   1 
HETATM 1073 O O   . HOH C 3 .   ? 33.848 22.769 23.856  1.00 31.24 ? 2104 HOH A O   1 
HETATM 1074 O O   . HOH C 3 .   ? 30.296 28.158 25.974  1.00 29.99 ? 2105 HOH A O   1 
HETATM 1075 O O   . HOH C 3 .   ? 22.976 31.037 33.715  1.00 51.01 ? 2106 HOH A O   1 
HETATM 1076 O O   . HOH C 3 .   ? 24.998 29.996 34.354  1.00 42.46 ? 2107 HOH A O   1 
HETATM 1077 O O   . HOH C 3 .   ? 22.233 20.802 25.325  1.00 20.20 ? 2108 HOH A O   1 
HETATM 1078 O O   . HOH C 3 .   ? 21.542 17.611 27.234  1.00 27.40 ? 2109 HOH A O   1 
HETATM 1079 O O   . HOH C 3 .   ? 17.601 25.964 27.686  1.00 38.44 ? 2110 HOH A O   1 
HETATM 1080 O O   . HOH C 3 .   ? 16.709 24.181 31.383  1.00 54.69 ? 2111 HOH A O   1 
HETATM 1081 O O   . HOH C 3 .   ? 17.460 18.883 29.539  1.00 48.81 ? 2112 HOH A O   1 
HETATM 1082 O O   . HOH C 3 .   ? 15.585 22.278 28.429  1.00 36.43 ? 2113 HOH A O   1 
HETATM 1083 O O   . HOH C 3 .   ? 17.619 21.400 33.260  1.00 36.77 ? 2114 HOH A O   1 
HETATM 1084 O O   . HOH C 3 .   ? 24.482 15.833 29.277  1.00 33.74 ? 2115 HOH A O   1 
HETATM 1085 O O   . HOH C 3 .   ? 23.714 16.207 34.276  1.00 18.65 ? 2116 HOH A O   1 
HETATM 1086 O O   . HOH C 3 .   ? 22.668 27.555 34.706  1.00 35.73 ? 2117 HOH A O   1 
HETATM 1087 O O   . HOH C 3 .   ? 21.120 30.744 31.116  1.00 32.17 ? 2118 HOH A O   1 
HETATM 1088 O O   . HOH C 3 .   ? 24.352 32.063 31.113  1.00 32.50 ? 2119 HOH A O   1 
HETATM 1089 O O   . HOH C 3 .   ? 21.506 34.592 27.969  1.00 34.32 ? 2120 HOH A O   1 
HETATM 1090 O O   . HOH C 3 .   ? 23.058 37.315 28.651  1.00 48.01 ? 2121 HOH A O   1 
HETATM 1091 O O   . HOH C 3 .   ? 29.500 37.921 27.744  1.00 42.97 ? 2122 HOH A O   1 
HETATM 1092 O O   . HOH C 3 .   ? 19.029 36.962 25.255  1.00 50.07 ? 2123 HOH A O   1 
HETATM 1093 O O   . HOH C 3 .   ? 26.408 39.823 28.544  0.50 44.07 ? 2124 HOH A O   1 
HETATM 1094 O O   . HOH C 3 .   ? 33.185 37.591 24.640  1.00 46.27 ? 2125 HOH A O   1 
HETATM 1095 O O   . HOH C 3 .   ? 28.886 28.722 29.730  1.00 21.96 ? 2126 HOH A O   1 
HETATM 1096 O O   . HOH C 3 .   ? 27.264 32.070 31.051  1.00 33.02 ? 2127 HOH A O   1 
HETATM 1097 O O   . HOH C 3 .   ? 33.435 34.327 26.571  1.00 36.62 ? 2128 HOH A O   1 
HETATM 1098 O O   . HOH C 3 .   ? 35.229 28.049 21.221  1.00 37.53 ? 2129 HOH A O   1 
HETATM 1099 O O   . HOH C 3 .   ? 25.078 23.977 13.676  1.00 32.34 ? 2130 HOH A O   1 
HETATM 1100 O O   . HOH C 3 .   ? 22.968 16.958 19.334  1.00 64.30 ? 2131 HOH A O   1 
HETATM 1101 O O   . HOH C 3 .   ? 25.226 19.996 14.057  1.00 34.56 ? 2132 HOH A O   1 
HETATM 1102 O O   . HOH C 3 .   ? 25.198 17.710 15.098  1.00 51.03 ? 2133 HOH A O   1 
HETATM 1103 O O   . HOH C 3 .   ? 27.819 15.954 14.971  1.00 51.77 ? 2134 HOH A O   1 
HETATM 1104 O O   . HOH C 3 .   ? 34.612 16.054 11.403  1.00 57.99 ? 2135 HOH A O   1 
HETATM 1105 O O   . HOH C 3 .   ? 34.582 16.190 9.399   1.00 56.22 ? 2136 HOH A O   1 
HETATM 1106 O O   . HOH C 3 .   ? 32.545 16.623 16.706  1.00 44.71 ? 2137 HOH A O   1 
HETATM 1107 O O   . HOH C 3 .   ? 36.615 20.304 13.974  1.00 37.76 ? 2138 HOH A O   1 
HETATM 1108 O O   . HOH C 3 .   ? 36.363 23.057 11.639  1.00 59.58 ? 2139 HOH A O   1 
HETATM 1109 O O   . HOH C 3 .   ? 34.150 29.883 13.130  1.00 39.32 ? 2140 HOH A O   1 
HETATM 1110 O O   . HOH C 3 .   ? 35.422 26.252 19.442  1.00 47.43 ? 2141 HOH A O   1 
HETATM 1111 O O   . HOH C 3 .   ? 37.368 26.706 17.936  1.00 53.65 ? 2142 HOH A O   1 
HETATM 1112 O O   . HOH C 3 .   ? 19.662 34.515 25.856  1.00 34.07 ? 2143 HOH A O   1 
HETATM 1113 O O   . HOH C 3 .   ? 17.564 36.842 23.176  1.00 51.71 ? 2144 HOH A O   1 
HETATM 1114 O O   . HOH C 3 .   ? 17.174 32.861 25.439  1.00 38.61 ? 2145 HOH A O   1 
HETATM 1115 O O   . HOH C 3 .   ? 13.617 33.065 22.537  1.00 39.10 ? 2146 HOH A O   1 
HETATM 1116 O O   . HOH C 3 .   ? 14.265 37.434 19.800  1.00 52.33 ? 2147 HOH A O   1 
HETATM 1117 O O   . HOH C 3 .   ? 17.901 38.182 19.693  1.00 51.84 ? 2148 HOH A O   1 
HETATM 1118 O O   . HOH C 3 .   ? 15.277 31.176 13.418  1.00 31.94 ? 2149 HOH A O   1 
HETATM 1119 O O   . HOH C 3 .   ? 11.438 35.498 18.683  1.00 37.18 ? 2150 HOH A O   1 
HETATM 1120 O O   . HOH C 3 .   ? 11.788 34.296 14.577  1.00 54.20 ? 2151 HOH A O   1 
HETATM 1121 O O   . HOH C 3 .   ? 7.884  32.967 15.953  1.00 50.63 ? 2152 HOH A O   1 
HETATM 1122 O O   . HOH C 3 .   ? 12.926 27.080 10.729  1.00 27.34 ? 2153 HOH A O   1 
HETATM 1123 O O   . HOH C 3 .   ? 1.334  9.273  7.639   1.00 32.39 ? 2154 HOH A O   1 
HETATM 1124 O O   . HOH C 3 .   ? 4.885  7.695  8.188   1.00 47.49 ? 2155 HOH A O   1 
HETATM 1125 O O   . HOH C 3 .   ? 5.068  11.615 1.388   1.00 50.21 ? 2156 HOH A O   1 
HETATM 1126 O O   . HOH C 3 .   ? 11.545 9.837  -2.540  1.00 45.98 ? 2157 HOH A O   1 
HETATM 1127 O O   . HOH C 3 .   ? 9.834  5.877  -2.919  1.00 61.42 ? 2158 HOH A O   1 
HETATM 1128 O O   . HOH C 3 .   ? 11.710 7.888  0.595   1.00 49.36 ? 2159 HOH A O   1 
HETATM 1129 O O   . HOH C 3 .   ? 14.684 9.356  6.350   1.00 51.01 ? 2160 HOH A O   1 
HETATM 1130 O O   . HOH C 3 .   ? 11.304 8.039  10.609  1.00 49.52 ? 2161 HOH A O   1 
HETATM 1131 O O   . HOH C 3 .   ? 4.241  12.912 12.124  1.00 29.00 ? 2162 HOH A O   1 
HETATM 1132 O O   . HOH C 3 .   ? 13.989 14.919 13.289  1.00 46.00 ? 2163 HOH A O   1 
HETATM 1133 O O   . HOH C 3 .   ? 14.006 29.801 3.251   1.00 48.96 ? 2164 HOH A O   1 
HETATM 1134 O O   . HOH C 3 .   ? 8.042  30.916 6.051   1.00 41.62 ? 2165 HOH A O   1 
HETATM 1135 O O   . HOH C 3 .   ? 20.585 22.520 7.953   1.00 36.98 ? 2166 HOH A O   1 
HETATM 1136 O O   . HOH C 3 .   ? 16.745 21.132 8.469   1.00 22.31 ? 2167 HOH A O   1 
HETATM 1137 O O   . HOH C 3 .   ? 14.328 27.826 1.564   1.00 45.76 ? 2168 HOH A O   1 
HETATM 1138 O O   . HOH C 3 .   ? 18.491 27.892 -0.558  1.00 55.07 ? 2169 HOH A O   1 
HETATM 1139 O O   . HOH C 3 .   ? 11.321 23.007 -6.084  1.00 26.82 ? 2170 HOH A O   1 
HETATM 1140 O O   . HOH C 3 .   ? 7.911  24.361 -10.751 1.00 44.53 ? 2171 HOH A O   1 
HETATM 1141 O O   . HOH C 3 .   ? 8.895  21.049 -8.583  1.00 29.80 ? 2172 HOH A O   1 
HETATM 1142 O O   . HOH C 3 .   ? 1.813  26.893 -8.345  1.00 36.35 ? 2173 HOH A O   1 
HETATM 1143 O O   . HOH C 3 .   ? 6.312  26.053 -11.481 1.00 40.69 ? 2174 HOH A O   1 
HETATM 1144 O O   . HOH C 3 .   ? 4.079  25.130 -4.585  1.00 34.20 ? 2175 HOH A O   1 
HETATM 1145 O O   . HOH C 3 .   ? 3.957  27.470 -4.382  1.00 56.08 ? 2176 HOH A O   1 
HETATM 1146 O O   . HOH C 3 .   ? 11.203 28.764 0.259   1.00 32.46 ? 2177 HOH A O   1 
HETATM 1147 O O   . HOH C 3 .   ? 16.390 28.497 -14.604 1.00 37.08 ? 2178 HOH A O   1 
HETATM 1148 O O   . HOH C 3 .   ? 12.842 30.078 -7.416  1.00 44.93 ? 2179 HOH A O   1 
HETATM 1149 O O   . HOH C 3 .   ? 18.996 30.632 -11.139 1.00 53.87 ? 2180 HOH A O   1 
HETATM 1150 O O   . HOH C 3 .   ? 14.886 28.874 -4.391  1.00 46.36 ? 2181 HOH A O   1 
HETATM 1151 O O   . HOH C 3 .   ? 15.264 23.670 -9.880  1.00 41.95 ? 2182 HOH A O   1 
HETATM 1152 O O   . HOH C 3 .   ? 26.610 27.622 -6.592  1.00 43.43 ? 2183 HOH A O   1 
HETATM 1153 O O   . HOH C 3 .   ? 21.731 28.558 -6.185  1.00 50.05 ? 2184 HOH A O   1 
HETATM 1154 O O   . HOH C 3 .   ? 13.433 30.909 9.716   1.00 47.11 ? 2185 HOH A O   1 
HETATM 1155 O O   . HOH C 3 .   ? 11.949 32.669 11.065  1.00 59.67 ? 2186 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
6   N N   . LYS A 5   ? 0.7699 0.8082 0.7944 0.0788  0.0416  -0.1149 877 LYS A N   
7   C CA  . LYS A 5   ? 0.6300 0.6803 0.6489 0.0653  0.0419  -0.1116 877 LYS A CA  
8   C C   . LYS A 5   ? 0.4579 0.4862 0.4716 0.0601  0.0341  -0.0960 877 LYS A C   
9   O O   . LYS A 5   ? 0.4046 0.4281 0.4238 0.0654  0.0264  -0.0822 877 LYS A O   
10  C CB  . LYS A 5   ? 0.6427 0.7409 0.6710 0.0634  0.0426  -0.1076 877 LYS A CB  
11  C CG  . LYS A 5   ? 0.6252 0.7429 0.6677 0.0703  0.0377  -0.0939 877 LYS A CG  
12  C CD  . LYS A 5   ? 0.6657 0.8083 0.7194 0.0792  0.0442  -0.1034 877 LYS A CD  
13  C CE  . LYS A 5   ? 0.6639 0.8374 0.7128 0.0737  0.0516  -0.1118 877 LYS A CE  
14  N NZ  . LYS A 5   ? 0.7099 0.9042 0.7666 0.0819  0.0601  -0.1226 877 LYS A NZ  
15  N N   . VAL A 6   ? 0.4108 0.4265 0.4144 0.0494  0.0364  -0.0987 878 VAL A N   
16  C CA  . VAL A 6   ? 0.4443 0.4340 0.4404 0.0441  0.0311  -0.0857 878 VAL A CA  
17  C C   . VAL A 6   ? 0.3730 0.3916 0.3745 0.0403  0.0254  -0.0699 878 VAL A C   
18  O O   . VAL A 6   ? 0.4126 0.4641 0.4174 0.0363  0.0276  -0.0729 878 VAL A O   
19  C CB  . VAL A 6   ? 0.5519 0.5150 0.5359 0.0340  0.0376  -0.0963 878 VAL A CB  
20  C CG1 . VAL A 6   ? 0.5173 0.4531 0.4927 0.0283  0.0338  -0.0829 878 VAL A CG1 
21  C CG2 . VAL A 6   ? 0.6319 0.5597 0.6059 0.0371  0.0442  -0.1113 878 VAL A CG2 
22  N N   . ILE A 7   ? 0.3246 0.3286 0.3249 0.0421  0.0177  -0.0532 879 ILE A N   
23  C CA  . ILE A 7   ? 0.2573 0.2808 0.2588 0.0382  0.0125  -0.0369 879 ILE A CA  
24  C C   . ILE A 7   ? 0.2839 0.2789 0.2729 0.0308  0.0111  -0.0295 879 ILE A C   
25  O O   . ILE A 7   ? 0.2978 0.2522 0.2776 0.0311  0.0092  -0.0265 879 ILE A O   
26  C CB  . ILE A 7   ? 0.2416 0.2692 0.2506 0.0440  0.0048  -0.0229 879 ILE A CB  
27  C CG1 . ILE A 7   ? 0.3127 0.3676 0.3365 0.0520  0.0073  -0.0312 879 ILE A CG1 
28  C CG2 . ILE A 7   ? 0.2720 0.3167 0.2790 0.0386  0.0006  -0.0063 879 ILE A CG2 
29  C CD1 . ILE A 7   ? 0.3050 0.4026 0.3338 0.0496  0.0133  -0.0358 879 ILE A CD1 
30  N N   . SER A 8   ? 0.2623 0.2773 0.2496 0.0249  0.0121  -0.0265 880 SER A N   
31  C CA  . SER A 8   ? 0.2358 0.2279 0.2134 0.0181  0.0130  -0.0225 880 SER A CA  
32  C C   . SER A 8   ? 0.1933 0.1949 0.1662 0.0164  0.0077  -0.0049 880 SER A C   
33  O O   . SER A 8   ? 0.2254 0.2592 0.2020 0.0185  0.0051  0.0013  880 SER A O   
34  C CB  . SER A 8   ? 0.3088 0.3124 0.2886 0.0126  0.0202  -0.0394 880 SER A CB  
35  O OG  . SER A 8   ? 0.3624 0.3562 0.3441 0.0131  0.0261  -0.0567 880 SER A OG  
36  N N   . VAL A 9   ? 0.2047 0.1766 0.1673 0.0120  0.0075  0.0027  881 VAL A N   
37  C CA  . VAL A 9   ? 0.2075 0.1844 0.1630 0.0104  0.0037  0.0185  881 VAL A CA  
38  C C   . VAL A 9   ? 0.2302 0.2473 0.1902 0.0107  0.0049  0.0144  881 VAL A C   
39  O O   . VAL A 9   ? 0.2334 0.2640 0.2000 0.0089  0.0097  -0.0015 881 VAL A O   
40  C CB  . VAL A 9   ? 0.2046 0.1433 0.1483 0.0055  0.0059  0.0234  881 VAL A CB  
41  C CG1 . VAL A 9   ? 0.2602 0.2075 0.1967 0.0046  0.0036  0.0370  881 VAL A CG1 
42  C CG2 . VAL A 9   ? 0.2611 0.1574 0.1948 0.0061  0.0022  0.0314  881 VAL A CG2 
43  N N   . GLY A 10  ? 0.2186 0.2533 0.1734 0.0128  0.0003  0.0283  882 GLY A N   
44  C CA  . GLY A 10  ? 0.2435 0.3122 0.1972 0.0147  0.0000  0.0268  882 GLY A CA  
45  C C   . GLY A 10  ? 0.2580 0.3610 0.2179 0.0179  0.0006  0.0192  882 GLY A C   
46  O O   . GLY A 10  ? 0.2458 0.3759 0.2009 0.0204  -0.0006 0.0195  882 GLY A O   
47  N N   . GLN A 11  ? 0.2067 0.3074 0.1755 0.0188  0.0025  0.0123  883 GLN A N   
48  C CA  . GLN A 11  ? 0.1879 0.3196 0.1627 0.0220  0.0048  0.0040  883 GLN A CA  
49  C C   . GLN A 11  ? 0.1882 0.3333 0.1587 0.0233  0.0028  0.0184  883 GLN A C   
50  O O   . GLN A 11  ? 0.2249 0.3519 0.1940 0.0219  -0.0004 0.0318  883 GLN A O   
51  C CB  . GLN A 11  ? 0.2416 0.3642 0.2276 0.0237  0.0083  -0.0086 883 GLN A CB  
52  C CG  . GLN A 11  ? 0.2767 0.4277 0.2696 0.0272  0.0125  -0.0208 883 GLN A CG  
53  C CD  . GLN A 11  ? 0.3542 0.4902 0.3560 0.0298  0.0163  -0.0344 883 GLN A CD  
54  O OE1 . GLN A 11  ? 0.4101 0.5144 0.4103 0.0279  0.0164  -0.0376 883 GLN A OE1 
55  N NE2 . GLN A 11  ? 0.2747 0.4303 0.2837 0.0344  0.0202  -0.0425 883 GLN A NE2 
56  N N   . THR A 12  ? 0.1591 0.3346 0.1265 0.0252  0.0050  0.0150  884 THR A N   
57  C CA  . THR A 12  ? 0.1679 0.3576 0.1328 0.0253  0.0062  0.0250  884 THR A CA  
58  C C   . THR A 12  ? 0.1803 0.3795 0.1615 0.0276  0.0106  0.0150  884 THR A C   
59  O O   . THR A 12  ? 0.1881 0.3992 0.1749 0.0303  0.0148  -0.0013 884 THR A O   
60  C CB  . THR A 12  ? 0.1875 0.4020 0.1370 0.0264  0.0077  0.0266  884 THR A CB  
61  O OG1 . THR A 12  ? 0.2300 0.4351 0.1642 0.0264  0.0028  0.0358  884 THR A OG1 
62  C CG2 . THR A 12  ? 0.2125 0.4386 0.1573 0.0246  0.0112  0.0371  884 THR A CG2 
63  N N   . VAL A 13  ? 0.1761 0.3702 0.1650 0.0268  0.0096  0.0244  885 VAL A N   
64  C CA  . VAL A 13  ? 0.1552 0.3590 0.1622 0.0306  0.0130  0.0162  885 VAL A CA  
65  C C   . VAL A 13  ? 0.1973 0.4194 0.2082 0.0280  0.0152  0.0265  885 VAL A C   
66  O O   . VAL A 13  ? 0.1960 0.4165 0.1936 0.0226  0.0136  0.0408  885 VAL A O   
67  C CB  . VAL A 13  ? 0.1686 0.3444 0.1862 0.0332  0.0080  0.0150  885 VAL A CB  
68  C CG1 . VAL A 13  ? 0.2178 0.3731 0.2307 0.0342  0.0082  0.0033  885 VAL A CG1 
69  C CG2 . VAL A 13  ? 0.1982 0.3525 0.2104 0.0289  0.0005  0.0328  885 VAL A CG2 
70  N N   . ILE A 14  ? 0.1769 0.4157 0.2059 0.0317  0.0197  0.0188  886 ILE A N   
71  C CA  . ILE A 14  ? 0.1461 0.4042 0.1839 0.0283  0.0229  0.0267  886 ILE A CA  
72  C C   . ILE A 14  ? 0.1723 0.4198 0.2306 0.0308  0.0162  0.0294  886 ILE A C   
73  O O   . ILE A 14  ? 0.1913 0.4301 0.2619 0.0386  0.0142  0.0187  886 ILE A O   
74  C CB  . ILE A 14  ? 0.1426 0.4323 0.1880 0.0309  0.0342  0.0152  886 ILE A CB  
75  C CG1 . ILE A 14  ? 0.2271 0.5266 0.2493 0.0292  0.0397  0.0122  886 ILE A CG1 
76  C CG2 . ILE A 14  ? 0.1864 0.4965 0.2448 0.0264  0.0389  0.0222  886 ILE A CG2 
77  C CD1 . ILE A 14  ? 0.2569 0.5501 0.2561 0.0222  0.0374  0.0280  886 ILE A CD1 
78  N N   . THR A 15  ? 0.1609 0.4064 0.2208 0.0243  0.0120  0.0435  887 THR A N   
79  C CA  . THR A 15  ? 0.1698 0.4083 0.2501 0.0270  0.0041  0.0456  887 THR A CA  
80  C C   . THR A 15  ? 0.1711 0.4422 0.2731 0.0244  0.0089  0.0459  887 THR A C   
81  O O   . THR A 15  ? 0.1855 0.4755 0.2805 0.0160  0.0170  0.0512  887 THR A O   
82  C CB  . THR A 15  ? 0.1698 0.3764 0.2382 0.0218  -0.0070 0.0601  887 THR A CB  
83  O OG1 . THR A 15  ? 0.2142 0.4226 0.2646 0.0112  -0.0046 0.0737  887 THR A OG1 
84  C CG2 . THR A 15  ? 0.2556 0.4280 0.3086 0.0258  -0.0115 0.0572  887 THR A CG2 
85  N N   . LYS A 16  ? 0.1611 0.4380 0.2889 0.0320  0.0041  0.0393  888 LYS A N   
86  C CA  . LYS A 16  ? 0.1419 0.4537 0.2977 0.0317  0.0087  0.0359  888 LYS A CA  
87  C C   . LYS A 16  ? 0.1791 0.4852 0.3462 0.0265  -0.0030 0.0469  888 LYS A C   
88  O O   . LYS A 16  ? 0.2071 0.4831 0.3710 0.0310  -0.0164 0.0504  888 LYS A O   
89  C CB  . LYS A 16  ? 0.2229 0.5462 0.4012 0.0463  0.0105  0.0193  888 LYS A CB  
90  C CG  . LYS A 16  ? 0.2854 0.6482 0.4971 0.0491  0.0165  0.0124  888 LYS A CG  
91  C CD  . LYS A 16  ? 0.3182 0.6866 0.5465 0.0657  0.0188  -0.0044 888 LYS A CD  
92  C CE  . LYS A 16  ? 0.3131 0.6502 0.5447 0.0773  0.0030  -0.0056 888 LYS A CE  
93  N NZ  . LYS A 16  ? 0.3425 0.6830 0.5882 0.0943  0.0060  -0.0220 888 LYS A NZ  
94  N N   . HIS A 17  ? 0.1485 0.4818 0.3273 0.0161  0.0024  0.0520  889 HIS A N   
95  C CA  . HIS A 17  ? 0.1576 0.4894 0.3475 0.0086  -0.0079 0.0620  889 HIS A CA  
96  C C   . HIS A 17  ? 0.1309 0.5063 0.3572 0.0068  -0.0024 0.0553  889 HIS A C   
97  O O   . HIS A 17  ? 0.1707 0.5725 0.3982 -0.0035 0.0121  0.0556  889 HIS A O   
98  C CB  . HIS A 17  ? 0.1541 0.4676 0.3139 -0.0070 -0.0070 0.0783  889 HIS A CB  
99  C CG  . HIS A 17  ? 0.1901 0.4642 0.3167 -0.0046 -0.0114 0.0841  889 HIS A CG  
100 N ND1 . HIS A 17  ? 0.2298 0.4671 0.3444 -0.0042 -0.0253 0.0925  889 HIS A ND1 
101 C CD2 . HIS A 17  ? 0.2301 0.4972 0.3351 -0.0018 -0.0038 0.0810  889 HIS A CD2 
102 C CE1 . HIS A 17  ? 0.2271 0.4372 0.3150 -0.0019 -0.0246 0.0946  889 HIS A CE1 
103 N NE2 . HIS A 17  ? 0.2541 0.4830 0.3369 -0.0003 -0.0124 0.0875  889 HIS A NE2 
104 N N   . ARG A 18  ? 0.1062 0.8671 0.3861 0.0086  0.0411  0.0195  890 ARG A N   
105 C CA  . ARG A 18  ? 0.1538 0.8657 0.4087 0.0046  0.0354  0.0123  890 ARG A CA  
106 C C   . ARG A 18  ? 0.1087 0.8159 0.3462 0.0216  0.0410  -0.0162 890 ARG A C   
107 O O   . ARG A 18  ? 0.1745 0.9253 0.4140 0.0347  0.0516  -0.0268 890 ARG A O   
108 C CB  . ARG A 18  ? 0.2765 0.9959 0.5217 -0.0092 0.0370  0.0329  890 ARG A CB  
109 C CG  . ARG A 18  ? 0.3239 1.0379 0.5846 -0.0277 0.0287  0.0611  890 ARG A CG  
110 C CD  . ARG A 18  ? 0.4936 1.2288 0.7487 -0.0391 0.0326  0.0824  890 ARG A CD  
111 N NE  . ARG A 18  ? 0.6294 1.3725 0.9048 -0.0562 0.0261  0.1112  890 ARG A NE  
112 C CZ  . ARG A 18  ? 0.7205 1.4216 0.9937 -0.0708 0.0138  0.1243  890 ARG A CZ  
113 N NH1 . ARG A 18  ? 0.7587 1.4086 1.0097 -0.0699 0.0078  0.1117  890 ARG A NH1 
114 N NH2 . ARG A 18  ? 0.7763 1.4870 1.0703 -0.0862 0.0071  0.1501  890 ARG A NH2 
115 N N   . ASN A 19  ? 0.1173 0.7720 0.3397 0.0218  0.0333  -0.0287 891 ASN A N   
116 C CA  . ASN A 19  ? 0.1503 0.7918 0.3555 0.0348  0.0360  -0.0540 891 ASN A CA  
117 C C   . ASN A 19  ? 0.1686 0.7607 0.3539 0.0271  0.0292  -0.0548 891 ASN A C   
118 O O   . ASN A 19  ? 0.1899 0.7426 0.3687 0.0323  0.0234  -0.0705 891 ASN A O   
119 C CB  . ASN A 19  ? 0.1956 0.8271 0.4109 0.0494  0.0336  -0.0756 891 ASN A CB  
120 C CG  . ASN A 19  ? 0.4290 1.0599 0.6314 0.0649  0.0375  -0.1026 891 ASN A CG  
121 O OD1 . ASN A 19  ? 0.4698 1.1101 0.6550 0.0651  0.0422  -0.1058 891 ASN A OD1 
122 N ND2 . ASN A 19  ? 0.4672 1.0866 0.6787 0.0781  0.0346  -0.1221 891 ASN A ND2 
123 N N   . THR A 20  ? 0.1217 0.7167 0.2982 0.0147  0.0298  -0.0366 892 THR A N   
124 C CA  . THR A 20  ? 0.1415 0.6930 0.3004 0.0069  0.0239  -0.0344 892 THR A CA  
125 C C   . THR A 20  ? 0.1562 0.7052 0.2972 0.0164  0.0280  -0.0538 892 THR A C   
126 O O   . THR A 20  ? 0.1920 0.7809 0.3295 0.0235  0.0364  -0.0594 892 THR A O   
127 C CB  . THR A 20  ? 0.1923 0.7486 0.3501 -0.0089 0.0225  -0.0081 892 THR A CB  
128 O OG1 . THR A 20  ? 0.2179 0.7757 0.3946 -0.0176 0.0171  0.0084  892 THR A OG1 
129 C CG2 . THR A 20  ? 0.1961 0.7064 0.3366 -0.0161 0.0161  -0.0059 892 THR A CG2 
130 N N   . ARG A 21  ? 0.1340 0.6369 0.2646 0.0173  0.0216  -0.0645 893 ARG A N   
131 C CA  . ARG A 21  ? 0.1832 0.6781 0.2985 0.0249  0.0233  -0.0826 893 ARG A CA  
132 C C   . ARG A 21  ? 0.1973 0.6604 0.2974 0.0152  0.0194  -0.0738 893 ARG A C   
133 O O   . ARG A 21  ? 0.1536 0.5846 0.2542 0.0060  0.0131  -0.0615 893 ARG A O   
134 C CB  . ARG A 21  ? 0.2105 0.6808 0.3294 0.0363  0.0193  -0.1052 893 ARG A CB  
135 C CG  . ARG A 21  ? 0.2577 0.7584 0.3914 0.0490  0.0231  -0.1180 893 ARG A CG  
136 C CD  . ARG A 21  ? 0.3848 0.9317 0.5133 0.0584  0.0321  -0.1282 893 ARG A CD  
137 N NE  . ARG A 21  ? 0.5449 1.0773 0.6577 0.0635  0.0309  -0.1452 893 ARG A NE  
138 C CZ  . ARG A 21  ? 0.6614 1.1756 0.7755 0.0749  0.0271  -0.1687 893 ARG A CZ  
139 N NH1 . ARG A 21  ? 0.7457 1.2539 0.8754 0.0830  0.0245  -0.1779 893 ARG A NH1 
140 N NH2 . ARG A 21  ? 0.6419 1.1435 0.7428 0.0780  0.0251  -0.1824 893 ARG A NH2 
141 N N   . TYR A 22  ? 0.1678 0.6392 0.2542 0.0181  0.0227  -0.0812 894 TYR A N   
142 C CA  . TYR A 22  ? 0.1896 0.6341 0.2623 0.0101  0.0196  -0.0737 894 TYR A CA  
143 C C   . TYR A 22  ? 0.2163 0.6409 0.2797 0.0178  0.0177  -0.0941 894 TYR A C   
144 O O   . TYR A 22  ? 0.2393 0.6858 0.3020 0.0283  0.0208  -0.1120 894 TYR A O   
145 C CB  . TYR A 22  ? 0.2300 0.7061 0.2958 0.0037  0.0245  -0.0582 894 TYR A CB  
146 C CG  . TYR A 22  ? 0.2221 0.7202 0.2990 -0.0050 0.0260  -0.0360 894 TYR A CG  
147 C CD1 . TYR A 22  ? 0.2464 0.7202 0.3244 -0.0177 0.0205  -0.0159 894 TYR A CD1 
148 C CD2 . TYR A 22  ? 0.1922 0.7359 0.2797 -0.0004 0.0326  -0.0350 894 TYR A CD2 
149 C CE1 . TYR A 22  ? 0.2364 0.7285 0.3266 -0.0266 0.0202  0.0048  894 TYR A CE1 
150 C CE2 . TYR A 22  ? 0.2186 0.7837 0.3188 -0.0094 0.0335  -0.0131 894 TYR A CE2 
151 C CZ  . TYR A 22  ? 0.2122 0.7507 0.3144 -0.0231 0.0268  0.0070  894 TYR A CZ  
152 O OH  . TYR A 22  ? 0.2937 0.8524 0.4106 -0.0329 0.0262  0.0293  894 TYR A OH  
153 N N   . TYR A 23  ? 0.1970 0.5810 0.2536 0.0128  0.0123  -0.0916 895 TYR A N   
154 C CA  . TYR A 23  ? 0.1902 0.5539 0.2403 0.0184  0.0097  -0.1084 895 TYR A CA  
155 C C   . TYR A 23  ? 0.1750 0.5172 0.2136 0.0108  0.0077  -0.0988 895 TYR A C   
156 O O   . TYR A 23  ? 0.1734 0.4966 0.2104 0.0023  0.0057  -0.0822 895 TYR A O   
157 C CB  . TYR A 23  ? 0.2071 0.5368 0.2650 0.0228  0.0042  -0.1190 895 TYR A CB  
158 C CG  . TYR A 23  ? 0.2378 0.5845 0.3093 0.0308  0.0051  -0.1283 895 TYR A CG  
159 C CD1 . TYR A 23  ? 0.3301 0.6969 0.4049 0.0425  0.0069  -0.1487 895 TYR A CD1 
160 C CD2 . TYR A 23  ? 0.2544 0.5963 0.3354 0.0271  0.0034  -0.1172 895 TYR A CD2 
161 C CE1 . TYR A 23  ? 0.3160 0.6993 0.4041 0.0511  0.0079  -0.1575 895 TYR A CE1 
162 C CE2 . TYR A 23  ? 0.2624 0.6211 0.3573 0.0347  0.0041  -0.1249 895 TYR A CE2 
163 C CZ  . TYR A 23  ? 0.2849 0.6642 0.3834 0.0470  0.0068  -0.1449 895 TYR A CZ  
164 O OH  . TYR A 23  ? 0.3375 0.7341 0.4507 0.0557  0.0077  -0.1530 895 TYR A OH  
165 N N   . SER A 24  ? 0.1947 0.5396 0.2260 0.0146  0.0077  -0.1102 896 SER A N   
166 C CA  A SER A 24  ? 0.2037 0.5277 0.2257 0.0089  0.0055  -0.1035 896 SER A CA  
167 C CA  B SER A 24  ? 0.1934 0.5171 0.2155 0.0089  0.0055  -0.1035 896 SER A CA  
168 C C   . SER A 24  ? 0.2435 0.5243 0.2685 0.0088  0.0004  -0.1071 896 SER A C   
169 O O   . SER A 24  ? 0.2621 0.5328 0.2942 0.0154  -0.0021 -0.1220 896 SER A O   
170 C CB  A SER A 24  ? 0.2157 0.5584 0.2305 0.0133  0.0063  -0.1157 896 SER A CB  
171 C CB  B SER A 24  ? 0.2205 0.5625 0.2352 0.0130  0.0062  -0.1153 896 SER A CB  
172 O OG  A SER A 24  ? 0.1853 0.5109 0.1926 0.0077  0.0042  -0.1080 896 SER A OG  
173 O OG  B SER A 24  ? 0.2510 0.6333 0.2606 0.0125  0.0112  -0.1093 896 SER A OG  
174 N N   . CYS A 25  ? 0.1877 0.4433 0.2073 0.0019  -0.0012 -0.0933 897 CYS A N   
175 C CA  A CYS A 25  ? 0.1894 0.4059 0.2103 0.0017  -0.0052 -0.0939 897 CYS A CA  
176 C CA  B CYS A 25  ? 0.1701 0.3875 0.1911 0.0021  -0.0052 -0.0951 897 CYS A CA  
177 C C   . CYS A 25  ? 0.2016 0.3997 0.2142 -0.0033 -0.0057 -0.0835 897 CYS A C   
178 O O   . CYS A 25  ? 0.1904 0.4024 0.1970 -0.0079 -0.0037 -0.0725 897 CYS A O   
179 C CB  A CYS A 25  ? 0.1946 0.3952 0.2192 -0.0008 -0.0071 -0.0850 897 CYS A CB  
180 C CB  B CYS A 25  ? 0.1842 0.3860 0.2109 0.0013  -0.0073 -0.0899 897 CYS A CB  
181 S SG  A CYS A 25  ? 0.2730 0.4924 0.3096 0.0046  -0.0069 -0.0939 897 CYS A SG  
182 S SG  B CYS A 25  ? 0.1773 0.3874 0.2018 -0.0071 -0.0064 -0.0692 897 CYS A SG  
183 N N   . ARG A 26  ? 0.2068 0.3742 0.2197 -0.0023 -0.0084 -0.0858 898 ARG A N   
184 C CA  . ARG A 26  ? 0.1718 0.3203 0.1778 -0.0058 -0.0084 -0.0764 898 ARG A CA  
185 C C   . ARG A 26  ? 0.1632 0.2829 0.1657 -0.0080 -0.0098 -0.0657 898 ARG A C   
186 O O   . ARG A 26  ? 0.2014 0.3051 0.2078 -0.0055 -0.0120 -0.0698 898 ARG A O   
187 C CB  . ARG A 26  ? 0.1950 0.3326 0.2047 -0.0026 -0.0101 -0.0867 898 ARG A CB  
188 C CG  . ARG A 26  ? 0.2411 0.3632 0.2456 -0.0054 -0.0095 -0.0776 898 ARG A CG  
189 C CD  . ARG A 26  ? 0.3293 0.4441 0.3405 -0.0030 -0.0118 -0.0875 898 ARG A CD  
190 N NE  . ARG A 26  ? 0.3790 0.4920 0.3869 -0.0055 -0.0108 -0.0801 898 ARG A NE  
191 C CZ  . ARG A 26  ? 0.4041 0.4997 0.4166 -0.0053 -0.0118 -0.0793 898 ARG A CZ  
192 N NH1 . ARG A 26  ? 0.3292 0.4069 0.3492 -0.0030 -0.0139 -0.0848 898 ARG A NH1 
193 N NH2 . ARG A 26  ? 0.4022 0.4995 0.4128 -0.0073 -0.0107 -0.0720 898 ARG A NH2 
194 N N   . VAL A 27  ? 0.1673 0.2794 0.1620 -0.0122 -0.0091 -0.0522 899 VAL A N   
195 C CA  . VAL A 27  ? 0.1816 0.2655 0.1708 -0.0135 -0.0111 -0.0431 899 VAL A CA  
196 C C   . VAL A 27  ? 0.1806 0.2396 0.1675 -0.0102 -0.0109 -0.0454 899 VAL A C   
197 O O   . VAL A 27  ? 0.2052 0.2638 0.1899 -0.0101 -0.0090 -0.0433 899 VAL A O   
198 C CB  . VAL A 27  ? 0.1923 0.2755 0.1748 -0.0183 -0.0113 -0.0286 899 VAL A CB  
199 C CG1 . VAL A 27  ? 0.2202 0.2725 0.1958 -0.0185 -0.0144 -0.0214 899 VAL A CG1 
200 C CG2 . VAL A 27  ? 0.1912 0.3014 0.1783 -0.0225 -0.0115 -0.0241 899 VAL A CG2 
201 N N   . MET A 28  ? 0.1947 0.2348 0.1828 -0.0075 -0.0131 -0.0487 900 MET A N   
202 C CA  . MET A 28  ? 0.1983 0.2166 0.1853 -0.0043 -0.0127 -0.0499 900 MET A CA  
203 C C   . MET A 28  ? 0.2107 0.2045 0.1861 -0.0038 -0.0127 -0.0397 900 MET A C   
204 O O   . MET A 28  ? 0.2311 0.2109 0.2033 -0.0013 -0.0105 -0.0370 900 MET A O   
205 C CB  . MET A 28  ? 0.2461 0.2588 0.2416 -0.0011 -0.0154 -0.0591 900 MET A CB  
206 C CG  . MET A 28  ? 0.2641 0.2997 0.2711 0.0002  -0.0161 -0.0715 900 MET A CG  
207 S SD  . MET A 28  ? 0.2676 0.3187 0.2786 -0.0001 -0.0142 -0.0772 900 MET A SD  
208 C CE  . MET A 28  ? 0.2973 0.3234 0.3142 0.0021  -0.0157 -0.0783 900 MET A CE  
209 N N   . ALA A 29  ? 0.2054 0.1941 0.1750 -0.0057 -0.0154 -0.0343 901 ALA A N   
210 C CA  . ALA A 29  ? 0.2354 0.1998 0.1927 -0.0045 -0.0169 -0.0267 901 ALA A CA  
211 C C   . ALA A 29  ? 0.2653 0.2303 0.2192 -0.0086 -0.0210 -0.0208 901 ALA A C   
212 O O   . ALA A 29  ? 0.2413 0.2228 0.2033 -0.0119 -0.0232 -0.0227 901 ALA A O   
213 C CB  . ALA A 29  ? 0.2417 0.1862 0.1963 -0.0005 -0.0187 -0.0295 901 ALA A CB  
214 N N   . VAL A 30  ? 0.2532 0.2010 0.1963 -0.0082 -0.0224 -0.0135 902 VAL A N   
215 C CA  . VAL A 30  ? 0.2853 0.2266 0.2249 -0.0121 -0.0285 -0.0074 902 VAL A CA  
216 C C   . VAL A 30  ? 0.3369 0.2486 0.2636 -0.0080 -0.0326 -0.0070 902 VAL A C   
217 O O   . VAL A 30  ? 0.3333 0.2290 0.2495 -0.0027 -0.0298 -0.0059 902 VAL A O   
218 C CB  . VAL A 30  ? 0.2972 0.2443 0.2358 -0.0153 -0.0281 0.0010  902 VAL A CB  
219 C CG1 . VAL A 30  ? 0.3147 0.2545 0.2526 -0.0204 -0.0359 0.0081  902 VAL A CG1 
220 C CG2 . VAL A 30  ? 0.2765 0.2544 0.2256 -0.0185 -0.0238 0.0007  902 VAL A CG2 
221 N N   . THR A 31  ? 0.2787 0.1841 0.2060 -0.0099 -0.0391 -0.0082 903 THR A N   
222 C CA  . THR A 31  ? 0.3134 0.1912 0.2268 -0.0058 -0.0440 -0.0088 903 THR A CA  
223 C C   . THR A 31  ? 0.3717 0.2386 0.2822 -0.0102 -0.0537 -0.0045 903 THR A C   
224 O O   . THR A 31  ? 0.3995 0.2824 0.3216 -0.0173 -0.0565 -0.0004 903 THR A O   
225 C CB  . THR A 31  ? 0.4058 0.2804 0.3205 -0.0027 -0.0447 -0.0146 903 THR A CB  
226 O OG1 . THR A 31  ? 0.4083 0.3005 0.3374 -0.0077 -0.0480 -0.0165 903 THR A OG1 
227 C CG2 . THR A 31  ? 0.4463 0.3270 0.3642 0.0017  -0.0365 -0.0181 903 THR A CG2 
228 N N   . SER A 32  ? 0.3162 0.2943 0.3072 -0.0225 -0.0528 0.0036  904 SER A N   
229 C CA  . SER A 32  ? 0.3535 0.3223 0.3456 -0.0201 -0.0525 0.0115  904 SER A CA  
230 C C   . SER A 32  ? 0.2980 0.2590 0.2854 -0.0242 -0.0443 0.0143  904 SER A C   
231 O O   . SER A 32  ? 0.3523 0.3148 0.3401 -0.0283 -0.0389 0.0094  904 SER A O   
232 C CB  . SER A 32  ? 0.4322 0.4041 0.4385 -0.0178 -0.0551 0.0079  904 SER A CB  
233 O OG  . SER A 32  ? 0.5257 0.5044 0.5366 -0.0129 -0.0634 0.0055  904 SER A OG  
234 N N   . GLN A 33  ? 0.2847 0.2372 0.2682 -0.0229 -0.0434 0.0222  905 GLN A N   
235 C CA  . GLN A 33  ? 0.3068 0.2528 0.2860 -0.0260 -0.0363 0.0246  905 GLN A CA  
236 C C   . GLN A 33  ? 0.2659 0.2051 0.2502 -0.0240 -0.0362 0.0301  905 GLN A C   
237 O O   . GLN A 33  ? 0.2963 0.2319 0.2804 -0.0212 -0.0403 0.0363  905 GLN A O   
238 C CB  . GLN A 33  ? 0.2822 0.2264 0.2477 -0.0279 -0.0340 0.0277  905 GLN A CB  
239 C CG  . GLN A 33  ? 0.3180 0.2555 0.2782 -0.0301 -0.0277 0.0313  905 GLN A CG  
240 C CD  . GLN A 33  ? 0.3624 0.2999 0.3235 -0.0328 -0.0219 0.0256  905 GLN A CD  
241 O OE1 . GLN A 33  ? 0.3827 0.3239 0.3425 -0.0348 -0.0210 0.0204  905 GLN A OE1 
242 N NE2 . GLN A 33  ? 0.2923 0.2260 0.2563 -0.0327 -0.0179 0.0264  905 GLN A NE2 
243 N N   . THR A 34  ? 0.2492 0.1869 0.2387 -0.0251 -0.0316 0.0277  906 THR A N   
244 C CA  . THR A 34  ? 0.2488 0.1812 0.2449 -0.0239 -0.0305 0.0309  906 THR A CA  
245 C C   . THR A 34  ? 0.2466 0.1729 0.2329 -0.0263 -0.0260 0.0366  906 THR A C   
246 O O   . THR A 34  ? 0.3115 0.2386 0.2893 -0.0287 -0.0215 0.0348  906 THR A O   
247 C CB  . THR A 34  ? 0.2670 0.2030 0.2724 -0.0233 -0.0274 0.0247  906 THR A CB  
248 O OG1 . THR A 34  ? 0.3279 0.2707 0.3436 -0.0209 -0.0314 0.0194  906 THR A OG1 
249 C CG2 . THR A 34  ? 0.2894 0.2211 0.3026 -0.0223 -0.0260 0.0263  906 THR A CG2 
250 N N   . PHE A 35  ? 0.2600 0.1802 0.2478 -0.0255 -0.0271 0.0435  907 PHE A N   
251 C CA  . PHE A 35  ? 0.2946 0.2099 0.2745 -0.0280 -0.0223 0.0492  907 PHE A CA  
252 C C   . PHE A 35  ? 0.2925 0.2031 0.2844 -0.0284 -0.0197 0.0499  907 PHE A C   
253 O O   . PHE A 35  ? 0.3171 0.2261 0.3224 -0.0260 -0.0231 0.0490  907 PHE A O   
254 C CB  . PHE A 35  ? 0.2910 0.2033 0.2609 -0.0273 -0.0247 0.0581  907 PHE A CB  
255 C CG  . PHE A 35  ? 0.3312 0.2498 0.2884 -0.0272 -0.0267 0.0565  907 PHE A CG  
256 C CD1 . PHE A 35  ? 0.3880 0.3091 0.3342 -0.0300 -0.0223 0.0550  907 PHE A CD1 
257 C CD2 . PHE A 35  ? 0.3753 0.2981 0.3327 -0.0239 -0.0332 0.0556  907 PHE A CD2 
258 C CE1 . PHE A 35  ? 0.3550 0.2823 0.2916 -0.0300 -0.0243 0.0521  907 PHE A CE1 
259 C CE2 . PHE A 35  ? 0.4131 0.3432 0.3607 -0.0238 -0.0352 0.0524  907 PHE A CE2 
260 C CZ  . PHE A 35  ? 0.4087 0.3410 0.3464 -0.0270 -0.0306 0.0505  907 PHE A CZ  
261 N N   . TYR A 36  ? 0.2736 0.1829 0.2620 -0.0312 -0.0138 0.0503  908 TYR A N   
262 C CA  . TYR A 36  ? 0.2919 0.1977 0.2928 -0.0321 -0.0108 0.0503  908 TYR A CA  
263 C C   . TYR A 36  ? 0.3414 0.2395 0.3396 -0.0344 -0.0086 0.0605  908 TYR A C   
264 O O   . TYR A 36  ? 0.3318 0.2292 0.3150 -0.0356 -0.0074 0.0669  908 TYR A O   
265 C CB  . TYR A 36  ? 0.2900 0.2004 0.2910 -0.0333 -0.0055 0.0434  908 TYR A CB  
266 C CG  . TYR A 36  ? 0.2915 0.2091 0.2977 -0.0303 -0.0066 0.0340  908 TYR A CG  
267 C CD1 . TYR A 36  ? 0.2819 0.2023 0.2947 -0.0274 -0.0117 0.0313  908 TYR A CD1 
268 C CD2 . TYR A 36  ? 0.2796 0.2021 0.2836 -0.0298 -0.0024 0.0279  908 TYR A CD2 
269 C CE1 . TYR A 36  ? 0.2904 0.2183 0.3069 -0.0246 -0.0117 0.0234  908 TYR A CE1 
270 C CE2 . TYR A 36  ? 0.2916 0.2208 0.2985 -0.0263 -0.0028 0.0206  908 TYR A CE2 
271 C CZ  . TYR A 36  ? 0.2652 0.1973 0.2783 -0.0239 -0.0071 0.0187  908 TYR A CZ  
272 O OH  . TYR A 36  ? 0.2695 0.2091 0.2847 -0.0204 -0.0066 0.0122  908 TYR A OH  
273 N N   . GLU A 37  ? 0.3614 0.2540 0.3749 -0.0348 -0.0077 0.0618  909 GLU A N   
274 C CA  . GLU A 37  ? 0.3636 0.2474 0.3774 -0.0375 -0.0041 0.0720  909 GLU A CA  
275 C C   . GLU A 37  ? 0.3731 0.2581 0.3953 -0.0416 0.0030  0.0678  909 GLU A C   
276 O O   . GLU A 37  ? 0.3567 0.2441 0.3958 -0.0411 0.0031  0.0590  909 GLU A O   
277 C CB  . GLU A 37  ? 0.3460 0.2212 0.3729 -0.0349 -0.0083 0.0770  909 GLU A CB  
278 C CG  . GLU A 37  ? 0.3752 0.2517 0.3949 -0.0299 -0.0161 0.0789  909 GLU A CG  
279 C CD  . GLU A 37  ? 0.4726 0.3402 0.5039 -0.0262 -0.0210 0.0844  909 GLU A CD  
280 O OE1 . GLU A 37  ? 0.4452 0.3038 0.4905 -0.0279 -0.0180 0.0877  909 GLU A OE1 
281 O OE2 . GLU A 37  ? 0.4413 0.3110 0.4683 -0.0216 -0.0279 0.0849  909 GLU A OE2 
282 N N   . VAL A 38  ? 0.3452 0.2302 0.3558 -0.0453 0.0087  0.0728  910 VAL A N   
283 C CA  . VAL A 38  ? 0.3881 0.2757 0.4062 -0.0494 0.0157  0.0681  910 VAL A CA  
284 C C   . VAL A 38  ? 0.4152 0.2964 0.4310 -0.0542 0.0222  0.0790  910 VAL A C   
285 O O   . VAL A 38  ? 0.3994 0.2782 0.3989 -0.0543 0.0224  0.0896  910 VAL A O   
286 C CB  . VAL A 38  ? 0.3610 0.2587 0.3680 -0.0493 0.0177  0.0601  910 VAL A CB  
287 C CG1 . VAL A 38  ? 0.3492 0.2530 0.3576 -0.0446 0.0126  0.0504  910 VAL A CG1 
288 C CG2 . VAL A 38  ? 0.4076 0.3065 0.3934 -0.0504 0.0188  0.0671  910 VAL A CG2 
289 N N   . MET A 39  ? 0.3936 0.2732 0.4264 -0.0581 0.0277  0.0758  911 MET A N   
290 C CA  A MET A 39  ? 0.4234 0.2982 0.4567 -0.0639 0.0359  0.0844  911 MET A CA  
291 C CA  B MET A 39  ? 0.4190 0.2941 0.4508 -0.0638 0.0359  0.0848  911 MET A CA  
292 C C   . MET A 39  ? 0.3938 0.2793 0.4217 -0.0672 0.0418  0.0771  911 MET A C   
293 O O   . MET A 39  ? 0.4014 0.2938 0.4430 -0.0675 0.0431  0.0644  911 MET A O   
294 C CB  A MET A 39  ? 0.4440 0.3106 0.5028 -0.0669 0.0391  0.0839  911 MET A CB  
295 C CB  B MET A 39  ? 0.4407 0.3054 0.4949 -0.0672 0.0395  0.0881  911 MET A CB  
296 C CG  A MET A 39  ? 0.4159 0.2771 0.4793 -0.0741 0.0491  0.0920  911 MET A CG  
297 C CG  B MET A 39  ? 0.4133 0.2743 0.4674 -0.0742 0.0497  0.0967  911 MET A CG  
298 S SD  A MET A 39  ? 0.5025 0.3514 0.5475 -0.0741 0.0506  0.1145  911 MET A SD  
299 S SD  B MET A 39  ? 0.4463 0.2894 0.5201 -0.0782 0.0548  0.1087  911 MET A SD  
300 C CE  A MET A 39  ? 0.5547 0.3878 0.6177 -0.0706 0.0452  0.1199  911 MET A CE  
301 C CE  B MET A 39  ? 0.5520 0.3844 0.6092 -0.0713 0.0468  0.1241  911 MET A CE  
302 N N   . PHE A 40  ? 0.4143 0.3026 0.4229 -0.0689 0.0449  0.0842  912 PHE A N   
303 C CA  . PHE A 40  ? 0.4583 0.3572 0.4616 -0.0717 0.0504  0.0773  912 PHE A CA  
304 C C   . PHE A 40  ? 0.5457 0.4438 0.5647 -0.0783 0.0594  0.0774  912 PHE A C   
305 O O   . PHE A 40  ? 0.5230 0.4107 0.5507 -0.0817 0.0629  0.0875  912 PHE A O   
306 C CB  . PHE A 40  ? 0.4368 0.3402 0.4158 -0.0713 0.0508  0.0841  912 PHE A CB  
307 C CG  . PHE A 40  ? 0.3922 0.2988 0.3576 -0.0655 0.0429  0.0807  912 PHE A CG  
308 C CD1 . PHE A 40  ? 0.4244 0.3393 0.3867 -0.0632 0.0411  0.0686  912 PHE A CD1 
309 C CD2 . PHE A 40  ? 0.5302 0.4316 0.4867 -0.0622 0.0373  0.0894  912 PHE A CD2 
310 C CE1 . PHE A 40  ? 0.4460 0.3628 0.3975 -0.0586 0.0348  0.0656  912 PHE A CE1 
311 C CE2 . PHE A 40  ? 0.5552 0.4603 0.5012 -0.0576 0.0305  0.0851  912 PHE A CE2 
312 C CZ  . PHE A 40  ? 0.4896 0.4019 0.4338 -0.0564 0.0297  0.0734  912 PHE A CZ  
313 N N   . ASP A 41  ? 0.5393 0.4482 0.5626 -0.0801 0.0633  0.0658  913 ASP A N   
314 C CA  . ASP A 41  ? 0.5748 0.4854 0.6152 -0.0868 0.0722  0.0629  913 ASP A CA  
315 C C   . ASP A 41  ? 0.5877 0.4923 0.6212 -0.0930 0.0801  0.0786  913 ASP A C   
316 O O   . ASP A 41  ? 0.5791 0.4798 0.6292 -0.0995 0.0881  0.0809  913 ASP A O   
317 C CB  . ASP A 41  ? 0.5625 0.4881 0.6046 -0.0868 0.0747  0.0480  913 ASP A CB  
318 C CG  . ASP A 41  ? 0.5489 0.4808 0.6008 -0.0805 0.0683  0.0327  913 ASP A CG  
319 O OD1 . ASP A 41  ? 0.5528 0.4783 0.6152 -0.0776 0.0632  0.0323  913 ASP A OD1 
320 O OD2 . ASP A 41  ? 0.5615 0.5053 0.6105 -0.0779 0.0684  0.0211  913 ASP A OD2 
321 N N   . ASP A 42  ? 0.6261 0.5305 0.6357 -0.0909 0.0783  0.0891  914 ASP A N   
322 C CA  . ASP A 42  ? 0.6598 0.5605 0.6593 -0.0954 0.0857  0.1049  914 ASP A CA  
323 C C   . ASP A 42  ? 0.6642 0.5485 0.6673 -0.0951 0.0851  0.1204  914 ASP A C   
324 O O   . ASP A 42  ? 0.6646 0.5438 0.6595 -0.0982 0.0914  0.1357  914 ASP A O   
325 C CB  . ASP A 42  ? 0.7011 0.6109 0.6734 -0.0925 0.0839  0.1088  914 ASP A CB  
326 C CG  . ASP A 42  ? 0.7950 0.7000 0.7522 -0.0854 0.0744  0.1151  914 ASP A CG  
327 O OD1 . ASP A 42  ? 0.7938 0.6908 0.7611 -0.0820 0.0679  0.1129  914 ASP A OD1 
328 O OD2 . ASP A 42  ? 0.8272 0.7379 0.7632 -0.0831 0.0732  0.1213  914 ASP A OD2 
329 N N   . GLY A 43  ? 0.6713 0.5478 0.6857 -0.0909 0.0776  0.1169  915 GLY A N   
330 C CA  . GLY A 43  ? 0.6341 0.4946 0.6542 -0.0896 0.0759  0.1299  915 GLY A CA  
331 C C   . GLY A 43  ? 0.6457 0.5033 0.6455 -0.0821 0.0673  0.1389  915 GLY A C   
332 O O   . GLY A 43  ? 0.6762 0.5213 0.6799 -0.0791 0.0638  0.1483  915 GLY A O   
333 N N   . SER A 44  ? 0.6450 0.5145 0.6242 -0.0789 0.0637  0.1353  916 SER A N   
334 C CA  . SER A 44  ? 0.6423 0.5121 0.6037 -0.0717 0.0548  0.1403  916 SER A CA  
335 C C   . SER A 44  ? 0.6488 0.5171 0.6204 -0.0668 0.0454  0.1299  916 SER A C   
336 O O   . SER A 44  ? 0.6447 0.5178 0.6288 -0.0679 0.0448  0.1160  916 SER A O   
337 C CB  . SER A 44  ? 0.7463 0.6303 0.6858 -0.0704 0.0542  0.1371  916 SER A CB  
338 O OG  . SER A 44  ? 0.8792 0.7652 0.8037 -0.0636 0.0456  0.1396  916 SER A OG  
339 N N   . PHE A 45  ? 0.5797 0.4423 0.5457 -0.0610 0.0380  0.1364  917 PHE A N   
340 C CA  . PHE A 45  ? 0.6338 0.4948 0.6105 -0.0565 0.0294  0.1276  917 PHE A CA  
341 C C   . PHE A 45  ? 0.6289 0.4973 0.5891 -0.0507 0.0211  0.1252  917 PHE A C   
342 O O   . PHE A 45  ? 0.6856 0.5533 0.6309 -0.0471 0.0185  0.1354  917 PHE A O   
343 C CB  . PHE A 45  ? 0.6681 0.5149 0.6600 -0.0550 0.0277  0.1353  917 PHE A CB  
344 C CG  . PHE A 45  ? 0.6441 0.4901 0.6510 -0.0510 0.0198  0.1249  917 PHE A CG  
345 C CD1 . PHE A 45  ? 0.5469 0.3960 0.5734 -0.0533 0.0210  0.1115  917 PHE A CD1 
346 C CD2 . PHE A 45  ? 0.6310 0.4748 0.6327 -0.0443 0.0111  0.1282  917 PHE A CD2 
347 C CE1 . PHE A 45  ? 0.5632 0.4134 0.6032 -0.0492 0.0139  0.1020  917 PHE A CE1 
348 C CE2 . PHE A 45  ? 0.5882 0.4326 0.6040 -0.0407 0.0042  0.1184  917 PHE A CE2 
349 C CZ  . PHE A 45  ? 0.5130 0.3607 0.5476 -0.0432 0.0057  0.1056  917 PHE A CZ  
350 N N   . SER A 46  ? 0.4729 0.3488 0.4361 -0.0494 0.0172  0.1116  918 SER A N   
351 C CA  . SER A 46  ? 0.4425 0.3257 0.3930 -0.0450 0.0104  0.1075  918 SER A CA  
352 C C   . SER A 46  ? 0.4310 0.3118 0.3929 -0.0410 0.0030  0.1022  918 SER A C   
353 O O   . SER A 46  ? 0.4347 0.3142 0.4132 -0.0418 0.0033  0.0944  918 SER A O   
354 C CB  . SER A 46  ? 0.4359 0.3292 0.3800 -0.0468 0.0122  0.0965  918 SER A CB  
355 O OG  . SER A 46  ? 0.4950 0.3940 0.4320 -0.0431 0.0059  0.0907  918 SER A OG  
356 N N   . ARG A 47  ? 0.4184 0.3006 0.3720 -0.0362 -0.0038 0.1053  919 ARG A N   
357 C CA  . ARG A 47  ? 0.4401 0.3223 0.4039 -0.0322 -0.0109 0.0992  919 ARG A CA  
358 C C   . ARG A 47  ? 0.4166 0.3091 0.3725 -0.0305 -0.0151 0.0901  919 ARG A C   
359 O O   . ARG A 47  ? 0.4049 0.2994 0.3671 -0.0274 -0.0209 0.0850  919 ARG A O   
360 C CB  . ARG A 47  ? 0.4553 0.3301 0.4198 -0.0274 -0.0161 0.1090  919 ARG A CB  
361 C CG  . ARG A 47  ? 0.4723 0.3343 0.4493 -0.0288 -0.0124 0.1176  919 ARG A CG  
362 C CD  . ARG A 47  ? 0.5927 0.4463 0.5694 -0.0228 -0.0179 0.1281  919 ARG A CD  
363 N NE  . ARG A 47  ? 0.6612 0.5006 0.6539 -0.0241 -0.0145 0.1351  919 ARG A NE  
364 C CZ  . ARG A 47  ? 0.7640 0.5945 0.7534 -0.0272 -0.0072 0.1477  919 ARG A CZ  
365 N NH1 . ARG A 47  ? 0.7847 0.6203 0.7538 -0.0286 -0.0030 0.1548  919 ARG A NH1 
366 N NH2 . ARG A 47  ? 0.7335 0.5502 0.7404 -0.0289 -0.0038 0.1531  919 ARG A NH2 
367 N N   . ASP A 48  ? 0.3811 0.2800 0.3240 -0.0328 -0.0119 0.0877  920 ASP A N   
368 C CA  . ASP A 48  ? 0.3821 0.2897 0.3185 -0.0318 -0.0150 0.0792  920 ASP A CA  
369 C C   . ASP A 48  ? 0.4313 0.3427 0.3661 -0.0353 -0.0100 0.0711  920 ASP A C   
370 O O   . ASP A 48  ? 0.4016 0.3189 0.3263 -0.0357 -0.0099 0.0669  920 ASP A O   
371 C CB  . ASP A 48  ? 0.4545 0.3679 0.3756 -0.0290 -0.0188 0.0832  920 ASP A CB  
372 C CG  . ASP A 48  ? 0.5673 0.4828 0.4743 -0.0307 -0.0140 0.0894  920 ASP A CG  
373 O OD1 . ASP A 48  ? 0.4653 0.3773 0.3744 -0.0346 -0.0075 0.0912  920 ASP A OD1 
374 O OD2 . ASP A 48  ? 0.6238 0.5461 0.5178 -0.0279 -0.0169 0.0921  920 ASP A OD2 
375 N N   . THR A 49  ? 0.3656 0.2738 0.3112 -0.0371 -0.0062 0.0682  921 THR A N   
376 C CA  . THR A 49  ? 0.3502 0.2620 0.2955 -0.0389 -0.0020 0.0601  921 THR A CA  
377 C C   . THR A 49  ? 0.3335 0.2485 0.2832 -0.0370 -0.0048 0.0517  921 THR A C   
378 O O   . THR A 49  ? 0.3164 0.2305 0.2774 -0.0350 -0.0078 0.0498  921 THR A O   
379 C CB  . THR A 49  ? 0.3479 0.2571 0.3034 -0.0408 0.0030  0.0593  921 THR A CB  
380 O OG1 . THR A 49  ? 0.3841 0.2912 0.3341 -0.0436 0.0070  0.0671  921 THR A OG1 
381 C CG2 . THR A 49  ? 0.3178 0.2315 0.2737 -0.0410 0.0064  0.0501  921 THR A CG2 
382 N N   . PHE A 50  ? 0.2901 0.2087 0.2316 -0.0375 -0.0034 0.0466  922 PHE A N   
383 C CA  . PHE A 50  ? 0.2805 0.2012 0.2262 -0.0362 -0.0043 0.0396  922 PHE A CA  
384 C C   . PHE A 50  ? 0.2376 0.1584 0.1922 -0.0349 -0.0014 0.0351  922 PHE A C   
385 O O   . PHE A 50  ? 0.2627 0.1833 0.2160 -0.0356 0.0027  0.0342  922 PHE A O   
386 C CB  . PHE A 50  ? 0.2917 0.2146 0.2277 -0.0373 -0.0027 0.0354  922 PHE A CB  
387 C CG  . PHE A 50  ? 0.2889 0.2147 0.2176 -0.0379 -0.0062 0.0366  922 PHE A CG  
388 C CD1 . PHE A 50  ? 0.2586 0.1869 0.1919 -0.0367 -0.0110 0.0354  922 PHE A CD1 
389 C CD2 . PHE A 50  ? 0.4216 0.3496 0.3394 -0.0391 -0.0048 0.0375  922 PHE A CD2 
390 C CE1 . PHE A 50  ? 0.2813 0.2143 0.2084 -0.0366 -0.0146 0.0349  922 PHE A CE1 
391 C CE2 . PHE A 50  ? 0.4810 0.4142 0.3923 -0.0388 -0.0084 0.0371  922 PHE A CE2 
392 C CZ  . PHE A 50  ? 0.4042 0.3399 0.3204 -0.0374 -0.0135 0.0357  922 PHE A CZ  
393 N N   . PRO A 51  ? 0.2478 0.1706 0.2114 -0.0327 -0.0035 0.0314  923 PRO A N   
394 C CA  . PRO A 51  ? 0.2558 0.1811 0.2269 -0.0303 -0.0009 0.0262  923 PRO A CA  
395 C C   . PRO A 51  ? 0.2590 0.1848 0.2215 -0.0299 0.0039  0.0231  923 PRO A C   
396 O O   . PRO A 51  ? 0.2604 0.1882 0.2261 -0.0281 0.0067  0.0202  923 PRO A O   
397 C CB  . PRO A 51  ? 0.2553 0.1845 0.2335 -0.0280 -0.0037 0.0227  923 PRO A CB  
398 C CG  . PRO A 51  ? 0.2732 0.2009 0.2541 -0.0289 -0.0090 0.0266  923 PRO A CG  
399 C CD  . PRO A 51  ? 0.2224 0.1469 0.1909 -0.0317 -0.0086 0.0313  923 PRO A CD  
400 N N   . GLU A 52  ? 0.2677 0.1921 0.2204 -0.0311 0.0049  0.0230  924 GLU A N   
401 C CA  . GLU A 52  ? 0.2634 0.1868 0.2084 -0.0301 0.0093  0.0201  924 GLU A CA  
402 C C   . GLU A 52  ? 0.2814 0.2043 0.2207 -0.0313 0.0117  0.0208  924 GLU A C   
403 O O   . GLU A 52  ? 0.3080 0.2308 0.2424 -0.0295 0.0150  0.0177  924 GLU A O   
404 C CB  . GLU A 52  ? 0.3191 0.2400 0.2571 -0.0315 0.0100  0.0192  924 GLU A CB  
405 C CG  . GLU A 52  ? 0.3579 0.2785 0.2913 -0.0350 0.0073  0.0214  924 GLU A CG  
406 C CD  . GLU A 52  ? 0.5321 0.4549 0.4715 -0.0358 0.0028  0.0220  924 GLU A CD  
407 O OE1 . GLU A 52  ? 0.5485 0.4722 0.4845 -0.0379 0.0014  0.0207  924 GLU A OE1 
408 O OE2 . GLU A 52  ? 0.3111 0.2358 0.2594 -0.0342 0.0005  0.0228  924 GLU A OE2 
409 N N   . ASP A 53  ? 0.2548 0.1775 0.1947 -0.0340 0.0102  0.0251  925 ASP A N   
410 C CA  . ASP A 53  ? 0.2657 0.1891 0.2009 -0.0357 0.0132  0.0261  925 ASP A CA  
411 C C   . ASP A 53  ? 0.2976 0.2233 0.2422 -0.0349 0.0155  0.0242  925 ASP A C   
412 O O   . ASP A 53  ? 0.2870 0.2145 0.2294 -0.0365 0.0188  0.0239  925 ASP A O   
413 C CB  . ASP A 53  ? 0.3000 0.2229 0.2292 -0.0390 0.0118  0.0323  925 ASP A CB  
414 C CG  . ASP A 53  ? 0.3369 0.2603 0.2564 -0.0395 0.0101  0.0313  925 ASP A CG  
415 O OD1 . ASP A 53  ? 0.4035 0.3264 0.3201 -0.0384 0.0117  0.0261  925 ASP A OD1 
416 O OD2 . ASP A 53  ? 0.3834 0.3080 0.2987 -0.0407 0.0072  0.0354  925 ASP A OD2 
417 N N   . ILE A 54  ? 0.2344 0.1614 0.1902 -0.0323 0.0140  0.0217  926 ILE A N   
418 C CA  . ILE A 54  ? 0.2360 0.1674 0.2021 -0.0305 0.0162  0.0166  926 ILE A CA  
419 C C   . ILE A 54  ? 0.2530 0.1882 0.2139 -0.0259 0.0184  0.0102  926 ILE A C   
420 O O   . ILE A 54  ? 0.2792 0.2147 0.2381 -0.0222 0.0173  0.0085  926 ILE A O   
421 C CB  . ILE A 54  ? 0.3098 0.2432 0.2904 -0.0282 0.0133  0.0143  926 ILE A CB  
422 C CG1 . ILE A 54  ? 0.3347 0.2631 0.3215 -0.0315 0.0104  0.0207  926 ILE A CG1 
423 C CG2 . ILE A 54  ? 0.2705 0.2106 0.2626 -0.0257 0.0154  0.0069  926 ILE A CG2 
424 C CD1 . ILE A 54  ? 0.3324 0.2572 0.3189 -0.0360 0.0131  0.0262  926 ILE A CD1 
425 N N   . VAL A 55  ? 0.2538 0.1922 0.2123 -0.0256 0.0217  0.0068  927 VAL A N   
426 C CA  . VAL A 55  ? 0.2609 0.2020 0.2125 -0.0203 0.0235  0.0014  927 VAL A CA  
427 C C   . VAL A 55  ? 0.2370 0.1868 0.1981 -0.0149 0.0243  -0.0066 927 VAL A C   
428 O O   . VAL A 55  ? 0.2968 0.2495 0.2526 -0.0085 0.0250  -0.0108 927 VAL A O   
429 C CB  . VAL A 55  ? 0.3517 0.2917 0.2920 -0.0217 0.0260  0.0011  927 VAL A CB  
430 C CG1 . VAL A 55  ? 0.4412 0.3747 0.3718 -0.0255 0.0248  0.0068  927 VAL A CG1 
431 C CG2 . VAL A 55  ? 0.3279 0.2724 0.2732 -0.0254 0.0286  -0.0001 927 VAL A CG2 
432 N N   . SER A 56  ? 0.2363 0.1901 0.2115 -0.0169 0.0240  -0.0087 928 SER A N   
433 C CA  . SER A 56  ? 0.2521 0.2163 0.2394 -0.0118 0.0242  -0.0180 928 SER A CA  
434 C C   . SER A 56  ? 0.2422 0.2105 0.2356 -0.0062 0.0211  -0.0208 928 SER A C   
435 O O   . SER A 56  ? 0.2411 0.2200 0.2428 -0.0001 0.0207  -0.0293 928 SER A O   
436 C CB  . SER A 56  ? 0.2752 0.2421 0.2779 -0.0170 0.0258  -0.0202 928 SER A CB  
437 O OG  . SER A 56  ? 0.2761 0.2354 0.2849 -0.0223 0.0240  -0.0129 928 SER A OG  
438 N N   . ARG A 57  ? 0.2244 0.1860 0.2144 -0.0080 0.0188  -0.0142 929 ARG A N   
439 C CA  . ARG A 57  ? 0.2181 0.1842 0.2131 -0.0033 0.0161  -0.0162 929 ARG A CA  
440 C C   . ARG A 57  ? 0.2578 0.2157 0.2408 -0.0050 0.0156  -0.0088 929 ARG A C   
441 O O   . ARG A 57  ? 0.2461 0.1960 0.2257 -0.0112 0.0150  -0.0026 929 ARG A O   
442 C CB  . ARG A 57  ? 0.2011 0.1686 0.2131 -0.0059 0.0131  -0.0172 929 ARG A CB  
443 C CG  . ARG A 57  ? 0.2218 0.1958 0.2403 -0.0010 0.0099  -0.0203 929 ARG A CG  
444 C CD  . ARG A 57  ? 0.2450 0.2191 0.2811 -0.0037 0.0065  -0.0215 929 ARG A CD  
445 N NE  . ARG A 57  ? 0.2144 0.1957 0.2568 0.0008  0.0032  -0.0249 929 ARG A NE  
446 C CZ  . ARG A 57  ? 0.2383 0.2328 0.2929 0.0070  0.0017  -0.0347 929 ARG A CZ  
447 N NH1 . ARG A 57  ? 0.2673 0.2696 0.3303 0.0094  0.0031  -0.0429 929 ARG A NH1 
448 N NH2 . ARG A 57  ? 0.2473 0.2489 0.3064 0.0108  -0.0012 -0.0373 929 ARG A NH2 
449 N N   . ASP A 58  ? 0.2230 0.1835 0.2001 0.0005  0.0161  -0.0096 930 ASP A N   
450 C CA  . ASP A 58  ? 0.2174 0.1706 0.1855 -0.0017 0.0164  -0.0035 930 ASP A CA  
451 C C   . ASP A 58  ? 0.2353 0.1905 0.2133 -0.0035 0.0129  -0.0026 930 ASP A C   
452 O O   . ASP A 58  ? 0.2355 0.1983 0.2180 0.0014  0.0123  -0.0057 930 ASP A O   
453 C CB  . ASP A 58  ? 0.2456 0.2000 0.2041 0.0048  0.0195  -0.0038 930 ASP A CB  
454 C CG  . ASP A 58  ? 0.3314 0.2765 0.2806 0.0016  0.0213  0.0021  930 ASP A CG  
455 O OD1 . ASP A 58  ? 0.2950 0.2377 0.2483 -0.0035 0.0192  0.0048  930 ASP A OD1 
456 O OD2 . ASP A 58  ? 0.4182 0.3585 0.3567 0.0044  0.0248  0.0035  930 ASP A OD2 
457 N N   . CYS A 59  ? 0.2302 0.1797 0.2114 -0.0097 0.0105  0.0013  931 CYS A N   
458 C CA  . CYS A 59  ? 0.2431 0.1947 0.2357 -0.0108 0.0063  0.0014  931 CYS A CA  
459 C C   . CYS A 59  ? 0.2320 0.1836 0.2214 -0.0110 0.0055  0.0032  931 CYS A C   
460 O O   . CYS A 59  ? 0.2634 0.2207 0.2623 -0.0093 0.0026  0.0008  931 CYS A O   
461 C CB  . CYS A 59  ? 0.2362 0.1815 0.2328 -0.0162 0.0039  0.0057  931 CYS A CB  
462 S SG  . CYS A 59  ? 0.2554 0.2017 0.2604 -0.0170 0.0057  0.0030  931 CYS A SG  
463 N N   . LEU A 60  ? 0.2339 0.1797 0.2112 -0.0130 0.0083  0.0066  932 LEU A N   
464 C CA  . LEU A 60  ? 0.2476 0.1942 0.2236 -0.0135 0.0087  0.0075  932 LEU A CA  
465 C C   . LEU A 60  ? 0.2528 0.2073 0.2303 -0.0076 0.0112  0.0045  932 LEU A C   
466 O O   . LEU A 60  ? 0.2792 0.2384 0.2608 -0.0074 0.0108  0.0039  932 LEU A O   
467 C CB  . LEU A 60  ? 0.2752 0.2137 0.2400 -0.0173 0.0117  0.0108  932 LEU A CB  
468 C CG  . LEU A 60  ? 0.3726 0.3058 0.3351 -0.0228 0.0089  0.0134  932 LEU A CG  
469 C CD1 . LEU A 60  ? 0.4123 0.3399 0.3663 -0.0260 0.0117  0.0144  932 LEU A CD1 
470 C CD2 . LEU A 60  ? 0.4145 0.3508 0.3860 -0.0244 0.0035  0.0137  932 LEU A CD2 
471 N N   . LYS A 61  ? 0.2420 0.1994 0.2160 -0.0023 0.0138  0.0023  933 LYS A N   
472 C CA  . LYS A 61  ? 0.2390 0.2054 0.2127 0.0048  0.0162  -0.0002 933 LYS A CA  
473 C C   . LYS A 61  ? 0.2172 0.1964 0.2041 0.0094  0.0124  -0.0069 933 LYS A C   
474 O O   . LYS A 61  ? 0.2559 0.2453 0.2466 0.0139  0.0125  -0.0095 933 LYS A O   
475 C CB  . LYS A 61  ? 0.2555 0.2197 0.2177 0.0100  0.0205  0.0004  933 LYS A CB  
476 C CG  . LYS A 61  ? 0.2613 0.2142 0.2111 0.0077  0.0253  0.0063  933 LYS A CG  
477 C CD  . LYS A 61  ? 0.2682 0.2191 0.2071 0.0145  0.0292  0.0068  933 LYS A CD  
478 C CE  . LYS A 61  ? 0.3038 0.2426 0.2318 0.0130  0.0344  0.0127  933 LYS A CE  
479 N NZ  . LYS A 61  ? 0.3396 0.2750 0.2565 0.0206  0.0379  0.0136  933 LYS A NZ  
480 N N   . LEU A 62  ? 0.2221 0.2016 0.2169 0.0084  0.0096  -0.0102 934 LEU A N   
481 C CA  . LEU A 62  ? 0.1826 0.1744 0.1920 0.0131  0.0065  -0.0184 934 LEU A CA  
482 C C   . LEU A 62  ? 0.2370 0.2280 0.2616 0.0089  0.0015  -0.0199 934 LEU A C   
483 O O   . LEU A 62  ? 0.2829 0.2831 0.3222 0.0121  -0.0013 -0.0274 934 LEU A O   
484 C CB  . LEU A 62  ? 0.2149 0.2099 0.2246 0.0165  0.0078  -0.0232 934 LEU A CB  
485 C CG  . LEU A 62  ? 0.1955 0.1924 0.1907 0.0228  0.0121  -0.0225 934 LEU A CG  
486 C CD1 . LEU A 62  ? 0.2206 0.2225 0.2177 0.0265  0.0127  -0.0289 934 LEU A CD1 
487 C CD2 . LEU A 62  ? 0.2321 0.2406 0.2256 0.0307  0.0129  -0.0247 934 LEU A CD2 
488 N N   . GLY A 63  ? 0.2445 0.2250 0.2663 0.0023  0.0001  -0.0134 935 GLY A N   
489 C CA  . GLY A 63  ? 0.2922 0.2697 0.3264 -0.0012 -0.0047 -0.0132 935 GLY A CA  
490 C C   . GLY A 63  ? 0.3026 0.2726 0.3400 -0.0047 -0.0045 -0.0114 935 GLY A C   
491 O O   . GLY A 63  ? 0.2528 0.2222 0.2839 -0.0044 -0.0009 -0.0119 935 GLY A O   
492 N N   . PRO A 64  ? 0.2671 0.2318 0.3144 -0.0079 -0.0081 -0.0091 936 PRO A N   
493 C CA  . PRO A 64  ? 0.2507 0.2070 0.3004 -0.0122 -0.0070 -0.0054 936 PRO A CA  
494 C C   . PRO A 64  ? 0.2632 0.2253 0.3246 -0.0103 -0.0050 -0.0129 936 PRO A C   
495 O O   . PRO A 64  ? 0.2859 0.2594 0.3577 -0.0050 -0.0062 -0.0219 936 PRO A O   
496 C CB  . PRO A 64  ? 0.2672 0.2175 0.3272 -0.0141 -0.0116 -0.0018 936 PRO A CB  
497 C CG  . PRO A 64  ? 0.3187 0.2779 0.3876 -0.0097 -0.0158 -0.0079 936 PRO A CG  
498 C CD  . PRO A 64  ? 0.2909 0.2565 0.3467 -0.0076 -0.0132 -0.0091 936 PRO A CD  
499 N N   . PRO A 65  ? 0.2657 0.2215 0.3260 -0.0145 -0.0018 -0.0097 937 PRO A N   
500 C CA  . PRO A 65  ? 0.2623 0.2233 0.3369 -0.0140 0.0004  -0.0173 937 PRO A CA  
501 C C   . PRO A 65  ? 0.2760 0.2371 0.3725 -0.0140 -0.0031 -0.0211 937 PRO A C   
502 O O   . PRO A 65  ? 0.3008 0.2559 0.3992 -0.0147 -0.0070 -0.0160 937 PRO A O   
503 C CB  . PRO A 65  ? 0.2784 0.2305 0.3466 -0.0202 0.0047  -0.0104 937 PRO A CB  
504 C CG  . PRO A 65  ? 0.2710 0.2156 0.3185 -0.0224 0.0048  -0.0008 937 PRO A CG  
505 C CD  . PRO A 65  ? 0.2659 0.2102 0.3141 -0.0202 -0.0003 0.0007  937 PRO A CD  
506 N N   . ALA A 66  ? 0.3015 0.2697 0.4156 -0.0128 -0.0019 -0.0308 938 ALA A N   
507 C CA  . ALA A 66  ? 0.3035 0.2699 0.4409 -0.0137 -0.0046 -0.0346 938 ALA A CA  
508 C C   . ALA A 66  ? 0.3054 0.2552 0.4444 -0.0211 -0.0022 -0.0235 938 ALA A C   
509 O O   . ALA A 66  ? 0.3499 0.2942 0.4768 -0.0255 0.0026  -0.0170 938 ALA A O   
510 C CB  . ALA A 66  ? 0.3331 0.3128 0.4907 -0.0106 -0.0038 -0.0496 938 ALA A CB  
511 N N   . GLU A 67  ? 0.3411 0.2830 0.4945 -0.0221 -0.0055 -0.0210 939 GLU A N   
512 C CA  . GLU A 67  ? 0.4349 0.3604 0.5897 -0.0283 -0.0028 -0.0092 939 GLU A CA  
513 C C   . GLU A 67  ? 0.4025 0.3279 0.5708 -0.0330 0.0037  -0.0133 939 GLU A C   
514 O O   . GLU A 67  ? 0.4150 0.3499 0.6040 -0.0313 0.0038  -0.0267 939 GLU A O   
515 C CB  . GLU A 67  ? 0.4342 0.3507 0.6022 -0.0272 -0.0080 -0.0056 939 GLU A CB  
516 C CG  . GLU A 67  ? 0.5123 0.4299 0.6669 -0.0229 -0.0143 -0.0019 939 GLU A CG  
517 C CD  . GLU A 67  ? 0.6856 0.5912 0.8473 -0.0222 -0.0191 0.0056  939 GLU A CD  
518 O OE1 . GLU A 67  ? 0.7219 0.6328 0.8947 -0.0174 -0.0252 -0.0011 939 GLU A OE1 
519 O OE2 . GLU A 67  ? 0.7946 0.6861 0.9502 -0.0260 -0.0167 0.0185  939 GLU A OE2 
520 N N   . GLY A 68  ? 0.4475 0.3136 0.6597 -0.0641 -0.0162 0.0332  940 GLY A N   
521 C CA  . GLY A 68  ? 0.4219 0.2937 0.6465 -0.0693 -0.0101 0.0384  940 GLY A CA  
522 C C   . GLY A 68  ? 0.4100 0.2938 0.6200 -0.0687 -0.0067 0.0290  940 GLY A C   
523 O O   . GLY A 68  ? 0.4321 0.3234 0.6483 -0.0725 -0.0012 0.0330  940 GLY A O   
524 N N   . GLU A 69  ? 0.3499 0.2359 0.5410 -0.0638 -0.0096 0.0173  941 GLU A N   
525 C CA  . GLU A 69  ? 0.3672 0.2635 0.5464 -0.0624 -0.0069 0.0079  941 GLU A CA  
526 C C   . GLU A 69  ? 0.3380 0.2428 0.4973 -0.0615 -0.0014 0.0171  941 GLU A C   
527 O O   . GLU A 69  ? 0.3413 0.2452 0.4853 -0.0596 -0.0012 0.0261  941 GLU A O   
528 C CB  . GLU A 69  ? 0.4195 0.3154 0.5864 -0.0575 -0.0114 -0.0061 941 GLU A CB  
529 C CG  . GLU A 69  ? 0.3654 0.2715 0.5210 -0.0551 -0.0087 -0.0145 941 GLU A CG  
530 C CD  . GLU A 69  ? 0.4941 0.4006 0.6421 -0.0508 -0.0130 -0.0275 941 GLU A CD  
531 O OE1 . GLU A 69  ? 0.4102 0.3097 0.5600 -0.0499 -0.0180 -0.0304 941 GLU A OE1 
532 O OE2 . GLU A 69  ? 0.5673 0.4821 0.7083 -0.0482 -0.0113 -0.0342 941 GLU A OE2 
533 N N   . VAL A 70  ? 0.3529 0.2678 0.5137 -0.0630 0.0031  0.0141  942 VAL A N   
534 C CA  . VAL A 70  ? 0.2966 0.2218 0.4395 -0.0618 0.0083  0.0197  942 VAL A CA  
535 C C   . VAL A 70  ? 0.3580 0.2842 0.4772 -0.0556 0.0068  0.0118  942 VAL A C   
536 O O   . VAL A 70  ? 0.3452 0.2698 0.4631 -0.0526 0.0041  -0.0004 942 VAL A O   
537 C CB  . VAL A 70  ? 0.3635 0.2999 0.5157 -0.0645 0.0131  0.0165  942 VAL A CB  
538 C CG1 . VAL A 70  ? 0.4001 0.3486 0.5326 -0.0619 0.0177  0.0184  942 VAL A CG1 
539 C CG2 . VAL A 70  ? 0.3985 0.3349 0.5738 -0.0716 0.0159  0.0264  942 VAL A CG2 
540 N N   . VAL A 71  ? 0.2956 0.2250 0.3971 -0.0536 0.0085  0.0189  943 VAL A N   
541 C CA  . VAL A 71  ? 0.2792 0.2094 0.3601 -0.0482 0.0076  0.0112  943 VAL A CA  
542 C C   . VAL A 71  ? 0.3002 0.2432 0.3672 -0.0469 0.0128  0.0147  943 VAL A C   
543 O O   . VAL A 71  ? 0.3265 0.2784 0.3972 -0.0501 0.0166  0.0254  943 VAL A O   
544 C CB  . VAL A 71  ? 0.2606 0.1824 0.3325 -0.0460 0.0033  0.0122  943 VAL A CB  
545 C CG1 . VAL A 71  ? 0.3153 0.2255 0.3995 -0.0465 -0.0024 0.0061  943 VAL A CG1 
546 C CG2 . VAL A 71  ? 0.3270 0.2528 0.3966 -0.0477 0.0046  0.0266  943 VAL A CG2 
547 N N   . GLN A 72  ? 0.2448 0.1897 0.2976 -0.0422 0.0133  0.0054  944 GLN A N   
548 C CA  . GLN A 72  ? 0.2816 0.2389 0.3206 -0.0401 0.0175  0.0061  944 GLN A CA  
549 C C   . GLN A 72  ? 0.2738 0.2284 0.2981 -0.0371 0.0154  0.0042  944 GLN A C   
550 O O   . GLN A 72  ? 0.2601 0.2037 0.2811 -0.0347 0.0118  -0.0037 944 GLN A O   
551 C CB  . GLN A 72  ? 0.3038 0.2660 0.3394 -0.0366 0.0200  -0.0039 944 GLN A CB  
552 C CG  . GLN A 72  ? 0.4218 0.3867 0.4716 -0.0386 0.0213  -0.0053 944 GLN A CG  
553 N N   . VAL A 73  ? 0.2658 0.2326 0.2820 -0.0374 0.0179  0.0114  945 VAL A N   
554 C CA  . VAL A 73  ? 0.2739 0.2425 0.2772 -0.0348 0.0162  0.0101  945 VAL A CA  
555 C C   . VAL A 73  ? 0.3490 0.3323 0.3397 -0.0317 0.0200  0.0033  945 VAL A C   
556 O O   . VAL A 73  ? 0.2992 0.2987 0.2895 -0.0325 0.0244  0.0076  945 VAL A O   
557 C CB  . VAL A 73  ? 0.2508 0.2248 0.2554 -0.0372 0.0154  0.0245  945 VAL A CB  
558 C CG1 . VAL A 73  ? 0.3404 0.3191 0.3312 -0.0341 0.0136  0.0223  945 VAL A CG1 
559 C CG2 . VAL A 73  ? 0.3557 0.3150 0.3759 -0.0403 0.0118  0.0310  945 VAL A CG2 
560 N N   . LYS A 74  ? 0.2891 0.2678 0.2707 -0.0282 0.0186  -0.0078 946 LYS A N   
561 C CA  . LYS A 74  ? 0.3123 0.3052 0.2840 -0.0251 0.0220  -0.0161 946 LYS A CA  
562 C C   . LYS A 74  ? 0.3008 0.3080 0.2627 -0.0245 0.0219  -0.0134 946 LYS A C   
563 O O   . LYS A 74  ? 0.3069 0.3074 0.2661 -0.0246 0.0182  -0.0119 946 LYS A O   
564 C CB  . LYS A 74  ? 0.3810 0.3634 0.3505 -0.0214 0.0218  -0.0308 946 LYS A CB  
565 C CG  . LYS A 74  ? 0.5252 0.4946 0.4905 -0.0206 0.0179  -0.0364 946 LYS A CG  
566 C CD  . LYS A 74  ? 0.6258 0.5867 0.5898 -0.0173 0.0189  -0.0499 946 LYS A CD  
567 C CE  . LYS A 74  ? 0.6519 0.5945 0.6168 -0.0175 0.0149  -0.0533 946 LYS A CE  
568 N NZ  . LYS A 74  ? 0.6809 0.6252 0.6388 -0.0183 0.0127  -0.0552 946 LYS A NZ  
569 N N   . TRP A 75  ? 0.3030 0.3326 0.2599 -0.0236 0.0261  -0.0136 947 TRP A N   
570 C CA  . TRP A 75  ? 0.2846 0.3341 0.2317 -0.0224 0.0266  -0.0125 947 TRP A CA  
571 C C   . TRP A 75  ? 0.3500 0.4028 0.2909 -0.0186 0.0275  -0.0311 947 TRP A C   
572 O O   . TRP A 75  ? 0.3495 0.3937 0.2943 -0.0170 0.0290  -0.0413 947 TRP A O   
573 C CB  . TRP A 75  ? 0.2973 0.3726 0.2435 -0.0237 0.0309  -0.0023 947 TRP A CB  
574 C CG  . TRP A 75  ? 0.3220 0.4208 0.2594 -0.0229 0.0312  0.0044  947 TRP A CG  
575 C CD1 . TRP A 75  ? 0.3177 0.4455 0.2466 -0.0205 0.0343  -0.0019 947 TRP A CD1 
576 C CD2 . TRP A 75  ? 0.3812 0.4783 0.3175 -0.0239 0.0279  0.0180  947 TRP A CD2 
577 N NE1 . TRP A 75  ? 0.3599 0.5061 0.2818 -0.0199 0.0334  0.0077  947 TRP A NE1 
578 C CE2 . TRP A 75  ? 0.4347 0.5617 0.3610 -0.0218 0.0294  0.0207  947 TRP A CE2 
579 C CE3 . TRP A 75  ? 0.4380 0.5127 0.3819 -0.0260 0.0238  0.0279  947 TRP A CE3 
580 C CZ2 . TRP A 75  ? 0.4883 0.6227 0.4111 -0.0212 0.0269  0.0341  947 TRP A CZ2 
581 C CZ3 . TRP A 75  ? 0.4811 0.5616 0.4226 -0.0255 0.0213  0.0405  947 TRP A CZ3 
582 C CH2 . TRP A 75  ? 0.4812 0.5909 0.4119 -0.0231 0.0228  0.0442  947 TRP A CH2 
583 N N   . PRO A 76  ? 0.3938 0.4594 0.3264 -0.0170 0.0268  -0.0360 948 PRO A N   
584 C CA  . PRO A 76  ? 0.3813 0.4456 0.3117 -0.0140 0.0275  -0.0553 948 PRO A CA  
585 C C   . PRO A 76  ? 0.4338 0.5109 0.3662 -0.0117 0.0321  -0.0666 948 PRO A C   
586 O O   . PRO A 76  ? 0.4425 0.5103 0.3775 -0.0094 0.0327  -0.0820 948 PRO A O   
587 C CB  . PRO A 76  ? 0.3576 0.4392 0.2794 -0.0130 0.0263  -0.0583 948 PRO A CB  
588 C CG  . PRO A 76  ? 0.4699 0.5469 0.3907 -0.0151 0.0227  -0.0407 948 PRO A CG  
589 C CD  . PRO A 76  ? 0.4430 0.5206 0.3697 -0.0174 0.0246  -0.0258 948 PRO A CD  
590 N N   . ASP A 77  ? 0.3954 0.4929 0.3275 -0.0122 0.0352  -0.0595 949 ASP A N   
591 C CA  . ASP A 77  ? 0.4163 0.5266 0.3512 -0.0096 0.0393  -0.0710 949 ASP A CA  
592 C C   . ASP A 77  ? 0.3607 0.4531 0.3041 -0.0096 0.0401  -0.0697 949 ASP A C   
593 O O   . ASP A 77  ? 0.3979 0.5009 0.3447 -0.0075 0.0434  -0.0768 949 ASP A O   
594 C CB  . ASP A 77  ? 0.4028 0.5494 0.3327 -0.0097 0.0427  -0.0669 949 ASP A CB  
595 C CG  . ASP A 77  ? 0.3597 0.5113 0.2909 -0.0135 0.0435  -0.0461 949 ASP A CG  
596 O OD1 . ASP A 77  ? 0.3594 0.4871 0.2959 -0.0163 0.0412  -0.0355 949 ASP A OD1 
597 O OD2 . ASP A 77  ? 0.3455 0.5271 0.2733 -0.0140 0.0467  -0.0408 949 ASP A OD2 
598 N N   . GLY A 78  ? 0.3686 0.4360 0.3161 -0.0118 0.0370  -0.0612 950 GLY A N   
599 C CA  . GLY A 78  ? 0.4204 0.4712 0.3762 -0.0113 0.0372  -0.0612 950 GLY A CA  
600 C C   . GLY A 78  ? 0.3505 0.4070 0.3108 -0.0147 0.0384  -0.0475 950 GLY A C   
601 O O   . GLY A 78  ? 0.3789 0.4229 0.3467 -0.0148 0.0382  -0.0462 950 GLY A O   
602 N N   . LYS A 79  ? 0.3090 0.3859 0.2657 -0.0174 0.0400  -0.0371 951 LYS A N   
603 C CA  . LYS A 79  ? 0.3094 0.3913 0.2722 -0.0215 0.0416  -0.0229 951 LYS A CA  
604 C C   . LYS A 79  ? 0.3017 0.3599 0.2717 -0.0246 0.0377  -0.0138 951 LYS A C   
605 O O   . LYS A 79  ? 0.3154 0.3623 0.2825 -0.0249 0.0340  -0.0119 951 LYS A O   
606 C CB  . LYS A 79  ? 0.2957 0.4038 0.2538 -0.0241 0.0440  -0.0110 951 LYS A CB  
607 C CG  . LYS A 79  ? 0.2962 0.4337 0.2491 -0.0216 0.0484  -0.0190 951 LYS A CG  
608 C CD  . LYS A 79  ? 0.3047 0.4705 0.2549 -0.0250 0.0516  -0.0038 951 LYS A CD  
609 C CE  . LYS A 79  ? 0.2909 0.4764 0.2305 -0.0235 0.0508  -0.0020 951 LYS A CE  
610 N NZ  . LYS A 79  ? 0.2904 0.4549 0.2285 -0.0238 0.0459  0.0036  951 LYS A NZ  
611 N N   . LEU A 80  ? 0.2921 0.3446 0.2720 -0.0270 0.0386  -0.0092 952 LEU A N   
612 C CA  . LEU A 80  ? 0.2917 0.3239 0.2810 -0.0299 0.0352  -0.0030 952 LEU A CA  
613 C C   . LEU A 80  ? 0.2667 0.3057 0.2646 -0.0356 0.0367  0.0128  952 LEU A C   
614 O O   . LEU A 80  ? 0.2843 0.3406 0.2847 -0.0376 0.0412  0.0174  952 LEU A O   
615 C CB  . LEU A 80  ? 0.3250 0.3453 0.3214 -0.0280 0.0348  -0.0118 952 LEU A CB  
616 C CG  . LEU A 80  ? 0.3704 0.3808 0.3614 -0.0224 0.0334  -0.0258 952 LEU A CG  
617 C CD1 . LEU A 80  ? 0.4062 0.4093 0.4051 -0.0201 0.0336  -0.0315 952 LEU A CD1 
618 C CD2 . LEU A 80  ? 0.3797 0.3740 0.3673 -0.0222 0.0289  -0.0269 952 LEU A CD2 
619 N N   . TYR A 81  ? 0.2623 0.2873 0.2663 -0.0383 0.0332  0.0210  953 TYR A N   
620 C CA  . TYR A 81  ? 0.2607 0.2886 0.2752 -0.0438 0.0342  0.0371  953 TYR A CA  
621 C C   . TYR A 81  ? 0.3018 0.3097 0.3319 -0.0467 0.0309  0.0387  953 TYR A C   
622 O O   . TYR A 81  ? 0.3471 0.3387 0.3768 -0.0447 0.0262  0.0319  953 TYR A O   
623 C CB  . TYR A 81  ? 0.2946 0.3295 0.3022 -0.0439 0.0332  0.0482  953 TYR A CB  
624 C CG  . TYR A 81  ? 0.2790 0.3388 0.2722 -0.0413 0.0366  0.0475  953 TYR A CG  
625 C CD1 . TYR A 81  ? 0.3066 0.3889 0.3005 -0.0442 0.0414  0.0598  953 TYR A CD1 
626 C CD2 . TYR A 81  ? 0.2723 0.3347 0.2526 -0.0363 0.0352  0.0337  953 TYR A CD2 
627 C CE1 . TYR A 81  ? 0.3183 0.4274 0.2994 -0.0417 0.0445  0.0580  953 TYR A CE1 
628 C CE2 . TYR A 81  ? 0.2777 0.3653 0.2465 -0.0338 0.0383  0.0307  953 TYR A CE2 
629 C CZ  . TYR A 81  ? 0.3056 0.4173 0.2745 -0.0363 0.0428  0.0425  953 TYR A CZ  
630 O OH  . TYR A 81  ? 0.3135 0.4535 0.2714 -0.0337 0.0456  0.0384  953 TYR A OH  
631 N N   . GLY A 82  ? 0.2841 0.2945 0.3290 -0.0519 0.0334  0.0473  954 GLY A N   
632 C CA  . GLY A 82  ? 0.2854 0.2792 0.3482 -0.0553 0.0305  0.0490  954 GLY A CA  
633 C C   . GLY A 82  ? 0.3310 0.3177 0.3987 -0.0573 0.0279  0.0620  954 GLY A C   
634 O O   . GLY A 82  ? 0.3535 0.3520 0.4165 -0.0584 0.0303  0.0754  954 GLY A O   
635 N N   . ALA A 83  ? 0.3090 0.2778 0.3863 -0.0574 0.0228  0.0581  955 ALA A N   
636 C CA  . ALA A 83  ? 0.3008 0.2607 0.3852 -0.0586 0.0196  0.0691  955 ALA A CA  
637 C C   . ALA A 83  ? 0.3367 0.2792 0.4405 -0.0605 0.0153  0.0631  955 ALA A C   
638 O O   . ALA A 83  ? 0.3761 0.3161 0.4864 -0.0608 0.0151  0.0509  955 ALA A O   
639 C CB  . ALA A 83  ? 0.3559 0.3158 0.4218 -0.0535 0.0163  0.0674  955 ALA A CB  
640 N N   . LYS A 84  ? 0.3535 0.2861 0.4678 -0.0615 0.0120  0.0716  956 LYS A N   
641 C CA  . LYS A 84  ? 0.3682 0.2852 0.5003 -0.0625 0.0070  0.0640  956 LYS A CA  
642 C C   . LYS A 84  ? 0.3177 0.2261 0.4420 -0.0584 0.0012  0.0634  956 LYS A C   
643 O O   . LYS A 84  ? 0.3699 0.2817 0.4868 -0.0570 0.0013  0.0761  956 LYS A O   
644 C CB  . LYS A 84  ? 0.4322 0.3441 0.5919 -0.0684 0.0085  0.0742  956 LYS A CB  
645 C CG  . LYS A 84  ? 0.5036 0.4189 0.6789 -0.0727 0.0117  0.0663  956 LYS A CG  
646 C CD  . LYS A 84  ? 0.5047 0.4171 0.7073 -0.0795 0.0148  0.0782  956 LYS A CD  
647 C CE  . LYS A 84  ? 0.5010 0.3971 0.7269 -0.0807 0.0097  0.0776  956 LYS A CE  
648 N NZ  . LYS A 84  ? 0.6232 0.5153 0.8776 -0.0876 0.0134  0.0912  956 LYS A NZ  
649 N N   . TYR A 85  ? 0.3245 0.2239 0.4502 -0.0562 -0.0037 0.0486  957 TYR A N   
650 C CA  . TYR A 85  ? 0.3179 0.2098 0.4366 -0.0525 -0.0094 0.0456  957 TYR A CA  
651 C C   . TYR A 85  ? 0.3594 0.2404 0.4996 -0.0541 -0.0133 0.0519  957 TYR A C   
652 O O   . TYR A 85  ? 0.3626 0.2375 0.5257 -0.0574 -0.0142 0.0476  957 TYR A O   
653 C CB  . TYR A 85  ? 0.3294 0.2177 0.4410 -0.0498 -0.0129 0.0276  957 TYR A CB  
654 C CG  . TYR A 85  ? 0.2930 0.1736 0.4008 -0.0467 -0.0190 0.0228  957 TYR A CG  
655 C CD1 . TYR A 85  ? 0.3352 0.2188 0.4224 -0.0432 -0.0198 0.0242  957 TYR A CD1 
656 C CD2 . TYR A 85  ? 0.3276 0.1996 0.4533 -0.0474 -0.0241 0.0156  957 TYR A CD2 
657 C CE1 . TYR A 85  ? 0.3209 0.1986 0.4047 -0.0406 -0.0253 0.0191  957 TYR A CE1 
658 C CE2 . TYR A 85  ? 0.3272 0.1936 0.4495 -0.0446 -0.0299 0.0105  957 TYR A CE2 
659 C CZ  . TYR A 85  ? 0.3193 0.1883 0.4201 -0.0412 -0.0304 0.0126  957 TYR A CZ  
660 O OH  . TYR A 85  ? 0.3182 0.1828 0.4158 -0.0386 -0.0359 0.0072  957 TYR A OH  
661 N N   . PHE A 86  ? 0.3473 0.2267 0.4816 -0.0515 -0.0156 0.0618  958 PHE A N   
662 C CA  . PHE A 86  ? 0.3878 0.2564 0.5439 -0.0523 -0.0192 0.0692  958 PHE A CA  
663 C C   . PHE A 86  ? 0.3451 0.2070 0.4973 -0.0478 -0.0259 0.0650  958 PHE A C   
664 O O   . PHE A 86  ? 0.5085 0.3621 0.6775 -0.0474 -0.0291 0.0725  958 PHE A O   
665 C CB  . PHE A 86  ? 0.4857 0.3578 0.6503 -0.0547 -0.0150 0.0909  958 PHE A CB  
666 C CG  . PHE A 86  ? 0.5448 0.4191 0.7254 -0.0606 -0.0094 0.0941  958 PHE A CG  
667 C CD1 . PHE A 86  ? 0.6606 0.5267 0.8636 -0.0640 -0.0108 0.0818  958 PHE A CD1 
668 C CD2 . PHE A 86  ? 0.6417 0.5289 0.8145 -0.0628 -0.0028 0.1075  958 PHE A CD2 
669 C CE1 . PHE A 86  ? 0.6612 0.5307 0.8800 -0.0698 -0.0056 0.0832  958 PHE A CE1 
670 C CE2 . PHE A 86  ? 0.6796 0.5700 0.8675 -0.0687 0.0024  0.1095  958 PHE A CE2 
671 C CZ  . PHE A 86  ? 0.6823 0.5632 0.8934 -0.0722 0.0010  0.0972  958 PHE A CZ  
672 N N   . GLY A 87  ? 0.3920 0.2572 0.5237 -0.0445 -0.0280 0.0525  959 GLY A N   
673 C CA  . GLY A 87  ? 0.3460 0.2056 0.4749 -0.0407 -0.0344 0.0461  959 GLY A CA  
674 C C   . GLY A 87  ? 0.3393 0.2072 0.4407 -0.0369 -0.0344 0.0438  959 GLY A C   
675 O O   . GLY A 87  ? 0.3392 0.2171 0.4246 -0.0370 -0.0295 0.0455  959 GLY A O   
676 N N   . SER A 88  ? 0.3179 0.1828 0.4152 -0.0335 -0.0399 0.0391  960 SER A N   
677 C CA  . SER A 88  ? 0.2952 0.1681 0.3683 -0.0302 -0.0402 0.0342  960 SER A CA  
678 C C   . SER A 88  ? 0.3485 0.2226 0.4195 -0.0262 -0.0446 0.0410  960 SER A C   
679 O O   . SER A 88  ? 0.3463 0.2125 0.4355 -0.0255 -0.0484 0.0470  960 SER A O   
680 C CB  . SER A 88  ? 0.3447 0.2146 0.4109 -0.0303 -0.0422 0.0156  960 SER A CB  
681 O OG  . SER A 88  ? 0.3763 0.2380 0.4553 -0.0296 -0.0484 0.0079  960 SER A OG  
682 N N   . ASN A 89  ? 0.3283 0.2134 0.3783 -0.0233 -0.0439 0.0400  961 ASN A N   
683 C CA  . ASN A 89  ? 0.3420 0.2308 0.3875 -0.0188 -0.0484 0.0436  961 ASN A CA  
684 C C   . ASN A 89  ? 0.3293 0.2255 0.3543 -0.0171 -0.0491 0.0297  961 ASN A C   
685 O O   . ASN A 89  ? 0.3378 0.2365 0.3523 -0.0192 -0.0453 0.0202  961 ASN A O   
686 C CB  . ASN A 89  ? 0.3775 0.2777 0.4207 -0.0164 -0.0462 0.0635  961 ASN A CB  
687 C CG  . ASN A 89  ? 0.3824 0.2996 0.4067 -0.0167 -0.0400 0.0659  961 ASN A CG  
688 O OD1 . ASN A 89  ? 0.3936 0.3222 0.3997 -0.0144 -0.0399 0.0573  961 ASN A OD1 
689 N ND2 . ASN A 89  ? 0.3971 0.3175 0.4269 -0.0197 -0.0348 0.0766  961 ASN A ND2 
690 N N   . ILE A 90  ? 0.3228 0.2222 0.3434 -0.0133 -0.0538 0.0283  962 ILE A N   
691 C CA  . ILE A 90  ? 0.4067 0.3151 0.4087 -0.0119 -0.0541 0.0158  962 ILE A CA  
692 C C   . ILE A 90  ? 0.3704 0.2969 0.3601 -0.0078 -0.0530 0.0256  962 ILE A C   
693 O O   . ILE A 90  ? 0.3874 0.3165 0.3836 -0.0042 -0.0561 0.0385  962 ILE A O   
694 C CB  . ILE A 90  ? 0.3865 0.2878 0.3920 -0.0108 -0.0604 0.0036  962 ILE A CB  
695 C CG1 . ILE A 90  ? 0.4632 0.3508 0.4802 -0.0147 -0.0613 -0.0069 962 ILE A CG1 
696 C CG2 . ILE A 90  ? 0.3907 0.3031 0.3776 -0.0094 -0.0605 -0.0078 962 ILE A CG2 
697 C CD1 . ILE A 90  ? 0.5558 0.4383 0.5785 -0.0139 -0.0677 -0.0186 962 ILE A CD1 
698 N N   . ALA A 91  ? 0.3401 0.3070 0.2330 -0.0814 -0.0833 -0.0222 963 ALA A N   
699 C CA  . ALA A 91  ? 0.3289 0.3065 0.2341 -0.0832 -0.0718 -0.0225 963 ALA A CA  
700 C C   . ALA A 91  ? 0.2876 0.2686 0.1989 -0.0719 -0.0642 -0.0218 963 ALA A C   
701 O O   . ALA A 91  ? 0.3726 0.3410 0.2722 -0.0634 -0.0661 -0.0203 963 ALA A O   
702 C CB  . ALA A 91  ? 0.4241 0.4269 0.3528 -0.0927 -0.0718 -0.0241 963 ALA A CB  
703 N N   . HIS A 92  ? 0.3287 0.3242 0.2557 -0.0722 -0.0555 -0.0227 964 HIS A N   
704 C CA  . HIS A 92  ? 0.3343 0.3302 0.2656 -0.0622 -0.0484 -0.0222 964 HIS A CA  
705 C C   . HIS A 92  ? 0.3581 0.3763 0.3133 -0.0588 -0.0470 -0.0242 964 HIS A C   
706 O O   . HIS A 92  ? 0.3683 0.4058 0.3404 -0.0650 -0.0482 -0.0266 964 HIS A O   
707 C CB  . HIS A 92  ? 0.4214 0.4090 0.3464 -0.0627 -0.0389 -0.0218 964 HIS A CB  
708 C CG  . HIS A 92  ? 0.4896 0.4546 0.3931 -0.0633 -0.0396 -0.0201 964 HIS A CG  
709 N ND1 . HIS A 92  ? 0.6378 0.5960 0.5331 -0.0721 -0.0412 -0.0203 964 HIS A ND1 
710 C CD2 . HIS A 92  ? 0.4786 0.4259 0.3672 -0.0561 -0.0384 -0.0185 964 HIS A CD2 
711 C CE1 . HIS A 92  ? 0.7113 0.6485 0.5885 -0.0692 -0.0413 -0.0194 964 HIS A CE1 
712 N NE2 . HIS A 92  ? 0.6658 0.5969 0.5389 -0.0596 -0.0389 -0.0185 964 HIS A NE2 
713 N N   . MET A 93  ? 0.2711 0.2862 0.2280 -0.0487 -0.0446 -0.0233 965 MET A N   
714 C CA  . MET A 93  ? 0.2495 0.2819 0.2276 -0.0436 -0.0411 -0.0257 965 MET A CA  
715 C C   . MET A 93  ? 0.2614 0.2874 0.2371 -0.0395 -0.0312 -0.0257 965 MET A C   
716 O O   . MET A 93  ? 0.2720 0.2799 0.2315 -0.0372 -0.0289 -0.0228 965 MET A O   
717 C CB  . MET A 93  ? 0.2735 0.3070 0.2573 -0.0347 -0.0493 -0.0245 965 MET A CB  
718 C CG  . MET A 93  ? 0.2869 0.3319 0.2799 -0.0382 -0.0611 -0.0252 965 MET A CG  
719 S SD  . MET A 93  ? 0.2582 0.3367 0.2844 -0.0438 -0.0579 -0.0306 965 MET A SD  
720 C CE  . MET A 93  ? 0.2636 0.3520 0.3093 -0.0306 -0.0547 -0.0328 965 MET A CE  
721 N N   . TYR A 94  ? 0.1901 0.2311 0.1823 -0.0388 -0.0252 -0.0293 966 TYR A N   
722 C CA  . TYR A 94  ? 0.2065 0.2421 0.1967 -0.0365 -0.0166 -0.0300 966 TYR A CA  
723 C C   . TYR A 94  ? 0.2099 0.2508 0.2132 -0.0270 -0.0154 -0.0319 966 TYR A C   
724 O O   . TYR A 94  ? 0.2045 0.2635 0.2261 -0.0257 -0.0151 -0.0360 966 TYR A O   
725 C CB  . TYR A 94  ? 0.2625 0.3078 0.2563 -0.0452 -0.0100 -0.0332 966 TYR A CB  
726 C CG  . TYR A 94  ? 0.2681 0.3055 0.2479 -0.0547 -0.0119 -0.0310 966 TYR A CG  
727 C CD1 . TYR A 94  ? 0.2567 0.2782 0.2218 -0.0566 -0.0092 -0.0288 966 TYR A CD1 
728 C CD2 . TYR A 94  ? 0.2625 0.3072 0.2444 -0.0614 -0.0173 -0.0309 966 TYR A CD2 
729 C CE1 . TYR A 94  ? 0.3178 0.3298 0.2700 -0.0642 -0.0117 -0.0267 966 TYR A CE1 
730 C CE2 . TYR A 94  ? 0.3055 0.3399 0.2732 -0.0701 -0.0198 -0.0288 966 TYR A CE2 
731 C CZ  . TYR A 94  ? 0.3409 0.3583 0.2934 -0.0710 -0.0169 -0.0267 966 TYR A CZ  
732 O OH  . TYR A 94  ? 0.3867 0.3922 0.3252 -0.0786 -0.0199 -0.0247 966 TYR A OH  
733 N N   . GLN A 95  ? 0.2027 0.2283 0.1979 -0.0204 -0.0148 -0.0288 967 GLN A N   
734 C CA  . GLN A 95  ? 0.1912 0.2180 0.1968 -0.0115 -0.0140 -0.0301 967 GLN A CA  
735 C C   . GLN A 95  ? 0.2069 0.2375 0.2181 -0.0129 -0.0056 -0.0343 967 GLN A C   
736 O O   . GLN A 95  ? 0.2172 0.2372 0.2176 -0.0165 -0.0014 -0.0328 967 GLN A O   
737 C CB  . GLN A 95  ? 0.2250 0.2322 0.2182 -0.0054 -0.0160 -0.0246 967 GLN A CB  
738 C CG  . GLN A 95  ? 0.2516 0.2562 0.2536 0.0037  -0.0166 -0.0249 967 GLN A CG  
739 C CD  . GLN A 95  ? 0.2711 0.2831 0.2833 0.0099  -0.0257 -0.0250 967 GLN A CD  
740 O OE1 . GLN A 95  ? 0.2902 0.3084 0.3017 0.0070  -0.0323 -0.0244 967 GLN A OE1 
741 N NE2 . GLN A 95  ? 0.3506 0.3610 0.3724 0.0184  -0.0272 -0.0259 967 GLN A NE2 
742 N N   . VAL A 96  ? 0.2081 0.2532 0.2358 -0.0099 -0.0033 -0.0398 968 VAL A N   
743 C CA  . VAL A 96  ? 0.2034 0.2510 0.2338 -0.0114 0.0048  -0.0448 968 VAL A CA  
744 C C   . VAL A 96  ? 0.2434 0.2890 0.2837 -0.0018 0.0059  -0.0479 968 VAL A C   
745 O O   . VAL A 96  ? 0.2773 0.3274 0.3288 0.0059  0.0010  -0.0481 968 VAL A O   
746 C CB  . VAL A 96  ? 0.1972 0.2634 0.2356 -0.0186 0.0099  -0.0502 968 VAL A CB  
747 C CG1 . VAL A 96  ? 0.2286 0.2940 0.2557 -0.0289 0.0079  -0.0465 968 VAL A CG1 
748 C CG2 . VAL A 96  ? 0.2155 0.3014 0.2756 -0.0135 0.0085  -0.0546 968 VAL A CG2 
749 N N   . GLU A 97  ? 0.2275 0.2654 0.2632 -0.0025 0.0115  -0.0504 969 GLU A N   
750 C CA  . GLU A 97  ? 0.2187 0.2519 0.2617 0.0057  0.0130  -0.0541 969 GLU A CA  
751 C C   . GLU A 97  ? 0.2753 0.3177 0.3239 0.0042  0.0207  -0.0629 969 GLU A C   
752 O O   . GLU A 97  ? 0.2819 0.3228 0.3202 -0.0039 0.0254  -0.0644 969 GLU A O   
753 C CB  . GLU A 97  ? 0.2638 0.2761 0.2955 0.0065  0.0120  -0.0493 969 GLU A CB  
754 C CG  . GLU A 97  ? 0.2881 0.2917 0.3250 0.0135  0.0131  -0.0527 969 GLU A CG  
755 C CD  . GLU A 97  ? 0.4457 0.4301 0.4726 0.0120  0.0125  -0.0476 969 GLU A CD  
756 O OE1 . GLU A 97  ? 0.4458 0.4263 0.4666 0.0059  0.0158  -0.0491 969 GLU A OE1 
757 O OE2 . GLU A 97  ? 0.4157 0.3890 0.4408 0.0164  0.0087  -0.0417 969 GLU A OE2 
758 N N   . PHE A 98  ? 0.2402 0.2908 0.3040 0.0126  0.0219  -0.0689 970 PHE A N   
759 C CA  . PHE A 98  ? 0.2569 0.3170 0.3265 0.0125  0.0305  -0.0785 970 PHE A CA  
760 C C   . PHE A 98  ? 0.3125 0.3559 0.3758 0.0163  0.0326  -0.0820 970 PHE A C   
761 O O   . PHE A 98  ? 0.3389 0.3648 0.3964 0.0194  0.0272  -0.0766 970 PHE A O   
762 C CB  . PHE A 98  ? 0.2659 0.3459 0.3583 0.0200  0.0314  -0.0841 970 PHE A CB  
763 C CG  . PHE A 98  ? 0.2536 0.3513 0.3537 0.0148  0.0289  -0.0812 970 PHE A CG  
764 C CD1 . PHE A 98  ? 0.2701 0.3827 0.3695 0.0048  0.0366  -0.0845 970 PHE A CD1 
765 C CD2 . PHE A 98  ? 0.2983 0.3958 0.4038 0.0188  0.0186  -0.0749 970 PHE A CD2 
766 C CE1 . PHE A 98  ? 0.2628 0.3909 0.3696 -0.0012 0.0336  -0.0815 970 PHE A CE1 
767 C CE2 . PHE A 98  ? 0.3421 0.4546 0.4540 0.0133  0.0150  -0.0724 970 PHE A CE2 
768 C CZ  . PHE A 98  ? 0.3061 0.4339 0.4193 0.0031  0.0224  -0.0756 970 PHE A CZ  
769 N N   . GLU A 99  ? 0.3849 0.4328 0.4479 0.0152  0.0409  -0.0910 971 GLU A N   
770 C CA  . GLU A 99  ? 0.4737 0.5044 0.5278 0.0172  0.0428  -0.0954 971 GLU A CA  
771 C C   . GLU A 99  ? 0.4529 0.4731 0.5170 0.0294  0.0382  -0.0964 971 GLU A C   
772 O O   . GLU A 99  ? 0.5111 0.5116 0.5666 0.0302  0.0357  -0.0954 971 GLU A O   
773 C CB  . GLU A 99  ? 0.5356 0.5728 0.5854 0.0140  0.0530  -0.1058 971 GLU A CB  
774 C CG  . GLU A 99  ? 0.6745 0.7144 0.7079 0.0006  0.0565  -0.1039 971 GLU A CG  
775 C CD  . GLU A 99  ? 0.8541 0.9001 0.8804 -0.0034 0.0675  -0.1140 971 GLU A CD  
776 O OE1 . GLU A 99  ? 0.9215 0.9701 0.9566 0.0049  0.0731  -0.1233 971 GLU A OE1 
777 O OE2 . GLU A 99  ? 0.8984 0.9453 0.9092 -0.0147 0.0706  -0.1126 971 GLU A OE2 
778 N N   . ASP A 100 ? 0.4637 0.4961 0.5462 0.0384  0.0362  -0.0977 972 ASP A N   
779 C CA  . ASP A 100 ? 0.5136 0.5345 0.6053 0.0506  0.0305  -0.0979 972 ASP A CA  
780 C C   . ASP A 100 ? 0.4878 0.4951 0.5746 0.0516  0.0203  -0.0861 972 ASP A C   
781 O O   . ASP A 100 ? 0.5399 0.5360 0.6325 0.0609  0.0142  -0.0841 972 ASP A O   
782 C CB  . ASP A 100 ? 0.5035 0.5425 0.6187 0.0613  0.0317  -0.1050 972 ASP A CB  
783 C CG  . ASP A 100 ? 0.4908 0.5493 0.6184 0.0606  0.0270  -0.0999 972 ASP A CG  
784 O OD1 . ASP A 100 ? 0.4435 0.4998 0.5596 0.0522  0.0230  -0.0910 972 ASP A OD1 
785 O OD2 . ASP A 100 ? 0.4641 0.5401 0.6139 0.0689  0.0269  -0.1050 972 ASP A OD2 
786 N N   . GLY A 101 ? 0.4280 0.4352 0.5033 0.0421  0.0189  -0.0783 973 GLY A N   
787 C CA  . GLY A 101 ? 0.4172 0.4113 0.4852 0.0421  0.0113  -0.0676 973 GLY A CA  
788 C C   . GLY A 101 ? 0.3995 0.4042 0.4747 0.0452  0.0049  -0.0628 973 GLY A C   
789 O O   . GLY A 101 ? 0.4281 0.4223 0.4938 0.0440  -0.0007 -0.0538 973 GLY A O   
790 N N   . SER A 102 ? 0.3877 0.4129 0.4795 0.0489  0.0057  -0.0687 974 SER A N   
791 C CA  . SER A 102 ? 0.3718 0.4085 0.4719 0.0511  -0.0018 -0.0647 974 SER A CA  
792 C C   . SER A 102 ? 0.3363 0.3784 0.4250 0.0398  -0.0013 -0.0598 974 SER A C   
793 O O   . SER A 102 ? 0.3189 0.3615 0.3981 0.0310  0.0058  -0.0613 974 SER A O   
794 C CB  . SER A 102 ? 0.3214 0.3812 0.4463 0.0578  -0.0010 -0.0727 974 SER A CB  
795 O OG  . SER A 102 ? 0.3551 0.4331 0.4845 0.0504  0.0094  -0.0799 974 SER A OG  
796 N N   . GLN A 103 ? 0.2887 0.3329 0.3769 0.0401  -0.0097 -0.0538 975 GLN A N   
797 C CA  . GLN A 103 ? 0.2793 0.3265 0.3559 0.0300  -0.0102 -0.0495 975 GLN A CA  
798 C C   . GLN A 103 ? 0.3044 0.3682 0.3925 0.0299  -0.0172 -0.0492 975 GLN A C   
799 O O   . GLN A 103 ? 0.3518 0.4208 0.4543 0.0387  -0.0246 -0.0497 975 GLN A O   
800 C CB  . GLN A 103 ? 0.2675 0.2925 0.3227 0.0278  -0.0133 -0.0408 975 GLN A CB  
801 C CG  . GLN A 103 ? 0.3024 0.3120 0.3479 0.0263  -0.0068 -0.0404 975 GLN A CG  
802 C CD  . GLN A 103 ? 0.3548 0.3466 0.3816 0.0225  -0.0076 -0.0323 975 GLN A CD  
803 O OE1 . GLN A 103 ? 0.3295 0.3198 0.3480 0.0204  -0.0120 -0.0276 975 GLN A OE1 
804 N NE2 . GLN A 103 ? 0.3992 0.3775 0.4199 0.0215  -0.0033 -0.0310 975 GLN A NE2 
805 N N   . ILE A 104 ? 0.2488 0.3199 0.3307 0.0198  -0.0160 -0.0480 976 ILE A N   
806 C CA  . ILE A 104 ? 0.2668 0.3524 0.3579 0.0174  -0.0235 -0.0472 976 ILE A CA  
807 C C   . ILE A 104 ? 0.2565 0.3369 0.3297 0.0062  -0.0234 -0.0432 976 ILE A C   
808 O O   . ILE A 104 ? 0.2622 0.3355 0.3228 -0.0002 -0.0156 -0.0432 976 ILE A O   
809 C CB  . ILE A 104 ? 0.2638 0.3771 0.3813 0.0174  -0.0192 -0.0552 976 ILE A CB  
810 C CG1 . ILE A 104 ? 0.3772 0.5068 0.5110 0.0179  -0.0296 -0.0544 976 ILE A CG1 
811 C CG2 . ILE A 104 ? 0.2854 0.4078 0.3991 0.0060  -0.0080 -0.0589 976 ILE A CG2 
812 C CD1 . ILE A 104 ? 0.4069 0.5654 0.5721 0.0202  -0.0252 -0.0626 976 ILE A CD1 
813 N N   . ALA A 105 ? 0.2406 0.3220 0.3113 0.0041  -0.0331 -0.0396 977 ALA A N   
814 C CA  . ALA A 105 ? 0.2466 0.3233 0.3016 -0.0063 -0.0339 -0.0367 977 ALA A CA  
815 C C   . ALA A 105 ? 0.1831 0.2827 0.2534 -0.0151 -0.0318 -0.0410 977 ALA A C   
816 O O   . ALA A 105 ? 0.2179 0.3369 0.3103 -0.0130 -0.0368 -0.0438 977 ALA A O   
817 C CB  . ALA A 105 ? 0.3793 0.4419 0.4199 -0.0047 -0.0454 -0.0308 977 ALA A CB  
818 N N   . MET A 106 ? 0.2064 0.3039 0.2657 -0.0253 -0.0250 -0.0412 978 MET A N   
819 C CA  . MET A 106 ? 0.1954 0.3127 0.2665 -0.0354 -0.0209 -0.0448 978 MET A CA  
820 C C   . MET A 106 ? 0.2236 0.3330 0.2791 -0.0462 -0.0252 -0.0411 978 MET A C   
821 O O   . MET A 106 ? 0.2204 0.3085 0.2534 -0.0474 -0.0257 -0.0372 978 MET A O   
822 C CB  . MET A 106 ? 0.3008 0.4218 0.3712 -0.0394 -0.0079 -0.0488 978 MET A CB  
823 C CG  . MET A 106 ? 0.3996 0.5196 0.4764 -0.0295 -0.0022 -0.0524 978 MET A CG  
824 S SD  . MET A 106 ? 0.3060 0.4558 0.4145 -0.0260 0.0033  -0.0606 978 MET A SD  
825 C CE  . MET A 106 ? 0.4168 0.5858 0.5310 -0.0417 0.0074  -0.0618 978 MET A CE  
826 N N   . LYS A 107 ? 0.1996 0.3265 0.2682 -0.0543 -0.0278 -0.0427 979 LYS A N   
827 C CA  . LYS A 107 ? 0.2164 0.3380 0.2726 -0.0667 -0.0310 -0.0401 979 LYS A CA  
828 C C   . LYS A 107 ? 0.2345 0.3526 0.2801 -0.0759 -0.0203 -0.0407 979 LYS A C   
829 O O   . LYS A 107 ? 0.2391 0.3684 0.2939 -0.0756 -0.0101 -0.0445 979 LYS A O   
830 C CB  . LYS A 107 ? 0.2423 0.3869 0.3201 -0.0738 -0.0363 -0.0420 979 LYS A CB  
831 C CG  . LYS A 107 ? 0.3153 0.4651 0.4053 -0.0662 -0.0494 -0.0413 979 LYS A CG  
832 C CD  . LYS A 107 ? 0.2219 0.3975 0.3372 -0.0744 -0.0545 -0.0435 979 LYS A CD  
833 C CE  . LYS A 107 ? 0.3739 0.5526 0.4995 -0.0679 -0.0707 -0.0422 979 LYS A CE  
834 N NZ  . LYS A 107 ? 0.4327 0.6418 0.5913 -0.0737 -0.0758 -0.0451 979 LYS A NZ  
835 N N   . ARG A 108 ? 0.2441 0.3461 0.2697 -0.0843 -0.0231 -0.0371 980 ARG A N   
836 C CA  . ARG A 108 ? 0.2303 0.3255 0.2431 -0.0932 -0.0151 -0.0367 980 ARG A CA  
837 C C   . ARG A 108 ? 0.2980 0.4155 0.3259 -0.1029 -0.0067 -0.0401 980 ARG A C   
838 O O   . ARG A 108 ? 0.2991 0.4159 0.3212 -0.1062 0.0029  -0.0415 980 ARG A O   
839 C CB  . ARG A 108 ? 0.2893 0.3644 0.2808 -0.1009 -0.0213 -0.0324 980 ARG A CB  
840 C CG  . ARG A 108 ? 0.2959 0.3617 0.2731 -0.1104 -0.0152 -0.0311 980 ARG A CG  
841 C CD  . ARG A 108 ? 0.3406 0.3934 0.3077 -0.1026 -0.0100 -0.0308 980 ARG A CD  
842 N NE  . ARG A 108 ? 0.3527 0.3952 0.3054 -0.1108 -0.0058 -0.0292 980 ARG A NE  
843 C CZ  . ARG A 108 ? 0.3819 0.4350 0.3376 -0.1175 0.0022  -0.0312 980 ARG A CZ  
844 N NH1 . ARG A 108 ? 0.3546 0.4306 0.3295 -0.1165 0.0081  -0.0357 980 ARG A NH1 
845 N NH2 . ARG A 108 ? 0.3770 0.4172 0.3159 -0.1249 0.0043  -0.0290 980 ARG A NH2 
846 N N   . GLU A 109 ? 0.2700 0.4073 0.3171 -0.1076 -0.0102 -0.0416 981 GLU A N   
847 C CA  . GLU A 109 ? 0.2826 0.4428 0.3456 -0.1180 -0.0014 -0.0447 981 GLU A CA  
848 C C   . GLU A 109 ? 0.2944 0.4704 0.3719 -0.1113 0.0107  -0.0504 981 GLU A C   
849 O O   . GLU A 109 ? 0.3171 0.5060 0.3991 -0.1197 0.0220  -0.0532 981 GLU A O   
850 C CB  . GLU A 109 ? 0.2562 0.4372 0.3418 -0.1238 -0.0084 -0.0453 981 GLU A CB  
851 C CG  . GLU A 109 ? 0.4782 0.6835 0.5808 -0.1367 0.0018  -0.0480 981 GLU A CG  
852 N N   . ASP A 110 ? 0.2380 0.4115 0.3211 -0.0964 0.0086  -0.0522 982 ASP A N   
853 C CA  . ASP A 110 ? 0.2184 0.4048 0.3156 -0.0883 0.0187  -0.0583 982 ASP A CA  
854 C C   . ASP A 110 ? 0.2084 0.3755 0.2845 -0.0850 0.0254  -0.0586 982 ASP A C   
855 O O   . ASP A 110 ? 0.2159 0.3883 0.2998 -0.0770 0.0324  -0.0637 982 ASP A O   
856 C CB  . ASP A 110 ? 0.2003 0.3957 0.3184 -0.0739 0.0120  -0.0605 982 ASP A CB  
857 C CG  . ASP A 110 ? 0.2459 0.4669 0.3922 -0.0763 0.0066  -0.0621 982 ASP A CG  
858 O OD1 . ASP A 110 ? 0.2409 0.4796 0.3973 -0.0883 0.0131  -0.0639 982 ASP A OD1 
859 O OD2 . ASP A 110 ? 0.2534 0.4764 0.4116 -0.0666 -0.0046 -0.0613 982 ASP A OD2 
860 N N   . ILE A 111 ? 0.1936 0.5218 0.2129 -0.0595 0.0147  -0.0461 983 ILE A N   
861 C CA  . ILE A 111 ? 0.1783 0.4600 0.1913 -0.0499 0.0150  -0.0435 983 ILE A CA  
862 C C   . ILE A 111 ? 0.2186 0.4788 0.2383 -0.0523 0.0240  -0.0466 983 ILE A C   
863 O O   . ILE A 111 ? 0.2344 0.5008 0.2614 -0.0695 0.0332  -0.0552 983 ILE A O   
864 C CB  . ILE A 111 ? 0.1902 0.4520 0.1984 -0.0611 0.0155  -0.0489 983 ILE A CB  
865 C CG1 . ILE A 111 ? 0.2271 0.5066 0.2260 -0.0581 0.0063  -0.0453 983 ILE A CG1 
866 C CG2 . ILE A 111 ? 0.2298 0.4490 0.2329 -0.0521 0.0154  -0.0461 983 ILE A CG2 
867 C CD1 . ILE A 111 ? 0.2633 0.5288 0.2571 -0.0712 0.0070  -0.0515 983 ILE A CD1 
868 N N   . TYR A 112 ? 0.1915 0.4243 0.2063 -0.0359 0.0217  -0.0395 984 TYR A N   
869 C CA  . TYR A 112 ? 0.2124 0.4223 0.2312 -0.0348 0.0287  -0.0402 984 TYR A CA  
870 C C   . TYR A 112 ? 0.2447 0.4161 0.2570 -0.0275 0.0267  -0.0368 984 TYR A C   
871 O O   . TYR A 112 ? 0.2218 0.3833 0.2235 -0.0158 0.0186  -0.0303 984 TYR A O   
872 C CB  . TYR A 112 ? 0.1995 0.4204 0.2186 -0.0214 0.0278  -0.0338 984 TYR A CB  
873 C CG  . TYR A 112 ? 0.2266 0.4913 0.2541 -0.0291 0.0299  -0.0370 984 TYR A CG  
874 C CD1 . TYR A 112 ? 0.2865 0.5609 0.3224 -0.0440 0.0397  -0.0446 984 TYR A CD1 
875 C CD2 . TYR A 112 ? 0.2260 0.5234 0.2517 -0.0229 0.0222  -0.0327 984 TYR A CD2 
876 C CE1 . TYR A 112 ? 0.2729 0.5904 0.3161 -0.0539 0.0417  -0.0482 984 TYR A CE1 
877 C CE2 . TYR A 112 ? 0.2678 0.6113 0.3025 -0.0310 0.0235  -0.0353 984 TYR A CE2 
878 C CZ  . TYR A 112 ? 0.2597 0.6140 0.3034 -0.0474 0.0331  -0.0434 984 TYR A CZ  
879 O OH  . TYR A 112 ? 0.2798 0.6824 0.3318 -0.0576 0.0344  -0.0466 984 TYR A OH  
880 N N   . THR A 113 ? 0.2585 0.4081 0.2757 -0.0346 0.0344  -0.0410 985 THR A N   
881 C CA  . THR A 113 ? 0.2238 0.3413 0.2364 -0.0270 0.0322  -0.0368 985 THR A CA  
882 C C   . THR A 113 ? 0.2244 0.3304 0.2307 -0.0117 0.0286  -0.0285 985 THR A C   
883 O O   . THR A 113 ? 0.2308 0.3513 0.2385 -0.0079 0.0301  -0.0271 985 THR A O   
884 C CB  . THR A 113 ? 0.2888 0.3867 0.3085 -0.0357 0.0416  -0.0418 985 THR A CB  
885 O OG1 . THR A 113 ? 0.3329 0.4265 0.3559 -0.0350 0.0484  -0.0418 985 THR A OG1 
886 C CG2 . THR A 113 ? 0.3746 0.4821 0.3995 -0.0525 0.0485  -0.0513 985 THR A CG2 
887 N N   . LEU A 114 ? 0.2309 0.3115 0.2296 -0.0039 0.0243  -0.0233 986 LEU A N   
888 C CA  . LEU A 114 ? 0.2247 0.2904 0.2143 0.0093  0.0212  -0.0156 986 LEU A CA  
889 C C   . LEU A 114 ? 0.2476 0.3047 0.2437 0.0082  0.0284  -0.0161 986 LEU A C   
890 O O   . LEU A 114 ? 0.2699 0.3170 0.2591 0.0177  0.0272  -0.0104 986 LEU A O   
891 C CB  . LEU A 114 ? 0.2072 0.2485 0.1853 0.0147  0.0149  -0.0105 986 LEU A CB  
892 C CG  . LEU A 114 ? 0.2575 0.3008 0.2241 0.0165  0.0079  -0.0092 986 LEU A CG  
893 C CD1 . LEU A 114 ? 0.2480 0.2662 0.2013 0.0195  0.0027  -0.0049 986 LEU A CD1 
894 C CD2 . LEU A 114 ? 0.3168 0.3720 0.2735 0.0271  0.0048  -0.0047 986 LEU A CD2 
895 N N   . ASP A 115 ? 0.2773 0.3359 0.2845 -0.0034 0.0365  -0.0228 987 ASP A N   
896 C CA  . ASP A 115 ? 0.3317 0.3796 0.3431 -0.0051 0.0448  -0.0236 987 ASP A CA  
897 C C   . ASP A 115 ? 0.3833 0.4504 0.3994 -0.0114 0.0519  -0.0283 987 ASP A C   
898 O O   . ASP A 115 ? 0.4794 0.5377 0.4949 -0.0099 0.0573  -0.0273 987 ASP A O   
899 C CB  . ASP A 115 ? 0.3400 0.3723 0.3577 -0.0127 0.0518  -0.0274 987 ASP A CB  
900 C CG  . ASP A 115 ? 0.3554 0.3675 0.3697 -0.0050 0.0462  -0.0212 987 ASP A CG  
901 O OD1 . ASP A 115 ? 0.3557 0.3564 0.3626 0.0045  0.0415  -0.0142 987 ASP A OD1 
902 O OD2 . ASP A 115 ? 0.3463 0.3554 0.3647 -0.0093 0.0465  -0.0235 987 ASP A OD2 
903 N N   . GLU A 116 ? 0.3073 0.4016 0.3275 -0.0193 0.0521  -0.0335 988 GLU A N   
904 C CA  . GLU A 116 ? 0.3316 0.4478 0.3568 -0.0280 0.0595  -0.0387 988 GLU A CA  
905 C C   . GLU A 116 ? 0.3716 0.5082 0.3951 -0.0176 0.0552  -0.0336 988 GLU A C   
906 O O   . GLU A 116 ? 0.3903 0.5303 0.4080 -0.0047 0.0461  -0.0269 988 GLU A O   
907 C CB  . GLU A 116 ? 0.3881 0.5268 0.4188 -0.0450 0.0638  -0.0477 988 GLU A CB  
908 C CG  . GLU A 116 ? 0.4301 0.5919 0.4602 -0.0430 0.0545  -0.0464 988 GLU A CG  
909 C CD  . GLU A 116 ? 0.4656 0.6465 0.4998 -0.0622 0.0596  -0.0559 988 GLU A CD  
910 O OE1 . GLU A 116 ? 0.3652 0.5400 0.3976 -0.0657 0.0568  -0.0575 988 GLU A OE1 
911 O OE2 . GLU A 116 ? 0.5461 0.7476 0.5841 -0.0751 0.0669  -0.0620 988 GLU A OE2 
912 N N   . GLU A 117 ? 0.3810 0.5297 0.4083 -0.0234 0.0628  -0.0369 989 GLU A N   
913 C CA  . GLU A 117 ? 0.3567 0.5293 0.3845 -0.0142 0.0605  -0.0327 989 GLU A CA  
914 C C   . GLU A 117 ? 0.3735 0.5854 0.4057 -0.0147 0.0549  -0.0331 989 GLU A C   
915 O O   . GLU A 117 ? 0.3506 0.5826 0.3887 -0.0306 0.0577  -0.0405 989 GLU A O   
916 C CB  . GLU A 117 ? 0.5729 0.7537 0.6047 -0.0239 0.0710  -0.0378 989 GLU A CB  
917 C CG  . GLU A 117 ? 0.6595 0.8039 0.6851 -0.0200 0.0761  -0.0354 989 GLU A CG  
918 C CD  . GLU A 117 ? 0.6434 0.7981 0.6691 -0.0184 0.0818  -0.0351 989 GLU A CD  
919 O OE1 . GLU A 117 ? 0.5856 0.7749 0.6185 -0.0287 0.0864  -0.0406 989 GLU A OE1 
920 O OE2 . GLU A 117 ? 0.6681 0.7975 0.6864 -0.0077 0.0816  -0.0293 989 GLU A OE2 
921 N N   . LEU A 118 ? 0.3009 0.5238 0.3290 0.0026  0.0477  -0.0247 990 LEU A N   
922 C CA  . LEU A 118 ? 0.2452 0.5086 0.2774 0.0049  0.0424  -0.0234 990 LEU A CA  
923 C C   . LEU A 118 ? 0.3598 0.6634 0.4027 -0.0016 0.0482  -0.0266 990 LEU A C   
924 O O   . LEU A 118 ? 0.3381 0.6354 0.3816 0.0016  0.0540  -0.0259 990 LEU A O   
925 C CB  . LEU A 118 ? 0.2934 0.5503 0.3146 0.0275  0.0337  -0.0125 990 LEU A CB  
926 C CG  . LEU A 118 ? 0.2731 0.4928 0.2819 0.0326  0.0279  -0.0094 990 LEU A CG  
927 C CD1 . LEU A 118 ? 0.2756 0.4871 0.2698 0.0543  0.0216  0.0011  990 LEU A CD1 
928 C CD2 . LEU A 118 ? 0.2522 0.4826 0.2645 0.0191  0.0252  -0.0152 990 LEU A CD2 
929 N N   . PRO A 119 ? 0.3157 0.6618 0.3667 -0.0121 0.0469  -0.0306 991 PRO A N   
930 C CA  . PRO A 119 ? 0.3379 0.7258 0.3998 -0.0237 0.0532  -0.0356 991 PRO A CA  
931 C C   . PRO A 119 ? 0.3263 0.7412 0.3918 -0.0050 0.0515  -0.0273 991 PRO A C   
932 O O   . PRO A 119 ? 0.2799 0.6898 0.3390 0.0176  0.0443  -0.0170 991 PRO A O   
933 C CB  . PRO A 119 ? 0.3944 0.8212 0.4619 -0.0391 0.0502  -0.0408 991 PRO A CB  
934 C CG  . PRO A 119 ? 0.3722 0.7863 0.4320 -0.0259 0.0398  -0.0341 991 PRO A CG  
935 C CD  . PRO A 119 ? 0.3559 0.7135 0.4055 -0.0166 0.0400  -0.0314 991 PRO A CD  
936 N N   . LYS A 120 ? 0.2898 0.7316 0.3641 -0.0147 0.0593  -0.0319 992 LYS A N   
937 C CA  A LYS A 120 ? 0.2526 0.7299 0.3334 0.0009  0.0589  -0.0249 992 LYS A CA  
938 C CA  B LYS A 120 ? 0.2516 0.7284 0.3323 0.0009  0.0589  -0.0250 992 LYS A CA  
939 C C   . LYS A 120 ? 0.2604 0.7992 0.3520 -0.0027 0.0536  -0.0243 992 LYS A C   
940 O O   . LYS A 120 ? 0.2765 0.8574 0.3791 -0.0215 0.0587  -0.0316 992 LYS A O   
941 C CB  A LYS A 120 ? 0.2603 0.7434 0.3463 -0.0093 0.0700  -0.0306 992 LYS A CB  
942 C CB  B LYS A 120 ? 0.2472 0.7266 0.3324 -0.0090 0.0701  -0.0305 992 LYS A CB  
943 C CG  A LYS A 120 ? 0.3051 0.7337 0.3817 -0.0182 0.0775  -0.0358 992 LYS A CG  
944 C CG  B LYS A 120 ? 0.2383 0.6597 0.3121 -0.0026 0.0749  -0.0293 992 LYS A CG  
945 C CD  A LYS A 120 ? 0.2436 0.6843 0.3248 -0.0336 0.0894  -0.0432 992 LYS A CD  
946 C CD  B LYS A 120 ? 0.2928 0.7127 0.3690 -0.0190 0.0872  -0.0373 992 LYS A CD  
947 C CE  A LYS A 120 ? 0.2904 0.6821 0.3620 -0.0490 0.0981  -0.0507 992 LYS A CE  
948 C CE  B LYS A 120 ? 0.3075 0.7098 0.3811 -0.0461 0.0942  -0.0491 992 LYS A CE  
949 N NZ  A LYS A 120 ? 0.3030 0.6974 0.3746 -0.0740 0.1020  -0.0611 992 LYS A NZ  
950 N NZ  B LYS A 120 ? 0.2469 0.5913 0.3090 -0.0435 0.0930  -0.0482 992 LYS A NZ  
951 N N   . ARG A 121 ? 0.3050 0.8494 0.3923 0.0142  0.0436  -0.0157 993 ARG A N   
952 C CA  . ARG A 121 ? 0.3563 0.9575 0.4522 0.0117  0.0371  -0.0138 993 ARG A CA  
953 C C   . ARG A 121 ? 0.4682 1.0819 0.5605 0.0434  0.0297  0.0007  993 ARG A C   
954 O O   . ARG A 121 ? 0.4123 1.0666 0.5081 0.0489  0.0223  0.0059  993 ARG A O   
955 C CB  . ARG A 121 ? 0.3225 0.9125 0.4126 -0.0030 0.0319  -0.0189 993 ARG A CB  
956 C CG  . ARG A 121 ? 0.3982 0.9760 0.4896 -0.0351 0.0397  -0.0334 993 ARG A CG  
957 C CD  . ARG A 121 ? 0.2656 0.8299 0.3500 -0.0463 0.0348  -0.0372 993 ARG A CD  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   873 ?   ?   ?   A . n 
A 1 2   MET 2   874 ?   ?   ?   A . n 
A 1 3   CYS 3   875 ?   ?   ?   A . n 
A 1 4   GLU 4   876 876 GLU GLU A . n 
A 1 5   LYS 5   877 877 LYS LYS A . n 
A 1 6   VAL 6   878 878 VAL VAL A . n 
A 1 7   ILE 7   879 879 ILE ILE A . n 
A 1 8   SER 8   880 880 SER SER A . n 
A 1 9   VAL 9   881 881 VAL VAL A . n 
A 1 10  GLY 10  882 882 GLY GLY A . n 
A 1 11  GLN 11  883 883 GLN GLN A . n 
A 1 12  THR 12  884 884 THR THR A . n 
A 1 13  VAL 13  885 885 VAL VAL A . n 
A 1 14  ILE 14  886 886 ILE ILE A . n 
A 1 15  THR 15  887 887 THR THR A . n 
A 1 16  LYS 16  888 888 LYS LYS A . n 
A 1 17  HIS 17  889 889 HIS HIS A . n 
A 1 18  ARG 18  890 890 ARG ARG A . n 
A 1 19  ASN 19  891 891 ASN ASN A . n 
A 1 20  THR 20  892 892 THR THR A . n 
A 1 21  ARG 21  893 893 ARG ARG A . n 
A 1 22  TYR 22  894 894 TYR TYR A . n 
A 1 23  TYR 23  895 895 TYR TYR A . n 
A 1 24  SER 24  896 896 SER SER A . n 
A 1 25  CYS 25  897 897 CYS CYS A . n 
A 1 26  ARG 26  898 898 ARG ARG A . n 
A 1 27  VAL 27  899 899 VAL VAL A . n 
A 1 28  MET 28  900 900 MET MET A . n 
A 1 29  ALA 29  901 901 ALA ALA A . n 
A 1 30  VAL 30  902 902 VAL VAL A . n 
A 1 31  THR 31  903 903 THR THR A . n 
A 1 32  SER 32  904 904 SER SER A . n 
A 1 33  GLN 33  905 905 GLN GLN A . n 
A 1 34  THR 34  906 906 THR THR A . n 
A 1 35  PHE 35  907 907 PHE PHE A . n 
A 1 36  TYR 36  908 908 TYR TYR A . n 
A 1 37  GLU 37  909 909 GLU GLU A . n 
A 1 38  VAL 38  910 910 VAL VAL A . n 
A 1 39  MET 39  911 911 MET MET A . n 
A 1 40  PHE 40  912 912 PHE PHE A . n 
A 1 41  ASP 41  913 913 ASP ASP A . n 
A 1 42  ASP 42  914 914 ASP ASP A . n 
A 1 43  GLY 43  915 915 GLY GLY A . n 
A 1 44  SER 44  916 916 SER SER A . n 
A 1 45  PHE 45  917 917 PHE PHE A . n 
A 1 46  SER 46  918 918 SER SER A . n 
A 1 47  ARG 47  919 919 ARG ARG A . n 
A 1 48  ASP 48  920 920 ASP ASP A . n 
A 1 49  THR 49  921 921 THR THR A . n 
A 1 50  PHE 50  922 922 PHE PHE A . n 
A 1 51  PRO 51  923 923 PRO PRO A . n 
A 1 52  GLU 52  924 924 GLU GLU A . n 
A 1 53  ASP 53  925 925 ASP ASP A . n 
A 1 54  ILE 54  926 926 ILE ILE A . n 
A 1 55  VAL 55  927 927 VAL VAL A . n 
A 1 56  SER 56  928 928 SER SER A . n 
A 1 57  ARG 57  929 929 ARG ARG A . n 
A 1 58  ASP 58  930 930 ASP ASP A . n 
A 1 59  CYS 59  931 931 CYS CYS A . n 
A 1 60  LEU 60  932 932 LEU LEU A . n 
A 1 61  LYS 61  933 933 LYS LYS A . n 
A 1 62  LEU 62  934 934 LEU LEU A . n 
A 1 63  GLY 63  935 935 GLY GLY A . n 
A 1 64  PRO 64  936 936 PRO PRO A . n 
A 1 65  PRO 65  937 937 PRO PRO A . n 
A 1 66  ALA 66  938 938 ALA ALA A . n 
A 1 67  GLU 67  939 939 GLU GLU A . n 
A 1 68  GLY 68  940 940 GLY GLY A . n 
A 1 69  GLU 69  941 941 GLU GLU A . n 
A 1 70  VAL 70  942 942 VAL VAL A . n 
A 1 71  VAL 71  943 943 VAL VAL A . n 
A 1 72  GLN 72  944 944 GLN GLN A . n 
A 1 73  VAL 73  945 945 VAL VAL A . n 
A 1 74  LYS 74  946 946 LYS LYS A . n 
A 1 75  TRP 75  947 947 TRP TRP A . n 
A 1 76  PRO 76  948 948 PRO PRO A . n 
A 1 77  ASP 77  949 949 ASP ASP A . n 
A 1 78  GLY 78  950 950 GLY GLY A . n 
A 1 79  LYS 79  951 951 LYS LYS A . n 
A 1 80  LEU 80  952 952 LEU LEU A . n 
A 1 81  TYR 81  953 953 TYR TYR A . n 
A 1 82  GLY 82  954 954 GLY GLY A . n 
A 1 83  ALA 83  955 955 ALA ALA A . n 
A 1 84  LYS 84  956 956 LYS LYS A . n 
A 1 85  TYR 85  957 957 TYR TYR A . n 
A 1 86  PHE 86  958 958 PHE PHE A . n 
A 1 87  GLY 87  959 959 GLY GLY A . n 
A 1 88  SER 88  960 960 SER SER A . n 
A 1 89  ASN 89  961 961 ASN ASN A . n 
A 1 90  ILE 90  962 962 ILE ILE A . n 
A 1 91  ALA 91  963 963 ALA ALA A . n 
A 1 92  HIS 92  964 964 HIS HIS A . n 
A 1 93  MET 93  965 965 MET MET A . n 
A 1 94  TYR 94  966 966 TYR TYR A . n 
A 1 95  GLN 95  967 967 GLN GLN A . n 
A 1 96  VAL 96  968 968 VAL VAL A . n 
A 1 97  GLU 97  969 969 GLU GLU A . n 
A 1 98  PHE 98  970 970 PHE PHE A . n 
A 1 99  GLU 99  971 971 GLU GLU A . n 
A 1 100 ASP 100 972 972 ASP ASP A . n 
A 1 101 GLY 101 973 973 GLY GLY A . n 
A 1 102 SER 102 974 974 SER SER A . n 
A 1 103 GLN 103 975 975 GLN GLN A . n 
A 1 104 ILE 104 976 976 ILE ILE A . n 
A 1 105 ALA 105 977 977 ALA ALA A . n 
A 1 106 MET 106 978 978 MET MET A . n 
A 1 107 LYS 107 979 979 LYS LYS A . n 
A 1 108 ARG 108 980 980 ARG ARG A . n 
A 1 109 GLU 109 981 981 GLU GLU A . n 
A 1 110 ASP 110 982 982 ASP ASP A . n 
A 1 111 ILE 111 983 983 ILE ILE A . n 
A 1 112 TYR 112 984 984 TYR TYR A . n 
A 1 113 THR 113 985 985 THR THR A . n 
A 1 114 LEU 114 986 986 LEU LEU A . n 
A 1 115 ASP 115 987 987 ASP ASP A . n 
A 1 116 GLU 116 988 988 GLU GLU A . n 
A 1 117 GLU 117 989 989 GLU GLU A . n 
A 1 118 LEU 118 990 990 LEU LEU A . n 
A 1 119 PRO 119 991 991 PRO PRO A . n 
A 1 120 LYS 120 992 992 LYS LYS A . n 
A 1 121 ARG 121 993 993 ARG ARG A . n 
A 1 122 VAL 122 994 994 VAL VAL A . n 
A 1 123 LYS 123 995 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   1995 1995 SO4 SO4 A . 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
C 3 HOH 137 2137 2137 HOH HOH A . 
C 3 HOH 138 2138 2138 HOH HOH A . 
C 3 HOH 139 2139 2139 HOH HOH A . 
C 3 HOH 140 2140 2140 HOH HOH A . 
C 3 HOH 141 2141 2141 HOH HOH A . 
C 3 HOH 142 2142 2142 HOH HOH A . 
C 3 HOH 143 2143 2143 HOH HOH A . 
C 3 HOH 144 2144 2144 HOH HOH A . 
C 3 HOH 145 2145 2145 HOH HOH A . 
C 3 HOH 146 2146 2146 HOH HOH A . 
C 3 HOH 147 2147 2147 HOH HOH A . 
C 3 HOH 148 2148 2148 HOH HOH A . 
C 3 HOH 149 2149 2149 HOH HOH A . 
C 3 HOH 150 2150 2150 HOH HOH A . 
C 3 HOH 151 2151 2151 HOH HOH A . 
C 3 HOH 152 2152 2152 HOH HOH A . 
C 3 HOH 153 2153 2153 HOH HOH A . 
C 3 HOH 154 2154 2154 HOH HOH A . 
C 3 HOH 155 2155 2155 HOH HOH A . 
C 3 HOH 156 2156 2156 HOH HOH A . 
C 3 HOH 157 2157 2157 HOH HOH A . 
C 3 HOH 158 2158 2158 HOH HOH A . 
C 3 HOH 159 2159 2159 HOH HOH A . 
C 3 HOH 160 2160 2160 HOH HOH A . 
C 3 HOH 161 2161 2161 HOH HOH A . 
C 3 HOH 162 2162 2162 HOH HOH A . 
C 3 HOH 163 2163 2163 HOH HOH A . 
C 3 HOH 164 2164 2164 HOH HOH A . 
C 3 HOH 165 2165 2165 HOH HOH A . 
C 3 HOH 166 2166 2166 HOH HOH A . 
C 3 HOH 167 2167 2167 HOH HOH A . 
C 3 HOH 168 2168 2168 HOH HOH A . 
C 3 HOH 169 2169 2169 HOH HOH A . 
C 3 HOH 170 2170 2170 HOH HOH A . 
C 3 HOH 171 2171 2171 HOH HOH A . 
C 3 HOH 172 2172 2172 HOH HOH A . 
C 3 HOH 173 2173 2173 HOH HOH A . 
C 3 HOH 174 2174 2174 HOH HOH A . 
C 3 HOH 175 2175 2175 HOH HOH A . 
C 3 HOH 176 2176 2176 HOH HOH A . 
C 3 HOH 177 2177 2177 HOH HOH A . 
C 3 HOH 178 2178 2178 HOH HOH A . 
C 3 HOH 179 2179 2179 HOH HOH A . 
C 3 HOH 180 2180 2180 HOH HOH A . 
C 3 HOH 181 2181 2181 HOH HOH A . 
C 3 HOH 182 2182 2182 HOH HOH A . 
C 3 HOH 183 2183 2183 HOH HOH A . 
C 3 HOH 184 2184 2184 HOH HOH A . 
C 3 HOH 185 2185 2185 HOH HOH A . 
C 3 HOH 186 2186 2186 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5500  ? 
1 MORE         -58.6 ? 
1 'SSA (A^2)'  13440 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 52.8150000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2053 ? C HOH . 
2 1 A HOH 2064 ? C HOH . 
3 1 A HOH 2124 ? C HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-09 
2 'Structure model' 1 1 2012-12-05 
3 'Structure model' 1 2 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'       
2 2 'Structure model' Other                       
3 2 'Structure model' 'Source and taxonomy'       
4 2 'Structure model' 'Structure summary'         
5 2 'Structure model' 'Version format compliance' 
6 3 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_citation_author.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 44.8309 22.2944 -1.9359 0.1403 0.2846 0.1663 0.0378  0.0038  0.0092  0.2473 1.9509 2.0424 -0.0286 
-0.3788 0.6423  0.0341  -0.6502 0.3044  -0.0465 0.0467  0.2943  -0.1443 -0.2442 -0.0168 
'X-RAY DIFFRACTION' 2 ? refined 12.9735 17.0104 2.0051  0.0992 0.3574 0.1467 -0.0061 -0.0050 -0.0652 1.8892 1.0117 1.0442 -0.3297 
0.6558  -0.4348 0.0196  0.7649  -0.1019 -0.0084 -0.0527 -0.2312 0.0211  0.3811  0.0163  
'X-RAY DIFFRACTION' 3 ? refined 23.2499 28.8135 19.6942 0.2281 0.1425 0.2217 -0.0361 0.0030  0.0389  1.5986 0.5575 0.8229 -0.4835 
-0.1330 0.6265  -0.0561 0.1217  0.3571  -0.2205 0.0653  -0.0299 -0.0837 0.0208  -0.0080 
'X-RAY DIFFRACTION' 4 ? refined 27.5273 27.9296 17.6071 0.2505 0.2038 0.2718 -0.0402 0.0083  0.0352  2.1667 0.1100 0.7112 -0.1648 
-0.1069 0.3418  -0.0113 0.5141  0.3886  -0.1873 -0.0289 -0.1233 -0.0937 0.1395  0.0899  
'X-RAY DIFFRACTION' 5 ? refined 10.6582 17.9853 7.5417  0.1697 0.2543 0.2203 -0.0215 -0.0028 -0.0468 0.8425 1.9723 1.2458 0.2430  
0.3347  0.0840  -0.0782 0.0982  -0.2064 0.0728  0.1139  -0.3975 0.0103  0.4297  -0.1037 
'X-RAY DIFFRACTION' 6 ? refined 14.6656 25.3287 -4.9500 0.1748 0.4111 0.2065 -0.0173 0.0436  -0.0334 0.4968 0.7917 2.4717 0.4560  
-0.8896 -0.1531 0.2650  -0.3865 0.1637  -0.0546 -0.1282 -0.1283 -0.0201 0.7786  -0.0639 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 877:889)' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 890:903)' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 904:939)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 940:962)' 
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 963:982)' 
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 983:993)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
MOSFLM 'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 2006 ? ? O A HOH 2081 ? ? 1.95 
2 1 O A HOH 2028 ? ? O A HOH 2158 ? ? 1.98 
3 1 O A HOH 2135 ? ? O A HOH 2136 ? ? 2.01 
4 1 O A HOH 2023 ? ? O A HOH 2136 ? ? 2.02 
5 1 O A HOH 2017 ? ? O A HOH 2114 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2140 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2180 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_655 
_pdbx_validate_symm_contact.dist              2.15 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     891 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -146.42 
_pdbx_validate_torsion.psi             55.32 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2038 ? 6.83 . 
2 1 O ? A HOH 2040 ? 6.44 . 
3 1 O ? A HOH 2041 ? 6.66 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 876 ? CG  ? A GLU 4   CG  
2  1 Y 1 A GLU 876 ? CD  ? A GLU 4   CD  
3  1 Y 1 A GLU 876 ? OE1 ? A GLU 4   OE1 
4  1 Y 1 A GLU 876 ? OE2 ? A GLU 4   OE2 
5  1 Y 1 A GLN 944 ? CD  ? A GLN 72  CD  
6  1 Y 1 A GLN 944 ? OE1 ? A GLN 72  OE1 
7  1 Y 1 A GLN 944 ? NE2 ? A GLN 72  NE2 
8  1 Y 1 A GLU 981 ? CD  ? A GLU 109 CD  
9  1 Y 1 A GLU 981 ? OE1 ? A GLU 109 OE1 
10 1 Y 1 A GLU 981 ? OE2 ? A GLU 109 OE2 
11 1 Y 1 A ARG 993 ? NE  ? A ARG 121 NE  
12 1 Y 1 A ARG 993 ? CZ  ? A ARG 121 CZ  
13 1 Y 1 A ARG 993 ? NH1 ? A ARG 121 NH1 
14 1 Y 1 A ARG 993 ? NH2 ? A ARG 121 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 873 ? A SER 1   
2 1 Y 1 A MET 874 ? A MET 2   
3 1 Y 1 A CYS 875 ? A CYS 3   
4 1 Y 1 A LYS 995 ? A LYS 123 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#