data_2XH1
# 
_entry.id   2XH1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XH1         
PDBE  EBI-44188    
WWPDB D_1290044188 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2VGZ 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF HUMAN KYNURENINE AMINOTRANSFERASE II' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XH1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rossi, F.'            1  
'Casazza, V.'          2  
'Garavaglia, S.'       3  
'Sathyasaikumar, K.V.' 4  
'Schwarcz, R.'         5  
'Kojima, S.I.'         6  
'Okuwaki, K.'          7  
'Ono, S.I.'            8  
'Kajii, Y.'            9  
'Rizzi, M.'            10 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure-Based Selective Targeting of the Pyridoxal 5'-Phsosphate Dependent Enzyme Kynurenine Aminotransferase II for Cognitive Enhancement
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            53 
_citation.page_first                5684 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20684605 
_citation.pdbx_database_id_DOI      10.1021/JM100464K 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rossi, F.'            1  
primary 'Casazza, V.'          2  
primary 'Garavaglia, S.'       3  
primary 'Sathyasaikumar, K.V.' 4  
primary 'Schwarcz, R.'         5  
primary 'Kojima, S.I.'         6  
primary 'Okuwaki, K.'          7  
primary 'Ono, S.I.'            8  
primary 'Kajii, Y.'            9  
primary 'Rizzi, M.'            10 
# 
_cell.entry_id           2XH1 
_cell.length_a           98.323 
_cell.length_b           152.857 
_cell.length_c           60.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XH1 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE, MITOCHONDRIAL' 47398.352 2   '2.6.1.7, 2.6.1.39' YES ? ? 
2 non-polymer syn 
'(3S)-10-(4-AMINOPIPERAZIN-1-YL)-9-FLUORO-7-HYDROXY-3-METHYL-2,3-DIHYDRO-8H-[1,4]OXAZINO[2,3,4-IJ]QUINOLINE-6-CARBOXYLATE' 362.356 
2   ?                   ?   ? ? 
3 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE" 247.142   2   ?                   ?   ? ? 
4 non-polymer syn 'IODIDE ION' 126.904   1   ?                   ?   ? ? 
5 non-polymer syn GLYCEROL 92.094    1   ?                   ?   ? ? 
6 water       nat water 18.015    416 ?                   ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;KYNURENINE AMINOTRANSFERASE II, KYNURENINE--OXOGLUTARATE AMINOTRANSFERASE II, KYNURENINE--OXOGLUTARATE TRANSAMINASE II, 2-AMINOADIPATE TRANSAMINASE, 2-AMINOADIPATE AMINOTRANSFERASE, ALPHA-AMINOADIPATE AMINOTRANSFERASE, AADAT
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ENYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ENYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASN n 
1 3   TYR n 
1 4   ALA n 
1 5   ARG n 
1 6   PHE n 
1 7   ILE n 
1 8   THR n 
1 9   ALA n 
1 10  ALA n 
1 11  SER n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  PRO n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  THR n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  SER n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  MET n 
1 34  ILE n 
1 35  SER n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  GLY n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  PRO n 
1 44  ASN n 
1 45  MET n 
1 46  PHE n 
1 47  PRO n 
1 48  PHE n 
1 49  LYS n 
1 50  THR n 
1 51  ALA n 
1 52  VAL n 
1 53  ILE n 
1 54  THR n 
1 55  VAL n 
1 56  GLU n 
1 57  ASN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ILE n 
1 62  GLN n 
1 63  PHE n 
1 64  GLY n 
1 65  GLU n 
1 66  GLU n 
1 67  MET n 
1 68  MET n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  TYR n 
1 75  SER n 
1 76  PRO n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ILE n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  LYS n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  ILE n 
1 93  LYS n 
1 94  LEU n 
1 95  HIS n 
1 96  ASN n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 TYR n 
1 103 PRO n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLY n 
1 108 GLN n 
1 109 MET n 
1 110 ASP n 
1 111 LEU n 
1 112 CYS n 
1 113 VAL n 
1 114 THR n 
1 115 SER n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 GLN n 
1 120 GLY n 
1 121 LEU n 
1 122 CYS n 
1 123 LYS n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 MET n 
1 128 ILE n 
1 129 ILE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLY n 
1 133 ASP n 
1 134 ASN n 
1 135 VAL n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 GLU n 
1 140 PRO n 
1 141 ALA n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 THR n 
1 146 LEU n 
1 147 GLN n 
1 148 SER n 
1 149 LEU n 
1 150 HIS n 
1 151 PRO n 
1 152 LEU n 
1 153 GLY n 
1 154 CYS n 
1 155 ASN n 
1 156 ILE n 
1 157 ILE n 
1 158 ASN n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 GLU n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 ASP n 
1 170 SER n 
1 171 LEU n 
1 172 ARG n 
1 173 ASP n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ARG n 
1 178 TRP n 
1 179 LYS n 
1 180 PRO n 
1 181 GLU n 
1 182 ASP n 
1 183 ALA n 
1 184 LYS n 
1 185 ASN n 
1 186 PRO n 
1 187 GLN n 
1 188 LYS n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 PHE n 
1 194 LEU n 
1 195 TYR n 
1 196 THR n 
1 197 VAL n 
1 198 PRO n 
1 199 ASN n 
1 200 GLY n 
1 201 ASN n 
1 202 ASN n 
1 203 PRO n 
1 204 THR n 
1 205 GLY n 
1 206 ASN n 
1 207 SER n 
1 208 LEU n 
1 209 THR n 
1 210 SER n 
1 211 GLU n 
1 212 ARG n 
1 213 LYS n 
1 214 LYS n 
1 215 GLU n 
1 216 ILE n 
1 217 TYR n 
1 218 GLU n 
1 219 LEU n 
1 220 ALA n 
1 221 ARG n 
1 222 LYS n 
1 223 TYR n 
1 224 ASP n 
1 225 PHE n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLU n 
1 230 ASP n 
1 231 ASP n 
1 232 PRO n 
1 233 TYR n 
1 234 TYR n 
1 235 PHE n 
1 236 LEU n 
1 237 GLN n 
1 238 PHE n 
1 239 ASN n 
1 240 LYS n 
1 241 PHE n 
1 242 ARG n 
1 243 VAL n 
1 244 PRO n 
1 245 THR n 
1 246 PHE n 
1 247 LEU n 
1 248 SER n 
1 249 MET n 
1 250 ASP n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ARG n 
1 255 VAL n 
1 256 ILE n 
1 257 ARG n 
1 258 ALA n 
1 259 ASP n 
1 260 SER n 
1 261 PHE n 
1 262 SER n 
1 263 LYS n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 SER n 
1 268 GLY n 
1 269 LEU n 
1 270 ARG n 
1 271 ILE n 
1 272 GLY n 
1 273 PHE n 
1 274 LEU n 
1 275 THR n 
1 276 GLY n 
1 277 PRO n 
1 278 LYS n 
1 279 PRO n 
1 280 LEU n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 LEU n 
1 287 HIS n 
1 288 ILE n 
1 289 GLN n 
1 290 VAL n 
1 291 SER n 
1 292 THR n 
1 293 LEU n 
1 294 HIS n 
1 295 PRO n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 ASN n 
1 300 GLN n 
1 301 LEU n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLN n 
1 306 LEU n 
1 307 LEU n 
1 308 HIS n 
1 309 GLU n 
1 310 TRP n 
1 311 GLY n 
1 312 GLU n 
1 313 GLU n 
1 314 GLY n 
1 315 PHE n 
1 316 MET n 
1 317 ALA n 
1 318 HIS n 
1 319 VAL n 
1 320 ASP n 
1 321 ARG n 
1 322 VAL n 
1 323 ILE n 
1 324 ASP n 
1 325 PHE n 
1 326 TYR n 
1 327 SER n 
1 328 ASN n 
1 329 GLN n 
1 330 LYS n 
1 331 ASP n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 ALA n 
1 337 ALA n 
1 338 ASP n 
1 339 LYS n 
1 340 TRP n 
1 341 LEU n 
1 342 THR n 
1 343 GLY n 
1 344 LEU n 
1 345 ALA n 
1 346 GLU n 
1 347 TRP n 
1 348 HIS n 
1 349 VAL n 
1 350 PRO n 
1 351 ALA n 
1 352 ALA n 
1 353 GLY n 
1 354 MET n 
1 355 PHE n 
1 356 LEU n 
1 357 TRP n 
1 358 ILE n 
1 359 LYS n 
1 360 VAL n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 ILE n 
1 371 GLU n 
1 372 GLU n 
1 373 LYS n 
1 374 ALA n 
1 375 VAL n 
1 376 LYS n 
1 377 MET n 
1 378 GLY n 
1 379 VAL n 
1 380 LEU n 
1 381 MET n 
1 382 LEU n 
1 383 PRO n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 PHE n 
1 388 TYR n 
1 389 VAL n 
1 390 ASP n 
1 391 SER n 
1 392 SER n 
1 393 ALA n 
1 394 PRO n 
1 395 SER n 
1 396 PRO n 
1 397 TYR n 
1 398 LEU n 
1 399 ARG n 
1 400 ALA n 
1 401 SER n 
1 402 PHE n 
1 403 SER n 
1 404 SER n 
1 405 ALA n 
1 406 SER n 
1 407 PRO n 
1 408 GLU n 
1 409 GLN n 
1 410 MET n 
1 411 ASP n 
1 412 VAL n 
1 413 ALA n 
1 414 PHE n 
1 415 GLN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 GLN n 
1 420 LEU n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET16B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AADAT_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q8N5Z0 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2XH1 A 1 ? 425 ? Q8N5Z0 1 ? 425 ? -1 425 
2 1 2XH1 B 1 ? 425 ? Q8N5Z0 1 ? 425 ? -1 425 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XH1 GLU A 1 ? UNP Q8N5Z0 MET 1 'engineered mutation' -1 1 
2 2XH1 GLU B 1 ? UNP Q8N5Z0 MET 1 'engineered mutation' -1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
BF5 non-polymer         . 
'(3S)-10-(4-AMINOPIPERAZIN-1-YL)-9-FLUORO-7-HYDROXY-3-METHYL-2,3-DIHYDRO-8H-[1,4]OXAZINO[2,3,4-IJ]QUINOLINE-6-CARBOXYLATE' ? 
'C17 H19 F N4 O4' 362.356 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
IOD non-polymer         . 'IODIDE ION' ?                               'I -1'            126.904 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate'          'C8 H10 N O6 P'   247.142 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2XH1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   48.96 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.981 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.981 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XH1 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   53172 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.20 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.40 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.80 
_reflns_shell.pdbx_redundancy        7.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XH1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     53172 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.04 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.18929 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18814 
_refine.ls_R_factor_R_free                       0.24123 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.1 
_refine.ls_number_reflns_R_free                  1113 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.902 
_refine.B_iso_mean                               29.306 
_refine.aniso_B[1][1]                            0.81 
_refine.aniso_B[2][2]                            -0.47 
_refine.aniso_B[3][3]                            -0.34 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2R2N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.209 
_refine.pdbx_overall_ESU_R_Free                  0.185 
_refine.overall_SU_ML                            0.126 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.583 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6467 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         89 
_refine_hist.number_atoms_solvent             416 
_refine_hist.number_atoms_total               6972 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        32.04 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.022  ? 6722 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.795  1.987  ? 9139 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.941  5.000  ? 820  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       43.159 24.789 ? 284  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.867 15.000 ? 1136 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.735 15.000 ? 28   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.147  0.200  ? 1004 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 5068 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.226  0.200  ? 3051 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.312  0.200  ? 4584 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.176  0.200  ? 448  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.278  0.200  ? 44   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.149  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.117  1.500  ? 4174 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.888  2.000  ? 6694 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.776  3.000  ? 2906 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.355  4.500  ? 2445 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             3846 
_refine_ls_shell.R_factor_R_work                  0.198 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.268 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.999600 
_struct_ncs_oper.matrix[1][2]   -0.003480 
_struct_ncs_oper.matrix[1][3]   0.028090 
_struct_ncs_oper.matrix[2][1]   0.017080 
_struct_ncs_oper.matrix[2][2]   -0.865390 
_struct_ncs_oper.matrix[2][3]   0.490000 
_struct_ncs_oper.matrix[3][1]   0.022570 
_struct_ncs_oper.matrix[3][2]   0.501090 
_struct_ncs_oper.matrix[3][3]   0.865100 
_struct_ncs_oper.vector[1]      29.79189 
_struct_ncs_oper.vector[2]      71.86334 
_struct_ncs_oper.vector[3]      -19.65713 
# 
_struct.entry_id                  2XH1 
_struct.title                     'Crystal structure of human KAT II-inhibitor complex' 
_struct.pdbx_descriptor           'KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE, MITOCHONDRIAL (E.C.2.6.1.7, 2.6.1.39)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XH1 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, COVALENT INHIBITION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 3   ? ILE A 7   ? TYR A 3   ILE A 7   5 ? 5  
HELX_P HELX_P2  2  THR A 8   ? ALA A 13  ? THR A 8   ALA A 13  1 ? 6  
HELX_P HELX_P3  3  ASN A 42  ? PHE A 46  ? ASN A 42  PHE A 46  5 ? 5  
HELX_P HELX_P4  4  GLY A 64  ? LEU A 72  ? GLY A 64  LEU A 72  1 ? 9  
HELX_P HELX_P5  5  ILE A 80  ? ASN A 96  ? ILE A 80  ASN A 96  1 ? 17 
HELX_P HELX_P6  6  PRO A 97  ? TYR A 102 ? PRO A 97  TYR A 102 5 ? 6  
HELX_P HELX_P7  7  PRO A 103 ? GLY A 107 ? PRO A 103 GLY A 107 5 ? 5  
HELX_P HELX_P8  8  GLY A 116 ? ILE A 129 ? GLY A 116 ILE A 129 1 ? 14 
HELX_P HELX_P9  9  TYR A 142 ? HIS A 150 ? TYR A 142 HIS A 150 1 ? 9  
HELX_P HELX_P10 10 PRO A 151 ? GLY A 153 ? PRO A 151 GLY A 153 5 ? 3  
HELX_P HELX_P11 11 VAL A 167 ? SER A 176 ? VAL A 167 SER A 176 1 ? 10 
HELX_P HELX_P12 12 LYS A 179 ? ALA A 183 ? LYS A 179 ALA A 183 5 ? 5  
HELX_P HELX_P13 13 THR A 209 ? TYR A 223 ? THR A 209 TYR A 223 1 ? 15 
HELX_P HELX_P14 14 PHE A 246 ? ASP A 250 ? PHE A 246 ASP A 250 5 ? 5  
HELX_P HELX_P15 15 LYS A 278 ? VAL A 290 ? LYS A 278 VAL A 290 1 ? 13 
HELX_P HELX_P16 16 SER A 296 ? THR A 342 ? SER A 296 THR A 342 1 ? 47 
HELX_P HELX_P17 17 VAL A 366 ? GLU A 372 ? VAL A 366 GLU A 372 1 ? 7  
HELX_P HELX_P18 18 GLU A 372 ? MET A 377 ? GLU A 372 MET A 377 1 ? 6  
HELX_P HELX_P19 19 ASN A 385 ? TYR A 388 ? ASN A 385 TYR A 388 5 ? 4  
HELX_P HELX_P20 20 SER A 406 ? LEU A 425 ? SER A 406 LEU A 425 1 ? 20 
HELX_P HELX_P21 21 TYR B 3   ? ILE B 7   ? TYR B 3   ILE B 7   5 ? 5  
HELX_P HELX_P22 22 THR B 8   ? ARG B 14  ? THR B 8   ARG B 14  1 ? 7  
HELX_P HELX_P23 23 ASN B 42  ? PHE B 46  ? ASN B 42  PHE B 46  5 ? 5  
HELX_P HELX_P24 24 GLY B 64  ? LEU B 72  ? GLY B 64  LEU B 72  1 ? 9  
HELX_P HELX_P25 25 ILE B 80  ? ASN B 96  ? ILE B 80  ASN B 96  1 ? 17 
HELX_P HELX_P26 26 PRO B 97  ? TYR B 102 ? PRO B 97  TYR B 102 5 ? 6  
HELX_P HELX_P27 27 GLY B 116 ? ILE B 129 ? GLY B 116 ILE B 129 1 ? 14 
HELX_P HELX_P28 28 TYR B 142 ? HIS B 150 ? TYR B 142 HIS B 150 1 ? 9  
HELX_P HELX_P29 29 PRO B 151 ? GLY B 153 ? PRO B 151 GLY B 153 5 ? 3  
HELX_P HELX_P30 30 VAL B 167 ? SER B 176 ? VAL B 167 SER B 176 1 ? 10 
HELX_P HELX_P31 31 LYS B 179 ? ALA B 183 ? LYS B 179 ALA B 183 5 ? 5  
HELX_P HELX_P32 32 THR B 209 ? TYR B 223 ? THR B 209 TYR B 223 1 ? 15 
HELX_P HELX_P33 33 PHE B 246 ? ASP B 250 ? PHE B 246 ASP B 250 5 ? 5  
HELX_P HELX_P34 34 LYS B 278 ? VAL B 290 ? LYS B 278 VAL B 290 1 ? 13 
HELX_P HELX_P35 35 SER B 296 ? THR B 342 ? SER B 296 THR B 342 1 ? 47 
HELX_P HELX_P36 36 VAL B 366 ? GLU B 372 ? VAL B 366 GLU B 372 1 ? 7  
HELX_P HELX_P37 37 ASN B 385 ? TYR B 388 ? ASN B 385 TYR B 388 5 ? 4  
HELX_P HELX_P38 38 SER B 406 ? SER B 424 ? SER B 406 SER B 424 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C BF5 . N4 ? ? ? 1_555 D PLP . C4A ? ? A BF5 1426 A PLP 1427 1_555 ? ? ? ? ? ? ? 1.424 ? 
covale2 covale ? ? F BF5 . N4 ? ? ? 1_555 G PLP . C4A ? ? B BF5 1426 B PLP 1427 1_555 ? ? ? ? ? ? ? 1.428 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 139 A . ? GLU 139 A PRO 140 A ? PRO 140 A 1 1.38  
2 ASN 202 A . ? ASN 202 A PRO 203 A ? PRO 203 A 1 15.10 
3 GLU 139 B . ? GLU 139 B PRO 140 B ? PRO 140 B 1 3.06  
4 ASN 202 B . ? ASN 202 B PRO 203 B ? PRO 203 B 1 12.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 4 ? 
AC ? 7 ? 
AD ? 2 ? 
AE ? 4 ? 
AF ? 2 ? 
BA ? 7 ? 
BB ? 2 ? 
BC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
AC 6 7 ? parallel      
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BA 5 6 ? parallel      
BA 6 7 ? parallel      
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 34  ? SER A 35  ? ILE A 34  SER A 35  
AA 2 VAL B 379 ? LEU B 380 ? VAL B 379 LEU B 380 
AB 1 ILE A 61  ? PHE A 63  ? ILE A 61  PHE A 63  
AB 2 PHE A 48  ? VAL A 55  ? PHE A 48  VAL A 55  
AB 3 PHE B 48  ? VAL B 55  ? PHE B 48  VAL B 55  
AB 4 ILE B 61  ? PHE B 63  ? ILE B 61  PHE B 63  
AC 1 MET A 109 ? THR A 114 ? MET A 109 THR A 114 
AC 2 GLY A 272 ? PRO A 277 ? GLY A 272 PRO A 277 
AC 3 VAL A 255 ? SER A 260 ? VAL A 255 SER A 260 
AC 4 LEU A 226 ? ASP A 230 ? LEU A 226 ASP A 230 
AC 5 PHE A 193 ? THR A 196 ? PHE A 193 THR A 196 
AC 6 ASN A 134 ? LEU A 137 ? ASN A 134 LEU A 137 
AC 7 ASN A 155 ? ASN A 158 ? ASN A 155 ASN A 158 
AD 1 SER A 161 ? ASP A 162 ? SER A 161 ASP A 162 
AD 2 GLY A 165 ? ILE A 166 ? GLY A 165 ILE A 166 
AE 1 ALA A 345 ? GLU A 346 ? ALA A 345 GLU A 346 
AE 2 PHE A 355 ? VAL A 360 ? PHE A 355 VAL A 360 
AE 3 TYR A 397 ? SER A 401 ? TYR A 397 SER A 401 
AE 4 LEU A 382 ? PRO A 383 ? LEU A 382 PRO A 383 
AF 1 VAL A 379 ? LEU A 380 ? VAL A 379 LEU A 380 
AF 2 ILE B 34  ? SER B 35  ? ILE B 34  SER B 35  
BA 1 MET B 109 ? THR B 114 ? MET B 109 THR B 114 
BA 2 GLY B 272 ? PRO B 277 ? GLY B 272 PRO B 277 
BA 3 VAL B 255 ? SER B 260 ? VAL B 255 SER B 260 
BA 4 LEU B 226 ? ASP B 230 ? LEU B 226 ASP B 230 
BA 5 PHE B 193 ? THR B 196 ? PHE B 193 THR B 196 
BA 6 ASN B 134 ? LEU B 137 ? ASN B 134 LEU B 137 
BA 7 ASN B 155 ? ASN B 158 ? ASN B 155 ASN B 158 
BB 1 SER B 161 ? ASP B 162 ? SER B 161 ASP B 162 
BB 2 GLY B 165 ? ILE B 166 ? GLY B 165 ILE B 166 
BC 1 ALA B 345 ? TRP B 347 ? ALA B 345 TRP B 347 
BC 2 PHE B 355 ? VAL B 360 ? PHE B 355 VAL B 360 
BC 3 TYR B 397 ? SER B 401 ? TYR B 397 SER B 401 
BC 4 LEU B 382 ? PRO B 383 ? LEU B 382 PRO B 383 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O ILE A 34  ? O ILE A 34  N LEU B 380 ? N LEU B 380 
AB 1 2 N PHE A 63  ? N PHE A 63  O ALA A 51  ? O ALA A 51  
AB 2 3 O THR A 54  ? O THR A 54  N LYS B 49  ? N LYS B 49  
AB 3 4 N ILE B 53  ? N ILE B 53  O ILE B 61  ? O ILE B 61  
AC 1 2 N THR A 114 ? N THR A 114 O GLY A 272 ? O GLY A 272 
AC 2 3 N THR A 275 ? N THR A 275 O ARG A 257 ? O ARG A 257 
AC 3 4 N ILE A 256 ? N ILE A 256 O ILE A 227 ? O ILE A 227 
AC 4 5 N ILE A 228 ? N ILE A 228 O LEU A 194 ? O LEU A 194 
AC 5 6 N TYR A 195 ? N TYR A 195 O LEU A 136 ? O LEU A 136 
AC 6 7 N VAL A 135 ? N VAL A 135 O ASN A 155 ? O ASN A 155 
AD 1 2 N ASP A 162 ? N ASP A 162 O GLY A 165 ? O GLY A 165 
AE 1 2 N GLU A 346 ? N GLU A 346 O LYS A 359 ? O LYS A 359 
AE 2 3 N ILE A 358 ? N ILE A 358 O LEU A 398 ? O LEU A 398 
AE 3 4 N ARG A 399 ? N ARG A 399 O LEU A 382 ? O LEU A 382 
AF 1 2 N LEU A 380 ? N LEU A 380 O ILE B 34  ? O ILE B 34  
BA 1 2 N THR B 114 ? N THR B 114 O GLY B 272 ? O GLY B 272 
BA 2 3 N THR B 275 ? N THR B 275 O ARG B 257 ? O ARG B 257 
BA 3 4 N ILE B 256 ? N ILE B 256 O ILE B 227 ? O ILE B 227 
BA 4 5 N ILE B 228 ? N ILE B 228 O LEU B 194 ? O LEU B 194 
BA 5 6 N TYR B 195 ? N TYR B 195 O LEU B 136 ? O LEU B 136 
BA 6 7 N VAL B 135 ? N VAL B 135 O ASN B 155 ? O ASN B 155 
BB 1 2 N ASP B 162 ? N ASP B 162 O GLY B 165 ? O GLY B 165 
BC 1 2 N GLU B 346 ? N GLU B 346 O LYS B 359 ? O LYS B 359 
BC 2 3 N ILE B 358 ? N ILE B 358 O LEU B 398 ? O LEU B 398 
BC 3 4 N ARG B 399 ? N ARG B 399 O LEU B 382 ? O LEU B 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BF5 A 1426' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP A 1427' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BF5 B 1426' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PLP B 1427' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE IOD A 1428' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL B 1428' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  TYR A 142 ? TYR A 142  . ? 1_555 ? 
2  AC1 8  PLP D .   ? PLP A 1427 . ? 1_555 ? 
3  AC1 8  HOH I .   ? HOH A 2240 . ? 1_555 ? 
4  AC1 8  HOH I .   ? HOH A 2241 . ? 1_555 ? 
5  AC1 8  GLY B 39  ? GLY B 39   . ? 1_555 ? 
6  AC1 8  LEU B 40  ? LEU B 40   . ? 1_555 ? 
7  AC1 8  SER B 75  ? SER B 75   . ? 1_555 ? 
8  AC1 8  PRO B 76  ? PRO B 76   . ? 1_555 ? 
9  AC2 14 SER A 117 ? SER A 117  . ? 1_555 ? 
10 AC2 14 GLN A 118 ? GLN A 118  . ? 1_555 ? 
11 AC2 14 TYR A 142 ? TYR A 142  . ? 1_555 ? 
12 AC2 14 ASN A 202 ? ASN A 202  . ? 1_555 ? 
13 AC2 14 ASP A 230 ? ASP A 230  . ? 1_555 ? 
14 AC2 14 PRO A 232 ? PRO A 232  . ? 1_555 ? 
15 AC2 14 TYR A 233 ? TYR A 233  . ? 1_555 ? 
16 AC2 14 SER A 260 ? SER A 260  . ? 1_555 ? 
17 AC2 14 SER A 262 ? SER A 262  . ? 1_555 ? 
18 AC2 14 LYS A 263 ? LYS A 263  . ? 1_555 ? 
19 AC2 14 ARG A 270 ? ARG A 270  . ? 1_555 ? 
20 AC2 14 BF5 C .   ? BF5 A 1426 . ? 1_555 ? 
21 AC2 14 HOH I .   ? HOH A 2187 . ? 1_555 ? 
22 AC2 14 TYR B 74  ? TYR B 74   . ? 1_555 ? 
23 AC3 6  GLY A 39  ? GLY A 39   . ? 1_555 ? 
24 AC3 6  LEU A 40  ? LEU A 40   . ? 1_555 ? 
25 AC3 6  TYR A 74  ? TYR A 74   . ? 1_555 ? 
26 AC3 6  SER A 77  ? SER A 77   . ? 1_555 ? 
27 AC3 6  TYR B 142 ? TYR B 142  . ? 1_555 ? 
28 AC3 6  PLP G .   ? PLP B 1427 . ? 1_555 ? 
29 AC4 13 TYR A 74  ? TYR A 74   . ? 1_555 ? 
30 AC4 13 SER B 117 ? SER B 117  . ? 1_555 ? 
31 AC4 13 GLN B 118 ? GLN B 118  . ? 1_555 ? 
32 AC4 13 TYR B 142 ? TYR B 142  . ? 1_555 ? 
33 AC4 13 ASN B 202 ? ASN B 202  . ? 1_555 ? 
34 AC4 13 ASP B 230 ? ASP B 230  . ? 1_555 ? 
35 AC4 13 PRO B 232 ? PRO B 232  . ? 1_555 ? 
36 AC4 13 TYR B 233 ? TYR B 233  . ? 1_555 ? 
37 AC4 13 SER B 260 ? SER B 260  . ? 1_555 ? 
38 AC4 13 SER B 262 ? SER B 262  . ? 1_555 ? 
39 AC4 13 LYS B 263 ? LYS B 263  . ? 1_555 ? 
40 AC4 13 ARG B 270 ? ARG B 270  . ? 1_555 ? 
41 AC4 13 BF5 F .   ? BF5 B 1426 . ? 1_555 ? 
42 AC5 4  GLN A 119 ? GLN A 119  . ? 1_555 ? 
43 AC5 4  LYS A 123 ? LYS A 123  . ? 1_555 ? 
44 AC5 4  GLN B 119 ? GLN B 119  . ? 1_555 ? 
45 AC5 4  LYS B 123 ? LYS B 123  . ? 1_555 ? 
46 AC6 6  GLU B 1   ? GLU B -1   . ? 1_555 ? 
47 AC6 6  ASN B 2   ? ASN B 2    . ? 1_555 ? 
48 AC6 6  SER B 105 ? SER B 105  . ? 1_555 ? 
49 AC6 6  PRO B 279 ? PRO B 279  . ? 1_555 ? 
50 AC6 6  HOH J .   ? HOH B 2173 . ? 1_555 ? 
51 AC6 6  HOH J .   ? HOH B 2174 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XH1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XH1 
_atom_sites.fract_transf_matrix[1][1]   0.010171 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006542 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016447 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
I 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? -7.775  47.039 -1.905  1.00 41.44 ?  -1   GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? -7.635  46.793 -0.419  1.00 40.61 ?  -1   GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? -7.858  45.337 -0.052  1.00 38.63 ?  -1   GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? -8.697  45.002 0.800   1.00 40.34 ?  -1   GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? -8.521  47.712 0.458   1.00 41.55 ?  -1   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? -8.745  49.122 -0.078  1.00 44.18 ?  -1   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? -9.874  49.196 -1.092  1.00 50.08 ?  -1   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? -10.469 48.134 -1.451  1.00 51.54 ?  -1   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? -10.178 50.334 -1.525  1.00 53.18 ?  -1   GLU A OE2 1 
ATOM   10   N N   . ASN A 1 2   ? -7.209  44.478 -0.819  1.00 35.65 ?  2    ASN A N   1 
ATOM   11   C CA  . ASN A 1 2   ? -6.310  43.521 -0.250  1.00 32.14 ?  2    ASN A CA  1 
ATOM   12   C C   . ASN A 1 2   ? -4.982  44.296 -0.494  1.00 29.28 ?  2    ASN A C   1 
ATOM   13   O O   . ASN A 1 2   ? -4.917  45.354 -1.165  1.00 29.15 ?  2    ASN A O   1 
ATOM   14   C CB  . ASN A 1 2   ? -6.326  42.161 -0.938  1.00 32.76 ?  2    ASN A CB  1 
ATOM   15   C CG  . ASN A 1 2   ? -5.631  41.047 -0.088  1.00 37.27 ?  2    ASN A CG  1 
ATOM   16   O OD1 . ASN A 1 2   ? -4.630  41.276 0.661   1.00 38.60 ?  2    ASN A OD1 1 
ATOM   17   N ND2 . ASN A 1 2   ? -6.151  39.846 -0.210  1.00 35.34 ?  2    ASN A ND2 1 
ATOM   18   N N   . TYR A 1 3   ? -3.934  43.791 0.085   1.00 25.74 ?  3    TYR A N   1 
ATOM   19   C CA  . TYR A 1 3   ? -2.709  44.522 0.186   1.00 22.54 ?  3    TYR A CA  1 
ATOM   20   C C   . TYR A 1 3   ? -1.636  43.688 -0.483  1.00 21.24 ?  3    TYR A C   1 
ATOM   21   O O   . TYR A 1 3   ? -0.477  44.082 -0.502  1.00 20.28 ?  3    TYR A O   1 
ATOM   22   C CB  . TYR A 1 3   ? -2.415  44.748 1.679   1.00 20.93 ?  3    TYR A CB  1 
ATOM   23   C CG  . TYR A 1 3   ? -3.232  45.894 2.236   1.00 19.48 ?  3    TYR A CG  1 
ATOM   24   C CD1 . TYR A 1 3   ? -4.517  45.668 2.756   1.00 17.21 ?  3    TYR A CD1 1 
ATOM   25   C CD2 . TYR A 1 3   ? -2.739  47.216 2.215   1.00 16.15 ?  3    TYR A CD2 1 
ATOM   26   C CE1 . TYR A 1 3   ? -5.301  46.748 3.276   1.00 17.10 ?  3    TYR A CE1 1 
ATOM   27   C CE2 . TYR A 1 3   ? -3.504  48.298 2.722   1.00 15.70 ?  3    TYR A CE2 1 
ATOM   28   C CZ  . TYR A 1 3   ? -4.798  48.041 3.242   1.00 18.33 ?  3    TYR A CZ  1 
ATOM   29   O OH  . TYR A 1 3   ? -5.585  49.063 3.742   1.00 17.01 ?  3    TYR A OH  1 
ATOM   30   N N   . ALA A 1 4   ? -2.057  42.541 -1.041  1.00 20.56 ?  4    ALA A N   1 
ATOM   31   C CA  . ALA A 1 4   ? -1.158  41.566 -1.672  1.00 20.66 ?  4    ALA A CA  1 
ATOM   32   C C   . ALA A 1 4   ? -0.197  42.175 -2.671  1.00 20.80 ?  4    ALA A C   1 
ATOM   33   O O   . ALA A 1 4   ? 0.973   41.842 -2.667  1.00 18.84 ?  4    ALA A O   1 
ATOM   34   C CB  . ALA A 1 4   ? -1.935  40.355 -2.310  1.00 20.97 ?  4    ALA A CB  1 
ATOM   35   N N   . ARG A 1 5   ? -0.683  43.075 -3.518  1.00 22.12 ?  5    ARG A N   1 
ATOM   36   C CA  . ARG A 1 5   ? 0.171   43.645 -4.565  1.00 24.07 ?  5    ARG A CA  1 
ATOM   37   C C   . ARG A 1 5   ? 1.310   44.441 -3.974  1.00 24.00 ?  5    ARG A C   1 
ATOM   38   O O   . ARG A 1 5   ? 2.256   44.746 -4.671  1.00 24.68 ?  5    ARG A O   1 
ATOM   39   C CB  . ARG A 1 5   ? -0.631  44.547 -5.537  1.00 24.85 ?  5    ARG A CB  1 
ATOM   40   C CG  . ARG A 1 5   ? -1.203  45.818 -4.924  1.00 27.13 ?  5    ARG A CG  1 
ATOM   41   C CD  . ARG A 1 5   ? -1.619  46.853 -5.980  1.00 30.64 ?  5    ARG A CD  1 
ATOM   42   N NE  . ARG A 1 5   ? -0.475  47.728 -6.310  1.00 33.92 ?  5    ARG A NE  1 
ATOM   43   C CZ  . ARG A 1 5   ? -0.487  49.065 -6.323  1.00 31.17 ?  5    ARG A CZ  1 
ATOM   44   N NH1 . ARG A 1 5   ? -1.614  49.750 -6.069  1.00 27.24 ?  5    ARG A NH1 1 
ATOM   45   N NH2 . ARG A 1 5   ? 0.648   49.710 -6.616  1.00 31.71 ?  5    ARG A NH2 1 
ATOM   46   N N   . PHE A 1 6   ? 1.226   44.784 -2.688  1.00 23.58 ?  6    PHE A N   1 
ATOM   47   C CA  . PHE A 1 6   ? 2.266   45.616 -2.102  1.00 23.27 ?  6    PHE A CA  1 
ATOM   48   C C   . PHE A 1 6   ? 3.429   44.845 -1.571  1.00 24.26 ?  6    PHE A C   1 
ATOM   49   O O   . PHE A 1 6   ? 4.504   45.426 -1.351  1.00 25.62 ?  6    PHE A O   1 
ATOM   50   C CB  . PHE A 1 6   ? 1.718   46.545 -1.006  1.00 22.09 ?  6    PHE A CB  1 
ATOM   51   C CG  . PHE A 1 6   ? 0.870   47.644 -1.550  1.00 20.37 ?  6    PHE A CG  1 
ATOM   52   C CD1 . PHE A 1 6   ? -0.525  47.607 -1.415  1.00 17.94 ?  6    PHE A CD1 1 
ATOM   53   C CD2 . PHE A 1 6   ? 1.461   48.698 -2.239  1.00 18.74 ?  6    PHE A CD2 1 
ATOM   54   C CE1 . PHE A 1 6   ? -1.326  48.669 -1.960  1.00 21.19 ?  6    PHE A CE1 1 
ATOM   55   C CE2 . PHE A 1 6   ? 0.682   49.758 -2.813  1.00 17.71 ?  6    PHE A CE2 1 
ATOM   56   C CZ  . PHE A 1 6   ? -0.700  49.756 -2.679  1.00 19.92 ?  6    PHE A CZ  1 
ATOM   57   N N   . ILE A 1 7   ? 3.215   43.554 -1.341  1.00 23.03 ?  7    ILE A N   1 
ATOM   58   C CA  . ILE A 1 7   ? 4.151   42.785 -0.566  1.00 22.61 ?  7    ILE A CA  1 
ATOM   59   C C   . ILE A 1 7   ? 4.872   41.691 -1.379  1.00 21.66 ?  7    ILE A C   1 
ATOM   60   O O   . ILE A 1 7   ? 4.463   41.352 -2.506  1.00 20.07 ?  7    ILE A O   1 
ATOM   61   C CB  . ILE A 1 7   ? 3.500   42.221 0.735   1.00 22.26 ?  7    ILE A CB  1 
ATOM   62   C CG1 . ILE A 1 7   ? 2.522   41.097 0.441   1.00 23.50 ?  7    ILE A CG1 1 
ATOM   63   C CG2 . ILE A 1 7   ? 2.821   43.333 1.567   1.00 23.02 ?  7    ILE A CG2 1 
ATOM   64   C CD1 . ILE A 1 7   ? 2.185   40.327 1.701   1.00 23.11 ?  7    ILE A CD1 1 
ATOM   65   N N   . THR A 1 8   ? 5.959   41.178 -0.790  1.00 21.10 ?  8    THR A N   1 
ATOM   66   C CA  . THR A 1 8   ? 6.789   40.169 -1.422  1.00 19.63 ?  8    THR A CA  1 
ATOM   67   C C   . THR A 1 8   ? 6.187   38.777 -1.228  1.00 20.11 ?  8    THR A C   1 
ATOM   68   O O   . THR A 1 8   ? 5.436   38.508 -0.267  1.00 20.10 ?  8    THR A O   1 
ATOM   69   C CB  . THR A 1 8   ? 8.198   40.168 -0.824  1.00 19.68 ?  8    THR A CB  1 
ATOM   70   O OG1 . THR A 1 8   ? 8.124   39.698 0.538   1.00 18.64 ?  8    THR A OG1 1 
ATOM   71   C CG2 . THR A 1 8   ? 8.771   41.572 -0.828  1.00 17.50 ?  8    THR A CG2 1 
ATOM   72   N N   . ALA A 1 9   ? 6.593   37.866 -2.094  1.00 19.66 ?  9    ALA A N   1 
ATOM   73   C CA  . ALA A 1 9   ? 6.287   36.447 -1.931  1.00 20.56 ?  9    ALA A CA  1 
ATOM   74   C C   . ALA A 1 9   ? 6.699   35.919 -0.552  1.00 20.52 ?  9    ALA A C   1 
ATOM   75   O O   . ALA A 1 9   ? 5.936   35.161 0.078   1.00 20.67 ?  9    ALA A O   1 
ATOM   76   C CB  . ALA A 1 9   ? 6.965   35.591 -3.098  1.00 20.12 ?  9    ALA A CB  1 
ATOM   77   N N   . ALA A 1 10  ? 7.887   36.310 -0.051  1.00 19.50 ?  10   ALA A N   1 
ATOM   78   C CA  . ALA A 1 10  ? 8.330   35.815 1.254   1.00 18.05 ?  10   ALA A CA  1 
ATOM   79   C C   . ALA A 1 10  ? 7.374   36.311 2.339   1.00 18.01 ?  10   ALA A C   1 
ATOM   80   O O   . ALA A 1 10  ? 6.977   35.547 3.245   1.00 17.19 ?  10   ALA A O   1 
ATOM   81   C CB  . ALA A 1 10  ? 9.804   36.285 1.578   1.00 18.98 ?  10   ALA A CB  1 
ATOM   82   N N   . SER A 1 11  ? 7.010   37.604 2.258   1.00 16.76 ?  11   SER A N   1 
ATOM   83   C CA  . SER A 1 11  ? 6.152   38.141 3.279   1.00 16.84 ?  11   SER A CA  1 
ATOM   84   C C   . SER A 1 11  ? 4.824   37.431 3.240   1.00 16.04 ?  11   SER A C   1 
ATOM   85   O O   . SER A 1 11  ? 4.318   37.072 4.265   1.00 17.44 ?  11   SER A O   1 
ATOM   86   C CB  . SER A 1 11  ? 5.961   39.675 3.188   1.00 16.92 ?  11   SER A CB  1 
ATOM   87   O OG  . SER A 1 11  ? 5.184   40.108 4.319   1.00 13.89 ?  11   SER A OG  1 
ATOM   88   N N   . ALA A 1 12  ? 4.269   37.239 2.051   1.00 16.79 ?  12   ALA A N   1 
ATOM   89   C CA  . ALA A 1 12  ? 2.961   36.623 1.904   1.00 18.48 ?  12   ALA A CA  1 
ATOM   90   C C   . ALA A 1 12  ? 2.998   35.153 2.370   1.00 19.74 ?  12   ALA A C   1 
ATOM   91   O O   . ALA A 1 12  ? 1.971   34.595 2.781   1.00 20.64 ?  12   ALA A O   1 
ATOM   92   C CB  . ALA A 1 12  ? 2.469   36.740 0.415   1.00 19.38 ?  12   ALA A CB  1 
ATOM   93   N N   . ALA A 1 13  ? 4.179   34.520 2.322   1.00 19.53 ?  13   ALA A N   1 
ATOM   94   C CA  . ALA A 1 13  ? 4.301   33.112 2.697   1.00 19.62 ?  13   ALA A CA  1 
ATOM   95   C C   . ALA A 1 13  ? 4.248   32.896 4.185   1.00 19.66 ?  13   ALA A C   1 
ATOM   96   O O   . ALA A 1 13  ? 4.153   31.756 4.609   1.00 18.60 ?  13   ALA A O   1 
ATOM   97   C CB  . ALA A 1 13  ? 5.585   32.509 2.168   1.00 19.20 ?  13   ALA A CB  1 
ATOM   98   N N   . ARG A 1 14  ? 4.373   33.968 4.974   1.00 19.75 ?  14   ARG A N   1 
ATOM   99   C CA  . ARG A 1 14  ? 4.553   33.815 6.407   1.00 21.01 ?  14   ARG A CA  1 
ATOM   100  C C   . ARG A 1 14  ? 3.253   33.310 7.020   1.00 22.36 ?  14   ARG A C   1 
ATOM   101  O O   . ARG A 1 14  ? 2.197   33.723 6.595   1.00 19.85 ?  14   ARG A O   1 
ATOM   102  C CB  . ARG A 1 14  ? 4.941   35.141 7.074   1.00 20.17 ?  14   ARG A CB  1 
ATOM   103  C CG  . ARG A 1 14  ? 6.375   35.535 6.835   1.00 20.31 ?  14   ARG A CG  1 
ATOM   104  C CD  . ARG A 1 14  ? 6.796   36.742 7.715   1.00 17.89 ?  14   ARG A CD  1 
ATOM   105  N NE  . ARG A 1 14  ? 7.979   37.381 7.131   1.00 17.54 ?  14   ARG A NE  1 
ATOM   106  C CZ  . ARG A 1 14  ? 9.213   36.873 7.192   1.00 18.25 ?  14   ARG A CZ  1 
ATOM   107  N NH1 . ARG A 1 14  ? 9.457   35.750 7.837   1.00 11.59 ?  14   ARG A NH1 1 
ATOM   108  N NH2 . ARG A 1 14  ? 10.232  37.522 6.624   1.00 23.48 ?  14   ARG A NH2 1 
ATOM   109  N N   . ASN A 1 15  ? 3.374   32.441 8.023   1.00 25.43 ?  15   ASN A N   1 
ATOM   110  C CA  . ASN A 1 15  ? 2.232   31.796 8.656   1.00 29.38 ?  15   ASN A CA  1 
ATOM   111  C C   . ASN A 1 15  ? 2.377   31.971 10.145  1.00 31.51 ?  15   ASN A C   1 
ATOM   112  O O   . ASN A 1 15  ? 3.503   31.959 10.639  1.00 30.99 ?  15   ASN A O   1 
ATOM   113  C CB  . ASN A 1 15  ? 2.172   30.288 8.316   1.00 29.58 ?  15   ASN A CB  1 
ATOM   114  C CG  . ASN A 1 15  ? 1.794   30.033 6.866   1.00 31.94 ?  15   ASN A CG  1 
ATOM   115  O OD1 . ASN A 1 15  ? 0.962   30.747 6.297   1.00 38.30 ?  15   ASN A OD1 1 
ATOM   116  N ND2 . ASN A 1 15  ? 2.427   29.040 6.245   1.00 34.00 ?  15   ASN A ND2 1 
ATOM   117  N N   . PRO A 1 16  ? 1.241   32.128 10.859  1.00 33.97 ?  16   PRO A N   1 
ATOM   118  C CA  . PRO A 1 16  ? 1.251   32.113 12.317  1.00 36.57 ?  16   PRO A CA  1 
ATOM   119  C C   . PRO A 1 16  ? 1.623   30.712 12.780  1.00 38.54 ?  16   PRO A C   1 
ATOM   120  O O   . PRO A 1 16  ? 1.347   29.737 12.068  1.00 39.05 ?  16   PRO A O   1 
ATOM   121  C CB  . PRO A 1 16  ? -0.202  32.459 12.697  1.00 36.55 ?  16   PRO A CB  1 
ATOM   122  C CG  . PRO A 1 16  ? -1.019  32.059 11.528  1.00 35.57 ?  16   PRO A CG  1 
ATOM   123  C CD  . PRO A 1 16  ? -0.124  32.295 10.315  1.00 35.21 ?  16   PRO A CD  1 
ATOM   124  N N   . SER A 1 17  ? 2.258   30.601 13.940  1.00 41.68 ?  17   SER A N   1 
ATOM   125  C CA  . SER A 1 17  ? 2.708   29.285 14.406  1.00 44.90 ?  17   SER A CA  1 
ATOM   126  C C   . SER A 1 17  ? 1.523   28.385 14.695  1.00 46.82 ?  17   SER A C   1 
ATOM   127  O O   . SER A 1 17  ? 0.431   28.873 15.035  1.00 46.86 ?  17   SER A O   1 
ATOM   128  C CB  . SER A 1 17  ? 3.594   29.388 15.643  1.00 44.71 ?  17   SER A CB  1 
ATOM   129  O OG  . SER A 1 17  ? 3.051   30.307 16.551  1.00 47.03 ?  17   SER A OG  1 
ATOM   130  N N   . PRO A 1 18  ? 1.728   27.058 14.551  1.00 48.96 ?  18   PRO A N   1 
ATOM   131  C CA  . PRO A 1 18  ? 0.719   26.082 14.974  1.00 50.11 ?  18   PRO A CA  1 
ATOM   132  C C   . PRO A 1 18  ? 0.799   25.948 16.499  1.00 51.61 ?  18   PRO A C   1 
ATOM   133  O O   . PRO A 1 18  ? 0.336   24.954 17.079  1.00 52.21 ?  18   PRO A O   1 
ATOM   134  C CB  . PRO A 1 18  ? 1.154   24.791 14.267  1.00 50.50 ?  18   PRO A CB  1 
ATOM   135  C CG  . PRO A 1 18  ? 2.365   25.176 13.382  1.00 49.68 ?  18   PRO A CG  1 
ATOM   136  C CD  . PRO A 1 18  ? 2.932   26.404 14.007  1.00 48.71 ?  18   PRO A CD  1 
ATOM   137  N N   . ILE A 1 19  ? 1.365   26.998 17.108  1.00 52.52 ?  19   ILE A N   1 
ATOM   138  C CA  . ILE A 1 19  ? 1.768   27.096 18.508  1.00 53.17 ?  19   ILE A CA  1 
ATOM   139  C C   . ILE A 1 19  ? 2.648   25.920 18.970  1.00 53.37 ?  19   ILE A C   1 
ATOM   140  O O   . ILE A 1 19  ? 3.855   25.854 18.670  1.00 53.29 ?  19   ILE A O   1 
ATOM   141  C CB  . ILE A 1 19  ? 0.558   27.402 19.469  1.00 53.71 ?  19   ILE A CB  1 
ATOM   142  C CG1 . ILE A 1 19  ? -0.503  28.273 18.766  1.00 54.90 ?  19   ILE A CG1 1 
ATOM   143  C CG2 . ILE A 1 19  ? 1.057   28.145 20.709  1.00 53.82 ?  19   ILE A CG2 1 
ATOM   144  C CD1 . ILE A 1 19  ? -1.969  28.109 19.305  1.00 56.75 ?  19   ILE A CD1 1 
ATOM   145  N N   . MET A 1 33  ? -6.081  25.367 36.186  1.00 67.96 ?  33   MET A N   1 
ATOM   146  C CA  . MET A 1 33  ? -5.601  24.624 35.020  1.00 68.24 ?  33   MET A CA  1 
ATOM   147  C C   . MET A 1 33  ? -4.178  24.116 35.230  1.00 67.80 ?  33   MET A C   1 
ATOM   148  O O   . MET A 1 33  ? -3.384  24.765 35.928  1.00 68.33 ?  33   MET A O   1 
ATOM   149  C CB  . MET A 1 33  ? -5.635  25.497 33.755  1.00 68.21 ?  33   MET A CB  1 
ATOM   150  C CG  . MET A 1 33  ? -5.281  24.738 32.458  1.00 69.31 ?  33   MET A CG  1 
ATOM   151  S SD  . MET A 1 33  ? -6.651  24.131 31.416  1.00 72.23 ?  33   MET A SD  1 
ATOM   152  C CE  . MET A 1 33  ? -7.799  23.377 32.575  1.00 71.19 ?  33   MET A CE  1 
ATOM   153  N N   . ILE A 1 34  ? -3.860  22.968 34.627  1.00 66.66 ?  34   ILE A N   1 
ATOM   154  C CA  . ILE A 1 34  ? -2.470  22.510 34.559  1.00 65.87 ?  34   ILE A CA  1 
ATOM   155  C C   . ILE A 1 34  ? -1.937  22.488 33.115  1.00 64.63 ?  34   ILE A C   1 
ATOM   156  O O   . ILE A 1 34  ? -2.381  21.696 32.280  1.00 64.18 ?  34   ILE A O   1 
ATOM   157  C CB  . ILE A 1 34  ? -2.228  21.182 35.353  1.00 66.14 ?  34   ILE A CB  1 
ATOM   158  C CG1 . ILE A 1 34  ? -0.873  20.547 35.006  1.00 66.67 ?  34   ILE A CG1 1 
ATOM   159  C CG2 . ILE A 1 34  ? -3.355  20.194 35.127  1.00 67.00 ?  34   ILE A CG2 1 
ATOM   160  C CD1 . ILE A 1 34  ? 0.325   21.337 35.464  1.00 68.31 ?  34   ILE A CD1 1 
ATOM   161  N N   . SER A 1 35  ? -1.000  23.403 32.847  1.00 63.40 ?  35   SER A N   1 
ATOM   162  C CA  . SER A 1 35  ? -0.350  23.548 31.539  1.00 62.12 ?  35   SER A CA  1 
ATOM   163  C C   . SER A 1 35  ? 1.011   22.853 31.499  1.00 61.04 ?  35   SER A C   1 
ATOM   164  O O   . SER A 1 35  ? 1.949   23.262 32.210  1.00 61.32 ?  35   SER A O   1 
ATOM   165  C CB  . SER A 1 35  ? -0.177  25.043 31.184  1.00 62.43 ?  35   SER A CB  1 
ATOM   166  O OG  . SER A 1 35  ? 0.764   25.254 30.125  1.00 62.35 ?  35   SER A OG  1 
ATOM   167  N N   . LEU A 1 36  ? 1.121   21.815 30.670  1.00 58.91 ?  36   LEU A N   1 
ATOM   168  C CA  . LEU A 1 36  ? 2.432   21.253 30.324  1.00 57.39 ?  36   LEU A CA  1 
ATOM   169  C C   . LEU A 1 36  ? 2.820   21.562 28.867  1.00 55.78 ?  36   LEU A C   1 
ATOM   170  O O   . LEU A 1 36  ? 3.796   21.020 28.337  1.00 55.30 ?  36   LEU A O   1 
ATOM   171  C CB  . LEU A 1 36  ? 2.466   19.738 30.575  1.00 57.44 ?  36   LEU A CB  1 
ATOM   172  C CG  . LEU A 1 36  ? 2.221   19.175 31.983  1.00 57.42 ?  36   LEU A CG  1 
ATOM   173  C CD1 . LEU A 1 36  ? 2.873   17.803 32.087  1.00 57.51 ?  36   LEU A CD1 1 
ATOM   174  C CD2 . LEU A 1 36  ? 2.728   20.068 33.095  1.00 56.91 ?  36   LEU A CD2 1 
ATOM   175  N N   . ALA A 1 37  ? 2.052   22.447 28.235  1.00 53.98 ?  37   ALA A N   1 
ATOM   176  C CA  . ALA A 1 37  ? 2.113   22.631 26.785  1.00 51.92 ?  37   ALA A CA  1 
ATOM   177  C C   . ALA A 1 37  ? 3.025   23.774 26.385  1.00 50.55 ?  37   ALA A C   1 
ATOM   178  O O   . ALA A 1 37  ? 3.257   24.008 25.200  1.00 51.15 ?  37   ALA A O   1 
ATOM   179  C CB  . ALA A 1 37  ? 0.713   22.856 26.224  1.00 51.83 ?  37   ALA A CB  1 
ATOM   180  N N   . GLY A 1 38  ? 3.552   24.477 27.372  1.00 48.47 ?  38   GLY A N   1 
ATOM   181  C CA  . GLY A 1 38  ? 4.188   25.731 27.118  1.00 46.59 ?  38   GLY A CA  1 
ATOM   182  C C   . GLY A 1 38  ? 5.651   25.559 27.155  1.00 45.21 ?  38   GLY A C   1 
ATOM   183  O O   . GLY A 1 38  ? 6.112   24.551 27.637  1.00 45.54 ?  38   GLY A O   1 
ATOM   184  N N   . GLY A 1 39  ? 6.385   26.552 26.652  1.00 44.40 ?  39   GLY A N   1 
ATOM   185  C CA  . GLY A 1 39  ? 7.845   26.486 26.604  1.00 42.96 ?  39   GLY A CA  1 
ATOM   186  C C   . GLY A 1 39  ? 8.560   27.465 27.515  1.00 42.61 ?  39   GLY A C   1 
ATOM   187  O O   . GLY A 1 39  ? 9.718   27.805 27.289  1.00 43.16 ?  39   GLY A O   1 
ATOM   188  N N   . LEU A 1 40  ? 7.879   27.904 28.563  1.00 41.25 ?  40   LEU A N   1 
ATOM   189  C CA  . LEU A 1 40  ? 8.383   28.931 29.459  1.00 39.96 ?  40   LEU A CA  1 
ATOM   190  C C   . LEU A 1 40  ? 9.449   28.396 30.400  1.00 38.97 ?  40   LEU A C   1 
ATOM   191  O O   . LEU A 1 40  ? 9.196   27.462 31.162  1.00 39.54 ?  40   LEU A O   1 
ATOM   192  C CB  . LEU A 1 40  ? 7.217   29.487 30.287  1.00 40.49 ?  40   LEU A CB  1 
ATOM   193  C CG  . LEU A 1 40  ? 6.128   30.220 29.506  1.00 41.90 ?  40   LEU A CG  1 
ATOM   194  C CD1 . LEU A 1 40  ? 4.957   30.555 30.433  1.00 45.26 ?  40   LEU A CD1 1 
ATOM   195  C CD2 . LEU A 1 40  ? 6.691   31.506 28.874  1.00 42.07 ?  40   LEU A CD2 1 
ATOM   196  N N   . PRO A 1 41  ? 10.639  28.991 30.386  1.00 37.25 ?  41   PRO A N   1 
ATOM   197  C CA  . PRO A 1 41  ? 11.547  28.601 31.459  1.00 36.28 ?  41   PRO A CA  1 
ATOM   198  C C   . PRO A 1 41  ? 10.931  28.969 32.814  1.00 35.94 ?  41   PRO A C   1 
ATOM   199  O O   . PRO A 1 41  ? 10.085  29.877 32.887  1.00 35.19 ?  41   PRO A O   1 
ATOM   200  C CB  . PRO A 1 41  ? 12.784  29.464 31.216  1.00 35.88 ?  41   PRO A CB  1 
ATOM   201  C CG  . PRO A 1 41  ? 12.329  30.565 30.252  1.00 36.52 ?  41   PRO A CG  1 
ATOM   202  C CD  . PRO A 1 41  ? 11.203  30.002 29.472  1.00 36.98 ?  41   PRO A CD  1 
ATOM   203  N N   . ASN A 1 42  ? 11.361  28.295 33.876  1.00 35.02 ?  42   ASN A N   1 
ATOM   204  C CA  . ASN A 1 42  ? 10.912  28.651 35.221  1.00 34.08 ?  42   ASN A CA  1 
ATOM   205  C C   . ASN A 1 42  ? 11.528  29.964 35.644  1.00 33.77 ?  42   ASN A C   1 
ATOM   206  O O   . ASN A 1 42  ? 12.739  30.041 35.780  1.00 33.36 ?  42   ASN A O   1 
ATOM   207  C CB  . ASN A 1 42  ? 11.273  27.580 36.246  1.00 34.01 ?  42   ASN A CB  1 
ATOM   208  C CG  . ASN A 1 42  ? 10.394  27.666 37.491  1.00 33.08 ?  42   ASN A CG  1 
ATOM   209  O OD1 . ASN A 1 42  ? 10.435  28.652 38.240  1.00 31.76 ?  42   ASN A OD1 1 
ATOM   210  N ND2 . ASN A 1 42  ? 9.569   26.656 37.687  1.00 27.40 ?  42   ASN A ND2 1 
ATOM   211  N N   . PRO A 1 43  ? 10.692  31.000 35.889  1.00 34.38 ?  43   PRO A N   1 
ATOM   212  C CA  . PRO A 1 43  ? 11.203  32.331 36.168  1.00 34.62 ?  43   PRO A CA  1 
ATOM   213  C C   . PRO A 1 43  ? 11.720  32.482 37.588  1.00 35.38 ?  43   PRO A C   1 
ATOM   214  O O   . PRO A 1 43  ? 12.415  33.472 37.891  1.00 35.23 ?  43   PRO A O   1 
ATOM   215  C CB  . PRO A 1 43  ? 9.981   33.220 35.972  1.00 35.56 ?  43   PRO A CB  1 
ATOM   216  C CG  . PRO A 1 43  ? 8.826   32.342 36.329  1.00 36.02 ?  43   PRO A CG  1 
ATOM   217  C CD  . PRO A 1 43  ? 9.217   30.953 35.924  1.00 34.76 ?  43   PRO A CD  1 
ATOM   218  N N   . ASN A 1 44  ? 11.374  31.523 38.453  1.00 35.09 ?  44   ASN A N   1 
ATOM   219  C CA  . ASN A 1 44  ? 11.943  31.444 39.793  1.00 35.04 ?  44   ASN A CA  1 
ATOM   220  C C   . ASN A 1 44  ? 13.437  31.171 39.783  1.00 34.21 ?  44   ASN A C   1 
ATOM   221  O O   . ASN A 1 44  ? 14.130  31.399 40.790  1.00 34.49 ?  44   ASN A O   1 
ATOM   222  C CB  . ASN A 1 44  ? 11.196  30.381 40.593  1.00 35.63 ?  44   ASN A CB  1 
ATOM   223  C CG  . ASN A 1 44  ? 9.812   30.845 40.978  1.00 37.95 ?  44   ASN A CG  1 
ATOM   224  O OD1 . ASN A 1 44  ? 9.655   31.619 41.923  1.00 41.22 ?  44   ASN A OD1 1 
ATOM   225  N ND2 . ASN A 1 44  ? 8.811   30.423 40.223  1.00 40.23 ?  44   ASN A ND2 1 
ATOM   226  N N   . MET A 1 45  ? 13.935  30.694 38.645  1.00 32.92 ?  45   MET A N   1 
ATOM   227  C CA  . MET A 1 45  ? 15.365  30.450 38.497  1.00 32.49 ?  45   MET A CA  1 
ATOM   228  C C   . MET A 1 45  ? 16.131  31.728 38.154  1.00 31.47 ?  45   MET A C   1 
ATOM   229  O O   . MET A 1 45  ? 17.352  31.814 38.364  1.00 30.79 ?  45   MET A O   1 
ATOM   230  C CB  . MET A 1 45  ? 15.638  29.342 37.473  1.00 33.38 ?  45   MET A CB  1 
ATOM   231  C CG  . MET A 1 45  ? 15.225  27.901 37.903  1.00 36.12 ?  45   MET A CG  1 
ATOM   232  S SD  . MET A 1 45  ? 15.951  27.306 39.453  1.00 41.01 ?  45   MET A SD  1 
ATOM   233  C CE  . MET A 1 45  ? 14.597  27.613 40.599  1.00 37.69 ?  45   MET A CE  1 
ATOM   234  N N   . PHE A 1 46  ? 15.413  32.745 37.673  1.00 30.13 ?  46   PHE A N   1 
ATOM   235  C CA  . PHE A 1 46  ? 16.054  34.028 37.333  1.00 28.26 ?  46   PHE A CA  1 
ATOM   236  C C   . PHE A 1 46  ? 16.566  34.722 38.594  1.00 27.47 ?  46   PHE A C   1 
ATOM   237  O O   . PHE A 1 46  ? 15.906  34.678 39.609  1.00 28.53 ?  46   PHE A O   1 
ATOM   238  C CB  . PHE A 1 46  ? 15.088  34.895 36.503  1.00 28.03 ?  46   PHE A CB  1 
ATOM   239  C CG  . PHE A 1 46  ? 14.656  34.231 35.209  1.00 27.23 ?  46   PHE A CG  1 
ATOM   240  C CD1 . PHE A 1 46  ? 15.507  33.305 34.556  1.00 27.66 ?  46   PHE A CD1 1 
ATOM   241  C CD2 . PHE A 1 46  ? 13.419  34.514 34.645  1.00 26.91 ?  46   PHE A CD2 1 
ATOM   242  C CE1 . PHE A 1 46  ? 15.136  32.687 33.358  1.00 26.15 ?  46   PHE A CE1 1 
ATOM   243  C CE2 . PHE A 1 46  ? 13.024  33.911 33.446  1.00 26.80 ?  46   PHE A CE2 1 
ATOM   244  C CZ  . PHE A 1 46  ? 13.897  32.995 32.789  1.00 28.58 ?  46   PHE A CZ  1 
ATOM   245  N N   . PRO A 1 47  ? 17.783  35.281 38.553  1.00 26.32 ?  47   PRO A N   1 
ATOM   246  C CA  . PRO A 1 47  ? 18.448  35.851 39.727  1.00 25.64 ?  47   PRO A CA  1 
ATOM   247  C C   . PRO A 1 47  ? 17.924  37.209 40.244  1.00 25.93 ?  47   PRO A C   1 
ATOM   248  O O   . PRO A 1 47  ? 18.120  37.515 41.426  1.00 25.71 ?  47   PRO A O   1 
ATOM   249  C CB  . PRO A 1 47  ? 19.911  36.011 39.263  1.00 25.15 ?  47   PRO A CB  1 
ATOM   250  C CG  . PRO A 1 47  ? 19.810  36.162 37.782  1.00 25.19 ?  47   PRO A CG  1 
ATOM   251  C CD  . PRO A 1 47  ? 18.647  35.323 37.350  1.00 26.06 ?  47   PRO A CD  1 
ATOM   252  N N   . PHE A 1 48  ? 17.341  38.017 39.354  1.00 25.70 ?  48   PHE A N   1 
ATOM   253  C CA  . PHE A 1 48  ? 16.773  39.343 39.669  1.00 25.13 ?  48   PHE A CA  1 
ATOM   254  C C   . PHE A 1 48  ? 15.417  39.163 40.300  1.00 25.11 ?  48   PHE A C   1 
ATOM   255  O O   . PHE A 1 48  ? 14.542  38.498 39.709  1.00 25.41 ?  48   PHE A O   1 
ATOM   256  C CB  . PHE A 1 48  ? 16.562  40.171 38.396  1.00 25.02 ?  48   PHE A CB  1 
ATOM   257  C CG  . PHE A 1 48  ? 17.753  40.217 37.474  1.00 24.63 ?  48   PHE A CG  1 
ATOM   258  C CD1 . PHE A 1 48  ? 18.872  40.974 37.797  1.00 22.19 ?  48   PHE A CD1 1 
ATOM   259  C CD2 . PHE A 1 48  ? 17.740  39.517 36.285  1.00 23.99 ?  48   PHE A CD2 1 
ATOM   260  C CE1 . PHE A 1 48  ? 19.969  41.024 36.945  1.00 22.13 ?  48   PHE A CE1 1 
ATOM   261  C CE2 . PHE A 1 48  ? 18.828  39.566 35.433  1.00 23.15 ?  48   PHE A CE2 1 
ATOM   262  C CZ  . PHE A 1 48  ? 19.938  40.323 35.766  1.00 24.20 ?  48   PHE A CZ  1 
ATOM   263  N N   . LYS A 1 49  ? 15.195  39.805 41.454  1.00 25.07 ?  49   LYS A N   1 
ATOM   264  C CA  . LYS A 1 49  ? 13.969  39.538 42.229  1.00 24.75 ?  49   LYS A CA  1 
ATOM   265  C C   . LYS A 1 49  ? 12.950  40.698 42.352  1.00 24.58 ?  49   LYS A C   1 
ATOM   266  O O   . LYS A 1 49  ? 11.772  40.444 42.340  1.00 24.18 ?  49   LYS A O   1 
ATOM   267  C CB  . LYS A 1 49  ? 14.301  38.941 43.610  1.00 25.60 ?  49   LYS A CB  1 
ATOM   268  C CG  . LYS A 1 49  ? 15.143  37.625 43.555  1.00 27.10 ?  49   LYS A CG  1 
ATOM   269  C CD  . LYS A 1 49  ? 14.416  36.547 42.731  1.00 31.28 ?  49   LYS A CD  1 
ATOM   270  C CE  . LYS A 1 49  ? 15.004  35.155 42.969  1.00 31.79 ?  49   LYS A CE  1 
ATOM   271  N NZ  . LYS A 1 49  ? 14.413  34.109 42.108  1.00 31.74 ?  49   LYS A NZ  1 
ATOM   272  N N   . THR A 1 50  ? 13.398  41.939 42.506  1.00 24.28 ?  50   THR A N   1 
ATOM   273  C CA  . THR A 1 50  ? 12.471  43.073 42.540  1.00 25.25 ?  50   THR A CA  1 
ATOM   274  C C   . THR A 1 50  ? 13.190  44.226 41.888  1.00 25.32 ?  50   THR A C   1 
ATOM   275  O O   . THR A 1 50  ? 14.409  44.150 41.660  1.00 26.87 ?  50   THR A O   1 
ATOM   276  C CB  . THR A 1 50  ? 12.071  43.545 44.000  1.00 25.23 ?  50   THR A CB  1 
ATOM   277  O OG1 . THR A 1 50  ? 13.197  44.157 44.630  1.00 28.60 ?  50   THR A OG1 1 
ATOM   278  C CG2 . THR A 1 50  ? 11.607  42.403 44.880  1.00 24.36 ?  50   THR A CG2 1 
ATOM   279  N N   . ALA A 1 51  ? 12.454  45.299 41.605  1.00 24.54 ?  51   ALA A N   1 
ATOM   280  C CA  . ALA A 1 51  ? 13.049  46.492 41.009  1.00 23.95 ?  51   ALA A CA  1 
ATOM   281  C C   . ALA A 1 51  ? 12.243  47.710 41.357  1.00 23.15 ?  51   ALA A C   1 
ATOM   282  O O   . ALA A 1 51  ? 10.990  47.657 41.447  1.00 23.60 ?  51   ALA A O   1 
ATOM   283  C CB  . ALA A 1 51  ? 13.160  46.357 39.482  1.00 22.51 ?  51   ALA A CB  1 
ATOM   284  N N   . VAL A 1 52  ? 12.973  48.801 41.535  1.00 22.04 ?  52   VAL A N   1 
ATOM   285  C CA  . VAL A 1 52  ? 12.404  50.079 41.830  1.00 22.74 ?  52   VAL A CA  1 
ATOM   286  C C   . VAL A 1 52  ? 13.073  51.115 40.918  1.00 22.30 ?  52   VAL A C   1 
ATOM   287  O O   . VAL A 1 52  ? 14.322  51.218 40.878  1.00 21.37 ?  52   VAL A O   1 
ATOM   288  C CB  . VAL A 1 52  ? 12.656  50.425 43.324  1.00 23.94 ?  52   VAL A CB  1 
ATOM   289  C CG1 . VAL A 1 52  ? 12.298  51.869 43.636  1.00 25.43 ?  52   VAL A CG1 1 
ATOM   290  C CG2 . VAL A 1 52  ? 11.865  49.470 44.210  1.00 24.30 ?  52   VAL A CG2 1 
ATOM   291  N N   . ILE A 1 53  ? 12.248  51.868 40.182  1.00 20.15 ?  53   ILE A N   1 
ATOM   292  C CA  . ILE A 1 53  ? 12.758  52.887 39.276  1.00 20.65 ?  53   ILE A CA  1 
ATOM   293  C C   . ILE A 1 53  ? 12.096  54.190 39.621  1.00 20.52 ?  53   ILE A C   1 
ATOM   294  O O   . ILE A 1 53  ? 10.867  54.298 39.570  1.00 21.38 ?  53   ILE A O   1 
ATOM   295  C CB  . ILE A 1 53  ? 12.362  52.542 37.809  1.00 20.99 ?  53   ILE A CB  1 
ATOM   296  C CG1 . ILE A 1 53  ? 12.766  51.104 37.495  1.00 22.41 ?  53   ILE A CG1 1 
ATOM   297  C CG2 . ILE A 1 53  ? 12.942  53.565 36.806  1.00 22.34 ?  53   ILE A CG2 1 
ATOM   298  C CD1 . ILE A 1 53  ? 14.216  51.019 37.320  1.00 26.87 ?  53   ILE A CD1 1 
ATOM   299  N N   . THR A 1 54  ? 12.882  55.194 39.920  1.00 21.38 ?  54   THR A N   1 
ATOM   300  C CA  . THR A 1 54  ? 12.273  56.460 40.275  1.00 23.46 ?  54   THR A CA  1 
ATOM   301  C C   . THR A 1 54  ? 11.914  57.246 39.013  1.00 23.87 ?  54   THR A C   1 
ATOM   302  O O   . THR A 1 54  ? 12.541  57.063 37.972  1.00 25.34 ?  54   THR A O   1 
ATOM   303  C CB  . THR A 1 54  ? 13.170  57.282 41.204  1.00 23.46 ?  54   THR A CB  1 
ATOM   304  O OG1 . THR A 1 54  ? 14.449  57.452 40.591  1.00 25.00 ?  54   THR A OG1 1 
ATOM   305  C CG2 . THR A 1 54  ? 13.356  56.569 42.521  1.00 23.13 ?  54   THR A CG2 1 
ATOM   306  N N   . VAL A 1 55  ? 10.881  58.086 39.109  1.00 23.66 ?  55   VAL A N   1 
ATOM   307  C CA  . VAL A 1 55  ? 10.430  58.932 38.007  1.00 23.74 ?  55   VAL A CA  1 
ATOM   308  C C   . VAL A 1 55  ? 10.453  60.404 38.509  1.00 25.82 ?  55   VAL A C   1 
ATOM   309  O O   . VAL A 1 55  ? 9.899   60.682 39.584  1.00 24.67 ?  55   VAL A O   1 
ATOM   310  C CB  . VAL A 1 55  ? 9.043   58.488 37.520  1.00 22.96 ?  55   VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 55  ? 8.396   59.521 36.631  1.00 21.29 ?  55   VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 55  ? 9.146   57.109 36.786  1.00 22.76 ?  55   VAL A CG2 1 
ATOM   313  N N   . GLU A 1 56  ? 11.102  61.318 37.764  1.00 26.27 ?  56   GLU A N   1 
ATOM   314  C CA  . GLU A 1 56  ? 11.267  62.708 38.241  1.00 28.57 ?  56   GLU A CA  1 
ATOM   315  C C   . GLU A 1 56  ? 9.926   63.360 38.516  1.00 28.85 ?  56   GLU A C   1 
ATOM   316  O O   . GLU A 1 56  ? 9.088   63.445 37.623  1.00 29.21 ?  56   GLU A O   1 
ATOM   317  C CB  . GLU A 1 56  ? 12.045  63.588 37.242  1.00 28.97 ?  56   GLU A CB  1 
ATOM   318  C CG  . GLU A 1 56  ? 12.391  64.977 37.810  1.00 33.42 ?  56   GLU A CG  1 
ATOM   319  C CD  . GLU A 1 56  ? 13.510  65.671 37.054  1.00 39.67 ?  56   GLU A CD  1 
ATOM   320  O OE1 . GLU A 1 56  ? 14.662  65.661 37.546  1.00 40.88 ?  56   GLU A OE1 1 
ATOM   321  O OE2 . GLU A 1 56  ? 13.238  66.227 35.959  1.00 42.39 ?  56   GLU A OE2 1 
ATOM   322  N N   . ASN A 1 57  ? 9.719   63.805 39.754  1.00 30.62 ?  57   ASN A N   1 
ATOM   323  C CA  . ASN A 1 57  ? 8.422   64.354 40.176  1.00 31.33 ?  57   ASN A CA  1 
ATOM   324  C C   . ASN A 1 57  ? 7.230   63.475 39.744  1.00 31.16 ?  57   ASN A C   1 
ATOM   325  O O   . ASN A 1 57  ? 6.187   63.971 39.292  1.00 32.20 ?  57   ASN A O   1 
ATOM   326  C CB  . ASN A 1 57  ? 8.276   65.794 39.670  1.00 32.34 ?  57   ASN A CB  1 
ATOM   327  C CG  . ASN A 1 57  ? 9.400   66.710 40.179  1.00 35.03 ?  57   ASN A CG  1 
ATOM   328  O OD1 . ASN A 1 57  ? 9.792   66.646 41.347  1.00 38.70 ?  57   ASN A OD1 1 
ATOM   329  N ND2 . ASN A 1 57  ? 9.935   67.538 39.297  1.00 35.39 ?  57   ASN A ND2 1 
ATOM   330  N N   . GLY A 1 58  ? 7.385   62.158 39.893  1.00 29.70 ?  58   GLY A N   1 
ATOM   331  C CA  . GLY A 1 58  ? 6.389   61.219 39.419  1.00 27.13 ?  58   GLY A CA  1 
ATOM   332  C C   . GLY A 1 58  ? 6.281   60.053 40.379  1.00 25.17 ?  58   GLY A C   1 
ATOM   333  O O   . GLY A 1 58  ? 6.980   60.006 41.391  1.00 23.62 ?  58   GLY A O   1 
ATOM   334  N N   . LYS A 1 59  ? 5.406   59.107 40.045  1.00 24.22 ?  59   LYS A N   1 
ATOM   335  C CA  . LYS A 1 59  ? 5.215   57.903 40.865  1.00 23.30 ?  59   LYS A CA  1 
ATOM   336  C C   . LYS A 1 59  ? 6.338   56.898 40.632  1.00 22.59 ?  59   LYS A C   1 
ATOM   337  O O   . LYS A 1 59  ? 6.637   56.535 39.473  1.00 19.41 ?  59   LYS A O   1 
ATOM   338  C CB  . LYS A 1 59  ? 3.895   57.256 40.504  1.00 23.85 ?  59   LYS A CB  1 
ATOM   339  C CG  . LYS A 1 59  ? 2.686   58.165 40.716  1.00 27.23 ?  59   LYS A CG  1 
ATOM   340  C CD  . LYS A 1 59  ? 1.939   57.834 41.980  1.00 28.15 ?  59   LYS A CD  1 
ATOM   341  C CE  . LYS A 1 59  ? 1.082   59.027 42.451  1.00 31.32 ?  59   LYS A CE  1 
ATOM   342  N NZ  . LYS A 1 59  ? 0.317   59.687 41.341  1.00 33.95 ?  59   LYS A NZ  1 
ATOM   343  N N   . THR A 1 60  ? 6.951   56.399 41.701  1.00 21.56 ?  60   THR A N   1 
ATOM   344  C CA  . THR A 1 60  ? 7.956   55.401 41.434  1.00 21.17 ?  60   THR A CA  1 
ATOM   345  C C   . THR A 1 60  ? 7.365   54.126 40.817  1.00 21.29 ?  60   THR A C   1 
ATOM   346  O O   . THR A 1 60  ? 6.201   53.735 41.083  1.00 20.31 ?  60   THR A O   1 
ATOM   347  C CB  . THR A 1 60  ? 9.091   55.214 42.543  1.00 22.94 ?  60   THR A CB  1 
ATOM   348  O OG1 . THR A 1 60  ? 9.153   53.867 43.030  1.00 25.45 ?  60   THR A OG1 1 
ATOM   349  C CG2 . THR A 1 60  ? 9.055   56.267 43.600  1.00 16.85 ?  60   THR A CG2 1 
ATOM   350  N N   . ILE A 1 61  ? 8.162   53.509 39.937  1.00 20.52 ?  61   ILE A N   1 
ATOM   351  C CA  . ILE A 1 61  ? 7.764   52.259 39.293  1.00 20.85 ?  61   ILE A CA  1 
ATOM   352  C C   . ILE A 1 61  ? 8.345   51.141 40.111  1.00 21.23 ?  61   ILE A C   1 
ATOM   353  O O   . ILE A 1 61  ? 9.534   51.090 40.328  1.00 21.93 ?  61   ILE A O   1 
ATOM   354  C CB  . ILE A 1 61  ? 8.264   52.198 37.809  1.00 20.55 ?  61   ILE A CB  1 
ATOM   355  C CG1 . ILE A 1 61  ? 7.551   53.319 37.032  1.00 24.15 ?  61   ILE A CG1 1 
ATOM   356  C CG2 . ILE A 1 61  ? 8.028   50.786 37.198  1.00 17.68 ?  61   ILE A CG2 1 
ATOM   357  C CD1 . ILE A 1 61  ? 8.171   53.703 35.662  1.00 29.64 ?  61   ILE A CD1 1 
ATOM   358  N N   . GLN A 1 62  ? 7.500   50.228 40.565  1.00 23.92 ?  62   GLN A N   1 
ATOM   359  C CA  . GLN A 1 62  ? 7.947   49.157 41.458  1.00 25.84 ?  62   GLN A CA  1 
ATOM   360  C C   . GLN A 1 62  ? 7.566   47.821 40.796  1.00 25.17 ?  62   GLN A C   1 
ATOM   361  O O   . GLN A 1 62  ? 6.421   47.618 40.375  1.00 25.34 ?  62   GLN A O   1 
ATOM   362  C CB  . GLN A 1 62  ? 7.296   49.328 42.866  1.00 26.48 ?  62   GLN A CB  1 
ATOM   363  C CG  . GLN A 1 62  ? 7.097   50.818 43.329  1.00 28.93 ?  62   GLN A CG  1 
ATOM   364  C CD  . GLN A 1 62  ? 6.036   51.079 44.480  1.00 29.44 ?  62   GLN A CD  1 
ATOM   365  O OE1 . GLN A 1 62  ? 6.281   50.810 45.638  1.00 32.18 ?  62   GLN A OE1 1 
ATOM   366  N NE2 . GLN A 1 62  ? 4.896   51.679 44.122  1.00 34.07 ?  62   GLN A NE2 1 
ATOM   367  N N   . PHE A 1 63  ? 8.531   46.921 40.640  1.00 24.99 ?  63   PHE A N   1 
ATOM   368  C CA  . PHE A 1 63  ? 8.176   45.556 40.310  1.00 25.20 ?  63   PHE A CA  1 
ATOM   369  C C   . PHE A 1 63  ? 8.400   44.701 41.570  1.00 26.42 ?  63   PHE A C   1 
ATOM   370  O O   . PHE A 1 63  ? 9.553   44.430 41.943  1.00 25.29 ?  63   PHE A O   1 
ATOM   371  C CB  . PHE A 1 63  ? 8.991   44.991 39.123  1.00 26.08 ?  63   PHE A CB  1 
ATOM   372  C CG  . PHE A 1 63  ? 8.854   45.776 37.811  1.00 26.30 ?  63   PHE A CG  1 
ATOM   373  C CD1 . PHE A 1 63  ? 7.782   46.655 37.581  1.00 27.30 ?  63   PHE A CD1 1 
ATOM   374  C CD2 . PHE A 1 63  ? 9.808   45.610 36.789  1.00 29.14 ?  63   PHE A CD2 1 
ATOM   375  C CE1 . PHE A 1 63  ? 7.675   47.392 36.352  1.00 27.60 ?  63   PHE A CE1 1 
ATOM   376  C CE2 . PHE A 1 63  ? 9.701   46.317 35.539  1.00 26.58 ?  63   PHE A CE2 1 
ATOM   377  C CZ  . PHE A 1 63  ? 8.644   47.214 35.342  1.00 26.80 ?  63   PHE A CZ  1 
ATOM   378  N N   . GLY A 1 64  ? 7.299   44.300 42.221  1.00 26.52 ?  64   GLY A N   1 
ATOM   379  C CA  . GLY A 1 64  ? 7.361   43.358 43.345  1.00 28.28 ?  64   GLY A CA  1 
ATOM   380  C C   . GLY A 1 64  ? 7.629   41.964 42.802  1.00 29.16 ?  64   GLY A C   1 
ATOM   381  O O   . GLY A 1 64  ? 7.947   41.819 41.615  1.00 29.01 ?  64   GLY A O   1 
ATOM   382  N N   . GLU A 1 65  ? 7.524   40.944 43.651  1.00 29.93 ?  65   GLU A N   1 
ATOM   383  C CA  . GLU A 1 65  ? 7.973   39.599 43.277  1.00 31.15 ?  65   GLU A CA  1 
ATOM   384  C C   . GLU A 1 65  ? 7.300   39.035 42.050  1.00 30.19 ?  65   GLU A C   1 
ATOM   385  O O   . GLU A 1 65  ? 7.986   38.628 41.131  1.00 30.27 ?  65   GLU A O   1 
ATOM   386  C CB  . GLU A 1 65  ? 7.967   38.610 44.458  1.00 31.86 ?  65   GLU A CB  1 
ATOM   387  C CG  . GLU A 1 65  ? 9.150   38.868 45.402  1.00 37.87 ?  65   GLU A CG  1 
ATOM   388  C CD  . GLU A 1 65  ? 9.451   37.723 46.410  1.00 47.58 ?  65   GLU A CD  1 
ATOM   389  O OE1 . GLU A 1 65  ? 9.015   36.550 46.190  1.00 50.86 ?  65   GLU A OE1 1 
ATOM   390  O OE2 . GLU A 1 65  ? 10.151  38.008 47.431  1.00 49.79 ?  65   GLU A OE2 1 
ATOM   391  N N   . GLU A 1 66  ? 5.969   39.039 42.012  1.00 29.82 ?  66   GLU A N   1 
ATOM   392  C CA  . GLU A 1 66  ? 5.236   38.490 40.863  1.00 29.85 ?  66   GLU A CA  1 
ATOM   393  C C   . GLU A 1 66  ? 5.398   39.322 39.591  1.00 28.36 ?  66   GLU A C   1 
ATOM   394  O O   . GLU A 1 66  ? 5.452   38.775 38.493  1.00 27.66 ?  66   GLU A O   1 
ATOM   395  C CB  . GLU A 1 66  ? 3.749   38.271 41.196  1.00 29.93 ?  66   GLU A CB  1 
ATOM   396  C CG  . GLU A 1 66  ? 3.544   37.143 42.230  1.00 35.05 ?  66   GLU A CG  1 
ATOM   397  C CD  . GLU A 1 66  ? 4.260   35.827 41.831  1.00 37.49 ?  66   GLU A CD  1 
ATOM   398  O OE1 . GLU A 1 66  ? 3.939   35.293 40.742  1.00 37.16 ?  66   GLU A OE1 1 
ATOM   399  O OE2 . GLU A 1 66  ? 5.146   35.352 42.601  1.00 38.25 ?  66   GLU A OE2 1 
ATOM   400  N N   . MET A 1 67  ? 5.470   40.639 39.749  1.00 27.40 ?  67   MET A N   1 
ATOM   401  C CA  . MET A 1 67  ? 5.585   41.515 38.601  1.00 27.95 ?  67   MET A CA  1 
ATOM   402  C C   . MET A 1 67  ? 6.944   41.364 37.920  1.00 26.78 ?  67   MET A C   1 
ATOM   403  O O   . MET A 1 67  ? 7.024   41.402 36.684  1.00 26.10 ?  67   MET A O   1 
ATOM   404  C CB  . MET A 1 67  ? 5.324   42.964 38.964  1.00 28.05 ?  67   MET A CB  1 
ATOM   405  C CG  . MET A 1 67  ? 5.580   43.913 37.780  1.00 34.34 ?  67   MET A CG  1 
ATOM   406  S SD  . MET A 1 67  ? 4.289   43.817 36.522  1.00 42.96 ?  67   MET A SD  1 
ATOM   407  C CE  . MET A 1 67  ? 3.080   44.844 37.363  1.00 43.97 ?  67   MET A CE  1 
ATOM   408  N N   . MET A 1 68  ? 7.996   41.224 38.731  1.00 26.07 ?  68   MET A N   1 
ATOM   409  C CA  . MET A 1 68  ? 9.344   40.950 38.227  1.00 25.41 ?  68   MET A CA  1 
ATOM   410  C C   . MET A 1 68  ? 9.428   39.631 37.421  1.00 24.94 ?  68   MET A C   1 
ATOM   411  O O   . MET A 1 68  ? 9.977   39.603 36.323  1.00 24.61 ?  68   MET A O   1 
ATOM   412  C CB  . MET A 1 68  ? 10.396  41.038 39.360  1.00 26.40 ?  68   MET A CB  1 
ATOM   413  C CG  . MET A 1 68  ? 11.857  40.932 38.910  1.00 27.51 ?  68   MET A CG  1 
ATOM   414  S SD  . MET A 1 68  ? 12.606  42.427 38.194  1.00 31.56 ?  68   MET A SD  1 
ATOM   415  C CE  . MET A 1 68  ? 11.276  43.117 37.270  1.00 32.89 ?  68   MET A CE  1 
ATOM   416  N N   . LYS A 1 69  ? 8.851   38.554 37.930  1.00 23.69 ?  69   LYS A N   1 
ATOM   417  C CA  . LYS A 1 69  ? 8.780   37.323 37.158  1.00 23.45 ?  69   LYS A CA  1 
ATOM   418  C C   . LYS A 1 69  ? 8.103   37.530 35.781  1.00 23.83 ?  69   LYS A C   1 
ATOM   419  O O   . LYS A 1 69  ? 8.534   36.928 34.807  1.00 23.36 ?  69   LYS A O   1 
ATOM   420  C CB  . LYS A 1 69  ? 8.008   36.225 37.913  1.00 22.98 ?  69   LYS A CB  1 
ATOM   421  C CG  . LYS A 1 69  ? 8.620   35.843 39.243  1.00 23.93 ?  69   LYS A CG  1 
ATOM   422  C CD  . LYS A 1 69  ? 7.784   34.755 39.857  1.00 30.55 ?  69   LYS A CD  1 
ATOM   423  C CE  . LYS A 1 69  ? 8.180   34.402 41.263  1.00 32.72 ?  69   LYS A CE  1 
ATOM   424  N NZ  . LYS A 1 69  ? 7.409   33.129 41.589  1.00 39.79 ?  69   LYS A NZ  1 
ATOM   425  N N   . ARG A 1 70  ? 7.024   38.320 35.727  1.00 21.06 ?  70   ARG A N   1 
ATOM   426  C CA  . ARG A 1 70  ? 6.403   38.649 34.457  1.00 20.85 ?  70   ARG A CA  1 
ATOM   427  C C   . ARG A 1 70  ? 7.338   39.471 33.552  1.00 19.69 ?  70   ARG A C   1 
ATOM   428  O O   . ARG A 1 70  ? 7.431   39.182 32.343  1.00 20.67 ?  70   ARG A O   1 
ATOM   429  C CB  . ARG A 1 70  ? 5.108   39.417 34.649  1.00 19.96 ?  70   ARG A CB  1 
ATOM   430  C CG  . ARG A 1 70  ? 4.436   39.741 33.276  1.00 20.23 ?  70   ARG A CG  1 
ATOM   431  C CD  . ARG A 1 70  ? 3.162   40.579 33.434  1.00 21.52 ?  70   ARG A CD  1 
ATOM   432  N NE  . ARG A 1 70  ? 2.606   40.989 32.135  1.00 23.09 ?  70   ARG A NE  1 
ATOM   433  C CZ  . ARG A 1 70  ? 1.816   42.036 31.970  1.00 23.72 ?  70   ARG A CZ  1 
ATOM   434  N NH1 . ARG A 1 70  ? 1.471   42.781 33.031  1.00 24.31 ?  70   ARG A NH1 1 
ATOM   435  N NH2 . ARG A 1 70  ? 1.377   42.341 30.762  1.00 21.35 ?  70   ARG A NH2 1 
ATOM   436  N N   . ALA A 1 71  ? 8.016   40.457 34.140  1.00 18.19 ?  71   ALA A N   1 
ATOM   437  C CA  . ALA A 1 71  ? 8.927   41.306 33.398  1.00 17.75 ?  71   ALA A CA  1 
ATOM   438  C C   . ALA A 1 71  ? 10.080  40.504 32.784  1.00 18.62 ?  71   ALA A C   1 
ATOM   439  O O   . ALA A 1 71  ? 10.641  40.908 31.761  1.00 18.92 ?  71   ALA A O   1 
ATOM   440  C CB  . ALA A 1 71  ? 9.485   42.310 34.258  1.00 17.52 ?  71   ALA A CB  1 
ATOM   441  N N   . LEU A 1 72  ? 10.478  39.434 33.455  1.00 17.29 ?  72   LEU A N   1 
ATOM   442  C CA  . LEU A 1 72  ? 11.670  38.677 33.060  1.00 18.11 ?  72   LEU A CA  1 
ATOM   443  C C   . LEU A 1 72  ? 11.324  37.468 32.160  1.00 18.12 ?  72   LEU A C   1 
ATOM   444  O O   . LEU A 1 72  ? 12.206  36.714 31.787  1.00 18.35 ?  72   LEU A O   1 
ATOM   445  C CB  . LEU A 1 72  ? 12.445  38.240 34.304  1.00 18.27 ?  72   LEU A CB  1 
ATOM   446  C CG  . LEU A 1 72  ? 13.090  39.347 35.137  1.00 19.44 ?  72   LEU A CG  1 
ATOM   447  C CD1 . LEU A 1 72  ? 13.698  38.711 36.402  1.00 20.89 ?  72   LEU A CD1 1 
ATOM   448  C CD2 . LEU A 1 72  ? 14.180  40.125 34.369  1.00 18.11 ?  72   LEU A CD2 1 
ATOM   449  N N   . GLN A 1 73  ? 10.041  37.325 31.817  1.00 18.06 ?  73   GLN A N   1 
ATOM   450  C CA  . GLN A 1 73  ? 9.507   36.200 31.074  1.00 18.83 ?  73   GLN A CA  1 
ATOM   451  C C   . GLN A 1 73  ? 9.047   36.598 29.654  1.00 18.22 ?  73   GLN A C   1 
ATOM   452  O O   . GLN A 1 73  ? 8.700   37.777 29.413  1.00 18.84 ?  73   GLN A O   1 
ATOM   453  C CB  . GLN A 1 73  ? 8.338   35.623 31.864  1.00 19.33 ?  73   GLN A CB  1 
ATOM   454  C CG  . GLN A 1 73  ? 7.736   34.312 31.295  1.00 24.44 ?  73   GLN A CG  1 
ATOM   455  C CD  . GLN A 1 73  ? 8.800   33.211 31.156  1.00 30.35 ?  73   GLN A CD  1 
ATOM   456  O OE1 . GLN A 1 73  ? 9.588   33.198 30.187  1.00 32.34 ?  73   GLN A OE1 1 
ATOM   457  N NE2 . GLN A 1 73  ? 8.850   32.312 32.133  1.00 26.42 ?  73   GLN A NE2 1 
ATOM   458  N N   . TYR A 1 74  ? 9.066   35.641 28.719  1.00 17.54 ?  74   TYR A N   1 
ATOM   459  C CA  . TYR A 1 74  ? 8.429   35.802 27.395  1.00 19.26 ?  74   TYR A CA  1 
ATOM   460  C C   . TYR A 1 74  ? 7.044   36.495 27.469  1.00 20.15 ?  74   TYR A C   1 
ATOM   461  O O   . TYR A 1 74  ? 6.318   36.338 28.459  1.00 20.13 ?  74   TYR A O   1 
ATOM   462  C CB  . TYR A 1 74  ? 8.262   34.432 26.683  1.00 18.80 ?  74   TYR A CB  1 
ATOM   463  C CG  . TYR A 1 74  ? 9.569   33.762 26.286  1.00 19.76 ?  74   TYR A CG  1 
ATOM   464  C CD1 . TYR A 1 74  ? 10.452  34.385 25.406  1.00 17.14 ?  74   TYR A CD1 1 
ATOM   465  C CD2 . TYR A 1 74  ? 9.900   32.489 26.741  1.00 17.66 ?  74   TYR A CD2 1 
ATOM   466  C CE1 . TYR A 1 74  ? 11.664  33.748 24.978  1.00 16.44 ?  74   TYR A CE1 1 
ATOM   467  C CE2 . TYR A 1 74  ? 11.141  31.839 26.327  1.00 19.73 ?  74   TYR A CE2 1 
ATOM   468  C CZ  . TYR A 1 74  ? 11.989  32.486 25.433  1.00 20.44 ?  74   TYR A CZ  1 
ATOM   469  O OH  . TYR A 1 74  ? 13.185  31.898 25.048  1.00 21.01 ?  74   TYR A OH  1 
ATOM   470  N N   . SER A 1 75  ? 6.702   37.252 26.422  1.00 19.76 ?  75   SER A N   1 
ATOM   471  C CA  . SER A 1 75  ? 5.398   37.904 26.294  1.00 19.75 ?  75   SER A CA  1 
ATOM   472  C C   . SER A 1 75  ? 4.926   38.015 24.817  1.00 18.47 ?  75   SER A C   1 
ATOM   473  O O   . SER A 1 75  ? 5.640   37.567 23.916  1.00 19.61 ?  75   SER A O   1 
ATOM   474  C CB  . SER A 1 75  ? 5.453   39.288 26.971  1.00 19.62 ?  75   SER A CB  1 
ATOM   475  O OG  . SER A 1 75  ? 6.479   40.076 26.362  1.00 22.10 ?  75   SER A OG  1 
ATOM   476  N N   . PRO A 1 76  ? 3.732   38.592 24.564  1.00 17.26 ?  76   PRO A N   1 
ATOM   477  C CA  . PRO A 1 76  ? 3.195   38.520 23.204  1.00 17.25 ?  76   PRO A CA  1 
ATOM   478  C C   . PRO A 1 76  ? 4.054   39.264 22.182  1.00 17.65 ?  76   PRO A C   1 
ATOM   479  O O   . PRO A 1 76  ? 4.585   40.338 22.481  1.00 18.07 ?  76   PRO A O   1 
ATOM   480  C CB  . PRO A 1 76  ? 1.789   39.151 23.338  1.00 16.74 ?  76   PRO A CB  1 
ATOM   481  C CG  . PRO A 1 76  ? 1.469   39.001 24.837  1.00 18.51 ?  76   PRO A CG  1 
ATOM   482  C CD  . PRO A 1 76  ? 2.787   39.273 25.490  1.00 16.77 ?  76   PRO A CD  1 
ATOM   483  N N   . SER A 1 77  ? 4.174   38.691 20.982  1.00 18.37 ?  77   SER A N   1 
ATOM   484  C CA  . SER A 1 77  ? 4.958   39.295 19.886  1.00 19.50 ?  77   SER A CA  1 
ATOM   485  C C   . SER A 1 77  ? 4.607   40.743 19.538  1.00 18.44 ?  77   SER A C   1 
ATOM   486  O O   . SER A 1 77  ? 5.503   41.549 19.342  1.00 18.74 ?  77   SER A O   1 
ATOM   487  C CB  . SER A 1 77  ? 4.929   38.388 18.632  1.00 20.11 ?  77   SER A CB  1 
ATOM   488  O OG  . SER A 1 77  ? 5.745   37.212 18.884  1.00 24.49 ?  77   SER A OG  1 
ATOM   489  N N   . ALA A 1 78  ? 3.311   41.065 19.461  1.00 16.75 ?  78   ALA A N   1 
ATOM   490  C CA  . ALA A 1 78  ? 2.850   42.448 19.172  1.00 15.33 ?  78   ALA A CA  1 
ATOM   491  C C   . ALA A 1 78  ? 3.085   43.433 20.334  1.00 15.22 ?  78   ALA A C   1 
ATOM   492  O O   . ALA A 1 78  ? 2.965   44.644 20.159  1.00 15.34 ?  78   ALA A O   1 
ATOM   493  C CB  . ALA A 1 78  ? 1.347   42.428 18.807  1.00 15.50 ?  78   ALA A CB  1 
ATOM   494  N N   . GLY A 1 79  ? 3.431   42.946 21.523  1.00 14.08 ?  79   GLY A N   1 
ATOM   495  C CA  . GLY A 1 79  ? 3.489   43.865 22.683  1.00 13.87 ?  79   GLY A CA  1 
ATOM   496  C C   . GLY A 1 79  ? 2.559   43.416 23.818  1.00 14.41 ?  79   GLY A C   1 
ATOM   497  O O   . GLY A 1 79  ? 1.639   42.592 23.607  1.00 14.57 ?  79   GLY A O   1 
ATOM   498  N N   . ILE A 1 80  ? 2.804   43.926 25.017  1.00 15.92 ?  80   ILE A N   1 
ATOM   499  C CA  . ILE A 1 80  ? 2.004   43.605 26.191  1.00 16.37 ?  80   ILE A CA  1 
ATOM   500  C C   . ILE A 1 80  ? 0.645   44.292 26.089  1.00 17.16 ?  80   ILE A C   1 
ATOM   501  O O   . ILE A 1 80  ? 0.537   45.383 25.534  1.00 16.12 ?  80   ILE A O   1 
ATOM   502  C CB  . ILE A 1 80  ? 2.735   43.938 27.533  1.00 16.44 ?  80   ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 80  ? 2.957   45.455 27.726  1.00 17.32 ?  80   ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 80  ? 4.054   43.141 27.627  1.00 15.34 ?  80   ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 80  ? 3.458   45.855 29.175  1.00 17.31 ?  80   ILE A CD1 1 
ATOM   506  N N   . PRO A 1 81  ? -0.418  43.628 26.569  1.00 18.95 ?  81   PRO A N   1 
ATOM   507  C CA  . PRO A 1 81  ? -1.755  44.179 26.264  1.00 19.53 ?  81   PRO A CA  1 
ATOM   508  C C   . PRO A 1 81  ? -2.020  45.568 26.815  1.00 20.17 ?  81   PRO A C   1 
ATOM   509  O O   . PRO A 1 81  ? -2.693  46.352 26.153  1.00 21.95 ?  81   PRO A O   1 
ATOM   510  C CB  . PRO A 1 81  ? -2.757  43.149 26.875  1.00 20.20 ?  81   PRO A CB  1 
ATOM   511  C CG  . PRO A 1 81  ? -1.941  42.371 27.891  1.00 22.06 ?  81   PRO A CG  1 
ATOM   512  C CD  . PRO A 1 81  ? -0.484  42.364 27.324  1.00 18.87 ?  81   PRO A CD  1 
ATOM   513  N N   . GLU A 1 82  ? -1.482  45.901 27.976  1.00 20.00 ?  82   GLU A N   1 
ATOM   514  C CA  . GLU A 1 82  ? -1.797  47.197 28.552  1.00 20.98 ?  82   GLU A CA  1 
ATOM   515  C C   . GLU A 1 82  ? -1.113  48.345 27.828  1.00 19.71 ?  82   GLU A C   1 
ATOM   516  O O   . GLU A 1 82  ? -1.672  49.462 27.724  1.00 16.46 ?  82   GLU A O   1 
ATOM   517  C CB  . GLU A 1 82  ? -1.509  47.232 30.064  1.00 22.41 ?  82   GLU A CB  1 
ATOM   518  C CG  . GLU A 1 82  ? -0.095  46.926 30.475  1.00 28.49 ?  82   GLU A CG  1 
ATOM   519  C CD  . GLU A 1 82  ? 0.080   45.435 30.841  1.00 30.11 ?  82   GLU A CD  1 
ATOM   520  O OE1 . GLU A 1 82  ? -0.273  44.559 30.022  1.00 31.58 ?  82   GLU A OE1 1 
ATOM   521  O OE2 . GLU A 1 82  ? 0.552   45.159 31.972  1.00 33.18 ?  82   GLU A OE2 1 
ATOM   522  N N   . LEU A 1 83  ? 0.098   48.087 27.321  1.00 17.46 ?  83   LEU A N   1 
ATOM   523  C CA  . LEU A 1 83  ? 0.752   49.097 26.496  1.00 16.16 ?  83   LEU A CA  1 
ATOM   524  C C   . LEU A 1 83  ? 0.040   49.282 25.121  1.00 16.38 ?  83   LEU A C   1 
ATOM   525  O O   . LEU A 1 83  ? -0.183  50.405 24.676  1.00 17.21 ?  83   LEU A O   1 
ATOM   526  C CB  . LEU A 1 83  ? 2.267   48.812 26.377  1.00 16.45 ?  83   LEU A CB  1 
ATOM   527  C CG  . LEU A 1 83  ? 3.136   49.831 25.635  1.00 15.17 ?  83   LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 83  ? 3.017   51.240 26.279  1.00 12.91 ?  83   LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 83  ? 4.601   49.337 25.557  1.00 15.33 ?  83   LEU A CD2 1 
ATOM   530  N N   . LEU A 1 84  ? -0.366  48.189 24.488  1.00 17.51 ?  84   LEU A N   1 
ATOM   531  C CA  . LEU A 1 84  ? -1.074  48.278 23.195  1.00 17.70 ?  84   LEU A CA  1 
ATOM   532  C C   . LEU A 1 84  ? -2.420  49.006 23.353  1.00 17.66 ?  84   LEU A C   1 
ATOM   533  O O   . LEU A 1 84  ? -2.757  49.823 22.516  1.00 16.20 ?  84   LEU A O   1 
ATOM   534  C CB  . LEU A 1 84  ? -1.344  46.880 22.631  1.00 18.99 ?  84   LEU A CB  1 
ATOM   535  C CG  . LEU A 1 84  ? -0.152  46.132 22.049  1.00 18.97 ?  84   LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 84  ? -0.591  44.720 21.742  1.00 19.50 ?  84   LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 84  ? 0.280   46.849 20.783  1.00 19.02 ?  84   LEU A CD2 1 
ATOM   538  N N   . SER A 1 85  ? -3.179  48.746 24.433  1.00 17.59 ?  85   SER A N   1 
ATOM   539  C CA  . SER A 1 85  ? -4.460  49.497 24.602  1.00 18.30 ?  85   SER A CA  1 
ATOM   540  C C   . SER A 1 85  ? -4.222  50.949 24.869  1.00 16.69 ?  85   SER A C   1 
ATOM   541  O O   . SER A 1 85  ? -4.950  51.788 24.325  1.00 17.98 ?  85   SER A O   1 
ATOM   542  C CB  . SER A 1 85  ? -5.366  48.956 25.707  1.00 19.05 ?  85   SER A CB  1 
ATOM   543  O OG  . SER A 1 85  ? -4.568  48.697 26.830  1.00 22.26 ?  85   SER A OG  1 
ATOM   544  N N   . TRP A 1 86  ? -3.239  51.272 25.697  1.00 15.64 ?  86   TRP A N   1 
ATOM   545  C CA  . TRP A 1 86  ? -2.919  52.669 25.932  1.00 15.86 ?  86   TRP A CA  1 
ATOM   546  C C   . TRP A 1 86  ? -2.525  53.406 24.638  1.00 15.78 ?  86   TRP A C   1 
ATOM   547  O O   . TRP A 1 86  ? -2.941  54.567 24.385  1.00 16.41 ?  86   TRP A O   1 
ATOM   548  C CB  . TRP A 1 86  ? -1.727  52.792 26.881  1.00 15.94 ?  86   TRP A CB  1 
ATOM   549  C CG  . TRP A 1 86  ? -1.715  54.112 27.584  1.00 18.96 ?  86   TRP A CG  1 
ATOM   550  C CD1 . TRP A 1 86  ? -2.386  54.417 28.793  1.00 16.93 ?  86   TRP A CD1 1 
ATOM   551  C CD2 . TRP A 1 86  ? -1.036  55.328 27.196  1.00 19.09 ?  86   TRP A CD2 1 
ATOM   552  N NE1 . TRP A 1 86  ? -2.123  55.726 29.142  1.00 18.76 ?  86   TRP A NE1 1 
ATOM   553  C CE2 . TRP A 1 86  ? -1.343  56.319 28.185  1.00 17.80 ?  86   TRP A CE2 1 
ATOM   554  C CE3 . TRP A 1 86  ? -0.223  55.698 26.106  1.00 21.34 ?  86   TRP A CE3 1 
ATOM   555  C CZ2 . TRP A 1 86  ? -0.861  57.635 28.107  1.00 19.19 ?  86   TRP A CZ2 1 
ATOM   556  C CZ3 . TRP A 1 86  ? 0.250   57.024 26.035  1.00 17.17 ?  86   TRP A CZ3 1 
ATOM   557  C CH2 . TRP A 1 86  ? -0.047  57.953 27.032  1.00 18.05 ?  86   TRP A CH2 1 
ATOM   558  N N   . LEU A 1 87  ? -1.643  52.770 23.859  1.00 14.73 ?  87   LEU A N   1 
ATOM   559  C CA  . LEU A 1 87  ? -1.170  53.398 22.603  1.00 15.09 ?  87   LEU A CA  1 
ATOM   560  C C   . LEU A 1 87  ? -2.314  53.519 21.605  1.00 14.30 ?  87   LEU A C   1 
ATOM   561  O O   . LEU A 1 87  ? -2.388  54.510 20.862  1.00 14.96 ?  87   LEU A O   1 
ATOM   562  C CB  . LEU A 1 87  ? 0.059   52.657 22.008  1.00 15.91 ?  87   LEU A CB  1 
ATOM   563  C CG  . LEU A 1 87  ? 1.340   52.635 22.869  1.00 14.49 ?  87   LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 87  ? 2.386   51.696 22.254  1.00 17.09 ?  87   LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 87  ? 1.877   54.069 22.982  1.00 15.51 ?  87   LEU A CD2 1 
ATOM   566  N N   . LYS A 1 88  ? -3.227  52.554 21.594  1.00 15.64 ?  88   LYS A N   1 
ATOM   567  C CA  . LYS A 1 88  ? -4.373  52.638 20.670  1.00 17.07 ?  88   LYS A CA  1 
ATOM   568  C C   . LYS A 1 88  ? -5.249  53.862 20.987  1.00 18.08 ?  88   LYS A C   1 
ATOM   569  O O   . LYS A 1 88  ? -5.633  54.610 20.083  1.00 17.43 ?  88   LYS A O   1 
ATOM   570  C CB  . LYS A 1 88  ? -5.187  51.334 20.644  1.00 17.26 ?  88   LYS A CB  1 
ATOM   571  C CG  . LYS A 1 88  ? -4.459  50.204 19.793  1.00 23.88 ?  88   LYS A CG  1 
ATOM   572  C CD  . LYS A 1 88  ? -5.485  49.223 19.063  1.00 30.75 ?  88   LYS A CD  1 
ATOM   573  C CE  . LYS A 1 88  ? -4.803  48.018 18.362  1.00 27.37 ?  88   LYS A CE  1 
ATOM   574  N NZ  . LYS A 1 88  ? -4.057  47.264 19.445  1.00 35.46 ?  88   LYS A NZ  1 
ATOM   575  N N   . GLN A 1 89  ? -5.518  54.079 22.283  1.00 18.79 ?  89   GLN A N   1 
ATOM   576  C CA  . GLN A 1 89  ? -6.236  55.264 22.754  1.00 19.45 ?  89   GLN A CA  1 
ATOM   577  C C   . GLN A 1 89  ? -5.477  56.546 22.507  1.00 18.53 ?  89   GLN A C   1 
ATOM   578  O O   . GLN A 1 89  ? -6.082  57.502 22.060  1.00 17.88 ?  89   GLN A O   1 
ATOM   579  C CB  . GLN A 1 89  ? -6.631  55.137 24.232  1.00 21.86 ?  89   GLN A CB  1 
ATOM   580  C CG  . GLN A 1 89  ? -7.904  56.021 24.633  1.00 28.37 ?  89   GLN A CG  1 
ATOM   581  C CD  . GLN A 1 89  ? -8.928  56.210 23.458  1.00 34.11 ?  89   GLN A CD  1 
ATOM   582  O OE1 . GLN A 1 89  ? -9.622  55.246 23.040  1.00 34.96 ?  89   GLN A OE1 1 
ATOM   583  N NE2 . GLN A 1 89  ? -8.983  57.446 22.908  1.00 29.60 ?  89   GLN A NE2 1 
ATOM   584  N N   . LEU A 1 90  ? -4.164  56.580 22.746  1.00 16.02 ?  90   LEU A N   1 
ATOM   585  C CA  . LEU A 1 90  ? -3.347  57.727 22.269  1.00 16.66 ?  90   LEU A CA  1 
ATOM   586  C C   . LEU A 1 90  ? -3.535  58.033 20.764  1.00 15.98 ?  90   LEU A C   1 
ATOM   587  O O   . LEU A 1 90  ? -3.801  59.207 20.371  1.00 15.64 ?  90   LEU A O   1 
ATOM   588  C CB  . LEU A 1 90  ? -1.847  57.533 22.538  1.00 16.03 ?  90   LEU A CB  1 
ATOM   589  C CG  . LEU A 1 90  ? -0.903  58.692 22.185  1.00 18.05 ?  90   LEU A CG  1 
ATOM   590  C CD1 . LEU A 1 90  ? -0.941  59.905 23.184  1.00 16.39 ?  90   LEU A CD1 1 
ATOM   591  C CD2 . LEU A 1 90  ? 0.549   58.148 22.013  1.00 17.93 ?  90   LEU A CD2 1 
ATOM   592  N N   . GLN A 1 91  ? -3.439  57.004 19.935  1.00 14.10 ?  91   GLN A N   1 
ATOM   593  C CA  . GLN A 1 91  ? -3.579  57.235 18.473  1.00 14.29 ?  91   GLN A CA  1 
ATOM   594  C C   . GLN A 1 91  ? -4.965  57.750 18.127  1.00 14.02 ?  91   GLN A C   1 
ATOM   595  O O   . GLN A 1 91  ? -5.124  58.663 17.296  1.00 15.06 ?  91   GLN A O   1 
ATOM   596  C CB  . GLN A 1 91  ? -3.271  55.982 17.660  1.00 13.34 ?  91   GLN A CB  1 
ATOM   597  C CG  . GLN A 1 91  ? -1.811  55.437 17.810  1.00 14.68 ?  91   GLN A CG  1 
ATOM   598  C CD  . GLN A 1 91  ? -0.764  56.444 17.359  1.00 17.44 ?  91   GLN A CD  1 
ATOM   599  O OE1 . GLN A 1 91  ? -0.088  56.267 16.326  1.00 18.60 ?  91   GLN A OE1 1 
ATOM   600  N NE2 . GLN A 1 91  ? -0.604  57.485 18.129  1.00 12.59 ?  91   GLN A NE2 1 
ATOM   601  N N   . ILE A 1 92  ? -5.968  57.155 18.739  1.00 15.72 ?  92   ILE A N   1 
ATOM   602  C CA  . ILE A 1 92  ? -7.357  57.606 18.523  1.00 18.01 ?  92   ILE A CA  1 
ATOM   603  C C   . ILE A 1 92  ? -7.585  59.095 18.893  1.00 18.03 ?  92   ILE A C   1 
ATOM   604  O O   . ILE A 1 92  ? -8.152  59.872 18.117  1.00 16.82 ?  92   ILE A O   1 
ATOM   605  C CB  . ILE A 1 92  ? -8.357  56.602 19.200  1.00 18.09 ?  92   ILE A CB  1 
ATOM   606  C CG1 . ILE A 1 92  ? -8.409  55.337 18.331  1.00 20.02 ?  92   ILE A CG1 1 
ATOM   607  C CG2 . ILE A 1 92  ? -9.776  57.241 19.405  1.00 19.74 ?  92   ILE A CG2 1 
ATOM   608  C CD1 . ILE A 1 92  ? -9.069  54.116 18.982  1.00 19.02 ?  92   ILE A CD1 1 
ATOM   609  N N   . LYS A 1 93  ? -7.099  59.492 20.070  1.00 18.86 ?  93   LYS A N   1 
ATOM   610  C CA  . LYS A 1 93  ? -7.205  60.876 20.547  1.00 19.89 ?  93   LYS A CA  1 
ATOM   611  C C   . LYS A 1 93  ? -6.433  61.889 19.754  1.00 18.77 ?  93   LYS A C   1 
ATOM   612  O O   . LYS A 1 93  ? -6.883  63.014 19.594  1.00 19.91 ?  93   LYS A O   1 
ATOM   613  C CB  . LYS A 1 93  ? -6.691  60.997 21.986  1.00 20.27 ?  93   LYS A CB  1 
ATOM   614  C CG  . LYS A 1 93  ? -7.579  60.279 22.951  1.00 27.32 ?  93   LYS A CG  1 
ATOM   615  C CD  . LYS A 1 93  ? -7.410  60.820 24.400  1.00 34.53 ?  93   LYS A CD  1 
ATOM   616  C CE  . LYS A 1 93  ? -7.785  59.718 25.440  1.00 36.85 ?  93   LYS A CE  1 
ATOM   617  N NZ  . LYS A 1 93  ? -9.148  59.134 25.205  1.00 37.29 ?  93   LYS A NZ  1 
ATOM   618  N N   . LEU A 1 94  ? -5.226  61.558 19.348  1.00 17.42 ?  94   LEU A N   1 
ATOM   619  C CA  . LEU A 1 94  ? -4.414  62.521 18.573  1.00 18.77 ?  94   LEU A CA  1 
ATOM   620  C C   . LEU A 1 94  ? -4.780  62.630 17.084  1.00 18.43 ?  94   LEU A C   1 
ATOM   621  O O   . LEU A 1 94  ? -4.673  63.710 16.515  1.00 20.79 ?  94   LEU A O   1 
ATOM   622  C CB  . LEU A 1 94  ? -2.900  62.184 18.681  1.00 18.86 ?  94   LEU A CB  1 
ATOM   623  C CG  . LEU A 1 94  ? -2.275  62.203 20.076  1.00 23.12 ?  94   LEU A CG  1 
ATOM   624  C CD1 . LEU A 1 94  ? -0.786  61.917 19.997  1.00 22.13 ?  94   LEU A CD1 1 
ATOM   625  C CD2 . LEU A 1 94  ? -2.528  63.537 20.808  1.00 25.94 ?  94   LEU A CD2 1 
ATOM   626  N N   . HIS A 1 95  ? -5.156  61.504 16.462  1.00 18.03 ?  95   HIS A N   1 
ATOM   627  C CA  . HIS A 1 95  ? -5.268  61.362 14.983  1.00 17.45 ?  95   HIS A CA  1 
ATOM   628  C C   . HIS A 1 95  ? -6.659  60.896 14.505  1.00 18.42 ?  95   HIS A C   1 
ATOM   629  O O   . HIS A 1 95  ? -6.945  60.958 13.317  1.00 18.18 ?  95   HIS A O   1 
ATOM   630  C CB  . HIS A 1 95  ? -4.188  60.361 14.487  1.00 16.45 ?  95   HIS A CB  1 
ATOM   631  C CG  . HIS A 1 95  ? -2.801  60.729 14.932  1.00 15.12 ?  95   HIS A CG  1 
ATOM   632  N ND1 . HIS A 1 95  ? -1.998  59.890 15.675  1.00 16.91 ?  95   HIS A ND1 1 
ATOM   633  C CD2 . HIS A 1 95  ? -2.109  61.895 14.802  1.00 14.67 ?  95   HIS A CD2 1 
ATOM   634  C CE1 . HIS A 1 95  ? -0.871  60.523 15.994  1.00 10.34 ?  95   HIS A CE1 1 
ATOM   635  N NE2 . HIS A 1 95  ? -0.917  61.744 15.484  1.00 17.46 ?  95   HIS A NE2 1 
ATOM   636  N N   . ASN A 1 96  ? -7.493  60.393 15.414  1.00 18.44 ?  96   ASN A N   1 
ATOM   637  C CA  . ASN A 1 96  ? -8.803  59.824 15.063  1.00 19.73 ?  96   ASN A CA  1 
ATOM   638  C C   . ASN A 1 96  ? -8.820  59.238 13.656  1.00 20.11 ?  96   ASN A C   1 
ATOM   639  O O   . ASN A 1 96  ? -9.533  59.768 12.785  1.00 20.39 ?  96   ASN A O   1 
ATOM   640  C CB  . ASN A 1 96  ? -9.838  60.959 15.102  1.00 20.93 ?  96   ASN A CB  1 
ATOM   641  C CG  . ASN A 1 96  ? -11.251 60.457 15.248  1.00 24.16 ?  96   ASN A CG  1 
ATOM   642  O OD1 . ASN A 1 96  ? -11.482 59.284 15.512  1.00 27.12 ?  96   ASN A OD1 1 
ATOM   643  N ND2 . ASN A 1 96  ? -12.217 61.353 15.058  1.00 28.28 ?  96   ASN A ND2 1 
ATOM   644  N N   . PRO A 1 97  ? -8.035  58.156 13.398  1.00 19.61 ?  97   PRO A N   1 
ATOM   645  C CA  . PRO A 1 97  ? -7.956  57.683 12.008  1.00 19.62 ?  97   PRO A CA  1 
ATOM   646  C C   . PRO A 1 97  ? -9.312  57.122 11.526  1.00 20.01 ?  97   PRO A C   1 
ATOM   647  O O   . PRO A 1 97  ? -10.004 56.419 12.283  1.00 18.67 ?  97   PRO A O   1 
ATOM   648  C CB  . PRO A 1 97  ? -6.873  56.602 12.068  1.00 19.12 ?  97   PRO A CB  1 
ATOM   649  C CG  . PRO A 1 97  ? -6.124  56.902 13.416  1.00 21.57 ?  97   PRO A CG  1 
ATOM   650  C CD  . PRO A 1 97  ? -7.229  57.324 14.301  1.00 18.99 ?  97   PRO A CD  1 
ATOM   651  N N   . PRO A 1 98  ? -9.708  57.454 10.287  1.00 19.57 ?  98   PRO A N   1 
ATOM   652  C CA  . PRO A 1 98  ? -11.002 57.037 9.704   1.00 20.30 ?  98   PRO A CA  1 
ATOM   653  C C   . PRO A 1 98  ? -11.159 55.508 9.725   1.00 20.55 ?  98   PRO A C   1 
ATOM   654  O O   . PRO A 1 98  ? -12.258 54.953 9.757   1.00 21.07 ?  98   PRO A O   1 
ATOM   655  C CB  . PRO A 1 98  ? -10.881 57.502 8.252   1.00 20.66 ?  98   PRO A CB  1 
ATOM   656  C CG  . PRO A 1 98  ? -9.966  58.683 8.327   1.00 22.26 ?  98   PRO A CG  1 
ATOM   657  C CD  . PRO A 1 98  ? -8.924  58.279 9.357   1.00 19.92 ?  98   PRO A CD  1 
ATOM   658  N N   . THR A 1 99  ? -10.023 54.863 9.829   1.00 19.26 ?  99   THR A N   1 
ATOM   659  C CA  . THR A 1 99  ? -9.822  53.487 9.554   1.00 19.08 ?  99   THR A CA  1 
ATOM   660  C C   . THR A 1 99  ? -10.158 52.582 10.790  1.00 19.17 ?  99   THR A C   1 
ATOM   661  O O   . THR A 1 99  ? -10.237 51.351 10.693  1.00 18.17 ?  99   THR A O   1 
ATOM   662  C CB  . THR A 1 99  ? -8.321  53.463 9.140   1.00 20.35 ?  99   THR A CB  1 
ATOM   663  O OG1 . THR A 1 99  ? -8.136  53.086 7.745   1.00 24.46 ?  99   THR A OG1 1 
ATOM   664  C CG2 . THR A 1 99  ? -7.510  52.755 10.060  1.00 17.17 ?  99   THR A CG2 1 
ATOM   665  N N   . ILE A 1 100 ? -10.386 53.188 11.950  1.00 18.87 ?  100  ILE A N   1 
ATOM   666  C CA  . ILE A 1 100 ? -10.735 52.392 13.119  1.00 19.58 ?  100  ILE A CA  1 
ATOM   667  C C   . ILE A 1 100 ? -12.064 51.627 12.967  1.00 20.99 ?  100  ILE A C   1 
ATOM   668  O O   . ILE A 1 100 ? -12.206 50.543 13.528  1.00 20.92 ?  100  ILE A O   1 
ATOM   669  C CB  . ILE A 1 100 ? -10.680 53.177 14.422  1.00 20.22 ?  100  ILE A CB  1 
ATOM   670  C CG1 . ILE A 1 100 ? -11.734 54.242 14.480  1.00 22.22 ?  100  ILE A CG1 1 
ATOM   671  C CG2 . ILE A 1 100 ? -9.332  53.896 14.571  1.00 20.20 ?  100  ILE A CG2 1 
ATOM   672  C CD1 . ILE A 1 100 ? -11.515 55.209 15.686  1.00 28.51 ?  100  ILE A CD1 1 
ATOM   673  N N   . HIS A 1 101 ? -12.961 52.123 12.128  1.00 21.72 ?  101  HIS A N   1 
ATOM   674  C CA  . HIS A 1 101 ? -14.252 51.492 11.968  1.00 24.53 ?  101  HIS A CA  1 
ATOM   675  C C   . HIS A 1 101 ? -14.316 50.523 10.781  1.00 24.26 ?  101  HIS A C   1 
ATOM   676  O O   . HIS A 1 101 ? -15.363 49.911 10.548  1.00 26.10 ?  101  HIS A O   1 
ATOM   677  C CB  . HIS A 1 101 ? -15.352 52.550 11.894  1.00 24.48 ?  101  HIS A CB  1 
ATOM   678  C CG  . HIS A 1 101 ? -15.473 53.367 13.146  1.00 31.10 ?  101  HIS A CG  1 
ATOM   679  N ND1 . HIS A 1 101 ? -15.228 54.731 13.184  1.00 31.97 ?  101  HIS A ND1 1 
ATOM   680  C CD2 . HIS A 1 101 ? -15.735 52.991 14.423  1.00 32.72 ?  101  HIS A CD2 1 
ATOM   681  C CE1 . HIS A 1 101 ? -15.374 55.158 14.427  1.00 37.03 ?  101  HIS A CE1 1 
ATOM   682  N NE2 . HIS A 1 101 ? -15.685 54.123 15.196  1.00 36.96 ?  101  HIS A NE2 1 
ATOM   683  N N   . TYR A 1 102 ? -13.208 50.361 10.050  1.00 22.34 ?  102  TYR A N   1 
ATOM   684  C CA  . TYR A 1 102 ? -13.188 49.441 8.881   1.00 20.98 ?  102  TYR A CA  1 
ATOM   685  C C   . TYR A 1 102 ? -13.049 47.957 9.289   1.00 21.63 ?  102  TYR A C   1 
ATOM   686  O O   . TYR A 1 102 ? -12.517 47.678 10.352  1.00 22.73 ?  102  TYR A O   1 
ATOM   687  C CB  . TYR A 1 102 ? -12.052 49.844 7.933   1.00 19.45 ?  102  TYR A CB  1 
ATOM   688  C CG  . TYR A 1 102 ? -12.181 51.223 7.295   1.00 16.81 ?  102  TYR A CG  1 
ATOM   689  C CD1 . TYR A 1 102 ? -11.252 51.638 6.345   1.00 17.65 ?  102  TYR A CD1 1 
ATOM   690  C CD2 . TYR A 1 102 ? -13.242 52.094 7.594   1.00 14.11 ?  102  TYR A CD2 1 
ATOM   691  C CE1 . TYR A 1 102 ? -11.326 52.879 5.773   1.00 15.44 ?  102  TYR A CE1 1 
ATOM   692  C CE2 . TYR A 1 102 ? -13.339 53.332 6.990   1.00 14.38 ?  102  TYR A CE2 1 
ATOM   693  C CZ  . TYR A 1 102 ? -12.356 53.726 6.079   1.00 17.20 ?  102  TYR A CZ  1 
ATOM   694  O OH  . TYR A 1 102 ? -12.407 54.930 5.428   1.00 13.25 ?  102  TYR A OH  1 
ATOM   695  N N   . PRO A 1 103 ? -13.514 47.008 8.447   1.00 22.07 ?  103  PRO A N   1 
ATOM   696  C CA  . PRO A 1 103 ? -13.181 45.587 8.624   1.00 22.78 ?  103  PRO A CA  1 
ATOM   697  C C   . PRO A 1 103 ? -11.658 45.373 8.426   1.00 23.44 ?  103  PRO A C   1 
ATOM   698  O O   . PRO A 1 103 ? -11.041 46.166 7.714   1.00 22.19 ?  103  PRO A O   1 
ATOM   699  C CB  . PRO A 1 103 ? -13.898 44.912 7.457   1.00 23.01 ?  103  PRO A CB  1 
ATOM   700  C CG  . PRO A 1 103 ? -14.981 45.935 7.009   1.00 24.48 ?  103  PRO A CG  1 
ATOM   701  C CD  . PRO A 1 103 ? -14.326 47.238 7.229   1.00 22.37 ?  103  PRO A CD  1 
ATOM   702  N N   . PRO A 1 104 ? -11.091 44.299 9.013   1.00 23.99 ?  104  PRO A N   1 
ATOM   703  C CA  . PRO A 1 104 ? -9.657  43.942 8.865   1.00 24.89 ?  104  PRO A CA  1 
ATOM   704  C C   . PRO A 1 104 ? -9.160  44.020 7.411   1.00 24.75 ?  104  PRO A C   1 
ATOM   705  O O   . PRO A 1 104 ? -8.208  44.758 7.127   1.00 23.69 ?  104  PRO A O   1 
ATOM   706  C CB  . PRO A 1 104 ? -9.616  42.519 9.405   1.00 25.58 ?  104  PRO A CB  1 
ATOM   707  C CG  . PRO A 1 104 ? -10.586 42.600 10.563  1.00 25.80 ?  104  PRO A CG  1 
ATOM   708  C CD  . PRO A 1 104 ? -11.773 43.338 9.903   1.00 24.29 ?  104  PRO A CD  1 
ATOM   709  N N   . SER A 1 105 ? -9.847  43.344 6.485   1.00 24.40 ?  105  SER A N   1 
ATOM   710  C CA  . SER A 1 105 ? -9.384  43.286 5.101   1.00 24.26 ?  105  SER A CA  1 
ATOM   711  C C   . SER A 1 105 ? -9.341  44.640 4.406   1.00 23.76 ?  105  SER A C   1 
ATOM   712  O O   . SER A 1 105 ? -8.552  44.823 3.466   1.00 23.17 ?  105  SER A O   1 
ATOM   713  C CB  . SER A 1 105 ? -10.201 42.273 4.287   1.00 24.63 ?  105  SER A CB  1 
ATOM   714  O OG  . SER A 1 105 ? -11.508 42.776 4.141   1.00 28.47 ?  105  SER A OG  1 
ATOM   715  N N   . GLN A 1 106 ? -10.185 45.580 4.848   1.00 23.01 ?  106  GLN A N   1 
ATOM   716  C CA  . GLN A 1 106 ? -10.238 46.913 4.243   1.00 22.81 ?  106  GLN A CA  1 
ATOM   717  C C   . GLN A 1 106 ? -9.275  47.856 4.941   1.00 22.36 ?  106  GLN A C   1 
ATOM   718  O O   . GLN A 1 106 ? -9.280  49.070 4.674   1.00 22.21 ?  106  GLN A O   1 
ATOM   719  C CB  . GLN A 1 106 ? -11.645 47.511 4.338   1.00 23.07 ?  106  GLN A CB  1 
ATOM   720  C CG  . GLN A 1 106 ? -12.731 46.774 3.555   1.00 24.18 ?  106  GLN A CG  1 
ATOM   721  C CD  . GLN A 1 106 ? -12.267 46.388 2.162   1.00 26.87 ?  106  GLN A CD  1 
ATOM   722  O OE1 . GLN A 1 106 ? -12.079 45.216 1.899   1.00 34.81 ?  106  GLN A OE1 1 
ATOM   723  N NE2 . GLN A 1 106 ? -11.986 47.364 1.312   1.00 27.40 ?  106  GLN A NE2 1 
ATOM   724  N N   . GLY A 1 107 ? -8.489  47.315 5.880   1.00 21.75 ?  107  GLY A N   1 
ATOM   725  C CA  . GLY A 1 107 ? -7.364  48.086 6.453   1.00 19.95 ?  107  GLY A CA  1 
ATOM   726  C C   . GLY A 1 107 ? -7.656  48.696 7.816   1.00 19.07 ?  107  GLY A C   1 
ATOM   727  O O   . GLY A 1 107 ? -7.145  49.759 8.146   1.00 18.69 ?  107  GLY A O   1 
ATOM   728  N N   . GLN A 1 108 ? -8.463  48.012 8.614   1.00 18.16 ?  108  GLN A N   1 
ATOM   729  C CA  . GLN A 1 108 ? -8.717  48.435 10.010  1.00 17.12 ?  108  GLN A CA  1 
ATOM   730  C C   . GLN A 1 108 ? -7.435  48.848 10.724  1.00 17.60 ?  108  GLN A C   1 
ATOM   731  O O   . GLN A 1 108 ? -6.458  48.102 10.681  1.00 16.73 ?  108  GLN A O   1 
ATOM   732  C CB  . GLN A 1 108 ? -9.312  47.254 10.786  1.00 17.35 ?  108  GLN A CB  1 
ATOM   733  C CG  . GLN A 1 108 ? -9.779  47.506 12.231  1.00 17.33 ?  108  GLN A CG  1 
ATOM   734  C CD  . GLN A 1 108 ? -10.418 46.227 12.812  1.00 24.66 ?  108  GLN A CD  1 
ATOM   735  O OE1 . GLN A 1 108 ? -11.616 45.984 12.664  1.00 29.12 ?  108  GLN A OE1 1 
ATOM   736  N NE2 . GLN A 1 108 ? -9.608  45.395 13.429  1.00 23.60 ?  108  GLN A NE2 1 
ATOM   737  N N   . MET A 1 109 ? -7.467  49.976 11.439  1.00 17.67 ?  109  MET A N   1 
ATOM   738  C CA  . MET A 1 109 ? -6.332  50.414 12.255  1.00 19.66 ?  109  MET A CA  1 
ATOM   739  C C   . MET A 1 109 ? -5.844  49.362 13.232  1.00 17.82 ?  109  MET A C   1 
ATOM   740  O O   . MET A 1 109 ? -6.632  48.809 13.985  1.00 16.23 ?  109  MET A O   1 
ATOM   741  C CB  . MET A 1 109 ? -6.656  51.691 13.034  1.00 19.73 ?  109  MET A CB  1 
ATOM   742  C CG  . MET A 1 109 ? -5.381  52.423 13.459  1.00 22.90 ?  109  MET A CG  1 
ATOM   743  S SD  . MET A 1 109 ? -5.651  53.564 14.851  1.00 28.57 ?  109  MET A SD  1 
ATOM   744  C CE  . MET A 1 109 ? -5.949  52.481 16.232  1.00 30.14 ?  109  MET A CE  1 
ATOM   745  N N   . ASP A 1 110 ? -4.533  49.068 13.199  1.00 16.88 ?  110  ASP A N   1 
ATOM   746  C CA  . ASP A 1 110 ? -3.932  48.174 14.155  1.00 17.28 ?  110  ASP A CA  1 
ATOM   747  C C   . ASP A 1 110 ? -2.527  48.710 14.536  1.00 17.43 ?  110  ASP A C   1 
ATOM   748  O O   . ASP A 1 110 ? -2.019  49.583 13.862  1.00 15.33 ?  110  ASP A O   1 
ATOM   749  C CB  . ASP A 1 110 ? -3.866  46.759 13.595  1.00 17.80 ?  110  ASP A CB  1 
ATOM   750  C CG  . ASP A 1 110 ? -3.716  45.679 14.711  1.00 24.50 ?  110  ASP A CG  1 
ATOM   751  O OD1 . ASP A 1 110 ? -3.871  45.972 15.931  1.00 26.01 ?  110  ASP A OD1 1 
ATOM   752  O OD2 . ASP A 1 110 ? -3.403  44.518 14.361  1.00 30.43 ?  110  ASP A OD2 1 
ATOM   753  N N   . LEU A 1 111 ? -1.931  48.165 15.599  1.00 16.17 ?  111  LEU A N   1 
ATOM   754  C CA  . LEU A 1 111 ? -0.700  48.707 16.184  1.00 18.00 ?  111  LEU A CA  1 
ATOM   755  C C   . LEU A 1 111 ? 0.163   47.528 16.638  1.00 17.50 ?  111  LEU A C   1 
ATOM   756  O O   . LEU A 1 111 ? -0.353  46.474 16.977  1.00 18.55 ?  111  LEU A O   1 
ATOM   757  C CB  . LEU A 1 111 ? -1.092  49.558 17.419  1.00 19.15 ?  111  LEU A CB  1 
ATOM   758  C CG  . LEU A 1 111 ? -0.244  50.724 17.943  1.00 24.08 ?  111  LEU A CG  1 
ATOM   759  C CD1 . LEU A 1 111 ? -1.117  51.840 18.369  1.00 24.25 ?  111  LEU A CD1 1 
ATOM   760  C CD2 . LEU A 1 111 ? 0.638   50.257 19.117  1.00 26.15 ?  111  LEU A CD2 1 
ATOM   761  N N   . CYS A 1 112 ? 1.473   47.700 16.683  1.00 16.89 ?  112  CYS A N   1 
ATOM   762  C CA  . CYS A 1 112 ? 2.339   46.788 17.392  1.00 17.32 ?  112  CYS A CA  1 
ATOM   763  C C   . CYS A 1 112 ? 3.521   47.552 17.924  1.00 15.71 ?  112  CYS A C   1 
ATOM   764  O O   . CYS A 1 112 ? 3.869   48.566 17.385  1.00 15.71 ?  112  CYS A O   1 
ATOM   765  C CB  . CYS A 1 112 ? 2.788   45.595 16.539  1.00 19.22 ?  112  CYS A CB  1 
ATOM   766  S SG  . CYS A 1 112 ? 3.778   46.004 15.122  1.00 25.61 ?  112  CYS A SG  1 
ATOM   767  N N   . VAL A 1 113 ? 4.025   47.120 19.074  1.00 14.74 ?  113  VAL A N   1 
ATOM   768  C CA  . VAL A 1 113 ? 5.193   47.706 19.721  1.00 13.88 ?  113  VAL A CA  1 
ATOM   769  C C   . VAL A 1 113 ? 6.373   47.060 18.994  1.00 15.15 ?  113  VAL A C   1 
ATOM   770  O O   . VAL A 1 113 ? 6.345   45.857 18.696  1.00 14.91 ?  113  VAL A O   1 
ATOM   771  C CB  . VAL A 1 113 ? 5.190   47.324 21.203  1.00 13.28 ?  113  VAL A CB  1 
ATOM   772  C CG1 . VAL A 1 113 ? 6.429   47.840 21.966  1.00 12.16 ?  113  VAL A CG1 1 
ATOM   773  C CG2 . VAL A 1 113 ? 3.879   47.830 21.853  1.00 13.32 ?  113  VAL A CG2 1 
ATOM   774  N N   . THR A 1 114 ? 7.390   47.860 18.691  1.00 14.35 ?  114  THR A N   1 
ATOM   775  C CA  . THR A 1 114 ? 8.568   47.373 18.022  1.00 15.08 ?  114  THR A CA  1 
ATOM   776  C C   . THR A 1 114 ? 9.787   47.769 18.891  1.00 15.23 ?  114  THR A C   1 
ATOM   777  O O   . THR A 1 114 ? 9.694   48.602 19.828  1.00 12.77 ?  114  THR A O   1 
ATOM   778  C CB  . THR A 1 114 ? 8.692   47.976 16.596  1.00 15.14 ?  114  THR A CB  1 
ATOM   779  O OG1 . THR A 1 114 ? 8.651   49.410 16.696  1.00 19.62 ?  114  THR A OG1 1 
ATOM   780  C CG2 . THR A 1 114 ? 7.523   47.542 15.664  1.00 14.77 ?  114  THR A CG2 1 
ATOM   781  N N   . SER A 1 115 ? 10.907  47.113 18.607  1.00 14.71 ?  115  SER A N   1 
ATOM   782  C CA  . SER A 1 115 ? 12.159  47.374 19.296  1.00 15.78 ?  115  SER A CA  1 
ATOM   783  C C   . SER A 1 115 ? 12.822  48.580 18.687  1.00 16.84 ?  115  SER A C   1 
ATOM   784  O O   . SER A 1 115 ? 13.848  48.423 18.022  1.00 18.32 ?  115  SER A O   1 
ATOM   785  C CB  . SER A 1 115 ? 13.054  46.136 19.200  1.00 16.31 ?  115  SER A CB  1 
ATOM   786  O OG  . SER A 1 115 ? 12.438  45.050 19.940  1.00 16.78 ?  115  SER A OG  1 
ATOM   787  N N   . GLY A 1 116 ? 12.264  49.771 19.008  1.00 16.14 ?  116  GLY A N   1 
ATOM   788  C CA  . GLY A 1 116 ? 12.533  51.033 18.360  1.00 17.00 ?  116  GLY A CA  1 
ATOM   789  C C   . GLY A 1 116 ? 11.675  51.211 17.105  1.00 17.12 ?  116  GLY A C   1 
ATOM   790  O O   . GLY A 1 116 ? 11.228  50.228 16.503  1.00 17.89 ?  116  GLY A O   1 
ATOM   791  N N   . SER A 1 117 ? 11.513  52.445 16.653  1.00 17.04 ?  117  SER A N   1 
ATOM   792  C CA  . SER A 1 117 ? 10.796  52.685 15.407  1.00 17.98 ?  117  SER A CA  1 
ATOM   793  C C   . SER A 1 117 ? 11.576  52.182 14.149  1.00 17.75 ?  117  SER A C   1 
ATOM   794  O O   . SER A 1 117 ? 10.957  51.796 13.160  1.00 16.73 ?  117  SER A O   1 
ATOM   795  C CB  . SER A 1 117 ? 10.401  54.171 15.267  1.00 19.15 ?  117  SER A CB  1 
ATOM   796  O OG  . SER A 1 117 ? 11.475  54.966 14.776  1.00 21.53 ?  117  SER A OG  1 
ATOM   797  N N   . GLN A 1 118 ? 12.914  52.144 14.216  1.00 16.32 ?  118  GLN A N   1 
ATOM   798  C CA  . GLN A 1 118 ? 13.741  51.576 13.135  1.00 15.94 ?  118  GLN A CA  1 
ATOM   799  C C   . GLN A 1 118 ? 13.378  50.126 12.779  1.00 15.47 ?  118  GLN A C   1 
ATOM   800  O O   . GLN A 1 118 ? 13.390  49.720 11.585  1.00 13.51 ?  118  GLN A O   1 
ATOM   801  C CB  . GLN A 1 118 ? 15.232  51.673 13.506  1.00 17.30 ?  118  GLN A CB  1 
ATOM   802  C CG  . GLN A 1 118 ? 16.203  51.188 12.408  1.00 23.67 ?  118  GLN A CG  1 
ATOM   803  C CD  . GLN A 1 118 ? 16.407  52.199 11.296  1.00 28.21 ?  118  GLN A CD  1 
ATOM   804  O OE1 . GLN A 1 118 ? 16.520  53.389 11.559  1.00 33.23 ?  118  GLN A OE1 1 
ATOM   805  N NE2 . GLN A 1 118 ? 16.482  51.720 10.040  1.00 31.71 ?  118  GLN A NE2 1 
ATOM   806  N N   . GLN A 1 119 ? 13.039  49.333 13.785  1.00 13.38 ?  119  GLN A N   1 
ATOM   807  C CA  . GLN A 1 119 ? 12.714  47.972 13.522  1.00 14.72 ?  119  GLN A CA  1 
ATOM   808  C C   . GLN A 1 119 ? 11.438  47.900 12.680  1.00 16.06 ?  119  GLN A C   1 
ATOM   809  O O   . GLN A 1 119 ? 11.409  47.172 11.691  1.00 15.56 ?  119  GLN A O   1 
ATOM   810  C CB  . GLN A 1 119 ? 12.535  47.113 14.779  1.00 14.85 ?  119  GLN A CB  1 
ATOM   811  C CG  . GLN A 1 119 ? 12.457  45.605 14.423  1.00 12.29 ?  119  GLN A CG  1 
ATOM   812  C CD  . GLN A 1 119 ? 11.962  44.754 15.573  1.00 14.06 ?  119  GLN A CD  1 
ATOM   813  O OE1 . GLN A 1 119 ? 11.127  45.196 16.361  1.00 13.43 ?  119  GLN A OE1 1 
ATOM   814  N NE2 . GLN A 1 119 ? 12.500  43.550 15.705  1.00 15.13 ?  119  GLN A NE2 1 
ATOM   815  N N   . GLY A 1 120 ? 10.414  48.645 13.098  1.00 16.30 ?  120  GLY A N   1 
ATOM   816  C CA  . GLY A 1 120 ? 9.162   48.793 12.347  1.00 17.03 ?  120  GLY A CA  1 
ATOM   817  C C   . GLY A 1 120 ? 9.416   49.151 10.892  1.00 16.80 ?  120  GLY A C   1 
ATOM   818  O O   . GLY A 1 120 ? 9.003   48.414 10.004  1.00 17.43 ?  120  GLY A O   1 
ATOM   819  N N   . LEU A 1 121 ? 10.150  50.230 10.654  1.00 16.28 ?  121  LEU A N   1 
ATOM   820  C CA  . LEU A 1 121 ? 10.492  50.667 9.278   1.00 17.15 ?  121  LEU A CA  1 
ATOM   821  C C   . LEU A 1 121 ? 11.216  49.609 8.472   1.00 16.97 ?  121  LEU A C   1 
ATOM   822  O O   . LEU A 1 121 ? 10.913  49.399 7.310   1.00 15.85 ?  121  LEU A O   1 
ATOM   823  C CB  . LEU A 1 121 ? 11.398  51.900 9.343   1.00 16.91 ?  121  LEU A CB  1 
ATOM   824  C CG  . LEU A 1 121 ? 10.780  53.227 9.806   1.00 20.24 ?  121  LEU A CG  1 
ATOM   825  C CD1 . LEU A 1 121 ? 11.913  54.267 9.968   1.00 19.68 ?  121  LEU A CD1 1 
ATOM   826  C CD2 . LEU A 1 121 ? 9.692   53.778 8.880   1.00 22.90 ?  121  LEU A CD2 1 
ATOM   827  N N   . CYS A 1 122 ? 12.228  48.981 9.095   1.00 17.49 ?  122  CYS A N   1 
ATOM   828  C CA  . CYS A 1 122 ? 13.025  47.985 8.404   1.00 16.61 ?  122  CYS A CA  1 
ATOM   829  C C   . CYS A 1 122 ? 12.116  46.821 8.004   1.00 15.26 ?  122  CYS A C   1 
ATOM   830  O O   . CYS A 1 122 ? 12.153  46.356 6.868   1.00 13.50 ?  122  CYS A O   1 
ATOM   831  C CB  . CYS A 1 122 ? 14.152  47.493 9.310   1.00 17.10 ?  122  CYS A CB  1 
ATOM   832  S SG  . CYS A 1 122 ? 15.196  46.296 8.451   1.00 24.12 ?  122  CYS A SG  1 
ATOM   833  N N   . LYS A 1 123 ? 11.276  46.369 8.928   1.00 12.58 ?  123  LYS A N   1 
ATOM   834  C CA  . LYS A 1 123 ? 10.368  45.270 8.618   1.00 13.47 ?  123  LYS A CA  1 
ATOM   835  C C   . LYS A 1 123 ? 9.333   45.629 7.510   1.00 14.13 ?  123  LYS A C   1 
ATOM   836  O O   . LYS A 1 123 ? 9.012   44.775 6.650   1.00 13.26 ?  123  LYS A O   1 
ATOM   837  C CB  . LYS A 1 123 ? 9.723   44.706 9.892   1.00 13.72 ?  123  LYS A CB  1 
ATOM   838  C CG  . LYS A 1 123 ? 10.628  43.610 10.501  1.00 18.05 ?  123  LYS A CG  1 
ATOM   839  C CD  . LYS A 1 123 ? 10.327  43.235 11.902  1.00 26.34 ?  123  LYS A CD  1 
ATOM   840  C CE  . LYS A 1 123 ? 10.981  41.878 12.306  1.00 26.93 ?  123  LYS A CE  1 
ATOM   841  N NZ  . LYS A 1 123 ? 12.274  41.471 11.628  1.00 25.97 ?  123  LYS A NZ  1 
ATOM   842  N N   . VAL A 1 124 ? 8.861   46.891 7.512   1.00 12.88 ?  124  VAL A N   1 
ATOM   843  C CA  . VAL A 1 124 ? 7.957   47.382 6.464   1.00 13.00 ?  124  VAL A CA  1 
ATOM   844  C C   . VAL A 1 124 ? 8.662   47.410 5.089   1.00 13.03 ?  124  VAL A C   1 
ATOM   845  O O   . VAL A 1 124 ? 8.116   46.919 4.110   1.00 13.45 ?  124  VAL A O   1 
ATOM   846  C CB  . VAL A 1 124 ? 7.372   48.755 6.880   1.00 12.72 ?  124  VAL A CB  1 
ATOM   847  C CG1 . VAL A 1 124 ? 6.726   49.514 5.681   1.00 13.81 ?  124  VAL A CG1 1 
ATOM   848  C CG2 . VAL A 1 124 ? 6.367   48.539 8.102   1.00 9.64  ?  124  VAL A CG2 1 
ATOM   849  N N   . PHE A 1 125 ? 9.872   47.965 5.022   1.00 12.10 ?  125  PHE A N   1 
ATOM   850  C CA  . PHE A 1 125 ? 10.636  47.969 3.756   1.00 12.10 ?  125  PHE A CA  1 
ATOM   851  C C   . PHE A 1 125 ? 10.852  46.550 3.220   1.00 11.27 ?  125  PHE A C   1 
ATOM   852  O O   . PHE A 1 125 ? 10.654  46.279 2.041   1.00 10.34 ?  125  PHE A O   1 
ATOM   853  C CB  . PHE A 1 125 ? 12.007  48.665 3.943   1.00 11.33 ?  125  PHE A CB  1 
ATOM   854  C CG  . PHE A 1 125 ? 11.940  50.121 4.308   1.00 12.51 ?  125  PHE A CG  1 
ATOM   855  C CD1 . PHE A 1 125 ? 12.979  50.690 5.063   1.00 12.80 ?  125  PHE A CD1 1 
ATOM   856  C CD2 . PHE A 1 125 ? 10.887  50.943 3.886   1.00 13.29 ?  125  PHE A CD2 1 
ATOM   857  C CE1 . PHE A 1 125 ? 12.956  52.058 5.429   1.00 14.30 ?  125  PHE A CE1 1 
ATOM   858  C CE2 . PHE A 1 125 ? 10.840  52.327 4.247   1.00 17.04 ?  125  PHE A CE2 1 
ATOM   859  C CZ  . PHE A 1 125 ? 11.887  52.887 5.007   1.00 14.71 ?  125  PHE A CZ  1 
ATOM   860  N N   . GLU A 1 126 ? 11.221  45.628 4.095   1.00 12.69 ?  126  GLU A N   1 
ATOM   861  C CA  . GLU A 1 126 ? 11.475  44.217 3.747   1.00 12.88 ?  126  GLU A CA  1 
ATOM   862  C C   . GLU A 1 126 ? 10.165  43.546 3.304   1.00 13.42 ?  126  GLU A C   1 
ATOM   863  O O   . GLU A 1 126 ? 10.137  42.717 2.393   1.00 13.91 ?  126  GLU A O   1 
ATOM   864  C CB  . GLU A 1 126 ? 12.080  43.441 4.954   1.00 12.93 ?  126  GLU A CB  1 
ATOM   865  C CG  . GLU A 1 126 ? 13.594  43.720 5.152   1.00 16.42 ?  126  GLU A CG  1 
ATOM   866  C CD  . GLU A 1 126 ? 14.126  43.307 6.508   1.00 24.77 ?  126  GLU A CD  1 
ATOM   867  O OE1 . GLU A 1 126 ? 15.385  43.285 6.659   1.00 26.76 ?  126  GLU A OE1 1 
ATOM   868  O OE2 . GLU A 1 126 ? 13.309  43.052 7.440   1.00 24.88 ?  126  GLU A OE2 1 
ATOM   869  N N   . MET A 1 127 ? 9.076   43.867 3.965   1.00 12.48 ?  127  MET A N   1 
ATOM   870  C CA  . MET A 1 127 ? 7.749   43.353 3.537   1.00 13.60 ?  127  MET A CA  1 
ATOM   871  C C   . MET A 1 127 ? 7.382   43.741 2.087   1.00 13.17 ?  127  MET A C   1 
ATOM   872  O O   . MET A 1 127 ? 6.713   42.998 1.356   1.00 14.88 ?  127  MET A O   1 
ATOM   873  C CB  . MET A 1 127 ? 6.676   43.926 4.468   1.00 12.76 ?  127  MET A CB  1 
ATOM   874  C CG  . MET A 1 127 ? 5.226   43.625 4.033   1.00 15.47 ?  127  MET A CG  1 
ATOM   875  S SD  . MET A 1 127 ? 4.024   44.278 5.222   1.00 16.50 ?  127  MET A SD  1 
ATOM   876  C CE  . MET A 1 127 ? 4.289   46.028 5.136   1.00 15.66 ?  127  MET A CE  1 
ATOM   877  N N   . ILE A 1 128 ? 7.763   44.929 1.683   1.00 12.44 ?  128  ILE A N   1 
ATOM   878  C CA  . ILE A 1 128 ? 7.213   45.470 0.464   1.00 13.78 ?  128  ILE A CA  1 
ATOM   879  C C   . ILE A 1 128 ? 8.125   45.295 -0.774  1.00 15.29 ?  128  ILE A C   1 
ATOM   880  O O   . ILE A 1 128 ? 7.632   45.100 -1.903  1.00 15.76 ?  128  ILE A O   1 
ATOM   881  C CB  . ILE A 1 128 ? 6.896   46.968 0.693   1.00 14.08 ?  128  ILE A CB  1 
ATOM   882  C CG1 . ILE A 1 128 ? 5.758   47.127 1.699   1.00 10.07 ?  128  ILE A CG1 1 
ATOM   883  C CG2 . ILE A 1 128 ? 6.490   47.727 -0.595  1.00 15.34 ?  128  ILE A CG2 1 
ATOM   884  C CD1 . ILE A 1 128 ? 5.652   48.567 2.139   1.00 12.74 ?  128  ILE A CD1 1 
ATOM   885  N N   . ILE A 1 129 ? 9.435   45.434 -0.587  1.00 14.80 ?  129  ILE A N   1 
ATOM   886  C CA  . ILE A 1 129 ? 10.322  45.701 -1.741  1.00 16.73 ?  129  ILE A CA  1 
ATOM   887  C C   . ILE A 1 129 ? 10.889  44.460 -2.434  1.00 17.75 ?  129  ILE A C   1 
ATOM   888  O O   . ILE A 1 129 ? 11.563  43.641 -1.800  1.00 18.31 ?  129  ILE A O   1 
ATOM   889  C CB  . ILE A 1 129 ? 11.445  46.695 -1.343  1.00 16.28 ?  129  ILE A CB  1 
ATOM   890  C CG1 . ILE A 1 129 ? 10.786  48.039 -0.994  1.00 14.80 ?  129  ILE A CG1 1 
ATOM   891  C CG2 . ILE A 1 129 ? 12.486  46.892 -2.496  1.00 16.52 ?  129  ILE A CG2 1 
ATOM   892  C CD1 . ILE A 1 129 ? 11.724  49.028 -0.302  1.00 18.99 ?  129  ILE A CD1 1 
ATOM   893  N N   . ASN A 1 130 ? 10.604  44.351 -3.732  1.00 17.98 ?  130  ASN A N   1 
ATOM   894  C CA  . ASN A 1 130 ? 11.305  43.442 -4.631  1.00 18.48 ?  130  ASN A CA  1 
ATOM   895  C C   . ASN A 1 130 ? 12.404  44.204 -5.371  1.00 18.68 ?  130  ASN A C   1 
ATOM   896  O O   . ASN A 1 130 ? 12.282  45.449 -5.571  1.00 16.65 ?  130  ASN A O   1 
ATOM   897  C CB  . ASN A 1 130 ? 10.329  42.834 -5.668  1.00 18.72 ?  130  ASN A CB  1 
ATOM   898  C CG  . ASN A 1 130 ? 9.263   41.976 -5.029  1.00 19.40 ?  130  ASN A CG  1 
ATOM   899  O OD1 . ASN A 1 130 ? 9.565   41.061 -4.285  1.00 23.05 ?  130  ASN A OD1 1 
ATOM   900  N ND2 . ASN A 1 130 ? 8.018   42.235 -5.362  1.00 20.71 ?  130  ASN A ND2 1 
ATOM   901  N N   . PRO A 1 131 ? 13.468  43.478 -5.805  1.00 18.68 ?  131  PRO A N   1 
ATOM   902  C CA  . PRO A 1 131 ? 14.495  44.087 -6.677  1.00 19.82 ?  131  PRO A CA  1 
ATOM   903  C C   . PRO A 1 131 ? 13.845  44.817 -7.869  1.00 19.89 ?  131  PRO A C   1 
ATOM   904  O O   . PRO A 1 131 ? 12.996  44.249 -8.516  1.00 19.60 ?  131  PRO A O   1 
ATOM   905  C CB  . PRO A 1 131 ? 15.292  42.875 -7.197  1.00 21.49 ?  131  PRO A CB  1 
ATOM   906  C CG  . PRO A 1 131 ? 15.128  41.799 -6.100  1.00 21.76 ?  131  PRO A CG  1 
ATOM   907  C CD  . PRO A 1 131 ? 13.748  42.055 -5.485  1.00 19.57 ?  131  PRO A CD  1 
ATOM   908  N N   . GLY A 1 132 ? 14.191  46.077 -8.107  1.00 19.43 ?  132  GLY A N   1 
ATOM   909  C CA  . GLY A 1 132 ? 13.626  46.812 -9.247  1.00 20.68 ?  132  GLY A CA  1 
ATOM   910  C C   . GLY A 1 132 ? 12.412  47.690 -8.956  1.00 21.16 ?  132  GLY A C   1 
ATOM   911  O O   . GLY A 1 132 ? 11.994  48.473 -9.810  1.00 20.96 ?  132  GLY A O   1 
ATOM   912  N N   . ASP A 1 133 ? 11.821  47.540 -7.760  1.00 20.52 ?  133  ASP A N   1 
ATOM   913  C CA  . ASP A 1 133 ? 10.627  48.298 -7.375  1.00 19.58 ?  133  ASP A CA  1 
ATOM   914  C C   . ASP A 1 133 ? 11.018  49.759 -7.330  1.00 18.67 ?  133  ASP A C   1 
ATOM   915  O O   . ASP A 1 133 ? 12.183  50.101 -7.050  1.00 18.62 ?  133  ASP A O   1 
ATOM   916  C CB  . ASP A 1 133 ? 10.091  47.831 -5.992  1.00 19.78 ?  133  ASP A CB  1 
ATOM   917  C CG  . ASP A 1 133 ? 9.238   46.556 -6.073  1.00 22.91 ?  133  ASP A CG  1 
ATOM   918  O OD1 . ASP A 1 133 ? 9.068   45.984 -7.186  1.00 23.77 ?  133  ASP A OD1 1 
ATOM   919  O OD2 . ASP A 1 133 ? 8.691   46.143 -5.019  1.00 24.45 ?  133  ASP A OD2 1 
ATOM   920  N N   . ASN A 1 134 ? 10.064  50.635 -7.615  1.00 15.76 ?  134  ASN A N   1 
ATOM   921  C CA  . ASN A 1 134 ? 10.297  52.067 -7.547  1.00 15.19 ?  134  ASN A CA  1 
ATOM   922  C C   . ASN A 1 134 ? 9.773   52.571 -6.195  1.00 15.93 ?  134  ASN A C   1 
ATOM   923  O O   . ASN A 1 134 ? 8.615   52.229 -5.783  1.00 15.79 ?  134  ASN A O   1 
ATOM   924  C CB  . ASN A 1 134 ? 9.539   52.741 -8.693  1.00 15.02 ?  134  ASN A CB  1 
ATOM   925  C CG  . ASN A 1 134 ? 10.232  52.541 -10.056 1.00 18.50 ?  134  ASN A CG  1 
ATOM   926  O OD1 . ASN A 1 134 ? 11.394  52.839 -10.166 1.00 17.92 ?  134  ASN A OD1 1 
ATOM   927  N ND2 . ASN A 1 134 ? 9.505   52.056 -11.084 1.00 15.17 ?  134  ASN A ND2 1 
ATOM   928  N N   . VAL A 1 135 ? 10.575  53.373 -5.495  1.00 15.20 ?  135  VAL A N   1 
ATOM   929  C CA  . VAL A 1 135 ? 10.090  54.006 -4.263  1.00 14.62 ?  135  VAL A CA  1 
ATOM   930  C C   . VAL A 1 135 ? 10.433  55.451 -4.327  1.00 14.84 ?  135  VAL A C   1 
ATOM   931  O O   . VAL A 1 135 ? 11.475  55.825 -4.883  1.00 16.79 ?  135  VAL A O   1 
ATOM   932  C CB  . VAL A 1 135 ? 10.601  53.281 -2.972  1.00 15.65 ?  135  VAL A CB  1 
ATOM   933  C CG1 . VAL A 1 135 ? 10.350  51.810 -3.076  1.00 14.45 ?  135  VAL A CG1 1 
ATOM   934  C CG2 . VAL A 1 135 ? 12.116  53.525 -2.716  1.00 14.72 ?  135  VAL A CG2 1 
ATOM   935  N N   . LEU A 1 136 ? 9.563   56.289 -3.794  1.00 13.69 ?  136  LEU A N   1 
ATOM   936  C CA  . LEU A 1 136 ? 9.757   57.748 -3.782  1.00 14.65 ?  136  LEU A CA  1 
ATOM   937  C C   . LEU A 1 136 ? 10.144  58.231 -2.387  1.00 16.01 ?  136  LEU A C   1 
ATOM   938  O O   . LEU A 1 136 ? 9.551   57.799 -1.399  1.00 15.22 ?  136  LEU A O   1 
ATOM   939  C CB  . LEU A 1 136 ? 8.399   58.402 -4.084  1.00 15.04 ?  136  LEU A CB  1 
ATOM   940  C CG  . LEU A 1 136 ? 7.643   57.804 -5.283  1.00 18.89 ?  136  LEU A CG  1 
ATOM   941  C CD1 . LEU A 1 136 ? 6.201   58.309 -5.361  1.00 20.48 ?  136  LEU A CD1 1 
ATOM   942  C CD2 . LEU A 1 136 ? 8.443   58.232 -6.539  1.00 18.76 ?  136  LEU A CD2 1 
ATOM   943  N N   . LEU A 1 137 ? 11.063  59.182 -2.319  1.00 16.21 ?  137  LEU A N   1 
ATOM   944  C CA  . LEU A 1 137 ? 11.349  59.919 -1.095  1.00 17.92 ?  137  LEU A CA  1 
ATOM   945  C C   . LEU A 1 137 ? 12.037  61.221 -1.432  1.00 17.36 ?  137  LEU A C   1 
ATOM   946  O O   . LEU A 1 137 ? 12.466  61.432 -2.559  1.00 19.42 ?  137  LEU A O   1 
ATOM   947  C CB  . LEU A 1 137 ? 12.231  59.115 -0.138  1.00 18.42 ?  137  LEU A CB  1 
ATOM   948  C CG  . LEU A 1 137 ? 13.551  58.527 -0.652  1.00 20.21 ?  137  LEU A CG  1 
ATOM   949  C CD1 . LEU A 1 137 ? 14.586  59.565 -0.802  1.00 20.68 ?  137  LEU A CD1 1 
ATOM   950  C CD2 . LEU A 1 137 ? 14.056  57.452 0.353   1.00 22.08 ?  137  LEU A CD2 1 
ATOM   951  N N   . ASP A 1 138 ? 12.161  62.106 -0.465  1.00 19.01 ?  138  ASP A N   1 
ATOM   952  C CA  . ASP A 1 138 ? 12.837  63.404 -0.684  1.00 19.55 ?  138  ASP A CA  1 
ATOM   953  C C   . ASP A 1 138 ? 14.227  63.317 -0.075  1.00 20.26 ?  138  ASP A C   1 
ATOM   954  O O   . ASP A 1 138 ? 14.339  62.981 1.097   1.00 18.40 ?  138  ASP A O   1 
ATOM   955  C CB  . ASP A 1 138 ? 12.037  64.539 -0.012  1.00 20.46 ?  138  ASP A CB  1 
ATOM   956  C CG  . ASP A 1 138 ? 11.611  64.216 1.463   1.00 24.52 ?  138  ASP A CG  1 
ATOM   957  O OD1 . ASP A 1 138 ? 10.939  63.158 1.745   1.00 25.47 ?  138  ASP A OD1 1 
ATOM   958  O OD2 . ASP A 1 138 ? 11.984  65.029 2.366   1.00 27.67 ?  138  ASP A OD2 1 
ATOM   959  N N   . GLU A 1 139 ? 15.276  63.543 -0.870  1.00 20.11 ?  139  GLU A N   1 
ATOM   960  C CA  . GLU A 1 139 ? 16.659  63.710 -0.359  1.00 23.79 ?  139  GLU A CA  1 
ATOM   961  C C   . GLU A 1 139 ? 16.928  65.229 -0.125  1.00 23.08 ?  139  GLU A C   1 
ATOM   962  O O   . GLU A 1 139 ? 16.431  66.057 -0.893  1.00 22.88 ?  139  GLU A O   1 
ATOM   963  C CB  . GLU A 1 139 ? 17.727  63.221 -1.368  1.00 23.98 ?  139  GLU A CB  1 
ATOM   964  C CG  . GLU A 1 139 ? 17.778  61.736 -1.718  1.00 27.45 ?  139  GLU A CG  1 
ATOM   965  C CD  . GLU A 1 139 ? 18.649  61.463 -2.993  1.00 29.28 ?  139  GLU A CD  1 
ATOM   966  O OE1 . GLU A 1 139 ? 19.882  61.415 -2.878  1.00 31.11 ?  139  GLU A OE1 1 
ATOM   967  O OE2 . GLU A 1 139 ? 18.090  61.259 -4.108  1.00 36.08 ?  139  GLU A OE2 1 
ATOM   968  N N   . PRO A 1 140 ? 17.718  65.595 0.910   1.00 22.39 ?  140  PRO A N   1 
ATOM   969  C CA  . PRO A 1 140 ? 18.398  64.720 1.855   1.00 21.94 ?  140  PRO A CA  1 
ATOM   970  C C   . PRO A 1 140 ? 17.444  63.973 2.799   1.00 20.79 ?  140  PRO A C   1 
ATOM   971  O O   . PRO A 1 140 ? 16.435  64.537 3.272   1.00 20.09 ?  140  PRO A O   1 
ATOM   972  C CB  . PRO A 1 140 ? 19.276  65.683 2.672   1.00 21.72 ?  140  PRO A CB  1 
ATOM   973  C CG  . PRO A 1 140 ? 18.624  67.014 2.532   1.00 22.26 ?  140  PRO A CG  1 
ATOM   974  C CD  . PRO A 1 140 ? 18.016  67.026 1.172   1.00 23.49 ?  140  PRO A CD  1 
ATOM   975  N N   . ALA A 1 141 ? 17.816  62.738 3.079   1.00 19.70 ?  141  ALA A N   1 
ATOM   976  C CA  . ALA A 1 141 ? 16.985  61.793 3.822   1.00 19.83 ?  141  ALA A CA  1 
ATOM   977  C C   . ALA A 1 141 ? 17.781  61.143 4.969   1.00 19.52 ?  141  ALA A C   1 
ATOM   978  O O   . ALA A 1 141 ? 19.022  61.067 4.929   1.00 18.63 ?  141  ALA A O   1 
ATOM   979  C CB  . ALA A 1 141 ? 16.478  60.718 2.862   1.00 18.90 ?  141  ALA A CB  1 
ATOM   980  N N   . TYR A 1 142 ? 17.083  60.658 5.991   1.00 18.99 ?  142  TYR A N   1 
ATOM   981  C CA  . TYR A 1 142 ? 17.759  59.975 7.105   1.00 19.47 ?  142  TYR A CA  1 
ATOM   982  C C   . TYR A 1 142 ? 18.690  58.853 6.601   1.00 19.17 ?  142  TYR A C   1 
ATOM   983  O O   . TYR A 1 142 ? 18.286  58.049 5.743   1.00 17.69 ?  142  TYR A O   1 
ATOM   984  C CB  . TYR A 1 142 ? 16.658  59.422 8.015   1.00 20.87 ?  142  TYR A CB  1 
ATOM   985  C CG  . TYR A 1 142 ? 17.050  58.430 9.065   1.00 20.16 ?  142  TYR A CG  1 
ATOM   986  C CD1 . TYR A 1 142 ? 16.275  57.264 9.247   1.00 21.31 ?  142  TYR A CD1 1 
ATOM   987  C CD2 . TYR A 1 142 ? 18.143  58.647 9.893   1.00 22.76 ?  142  TYR A CD2 1 
ATOM   988  C CE1 . TYR A 1 142 ? 16.570  56.353 10.236  1.00 21.46 ?  142  TYR A CE1 1 
ATOM   989  C CE2 . TYR A 1 142 ? 18.484  57.712 10.893  1.00 22.26 ?  142  TYR A CE2 1 
ATOM   990  C CZ  . TYR A 1 142 ? 17.689  56.579 11.041  1.00 23.04 ?  142  TYR A CZ  1 
ATOM   991  O OH  . TYR A 1 142 ? 18.018  55.663 11.996  1.00 26.76 ?  142  TYR A OH  1 
ATOM   992  N N   . SER A 1 143 ? 19.935  58.788 7.081   1.00 19.78 ?  143  SER A N   1 
ATOM   993  C CA  . SER A 1 143 ? 20.850  57.808 6.464   1.00 20.06 ?  143  SER A CA  1 
ATOM   994  C C   . SER A 1 143 ? 20.509  56.373 6.792   1.00 19.90 ?  143  SER A C   1 
ATOM   995  O O   . SER A 1 143 ? 20.822  55.489 6.013   1.00 19.97 ?  143  SER A O   1 
ATOM   996  C CB  . SER A 1 143 ? 22.320  58.078 6.788   1.00 22.20 ?  143  SER A CB  1 
ATOM   997  O OG  . SER A 1 143 ? 22.473  58.123 8.162   1.00 26.81 ?  143  SER A OG  1 
ATOM   998  N N   . GLY A 1 144 ? 19.879  56.126 7.946   1.00 19.74 ?  144  GLY A N   1 
ATOM   999  C CA  . GLY A 1 144 ? 19.560  54.747 8.381   1.00 18.11 ?  144  GLY A CA  1 
ATOM   1000 C C   . GLY A 1 144 ? 18.499  54.177 7.429   1.00 17.43 ?  144  GLY A C   1 
ATOM   1001 O O   . GLY A 1 144 ? 18.468  52.996 7.147   1.00 17.37 ?  144  GLY A O   1 
ATOM   1002 N N   . THR A 1 145 ? 17.633  55.044 6.920   1.00 17.03 ?  145  THR A N   1 
ATOM   1003 C CA  . THR A 1 145 ? 16.683  54.670 5.882   1.00 15.92 ?  145  THR A CA  1 
ATOM   1004 C C   . THR A 1 145 ? 17.345  54.368 4.535   1.00 14.40 ?  145  THR A C   1 
ATOM   1005 O O   . THR A 1 145 ? 17.027  53.378 3.875   1.00 13.97 ?  145  THR A O   1 
ATOM   1006 C CB  . THR A 1 145 ? 15.587  55.794 5.732   1.00 16.48 ?  145  THR A CB  1 
ATOM   1007 O OG1 . THR A 1 145 ? 14.670  55.728 6.841   1.00 21.10 ?  145  THR A OG1 1 
ATOM   1008 C CG2 . THR A 1 145 ? 14.792  55.679 4.349   1.00 12.73 ?  145  THR A CG2 1 
ATOM   1009 N N   . LEU A 1 146 ? 18.217  55.249 4.075   1.00 13.37 ?  146  LEU A N   1 
ATOM   1010 C CA  . LEU A 1 146 ? 18.959  54.954 2.833   1.00 13.32 ?  146  LEU A CA  1 
ATOM   1011 C C   . LEU A 1 146 ? 19.773  53.653 2.949   1.00 13.16 ?  146  LEU A C   1 
ATOM   1012 O O   . LEU A 1 146 ? 19.962  52.936 1.955   1.00 12.61 ?  146  LEU A O   1 
ATOM   1013 C CB  . LEU A 1 146 ? 19.921  56.122 2.481   1.00 13.50 ?  146  LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 146 ? 19.223  57.482 2.281   1.00 13.51 ?  146  LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 146 ? 20.271  58.517 1.982   1.00 15.89 ?  146  LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 146 ? 18.254  57.338 1.098   1.00 17.53 ?  146  LEU A CD2 1 
ATOM   1017 N N   . GLN A 1 147 ? 20.310  53.371 4.136   1.00 13.64 ?  147  GLN A N   1 
ATOM   1018 C CA  . GLN A 1 147 ? 21.157  52.177 4.318   1.00 16.17 ?  147  GLN A CA  1 
ATOM   1019 C C   . GLN A 1 147 ? 20.324  50.926 4.374   1.00 16.72 ?  147  GLN A C   1 
ATOM   1020 O O   . GLN A 1 147 ? 20.807  49.813 4.080   1.00 17.47 ?  147  GLN A O   1 
ATOM   1021 C CB  . GLN A 1 147 ? 22.022  52.285 5.579   1.00 17.96 ?  147  GLN A CB  1 
ATOM   1022 C CG  . GLN A 1 147 ? 23.124  53.346 5.423   1.00 21.95 ?  147  GLN A CG  1 
ATOM   1023 C CD  . GLN A 1 147 ? 24.332  52.751 4.748   1.00 30.70 ?  147  GLN A CD  1 
ATOM   1024 O OE1 . GLN A 1 147 ? 24.547  52.914 3.521   1.00 30.33 ?  147  GLN A OE1 1 
ATOM   1025 N NE2 . GLN A 1 147 ? 25.108  51.966 5.535   1.00 32.84 ?  147  GLN A NE2 1 
ATOM   1026 N N   . SER A 1 148 ? 19.072  51.096 4.809   1.00 15.69 ?  148  SER A N   1 
ATOM   1027 C CA  . SER A 1 148 ? 18.129  49.996 4.836   1.00 17.16 ?  148  SER A CA  1 
ATOM   1028 C C   . SER A 1 148 ? 17.640  49.672 3.435   1.00 15.65 ?  148  SER A C   1 
ATOM   1029 O O   . SER A 1 148 ? 17.454  48.501 3.113   1.00 15.36 ?  148  SER A O   1 
ATOM   1030 C CB  . SER A 1 148 ? 16.952  50.367 5.762   1.00 17.28 ?  148  SER A CB  1 
ATOM   1031 O OG  . SER A 1 148 ? 16.129  49.252 5.871   1.00 27.06 ?  148  SER A OG  1 
ATOM   1032 N N   . LEU A 1 149 ? 17.475  50.703 2.589   1.00 15.54 ?  149  LEU A N   1 
ATOM   1033 C CA  . LEU A 1 149 ? 16.874  50.533 1.243   1.00 15.45 ?  149  LEU A CA  1 
ATOM   1034 C C   . LEU A 1 149 ? 17.904  50.001 0.245   1.00 16.46 ?  149  LEU A C   1 
ATOM   1035 O O   . LEU A 1 149 ? 17.583  49.219 -0.647  1.00 16.44 ?  149  LEU A O   1 
ATOM   1036 C CB  . LEU A 1 149 ? 16.318  51.860 0.696   1.00 14.01 ?  149  LEU A CB  1 
ATOM   1037 C CG  . LEU A 1 149 ? 15.093  52.366 1.439   1.00 13.28 ?  149  LEU A CG  1 
ATOM   1038 C CD1 . LEU A 1 149 ? 14.726  53.774 1.000   1.00 14.97 ?  149  LEU A CD1 1 
ATOM   1039 C CD2 . LEU A 1 149 ? 13.920  51.399 1.260   1.00 10.73 ?  149  LEU A CD2 1 
ATOM   1040 N N   . HIS A 1 150 ? 19.137  50.447 0.407   1.00 17.16 ?  150  HIS A N   1 
ATOM   1041 C CA  . HIS A 1 150 ? 20.219  50.101 -0.529  1.00 19.27 ?  150  HIS A CA  1 
ATOM   1042 C C   . HIS A 1 150 ? 20.332  48.620 -0.883  1.00 18.53 ?  150  HIS A C   1 
ATOM   1043 O O   . HIS A 1 150 ? 20.268  48.298 -2.046  1.00 20.44 ?  150  HIS A O   1 
ATOM   1044 C CB  . HIS A 1 150 ? 21.575  50.668 -0.087  1.00 18.51 ?  150  HIS A CB  1 
ATOM   1045 C CG  . HIS A 1 150 ? 22.709  50.249 -0.981  1.00 24.91 ?  150  HIS A CG  1 
ATOM   1046 N ND1 . HIS A 1 150 ? 23.786  49.510 -0.528  1.00 28.32 ?  150  HIS A ND1 1 
ATOM   1047 C CD2 . HIS A 1 150 ? 22.911  50.428 -2.311  1.00 28.37 ?  150  HIS A CD2 1 
ATOM   1048 C CE1 . HIS A 1 150 ? 24.609  49.264 -1.537  1.00 30.22 ?  150  HIS A CE1 1 
ATOM   1049 N NE2 . HIS A 1 150 ? 24.101  49.804 -2.633  1.00 31.56 ?  150  HIS A NE2 1 
ATOM   1050 N N   . PRO A 1 151 ? 20.501  47.721 0.101   1.00 18.72 ?  151  PRO A N   1 
ATOM   1051 C CA  . PRO A 1 151 ? 20.601  46.312 -0.288  1.00 18.50 ?  151  PRO A CA  1 
ATOM   1052 C C   . PRO A 1 151 ? 19.335  45.653 -0.807  1.00 19.88 ?  151  PRO A C   1 
ATOM   1053 O O   . PRO A 1 151 ? 19.424  44.513 -1.232  1.00 19.31 ?  151  PRO A O   1 
ATOM   1054 C CB  . PRO A 1 151 ? 20.983  45.598 1.007   1.00 17.68 ?  151  PRO A CB  1 
ATOM   1055 C CG  . PRO A 1 151 ? 20.562  46.526 2.096   1.00 20.54 ?  151  PRO A CG  1 
ATOM   1056 C CD  . PRO A 1 151 ? 20.699  47.920 1.551   1.00 17.80 ?  151  PRO A CD  1 
ATOM   1057 N N   . LEU A 1 152 ? 18.174  46.319 -0.747  1.00 19.90 ?  152  LEU A N   1 
ATOM   1058 C CA  . LEU A 1 152 ? 16.940  45.715 -1.264  1.00 19.84 ?  152  LEU A CA  1 
ATOM   1059 C C   . LEU A 1 152 ? 16.802  45.839 -2.810  1.00 20.99 ?  152  LEU A C   1 
ATOM   1060 O O   . LEU A 1 152 ? 15.915  45.209 -3.419  1.00 20.03 ?  152  LEU A O   1 
ATOM   1061 C CB  . LEU A 1 152 ? 15.691  46.250 -0.518  1.00 19.53 ?  152  LEU A CB  1 
ATOM   1062 C CG  . LEU A 1 152 ? 15.633  46.073 1.014   1.00 19.35 ?  152  LEU A CG  1 
ATOM   1063 C CD1 . LEU A 1 152 ? 14.445  46.760 1.638   1.00 19.38 ?  152  LEU A CD1 1 
ATOM   1064 C CD2 . LEU A 1 152 ? 15.610  44.595 1.394   1.00 19.63 ?  152  LEU A CD2 1 
ATOM   1065 N N   . GLY A 1 153 ? 17.692  46.608 -3.453  1.00 22.39 ?  153  GLY A N   1 
ATOM   1066 C CA  . GLY A 1 153 ? 17.655  46.712 -4.939  1.00 23.27 ?  153  GLY A CA  1 
ATOM   1067 C C   . GLY A 1 153 ? 16.510  47.555 -5.543  1.00 23.32 ?  153  GLY A C   1 
ATOM   1068 O O   . GLY A 1 153 ? 16.176  47.438 -6.727  1.00 24.44 ?  153  GLY A O   1 
ATOM   1069 N N   . CYS A 1 154 ? 15.920  48.446 -4.767  1.00 23.23 ?  154  CYS A N   1 
ATOM   1070 C CA  . CYS A 1 154 ? 14.923  49.334 -5.372  1.00 22.57 ?  154  CYS A CA  1 
ATOM   1071 C C   . CYS A 1 154 ? 15.568  50.499 -6.095  1.00 21.74 ?  154  CYS A C   1 
ATOM   1072 O O   . CYS A 1 154 ? 16.726  50.848 -5.839  1.00 21.04 ?  154  CYS A O   1 
ATOM   1073 C CB  . CYS A 1 154 ? 13.915  49.849 -4.346  1.00 22.44 ?  154  CYS A CB  1 
ATOM   1074 S SG  . CYS A 1 154 ? 14.619  50.532 -2.837  1.00 25.23 ?  154  CYS A SG  1 
ATOM   1075 N N   . ASN A 1 155 ? 14.822  51.087 -7.017  1.00 20.35 ?  155  ASN A N   1 
ATOM   1076 C CA  . ASN A 1 155 ? 15.149  52.386 -7.510  1.00 20.46 ?  155  ASN A CA  1 
ATOM   1077 C C   . ASN A 1 155 ? 14.516  53.403 -6.584  1.00 20.36 ?  155  ASN A C   1 
ATOM   1078 O O   . ASN A 1 155 ? 13.266  53.448 -6.436  1.00 18.32 ?  155  ASN A O   1 
ATOM   1079 C CB  . ASN A 1 155 ? 14.612  52.594 -8.927  1.00 20.62 ?  155  ASN A CB  1 
ATOM   1080 C CG  . ASN A 1 155 ? 15.098  51.513 -9.892  1.00 25.40 ?  155  ASN A CG  1 
ATOM   1081 O OD1 . ASN A 1 155 ? 16.310  51.355 -10.117 1.00 26.78 ?  155  ASN A OD1 1 
ATOM   1082 N ND2 . ASN A 1 155 ? 14.155  50.806 -10.516 1.00 26.85 ?  155  ASN A ND2 1 
ATOM   1083 N N   . ILE A 1 156 ? 15.371  54.240 -5.997  1.00 19.13 ?  156  ILE A N   1 
ATOM   1084 C CA  . ILE A 1 156 ? 14.924  55.350 -5.193  1.00 20.76 ?  156  ILE A CA  1 
ATOM   1085 C C   . ILE A 1 156 ? 14.845  56.566 -6.081  1.00 21.50 ?  156  ILE A C   1 
ATOM   1086 O O   . ILE A 1 156 ? 15.835  56.938 -6.715  1.00 22.25 ?  156  ILE A O   1 
ATOM   1087 C CB  . ILE A 1 156 ? 15.913  55.603 -4.019  1.00 21.51 ?  156  ILE A CB  1 
ATOM   1088 C CG1 . ILE A 1 156 ? 15.990  54.358 -3.132  1.00 19.32 ?  156  ILE A CG1 1 
ATOM   1089 C CG2 . ILE A 1 156 ? 15.501  56.844 -3.217  1.00 23.22 ?  156  ILE A CG2 1 
ATOM   1090 C CD1 . ILE A 1 156 ? 17.165  54.400 -2.111  1.00 23.10 ?  156  ILE A CD1 1 
ATOM   1091 N N   . ILE A 1 157 ? 13.664  57.177 -6.134  1.00 21.38 ?  157  ILE A N   1 
ATOM   1092 C CA  . ILE A 1 157 ? 13.415  58.332 -6.974  1.00 20.45 ?  157  ILE A CA  1 
ATOM   1093 C C   . ILE A 1 157 ? 13.238  59.586 -6.114  1.00 21.36 ?  157  ILE A C   1 
ATOM   1094 O O   . ILE A 1 157 ? 12.355  59.641 -5.254  1.00 20.42 ?  157  ILE A O   1 
ATOM   1095 C CB  . ILE A 1 157 ? 12.189  58.075 -7.833  1.00 21.56 ?  157  ILE A CB  1 
ATOM   1096 C CG1 . ILE A 1 157 ? 12.445  56.796 -8.632  1.00 22.49 ?  157  ILE A CG1 1 
ATOM   1097 C CG2 . ILE A 1 157 ? 11.884  59.282 -8.761  1.00 18.78 ?  157  ILE A CG2 1 
ATOM   1098 C CD1 . ILE A 1 157 ? 11.217  56.250 -9.311  1.00 27.63 ?  157  ILE A CD1 1 
ATOM   1099 N N   . ASN A 1 158 ? 14.092  60.582 -6.340  1.00 20.65 ?  158  ASN A N   1 
ATOM   1100 C CA  . ASN A 1 158 ? 14.119  61.764 -5.480  1.00 21.53 ?  158  ASN A CA  1 
ATOM   1101 C C   . ASN A 1 158 ? 12.942  62.660 -5.848  1.00 20.65 ?  158  ASN A C   1 
ATOM   1102 O O   . ASN A 1 158 ? 12.749  62.930 -7.012  1.00 20.51 ?  158  ASN A O   1 
ATOM   1103 C CB  . ASN A 1 158 ? 15.430  62.559 -5.646  1.00 21.60 ?  158  ASN A CB  1 
ATOM   1104 C CG  . ASN A 1 158 ? 15.521  63.721 -4.668  1.00 24.46 ?  158  ASN A CG  1 
ATOM   1105 O OD1 . ASN A 1 158 ? 15.191  63.581 -3.503  1.00 26.86 ?  158  ASN A OD1 1 
ATOM   1106 N ND2 . ASN A 1 158 ? 15.955  64.861 -5.136  1.00 22.86 ?  158  ASN A ND2 1 
ATOM   1107 N N   . VAL A 1 159 ? 12.146  63.062 -4.866  1.00 19.65 ?  159  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 159 ? 11.148  64.110 -5.067  1.00 20.16 ?  159  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 159 ? 11.692  65.425 -4.481  1.00 20.05 ?  159  VAL A C   1 
ATOM   1110 O O   . VAL A 1 159 ? 12.205  65.435 -3.371  1.00 19.19 ?  159  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 159 ? 9.816   63.740 -4.366  1.00 20.49 ?  159  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 159 ? 8.767   64.835 -4.581  1.00 19.76 ?  159  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 159 ? 9.320   62.377 -4.873  1.00 20.35 ?  159  VAL A CG2 1 
ATOM   1114 N N   . ALA A 1 160 ? 11.571  66.532 -5.217  1.00 21.01 ?  160  ALA A N   1 
ATOM   1115 C CA  . ALA A 1 160 ? 12.116  67.833 -4.758  1.00 22.12 ?  160  ALA A CA  1 
ATOM   1116 C C   . ALA A 1 160 ? 11.481  68.290 -3.485  1.00 22.91 ?  160  ALA A C   1 
ATOM   1117 O O   . ALA A 1 160 ? 10.319  67.998 -3.228  1.00 22.72 ?  160  ALA A O   1 
ATOM   1118 C CB  . ALA A 1 160 ? 11.922  68.916 -5.831  1.00 22.43 ?  160  ALA A CB  1 
ATOM   1119 N N   . SER A 1 161 ? 12.243  69.025 -2.675  1.00 25.17 ?  161  SER A N   1 
ATOM   1120 C CA  . SER A 1 161 ? 11.705  69.589 -1.445  1.00 25.70 ?  161  SER A CA  1 
ATOM   1121 C C   . SER A 1 161 ? 12.246  70.988 -1.189  1.00 25.82 ?  161  SER A C   1 
ATOM   1122 O O   . SER A 1 161 ? 13.190  71.410 -1.839  1.00 25.38 ?  161  SER A O   1 
ATOM   1123 C CB  . SER A 1 161 ? 12.019  68.683 -0.258  1.00 26.17 ?  161  SER A CB  1 
ATOM   1124 O OG  . SER A 1 161 ? 13.387  68.328 -0.273  1.00 26.97 ?  161  SER A OG  1 
ATOM   1125 N N   . ASP A 1 162 ? 11.638  71.707 -0.249  1.00 25.08 ?  162  ASP A N   1 
ATOM   1126 C CA  . ASP A 1 162 ? 12.165  73.012 0.139   1.00 25.35 ?  162  ASP A CA  1 
ATOM   1127 C C   . ASP A 1 162 ? 11.876  73.204 1.631   1.00 25.30 ?  162  ASP A C   1 
ATOM   1128 O O   . ASP A 1 162 ? 11.722  72.205 2.350   1.00 25.01 ?  162  ASP A O   1 
ATOM   1129 C CB  . ASP A 1 162 ? 11.523  74.092 -0.721  1.00 26.33 ?  162  ASP A CB  1 
ATOM   1130 C CG  . ASP A 1 162 ? 9.979   74.183 -0.505  1.00 25.55 ?  162  ASP A CG  1 
ATOM   1131 O OD1 . ASP A 1 162 ? 9.449   73.547 0.472   1.00 20.19 ?  162  ASP A OD1 1 
ATOM   1132 O OD2 . ASP A 1 162 ? 9.325   74.849 -1.343  1.00 24.03 ?  162  ASP A OD2 1 
ATOM   1133 N N   . GLU A 1 163 ? 11.777  74.450 2.102   1.00 24.97 ?  163  GLU A N   1 
ATOM   1134 C CA  . GLU A 1 163 ? 11.636  74.715 3.558   1.00 25.63 ?  163  GLU A CA  1 
ATOM   1135 C C   . GLU A 1 163 ? 10.346  74.199 4.102   1.00 24.42 ?  163  GLU A C   1 
ATOM   1136 O O   . GLU A 1 163 ? 10.247  73.977 5.318   1.00 24.69 ?  163  GLU A O   1 
ATOM   1137 C CB  . GLU A 1 163 ? 11.801  76.211 3.945   1.00 27.02 ?  163  GLU A CB  1 
ATOM   1138 C CG  . GLU A 1 163 ? 10.947  77.198 3.113   1.00 32.58 ?  163  GLU A CG  1 
ATOM   1139 C CD  . GLU A 1 163 ? 11.632  77.631 1.809   1.00 40.05 ?  163  GLU A CD  1 
ATOM   1140 O OE1 . GLU A 1 163 ? 11.670  78.861 1.560   1.00 42.19 ?  163  GLU A OE1 1 
ATOM   1141 O OE2 . GLU A 1 163 ? 12.148  76.755 1.045   1.00 41.70 ?  163  GLU A OE2 1 
ATOM   1142 N N   . SER A 1 164 ? 9.358   73.965 3.225   1.00 22.52 ?  164  SER A N   1 
ATOM   1143 C CA  . SER A 1 164 ? 8.081   73.401 3.689   1.00 22.91 ?  164  SER A CA  1 
ATOM   1144 C C   . SER A 1 164 ? 7.936   71.921 3.387   1.00 21.57 ?  164  SER A C   1 
ATOM   1145 O O   . SER A 1 164 ? 6.831   71.453 3.304   1.00 22.53 ?  164  SER A O   1 
ATOM   1146 C CB  . SER A 1 164 ? 6.866   74.151 3.115   1.00 23.21 ?  164  SER A CB  1 
ATOM   1147 O OG  . SER A 1 164 ? 6.857   75.522 3.534   1.00 26.14 ?  164  SER A OG  1 
ATOM   1148 N N   . GLY A 1 165 ? 9.048   71.218 3.166   1.00 21.82 ?  165  GLY A N   1 
ATOM   1149 C CA  . GLY A 1 165 ? 9.057   69.783 2.840   1.00 21.02 ?  165  GLY A CA  1 
ATOM   1150 C C   . GLY A 1 165 ? 8.902   69.496 1.330   1.00 21.62 ?  165  GLY A C   1 
ATOM   1151 O O   . GLY A 1 165 ? 9.172   70.360 0.512   1.00 20.73 ?  165  GLY A O   1 
ATOM   1152 N N   . ILE A 1 166 ? 8.469   68.268 0.996   1.00 20.54 ?  166  ILE A N   1 
ATOM   1153 C CA  . ILE A 1 166 ? 8.112   67.817 -0.359  1.00 21.09 ?  166  ILE A CA  1 
ATOM   1154 C C   . ILE A 1 166 ? 7.203   68.836 -1.056  1.00 20.38 ?  166  ILE A C   1 
ATOM   1155 O O   . ILE A 1 166 ? 6.262   69.334 -0.475  1.00 19.51 ?  166  ILE A O   1 
ATOM   1156 C CB  . ILE A 1 166 ? 7.391   66.407 -0.299  1.00 20.55 ?  166  ILE A CB  1 
ATOM   1157 C CG1 . ILE A 1 166 ? 8.398   65.269 -0.082  1.00 21.14 ?  166  ILE A CG1 1 
ATOM   1158 C CG2 . ILE A 1 166 ? 6.567   66.111 -1.590  1.00 22.79 ?  166  ILE A CG2 1 
ATOM   1159 C CD1 . ILE A 1 166 ? 7.733   63.917 0.290   1.00 23.00 ?  166  ILE A CD1 1 
ATOM   1160 N N   . VAL A 1 167 ? 7.509   69.114 -2.309  1.00 20.43 ?  167  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 167 ? 6.786   70.047 -3.154  1.00 20.62 ?  167  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 167 ? 5.813   69.210 -3.966  1.00 20.58 ?  167  VAL A C   1 
ATOM   1163 O O   . VAL A 1 167 ? 6.251   68.385 -4.755  1.00 19.82 ?  167  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 167 ? 7.803   70.707 -4.115  1.00 20.98 ?  167  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 167 ? 7.097   71.643 -5.150  1.00 21.91 ?  167  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 167 ? 8.861   71.453 -3.301  1.00 20.02 ?  167  VAL A CG2 1 
ATOM   1167 N N   . PRO A 1 168 ? 4.493   69.345 -3.711  1.00 20.88 ?  168  PRO A N   1 
ATOM   1168 C CA  . PRO A 1 168 ? 3.510   68.482 -4.382  1.00 22.56 ?  168  PRO A CA  1 
ATOM   1169 C C   . PRO A 1 168 ? 3.622   68.529 -5.893  1.00 23.68 ?  168  PRO A C   1 
ATOM   1170 O O   . PRO A 1 168 ? 3.460   67.498 -6.553  1.00 24.09 ?  168  PRO A O   1 
ATOM   1171 C CB  . PRO A 1 168 ? 2.163   69.047 -3.903  1.00 22.33 ?  168  PRO A CB  1 
ATOM   1172 C CG  . PRO A 1 168 ? 2.500   69.570 -2.535  1.00 21.96 ?  168  PRO A CG  1 
ATOM   1173 C CD  . PRO A 1 168 ? 3.850   70.208 -2.708  1.00 21.20 ?  168  PRO A CD  1 
ATOM   1174 N N   . ASP A 1 169 ? 3.908   69.715 -6.430  1.00 23.91 ?  169  ASP A N   1 
ATOM   1175 C CA  . ASP A 1 169 ? 4.116   69.859 -7.861  1.00 26.54 ?  169  ASP A CA  1 
ATOM   1176 C C   . ASP A 1 169 ? 5.272   69.018 -8.472  1.00 25.13 ?  169  ASP A C   1 
ATOM   1177 O O   . ASP A 1 169 ? 5.142   68.517 -9.585  1.00 25.97 ?  169  ASP A O   1 
ATOM   1178 C CB  . ASP A 1 169 ? 4.277   71.333 -8.140  1.00 28.05 ?  169  ASP A CB  1 
ATOM   1179 C CG  . ASP A 1 169 ? 3.298   72.161 -7.318  1.00 33.76 ?  169  ASP A CG  1 
ATOM   1180 O OD1 . ASP A 1 169 ? 2.340   72.586 -7.995  1.00 38.86 ?  169  ASP A OD1 1 
ATOM   1181 O OD2 . ASP A 1 169 ? 3.465   72.346 -6.028  1.00 34.22 ?  169  ASP A OD2 1 
ATOM   1182 N N   . SER A 1 170 ? 6.388   68.876 -7.762  1.00 23.64 ?  170  SER A N   1 
ATOM   1183 C CA  . SER A 1 170 ? 7.451   67.973 -8.208  1.00 22.97 ?  170  SER A CA  1 
ATOM   1184 C C   . SER A 1 170 ? 7.026   66.497 -8.083  1.00 22.30 ?  170  SER A C   1 
ATOM   1185 O O   . SER A 1 170 ? 7.325   65.693 -8.946  1.00 21.94 ?  170  SER A O   1 
ATOM   1186 C CB  . SER A 1 170 ? 8.739   68.228 -7.428  1.00 24.05 ?  170  SER A CB  1 
ATOM   1187 O OG  . SER A 1 170 ? 9.572   67.058 -7.471  1.00 24.84 ?  170  SER A OG  1 
ATOM   1188 N N   . LEU A 1 171 ? 6.314   66.127 -7.013  1.00 20.84 ?  171  LEU A N   1 
ATOM   1189 C CA  . LEU A 1 171 ? 5.770   64.769 -6.921  1.00 19.18 ?  171  LEU A CA  1 
ATOM   1190 C C   . LEU A 1 171 ? 4.848   64.515 -8.106  1.00 19.47 ?  171  LEU A C   1 
ATOM   1191 O O   . LEU A 1 171 ? 4.836   63.439 -8.690  1.00 18.48 ?  171  LEU A O   1 
ATOM   1192 C CB  . LEU A 1 171 ? 5.004   64.574 -5.575  1.00 19.87 ?  171  LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 171 ? 4.432   63.180 -5.233  1.00 19.45 ?  171  LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 171 ? 5.476   62.110 -5.348  1.00 17.69 ?  171  LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 171 ? 3.714   63.097 -3.769  1.00 17.82 ?  171  LEU A CD2 1 
ATOM   1196 N N   . ARG A 1 172 ? 4.032   65.507 -8.431  1.00 19.59 ?  172  ARG A N   1 
ATOM   1197 C CA  . ARG A 1 172 ? 3.044   65.379 -9.476  1.00 21.55 ?  172  ARG A CA  1 
ATOM   1198 C C   . ARG A 1 172 ? 3.706   65.090 -10.806 1.00 22.85 ?  172  ARG A C   1 
ATOM   1199 O O   . ARG A 1 172 ? 3.260   64.244 -11.561 1.00 23.12 ?  172  ARG A O   1 
ATOM   1200 C CB  . ARG A 1 172 ? 2.245   66.665 -9.607  1.00 21.16 ?  172  ARG A CB  1 
ATOM   1201 C CG  . ARG A 1 172 ? 1.081   66.600 -10.621 1.00 25.81 ?  172  ARG A CG  1 
ATOM   1202 C CD  . ARG A 1 172 ? 0.138   67.815 -10.416 1.00 32.66 ?  172  ARG A CD  1 
ATOM   1203 N NE  . ARG A 1 172 ? -0.663  67.664 -9.184  1.00 35.84 ?  172  ARG A NE  1 
ATOM   1204 C CZ  . ARG A 1 172 ? -0.537  68.374 -8.061  1.00 37.00 ?  172  ARG A CZ  1 
ATOM   1205 N NH1 . ARG A 1 172 ? 0.368   69.347 -7.944  1.00 38.99 ?  172  ARG A NH1 1 
ATOM   1206 N NH2 . ARG A 1 172 ? -1.331  68.098 -7.039  1.00 32.47 ?  172  ARG A NH2 1 
ATOM   1207 N N   . ASP A 1 173 ? 4.768   65.808 -11.097 1.00 24.61 ?  173  ASP A N   1 
ATOM   1208 C CA  . ASP A 1 173 ? 5.401   65.637 -12.372 1.00 26.64 ?  173  ASP A CA  1 
ATOM   1209 C C   . ASP A 1 173 ? 6.337   64.399 -12.458 1.00 25.03 ?  173  ASP A C   1 
ATOM   1210 O O   . ASP A 1 173 ? 6.496   63.837 -13.526 1.00 24.55 ?  173  ASP A O   1 
ATOM   1211 C CB  . ASP A 1 173 ? 6.073   66.920 -12.749 1.00 29.00 ?  173  ASP A CB  1 
ATOM   1212 C CG  . ASP A 1 173 ? 7.367   67.072 -12.102 1.00 35.97 ?  173  ASP A CG  1 
ATOM   1213 O OD1 . ASP A 1 173 ? 8.033   66.024 -11.924 1.00 45.02 ?  173  ASP A OD1 1 
ATOM   1214 O OD2 . ASP A 1 173 ? 7.740   68.234 -11.798 1.00 44.28 ?  173  ASP A OD2 1 
ATOM   1215 N N   . ILE A 1 174 ? 6.869   63.949 -11.319 1.00 23.36 ?  174  ILE A N   1 
ATOM   1216 C CA  . ILE A 1 174 ? 7.563   62.665 -11.241 1.00 21.40 ?  174  ILE A CA  1 
ATOM   1217 C C   . ILE A 1 174 ? 6.561   61.586 -11.520 1.00 20.21 ?  174  ILE A C   1 
ATOM   1218 O O   . ILE A 1 174 ? 6.797   60.707 -12.367 1.00 18.91 ?  174  ILE A O   1 
ATOM   1219 C CB  . ILE A 1 174 ? 8.281   62.466 -9.854  1.00 22.72 ?  174  ILE A CB  1 
ATOM   1220 C CG1 . ILE A 1 174 ? 9.550   63.303 -9.846  1.00 23.52 ?  174  ILE A CG1 1 
ATOM   1221 C CG2 . ILE A 1 174 ? 8.588   60.982 -9.571  1.00 21.79 ?  174  ILE A CG2 1 
ATOM   1222 C CD1 . ILE A 1 174 ? 10.218  63.357 -8.568  1.00 29.05 ?  174  ILE A CD1 1 
ATOM   1223 N N   . LEU A 1 175 ? 5.407   61.661 -10.861 1.00 17.21 ?  175  LEU A N   1 
ATOM   1224 C CA  . LEU A 1 175 ? 4.406   60.612 -11.048 1.00 16.80 ?  175  LEU A CA  1 
ATOM   1225 C C   . LEU A 1 175 ? 3.837   60.567 -12.486 1.00 17.70 ?  175  LEU A C   1 
ATOM   1226 O O   . LEU A 1 175 ? 3.348   59.519 -12.932 1.00 16.49 ?  175  LEU A O   1 
ATOM   1227 C CB  . LEU A 1 175 ? 3.280   60.779 -10.039 1.00 16.63 ?  175  LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 175 ? 3.632   60.455 -8.566  1.00 15.44 ?  175  LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 175 ? 2.498   60.981 -7.632  1.00 11.50 ?  175  LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 175 ? 3.772   58.925 -8.400  1.00 14.60 ?  175  LEU A CD2 1 
ATOM   1231 N N   . SER A 1 176 ? 3.897   61.691 -13.209 1.00 17.86 ?  176  SER A N   1 
ATOM   1232 C CA  . SER A 1 176 ? 3.300   61.710 -14.562 1.00 20.25 ?  176  SER A CA  1 
ATOM   1233 C C   . SER A 1 176 ? 3.980   60.752 -15.568 1.00 20.43 ?  176  SER A C   1 
ATOM   1234 O O   . SER A 1 176 ? 3.455   60.532 -16.641 1.00 21.40 ?  176  SER A O   1 
ATOM   1235 C CB  . SER A 1 176 ? 3.246   63.150 -15.120 1.00 20.05 ?  176  SER A CB  1 
ATOM   1236 O OG  . SER A 1 176 ? 4.554   63.520 -15.538 1.00 21.84 ?  176  SER A OG  1 
ATOM   1237 N N   . ARG A 1 177 ? 5.115   60.156 -15.210 1.00 21.23 ?  177  ARG A N   1 
ATOM   1238 C CA  . ARG A 1 177 ? 5.699   59.090 -16.006 1.00 22.20 ?  177  ARG A CA  1 
ATOM   1239 C C   . ARG A 1 177 ? 5.014   57.745 -15.966 1.00 22.63 ?  177  ARG A C   1 
ATOM   1240 O O   . ARG A 1 177 ? 5.305   56.863 -16.838 1.00 21.33 ?  177  ARG A O   1 
ATOM   1241 C CB  . ARG A 1 177 ? 7.194   58.927 -15.736 1.00 23.75 ?  177  ARG A CB  1 
ATOM   1242 C CG  . ARG A 1 177 ? 7.568   58.160 -14.508 1.00 27.24 ?  177  ARG A CG  1 
ATOM   1243 C CD  . ARG A 1 177 ? 8.586   59.030 -13.825 1.00 35.63 ?  177  ARG A CD  1 
ATOM   1244 N NE  . ARG A 1 177 ? 9.788   58.332 -13.453 1.00 38.75 ?  177  ARG A NE  1 
ATOM   1245 C CZ  . ARG A 1 177 ? 10.892  58.947 -13.046 1.00 39.32 ?  177  ARG A CZ  1 
ATOM   1246 N NH1 . ARG A 1 177 ? 10.940  60.273 -12.943 1.00 38.93 ?  177  ARG A NH1 1 
ATOM   1247 N NH2 . ARG A 1 177 ? 11.943  58.216 -12.745 1.00 40.98 ?  177  ARG A NH2 1 
ATOM   1248 N N   . TRP A 1 178 ? 4.090   57.582 -15.011 1.00 20.81 ?  178  TRP A N   1 
ATOM   1249 C CA  . TRP A 1 178 ? 3.281   56.359 -14.866 1.00 20.80 ?  178  TRP A CA  1 
ATOM   1250 C C   . TRP A 1 178 ? 1.828   56.660 -15.207 1.00 20.47 ?  178  TRP A C   1 
ATOM   1251 O O   . TRP A 1 178 ? 1.392   57.791 -15.127 1.00 21.45 ?  178  TRP A O   1 
ATOM   1252 C CB  . TRP A 1 178 ? 3.353   55.806 -13.392 1.00 20.93 ?  178  TRP A CB  1 
ATOM   1253 C CG  . TRP A 1 178 ? 4.744   55.308 -13.058 1.00 20.96 ?  178  TRP A CG  1 
ATOM   1254 C CD1 . TRP A 1 178 ? 5.355   54.166 -13.557 1.00 21.09 ?  178  TRP A CD1 1 
ATOM   1255 C CD2 . TRP A 1 178 ? 5.710   55.936 -12.213 1.00 21.73 ?  178  TRP A CD2 1 
ATOM   1256 N NE1 . TRP A 1 178 ? 6.634   54.073 -13.079 1.00 23.06 ?  178  TRP A NE1 1 
ATOM   1257 C CE2 . TRP A 1 178 ? 6.877   55.123 -12.233 1.00 21.36 ?  178  TRP A CE2 1 
ATOM   1258 C CE3 . TRP A 1 178 ? 5.708   57.097 -11.425 1.00 21.73 ?  178  TRP A CE3 1 
ATOM   1259 C CZ2 . TRP A 1 178 ? 8.034   55.448 -11.507 1.00 21.16 ?  178  TRP A CZ2 1 
ATOM   1260 C CZ3 . TRP A 1 178 ? 6.864   57.412 -10.687 1.00 21.63 ?  178  TRP A CZ3 1 
ATOM   1261 C CH2 . TRP A 1 178 ? 8.009   56.584 -10.738 1.00 21.19 ?  178  TRP A CH2 1 
ATOM   1262 N N   . LYS A 1 179 ? 1.065   55.624 -15.501 1.00 20.93 ?  179  LYS A N   1 
ATOM   1263 C CA  . LYS A 1 179 ? -0.370  55.698 -15.708 1.00 22.38 ?  179  LYS A CA  1 
ATOM   1264 C C   . LYS A 1 179 ? -1.065  55.316 -14.400 1.00 21.94 ?  179  LYS A C   1 
ATOM   1265 O O   . LYS A 1 179 ? -0.709  54.301 -13.826 1.00 21.29 ?  179  LYS A O   1 
ATOM   1266 C CB  . LYS A 1 179 ? -0.720  54.636 -16.756 1.00 23.74 ?  179  LYS A CB  1 
ATOM   1267 C CG  . LYS A 1 179 ? -0.949  55.114 -18.165 1.00 29.25 ?  179  LYS A CG  1 
ATOM   1268 C CD  . LYS A 1 179 ? -1.311  53.942 -19.094 1.00 33.98 ?  179  LYS A CD  1 
ATOM   1269 C CE  . LYS A 1 179 ? -2.536  54.290 -19.946 1.00 38.85 ?  179  LYS A CE  1 
ATOM   1270 N NZ  . LYS A 1 179 ? -2.805  53.269 -21.048 1.00 41.43 ?  179  LYS A NZ  1 
ATOM   1271 N N   . PRO A 1 180 ? -2.072  56.094 -13.923 1.00 22.39 ?  180  PRO A N   1 
ATOM   1272 C CA  . PRO A 1 180 ? -2.796  55.659 -12.700 1.00 22.78 ?  180  PRO A CA  1 
ATOM   1273 C C   . PRO A 1 180 ? -3.400  54.258 -12.846 1.00 23.88 ?  180  PRO A C   1 
ATOM   1274 O O   . PRO A 1 180 ? -3.398  53.478 -11.890 1.00 24.34 ?  180  PRO A O   1 
ATOM   1275 C CB  . PRO A 1 180 ? -3.909  56.704 -12.568 1.00 22.66 ?  180  PRO A CB  1 
ATOM   1276 C CG  . PRO A 1 180 ? -3.355  57.886 -13.203 1.00 22.28 ?  180  PRO A CG  1 
ATOM   1277 C CD  . PRO A 1 180 ? -2.595  57.382 -14.400 1.00 21.66 ?  180  PRO A CD  1 
ATOM   1278 N N   . GLU A 1 181 ? -3.861  53.925 -14.057 1.00 23.37 ?  181  GLU A N   1 
ATOM   1279 C CA  . GLU A 1 181 ? -4.422  52.595 -14.338 1.00 23.07 ?  181  GLU A CA  1 
ATOM   1280 C C   . GLU A 1 181 ? -3.462  51.424 -14.329 1.00 20.71 ?  181  GLU A C   1 
ATOM   1281 O O   . GLU A 1 181 ? -3.909  50.286 -14.368 1.00 20.20 ?  181  GLU A O   1 
ATOM   1282 C CB  . GLU A 1 181 ? -5.281  52.546 -15.641 1.00 24.90 ?  181  GLU A CB  1 
ATOM   1283 C CG  . GLU A 1 181 ? -4.737  53.217 -16.850 1.00 28.05 ?  181  GLU A CG  1 
ATOM   1284 C CD  . GLU A 1 181 ? -4.983  54.721 -16.782 1.00 37.70 ?  181  GLU A CD  1 
ATOM   1285 O OE1 . GLU A 1 181 ? -6.155  55.134 -16.962 1.00 41.45 ?  181  GLU A OE1 1 
ATOM   1286 O OE2 . GLU A 1 181 ? -4.012  55.477 -16.514 1.00 37.29 ?  181  GLU A OE2 1 
ATOM   1287 N N   . ASP A 1 182 ? -2.168  51.690 -14.274 1.00 19.17 ?  182  ASP A N   1 
ATOM   1288 C CA  . ASP A 1 182 ? -1.170  50.631 -14.137 1.00 19.13 ?  182  ASP A CA  1 
ATOM   1289 C C   . ASP A 1 182 ? -0.905  50.254 -12.688 1.00 18.54 ?  182  ASP A C   1 
ATOM   1290 O O   . ASP A 1 182 ? -0.267  49.213 -12.420 1.00 17.27 ?  182  ASP A O   1 
ATOM   1291 C CB  . ASP A 1 182 ? 0.159   50.989 -14.831 1.00 19.09 ?  182  ASP A CB  1 
ATOM   1292 C CG  . ASP A 1 182 ? 0.038   51.021 -16.369 1.00 24.72 ?  182  ASP A CG  1 
ATOM   1293 O OD1 . ASP A 1 182 ? 0.869   51.721 -16.981 1.00 25.66 ?  182  ASP A OD1 1 
ATOM   1294 O OD2 . ASP A 1 182 ? -0.870  50.355 -16.962 1.00 25.53 ?  182  ASP A OD2 1 
ATOM   1295 N N   . ALA A 1 183 ? -1.400  51.066 -11.748 1.00 18.21 ?  183  ALA A N   1 
ATOM   1296 C CA  . ALA A 1 183 ? -1.159  50.736 -10.328 1.00 18.24 ?  183  ALA A CA  1 
ATOM   1297 C C   . ALA A 1 183 ? -1.526  49.285 -9.969  1.00 17.10 ?  183  ALA A C   1 
ATOM   1298 O O   . ALA A 1 183 ? -0.729  48.583 -9.383  1.00 17.14 ?  183  ALA A O   1 
ATOM   1299 C CB  . ALA A 1 183 ? -1.859  51.720 -9.392  1.00 18.41 ?  183  ALA A CB  1 
ATOM   1300 N N   . LYS A 1 184 ? -2.715  48.829 -10.344 1.00 16.85 ?  184  LYS A N   1 
ATOM   1301 C CA  . LYS A 1 184 ? -3.149  47.465 -9.978  1.00 18.17 ?  184  LYS A CA  1 
ATOM   1302 C C   . LYS A 1 184 ? -2.768  46.407 -10.985 1.00 19.61 ?  184  LYS A C   1 
ATOM   1303 O O   . LYS A 1 184 ? -3.157  45.246 -10.818 1.00 19.90 ?  184  LYS A O   1 
ATOM   1304 C CB  . LYS A 1 184 ? -4.680  47.427 -9.731  1.00 18.80 ?  184  LYS A CB  1 
ATOM   1305 C CG  . LYS A 1 184 ? -5.079  47.994 -8.324  1.00 20.04 ?  184  LYS A CG  1 
ATOM   1306 C CD  . LYS A 1 184 ? -6.603  48.113 -8.175  1.00 25.04 ?  184  LYS A CD  1 
ATOM   1307 C CE  . LYS A 1 184 ? -6.917  48.938 -6.931  1.00 29.65 ?  184  LYS A CE  1 
ATOM   1308 N NZ  . LYS A 1 184 ? -8.184  48.523 -6.223  1.00 36.42 ?  184  LYS A NZ  1 
ATOM   1309 N N   . ASN A 1 185 ? -2.022  46.789 -12.033 1.00 19.90 ?  185  ASN A N   1 
ATOM   1310 C CA  . ASN A 1 185 ? -1.432  45.825 -12.973 1.00 21.31 ?  185  ASN A CA  1 
ATOM   1311 C C   . ASN A 1 185 ? -0.114  45.230 -12.439 1.00 21.37 ?  185  ASN A C   1 
ATOM   1312 O O   . ASN A 1 185 ? 0.870   45.934 -12.227 1.00 22.36 ?  185  ASN A O   1 
ATOM   1313 C CB  . ASN A 1 185 ? -1.317  46.492 -14.369 1.00 22.34 ?  185  ASN A CB  1 
ATOM   1314 C CG  . ASN A 1 185 ? -0.774  45.560 -15.435 1.00 27.03 ?  185  ASN A CG  1 
ATOM   1315 O OD1 . ASN A 1 185 ? -0.182  44.513 -15.138 1.00 31.31 ?  185  ASN A OD1 1 
ATOM   1316 N ND2 . ASN A 1 185 ? -0.955  45.948 -16.694 1.00 27.39 ?  185  ASN A ND2 1 
ATOM   1317 N N   . PRO A 1 186 ? -0.083  43.920 -12.168 1.00 22.23 ?  186  PRO A N   1 
ATOM   1318 C CA  . PRO A 1 186 ? 1.106   43.397 -11.492 1.00 22.44 ?  186  PRO A CA  1 
ATOM   1319 C C   . PRO A 1 186 ? 2.417   43.448 -12.330 1.00 23.60 ?  186  PRO A C   1 
ATOM   1320 O O   . PRO A 1 186 ? 3.492   43.338 -11.767 1.00 22.67 ?  186  PRO A O   1 
ATOM   1321 C CB  . PRO A 1 186 ? 0.746   41.935 -11.187 1.00 23.33 ?  186  PRO A CB  1 
ATOM   1322 C CG  . PRO A 1 186 ? -0.675  41.711 -11.704 1.00 22.34 ?  186  PRO A CG  1 
ATOM   1323 C CD  . PRO A 1 186 ? -1.080  42.880 -12.509 1.00 22.26 ?  186  PRO A CD  1 
ATOM   1324 N N   . GLN A 1 187 ? 2.310   43.648 -13.647 1.00 24.81 ?  187  GLN A N   1 
ATOM   1325 C CA  . GLN A 1 187 ? 3.472   43.592 -14.542 1.00 26.75 ?  187  GLN A CA  1 
ATOM   1326 C C   . GLN A 1 187 ? 3.953   45.007 -14.887 1.00 26.98 ?  187  GLN A C   1 
ATOM   1327 O O   . GLN A 1 187 ? 4.800   45.179 -15.795 1.00 27.94 ?  187  GLN A O   1 
ATOM   1328 C CB  . GLN A 1 187 ? 3.061   42.870 -15.828 1.00 27.32 ?  187  GLN A CB  1 
ATOM   1329 C CG  . GLN A 1 187 ? 2.545   41.422 -15.644 1.00 32.55 ?  187  GLN A CG  1 
ATOM   1330 C CD  . GLN A 1 187 ? 3.625   40.385 -15.892 1.00 36.20 ?  187  GLN A CD  1 
ATOM   1331 O OE1 . GLN A 1 187 ? 4.440   40.534 -16.831 1.00 36.43 ?  187  GLN A OE1 1 
ATOM   1332 N NE2 . GLN A 1 187 ? 3.645   39.331 -15.070 1.00 35.48 ?  187  GLN A NE2 1 
ATOM   1333 N N   . LYS A 1 188 ? 3.414   46.012 -14.187 1.00 25.46 ?  188  LYS A N   1 
ATOM   1334 C CA  . LYS A 1 188 ? 3.800   47.407 -14.352 1.00 24.57 ?  188  LYS A CA  1 
ATOM   1335 C C   . LYS A 1 188 ? 4.349   47.968 -13.031 1.00 25.59 ?  188  LYS A C   1 
ATOM   1336 O O   . LYS A 1 188 ? 3.706   47.847 -11.984 1.00 25.54 ?  188  LYS A O   1 
ATOM   1337 C CB  . LYS A 1 188 ? 2.588   48.246 -14.774 1.00 24.23 ?  188  LYS A CB  1 
ATOM   1338 C CG  . LYS A 1 188 ? 2.029   47.940 -16.153 1.00 24.32 ?  188  LYS A CG  1 
ATOM   1339 C CD  . LYS A 1 188 ? 2.967   48.527 -17.203 1.00 28.12 ?  188  LYS A CD  1 
ATOM   1340 C CE  . LYS A 1 188 ? 2.520   48.117 -18.610 1.00 36.58 ?  188  LYS A CE  1 
ATOM   1341 N NZ  . LYS A 1 188 ? 1.201   48.764 -18.933 1.00 39.48 ?  188  LYS A NZ  1 
ATOM   1342 N N   . ASN A 1 189 ? 5.478   48.669 -13.103 1.00 24.36 ?  189  ASN A N   1 
ATOM   1343 C CA  . ASN A 1 189 ? 6.317   48.933 -11.943 1.00 23.12 ?  189  ASN A CA  1 
ATOM   1344 C C   . ASN A 1 189 ? 6.058   50.331 -11.378 1.00 21.56 ?  189  ASN A C   1 
ATOM   1345 O O   . ASN A 1 189 ? 7.004   51.098 -11.115 1.00 21.96 ?  189  ASN A O   1 
ATOM   1346 C CB  . ASN A 1 189 ? 7.804   48.778 -12.347 1.00 23.87 ?  189  ASN A CB  1 
ATOM   1347 C CG  . ASN A 1 189 ? 8.709   48.482 -11.169 1.00 27.93 ?  189  ASN A CG  1 
ATOM   1348 O OD1 . ASN A 1 189 ? 8.250   48.049 -10.084 1.00 33.19 ?  189  ASN A OD1 1 
ATOM   1349 N ND2 . ASN A 1 189 ? 10.011  48.710 -11.362 1.00 26.70 ?  189  ASN A ND2 1 
ATOM   1350 N N   . THR A 1 190 ? 4.780   50.650 -11.188 1.00 17.91 ?  190  THR A N   1 
ATOM   1351 C CA  . THR A 1 190 ? 4.369   51.865 -10.523 1.00 16.34 ?  190  THR A CA  1 
ATOM   1352 C C   . THR A 1 190 ? 4.922   51.857 -9.070  1.00 15.20 ?  190  THR A C   1 
ATOM   1353 O O   . THR A 1 190 ? 5.158   50.783 -8.500  1.00 15.15 ?  190  THR A O   1 
ATOM   1354 C CB  . THR A 1 190 ? 2.808   52.073 -10.599 1.00 15.67 ?  190  THR A CB  1 
ATOM   1355 O OG1 . THR A 1 190 ? 2.161   51.034 -9.879  1.00 18.00 ?  190  THR A OG1 1 
ATOM   1356 C CG2 . THR A 1 190 ? 2.318   51.966 -12.040 1.00 15.58 ?  190  THR A CG2 1 
ATOM   1357 N N   . PRO A 1 191 ? 5.207   53.044 -8.501  1.00 14.27 ?  191  PRO A N   1 
ATOM   1358 C CA  . PRO A 1 191 ? 5.825   53.089 -7.131  1.00 13.83 ?  191  PRO A CA  1 
ATOM   1359 C C   . PRO A 1 191 ? 5.041   52.407 -6.042  1.00 14.05 ?  191  PRO A C   1 
ATOM   1360 O O   . PRO A 1 191 ? 3.772   52.459 -6.013  1.00 13.86 ?  191  PRO A O   1 
ATOM   1361 C CB  . PRO A 1 191 ? 5.896   54.551 -6.788  1.00 13.23 ?  191  PRO A CB  1 
ATOM   1362 C CG  . PRO A 1 191 ? 5.395   55.317 -7.967  1.00 15.60 ?  191  PRO A CG  1 
ATOM   1363 C CD  . PRO A 1 191 ? 4.980   54.378 -9.072  1.00 13.86 ?  191  PRO A CD  1 
ATOM   1364 N N   . LYS A 1 192 ? 5.769   51.773 -5.132  1.00 13.07 ?  192  LYS A N   1 
ATOM   1365 C CA  . LYS A 1 192 ? 5.109   51.029 -4.070  1.00 14.61 ?  192  LYS A CA  1 
ATOM   1366 C C   . LYS A 1 192 ? 4.701   51.976 -2.935  1.00 13.40 ?  192  LYS A C   1 
ATOM   1367 O O   . LYS A 1 192 ? 3.672   51.789 -2.306  1.00 13.01 ?  192  LYS A O   1 
ATOM   1368 C CB  . LYS A 1 192 ? 6.050   49.932 -3.523  1.00 15.51 ?  192  LYS A CB  1 
ATOM   1369 C CG  . LYS A 1 192 ? 6.280   48.765 -4.484  1.00 18.76 ?  192  LYS A CG  1 
ATOM   1370 C CD  . LYS A 1 192 ? 5.047   47.915 -4.538  1.00 17.01 ?  192  LYS A CD  1 
ATOM   1371 C CE  . LYS A 1 192 ? 5.337   46.562 -5.160  1.00 23.47 ?  192  LYS A CE  1 
ATOM   1372 N NZ  . LYS A 1 192 ? 6.273   45.730 -4.298  1.00 18.76 ?  192  LYS A NZ  1 
ATOM   1373 N N   . PHE A 1 193 ? 5.523   52.991 -2.686  1.00 12.56 ?  193  PHE A N   1 
ATOM   1374 C CA  . PHE A 1 193 ? 5.282   53.881 -1.578  1.00 11.32 ?  193  PHE A CA  1 
ATOM   1375 C C   . PHE A 1 193 ? 6.083   55.151 -1.710  1.00 12.16 ?  193  PHE A C   1 
ATOM   1376 O O   . PHE A 1 193 ? 7.093   55.223 -2.469  1.00 10.47 ?  193  PHE A O   1 
ATOM   1377 C CB  . PHE A 1 193 ? 5.545   53.178 -0.205  1.00 11.38 ?  193  PHE A CB  1 
ATOM   1378 C CG  . PHE A 1 193 ? 7.001   52.800 0.072   1.00 11.60 ?  193  PHE A CG  1 
ATOM   1379 C CD1 . PHE A 1 193 ? 7.402   51.459 0.037   1.00 9.89  ?  193  PHE A CD1 1 
ATOM   1380 C CD2 . PHE A 1 193 ? 7.943   53.771 0.437   1.00 14.40 ?  193  PHE A CD2 1 
ATOM   1381 C CE1 . PHE A 1 193 ? 8.746   51.083 0.336   1.00 14.03 ?  193  PHE A CE1 1 
ATOM   1382 C CE2 . PHE A 1 193 ? 9.282   53.425 0.744   1.00 16.36 ?  193  PHE A CE2 1 
ATOM   1383 C CZ  . PHE A 1 193 ? 9.698   52.093 0.677   1.00 14.66 ?  193  PHE A CZ  1 
ATOM   1384 N N   . LEU A 1 194 ? 5.637   56.134 -0.934  1.00 11.28 ?  194  LEU A N   1 
ATOM   1385 C CA  . LEU A 1 194 ? 6.350   57.360 -0.697  1.00 12.02 ?  194  LEU A CA  1 
ATOM   1386 C C   . LEU A 1 194 ? 6.715   57.356 0.803   1.00 12.33 ?  194  LEU A C   1 
ATOM   1387 O O   . LEU A 1 194 ? 5.862   57.088 1.675   1.00 11.36 ?  194  LEU A O   1 
ATOM   1388 C CB  . LEU A 1 194 ? 5.454   58.571 -1.015  1.00 11.80 ?  194  LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 194 ? 5.959   59.954 -0.578  1.00 16.28 ?  194  LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 194 ? 7.181   60.435 -1.303  1.00 16.79 ?  194  LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 194 ? 4.809   60.957 -0.692  1.00 21.53 ?  194  LEU A CD2 1 
ATOM   1392 N N   . TYR A 1 195 ? 7.970   57.645 1.098   1.00 12.61 ?  195  TYR A N   1 
ATOM   1393 C CA  . TYR A 1 195 ? 8.463   57.672 2.486   1.00 12.47 ?  195  TYR A CA  1 
ATOM   1394 C C   . TYR A 1 195 ? 8.732   59.146 2.747   1.00 12.75 ?  195  TYR A C   1 
ATOM   1395 O O   . TYR A 1 195 ? 9.307   59.794 1.884   1.00 12.45 ?  195  TYR A O   1 
ATOM   1396 C CB  . TYR A 1 195 ? 9.773   56.854 2.595   1.00 12.77 ?  195  TYR A CB  1 
ATOM   1397 C CG  . TYR A 1 195 ? 10.611  57.133 3.852   1.00 13.68 ?  195  TYR A CG  1 
ATOM   1398 C CD1 . TYR A 1 195 ? 10.360  56.435 5.041   1.00 10.48 ?  195  TYR A CD1 1 
ATOM   1399 C CD2 . TYR A 1 195 ? 11.603  58.120 3.860   1.00 14.70 ?  195  TYR A CD2 1 
ATOM   1400 C CE1 . TYR A 1 195 ? 11.095  56.689 6.217   1.00 11.77 ?  195  TYR A CE1 1 
ATOM   1401 C CE2 . TYR A 1 195 ? 12.360  58.399 5.040   1.00 14.14 ?  195  TYR A CE2 1 
ATOM   1402 C CZ  . TYR A 1 195 ? 12.087  57.658 6.202   1.00 14.92 ?  195  TYR A CZ  1 
ATOM   1403 O OH  . TYR A 1 195 ? 12.791  57.873 7.374   1.00 17.58 ?  195  TYR A OH  1 
ATOM   1404 N N   . THR A 1 196 ? 8.308   59.693 3.895   1.00 14.19 ?  196  THR A N   1 
ATOM   1405 C CA  . THR A 1 196 ? 8.747   61.036 4.326   1.00 14.93 ?  196  THR A CA  1 
ATOM   1406 C C   . THR A 1 196 ? 8.768   61.100 5.850   1.00 15.13 ?  196  THR A C   1 
ATOM   1407 O O   . THR A 1 196 ? 8.106   60.295 6.540   1.00 13.38 ?  196  THR A O   1 
ATOM   1408 C CB  . THR A 1 196 ? 7.887   62.286 3.768   1.00 18.27 ?  196  THR A CB  1 
ATOM   1409 O OG1 . THR A 1 196 ? 8.695   63.536 3.735   1.00 21.99 ?  196  THR A OG1 1 
ATOM   1410 C CG2 . THR A 1 196 ? 6.659   62.532 4.602   1.00 15.09 ?  196  THR A CG2 1 
ATOM   1411 N N   . VAL A 1 197 ? 9.526   62.074 6.341   1.00 13.31 ?  197  VAL A N   1 
ATOM   1412 C CA  . VAL A 1 197 ? 9.568   62.445 7.755   1.00 14.41 ?  197  VAL A CA  1 
ATOM   1413 C C   . VAL A 1 197 ? 8.861   63.825 7.766   1.00 14.16 ?  197  VAL A C   1 
ATOM   1414 O O   . VAL A 1 197 ? 9.424   64.835 7.365   1.00 14.92 ?  197  VAL A O   1 
ATOM   1415 C CB  . VAL A 1 197 ? 11.032  62.532 8.274   1.00 14.49 ?  197  VAL A CB  1 
ATOM   1416 C CG1 . VAL A 1 197 ? 11.118  62.966 9.782   1.00 15.37 ?  197  VAL A CG1 1 
ATOM   1417 C CG2 . VAL A 1 197 ? 11.751  61.223 8.080   1.00 14.50 ?  197  VAL A CG2 1 
ATOM   1418 N N   . PRO A 1 198 ? 7.575   63.848 8.106   1.00 14.02 ?  198  PRO A N   1 
ATOM   1419 C CA  . PRO A 1 198 ? 6.845   65.105 7.907   1.00 14.76 ?  198  PRO A CA  1 
ATOM   1420 C C   . PRO A 1 198 ? 7.192   66.205 8.890   1.00 16.14 ?  198  PRO A C   1 
ATOM   1421 O O   . PRO A 1 198 ? 6.950   67.363 8.574   1.00 17.56 ?  198  PRO A O   1 
ATOM   1422 C CB  . PRO A 1 198 ? 5.375   64.705 8.130   1.00 15.26 ?  198  PRO A CB  1 
ATOM   1423 C CG  . PRO A 1 198 ? 5.354   63.225 8.154   1.00 16.93 ?  198  PRO A CG  1 
ATOM   1424 C CD  . PRO A 1 198 ? 6.725   62.801 8.681   1.00 13.31 ?  198  PRO A CD  1 
ATOM   1425 N N   . ASN A 1 199 ? 7.726   65.875 10.077  1.00 15.56 ?  199  ASN A N   1 
ATOM   1426 C CA  . ASN A 1 199 ? 8.107   66.916 11.038  1.00 16.37 ?  199  ASN A CA  1 
ATOM   1427 C C   . ASN A 1 199 ? 9.600   66.810 11.380  1.00 16.86 ?  199  ASN A C   1 
ATOM   1428 O O   . ASN A 1 199 ? 10.063  65.746 11.771  1.00 15.44 ?  199  ASN A O   1 
ATOM   1429 C CB  . ASN A 1 199 ? 7.319   66.776 12.325  1.00 15.39 ?  199  ASN A CB  1 
ATOM   1430 C CG  . ASN A 1 199 ? 5.814   66.929 12.102  1.00 19.49 ?  199  ASN A CG  1 
ATOM   1431 O OD1 . ASN A 1 199 ? 5.327   68.037 11.813  1.00 16.15 ?  199  ASN A OD1 1 
ATOM   1432 N ND2 . ASN A 1 199 ? 5.084   65.817 12.203  1.00 17.61 ?  199  ASN A ND2 1 
ATOM   1433 N N   . GLY A 1 200 ? 10.312  67.923 11.247  1.00 17.24 ?  200  GLY A N   1 
ATOM   1434 C CA  . GLY A 1 200 ? 11.690  68.015 11.674  1.00 17.87 ?  200  GLY A CA  1 
ATOM   1435 C C   . GLY A 1 200 ? 12.567  67.039 10.932  1.00 18.78 ?  200  GLY A C   1 
ATOM   1436 O O   . GLY A 1 200 ? 13.369  66.352 11.540  1.00 20.04 ?  200  GLY A O   1 
ATOM   1437 N N   . ASN A 1 201 ? 12.400  66.941 9.624   1.00 18.92 ?  201  ASN A N   1 
ATOM   1438 C CA  . ASN A 1 201 ? 13.149  65.955 8.842   1.00 19.53 ?  201  ASN A CA  1 
ATOM   1439 C C   . ASN A 1 201 ? 14.617  65.914 9.293   1.00 18.31 ?  201  ASN A C   1 
ATOM   1440 O O   . ASN A 1 201 ? 15.252  66.961 9.590   1.00 16.95 ?  201  ASN A O   1 
ATOM   1441 C CB  . ASN A 1 201 ? 12.962  66.237 7.335   1.00 20.58 ?  201  ASN A CB  1 
ATOM   1442 C CG  . ASN A 1 201 ? 13.825  65.314 6.421   1.00 25.46 ?  201  ASN A CG  1 
ATOM   1443 O OD1 . ASN A 1 201 ? 14.663  65.805 5.651   1.00 28.80 ?  201  ASN A OD1 1 
ATOM   1444 N ND2 . ASN A 1 201 ? 13.636  64.006 6.520   1.00 25.94 ?  201  ASN A ND2 1 
ATOM   1445 N N   . ASN A 1 202 ? 15.150  64.706 9.410   1.00 16.95 ?  202  ASN A N   1 
ATOM   1446 C CA  . ASN A 1 202 ? 16.568  64.551 9.599   1.00 17.28 ?  202  ASN A CA  1 
ATOM   1447 C C   . ASN A 1 202 ? 17.196  64.352 8.191   1.00 18.02 ?  202  ASN A C   1 
ATOM   1448 O O   . ASN A 1 202 ? 16.895  63.357 7.496   1.00 18.06 ?  202  ASN A O   1 
ATOM   1449 C CB  . ASN A 1 202 ? 16.845  63.409 10.628  1.00 17.22 ?  202  ASN A CB  1 
ATOM   1450 C CG  . ASN A 1 202 ? 18.320  62.970 10.685  1.00 19.39 ?  202  ASN A CG  1 
ATOM   1451 O OD1 . ASN A 1 202 ? 19.232  63.717 10.281  1.00 18.25 ?  202  ASN A OD1 1 
ATOM   1452 N ND2 . ASN A 1 202 ? 18.560  61.771 11.285  1.00 13.96 ?  202  ASN A ND2 1 
ATOM   1453 N N   . PRO A 1 203 ? 18.131  65.255 7.765   1.00 18.65 ?  203  PRO A N   1 
ATOM   1454 C CA  . PRO A 1 203 ? 18.898  66.255 8.477   1.00 18.96 ?  203  PRO A CA  1 
ATOM   1455 C C   . PRO A 1 203 ? 18.399  67.706 8.382   1.00 19.95 ?  203  PRO A C   1 
ATOM   1456 O O   . PRO A 1 203 ? 18.972  68.560 9.058   1.00 20.53 ?  203  PRO A O   1 
ATOM   1457 C CB  . PRO A 1 203 ? 20.260  66.160 7.778   1.00 19.25 ?  203  PRO A CB  1 
ATOM   1458 C CG  . PRO A 1 203 ? 19.889  65.912 6.323   1.00 18.75 ?  203  PRO A CG  1 
ATOM   1459 C CD  . PRO A 1 203 ? 18.516  65.230 6.333   1.00 18.22 ?  203  PRO A CD  1 
ATOM   1460 N N   . THR A 1 204 ? 17.403  68.005 7.537   1.00 20.31 ?  204  THR A N   1 
ATOM   1461 C CA  . THR A 1 204 ? 17.143  69.405 7.164   1.00 20.48 ?  204  THR A CA  1 
ATOM   1462 C C   . THR A 1 204 ? 16.440  70.254 8.218   1.00 20.29 ?  204  THR A C   1 
ATOM   1463 O O   . THR A 1 204 ? 16.546  71.468 8.188   1.00 21.67 ?  204  THR A O   1 
ATOM   1464 C CB  . THR A 1 204 ? 16.287  69.560 5.901   1.00 21.48 ?  204  THR A CB  1 
ATOM   1465 O OG1 . THR A 1 204 ? 15.012  68.954 6.102   1.00 17.63 ?  204  THR A OG1 1 
ATOM   1466 C CG2 . THR A 1 204 ? 16.956  68.975 4.692   1.00 22.01 ?  204  THR A CG2 1 
ATOM   1467 N N   . GLY A 1 205 ? 15.678  69.640 9.107   1.00 18.69 ?  205  GLY A N   1 
ATOM   1468 C CA  . GLY A 1 205 ? 14.891  70.406 10.073  1.00 17.54 ?  205  GLY A CA  1 
ATOM   1469 C C   . GLY A 1 205 ? 13.529  70.842 9.548   1.00 17.70 ?  205  GLY A C   1 
ATOM   1470 O O   . GLY A 1 205 ? 12.758  71.392 10.302  1.00 18.59 ?  205  GLY A O   1 
ATOM   1471 N N   . ASN A 1 206 ? 13.211  70.585 8.272   1.00 18.15 ?  206  ASN A N   1 
ATOM   1472 C CA  . ASN A 1 206 ? 11.976  71.141 7.621   1.00 18.72 ?  206  ASN A CA  1 
ATOM   1473 C C   . ASN A 1 206 ? 10.750  70.276 7.873   1.00 19.31 ?  206  ASN A C   1 
ATOM   1474 O O   . ASN A 1 206 ? 10.871  69.026 8.047   1.00 20.34 ?  206  ASN A O   1 
ATOM   1475 C CB  . ASN A 1 206 ? 12.186  71.299 6.106   1.00 18.95 ?  206  ASN A CB  1 
ATOM   1476 C CG  . ASN A 1 206 ? 13.381  72.226 5.753   1.00 19.21 ?  206  ASN A CG  1 
ATOM   1477 O OD1 . ASN A 1 206 ? 14.022  72.047 4.718   1.00 24.85 ?  206  ASN A OD1 1 
ATOM   1478 N ND2 . ASN A 1 206 ? 13.671  73.187 6.607   1.00 19.95 ?  206  ASN A ND2 1 
ATOM   1479 N N   . SER A 1 207 ? 9.580   70.915 7.904   1.00 17.87 ?  207  SER A N   1 
ATOM   1480 C CA  . SER A 1 207 ? 8.318   70.257 8.158   1.00 17.65 ?  207  SER A CA  1 
ATOM   1481 C C   . SER A 1 207 ? 7.317   70.551 7.028   1.00 18.08 ?  207  SER A C   1 
ATOM   1482 O O   . SER A 1 207 ? 7.299   71.653 6.454   1.00 16.93 ?  207  SER A O   1 
ATOM   1483 C CB  . SER A 1 207 ? 7.731   70.763 9.490   1.00 18.07 ?  207  SER A CB  1 
ATOM   1484 O OG  . SER A 1 207 ? 8.520   70.312 10.565  1.00 21.00 ?  207  SER A OG  1 
ATOM   1485 N N   . LEU A 1 208 ? 6.485   69.564 6.725   1.00 17.54 ?  208  LEU A N   1 
ATOM   1486 C CA  . LEU A 1 208 ? 5.343   69.724 5.822   1.00 17.06 ?  208  LEU A CA  1 
ATOM   1487 C C   . LEU A 1 208 ? 4.203   70.571 6.397   1.00 16.93 ?  208  LEU A C   1 
ATOM   1488 O O   . LEU A 1 208 ? 3.865   70.435 7.556   1.00 17.78 ?  208  LEU A O   1 
ATOM   1489 C CB  . LEU A 1 208 ? 4.758   68.368 5.515   1.00 16.62 ?  208  LEU A CB  1 
ATOM   1490 C CG  . LEU A 1 208 ? 5.392   67.578 4.369   1.00 18.67 ?  208  LEU A CG  1 
ATOM   1491 C CD1 . LEU A 1 208 ? 4.862   66.147 4.414   1.00 15.05 ?  208  LEU A CD1 1 
ATOM   1492 C CD2 . LEU A 1 208 ? 5.051   68.300 3.036   1.00 13.43 ?  208  LEU A CD2 1 
ATOM   1493 N N   . THR A 1 209 ? 3.588   71.402 5.570   1.00 16.89 ?  209  THR A N   1 
ATOM   1494 C CA  . THR A 1 209 ? 2.384   72.148 5.975   1.00 16.95 ?  209  THR A CA  1 
ATOM   1495 C C   . THR A 1 209 ? 1.157   71.268 5.753   1.00 17.70 ?  209  THR A C   1 
ATOM   1496 O O   . THR A 1 209 ? 1.220   70.215 5.071   1.00 16.84 ?  209  THR A O   1 
ATOM   1497 C CB  . THR A 1 209 ? 2.222   73.432 5.153   1.00 17.13 ?  209  THR A CB  1 
ATOM   1498 O OG1 . THR A 1 209 ? 1.926   73.079 3.790   1.00 18.48 ?  209  THR A OG1 1 
ATOM   1499 C CG2 . THR A 1 209 ? 3.500   74.259 5.169   1.00 16.63 ?  209  THR A CG2 1 
ATOM   1500 N N   . SER A 1 210 ? 0.016   71.699 6.294   1.00 17.18 ?  210  SER A N   1 
ATOM   1501 C CA  . SER A 1 210 ? -1.152  70.860 6.247   1.00 18.62 ?  210  SER A CA  1 
ATOM   1502 C C   . SER A 1 210 ? -1.727  70.763 4.798   1.00 18.32 ?  210  SER A C   1 
ATOM   1503 O O   . SER A 1 210 ? -2.215  69.692 4.357   1.00 17.78 ?  210  SER A O   1 
ATOM   1504 C CB  . SER A 1 210 ? -2.149  71.436 7.271   1.00 20.77 ?  210  SER A CB  1 
ATOM   1505 O OG  . SER A 1 210 ? -3.393  70.793 7.166   1.00 28.55 ?  210  SER A OG  1 
ATOM   1506 N N   . GLU A 1 211 ? -1.646  71.872 4.058   1.00 16.55 ?  211  GLU A N   1 
ATOM   1507 C CA  . GLU A 1 211 ? -2.108  71.957 2.664   1.00 19.21 ?  211  GLU A CA  1 
ATOM   1508 C C   . GLU A 1 211 ? -1.303  71.029 1.721   1.00 18.10 ?  211  GLU A C   1 
ATOM   1509 O O   . GLU A 1 211 ? -1.864  70.299 0.909   1.00 18.28 ?  211  GLU A O   1 
ATOM   1510 C CB  . GLU A 1 211 ? -2.005  73.425 2.180   1.00 20.77 ?  211  GLU A CB  1 
ATOM   1511 C CG  . GLU A 1 211 ? -2.472  74.417 3.306   1.00 27.01 ?  211  GLU A CG  1 
ATOM   1512 C CD  . GLU A 1 211 ? -1.294  74.920 4.212   1.00 30.65 ?  211  GLU A CD  1 
ATOM   1513 O OE1 . GLU A 1 211 ? -0.402  75.662 3.699   1.00 31.83 ?  211  GLU A OE1 1 
ATOM   1514 O OE2 . GLU A 1 211 ? -1.291  74.638 5.422   1.00 25.78 ?  211  GLU A OE2 1 
ATOM   1515 N N   . ARG A 1 212 ? 0.006   71.015 1.883   1.00 15.91 ?  212  ARG A N   1 
ATOM   1516 C CA  . ARG A 1 212 ? 0.852   70.043 1.175   1.00 15.79 ?  212  ARG A CA  1 
ATOM   1517 C C   . ARG A 1 212 ? 0.537   68.555 1.439   1.00 15.24 ?  212  ARG A C   1 
ATOM   1518 O O   . ARG A 1 212 ? 0.476   67.770 0.503   1.00 13.99 ?  212  ARG A O   1 
ATOM   1519 C CB  . ARG A 1 212 ? 2.314   70.383 1.447   1.00 14.23 ?  212  ARG A CB  1 
ATOM   1520 C CG  . ARG A 1 212 ? 2.719   71.675 0.719   1.00 15.52 ?  212  ARG A CG  1 
ATOM   1521 C CD  . ARG A 1 212 ? 4.265   71.804 0.700   1.00 15.03 ?  212  ARG A CD  1 
ATOM   1522 N NE  . ARG A 1 212 ? 4.728   72.940 -0.102  1.00 15.84 ?  212  ARG A NE  1 
ATOM   1523 C CZ  . ARG A 1 212 ? 5.996   73.120 -0.444  1.00 17.04 ?  212  ARG A CZ  1 
ATOM   1524 N NH1 . ARG A 1 212 ? 6.918   72.245 -0.073  1.00 15.51 ?  212  ARG A NH1 1 
ATOM   1525 N NH2 . ARG A 1 212 ? 6.368   74.194 -1.120  1.00 24.88 ?  212  ARG A NH2 1 
ATOM   1526 N N   . LYS A 1 213 ? 0.315   68.186 2.706   1.00 15.70 ?  213  LYS A N   1 
ATOM   1527 C CA  . LYS A 1 213 ? -0.145  66.847 3.070   1.00 15.90 ?  213  LYS A CA  1 
ATOM   1528 C C   . LYS A 1 213 ? -1.422  66.378 2.335   1.00 16.24 ?  213  LYS A C   1 
ATOM   1529 O O   . LYS A 1 213 ? -1.467  65.271 1.790   1.00 17.62 ?  213  LYS A O   1 
ATOM   1530 C CB  . LYS A 1 213 ? -0.345  66.737 4.586   1.00 15.06 ?  213  LYS A CB  1 
ATOM   1531 C CG  . LYS A 1 213 ? 0.968   66.667 5.381   1.00 17.33 ?  213  LYS A CG  1 
ATOM   1532 C CD  . LYS A 1 213 ? 0.694   66.615 6.881   1.00 19.02 ?  213  LYS A CD  1 
ATOM   1533 C CE  . LYS A 1 213 ? 1.949   66.335 7.698   1.00 19.06 ?  213  LYS A CE  1 
ATOM   1534 N NZ  . LYS A 1 213 ? 1.729   66.324 9.231   1.00 17.99 ?  213  LYS A NZ  1 
ATOM   1535 N N   . LYS A 1 214 ? -2.466  67.192 2.369   1.00 16.56 ?  214  LYS A N   1 
ATOM   1536 C CA  . LYS A 1 214 ? -3.671  66.920 1.599   1.00 18.57 ?  214  LYS A CA  1 
ATOM   1537 C C   . LYS A 1 214 ? -3.376  66.701 0.121   1.00 16.95 ?  214  LYS A C   1 
ATOM   1538 O O   . LYS A 1 214 ? -3.829  65.733 -0.440  1.00 18.74 ?  214  LYS A O   1 
ATOM   1539 C CB  . LYS A 1 214 ? -4.622  68.122 1.731   1.00 18.94 ?  214  LYS A CB  1 
ATOM   1540 C CG  . LYS A 1 214 ? -5.029  68.366 3.228   1.00 25.58 ?  214  LYS A CG  1 
ATOM   1541 C CD  . LYS A 1 214 ? -6.518  68.574 3.346   1.00 34.43 ?  214  LYS A CD  1 
ATOM   1542 C CE  . LYS A 1 214 ? -6.837  69.817 4.140   1.00 39.55 ?  214  LYS A CE  1 
ATOM   1543 N NZ  . LYS A 1 214 ? -6.199  69.781 5.486   1.00 43.06 ?  214  LYS A NZ  1 
ATOM   1544 N N   . GLU A 1 215 ? -2.649  67.607 -0.504  1.00 16.29 ?  215  GLU A N   1 
ATOM   1545 C CA  . GLU A 1 215 ? -2.204  67.434 -1.916  1.00 17.83 ?  215  GLU A CA  1 
ATOM   1546 C C   . GLU A 1 215 ? -1.446  66.109 -2.195  1.00 16.55 ?  215  GLU A C   1 
ATOM   1547 O O   . GLU A 1 215 ? -1.710  65.407 -3.189  1.00 16.22 ?  215  GLU A O   1 
ATOM   1548 C CB  . GLU A 1 215 ? -1.324  68.602 -2.325  1.00 17.64 ?  215  GLU A CB  1 
ATOM   1549 C CG  . GLU A 1 215 ? -2.035  69.748 -2.963  1.00 24.90 ?  215  GLU A CG  1 
ATOM   1550 C CD  . GLU A 1 215 ? -1.043  70.694 -3.704  1.00 32.35 ?  215  GLU A CD  1 
ATOM   1551 O OE1 . GLU A 1 215 ? -0.374  71.499 -3.009  1.00 38.96 ?  215  GLU A OE1 1 
ATOM   1552 O OE2 . GLU A 1 215 ? -0.919  70.623 -4.960  1.00 32.91 ?  215  GLU A OE2 1 
ATOM   1553 N N   . ILE A 1 216 ? -0.518  65.786 -1.322  1.00 15.17 ?  216  ILE A N   1 
ATOM   1554 C CA  . ILE A 1 216 ? 0.280   64.530 -1.430  1.00 14.74 ?  216  ILE A CA  1 
ATOM   1555 C C   . ILE A 1 216 ? -0.621  63.308 -1.223  1.00 14.23 ?  216  ILE A C   1 
ATOM   1556 O O   . ILE A 1 216 ? -0.534  62.319 -1.944  1.00 14.10 ?  216  ILE A O   1 
ATOM   1557 C CB  . ILE A 1 216 ? 1.417   64.585 -0.409  1.00 14.79 ?  216  ILE A CB  1 
ATOM   1558 C CG1 . ILE A 1 216 ? 2.426   65.689 -0.788  1.00 13.74 ?  216  ILE A CG1 1 
ATOM   1559 C CG2 . ILE A 1 216 ? 2.128   63.232 -0.284  1.00 15.17 ?  216  ILE A CG2 1 
ATOM   1560 C CD1 . ILE A 1 216 ? 3.496   65.980 0.354   1.00 11.37 ?  216  ILE A CD1 1 
ATOM   1561 N N   . TYR A 1 217 ? -1.552  63.400 -0.272  1.00 14.48 ?  217  TYR A N   1 
ATOM   1562 C CA  . TYR A 1 217 ? -2.492  62.316 -0.056  1.00 13.40 ?  217  TYR A CA  1 
ATOM   1563 C C   . TYR A 1 217 ? -3.363  62.033 -1.300  1.00 14.19 ?  217  TYR A C   1 
ATOM   1564 O O   . TYR A 1 217 ? -3.562  60.862 -1.671  1.00 13.50 ?  217  TYR A O   1 
ATOM   1565 C CB  . TYR A 1 217 ? -3.398  62.591 1.185   1.00 14.22 ?  217  TYR A CB  1 
ATOM   1566 C CG  . TYR A 1 217 ? -4.151  61.320 1.566   1.00 12.73 ?  217  TYR A CG  1 
ATOM   1567 C CD1 . TYR A 1 217 ? -3.536  60.364 2.394   1.00 15.63 ?  217  TYR A CD1 1 
ATOM   1568 C CD2 . TYR A 1 217 ? -5.427  61.026 1.030   1.00 10.69 ?  217  TYR A CD2 1 
ATOM   1569 C CE1 . TYR A 1 217 ? -4.191  59.160 2.747   1.00 12.90 ?  217  TYR A CE1 1 
ATOM   1570 C CE2 . TYR A 1 217 ? -6.104  59.786 1.358   1.00 12.69 ?  217  TYR A CE2 1 
ATOM   1571 C CZ  . TYR A 1 217 ? -5.475  58.879 2.243   1.00 14.15 ?  217  TYR A CZ  1 
ATOM   1572 O OH  . TYR A 1 217 ? -6.039  57.650 2.588   1.00 11.83 ?  217  TYR A OH  1 
ATOM   1573 N N   . GLU A 1 218 ? -3.860  63.085 -1.943  1.00 15.95 ?  218  GLU A N   1 
ATOM   1574 C CA  . GLU A 1 218 ? -4.669  62.949 -3.202  1.00 18.77 ?  218  GLU A CA  1 
ATOM   1575 C C   . GLU A 1 218 ? -3.858  62.277 -4.315  1.00 16.03 ?  218  GLU A C   1 
ATOM   1576 O O   . GLU A 1 218 ? -4.377  61.437 -5.038  1.00 15.91 ?  218  GLU A O   1 
ATOM   1577 C CB  . GLU A 1 218 ? -5.155  64.303 -3.755  1.00 18.71 ?  218  GLU A CB  1 
ATOM   1578 C CG  . GLU A 1 218 ? -5.758  65.297 -2.838  1.00 24.46 ?  218  GLU A CG  1 
ATOM   1579 C CD  . GLU A 1 218 ? -6.243  66.596 -3.582  1.00 28.72 ?  218  GLU A CD  1 
ATOM   1580 O OE1 . GLU A 1 218 ? -7.497  66.807 -3.575  1.00 40.65 ?  218  GLU A OE1 1 
ATOM   1581 O OE2 . GLU A 1 218 ? -5.411  67.416 -4.156  1.00 35.94 ?  218  GLU A OE2 1 
ATOM   1582 N N   . LEU A 1 219 ? -2.580  62.645 -4.443  1.00 14.76 ?  219  LEU A N   1 
ATOM   1583 C CA  . LEU A 1 219 ? -1.646  61.968 -5.368  1.00 14.95 ?  219  LEU A CA  1 
ATOM   1584 C C   . LEU A 1 219 ? -1.436  60.494 -5.084  1.00 15.69 ?  219  LEU A C   1 
ATOM   1585 O O   . LEU A 1 219 ? -1.418  59.673 -6.008  1.00 15.69 ?  219  LEU A O   1 
ATOM   1586 C CB  . LEU A 1 219 ? -0.256  62.695 -5.416  1.00 15.02 ?  219  LEU A CB  1 
ATOM   1587 C CG  . LEU A 1 219 ? -0.311  64.062 -6.126  1.00 15.30 ?  219  LEU A CG  1 
ATOM   1588 C CD1 . LEU A 1 219 ? 0.909   64.890 -5.778  1.00 13.30 ?  219  LEU A CD1 1 
ATOM   1589 C CD2 . LEU A 1 219 ? -0.466  63.912 -7.679  1.00 16.86 ?  219  LEU A CD2 1 
ATOM   1590 N N   . ALA A 1 220 ? -1.296  60.144 -3.798  1.00 15.51 ?  220  ALA A N   1 
ATOM   1591 C CA  . ALA A 1 220 ? -1.078  58.770 -3.375  1.00 14.73 ?  220  ALA A CA  1 
ATOM   1592 C C   . ALA A 1 220 ? -2.313  57.936 -3.685  1.00 15.12 ?  220  ALA A C   1 
ATOM   1593 O O   . ALA A 1 220 ? -2.236  56.755 -4.077  1.00 15.69 ?  220  ALA A O   1 
ATOM   1594 C CB  . ALA A 1 220 ? -0.767  58.751 -1.873  1.00 14.18 ?  220  ALA A CB  1 
ATOM   1595 N N   . ARG A 1 221 ? -3.461  58.556 -3.550  1.00 15.65 ?  221  ARG A N   1 
ATOM   1596 C CA  . ARG A 1 221 ? -4.712  57.928 -3.950  1.00 17.34 ?  221  ARG A CA  1 
ATOM   1597 C C   . ARG A 1 221 ? -4.840  57.784 -5.487  1.00 17.80 ?  221  ARG A C   1 
ATOM   1598 O O   . ARG A 1 221 ? -5.206  56.717 -5.972  1.00 19.50 ?  221  ARG A O   1 
ATOM   1599 C CB  . ARG A 1 221 ? -5.882  58.730 -3.385  1.00 15.92 ?  221  ARG A CB  1 
ATOM   1600 C CG  . ARG A 1 221 ? -7.288  58.371 -3.951  1.00 21.04 ?  221  ARG A CG  1 
ATOM   1601 C CD  . ARG A 1 221 ? -8.330  59.414 -3.428  1.00 27.71 ?  221  ARG A CD  1 
ATOM   1602 N NE  . ARG A 1 221 ? -8.587  59.186 -2.013  1.00 32.73 ?  221  ARG A NE  1 
ATOM   1603 C CZ  . ARG A 1 221 ? -9.803  59.120 -1.463  1.00 38.04 ?  221  ARG A CZ  1 
ATOM   1604 N NH1 . ARG A 1 221 ? -10.900 59.330 -2.203  1.00 37.41 ?  221  ARG A NH1 1 
ATOM   1605 N NH2 . ARG A 1 221 ? -9.924  58.860 -0.160  1.00 39.70 ?  221  ARG A NH2 1 
ATOM   1606 N N   . LYS A 1 222 ? -4.569  58.856 -6.223  1.00 18.36 ?  222  LYS A N   1 
ATOM   1607 C CA  . LYS A 1 222 ? -4.630  58.862 -7.718  1.00 19.25 ?  222  LYS A CA  1 
ATOM   1608 C C   . LYS A 1 222 ? -3.755  57.783 -8.351  1.00 19.33 ?  222  LYS A C   1 
ATOM   1609 O O   . LYS A 1 222 ? -4.217  57.033 -9.231  1.00 19.41 ?  222  LYS A O   1 
ATOM   1610 C CB  . LYS A 1 222 ? -4.247  60.241 -8.273  1.00 18.55 ?  222  LYS A CB  1 
ATOM   1611 C CG  . LYS A 1 222 ? -4.365  60.342 -9.790  1.00 22.95 ?  222  LYS A CG  1 
ATOM   1612 C CD  . LYS A 1 222 ? -4.011  61.719 -10.328 1.00 28.01 ?  222  LYS A CD  1 
ATOM   1613 C CE  . LYS A 1 222 ? -4.037  61.706 -11.911 1.00 30.33 ?  222  LYS A CE  1 
ATOM   1614 N NZ  . LYS A 1 222 ? -3.668  63.053 -12.483 1.00 30.64 ?  222  LYS A NZ  1 
ATOM   1615 N N   . TYR A 1 223 ? -2.493  57.707 -7.889  1.00 18.97 ?  223  TYR A N   1 
ATOM   1616 C CA  . TYR A 1 223 ? -1.513  56.684 -8.331  1.00 18.46 ?  223  TYR A CA  1 
ATOM   1617 C C   . TYR A 1 223 ? -1.451  55.425 -7.452  1.00 18.44 ?  223  TYR A C   1 
ATOM   1618 O O   . TYR A 1 223 ? -0.678  54.485 -7.719  1.00 18.03 ?  223  TYR A O   1 
ATOM   1619 C CB  . TYR A 1 223 ? -0.133  57.331 -8.467  1.00 18.26 ?  223  TYR A CB  1 
ATOM   1620 C CG  . TYR A 1 223 ? -0.100  58.317 -9.570  1.00 18.30 ?  223  TYR A CG  1 
ATOM   1621 C CD1 . TYR A 1 223 ? 0.287   57.937 -10.865 1.00 20.93 ?  223  TYR A CD1 1 
ATOM   1622 C CD2 . TYR A 1 223 ? -0.538  59.623 -9.355  1.00 19.80 ?  223  TYR A CD2 1 
ATOM   1623 C CE1 . TYR A 1 223 ? 0.242   58.868 -11.940 1.00 19.56 ?  223  TYR A CE1 1 
ATOM   1624 C CE2 . TYR A 1 223 ? -0.572  60.551 -10.381 1.00 22.48 ?  223  TYR A CE2 1 
ATOM   1625 C CZ  . TYR A 1 223 ? -0.190  60.161 -11.686 1.00 21.52 ?  223  TYR A CZ  1 
ATOM   1626 O OH  . TYR A 1 223 ? -0.200  61.125 -12.670 1.00 19.94 ?  223  TYR A OH  1 
ATOM   1627 N N   . ASP A 1 224 ? -2.261  55.430 -6.398  1.00 18.11 ?  224  ASP A N   1 
ATOM   1628 C CA  . ASP A 1 224 ? -2.503  54.269 -5.563  1.00 17.52 ?  224  ASP A CA  1 
ATOM   1629 C C   . ASP A 1 224 ? -1.196  53.684 -4.971  1.00 16.62 ?  224  ASP A C   1 
ATOM   1630 O O   . ASP A 1 224 ? -0.867  52.509 -5.206  1.00 17.09 ?  224  ASP A O   1 
ATOM   1631 C CB  . ASP A 1 224 ? -3.303  53.240 -6.348  1.00 19.34 ?  224  ASP A CB  1 
ATOM   1632 C CG  . ASP A 1 224 ? -4.022  52.237 -5.454  1.00 21.64 ?  224  ASP A CG  1 
ATOM   1633 O OD1 . ASP A 1 224 ? -4.012  52.357 -4.212  1.00 24.75 ?  224  ASP A OD1 1 
ATOM   1634 O OD2 . ASP A 1 224 ? -4.621  51.297 -6.018  1.00 28.81 ?  224  ASP A OD2 1 
ATOM   1635 N N   . PHE A 1 225 ? -0.464  54.492 -4.190  1.00 13.33 ?  225  PHE A N   1 
ATOM   1636 C CA  . PHE A 1 225 ? 0.699   53.951 -3.492  1.00 12.99 ?  225  PHE A CA  1 
ATOM   1637 C C   . PHE A 1 225 ? 0.543   54.161 -1.942  1.00 11.94 ?  225  PHE A C   1 
ATOM   1638 O O   . PHE A 1 225 ? -0.366  54.897 -1.508  1.00 12.10 ?  225  PHE A O   1 
ATOM   1639 C CB  . PHE A 1 225 ? 2.024   54.513 -4.062  1.00 10.99 ?  225  PHE A CB  1 
ATOM   1640 C CG  . PHE A 1 225 ? 2.111   56.020 -4.073  1.00 11.08 ?  225  PHE A CG  1 
ATOM   1641 C CD1 . PHE A 1 225 ? 2.390   56.725 -2.893  1.00 12.30 ?  225  PHE A CD1 1 
ATOM   1642 C CD2 . PHE A 1 225 ? 1.922   56.745 -5.281  1.00 13.03 ?  225  PHE A CD2 1 
ATOM   1643 C CE1 . PHE A 1 225 ? 2.462   58.093 -2.859  1.00 9.23  ?  225  PHE A CE1 1 
ATOM   1644 C CE2 . PHE A 1 225 ? 1.986   58.178 -5.288  1.00 13.59 ?  225  PHE A CE2 1 
ATOM   1645 C CZ  . PHE A 1 225 ? 2.283   58.858 -4.104  1.00 13.92 ?  225  PHE A CZ  1 
ATOM   1646 N N   . LEU A 1 226 ? 1.361   53.477 -1.148  1.00 11.68 ?  226  LEU A N   1 
ATOM   1647 C CA  . LEU A 1 226 ? 1.335   53.639 0.326   1.00 12.65 ?  226  LEU A CA  1 
ATOM   1648 C C   . LEU A 1 226 ? 2.117   54.872 0.723   1.00 13.42 ?  226  LEU A C   1 
ATOM   1649 O O   . LEU A 1 226 ? 2.978   55.375 -0.045  1.00 13.62 ?  226  LEU A O   1 
ATOM   1650 C CB  . LEU A 1 226 ? 1.941   52.439 1.004   1.00 12.24 ?  226  LEU A CB  1 
ATOM   1651 C CG  . LEU A 1 226 ? 1.293   51.126 0.595   1.00 15.78 ?  226  LEU A CG  1 
ATOM   1652 C CD1 . LEU A 1 226 ? 2.004   49.937 1.270   1.00 13.64 ?  226  LEU A CD1 1 
ATOM   1653 C CD2 . LEU A 1 226 ? -0.222  51.145 0.933   1.00 15.60 ?  226  LEU A CD2 1 
ATOM   1654 N N   . ILE A 1 227 ? 1.782   55.410 1.888   1.00 13.64 ?  227  ILE A N   1 
ATOM   1655 C CA  . ILE A 1 227 ? 2.570   56.491 2.469   1.00 12.45 ?  227  ILE A CA  1 
ATOM   1656 C C   . ILE A 1 227 ? 3.153   55.927 3.746   1.00 13.68 ?  227  ILE A C   1 
ATOM   1657 O O   . ILE A 1 227 ? 2.425   55.406 4.623   1.00 11.41 ?  227  ILE A O   1 
ATOM   1658 C CB  . ILE A 1 227 ? 1.705   57.750 2.753   1.00 12.56 ?  227  ILE A CB  1 
ATOM   1659 C CG1 . ILE A 1 227 ? 1.252   58.401 1.425   1.00 13.36 ?  227  ILE A CG1 1 
ATOM   1660 C CG2 . ILE A 1 227 ? 2.506   58.733 3.613   1.00 10.44 ?  227  ILE A CG2 1 
ATOM   1661 C CD1 . ILE A 1 227 ? 0.161   59.493 1.598   1.00 15.41 ?  227  ILE A CD1 1 
ATOM   1662 N N   . ILE A 1 228 ? 4.472   55.961 3.822   1.00 13.70 ?  228  ILE A N   1 
ATOM   1663 C CA  . ILE A 1 228 ? 5.091   55.633 5.062   1.00 15.66 ?  228  ILE A CA  1 
ATOM   1664 C C   . ILE A 1 228 ? 5.578   56.870 5.791   1.00 14.91 ?  228  ILE A C   1 
ATOM   1665 O O   . ILE A 1 228 ? 6.450   57.614 5.319   1.00 15.45 ?  228  ILE A O   1 
ATOM   1666 C CB  . ILE A 1 228 ? 6.118   54.467 4.989   1.00 16.72 ?  228  ILE A CB  1 
ATOM   1667 C CG1 . ILE A 1 228 ? 7.377   54.795 5.719   1.00 19.16 ?  228  ILE A CG1 1 
ATOM   1668 C CG2 . ILE A 1 228 ? 6.215   53.741 3.662   1.00 18.67 ?  228  ILE A CG2 1 
ATOM   1669 C CD1 . ILE A 1 228 ? 7.514   53.890 6.759   1.00 23.43 ?  228  ILE A CD1 1 
ATOM   1670 N N   . GLU A 1 229 ? 4.891   57.133 6.892   1.00 15.00 ?  229  GLU A N   1 
ATOM   1671 C CA  . GLU A 1 229 ? 4.989   58.384 7.639   1.00 14.22 ?  229  GLU A CA  1 
ATOM   1672 C C   . GLU A 1 229 ? 5.923   58.074 8.807   1.00 13.61 ?  229  GLU A C   1 
ATOM   1673 O O   . GLU A 1 229 ? 5.491   57.507 9.794   1.00 13.99 ?  229  GLU A O   1 
ATOM   1674 C CB  . GLU A 1 229 ? 3.579   58.815 8.150   1.00 12.95 ?  229  GLU A CB  1 
ATOM   1675 C CG  . GLU A 1 229 ? 3.573   60.133 8.819   1.00 15.47 ?  229  GLU A CG  1 
ATOM   1676 C CD  . GLU A 1 229 ? 2.174   60.669 9.186   1.00 15.95 ?  229  GLU A CD  1 
ATOM   1677 O OE1 . GLU A 1 229 ? 1.967   61.891 8.997   1.00 17.12 ?  229  GLU A OE1 1 
ATOM   1678 O OE2 . GLU A 1 229 ? 1.283   59.880 9.619   1.00 12.66 ?  229  GLU A OE2 1 
ATOM   1679 N N   . ASP A 1 230 ? 7.190   58.476 8.696   1.00 12.68 ?  230  ASP A N   1 
ATOM   1680 C CA  . ASP A 1 230 ? 8.177   58.165 9.735   1.00 14.23 ?  230  ASP A CA  1 
ATOM   1681 C C   . ASP A 1 230 ? 8.229   59.429 10.563  1.00 14.96 ?  230  ASP A C   1 
ATOM   1682 O O   . ASP A 1 230 ? 8.774   60.414 10.100  1.00 15.96 ?  230  ASP A O   1 
ATOM   1683 C CB  . ASP A 1 230 ? 9.529   57.845 9.047   1.00 14.60 ?  230  ASP A CB  1 
ATOM   1684 C CG  . ASP A 1 230 ? 10.703  57.641 10.023  1.00 16.79 ?  230  ASP A CG  1 
ATOM   1685 O OD1 . ASP A 1 230 ? 10.430  57.339 11.195  1.00 17.37 ?  230  ASP A OD1 1 
ATOM   1686 O OD2 . ASP A 1 230 ? 11.911  57.712 9.563   1.00 15.32 ?  230  ASP A OD2 1 
ATOM   1687 N N   . ASP A 1 231 ? 7.683   59.426 11.784  1.00 15.31 ?  231  ASP A N   1 
ATOM   1688 C CA  . ASP A 1 231 ? 7.391   60.735 12.473  1.00 16.14 ?  231  ASP A CA  1 
ATOM   1689 C C   . ASP A 1 231 ? 7.981   60.764 13.903  1.00 15.80 ?  231  ASP A C   1 
ATOM   1690 O O   . ASP A 1 231 ? 7.250   61.004 14.884  1.00 16.83 ?  231  ASP A O   1 
ATOM   1691 C CB  . ASP A 1 231 ? 5.855   60.975 12.463  1.00 15.91 ?  231  ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 231 ? 5.424   62.509 12.435  1.00 18.95 ?  231  ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 231 ? 6.284   63.422 12.513  1.00 17.03 ?  231  ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 231 ? 4.171   62.771 12.372  1.00 18.08 ?  231  ASP A OD2 1 
ATOM   1695 N N   . PRO A 1 232 ? 9.299   60.465 14.050  1.00 16.36 ?  232  PRO A N   1 
ATOM   1696 C CA  . PRO A 1 232 ? 9.895   60.349 15.424  1.00 14.92 ?  232  PRO A CA  1 
ATOM   1697 C C   . PRO A 1 232 ? 9.994   61.699 16.145  1.00 15.70 ?  232  PRO A C   1 
ATOM   1698 O O   . PRO A 1 232 ? 10.173  61.721 17.374  1.00 14.99 ?  232  PRO A O   1 
ATOM   1699 C CB  . PRO A 1 232 ? 11.296  59.782 15.166  1.00 15.52 ?  232  PRO A CB  1 
ATOM   1700 C CG  . PRO A 1 232 ? 11.646  60.112 13.726  1.00 12.75 ?  232  PRO A CG  1 
ATOM   1701 C CD  . PRO A 1 232 ? 10.310  60.239 12.981  1.00 15.70 ?  232  PRO A CD  1 
ATOM   1702 N N   . TYR A 1 233 ? 9.897   62.816 15.408  1.00 15.99 ?  233  TYR A N   1 
ATOM   1703 C CA  . TYR A 1 233 ? 9.932   64.155 16.044  1.00 16.64 ?  233  TYR A CA  1 
ATOM   1704 C C   . TYR A 1 233 ? 8.527   64.808 16.182  1.00 17.14 ?  233  TYR A C   1 
ATOM   1705 O O   . TYR A 1 233 ? 8.390   66.012 16.502  1.00 18.03 ?  233  TYR A O   1 
ATOM   1706 C CB  . TYR A 1 233 ? 10.926  65.095 15.328  1.00 17.81 ?  233  TYR A CB  1 
ATOM   1707 C CG  . TYR A 1 233 ? 12.288  64.426 15.073  1.00 18.00 ?  233  TYR A CG  1 
ATOM   1708 C CD1 . TYR A 1 233 ? 12.624  63.997 13.802  1.00 17.49 ?  233  TYR A CD1 1 
ATOM   1709 C CD2 . TYR A 1 233 ? 13.210  64.237 16.098  1.00 18.36 ?  233  TYR A CD2 1 
ATOM   1710 C CE1 . TYR A 1 233 ? 13.839  63.356 13.540  1.00 19.43 ?  233  TYR A CE1 1 
ATOM   1711 C CE2 . TYR A 1 233 ? 14.445  63.596 15.856  1.00 20.77 ?  233  TYR A CE2 1 
ATOM   1712 C CZ  . TYR A 1 233 ? 14.735  63.169 14.538  1.00 20.83 ?  233  TYR A CZ  1 
ATOM   1713 O OH  . TYR A 1 233 ? 15.893  62.516 14.213  1.00 22.92 ?  233  TYR A OH  1 
ATOM   1714 N N   . TYR A 1 234 ? 7.485   64.030 15.911  1.00 16.75 ?  234  TYR A N   1 
ATOM   1715 C CA  . TYR A 1 234 ? 6.102   64.509 16.041  1.00 15.98 ?  234  TYR A CA  1 
ATOM   1716 C C   . TYR A 1 234 ? 5.823   65.310 17.325  1.00 16.95 ?  234  TYR A C   1 
ATOM   1717 O O   . TYR A 1 234 ? 5.149   66.343 17.269  1.00 15.99 ?  234  TYR A O   1 
ATOM   1718 C CB  . TYR A 1 234 ? 5.151   63.324 16.003  1.00 15.35 ?  234  TYR A CB  1 
ATOM   1719 C CG  . TYR A 1 234 ? 3.721   63.729 16.143  1.00 14.66 ?  234  TYR A CG  1 
ATOM   1720 C CD1 . TYR A 1 234 ? 3.060   64.475 15.116  1.00 12.86 ?  234  TYR A CD1 1 
ATOM   1721 C CD2 . TYR A 1 234 ? 3.025   63.433 17.304  1.00 15.79 ?  234  TYR A CD2 1 
ATOM   1722 C CE1 . TYR A 1 234 ? 1.716   64.858 15.241  1.00 14.66 ?  234  TYR A CE1 1 
ATOM   1723 C CE2 . TYR A 1 234 ? 1.666   63.858 17.463  1.00 16.13 ?  234  TYR A CE2 1 
ATOM   1724 C CZ  . TYR A 1 234 ? 1.035   64.567 16.435  1.00 17.61 ?  234  TYR A CZ  1 
ATOM   1725 O OH  . TYR A 1 234 ? -0.280  64.979 16.630  1.00 19.64 ?  234  TYR A OH  1 
ATOM   1726 N N   . PHE A 1 235 ? 6.259   64.782 18.471  1.00 17.77 ?  235  PHE A N   1 
ATOM   1727 C CA  . PHE A 1 235 ? 6.100   65.461 19.778  1.00 21.31 ?  235  PHE A CA  1 
ATOM   1728 C C   . PHE A 1 235 ? 7.152   66.536 20.064  1.00 22.90 ?  235  PHE A C   1 
ATOM   1729 O O   . PHE A 1 235 ? 7.130   67.138 21.115  1.00 25.19 ?  235  PHE A O   1 
ATOM   1730 C CB  . PHE A 1 235 ? 6.061   64.434 20.945  1.00 20.89 ?  235  PHE A CB  1 
ATOM   1731 C CG  . PHE A 1 235 ? 4.861   63.523 20.897  1.00 20.73 ?  235  PHE A CG  1 
ATOM   1732 C CD1 . PHE A 1 235 ? 3.586   64.033 21.147  1.00 23.81 ?  235  PHE A CD1 1 
ATOM   1733 C CD2 . PHE A 1 235 ? 5.009   62.183 20.605  1.00 22.36 ?  235  PHE A CD2 1 
ATOM   1734 C CE1 . PHE A 1 235 ? 2.459   63.215 21.090  1.00 24.80 ?  235  PHE A CE1 1 
ATOM   1735 C CE2 . PHE A 1 235 ? 3.887   61.342 20.551  1.00 26.30 ?  235  PHE A CE2 1 
ATOM   1736 C CZ  . PHE A 1 235 ? 2.611   61.878 20.784  1.00 22.76 ?  235  PHE A CZ  1 
ATOM   1737 N N   . LEU A 1 236 ? 8.052   66.821 19.130  1.00 23.98 ?  236  LEU A N   1 
ATOM   1738 C CA  . LEU A 1 236 ? 9.039   67.875 19.345  1.00 23.83 ?  236  LEU A CA  1 
ATOM   1739 C C   . LEU A 1 236 ? 8.874   69.079 18.428  1.00 23.85 ?  236  LEU A C   1 
ATOM   1740 O O   . LEU A 1 236 ? 9.843   69.517 17.839  1.00 23.01 ?  236  LEU A O   1 
ATOM   1741 C CB  . LEU A 1 236 ? 10.425  67.320 19.074  1.00 25.79 ?  236  LEU A CB  1 
ATOM   1742 C CG  . LEU A 1 236 ? 11.233  66.554 20.106  1.00 28.93 ?  236  LEU A CG  1 
ATOM   1743 C CD1 . LEU A 1 236 ? 10.672  65.170 20.247  1.00 30.83 ?  236  LEU A CD1 1 
ATOM   1744 C CD2 . LEU A 1 236 ? 12.642  66.470 19.518  1.00 28.85 ?  236  LEU A CD2 1 
ATOM   1745 N N   . GLN A 1 237 ? 7.654   69.604 18.302  1.00 24.73 ?  237  GLN A N   1 
ATOM   1746 C CA  . GLN A 1 237 ? 7.354   70.698 17.389  1.00 24.72 ?  237  GLN A CA  1 
ATOM   1747 C C   . GLN A 1 237 ? 7.398   72.022 18.163  1.00 25.00 ?  237  GLN A C   1 
ATOM   1748 O O   . GLN A 1 237 ? 6.700   72.188 19.158  1.00 24.26 ?  237  GLN A O   1 
ATOM   1749 C CB  . GLN A 1 237 ? 5.982   70.455 16.708  1.00 25.21 ?  237  GLN A CB  1 
ATOM   1750 C CG  . GLN A 1 237 ? 6.004   69.182 15.790  1.00 25.32 ?  237  GLN A CG  1 
ATOM   1751 C CD  . GLN A 1 237 ? 4.694   68.915 15.048  1.00 25.53 ?  237  GLN A CD  1 
ATOM   1752 O OE1 . GLN A 1 237 ? 4.174   67.811 15.093  1.00 23.23 ?  237  GLN A OE1 1 
ATOM   1753 N NE2 . GLN A 1 237 ? 4.180   69.921 14.347  1.00 24.30 ?  237  GLN A NE2 1 
ATOM   1754 N N   . PHE A 1 238 ? 8.222   72.958 17.704  1.00 25.37 ?  238  PHE A N   1 
ATOM   1755 C CA  . PHE A 1 238 ? 8.579   74.138 18.526  1.00 27.53 ?  238  PHE A CA  1 
ATOM   1756 C C   . PHE A 1 238 ? 7.489   75.176 18.717  1.00 29.58 ?  238  PHE A C   1 
ATOM   1757 O O   . PHE A 1 238 ? 7.521   75.905 19.697  1.00 30.19 ?  238  PHE A O   1 
ATOM   1758 C CB  . PHE A 1 238 ? 9.854   74.807 18.005  1.00 26.48 ?  238  PHE A CB  1 
ATOM   1759 C CG  . PHE A 1 238 ? 10.988  73.878 17.952  1.00 24.62 ?  238  PHE A CG  1 
ATOM   1760 C CD1 . PHE A 1 238 ? 11.751  73.749 16.810  1.00 23.13 ?  238  PHE A CD1 1 
ATOM   1761 C CD2 . PHE A 1 238 ? 11.259  73.065 19.053  1.00 25.57 ?  238  PHE A CD2 1 
ATOM   1762 C CE1 . PHE A 1 238 ? 12.813  72.871 16.771  1.00 24.22 ?  238  PHE A CE1 1 
ATOM   1763 C CE2 . PHE A 1 238 ? 12.286  72.143 19.009  1.00 26.19 ?  238  PHE A CE2 1 
ATOM   1764 C CZ  . PHE A 1 238 ? 13.067  72.051 17.853  1.00 25.40 ?  238  PHE A CZ  1 
ATOM   1765 N N   . ASN A 1 239 ? 6.543   75.258 17.784  1.00 31.85 ?  239  ASN A N   1 
ATOM   1766 C CA  . ASN A 1 239 ? 5.446   76.217 17.956  1.00 34.21 ?  239  ASN A CA  1 
ATOM   1767 C C   . ASN A 1 239 ? 4.214   75.587 18.649  1.00 34.28 ?  239  ASN A C   1 
ATOM   1768 O O   . ASN A 1 239 ? 3.155   76.209 18.784  1.00 35.35 ?  239  ASN A O   1 
ATOM   1769 C CB  . ASN A 1 239 ? 5.126   76.898 16.624  1.00 34.25 ?  239  ASN A CB  1 
ATOM   1770 C CG  . ASN A 1 239 ? 4.522   75.958 15.625  1.00 36.33 ?  239  ASN A CG  1 
ATOM   1771 O OD1 . ASN A 1 239 ? 3.872   74.981 16.001  1.00 40.33 ?  239  ASN A OD1 1 
ATOM   1772 N ND2 . ASN A 1 239 ? 4.714   76.247 14.333  1.00 35.31 ?  239  ASN A ND2 1 
ATOM   1773 N N   . LYS A 1 240 ? 4.378   74.342 19.084  1.00 34.29 ?  240  LYS A N   1 
ATOM   1774 C CA  . LYS A 1 240 ? 3.424   73.678 19.966  1.00 34.45 ?  240  LYS A CA  1 
ATOM   1775 C C   . LYS A 1 240 ? 1.997   73.592 19.400  1.00 34.25 ?  240  LYS A C   1 
ATOM   1776 O O   . LYS A 1 240 ? 1.046   73.309 20.119  1.00 35.61 ?  240  LYS A O   1 
ATOM   1777 C CB  . LYS A 1 240 ? 3.419   74.314 21.362  1.00 34.74 ?  240  LYS A CB  1 
ATOM   1778 C CG  . LYS A 1 240 ? 4.806   74.537 21.915  1.00 33.91 ?  240  LYS A CG  1 
ATOM   1779 C CD  . LYS A 1 240 ? 4.802   74.645 23.421  1.00 36.67 ?  240  LYS A CD  1 
ATOM   1780 C CE  . LYS A 1 240 ? 6.172   75.038 23.909  1.00 35.95 ?  240  LYS A CE  1 
ATOM   1781 N NZ  . LYS A 1 240 ? 6.147   75.345 25.365  1.00 41.30 ?  240  LYS A NZ  1 
ATOM   1782 N N   . PHE A 1 241 ? 1.849   73.817 18.107  1.00 32.37 ?  241  PHE A N   1 
ATOM   1783 C CA  . PHE A 1 241 ? 0.627   73.409 17.472  1.00 30.11 ?  241  PHE A CA  1 
ATOM   1784 C C   . PHE A 1 241 ? 0.995   72.343 16.451  1.00 27.99 ?  241  PHE A C   1 
ATOM   1785 O O   . PHE A 1 241 ? 1.796   72.604 15.562  1.00 28.13 ?  241  PHE A O   1 
ATOM   1786 C CB  . PHE A 1 241 ? -0.068  74.579 16.770  1.00 31.09 ?  241  PHE A CB  1 
ATOM   1787 C CG  . PHE A 1 241 ? -1.251  74.150 16.005  1.00 31.21 ?  241  PHE A CG  1 
ATOM   1788 C CD1 . PHE A 1 241 ? -2.339  73.597 16.674  1.00 31.52 ?  241  PHE A CD1 1 
ATOM   1789 C CD2 . PHE A 1 241 ? -1.261  74.221 14.626  1.00 32.31 ?  241  PHE A CD2 1 
ATOM   1790 C CE1 . PHE A 1 241 ? -3.439  73.147 15.982  1.00 32.93 ?  241  PHE A CE1 1 
ATOM   1791 C CE2 . PHE A 1 241 ? -2.369  73.769 13.919  1.00 34.04 ?  241  PHE A CE2 1 
ATOM   1792 C CZ  . PHE A 1 241 ? -3.467  73.245 14.602  1.00 33.01 ?  241  PHE A CZ  1 
ATOM   1793 N N   . ARG A 1 242 ? 0.420   71.156 16.577  1.00 25.22 ?  242  ARG A N   1 
ATOM   1794 C CA  . ARG A 1 242 ? 0.763   70.055 15.663  1.00 24.28 ?  242  ARG A CA  1 
ATOM   1795 C C   . ARG A 1 242 ? -0.303  69.943 14.581  1.00 23.95 ?  242  ARG A C   1 
ATOM   1796 O O   . ARG A 1 242 ? -1.489  69.775 14.863  1.00 24.17 ?  242  ARG A O   1 
ATOM   1797 C CB  . ARG A 1 242 ? 0.940   68.737 16.440  1.00 22.90 ?  242  ARG A CB  1 
ATOM   1798 C CG  . ARG A 1 242 ? 2.000   68.802 17.535  1.00 20.97 ?  242  ARG A CG  1 
ATOM   1799 C CD  . ARG A 1 242 ? 2.138   67.496 18.305  1.00 22.97 ?  242  ARG A CD  1 
ATOM   1800 N NE  . ARG A 1 242 ? 0.793   67.040 18.633  1.00 29.19 ?  242  ARG A NE  1 
ATOM   1801 C CZ  . ARG A 1 242 ? 0.284   66.961 19.858  1.00 34.08 ?  242  ARG A CZ  1 
ATOM   1802 N NH1 . ARG A 1 242 ? 1.054   67.205 20.912  1.00 34.42 ?  242  ARG A NH1 1 
ATOM   1803 N NH2 . ARG A 1 242 ? -0.993  66.589 20.023  1.00 35.97 ?  242  ARG A NH2 1 
ATOM   1804 N N   . VAL A 1 243 ? 0.100   70.043 13.321  1.00 23.85 ?  243  VAL A N   1 
ATOM   1805 C CA  . VAL A 1 243 ? -0.886  69.909 12.256  1.00 22.35 ?  243  VAL A CA  1 
ATOM   1806 C C   . VAL A 1 243 ? -1.232  68.454 12.031  1.00 21.11 ?  243  VAL A C   1 
ATOM   1807 O O   . VAL A 1 243 ? -0.450  67.550 12.402  1.00 20.08 ?  243  VAL A O   1 
ATOM   1808 C CB  . VAL A 1 243 ? -0.432  70.584 10.907  1.00 23.19 ?  243  VAL A CB  1 
ATOM   1809 C CG1 . VAL A 1 243 ? 0.268   71.927 11.178  1.00 25.66 ?  243  VAL A CG1 1 
ATOM   1810 C CG2 . VAL A 1 243 ? 0.470   69.636 10.082  1.00 22.05 ?  243  VAL A CG2 1 
ATOM   1811 N N   . PRO A 1 244 ? -2.386  68.225 11.390  1.00 20.61 ?  244  PRO A N   1 
ATOM   1812 C CA  . PRO A 1 244 ? -2.866  66.862 11.154  1.00 19.62 ?  244  PRO A CA  1 
ATOM   1813 C C   . PRO A 1 244 ? -1.844  65.977 10.485  1.00 17.86 ?  244  PRO A C   1 
ATOM   1814 O O   . PRO A 1 244 ? -1.065  66.422 9.660   1.00 18.23 ?  244  PRO A O   1 
ATOM   1815 C CB  . PRO A 1 244 ? -4.074  67.059 10.244  1.00 20.40 ?  244  PRO A CB  1 
ATOM   1816 C CG  . PRO A 1 244 ? -4.612  68.462 10.647  1.00 22.93 ?  244  PRO A CG  1 
ATOM   1817 C CD  . PRO A 1 244 ? -3.331  69.257 10.871  1.00 20.25 ?  244  PRO A CD  1 
ATOM   1818 N N   . THR A 1 245 ? -1.836  64.719 10.867  1.00 16.87 ?  245  THR A N   1 
ATOM   1819 C CA  . THR A 1 245 ? -0.874  63.786 10.302  1.00 14.93 ?  245  THR A CA  1 
ATOM   1820 C C   . THR A 1 245 ? -1.504  63.129 9.043   1.00 14.45 ?  245  THR A C   1 
ATOM   1821 O O   . THR A 1 245 ? -2.723  63.238 8.826   1.00 12.67 ?  245  THR A O   1 
ATOM   1822 C CB  . THR A 1 245 ? -0.536  62.713 11.340  1.00 14.39 ?  245  THR A CB  1 
ATOM   1823 O OG1 . THR A 1 245 ? -1.752  62.101 11.747  1.00 14.26 ?  245  THR A OG1 1 
ATOM   1824 C CG2 . THR A 1 245 ? 0.121   63.296 12.565  1.00 13.57 ?  245  THR A CG2 1 
ATOM   1825 N N   . PHE A 1 246 ? -0.689  62.461 8.212   1.00 12.72 ?  246  PHE A N   1 
ATOM   1826 C CA  . PHE A 1 246 ? -1.231  61.606 7.143   1.00 11.58 ?  246  PHE A CA  1 
ATOM   1827 C C   . PHE A 1 246 ? -2.140  60.511 7.699   1.00 11.99 ?  246  PHE A C   1 
ATOM   1828 O O   . PHE A 1 246 ? -3.183  60.219 7.132   1.00 10.58 ?  246  PHE A O   1 
ATOM   1829 C CB  . PHE A 1 246 ? -0.087  60.907 6.361   1.00 11.02 ?  246  PHE A CB  1 
ATOM   1830 C CG  . PHE A 1 246 ? 0.647   61.807 5.433   1.00 12.72 ?  246  PHE A CG  1 
ATOM   1831 C CD1 . PHE A 1 246 ? 1.981   62.122 5.651   1.00 13.36 ?  246  PHE A CD1 1 
ATOM   1832 C CD2 . PHE A 1 246 ? -0.010  62.343 4.305   1.00 12.53 ?  246  PHE A CD2 1 
ATOM   1833 C CE1 . PHE A 1 246 ? 2.706   62.927 4.735   1.00 12.99 ?  246  PHE A CE1 1 
ATOM   1834 C CE2 . PHE A 1 246 ? 0.669   63.157 3.394   1.00 14.50 ?  246  PHE A CE2 1 
ATOM   1835 C CZ  . PHE A 1 246 ? 2.036   63.438 3.575   1.00 12.58 ?  246  PHE A CZ  1 
ATOM   1836 N N   . LEU A 1 247 ? -1.798  59.934 8.849   1.00 11.35 ?  247  LEU A N   1 
ATOM   1837 C CA  . LEU A 1 247 ? -2.665  58.891 9.423   1.00 12.58 ?  247  LEU A CA  1 
ATOM   1838 C C   . LEU A 1 247 ? -4.082  59.435 9.715   1.00 13.88 ?  247  LEU A C   1 
ATOM   1839 O O   . LEU A 1 247 ? -5.100  58.724 9.498   1.00 14.37 ?  247  LEU A O   1 
ATOM   1840 C CB  . LEU A 1 247 ? -2.029  58.244 10.685  1.00 12.03 ?  247  LEU A CB  1 
ATOM   1841 C CG  . LEU A 1 247 ? -2.908  57.173 11.403  1.00 15.43 ?  247  LEU A CG  1 
ATOM   1842 C CD1 . LEU A 1 247 ? -3.018  55.854 10.575  1.00 15.36 ?  247  LEU A CD1 1 
ATOM   1843 C CD2 . LEU A 1 247 ? -2.458  56.887 12.865  1.00 13.64 ?  247  LEU A CD2 1 
ATOM   1844 N N   . SER A 1 248 ? -4.150  60.672 10.209  1.00 14.64 ?  248  SER A N   1 
ATOM   1845 C CA  . SER A 1 248 ? -5.455  61.343 10.515  1.00 16.12 ?  248  SER A CA  1 
ATOM   1846 C C   . SER A 1 248 ? -6.389  61.519 9.309   1.00 16.92 ?  248  SER A C   1 
ATOM   1847 O O   . SER A 1 248 ? -7.616  61.593 9.455   1.00 17.99 ?  248  SER A O   1 
ATOM   1848 C CB  . SER A 1 248 ? -5.219  62.695 11.182  1.00 13.71 ?  248  SER A CB  1 
ATOM   1849 O OG  . SER A 1 248 ? -4.844  63.640 10.194  1.00 15.70 ?  248  SER A OG  1 
ATOM   1850 N N   . MET A 1 249 ? -5.826  61.600 8.113   1.00 17.30 ?  249  MET A N   1 
ATOM   1851 C CA  . MET A 1 249 ? -6.658  61.761 6.918   1.00 18.96 ?  249  MET A CA  1 
ATOM   1852 C C   . MET A 1 249 ? -6.776  60.473 6.061   1.00 18.46 ?  249  MET A C   1 
ATOM   1853 O O   . MET A 1 249 ? -7.243  60.522 4.903   1.00 19.36 ?  249  MET A O   1 
ATOM   1854 C CB  . MET A 1 249 ? -6.129  62.934 6.083   1.00 19.23 ?  249  MET A CB  1 
ATOM   1855 C CG  . MET A 1 249 ? -4.697  62.726 5.591   1.00 20.04 ?  249  MET A CG  1 
ATOM   1856 S SD  . MET A 1 249 ? -3.948  64.184 4.754   1.00 22.01 ?  249  MET A SD  1 
ATOM   1857 C CE  . MET A 1 249 ? -3.588  65.377 6.065   1.00 20.60 ?  249  MET A CE  1 
ATOM   1858 N N   . ASP A 1 250 ? -6.387  59.344 6.642   1.00 16.09 ?  250  ASP A N   1 
ATOM   1859 C CA  . ASP A 1 250 ? -6.219  58.136 5.874   1.00 16.76 ?  250  ASP A CA  1 
ATOM   1860 C C   . ASP A 1 250 ? -7.520  57.369 5.631   1.00 16.20 ?  250  ASP A C   1 
ATOM   1861 O O   . ASP A 1 250 ? -7.669  56.255 6.052   1.00 14.66 ?  250  ASP A O   1 
ATOM   1862 C CB  . ASP A 1 250 ? -5.183  57.191 6.517   1.00 16.67 ?  250  ASP A CB  1 
ATOM   1863 C CG  . ASP A 1 250 ? -4.825  56.005 5.609   1.00 16.95 ?  250  ASP A CG  1 
ATOM   1864 O OD1 . ASP A 1 250 ? -5.025  56.061 4.357   1.00 15.48 ?  250  ASP A OD1 1 
ATOM   1865 O OD2 . ASP A 1 250 ? -4.387  54.989 6.166   1.00 19.36 ?  250  ASP A OD2 1 
ATOM   1866 N N   . VAL A 1 251 ? -8.415  57.973 4.877   1.00 17.03 ?  251  VAL A N   1 
ATOM   1867 C CA  . VAL A 1 251 ? -9.683  57.339 4.426   1.00 17.43 ?  251  VAL A CA  1 
ATOM   1868 C C   . VAL A 1 251 ? -9.465  56.021 3.668   1.00 17.54 ?  251  VAL A C   1 
ATOM   1869 O O   . VAL A 1 251 ? -10.246 55.082 3.802   1.00 17.09 ?  251  VAL A O   1 
ATOM   1870 C CB  . VAL A 1 251 ? -10.451 58.344 3.535   1.00 17.66 ?  251  VAL A CB  1 
ATOM   1871 C CG1 . VAL A 1 251 ? -11.647 57.722 2.949   1.00 20.67 ?  251  VAL A CG1 1 
ATOM   1872 C CG2 . VAL A 1 251 ? -10.818 59.543 4.353   1.00 15.69 ?  251  VAL A CG2 1 
ATOM   1873 N N   . ASP A 1 252 ? -8.379  55.925 2.900   1.00 16.80 ?  252  ASP A N   1 
ATOM   1874 C CA  . ASP A 1 252 ? -8.107  54.716 2.102   1.00 17.26 ?  252  ASP A CA  1 
ATOM   1875 C C   . ASP A 1 252 ? -7.448  53.570 2.826   1.00 17.32 ?  252  ASP A C   1 
ATOM   1876 O O   . ASP A 1 252 ? -7.369  52.479 2.285   1.00 18.44 ?  252  ASP A O   1 
ATOM   1877 C CB  . ASP A 1 252 ? -7.204  55.051 0.905   1.00 17.39 ?  252  ASP A CB  1 
ATOM   1878 C CG  . ASP A 1 252 ? -7.881  56.003 -0.082  1.00 23.12 ?  252  ASP A CG  1 
ATOM   1879 O OD1 . ASP A 1 252 ? -9.111  56.142 0.030   1.00 27.86 ?  252  ASP A OD1 1 
ATOM   1880 O OD2 . ASP A 1 252 ? -7.203  56.638 -0.940  1.00 27.45 ?  252  ASP A OD2 1 
ATOM   1881 N N   . GLY A 1 253 ? -6.919  53.791 4.027   1.00 16.44 ?  253  GLY A N   1 
ATOM   1882 C CA  . GLY A 1 253 ? -6.084  52.761 4.639   1.00 13.96 ?  253  GLY A CA  1 
ATOM   1883 C C   . GLY A 1 253 ? -4.771  52.551 3.876   1.00 13.36 ?  253  GLY A C   1 
ATOM   1884 O O   . GLY A 1 253 ? -4.354  51.413 3.668   1.00 13.79 ?  253  GLY A O   1 
ATOM   1885 N N   . ARG A 1 254 ? -4.116  53.632 3.468   1.00 13.03 ?  254  ARG A N   1 
ATOM   1886 C CA  . ARG A 1 254 ? -2.869  53.524 2.688   1.00 13.16 ?  254  ARG A CA  1 
ATOM   1887 C C   . ARG A 1 254 ? -1.641  54.057 3.458   1.00 13.04 ?  254  ARG A C   1 
ATOM   1888 O O   . ARG A 1 254 ? -0.539  54.088 2.944   1.00 11.22 ?  254  ARG A O   1 
ATOM   1889 C CB  . ARG A 1 254 ? -3.029  54.219 1.321   1.00 12.44 ?  254  ARG A CB  1 
ATOM   1890 C CG  . ARG A 1 254 ? -3.077  55.789 1.377   1.00 14.09 ?  254  ARG A CG  1 
ATOM   1891 C CD  . ARG A 1 254 ? -3.076  56.377 -0.070  1.00 13.04 ?  254  ARG A CD  1 
ATOM   1892 N NE  . ARG A 1 254 ? -4.225  55.908 -0.842  1.00 12.94 ?  254  ARG A NE  1 
ATOM   1893 C CZ  . ARG A 1 254 ? -4.228  54.882 -1.708  1.00 17.25 ?  254  ARG A CZ  1 
ATOM   1894 N NH1 . ARG A 1 254 ? -3.130  54.143 -1.965  1.00 16.06 ?  254  ARG A NH1 1 
ATOM   1895 N NH2 . ARG A 1 254 ? -5.360  54.568 -2.318  1.00 17.31 ?  254  ARG A NH2 1 
ATOM   1896 N N   . VAL A 1 255 ? -1.833  54.409 4.732   1.00 12.54 ?  255  VAL A N   1 
ATOM   1897 C CA  . VAL A 1 255 ? -0.734  54.983 5.572   1.00 11.50 ?  255  VAL A CA  1 
ATOM   1898 C C   . VAL A 1 255 ? -0.219  53.964 6.594   1.00 13.21 ?  255  VAL A C   1 
ATOM   1899 O O   . VAL A 1 255 ? -1.004  53.319 7.336   1.00 11.03 ?  255  VAL A O   1 
ATOM   1900 C CB  . VAL A 1 255 ? -1.204  56.266 6.335   1.00 10.68 ?  255  VAL A CB  1 
ATOM   1901 C CG1 . VAL A 1 255 ? -0.080  56.897 7.325   1.00 7.52  ?  255  VAL A CG1 1 
ATOM   1902 C CG2 . VAL A 1 255 ? -1.712  57.320 5.340   1.00 8.23  ?  255  VAL A CG2 1 
ATOM   1903 N N   . ILE A 1 256 ? 1.104   53.847 6.648   1.00 11.87 ?  256  ILE A N   1 
ATOM   1904 C CA  . ILE A 1 256 ? 1.737   53.159 7.737   1.00 12.17 ?  256  ILE A CA  1 
ATOM   1905 C C   . ILE A 1 256 ? 2.604   54.207 8.452   1.00 11.48 ?  256  ILE A C   1 
ATOM   1906 O O   . ILE A 1 256 ? 3.377   54.893 7.793   1.00 12.68 ?  256  ILE A O   1 
ATOM   1907 C CB  . ILE A 1 256 ? 2.685   52.055 7.235   1.00 13.31 ?  256  ILE A CB  1 
ATOM   1908 C CG1 . ILE A 1 256 ? 1.881   50.945 6.569   1.00 15.71 ?  256  ILE A CG1 1 
ATOM   1909 C CG2 . ILE A 1 256 ? 3.477   51.490 8.433   1.00 12.75 ?  256  ILE A CG2 1 
ATOM   1910 C CD1 . ILE A 1 256 ? 2.763   50.002 5.706   1.00 19.97 ?  256  ILE A CD1 1 
ATOM   1911 N N   . ARG A 1 257 ? 2.502   54.272 9.787   1.00 11.40 ?  257  ARG A N   1 
ATOM   1912 C CA  . ARG A 1 257 ? 3.087   55.351 10.552  1.00 11.67 ?  257  ARG A CA  1 
ATOM   1913 C C   . ARG A 1 257 ? 3.971   54.745 11.620  1.00 11.79 ?  257  ARG A C   1 
ATOM   1914 O O   . ARG A 1 257 ? 3.573   53.808 12.302  1.00 11.03 ?  257  ARG A O   1 
ATOM   1915 C CB  . ARG A 1 257 ? 1.968   56.222 11.177  1.00 12.92 ?  257  ARG A CB  1 
ATOM   1916 C CG  . ARG A 1 257 ? 2.529   57.172 12.256  1.00 11.84 ?  257  ARG A CG  1 
ATOM   1917 C CD  . ARG A 1 257 ? 1.432   57.940 12.964  1.00 17.11 ?  257  ARG A CD  1 
ATOM   1918 N NE  . ARG A 1 257 ? 1.956   58.850 13.988  1.00 13.06 ?  257  ARG A NE  1 
ATOM   1919 C CZ  . ARG A 1 257 ? 2.415   60.072 13.709  1.00 14.75 ?  257  ARG A CZ  1 
ATOM   1920 N NH1 . ARG A 1 257 ? 2.369   60.560 12.447  1.00 11.60 ?  257  ARG A NH1 1 
ATOM   1921 N NH2 . ARG A 1 257 ? 2.882   60.833 14.696  1.00 15.93 ?  257  ARG A NH2 1 
ATOM   1922 N N   . ALA A 1 258 ? 5.192   55.266 11.720  1.00 10.83 ?  258  ALA A N   1 
ATOM   1923 C CA  . ALA A 1 258 ? 6.150   54.857 12.733  1.00 12.34 ?  258  ALA A CA  1 
ATOM   1924 C C   . ALA A 1 258 ? 6.253   56.027 13.742  1.00 12.36 ?  258  ALA A C   1 
ATOM   1925 O O   . ALA A 1 258 ? 6.503   57.164 13.357  1.00 13.26 ?  258  ALA A O   1 
ATOM   1926 C CB  . ALA A 1 258 ? 7.524   54.608 12.069  1.00 11.10 ?  258  ALA A CB  1 
ATOM   1927 N N   . ASP A 1 259 ? 6.013   55.737 15.018  1.00 13.01 ?  259  ASP A N   1 
ATOM   1928 C CA  . ASP A 1 259 ? 6.176   56.714 16.117  1.00 14.48 ?  259  ASP A CA  1 
ATOM   1929 C C   . ASP A 1 259 ? 7.336   56.188 17.001  1.00 14.06 ?  259  ASP A C   1 
ATOM   1930 O O   . ASP A 1 259 ? 7.571   55.000 17.060  1.00 14.44 ?  259  ASP A O   1 
ATOM   1931 C CB  . ASP A 1 259 ? 4.931   56.758 17.002  1.00 13.42 ?  259  ASP A CB  1 
ATOM   1932 C CG  . ASP A 1 259 ? 3.845   57.696 16.498  1.00 19.96 ?  259  ASP A CG  1 
ATOM   1933 O OD1 . ASP A 1 259 ? 3.875   58.937 16.847  1.00 23.70 ?  259  ASP A OD1 1 
ATOM   1934 O OD2 . ASP A 1 259 ? 2.904   57.173 15.823  1.00 20.88 ?  259  ASP A OD2 1 
ATOM   1935 N N   . SER A 1 260 ? 8.059   57.076 17.665  1.00 14.44 ?  260  SER A N   1 
ATOM   1936 C CA  . SER A 1 260 ? 9.238   56.675 18.441  1.00 16.73 ?  260  SER A CA  1 
ATOM   1937 C C   . SER A 1 260 ? 9.134   57.333 19.827  1.00 16.98 ?  260  SER A C   1 
ATOM   1938 O O   . SER A 1 260 ? 8.658   58.446 19.945  1.00 16.56 ?  260  SER A O   1 
ATOM   1939 C CB  . SER A 1 260 ? 10.510  57.187 17.733  1.00 15.50 ?  260  SER A CB  1 
ATOM   1940 O OG  . SER A 1 260 ? 11.684  56.863 18.478  1.00 18.86 ?  260  SER A OG  1 
ATOM   1941 N N   . PHE A 1 261 ? 9.590   56.627 20.854  1.00 18.80 ?  261  PHE A N   1 
ATOM   1942 C CA  . PHE A 1 261 ? 9.758   57.199 22.163  1.00 19.45 ?  261  PHE A CA  1 
ATOM   1943 C C   . PHE A 1 261 ? 11.208  57.609 22.392  1.00 19.26 ?  261  PHE A C   1 
ATOM   1944 O O   . PHE A 1 261 ? 11.549  58.059 23.468  1.00 17.13 ?  261  PHE A O   1 
ATOM   1945 C CB  . PHE A 1 261 ? 9.364   56.164 23.225  1.00 20.32 ?  261  PHE A CB  1 
ATOM   1946 C CG  . PHE A 1 261 ? 7.891   56.010 23.413  1.00 23.62 ?  261  PHE A CG  1 
ATOM   1947 C CD1 . PHE A 1 261 ? 7.069   57.126 23.577  1.00 25.71 ?  261  PHE A CD1 1 
ATOM   1948 C CD2 . PHE A 1 261 ? 7.324   54.749 23.462  1.00 25.35 ?  261  PHE A CD2 1 
ATOM   1949 C CE1 . PHE A 1 261 ? 5.671   56.991 23.780  1.00 27.33 ?  261  PHE A CE1 1 
ATOM   1950 C CE2 . PHE A 1 261 ? 5.938   54.602 23.650  1.00 26.61 ?  261  PHE A CE2 1 
ATOM   1951 C CZ  . PHE A 1 261 ? 5.120   55.726 23.813  1.00 25.03 ?  261  PHE A CZ  1 
ATOM   1952 N N   . SER A 1 262 ? 12.079  57.412 21.405  1.00 18.71 ?  262  SER A N   1 
ATOM   1953 C CA  . SER A 1 262 ? 13.521  57.604 21.641  1.00 20.83 ?  262  SER A CA  1 
ATOM   1954 C C   . SER A 1 262 ? 13.913  59.056 21.944  1.00 22.91 ?  262  SER A C   1 
ATOM   1955 O O   . SER A 1 262 ? 14.923  59.339 22.636  1.00 22.69 ?  262  SER A O   1 
ATOM   1956 C CB  . SER A 1 262 ? 14.311  57.165 20.438  1.00 20.58 ?  262  SER A CB  1 
ATOM   1957 O OG  . SER A 1 262 ? 14.163  55.778 20.260  1.00 21.33 ?  262  SER A OG  1 
ATOM   1958 N N   . LYS A 1 263 ? 13.152  59.976 21.370  1.00 23.62 ?  263  LYS A N   1 
ATOM   1959 C CA  . LYS A 1 263 ? 13.491  61.368 21.510  1.00 26.20 ?  263  LYS A CA  1 
ATOM   1960 C C   . LYS A 1 263 ? 12.822  62.000 22.698  1.00 26.16 ?  263  LYS A C   1 
ATOM   1961 O O   . LYS A 1 263 ? 13.303  63.024 23.150  1.00 30.05 ?  263  LYS A O   1 
ATOM   1962 C CB  . LYS A 1 263 ? 13.237  62.139 20.197  1.00 26.31 ?  263  LYS A CB  1 
ATOM   1963 C CG  . LYS A 1 263 ? 14.436  61.951 19.218  1.00 31.08 ?  263  LYS A CG  1 
ATOM   1964 C CD  . LYS A 1 263 ? 14.222  60.804 18.271  1.00 34.43 ?  263  LYS A CD  1 
ATOM   1965 C CE  . LYS A 1 263 ? 15.435  59.909 18.028  1.00 38.30 ?  263  LYS A CE  1 
ATOM   1966 N NZ  . LYS A 1 263 ? 16.697  60.485 17.460  1.00 40.62 ?  263  LYS A NZ  1 
ATOM   1967 N N   . ILE A 1 264 ? 11.725  61.428 23.204  1.00 24.97 ?  264  ILE A N   1 
ATOM   1968 C CA  . ILE A 1 264 ? 11.053  62.000 24.387  1.00 23.94 ?  264  ILE A CA  1 
ATOM   1969 C C   . ILE A 1 264 ? 11.129  61.160 25.670  1.00 23.34 ?  264  ILE A C   1 
ATOM   1970 O O   . ILE A 1 264 ? 10.980  61.729 26.741  1.00 23.78 ?  264  ILE A O   1 
ATOM   1971 C CB  . ILE A 1 264 ? 9.527   62.248 24.179  1.00 23.34 ?  264  ILE A CB  1 
ATOM   1972 C CG1 . ILE A 1 264 ? 8.828   60.950 23.756  1.00 23.92 ?  264  ILE A CG1 1 
ATOM   1973 C CG2 . ILE A 1 264 ? 9.273   63.464 23.248  1.00 23.30 ?  264  ILE A CG2 1 
ATOM   1974 C CD1 . ILE A 1 264 ? 7.328   61.025 23.671  1.00 26.47 ?  264  ILE A CD1 1 
ATOM   1975 N N   . ILE A 1 265 ? 11.294  59.841 25.576  1.00 19.81 ?  265  ILE A N   1 
ATOM   1976 C CA  . ILE A 1 265 ? 11.286  58.998 26.772  1.00 20.79 ?  265  ILE A CA  1 
ATOM   1977 C C   . ILE A 1 265 ? 12.591  58.220 27.051  1.00 20.35 ?  265  ILE A C   1 
ATOM   1978 O O   . ILE A 1 265 ? 13.143  58.270 28.189  1.00 20.27 ?  265  ILE A O   1 
ATOM   1979 C CB  . ILE A 1 265 ? 10.022  58.075 26.848  1.00 20.72 ?  265  ILE A CB  1 
ATOM   1980 C CG1 . ILE A 1 265 ? 8.813   58.944 27.232  1.00 25.00 ?  265  ILE A CG1 1 
ATOM   1981 C CG2 . ILE A 1 265 ? 10.251  56.970 27.835  1.00 19.60 ?  265  ILE A CG2 1 
ATOM   1982 C CD1 . ILE A 1 265 ? 7.425   58.267 27.011  1.00 28.28 ?  265  ILE A CD1 1 
ATOM   1983 N N   . SER A 1 266 ? 13.094  57.524 26.034  1.00 18.26 ?  266  SER A N   1 
ATOM   1984 C CA  . SER A 1 266 ? 14.400  56.853 26.107  1.00 17.32 ?  266  SER A CA  1 
ATOM   1985 C C   . SER A 1 266 ? 14.766  56.165 24.779  1.00 17.06 ?  266  SER A C   1 
ATOM   1986 O O   . SER A 1 266 ? 13.989  55.385 24.243  1.00 16.38 ?  266  SER A O   1 
ATOM   1987 C CB  . SER A 1 266 ? 14.415  55.784 27.197  1.00 17.64 ?  266  SER A CB  1 
ATOM   1988 O OG  . SER A 1 266 ? 15.536  54.901 26.992  1.00 16.62 ?  266  SER A OG  1 
ATOM   1989 N N   . SER A 1 267 ? 15.964  56.444 24.285  1.00 16.54 ?  267  SER A N   1 
ATOM   1990 C CA  . SER A 1 267 ? 16.461  55.794 23.093  1.00 16.59 ?  267  SER A CA  1 
ATOM   1991 C C   . SER A 1 267 ? 17.001  54.410 23.403  1.00 16.61 ?  267  SER A C   1 
ATOM   1992 O O   . SER A 1 267 ? 16.815  53.498 22.608  1.00 15.73 ?  267  SER A O   1 
ATOM   1993 C CB  . SER A 1 267 ? 17.540  56.674 22.453  1.00 16.45 ?  267  SER A CB  1 
ATOM   1994 O OG  . SER A 1 267 ? 18.432  57.133 23.457  1.00 16.70 ?  267  SER A OG  1 
ATOM   1995 N N   . GLY A 1 268 ? 17.620  54.246 24.576  1.00 15.75 ?  268  GLY A N   1 
ATOM   1996 C CA  . GLY A 1 268 ? 18.276  52.999 24.957  1.00 16.11 ?  268  GLY A CA  1 
ATOM   1997 C C   . GLY A 1 268 ? 17.321  51.871 25.309  1.00 17.94 ?  268  GLY A C   1 
ATOM   1998 O O   . GLY A 1 268 ? 17.719  50.729 25.359  1.00 18.77 ?  268  GLY A O   1 
ATOM   1999 N N   . LEU A 1 269 ? 16.052  52.168 25.540  1.00 17.02 ?  269  LEU A N   1 
ATOM   2000 C CA  . LEU A 1 269 ? 15.126  51.107 25.917  1.00 16.61 ?  269  LEU A CA  1 
ATOM   2001 C C   . LEU A 1 269 ? 14.652  50.339 24.717  1.00 16.06 ?  269  LEU A C   1 
ATOM   2002 O O   . LEU A 1 269 ? 14.166  49.221 24.888  1.00 16.10 ?  269  LEU A O   1 
ATOM   2003 C CB  . LEU A 1 269 ? 13.922  51.655 26.711  1.00 17.14 ?  269  LEU A CB  1 
ATOM   2004 C CG  . LEU A 1 269 ? 14.156  52.056 28.190  1.00 19.39 ?  269  LEU A CG  1 
ATOM   2005 C CD1 . LEU A 1 269 ? 12.777  52.401 28.830  1.00 20.90 ?  269  LEU A CD1 1 
ATOM   2006 C CD2 . LEU A 1 269 ? 14.807  50.934 29.021  1.00 17.44 ?  269  LEU A CD2 1 
ATOM   2007 N N   . ARG A 1 270 ? 14.834  50.912 23.512  1.00 15.79 ?  270  ARG A N   1 
ATOM   2008 C CA  . ARG A 1 270 ? 14.413  50.285 22.259  1.00 15.63 ?  270  ARG A CA  1 
ATOM   2009 C C   . ARG A 1 270 ? 12.915  49.942 22.283  1.00 16.00 ?  270  ARG A C   1 
ATOM   2010 O O   . ARG A 1 270 ? 12.567  48.784 22.226  1.00 15.45 ?  270  ARG A O   1 
ATOM   2011 C CB  . ARG A 1 270 ? 15.232  48.992 21.959  1.00 15.74 ?  270  ARG A CB  1 
ATOM   2012 C CG  . ARG A 1 270 ? 16.770  49.171 21.854  1.00 15.90 ?  270  ARG A CG  1 
ATOM   2013 C CD  . ARG A 1 270 ? 17.081  50.526 21.260  1.00 18.97 ?  270  ARG A CD  1 
ATOM   2014 N NE  . ARG A 1 270 ? 16.720  50.545 19.855  1.00 20.11 ?  270  ARG A NE  1 
ATOM   2015 C CZ  . ARG A 1 270 ? 16.225  51.580 19.202  1.00 19.64 ?  270  ARG A CZ  1 
ATOM   2016 N NH1 . ARG A 1 270 ? 15.990  52.765 19.812  1.00 18.21 ?  270  ARG A NH1 1 
ATOM   2017 N NH2 . ARG A 1 270 ? 15.971  51.416 17.913  1.00 18.35 ?  270  ARG A NH2 1 
ATOM   2018 N N   . ILE A 1 271 ? 12.050  50.947 22.395  1.00 16.83 ?  271  ILE A N   1 
ATOM   2019 C CA  . ILE A 1 271 ? 10.575  50.736 22.339  1.00 16.72 ?  271  ILE A CA  1 
ATOM   2020 C C   . ILE A 1 271 ? 10.022  51.818 21.387  1.00 16.45 ?  271  ILE A C   1 
ATOM   2021 O O   . ILE A 1 271 ? 10.247  53.021 21.606  1.00 18.22 ?  271  ILE A O   1 
ATOM   2022 C CB  . ILE A 1 271 ? 9.912   50.846 23.758  1.00 17.49 ?  271  ILE A CB  1 
ATOM   2023 C CG1 . ILE A 1 271 ? 10.517  49.824 24.757  1.00 19.35 ?  271  ILE A CG1 1 
ATOM   2024 C CG2 . ILE A 1 271 ? 8.320   50.699 23.718  1.00 16.74 ?  271  ILE A CG2 1 
ATOM   2025 C CD1 . ILE A 1 271 ? 10.308  48.252 24.458  1.00 19.75 ?  271  ILE A CD1 1 
ATOM   2026 N N   . GLY A 1 272 ? 9.341   51.414 20.319  1.00 14.84 ?  272  GLY A N   1 
ATOM   2027 C CA  . GLY A 1 272 ? 8.683   52.349 19.401  1.00 13.37 ?  272  GLY A CA  1 
ATOM   2028 C C   . GLY A 1 272 ? 7.366   51.672 19.018  1.00 13.79 ?  272  GLY A C   1 
ATOM   2029 O O   . GLY A 1 272 ? 7.042   50.635 19.546  1.00 12.68 ?  272  GLY A O   1 
ATOM   2030 N N   . PHE A 1 273 ? 6.592   52.226 18.097  1.00 13.38 ?  273  PHE A N   1 
ATOM   2031 C CA  . PHE A 1 273 ? 5.396   51.498 17.687  1.00 13.88 ?  273  PHE A CA  1 
ATOM   2032 C C   . PHE A 1 273 ? 4.996   51.839 16.300  1.00 13.65 ?  273  PHE A C   1 
ATOM   2033 O O   . PHE A 1 273 ? 5.294   52.922 15.796  1.00 15.93 ?  273  PHE A O   1 
ATOM   2034 C CB  . PHE A 1 273 ? 4.222   51.667 18.677  1.00 13.28 ?  273  PHE A CB  1 
ATOM   2035 C CG  . PHE A 1 273 ? 3.840   53.087 18.947  1.00 14.90 ?  273  PHE A CG  1 
ATOM   2036 C CD1 . PHE A 1 273 ? 4.627   53.891 19.751  1.00 12.63 ?  273  PHE A CD1 1 
ATOM   2037 C CD2 . PHE A 1 273 ? 2.675   53.614 18.399  1.00 19.45 ?  273  PHE A CD2 1 
ATOM   2038 C CE1 . PHE A 1 273 ? 4.268   55.195 20.022  1.00 18.25 ?  273  PHE A CE1 1 
ATOM   2039 C CE2 . PHE A 1 273 ? 2.295   54.956 18.673  1.00 19.89 ?  273  PHE A CE2 1 
ATOM   2040 C CZ  . PHE A 1 273 ? 3.092   55.724 19.481  1.00 17.27 ?  273  PHE A CZ  1 
ATOM   2041 N N   . LEU A 1 274 ? 4.312   50.904 15.677  1.00 13.78 ?  274  LEU A N   1 
ATOM   2042 C CA  . LEU A 1 274 ? 3.904   51.028 14.295  1.00 14.61 ?  274  LEU A CA  1 
ATOM   2043 C C   . LEU A 1 274 ? 2.376   50.970 14.258  1.00 15.72 ?  274  LEU A C   1 
ATOM   2044 O O   . LEU A 1 274 ? 1.804   50.143 14.976  1.00 15.96 ?  274  LEU A O   1 
ATOM   2045 C CB  . LEU A 1 274 ? 4.529   49.821 13.559  1.00 15.02 ?  274  LEU A CB  1 
ATOM   2046 C CG  . LEU A 1 274 ? 4.807   49.834 12.062  1.00 19.52 ?  274  LEU A CG  1 
ATOM   2047 C CD1 . LEU A 1 274 ? 5.849   50.910 11.711  1.00 16.75 ?  274  LEU A CD1 1 
ATOM   2048 C CD2 . LEU A 1 274 ? 5.265   48.492 11.601  1.00 19.27 ?  274  LEU A CD2 1 
ATOM   2049 N N   . THR A 1 275 ? 1.730   51.863 13.478  1.00 15.03 ?  275  THR A N   1 
ATOM   2050 C CA  . THR A 1 275 ? 0.250   51.924 13.343  1.00 15.33 ?  275  THR A CA  1 
ATOM   2051 C C   . THR A 1 275 ? -0.086  51.853 11.830  1.00 15.56 ?  275  THR A C   1 
ATOM   2052 O O   . THR A 1 275 ? 0.531   52.548 11.005  1.00 14.86 ?  275  THR A O   1 
ATOM   2053 C CB  . THR A 1 275 ? -0.327  53.274 13.928  1.00 15.11 ?  275  THR A CB  1 
ATOM   2054 O OG1 . THR A 1 275 ? 0.198   53.514 15.243  1.00 16.79 ?  275  THR A OG1 1 
ATOM   2055 C CG2 . THR A 1 275 ? -1.868  53.296 14.007  1.00 13.81 ?  275  THR A CG2 1 
ATOM   2056 N N   . GLY A 1 276 ? -1.053  51.013 11.458  1.00 16.35 ?  276  GLY A N   1 
ATOM   2057 C CA  . GLY A 1 276 ? -1.512  50.979 10.065  1.00 15.65 ?  276  GLY A CA  1 
ATOM   2058 C C   . GLY A 1 276 ? -2.535  49.889 9.798   1.00 15.20 ?  276  GLY A C   1 
ATOM   2059 O O   . GLY A 1 276 ? -3.068  49.290 10.750  1.00 15.93 ?  276  GLY A O   1 
ATOM   2060 N N   . PRO A 1 277 ? -2.737  49.562 8.504   1.00 14.44 ?  277  PRO A N   1 
ATOM   2061 C CA  . PRO A 1 277 ? -3.776  48.597 8.098   1.00 14.72 ?  277  PRO A CA  1 
ATOM   2062 C C   . PRO A 1 277 ? -3.440  47.264 8.704   1.00 15.17 ?  277  PRO A C   1 
ATOM   2063 O O   . PRO A 1 277 ? -2.268  46.800 8.657   1.00 14.24 ?  277  PRO A O   1 
ATOM   2064 C CB  . PRO A 1 277 ? -3.649  48.546 6.570   1.00 14.97 ?  277  PRO A CB  1 
ATOM   2065 C CG  . PRO A 1 277 ? -2.829  49.773 6.189   1.00 14.87 ?  277  PRO A CG  1 
ATOM   2066 C CD  . PRO A 1 277 ? -1.919  50.010 7.357   1.00 12.62 ?  277  PRO A CD  1 
ATOM   2067 N N   . LYS A 1 278 ? -4.442  46.658 9.326   1.00 15.25 ?  278  LYS A N   1 
ATOM   2068 C CA  . LYS A 1 278 ? -4.250  45.385 10.006  1.00 16.71 ?  278  LYS A CA  1 
ATOM   2069 C C   . LYS A 1 278 ? -3.496  44.285 9.192   1.00 16.46 ?  278  LYS A C   1 
ATOM   2070 O O   . LYS A 1 278 ? -2.634  43.575 9.768   1.00 15.47 ?  278  LYS A O   1 
ATOM   2071 C CB  . LYS A 1 278 ? -5.610  44.872 10.530  1.00 17.58 ?  278  LYS A CB  1 
ATOM   2072 C CG  . LYS A 1 278 ? -5.541  43.660 11.401  1.00 20.92 ?  278  LYS A CG  1 
ATOM   2073 C CD  . LYS A 1 278 ? -6.949  43.429 12.034  1.00 27.54 ?  278  LYS A CD  1 
ATOM   2074 C CE  . LYS A 1 278 ? -7.012  42.199 12.992  1.00 30.48 ?  278  LYS A CE  1 
ATOM   2075 N NZ  . LYS A 1 278 ? -6.198  42.461 14.162  1.00 34.38 ?  278  LYS A NZ  1 
ATOM   2076 N N   . PRO A 1 279 ? -3.838  44.099 7.902   1.00 16.78 ?  279  PRO A N   1 
ATOM   2077 C CA  . PRO A 1 279 ? -3.174  43.035 7.125   1.00 16.97 ?  279  PRO A CA  1 
ATOM   2078 C C   . PRO A 1 279 ? -1.661  43.218 7.006   1.00 17.03 ?  279  PRO A C   1 
ATOM   2079 O O   . PRO A 1 279 ? -0.918  42.236 6.997   1.00 16.07 ?  279  PRO A O   1 
ATOM   2080 C CB  . PRO A 1 279 ? -3.796  43.183 5.734   1.00 18.07 ?  279  PRO A CB  1 
ATOM   2081 C CG  . PRO A 1 279 ? -5.169  43.746 6.001   1.00 17.60 ?  279  PRO A CG  1 
ATOM   2082 C CD  . PRO A 1 279 ? -4.884  44.760 7.094   1.00 17.23 ?  279  PRO A CD  1 
ATOM   2083 N N   . LEU A 1 280 ? -1.230  44.478 6.923   1.00 17.30 ?  280  LEU A N   1 
ATOM   2084 C CA  . LEU A 1 280 ? 0.180   44.828 6.803   1.00 16.05 ?  280  LEU A CA  1 
ATOM   2085 C C   . LEU A 1 280 ? 0.889   44.759 8.153   1.00 16.14 ?  280  LEU A C   1 
ATOM   2086 O O   . LEU A 1 280 ? 2.043   44.265 8.275   1.00 16.11 ?  280  LEU A O   1 
ATOM   2087 C CB  . LEU A 1 280 ? 0.295   46.236 6.234   1.00 15.69 ?  280  LEU A CB  1 
ATOM   2088 C CG  . LEU A 1 280 ? -0.165  46.440 4.777   1.00 17.88 ?  280  LEU A CG  1 
ATOM   2089 C CD1 . LEU A 1 280 ? 0.092   47.882 4.368   1.00 14.76 ?  280  LEU A CD1 1 
ATOM   2090 C CD2 . LEU A 1 280 ? 0.526   45.470 3.803   1.00 17.39 ?  280  LEU A CD2 1 
ATOM   2091 N N   . ILE A 1 281 ? 0.246   45.297 9.175   1.00 13.62 ?  281  ILE A N   1 
ATOM   2092 C CA  . ILE A 1 281 ? 0.735   45.093 10.556  1.00 13.99 ?  281  ILE A CA  1 
ATOM   2093 C C   . ILE A 1 281 ? 0.899   43.612 10.943  1.00 13.78 ?  281  ILE A C   1 
ATOM   2094 O O   . ILE A 1 281 ? 1.892   43.227 11.590  1.00 14.96 ?  281  ILE A O   1 
ATOM   2095 C CB  . ILE A 1 281 ? -0.196  45.821 11.595  1.00 13.16 ?  281  ILE A CB  1 
ATOM   2096 C CG1 . ILE A 1 281 ? -0.246  47.327 11.291  1.00 12.03 ?  281  ILE A CG1 1 
ATOM   2097 C CG2 . ILE A 1 281 ? 0.297   45.621 13.009  1.00 12.92 ?  281  ILE A CG2 1 
ATOM   2098 C CD1 . ILE A 1 281 ? 1.030   48.136 11.687  1.00 15.00 ?  281  ILE A CD1 1 
ATOM   2099 N N   . GLU A 1 282 ? -0.084  42.786 10.574  1.00 14.78 ?  282  GLU A N   1 
ATOM   2100 C CA  . GLU A 1 282 ? -0.015  41.341 10.768  1.00 15.76 ?  282  GLU A CA  1 
ATOM   2101 C C   . GLU A 1 282 ? 1.212   40.720 10.056  1.00 14.68 ?  282  GLU A C   1 
ATOM   2102 O O   . GLU A 1 282 ? 1.835   39.865 10.631  1.00 15.40 ?  282  GLU A O   1 
ATOM   2103 C CB  . GLU A 1 282 ? -1.343  40.673 10.351  1.00 16.96 ?  282  GLU A CB  1 
ATOM   2104 C CG  . GLU A 1 282 ? -1.412  39.118 10.378  1.00 27.31 ?  282  GLU A CG  1 
ATOM   2105 C CD  . GLU A 1 282 ? -2.395  38.581 9.304   1.00 38.85 ?  282  GLU A CD  1 
ATOM   2106 O OE1 . GLU A 1 282 ? -3.632  38.809 9.440   1.00 46.54 ?  282  GLU A OE1 1 
ATOM   2107 O OE2 . GLU A 1 282 ? -1.938  38.000 8.285   1.00 38.07 ?  282  GLU A OE2 1 
ATOM   2108 N N   . ARG A 1 283 ? 1.556   41.145 8.826   1.00 14.82 ?  283  ARG A N   1 
ATOM   2109 C CA  . ARG A 1 283 ? 2.808   40.716 8.175   1.00 14.03 ?  283  ARG A CA  1 
ATOM   2110 C C   . ARG A 1 283 ? 4.050   41.051 8.957   1.00 12.84 ?  283  ARG A C   1 
ATOM   2111 O O   . ARG A 1 283 ? 4.999   40.253 9.015   1.00 13.26 ?  283  ARG A O   1 
ATOM   2112 C CB  . ARG A 1 283 ? 2.955   41.292 6.767   1.00 13.64 ?  283  ARG A CB  1 
ATOM   2113 C CG  . ARG A 1 283 ? 1.826   40.922 5.726   1.00 17.38 ?  283  ARG A CG  1 
ATOM   2114 C CD  . ARG A 1 283 ? 0.905   39.792 6.149   1.00 25.78 ?  283  ARG A CD  1 
ATOM   2115 N NE  . ARG A 1 283 ? 1.528   38.543 5.867   1.00 23.38 ?  283  ARG A NE  1 
ATOM   2116 C CZ  . ARG A 1 283 ? 1.083   37.335 6.174   1.00 22.24 ?  283  ARG A CZ  1 
ATOM   2117 N NH1 . ARG A 1 283 ? -0.045  37.160 6.808   1.00 26.00 ?  283  ARG A NH1 1 
ATOM   2118 N NH2 . ARG A 1 283 ? 1.809   36.268 5.788   1.00 17.85 ?  283  ARG A NH2 1 
ATOM   2119 N N   . VAL A 1 284 ? 4.072   42.256 9.515   1.00 13.56 ?  284  VAL A N   1 
ATOM   2120 C CA  . VAL A 1 284 ? 5.195   42.731 10.318  1.00 13.57 ?  284  VAL A CA  1 
ATOM   2121 C C   . VAL A 1 284 ? 5.316   41.911 11.607  1.00 14.03 ?  284  VAL A C   1 
ATOM   2122 O O   . VAL A 1 284 ? 6.411   41.456 11.975  1.00 13.41 ?  284  VAL A O   1 
ATOM   2123 C CB  . VAL A 1 284 ? 5.096   44.249 10.658  1.00 13.89 ?  284  VAL A CB  1 
ATOM   2124 C CG1 . VAL A 1 284 ? 6.197   44.654 11.694  1.00 11.80 ?  284  VAL A CG1 1 
ATOM   2125 C CG2 . VAL A 1 284 ? 5.234   45.084 9.387   1.00 13.91 ?  284  VAL A CG2 1 
ATOM   2126 N N   . ILE A 1 285 ? 4.182   41.698 12.274  1.00 13.29 ?  285  ILE A N   1 
ATOM   2127 C CA  . ILE A 1 285 ? 4.156   40.912 13.505  1.00 13.72 ?  285  ILE A CA  1 
ATOM   2128 C C   . ILE A 1 285 ? 4.690   39.497 13.251  1.00 14.64 ?  285  ILE A C   1 
ATOM   2129 O O   . ILE A 1 285 ? 5.440   38.964 14.070  1.00 14.77 ?  285  ILE A O   1 
ATOM   2130 C CB  . ILE A 1 285 ? 2.730   40.827 14.143  1.00 13.96 ?  285  ILE A CB  1 
ATOM   2131 C CG1 . ILE A 1 285 ? 2.325   42.181 14.773  1.00 13.87 ?  285  ILE A CG1 1 
ATOM   2132 C CG2 . ILE A 1 285 ? 2.702   39.802 15.321  1.00 13.40 ?  285  ILE A CG2 1 
ATOM   2133 C CD1 . ILE A 1 285 ? 0.697   42.307 14.931  1.00 13.24 ?  285  ILE A CD1 1 
ATOM   2134 N N   . LEU A 1 286 ? 4.363   38.918 12.100  1.00 13.29 ?  286  LEU A N   1 
ATOM   2135 C CA  . LEU A 1 286 ? 4.734   37.530 11.865  1.00 14.61 ?  286  LEU A CA  1 
ATOM   2136 C C   . LEU A 1 286 ? 6.253   37.470 11.649  1.00 14.74 ?  286  LEU A C   1 
ATOM   2137 O O   . LEU A 1 286 ? 6.872   36.506 12.012  1.00 15.61 ?  286  LEU A O   1 
ATOM   2138 C CB  . LEU A 1 286 ? 4.006   36.974 10.637  1.00 13.91 ?  286  LEU A CB  1 
ATOM   2139 C CG  . LEU A 1 286 ? 2.533   36.594 10.873  1.00 17.20 ?  286  LEU A CG  1 
ATOM   2140 C CD1 . LEU A 1 286 ? 1.877   36.128 9.540   1.00 17.66 ?  286  LEU A CD1 1 
ATOM   2141 C CD2 . LEU A 1 286 ? 2.481   35.495 11.944  1.00 19.96 ?  286  LEU A CD2 1 
ATOM   2142 N N   . HIS A 1 287 ? 6.831   38.530 11.100  1.00 12.41 ?  287  HIS A N   1 
ATOM   2143 C CA  . HIS A 1 287 ? 8.283   38.609 10.911  1.00 14.86 ?  287  HIS A CA  1 
ATOM   2144 C C   . HIS A 1 287 ? 9.010   38.799 12.260  1.00 15.08 ?  287  HIS A C   1 
ATOM   2145 O O   . HIS A 1 287 ? 10.027  38.120 12.553  1.00 14.43 ?  287  HIS A O   1 
ATOM   2146 C CB  . HIS A 1 287 ? 8.652   39.746 9.938   1.00 14.33 ?  287  HIS A CB  1 
ATOM   2147 C CG  . HIS A 1 287 ? 10.047  39.668 9.397   1.00 17.13 ?  287  HIS A CG  1 
ATOM   2148 N ND1 . HIS A 1 287 ? 10.510  40.532 8.431   1.00 18.25 ?  287  HIS A ND1 1 
ATOM   2149 C CD2 . HIS A 1 287 ? 11.067  38.809 9.657   1.00 17.76 ?  287  HIS A CD2 1 
ATOM   2150 C CE1 . HIS A 1 287 ? 11.759  40.216 8.124   1.00 21.16 ?  287  HIS A CE1 1 
ATOM   2151 N NE2 . HIS A 1 287 ? 12.122  39.179 8.863   1.00 17.65 ?  287  HIS A NE2 1 
ATOM   2152 N N   . ILE A 1 288 ? 8.503   39.727 13.073  1.00 15.19 ?  288  ILE A N   1 
ATOM   2153 C CA  . ILE A 1 288 ? 9.004   39.963 14.437  1.00 15.95 ?  288  ILE A CA  1 
ATOM   2154 C C   . ILE A 1 288 ? 9.031   38.638 15.258  1.00 16.07 ?  288  ILE A C   1 
ATOM   2155 O O   . ILE A 1 288 ? 9.954   38.357 16.000  1.00 15.74 ?  288  ILE A O   1 
ATOM   2156 C CB  . ILE A 1 288 ? 8.122   41.027 15.176  1.00 15.34 ?  288  ILE A CB  1 
ATOM   2157 C CG1 . ILE A 1 288 ? 8.503   42.446 14.751  1.00 17.52 ?  288  ILE A CG1 1 
ATOM   2158 C CG2 . ILE A 1 288 ? 8.218   40.838 16.727  1.00 18.68 ?  288  ILE A CG2 1 
ATOM   2159 C CD1 . ILE A 1 288 ? 7.476   43.581 15.126  1.00 17.09 ?  288  ILE A CD1 1 
ATOM   2160 N N   . GLN A 1 289 ? 7.972   37.858 15.109  1.00 17.05 ?  289  GLN A N   1 
ATOM   2161 C CA  . GLN A 1 289 ? 7.790   36.603 15.786  1.00 18.80 ?  289  GLN A CA  1 
ATOM   2162 C C   . GLN A 1 289 ? 8.908   35.594 15.522  1.00 19.17 ?  289  GLN A C   1 
ATOM   2163 O O   . GLN A 1 289 ? 9.175   34.773 16.362  1.00 20.88 ?  289  GLN A O   1 
ATOM   2164 C CB  . GLN A 1 289 ? 6.471   35.987 15.320  1.00 19.58 ?  289  GLN A CB  1 
ATOM   2165 C CG  . GLN A 1 289 ? 6.094   34.743 16.033  1.00 24.46 ?  289  GLN A CG  1 
ATOM   2166 C CD  . GLN A 1 289 ? 4.588   34.610 16.106  1.00 31.67 ?  289  GLN A CD  1 
ATOM   2167 O OE1 . GLN A 1 289 ? 3.938   34.171 15.148  1.00 31.63 ?  289  GLN A OE1 1 
ATOM   2168 N NE2 . GLN A 1 289 ? 4.023   35.018 17.240  1.00 32.35 ?  289  GLN A NE2 1 
ATOM   2169 N N   . VAL A 1 290 ? 9.526   35.637 14.351  1.00 19.25 ?  290  VAL A N   1 
ATOM   2170 C CA  . VAL A 1 290 ? 10.636  34.741 14.046  1.00 19.27 ?  290  VAL A CA  1 
ATOM   2171 C C   . VAL A 1 290 ? 11.992  35.418 14.166  1.00 18.73 ?  290  VAL A C   1 
ATOM   2172 O O   . VAL A 1 290 ? 12.979  34.800 13.812  1.00 18.99 ?  290  VAL A O   1 
ATOM   2173 C CB  . VAL A 1 290 ? 10.505  34.063 12.622  1.00 19.03 ?  290  VAL A CB  1 
ATOM   2174 C CG1 . VAL A 1 290 ? 9.191   33.253 12.518  1.00 19.46 ?  290  VAL A CG1 1 
ATOM   2175 C CG2 . VAL A 1 290 ? 10.548  35.094 11.520  1.00 17.86 ?  290  VAL A CG2 1 
ATOM   2176 N N   . SER A 1 291 ? 12.035  36.689 14.592  1.00 18.54 ?  291  SER A N   1 
ATOM   2177 C CA  . SER A 1 291 ? 13.321  37.416 14.748  1.00 18.17 ?  291  SER A CA  1 
ATOM   2178 C C   . SER A 1 291 ? 13.534  37.787 16.215  1.00 19.00 ?  291  SER A C   1 
ATOM   2179 O O   . SER A 1 291 ? 14.092  36.989 16.981  1.00 19.49 ?  291  SER A O   1 
ATOM   2180 C CB  . SER A 1 291 ? 13.476  38.600 13.787  1.00 18.61 ?  291  SER A CB  1 
ATOM   2181 O OG  . SER A 1 291 ? 12.397  39.523 13.909  1.00 19.91 ?  291  SER A OG  1 
ATOM   2182 N N   . THR A 1 292 ? 13.086  38.949 16.650  1.00 17.23 ?  292  THR A N   1 
ATOM   2183 C CA  . THR A 1 292 ? 13.284  39.270 18.051  1.00 17.26 ?  292  THR A CA  1 
ATOM   2184 C C   . THR A 1 292 ? 12.277  38.584 19.028  1.00 18.19 ?  292  THR A C   1 
ATOM   2185 O O   . THR A 1 292 ? 12.479  38.665 20.252  1.00 17.46 ?  292  THR A O   1 
ATOM   2186 C CB  . THR A 1 292 ? 13.173  40.766 18.272  1.00 17.65 ?  292  THR A CB  1 
ATOM   2187 O OG1 . THR A 1 292 ? 11.950  41.224 17.694  1.00 15.38 ?  292  THR A OG1 1 
ATOM   2188 C CG2 . THR A 1 292 ? 14.386  41.501 17.658  1.00 17.16 ?  292  THR A CG2 1 
ATOM   2189 N N   . LEU A 1 293 ? 11.196  37.979 18.487  1.00 17.14 ?  293  LEU A N   1 
ATOM   2190 C CA  . LEU A 1 293 ? 10.101  37.333 19.276  1.00 18.85 ?  293  LEU A CA  1 
ATOM   2191 C C   . LEU A 1 293 ? 9.154   38.367 19.844  1.00 18.12 ?  293  LEU A C   1 
ATOM   2192 O O   . LEU A 1 293 ? 7.960   38.307 19.580  1.00 18.91 ?  293  LEU A O   1 
ATOM   2193 C CB  . LEU A 1 293 ? 10.580  36.378 20.398  1.00 19.69 ?  293  LEU A CB  1 
ATOM   2194 C CG  . LEU A 1 293 ? 11.441  35.134 20.114  1.00 22.38 ?  293  LEU A CG  1 
ATOM   2195 C CD1 . LEU A 1 293 ? 11.589  34.251 21.368  1.00 24.97 ?  293  LEU A CD1 1 
ATOM   2196 C CD2 . LEU A 1 293 ? 10.867  34.318 18.985  1.00 25.06 ?  293  LEU A CD2 1 
ATOM   2197 N N   . HIS A 1 294 ? 9.698   39.323 20.588  1.00 16.78 ?  294  HIS A N   1 
ATOM   2198 C CA  . HIS A 1 294 ? 8.905   40.422 21.112  1.00 17.87 ?  294  HIS A CA  1 
ATOM   2199 C C   . HIS A 1 294 ? 9.872   41.449 21.623  1.00 16.95 ?  294  HIS A C   1 
ATOM   2200 O O   . HIS A 1 294 ? 11.031  41.143 21.793  1.00 16.65 ?  294  HIS A O   1 
ATOM   2201 C CB  . HIS A 1 294 ? 7.961   39.932 22.267  1.00 17.16 ?  294  HIS A CB  1 
ATOM   2202 C CG  . HIS A 1 294 ? 8.680   39.340 23.434  1.00 16.39 ?  294  HIS A CG  1 
ATOM   2203 N ND1 . HIS A 1 294 ? 8.850   37.976 23.595  1.00 17.17 ?  294  HIS A ND1 1 
ATOM   2204 C CD2 . HIS A 1 294 ? 9.258   39.920 24.516  1.00 15.94 ?  294  HIS A CD2 1 
ATOM   2205 C CE1 . HIS A 1 294 ? 9.519   37.743 24.710  1.00 14.90 ?  294  HIS A CE1 1 
ATOM   2206 N NE2 . HIS A 1 294 ? 9.785   38.902 25.287  1.00 19.09 ?  294  HIS A NE2 1 
ATOM   2207 N N   . PRO A 1 295 ? 9.399   42.675 21.934  1.00 17.41 ?  295  PRO A N   1 
ATOM   2208 C CA  . PRO A 1 295 ? 10.250  43.646 22.630  1.00 15.19 ?  295  PRO A CA  1 
ATOM   2209 C C   . PRO A 1 295 ? 10.430  43.338 24.149  1.00 15.75 ?  295  PRO A C   1 
ATOM   2210 O O   . PRO A 1 295 ? 9.562   42.711 24.795  1.00 13.67 ?  295  PRO A O   1 
ATOM   2211 C CB  . PRO A 1 295 ? 9.500   44.987 22.420  1.00 15.53 ?  295  PRO A CB  1 
ATOM   2212 C CG  . PRO A 1 295 ? 8.344   44.697 21.467  1.00 17.62 ?  295  PRO A CG  1 
ATOM   2213 C CD  . PRO A 1 295 ? 8.059   43.216 21.631  1.00 18.80 ?  295  PRO A CD  1 
ATOM   2214 N N   . SER A 1 296 ? 11.542  43.783 24.727  1.00 15.36 ?  296  SER A N   1 
ATOM   2215 C CA  . SER A 1 296 ? 11.843  43.454 26.104  1.00 15.93 ?  296  SER A CA  1 
ATOM   2216 C C   . SER A 1 296 ? 10.550  43.652 26.950  1.00 15.63 ?  296  SER A C   1 
ATOM   2217 O O   . SER A 1 296 ? 9.932   44.768 26.943  1.00 15.28 ?  296  SER A O   1 
ATOM   2218 C CB  . SER A 1 296 ? 12.912  44.387 26.622  1.00 15.50 ?  296  SER A CB  1 
ATOM   2219 O OG  . SER A 1 296 ? 13.131  44.135 28.001  1.00 20.75 ?  296  SER A OG  1 
ATOM   2220 N N   . THR A 1 297 ? 10.138  42.593 27.639  1.00 14.73 ?  297  THR A N   1 
ATOM   2221 C CA  . THR A 1 297 ? 8.922   42.621 28.483  1.00 15.64 ?  297  THR A CA  1 
ATOM   2222 C C   . THR A 1 297 ? 9.121   43.656 29.601  1.00 16.19 ?  297  THR A C   1 
ATOM   2223 O O   . THR A 1 297 ? 8.264   44.492 29.867  1.00 16.54 ?  297  THR A O   1 
ATOM   2224 C CB  . THR A 1 297 ? 8.595   41.200 29.077  1.00 14.03 ?  297  THR A CB  1 
ATOM   2225 O OG1 . THR A 1 297 ? 8.634   40.221 28.016  1.00 13.97 ?  297  THR A OG1 1 
ATOM   2226 C CG2 . THR A 1 297 ? 7.177   41.201 29.642  1.00 15.12 ?  297  THR A CG2 1 
ATOM   2227 N N   . PHE A 1 298 ? 10.316  43.631 30.175  1.00 15.70 ?  298  PHE A N   1 
ATOM   2228 C CA  . PHE A 1 298 ? 10.735  44.515 31.230  1.00 15.92 ?  298  PHE A CA  1 
ATOM   2229 C C   . PHE A 1 298 ? 10.637  46.004 30.826  1.00 16.20 ?  298  PHE A C   1 
ATOM   2230 O O   . PHE A 1 298 ? 10.128  46.837 31.582  1.00 14.36 ?  298  PHE A O   1 
ATOM   2231 C CB  . PHE A 1 298 ? 12.175  44.133 31.592  1.00 17.83 ?  298  PHE A CB  1 
ATOM   2232 C CG  . PHE A 1 298 ? 12.696  44.764 32.877  1.00 20.08 ?  298  PHE A CG  1 
ATOM   2233 C CD1 . PHE A 1 298 ? 13.083  46.082 32.908  1.00 22.87 ?  298  PHE A CD1 1 
ATOM   2234 C CD2 . PHE A 1 298 ? 12.871  44.000 34.018  1.00 23.72 ?  298  PHE A CD2 1 
ATOM   2235 C CE1 . PHE A 1 298 ? 13.581  46.669 34.104  1.00 25.08 ?  298  PHE A CE1 1 
ATOM   2236 C CE2 . PHE A 1 298 ? 13.383  44.586 35.213  1.00 25.05 ?  298  PHE A CE2 1 
ATOM   2237 C CZ  . PHE A 1 298 ? 13.734  45.920 35.230  1.00 23.02 ?  298  PHE A CZ  1 
ATOM   2238 N N   . ASN A 1 299 ? 11.131  46.347 29.634  1.00 15.18 ?  299  ASN A N   1 
ATOM   2239 C CA  . ASN A 1 299 ? 11.162  47.759 29.247  1.00 14.39 ?  299  ASN A CA  1 
ATOM   2240 C C   . ASN A 1 299 ? 9.737   48.248 28.914  1.00 13.55 ?  299  ASN A C   1 
ATOM   2241 O O   . ASN A 1 299 ? 9.414   49.392 29.161  1.00 14.90 ?  299  ASN A O   1 
ATOM   2242 C CB  . ASN A 1 299 ? 12.079  47.962 28.055  1.00 13.73 ?  299  ASN A CB  1 
ATOM   2243 C CG  . ASN A 1 299 ? 13.501  47.518 28.333  1.00 17.50 ?  299  ASN A CG  1 
ATOM   2244 O OD1 . ASN A 1 299 ? 14.306  47.441 27.412  1.00 22.63 ?  299  ASN A OD1 1 
ATOM   2245 N ND2 . ASN A 1 299 ? 13.837  47.258 29.615  1.00 14.31 ?  299  ASN A ND2 1 
ATOM   2246 N N   . GLN A 1 300 ? 8.927   47.371 28.337  1.00 12.89 ?  300  GLN A N   1 
ATOM   2247 C CA  . GLN A 1 300 ? 7.530   47.658 28.041  1.00 14.59 ?  300  GLN A CA  1 
ATOM   2248 C C   . GLN A 1 300 ? 6.755   47.980 29.333  1.00 15.20 ?  300  GLN A C   1 
ATOM   2249 O O   . GLN A 1 300 ? 6.022   48.997 29.431  1.00 15.26 ?  300  GLN A O   1 
ATOM   2250 C CB  . GLN A 1 300 ? 6.888   46.472 27.358  1.00 14.19 ?  300  GLN A CB  1 
ATOM   2251 C CG  . GLN A 1 300 ? 7.203   46.421 25.861  1.00 17.02 ?  300  GLN A CG  1 
ATOM   2252 C CD  . GLN A 1 300 ? 6.401   45.376 25.231  1.00 14.92 ?  300  GLN A CD  1 
ATOM   2253 O OE1 . GLN A 1 300 ? 5.235   45.600 24.850  1.00 15.72 ?  300  GLN A OE1 1 
ATOM   2254 N NE2 . GLN A 1 300 ? 6.965   44.192 25.161  1.00 14.22 ?  300  GLN A NE2 1 
ATOM   2255 N N   . LEU A 1 301 ? 6.958   47.145 30.345  1.00 14.69 ?  301  LEU A N   1 
ATOM   2256 C CA  . LEU A 1 301 ? 6.321   47.416 31.623  1.00 15.89 ?  301  LEU A CA  1 
ATOM   2257 C C   . LEU A 1 301 ? 6.794   48.718 32.270  1.00 16.70 ?  301  LEU A C   1 
ATOM   2258 O O   . LEU A 1 301 ? 5.990   49.463 32.822  1.00 17.74 ?  301  LEU A O   1 
ATOM   2259 C CB  . LEU A 1 301 ? 6.554   46.193 32.506  1.00 16.11 ?  301  LEU A CB  1 
ATOM   2260 C CG  . LEU A 1 301 ? 5.525   45.140 32.826  1.00 17.68 ?  301  LEU A CG  1 
ATOM   2261 C CD1 . LEU A 1 301 ? 4.119   45.240 32.239  1.00 16.49 ?  301  LEU A CD1 1 
ATOM   2262 C CD2 . LEU A 1 301 ? 6.143   43.689 32.922  1.00 20.97 ?  301  LEU A CD2 1 
ATOM   2263 N N   . MET A 1 302 ? 8.092   49.024 32.221  1.00 17.02 ?  302  MET A N   1 
ATOM   2264 C CA  . MET A 1 302 ? 8.555   50.309 32.766  1.00 19.10 ?  302  MET A CA  1 
ATOM   2265 C C   . MET A 1 302 ? 7.754   51.442 32.099  1.00 19.03 ?  302  MET A C   1 
ATOM   2266 O O   . MET A 1 302 ? 7.227   52.333 32.769  1.00 18.54 ?  302  MET A O   1 
ATOM   2267 C CB  . MET A 1 302 ? 10.050  50.579 32.476  1.00 18.41 ?  302  MET A CB  1 
ATOM   2268 C CG  . MET A 1 302 ? 11.103  49.693 33.137  1.00 22.36 ?  302  MET A CG  1 
ATOM   2269 S SD  . MET A 1 302 ? 12.788  49.943 32.434  1.00 23.85 ?  302  MET A SD  1 
ATOM   2270 C CE  . MET A 1 302 ? 13.102  51.660 32.877  1.00 24.49 ?  302  MET A CE  1 
ATOM   2271 N N   . ILE A 1 303 ? 7.703   51.413 30.759  1.00 18.25 ?  303  ILE A N   1 
ATOM   2272 C CA  . ILE A 1 303 ? 7.041   52.464 30.022  1.00 18.10 ?  303  ILE A CA  1 
ATOM   2273 C C   . ILE A 1 303 ? 5.523   52.460 30.241  1.00 16.66 ?  303  ILE A C   1 
ATOM   2274 O O   . ILE A 1 303 ? 4.949   53.520 30.431  1.00 16.62 ?  303  ILE A O   1 
ATOM   2275 C CB  . ILE A 1 303 ? 7.448   52.454 28.516  1.00 18.33 ?  303  ILE A CB  1 
ATOM   2276 C CG1 . ILE A 1 303 ? 8.897   52.905 28.393  1.00 19.12 ?  303  ILE A CG1 1 
ATOM   2277 C CG2 . ILE A 1 303 ? 6.553   53.360 27.673  1.00 18.26 ?  303  ILE A CG2 1 
ATOM   2278 C CD1 . ILE A 1 303 ? 9.493   52.603 27.031  1.00 22.85 ?  303  ILE A CD1 1 
ATOM   2279 N N   . SER A 1 304 ? 4.903   51.289 30.273  1.00 15.89 ?  304  SER A N   1 
ATOM   2280 C CA  . SER A 1 304 ? 3.472   51.221 30.462  1.00 17.07 ?  304  SER A CA  1 
ATOM   2281 C C   . SER A 1 304 ? 3.081   51.822 31.816  1.00 17.81 ?  304  SER A C   1 
ATOM   2282 O O   . SER A 1 304 ? 2.114   52.562 31.921  1.00 17.55 ?  304  SER A O   1 
ATOM   2283 C CB  . SER A 1 304 ? 2.985   49.773 30.421  1.00 17.61 ?  304  SER A CB  1 
ATOM   2284 O OG  . SER A 1 304 ? 1.553   49.763 30.363  1.00 17.29 ?  304  SER A OG  1 
ATOM   2285 N N   . GLN A 1 305 ? 3.853   51.496 32.840  1.00 17.98 ?  305  GLN A N   1 
ATOM   2286 C CA  . GLN A 1 305 ? 3.630   52.073 34.171  1.00 19.95 ?  305  GLN A CA  1 
ATOM   2287 C C   . GLN A 1 305 ? 3.734   53.605 34.196  1.00 19.79 ?  305  GLN A C   1 
ATOM   2288 O O   . GLN A 1 305 ? 2.813   54.288 34.711  1.00 19.87 ?  305  GLN A O   1 
ATOM   2289 C CB  . GLN A 1 305 ? 4.566   51.429 35.205  1.00 18.65 ?  305  GLN A CB  1 
ATOM   2290 C CG  . GLN A 1 305 ? 4.009   50.070 35.613  1.00 26.31 ?  305  GLN A CG  1 
ATOM   2291 C CD  . GLN A 1 305 ? 4.426   49.653 37.008  1.00 33.96 ?  305  GLN A CD  1 
ATOM   2292 O OE1 . GLN A 1 305 ? 4.647   48.470 37.245  1.00 38.08 ?  305  GLN A OE1 1 
ATOM   2293 N NE2 . GLN A 1 305 ? 4.545   50.615 37.943  1.00 35.01 ?  305  GLN A NE2 1 
ATOM   2294 N N   . LEU A 1 306 ? 4.839   54.142 33.659  1.00 18.24 ?  306  LEU A N   1 
ATOM   2295 C CA  . LEU A 1 306 ? 5.008   55.605 33.522  1.00 17.61 ?  306  LEU A CA  1 
ATOM   2296 C C   . LEU A 1 306 ? 3.791   56.242 32.868  1.00 18.17 ?  306  LEU A C   1 
ATOM   2297 O O   . LEU A 1 306 ? 3.202   57.205 33.386  1.00 16.75 ?  306  LEU A O   1 
ATOM   2298 C CB  . LEU A 1 306 ? 6.218   55.913 32.662  1.00 17.71 ?  306  LEU A CB  1 
ATOM   2299 C CG  . LEU A 1 306 ? 6.564   57.373 32.398  1.00 16.54 ?  306  LEU A CG  1 
ATOM   2300 C CD1 . LEU A 1 306 ? 7.254   57.999 33.559  1.00 12.35 ?  306  LEU A CD1 1 
ATOM   2301 C CD2 . LEU A 1 306 ? 7.490   57.433 31.152  1.00 16.73 ?  306  LEU A CD2 1 
ATOM   2302 N N   . LEU A 1 307 ? 3.434   55.723 31.699  1.00 17.90 ?  307  LEU A N   1 
ATOM   2303 C CA  . LEU A 1 307 ? 2.353   56.324 30.878  1.00 18.70 ?  307  LEU A CA  1 
ATOM   2304 C C   . LEU A 1 307 ? 0.992   56.260 31.579  1.00 19.18 ?  307  LEU A C   1 
ATOM   2305 O O   . LEU A 1 307 ? 0.234   57.207 31.556  1.00 18.23 ?  307  LEU A O   1 
ATOM   2306 C CB  . LEU A 1 307 ? 2.241   55.533 29.564  1.00 18.78 ?  307  LEU A CB  1 
ATOM   2307 C CG  . LEU A 1 307 ? 2.919   56.037 28.269  1.00 21.12 ?  307  LEU A CG  1 
ATOM   2308 C CD1 . LEU A 1 307 ? 3.944   57.173 28.418  1.00 18.34 ?  307  LEU A CD1 1 
ATOM   2309 C CD2 . LEU A 1 307 ? 3.336   54.926 27.344  1.00 17.48 ?  307  LEU A CD2 1 
ATOM   2310 N N   . HIS A 1 308 ? 0.682   55.113 32.166  1.00 19.91 ?  308  HIS A N   1 
ATOM   2311 C CA  . HIS A 1 308 ? -0.576  54.952 32.895  1.00 22.42 ?  308  HIS A CA  1 
ATOM   2312 C C   . HIS A 1 308 ? -0.696  55.894 34.083  1.00 23.74 ?  308  HIS A C   1 
ATOM   2313 O O   . HIS A 1 308 ? -1.715  56.515 34.257  1.00 23.25 ?  308  HIS A O   1 
ATOM   2314 C CB  . HIS A 1 308 ? -0.769  53.509 33.337  1.00 22.67 ?  308  HIS A CB  1 
ATOM   2315 C CG  . HIS A 1 308 ? -1.351  52.646 32.276  1.00 23.82 ?  308  HIS A CG  1 
ATOM   2316 N ND1 . HIS A 1 308 ? -0.576  52.019 31.323  1.00 22.25 ?  308  HIS A ND1 1 
ATOM   2317 C CD2 . HIS A 1 308 ? -2.639  52.360 31.971  1.00 23.97 ?  308  HIS A CD2 1 
ATOM   2318 C CE1 . HIS A 1 308 ? -1.362  51.322 30.521  1.00 24.56 ?  308  HIS A CE1 1 
ATOM   2319 N NE2 . HIS A 1 308 ? -2.618  51.523 30.883  1.00 24.82 ?  308  HIS A NE2 1 
ATOM   2320 N N   . GLU A 1 309 ? 0.371   56.031 34.857  1.00 25.00 ?  309  GLU A N   1 
ATOM   2321 C CA  . GLU A 1 309 ? 0.359   56.940 35.977  1.00 26.61 ?  309  GLU A CA  1 
ATOM   2322 C C   . GLU A 1 309 ? 0.350   58.386 35.528  1.00 27.11 ?  309  GLU A C   1 
ATOM   2323 O O   . GLU A 1 309 ? -0.344  59.206 36.139  1.00 27.15 ?  309  GLU A O   1 
ATOM   2324 C CB  . GLU A 1 309 ? 1.485   56.644 36.968  1.00 26.70 ?  309  GLU A CB  1 
ATOM   2325 C CG  . GLU A 1 309 ? 1.311   55.246 37.619  1.00 31.22 ?  309  GLU A CG  1 
ATOM   2326 C CD  . GLU A 1 309 ? -0.139  55.000 38.106  1.00 37.88 ?  309  GLU A CD  1 
ATOM   2327 O OE1 . GLU A 1 309 ? -0.715  55.926 38.756  1.00 40.02 ?  309  GLU A OE1 1 
ATOM   2328 O OE2 . GLU A 1 309 ? -0.692  53.892 37.830  1.00 39.61 ?  309  GLU A OE2 1 
ATOM   2329 N N   . TRP A 1 310 ? 1.082   58.699 34.454  1.00 25.74 ?  310  TRP A N   1 
ATOM   2330 C CA  . TRP A 1 310 ? 1.070   60.061 33.931  1.00 24.67 ?  310  TRP A CA  1 
ATOM   2331 C C   . TRP A 1 310 ? -0.329  60.455 33.500  1.00 24.13 ?  310  TRP A C   1 
ATOM   2332 O O   . TRP A 1 310 ? -0.755  61.546 33.772  1.00 24.38 ?  310  TRP A O   1 
ATOM   2333 C CB  . TRP A 1 310 ? 1.965   60.194 32.719  1.00 23.73 ?  310  TRP A CB  1 
ATOM   2334 C CG  . TRP A 1 310 ? 3.316   60.627 32.961  1.00 23.46 ?  310  TRP A CG  1 
ATOM   2335 C CD1 . TRP A 1 310 ? 3.845   61.106 34.132  1.00 23.57 ?  310  TRP A CD1 1 
ATOM   2336 C CD2 . TRP A 1 310 ? 4.365   60.678 31.988  1.00 23.10 ?  310  TRP A CD2 1 
ATOM   2337 N NE1 . TRP A 1 310 ? 5.160   61.454 33.931  1.00 23.00 ?  310  TRP A NE1 1 
ATOM   2338 C CE2 . TRP A 1 310 ? 5.502   61.200 32.626  1.00 21.26 ?  310  TRP A CE2 1 
ATOM   2339 C CE3 . TRP A 1 310 ? 4.439   60.355 30.634  1.00 23.78 ?  310  TRP A CE3 1 
ATOM   2340 C CZ2 . TRP A 1 310 ? 6.721   61.400 31.960  1.00 22.17 ?  310  TRP A CZ2 1 
ATOM   2341 C CZ3 . TRP A 1 310 ? 5.670   60.526 29.975  1.00 25.30 ?  310  TRP A CZ3 1 
ATOM   2342 C CH2 . TRP A 1 310 ? 6.785   61.056 30.642  1.00 21.23 ?  310  TRP A CH2 1 
ATOM   2343 N N   . GLY A 1 311 ? -1.024  59.588 32.790  1.00 23.95 ?  311  GLY A N   1 
ATOM   2344 C CA  . GLY A 1 311 ? -2.256  59.986 32.136  1.00 25.77 ?  311  GLY A CA  1 
ATOM   2345 C C   . GLY A 1 311 ? -2.008  61.159 31.188  1.00 27.26 ?  311  GLY A C   1 
ATOM   2346 O O   . GLY A 1 311 ? -0.847  61.446 30.809  1.00 24.36 ?  311  GLY A O   1 
ATOM   2347 N N   . GLU A 1 312 ? -3.085  61.864 30.835  1.00 29.86 ?  312  GLU A N   1 
ATOM   2348 C CA  . GLU A 1 312 ? -2.994  62.989 29.866  1.00 32.97 ?  312  GLU A CA  1 
ATOM   2349 C C   . GLU A 1 312 ? -2.247  64.171 30.448  1.00 33.95 ?  312  GLU A C   1 
ATOM   2350 O O   . GLU A 1 312 ? -1.309  64.738 29.837  1.00 35.09 ?  312  GLU A O   1 
ATOM   2351 C CB  . GLU A 1 312 ? -4.379  63.421 29.434  1.00 33.83 ?  312  GLU A CB  1 
ATOM   2352 C CG  . GLU A 1 312 ? -4.356  64.328 28.201  1.00 39.60 ?  312  GLU A CG  1 
ATOM   2353 C CD  . GLU A 1 312 ? -5.612  64.133 27.324  1.00 46.28 ?  312  GLU A CD  1 
ATOM   2354 O OE1 . GLU A 1 312 ? -5.502  63.450 26.243  1.00 48.36 ?  312  GLU A OE1 1 
ATOM   2355 O OE2 . GLU A 1 312 ? -6.690  64.647 27.749  1.00 41.54 ?  312  GLU A OE2 1 
ATOM   2356 N N   . GLU A 1 313 ? -2.658  64.531 31.653  1.00 34.44 ?  313  GLU A N   1 
ATOM   2357 C CA  . GLU A 1 313 ? -1.988  65.539 32.466  1.00 34.90 ?  313  GLU A CA  1 
ATOM   2358 C C   . GLU A 1 313 ? -0.443  65.408 32.467  1.00 33.04 ?  313  GLU A C   1 
ATOM   2359 O O   . GLU A 1 313 ? 0.277   66.341 32.078  1.00 33.01 ?  313  GLU A O   1 
ATOM   2360 C CB  . GLU A 1 313 ? -2.567  65.468 33.895  1.00 36.12 ?  313  GLU A CB  1 
ATOM   2361 C CG  . GLU A 1 313 ? -2.884  64.006 34.396  1.00 41.86 ?  313  GLU A CG  1 
ATOM   2362 C CD  . GLU A 1 313 ? -4.232  63.392 33.883  1.00 48.46 ?  313  GLU A CD  1 
ATOM   2363 O OE1 . GLU A 1 313 ? -5.211  64.141 33.632  1.00 51.71 ?  313  GLU A OE1 1 
ATOM   2364 O OE2 . GLU A 1 313 ? -4.320  62.139 33.756  1.00 51.63 ?  313  GLU A OE2 1 
ATOM   2365 N N   . GLY A 1 314 ? 0.058   64.251 32.885  1.00 30.24 ?  314  GLY A N   1 
ATOM   2366 C CA  . GLY A 1 314 ? 1.492   64.057 33.026  1.00 27.85 ?  314  GLY A CA  1 
ATOM   2367 C C   . GLY A 1 314 ? 2.270   63.972 31.709  1.00 26.34 ?  314  GLY A C   1 
ATOM   2368 O O   . GLY A 1 314 ? 3.395   64.477 31.611  1.00 25.07 ?  314  GLY A O   1 
ATOM   2369 N N   . PHE A 1 315 ? 1.678   63.298 30.735  1.00 25.42 ?  315  PHE A N   1 
ATOM   2370 C CA  . PHE A 1 315 ? 2.281   63.136 29.424  1.00 26.53 ?  315  PHE A CA  1 
ATOM   2371 C C   . PHE A 1 315 ? 2.441   64.521 28.743  1.00 27.57 ?  315  PHE A C   1 
ATOM   2372 O O   . PHE A 1 315 ? 3.551   64.848 28.286  1.00 27.09 ?  315  PHE A O   1 
ATOM   2373 C CB  . PHE A 1 315 ? 1.464   62.163 28.571  1.00 25.68 ?  315  PHE A CB  1 
ATOM   2374 C CG  . PHE A 1 315 ? 2.089   61.863 27.222  1.00 27.28 ?  315  PHE A CG  1 
ATOM   2375 C CD1 . PHE A 1 315 ? 3.015   60.819 27.082  1.00 26.10 ?  315  PHE A CD1 1 
ATOM   2376 C CD2 . PHE A 1 315 ? 1.758   62.641 26.101  1.00 26.68 ?  315  PHE A CD2 1 
ATOM   2377 C CE1 . PHE A 1 315 ? 3.625   60.536 25.828  1.00 30.20 ?  315  PHE A CE1 1 
ATOM   2378 C CE2 . PHE A 1 315 ? 2.322   62.367 24.833  1.00 31.43 ?  315  PHE A CE2 1 
ATOM   2379 C CZ  . PHE A 1 315 ? 3.280   61.309 24.697  1.00 29.00 ?  315  PHE A CZ  1 
ATOM   2380 N N   . MET A 1 316 ? 1.362   65.330 28.731  1.00 28.21 ?  316  MET A N   1 
ATOM   2381 C CA  . MET A 1 316 ? 1.376   66.681 28.148  1.00 30.96 ?  316  MET A CA  1 
ATOM   2382 C C   . MET A 1 316 ? 2.407   67.515 28.827  1.00 28.63 ?  316  MET A C   1 
ATOM   2383 O O   . MET A 1 316 ? 3.136   68.253 28.163  1.00 29.48 ?  316  MET A O   1 
ATOM   2384 C CB  . MET A 1 316 ? 0.033   67.424 28.302  1.00 31.20 ?  316  MET A CB  1 
ATOM   2385 C CG  . MET A 1 316 ? -1.129  66.890 27.490  1.00 32.86 ?  316  MET A CG  1 
ATOM   2386 S SD  . MET A 1 316 ? -2.686  67.861 27.684  1.00 40.23 ?  316  MET A SD  1 
ATOM   2387 C CE  . MET A 1 316 ? -2.776  68.376 29.415  1.00 42.43 ?  316  MET A CE  1 
ATOM   2388 N N   . ALA A 1 317 ? 2.481   67.410 30.155  1.00 26.99 ?  317  ALA A N   1 
ATOM   2389 C CA  . ALA A 1 317 ? 3.434   68.213 30.890  1.00 25.36 ?  317  ALA A CA  1 
ATOM   2390 C C   . ALA A 1 317 ? 4.879   67.817 30.557  1.00 24.75 ?  317  ALA A C   1 
ATOM   2391 O O   . ALA A 1 317 ? 5.764   68.667 30.467  1.00 24.40 ?  317  ALA A O   1 
ATOM   2392 C CB  . ALA A 1 317 ? 3.180   68.140 32.387  1.00 25.97 ?  317  ALA A CB  1 
ATOM   2393 N N   . HIS A 1 318 ? 5.116   66.529 30.365  1.00 23.50 ?  318  HIS A N   1 
ATOM   2394 C CA  . HIS A 1 318 ? 6.471   66.068 30.072  1.00 22.91 ?  318  HIS A CA  1 
ATOM   2395 C C   . HIS A 1 318 ? 6.899   66.601 28.700  1.00 22.23 ?  318  HIS A C   1 
ATOM   2396 O O   . HIS A 1 318 ? 7.954   67.218 28.572  1.00 21.72 ?  318  HIS A O   1 
ATOM   2397 C CB  . HIS A 1 318 ? 6.543   64.542 30.072  1.00 22.23 ?  318  HIS A CB  1 
ATOM   2398 C CG  . HIS A 1 318 ? 7.889   64.024 29.670  1.00 20.31 ?  318  HIS A CG  1 
ATOM   2399 N ND1 . HIS A 1 318 ? 8.129   63.413 28.453  1.00 22.14 ?  318  HIS A ND1 1 
ATOM   2400 C CD2 . HIS A 1 318 ? 9.074   64.070 30.307  1.00 16.55 ?  318  HIS A CD2 1 
ATOM   2401 C CE1 . HIS A 1 318 ? 9.410   63.101 28.369  1.00 15.38 ?  318  HIS A CE1 1 
ATOM   2402 N NE2 . HIS A 1 318 ? 10.002  63.484 29.484  1.00 22.90 ?  318  HIS A NE2 1 
ATOM   2403 N N   . VAL A 1 319 ? 6.051   66.378 27.696  1.00 23.33 ?  319  VAL A N   1 
ATOM   2404 C CA  . VAL A 1 319 ? 6.368   66.795 26.325  1.00 24.45 ?  319  VAL A CA  1 
ATOM   2405 C C   . VAL A 1 319 ? 6.536   68.316 26.216  1.00 24.83 ?  319  VAL A C   1 
ATOM   2406 O O   . VAL A 1 319 ? 7.433   68.776 25.517  1.00 24.76 ?  319  VAL A O   1 
ATOM   2407 C CB  . VAL A 1 319 ? 5.408   66.188 25.209  1.00 24.56 ?  319  VAL A CB  1 
ATOM   2408 C CG1 . VAL A 1 319 ? 5.292   64.691 25.318  1.00 23.06 ?  319  VAL A CG1 1 
ATOM   2409 C CG2 . VAL A 1 319 ? 4.069   66.808 25.236  1.00 28.77 ?  319  VAL A CG2 1 
ATOM   2410 N N   . ASP A 1 320 ? 5.697   69.100 26.916  1.00 25.50 ?  320  ASP A N   1 
ATOM   2411 C CA  . ASP A 1 320 ? 5.934   70.571 27.026  1.00 26.17 ?  320  ASP A CA  1 
ATOM   2412 C C   . ASP A 1 320 ? 7.321   70.933 27.546  1.00 25.59 ?  320  ASP A C   1 
ATOM   2413 O O   . ASP A 1 320 ? 8.005   71.782 26.953  1.00 26.51 ?  320  ASP A O   1 
ATOM   2414 C CB  . ASP A 1 320 ? 4.854   71.302 27.841  1.00 27.04 ?  320  ASP A CB  1 
ATOM   2415 C CG  . ASP A 1 320 ? 4.915   72.831 27.647  1.00 32.85 ?  320  ASP A CG  1 
ATOM   2416 O OD1 . ASP A 1 320 ? 5.229   73.564 28.632  1.00 38.02 ?  320  ASP A OD1 1 
ATOM   2417 O OD2 . ASP A 1 320 ? 4.696   73.301 26.496  1.00 34.34 ?  320  ASP A OD2 1 
ATOM   2418 N N   . ARG A 1 321 ? 7.768   70.299 28.628  1.00 24.60 ?  321  ARG A N   1 
ATOM   2419 C CA  . ARG A 1 321 ? 9.119   70.579 29.151  1.00 24.09 ?  321  ARG A CA  1 
ATOM   2420 C C   . ARG A 1 321 ? 10.220  70.214 28.182  1.00 23.37 ?  321  ARG A C   1 
ATOM   2421 O O   . ARG A 1 321 ? 11.223  70.943 28.057  1.00 21.91 ?  321  ARG A O   1 
ATOM   2422 C CB  . ARG A 1 321 ? 9.382   69.827 30.453  1.00 24.62 ?  321  ARG A CB  1 
ATOM   2423 C CG  . ARG A 1 321 ? 8.477   70.266 31.631  1.00 29.57 ?  321  ARG A CG  1 
ATOM   2424 C CD  . ARG A 1 321 ? 8.964   69.585 32.967  1.00 34.42 ?  321  ARG A CD  1 
ATOM   2425 N NE  . ARG A 1 321 ? 8.636   68.152 33.050  1.00 34.12 ?  321  ARG A NE  1 
ATOM   2426 C CZ  . ARG A 1 321 ? 7.432   67.691 33.369  1.00 35.71 ?  321  ARG A CZ  1 
ATOM   2427 N NH1 . ARG A 1 321 ? 6.430   68.534 33.600  1.00 37.26 ?  321  ARG A NH1 1 
ATOM   2428 N NH2 . ARG A 1 321 ? 7.213   66.391 33.458  1.00 33.52 ?  321  ARG A NH2 1 
ATOM   2429 N N   . VAL A 1 322 ? 10.086  69.066 27.514  1.00 23.04 ?  322  VAL A N   1 
ATOM   2430 C CA  . VAL A 1 322 ? 11.133  68.739 26.549  1.00 23.49 ?  322  VAL A CA  1 
ATOM   2431 C C   . VAL A 1 322 ? 11.077  69.694 25.333  1.00 22.34 ?  322  VAL A C   1 
ATOM   2432 O O   . VAL A 1 322 ? 12.112  70.192 24.942  1.00 22.16 ?  322  VAL A O   1 
ATOM   2433 C CB  . VAL A 1 322 ? 11.342  67.185 26.227  1.00 24.42 ?  322  VAL A CB  1 
ATOM   2434 C CG1 . VAL A 1 322 ? 10.584  66.245 27.184  1.00 24.16 ?  322  VAL A CG1 1 
ATOM   2435 C CG2 . VAL A 1 322 ? 11.202  66.864 24.738  1.00 26.04 ?  322  VAL A CG2 1 
ATOM   2436 N N   . ILE A 1 323 ? 9.890   70.001 24.803  1.00 22.50 ?  323  ILE A N   1 
ATOM   2437 C CA  . ILE A 1 323 ? 9.801   71.049 23.743  1.00 23.40 ?  323  ILE A CA  1 
ATOM   2438 C C   . ILE A 1 323 ? 10.485  72.339 24.195  1.00 23.94 ?  323  ILE A C   1 
ATOM   2439 O O   . ILE A 1 323 ? 11.339  72.842 23.474  1.00 24.26 ?  323  ILE A O   1 
ATOM   2440 C CB  . ILE A 1 323 ? 8.370   71.356 23.250  1.00 23.49 ?  323  ILE A CB  1 
ATOM   2441 C CG1 . ILE A 1 323 ? 7.766   70.167 22.511  1.00 23.46 ?  323  ILE A CG1 1 
ATOM   2442 C CG2 . ILE A 1 323 ? 8.366   72.636 22.357  1.00 23.78 ?  323  ILE A CG2 1 
ATOM   2443 C CD1 . ILE A 1 323 ? 6.193   70.194 22.462  1.00 24.78 ?  323  ILE A CD1 1 
ATOM   2444 N N   . ASP A 1 324 ? 10.150  72.832 25.393  1.00 24.91 ?  324  ASP A N   1 
ATOM   2445 C CA  . ASP A 1 324 ? 10.771  74.056 25.932  1.00 26.40 ?  324  ASP A CA  1 
ATOM   2446 C C   . ASP A 1 324 ? 12.297  73.966 25.973  1.00 26.29 ?  324  ASP A C   1 
ATOM   2447 O O   . ASP A 1 324 ? 12.962  74.921 25.599  1.00 25.37 ?  324  ASP A O   1 
ATOM   2448 C CB  . ASP A 1 324 ? 10.215  74.443 27.325  1.00 27.63 ?  324  ASP A CB  1 
ATOM   2449 C CG  . ASP A 1 324 ? 8.837   75.087 27.257  1.00 31.56 ?  324  ASP A CG  1 
ATOM   2450 O OD1 . ASP A 1 324 ? 8.405   75.513 26.157  1.00 36.19 ?  324  ASP A OD1 1 
ATOM   2451 O OD2 . ASP A 1 324 ? 8.151   75.157 28.309  1.00 36.41 ?  324  ASP A OD2 1 
ATOM   2452 N N   . PHE A 1 325 ? 12.849  72.808 26.387  1.00 25.92 ?  325  PHE A N   1 
ATOM   2453 C CA  . PHE A 1 325 ? 14.301  72.619 26.341  1.00 26.47 ?  325  PHE A CA  1 
ATOM   2454 C C   . PHE A 1 325 ? 14.902  72.719 24.930  1.00 25.60 ?  325  PHE A C   1 
ATOM   2455 O O   . PHE A 1 325 ? 15.878  73.416 24.730  1.00 26.50 ?  325  PHE A O   1 
ATOM   2456 C CB  . PHE A 1 325 ? 14.748  71.268 26.962  1.00 27.69 ?  325  PHE A CB  1 
ATOM   2457 C CG  . PHE A 1 325 ? 16.238  70.988 26.777  1.00 29.35 ?  325  PHE A CG  1 
ATOM   2458 C CD1 . PHE A 1 325 ? 17.186  71.633 27.582  1.00 32.50 ?  325  PHE A CD1 1 
ATOM   2459 C CD2 . PHE A 1 325 ? 16.685  70.103 25.800  1.00 29.29 ?  325  PHE A CD2 1 
ATOM   2460 C CE1 . PHE A 1 325 ? 18.567  71.414 27.417  1.00 31.66 ?  325  PHE A CE1 1 
ATOM   2461 C CE2 . PHE A 1 325 ? 18.068  69.864 25.620  1.00 30.80 ?  325  PHE A CE2 1 
ATOM   2462 C CZ  . PHE A 1 325 ? 19.014  70.530 26.444  1.00 31.43 ?  325  PHE A CZ  1 
ATOM   2463 N N   . TYR A 1 326 ? 14.347  71.978 23.974  1.00 24.67 ?  326  TYR A N   1 
ATOM   2464 C CA  . TYR A 1 326 ? 14.894  71.923 22.627  1.00 23.50 ?  326  TYR A CA  1 
ATOM   2465 C C   . TYR A 1 326 ? 14.730  73.287 21.900  1.00 24.45 ?  326  TYR A C   1 
ATOM   2466 O O   . TYR A 1 326 ? 15.603  73.649 21.106  1.00 24.15 ?  326  TYR A O   1 
ATOM   2467 C CB  . TYR A 1 326 ? 14.274  70.759 21.846  1.00 23.00 ?  326  TYR A CB  1 
ATOM   2468 C CG  . TYR A 1 326 ? 14.923  69.402 22.196  1.00 23.33 ?  326  TYR A CG  1 
ATOM   2469 C CD1 . TYR A 1 326 ? 16.152  69.055 21.678  1.00 22.83 ?  326  TYR A CD1 1 
ATOM   2470 C CD2 . TYR A 1 326 ? 14.310  68.485 23.060  1.00 24.01 ?  326  TYR A CD2 1 
ATOM   2471 C CE1 . TYR A 1 326 ? 16.769  67.838 21.994  1.00 26.45 ?  326  TYR A CE1 1 
ATOM   2472 C CE2 . TYR A 1 326 ? 14.935  67.233 23.359  1.00 21.40 ?  326  TYR A CE2 1 
ATOM   2473 C CZ  . TYR A 1 326 ? 16.159  66.937 22.825  1.00 24.90 ?  326  TYR A CZ  1 
ATOM   2474 O OH  . TYR A 1 326 ? 16.818  65.741 23.097  1.00 26.42 ?  326  TYR A OH  1 
ATOM   2475 N N   . SER A 1 327 ? 13.663  74.057 22.186  1.00 23.60 ?  327  SER A N   1 
ATOM   2476 C CA  . SER A 1 327 ? 13.553  75.365 21.520  1.00 25.96 ?  327  SER A CA  1 
ATOM   2477 C C   . SER A 1 327 ? 14.479  76.439 22.079  1.00 25.78 ?  327  SER A C   1 
ATOM   2478 O O   . SER A 1 327 ? 14.938  77.281 21.315  1.00 26.40 ?  327  SER A O   1 
ATOM   2479 C CB  . SER A 1 327 ? 12.119  75.876 21.331  1.00 25.63 ?  327  SER A CB  1 
ATOM   2480 O OG  . SER A 1 327 ? 11.441  75.830 22.539  1.00 31.34 ?  327  SER A OG  1 
ATOM   2481 N N   . ASN A 1 328 ? 14.792  76.392 23.377  1.00 26.67 ?  328  ASN A N   1 
ATOM   2482 C CA  . ASN A 1 328 ? 15.883  77.200 23.913  1.00 27.30 ?  328  ASN A CA  1 
ATOM   2483 C C   . ASN A 1 328 ? 17.189  76.861 23.212  1.00 27.31 ?  328  ASN A C   1 
ATOM   2484 O O   . ASN A 1 328 ? 17.857  77.777 22.710  1.00 28.03 ?  328  ASN A O   1 
ATOM   2485 C CB  . ASN A 1 328 ? 16.039  77.030 25.412  1.00 29.06 ?  328  ASN A CB  1 
ATOM   2486 C CG  . ASN A 1 328 ? 14.942  77.720 26.214  1.00 32.48 ?  328  ASN A CG  1 
ATOM   2487 O OD1 . ASN A 1 328 ? 14.718  77.370 27.371  1.00 38.88 ?  328  ASN A OD1 1 
ATOM   2488 N ND2 . ASN A 1 328 ? 14.263  78.702 25.621  1.00 34.39 ?  328  ASN A ND2 1 
ATOM   2489 N N   . GLN A 1 329 ? 17.538  75.565 23.121  1.00 25.70 ?  329  GLN A N   1 
ATOM   2490 C CA  . GLN A 1 329 ? 18.707  75.117 22.325  1.00 24.04 ?  329  GLN A CA  1 
ATOM   2491 C C   . GLN A 1 329 ? 18.670  75.629 20.870  1.00 23.74 ?  329  GLN A C   1 
ATOM   2492 O O   . GLN A 1 329 ? 19.676  76.100 20.346  1.00 23.84 ?  329  GLN A O   1 
ATOM   2493 C CB  . GLN A 1 329 ? 18.836  73.579 22.282  1.00 23.32 ?  329  GLN A CB  1 
ATOM   2494 C CG  . GLN A 1 329 ? 19.079  72.878 23.631  1.00 25.12 ?  329  GLN A CG  1 
ATOM   2495 C CD  . GLN A 1 329 ? 20.430  73.235 24.224  1.00 27.84 ?  329  GLN A CD  1 
ATOM   2496 O OE1 . GLN A 1 329 ? 20.513  74.102 25.082  1.00 30.91 ?  329  GLN A OE1 1 
ATOM   2497 N NE2 . GLN A 1 329 ? 21.496  72.591 23.750  1.00 28.96 ?  329  GLN A NE2 1 
ATOM   2498 N N   . LYS A 1 330 ? 17.535  75.479 20.202  1.00 23.72 ?  330  LYS A N   1 
ATOM   2499 C CA  . LYS A 1 330 ? 17.396  75.979 18.851  1.00 23.57 ?  330  LYS A CA  1 
ATOM   2500 C C   . LYS A 1 330 ? 17.641  77.516 18.788  1.00 23.81 ?  330  LYS A C   1 
ATOM   2501 O O   . LYS A 1 330 ? 18.345  77.999 17.921  1.00 23.64 ?  330  LYS A O   1 
ATOM   2502 C CB  . LYS A 1 330 ? 16.009  75.636 18.316  1.00 23.97 ?  330  LYS A CB  1 
ATOM   2503 C CG  . LYS A 1 330 ? 15.769  76.139 16.879  1.00 23.78 ?  330  LYS A CG  1 
ATOM   2504 C CD  . LYS A 1 330 ? 14.325  76.445 16.735  1.00 28.74 ?  330  LYS A CD  1 
ATOM   2505 C CE  . LYS A 1 330 ? 14.002  77.827 17.203  1.00 29.35 ?  330  LYS A CE  1 
ATOM   2506 N NZ  . LYS A 1 330 ? 12.709  77.821 17.886  1.00 32.13 ?  330  LYS A NZ  1 
ATOM   2507 N N   . ASP A 1 331 ? 17.084  78.269 19.734  1.00 25.14 ?  331  ASP A N   1 
ATOM   2508 C CA  . ASP A 1 331 ? 17.312  79.729 19.779  1.00 25.78 ?  331  ASP A CA  1 
ATOM   2509 C C   . ASP A 1 331 ? 18.816  80.027 19.953  1.00 25.61 ?  331  ASP A C   1 
ATOM   2510 O O   . ASP A 1 331 ? 19.342  80.934 19.297  1.00 26.24 ?  331  ASP A O   1 
ATOM   2511 C CB  . ASP A 1 331 ? 16.499  80.388 20.886  1.00 25.40 ?  331  ASP A CB  1 
ATOM   2512 C CG  . ASP A 1 331 ? 15.014  80.362 20.609  1.00 29.89 ?  331  ASP A CG  1 
ATOM   2513 O OD1 . ASP A 1 331 ? 14.596  80.110 19.442  1.00 30.39 ?  331  ASP A OD1 1 
ATOM   2514 O OD2 . ASP A 1 331 ? 14.247  80.594 21.572  1.00 33.75 ?  331  ASP A OD2 1 
ATOM   2515 N N   . ALA A 1 332 ? 19.499  79.252 20.805  1.00 24.09 ?  332  ALA A N   1 
ATOM   2516 C CA  . ALA A 1 332 ? 20.932  79.373 20.973  1.00 23.35 ?  332  ALA A CA  1 
ATOM   2517 C C   . ALA A 1 332 ? 21.773  79.090 19.716  1.00 23.28 ?  332  ALA A C   1 
ATOM   2518 O O   . ALA A 1 332 ? 22.744  79.831 19.417  1.00 23.34 ?  332  ALA A O   1 
ATOM   2519 C CB  . ALA A 1 332 ? 21.415  78.491 22.149  1.00 23.47 ?  332  ALA A CB  1 
ATOM   2520 N N   . ILE A 1 333 ? 21.446  78.028 18.971  1.00 22.13 ?  333  ILE A N   1 
ATOM   2521 C CA  . ILE A 1 333 ? 22.304  77.700 17.836  1.00 21.06 ?  333  ILE A CA  1 
ATOM   2522 C C   . ILE A 1 333 ? 22.073  78.706 16.726  1.00 20.63 ?  333  ILE A C   1 
ATOM   2523 O O   . ILE A 1 333 ? 22.983  78.998 15.953  1.00 20.37 ?  333  ILE A O   1 
ATOM   2524 C CB  . ILE A 1 333 ? 22.193  76.205 17.342  1.00 21.53 ?  333  ILE A CB  1 
ATOM   2525 C CG1 . ILE A 1 333 ? 23.480  75.827 16.603  1.00 21.56 ?  333  ILE A CG1 1 
ATOM   2526 C CG2 . ILE A 1 333 ? 20.843  75.931 16.523  1.00 19.39 ?  333  ILE A CG2 1 
ATOM   2527 C CD1 . ILE A 1 333 ? 23.523  74.399 16.100  1.00 26.52 ?  333  ILE A CD1 1 
ATOM   2528 N N   . LEU A 1 334 ? 20.857  79.249 16.695  1.00 20.98 ?  334  LEU A N   1 
ATOM   2529 C CA  . LEU A 1 334 ? 20.453  80.232 15.712  1.00 21.72 ?  334  LEU A CA  1 
ATOM   2530 C C   . LEU A 1 334 ? 21.153  81.550 15.982  1.00 22.35 ?  334  LEU A C   1 
ATOM   2531 O O   . LEU A 1 334 ? 21.608  82.174 15.049  1.00 22.78 ?  334  LEU A O   1 
ATOM   2532 C CB  . LEU A 1 334 ? 18.943  80.409 15.715  1.00 21.83 ?  334  LEU A CB  1 
ATOM   2533 C CG  . LEU A 1 334 ? 18.071  79.848 14.563  1.00 23.91 ?  334  LEU A CG  1 
ATOM   2534 C CD1 . LEU A 1 334 ? 18.675  78.782 13.620  1.00 20.21 ?  334  LEU A CD1 1 
ATOM   2535 C CD2 . LEU A 1 334 ? 16.624  79.488 15.039  1.00 22.53 ?  334  LEU A CD2 1 
ATOM   2536 N N   . ALA A 1 335 ? 21.244  81.947 17.254  1.00 23.74 ?  335  ALA A N   1 
ATOM   2537 C CA  . ALA A 1 335 ? 22.045  83.111 17.682  1.00 25.56 ?  335  ALA A CA  1 
ATOM   2538 C C   . ALA A 1 335 ? 23.498  82.990 17.260  1.00 26.03 ?  335  ALA A C   1 
ATOM   2539 O O   . ALA A 1 335 ? 24.123  83.970 16.833  1.00 26.81 ?  335  ALA A O   1 
ATOM   2540 C CB  . ALA A 1 335 ? 21.983  83.287 19.206  1.00 25.88 ?  335  ALA A CB  1 
ATOM   2541 N N   . ALA A 1 336 ? 24.036  81.779 17.386  1.00 25.76 ?  336  ALA A N   1 
ATOM   2542 C CA  . ALA A 1 336 ? 25.428  81.565 17.110  1.00 25.79 ?  336  ALA A CA  1 
ATOM   2543 C C   . ALA A 1 336 ? 25.662  81.562 15.583  1.00 26.59 ?  336  ALA A C   1 
ATOM   2544 O O   . ALA A 1 336 ? 26.699  82.052 15.086  1.00 26.09 ?  336  ALA A O   1 
ATOM   2545 C CB  . ALA A 1 336 ? 25.907  80.256 17.788  1.00 24.35 ?  336  ALA A CB  1 
ATOM   2546 N N   . ALA A 1 337 ? 24.693  81.030 14.834  1.00 26.55 ?  337  ALA A N   1 
ATOM   2547 C CA  . ALA A 1 337 ? 24.810  81.032 13.379  1.00 27.31 ?  337  ALA A CA  1 
ATOM   2548 C C   . ALA A 1 337 ? 24.750  82.488 12.829  1.00 27.63 ?  337  ALA A C   1 
ATOM   2549 O O   . ALA A 1 337 ? 25.575  82.844 12.014  1.00 27.72 ?  337  ALA A O   1 
ATOM   2550 C CB  . ALA A 1 337 ? 23.755  80.161 12.753  1.00 26.07 ?  337  ALA A CB  1 
ATOM   2551 N N   . ASP A 1 338 ? 23.785  83.289 13.288  1.00 29.28 ?  338  ASP A N   1 
ATOM   2552 C CA  . ASP A 1 338 ? 23.704  84.737 13.005  1.00 30.72 ?  338  ASP A CA  1 
ATOM   2553 C C   . ASP A 1 338 ? 25.011  85.495 13.267  1.00 31.77 ?  338  ASP A C   1 
ATOM   2554 O O   . ASP A 1 338 ? 25.461  86.283 12.430  1.00 31.89 ?  338  ASP A O   1 
ATOM   2555 C CB  . ASP A 1 338 ? 22.586  85.382 13.828  1.00 31.12 ?  338  ASP A CB  1 
ATOM   2556 C CG  . ASP A 1 338 ? 21.190  84.973 13.360  1.00 33.80 ?  338  ASP A CG  1 
ATOM   2557 O OD1 . ASP A 1 338 ? 21.025  84.483 12.208  1.00 35.87 ?  338  ASP A OD1 1 
ATOM   2558 O OD2 . ASP A 1 338 ? 20.250  85.126 14.164  1.00 35.00 ?  338  ASP A OD2 1 
ATOM   2559 N N   . LYS A 1 339 ? 25.623  85.245 14.424  1.00 32.82 ?  339  LYS A N   1 
ATOM   2560 C CA  . LYS A 1 339 ? 26.845  85.939 14.827  1.00 32.70 ?  339  LYS A CA  1 
ATOM   2561 C C   . LYS A 1 339 ? 28.003  85.659 13.872  1.00 32.46 ?  339  LYS A C   1 
ATOM   2562 O O   . LYS A 1 339 ? 28.650  86.591 13.405  1.00 32.76 ?  339  LYS A O   1 
ATOM   2563 C CB  . LYS A 1 339 ? 27.213  85.550 16.259  1.00 33.37 ?  339  LYS A CB  1 
ATOM   2564 C CG  . LYS A 1 339 ? 28.316  86.403 16.911  1.00 36.11 ?  339  LYS A CG  1 
ATOM   2565 C CD  . LYS A 1 339 ? 28.537  85.996 18.396  1.00 39.24 ?  339  LYS A CD  1 
ATOM   2566 C CE  . LYS A 1 339 ? 29.980  86.257 18.911  1.00 40.66 ?  339  LYS A CE  1 
ATOM   2567 N NZ  . LYS A 1 339 ? 30.279  85.553 20.237  1.00 41.34 ?  339  LYS A NZ  1 
ATOM   2568 N N   . TRP A 1 340 ? 28.240  84.390 13.554  1.00 31.33 ?  340  TRP A N   1 
ATOM   2569 C CA  . TRP A 1 340 ? 29.463  83.988 12.870  1.00 30.86 ?  340  TRP A CA  1 
ATOM   2570 C C   . TRP A 1 340 ? 29.302  83.689 11.396  1.00 30.01 ?  340  TRP A C   1 
ATOM   2571 O O   . TRP A 1 340 ? 30.278  83.748 10.666  1.00 30.74 ?  340  TRP A O   1 
ATOM   2572 C CB  . TRP A 1 340 ? 30.103  82.772 13.576  1.00 32.73 ?  340  TRP A CB  1 
ATOM   2573 C CG  . TRP A 1 340 ? 30.521  83.113 14.964  1.00 34.77 ?  340  TRP A CG  1 
ATOM   2574 C CD1 . TRP A 1 340 ? 29.850  82.837 16.113  1.00 37.67 ?  340  TRP A CD1 1 
ATOM   2575 C CD2 . TRP A 1 340 ? 31.686  83.867 15.345  1.00 37.59 ?  340  TRP A CD2 1 
ATOM   2576 N NE1 . TRP A 1 340 ? 30.530  83.364 17.198  1.00 39.75 ?  340  TRP A NE1 1 
ATOM   2577 C CE2 . TRP A 1 340 ? 31.662  83.993 16.752  1.00 39.23 ?  340  TRP A CE2 1 
ATOM   2578 C CE3 . TRP A 1 340 ? 32.759  84.433 14.628  1.00 38.48 ?  340  TRP A CE3 1 
ATOM   2579 C CZ2 . TRP A 1 340 ? 32.663  84.673 17.465  1.00 39.30 ?  340  TRP A CZ2 1 
ATOM   2580 C CZ3 . TRP A 1 340 ? 33.766  85.105 15.337  1.00 39.15 ?  340  TRP A CZ3 1 
ATOM   2581 C CH2 . TRP A 1 340 ? 33.704  85.224 16.740  1.00 38.46 ?  340  TRP A CH2 1 
ATOM   2582 N N   . LEU A 1 341 ? 28.110  83.299 10.961  1.00 27.84 ?  341  LEU A N   1 
ATOM   2583 C CA  . LEU A 1 341 ? 27.953  82.769 9.604   1.00 27.67 ?  341  LEU A CA  1 
ATOM   2584 C C   . LEU A 1 341 ? 27.155  83.673 8.651   1.00 27.22 ?  341  LEU A C   1 
ATOM   2585 O O   . LEU A 1 341 ? 26.900  83.312 7.498   1.00 25.63 ?  341  LEU A O   1 
ATOM   2586 C CB  . LEU A 1 341 ? 27.307  81.376 9.646   1.00 27.93 ?  341  LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 341 ? 28.150  80.094 9.716   1.00 29.82 ?  341  LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 341 ? 29.556  80.217 10.311  1.00 26.66 ?  341  LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 341 ? 27.310  78.999 10.418  1.00 29.25 ?  341  LEU A CD2 1 
ATOM   2590 N N   . THR A 1 342 ? 26.741  84.841 9.126   1.00 28.10 ?  342  THR A N   1 
ATOM   2591 C CA  . THR A 1 342 ? 26.006  85.742 8.241   1.00 29.43 ?  342  THR A CA  1 
ATOM   2592 C C   . THR A 1 342 ? 26.844  86.064 6.975   1.00 29.00 ?  342  THR A C   1 
ATOM   2593 O O   . THR A 1 342 ? 28.019  86.359 7.074   1.00 29.46 ?  342  THR A O   1 
ATOM   2594 C CB  . THR A 1 342 ? 25.470  86.929 9.026   1.00 30.20 ?  342  THR A CB  1 
ATOM   2595 O OG1 . THR A 1 342 ? 24.515  86.411 9.976   1.00 31.76 ?  342  THR A OG1 1 
ATOM   2596 C CG2 . THR A 1 342 ? 24.780  87.963 8.105   1.00 30.09 ?  342  THR A CG2 1 
ATOM   2597 N N   . GLY A 1 343 ? 26.250  85.876 5.799   1.00 28.15 ?  343  GLY A N   1 
ATOM   2598 C CA  . GLY A 1 343 ? 26.927  86.070 4.517   1.00 26.64 ?  343  GLY A CA  1 
ATOM   2599 C C   . GLY A 1 343 ? 27.898  84.979 4.050   1.00 26.43 ?  343  GLY A C   1 
ATOM   2600 O O   . GLY A 1 343 ? 28.389  85.045 2.906   1.00 24.93 ?  343  GLY A O   1 
ATOM   2601 N N   . LEU A 1 344 ? 28.155  83.977 4.906   1.00 24.88 ?  344  LEU A N   1 
ATOM   2602 C CA  . LEU A 1 344 ? 29.039  82.847 4.570   1.00 25.25 ?  344  LEU A CA  1 
ATOM   2603 C C   . LEU A 1 344 ? 28.298  81.515 4.309   1.00 26.03 ?  344  LEU A C   1 
ATOM   2604 O O   . LEU A 1 344 ? 28.864  80.588 3.723   1.00 25.88 ?  344  LEU A O   1 
ATOM   2605 C CB  . LEU A 1 344 ? 30.072  82.618 5.703   1.00 25.50 ?  344  LEU A CB  1 
ATOM   2606 C CG  . LEU A 1 344 ? 31.014  83.784 6.051   1.00 25.59 ?  344  LEU A CG  1 
ATOM   2607 C CD1 . LEU A 1 344 ? 31.939  83.424 7.230   1.00 25.24 ?  344  LEU A CD1 1 
ATOM   2608 C CD2 . LEU A 1 344 ? 31.805  84.200 4.829   1.00 23.85 ?  344  LEU A CD2 1 
ATOM   2609 N N   . ALA A 1 345 ? 27.048  81.429 4.775   1.00 26.03 ?  345  ALA A N   1 
ATOM   2610 C CA  . ALA A 1 345 ? 26.248  80.211 4.719   1.00 26.54 ?  345  ALA A CA  1 
ATOM   2611 C C   . ALA A 1 345 ? 24.747  80.583 4.709   1.00 27.22 ?  345  ALA A C   1 
ATOM   2612 O O   . ALA A 1 345 ? 24.369  81.688 5.156   1.00 27.52 ?  345  ALA A O   1 
ATOM   2613 C CB  . ALA A 1 345 ? 26.555  79.310 5.945   1.00 24.87 ?  345  ALA A CB  1 
ATOM   2614 N N   . GLU A 1 346 ? 23.911  79.644 4.252   1.00 27.07 ?  346  GLU A N   1 
ATOM   2615 C CA  . GLU A 1 346 ? 22.451  79.794 4.345   1.00 27.92 ?  346  GLU A CA  1 
ATOM   2616 C C   . GLU A 1 346 ? 21.785  78.651 5.116   1.00 26.43 ?  346  GLU A C   1 
ATOM   2617 O O   . GLU A 1 346 ? 22.199  77.478 5.019   1.00 24.78 ?  346  GLU A O   1 
ATOM   2618 C CB  . GLU A 1 346 ? 21.778  80.068 2.980   1.00 26.68 ?  346  GLU A CB  1 
ATOM   2619 C CG  . GLU A 1 346 ? 22.310  79.305 1.812   1.00 31.03 ?  346  GLU A CG  1 
ATOM   2620 C CD  . GLU A 1 346 ? 21.564  79.590 0.479   1.00 34.67 ?  346  GLU A CD  1 
ATOM   2621 O OE1 . GLU A 1 346 ? 20.296  79.714 0.476   1.00 39.35 ?  346  GLU A OE1 1 
ATOM   2622 O OE2 . GLU A 1 346 ? 22.277  79.676 -0.574  1.00 42.19 ?  346  GLU A OE2 1 
ATOM   2623 N N   . TRP A 1 347 ? 20.789  79.018 5.928   1.00 25.74 ?  347  TRP A N   1 
ATOM   2624 C CA  . TRP A 1 347 ? 20.041  78.031 6.722   1.00 25.93 ?  347  TRP A CA  1 
ATOM   2625 C C   . TRP A 1 347 ? 18.620  78.511 6.935   1.00 25.66 ?  347  TRP A C   1 
ATOM   2626 O O   . TRP A 1 347 ? 18.381  79.732 7.001   1.00 25.31 ?  347  TRP A O   1 
ATOM   2627 C CB  . TRP A 1 347 ? 20.736  77.783 8.077   1.00 24.88 ?  347  TRP A CB  1 
ATOM   2628 C CG  . TRP A 1 347 ? 20.791  78.986 8.938   1.00 25.20 ?  347  TRP A CG  1 
ATOM   2629 C CD1 . TRP A 1 347 ? 19.885  79.366 9.889   1.00 26.43 ?  347  TRP A CD1 1 
ATOM   2630 C CD2 . TRP A 1 347 ? 21.789  80.004 8.912   1.00 26.60 ?  347  TRP A CD2 1 
ATOM   2631 N NE1 . TRP A 1 347 ? 20.273  80.561 10.473  1.00 26.89 ?  347  TRP A NE1 1 
ATOM   2632 C CE2 . TRP A 1 347 ? 21.444  80.964 9.888   1.00 26.55 ?  347  TRP A CE2 1 
ATOM   2633 C CE3 . TRP A 1 347 ? 22.967  80.182 8.178   1.00 27.50 ?  347  TRP A CE3 1 
ATOM   2634 C CZ2 . TRP A 1 347 ? 22.208  82.113 10.115  1.00 26.06 ?  347  TRP A CZ2 1 
ATOM   2635 C CZ3 . TRP A 1 347 ? 23.731  81.324 8.416   1.00 27.68 ?  347  TRP A CZ3 1 
ATOM   2636 C CH2 . TRP A 1 347 ? 23.343  82.273 9.382   1.00 26.43 ?  347  TRP A CH2 1 
ATOM   2637 N N   . HIS A 1 348 ? 17.690  77.557 7.031   1.00 24.96 ?  348  HIS A N   1 
ATOM   2638 C CA  . HIS A 1 348 ? 16.324  77.837 7.486   1.00 25.20 ?  348  HIS A CA  1 
ATOM   2639 C C   . HIS A 1 348 ? 16.162  77.474 8.972   1.00 24.52 ?  348  HIS A C   1 
ATOM   2640 O O   . HIS A 1 348 ? 16.876  76.626 9.487   1.00 24.01 ?  348  HIS A O   1 
ATOM   2641 C CB  . HIS A 1 348 ? 15.314  77.054 6.626   1.00 25.16 ?  348  HIS A CB  1 
ATOM   2642 C CG  . HIS A 1 348 ? 15.507  77.258 5.155   1.00 26.76 ?  348  HIS A CG  1 
ATOM   2643 N ND1 . HIS A 1 348 ? 15.035  78.368 4.492   1.00 26.22 ?  348  HIS A ND1 1 
ATOM   2644 C CD2 . HIS A 1 348 ? 16.126  76.499 4.220   1.00 29.63 ?  348  HIS A CD2 1 
ATOM   2645 C CE1 . HIS A 1 348 ? 15.348  78.286 3.212   1.00 30.05 ?  348  HIS A CE1 1 
ATOM   2646 N NE2 . HIS A 1 348 ? 16.006  77.157 3.019   1.00 31.63 ?  348  HIS A NE2 1 
ATOM   2647 N N   . VAL A 1 349 ? 15.252  78.163 9.645   1.00 23.29 ?  349  VAL A N   1 
ATOM   2648 C CA  . VAL A 1 349 ? 14.852  77.915 11.020  1.00 23.54 ?  349  VAL A CA  1 
ATOM   2649 C C   . VAL A 1 349 ? 14.114  76.544 11.101  1.00 23.66 ?  349  VAL A C   1 
ATOM   2650 O O   . VAL A 1 349 ? 13.098  76.330 10.410  1.00 23.42 ?  349  VAL A O   1 
ATOM   2651 C CB  . VAL A 1 349 ? 13.955  79.085 11.544  1.00 24.36 ?  349  VAL A CB  1 
ATOM   2652 C CG1 . VAL A 1 349 ? 13.369  78.787 12.926  1.00 25.32 ?  349  VAL A CG1 1 
ATOM   2653 C CG2 . VAL A 1 349 ? 14.762  80.425 11.602  1.00 23.66 ?  349  VAL A CG2 1 
ATOM   2654 N N   . PRO A 1 350 ? 14.642  75.612 11.904  1.00 22.67 ?  350  PRO A N   1 
ATOM   2655 C CA  . PRO A 1 350 ? 13.951  74.323 12.004  1.00 23.84 ?  350  PRO A CA  1 
ATOM   2656 C C   . PRO A 1 350 ? 12.628  74.443 12.734  1.00 23.90 ?  350  PRO A C   1 
ATOM   2657 O O   . PRO A 1 350 ? 12.502  75.200 13.702  1.00 24.89 ?  350  PRO A O   1 
ATOM   2658 C CB  . PRO A 1 350 ? 14.916  73.427 12.783  1.00 23.58 ?  350  PRO A CB  1 
ATOM   2659 C CG  . PRO A 1 350 ? 15.941  74.329 13.404  1.00 23.12 ?  350  PRO A CG  1 
ATOM   2660 C CD  . PRO A 1 350 ? 15.866  75.683 12.724  1.00 23.61 ?  350  PRO A CD  1 
ATOM   2661 N N   . ALA A 1 351 ? 11.634  73.703 12.274  1.00 23.98 ?  351  ALA A N   1 
ATOM   2662 C CA  . ALA A 1 351 ? 10.343  73.719 12.960  1.00 23.37 ?  351  ALA A CA  1 
ATOM   2663 C C   . ALA A 1 351 ? 10.204  72.664 14.052  1.00 22.68 ?  351  ALA A C   1 
ATOM   2664 O O   . ALA A 1 351 ? 9.287   72.720 14.870  1.00 23.00 ?  351  ALA A O   1 
ATOM   2665 C CB  . ALA A 1 351 ? 9.188   73.595 11.928  1.00 24.65 ?  351  ALA A CB  1 
ATOM   2666 N N   . ALA A 1 352 ? 11.092  71.696 14.070  1.00 22.58 ?  352  ALA A N   1 
ATOM   2667 C CA  . ALA A 1 352 ? 10.975  70.582 14.975  1.00 22.33 ?  352  ALA A CA  1 
ATOM   2668 C C   . ALA A 1 352 ? 12.274  69.871 14.897  1.00 22.74 ?  352  ALA A C   1 
ATOM   2669 O O   . ALA A 1 352 ? 13.082  70.120 14.007  1.00 22.57 ?  352  ALA A O   1 
ATOM   2670 C CB  . ALA A 1 352 ? 9.853   69.627 14.528  1.00 22.53 ?  352  ALA A CB  1 
ATOM   2671 N N   . GLY A 1 353 ? 12.458  68.928 15.804  1.00 24.39 ?  353  GLY A N   1 
ATOM   2672 C CA  . GLY A 1 353 ? 13.651  68.083 15.760  1.00 25.05 ?  353  GLY A CA  1 
ATOM   2673 C C   . GLY A 1 353 ? 14.857  68.691 16.451  1.00 24.86 ?  353  GLY A C   1 
ATOM   2674 O O   . GLY A 1 353 ? 14.709  69.488 17.359  1.00 25.83 ?  353  GLY A O   1 
ATOM   2675 N N   . MET A 1 354 ? 16.044  68.292 16.036  1.00 24.56 ?  354  MET A N   1 
ATOM   2676 C CA  . MET A 1 354 ? 17.237  68.616 16.783  1.00 26.84 ?  354  MET A CA  1 
ATOM   2677 C C   . MET A 1 354 ? 18.398  69.050 15.911  1.00 24.27 ?  354  MET A C   1 
ATOM   2678 O O   . MET A 1 354 ? 19.514  69.190 16.403  1.00 23.45 ?  354  MET A O   1 
ATOM   2679 C CB  . MET A 1 354 ? 17.630  67.487 17.777  1.00 26.83 ?  354  MET A CB  1 
ATOM   2680 C CG  . MET A 1 354 ? 17.712  66.073 17.224  1.00 30.27 ?  354  MET A CG  1 
ATOM   2681 S SD  . MET A 1 354 ? 17.844  64.760 18.516  1.00 35.08 ?  354  MET A SD  1 
ATOM   2682 C CE  . MET A 1 354 ? 16.657  65.345 19.677  1.00 34.42 ?  354  MET A CE  1 
ATOM   2683 N N   . PHE A 1 355 ? 18.122  69.311 14.635  1.00 23.46 ?  355  PHE A N   1 
ATOM   2684 C CA  . PHE A 1 355 ? 19.196  69.582 13.676  1.00 23.37 ?  355  PHE A CA  1 
ATOM   2685 C C   . PHE A 1 355 ? 19.034  70.938 12.967  1.00 23.28 ?  355  PHE A C   1 
ATOM   2686 O O   . PHE A 1 355 ? 17.925  71.361 12.642  1.00 23.97 ?  355  PHE A O   1 
ATOM   2687 C CB  . PHE A 1 355 ? 19.338  68.425 12.669  1.00 22.24 ?  355  PHE A CB  1 
ATOM   2688 C CG  . PHE A 1 355 ? 19.495  67.055 13.326  1.00 24.01 ?  355  PHE A CG  1 
ATOM   2689 C CD1 . PHE A 1 355 ? 20.681  66.696 13.960  1.00 21.23 ?  355  PHE A CD1 1 
ATOM   2690 C CD2 . PHE A 1 355 ? 18.454  66.139 13.309  1.00 20.68 ?  355  PHE A CD2 1 
ATOM   2691 C CE1 . PHE A 1 355 ? 20.812  65.437 14.567  1.00 23.92 ?  355  PHE A CE1 1 
ATOM   2692 C CE2 . PHE A 1 355 ? 18.574  64.903 13.919  1.00 23.41 ?  355  PHE A CE2 1 
ATOM   2693 C CZ  . PHE A 1 355 ? 19.763  64.542 14.560  1.00 20.58 ?  355  PHE A CZ  1 
ATOM   2694 N N   . LEU A 1 356 ? 20.161  71.613 12.751  1.00 23.64 ?  356  LEU A N   1 
ATOM   2695 C CA  . LEU A 1 356 ? 20.267  72.742 11.825  1.00 22.25 ?  356  LEU A CA  1 
ATOM   2696 C C   . LEU A 1 356 ? 21.023  72.306 10.569  1.00 21.86 ?  356  LEU A C   1 
ATOM   2697 O O   . LEU A 1 356 ? 22.103  71.734 10.668  1.00 21.93 ?  356  LEU A O   1 
ATOM   2698 C CB  . LEU A 1 356 ? 21.049  73.881 12.496  1.00 22.35 ?  356  LEU A CB  1 
ATOM   2699 C CG  . LEU A 1 356 ? 21.079  75.224 11.746  1.00 22.35 ?  356  LEU A CG  1 
ATOM   2700 C CD1 . LEU A 1 356 ? 19.669  75.878 11.560  1.00 20.87 ?  356  LEU A CD1 1 
ATOM   2701 C CD2 . LEU A 1 356 ? 22.047  76.231 12.420  1.00 24.11 ?  356  LEU A CD2 1 
ATOM   2702 N N   . TRP A 1 357 ? 20.503  72.615 9.386   1.00 19.88 ?  357  TRP A N   1 
ATOM   2703 C CA  . TRP A 1 357 ? 21.165  72.190 8.142   1.00 19.76 ?  357  TRP A CA  1 
ATOM   2704 C C   . TRP A 1 357 ? 21.724  73.445 7.443   1.00 20.86 ?  357  TRP A C   1 
ATOM   2705 O O   . TRP A 1 357 ? 20.978  74.374 7.092   1.00 20.42 ?  357  TRP A O   1 
ATOM   2706 C CB  . TRP A 1 357 ? 20.103  71.500 7.293   1.00 17.68 ?  357  TRP A CB  1 
ATOM   2707 C CG  . TRP A 1 357 ? 20.381  70.972 5.958   1.00 15.21 ?  357  TRP A CG  1 
ATOM   2708 C CD1 . TRP A 1 357 ? 19.748  71.348 4.796   1.00 14.74 ?  357  TRP A CD1 1 
ATOM   2709 C CD2 . TRP A 1 357 ? 21.209  69.841 5.617   1.00 14.43 ?  357  TRP A CD2 1 
ATOM   2710 N NE1 . TRP A 1 357 ? 20.183  70.555 3.746   1.00 17.19 ?  357  TRP A NE1 1 
ATOM   2711 C CE2 . TRP A 1 357 ? 21.070  69.622 4.235   1.00 17.50 ?  357  TRP A CE2 1 
ATOM   2712 C CE3 . TRP A 1 357 ? 22.054  68.982 6.359   1.00 15.29 ?  357  TRP A CE3 1 
ATOM   2713 C CZ2 . TRP A 1 357 ? 21.763  68.618 3.576   1.00 17.35 ?  357  TRP A CZ2 1 
ATOM   2714 C CZ3 . TRP A 1 357 ? 22.741  68.001 5.684   1.00 14.71 ?  357  TRP A CZ3 1 
ATOM   2715 C CH2 . TRP A 1 357 ? 22.577  67.816 4.326   1.00 15.43 ?  357  TRP A CH2 1 
ATOM   2716 N N   . ILE A 1 358 ? 23.031  73.458 7.213   1.00 21.35 ?  358  ILE A N   1 
ATOM   2717 C CA  . ILE A 1 358 ? 23.714  74.685 6.836   1.00 21.94 ?  358  ILE A CA  1 
ATOM   2718 C C   . ILE A 1 358 ? 24.333  74.511 5.452   1.00 21.70 ?  358  ILE A C   1 
ATOM   2719 O O   . ILE A 1 358 ? 25.115  73.608 5.262   1.00 21.78 ?  358  ILE A O   1 
ATOM   2720 C CB  . ILE A 1 358 ? 24.804  75.008 7.877   1.00 22.07 ?  358  ILE A CB  1 
ATOM   2721 C CG1 . ILE A 1 358 ? 24.167  75.172 9.266   1.00 23.74 ?  358  ILE A CG1 1 
ATOM   2722 C CG2 . ILE A 1 358 ? 25.602  76.266 7.473   1.00 23.02 ?  358  ILE A CG2 1 
ATOM   2723 C CD1 . ILE A 1 358 ? 25.174  75.144 10.445  1.00 29.06 ?  358  ILE A CD1 1 
ATOM   2724 N N   . LYS A 1 359 ? 24.007  75.379 4.492   1.00 21.92 ?  359  LYS A N   1 
ATOM   2725 C CA  . LYS A 1 359 ? 24.664  75.349 3.164   1.00 22.97 ?  359  LYS A CA  1 
ATOM   2726 C C   . LYS A 1 359 ? 25.803  76.359 3.161   1.00 23.19 ?  359  LYS A C   1 
ATOM   2727 O O   . LYS A 1 359 ? 25.576  77.537 3.337   1.00 24.19 ?  359  LYS A O   1 
ATOM   2728 C CB  . LYS A 1 359 ? 23.675  75.700 2.062   1.00 23.61 ?  359  LYS A CB  1 
ATOM   2729 C CG  . LYS A 1 359 ? 24.204  75.543 0.645   1.00 25.61 ?  359  LYS A CG  1 
ATOM   2730 C CD  . LYS A 1 359 ? 23.065  75.785 -0.299  1.00 31.85 ?  359  LYS A CD  1 
ATOM   2731 C CE  . LYS A 1 359 ? 23.535  76.147 -1.696  1.00 36.91 ?  359  LYS A CE  1 
ATOM   2732 N NZ  . LYS A 1 359 ? 23.944  74.947 -2.389  1.00 37.19 ?  359  LYS A NZ  1 
ATOM   2733 N N   . VAL A 1 360 ? 27.027  75.898 2.967   1.00 24.17 ?  360  VAL A N   1 
ATOM   2734 C CA  . VAL A 1 360 ? 28.184  76.813 2.936   1.00 24.79 ?  360  VAL A CA  1 
ATOM   2735 C C   . VAL A 1 360 ? 28.284  77.455 1.547   1.00 25.95 ?  360  VAL A C   1 
ATOM   2736 O O   . VAL A 1 360 ? 28.138  76.777 0.532   1.00 24.90 ?  360  VAL A O   1 
ATOM   2737 C CB  . VAL A 1 360 ? 29.471  76.071 3.322   1.00 24.91 ?  360  VAL A CB  1 
ATOM   2738 C CG1 . VAL A 1 360 ? 30.700  76.958 3.139   1.00 25.53 ?  360  VAL A CG1 1 
ATOM   2739 C CG2 . VAL A 1 360 ? 29.388  75.642 4.767   1.00 23.71 ?  360  VAL A CG2 1 
ATOM   2740 N N   . LYS A 1 361 ? 28.518  78.764 1.485   1.00 27.82 ?  361  LYS A N   1 
ATOM   2741 C CA  . LYS A 1 361 ? 28.465  79.436 0.184   1.00 29.89 ?  361  LYS A CA  1 
ATOM   2742 C C   . LYS A 1 361 ? 29.863  79.380 -0.433  1.00 31.78 ?  361  LYS A C   1 
ATOM   2743 O O   . LYS A 1 361 ? 30.848  79.423 0.280   1.00 31.64 ?  361  LYS A O   1 
ATOM   2744 C CB  . LYS A 1 361 ? 27.979  80.885 0.347   1.00 30.18 ?  361  LYS A CB  1 
ATOM   2745 C CG  . LYS A 1 361 ? 26.500  81.038 0.687   1.00 30.79 ?  361  LYS A CG  1 
ATOM   2746 C CD  . LYS A 1 361 ? 26.126  82.496 0.999   1.00 34.38 ?  361  LYS A CD  1 
ATOM   2747 C CE  . LYS A 1 361 ? 24.636  82.759 0.675   1.00 34.35 ?  361  LYS A CE  1 
ATOM   2748 N NZ  . LYS A 1 361 ? 23.851  82.612 1.898   1.00 38.95 ?  361  LYS A NZ  1 
ATOM   2749 N N   . GLY A 1 362 ? 29.946  79.245 -1.752  1.00 33.93 ?  362  GLY A N   1 
ATOM   2750 C CA  . GLY A 1 362 ? 31.228  79.356 -2.438  1.00 36.66 ?  362  GLY A CA  1 
ATOM   2751 C C   . GLY A 1 362 ? 32.092  78.107 -2.412  1.00 38.59 ?  362  GLY A C   1 
ATOM   2752 O O   . GLY A 1 362 ? 33.140  78.055 -3.080  1.00 38.73 ?  362  GLY A O   1 
ATOM   2753 N N   . ILE A 1 363 ? 31.680  77.099 -1.648  1.00 39.47 ?  363  ILE A N   1 
ATOM   2754 C CA  . ILE A 1 363 ? 32.404  75.820 -1.666  1.00 41.23 ?  363  ILE A CA  1 
ATOM   2755 C C   . ILE A 1 363 ? 31.523  74.687 -2.222  1.00 42.02 ?  363  ILE A C   1 
ATOM   2756 O O   . ILE A 1 363 ? 30.333  74.601 -1.912  1.00 41.96 ?  363  ILE A O   1 
ATOM   2757 C CB  . ILE A 1 363 ? 33.028  75.480 -0.300  1.00 41.13 ?  363  ILE A CB  1 
ATOM   2758 C CG1 . ILE A 1 363 ? 34.038  76.558 0.084   1.00 40.72 ?  363  ILE A CG1 1 
ATOM   2759 C CG2 . ILE A 1 363 ? 33.770  74.148 -0.369  1.00 42.60 ?  363  ILE A CG2 1 
ATOM   2760 C CD1 . ILE A 1 363 ? 34.051  76.895 1.565   1.00 39.85 ?  363  ILE A CD1 1 
ATOM   2761 N N   . ASN A 1 364 ? 32.112  73.840 -3.058  1.00 42.92 ?  364  ASN A N   1 
ATOM   2762 C CA  . ASN A 1 364 ? 31.343  72.805 -3.750  1.00 44.36 ?  364  ASN A CA  1 
ATOM   2763 C C   . ASN A 1 364 ? 31.164  71.548 -2.922  1.00 44.33 ?  364  ASN A C   1 
ATOM   2764 O O   . ASN A 1 364 ? 30.148  70.866 -3.030  1.00 43.79 ?  364  ASN A O   1 
ATOM   2765 C CB  . ASN A 1 364 ? 31.957  72.500 -5.112  1.00 44.74 ?  364  ASN A CB  1 
ATOM   2766 C CG  . ASN A 1 364 ? 32.019  73.737 -5.995  1.00 47.10 ?  364  ASN A CG  1 
ATOM   2767 O OD1 . ASN A 1 364 ? 32.975  74.515 -5.924  1.00 49.98 ?  364  ASN A OD1 1 
ATOM   2768 N ND2 . ASN A 1 364 ? 30.992  73.936 -6.817  1.00 48.01 ?  364  ASN A ND2 1 
ATOM   2769 N N   . ASP A 1 365 ? 32.163  71.262 -2.093  1.00 44.92 ?  365  ASP A N   1 
ATOM   2770 C CA  . ASP A 1 365 ? 32.119  70.140 -1.167  1.00 45.58 ?  365  ASP A CA  1 
ATOM   2771 C C   . ASP A 1 365 ? 32.861  70.487 0.109   1.00 45.57 ?  365  ASP A C   1 
ATOM   2772 O O   . ASP A 1 365 ? 34.028  70.862 0.073   1.00 44.50 ?  365  ASP A O   1 
ATOM   2773 C CB  . ASP A 1 365 ? 32.731  68.873 -1.765  1.00 46.00 ?  365  ASP A CB  1 
ATOM   2774 C CG  . ASP A 1 365 ? 32.747  67.723 -0.761  1.00 48.03 ?  365  ASP A CG  1 
ATOM   2775 O OD1 . ASP A 1 365 ? 33.845  67.439 -0.240  1.00 48.49 ?  365  ASP A OD1 1 
ATOM   2776 O OD2 . ASP A 1 365 ? 31.657  67.149 -0.443  1.00 50.01 ?  365  ASP A OD2 1 
ATOM   2777 N N   . VAL A 1 366 ? 32.175  70.330 1.235   1.00 46.27 ?  366  VAL A N   1 
ATOM   2778 C CA  . VAL A 1 366 ? 32.720  70.716 2.525   1.00 47.34 ?  366  VAL A CA  1 
ATOM   2779 C C   . VAL A 1 366 ? 33.420  69.571 3.235   1.00 48.46 ?  366  VAL A C   1 
ATOM   2780 O O   . VAL A 1 366 ? 34.046  69.765 4.284   1.00 48.18 ?  366  VAL A O   1 
ATOM   2781 C CB  . VAL A 1 366 ? 31.642  71.324 3.440   1.00 46.86 ?  366  VAL A CB  1 
ATOM   2782 C CG1 . VAL A 1 366 ? 31.273  72.722 2.942   1.00 47.89 ?  366  VAL A CG1 1 
ATOM   2783 C CG2 . VAL A 1 366 ? 30.416  70.416 3.552   1.00 46.61 ?  366  VAL A CG2 1 
ATOM   2784 N N   . LYS A 1 367 ? 33.315  68.382 2.659   1.00 50.29 ?  367  LYS A N   1 
ATOM   2785 C CA  . LYS A 1 367 ? 33.839  67.185 3.305   1.00 52.58 ?  367  LYS A CA  1 
ATOM   2786 C C   . LYS A 1 367 ? 35.338  67.291 3.598   1.00 54.20 ?  367  LYS A C   1 
ATOM   2787 O O   . LYS A 1 367 ? 35.762  66.855 4.662   1.00 54.70 ?  367  LYS A O   1 
ATOM   2788 C CB  . LYS A 1 367 ? 33.501  65.927 2.510   1.00 52.55 ?  367  LYS A CB  1 
ATOM   2789 C CG  . LYS A 1 367 ? 33.282  64.713 3.389   1.00 53.67 ?  367  LYS A CG  1 
ATOM   2790 C CD  . LYS A 1 367 ? 32.735  63.533 2.614   1.00 54.68 ?  367  LYS A CD  1 
ATOM   2791 C CE  . LYS A 1 367 ? 33.795  62.901 1.740   1.00 55.57 ?  367  LYS A CE  1 
ATOM   2792 N NZ  . LYS A 1 367 ? 33.245  61.712 1.035   1.00 57.78 ?  367  LYS A NZ  1 
ATOM   2793 N N   . GLU A 1 368 ? 36.122  67.891 2.683   1.00 55.92 ?  368  GLU A N   1 
ATOM   2794 C CA  . GLU A 1 368 ? 37.521  68.273 2.988   1.00 57.74 ?  368  GLU A CA  1 
ATOM   2795 C C   . GLU A 1 368 ? 37.599  69.121 4.256   1.00 58.22 ?  368  GLU A C   1 
ATOM   2796 O O   . GLU A 1 368 ? 38.344  68.802 5.184   1.00 58.39 ?  368  GLU A O   1 
ATOM   2797 C CB  . GLU A 1 368 ? 38.183  69.057 1.839   1.00 57.88 ?  368  GLU A CB  1 
ATOM   2798 C CG  . GLU A 1 368 ? 39.737  68.967 1.871   1.00 60.03 ?  368  GLU A CG  1 
ATOM   2799 C CD  . GLU A 1 368 ? 40.485  70.255 1.455   1.00 61.57 ?  368  GLU A CD  1 
ATOM   2800 O OE1 . GLU A 1 368 ? 41.308  70.758 2.272   1.00 60.25 ?  368  GLU A OE1 1 
ATOM   2801 O OE2 . GLU A 1 368 ? 40.264  70.754 0.321   1.00 61.62 ?  368  GLU A OE2 1 
ATOM   2802 N N   . LEU A 1 369 ? 36.808  70.193 4.273   1.00 59.09 ?  369  LEU A N   1 
ATOM   2803 C CA  . LEU A 1 369 ? 36.872  71.234 5.300   1.00 59.93 ?  369  LEU A CA  1 
ATOM   2804 C C   . LEU A 1 369 ? 36.422  70.770 6.693   1.00 60.55 ?  369  LEU A C   1 
ATOM   2805 O O   . LEU A 1 369 ? 36.977  71.197 7.709   1.00 60.25 ?  369  LEU A O   1 
ATOM   2806 C CB  . LEU A 1 369 ? 36.073  72.468 4.832   1.00 59.93 ?  369  LEU A CB  1 
ATOM   2807 C CG  . LEU A 1 369 ? 35.962  73.777 5.627   1.00 59.35 ?  369  LEU A CG  1 
ATOM   2808 C CD1 . LEU A 1 369 ? 35.371  74.845 4.737   1.00 59.92 ?  369  LEU A CD1 1 
ATOM   2809 C CD2 . LEU A 1 369 ? 35.117  73.649 6.878   1.00 58.95 ?  369  LEU A CD2 1 
ATOM   2810 N N   . ILE A 1 370 ? 35.414  69.907 6.753   1.00 61.74 ?  370  ILE A N   1 
ATOM   2811 C CA  . ILE A 1 370 ? 34.965  69.440 8.063   1.00 62.85 ?  370  ILE A CA  1 
ATOM   2812 C C   . ILE A 1 370 ? 35.684  68.165 8.495   1.00 63.87 ?  370  ILE A C   1 
ATOM   2813 O O   . ILE A 1 370 ? 36.371  68.167 9.521   1.00 64.50 ?  370  ILE A O   1 
ATOM   2814 C CB  . ILE A 1 370 ? 33.401  69.388 8.218   1.00 62.48 ?  370  ILE A CB  1 
ATOM   2815 C CG1 . ILE A 1 370 ? 32.974  69.573 9.690   1.00 62.46 ?  370  ILE A CG1 1 
ATOM   2816 C CG2 . ILE A 1 370 ? 32.784  68.170 7.539   1.00 62.05 ?  370  ILE A CG2 1 
ATOM   2817 C CD1 . ILE A 1 370 ? 33.671  68.677 10.730  1.00 60.92 ?  370  ILE A CD1 1 
ATOM   2818 N N   . GLU A 1 371 ? 35.569  67.100 7.704   1.00 65.01 ?  371  GLU A N   1 
ATOM   2819 C CA  . GLU A 1 371 ? 36.134  65.791 8.076   1.00 66.07 ?  371  GLU A CA  1 
ATOM   2820 C C   . GLU A 1 371 ? 37.650  65.813 8.336   1.00 66.39 ?  371  GLU A C   1 
ATOM   2821 O O   . GLU A 1 371 ? 38.191  64.867 8.926   1.00 66.83 ?  371  GLU A O   1 
ATOM   2822 C CB  . GLU A 1 371 ? 35.789  64.725 7.024   1.00 66.18 ?  371  GLU A CB  1 
ATOM   2823 C CG  . GLU A 1 371 ? 34.492  63.953 7.263   1.00 66.91 ?  371  GLU A CG  1 
ATOM   2824 C CD  . GLU A 1 371 ? 34.223  62.913 6.168   1.00 69.34 ?  371  GLU A CD  1 
ATOM   2825 O OE1 . GLU A 1 371 ? 35.159  62.617 5.376   1.00 69.68 ?  371  GLU A OE1 1 
ATOM   2826 O OE2 . GLU A 1 371 ? 33.076  62.395 6.092   1.00 69.09 ?  371  GLU A OE2 1 
ATOM   2827 N N   . GLU A 1 372 ? 38.324  66.887 7.912   1.00 66.79 ?  372  GLU A N   1 
ATOM   2828 C CA  . GLU A 1 372 ? 39.778  67.028 8.095   1.00 66.97 ?  372  GLU A CA  1 
ATOM   2829 C C   . GLU A 1 372 ? 40.233  68.303 8.823   1.00 66.93 ?  372  GLU A C   1 
ATOM   2830 O O   . GLU A 1 372 ? 40.827  68.213 9.901   1.00 67.12 ?  372  GLU A O   1 
ATOM   2831 C CB  . GLU A 1 372 ? 40.507  66.913 6.755   1.00 67.23 ?  372  GLU A CB  1 
ATOM   2832 C CG  . GLU A 1 372 ? 40.933  65.507 6.397   1.00 67.89 ?  372  GLU A CG  1 
ATOM   2833 C CD  . GLU A 1 372 ? 41.708  65.460 5.096   1.00 69.66 ?  372  GLU A CD  1 
ATOM   2834 O OE1 . GLU A 1 372 ? 41.383  64.601 4.241   1.00 70.35 ?  372  GLU A OE1 1 
ATOM   2835 O OE2 . GLU A 1 372 ? 42.634  66.286 4.926   1.00 69.22 ?  372  GLU A OE2 1 
ATOM   2836 N N   . LYS A 1 373 ? 39.970  69.473 8.231   1.00 66.49 ?  373  LYS A N   1 
ATOM   2837 C CA  . LYS A 1 373 ? 40.447  70.760 8.778   1.00 66.09 ?  373  LYS A CA  1 
ATOM   2838 C C   . LYS A 1 373 ? 39.822  71.145 10.144  1.00 65.73 ?  373  LYS A C   1 
ATOM   2839 O O   . LYS A 1 373 ? 40.537  71.501 11.082  1.00 65.69 ?  373  LYS A O   1 
ATOM   2840 C CB  . LYS A 1 373 ? 40.288  71.901 7.746   1.00 66.04 ?  373  LYS A CB  1 
ATOM   2841 C CG  . LYS A 1 373 ? 41.035  71.702 6.416   1.00 65.94 ?  373  LYS A CG  1 
ATOM   2842 C CD  . LYS A 1 373 ? 41.076  72.974 5.529   1.00 66.42 ?  373  LYS A CD  1 
ATOM   2843 C CE  . LYS A 1 373 ? 39.725  73.274 4.828   1.00 67.05 ?  373  LYS A CE  1 
ATOM   2844 N NZ  . LYS A 1 373 ? 39.808  74.056 3.532   1.00 65.20 ?  373  LYS A NZ  1 
ATOM   2845 N N   . ALA A 1 374 ? 38.499  71.047 10.256  1.00 65.30 ?  374  ALA A N   1 
ATOM   2846 C CA  . ALA A 1 374 ? 37.792  71.404 11.490  1.00 64.97 ?  374  ALA A CA  1 
ATOM   2847 C C   . ALA A 1 374 ? 38.176  70.556 12.717  1.00 64.88 ?  374  ALA A C   1 
ATOM   2848 O O   . ALA A 1 374 ? 38.242  71.069 13.842  1.00 64.46 ?  374  ALA A O   1 
ATOM   2849 C CB  . ALA A 1 374 ? 36.261  71.395 11.266  1.00 64.75 ?  374  ALA A CB  1 
ATOM   2850 N N   . VAL A 1 375 ? 38.424  69.265 12.500  1.00 64.89 ?  375  VAL A N   1 
ATOM   2851 C CA  . VAL A 1 375 ? 38.754  68.350 13.605  1.00 65.15 ?  375  VAL A CA  1 
ATOM   2852 C C   . VAL A 1 375 ? 40.121  68.612 14.284  1.00 65.18 ?  375  VAL A C   1 
ATOM   2853 O O   . VAL A 1 375 ? 40.287  68.333 15.474  1.00 64.92 ?  375  VAL A O   1 
ATOM   2854 C CB  . VAL A 1 375 ? 38.536  66.845 13.231  1.00 65.13 ?  375  VAL A CB  1 
ATOM   2855 C CG1 . VAL A 1 375 ? 37.068  66.607 12.889  1.00 65.30 ?  375  VAL A CG1 1 
ATOM   2856 C CG2 . VAL A 1 375 ? 39.437  66.395 12.081  1.00 64.54 ?  375  VAL A CG2 1 
ATOM   2857 N N   . LYS A 1 376 ? 41.070  69.169 13.526  1.00 65.51 ?  376  LYS A N   1 
ATOM   2858 C CA  . LYS A 1 376 ? 42.328  69.711 14.069  1.00 65.62 ?  376  LYS A CA  1 
ATOM   2859 C C   . LYS A 1 376 ? 42.061  70.865 15.047  1.00 65.30 ?  376  LYS A C   1 
ATOM   2860 O O   . LYS A 1 376 ? 42.801  71.049 16.021  1.00 65.52 ?  376  LYS A O   1 
ATOM   2861 C CB  . LYS A 1 376 ? 43.228  70.224 12.939  1.00 66.02 ?  376  LYS A CB  1 
ATOM   2862 C CG  . LYS A 1 376 ? 43.502  69.223 11.813  1.00 67.44 ?  376  LYS A CG  1 
ATOM   2863 C CD  . LYS A 1 376 ? 43.973  69.945 10.538  1.00 69.22 ?  376  LYS A CD  1 
ATOM   2864 C CE  . LYS A 1 376 ? 44.475  68.970 9.472   1.00 69.64 ?  376  LYS A CE  1 
ATOM   2865 N NZ  . LYS A 1 376 ? 45.771  68.347 9.876   1.00 69.89 ?  376  LYS A NZ  1 
ATOM   2866 N N   . MET A 1 377 ? 41.000  71.632 14.772  1.00 64.53 ?  377  MET A N   1 
ATOM   2867 C CA  . MET A 1 377 ? 40.549  72.739 15.622  1.00 63.50 ?  377  MET A CA  1 
ATOM   2868 C C   . MET A 1 377 ? 39.636  72.279 16.773  1.00 62.41 ?  377  MET A C   1 
ATOM   2869 O O   . MET A 1 377 ? 39.078  73.103 17.513  1.00 62.63 ?  377  MET A O   1 
ATOM   2870 C CB  . MET A 1 377 ? 39.800  73.768 14.779  1.00 63.96 ?  377  MET A CB  1 
ATOM   2871 C CG  . MET A 1 377 ? 40.507  74.236 13.516  1.00 65.44 ?  377  MET A CG  1 
ATOM   2872 S SD  . MET A 1 377 ? 41.842  75.410 13.820  1.00 70.19 ?  377  MET A SD  1 
ATOM   2873 C CE  . MET A 1 377 ? 40.999  76.717 14.736  1.00 69.97 ?  377  MET A CE  1 
ATOM   2874 N N   . GLY A 1 378 ? 39.473  70.969 16.921  1.00 60.84 ?  378  GLY A N   1 
ATOM   2875 C CA  . GLY A 1 378 ? 38.629  70.417 17.976  1.00 59.07 ?  378  GLY A CA  1 
ATOM   2876 C C   . GLY A 1 378 ? 37.137  70.661 17.807  1.00 57.62 ?  378  GLY A C   1 
ATOM   2877 O O   . GLY A 1 378 ? 36.420  70.844 18.789  1.00 57.25 ?  378  GLY A O   1 
ATOM   2878 N N   . VAL A 1 379 ? 36.659  70.666 16.565  1.00 56.24 ?  379  VAL A N   1 
ATOM   2879 C CA  . VAL A 1 379 ? 35.207  70.767 16.324  1.00 54.80 ?  379  VAL A CA  1 
ATOM   2880 C C   . VAL A 1 379 ? 34.748  69.992 15.100  1.00 53.67 ?  379  VAL A C   1 
ATOM   2881 O O   . VAL A 1 379 ? 35.412  69.987 14.059  1.00 53.33 ?  379  VAL A O   1 
ATOM   2882 C CB  . VAL A 1 379 ? 34.643  72.248 16.328  1.00 54.83 ?  379  VAL A CB  1 
ATOM   2883 C CG1 . VAL A 1 379 ? 35.645  73.222 15.813  1.00 54.46 ?  379  VAL A CG1 1 
ATOM   2884 C CG2 . VAL A 1 379 ? 33.336  72.352 15.534  1.00 54.56 ?  379  VAL A CG2 1 
ATOM   2885 N N   . LEU A 1 380 ? 33.613  69.310 15.244  1.00 52.10 ?  380  LEU A N   1 
ATOM   2886 C CA  . LEU A 1 380 ? 32.995  68.681 14.093  1.00 49.98 ?  380  LEU A CA  1 
ATOM   2887 C C   . LEU A 1 380 ? 31.483  68.768 14.030  1.00 47.75 ?  380  LEU A C   1 
ATOM   2888 O O   . LEU A 1 380 ? 30.774  68.587 15.022  1.00 47.07 ?  380  LEU A O   1 
ATOM   2889 C CB  . LEU A 1 380 ? 33.481  67.241 13.846  1.00 50.77 ?  380  LEU A CB  1 
ATOM   2890 C CG  . LEU A 1 380 ? 33.813  66.118 14.826  1.00 51.75 ?  380  LEU A CG  1 
ATOM   2891 C CD1 . LEU A 1 380 ? 33.132  66.232 16.177  1.00 53.84 ?  380  LEU A CD1 1 
ATOM   2892 C CD2 . LEU A 1 380 ? 33.436  64.805 14.124  1.00 52.56 ?  380  LEU A CD2 1 
ATOM   2893 N N   . MET A 1 381 ? 31.033  69.065 12.817  1.00 45.08 ?  381  MET A N   1 
ATOM   2894 C CA  . MET A 1 381 ? 29.665  68.875 12.397  1.00 41.61 ?  381  MET A CA  1 
ATOM   2895 C C   . MET A 1 381 ? 29.728  67.825 11.308  1.00 38.81 ?  381  MET A C   1 
ATOM   2896 O O   . MET A 1 381 ? 30.800  67.308 11.021  1.00 38.08 ?  381  MET A O   1 
ATOM   2897 C CB  . MET A 1 381 ? 29.110  70.192 11.909  1.00 42.35 ?  381  MET A CB  1 
ATOM   2898 C CG  . MET A 1 381 ? 28.990  71.170 13.034  1.00 42.92 ?  381  MET A CG  1 
ATOM   2899 S SD  . MET A 1 381 ? 29.409  72.790 12.460  1.00 49.61 ?  381  MET A SD  1 
ATOM   2900 C CE  . MET A 1 381 ? 27.852  73.371 11.808  1.00 47.05 ?  381  MET A CE  1 
ATOM   2901 N N   . LEU A 1 382 ? 28.591  67.460 10.733  1.00 34.98 ?  382  LEU A N   1 
ATOM   2902 C CA  . LEU A 1 382 ? 28.580  66.301 9.880   1.00 32.12 ?  382  LEU A CA  1 
ATOM   2903 C C   . LEU A 1 382 ? 28.339  66.785 8.476   1.00 29.94 ?  382  LEU A C   1 
ATOM   2904 O O   . LEU A 1 382 ? 27.385  67.508 8.261   1.00 29.24 ?  382  LEU A O   1 
ATOM   2905 C CB  . LEU A 1 382 ? 27.484  65.340 10.382  1.00 32.15 ?  382  LEU A CB  1 
ATOM   2906 C CG  . LEU A 1 382 ? 27.213  64.032 9.673   1.00 32.04 ?  382  LEU A CG  1 
ATOM   2907 C CD1 . LEU A 1 382 ? 28.438  63.099 9.830   1.00 33.35 ?  382  LEU A CD1 1 
ATOM   2908 C CD2 . LEU A 1 382 ? 25.989  63.388 10.283  1.00 31.93 ?  382  LEU A CD2 1 
ATOM   2909 N N   . PRO A 1 383 ? 29.203  66.412 7.512   1.00 29.21 ?  383  PRO A N   1 
ATOM   2910 C CA  . PRO A 1 383 ? 28.961  66.753 6.093   1.00 27.88 ?  383  PRO A CA  1 
ATOM   2911 C C   . PRO A 1 383 ? 27.734  66.060 5.523   1.00 27.37 ?  383  PRO A C   1 
ATOM   2912 O O   . PRO A 1 383 ? 27.400  64.915 5.934   1.00 25.86 ?  383  PRO A O   1 
ATOM   2913 C CB  . PRO A 1 383 ? 30.191  66.215 5.378   1.00 28.14 ?  383  PRO A CB  1 
ATOM   2914 C CG  . PRO A 1 383 ? 30.693  65.154 6.263   1.00 30.92 ?  383  PRO A CG  1 
ATOM   2915 C CD  . PRO A 1 383 ? 30.459  65.652 7.666   1.00 29.78 ?  383  PRO A CD  1 
ATOM   2916 N N   . GLY A 1 384 ? 27.103  66.735 4.556   1.00 26.08 ?  384  GLY A N   1 
ATOM   2917 C CA  . GLY A 1 384 ? 25.777  66.368 4.041   1.00 25.10 ?  384  GLY A CA  1 
ATOM   2918 C C   . GLY A 1 384 ? 25.743  65.163 3.120   1.00 24.92 ?  384  GLY A C   1 
ATOM   2919 O O   . GLY A 1 384 ? 24.657  64.648 2.833   1.00 23.62 ?  384  GLY A O   1 
ATOM   2920 N N   . ASN A 1 385 ? 26.919  64.718 2.643   1.00 25.51 ?  385  ASN A N   1 
ATOM   2921 C CA  . ASN A 1 385 ? 27.007  63.588 1.665   1.00 25.94 ?  385  ASN A CA  1 
ATOM   2922 C C   . ASN A 1 385 ? 26.243  62.344 2.132   1.00 24.89 ?  385  ASN A C   1 
ATOM   2923 O O   . ASN A 1 385 ? 25.559  61.729 1.325   1.00 24.95 ?  385  ASN A O   1 
ATOM   2924 C CB  . ASN A 1 385 ? 28.456  63.145 1.360   1.00 27.00 ?  385  ASN A CB  1 
ATOM   2925 C CG  . ASN A 1 385 ? 29.396  64.313 1.167   1.00 31.42 ?  385  ASN A CG  1 
ATOM   2926 O OD1 . ASN A 1 385 ? 29.735  65.006 2.129   1.00 34.81 ?  385  ASN A OD1 1 
ATOM   2927 N ND2 . ASN A 1 385 ? 29.833  64.538 -0.085  1.00 33.31 ?  385  ASN A ND2 1 
ATOM   2928 N N   . ALA A 1 386 ? 26.383  61.999 3.413   1.00 23.42 ?  386  ALA A N   1 
ATOM   2929 C CA  . ALA A 1 386 ? 25.725  60.847 4.029   1.00 24.61 ?  386  ALA A CA  1 
ATOM   2930 C C   . ALA A 1 386 ? 24.200  60.843 3.867   1.00 24.10 ?  386  ALA A C   1 
ATOM   2931 O O   . ALA A 1 386 ? 23.531  59.809 4.079   1.00 25.01 ?  386  ALA A O   1 
ATOM   2932 C CB  . ALA A 1 386 ? 26.065  60.794 5.510   1.00 25.01 ?  386  ALA A CB  1 
ATOM   2933 N N   . PHE A 1 387 ? 23.621  61.987 3.523   1.00 22.35 ?  387  PHE A N   1 
ATOM   2934 C CA  . PHE A 1 387 ? 22.148  62.001 3.464   1.00 21.37 ?  387  PHE A CA  1 
ATOM   2935 C C   . PHE A 1 387 ? 21.600  61.890 2.074   1.00 20.66 ?  387  PHE A C   1 
ATOM   2936 O O   . PHE A 1 387 ? 20.425  62.122 1.870   1.00 21.90 ?  387  PHE A O   1 
ATOM   2937 C CB  . PHE A 1 387 ? 21.591  63.176 4.271   1.00 19.04 ?  387  PHE A CB  1 
ATOM   2938 C CG  . PHE A 1 387 ? 22.155  63.226 5.670   1.00 20.02 ?  387  PHE A CG  1 
ATOM   2939 C CD1 . PHE A 1 387 ? 23.246  64.044 5.976   1.00 18.41 ?  387  PHE A CD1 1 
ATOM   2940 C CD2 . PHE A 1 387 ? 21.629  62.412 6.676   1.00 18.00 ?  387  PHE A CD2 1 
ATOM   2941 C CE1 . PHE A 1 387 ? 23.781  64.088 7.261   1.00 16.72 ?  387  PHE A CE1 1 
ATOM   2942 C CE2 . PHE A 1 387 ? 22.168  62.445 7.963   1.00 18.49 ?  387  PHE A CE2 1 
ATOM   2943 C CZ  . PHE A 1 387 ? 23.236  63.286 8.254   1.00 18.61 ?  387  PHE A CZ  1 
ATOM   2944 N N   . TYR A 1 388 ? 22.443  61.480 1.127   1.00 20.75 ?  388  TYR A N   1 
ATOM   2945 C CA  . TYR A 1 388 ? 22.026  61.294 -0.278  1.00 20.88 ?  388  TYR A CA  1 
ATOM   2946 C C   . TYR A 1 388 ? 22.183  59.848 -0.723  1.00 21.56 ?  388  TYR A C   1 
ATOM   2947 O O   . TYR A 1 388 ? 23.008  59.107 -0.176  1.00 20.82 ?  388  TYR A O   1 
ATOM   2948 C CB  . TYR A 1 388 ? 22.796  62.225 -1.232  1.00 21.34 ?  388  TYR A CB  1 
ATOM   2949 C CG  . TYR A 1 388 ? 22.518  63.692 -0.920  1.00 22.60 ?  388  TYR A CG  1 
ATOM   2950 C CD1 . TYR A 1 388 ? 21.552  64.419 -1.639  1.00 24.65 ?  388  TYR A CD1 1 
ATOM   2951 C CD2 . TYR A 1 388 ? 23.186  64.342 0.128   1.00 22.29 ?  388  TYR A CD2 1 
ATOM   2952 C CE1 . TYR A 1 388 ? 21.284  65.783 -1.334  1.00 23.74 ?  388  TYR A CE1 1 
ATOM   2953 C CE2 . TYR A 1 388 ? 22.930  65.719 0.434   1.00 22.18 ?  388  TYR A CE2 1 
ATOM   2954 C CZ  . TYR A 1 388 ? 21.973  66.413 -0.281  1.00 23.45 ?  388  TYR A CZ  1 
ATOM   2955 O OH  . TYR A 1 388 ? 21.724  67.744 0.052   1.00 21.89 ?  388  TYR A OH  1 
ATOM   2956 N N   . VAL A 1 389 ? 21.387  59.442 -1.698  1.00 21.59 ?  389  VAL A N   1 
ATOM   2957 C CA  . VAL A 1 389 ? 21.549  58.091 -2.240  1.00 24.82 ?  389  VAL A CA  1 
ATOM   2958 C C   . VAL A 1 389 ? 22.960  57.909 -2.839  1.00 26.55 ?  389  VAL A C   1 
ATOM   2959 O O   . VAL A 1 389 ? 23.627  56.892 -2.622  1.00 27.26 ?  389  VAL A O   1 
ATOM   2960 C CB  . VAL A 1 389 ? 20.456  57.766 -3.254  1.00 23.99 ?  389  VAL A CB  1 
ATOM   2961 C CG1 . VAL A 1 389 ? 20.760  56.449 -3.981  1.00 26.96 ?  389  VAL A CG1 1 
ATOM   2962 C CG2 . VAL A 1 389 ? 19.141  57.654 -2.546  1.00 24.79 ?  389  VAL A CG2 1 
ATOM   2963 N N   . ASP A 1 390 ? 23.420  58.915 -3.576  1.00 27.82 ?  390  ASP A N   1 
ATOM   2964 C CA  . ASP A 1 390 ? 24.792  58.907 -4.055  1.00 28.82 ?  390  ASP A CA  1 
ATOM   2965 C C   . ASP A 1 390 ? 25.625  59.773 -3.121  1.00 28.42 ?  390  ASP A C   1 
ATOM   2966 O O   . ASP A 1 390 ? 25.726  60.965 -3.317  1.00 27.01 ?  390  ASP A O   1 
ATOM   2967 C CB  . ASP A 1 390 ? 24.854  59.388 -5.503  1.00 29.96 ?  390  ASP A CB  1 
ATOM   2968 C CG  . ASP A 1 390 ? 26.301  59.508 -6.040  1.00 34.46 ?  390  ASP A CG  1 
ATOM   2969 O OD1 . ASP A 1 390 ? 26.449  60.133 -7.114  1.00 38.84 ?  390  ASP A OD1 1 
ATOM   2970 O OD2 . ASP A 1 390 ? 27.267  58.994 -5.400  1.00 37.14 ?  390  ASP A OD2 1 
ATOM   2971 N N   . SER A 1 391 ? 26.192  59.151 -2.086  1.00 28.45 ?  391  SER A N   1 
ATOM   2972 C CA  . SER A 1 391 ? 27.012  59.852 -1.130  1.00 29.74 ?  391  SER A CA  1 
ATOM   2973 C C   . SER A 1 391 ? 28.386  60.250 -1.677  1.00 30.22 ?  391  SER A C   1 
ATOM   2974 O O   . SER A 1 391 ? 29.147  60.909 -1.001  1.00 29.48 ?  391  SER A O   1 
ATOM   2975 C CB  . SER A 1 391 ? 27.133  59.055 0.179   1.00 30.93 ?  391  SER A CB  1 
ATOM   2976 O OG  . SER A 1 391 ? 27.382  57.665 -0.057  1.00 31.58 ?  391  SER A OG  1 
ATOM   2977 N N   . SER A 1 392 ? 28.682  59.893 -2.926  1.00 32.05 ?  392  SER A N   1 
ATOM   2978 C CA  . SER A 1 392 ? 29.976  60.231 -3.534  1.00 32.59 ?  392  SER A CA  1 
ATOM   2979 C C   . SER A 1 392 ? 29.896  61.594 -4.211  1.00 33.10 ?  392  SER A C   1 
ATOM   2980 O O   . SER A 1 392 ? 30.923  62.198 -4.529  1.00 34.24 ?  392  SER A O   1 
ATOM   2981 C CB  . SER A 1 392 ? 30.418  59.142 -4.522  1.00 32.81 ?  392  SER A CB  1 
ATOM   2982 O OG  . SER A 1 392 ? 29.892  59.394 -5.822  1.00 33.33 ?  392  SER A OG  1 
ATOM   2983 N N   . ALA A 1 393 ? 28.676  62.087 -4.424  1.00 32.54 ?  393  ALA A N   1 
ATOM   2984 C CA  . ALA A 1 393 ? 28.476  63.422 -4.948  1.00 32.45 ?  393  ALA A CA  1 
ATOM   2985 C C   . ALA A 1 393 ? 28.948  64.472 -3.936  1.00 32.32 ?  393  ALA A C   1 
ATOM   2986 O O   . ALA A 1 393 ? 28.806  64.281 -2.728  1.00 32.81 ?  393  ALA A O   1 
ATOM   2987 C CB  . ALA A 1 393 ? 27.012  63.647 -5.315  1.00 32.13 ?  393  ALA A CB  1 
ATOM   2988 N N   . PRO A 1 394 ? 29.527  65.584 -4.429  1.00 32.25 ?  394  PRO A N   1 
ATOM   2989 C CA  . PRO A 1 394 ? 30.024  66.610 -3.509  1.00 31.69 ?  394  PRO A CA  1 
ATOM   2990 C C   . PRO A 1 394 ? 28.839  67.288 -2.824  1.00 30.22 ?  394  PRO A C   1 
ATOM   2991 O O   . PRO A 1 394 ? 27.764  67.368 -3.392  1.00 29.95 ?  394  PRO A O   1 
ATOM   2992 C CB  . PRO A 1 394 ? 30.769  67.577 -4.436  1.00 32.00 ?  394  PRO A CB  1 
ATOM   2993 C CG  . PRO A 1 394 ? 30.006  67.459 -5.744  1.00 33.28 ?  394  PRO A CG  1 
ATOM   2994 C CD  . PRO A 1 394 ? 29.722  65.967 -5.841  1.00 31.98 ?  394  PRO A CD  1 
ATOM   2995 N N   . SER A 1 395 ? 29.016  67.713 -1.583  1.00 29.17 ?  395  SER A N   1 
ATOM   2996 C CA  . SER A 1 395 ? 27.939  68.405 -0.898  1.00 27.79 ?  395  SER A CA  1 
ATOM   2997 C C   . SER A 1 395 ? 28.456  69.649 -0.158  1.00 26.52 ?  395  SER A C   1 
ATOM   2998 O O   . SER A 1 395 ? 29.391  69.545 0.631   1.00 26.24 ?  395  SER A O   1 
ATOM   2999 C CB  . SER A 1 395 ? 27.229  67.442 0.059   1.00 27.59 ?  395  SER A CB  1 
ATOM   3000 O OG  . SER A 1 395 ? 26.315  68.127 0.911   1.00 26.73 ?  395  SER A OG  1 
ATOM   3001 N N   . PRO A 1 396 ? 27.823  70.825 -0.382  1.00 25.23 ?  396  PRO A N   1 
ATOM   3002 C CA  . PRO A 1 396 ? 28.198  72.011 0.404   1.00 24.68 ?  396  PRO A CA  1 
ATOM   3003 C C   . PRO A 1 396 ? 27.497  72.149 1.776   1.00 24.54 ?  396  PRO A C   1 
ATOM   3004 O O   . PRO A 1 396 ? 27.656  73.180 2.451   1.00 24.75 ?  396  PRO A O   1 
ATOM   3005 C CB  . PRO A 1 396 ? 27.808  73.170 -0.513  1.00 23.97 ?  396  PRO A CB  1 
ATOM   3006 C CG  . PRO A 1 396 ? 26.636  72.637 -1.311  1.00 25.47 ?  396  PRO A CG  1 
ATOM   3007 C CD  . PRO A 1 396 ? 26.780  71.128 -1.386  1.00 24.89 ?  396  PRO A CD  1 
ATOM   3008 N N   . TYR A 1 397 ? 26.770  71.118 2.200   1.00 24.03 ?  397  TYR A N   1 
ATOM   3009 C CA  . TYR A 1 397 ? 25.971  71.189 3.431   1.00 23.51 ?  397  TYR A CA  1 
ATOM   3010 C C   . TYR A 1 397 ? 26.600  70.527 4.650   1.00 22.78 ?  397  TYR A C   1 
ATOM   3011 O O   . TYR A 1 397 ? 27.356  69.558 4.541   1.00 22.06 ?  397  TYR A O   1 
ATOM   3012 C CB  . TYR A 1 397 ? 24.584  70.558 3.195   1.00 24.05 ?  397  TYR A CB  1 
ATOM   3013 C CG  . TYR A 1 397 ? 23.635  71.279 2.235   1.00 23.90 ?  397  TYR A CG  1 
ATOM   3014 C CD1 . TYR A 1 397 ? 23.588  70.935 0.894   1.00 23.44 ?  397  TYR A CD1 1 
ATOM   3015 C CD2 . TYR A 1 397 ? 22.723  72.233 2.707   1.00 24.91 ?  397  TYR A CD2 1 
ATOM   3016 C CE1 . TYR A 1 397 ? 22.697  71.575 0.004   1.00 27.94 ?  397  TYR A CE1 1 
ATOM   3017 C CE2 . TYR A 1 397 ? 21.799  72.885 1.836   1.00 24.85 ?  397  TYR A CE2 1 
ATOM   3018 C CZ  . TYR A 1 397 ? 21.793  72.545 0.489   1.00 27.70 ?  397  TYR A CZ  1 
ATOM   3019 O OH  . TYR A 1 397 ? 20.922  73.176 -0.391  1.00 27.89 ?  397  TYR A OH  1 
ATOM   3020 N N   . LEU A 1 398 ? 26.224  71.028 5.825   1.00 23.15 ?  398  LEU A N   1 
ATOM   3021 C CA  . LEU A 1 398 ? 26.637  70.507 7.135   1.00 23.34 ?  398  LEU A CA  1 
ATOM   3022 C C   . LEU A 1 398 ? 25.394  70.329 7.995   1.00 22.73 ?  398  LEU A C   1 
ATOM   3023 O O   . LEU A 1 398 ? 24.526  71.218 7.996   1.00 21.79 ?  398  LEU A O   1 
ATOM   3024 C CB  . LEU A 1 398 ? 27.507  71.537 7.882   1.00 23.48 ?  398  LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 398 ? 28.930  71.693 7.333   1.00 28.23 ?  398  LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 398 ? 29.550  72.992 7.768   1.00 29.14 ?  398  LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 398 ? 29.857  70.499 7.765   1.00 34.67 ?  398  LEU A CD2 1 
ATOM   3028 N N   . ARG A 1 399 ? 25.325  69.234 8.750   1.00 21.56 ?  399  ARG A N   1 
ATOM   3029 C CA  . ARG A 1 399 ? 24.279  69.093 9.755   1.00 21.95 ?  399  ARG A CA  1 
ATOM   3030 C C   . ARG A 1 399 ? 24.907  69.414 11.095  1.00 22.76 ?  399  ARG A C   1 
ATOM   3031 O O   . ARG A 1 399 ? 26.000  68.894 11.424  1.00 22.63 ?  399  ARG A O   1 
ATOM   3032 C CB  . ARG A 1 399 ? 23.672  67.677 9.756   1.00 21.27 ?  399  ARG A CB  1 
ATOM   3033 C CG  . ARG A 1 399 ? 22.431  67.512 10.656  1.00 21.02 ?  399  ARG A CG  1 
ATOM   3034 C CD  . ARG A 1 399 ? 22.062  66.011 10.879  1.00 20.57 ?  399  ARG A CD  1 
ATOM   3035 N NE  . ARG A 1 399 ? 22.967  65.371 11.815  1.00 17.25 ?  399  ARG A NE  1 
ATOM   3036 C CZ  . ARG A 1 399 ? 22.893  64.098 12.225  1.00 18.42 ?  399  ARG A CZ  1 
ATOM   3037 N NH1 . ARG A 1 399 ? 21.960  63.302 11.736  1.00 17.75 ?  399  ARG A NH1 1 
ATOM   3038 N NH2 . ARG A 1 399 ? 23.802  63.612 13.095  1.00 14.69 ?  399  ARG A NH2 1 
ATOM   3039 N N   . ALA A 1 400 ? 24.232  70.284 11.856  1.00 21.92 ?  400  ALA A N   1 
ATOM   3040 C CA  . ALA A 1 400 ? 24.668  70.617 13.203  1.00 22.60 ?  400  ALA A CA  1 
ATOM   3041 C C   . ALA A 1 400 ? 23.562  70.271 14.217  1.00 23.53 ?  400  ALA A C   1 
ATOM   3042 O O   . ALA A 1 400 ? 22.451  70.815 14.140  1.00 22.72 ?  400  ALA A O   1 
ATOM   3043 C CB  . ALA A 1 400 ? 25.015  72.112 13.278  1.00 22.27 ?  400  ALA A CB  1 
ATOM   3044 N N   . SER A 1 401 ? 23.856  69.393 15.176  1.00 23.29 ?  401  SER A N   1 
ATOM   3045 C CA  . SER A 1 401 ? 22.880  69.135 16.232  1.00 24.68 ?  401  SER A CA  1 
ATOM   3046 C C   . SER A 1 401 ? 22.837  70.153 17.364  1.00 24.75 ?  401  SER A C   1 
ATOM   3047 O O   . SER A 1 401 ? 23.880  70.571 17.853  1.00 26.74 ?  401  SER A O   1 
ATOM   3048 C CB  . SER A 1 401 ? 23.077  67.755 16.865  1.00 24.44 ?  401  SER A CB  1 
ATOM   3049 O OG  . SER A 1 401 ? 22.249  67.702 18.026  1.00 26.87 ?  401  SER A OG  1 
ATOM   3050 N N   . PHE A 1 402 ? 21.645  70.508 17.833  1.00 23.61 ?  402  PHE A N   1 
ATOM   3051 C CA  . PHE A 1 402 ? 21.550  71.376 19.016  1.00 24.20 ?  402  PHE A CA  1 
ATOM   3052 C C   . PHE A 1 402 ? 20.997  70.650 20.253  1.00 24.97 ?  402  PHE A C   1 
ATOM   3053 O O   . PHE A 1 402 ? 20.515  71.285 21.176  1.00 24.35 ?  402  PHE A O   1 
ATOM   3054 C CB  . PHE A 1 402 ? 20.759  72.683 18.727  1.00 22.67 ?  402  PHE A CB  1 
ATOM   3055 C CG  . PHE A 1 402 ? 19.385  72.457 18.104  1.00 22.29 ?  402  PHE A CG  1 
ATOM   3056 C CD1 . PHE A 1 402 ? 18.267  72.224 18.896  1.00 22.14 ?  402  PHE A CD1 1 
ATOM   3057 C CD2 . PHE A 1 402 ? 19.218  72.493 16.722  1.00 18.04 ?  402  PHE A CD2 1 
ATOM   3058 C CE1 . PHE A 1 402 ? 16.998  72.021 18.323  1.00 21.64 ?  402  PHE A CE1 1 
ATOM   3059 C CE2 . PHE A 1 402 ? 17.962  72.303 16.145  1.00 20.41 ?  402  PHE A CE2 1 
ATOM   3060 C CZ  . PHE A 1 402 ? 16.851  72.047 16.931  1.00 19.49 ?  402  PHE A CZ  1 
ATOM   3061 N N   . SER A 1 403 ? 21.105  69.320 20.304  1.00 26.73 ?  403  SER A N   1 
ATOM   3062 C CA  . SER A 1 403 ? 20.480  68.591 21.401  1.00 28.54 ?  403  SER A CA  1 
ATOM   3063 C C   . SER A 1 403 ? 21.213  68.755 22.735  1.00 30.76 ?  403  SER A C   1 
ATOM   3064 O O   . SER A 1 403 ? 20.553  68.740 23.783  1.00 31.89 ?  403  SER A O   1 
ATOM   3065 C CB  . SER A 1 403 ? 20.320  67.114 21.052  1.00 29.77 ?  403  SER A CB  1 
ATOM   3066 O OG  . SER A 1 403 ? 21.573  66.531 20.727  1.00 28.24 ?  403  SER A OG  1 
ATOM   3067 N N   . SER A 1 404 ? 22.536  68.963 22.699  1.00 32.14 ?  404  SER A N   1 
ATOM   3068 C CA  . SER A 1 404 ? 23.397  68.881 23.907  1.00 35.29 ?  404  SER A CA  1 
ATOM   3069 C C   . SER A 1 404 ? 24.290  70.074 24.190  1.00 35.82 ?  404  SER A C   1 
ATOM   3070 O O   . SER A 1 404 ? 24.485  70.447 25.341  1.00 36.49 ?  404  SER A O   1 
ATOM   3071 C CB  . SER A 1 404 ? 24.307  67.661 23.812  1.00 34.48 ?  404  SER A CB  1 
ATOM   3072 O OG  . SER A 1 404 ? 23.505  66.552 23.424  1.00 43.17 ?  404  SER A OG  1 
ATOM   3073 N N   . ALA A 1 405 ? 24.864  70.646 23.142  1.00 36.80 ?  405  ALA A N   1 
ATOM   3074 C CA  . ALA A 1 405 ? 25.877  71.670 23.311  1.00 37.30 ?  405  ALA A CA  1 
ATOM   3075 C C   . ALA A 1 405 ? 25.330  72.882 24.041  1.00 38.31 ?  405  ALA A C   1 
ATOM   3076 O O   . ALA A 1 405 ? 24.146  73.259 23.891  1.00 38.06 ?  405  ALA A O   1 
ATOM   3077 C CB  . ALA A 1 405 ? 26.477  72.047 21.983  1.00 37.00 ?  405  ALA A CB  1 
ATOM   3078 N N   . SER A 1 406 ? 26.187  73.473 24.869  1.00 39.14 ?  406  SER A N   1 
ATOM   3079 C CA  . SER A 1 406 ? 25.831  74.678 25.596  1.00 40.32 ?  406  SER A CA  1 
ATOM   3080 C C   . SER A 1 406 ? 25.968  75.873 24.639  1.00 41.36 ?  406  SER A C   1 
ATOM   3081 O O   . SER A 1 406 ? 26.674  75.779 23.631  1.00 40.85 ?  406  SER A O   1 
ATOM   3082 C CB  . SER A 1 406 ? 26.750  74.854 26.795  1.00 39.68 ?  406  SER A CB  1 
ATOM   3083 O OG  . SER A 1 406 ? 28.041  75.194 26.347  1.00 40.67 ?  406  SER A OG  1 
ATOM   3084 N N   . PRO A 1 407 ? 25.233  76.970 24.912  1.00 42.64 ?  407  PRO A N   1 
ATOM   3085 C CA  . PRO A 1 407 ? 25.460  78.279 24.292  1.00 43.34 ?  407  PRO A CA  1 
ATOM   3086 C C   . PRO A 1 407 ? 26.930  78.617 24.004  1.00 44.15 ?  407  PRO A C   1 
ATOM   3087 O O   . PRO A 1 407 ? 27.238  79.070 22.907  1.00 44.20 ?  407  PRO A O   1 
ATOM   3088 C CB  . PRO A 1 407 ? 24.855  79.227 25.314  1.00 43.23 ?  407  PRO A CB  1 
ATOM   3089 C CG  . PRO A 1 407 ? 23.620  78.478 25.742  1.00 43.81 ?  407  PRO A CG  1 
ATOM   3090 C CD  . PRO A 1 407 ? 24.033  76.998 25.776  1.00 42.92 ?  407  PRO A CD  1 
ATOM   3091 N N   . GLU A 1 408 ? 27.816  78.378 24.975  1.00 45.11 ?  408  GLU A N   1 
ATOM   3092 C CA  . GLU A 1 408 ? 29.255  78.664 24.863  1.00 45.45 ?  408  GLU A CA  1 
ATOM   3093 C C   . GLU A 1 408 ? 29.942  77.766 23.845  1.00 44.78 ?  408  GLU A C   1 
ATOM   3094 O O   . GLU A 1 408 ? 30.805  78.211 23.084  1.00 44.89 ?  408  GLU A O   1 
ATOM   3095 C CB  . GLU A 1 408 ? 29.944  78.475 26.227  1.00 46.36 ?  408  GLU A CB  1 
ATOM   3096 C CG  . GLU A 1 408 ? 29.663  79.566 27.279  1.00 50.10 ?  408  GLU A CG  1 
ATOM   3097 C CD  . GLU A 1 408 ? 28.200  79.633 27.757  1.00 54.56 ?  408  GLU A CD  1 
ATOM   3098 O OE1 . GLU A 1 408 ? 27.449  78.608 27.664  1.00 53.50 ?  408  GLU A OE1 1 
ATOM   3099 O OE2 . GLU A 1 408 ? 27.814  80.740 28.230  1.00 55.25 ?  408  GLU A OE2 1 
ATOM   3100 N N   . GLN A 1 409 ? 29.579  76.485 23.850  1.00 43.86 ?  409  GLN A N   1 
ATOM   3101 C CA  . GLN A 1 409 ? 30.188  75.537 22.930  1.00 42.88 ?  409  GLN A CA  1 
ATOM   3102 C C   . GLN A 1 409 ? 29.742  75.812 21.490  1.00 41.72 ?  409  GLN A C   1 
ATOM   3103 O O   . GLN A 1 409 ? 30.515  75.647 20.553  1.00 40.87 ?  409  GLN A O   1 
ATOM   3104 C CB  . GLN A 1 409 ? 29.846  74.102 23.338  1.00 43.53 ?  409  GLN A CB  1 
ATOM   3105 C CG  . GLN A 1 409 ? 30.516  73.644 24.603  1.00 43.46 ?  409  GLN A CG  1 
ATOM   3106 C CD  . GLN A 1 409 ? 29.877  72.407 25.184  1.00 44.59 ?  409  GLN A CD  1 
ATOM   3107 O OE1 . GLN A 1 409 ? 28.658  72.223 25.108  1.00 45.90 ?  409  GLN A OE1 1 
ATOM   3108 N NE2 . GLN A 1 409 ? 30.691  71.555 25.790  1.00 44.29 ?  409  GLN A NE2 1 
ATOM   3109 N N   . MET A 1 410 ? 28.493  76.225 21.316  1.00 40.62 ?  410  MET A N   1 
ATOM   3110 C CA  . MET A 1 410 ? 28.015  76.535 19.979  1.00 40.66 ?  410  MET A CA  1 
ATOM   3111 C C   . MET A 1 410 ? 28.779  77.723 19.397  1.00 40.57 ?  410  MET A C   1 
ATOM   3112 O O   . MET A 1 410 ? 29.176  77.720 18.221  1.00 40.59 ?  410  MET A O   1 
ATOM   3113 C CB  . MET A 1 410 ? 26.517  76.805 19.983  1.00 40.29 ?  410  MET A CB  1 
ATOM   3114 C CG  . MET A 1 410 ? 25.680  75.599 20.369  1.00 41.02 ?  410  MET A CG  1 
ATOM   3115 S SD  . MET A 1 410 ? 23.956  76.053 20.599  1.00 40.58 ?  410  MET A SD  1 
ATOM   3116 C CE  . MET A 1 410 ? 23.231  74.440 20.959  1.00 37.37 ?  410  MET A CE  1 
ATOM   3117 N N   . ASP A 1 411 ? 29.002  78.729 20.232  1.00 40.59 ?  411  ASP A N   1 
ATOM   3118 C CA  . ASP A 1 411 ? 29.727  79.928 19.813  1.00 41.06 ?  411  ASP A CA  1 
ATOM   3119 C C   . ASP A 1 411 ? 31.127  79.612 19.240  1.00 40.75 ?  411  ASP A C   1 
ATOM   3120 O O   . ASP A 1 411 ? 31.483  80.083 18.141  1.00 41.38 ?  411  ASP A O   1 
ATOM   3121 C CB  . ASP A 1 411 ? 29.796  80.921 20.976  1.00 41.58 ?  411  ASP A CB  1 
ATOM   3122 C CG  . ASP A 1 411 ? 30.591  82.169 20.638  1.00 42.32 ?  411  ASP A CG  1 
ATOM   3123 O OD1 . ASP A 1 411 ? 31.678  82.332 21.237  1.00 45.69 ?  411  ASP A OD1 1 
ATOM   3124 O OD2 . ASP A 1 411 ? 30.143  82.958 19.777  1.00 40.47 ?  411  ASP A OD2 1 
ATOM   3125 N N   . VAL A 1 412 ? 31.898  78.803 19.965  1.00 39.54 ?  412  VAL A N   1 
ATOM   3126 C CA  . VAL A 1 412 ? 33.255  78.462 19.567  1.00 38.47 ?  412  VAL A CA  1 
ATOM   3127 C C   . VAL A 1 412 ? 33.238  77.608 18.303  1.00 37.93 ?  412  VAL A C   1 
ATOM   3128 O O   . VAL A 1 412 ? 34.023  77.826 17.369  1.00 36.59 ?  412  VAL A O   1 
ATOM   3129 C CB  . VAL A 1 412 ? 33.957  77.685 20.687  1.00 39.57 ?  412  VAL A CB  1 
ATOM   3130 C CG1 . VAL A 1 412 ? 35.396  77.353 20.297  1.00 39.71 ?  412  VAL A CG1 1 
ATOM   3131 C CG2 . VAL A 1 412 ? 33.911  78.463 22.020  1.00 41.10 ?  412  VAL A CG2 1 
ATOM   3132 N N   . ALA A 1 413 ? 32.344  76.615 18.292  1.00 36.78 ?  413  ALA A N   1 
ATOM   3133 C CA  . ALA A 1 413 ? 32.125  75.790 17.136  1.00 35.50 ?  413  ALA A CA  1 
ATOM   3134 C C   . ALA A 1 413 ? 31.871  76.627 15.869  1.00 35.07 ?  413  ALA A C   1 
ATOM   3135 O O   . ALA A 1 413 ? 32.496  76.378 14.829  1.00 33.82 ?  413  ALA A O   1 
ATOM   3136 C CB  . ALA A 1 413 ? 30.976  74.834 17.399  1.00 35.93 ?  413  ALA A CB  1 
ATOM   3137 N N   . PHE A 1 414 ? 30.960  77.603 15.956  1.00 34.71 ?  414  PHE A N   1 
ATOM   3138 C CA  . PHE A 1 414 ? 30.630  78.433 14.782  1.00 35.75 ?  414  PHE A CA  1 
ATOM   3139 C C   . PHE A 1 414 ? 31.730  79.455 14.454  1.00 36.21 ?  414  PHE A C   1 
ATOM   3140 O O   . PHE A 1 414 ? 31.938  79.803 13.286  1.00 36.41 ?  414  PHE A O   1 
ATOM   3141 C CB  . PHE A 1 414 ? 29.258  79.089 14.928  1.00 35.42 ?  414  PHE A CB  1 
ATOM   3142 C CG  . PHE A 1 414 ? 28.095  78.148 14.666  1.00 37.59 ?  414  PHE A CG  1 
ATOM   3143 C CD1 . PHE A 1 414 ? 27.726  77.184 15.596  1.00 39.38 ?  414  PHE A CD1 1 
ATOM   3144 C CD2 . PHE A 1 414 ? 27.373  78.224 13.490  1.00 38.35 ?  414  PHE A CD2 1 
ATOM   3145 C CE1 . PHE A 1 414 ? 26.646  76.316 15.346  1.00 41.18 ?  414  PHE A CE1 1 
ATOM   3146 C CE2 . PHE A 1 414 ? 26.287  77.362 13.240  1.00 39.25 ?  414  PHE A CE2 1 
ATOM   3147 C CZ  . PHE A 1 414 ? 25.924  76.409 14.161  1.00 36.55 ?  414  PHE A CZ  1 
ATOM   3148 N N   . GLN A 1 415 ? 32.427  79.925 15.490  1.00 36.82 ?  415  GLN A N   1 
ATOM   3149 C CA  . GLN A 1 415 ? 33.596  80.788 15.333  1.00 37.90 ?  415  GLN A CA  1 
ATOM   3150 C C   . GLN A 1 415 ? 34.652  80.071 14.515  1.00 36.77 ?  415  GLN A C   1 
ATOM   3151 O O   . GLN A 1 415 ? 35.178  80.612 13.555  1.00 36.68 ?  415  GLN A O   1 
ATOM   3152 C CB  . GLN A 1 415 ? 34.098  81.203 16.712  1.00 37.57 ?  415  GLN A CB  1 
ATOM   3153 C CG  . GLN A 1 415 ? 35.567  81.639 16.876  1.00 41.44 ?  415  GLN A CG  1 
ATOM   3154 C CD  . GLN A 1 415 ? 35.940  81.775 18.387  1.00 42.19 ?  415  GLN A CD  1 
ATOM   3155 O OE1 . GLN A 1 415 ? 35.443  82.682 19.073  1.00 48.83 ?  415  GLN A OE1 1 
ATOM   3156 N NE2 . GLN A 1 415 ? 36.773  80.850 18.904  1.00 45.52 ?  415  GLN A NE2 1 
ATOM   3157 N N   . VAL A 1 416 ? 34.905  78.820 14.865  1.00 36.36 ?  416  VAL A N   1 
ATOM   3158 C CA  . VAL A 1 416 ? 35.868  77.989 14.156  1.00 36.21 ?  416  VAL A CA  1 
ATOM   3159 C C   . VAL A 1 416 ? 35.474  77.683 12.700  1.00 36.07 ?  416  VAL A C   1 
ATOM   3160 O O   . VAL A 1 416 ? 36.317  77.794 11.786  1.00 35.56 ?  416  VAL A O   1 
ATOM   3161 C CB  . VAL A 1 416 ? 36.157  76.706 14.979  1.00 36.52 ?  416  VAL A CB  1 
ATOM   3162 C CG1 . VAL A 1 416 ? 36.995  75.706 14.185  1.00 37.74 ?  416  VAL A CG1 1 
ATOM   3163 C CG2 . VAL A 1 416 ? 36.869  77.088 16.288  1.00 35.78 ?  416  VAL A CG2 1 
ATOM   3164 N N   . LEU A 1 417 ? 34.200  77.304 12.488  1.00 34.91 ?  417  LEU A N   1 
ATOM   3165 C CA  . LEU A 1 417 ? 33.669  77.079 11.134  1.00 34.71 ?  417  LEU A CA  1 
ATOM   3166 C C   . LEU A 1 417 ? 33.830  78.318 10.240  1.00 34.59 ?  417  LEU A C   1 
ATOM   3167 O O   . LEU A 1 417 ? 34.298  78.215 9.099   1.00 34.59 ?  417  LEU A O   1 
ATOM   3168 C CB  . LEU A 1 417 ? 32.186  76.714 11.194  1.00 33.57 ?  417  LEU A CB  1 
ATOM   3169 C CG  . LEU A 1 417 ? 31.529  75.762 10.190  1.00 34.70 ?  417  LEU A CG  1 
ATOM   3170 C CD1 . LEU A 1 417 ? 30.004  76.105 9.997   1.00 32.41 ?  417  LEU A CD1 1 
ATOM   3171 C CD2 . LEU A 1 417 ? 32.215  75.599 8.857   1.00 28.66 ?  417  LEU A CD2 1 
ATOM   3172 N N   . ALA A 1 418 ? 33.412  79.471 10.742  1.00 35.30 ?  418  ALA A N   1 
ATOM   3173 C CA  . ALA A 1 418 ? 33.588  80.736 9.997   1.00 37.29 ?  418  ALA A CA  1 
ATOM   3174 C C   . ALA A 1 418 ? 35.061  80.990 9.627   1.00 38.76 ?  418  ALA A C   1 
ATOM   3175 O O   . ALA A 1 418 ? 35.355  81.384 8.492   1.00 39.33 ?  418  ALA A O   1 
ATOM   3176 C CB  . ALA A 1 418 ? 33.025  81.909 10.791  1.00 36.95 ?  418  ALA A CB  1 
ATOM   3177 N N   . GLN A 1 419 ? 35.978  80.739 10.570  1.00 40.14 ?  419  GLN A N   1 
ATOM   3178 C CA  . GLN A 1 419 ? 37.398  80.865 10.294  1.00 42.80 ?  419  GLN A CA  1 
ATOM   3179 C C   . GLN A 1 419 ? 37.781  80.007 9.095   1.00 42.21 ?  419  GLN A C   1 
ATOM   3180 O O   . GLN A 1 419 ? 38.352  80.502 8.129   1.00 42.05 ?  419  GLN A O   1 
ATOM   3181 C CB  . GLN A 1 419 ? 38.227  80.455 11.504  1.00 42.81 ?  419  GLN A CB  1 
ATOM   3182 C CG  . GLN A 1 419 ? 38.598  81.585 12.499  1.00 46.61 ?  419  GLN A CG  1 
ATOM   3183 C CD  . GLN A 1 419 ? 39.243  81.042 13.810  1.00 47.03 ?  419  GLN A CD  1 
ATOM   3184 O OE1 . GLN A 1 419 ? 38.932  81.518 14.917  1.00 51.76 ?  419  GLN A OE1 1 
ATOM   3185 N NE2 . GLN A 1 419 ? 40.121  80.026 13.678  1.00 50.39 ?  419  GLN A NE2 1 
ATOM   3186 N N   . LEU A 1 420 ? 37.440  78.722 9.168   1.00 43.12 ?  420  LEU A N   1 
ATOM   3187 C CA  . LEU A 1 420 ? 37.730  77.751 8.104   1.00 43.56 ?  420  LEU A CA  1 
ATOM   3188 C C   . LEU A 1 420 ? 37.141  78.113 6.745   1.00 43.80 ?  420  LEU A C   1 
ATOM   3189 O O   . LEU A 1 420 ? 37.793  77.914 5.716   1.00 43.97 ?  420  LEU A O   1 
ATOM   3190 C CB  . LEU A 1 420 ? 37.244  76.359 8.520   1.00 43.46 ?  420  LEU A CB  1 
ATOM   3191 C CG  . LEU A 1 420 ? 38.243  75.346 9.094   1.00 44.47 ?  420  LEU A CG  1 
ATOM   3192 C CD1 . LEU A 1 420 ? 39.663  75.876 9.227   1.00 44.56 ?  420  LEU A CD1 1 
ATOM   3193 C CD2 . LEU A 1 420 ? 37.727  74.802 10.430  1.00 44.15 ?  420  LEU A CD2 1 
ATOM   3194 N N   . ILE A 1 421 ? 35.899  78.598 6.741   1.00 44.13 ?  421  ILE A N   1 
ATOM   3195 C CA  . ILE A 1 421 ? 35.234  79.013 5.507   1.00 44.00 ?  421  ILE A CA  1 
ATOM   3196 C C   . ILE A 1 421 ? 35.981  80.186 4.858   1.00 45.36 ?  421  ILE A C   1 
ATOM   3197 O O   . ILE A 1 421 ? 36.194  80.195 3.641   1.00 44.65 ?  421  ILE A O   1 
ATOM   3198 C CB  . ILE A 1 421 ? 33.747  79.373 5.744   1.00 43.50 ?  421  ILE A CB  1 
ATOM   3199 C CG1 . ILE A 1 421 ? 32.970  78.123 6.213   1.00 42.07 ?  421  ILE A CG1 1 
ATOM   3200 C CG2 . ILE A 1 421 ? 33.142  79.987 4.472   1.00 40.97 ?  421  ILE A CG2 1 
ATOM   3201 C CD1 . ILE A 1 421 ? 31.540  78.382 6.709   1.00 36.01 ?  421  ILE A CD1 1 
ATOM   3202 N N   . LYS A 1 422 ? 36.374  81.160 5.682   1.00 47.46 ?  422  LYS A N   1 
ATOM   3203 C CA  . LYS A 1 422 ? 37.166  82.314 5.223   1.00 49.67 ?  422  LYS A CA  1 
ATOM   3204 C C   . LYS A 1 422 ? 38.507  81.883 4.619   1.00 51.20 ?  422  LYS A C   1 
ATOM   3205 O O   . LYS A 1 422 ? 38.820  82.242 3.483   1.00 51.37 ?  422  LYS A O   1 
ATOM   3206 C CB  . LYS A 1 422 ? 37.363  83.329 6.355   1.00 49.11 ?  422  LYS A CB  1 
ATOM   3207 C CG  . LYS A 1 422 ? 36.119  84.187 6.599   1.00 49.52 ?  422  LYS A CG  1 
ATOM   3208 C CD  . LYS A 1 422 ? 36.272  85.180 7.746   1.00 49.88 ?  422  LYS A CD  1 
ATOM   3209 C CE  . LYS A 1 422 ? 36.238  84.498 9.100   1.00 51.53 ?  422  LYS A CE  1 
ATOM   3210 N NZ  . LYS A 1 422 ? 35.950  85.432 10.234  1.00 53.73 ?  422  LYS A NZ  1 
ATOM   3211 N N   . GLU A 1 423 ? 39.268  81.087 5.371   1.00 53.15 ?  423  GLU A N   1 
ATOM   3212 C CA  . GLU A 1 423 ? 40.580  80.602 4.933   1.00 55.30 ?  423  GLU A CA  1 
ATOM   3213 C C   . GLU A 1 423 ? 40.487  79.770 3.667   1.00 56.55 ?  423  GLU A C   1 
ATOM   3214 O O   . GLU A 1 423 ? 41.398  79.769 2.848   1.00 57.25 ?  423  GLU A O   1 
ATOM   3215 C CB  . GLU A 1 423 ? 41.218  79.731 6.011   1.00 55.46 ?  423  GLU A CB  1 
ATOM   3216 C CG  . GLU A 1 423 ? 41.733  80.460 7.232   1.00 56.51 ?  423  GLU A CG  1 
ATOM   3217 C CD  . GLU A 1 423 ? 42.181  79.499 8.317   1.00 58.16 ?  423  GLU A CD  1 
ATOM   3218 O OE1 . GLU A 1 423 ? 41.998  78.277 8.147   1.00 59.75 ?  423  GLU A OE1 1 
ATOM   3219 O OE2 . GLU A 1 423 ? 42.712  79.966 9.343   1.00 60.58 ?  423  GLU A OE2 1 
ATOM   3220 N N   . SER A 1 424 ? 39.392  79.044 3.518   1.00 57.83 ?  424  SER A N   1 
ATOM   3221 C CA  . SER A 1 424 ? 39.241  78.145 2.392   1.00 59.38 ?  424  SER A CA  1 
ATOM   3222 C C   . SER A 1 424 ? 39.008  78.900 1.096   1.00 60.23 ?  424  SER A C   1 
ATOM   3223 O O   . SER A 1 424 ? 39.421  78.439 0.024   1.00 60.61 ?  424  SER A O   1 
ATOM   3224 C CB  . SER A 1 424 ? 38.094  77.161 2.642   1.00 59.52 ?  424  SER A CB  1 
ATOM   3225 O OG  . SER A 1 424 ? 37.484  76.791 1.423   1.00 59.58 ?  424  SER A OG  1 
ATOM   3226 N N   . LEU A 1 425 ? 38.353  80.056 1.212   1.00 60.97 ?  425  LEU A N   1 
ATOM   3227 C CA  . LEU A 1 425 ? 37.907  80.851 0.069   1.00 61.47 ?  425  LEU A CA  1 
ATOM   3228 C C   . LEU A 1 425 ? 39.049  81.547 -0.672  1.00 61.66 ?  425  LEU A C   1 
ATOM   3229 O O   . LEU A 1 425 ? 38.810  82.401 -1.534  1.00 61.94 ?  425  LEU A O   1 
ATOM   3230 C CB  . LEU A 1 425 ? 36.842  81.866 0.508   1.00 61.47 ?  425  LEU A CB  1 
ATOM   3231 C CG  . LEU A 1 425 ? 35.407  81.334 0.464   1.00 61.81 ?  425  LEU A CG  1 
ATOM   3232 C CD1 . LEU A 1 425 ? 34.497  82.203 1.313   1.00 62.73 ?  425  LEU A CD1 1 
ATOM   3233 C CD2 . LEU A 1 425 ? 34.890  81.245 -0.977  1.00 62.44 ?  425  LEU A CD2 1 
ATOM   3234 N N   . GLU B 1 1   ? 38.596  30.285 4.692   1.00 41.89 ?  -1   GLU B N   1 
ATOM   3235 C CA  . GLU B 1 1   ? 37.701  30.447 3.496   1.00 41.77 ?  -1   GLU B CA  1 
ATOM   3236 C C   . GLU B 1 1   ? 37.386  31.905 3.227   1.00 39.43 ?  -1   GLU B C   1 
ATOM   3237 O O   . GLU B 1 1   ? 37.429  32.717 4.133   1.00 41.55 ?  -1   GLU B O   1 
ATOM   3238 C CB  . GLU B 1 1   ? 36.345  29.766 3.751   1.00 42.78 ?  -1   GLU B CB  1 
ATOM   3239 C CG  . GLU B 1 1   ? 36.319  28.253 3.701   1.00 46.65 ?  -1   GLU B CG  1 
ATOM   3240 C CD  . GLU B 1 1   ? 34.900  27.722 3.756   1.00 50.35 ?  -1   GLU B CD  1 
ATOM   3241 O OE1 . GLU B 1 1   ? 33.945  28.533 3.774   1.00 52.12 ?  -1   GLU B OE1 1 
ATOM   3242 O OE2 . GLU B 1 1   ? 34.744  26.495 3.768   1.00 50.29 ?  -1   GLU B OE2 1 
ATOM   3243 N N   . ASN B 1 2   ? 37.044  32.237 1.997   1.00 35.33 ?  2    ASN B N   1 
ATOM   3244 C CA  . ASN B 1 2   ? 36.198  33.390 1.775   1.00 31.13 ?  2    ASN B CA  1 
ATOM   3245 C C   . ASN B 1 2   ? 34.746  32.825 1.847   1.00 27.90 ?  2    ASN B C   1 
ATOM   3246 O O   . ASN B 1 2   ? 34.502  31.630 1.641   1.00 27.07 ?  2    ASN B O   1 
ATOM   3247 C CB  . ASN B 1 2   ? 36.632  34.112 0.514   1.00 31.22 ?  2    ASN B CB  1 
ATOM   3248 C CG  . ASN B 1 2   ? 35.627  35.054 -0.041  1.00 33.43 ?  2    ASN B CG  1 
ATOM   3249 O OD1 . ASN B 1 2   ? 34.732  34.616 -0.758  1.00 37.42 ?  2    ASN B OD1 1 
ATOM   3250 N ND2 . ASN B 1 2   ? 35.820  36.383 0.172   1.00 35.97 ?  2    ASN B ND2 1 
ATOM   3251 N N   . TYR B 1 3   ? 33.816  33.668 2.224   1.00 22.76 ?  3    TYR B N   1 
ATOM   3252 C CA  . TYR B 1 3   ? 32.503  33.197 2.613   1.00 20.92 ?  3    TYR B CA  1 
ATOM   3253 C C   . TYR B 1 3   ? 31.441  33.598 1.609   1.00 20.28 ?  3    TYR B C   1 
ATOM   3254 O O   . TYR B 1 3   ? 30.258  33.332 1.840   1.00 20.06 ?  3    TYR B O   1 
ATOM   3255 C CB  . TYR B 1 3   ? 32.173  33.690 4.065   1.00 19.86 ?  3    TYR B CB  1 
ATOM   3256 C CG  . TYR B 1 3   ? 33.053  33.017 5.116   1.00 16.71 ?  3    TYR B CG  1 
ATOM   3257 C CD1 . TYR B 1 3   ? 34.276  33.565 5.497   1.00 17.78 ?  3    TYR B CD1 1 
ATOM   3258 C CD2 . TYR B 1 3   ? 32.677  31.794 5.676   1.00 18.76 ?  3    TYR B CD2 1 
ATOM   3259 C CE1 . TYR B 1 3   ? 35.097  32.919 6.483   1.00 17.64 ?  3    TYR B CE1 1 
ATOM   3260 C CE2 . TYR B 1 3   ? 33.463  31.134 6.628   1.00 18.35 ?  3    TYR B CE2 1 
ATOM   3261 C CZ  . TYR B 1 3   ? 34.679  31.690 7.026   1.00 15.59 ?  3    TYR B CZ  1 
ATOM   3262 O OH  . TYR B 1 3   ? 35.421  31.003 7.974   1.00 15.26 ?  3    TYR B OH  1 
ATOM   3263 N N   . ALA B 1 4   ? 31.870  34.224 0.498   1.00 19.81 ?  4    ALA B N   1 
ATOM   3264 C CA  . ALA B 1 4   ? 30.953  34.837 -0.478  1.00 20.45 ?  4    ALA B CA  1 
ATOM   3265 C C   . ALA B 1 4   ? 29.897  33.857 -0.996  1.00 21.23 ?  4    ALA B C   1 
ATOM   3266 O O   . ALA B 1 4   ? 28.747  34.237 -1.144  1.00 18.50 ?  4    ALA B O   1 
ATOM   3267 C CB  . ALA B 1 4   ? 31.724  35.495 -1.652  1.00 20.21 ?  4    ALA B CB  1 
ATOM   3268 N N   . ARG B 1 5   ? 30.301  32.599 -1.236  1.00 22.37 ?  5    ARG B N   1 
ATOM   3269 C CA  . ARG B 1 5   ? 29.396  31.494 -1.603  1.00 25.23 ?  5    ARG B CA  1 
ATOM   3270 C C   . ARG B 1 5   ? 28.177  31.411 -0.737  1.00 25.37 ?  5    ARG B C   1 
ATOM   3271 O O   . ARG B 1 5   ? 27.136  30.998 -1.206  1.00 26.38 ?  5    ARG B O   1 
ATOM   3272 C CB  . ARG B 1 5   ? 30.039  30.119 -1.332  1.00 25.06 ?  5    ARG B CB  1 
ATOM   3273 C CG  . ARG B 1 5   ? 30.977  29.567 -2.291  1.00 29.26 ?  5    ARG B CG  1 
ATOM   3274 C CD  . ARG B 1 5   ? 31.438  28.163 -1.779  1.00 31.69 ?  5    ARG B CD  1 
ATOM   3275 N NE  . ARG B 1 5   ? 30.243  27.358 -1.469  1.00 33.00 ?  5    ARG B NE  1 
ATOM   3276 C CZ  . ARG B 1 5   ? 30.234  26.224 -0.780  1.00 28.70 ?  5    ARG B CZ  1 
ATOM   3277 N NH1 . ARG B 1 5   ? 29.068  25.611 -0.543  1.00 28.03 ?  5    ARG B NH1 1 
ATOM   3278 N NH2 . ARG B 1 5   ? 31.366  25.720 -0.314  1.00 28.84 ?  5    ARG B NH2 1 
ATOM   3279 N N   . PHE B 1 6   ? 28.351  31.646 0.556   1.00 25.44 ?  6    PHE B N   1 
ATOM   3280 C CA  . PHE B 1 6   ? 27.273  31.461 1.531   1.00 26.46 ?  6    PHE B CA  1 
ATOM   3281 C C   . PHE B 1 6   ? 26.487  32.709 1.875   1.00 28.29 ?  6    PHE B C   1 
ATOM   3282 O O   . PHE B 1 6   ? 25.842  32.761 2.943   1.00 32.90 ?  6    PHE B O   1 
ATOM   3283 C CB  . PHE B 1 6   ? 27.866  31.020 2.851   1.00 25.03 ?  6    PHE B CB  1 
ATOM   3284 C CG  . PHE B 1 6   ? 28.632  29.743 2.775   1.00 23.10 ?  6    PHE B CG  1 
ATOM   3285 C CD1 . PHE B 1 6   ? 30.022  29.764 2.782   1.00 18.31 ?  6    PHE B CD1 1 
ATOM   3286 C CD2 . PHE B 1 6   ? 27.959  28.531 2.676   1.00 18.73 ?  6    PHE B CD2 1 
ATOM   3287 C CE1 . PHE B 1 6   ? 30.754  28.576 2.750   1.00 22.34 ?  6    PHE B CE1 1 
ATOM   3288 C CE2 . PHE B 1 6   ? 28.685  27.331 2.595   1.00 23.78 ?  6    PHE B CE2 1 
ATOM   3289 C CZ  . PHE B 1 6   ? 30.083  27.350 2.652   1.00 21.57 ?  6    PHE B CZ  1 
ATOM   3290 N N   . ILE B 1 7   ? 26.611  33.754 1.088   1.00 26.95 ?  7    ILE B N   1 
ATOM   3291 C CA  . ILE B 1 7   ? 26.033  35.044 1.448   1.00 27.03 ?  7    ILE B CA  1 
ATOM   3292 C C   . ILE B 1 7   ? 25.158  35.478 0.267   1.00 25.73 ?  7    ILE B C   1 
ATOM   3293 O O   . ILE B 1 7   ? 25.594  35.302 -0.875  1.00 25.32 ?  7    ILE B O   1 
ATOM   3294 C CB  . ILE B 1 7   ? 27.184  36.037 1.702   1.00 26.91 ?  7    ILE B CB  1 
ATOM   3295 C CG1 . ILE B 1 7   ? 27.651  35.908 3.144   1.00 29.22 ?  7    ILE B CG1 1 
ATOM   3296 C CG2 . ILE B 1 7   ? 26.791  37.452 1.509   1.00 29.42 ?  7    ILE B CG2 1 
ATOM   3297 C CD1 . ILE B 1 7   ? 29.100  36.504 3.338   1.00 31.84 ?  7    ILE B CD1 1 
ATOM   3298 N N   . THR B 1 8   ? 23.943  35.990 0.524   1.00 23.38 ?  8    THR B N   1 
ATOM   3299 C CA  . THR B 1 8   ? 23.113  36.515 -0.548  1.00 21.77 ?  8    THR B CA  1 
ATOM   3300 C C   . THR B 1 8   ? 23.698  37.823 -1.129  1.00 21.89 ?  8    THR B C   1 
ATOM   3301 O O   . THR B 1 8   ? 24.566  38.475 -0.508  1.00 22.13 ?  8    THR B O   1 
ATOM   3302 C CB  . THR B 1 8   ? 21.669  36.844 -0.095  1.00 21.94 ?  8    THR B CB  1 
ATOM   3303 O OG1 . THR B 1 8   ? 21.715  37.870 0.907   1.00 22.80 ?  8    THR B OG1 1 
ATOM   3304 C CG2 . THR B 1 8   ? 20.932  35.585 0.411   1.00 17.48 ?  8    THR B CG2 1 
ATOM   3305 N N   . ALA B 1 9   ? 23.183  38.198 -2.301  1.00 20.70 ?  9    ALA B N   1 
ATOM   3306 C CA  . ALA B 1 9   ? 23.434  39.492 -2.941  1.00 20.80 ?  9    ALA B CA  1 
ATOM   3307 C C   . ALA B 1 9   ? 23.087  40.677 -2.044  1.00 19.35 ?  9    ALA B C   1 
ATOM   3308 O O   . ALA B 1 9   ? 23.864  41.632 -1.920  1.00 19.46 ?  9    ALA B O   1 
ATOM   3309 C CB  . ALA B 1 9   ? 22.624  39.570 -4.250  1.00 21.55 ?  9    ALA B CB  1 
ATOM   3310 N N   . ALA B 1 10  ? 21.916  40.612 -1.433  1.00 17.39 ?  10   ALA B N   1 
ATOM   3311 C CA  . ALA B 1 10  ? 21.469  41.633 -0.496  1.00 17.01 ?  10   ALA B CA  1 
ATOM   3312 C C   . ALA B 1 10  ? 22.438  41.760 0.685   1.00 15.56 ?  10   ALA B C   1 
ATOM   3313 O O   . ALA B 1 10  ? 22.823  42.873 1.042   1.00 15.49 ?  10   ALA B O   1 
ATOM   3314 C CB  . ALA B 1 10  ? 20.070  41.287 0.021   1.00 15.98 ?  10   ALA B CB  1 
ATOM   3315 N N   . SER B 1 11  ? 22.820  40.641 1.298   1.00 15.58 ?  11   SER B N   1 
ATOM   3316 C CA  . SER B 1 11  ? 23.749  40.714 2.472   1.00 16.63 ?  11   SER B CA  1 
ATOM   3317 C C   . SER B 1 11  ? 25.154  41.267 2.071   1.00 17.24 ?  11   SER B C   1 
ATOM   3318 O O   . SER B 1 11  ? 25.706  42.146 2.740   1.00 16.45 ?  11   SER B O   1 
ATOM   3319 C CB  . SER B 1 11  ? 23.815  39.375 3.196   1.00 16.58 ?  11   SER B CB  1 
ATOM   3320 O OG  . SER B 1 11  ? 24.782  39.398 4.246   1.00 18.38 ?  11   SER B OG  1 
ATOM   3321 N N   . ALA B 1 12  ? 25.698  40.807 0.939   1.00 17.84 ?  12   ALA B N   1 
ATOM   3322 C CA  . ALA B 1 12  ? 26.974  41.357 0.474   1.00 18.31 ?  12   ALA B CA  1 
ATOM   3323 C C   . ALA B 1 12  ? 26.943  42.859 0.146   1.00 18.46 ?  12   ALA B C   1 
ATOM   3324 O O   . ALA B 1 12  ? 27.979  43.508 0.237   1.00 17.32 ?  12   ALA B O   1 
ATOM   3325 C CB  . ALA B 1 12  ? 27.586  40.532 -0.695  1.00 18.64 ?  12   ALA B CB  1 
ATOM   3326 N N   . ALA B 1 13  ? 25.759  43.403 -0.192  1.00 19.12 ?  13   ALA B N   1 
ATOM   3327 C CA  . ALA B 1 13  ? 25.627  44.818 -0.573  1.00 19.10 ?  13   ALA B CA  1 
ATOM   3328 C C   . ALA B 1 13  ? 25.623  45.772 0.624   1.00 19.04 ?  13   ALA B C   1 
ATOM   3329 O O   . ALA B 1 13  ? 25.827  46.977 0.445   1.00 19.80 ?  13   ALA B O   1 
ATOM   3330 C CB  . ALA B 1 13  ? 24.355  45.057 -1.494  1.00 18.38 ?  13   ALA B CB  1 
ATOM   3331 N N   . ARG B 1 14  ? 25.428  45.243 1.824   1.00 18.24 ?  14   ARG B N   1 
ATOM   3332 C CA  . ARG B 1 14  ? 25.358  46.057 3.054   1.00 19.77 ?  14   ARG B CA  1 
ATOM   3333 C C   . ARG B 1 14  ? 26.707  46.750 3.325   1.00 21.35 ?  14   ARG B C   1 
ATOM   3334 O O   . ARG B 1 14  ? 27.762  46.128 3.201   1.00 19.77 ?  14   ARG B O   1 
ATOM   3335 C CB  . ARG B 1 14  ? 24.986  45.176 4.276   1.00 17.99 ?  14   ARG B CB  1 
ATOM   3336 C CG  . ARG B 1 14  ? 23.571  44.648 4.278   1.00 17.63 ?  14   ARG B CG  1 
ATOM   3337 C CD  . ARG B 1 14  ? 23.176  43.918 5.604   1.00 19.13 ?  14   ARG B CD  1 
ATOM   3338 N NE  . ARG B 1 14  ? 21.960  43.137 5.346   1.00 16.47 ?  14   ARG B NE  1 
ATOM   3339 C CZ  . ARG B 1 14  ? 20.754  43.671 5.156   1.00 16.98 ?  14   ARG B CZ  1 
ATOM   3340 N NH1 . ARG B 1 14  ? 20.567  44.970 5.307   1.00 14.04 ?  14   ARG B NH1 1 
ATOM   3341 N NH2 . ARG B 1 14  ? 19.719  42.898 4.844   1.00 16.94 ?  14   ARG B NH2 1 
ATOM   3342 N N   . ASN B 1 15  ? 26.631  48.024 3.679   1.00 24.55 ?  15   ASN B N   1 
ATOM   3343 C CA  . ASN B 1 15  ? 27.790  48.876 3.978   1.00 29.60 ?  15   ASN B CA  1 
ATOM   3344 C C   . ASN B 1 15  ? 27.671  49.409 5.397   1.00 31.12 ?  15   ASN B C   1 
ATOM   3345 O O   . ASN B 1 15  ? 26.558  49.613 5.877   1.00 30.66 ?  15   ASN B O   1 
ATOM   3346 C CB  . ASN B 1 15  ? 27.851  50.078 3.024   1.00 29.52 ?  15   ASN B CB  1 
ATOM   3347 C CG  . ASN B 1 15  ? 28.027  49.670 1.594   1.00 32.28 ?  15   ASN B CG  1 
ATOM   3348 O OD1 . ASN B 1 15  ? 28.867  48.822 1.261   1.00 33.21 ?  15   ASN B OD1 1 
ATOM   3349 N ND2 . ASN B 1 15  ? 27.208  50.244 0.729   1.00 33.93 ?  15   ASN B ND2 1 
ATOM   3350 N N   . PRO B 1 16  ? 28.811  49.653 6.068   1.00 34.21 ?  16   PRO B N   1 
ATOM   3351 C CA  . PRO B 1 16  ? 28.736  50.405 7.328   1.00 37.10 ?  16   PRO B CA  1 
ATOM   3352 C C   . PRO B 1 16  ? 28.208  51.826 7.054   1.00 39.14 ?  16   PRO B C   1 
ATOM   3353 O O   . PRO B 1 16  ? 28.372  52.360 5.944   1.00 39.15 ?  16   PRO B O   1 
ATOM   3354 C CB  . PRO B 1 16  ? 30.205  50.439 7.804   1.00 36.80 ?  16   PRO B CB  1 
ATOM   3355 C CG  . PRO B 1 16  ? 30.994  50.312 6.568   1.00 36.40 ?  16   PRO B CG  1 
ATOM   3356 C CD  . PRO B 1 16  ? 30.201  49.319 5.727   1.00 34.94 ?  16   PRO B CD  1 
ATOM   3357 N N   . SER B 1 17  ? 27.538  52.426 8.021   1.00 42.80 ?  17   SER B N   1 
ATOM   3358 C CA  . SER B 1 17  ? 27.082  53.797 7.822   1.00 46.79 ?  17   SER B CA  1 
ATOM   3359 C C   . SER B 1 17  ? 28.246  54.731 7.407   1.00 48.96 ?  17   SER B C   1 
ATOM   3360 O O   . SER B 1 17  ? 29.403  54.551 7.845   1.00 48.81 ?  17   SER B O   1 
ATOM   3361 C CB  . SER B 1 17  ? 26.474  54.331 9.117   1.00 47.06 ?  17   SER B CB  1 
ATOM   3362 O OG  . SER B 1 17  ? 26.171  53.259 9.991   1.00 50.34 ?  17   SER B OG  1 
ATOM   3363 N N   . PRO B 1 18  ? 27.944  55.749 6.576   1.00 50.98 ?  18   PRO B N   1 
ATOM   3364 C CA  . PRO B 1 18  ? 28.809  56.924 6.737   1.00 51.97 ?  18   PRO B CA  1 
ATOM   3365 C C   . PRO B 1 18  ? 28.469  57.498 8.124   1.00 53.01 ?  18   PRO B C   1 
ATOM   3366 O O   . PRO B 1 18  ? 27.820  56.810 8.927   1.00 53.54 ?  18   PRO B O   1 
ATOM   3367 C CB  . PRO B 1 18  ? 28.367  57.855 5.598   1.00 52.18 ?  18   PRO B CB  1 
ATOM   3368 C CG  . PRO B 1 18  ? 27.509  56.997 4.666   1.00 51.68 ?  18   PRO B CG  1 
ATOM   3369 C CD  . PRO B 1 18  ? 26.897  55.950 5.551   1.00 51.57 ?  18   PRO B CD  1 
ATOM   3370 N N   . ILE B 1 19  ? 28.890  58.716 8.440   1.00 54.07 ?  19   ILE B N   1 
ATOM   3371 C CA  . ILE B 1 19  ? 28.587  59.284 9.769   1.00 54.41 ?  19   ILE B CA  1 
ATOM   3372 C C   . ILE B 1 19  ? 29.467  58.692 10.864  1.00 54.62 ?  19   ILE B C   1 
ATOM   3373 O O   . ILE B 1 19  ? 30.543  59.218 11.137  1.00 55.48 ?  19   ILE B O   1 
ATOM   3374 C CB  . ILE B 1 19  ? 27.086  59.119 10.161  1.00 54.34 ?  19   ILE B CB  1 
ATOM   3375 C CG1 . ILE B 1 19  ? 26.202  59.818 9.116   1.00 53.86 ?  19   ILE B CG1 1 
ATOM   3376 C CG2 . ILE B 1 19  ? 26.837  59.631 11.596  1.00 54.05 ?  19   ILE B CG2 1 
ATOM   3377 C CD1 . ILE B 1 19  ? 24.732  59.720 9.365   1.00 52.90 ?  19   ILE B CD1 1 
ATOM   3378 N N   . MET B 1 33  ? 37.113  68.961 22.426  1.00 55.83 ?  33   MET B N   1 
ATOM   3379 C CA  . MET B 1 33  ? 36.381  68.729 21.178  1.00 55.94 ?  33   MET B CA  1 
ATOM   3380 C C   . MET B 1 33  ? 34.883  69.019 21.362  1.00 54.97 ?  33   MET B C   1 
ATOM   3381 O O   . MET B 1 33  ? 34.165  68.275 22.066  1.00 54.95 ?  33   MET B O   1 
ATOM   3382 C CB  . MET B 1 33  ? 36.618  67.297 20.648  1.00 56.42 ?  33   MET B CB  1 
ATOM   3383 C CG  . MET B 1 33  ? 35.727  66.875 19.468  1.00 58.58 ?  33   MET B CG  1 
ATOM   3384 S SD  . MET B 1 33  ? 36.353  67.350 17.827  1.00 64.26 ?  33   MET B SD  1 
ATOM   3385 C CE  . MET B 1 33  ? 37.622  66.104 17.535  1.00 64.19 ?  33   MET B CE  1 
ATOM   3386 N N   . ILE B 1 34  ? 34.431  70.114 20.745  1.00 53.59 ?  34   ILE B N   1 
ATOM   3387 C CA  . ILE B 1 34  ? 33.004  70.433 20.678  1.00 52.15 ?  34   ILE B CA  1 
ATOM   3388 C C   . ILE B 1 34  ? 32.453  69.707 19.467  1.00 50.88 ?  34   ILE B C   1 
ATOM   3389 O O   . ILE B 1 34  ? 32.938  69.909 18.361  1.00 51.02 ?  34   ILE B O   1 
ATOM   3390 C CB  . ILE B 1 34  ? 32.743  71.946 20.511  1.00 51.96 ?  34   ILE B CB  1 
ATOM   3391 C CG1 . ILE B 1 34  ? 33.412  72.740 21.644  1.00 53.56 ?  34   ILE B CG1 1 
ATOM   3392 C CG2 . ILE B 1 34  ? 31.243  72.220 20.484  1.00 51.83 ?  34   ILE B CG2 1 
ATOM   3393 C CD1 . ILE B 1 34  ? 33.501  74.264 21.396  1.00 53.66 ?  34   ILE B CD1 1 
ATOM   3394 N N   . SER B 1 35  ? 31.460  68.851 19.677  1.00 49.18 ?  35   SER B N   1 
ATOM   3395 C CA  . SER B 1 35  ? 30.863  68.120 18.574  1.00 47.72 ?  35   SER B CA  1 
ATOM   3396 C C   . SER B 1 35  ? 29.375  68.421 18.444  1.00 46.10 ?  35   SER B C   1 
ATOM   3397 O O   . SER B 1 35  ? 28.608  68.263 19.382  1.00 45.33 ?  35   SER B O   1 
ATOM   3398 C CB  . SER B 1 35  ? 31.102  66.614 18.718  1.00 48.30 ?  35   SER B CB  1 
ATOM   3399 O OG  . SER B 1 35  ? 30.414  65.895 17.703  1.00 49.08 ?  35   SER B OG  1 
ATOM   3400 N N   . LEU B 1 36  ? 28.998  68.882 17.261  1.00 44.72 ?  36   LEU B N   1 
ATOM   3401 C CA  . LEU B 1 36  ? 27.604  69.065 16.895  1.00 43.49 ?  36   LEU B CA  1 
ATOM   3402 C C   . LEU B 1 36  ? 27.248  68.039 15.831  1.00 42.38 ?  36   LEU B C   1 
ATOM   3403 O O   . LEU B 1 36  ? 26.256  68.183 15.135  1.00 41.54 ?  36   LEU B O   1 
ATOM   3404 C CB  . LEU B 1 36  ? 27.398  70.492 16.355  1.00 43.21 ?  36   LEU B CB  1 
ATOM   3405 C CG  . LEU B 1 36  ? 27.863  71.641 17.255  1.00 43.79 ?  36   LEU B CG  1 
ATOM   3406 C CD1 . LEU B 1 36  ? 27.777  72.989 16.531  1.00 45.11 ?  36   LEU B CD1 1 
ATOM   3407 C CD2 . LEU B 1 36  ? 27.078  71.690 18.545  1.00 44.71 ?  36   LEU B CD2 1 
ATOM   3408 N N   . ALA B 1 37  ? 28.068  66.999 15.711  1.00 41.67 ?  37   ALA B N   1 
ATOM   3409 C CA  . ALA B 1 37  ? 27.928  66.055 14.600  1.00 41.57 ?  37   ALA B CA  1 
ATOM   3410 C C   . ALA B 1 37  ? 27.073  64.865 14.968  1.00 40.83 ?  37   ALA B C   1 
ATOM   3411 O O   . ALA B 1 37  ? 26.710  64.082 14.092  1.00 40.91 ?  37   ALA B O   1 
ATOM   3412 C CB  . ALA B 1 37  ? 29.283  65.585 14.104  1.00 41.57 ?  37   ALA B CB  1 
ATOM   3413 N N   . GLY B 1 38  ? 26.759  64.742 16.258  1.00 39.92 ?  38   GLY B N   1 
ATOM   3414 C CA  . GLY B 1 38  ? 26.066  63.577 16.789  1.00 38.35 ?  38   GLY B CA  1 
ATOM   3415 C C   . GLY B 1 38  ? 24.566  63.693 16.705  1.00 37.40 ?  38   GLY B C   1 
ATOM   3416 O O   . GLY B 1 38  ? 24.034  64.778 16.787  1.00 37.86 ?  38   GLY B O   1 
ATOM   3417 N N   . GLY B 1 39  ? 23.881  62.562 16.558  1.00 36.62 ?  39   GLY B N   1 
ATOM   3418 C CA  . GLY B 1 39  ? 22.429  62.552 16.491  1.00 35.78 ?  39   GLY B CA  1 
ATOM   3419 C C   . GLY B 1 39  ? 21.722  62.072 17.751  1.00 35.04 ?  39   GLY B C   1 
ATOM   3420 O O   . GLY B 1 39  ? 20.595  61.589 17.678  1.00 35.29 ?  39   GLY B O   1 
ATOM   3421 N N   . LEU B 1 40  ? 22.371  62.225 18.904  1.00 34.32 ?  40   LEU B N   1 
ATOM   3422 C CA  . LEU B 1 40  ? 21.837  61.753 20.201  1.00 33.64 ?  40   LEU B CA  1 
ATOM   3423 C C   . LEU B 1 40  ? 20.822  62.692 20.830  1.00 32.06 ?  40   LEU B C   1 
ATOM   3424 O O   . LEU B 1 40  ? 21.051  63.893 20.835  1.00 32.66 ?  40   LEU B O   1 
ATOM   3425 C CB  . LEU B 1 40  ? 22.988  61.567 21.182  1.00 34.21 ?  40   LEU B CB  1 
ATOM   3426 C CG  . LEU B 1 40  ? 23.968  60.468 20.729  1.00 36.57 ?  40   LEU B CG  1 
ATOM   3427 C CD1 . LEU B 1 40  ? 25.422  60.870 20.947  1.00 39.68 ?  40   LEU B CD1 1 
ATOM   3428 C CD2 . LEU B 1 40  ? 23.656  59.108 21.385  1.00 35.76 ?  40   LEU B CD2 1 
ATOM   3429 N N   . PRO B 1 41  ? 19.687  62.157 21.343  1.00 30.32 ?  41   PRO B N   1 
ATOM   3430 C CA  . PRO B 1 41  ? 18.813  63.012 22.164  1.00 29.38 ?  41   PRO B CA  1 
ATOM   3431 C C   . PRO B 1 41  ? 19.441  63.302 23.522  1.00 29.16 ?  41   PRO B C   1 
ATOM   3432 O O   . PRO B 1 41  ? 20.191  62.468 24.088  1.00 28.90 ?  41   PRO B O   1 
ATOM   3433 C CB  . PRO B 1 41  ? 17.566  62.139 22.397  1.00 29.58 ?  41   PRO B CB  1 
ATOM   3434 C CG  . PRO B 1 41  ? 18.057  60.725 22.278  1.00 29.54 ?  41   PRO B CG  1 
ATOM   3435 C CD  . PRO B 1 41  ? 19.129  60.802 21.175  1.00 29.48 ?  41   PRO B CD  1 
ATOM   3436 N N   . ASN B 1 42  ? 19.073  64.434 24.093  1.00 28.43 ?  42   ASN B N   1 
ATOM   3437 C CA  . ASN B 1 42  ? 19.598  64.799 25.383  1.00 28.22 ?  42   ASN B CA  1 
ATOM   3438 C C   . ASN B 1 42  ? 19.027  63.885 26.469  1.00 28.06 ?  42   ASN B C   1 
ATOM   3439 O O   . ASN B 1 42  ? 17.823  63.912 26.743  1.00 27.16 ?  42   ASN B O   1 
ATOM   3440 C CB  . ASN B 1 42  ? 19.239  66.256 25.688  1.00 29.03 ?  42   ASN B CB  1 
ATOM   3441 C CG  . ASN B 1 42  ? 20.061  66.821 26.807  1.00 29.12 ?  42   ASN B CG  1 
ATOM   3442 O OD1 . ASN B 1 42  ? 20.721  67.859 26.647  1.00 30.99 ?  42   ASN B OD1 1 
ATOM   3443 N ND2 . ASN B 1 42  ? 20.069  66.128 27.934  1.00 22.46 ?  42   ASN B ND2 1 
ATOM   3444 N N   . PRO B 1 43  ? 19.893  63.091 27.126  1.00 29.27 ?  43   PRO B N   1 
ATOM   3445 C CA  . PRO B 1 43  ? 19.344  62.144 28.114  1.00 30.15 ?  43   PRO B CA  1 
ATOM   3446 C C   . PRO B 1 43  ? 18.845  62.793 29.430  1.00 30.85 ?  43   PRO B C   1 
ATOM   3447 O O   . PRO B 1 43  ? 18.144  62.147 30.223  1.00 31.73 ?  43   PRO B O   1 
ATOM   3448 C CB  . PRO B 1 43  ? 20.515  61.176 28.366  1.00 29.47 ?  43   PRO B CB  1 
ATOM   3449 C CG  . PRO B 1 43  ? 21.708  61.979 28.147  1.00 30.08 ?  43   PRO B CG  1 
ATOM   3450 C CD  . PRO B 1 43  ? 21.366  63.002 27.043  1.00 29.18 ?  43   PRO B CD  1 
ATOM   3451 N N   . ASN B 1 44  ? 19.157  64.064 29.631  1.00 30.43 ?  44   ASN B N   1 
ATOM   3452 C CA  . ASN B 1 44  ? 18.606  64.789 30.761  1.00 31.03 ?  44   ASN B CA  1 
ATOM   3453 C C   . ASN B 1 44  ? 17.127  64.978 30.651  1.00 29.72 ?  44   ASN B C   1 
ATOM   3454 O O   . ASN B 1 44  ? 16.491  65.255 31.642  1.00 30.54 ?  44   ASN B O   1 
ATOM   3455 C CB  . ASN B 1 44  ? 19.324  66.122 30.963  1.00 31.23 ?  44   ASN B CB  1 
ATOM   3456 C CG  . ASN B 1 44  ? 20.759  65.923 31.352  1.00 34.80 ?  44   ASN B CG  1 
ATOM   3457 O OD1 . ASN B 1 44  ? 21.048  65.254 32.341  1.00 36.74 ?  44   ASN B OD1 1 
ATOM   3458 N ND2 . ASN B 1 44  ? 21.675  66.479 30.567  1.00 38.35 ?  44   ASN B ND2 1 
ATOM   3459 N N   . MET B 1 45  ? 16.577  64.807 29.451  1.00 29.15 ?  45   MET B N   1 
ATOM   3460 C CA  . MET B 1 45  ? 15.114  64.879 29.244  1.00 27.89 ?  45   MET B CA  1 
ATOM   3461 C C   . MET B 1 45  ? 14.372  63.574 29.595  1.00 26.27 ?  45   MET B C   1 
ATOM   3462 O O   . MET B 1 45  ? 13.149  63.539 29.630  1.00 26.42 ?  45   MET B O   1 
ATOM   3463 C CB  . MET B 1 45  ? 14.796  65.284 27.794  1.00 28.79 ?  45   MET B CB  1 
ATOM   3464 C CG  . MET B 1 45  ? 15.213  66.712 27.408  1.00 30.72 ?  45   MET B CG  1 
ATOM   3465 S SD  . MET B 1 45  ? 14.560  67.997 28.523  1.00 36.53 ?  45   MET B SD  1 
ATOM   3466 C CE  . MET B 1 45  ? 15.987  68.375 29.517  1.00 30.75 ?  45   MET B CE  1 
ATOM   3467 N N   . PHE B 1 46  ? 15.100  62.491 29.826  1.00 25.04 ?  46   PHE B N   1 
ATOM   3468 C CA  . PHE B 1 46  ? 14.463  61.187 30.029  1.00 22.98 ?  46   PHE B CA  1 
ATOM   3469 C C   . PHE B 1 46  ? 13.933  61.134 31.464  1.00 22.75 ?  46   PHE B C   1 
ATOM   3470 O O   . PHE B 1 46  ? 14.606  61.539 32.384  1.00 22.08 ?  46   PHE B O   1 
ATOM   3471 C CB  . PHE B 1 46  ? 15.447  60.026 29.729  1.00 22.86 ?  46   PHE B CB  1 
ATOM   3472 C CG  . PHE B 1 46  ? 15.844  59.916 28.246  1.00 23.98 ?  46   PHE B CG  1 
ATOM   3473 C CD1 . PHE B 1 46  ? 17.031  59.293 27.881  1.00 21.21 ?  46   PHE B CD1 1 
ATOM   3474 C CD2 . PHE B 1 46  ? 15.020  60.457 27.232  1.00 25.92 ?  46   PHE B CD2 1 
ATOM   3475 C CE1 . PHE B 1 46  ? 17.437  59.214 26.541  1.00 22.74 ?  46   PHE B CE1 1 
ATOM   3476 C CE2 . PHE B 1 46  ? 15.396  60.396 25.842  1.00 27.33 ?  46   PHE B CE2 1 
ATOM   3477 C CZ  . PHE B 1 46  ? 16.600  59.759 25.496  1.00 24.68 ?  46   PHE B CZ  1 
ATOM   3478 N N   . PRO B 1 47  ? 12.701  60.645 31.648  1.00 21.78 ?  47   PRO B N   1 
ATOM   3479 C CA  . PRO B 1 47  ? 12.075  60.769 32.966  1.00 21.18 ?  47   PRO B CA  1 
ATOM   3480 C C   . PRO B 1 47  ? 12.522  59.804 34.053  1.00 21.15 ?  47   PRO B C   1 
ATOM   3481 O O   . PRO B 1 47  ? 12.315  60.113 35.229  1.00 21.33 ?  47   PRO B O   1 
ATOM   3482 C CB  . PRO B 1 47  ? 10.610  60.537 32.675  1.00 20.65 ?  47   PRO B CB  1 
ATOM   3483 C CG  . PRO B 1 47  ? 10.611  59.621 31.429  1.00 21.05 ?  47   PRO B CG  1 
ATOM   3484 C CD  . PRO B 1 47  ? 11.818  60.033 30.638  1.00 20.37 ?  47   PRO B CD  1 
ATOM   3485 N N   . PHE B 1 48  ? 13.028  58.628 33.696  1.00 20.63 ?  48   PHE B N   1 
ATOM   3486 C CA  . PHE B 1 48  ? 13.515  57.679 34.706  1.00 20.39 ?  48   PHE B CA  1 
ATOM   3487 C C   . PHE B 1 48  ? 14.900  58.110 35.189  1.00 21.89 ?  48   PHE B C   1 
ATOM   3488 O O   . PHE B 1 48  ? 15.778  58.408 34.361  1.00 21.75 ?  48   PHE B O   1 
ATOM   3489 C CB  . PHE B 1 48  ? 13.621  56.251 34.156  1.00 20.60 ?  48   PHE B CB  1 
ATOM   3490 C CG  . PHE B 1 48  ? 12.474  55.822 33.307  1.00 17.64 ?  48   PHE B CG  1 
ATOM   3491 C CD1 . PHE B 1 48  ? 12.572  55.888 31.926  1.00 17.47 ?  48   PHE B CD1 1 
ATOM   3492 C CD2 . PHE B 1 48  ? 11.316  55.326 33.879  1.00 15.52 ?  48   PHE B CD2 1 
ATOM   3493 C CE1 . PHE B 1 48  ? 11.517  55.430 31.102  1.00 17.99 ?  48   PHE B CE1 1 
ATOM   3494 C CE2 . PHE B 1 48  ? 10.265  54.869 33.095  1.00 15.75 ?  48   PHE B CE2 1 
ATOM   3495 C CZ  . PHE B 1 48  ? 10.356  54.938 31.687  1.00 16.78 ?  48   PHE B CZ  1 
ATOM   3496 N N   . LYS B 1 49  ? 15.119  58.111 36.514  1.00 21.81 ?  49   LYS B N   1 
ATOM   3497 C CA  . LYS B 1 49  ? 16.330  58.715 37.097  1.00 21.12 ?  49   LYS B CA  1 
ATOM   3498 C C   . LYS B 1 49  ? 17.336  57.832 37.856  1.00 20.73 ?  49   LYS B C   1 
ATOM   3499 O O   . LYS B 1 49  ? 18.552  58.093 37.817  1.00 20.15 ?  49   LYS B O   1 
ATOM   3500 C CB  . LYS B 1 49  ? 15.948  59.912 37.980  1.00 21.22 ?  49   LYS B CB  1 
ATOM   3501 C CG  . LYS B 1 49  ? 15.280  61.072 37.220  1.00 22.31 ?  49   LYS B CG  1 
ATOM   3502 C CD  . LYS B 1 49  ? 16.107  61.623 36.021  1.00 24.00 ?  49   LYS B CD  1 
ATOM   3503 C CE  . LYS B 1 49  ? 15.317  62.745 35.303  1.00 26.19 ?  49   LYS B CE  1 
ATOM   3504 N NZ  . LYS B 1 49  ? 15.930  63.273 34.036  1.00 27.27 ?  49   LYS B NZ  1 
ATOM   3505 N N   . THR B 1 50  ? 16.850  56.817 38.552  1.00 19.58 ?  50   THR B N   1 
ATOM   3506 C CA  . THR B 1 50  ? 17.742  55.870 39.203  1.00 20.32 ?  50   THR B CA  1 
ATOM   3507 C C   . THR B 1 50  ? 16.980  54.587 39.164  1.00 20.45 ?  50   THR B C   1 
ATOM   3508 O O   . THR B 1 50  ? 15.742  54.589 39.031  1.00 21.12 ?  50   THR B O   1 
ATOM   3509 C CB  . THR B 1 50  ? 17.952  56.199 40.735  1.00 20.49 ?  50   THR B CB  1 
ATOM   3510 O OG1 . THR B 1 50  ? 16.681  56.078 41.392  1.00 24.76 ?  50   THR B OG1 1 
ATOM   3511 C CG2 . THR B 1 50  ? 18.446  57.606 40.932  1.00 19.07 ?  50   THR B CG2 1 
ATOM   3512 N N   . ALA B 1 51  ? 17.698  53.493 39.344  1.00 20.40 ?  51   ALA B N   1 
ATOM   3513 C CA  . ALA B 1 51  ? 17.091  52.183 39.443  1.00 21.11 ?  51   ALA B CA  1 
ATOM   3514 C C   . ALA B 1 51  ? 17.775  51.327 40.512  1.00 21.13 ?  51   ALA B C   1 
ATOM   3515 O O   . ALA B 1 51  ? 18.998  51.424 40.709  1.00 21.01 ?  51   ALA B O   1 
ATOM   3516 C CB  . ALA B 1 51  ? 17.170  51.482 38.118  1.00 21.21 ?  51   ALA B CB  1 
ATOM   3517 N N   . VAL B 1 52  ? 16.999  50.464 41.164  1.00 21.32 ?  52   VAL B N   1 
ATOM   3518 C CA  . VAL B 1 52  ? 17.575  49.498 42.130  1.00 23.09 ?  52   VAL B CA  1 
ATOM   3519 C C   . VAL B 1 52  ? 17.024  48.151 41.834  1.00 23.27 ?  52   VAL B C   1 
ATOM   3520 O O   . VAL B 1 52  ? 15.809  47.962 41.862  1.00 25.00 ?  52   VAL B O   1 
ATOM   3521 C CB  . VAL B 1 52  ? 17.250  49.865 43.593  1.00 22.67 ?  52   VAL B CB  1 
ATOM   3522 C CG1 . VAL B 1 52  ? 17.741  48.792 44.580  1.00 23.96 ?  52   VAL B CG1 1 
ATOM   3523 C CG2 . VAL B 1 52  ? 17.844  51.210 43.926  1.00 24.37 ?  52   VAL B CG2 1 
ATOM   3524 N N   . ILE B 1 53  ? 17.896  47.196 41.544  1.00 23.63 ?  53   ILE B N   1 
ATOM   3525 C CA  . ILE B 1 53  ? 17.432  45.848 41.264  1.00 24.64 ?  53   ILE B CA  1 
ATOM   3526 C C   . ILE B 1 53  ? 18.082  44.886 42.261  1.00 26.77 ?  53   ILE B C   1 
ATOM   3527 O O   . ILE B 1 53  ? 19.327  44.859 42.376  1.00 26.69 ?  53   ILE B O   1 
ATOM   3528 C CB  . ILE B 1 53  ? 17.708  45.387 39.785  1.00 24.56 ?  53   ILE B CB  1 
ATOM   3529 C CG1 . ILE B 1 53  ? 17.167  46.391 38.752  1.00 23.82 ?  53   ILE B CG1 1 
ATOM   3530 C CG2 . ILE B 1 53  ? 17.134  43.939 39.532  1.00 25.29 ?  53   ILE B CG2 1 
ATOM   3531 C CD1 . ILE B 1 53  ? 18.288  47.333 38.210  1.00 25.35 ?  53   ILE B CD1 1 
ATOM   3532 N N   . THR B 1 54  ? 17.242  44.127 42.977  1.00 27.69 ?  54   THR B N   1 
ATOM   3533 C CA  . THR B 1 54  ? 17.732  43.128 43.927  1.00 29.93 ?  54   THR B CA  1 
ATOM   3534 C C   . THR B 1 54  ? 17.983  41.762 43.252  1.00 30.67 ?  54   THR B C   1 
ATOM   3535 O O   . THR B 1 54  ? 17.272  41.351 42.302  1.00 28.91 ?  54   THR B O   1 
ATOM   3536 C CB  . THR B 1 54  ? 16.786  42.914 45.107  1.00 29.47 ?  54   THR B CB  1 
ATOM   3537 O OG1 . THR B 1 54  ? 15.598  42.265 44.642  1.00 33.18 ?  54   THR B OG1 1 
ATOM   3538 C CG2 . THR B 1 54  ? 16.401  44.254 45.750  1.00 30.30 ?  54   THR B CG2 1 
ATOM   3539 N N   . VAL B 1 55  ? 18.990  41.075 43.793  1.00 31.65 ?  55   VAL B N   1 
ATOM   3540 C CA  . VAL B 1 55  ? 19.518  39.836 43.249  1.00 34.46 ?  55   VAL B CA  1 
ATOM   3541 C C   . VAL B 1 55  ? 19.549  38.796 44.371  1.00 36.41 ?  55   VAL B C   1 
ATOM   3542 O O   . VAL B 1 55  ? 20.124  39.053 45.450  1.00 35.72 ?  55   VAL B O   1 
ATOM   3543 C CB  . VAL B 1 55  ? 20.957  40.082 42.719  1.00 34.23 ?  55   VAL B CB  1 
ATOM   3544 C CG1 . VAL B 1 55  ? 21.619  38.764 42.271  1.00 34.79 ?  55   VAL B CG1 1 
ATOM   3545 C CG2 . VAL B 1 55  ? 20.931  41.094 41.584  1.00 33.83 ?  55   VAL B CG2 1 
ATOM   3546 N N   . GLU B 1 56  ? 18.932  37.636 44.146  1.00 39.12 ?  56   GLU B N   1 
ATOM   3547 C CA  . GLU B 1 56  ? 18.762  36.679 45.257  1.00 42.36 ?  56   GLU B CA  1 
ATOM   3548 C C   . GLU B 1 56  ? 20.105  36.256 45.823  1.00 43.34 ?  56   GLU B C   1 
ATOM   3549 O O   . GLU B 1 56  ? 20.977  35.784 45.076  1.00 42.95 ?  56   GLU B O   1 
ATOM   3550 C CB  . GLU B 1 56  ? 17.958  35.444 44.870  1.00 43.38 ?  56   GLU B CB  1 
ATOM   3551 C CG  . GLU B 1 56  ? 17.368  34.749 46.114  1.00 47.17 ?  56   GLU B CG  1 
ATOM   3552 C CD  . GLU B 1 56  ? 16.164  33.904 45.783  1.00 53.45 ?  56   GLU B CD  1 
ATOM   3553 O OE1 . GLU B 1 56  ? 15.021  34.344 46.108  1.00 55.26 ?  56   GLU B OE1 1 
ATOM   3554 O OE2 . GLU B 1 56  ? 16.360  32.816 45.176  1.00 55.81 ?  56   GLU B OE2 1 
ATOM   3555 N N   . ASN B 1 57  ? 20.262  36.460 47.137  1.00 44.70 ?  57   ASN B N   1 
ATOM   3556 C CA  . ASN B 1 57  ? 21.503  36.139 47.851  1.00 45.48 ?  57   ASN B CA  1 
ATOM   3557 C C   . ASN B 1 57  ? 22.730  36.767 47.187  1.00 45.43 ?  57   ASN B C   1 
ATOM   3558 O O   . ASN B 1 57  ? 23.835  36.199 47.253  1.00 45.69 ?  57   ASN B O   1 
ATOM   3559 C CB  . ASN B 1 57  ? 21.718  34.610 47.941  1.00 46.02 ?  57   ASN B CB  1 
ATOM   3560 C CG  . ASN B 1 57  ? 20.675  33.907 48.777  1.00 48.53 ?  57   ASN B CG  1 
ATOM   3561 O OD1 . ASN B 1 57  ? 20.160  32.866 48.365  1.00 52.27 ?  57   ASN B OD1 1 
ATOM   3562 N ND2 . ASN B 1 57  ? 20.353  34.458 49.962  1.00 50.12 ?  57   ASN B ND2 1 
ATOM   3563 N N   . GLY B 1 58  ? 22.540  37.916 46.531  1.00 44.87 ?  58   GLY B N   1 
ATOM   3564 C CA  . GLY B 1 58  ? 23.623  38.561 45.770  1.00 42.97 ?  58   GLY B CA  1 
ATOM   3565 C C   . GLY B 1 58  ? 23.620  40.050 45.986  1.00 41.67 ?  58   GLY B C   1 
ATOM   3566 O O   . GLY B 1 58  ? 22.740  40.575 46.661  1.00 41.98 ?  58   GLY B O   1 
ATOM   3567 N N   . LYS B 1 59  ? 24.611  40.732 45.419  1.00 40.81 ?  59   LYS B N   1 
ATOM   3568 C CA  . LYS B 1 59  ? 24.707  42.196 45.505  1.00 39.30 ?  59   LYS B CA  1 
ATOM   3569 C C   . LYS B 1 59  ? 23.571  42.893 44.706  1.00 38.23 ?  59   LYS B C   1 
ATOM   3570 O O   . LYS B 1 59  ? 23.338  42.623 43.515  1.00 36.72 ?  59   LYS B O   1 
ATOM   3571 C CB  . LYS B 1 59  ? 26.087  42.683 45.043  1.00 39.42 ?  59   LYS B CB  1 
ATOM   3572 C CG  . LYS B 1 59  ? 26.394  44.143 45.372  1.00 41.78 ?  59   LYS B CG  1 
ATOM   3573 C CD  . LYS B 1 59  ? 27.831  44.541 45.010  1.00 46.32 ?  59   LYS B CD  1 
ATOM   3574 C CE  . LYS B 1 59  ? 28.050  46.063 45.188  1.00 51.19 ?  59   LYS B CE  1 
ATOM   3575 N NZ  . LYS B 1 59  ? 29.427  46.551 44.785  1.00 53.36 ?  59   LYS B NZ  1 
ATOM   3576 N N   . THR B 1 60  ? 22.864  43.782 45.393  1.00 36.19 ?  60   THR B N   1 
ATOM   3577 C CA  . THR B 1 60  ? 21.859  44.612 44.771  1.00 34.25 ?  60   THR B CA  1 
ATOM   3578 C C   . THR B 1 60  ? 22.519  45.434 43.661  1.00 33.20 ?  60   THR B C   1 
ATOM   3579 O O   . THR B 1 60  ? 23.624  45.964 43.849  1.00 32.60 ?  60   THR B O   1 
ATOM   3580 C CB  . THR B 1 60  ? 21.200  45.448 45.873  1.00 34.59 ?  60   THR B CB  1 
ATOM   3581 O OG1 . THR B 1 60  ? 20.568  44.518 46.766  1.00 33.48 ?  60   THR B OG1 1 
ATOM   3582 C CG2 . THR B 1 60  ? 20.146  46.386 45.339  1.00 32.89 ?  60   THR B CG2 1 
ATOM   3583 N N   . ILE B 1 61  ? 21.875  45.484 42.497  1.00 31.22 ?  61   ILE B N   1 
ATOM   3584 C CA  . ILE B 1 61  ? 22.380  46.266 41.369  1.00 30.46 ?  61   ILE B CA  1 
ATOM   3585 C C   . ILE B 1 61  ? 21.809  47.715 41.415  1.00 30.18 ?  61   ILE B C   1 
ATOM   3586 O O   . ILE B 1 61  ? 20.596  47.909 41.470  1.00 29.66 ?  61   ILE B O   1 
ATOM   3587 C CB  . ILE B 1 61  ? 22.047  45.560 39.991  1.00 30.42 ?  61   ILE B CB  1 
ATOM   3588 C CG1 . ILE B 1 61  ? 22.882  44.288 39.826  1.00 31.46 ?  61   ILE B CG1 1 
ATOM   3589 C CG2 . ILE B 1 61  ? 22.352  46.482 38.829  1.00 29.68 ?  61   ILE B CG2 1 
ATOM   3590 C CD1 . ILE B 1 61  ? 22.262  43.229 38.903  1.00 31.03 ?  61   ILE B CD1 1 
ATOM   3591 N N   . GLN B 1 62  ? 22.695  48.703 41.371  1.00 29.58 ?  62   GLN B N   1 
ATOM   3592 C CA  . GLN B 1 62  ? 22.332  50.110 41.495  1.00 30.87 ?  62   GLN B CA  1 
ATOM   3593 C C   . GLN B 1 62  ? 22.633  50.853 40.194  1.00 30.13 ?  62   GLN B C   1 
ATOM   3594 O O   . GLN B 1 62  ? 23.765  50.804 39.695  1.00 30.47 ?  62   GLN B O   1 
ATOM   3595 C CB  . GLN B 1 62  ? 23.173  50.780 42.598  1.00 32.02 ?  62   GLN B CB  1 
ATOM   3596 C CG  . GLN B 1 62  ? 23.035  50.186 43.972  1.00 35.04 ?  62   GLN B CG  1 
ATOM   3597 C CD  . GLN B 1 62  ? 22.049  50.954 44.835  1.00 43.09 ?  62   GLN B CD  1 
ATOM   3598 O OE1 . GLN B 1 62  ? 22.271  51.128 46.040  1.00 46.33 ?  62   GLN B OE1 1 
ATOM   3599 N NE2 . GLN B 1 62  ? 20.965  51.436 44.225  1.00 44.51 ?  62   GLN B NE2 1 
ATOM   3600 N N   . PHE B 1 63  ? 21.639  51.539 39.640  1.00 28.47 ?  63   PHE B N   1 
ATOM   3601 C CA  . PHE B 1 63  ? 21.926  52.487 38.566  1.00 28.70 ?  63   PHE B CA  1 
ATOM   3602 C C   . PHE B 1 63  ? 21.703  53.867 39.171  1.00 27.37 ?  63   PHE B C   1 
ATOM   3603 O O   . PHE B 1 63  ? 20.549  54.246 39.392  1.00 26.62 ?  63   PHE B O   1 
ATOM   3604 C CB  . PHE B 1 63  ? 21.001  52.321 37.344  1.00 28.21 ?  63   PHE B CB  1 
ATOM   3605 C CG  . PHE B 1 63  ? 21.237  51.076 36.504  1.00 31.31 ?  63   PHE B CG  1 
ATOM   3606 C CD1 . PHE B 1 63  ? 20.361  50.777 35.462  1.00 34.20 ?  63   PHE B CD1 1 
ATOM   3607 C CD2 . PHE B 1 63  ? 22.296  50.213 36.734  1.00 34.27 ?  63   PHE B CD2 1 
ATOM   3608 C CE1 . PHE B 1 63  ? 20.552  49.639 34.651  1.00 35.47 ?  63   PHE B CE1 1 
ATOM   3609 C CE2 . PHE B 1 63  ? 22.486  49.062 35.931  1.00 35.12 ?  63   PHE B CE2 1 
ATOM   3610 C CZ  . PHE B 1 63  ? 21.611  48.779 34.904  1.00 33.41 ?  63   PHE B CZ  1 
ATOM   3611 N N   . GLY B 1 64  ? 22.795  54.588 39.417  1.00 27.26 ?  64   GLY B N   1 
ATOM   3612 C CA  . GLY B 1 64  ? 22.777  55.958 39.959  1.00 27.50 ?  64   GLY B CA  1 
ATOM   3613 C C   . GLY B 1 64  ? 22.526  56.850 38.769  1.00 28.57 ?  64   GLY B C   1 
ATOM   3614 O O   . GLY B 1 64  ? 22.375  56.350 37.654  1.00 27.38 ?  64   GLY B O   1 
ATOM   3615 N N   . GLU B 1 65  ? 22.519  58.157 38.978  1.00 29.04 ?  65   GLU B N   1 
ATOM   3616 C CA  . GLU B 1 65  ? 22.046  59.081 37.949  1.00 30.61 ?  65   GLU B CA  1 
ATOM   3617 C C   . GLU B 1 65  ? 22.866  59.012 36.656  1.00 29.78 ?  65   GLU B C   1 
ATOM   3618 O O   . GLU B 1 65  ? 22.283  59.081 35.575  1.00 28.59 ?  65   GLU B O   1 
ATOM   3619 C CB  . GLU B 1 65  ? 21.995  60.535 38.464  1.00 31.68 ?  65   GLU B CB  1 
ATOM   3620 C CG  . GLU B 1 65  ? 22.087  60.689 39.963  1.00 36.84 ?  65   GLU B CG  1 
ATOM   3621 C CD  . GLU B 1 65  ? 20.749  60.597 40.636  1.00 44.54 ?  65   GLU B CD  1 
ATOM   3622 O OE1 . GLU B 1 65  ? 20.697  60.229 41.846  1.00 47.52 ?  65   GLU B OE1 1 
ATOM   3623 O OE2 . GLU B 1 65  ? 19.745  60.889 39.944  1.00 48.22 ?  65   GLU B OE2 1 
ATOM   3624 N N   . GLU B 1 66  ? 24.197  58.881 36.754  1.00 29.48 ?  66   GLU B N   1 
ATOM   3625 C CA  . GLU B 1 66  ? 25.034  58.846 35.539  1.00 30.11 ?  66   GLU B CA  1 
ATOM   3626 C C   . GLU B 1 66  ? 24.871  57.529 34.785  1.00 29.16 ?  66   GLU B C   1 
ATOM   3627 O O   . GLU B 1 66  ? 24.654  57.500 33.563  1.00 29.22 ?  66   GLU B O   1 
ATOM   3628 C CB  . GLU B 1 66  ? 26.521  59.111 35.844  1.00 31.14 ?  66   GLU B CB  1 
ATOM   3629 C CG  . GLU B 1 66  ? 26.881  60.599 36.061  1.00 36.42 ?  66   GLU B CG  1 
ATOM   3630 C CD  . GLU B 1 66  ? 26.399  61.541 34.902  1.00 43.46 ?  66   GLU B CD  1 
ATOM   3631 O OE1 . GLU B 1 66  ? 26.893  61.415 33.752  1.00 46.55 ?  66   GLU B OE1 1 
ATOM   3632 O OE2 . GLU B 1 66  ? 25.517  62.402 35.145  1.00 45.12 ?  66   GLU B OE2 1 
ATOM   3633 N N   . MET B 1 67  ? 24.985  56.434 35.514  1.00 27.46 ?  67   MET B N   1 
ATOM   3634 C CA  . MET B 1 67  ? 24.733  55.128 34.962  1.00 26.87 ?  67   MET B CA  1 
ATOM   3635 C C   . MET B 1 67  ? 23.316  54.983 34.329  1.00 25.50 ?  67   MET B C   1 
ATOM   3636 O O   . MET B 1 67  ? 23.153  54.332 33.285  1.00 25.16 ?  67   MET B O   1 
ATOM   3637 C CB  . MET B 1 67  ? 24.919  54.085 36.049  1.00 26.56 ?  67   MET B CB  1 
ATOM   3638 C CG  . MET B 1 67  ? 24.635  52.700 35.559  1.00 31.99 ?  67   MET B CG  1 
ATOM   3639 S SD  . MET B 1 67  ? 25.968  52.156 34.475  1.00 45.00 ?  67   MET B SD  1 
ATOM   3640 C CE  . MET B 1 67  ? 26.929  51.177 35.661  1.00 42.29 ?  67   MET B CE  1 
ATOM   3641 N N   . MET B 1 68  ? 22.303  55.537 34.976  1.00 23.90 ?  68   MET B N   1 
ATOM   3642 C CA  . MET B 1 68  ? 20.938  55.506 34.413  1.00 24.90 ?  68   MET B CA  1 
ATOM   3643 C C   . MET B 1 68  ? 20.881  56.206 33.035  1.00 23.77 ?  68   MET B C   1 
ATOM   3644 O O   . MET B 1 68  ? 20.254  55.695 32.128  1.00 22.91 ?  68   MET B O   1 
ATOM   3645 C CB  . MET B 1 68  ? 19.905  56.103 35.364  1.00 24.29 ?  68   MET B CB  1 
ATOM   3646 C CG  . MET B 1 68  ? 18.473  55.910 34.909  1.00 26.82 ?  68   MET B CG  1 
ATOM   3647 S SD  . MET B 1 68  ? 17.998  54.182 35.059  1.00 34.81 ?  68   MET B SD  1 
ATOM   3648 C CE  . MET B 1 68  ? 16.228  54.239 34.858  1.00 31.52 ?  68   MET B CE  1 
ATOM   3649 N N   . LYS B 1 69  ? 21.530  57.361 32.924  1.00 22.97 ?  69   LYS B N   1 
ATOM   3650 C CA  . LYS B 1 69  ? 21.635  58.080 31.688  1.00 25.82 ?  69   LYS B CA  1 
ATOM   3651 C C   . LYS B 1 69  ? 22.229  57.180 30.597  1.00 25.08 ?  69   LYS B C   1 
ATOM   3652 O O   . LYS B 1 69  ? 21.678  57.118 29.510  1.00 26.44 ?  69   LYS B O   1 
ATOM   3653 C CB  . LYS B 1 69  ? 22.494  59.363 31.847  1.00 24.88 ?  69   LYS B CB  1 
ATOM   3654 C CG  . LYS B 1 69  ? 21.734  60.599 32.437  1.00 28.96 ?  69   LYS B CG  1 
ATOM   3655 C CD  . LYS B 1 69  ? 22.684  61.818 32.723  1.00 29.32 ?  69   LYS B CD  1 
ATOM   3656 C CE  . LYS B 1 69  ? 23.550  62.194 31.468  1.00 38.28 ?  69   LYS B CE  1 
ATOM   3657 N NZ  . LYS B 1 69  ? 24.716  63.233 31.567  1.00 37.86 ?  69   LYS B NZ  1 
ATOM   3658 N N   . ARG B 1 70  ? 23.342  56.501 30.881  1.00 23.61 ?  70   ARG B N   1 
ATOM   3659 C CA  . ARG B 1 70  ? 23.909  55.538 29.915  1.00 23.10 ?  70   ARG B CA  1 
ATOM   3660 C C   . ARG B 1 70  ? 22.915  54.437 29.521  1.00 21.13 ?  70   ARG B C   1 
ATOM   3661 O O   . ARG B 1 70  ? 22.745  54.125 28.325  1.00 22.28 ?  70   ARG B O   1 
ATOM   3662 C CB  . ARG B 1 70  ? 25.227  54.925 30.442  1.00 23.00 ?  70   ARG B CB  1 
ATOM   3663 C CG  . ARG B 1 70  ? 25.864  53.948 29.428  1.00 23.98 ?  70   ARG B CG  1 
ATOM   3664 C CD  . ARG B 1 70  ? 27.149  53.301 29.960  1.00 26.21 ?  70   ARG B CD  1 
ATOM   3665 N NE  . ARG B 1 70  ? 27.734  52.411 28.944  1.00 27.18 ?  70   ARG B NE  1 
ATOM   3666 C CZ  . ARG B 1 70  ? 28.507  51.362 29.227  1.00 26.70 ?  70   ARG B CZ  1 
ATOM   3667 N NH1 . ARG B 1 70  ? 28.784  51.069 30.492  1.00 26.36 ?  70   ARG B NH1 1 
ATOM   3668 N NH2 . ARG B 1 70  ? 28.999  50.600 28.251  1.00 23.20 ?  70   ARG B NH2 1 
ATOM   3669 N N   . ALA B 1 71  ? 22.226  53.887 30.518  1.00 19.12 ?  71   ALA B N   1 
ATOM   3670 C CA  . ALA B 1 71  ? 21.312  52.783 30.318  1.00 17.94 ?  71   ALA B CA  1 
ATOM   3671 C C   . ALA B 1 71  ? 20.147  53.183 29.441  1.00 17.50 ?  71   ALA B C   1 
ATOM   3672 O O   . ALA B 1 71  ? 19.582  52.338 28.762  1.00 16.62 ?  71   ALA B O   1 
ATOM   3673 C CB  . ALA B 1 71  ? 20.812  52.212 31.666  1.00 18.10 ?  71   ALA B CB  1 
ATOM   3674 N N   . LEU B 1 72  ? 19.809  54.475 29.447  1.00 16.57 ?  72   LEU B N   1 
ATOM   3675 C CA  . LEU B 1 72  ? 18.645  54.954 28.717  1.00 16.01 ?  72   LEU B CA  1 
ATOM   3676 C C   . LEU B 1 72  ? 18.975  55.505 27.320  1.00 15.14 ?  72   LEU B C   1 
ATOM   3677 O O   . LEU B 1 72  ? 18.073  55.978 26.619  1.00 14.12 ?  72   LEU B O   1 
ATOM   3678 C CB  . LEU B 1 72  ? 17.929  56.026 29.538  1.00 16.41 ?  72   LEU B CB  1 
ATOM   3679 C CG  . LEU B 1 72  ? 17.300  55.619 30.880  1.00 14.49 ?  72   LEU B CG  1 
ATOM   3680 C CD1 . LEU B 1 72  ? 16.701  56.940 31.536  1.00 15.16 ?  72   LEU B CD1 1 
ATOM   3681 C CD2 . LEU B 1 72  ? 16.217  54.495 30.680  1.00 12.69 ?  72   LEU B CD2 1 
ATOM   3682 N N   . GLN B 1 73  ? 20.253  55.480 26.962  1.00 13.76 ?  73   GLN B N   1 
ATOM   3683 C CA  . GLN B 1 73  ? 20.757  56.085 25.706  1.00 15.34 ?  73   GLN B CA  1 
ATOM   3684 C C   . GLN B 1 73  ? 21.172  55.001 24.683  1.00 14.63 ?  73   GLN B C   1 
ATOM   3685 O O   . GLN B 1 73  ? 21.433  53.835 25.076  1.00 12.99 ?  73   GLN B O   1 
ATOM   3686 C CB  . GLN B 1 73  ? 21.947  57.020 26.041  1.00 15.97 ?  73   GLN B CB  1 
ATOM   3687 C CG  . GLN B 1 73  ? 22.544  57.856 24.915  1.00 17.59 ?  73   GLN B CG  1 
ATOM   3688 C CD  . GLN B 1 73  ? 21.510  58.742 24.182  1.00 22.76 ?  73   GLN B CD  1 
ATOM   3689 O OE1 . GLN B 1 73  ? 20.714  58.261 23.353  1.00 19.87 ?  73   GLN B OE1 1 
ATOM   3690 N NE2 . GLN B 1 73  ? 21.559  60.043 24.456  1.00 21.01 ?  73   GLN B NE2 1 
ATOM   3691 N N   . TYR B 1 74  ? 21.192  55.359 23.386  1.00 14.54 ?  74   TYR B N   1 
ATOM   3692 C CA  . TYR B 1 74  ? 21.770  54.494 22.344  1.00 15.91 ?  74   TYR B CA  1 
ATOM   3693 C C   . TYR B 1 74  ? 23.135  53.991 22.761  1.00 15.61 ?  74   TYR B C   1 
ATOM   3694 O O   . TYR B 1 74  ? 23.850  54.696 23.485  1.00 16.13 ?  74   TYR B O   1 
ATOM   3695 C CB  . TYR B 1 74  ? 22.008  55.277 21.001  1.00 14.94 ?  74   TYR B CB  1 
ATOM   3696 C CG  . TYR B 1 74  ? 20.754  55.745 20.330  1.00 14.20 ?  74   TYR B CG  1 
ATOM   3697 C CD1 . TYR B 1 74  ? 19.833  54.825 19.859  1.00 13.80 ?  74   TYR B CD1 1 
ATOM   3698 C CD2 . TYR B 1 74  ? 20.498  57.119 20.125  1.00 13.37 ?  74   TYR B CD2 1 
ATOM   3699 C CE1 . TYR B 1 74  ? 18.654  55.214 19.225  1.00 13.11 ?  74   TYR B CE1 1 
ATOM   3700 C CE2 . TYR B 1 74  ? 19.302  57.523 19.462  1.00 12.72 ?  74   TYR B CE2 1 
ATOM   3701 C CZ  . TYR B 1 74  ? 18.406  56.553 18.997  1.00 14.05 ?  74   TYR B CZ  1 
ATOM   3702 O OH  . TYR B 1 74  ? 17.213  56.888 18.343  1.00 14.89 ?  74   TYR B OH  1 
ATOM   3703 N N   . SER B 1 75  ? 23.496  52.807 22.255  1.00 16.12 ?  75   SER B N   1 
ATOM   3704 C CA  . SER B 1 75  ? 24.772  52.151 22.497  1.00 15.67 ?  75   SER B CA  1 
ATOM   3705 C C   . SER B 1 75  ? 25.214  51.304 21.265  1.00 16.48 ?  75   SER B C   1 
ATOM   3706 O O   . SER B 1 75  ? 24.469  51.237 20.283  1.00 18.03 ?  75   SER B O   1 
ATOM   3707 C CB  . SER B 1 75  ? 24.715  51.330 23.755  1.00 15.63 ?  75   SER B CB  1 
ATOM   3708 O OG  . SER B 1 75  ? 23.718  50.320 23.678  1.00 17.61 ?  75   SER B OG  1 
ATOM   3709 N N   . PRO B 1 76  ? 26.456  50.740 21.273  1.00 16.60 ?  76   PRO B N   1 
ATOM   3710 C CA  . PRO B 1 76  ? 26.939  50.090 20.056  1.00 15.52 ?  76   PRO B CA  1 
ATOM   3711 C C   . PRO B 1 76  ? 26.117  48.931 19.554  1.00 14.88 ?  76   PRO B C   1 
ATOM   3712 O O   . PRO B 1 76  ? 25.560  48.141 20.347  1.00 13.21 ?  76   PRO B O   1 
ATOM   3713 C CB  . PRO B 1 76  ? 28.370  49.695 20.396  1.00 15.74 ?  76   PRO B CB  1 
ATOM   3714 C CG  . PRO B 1 76  ? 28.745  50.616 21.583  1.00 16.84 ?  76   PRO B CG  1 
ATOM   3715 C CD  . PRO B 1 76  ? 27.492  50.746 22.341  1.00 16.68 ?  76   PRO B CD  1 
ATOM   3716 N N   . SER B 1 77  ? 26.023  48.851 18.223  1.00 14.20 ?  77   SER B N   1 
ATOM   3717 C CA  . SER B 1 77  ? 25.218  47.830 17.563  1.00 14.86 ?  77   SER B CA  1 
ATOM   3718 C C   . SER B 1 77  ? 25.553  46.400 17.967  1.00 15.09 ?  77   SER B C   1 
ATOM   3719 O O   . SER B 1 77  ? 24.659  45.603 18.233  1.00 15.72 ?  77   SER B O   1 
ATOM   3720 C CB  . SER B 1 77  ? 25.366  47.984 16.042  1.00 15.40 ?  77   SER B CB  1 
ATOM   3721 O OG  . SER B 1 77  ? 24.559  49.077 15.603  1.00 18.21 ?  77   SER B OG  1 
ATOM   3722 N N   . ALA B 1 78  ? 26.842  46.098 18.066  1.00 13.83 ?  78   ALA B N   1 
ATOM   3723 C CA  . ALA B 1 78  ? 27.347  44.748 18.423  1.00 14.84 ?  78   ALA B CA  1 
ATOM   3724 C C   . ALA B 1 78  ? 27.178  44.421 19.902  1.00 15.50 ?  78   ALA B C   1 
ATOM   3725 O O   . ALA B 1 78  ? 27.414  43.276 20.325  1.00 16.27 ?  78   ALA B O   1 
ATOM   3726 C CB  . ALA B 1 78  ? 28.847  44.677 18.064  1.00 13.65 ?  78   ALA B CB  1 
ATOM   3727 N N   . GLY B 1 79  ? 26.829  45.424 20.714  1.00 14.95 ?  79   GLY B N   1 
ATOM   3728 C CA  . GLY B 1 79  ? 26.676  45.199 22.181  1.00 14.77 ?  79   GLY B CA  1 
ATOM   3729 C C   . GLY B 1 79  ? 27.560  46.147 22.976  1.00 14.70 ?  79   GLY B C   1 
ATOM   3730 O O   . GLY B 1 79  ? 28.484  46.711 22.424  1.00 13.53 ?  79   GLY B O   1 
ATOM   3731 N N   . ILE B 1 80  ? 27.296  46.330 24.277  1.00 15.37 ?  80   ILE B N   1 
ATOM   3732 C CA  . ILE B 1 80  ? 28.167  47.188 25.090  1.00 15.84 ?  80   ILE B CA  1 
ATOM   3733 C C   . ILE B 1 80  ? 29.530  46.487 25.314  1.00 16.40 ?  80   ILE B C   1 
ATOM   3734 O O   . ILE B 1 80  ? 29.579  45.257 25.469  1.00 14.41 ?  80   ILE B O   1 
ATOM   3735 C CB  . ILE B 1 80  ? 27.505  47.591 26.481  1.00 16.37 ?  80   ILE B CB  1 
ATOM   3736 C CG1 . ILE B 1 80  ? 27.321  46.359 27.386  1.00 17.51 ?  80   ILE B CG1 1 
ATOM   3737 C CG2 . ILE B 1 80  ? 26.180  48.364 26.226  1.00 14.65 ?  80   ILE B CG2 1 
ATOM   3738 C CD1 . ILE B 1 80  ? 26.758  46.644 28.772  1.00 17.13 ?  80   ILE B CD1 1 
ATOM   3739 N N   . PRO B 1 81  ? 30.630  47.263 25.342  1.00 17.39 ?  81   PRO B N   1 
ATOM   3740 C CA  . PRO B 1 81  ? 31.972  46.654 25.401  1.00 18.55 ?  81   PRO B CA  1 
ATOM   3741 C C   . PRO B 1 81  ? 32.244  45.726 26.584  1.00 19.83 ?  81   PRO B C   1 
ATOM   3742 O O   . PRO B 1 81  ? 32.955  44.734 26.418  1.00 22.02 ?  81   PRO B O   1 
ATOM   3743 C CB  . PRO B 1 81  ? 32.935  47.859 25.443  1.00 19.08 ?  81   PRO B CB  1 
ATOM   3744 C CG  . PRO B 1 81  ? 32.133  49.034 25.124  1.00 20.52 ?  81   PRO B CG  1 
ATOM   3745 C CD  . PRO B 1 81  ? 30.680  48.736 25.364  1.00 17.38 ?  81   PRO B CD  1 
ATOM   3746 N N   . GLU B 1 82  ? 31.681  46.001 27.750  1.00 20.28 ?  82   GLU B N   1 
ATOM   3747 C CA  . GLU B 1 82  ? 31.927  45.124 28.887  1.00 21.41 ?  82   GLU B CA  1 
ATOM   3748 C C   . GLU B 1 82  ? 31.210  43.768 28.782  1.00 19.69 ?  82   GLU B C   1 
ATOM   3749 O O   . GLU B 1 82  ? 31.719  42.722 29.227  1.00 17.42 ?  82   GLU B O   1 
ATOM   3750 C CB  . GLU B 1 82  ? 31.649  45.829 30.246  1.00 22.47 ?  82   GLU B CB  1 
ATOM   3751 C CG  . GLU B 1 82  ? 30.370  46.682 30.388  1.00 27.67 ?  82   GLU B CG  1 
ATOM   3752 C CD  . GLU B 1 82  ? 30.548  48.088 29.827  1.00 27.62 ?  82   GLU B CD  1 
ATOM   3753 O OE1 . GLU B 1 82  ? 30.439  48.234 28.624  1.00 25.99 ?  82   GLU B OE1 1 
ATOM   3754 O OE2 . GLU B 1 82  ? 30.810  49.050 30.574  1.00 34.91 ?  82   GLU B OE2 1 
ATOM   3755 N N   . LEU B 1 83  ? 30.037  43.771 28.176  1.00 18.92 ?  83   LEU B N   1 
ATOM   3756 C CA  . LEU B 1 83  ? 29.353  42.530 28.004  1.00 18.47 ?  83   LEU B CA  1 
ATOM   3757 C C   . LEU B 1 83  ? 30.104  41.707 26.931  1.00 18.96 ?  83   LEU B C   1 
ATOM   3758 O O   . LEU B 1 83  ? 30.360  40.545 27.140  1.00 18.25 ?  83   LEU B O   1 
ATOM   3759 C CB  . LEU B 1 83  ? 27.869  42.744 27.669  1.00 18.89 ?  83   LEU B CB  1 
ATOM   3760 C CG  . LEU B 1 83  ? 26.958  41.514 27.601  1.00 18.14 ?  83   LEU B CG  1 
ATOM   3761 C CD1 . LEU B 1 83  ? 27.116  40.575 28.830  1.00 16.05 ?  83   LEU B CD1 1 
ATOM   3762 C CD2 . LEU B 1 83  ? 25.486  41.937 27.413  1.00 16.01 ?  83   LEU B CD2 1 
ATOM   3763 N N   . LEU B 1 84  ? 30.463  42.331 25.803  1.00 20.57 ?  84   LEU B N   1 
ATOM   3764 C CA  . LEU B 1 84  ? 31.288  41.688 24.770  1.00 21.33 ?  84   LEU B CA  1 
ATOM   3765 C C   . LEU B 1 84  ? 32.577  41.056 25.303  1.00 21.18 ?  84   LEU B C   1 
ATOM   3766 O O   . LEU B 1 84  ? 32.836  39.878 25.051  1.00 21.29 ?  84   LEU B O   1 
ATOM   3767 C CB  . LEU B 1 84  ? 31.608  42.677 23.634  1.00 21.43 ?  84   LEU B CB  1 
ATOM   3768 C CG  . LEU B 1 84  ? 30.650  42.721 22.440  1.00 22.73 ?  84   LEU B CG  1 
ATOM   3769 C CD1 . LEU B 1 84  ? 29.327  42.572 22.952  1.00 29.87 ?  84   LEU B CD1 1 
ATOM   3770 C CD2 . LEU B 1 84  ? 30.759  43.969 21.583  1.00 23.26 ?  84   LEU B CD2 1 
ATOM   3771 N N   . SER B 1 85  ? 33.386  41.828 26.037  1.00 22.32 ?  85   SER B N   1 
ATOM   3772 C CA  . SER B 1 85  ? 34.676  41.274 26.506  1.00 23.72 ?  85   SER B CA  1 
ATOM   3773 C C   . SER B 1 85  ? 34.472  40.089 27.449  1.00 23.31 ?  85   SER B C   1 
ATOM   3774 O O   . SER B 1 85  ? 35.228  39.102 27.363  1.00 22.84 ?  85   SER B O   1 
ATOM   3775 C CB  . SER B 1 85  ? 35.585  42.328 27.148  1.00 24.34 ?  85   SER B CB  1 
ATOM   3776 O OG  . SER B 1 85  ? 34.893  42.995 28.171  1.00 29.77 ?  85   SER B OG  1 
ATOM   3777 N N   . TRP B 1 86  ? 33.450  40.178 28.311  1.00 21.43 ?  86   TRP B N   1 
ATOM   3778 C CA  . TRP B 1 86  ? 33.086  39.101 29.208  1.00 21.51 ?  86   TRP B CA  1 
ATOM   3779 C C   . TRP B 1 86  ? 32.632  37.838 28.481  1.00 20.26 ?  86   TRP B C   1 
ATOM   3780 O O   . TRP B 1 86  ? 33.055  36.722 28.821  1.00 20.00 ?  86   TRP B O   1 
ATOM   3781 C CB  . TRP B 1 86  ? 31.966  39.555 30.185  1.00 22.18 ?  86   TRP B CB  1 
ATOM   3782 C CG  . TRP B 1 86  ? 31.793  38.640 31.396  1.00 22.51 ?  86   TRP B CG  1 
ATOM   3783 C CD1 . TRP B 1 86  ? 32.368  38.827 32.635  1.00 22.83 ?  86   TRP B CD1 1 
ATOM   3784 C CD2 . TRP B 1 86  ? 31.028  37.415 31.497  1.00 21.41 ?  86   TRP B CD2 1 
ATOM   3785 N NE1 . TRP B 1 86  ? 32.000  37.827 33.470  1.00 24.18 ?  86   TRP B NE1 1 
ATOM   3786 C CE2 . TRP B 1 86  ? 31.181  36.947 32.819  1.00 22.18 ?  86   TRP B CE2 1 
ATOM   3787 C CE3 . TRP B 1 86  ? 30.229  36.678 30.606  1.00 19.57 ?  86   TRP B CE3 1 
ATOM   3788 C CZ2 . TRP B 1 86  ? 30.603  35.759 33.276  1.00 23.05 ?  86   TRP B CZ2 1 
ATOM   3789 C CZ3 . TRP B 1 86  ? 29.629  35.502 31.059  1.00 23.50 ?  86   TRP B CZ3 1 
ATOM   3790 C CH2 . TRP B 1 86  ? 29.810  35.058 32.402  1.00 22.23 ?  86   TRP B CH2 1 
ATOM   3791 N N   . LEU B 1 87  ? 31.755  37.999 27.492  1.00 20.26 ?  87   LEU B N   1 
ATOM   3792 C CA  . LEU B 1 87  ? 31.317  36.864 26.645  1.00 19.19 ?  87   LEU B CA  1 
ATOM   3793 C C   . LEU B 1 87  ? 32.433  36.202 25.859  1.00 18.44 ?  87   LEU B C   1 
ATOM   3794 O O   . LEU B 1 87  ? 32.399  35.019 25.634  1.00 19.19 ?  87   LEU B O   1 
ATOM   3795 C CB  . LEU B 1 87  ? 30.188  37.281 25.686  1.00 19.46 ?  87   LEU B CB  1 
ATOM   3796 C CG  . LEU B 1 87  ? 28.912  37.708 26.396  1.00 18.66 ?  87   LEU B CG  1 
ATOM   3797 C CD1 . LEU B 1 87  ? 27.874  38.225 25.413  1.00 20.05 ?  87   LEU B CD1 1 
ATOM   3798 C CD2 . LEU B 1 87  ? 28.362  36.510 27.184  1.00 20.39 ?  87   LEU B CD2 1 
ATOM   3799 N N   . LYS B 1 88  ? 33.390  36.977 25.389  1.00 19.94 ?  88   LYS B N   1 
ATOM   3800 C CA  . LYS B 1 88  ? 34.490  36.426 24.603  1.00 21.51 ?  88   LYS B CA  1 
ATOM   3801 C C   . LYS B 1 88  ? 35.363  35.544 25.475  1.00 22.36 ?  88   LYS B C   1 
ATOM   3802 O O   . LYS B 1 88  ? 35.725  34.427 25.086  1.00 21.10 ?  88   LYS B O   1 
ATOM   3803 C CB  . LYS B 1 88  ? 35.313  37.530 23.948  1.00 22.86 ?  88   LYS B CB  1 
ATOM   3804 C CG  . LYS B 1 88  ? 34.638  38.089 22.647  1.00 26.57 ?  88   LYS B CG  1 
ATOM   3805 C CD  . LYS B 1 88  ? 35.453  39.188 21.949  1.00 34.88 ?  88   LYS B CD  1 
ATOM   3806 C CE  . LYS B 1 88  ? 34.549  40.099 21.067  1.00 38.32 ?  88   LYS B CE  1 
ATOM   3807 N NZ  . LYS B 1 88  ? 35.207  40.468 19.748  1.00 42.94 ?  88   LYS B NZ  1 
ATOM   3808 N N   . GLN B 1 89  ? 35.655  36.034 26.669  1.00 22.25 ?  89   GLN B N   1 
ATOM   3809 C CA  . GLN B 1 89  ? 36.385  35.233 27.663  1.00 24.14 ?  89   GLN B CA  1 
ATOM   3810 C C   . GLN B 1 89  ? 35.609  33.991 28.094  1.00 22.52 ?  89   GLN B C   1 
ATOM   3811 O O   . GLN B 1 89  ? 36.194  32.924 28.204  1.00 22.70 ?  89   GLN B O   1 
ATOM   3812 C CB  . GLN B 1 89  ? 36.841  36.072 28.850  1.00 24.17 ?  89   GLN B CB  1 
ATOM   3813 C CG  . GLN B 1 89  ? 37.967  35.393 29.686  1.00 31.62 ?  89   GLN B CG  1 
ATOM   3814 C CD  . GLN B 1 89  ? 39.096  34.720 28.850  1.00 37.45 ?  89   GLN B CD  1 
ATOM   3815 O OE1 . GLN B 1 89  ? 39.240  33.476 28.866  1.00 37.72 ?  89   GLN B OE1 1 
ATOM   3816 N NE2 . GLN B 1 89  ? 39.881  35.536 28.110  1.00 37.66 ?  89   GLN B NE2 1 
ATOM   3817 N N   . LEU B 1 90  ? 34.290  34.102 28.250  1.00 22.33 ?  90   LEU B N   1 
ATOM   3818 C CA  . LEU B 1 90  ? 33.440  32.926 28.441  1.00 21.95 ?  90   LEU B CA  1 
ATOM   3819 C C   . LEU B 1 90  ? 33.614  31.840 27.334  1.00 21.94 ?  90   LEU B C   1 
ATOM   3820 O O   . LEU B 1 90  ? 33.846  30.669 27.637  1.00 21.50 ?  90   LEU B O   1 
ATOM   3821 C CB  . LEU B 1 90  ? 31.963  33.337 28.569  1.00 22.99 ?  90   LEU B CB  1 
ATOM   3822 C CG  . LEU B 1 90  ? 30.997  32.158 28.721  1.00 25.11 ?  90   LEU B CG  1 
ATOM   3823 C CD1 . LEU B 1 90  ? 31.066  31.526 30.144  1.00 27.14 ?  90   LEU B CD1 1 
ATOM   3824 C CD2 . LEU B 1 90  ? 29.557  32.565 28.366  1.00 24.08 ?  90   LEU B CD2 1 
ATOM   3825 N N   . GLN B 1 91  ? 33.491  32.215 26.060  1.00 20.86 ?  91   GLN B N   1 
ATOM   3826 C CA  . GLN B 1 91  ? 33.591  31.249 24.969  1.00 20.83 ?  91   GLN B CA  1 
ATOM   3827 C C   . GLN B 1 91  ? 34.976  30.597 24.904  1.00 20.71 ?  91   GLN B C   1 
ATOM   3828 O O   . GLN B 1 91  ? 35.094  29.416 24.615  1.00 19.54 ?  91   GLN B O   1 
ATOM   3829 C CB  . GLN B 1 91  ? 33.361  31.926 23.606  1.00 20.57 ?  91   GLN B CB  1 
ATOM   3830 C CG  . GLN B 1 91  ? 31.983  32.583 23.437  1.00 23.50 ?  91   GLN B CG  1 
ATOM   3831 C CD  . GLN B 1 91  ? 30.868  31.619 23.591  1.00 24.00 ?  91   GLN B CD  1 
ATOM   3832 O OE1 . GLN B 1 91  ? 30.651  31.074 24.666  1.00 26.76 ?  91   GLN B OE1 1 
ATOM   3833 N NE2 . GLN B 1 91  ? 30.138  31.390 22.514  1.00 27.39 ?  91   GLN B NE2 1 
ATOM   3834 N N   . ILE B 1 92  ? 36.004  31.414 25.109  1.00 20.23 ?  92   ILE B N   1 
ATOM   3835 C CA  . ILE B 1 92  ? 37.401  30.954 25.105  1.00 21.31 ?  92   ILE B CA  1 
ATOM   3836 C C   . ILE B 1 92  ? 37.589  29.943 26.236  1.00 21.73 ?  92   ILE B C   1 
ATOM   3837 O O   . ILE B 1 92  ? 38.087  28.836 26.005  1.00 21.61 ?  92   ILE B O   1 
ATOM   3838 C CB  . ILE B 1 92  ? 38.382  32.135 25.184  1.00 19.25 ?  92   ILE B CB  1 
ATOM   3839 C CG1 . ILE B 1 92  ? 38.265  32.945 23.912  1.00 19.75 ?  92   ILE B CG1 1 
ATOM   3840 C CG2 . ILE B 1 92  ? 39.888  31.653 25.369  1.00 22.19 ?  92   ILE B CG2 1 
ATOM   3841 C CD1 . ILE B 1 92  ? 39.096  34.284 23.940  1.00 19.92 ?  92   ILE B CD1 1 
ATOM   3842 N N   . LYS B 1 93  ? 37.097  30.289 27.422  1.00 22.39 ?  93   LYS B N   1 
ATOM   3843 C CA  . LYS B 1 93  ? 37.198  29.402 28.579  1.00 24.84 ?  93   LYS B CA  1 
ATOM   3844 C C   . LYS B 1 93  ? 36.469  28.101 28.371  1.00 24.49 ?  93   LYS B C   1 
ATOM   3845 O O   . LYS B 1 93  ? 36.975  27.038 28.735  1.00 24.71 ?  93   LYS B O   1 
ATOM   3846 C CB  . LYS B 1 93  ? 36.733  30.090 29.886  1.00 23.93 ?  93   LYS B CB  1 
ATOM   3847 C CG  . LYS B 1 93  ? 37.712  31.233 30.382  1.00 28.60 ?  93   LYS B CG  1 
ATOM   3848 C CD  . LYS B 1 93  ? 37.190  31.999 31.654  1.00 28.49 ?  93   LYS B CD  1 
ATOM   3849 C CE  . LYS B 1 93  ? 38.058  33.247 32.047  1.00 32.00 ?  93   LYS B CE  1 
ATOM   3850 N NZ  . LYS B 1 93  ? 39.571  33.052 32.061  1.00 35.66 ?  93   LYS B NZ  1 
ATOM   3851 N N   . LEU B 1 94  ? 35.252  28.174 27.843  1.00 23.88 ?  94   LEU B N   1 
ATOM   3852 C CA  . LEU B 1 94  ? 34.443  26.984 27.715  1.00 22.74 ?  94   LEU B CA  1 
ATOM   3853 C C   . LEU B 1 94  ? 34.757  26.120 26.474  1.00 22.33 ?  94   LEU B C   1 
ATOM   3854 O O   . LEU B 1 94  ? 34.615  24.904 26.543  1.00 20.62 ?  94   LEU B O   1 
ATOM   3855 C CB  . LEU B 1 94  ? 32.966  27.356 27.709  1.00 23.59 ?  94   LEU B CB  1 
ATOM   3856 C CG  . LEU B 1 94  ? 32.317  27.970 28.977  1.00 27.20 ?  94   LEU B CG  1 
ATOM   3857 C CD1 . LEU B 1 94  ? 30.845  28.196 28.644  1.00 27.32 ?  94   LEU B CD1 1 
ATOM   3858 C CD2 . LEU B 1 94  ? 32.458  27.042 30.221  1.00 28.68 ?  94   LEU B CD2 1 
ATOM   3859 N N   . HIS B 1 95  ? 35.120  26.762 25.348  1.00 21.63 ?  95   HIS B N   1 
ATOM   3860 C CA  . HIS B 1 95  ? 35.190  26.085 24.039  1.00 20.98 ?  95   HIS B CA  1 
ATOM   3861 C C   . HIS B 1 95  ? 36.567  26.163 23.381  1.00 20.85 ?  95   HIS B C   1 
ATOM   3862 O O   . HIS B 1 95  ? 36.859  25.447 22.417  1.00 19.53 ?  95   HIS B O   1 
ATOM   3863 C CB  . HIS B 1 95  ? 34.119  26.661 23.086  1.00 20.26 ?  95   HIS B CB  1 
ATOM   3864 C CG  . HIS B 1 95  ? 32.751  26.755 23.695  1.00 21.55 ?  95   HIS B CG  1 
ATOM   3865 N ND1 . HIS B 1 95  ? 32.030  25.650 24.096  1.00 22.99 ?  95   HIS B ND1 1 
ATOM   3866 C CD2 . HIS B 1 95  ? 31.972  27.825 23.973  1.00 23.12 ?  95   HIS B CD2 1 
ATOM   3867 C CE1 . HIS B 1 95  ? 30.871  26.034 24.591  1.00 23.62 ?  95   HIS B CE1 1 
ATOM   3868 N NE2 . HIS B 1 95  ? 30.814  27.353 24.531  1.00 23.52 ?  95   HIS B NE2 1 
ATOM   3869 N N   . ASN B 1 96  ? 37.413  27.058 23.888  1.00 22.08 ?  96   ASN B N   1 
ATOM   3870 C CA  . ASN B 1 96  ? 38.743  27.298 23.330  1.00 22.86 ?  96   ASN B CA  1 
ATOM   3871 C C   . ASN B 1 96  ? 38.772  27.102 21.799  1.00 22.69 ?  96   ASN B C   1 
ATOM   3872 O O   . ASN B 1 96  ? 39.404  26.159 21.318  1.00 22.87 ?  96   ASN B O   1 
ATOM   3873 C CB  . ASN B 1 96  ? 39.745  26.336 23.974  1.00 23.33 ?  96   ASN B CB  1 
ATOM   3874 C CG  . ASN B 1 96  ? 41.165  26.667 23.594  1.00 27.60 ?  96   ASN B CG  1 
ATOM   3875 O OD1 . ASN B 1 96  ? 41.499  27.836 23.295  1.00 30.07 ?  96   ASN B OD1 1 
ATOM   3876 N ND2 . ASN B 1 96  ? 42.019  25.652 23.597  1.00 32.10 ?  96   ASN B ND2 1 
ATOM   3877 N N   . PRO B 1 97  ? 38.067  27.964 21.040  1.00 21.80 ?  97   PRO B N   1 
ATOM   3878 C CA  . PRO B 1 97  ? 37.885  27.661 19.612  1.00 20.57 ?  97   PRO B CA  1 
ATOM   3879 C C   . PRO B 1 97  ? 39.160  27.879 18.835  1.00 20.27 ?  97   PRO B C   1 
ATOM   3880 O O   . PRO B 1 97  ? 39.846  28.886 19.048  1.00 20.06 ?  97   PRO B O   1 
ATOM   3881 C CB  . PRO B 1 97  ? 36.834  28.682 19.151  1.00 20.72 ?  97   PRO B CB  1 
ATOM   3882 C CG  . PRO B 1 97  ? 36.176  29.205 20.453  1.00 19.95 ?  97   PRO B CG  1 
ATOM   3883 C CD  . PRO B 1 97  ? 37.376  29.207 21.421  1.00 21.48 ?  97   PRO B CD  1 
ATOM   3884 N N   . PRO B 1 98  ? 39.470  26.962 17.897  1.00 19.66 ?  98   PRO B N   1 
ATOM   3885 C CA  . PRO B 1 98  ? 40.688  27.062 17.079  1.00 19.45 ?  98   PRO B CA  1 
ATOM   3886 C C   . PRO B 1 98  ? 40.854  28.434 16.428  1.00 18.43 ?  98   PRO B C   1 
ATOM   3887 O O   . PRO B 1 98  ? 41.973  28.873 16.152  1.00 18.86 ?  98   PRO B O   1 
ATOM   3888 C CB  . PRO B 1 98  ? 40.466  25.979 16.009  1.00 19.08 ?  98   PRO B CB  1 
ATOM   3889 C CG  . PRO B 1 98  ? 39.656  24.949 16.686  1.00 20.05 ?  98   PRO B CG  1 
ATOM   3890 C CD  . PRO B 1 98  ? 38.704  25.746 17.591  1.00 20.08 ?  98   PRO B CD  1 
ATOM   3891 N N   . THR B 1 99  ? 39.740  29.130 16.187  1.00 18.14 ?  99   THR B N   1 
ATOM   3892 C CA  . THR B 1 99  ? 39.733  30.270 15.263  1.00 16.76 ?  99   THR B CA  1 
ATOM   3893 C C   . THR B 1 99  ? 40.081  31.577 15.958  1.00 16.81 ?  99   THR B C   1 
ATOM   3894 O O   . THR B 1 99  ? 40.233  32.598 15.297  1.00 14.53 ?  99   THR B O   1 
ATOM   3895 C CB  . THR B 1 99  ? 38.322  30.463 14.618  1.00 17.97 ?  99   THR B CB  1 
ATOM   3896 O OG1 . THR B 1 99  ? 37.378  30.570 15.699  1.00 14.44 ?  99   THR B OG1 1 
ATOM   3897 C CG2 . THR B 1 99  ? 37.950  29.271 13.693  1.00 16.77 ?  99   THR B CG2 1 
ATOM   3898 N N   . ILE B 1 100 ? 40.225  31.579 17.281  1.00 18.53 ?  100  ILE B N   1 
ATOM   3899 C CA  . ILE B 1 100 ? 40.655  32.825 17.937  1.00 21.86 ?  100  ILE B CA  1 
ATOM   3900 C C   . ILE B 1 100 ? 41.932  33.455 17.310  1.00 22.73 ?  100  ILE B C   1 
ATOM   3901 O O   . ILE B 1 100 ? 42.009  34.679 17.195  1.00 22.88 ?  100  ILE B O   1 
ATOM   3902 C CB  . ILE B 1 100 ? 40.722  32.728 19.502  1.00 22.60 ?  100  ILE B CB  1 
ATOM   3903 C CG1 . ILE B 1 100 ? 41.806  31.766 19.936  1.00 24.10 ?  100  ILE B CG1 1 
ATOM   3904 C CG2 . ILE B 1 100 ? 39.400  32.106 20.039  1.00 21.93 ?  100  ILE B CG2 1 
ATOM   3905 C CD1 . ILE B 1 100 ? 41.918  31.538 21.494  1.00 26.14 ?  100  ILE B CD1 1 
ATOM   3906 N N   . HIS B 1 101 ? 42.916  32.667 16.887  1.00 22.95 ?  101  HIS B N   1 
ATOM   3907 C CA  . HIS B 1 101 ? 44.058  33.344 16.236  1.00 25.72 ?  101  HIS B CA  1 
ATOM   3908 C C   . HIS B 1 101 ? 44.196  33.288 14.716  1.00 24.33 ?  101  HIS B C   1 
ATOM   3909 O O   . HIS B 1 101 ? 45.279  33.590 14.190  1.00 25.04 ?  101  HIS B O   1 
ATOM   3910 C CB  . HIS B 1 101 ? 45.404  33.050 16.889  1.00 27.22 ?  101  HIS B CB  1 
ATOM   3911 C CG  . HIS B 1 101 ? 45.458  33.457 18.333  1.00 32.06 ?  101  HIS B CG  1 
ATOM   3912 N ND1 . HIS B 1 101 ? 45.428  32.532 19.365  1.00 32.40 ?  101  HIS B ND1 1 
ATOM   3913 C CD2 . HIS B 1 101 ? 45.466  34.687 18.910  1.00 33.49 ?  101  HIS B CD2 1 
ATOM   3914 C CE1 . HIS B 1 101 ? 45.459  33.186 20.517  1.00 37.38 ?  101  HIS B CE1 1 
ATOM   3915 N NE2 . HIS B 1 101 ? 45.462  34.491 20.269  1.00 35.43 ?  101  HIS B NE2 1 
ATOM   3916 N N   . TYR B 1 102 ? 43.099  33.022 14.020  1.00 21.23 ?  102  TYR B N   1 
ATOM   3917 C CA  . TYR B 1 102 ? 43.137  33.007 12.555  1.00 19.95 ?  102  TYR B CA  1 
ATOM   3918 C C   . TYR B 1 102 ? 42.990  34.435 12.065  1.00 19.92 ?  102  TYR B C   1 
ATOM   3919 O O   . TYR B 1 102 ? 42.403  35.230 12.752  1.00 21.00 ?  102  TYR B O   1 
ATOM   3920 C CB  . TYR B 1 102 ? 41.986  32.167 12.003  1.00 18.46 ?  102  TYR B CB  1 
ATOM   3921 C CG  . TYR B 1 102 ? 42.100  30.671 12.197  1.00 17.90 ?  102  TYR B CG  1 
ATOM   3922 C CD1 . TYR B 1 102 ? 41.149  29.831 11.639  1.00 15.09 ?  102  TYR B CD1 1 
ATOM   3923 C CD2 . TYR B 1 102 ? 43.159  30.085 12.921  1.00 15.94 ?  102  TYR B CD2 1 
ATOM   3924 C CE1 . TYR B 1 102 ? 41.198  28.455 11.829  1.00 17.93 ?  102  TYR B CE1 1 
ATOM   3925 C CE2 . TYR B 1 102 ? 43.214  28.670 13.110  1.00 17.00 ?  102  TYR B CE2 1 
ATOM   3926 C CZ  . TYR B 1 102 ? 42.234  27.875 12.531  1.00 17.29 ?  102  TYR B CZ  1 
ATOM   3927 O OH  . TYR B 1 102 ? 42.267  26.493 12.637  1.00 16.10 ?  102  TYR B OH  1 
ATOM   3928 N N   . PRO B 1 103 ? 43.507  34.768 10.863  1.00 19.92 ?  103  PRO B N   1 
ATOM   3929 C CA  . PRO B 1 103 ? 43.222  36.099 10.292  1.00 19.68 ?  103  PRO B CA  1 
ATOM   3930 C C   . PRO B 1 103 ? 41.670  36.275 10.068  1.00 20.31 ?  103  PRO B C   1 
ATOM   3931 O O   . PRO B 1 103 ? 40.972  35.280 9.992   1.00 20.52 ?  103  PRO B O   1 
ATOM   3932 C CB  . PRO B 1 103 ? 43.957  36.066 8.938   1.00 20.86 ?  103  PRO B CB  1 
ATOM   3933 C CG  . PRO B 1 103 ? 44.984  34.886 9.073   1.00 22.02 ?  103  PRO B CG  1 
ATOM   3934 C CD  . PRO B 1 103 ? 44.297  33.899 9.963   1.00 18.58 ?  103  PRO B CD  1 
ATOM   3935 N N   . PRO B 1 104 ? 41.145  37.519 10.011  1.00 21.05 ?  104  PRO B N   1 
ATOM   3936 C CA  . PRO B 1 104 ? 39.692  37.714 9.731   1.00 22.34 ?  104  PRO B CA  1 
ATOM   3937 C C   . PRO B 1 104 ? 39.147  36.915 8.542   1.00 22.69 ?  104  PRO B C   1 
ATOM   3938 O O   . PRO B 1 104 ? 38.130  36.229 8.688   1.00 22.36 ?  104  PRO B O   1 
ATOM   3939 C CB  . PRO B 1 104 ? 39.552  39.229 9.496   1.00 22.02 ?  104  PRO B CB  1 
ATOM   3940 C CG  . PRO B 1 104 ? 40.679  39.848 10.336  1.00 21.93 ?  104  PRO B CG  1 
ATOM   3941 C CD  . PRO B 1 104 ? 41.833  38.801 10.320  1.00 21.54 ?  104  PRO B CD  1 
ATOM   3942 N N   . SER B 1 105 ? 39.825  36.961 7.396   1.00 23.86 ?  105  SER B N   1 
ATOM   3943 C CA  . SER B 1 105 ? 39.330  36.312 6.181   1.00 24.21 ?  105  SER B CA  1 
ATOM   3944 C C   . SER B 1 105 ? 39.226  34.818 6.349   1.00 23.77 ?  105  SER B C   1 
ATOM   3945 O O   . SER B 1 105 ? 38.421  34.186 5.667   1.00 22.20 ?  105  SER B O   1 
ATOM   3946 C CB  . SER B 1 105 ? 40.222  36.633 4.980   1.00 25.80 ?  105  SER B CB  1 
ATOM   3947 O OG  . SER B 1 105 ? 41.411  35.855 5.054   1.00 30.75 ?  105  SER B OG  1 
ATOM   3948 N N   . GLN B 1 106 ? 40.037  34.244 7.260   1.00 22.60 ?  106  GLN B N   1 
ATOM   3949 C CA  . GLN B 1 106 ? 39.935  32.818 7.593   1.00 22.71 ?  106  GLN B CA  1 
ATOM   3950 C C   . GLN B 1 106 ? 38.896  32.819 8.703   1.00 22.59 ?  106  GLN B C   1 
ATOM   3951 O O   . GLN B 1 106 ? 38.176  33.811 8.921   1.00 22.94 ?  106  GLN B O   1 
ATOM   3952 C CB  . GLN B 1 106 ? 41.303  32.202 7.999   1.00 23.48 ?  106  GLN B CB  1 
ATOM   3953 C CG  . GLN B 1 106 ? 42.410  32.368 6.924   1.00 25.92 ?  106  GLN B CG  1 
ATOM   3954 C CD  . GLN B 1 106 ? 41.947  32.040 5.473   1.00 32.36 ?  106  GLN B CD  1 
ATOM   3955 O OE1 . GLN B 1 106 ? 41.586  30.915 5.144   1.00 36.22 ?  106  GLN B OE1 1 
ATOM   3956 N NE2 . GLN B 1 106 ? 41.927  33.050 4.629   1.00 37.76 ?  106  GLN B NE2 1 
ATOM   3957 N N   . GLY B 1 107 ? 38.625  31.790 9.431   1.00 22.53 ?  107  GLY B N   1 
ATOM   3958 C CA  . GLY B 1 107 ? 37.428  32.282 10.270  1.00 23.03 ?  107  GLY B CA  1 
ATOM   3959 C C   . GLY B 1 107 ? 37.558  33.024 11.611  1.00 20.47 ?  107  GLY B C   1 
ATOM   3960 O O   . GLY B 1 107 ? 36.857  32.656 12.542  1.00 19.20 ?  107  GLY B O   1 
ATOM   3961 N N   . GLN B 1 108 ? 38.410  34.062 11.723  1.00 20.39 ?  108  GLN B N   1 
ATOM   3962 C CA  . GLN B 1 108 ? 38.764  34.609 13.056  1.00 18.88 ?  108  GLN B CA  1 
ATOM   3963 C C   . GLN B 1 108 ? 37.510  34.732 13.943  1.00 19.11 ?  108  GLN B C   1 
ATOM   3964 O O   . GLN B 1 108 ? 36.543  35.394 13.559  1.00 18.13 ?  108  GLN B O   1 
ATOM   3965 C CB  . GLN B 1 108 ? 39.485  35.964 12.972  1.00 18.03 ?  108  GLN B CB  1 
ATOM   3966 C CG  . GLN B 1 108 ? 39.658  36.630 14.364  1.00 21.43 ?  108  GLN B CG  1 
ATOM   3967 C CD  . GLN B 1 108 ? 40.299  37.998 14.324  1.00 22.44 ?  108  GLN B CD  1 
ATOM   3968 O OE1 . GLN B 1 108 ? 41.495  38.110 14.165  1.00 24.83 ?  108  GLN B OE1 1 
ATOM   3969 N NE2 . GLN B 1 108 ? 39.501  39.037 14.459  1.00 24.69 ?  108  GLN B NE2 1 
ATOM   3970 N N   . MET B 1 109 ? 37.531  34.131 15.137  1.00 19.15 ?  109  MET B N   1 
ATOM   3971 C CA  . MET B 1 109 ? 36.344  34.160 16.021  1.00 20.03 ?  109  MET B CA  1 
ATOM   3972 C C   . MET B 1 109 ? 35.919  35.595 16.323  1.00 19.15 ?  109  MET B C   1 
ATOM   3973 O O   . MET B 1 109 ? 36.767  36.462 16.617  1.00 18.62 ?  109  MET B O   1 
ATOM   3974 C CB  . MET B 1 109 ? 36.608  33.414 17.333  1.00 20.61 ?  109  MET B CB  1 
ATOM   3975 C CG  . MET B 1 109 ? 35.364  33.038 18.108  1.00 22.61 ?  109  MET B CG  1 
ATOM   3976 S SD  . MET B 1 109 ? 35.620  32.681 19.888  1.00 26.88 ?  109  MET B SD  1 
ATOM   3977 C CE  . MET B 1 109 ? 35.976  34.311 20.608  1.00 25.41 ?  109  MET B CE  1 
ATOM   3978 N N   . ASP B 1 110 ? 34.612  35.850 16.229  1.00 17.79 ?  110  ASP B N   1 
ATOM   3979 C CA  . ASP B 1 110 ? 34.029  37.116 16.677  1.00 17.66 ?  110  ASP B CA  1 
ATOM   3980 C C   . ASP B 1 110 ? 32.642  36.843 17.298  1.00 17.35 ?  110  ASP B C   1 
ATOM   3981 O O   . ASP B 1 110 ? 32.149  35.728 17.210  1.00 17.24 ?  110  ASP B O   1 
ATOM   3982 C CB  . ASP B 1 110 ? 33.958  38.129 15.538  1.00 16.08 ?  110  ASP B CB  1 
ATOM   3983 C CG  . ASP B 1 110 ? 33.810  39.618 16.044  1.00 21.87 ?  110  ASP B CG  1 
ATOM   3984 O OD1 . ASP B 1 110 ? 33.925  39.929 17.281  1.00 21.68 ?  110  ASP B OD1 1 
ATOM   3985 O OD2 . ASP B 1 110 ? 33.554  40.482 15.177  1.00 22.14 ?  110  ASP B OD2 1 
ATOM   3986 N N   . LEU B 1 111 ? 32.019  37.852 17.903  1.00 17.18 ?  111  LEU B N   1 
ATOM   3987 C CA  . LEU B 1 111 ? 30.813  37.611 18.691  1.00 17.62 ?  111  LEU B CA  1 
ATOM   3988 C C   . LEU B 1 111 ? 29.993  38.904 18.659  1.00 18.07 ?  111  LEU B C   1 
ATOM   3989 O O   . LEU B 1 111 ? 30.555  40.008 18.631  1.00 17.79 ?  111  LEU B O   1 
ATOM   3990 C CB  . LEU B 1 111 ? 31.283  37.324 20.138  1.00 18.92 ?  111  LEU B CB  1 
ATOM   3991 C CG  . LEU B 1 111 ? 30.459  36.742 21.278  1.00 22.56 ?  111  LEU B CG  1 
ATOM   3992 C CD1 . LEU B 1 111 ? 31.363  35.940 22.248  1.00 24.28 ?  111  LEU B CD1 1 
ATOM   3993 C CD2 . LEU B 1 111 ? 29.750  37.921 22.012  1.00 25.84 ?  111  LEU B CD2 1 
ATOM   3994 N N   . CYS B 1 112 ? 28.678  38.802 18.683  1.00 16.36 ?  112  CYS B N   1 
ATOM   3995 C CA  . CYS B 1 112 ? 27.913  40.015 18.893  1.00 17.16 ?  112  CYS B CA  1 
ATOM   3996 C C   . CYS B 1 112 ? 26.729  39.694 19.766  1.00 15.07 ?  112  CYS B C   1 
ATOM   3997 O O   . CYS B 1 112 ? 26.286  38.557 19.779  1.00 15.19 ?  112  CYS B O   1 
ATOM   3998 C CB  . CYS B 1 112 ? 27.506  40.641 17.559  1.00 17.42 ?  112  CYS B CB  1 
ATOM   3999 S SG  . CYS B 1 112 ? 26.493  39.594 16.583  1.00 24.46 ?  112  CYS B SG  1 
ATOM   4000 N N   . VAL B 1 113 ? 26.304  40.649 20.577  1.00 14.78 ?  113  VAL B N   1 
ATOM   4001 C CA  . VAL B 1 113 ? 25.104  40.491 21.415  1.00 14.96 ?  113  VAL B CA  1 
ATOM   4002 C C   . VAL B 1 113 ? 23.918  40.643 20.486  1.00 14.29 ?  113  VAL B C   1 
ATOM   4003 O O   . VAL B 1 113 ? 23.949  41.473 19.592  1.00 16.08 ?  113  VAL B O   1 
ATOM   4004 C CB  . VAL B 1 113 ? 25.031  41.543 22.561  1.00 15.34 ?  113  VAL B CB  1 
ATOM   4005 C CG1 . VAL B 1 113 ? 23.872  41.226 23.512  1.00 15.11 ?  113  VAL B CG1 1 
ATOM   4006 C CG2 . VAL B 1 113 ? 26.385  41.596 23.343  1.00 17.03 ?  113  VAL B CG2 1 
ATOM   4007 N N   . THR B 1 114 ? 22.881  39.858 20.690  1.00 15.98 ?  114  THR B N   1 
ATOM   4008 C CA  . THR B 1 114 ? 21.653  39.950 19.894  1.00 16.66 ?  114  THR B CA  1 
ATOM   4009 C C   . THR B 1 114 ? 20.427  40.127 20.819  1.00 17.49 ?  114  THR B C   1 
ATOM   4010 O O   . THR B 1 114 ? 20.496  39.880 22.047  1.00 17.52 ?  114  THR B O   1 
ATOM   4011 C CB  . THR B 1 114 ? 21.496  38.699 18.939  1.00 17.39 ?  114  THR B CB  1 
ATOM   4012 O OG1 . THR B 1 114 ? 21.502  37.511 19.725  1.00 20.09 ?  114  THR B OG1 1 
ATOM   4013 C CG2 . THR B 1 114 ? 22.669  38.606 17.895  1.00 16.16 ?  114  THR B CG2 1 
ATOM   4014 N N   . SER B 1 115 ? 19.335  40.601 20.243  1.00 17.73 ?  115  SER B N   1 
ATOM   4015 C CA  . SER B 1 115 ? 18.062  40.766 20.946  1.00 19.28 ?  115  SER B CA  1 
ATOM   4016 C C   . SER B 1 115 ? 17.377  39.413 21.017  1.00 19.86 ?  115  SER B C   1 
ATOM   4017 O O   . SER B 1 115 ? 16.429  39.167 20.272  1.00 21.37 ?  115  SER B O   1 
ATOM   4018 C CB  . SER B 1 115 ? 17.196  41.880 20.298  1.00 20.29 ?  115  SER B CB  1 
ATOM   4019 O OG  . SER B 1 115 ? 17.972  43.131 20.199  1.00 20.17 ?  115  SER B OG  1 
ATOM   4020 N N   . GLY B 1 116 ? 17.863  38.566 21.947  1.00 18.69 ?  116  GLY B N   1 
ATOM   4021 C CA  . GLY B 1 116 ? 17.522  37.131 22.036  1.00 18.66 ?  116  GLY B CA  1 
ATOM   4022 C C   . GLY B 1 116 ? 18.399  36.334 21.062  1.00 19.36 ?  116  GLY B C   1 
ATOM   4023 O O   . GLY B 1 116 ? 18.946  36.895 20.081  1.00 19.09 ?  116  GLY B O   1 
ATOM   4024 N N   . SER B 1 117 ? 18.511  35.032 21.266  1.00 19.26 ?  117  SER B N   1 
ATOM   4025 C CA  . SER B 1 117 ? 19.262  34.221 20.283  1.00 19.67 ?  117  SER B CA  1 
ATOM   4026 C C   . SER B 1 117 ? 18.494  34.008 18.947  1.00 19.99 ?  117  SER B C   1 
ATOM   4027 O O   . SER B 1 117 ? 19.110  33.746 17.922  1.00 19.52 ?  117  SER B O   1 
ATOM   4028 C CB  . SER B 1 117 ? 19.764  32.908 20.896  1.00 20.09 ?  117  SER B CB  1 
ATOM   4029 O OG  . SER B 1 117 ? 18.767  31.927 20.836  1.00 20.51 ?  117  SER B OG  1 
ATOM   4030 N N   . GLN B 1 118 ? 17.153  34.104 18.966  1.00 18.27 ?  118  GLN B N   1 
ATOM   4031 C CA  . GLN B 1 118 ? 16.357  33.974 17.753  1.00 18.53 ?  118  GLN B CA  1 
ATOM   4032 C C   . GLN B 1 118 ? 16.660  35.072 16.681  1.00 17.66 ?  118  GLN B C   1 
ATOM   4033 O O   . GLN B 1 118 ? 16.505  34.852 15.449  1.00 17.98 ?  118  GLN B O   1 
ATOM   4034 C CB  . GLN B 1 118 ? 14.895  34.042 18.156  1.00 18.57 ?  118  GLN B CB  1 
ATOM   4035 C CG  . GLN B 1 118 ? 13.966  33.831 17.045  1.00 25.45 ?  118  GLN B CG  1 
ATOM   4036 C CD  . GLN B 1 118 ? 13.590  32.408 16.877  1.00 33.11 ?  118  GLN B CD  1 
ATOM   4037 O OE1 . GLN B 1 118 ? 14.426  31.561 16.555  1.00 41.25 ?  118  GLN B OE1 1 
ATOM   4038 N NE2 . GLN B 1 118 ? 12.322  32.118 17.085  1.00 37.71 ?  118  GLN B NE2 1 
ATOM   4039 N N   . GLN B 1 119 ? 17.030  36.264 17.140  1.00 15.81 ?  119  GLN B N   1 
ATOM   4040 C CA  . GLN B 1 119 ? 17.436  37.350 16.219  1.00 14.66 ?  119  GLN B CA  1 
ATOM   4041 C C   . GLN B 1 119 ? 18.675  36.994 15.444  1.00 14.57 ?  119  GLN B C   1 
ATOM   4042 O O   . GLN B 1 119 ? 18.711  37.217 14.235  1.00 14.88 ?  119  GLN B O   1 
ATOM   4043 C CB  . GLN B 1 119 ? 17.716  38.675 16.928  1.00 13.51 ?  119  GLN B CB  1 
ATOM   4044 C CG  . GLN B 1 119 ? 17.768  39.857 15.903  1.00 12.05 ?  119  GLN B CG  1 
ATOM   4045 C CD  . GLN B 1 119 ? 18.310  41.157 16.491  1.00 16.26 ?  119  GLN B CD  1 
ATOM   4046 O OE1 . GLN B 1 119 ? 19.070  41.143 17.469  1.00 21.13 ?  119  GLN B OE1 1 
ATOM   4047 N NE2 . GLN B 1 119 ? 17.895  42.295 15.921  1.00 16.08 ?  119  GLN B NE2 1 
ATOM   4048 N N   . GLY B 1 120 ? 19.661  36.448 16.158  1.00 14.43 ?  120  GLY B N   1 
ATOM   4049 C CA  . GLY B 1 120 ? 20.902  35.912 15.578  1.00 15.61 ?  120  GLY B CA  1 
ATOM   4050 C C   . GLY B 1 120 ? 20.643  34.880 14.511  1.00 15.33 ?  120  GLY B C   1 
ATOM   4051 O O   . GLY B 1 120 ? 21.118  34.989 13.417  1.00 15.88 ?  120  GLY B O   1 
ATOM   4052 N N   . LEU B 1 121 ? 19.865  33.872 14.840  1.00 16.66 ?  121  LEU B N   1 
ATOM   4053 C CA  . LEU B 1 121 ? 19.538  32.813 13.906  1.00 17.14 ?  121  LEU B CA  1 
ATOM   4054 C C   . LEU B 1 121 ? 18.762  33.342 12.699  1.00 16.88 ?  121  LEU B C   1 
ATOM   4055 O O   . LEU B 1 121 ? 19.040  32.981 11.572  1.00 15.57 ?  121  LEU B O   1 
ATOM   4056 C CB  . LEU B 1 121 ? 18.686  31.771 14.648  1.00 17.98 ?  121  LEU B CB  1 
ATOM   4057 C CG  . LEU B 1 121 ? 19.107  30.363 15.056  1.00 23.86 ?  121  LEU B CG  1 
ATOM   4058 C CD1 . LEU B 1 121 ? 20.614  30.053 14.989  1.00 24.08 ?  121  LEU B CD1 1 
ATOM   4059 C CD2 . LEU B 1 121 ? 18.457  29.961 16.411  1.00 27.67 ?  121  LEU B CD2 1 
ATOM   4060 N N   . CYS B 1 122 ? 17.795  34.222 12.941  1.00 17.76 ?  122  CYS B N   1 
ATOM   4061 C CA  . CYS B 1 122 ? 16.974  34.763 11.864  1.00 16.10 ?  122  CYS B CA  1 
ATOM   4062 C C   . CYS B 1 122 ? 17.867  35.510 10.888  1.00 16.28 ?  122  CYS B C   1 
ATOM   4063 O O   . CYS B 1 122 ? 17.741  35.323 9.664   1.00 14.64 ?  122  CYS B O   1 
ATOM   4064 C CB  . CYS B 1 122 ? 15.912  35.725 12.392  1.00 16.58 ?  122  CYS B CB  1 
ATOM   4065 S SG  . CYS B 1 122 ? 14.733  36.195 11.064  1.00 23.39 ?  122  CYS B SG  1 
ATOM   4066 N N   . LYS B 1 123 ? 18.773  36.343 11.420  1.00 14.66 ?  123  LYS B N   1 
ATOM   4067 C CA  . LYS B 1 123 ? 19.685  37.109 10.546  1.00 14.66 ?  123  LYS B CA  1 
ATOM   4068 C C   . LYS B 1 123 ? 20.722  36.260 9.765   1.00 13.86 ?  123  LYS B C   1 
ATOM   4069 O O   . LYS B 1 123 ? 21.022  36.569 8.611   1.00 13.79 ?  123  LYS B O   1 
ATOM   4070 C CB  . LYS B 1 123 ? 20.296  38.293 11.320  1.00 16.08 ?  123  LYS B CB  1 
ATOM   4071 C CG  . LYS B 1 123 ? 19.159  39.388 11.560  1.00 16.34 ?  123  LYS B CG  1 
ATOM   4072 C CD  . LYS B 1 123 ? 19.705  40.586 12.193  1.00 24.18 ?  123  LYS B CD  1 
ATOM   4073 C CE  . LYS B 1 123 ? 18.585  41.616 12.499  1.00 26.25 ?  123  LYS B CE  1 
ATOM   4074 N NZ  . LYS B 1 123 ? 17.711  41.890 11.317  1.00 26.49 ?  123  LYS B NZ  1 
ATOM   4075 N N   . VAL B 1 124 ? 21.242  35.207 10.395  1.00 12.58 ?  124  VAL B N   1 
ATOM   4076 C CA  . VAL B 1 124 ? 22.074  34.194 9.701   1.00 12.59 ?  124  VAL B CA  1 
ATOM   4077 C C   . VAL B 1 124 ? 21.339  33.486 8.539   1.00 13.36 ?  124  VAL B C   1 
ATOM   4078 O O   . VAL B 1 124 ? 21.865  33.436 7.415   1.00 12.35 ?  124  VAL B O   1 
ATOM   4079 C CB  . VAL B 1 124 ? 22.603  33.155 10.720  1.00 12.97 ?  124  VAL B CB  1 
ATOM   4080 C CG1 . VAL B 1 124 ? 23.219  31.959 10.031  1.00 15.60 ?  124  VAL B CG1 1 
ATOM   4081 C CG2 . VAL B 1 124 ? 23.617  33.845 11.718  1.00 9.28  ?  124  VAL B CG2 1 
ATOM   4082 N N   . PHE B 1 125 ? 20.113  32.951 8.794   1.00 12.92 ?  125  PHE B N   1 
ATOM   4083 C CA  . PHE B 1 125 ? 19.284  32.407 7.742   1.00 13.65 ?  125  PHE B CA  1 
ATOM   4084 C C   . PHE B 1 125 ? 19.036  33.357 6.580   1.00 14.60 ?  125  PHE B C   1 
ATOM   4085 O O   . PHE B 1 125 ? 19.116  32.936 5.413   1.00 14.85 ?  125  PHE B O   1 
ATOM   4086 C CB  . PHE B 1 125 ? 17.898  31.936 8.286   1.00 14.53 ?  125  PHE B CB  1 
ATOM   4087 C CG  . PHE B 1 125 ? 17.967  30.877 9.337   1.00 14.65 ?  125  PHE B CG  1 
ATOM   4088 C CD1 . PHE B 1 125 ? 16.913  30.741 10.249  1.00 16.46 ?  125  PHE B CD1 1 
ATOM   4089 C CD2 . PHE B 1 125 ? 19.055  30.006 9.428   1.00 17.10 ?  125  PHE B CD2 1 
ATOM   4090 C CE1 . PHE B 1 125 ? 16.909  29.772 11.230  1.00 19.79 ?  125  PHE B CE1 1 
ATOM   4091 C CE2 . PHE B 1 125 ? 19.093  29.029 10.439  1.00 17.27 ?  125  PHE B CE2 1 
ATOM   4092 C CZ  . PHE B 1 125 ? 17.985  28.904 11.348  1.00 16.68 ?  125  PHE B CZ  1 
ATOM   4093 N N   . GLU B 1 126 ? 18.736  34.628 6.903   1.00 14.03 ?  126  GLU B N   1 
ATOM   4094 C CA  . GLU B 1 126 ? 18.511  35.698 5.925   1.00 16.88 ?  126  GLU B CA  1 
ATOM   4095 C C   . GLU B 1 126 ? 19.790  36.046 5.158   1.00 15.10 ?  126  GLU B C   1 
ATOM   4096 O O   . GLU B 1 126 ? 19.760  36.206 3.945   1.00 16.44 ?  126  GLU B O   1 
ATOM   4097 C CB  . GLU B 1 126 ? 17.945  36.963 6.623   1.00 14.95 ?  126  GLU B CB  1 
ATOM   4098 C CG  . GLU B 1 126 ? 16.391  36.949 6.755   1.00 21.33 ?  126  GLU B CG  1 
ATOM   4099 C CD  . GLU B 1 126 ? 15.848  37.909 7.868   1.00 22.91 ?  126  GLU B CD  1 
ATOM   4100 O OE1 . GLU B 1 126 ? 14.592  38.059 7.947   1.00 27.13 ?  126  GLU B OE1 1 
ATOM   4101 O OE2 . GLU B 1 126 ? 16.670  38.452 8.668   1.00 24.11 ?  126  GLU B OE2 1 
ATOM   4102 N N   . MET B 1 127 ? 20.908  36.146 5.866   1.00 14.27 ?  127  MET B N   1 
ATOM   4103 C CA  . MET B 1 127 ? 22.200  36.365 5.212   1.00 14.45 ?  127  MET B CA  1 
ATOM   4104 C C   . MET B 1 127 ? 22.535  35.263 4.179   1.00 14.55 ?  127  MET B C   1 
ATOM   4105 O O   . MET B 1 127 ? 23.160  35.552 3.204   1.00 16.98 ?  127  MET B O   1 
ATOM   4106 C CB  . MET B 1 127 ? 23.310  36.476 6.275   1.00 14.54 ?  127  MET B CB  1 
ATOM   4107 C CG  . MET B 1 127 ? 24.779  36.284 5.749   1.00 13.23 ?  127  MET B CG  1 
ATOM   4108 S SD  . MET B 1 127 ? 25.866  36.263 7.174   1.00 17.20 ?  127  MET B SD  1 
ATOM   4109 C CE  . MET B 1 127 ? 25.606  34.605 7.850   1.00 14.14 ?  127  MET B CE  1 
ATOM   4110 N N   . ILE B 1 128 ? 22.099  34.021 4.384   1.00 15.51 ?  128  ILE B N   1 
ATOM   4111 C CA  . ILE B 1 128 ? 22.588  32.863 3.604   1.00 15.85 ?  128  ILE B CA  1 
ATOM   4112 C C   . ILE B 1 128 ? 21.635  32.398 2.470   1.00 17.02 ?  128  ILE B C   1 
ATOM   4113 O O   . ILE B 1 128 ? 22.085  32.085 1.403   1.00 17.31 ?  128  ILE B O   1 
ATOM   4114 C CB  . ILE B 1 128 ? 22.906  31.655 4.548   1.00 15.74 ?  128  ILE B CB  1 
ATOM   4115 C CG1 . ILE B 1 128 ? 24.128  31.970 5.438   1.00 16.30 ?  128  ILE B CG1 1 
ATOM   4116 C CG2 . ILE B 1 128 ? 23.077  30.333 3.743   1.00 16.18 ?  128  ILE B CG2 1 
ATOM   4117 C CD1 . ILE B 1 128 ? 24.337  31.011 6.642   1.00 14.73 ?  128  ILE B CD1 1 
ATOM   4118 N N   . ILE B 1 129 ? 20.322  32.366 2.707   1.00 18.37 ?  129  ILE B N   1 
ATOM   4119 C CA  . ILE B 1 129 ? 19.405  31.588 1.861   1.00 19.60 ?  129  ILE B CA  1 
ATOM   4120 C C   . ILE B 1 129 ? 18.823  32.354 0.677   1.00 20.33 ?  129  ILE B C   1 
ATOM   4121 O O   . ILE B 1 129 ? 18.195  33.418 0.841   1.00 18.96 ?  129  ILE B O   1 
ATOM   4122 C CB  . ILE B 1 129 ? 18.271  30.956 2.729   1.00 20.58 ?  129  ILE B CB  1 
ATOM   4123 C CG1 . ILE B 1 129 ? 18.889  30.056 3.790   1.00 20.59 ?  129  ILE B CG1 1 
ATOM   4124 C CG2 . ILE B 1 129 ? 17.221  30.175 1.861   1.00 20.22 ?  129  ILE B CG2 1 
ATOM   4125 C CD1 . ILE B 1 129 ? 17.921  29.689 4.927   1.00 26.18 ?  129  ILE B CD1 1 
ATOM   4126 N N   . ASN B 1 130 ? 19.089  31.831 -0.526  1.00 20.65 ?  130  ASN B N   1 
ATOM   4127 C CA  . ASN B 1 130 ? 18.425  32.249 -1.750  1.00 22.07 ?  130  ASN B CA  1 
ATOM   4128 C C   . ASN B 1 130 ? 17.291  31.262 -1.992  1.00 23.03 ?  130  ASN B C   1 
ATOM   4129 O O   . ASN B 1 130 ? 17.404  30.101 -1.572  1.00 23.65 ?  130  ASN B O   1 
ATOM   4130 C CB  . ASN B 1 130 ? 19.386  32.230 -2.954  1.00 22.92 ?  130  ASN B CB  1 
ATOM   4131 C CG  . ASN B 1 130 ? 20.446  33.296 -2.873  1.00 26.13 ?  130  ASN B CG  1 
ATOM   4132 O OD1 . ASN B 1 130 ? 20.149  34.457 -2.577  1.00 32.16 ?  130  ASN B OD1 1 
ATOM   4133 N ND2 . ASN B 1 130 ? 21.692  32.913 -3.108  1.00 28.45 ?  130  ASN B ND2 1 
ATOM   4134 N N   . PRO B 1 131 ? 16.187  31.701 -2.649  1.00 23.33 ?  131  PRO B N   1 
ATOM   4135 C CA  . PRO B 1 131 ? 15.118  30.733 -2.917  1.00 23.76 ?  131  PRO B CA  1 
ATOM   4136 C C   . PRO B 1 131 ? 15.684  29.555 -3.744  1.00 23.52 ?  131  PRO B C   1 
ATOM   4137 O O   . PRO B 1 131 ? 16.437  29.776 -4.693  1.00 22.34 ?  131  PRO B O   1 
ATOM   4138 C CB  . PRO B 1 131 ? 14.113  31.552 -3.738  1.00 24.62 ?  131  PRO B CB  1 
ATOM   4139 C CG  . PRO B 1 131 ? 14.347  33.003 -3.287  1.00 25.05 ?  131  PRO B CG  1 
ATOM   4140 C CD  . PRO B 1 131 ? 15.855  33.058 -3.142  1.00 23.51 ?  131  PRO B CD  1 
ATOM   4141 N N   . GLY B 1 132 ? 15.363  28.321 -3.364  1.00 23.31 ?  132  GLY B N   1 
ATOM   4142 C CA  . GLY B 1 132 ? 15.925  27.149 -4.090  1.00 23.23 ?  132  GLY B CA  1 
ATOM   4143 C C   . GLY B 1 132 ? 17.158  26.517 -3.440  1.00 22.90 ?  132  GLY B C   1 
ATOM   4144 O O   . GLY B 1 132 ? 17.540  25.386 -3.794  1.00 23.93 ?  132  GLY B O   1 
ATOM   4145 N N   . ASP B 1 133 ? 17.773  27.197 -2.469  1.00 21.46 ?  133  ASP B N   1 
ATOM   4146 C CA  . ASP B 1 133 ? 18.926  26.634 -1.754  1.00 20.05 ?  133  ASP B CA  1 
ATOM   4147 C C   . ASP B 1 133 ? 18.525  25.394 -0.943  1.00 19.82 ?  133  ASP B C   1 
ATOM   4148 O O   . ASP B 1 133 ? 17.382  25.325 -0.463  1.00 20.21 ?  133  ASP B O   1 
ATOM   4149 C CB  . ASP B 1 133 ? 19.573  27.680 -0.824  1.00 19.69 ?  133  ASP B CB  1 
ATOM   4150 C CG  . ASP B 1 133 ? 20.407  28.715 -1.579  1.00 19.82 ?  133  ASP B CG  1 
ATOM   4151 O OD1 . ASP B 1 133 ? 20.559  28.592 -2.819  1.00 22.59 ?  133  ASP B OD1 1 
ATOM   4152 O OD2 . ASP B 1 133 ? 20.927  29.674 -0.927  1.00 21.11 ?  133  ASP B OD2 1 
ATOM   4153 N N   . ASN B 1 134 ? 19.446  24.442 -0.779  1.00 16.49 ?  134  ASN B N   1 
ATOM   4154 C CA  . ASN B 1 134 ? 19.210  23.300 0.078   1.00 17.42 ?  134  ASN B CA  1 
ATOM   4155 C C   . ASN B 1 134 ? 19.830  23.501 1.438   1.00 16.79 ?  134  ASN B C   1 
ATOM   4156 O O   . ASN B 1 134 ? 20.961  23.978 1.539   1.00 15.48 ?  134  ASN B O   1 
ATOM   4157 C CB  . ASN B 1 134 ? 19.757  22.007 -0.604  1.00 18.59 ?  134  ASN B CB  1 
ATOM   4158 C CG  . ASN B 1 134 ? 19.088  21.733 -1.967  1.00 19.87 ?  134  ASN B CG  1 
ATOM   4159 O OD1 . ASN B 1 134 ? 17.873  21.545 -2.045  1.00 19.44 ?  134  ASN B OD1 1 
ATOM   4160 N ND2 . ASN B 1 134 ? 19.878  21.721 -3.046  1.00 21.93 ?  134  ASN B ND2 1 
ATOM   4161 N N   . VAL B 1 135 ? 19.083  23.187 2.499   1.00 16.86 ?  135  VAL B N   1 
ATOM   4162 C CA  . VAL B 1 135 ? 19.612  23.250 3.841   1.00 17.56 ?  135  VAL B CA  1 
ATOM   4163 C C   . VAL B 1 135 ? 19.289  21.920 4.481   1.00 18.17 ?  135  VAL B C   1 
ATOM   4164 O O   . VAL B 1 135 ? 18.304  21.267 4.115   1.00 18.79 ?  135  VAL B O   1 
ATOM   4165 C CB  . VAL B 1 135 ? 18.959  24.410 4.657   1.00 19.24 ?  135  VAL B CB  1 
ATOM   4166 C CG1 . VAL B 1 135 ? 19.090  25.695 3.863   1.00 20.06 ?  135  VAL B CG1 1 
ATOM   4167 C CG2 . VAL B 1 135 ? 17.453  24.113 4.950   1.00 18.33 ?  135  VAL B CG2 1 
ATOM   4168 N N   . LEU B 1 136 ? 20.090  21.521 5.445   1.00 18.61 ?  136  LEU B N   1 
ATOM   4169 C CA  . LEU B 1 136 ? 19.898  20.231 6.080   1.00 19.87 ?  136  LEU B CA  1 
ATOM   4170 C C   . LEU B 1 136 ? 19.532  20.425 7.526   1.00 19.84 ?  136  LEU B C   1 
ATOM   4171 O O   . LEU B 1 136 ? 20.078  21.315 8.178   1.00 18.21 ?  136  LEU B O   1 
ATOM   4172 C CB  . LEU B 1 136 ? 21.186  19.404 5.980   1.00 19.52 ?  136  LEU B CB  1 
ATOM   4173 C CG  . LEU B 1 136 ? 21.770  19.291 4.553   1.00 23.09 ?  136  LEU B CG  1 
ATOM   4174 C CD1 . LEU B 1 136 ? 23.281  18.984 4.572   1.00 23.67 ?  136  LEU B CD1 1 
ATOM   4175 C CD2 . LEU B 1 136 ? 21.029  18.237 3.762   1.00 25.26 ?  136  LEU B CD2 1 
ATOM   4176 N N   . LEU B 1 137 ? 18.622  19.589 8.032   1.00 20.31 ?  137  LEU B N   1 
ATOM   4177 C CA  . LEU B 1 137 ? 18.281  19.624 9.454   1.00 21.91 ?  137  LEU B CA  1 
ATOM   4178 C C   . LEU B 1 137 ? 17.568  18.353 9.883   1.00 23.75 ?  137  LEU B C   1 
ATOM   4179 O O   . LEU B 1 137 ? 17.011  17.651 9.035   1.00 24.16 ?  137  LEU B O   1 
ATOM   4180 C CB  . LEU B 1 137 ? 17.446  20.893 9.722   1.00 22.59 ?  137  LEU B CB  1 
ATOM   4181 C CG  . LEU B 1 137 ? 15.953  21.142 9.952   1.00 24.13 ?  137  LEU B CG  1 
ATOM   4182 C CD1 . LEU B 1 137 ? 15.650  22.582 9.601   1.00 25.87 ?  137  LEU B CD1 1 
ATOM   4183 C CD2 . LEU B 1 137 ? 14.938  20.202 9.299   1.00 24.89 ?  137  LEU B CD2 1 
ATOM   4184 N N   . ASP B 1 138 ? 17.562  18.039 11.176  1.00 24.65 ?  138  ASP B N   1 
ATOM   4185 C CA  . ASP B 1 138 ? 16.748  16.902 11.663  1.00 27.45 ?  138  ASP B CA  1 
ATOM   4186 C C   . ASP B 1 138 ? 15.349  17.314 12.188  1.00 27.73 ?  138  ASP B C   1 
ATOM   4187 O O   . ASP B 1 138 ? 15.249  18.155 13.066  1.00 27.54 ?  138  ASP B O   1 
ATOM   4188 C CB  . ASP B 1 138 ? 17.488  16.157 12.779  1.00 27.49 ?  138  ASP B CB  1 
ATOM   4189 C CG  . ASP B 1 138 ? 18.015  17.104 13.863  1.00 31.89 ?  138  ASP B CG  1 
ATOM   4190 O OD1 . ASP B 1 138 ? 18.640  18.163 13.513  1.00 36.61 ?  138  ASP B OD1 1 
ATOM   4191 O OD2 . ASP B 1 138 ? 17.795  16.794 15.063  1.00 36.33 ?  138  ASP B OD2 1 
ATOM   4192 N N   . GLU B 1 139 ? 14.295  16.718 11.648  1.00 28.13 ?  139  GLU B N   1 
ATOM   4193 C CA  . GLU B 1 139 ? 12.935  16.902 12.155  1.00 30.18 ?  139  GLU B CA  1 
ATOM   4194 C C   . GLU B 1 139 ? 12.707  15.767 13.130  1.00 30.08 ?  139  GLU B C   1 
ATOM   4195 O O   . GLU B 1 139 ? 13.190  14.666 12.890  1.00 30.94 ?  139  GLU B O   1 
ATOM   4196 C CB  . GLU B 1 139 ? 11.902  16.796 11.017  1.00 31.20 ?  139  GLU B CB  1 
ATOM   4197 C CG  . GLU B 1 139 ? 12.050  17.834 9.920   1.00 34.70 ?  139  GLU B CG  1 
ATOM   4198 C CD  . GLU B 1 139 ? 11.079  17.655 8.745   1.00 40.43 ?  139  GLU B CD  1 
ATOM   4199 O OE1 . GLU B 1 139 ? 9.846   17.559 8.967   1.00 38.69 ?  139  GLU B OE1 1 
ATOM   4200 O OE2 . GLU B 1 139 ? 11.560  17.672 7.574   1.00 44.95 ?  139  GLU B OE2 1 
ATOM   4201 N N   . PRO B 1 140 ? 11.969  15.994 14.231  1.00 30.19 ?  140  PRO B N   1 
ATOM   4202 C CA  . PRO B 1 140 ? 11.262  17.228 14.627  1.00 29.40 ?  140  PRO B CA  1 
ATOM   4203 C C   . PRO B 1 140 ? 12.239  18.318 15.114  1.00 28.48 ?  140  PRO B C   1 
ATOM   4204 O O   . PRO B 1 140 ? 13.249  18.023 15.767  1.00 27.40 ?  140  PRO B O   1 
ATOM   4205 C CB  . PRO B 1 140 ? 10.327  16.772 15.746  1.00 29.37 ?  140  PRO B CB  1 
ATOM   4206 C CG  . PRO B 1 140 ? 10.924  15.499 16.270  1.00 30.56 ?  140  PRO B CG  1 
ATOM   4207 C CD  . PRO B 1 140 ? 11.789  14.899 15.209  1.00 29.72 ?  140  PRO B CD  1 
ATOM   4208 N N   . ALA B 1 141 ? 11.915  19.554 14.780  1.00 27.54 ?  141  ALA B N   1 
ATOM   4209 C CA  . ALA B 1 141 ? 12.796  20.686 15.005  1.00 27.61 ?  141  ALA B CA  1 
ATOM   4210 C C   . ALA B 1 141 ? 12.018  21.845 15.618  1.00 27.40 ?  141  ALA B C   1 
ATOM   4211 O O   . ALA B 1 141 ? 10.779  21.893 15.578  1.00 27.07 ?  141  ALA B O   1 
ATOM   4212 C CB  . ALA B 1 141 ? 13.450  21.108 13.653  1.00 27.83 ?  141  ALA B CB  1 
ATOM   4213 N N   . TYR B 1 142 ? 12.748  22.775 16.221  1.00 27.05 ?  142  TYR B N   1 
ATOM   4214 C CA  . TYR B 1 142 ? 12.136  23.916 16.854  1.00 26.67 ?  142  TYR B CA  1 
ATOM   4215 C C   . TYR B 1 142 ? 11.186  24.637 15.888  1.00 26.15 ?  142  TYR B C   1 
ATOM   4216 O O   . TYR B 1 142 ? 11.544  24.925 14.755  1.00 25.81 ?  142  TYR B O   1 
ATOM   4217 C CB  . TYR B 1 142 ? 13.247  24.798 17.397  1.00 27.78 ?  142  TYR B CB  1 
ATOM   4218 C CG  . TYR B 1 142 ? 12.846  26.182 17.804  1.00 28.15 ?  142  TYR B CG  1 
ATOM   4219 C CD1 . TYR B 1 142 ? 11.749  26.411 18.618  1.00 27.31 ?  142  TYR B CD1 1 
ATOM   4220 C CD2 . TYR B 1 142 ? 13.613  27.270 17.396  1.00 29.13 ?  142  TYR B CD2 1 
ATOM   4221 C CE1 . TYR B 1 142 ? 11.411  27.717 18.996  1.00 28.29 ?  142  TYR B CE1 1 
ATOM   4222 C CE2 . TYR B 1 142 ? 13.289  28.551 17.767  1.00 31.25 ?  142  TYR B CE2 1 
ATOM   4223 C CZ  . TYR B 1 142 ? 12.190  28.769 18.560  1.00 28.72 ?  142  TYR B CZ  1 
ATOM   4224 O OH  . TYR B 1 142 ? 11.889  30.072 18.908  1.00 33.44 ?  142  TYR B OH  1 
ATOM   4225 N N   . SER B 1 143 ? 9.948   24.861 16.318  1.00 25.90 ?  143  SER B N   1 
ATOM   4226 C CA  . SER B 1 143 ? 8.936   25.389 15.418  1.00 26.71 ?  143  SER B CA  1 
ATOM   4227 C C   . SER B 1 143 ? 9.361   26.745 14.865  1.00 24.99 ?  143  SER B C   1 
ATOM   4228 O O   . SER B 1 143 ? 9.134   27.036 13.707  1.00 25.69 ?  143  SER B O   1 
ATOM   4229 C CB  . SER B 1 143 ? 7.570   25.505 16.128  1.00 26.38 ?  143  SER B CB  1 
ATOM   4230 O OG  . SER B 1 143 ? 7.615   26.580 17.049  1.00 31.90 ?  143  SER B OG  1 
ATOM   4231 N N   . GLY B 1 144 ? 9.972   27.556 15.717  1.00 24.66 ?  144  GLY B N   1 
ATOM   4232 C CA  . GLY B 1 144 ? 10.506  28.864 15.335  1.00 23.87 ?  144  GLY B CA  1 
ATOM   4233 C C   . GLY B 1 144 ? 11.540  28.883 14.232  1.00 23.78 ?  144  GLY B C   1 
ATOM   4234 O O   . GLY B 1 144 ? 11.563  29.852 13.488  1.00 23.89 ?  144  GLY B O   1 
ATOM   4235 N N   . THR B 1 145 ? 12.415  27.858 14.120  1.00 22.54 ?  145  THR B N   1 
ATOM   4236 C CA  . THR B 1 145 ? 13.314  27.839 12.950  1.00 22.05 ?  145  THR B CA  1 
ATOM   4237 C C   . THR B 1 145 ? 12.622  27.401 11.664  1.00 21.00 ?  145  THR B C   1 
ATOM   4238 O O   . THR B 1 145 ? 12.836  28.004 10.642  1.00 20.47 ?  145  THR B O   1 
ATOM   4239 C CB  . THR B 1 145 ? 14.716  27.188 13.118  1.00 22.82 ?  145  THR B CB  1 
ATOM   4240 O OG1 . THR B 1 145 ? 14.834  25.984 12.341  1.00 27.27 ?  145  THR B OG1 1 
ATOM   4241 C CG2 . THR B 1 145 ? 15.095  27.045 14.467  1.00 19.13 ?  145  THR B CG2 1 
ATOM   4242 N N   . LEU B 1 146 ? 11.715  26.432 11.764  1.00 20.36 ?  146  LEU B N   1 
ATOM   4243 C CA  . LEU B 1 146 ? 10.847  26.043 10.630  1.00 21.00 ?  146  LEU B CA  1 
ATOM   4244 C C   . LEU B 1 146 ? 10.025  27.206 10.073  1.00 20.70 ?  146  LEU B C   1 
ATOM   4245 O O   . LEU B 1 146 ? 9.890   27.368 8.855   1.00 20.90 ?  146  LEU B O   1 
ATOM   4246 C CB  . LEU B 1 146 ? 9.875   24.929 11.061  1.00 21.19 ?  146  LEU B CB  1 
ATOM   4247 C CG  . LEU B 1 146 ? 10.553  23.635 11.533  1.00 23.82 ?  146  LEU B CG  1 
ATOM   4248 C CD1 . LEU B 1 146 ? 9.527   22.528 11.814  1.00 23.30 ?  146  LEU B CD1 1 
ATOM   4249 C CD2 . LEU B 1 146 ? 11.580  23.183 10.475  1.00 20.49 ?  146  LEU B CD2 1 
ATOM   4250 N N   . GLN B 1 147 ? 9.478   28.014 10.979  1.00 20.53 ?  147  GLN B N   1 
ATOM   4251 C CA  . GLN B 1 147 ? 8.636   29.151 10.592  1.00 21.39 ?  147  GLN B CA  1 
ATOM   4252 C C   . GLN B 1 147 ? 9.475   30.237 9.931   1.00 20.27 ?  147  GLN B C   1 
ATOM   4253 O O   . GLN B 1 147 ? 8.997   30.959 9.074   1.00 21.88 ?  147  GLN B O   1 
ATOM   4254 C CB  . GLN B 1 147 ? 7.945   29.730 11.836  1.00 20.95 ?  147  GLN B CB  1 
ATOM   4255 C CG  . GLN B 1 147 ? 6.745   28.872 12.330  1.00 26.07 ?  147  GLN B CG  1 
ATOM   4256 C CD  . GLN B 1 147 ? 5.514   29.124 11.490  1.00 32.37 ?  147  GLN B CD  1 
ATOM   4257 O OE1 . GLN B 1 147 ? 5.134   28.312 10.613  1.00 32.51 ?  147  GLN B OE1 1 
ATOM   4258 N NE2 . GLN B 1 147 ? 4.872   30.275 11.740  1.00 34.96 ?  147  GLN B NE2 1 
ATOM   4259 N N   . SER B 1 148 ? 10.705  30.371 10.385  1.00 19.69 ?  148  SER B N   1 
ATOM   4260 C CA  . SER B 1 148 ? 11.677  31.306 9.811   1.00 20.69 ?  148  SER B CA  1 
ATOM   4261 C C   . SER B 1 148 ? 12.182  30.852 8.419   1.00 19.69 ?  148  SER B C   1 
ATOM   4262 O O   . SER B 1 148 ? 12.411  31.670 7.501   1.00 19.60 ?  148  SER B O   1 
ATOM   4263 C CB  . SER B 1 148 ? 12.819  31.465 10.831  1.00 20.87 ?  148  SER B CB  1 
ATOM   4264 O OG  . SER B 1 148 ? 13.706  32.495 10.448  1.00 28.85 ?  148  SER B OG  1 
ATOM   4265 N N   . LEU B 1 149 ? 12.331  29.543 8.235   1.00 19.31 ?  149  LEU B N   1 
ATOM   4266 C CA  . LEU B 1 149 ? 12.915  29.023 6.977   1.00 19.09 ?  149  LEU B CA  1 
ATOM   4267 C C   . LEU B 1 149 ? 11.921  28.965 5.843   1.00 19.12 ?  149  LEU B C   1 
ATOM   4268 O O   . LEU B 1 149 ? 12.284  29.117 4.674   1.00 18.57 ?  149  LEU B O   1 
ATOM   4269 C CB  . LEU B 1 149 ? 13.510  27.617 7.213   1.00 18.49 ?  149  LEU B CB  1 
ATOM   4270 C CG  . LEU B 1 149 ? 14.791  27.602 8.069   1.00 18.70 ?  149  LEU B CG  1 
ATOM   4271 C CD1 . LEU B 1 149 ? 15.239  26.161 8.334   1.00 21.87 ?  149  LEU B CD1 1 
ATOM   4272 C CD2 . LEU B 1 149 ? 15.946  28.344 7.337   1.00 12.48 ?  149  LEU B CD2 1 
ATOM   4273 N N   . HIS B 1 150 ? 10.658  28.691 6.186   1.00 20.41 ?  150  HIS B N   1 
ATOM   4274 C CA  . HIS B 1 150 ? 9.587   28.464 5.178   1.00 21.01 ?  150  HIS B CA  1 
ATOM   4275 C C   . HIS B 1 150 ? 9.451   29.626 4.187   1.00 20.54 ?  150  HIS B C   1 
ATOM   4276 O O   . HIS B 1 150 ? 9.478   29.419 2.959   1.00 21.70 ?  150  HIS B O   1 
ATOM   4277 C CB  . HIS B 1 150 ? 8.230   28.135 5.868   1.00 22.48 ?  150  HIS B CB  1 
ATOM   4278 C CG  . HIS B 1 150 ? 7.081   28.062 4.900   1.00 27.14 ?  150  HIS B CG  1 
ATOM   4279 N ND1 . HIS B 1 150 ? 6.223   29.124 4.679   1.00 34.26 ?  150  HIS B ND1 1 
ATOM   4280 C CD2 . HIS B 1 150 ? 6.689   27.079 4.052   1.00 29.36 ?  150  HIS B CD2 1 
ATOM   4281 C CE1 . HIS B 1 150 ? 5.340   28.788 3.749   1.00 34.76 ?  150  HIS B CE1 1 
ATOM   4282 N NE2 . HIS B 1 150 ? 5.607   27.554 3.349   1.00 33.63 ?  150  HIS B NE2 1 
ATOM   4283 N N   . PRO B 1 151 ? 9.343   30.879 4.686   1.00 19.61 ?  151  PRO B N   1 
ATOM   4284 C CA  . PRO B 1 151 ? 9.234   31.991 3.771   1.00 19.86 ?  151  PRO B CA  1 
ATOM   4285 C C   . PRO B 1 151 ? 10.487  32.300 2.922   1.00 19.47 ?  151  PRO B C   1 
ATOM   4286 O O   . PRO B 1 151 ? 10.400  33.077 1.978   1.00 19.00 ?  151  PRO B O   1 
ATOM   4287 C CB  . PRO B 1 151 ? 8.964   33.190 4.704   1.00 19.04 ?  151  PRO B CB  1 
ATOM   4288 C CG  . PRO B 1 151 ? 8.589   32.619 5.953   1.00 20.04 ?  151  PRO B CG  1 
ATOM   4289 C CD  . PRO B 1 151 ? 9.298   31.347 6.074   1.00 20.15 ?  151  PRO B CD  1 
ATOM   4290 N N   . LEU B 1 152 ? 11.640  31.740 3.263   1.00 19.90 ?  152  LEU B N   1 
ATOM   4291 C CA  . LEU B 1 152 ? 12.839  31.993 2.474   1.00 19.38 ?  152  LEU B CA  1 
ATOM   4292 C C   . LEU B 1 152 ? 12.946  31.122 1.212   1.00 20.32 ?  152  LEU B C   1 
ATOM   4293 O O   . LEU B 1 152 ? 13.837  31.333 0.378   1.00 19.61 ?  152  LEU B O   1 
ATOM   4294 C CB  . LEU B 1 152 ? 14.088  31.873 3.374   1.00 20.61 ?  152  LEU B CB  1 
ATOM   4295 C CG  . LEU B 1 152 ? 14.152  32.828 4.585   1.00 19.62 ?  152  LEU B CG  1 
ATOM   4296 C CD1 . LEU B 1 152 ? 15.354  32.505 5.402   1.00 19.81 ?  152  LEU B CD1 1 
ATOM   4297 C CD2 . LEU B 1 152 ? 14.211  34.301 4.163   1.00 23.47 ?  152  LEU B CD2 1 
ATOM   4298 N N   . GLY B 1 153 ? 12.054  30.138 1.094   1.00 20.94 ?  153  GLY B N   1 
ATOM   4299 C CA  . GLY B 1 153 ? 11.920  29.310 -0.106  1.00 22.82 ?  153  GLY B CA  1 
ATOM   4300 C C   . GLY B 1 153 ? 13.055  28.332 -0.325  1.00 23.63 ?  153  GLY B C   1 
ATOM   4301 O O   . GLY B 1 153 ? 13.352  27.958 -1.441  1.00 24.04 ?  153  GLY B O   1 
ATOM   4302 N N   . CYS B 1 154 ? 13.710  27.925 0.745   1.00 25.11 ?  154  CYS B N   1 
ATOM   4303 C CA  . CYS B 1 154 ? 14.751  26.929 0.604   1.00 25.75 ?  154  CYS B CA  1 
ATOM   4304 C C   . CYS B 1 154 ? 14.104  25.545 0.568   1.00 25.38 ?  154  CYS B C   1 
ATOM   4305 O O   . CYS B 1 154 ? 12.926  25.396 0.972   1.00 25.22 ?  154  CYS B O   1 
ATOM   4306 C CB  . CYS B 1 154 ? 15.750  27.041 1.741   1.00 24.66 ?  154  CYS B CB  1 
ATOM   4307 S SG  . CYS B 1 154 ? 15.008  26.999 3.353   1.00 29.73 ?  154  CYS B SG  1 
ATOM   4308 N N   . ASN B 1 155 ? 14.840  24.555 0.037   1.00 23.92 ?  155  ASN B N   1 
ATOM   4309 C CA  . ASN B 1 155 ? 14.495  23.150 0.238   1.00 23.11 ?  155  ASN B CA  1 
ATOM   4310 C C   . ASN B 1 155 ? 15.111  22.624 1.496   1.00 22.44 ?  155  ASN B C   1 
ATOM   4311 O O   . ASN B 1 155 ? 16.328  22.595 1.621   1.00 21.77 ?  155  ASN B O   1 
ATOM   4312 C CB  . ASN B 1 155 ? 15.001  22.291 -0.919  1.00 24.28 ?  155  ASN B CB  1 
ATOM   4313 C CG  . ASN B 1 155 ? 14.417  22.711 -2.232  1.00 24.11 ?  155  ASN B CG  1 
ATOM   4314 O OD1 . ASN B 1 155 ? 13.197  22.640 -2.433  1.00 28.63 ?  155  ASN B OD1 1 
ATOM   4315 N ND2 . ASN B 1 155 ? 15.260  23.157 -3.135  1.00 23.82 ?  155  ASN B ND2 1 
ATOM   4316 N N   . ILE B 1 156 ? 14.265  22.195 2.418   1.00 21.71 ?  156  ILE B N   1 
ATOM   4317 C CA  . ILE B 1 156 ? 14.699  21.620 3.654   1.00 21.61 ?  156  ILE B CA  1 
ATOM   4318 C C   . ILE B 1 156 ? 14.855  20.106 3.451   1.00 22.16 ?  156  ILE B C   1 
ATOM   4319 O O   . ILE B 1 156 ? 13.885  19.414 3.113   1.00 20.70 ?  156  ILE B O   1 
ATOM   4320 C CB  . ILE B 1 156 ? 13.687  21.932 4.775   1.00 21.73 ?  156  ILE B CB  1 
ATOM   4321 C CG1 . ILE B 1 156 ? 13.677  23.448 5.063   1.00 23.44 ?  156  ILE B CG1 1 
ATOM   4322 C CG2 . ILE B 1 156 ? 14.034  21.205 6.043   1.00 22.18 ?  156  ILE B CG2 1 
ATOM   4323 C CD1 . ILE B 1 156 ? 12.807  23.855 6.352   1.00 21.62 ?  156  ILE B CD1 1 
ATOM   4324 N N   . ILE B 1 157 ? 16.080  19.596 3.615   1.00 20.93 ?  157  ILE B N   1 
ATOM   4325 C CA  . ILE B 1 157 ? 16.284  18.165 3.452   1.00 21.36 ?  157  ILE B CA  1 
ATOM   4326 C C   . ILE B 1 157 ? 16.384  17.596 4.860   1.00 22.04 ?  157  ILE B C   1 
ATOM   4327 O O   . ILE B 1 157 ? 17.221  18.015 5.665   1.00 21.30 ?  157  ILE B O   1 
ATOM   4328 C CB  . ILE B 1 157 ? 17.531  17.826 2.592   1.00 21.36 ?  157  ILE B CB  1 
ATOM   4329 C CG1 . ILE B 1 157 ? 17.463  18.554 1.250   1.00 21.00 ?  157  ILE B CG1 1 
ATOM   4330 C CG2 . ILE B 1 157 ? 17.655  16.286 2.353   1.00 21.41 ?  157  ILE B CG2 1 
ATOM   4331 C CD1 . ILE B 1 157 ? 18.814  18.666 0.580   1.00 24.43 ?  157  ILE B CD1 1 
ATOM   4332 N N   . ASN B 1 158 ? 15.484  16.675 5.172   1.00 22.77 ?  158  ASN B N   1 
ATOM   4333 C CA  . ASN B 1 158 ? 15.416  16.121 6.500   1.00 24.30 ?  158  ASN B CA  1 
ATOM   4334 C C   . ASN B 1 158 ? 16.480  15.022 6.642   1.00 24.64 ?  158  ASN B C   1 
ATOM   4335 O O   . ASN B 1 158 ? 16.588  14.160 5.784   1.00 24.51 ?  158  ASN B O   1 
ATOM   4336 C CB  . ASN B 1 158 ? 14.031  15.520 6.747   1.00 25.42 ?  158  ASN B CB  1 
ATOM   4337 C CG  . ASN B 1 158 ? 13.935  14.855 8.101   1.00 28.48 ?  158  ASN B CG  1 
ATOM   4338 O OD1 . ASN B 1 158 ? 14.407  15.391 9.110   1.00 29.32 ?  158  ASN B OD1 1 
ATOM   4339 N ND2 . ASN B 1 158 ? 13.387  13.646 8.125   1.00 34.14 ?  158  ASN B ND2 1 
ATOM   4340 N N   . VAL B 1 159 ? 17.252  15.065 7.719   1.00 24.51 ?  159  VAL B N   1 
ATOM   4341 C CA  . VAL B 1 159 ? 18.292  14.085 7.985   1.00 24.75 ?  159  VAL B CA  1 
ATOM   4342 C C   . VAL B 1 159 ? 17.768  13.264 9.152   1.00 26.70 ?  159  VAL B C   1 
ATOM   4343 O O   . VAL B 1 159 ? 17.236  13.828 10.119  1.00 26.93 ?  159  VAL B O   1 
ATOM   4344 C CB  . VAL B 1 159 ? 19.623  14.766 8.426   1.00 25.15 ?  159  VAL B CB  1 
ATOM   4345 C CG1 . VAL B 1 159 ? 20.714  13.734 8.749   1.00 23.36 ?  159  VAL B CG1 1 
ATOM   4346 C CG2 . VAL B 1 159 ? 20.090  15.833 7.394   1.00 23.59 ?  159  VAL B CG2 1 
ATOM   4347 N N   . ALA B 1 160 ? 17.958  11.949 9.103   1.00 27.27 ?  160  ALA B N   1 
ATOM   4348 C CA  . ALA B 1 160 ? 17.399  11.065 10.126  1.00 28.73 ?  160  ALA B CA  1 
ATOM   4349 C C   . ALA B 1 160 ? 18.102  11.196 11.473  1.00 29.56 ?  160  ALA B C   1 
ATOM   4350 O O   . ALA B 1 160 ? 19.285  11.545 11.542  1.00 29.40 ?  160  ALA B O   1 
ATOM   4351 C CB  . ALA B 1 160 ? 17.400  9.574  9.616   1.00 28.32 ?  160  ALA B CB  1 
ATOM   4352 N N   . SER B 1 161 ? 17.366  10.930 12.551  1.00 30.80 ?  161  SER B N   1 
ATOM   4353 C CA  . SER B 1 161 ? 17.888  11.067 13.903  1.00 32.71 ?  161  SER B CA  1 
ATOM   4354 C C   . SER B 1 161 ? 17.316  9.990  14.808  1.00 34.18 ?  161  SER B C   1 
ATOM   4355 O O   . SER B 1 161 ? 16.315  9.363  14.461  1.00 33.83 ?  161  SER B O   1 
ATOM   4356 C CB  . SER B 1 161 ? 17.613  12.470 14.493  1.00 33.32 ?  161  SER B CB  1 
ATOM   4357 O OG  . SER B 1 161 ? 16.228  12.800 14.558  1.00 33.54 ?  161  SER B OG  1 
ATOM   4358 N N   . ASP B 1 162 ? 17.941  9.806  15.972  1.00 35.55 ?  162  ASP B N   1 
ATOM   4359 C CA  . ASP B 1 162 ? 17.451  8.892  17.017  1.00 36.94 ?  162  ASP B CA  1 
ATOM   4360 C C   . ASP B 1 162 ? 17.710  9.505  18.382  1.00 37.38 ?  162  ASP B C   1 
ATOM   4361 O O   . ASP B 1 162 ? 17.798  10.723 18.490  1.00 36.91 ?  162  ASP B O   1 
ATOM   4362 C CB  . ASP B 1 162 ? 18.118  7.514  16.908  1.00 37.54 ?  162  ASP B CB  1 
ATOM   4363 C CG  . ASP B 1 162 ? 19.663  7.577  16.923  1.00 39.11 ?  162  ASP B CG  1 
ATOM   4364 O OD1 . ASP B 1 162 ? 20.237  8.580  17.402  1.00 39.77 ?  162  ASP B OD1 1 
ATOM   4365 O OD2 . ASP B 1 162 ? 20.300  6.593  16.470  1.00 37.25 ?  162  ASP B OD2 1 
ATOM   4366 N N   . GLU B 1 163 ? 17.867  8.671  19.414  1.00 37.09 ?  163  GLU B N   1 
ATOM   4367 C CA  . GLU B 1 163 ? 18.067  9.173  20.777  1.00 37.32 ?  163  GLU B CA  1 
ATOM   4368 C C   . GLU B 1 163 ? 19.444  9.786  20.970  1.00 36.45 ?  163  GLU B C   1 
ATOM   4369 O O   . GLU B 1 163 ? 19.747  10.313 22.044  1.00 37.07 ?  163  GLU B O   1 
ATOM   4370 C CB  . GLU B 1 163 ? 17.878  8.072  21.838  1.00 38.04 ?  163  GLU B CB  1 
ATOM   4371 C CG  . GLU B 1 163 ? 17.202  6.802  21.374  1.00 42.36 ?  163  GLU B CG  1 
ATOM   4372 C CD  . GLU B 1 163 ? 18.166  5.802  20.744  1.00 48.74 ?  163  GLU B CD  1 
ATOM   4373 O OE1 . GLU B 1 163 ? 17.941  5.463  19.556  1.00 50.98 ?  163  GLU B OE1 1 
ATOM   4374 O OE2 . GLU B 1 163 ? 19.135  5.354  21.427  1.00 50.73 ?  163  GLU B OE2 1 
ATOM   4375 N N   . SER B 1 164 ? 20.291  9.689  19.959  1.00 35.42 ?  164  SER B N   1 
ATOM   4376 C CA  . SER B 1 164 ? 21.634  10.246 20.040  1.00 35.30 ?  164  SER B CA  1 
ATOM   4377 C C   . SER B 1 164 ? 21.806  11.317 18.969  1.00 34.11 ?  164  SER B C   1 
ATOM   4378 O O   . SER B 1 164 ? 22.917  11.721 18.637  1.00 33.41 ?  164  SER B O   1 
ATOM   4379 C CB  . SER B 1 164 ? 22.675  9.139  19.903  1.00 35.55 ?  164  SER B CB  1 
ATOM   4380 O OG  . SER B 1 164 ? 22.650  8.281  21.041  1.00 37.48 ?  164  SER B OG  1 
ATOM   4381 N N   . GLY B 1 165 ? 20.671  11.766 18.440  1.00 33.65 ?  165  GLY B N   1 
ATOM   4382 C CA  . GLY B 1 165 ? 20.629  12.891 17.533  1.00 32.97 ?  165  GLY B CA  1 
ATOM   4383 C C   . GLY B 1 165 ? 20.741  12.425 16.100  1.00 33.09 ?  165  GLY B C   1 
ATOM   4384 O O   . GLY B 1 165 ? 20.391  11.277 15.770  1.00 32.69 ?  165  GLY B O   1 
ATOM   4385 N N   . ILE B 1 166 ? 21.249  13.328 15.258  1.00 31.49 ?  166  ILE B N   1 
ATOM   4386 C CA  . ILE B 1 166 ? 21.399  13.096 13.838  1.00 30.37 ?  166  ILE B CA  1 
ATOM   4387 C C   . ILE B 1 166 ? 22.221  11.823 13.636  1.00 29.36 ?  166  ILE B C   1 
ATOM   4388 O O   . ILE B 1 166 ? 23.206  11.607 14.322  1.00 29.36 ?  166  ILE B O   1 
ATOM   4389 C CB  . ILE B 1 166 ? 22.093  14.322 13.203  1.00 29.90 ?  166  ILE B CB  1 
ATOM   4390 C CG1 . ILE B 1 166 ? 21.055  15.398 12.855  1.00 32.46 ?  166  ILE B CG1 1 
ATOM   4391 C CG2 . ILE B 1 166 ? 22.961  13.967 11.990  1.00 29.33 ?  166  ILE B CG2 1 
ATOM   4392 C CD1 . ILE B 1 166 ? 21.673  16.716 12.456  1.00 31.30 ?  166  ILE B CD1 1 
ATOM   4393 N N   . VAL B 1 167 ? 21.816  10.993 12.685  1.00 29.43 ?  167  VAL B N   1 
ATOM   4394 C CA  . VAL B 1 167 ? 22.578  9.802  12.342  1.00 28.47 ?  167  VAL B CA  1 
ATOM   4395 C C   . VAL B 1 167 ? 23.496  10.137 11.175  1.00 28.39 ?  167  VAL B C   1 
ATOM   4396 O O   . VAL B 1 167 ? 23.033  10.446 10.092  1.00 29.04 ?  167  VAL B O   1 
ATOM   4397 C CB  . VAL B 1 167 ? 21.657  8.590  12.015  1.00 28.61 ?  167  VAL B CB  1 
ATOM   4398 C CG1 . VAL B 1 167 ? 22.499  7.289  11.854  1.00 28.94 ?  167  VAL B CG1 1 
ATOM   4399 C CG2 . VAL B 1 167 ? 20.617  8.399  13.115  1.00 25.95 ?  167  VAL B CG2 1 
ATOM   4400 N N   . PRO B 1 168 ? 24.812  10.103 11.398  1.00 28.67 ?  168  PRO B N   1 
ATOM   4401 C CA  . PRO B 1 168 ? 25.752  10.498 10.337  1.00 28.58 ?  168  PRO B CA  1 
ATOM   4402 C C   . PRO B 1 168 ? 25.564  9.738  9.030   1.00 28.98 ?  168  PRO B C   1 
ATOM   4403 O O   . PRO B 1 168 ? 25.631  10.341 7.942   1.00 29.21 ?  168  PRO B O   1 
ATOM   4404 C CB  . PRO B 1 168 ? 27.119  10.226 10.972  1.00 28.63 ?  168  PRO B CB  1 
ATOM   4405 C CG  . PRO B 1 168 ? 26.892  10.372 12.410  1.00 26.91 ?  168  PRO B CG  1 
ATOM   4406 C CD  . PRO B 1 168 ? 25.525  9.758  12.640  1.00 28.76 ?  168  PRO B CD  1 
ATOM   4407 N N   . ASP B 1 169 ? 25.265  8.444  9.122   1.00 29.39 ?  169  ASP B N   1 
ATOM   4408 C CA  . ASP B 1 169 ? 25.073  7.628  7.937   1.00 29.80 ?  169  ASP B CA  1 
ATOM   4409 C C   . ASP B 1 169 ? 23.940  8.118  7.046   1.00 28.35 ?  169  ASP B C   1 
ATOM   4410 O O   . ASP B 1 169 ? 24.058  8.084  5.813   1.00 28.50 ?  169  ASP B O   1 
ATOM   4411 C CB  . ASP B 1 169 ? 24.893  6.133  8.302   1.00 31.99 ?  169  ASP B CB  1 
ATOM   4412 C CG  . ASP B 1 169 ? 25.294  5.187  7.117   1.00 36.29 ?  169  ASP B CG  1 
ATOM   4413 O OD1 . ASP B 1 169 ? 26.247  5.513  6.346   1.00 38.31 ?  169  ASP B OD1 1 
ATOM   4414 O OD2 . ASP B 1 169 ? 24.627  4.146  6.954   1.00 43.41 ?  169  ASP B OD2 1 
ATOM   4415 N N   . SER B 1 170 ? 22.847  8.575  7.654   1.00 26.84 ?  170  SER B N   1 
ATOM   4416 C CA  . SER B 1 170 ? 21.780  9.273  6.890   1.00 25.83 ?  170  SER B CA  1 
ATOM   4417 C C   . SER B 1 170 ? 22.284  10.558 6.212   1.00 24.27 ?  170  SER B C   1 
ATOM   4418 O O   . SER B 1 170 ? 21.939  10.869 5.067   1.00 23.63 ?  170  SER B O   1 
ATOM   4419 C CB  . SER B 1 170 ? 20.641  9.659  7.838   1.00 26.80 ?  170  SER B CB  1 
ATOM   4420 O OG  . SER B 1 170 ? 19.773  10.592 7.213   1.00 29.87 ?  170  SER B OG  1 
ATOM   4421 N N   . LEU B 1 171 ? 23.054  11.347 6.957   1.00 22.82 ?  171  LEU B N   1 
ATOM   4422 C CA  . LEU B 1 171 ? 23.716  12.520 6.399   1.00 22.19 ?  171  LEU B CA  1 
ATOM   4423 C C   . LEU B 1 171 ? 24.631  12.142 5.216   1.00 21.09 ?  171  LEU B C   1 
ATOM   4424 O O   . LEU B 1 171 ? 24.565  12.743 4.132   1.00 21.52 ?  171  LEU B O   1 
ATOM   4425 C CB  . LEU B 1 171 ? 24.487  13.249 7.512   1.00 21.70 ?  171  LEU B CB  1 
ATOM   4426 C CG  . LEU B 1 171 ? 25.140  14.594 7.142   1.00 23.42 ?  171  LEU B CG  1 
ATOM   4427 C CD1 . LEU B 1 171 ? 24.140  15.522 6.405   1.00 22.95 ?  171  LEU B CD1 1 
ATOM   4428 C CD2 . LEU B 1 171 ? 25.752  15.299 8.398   1.00 22.93 ?  171  LEU B CD2 1 
ATOM   4429 N N   . ARG B 1 172 ? 25.432  11.105 5.393   1.00 21.94 ?  172  ARG B N   1 
ATOM   4430 C CA  . ARG B 1 172 ? 26.305  10.610 4.323   1.00 23.50 ?  172  ARG B CA  1 
ATOM   4431 C C   . ARG B 1 172 ? 25.533  10.238 3.069   1.00 22.65 ?  172  ARG B C   1 
ATOM   4432 O O   . ARG B 1 172 ? 25.969  10.554 1.968   1.00 21.63 ?  172  ARG B O   1 
ATOM   4433 C CB  . ARG B 1 172 ? 27.054  9.346  4.766   1.00 24.73 ?  172  ARG B CB  1 
ATOM   4434 C CG  . ARG B 1 172 ? 28.178  9.614  5.694   1.00 31.10 ?  172  ARG B CG  1 
ATOM   4435 C CD  . ARG B 1 172 ? 29.133  8.386  5.907   1.00 35.00 ?  172  ARG B CD  1 
ATOM   4436 N NE  . ARG B 1 172 ? 29.938  8.675  7.089   1.00 36.79 ?  172  ARG B NE  1 
ATOM   4437 C CZ  . ARG B 1 172 ? 29.581  8.372  8.335   1.00 39.35 ?  172  ARG B CZ  1 
ATOM   4438 N NH1 . ARG B 1 172 ? 28.446  7.708  8.571   1.00 39.71 ?  172  ARG B NH1 1 
ATOM   4439 N NH2 . ARG B 1 172 ? 30.378  8.712  9.352   1.00 38.99 ?  172  ARG B NH2 1 
ATOM   4440 N N   . ASP B 1 173 ? 24.410  9.528  3.240   1.00 22.90 ?  173  ASP B N   1 
ATOM   4441 C CA  . ASP B 1 173 ? 23.557  9.159  2.098   1.00 22.74 ?  173  ASP B CA  1 
ATOM   4442 C C   . ASP B 1 173 ? 22.987  10.348 1.372   1.00 22.21 ?  173  ASP B C   1 
ATOM   4443 O O   . ASP B 1 173 ? 23.014  10.385 0.138   1.00 22.63 ?  173  ASP B O   1 
ATOM   4444 C CB  . ASP B 1 173 ? 22.404  8.273  2.512   1.00 23.66 ?  173  ASP B CB  1 
ATOM   4445 C CG  . ASP B 1 173 ? 22.853  6.861  2.867   1.00 27.96 ?  173  ASP B CG  1 
ATOM   4446 O OD1 . ASP B 1 173 ? 24.031  6.502  2.575   1.00 33.37 ?  173  ASP B OD1 1 
ATOM   4447 O OD2 . ASP B 1 173 ? 22.029  6.116  3.454   1.00 28.19 ?  173  ASP B OD2 1 
ATOM   4448 N N   . ILE B 1 174 ? 22.443  11.310 2.119   1.00 20.93 ?  174  ILE B N   1 
ATOM   4449 C CA  . ILE B 1 174 ? 21.901  12.503 1.496   1.00 20.20 ?  174  ILE B CA  1 
ATOM   4450 C C   . ILE B 1 174 ? 22.988  13.214 0.680   1.00 18.97 ?  174  ILE B C   1 
ATOM   4451 O O   . ILE B 1 174 ? 22.783  13.613 -0.468  1.00 18.66 ?  174  ILE B O   1 
ATOM   4452 C CB  . ILE B 1 174 ? 21.319  13.497 2.567   1.00 19.92 ?  174  ILE B CB  1 
ATOM   4453 C CG1 . ILE B 1 174 ? 19.990  12.943 3.119   1.00 20.84 ?  174  ILE B CG1 1 
ATOM   4454 C CG2 . ILE B 1 174 ? 21.147  14.919 1.970   1.00 19.60 ?  174  ILE B CG2 1 
ATOM   4455 C CD1 . ILE B 1 174 ? 19.825  13.170 4.594   1.00 23.53 ?  174  ILE B CD1 1 
ATOM   4456 N N   . LEU B 1 175 ? 24.156  13.351 1.268   1.00 18.81 ?  175  LEU B N   1 
ATOM   4457 C CA  . LEU B 1 175 ? 25.201  14.141 0.619   1.00 19.76 ?  175  LEU B CA  1 
ATOM   4458 C C   . LEU B 1 175 ? 25.769  13.448 -0.630  1.00 21.27 ?  175  LEU B C   1 
ATOM   4459 O O   . LEU B 1 175 ? 26.292  14.133 -1.528  1.00 21.97 ?  175  LEU B O   1 
ATOM   4460 C CB  . LEU B 1 175 ? 26.295  14.486 1.635   1.00 19.82 ?  175  LEU B CB  1 
ATOM   4461 C CG  . LEU B 1 175 ? 25.854  15.442 2.752   1.00 19.28 ?  175  LEU B CG  1 
ATOM   4462 C CD1 . LEU B 1 175 ? 26.846  15.354 3.924   1.00 14.43 ?  175  LEU B CD1 1 
ATOM   4463 C CD2 . LEU B 1 175 ? 25.723  16.903 2.237   1.00 17.94 ?  175  LEU B CD2 1 
ATOM   4464 N N   . SER B 1 176 ? 25.597  12.113 -0.707  1.00 22.31 ?  176  SER B N   1 
ATOM   4465 C CA  . SER B 1 176 ? 25.932  11.310 -1.905  1.00 23.18 ?  176  SER B CA  1 
ATOM   4466 C C   . SER B 1 176 ? 25.306  11.748 -3.225  1.00 23.41 ?  176  SER B C   1 
ATOM   4467 O O   . SER B 1 176 ? 25.851  11.431 -4.302  1.00 24.18 ?  176  SER B O   1 
ATOM   4468 C CB  . SER B 1 176 ? 25.664  9.827  -1.678  1.00 23.81 ?  176  SER B CB  1 
ATOM   4469 O OG  . SER B 1 176 ? 24.266  9.555  -1.769  1.00 26.35 ?  176  SER B OG  1 
ATOM   4470 N N   . ARG B 1 177 ? 24.224  12.532 -3.183  1.00 23.11 ?  177  ARG B N   1 
ATOM   4471 C CA  . ARG B 1 177 ? 23.699  13.090 -4.415  1.00 22.50 ?  177  ARG B CA  1 
ATOM   4472 C C   . ARG B 1 177 ? 24.632  14.143 -5.044  1.00 23.18 ?  177  ARG B C   1 
ATOM   4473 O O   . ARG B 1 177 ? 24.461  14.502 -6.202  1.00 22.88 ?  177  ARG B O   1 
ATOM   4474 C CB  . ARG B 1 177 ? 22.284  13.611 -4.227  1.00 23.02 ?  177  ARG B CB  1 
ATOM   4475 C CG  . ARG B 1 177 ? 22.147  14.886 -3.414  1.00 26.16 ?  177  ARG B CG  1 
ATOM   4476 C CD  . ARG B 1 177 ? 20.645  15.148 -3.048  1.00 28.75 ?  177  ARG B CD  1 
ATOM   4477 N NE  . ARG B 1 177 ? 20.100  14.129 -2.154  1.00 27.84 ?  177  ARG B NE  1 
ATOM   4478 C CZ  . ARG B 1 177 ? 18.905  14.200 -1.559  1.00 30.45 ?  177  ARG B CZ  1 
ATOM   4479 N NH1 . ARG B 1 177 ? 18.113  15.248 -1.769  1.00 29.46 ?  177  ARG B NH1 1 
ATOM   4480 N NH2 . ARG B 1 177 ? 18.495  13.219 -0.750  1.00 28.17 ?  177  ARG B NH2 1 
ATOM   4481 N N   . TRP B 1 178 ? 25.640  14.619 -4.305  1.00 22.67 ?  178  TRP B N   1 
ATOM   4482 C CA  . TRP B 1 178 ? 26.631  15.514 -4.922  1.00 23.04 ?  178  TRP B CA  1 
ATOM   4483 C C   . TRP B 1 178 ? 28.006  14.880 -4.831  1.00 22.14 ?  178  TRP B C   1 
ATOM   4484 O O   . TRP B 1 178 ? 28.184  13.927 -4.096  1.00 22.39 ?  178  TRP B O   1 
ATOM   4485 C CB  . TRP B 1 178 ? 26.672  16.846 -4.175  1.00 23.76 ?  178  TRP B CB  1 
ATOM   4486 C CG  . TRP B 1 178 ? 25.475  17.081 -3.337  1.00 26.81 ?  178  TRP B CG  1 
ATOM   4487 C CD1 . TRP B 1 178 ? 25.265  16.636 -2.038  1.00 30.14 ?  178  TRP B CD1 1 
ATOM   4488 C CD2 . TRP B 1 178 ? 24.351  17.829 -3.676  1.00 23.86 ?  178  TRP B CD2 1 
ATOM   4489 N NE1 . TRP B 1 178 ? 24.052  17.048 -1.576  1.00 28.88 ?  178  TRP B NE1 1 
ATOM   4490 C CE2 . TRP B 1 178 ? 23.466  17.789 -2.561  1.00 28.70 ?  178  TRP B CE2 1 
ATOM   4491 C CE3 . TRP B 1 178 ? 23.983  18.525 -4.812  1.00 25.69 ?  178  TRP B CE3 1 
ATOM   4492 C CZ2 . TRP B 1 178 ? 22.256  18.418 -2.559  1.00 25.10 ?  178  TRP B CZ2 1 
ATOM   4493 C CZ3 . TRP B 1 178 ? 22.812  19.138 -4.811  1.00 27.91 ?  178  TRP B CZ3 1 
ATOM   4494 C CH2 . TRP B 1 178 ? 21.942  19.086 -3.695  1.00 28.24 ?  178  TRP B CH2 1 
ATOM   4495 N N   . LYS B 1 179 ? 28.958  15.427 -5.559  1.00 22.38 ?  179  LYS B N   1 
ATOM   4496 C CA  . LYS B 1 179 ? 30.370  15.125 -5.356  1.00 23.94 ?  179  LYS B CA  1 
ATOM   4497 C C   . LYS B 1 179 ? 30.972  16.182 -4.417  1.00 23.02 ?  179  LYS B C   1 
ATOM   4498 O O   . LYS B 1 179 ? 30.566  17.346 -4.458  1.00 21.60 ?  179  LYS B O   1 
ATOM   4499 C CB  . LYS B 1 179 ? 31.105  15.076 -6.708  1.00 24.94 ?  179  LYS B CB  1 
ATOM   4500 C CG  . LYS B 1 179 ? 30.468  14.006 -7.662  1.00 29.49 ?  179  LYS B CG  1 
ATOM   4501 C CD  . LYS B 1 179 ? 31.220  13.857 -8.988  1.00 39.25 ?  179  LYS B CD  1 
ATOM   4502 C CE  . LYS B 1 179 ? 30.684  14.799 -10.097 1.00 42.70 ?  179  LYS B CE  1 
ATOM   4503 N NZ  . LYS B 1 179 ? 29.263  14.463 -10.525 1.00 43.52 ?  179  LYS B NZ  1 
ATOM   4504 N N   . PRO B 1 180 ? 31.937  15.779 -3.576  1.00 22.79 ?  180  PRO B N   1 
ATOM   4505 C CA  . PRO B 1 180 ? 32.639  16.730 -2.683  1.00 23.05 ?  180  PRO B CA  1 
ATOM   4506 C C   . PRO B 1 180 ? 33.111  17.978 -3.441  1.00 23.43 ?  180  PRO B C   1 
ATOM   4507 O O   . PRO B 1 180 ? 32.919  19.101 -2.975  1.00 24.35 ?  180  PRO B O   1 
ATOM   4508 C CB  . PRO B 1 180 ? 33.823  15.903 -2.145  1.00 22.90 ?  180  PRO B CB  1 
ATOM   4509 C CG  . PRO B 1 180 ? 33.328  14.461 -2.193  1.00 23.11 ?  180  PRO B CG  1 
ATOM   4510 C CD  . PRO B 1 180 ? 32.428  14.387 -3.418  1.00 23.32 ?  180  PRO B CD  1 
ATOM   4511 N N   . GLU B 1 181 ? 33.624  17.781 -4.647  1.00 23.19 ?  181  GLU B N   1 
ATOM   4512 C CA  . GLU B 1 181 ? 34.025  18.868 -5.541  1.00 24.21 ?  181  GLU B CA  1 
ATOM   4513 C C   . GLU B 1 181 ? 32.925  19.788 -6.091  1.00 22.70 ?  181  GLU B C   1 
ATOM   4514 O O   . GLU B 1 181 ? 33.241  20.785 -6.734  1.00 21.20 ?  181  GLU B O   1 
ATOM   4515 C CB  . GLU B 1 181 ? 34.720  18.268 -6.768  1.00 25.79 ?  181  GLU B CB  1 
ATOM   4516 C CG  . GLU B 1 181 ? 35.610  17.124 -6.453  1.00 32.32 ?  181  GLU B CG  1 
ATOM   4517 C CD  . GLU B 1 181 ? 34.887  15.817 -6.505  1.00 35.97 ?  181  GLU B CD  1 
ATOM   4518 O OE1 . GLU B 1 181 ? 35.013  15.037 -5.534  1.00 37.48 ?  181  GLU B OE1 1 
ATOM   4519 O OE2 . GLU B 1 181 ? 34.193  15.587 -7.519  1.00 43.92 ?  181  GLU B OE2 1 
ATOM   4520 N N   . ASP B 1 182 ? 31.651  19.424 -5.907  1.00 22.24 ?  182  ASP B N   1 
ATOM   4521 C CA  . ASP B 1 182 ? 30.549  20.313 -6.318  1.00 22.01 ?  182  ASP B CA  1 
ATOM   4522 C C   . ASP B 1 182 ? 30.423  21.562 -5.410  1.00 20.27 ?  182  ASP B C   1 
ATOM   4523 O O   . ASP B 1 182 ? 29.923  22.605 -5.831  1.00 19.94 ?  182  ASP B O   1 
ATOM   4524 C CB  . ASP B 1 182 ? 29.244  19.516 -6.396  1.00 22.02 ?  182  ASP B CB  1 
ATOM   4525 C CG  . ASP B 1 182 ? 29.222  18.533 -7.599  1.00 26.06 ?  182  ASP B CG  1 
ATOM   4526 O OD1 . ASP B 1 182 ? 30.073  18.677 -8.515  1.00 26.24 ?  182  ASP B OD1 1 
ATOM   4527 O OD2 . ASP B 1 182 ? 28.361  17.625 -7.622  1.00 27.86 ?  182  ASP B OD2 1 
ATOM   4528 N N   . ALA B 1 183 ? 30.921  21.453 -4.189  1.00 19.50 ?  183  ALA B N   1 
ATOM   4529 C CA  . ALA B 1 183 ? 30.747  22.518 -3.176  1.00 20.54 ?  183  ALA B CA  1 
ATOM   4530 C C   . ALA B 1 183 ? 31.188  23.890 -3.675  1.00 19.90 ?  183  ALA B C   1 
ATOM   4531 O O   . ALA B 1 183 ? 30.452  24.856 -3.549  1.00 19.74 ?  183  ALA B O   1 
ATOM   4532 C CB  . ALA B 1 183 ? 31.487  22.151 -1.897  1.00 20.90 ?  183  ALA B CB  1 
ATOM   4533 N N   . LYS B 1 184 ? 32.373  23.974 -4.287  1.00 20.73 ?  184  LYS B N   1 
ATOM   4534 C CA  . LYS B 1 184 ? 32.877  25.285 -4.751  1.00 21.39 ?  184  LYS B CA  1 
ATOM   4535 C C   . LYS B 1 184 ? 32.493  25.614 -6.178  1.00 21.31 ?  184  LYS B C   1 
ATOM   4536 O O   . LYS B 1 184 ? 32.767  26.696 -6.647  1.00 20.98 ?  184  LYS B O   1 
ATOM   4537 C CB  . LYS B 1 184 ? 34.389  25.397 -4.481  1.00 22.17 ?  184  LYS B CB  1 
ATOM   4538 C CG  . LYS B 1 184 ? 34.621  25.791 -3.031  1.00 23.00 ?  184  LYS B CG  1 
ATOM   4539 C CD  . LYS B 1 184 ? 35.737  25.038 -2.394  1.00 30.21 ?  184  LYS B CD  1 
ATOM   4540 C CE  . LYS B 1 184 ? 36.935  25.925 -2.281  1.00 30.57 ?  184  LYS B CE  1 
ATOM   4541 N NZ  . LYS B 1 184 ? 37.480  25.880 -0.918  1.00 30.50 ?  184  LYS B NZ  1 
ATOM   4542 N N   . ASN B 1 185 ? 31.850  24.663 -6.859  1.00 21.31 ?  185  ASN B N   1 
ATOM   4543 C CA  . ASN B 1 185 ? 31.254  24.917 -8.187  1.00 22.31 ?  185  ASN B CA  1 
ATOM   4544 C C   . ASN B 1 185 ? 29.934  25.732 -8.081  1.00 22.74 ?  185  ASN B C   1 
ATOM   4545 O O   . ASN B 1 185 ? 28.934  25.221 -7.582  1.00 22.78 ?  185  ASN B O   1 
ATOM   4546 C CB  . ASN B 1 185 ? 30.965  23.566 -8.865  1.00 21.83 ?  185  ASN B CB  1 
ATOM   4547 C CG  . ASN B 1 185 ? 30.556  23.717 -10.309 1.00 23.65 ?  185  ASN B CG  1 
ATOM   4548 O OD1 . ASN B 1 185 ? 30.616  22.751 -11.075 1.00 26.94 ?  185  ASN B OD1 1 
ATOM   4549 N ND2 . ASN B 1 185 ? 30.166  24.918 -10.701 1.00 17.92 ?  185  ASN B ND2 1 
ATOM   4550 N N   . PRO B 1 186 ? 29.934  27.000 -8.515  1.00 24.57 ?  186  PRO B N   1 
ATOM   4551 C CA  . PRO B 1 186 ? 28.721  27.777 -8.238  1.00 26.52 ?  186  PRO B CA  1 
ATOM   4552 C C   . PRO B 1 186 ? 27.528  27.349 -9.082  1.00 27.67 ?  186  PRO B C   1 
ATOM   4553 O O   . PRO B 1 186 ? 26.473  27.954 -8.975  1.00 28.40 ?  186  PRO B O   1 
ATOM   4554 C CB  . PRO B 1 186 ? 29.105  29.204 -8.643  1.00 26.14 ?  186  PRO B CB  1 
ATOM   4555 C CG  . PRO B 1 186 ? 30.153  29.020 -9.708  1.00 27.43 ?  186  PRO B CG  1 
ATOM   4556 C CD  . PRO B 1 186 ? 30.952  27.799 -9.226  1.00 23.39 ?  186  PRO B CD  1 
ATOM   4557 N N   . GLN B 1 187 ? 27.698  26.348 -9.929  1.00 29.24 ?  187  GLN B N   1 
ATOM   4558 C CA  . GLN B 1 187 ? 26.613  25.928 -10.807 1.00 30.00 ?  187  GLN B CA  1 
ATOM   4559 C C   . GLN B 1 187 ? 25.938  24.743 -10.162 1.00 28.89 ?  187  GLN B C   1 
ATOM   4560 O O   . GLN B 1 187 ? 24.941  24.270 -10.658 1.00 28.94 ?  187  GLN B O   1 
ATOM   4561 C CB  . GLN B 1 187 ? 27.142  25.540 -12.195 1.00 31.17 ?  187  GLN B CB  1 
ATOM   4562 C CG  . GLN B 1 187 ? 26.185  25.906 -13.362 1.00 37.57 ?  187  GLN B CG  1 
ATOM   4563 C CD  . GLN B 1 187 ? 25.220  24.769 -13.848 1.00 42.50 ?  187  GLN B CD  1 
ATOM   4564 O OE1 . GLN B 1 187 ? 25.262  23.622 -13.373 1.00 46.41 ?  187  GLN B OE1 1 
ATOM   4565 N NE2 . GLN B 1 187 ? 24.344  25.112 -14.812 1.00 44.59 ?  187  GLN B NE2 1 
ATOM   4566 N N   . LYS B 1 188 ? 26.506  24.230 -9.072  1.00 26.82 ?  188  LYS B N   1 
ATOM   4567 C CA  . LYS B 1 188 ? 25.925  23.074 -8.414  1.00 24.84 ?  188  LYS B CA  1 
ATOM   4568 C C   . LYS B 1 188 ? 25.273  23.548 -7.096  1.00 24.79 ?  188  LYS B C   1 
ATOM   4569 O O   . LYS B 1 188 ? 25.885  24.336 -6.338  1.00 21.94 ?  188  LYS B O   1 
ATOM   4570 C CB  . LYS B 1 188 ? 26.997  21.993 -8.135  1.00 25.77 ?  188  LYS B CB  1 
ATOM   4571 C CG  . LYS B 1 188 ? 27.786  21.423 -9.405  1.00 24.90 ?  188  LYS B CG  1 
ATOM   4572 C CD  . LYS B 1 188 ? 26.955  20.296 -10.105 1.00 24.63 ?  188  LYS B CD  1 
ATOM   4573 C CE  . LYS B 1 188 ? 27.593  19.881 -11.457 1.00 28.35 ?  188  LYS B CE  1 
ATOM   4574 N NZ  . LYS B 1 188 ? 26.568  19.321 -12.436 1.00 32.80 ?  188  LYS B NZ  1 
ATOM   4575 N N   . ASN B 1 189 ? 24.079  23.022 -6.801  1.00 22.28 ?  189  ASN B N   1 
ATOM   4576 C CA  . ASN B 1 189 ? 23.242  23.506 -5.655  1.00 22.45 ?  189  ASN B CA  1 
ATOM   4577 C C   . ASN B 1 189 ? 23.536  22.702 -4.408  1.00 20.81 ?  189  ASN B C   1 
ATOM   4578 O O   . ASN B 1 189 ? 22.648  22.057 -3.829  1.00 20.20 ?  189  ASN B O   1 
ATOM   4579 C CB  . ASN B 1 189 ? 21.747  23.387 -6.021  1.00 23.16 ?  189  ASN B CB  1 
ATOM   4580 C CG  . ASN B 1 189 ? 20.818  24.366 -5.224  1.00 27.40 ?  189  ASN B CG  1 
ATOM   4581 O OD1 . ASN B 1 189 ? 19.585  24.251 -5.325  1.00 30.38 ?  189  ASN B OD1 1 
ATOM   4582 N ND2 . ASN B 1 189 ? 21.392  25.323 -4.489  1.00 27.05 ?  189  ASN B ND2 1 
ATOM   4583 N N   . THR B 1 190 ? 24.807  22.705 -3.993  1.00 19.84 ?  190  THR B N   1 
ATOM   4584 C CA  . THR B 1 190 ? 25.193  21.919 -2.848  1.00 19.06 ?  190  THR B CA  1 
ATOM   4585 C C   . THR B 1 190 ? 24.604  22.619 -1.580  1.00 18.25 ?  190  THR B C   1 
ATOM   4586 O O   . THR B 1 190 ? 24.357  23.809 -1.608  1.00 17.42 ?  190  THR B O   1 
ATOM   4587 C CB  . THR B 1 190 ? 26.722  21.761 -2.782  1.00 19.91 ?  190  THR B CB  1 
ATOM   4588 O OG1 . THR B 1 190 ? 27.311  23.060 -2.778  1.00 21.34 ?  190  THR B OG1 1 
ATOM   4589 C CG2 . THR B 1 190 ? 27.227  20.964 -4.017  1.00 19.67 ?  190  THR B CG2 1 
ATOM   4590 N N   . PRO B 1 191 ? 24.349  21.870 -0.500  1.00 18.11 ?  191  PRO B N   1 
ATOM   4591 C CA  . PRO B 1 191 ? 23.767  22.475 0.707   1.00 17.99 ?  191  PRO B CA  1 
ATOM   4592 C C   . PRO B 1 191 ? 24.619  23.618 1.286   1.00 18.87 ?  191  PRO B C   1 
ATOM   4593 O O   . PRO B 1 191 ? 25.860  23.479 1.387   1.00 17.92 ?  191  PRO B O   1 
ATOM   4594 C CB  . PRO B 1 191 ? 23.746  21.323 1.717   1.00 18.18 ?  191  PRO B CB  1 
ATOM   4595 C CG  . PRO B 1 191 ? 23.801  20.082 0.915   1.00 19.30 ?  191  PRO B CG  1 
ATOM   4596 C CD  . PRO B 1 191 ? 24.562  20.420 -0.357  1.00 18.48 ?  191  PRO B CD  1 
ATOM   4597 N N   . LYS B 1 192 ? 23.956  24.695 1.712   1.00 17.22 ?  192  LYS B N   1 
ATOM   4598 C CA  . LYS B 1 192 ? 24.623  25.836 2.355   1.00 17.35 ?  192  LYS B CA  1 
ATOM   4599 C C   . LYS B 1 192 ? 24.987  25.502 3.803   1.00 17.22 ?  192  LYS B C   1 
ATOM   4600 O O   . LYS B 1 192 ? 26.033  25.957 4.316   1.00 17.84 ?  192  LYS B O   1 
ATOM   4601 C CB  . LYS B 1 192 ? 23.724  27.082 2.331   1.00 16.34 ?  192  LYS B CB  1 
ATOM   4602 C CG  . LYS B 1 192 ? 23.347  27.652 0.932   1.00 20.27 ?  192  LYS B CG  1 
ATOM   4603 C CD  . LYS B 1 192 ? 24.558  28.308 0.244   1.00 23.20 ?  192  LYS B CD  1 
ATOM   4604 C CE  . LYS B 1 192 ? 24.226  29.006 -1.050  1.00 25.72 ?  192  LYS B CE  1 
ATOM   4605 N NZ  . LYS B 1 192 ? 23.628  30.367 -0.795  1.00 26.82 ?  192  LYS B NZ  1 
ATOM   4606 N N   . PHE B 1 193 ? 24.110  24.764 4.491   1.00 17.39 ?  193  PHE B N   1 
ATOM   4607 C CA  . PHE B 1 193 ? 24.332  24.465 5.899   1.00 17.22 ?  193  PHE B CA  1 
ATOM   4608 C C   . PHE B 1 193 ? 23.521  23.340 6.455   1.00 17.91 ?  193  PHE B C   1 
ATOM   4609 O O   . PHE B 1 193 ? 22.491  22.923 5.878   1.00 16.57 ?  193  PHE B O   1 
ATOM   4610 C CB  . PHE B 1 193 ? 24.180  25.739 6.801   1.00 17.43 ?  193  PHE B CB  1 
ATOM   4611 C CG  . PHE B 1 193 ? 22.750  26.308 6.874   1.00 17.75 ?  193  PHE B CG  1 
ATOM   4612 C CD1 . PHE B 1 193 ? 22.397  27.449 6.139   1.00 17.05 ?  193  PHE B CD1 1 
ATOM   4613 C CD2 . PHE B 1 193 ? 21.780  25.703 7.667   1.00 18.22 ?  193  PHE B CD2 1 
ATOM   4614 C CE1 . PHE B 1 193 ? 21.098  27.980 6.210   1.00 15.62 ?  193  PHE B CE1 1 
ATOM   4615 C CE2 . PHE B 1 193 ? 20.474  26.199 7.762   1.00 16.91 ?  193  PHE B CE2 1 
ATOM   4616 C CZ  . PHE B 1 193 ? 20.106  27.336 7.050   1.00 16.32 ?  193  PHE B CZ  1 
ATOM   4617 N N   . LEU B 1 194 ? 24.039  22.847 7.586   1.00 18.26 ?  194  LEU B N   1 
ATOM   4618 C CA  . LEU B 1 194 ? 23.367  21.934 8.493   1.00 18.55 ?  194  LEU B CA  1 
ATOM   4619 C C   . LEU B 1 194 ? 22.968  22.756 9.739   1.00 18.55 ?  194  LEU B C   1 
ATOM   4620 O O   . LEU B 1 194 ? 23.831  23.397 10.386  1.00 17.96 ?  194  LEU B O   1 
ATOM   4621 C CB  . LEU B 1 194 ? 24.348  20.804 8.915   1.00 18.76 ?  194  LEU B CB  1 
ATOM   4622 C CG  . LEU B 1 194 ? 23.828  19.830 9.985   1.00 19.54 ?  194  LEU B CG  1 
ATOM   4623 C CD1 . LEU B 1 194 ? 22.594  19.088 9.471   1.00 20.64 ?  194  LEU B CD1 1 
ATOM   4624 C CD2 . LEU B 1 194 ? 24.907  18.828 10.480  1.00 21.08 ?  194  LEU B CD2 1 
ATOM   4625 N N   . TYR B 1 195 ? 21.670  22.748 10.084  1.00 18.13 ?  195  TYR B N   1 
ATOM   4626 C CA  . TYR B 1 195 ? 21.209  23.328 11.355  1.00 17.35 ?  195  TYR B CA  1 
ATOM   4627 C C   . TYR B 1 195 ? 20.962  22.187 12.338  1.00 17.60 ?  195  TYR B C   1 
ATOM   4628 O O   . TYR B 1 195 ? 20.355  21.207 11.956  1.00 17.04 ?  195  TYR B O   1 
ATOM   4629 C CB  . TYR B 1 195 ? 19.900  24.112 11.122  1.00 17.73 ?  195  TYR B CB  1 
ATOM   4630 C CG  . TYR B 1 195 ? 19.158  24.507 12.415  1.00 17.21 ?  195  TYR B CG  1 
ATOM   4631 C CD1 . TYR B 1 195 ? 19.436  25.736 13.049  1.00 17.27 ?  195  TYR B CD1 1 
ATOM   4632 C CD2 . TYR B 1 195 ? 18.182  23.667 12.982  1.00 16.47 ?  195  TYR B CD2 1 
ATOM   4633 C CE1 . TYR B 1 195 ? 18.755  26.128 14.251  1.00 19.30 ?  195  TYR B CE1 1 
ATOM   4634 C CE2 . TYR B 1 195 ? 17.481  24.030 14.212  1.00 17.66 ?  195  TYR B CE2 1 
ATOM   4635 C CZ  . TYR B 1 195 ? 17.784  25.260 14.821  1.00 18.52 ?  195  TYR B CZ  1 
ATOM   4636 O OH  . TYR B 1 195 ? 17.151  25.664 15.984  1.00 21.07 ?  195  TYR B OH  1 
ATOM   4637 N N   . THR B 1 196 ? 21.427  22.296 13.588  1.00 18.41 ?  196  THR B N   1 
ATOM   4638 C CA  . THR B 1 196 ? 20.962  21.388 14.662  1.00 20.17 ?  196  THR B CA  1 
ATOM   4639 C C   . THR B 1 196 ? 21.061  22.068 16.000  1.00 19.97 ?  196  THR B C   1 
ATOM   4640 O O   . THR B 1 196 ? 21.811  23.044 16.181  1.00 19.89 ?  196  THR B O   1 
ATOM   4641 C CB  . THR B 1 196 ? 21.704  19.959 14.739  1.00 22.27 ?  196  THR B CB  1 
ATOM   4642 O OG1 . THR B 1 196 ? 20.865  18.965 15.389  1.00 26.28 ?  196  THR B OG1 1 
ATOM   4643 C CG2 . THR B 1 196 ? 23.032  20.036 15.498  1.00 19.81 ?  196  THR B CG2 1 
ATOM   4644 N N   . VAL B 1 197 ? 20.287  21.537 16.927  1.00 19.98 ?  197  VAL B N   1 
ATOM   4645 C CA  . VAL B 1 197 ? 20.306  21.921 18.334  1.00 20.69 ?  197  VAL B CA  1 
ATOM   4646 C C   . VAL B 1 197 ? 20.891  20.686 19.024  1.00 21.61 ?  197  VAL B C   1 
ATOM   4647 O O   . VAL B 1 197 ? 20.223  19.689 19.137  1.00 20.49 ?  197  VAL B O   1 
ATOM   4648 C CB  . VAL B 1 197 ? 18.879  22.109 18.802  1.00 20.85 ?  197  VAL B CB  1 
ATOM   4649 C CG1 . VAL B 1 197 ? 18.805  22.419 20.337  1.00 23.35 ?  197  VAL B CG1 1 
ATOM   4650 C CG2 . VAL B 1 197 ? 18.161  23.170 17.934  1.00 20.11 ?  197  VAL B CG2 1 
ATOM   4651 N N   . PRO B 1 198 ? 22.168  20.747 19.424  1.00 22.22 ?  198  PRO B N   1 
ATOM   4652 C CA  . PRO B 1 198 ? 22.914  19.547 19.884  1.00 23.41 ?  198  PRO B CA  1 
ATOM   4653 C C   . PRO B 1 198 ? 22.614  19.062 21.304  1.00 23.46 ?  198  PRO B C   1 
ATOM   4654 O O   . PRO B 1 198 ? 22.995  17.934 21.640  1.00 24.30 ?  198  PRO B O   1 
ATOM   4655 C CB  . PRO B 1 198 ? 24.385  19.975 19.785  1.00 21.66 ?  198  PRO B CB  1 
ATOM   4656 C CG  . PRO B 1 198 ? 24.351  21.352 19.215  1.00 23.97 ?  198  PRO B CG  1 
ATOM   4657 C CD  . PRO B 1 198 ? 23.013  21.938 19.408  1.00 21.79 ?  198  PRO B CD  1 
ATOM   4658 N N   . ASN B 1 199 ? 21.973  19.906 22.122  1.00 23.42 ?  199  ASN B N   1 
ATOM   4659 C CA  . ASN B 1 199 ? 21.660  19.588 23.510  1.00 23.99 ?  199  ASN B CA  1 
ATOM   4660 C C   . ASN B 1 199 ? 20.213  19.861 23.820  1.00 24.41 ?  199  ASN B C   1 
ATOM   4661 O O   . ASN B 1 199 ? 19.738  20.969 23.629  1.00 23.00 ?  199  ASN B O   1 
ATOM   4662 C CB  . ASN B 1 199 ? 22.530  20.416 24.455  1.00 24.46 ?  199  ASN B CB  1 
ATOM   4663 C CG  . ASN B 1 199 ? 23.959  20.057 24.345  1.00 26.55 ?  199  ASN B CG  1 
ATOM   4664 O OD1 . ASN B 1 199 ? 24.336  18.899 24.606  1.00 29.06 ?  199  ASN B OD1 1 
ATOM   4665 N ND2 . ASN B 1 199 ? 24.780  21.003 23.896  1.00 22.25 ?  199  ASN B ND2 1 
ATOM   4666 N N   . GLY B 1 200 ? 19.509  18.833 24.289  1.00 25.62 ?  200  GLY B N   1 
ATOM   4667 C CA  . GLY B 1 200 ? 18.085  18.943 24.632  1.00 25.18 ?  200  GLY B CA  1 
ATOM   4668 C C   . GLY B 1 200 ? 17.281  19.586 23.522  1.00 25.68 ?  200  GLY B C   1 
ATOM   4669 O O   . GLY B 1 200 ? 16.652  20.600 23.733  1.00 26.86 ?  200  GLY B O   1 
ATOM   4670 N N   . ASN B 1 201 ? 17.294  18.992 22.344  1.00 25.51 ?  201  ASN B N   1 
ATOM   4671 C CA  . ASN B 1 201 ? 16.526  19.489 21.230  1.00 26.63 ?  201  ASN B CA  1 
ATOM   4672 C C   . ASN B 1 201 ? 15.089  19.759 21.696  1.00 26.80 ?  201  ASN B C   1 
ATOM   4673 O O   . ASN B 1 201 ? 14.551  19.028 22.529  1.00 26.79 ?  201  ASN B O   1 
ATOM   4674 C CB  . ASN B 1 201 ? 16.534  18.467 20.111  1.00 26.80 ?  201  ASN B CB  1 
ATOM   4675 C CG  . ASN B 1 201 ? 15.978  19.004 18.820  1.00 30.77 ?  201  ASN B CG  1 
ATOM   4676 O OD1 . ASN B 1 201 ? 15.466  18.242 18.013  1.00 34.92 ?  201  ASN B OD1 1 
ATOM   4677 N ND2 . ASN B 1 201 ? 16.061  20.328 18.614  1.00 31.27 ?  201  ASN B ND2 1 
ATOM   4678 N N   . ASN B 1 202 ? 14.501  20.824 21.169  1.00 26.72 ?  202  ASN B N   1 
ATOM   4679 C CA  . ASN B 1 202 ? 13.112  21.148 21.347  1.00 26.47 ?  202  ASN B CA  1 
ATOM   4680 C C   . ASN B 1 202 ? 12.486  20.656 20.056  1.00 27.66 ?  202  ASN B C   1 
ATOM   4681 O O   . ASN B 1 202 ? 12.788  21.193 18.979  1.00 28.46 ?  202  ASN B O   1 
ATOM   4682 C CB  . ASN B 1 202 ? 12.991  22.671 21.531  1.00 25.39 ?  202  ASN B CB  1 
ATOM   4683 C CG  . ASN B 1 202 ? 11.554  23.168 21.607  1.00 26.45 ?  202  ASN B CG  1 
ATOM   4684 O OD1 . ASN B 1 202 ? 10.574  22.411 21.424  1.00 24.40 ?  202  ASN B OD1 1 
ATOM   4685 N ND2 . ASN B 1 202 ? 11.416  24.471 21.838  1.00 22.39 ?  202  ASN B ND2 1 
ATOM   4686 N N   . PRO B 1 203 ? 11.562  19.670 20.125  1.00 27.81 ?  203  PRO B N   1 
ATOM   4687 C CA  . PRO B 1 203 ? 10.837  19.089 21.255  1.00 28.40 ?  203  PRO B CA  1 
ATOM   4688 C C   . PRO B 1 203 ? 11.342  17.781 21.888  1.00 29.21 ?  203  PRO B C   1 
ATOM   4689 O O   . PRO B 1 203 ? 10.849  17.426 22.967  1.00 29.89 ?  203  PRO B O   1 
ATOM   4690 C CB  . PRO B 1 203 ? 9.460   18.825 20.647  1.00 27.92 ?  203  PRO B CB  1 
ATOM   4691 C CG  . PRO B 1 203 ? 9.793   18.339 19.274  1.00 27.36 ?  203  PRO B CG  1 
ATOM   4692 C CD  . PRO B 1 203 ? 11.082  19.112 18.857  1.00 27.22 ?  203  PRO B CD  1 
ATOM   4693 N N   . THR B 1 204 ? 12.301  17.093 21.261  1.00 29.24 ?  204  THR B N   1 
ATOM   4694 C CA  . THR B 1 204 ? 12.626  15.690 21.596  1.00 29.50 ?  204  THR B CA  1 
ATOM   4695 C C   . THR B 1 204 ? 13.369  15.482 22.921  1.00 29.58 ?  204  THR B C   1 
ATOM   4696 O O   . THR B 1 204 ? 13.332  14.388 23.487  1.00 30.54 ?  204  THR B O   1 
ATOM   4697 C CB  . THR B 1 204 ? 13.452  14.977 20.499  1.00 28.70 ?  204  THR B CB  1 
ATOM   4698 O OG1 . THR B 1 204 ? 14.778  15.512 20.494  1.00 29.50 ?  204  THR B OG1 1 
ATOM   4699 C CG2 . THR B 1 204 ? 12.853  15.128 19.153  1.00 29.09 ?  204  THR B CG2 1 
ATOM   4700 N N   . GLY B 1 205 ? 14.054  16.506 23.408  1.00 29.40 ?  205  GLY B N   1 
ATOM   4701 C CA  . GLY B 1 205 ? 14.940  16.347 24.572  1.00 28.98 ?  205  GLY B CA  1 
ATOM   4702 C C   . GLY B 1 205 ? 16.207  15.516 24.306  1.00 29.05 ?  205  GLY B C   1 
ATOM   4703 O O   . GLY B 1 205 ? 16.997  15.319 25.229  1.00 28.66 ?  205  GLY B O   1 
ATOM   4704 N N   . ASN B 1 206 ? 16.394  15.012 23.077  1.00 28.36 ?  206  ASN B N   1 
ATOM   4705 C CA  . ASN B 1 206 ? 17.644  14.252 22.717  1.00 29.76 ?  206  ASN B CA  1 
ATOM   4706 C C   . ASN B 1 206 ? 18.887  15.148 22.526  1.00 29.33 ?  206  ASN B C   1 
ATOM   4707 O O   . ASN B 1 206 ? 18.781  16.329 22.136  1.00 29.47 ?  206  ASN B O   1 
ATOM   4708 C CB  . ASN B 1 206 ? 17.443  13.360 21.461  1.00 29.50 ?  206  ASN B CB  1 
ATOM   4709 C CG  . ASN B 1 206 ? 16.262  12.333 21.617  1.00 31.43 ?  206  ASN B CG  1 
ATOM   4710 O OD1 . ASN B 1 206 ? 15.493  12.126 20.684  1.00 30.91 ?  206  ASN B OD1 1 
ATOM   4711 N ND2 . ASN B 1 206 ? 16.133  11.719 22.795  1.00 27.69 ?  206  ASN B ND2 1 
ATOM   4712 N N   . SER B 1 207 ? 20.056  14.572 22.800  1.00 29.47 ?  207  SER B N   1 
ATOM   4713 C CA  . SER B 1 207 ? 21.341  15.225 22.622  1.00 29.12 ?  207  SER B CA  1 
ATOM   4714 C C   . SER B 1 207 ? 22.323  14.405 21.757  1.00 29.95 ?  207  SER B C   1 
ATOM   4715 O O   . SER B 1 207 ? 22.295  13.163 21.750  1.00 29.67 ?  207  SER B O   1 
ATOM   4716 C CB  . SER B 1 207 ? 21.991  15.459 23.976  1.00 29.52 ?  207  SER B CB  1 
ATOM   4717 O OG  . SER B 1 207 ? 21.292  16.428 24.729  1.00 28.38 ?  207  SER B OG  1 
ATOM   4718 N N   . LEU B 1 208 ? 23.202  15.120 21.057  1.00 29.24 ?  208  LEU B N   1 
ATOM   4719 C CA  . LEU B 1 208 ? 24.292  14.532 20.285  1.00 28.27 ?  208  LEU B CA  1 
ATOM   4720 C C   . LEU B 1 208 ? 25.434  14.111 21.180  1.00 28.24 ?  208  LEU B C   1 
ATOM   4721 O O   . LEU B 1 208 ? 25.812  14.814 22.116  1.00 27.67 ?  208  LEU B O   1 
ATOM   4722 C CB  . LEU B 1 208 ? 24.847  15.540 19.273  1.00 28.48 ?  208  LEU B CB  1 
ATOM   4723 C CG  . LEU B 1 208 ? 24.223  15.716 17.892  1.00 28.30 ?  208  LEU B CG  1 
ATOM   4724 C CD1 . LEU B 1 208 ? 24.960  16.844 17.137  1.00 24.07 ?  208  LEU B CD1 1 
ATOM   4725 C CD2 . LEU B 1 208 ? 24.289  14.407 17.124  1.00 27.76 ?  208  LEU B CD2 1 
ATOM   4726 N N   . THR B 1 209 ? 26.011  12.957 20.873  1.00 28.40 ?  209  THR B N   1 
ATOM   4727 C CA  . THR B 1 209 ? 27.185  12.528 21.579  1.00 28.00 ?  209  THR B CA  1 
ATOM   4728 C C   . THR B 1 209 ? 28.393  13.153 20.880  1.00 28.36 ?  209  THR B C   1 
ATOM   4729 O O   . THR B 1 209 ? 28.307  13.654 19.746  1.00 28.08 ?  209  THR B O   1 
ATOM   4730 C CB  . THR B 1 209 ? 27.297  10.997 21.566  1.00 28.28 ?  209  THR B CB  1 
ATOM   4731 O OG1 . THR B 1 209 ? 27.317  10.564 20.215  1.00 28.70 ?  209  THR B OG1 1 
ATOM   4732 C CG2 . THR B 1 209 ? 26.109  10.327 22.282  1.00 28.60 ?  209  THR B CG2 1 
ATOM   4733 N N   . SER B 1 210 ? 29.521  13.107 21.578  1.00 29.42 ?  210  SER B N   1 
ATOM   4734 C CA  . SER B 1 210 ? 30.813  13.630 21.128  1.00 29.68 ?  210  SER B CA  1 
ATOM   4735 C C   . SER B 1 210 ? 31.295  12.923 19.876  1.00 29.87 ?  210  SER B C   1 
ATOM   4736 O O   . SER B 1 210 ? 31.854  13.569 18.958  1.00 29.96 ?  210  SER B O   1 
ATOM   4737 C CB  . SER B 1 210 ? 31.827  13.402 22.246  1.00 30.07 ?  210  SER B CB  1 
ATOM   4738 O OG  . SER B 1 210 ? 33.064  13.996 21.942  1.00 32.24 ?  210  SER B OG  1 
ATOM   4739 N N   . GLU B 1 211 ? 31.023  11.609 19.821  1.00 30.18 ?  211  GLU B N   1 
ATOM   4740 C CA  . GLU B 1 211 ? 31.420  10.726 18.715  1.00 30.15 ?  211  GLU B CA  1 
ATOM   4741 C C   . GLU B 1 211 ? 30.675  11.052 17.411  1.00 28.38 ?  211  GLU B C   1 
ATOM   4742 O O   . GLU B 1 211 ? 31.262  11.070 16.346  1.00 27.57 ?  211  GLU B O   1 
ATOM   4743 C CB  . GLU B 1 211 ? 31.182  9.251  19.096  1.00 31.53 ?  211  GLU B CB  1 
ATOM   4744 C CG  . GLU B 1 211 ? 32.139  8.701  20.223  1.00 36.70 ?  211  GLU B CG  1 
ATOM   4745 C CD  . GLU B 1 211 ? 31.757  9.136  21.671  1.00 43.69 ?  211  GLU B CD  1 
ATOM   4746 O OE1 . GLU B 1 211 ? 30.566  9.483  21.938  1.00 43.98 ?  211  GLU B OE1 1 
ATOM   4747 O OE2 . GLU B 1 211 ? 32.663  9.109  22.557  1.00 46.18 ?  211  GLU B OE2 1 
ATOM   4748 N N   . ARG B 1 212 ? 29.375  11.316 17.501  1.00 26.91 ?  212  ARG B N   1 
ATOM   4749 C CA  . ARG B 1 212 ? 28.616  11.732 16.320  1.00 25.82 ?  212  ARG B CA  1 
ATOM   4750 C C   . ARG B 1 212 ? 29.042  13.119 15.811  1.00 24.90 ?  212  ARG B C   1 
ATOM   4751 O O   . ARG B 1 212 ? 29.136  13.324 14.590  1.00 23.19 ?  212  ARG B O   1 
ATOM   4752 C CB  . ARG B 1 212 ? 27.110  11.658 16.584  1.00 26.73 ?  212  ARG B CB  1 
ATOM   4753 C CG  . ARG B 1 212 ? 26.620  10.202 16.774  1.00 28.32 ?  212  ARG B CG  1 
ATOM   4754 C CD  . ARG B 1 212 ? 25.135  10.129 16.820  1.00 32.43 ?  212  ARG B CD  1 
ATOM   4755 N NE  . ARG B 1 212 ? 24.659  8.754  16.743  1.00 34.36 ?  212  ARG B NE  1 
ATOM   4756 C CZ  . ARG B 1 212 ? 23.441  8.396  16.340  1.00 37.54 ?  212  ARG B CZ  1 
ATOM   4757 N NH1 . ARG B 1 212 ? 22.552  9.318  15.976  1.00 36.65 ?  212  ARG B NH1 1 
ATOM   4758 N NH2 . ARG B 1 212 ? 23.103  7.108  16.310  1.00 36.12 ?  212  ARG B NH2 1 
ATOM   4759 N N   . LYS B 1 213 ? 29.361  14.036 16.742  1.00 24.70 ?  213  LYS B N   1 
ATOM   4760 C CA  . LYS B 1 213 ? 29.723  15.415 16.375  1.00 25.23 ?  213  LYS B CA  1 
ATOM   4761 C C   . LYS B 1 213 ? 30.968  15.434 15.509  1.00 24.87 ?  213  LYS B C   1 
ATOM   4762 O O   . LYS B 1 213 ? 31.033  16.161 14.510  1.00 24.43 ?  213  LYS B O   1 
ATOM   4763 C CB  . LYS B 1 213 ? 29.953  16.281 17.608  1.00 25.87 ?  213  LYS B CB  1 
ATOM   4764 C CG  . LYS B 1 213 ? 28.669  16.790 18.273  1.00 28.45 ?  213  LYS B CG  1 
ATOM   4765 C CD  . LYS B 1 213 ? 29.012  17.539 19.581  1.00 28.07 ?  213  LYS B CD  1 
ATOM   4766 C CE  . LYS B 1 213 ? 27.882  18.529 19.944  1.00 28.08 ?  213  LYS B CE  1 
ATOM   4767 N NZ  . LYS B 1 213 ? 27.930  18.876 21.392  1.00 24.82 ?  213  LYS B NZ  1 
ATOM   4768 N N   . LYS B 1 214 ? 31.938  14.599 15.882  1.00 25.38 ?  214  LYS B N   1 
ATOM   4769 C CA  . LYS B 1 214 ? 33.157  14.415 15.087  1.00 24.96 ?  214  LYS B CA  1 
ATOM   4770 C C   . LYS B 1 214 ? 32.852  13.927 13.674  1.00 23.43 ?  214  LYS B C   1 
ATOM   4771 O O   . LYS B 1 214 ? 33.354  14.502 12.732  1.00 22.83 ?  214  LYS B O   1 
ATOM   4772 C CB  . LYS B 1 214 ? 34.164  13.510 15.830  1.00 26.00 ?  214  LYS B CB  1 
ATOM   4773 C CG  . LYS B 1 214 ? 34.660  14.135 17.164  1.00 28.25 ?  214  LYS B CG  1 
ATOM   4774 C CD  . LYS B 1 214 ? 35.611  13.224 17.946  1.00 36.16 ?  214  LYS B CD  1 
ATOM   4775 C CE  . LYS B 1 214 ? 36.061  13.901 19.273  1.00 39.52 ?  214  LYS B CE  1 
ATOM   4776 N NZ  . LYS B 1 214 ? 36.332  12.951 20.402  1.00 41.70 ?  214  LYS B NZ  1 
ATOM   4777 N N   . GLU B 1 215 ? 31.987  12.913 13.542  1.00 23.76 ?  215  GLU B N   1 
ATOM   4778 C CA  . GLU B 1 215 ? 31.601  12.358 12.258  1.00 24.14 ?  215  GLU B CA  1 
ATOM   4779 C C   . GLU B 1 215 ? 30.847  13.368 11.417  1.00 23.00 ?  215  GLU B C   1 
ATOM   4780 O O   . GLU B 1 215 ? 31.053  13.450 10.226  1.00 22.58 ?  215  GLU B O   1 
ATOM   4781 C CB  . GLU B 1 215 ? 30.702  11.125 12.401  1.00 25.64 ?  215  GLU B CB  1 
ATOM   4782 C CG  . GLU B 1 215 ? 31.348  9.846  12.908  1.00 31.08 ?  215  GLU B CG  1 
ATOM   4783 C CD  . GLU B 1 215 ? 30.370  8.652  12.846  1.00 34.09 ?  215  GLU B CD  1 
ATOM   4784 O OE1 . GLU B 1 215 ? 29.743  8.360  13.884  1.00 36.34 ?  215  GLU B OE1 1 
ATOM   4785 O OE2 . GLU B 1 215 ? 30.191  8.061  11.746  1.00 36.53 ?  215  GLU B OE2 1 
ATOM   4786 N N   . ILE B 1 216 ? 29.928  14.109 12.044  1.00 22.65 ?  216  ILE B N   1 
ATOM   4787 C CA  . ILE B 1 216 ? 29.243  15.204 11.387  1.00 20.00 ?  216  ILE B CA  1 
ATOM   4788 C C   . ILE B 1 216 ? 30.204  16.326 10.942  1.00 18.92 ?  216  ILE B C   1 
ATOM   4789 O O   . ILE B 1 216 ? 30.108  16.806 9.825   1.00 17.61 ?  216  ILE B O   1 
ATOM   4790 C CB  . ILE B 1 216 ? 28.139  15.768 12.324  1.00 21.22 ?  216  ILE B CB  1 
ATOM   4791 C CG1 . ILE B 1 216 ? 27.001  14.765 12.428  1.00 23.74 ?  216  ILE B CG1 1 
ATOM   4792 C CG2 . ILE B 1 216 ? 27.605  17.050 11.788  1.00 20.15 ?  216  ILE B CG2 1 
ATOM   4793 C CD1 . ILE B 1 216 ? 26.260  14.817 13.797  1.00 26.45 ?  216  ILE B CD1 1 
ATOM   4794 N N   . TYR B 1 217 ? 31.116  16.775 11.801  1.00 18.37 ?  217  TYR B N   1 
ATOM   4795 C CA  . TYR B 1 217 ? 32.097  17.812 11.346  1.00 18.89 ?  217  TYR B CA  1 
ATOM   4796 C C   . TYR B 1 217 ? 32.935  17.341 10.110  1.00 19.94 ?  217  TYR B C   1 
ATOM   4797 O O   . TYR B 1 217 ? 33.223  18.123 9.179   1.00 19.33 ?  217  TYR B O   1 
ATOM   4798 C CB  . TYR B 1 217 ? 33.013  18.263 12.528  1.00 19.12 ?  217  TYR B CB  1 
ATOM   4799 C CG  . TYR B 1 217 ? 33.803  19.524 12.231  1.00 17.70 ?  217  TYR B CG  1 
ATOM   4800 C CD1 . TYR B 1 217 ? 33.260  20.784 12.524  1.00 16.53 ?  217  TYR B CD1 1 
ATOM   4801 C CD2 . TYR B 1 217 ? 35.058  19.467 11.571  1.00 16.56 ?  217  TYR B CD2 1 
ATOM   4802 C CE1 . TYR B 1 217 ? 33.925  21.928 12.216  1.00 14.36 ?  217  TYR B CE1 1 
ATOM   4803 C CE2 . TYR B 1 217 ? 35.731  20.635 11.239  1.00 12.14 ?  217  TYR B CE2 1 
ATOM   4804 C CZ  . TYR B 1 217 ? 35.156  21.856 11.575  1.00 14.41 ?  217  TYR B CZ  1 
ATOM   4805 O OH  . TYR B 1 217 ? 35.789  23.042 11.293  1.00 18.79 ?  217  TYR B OH  1 
ATOM   4806 N N   . GLU B 1 218 ? 33.323  16.063 10.100  1.00 20.89 ?  218  GLU B N   1 
ATOM   4807 C CA  . GLU B 1 218 ? 34.054  15.480 8.955   1.00 22.31 ?  218  GLU B CA  1 
ATOM   4808 C C   . GLU B 1 218 ? 33.223  15.551 7.691   1.00 21.30 ?  218  GLU B C   1 
ATOM   4809 O O   . GLU B 1 218 ? 33.750  15.888 6.650   1.00 22.58 ?  218  GLU B O   1 
ATOM   4810 C CB  . GLU B 1 218 ? 34.428  13.994 9.206   1.00 23.69 ?  218  GLU B CB  1 
ATOM   4811 C CG  . GLU B 1 218 ? 35.179  13.736 10.497  1.00 30.09 ?  218  GLU B CG  1 
ATOM   4812 C CD  . GLU B 1 218 ? 35.647  12.280 10.639  1.00 40.94 ?  218  GLU B CD  1 
ATOM   4813 O OE1 . GLU B 1 218 ? 35.451  11.677 11.749  1.00 42.51 ?  218  GLU B OE1 1 
ATOM   4814 O OE2 . GLU B 1 218 ? 36.188  11.728 9.619   1.00 46.43 ?  218  GLU B OE2 1 
ATOM   4815 N N   . LEU B 1 219 ? 31.923  15.240 7.762   1.00 21.04 ?  219  LEU B N   1 
ATOM   4816 C CA  . LEU B 1 219 ? 31.052  15.401 6.594   1.00 19.74 ?  219  LEU B CA  1 
ATOM   4817 C C   . LEU B 1 219 ? 30.914  16.837 6.176   1.00 19.90 ?  219  LEU B C   1 
ATOM   4818 O O   . LEU B 1 219 ? 30.897  17.125 4.982   1.00 18.00 ?  219  LEU B O   1 
ATOM   4819 C CB  . LEU B 1 219 ? 29.647  14.806 6.790   1.00 21.34 ?  219  LEU B CB  1 
ATOM   4820 C CG  . LEU B 1 219 ? 29.250  13.323 6.506   1.00 20.86 ?  219  LEU B CG  1 
ATOM   4821 C CD1 . LEU B 1 219 ? 30.137  12.565 5.516   1.00 20.76 ?  219  LEU B CD1 1 
ATOM   4822 C CD2 . LEU B 1 219 ? 29.083  12.547 7.775   1.00 25.19 ?  219  LEU B CD2 1 
ATOM   4823 N N   . ALA B 1 220 ? 30.805  17.753 7.156   1.00 19.91 ?  220  ALA B N   1 
ATOM   4824 C CA  . ALA B 1 220 ? 30.744  19.207 6.815   1.00 19.66 ?  220  ALA B CA  1 
ATOM   4825 C C   . ALA B 1 220 ? 32.002  19.716 6.119   1.00 19.16 ?  220  ALA B C   1 
ATOM   4826 O O   . ALA B 1 220 ? 31.938  20.551 5.228   1.00 20.13 ?  220  ALA B O   1 
ATOM   4827 C CB  . ALA B 1 220 ? 30.411  20.042 8.051   1.00 19.20 ?  220  ALA B CB  1 
ATOM   4828 N N   . ARG B 1 221 ? 33.158  19.207 6.507   1.00 20.46 ?  221  ARG B N   1 
ATOM   4829 C CA  . ARG B 1 221 ? 34.399  19.517 5.800   1.00 20.78 ?  221  ARG B CA  1 
ATOM   4830 C C   . ARG B 1 221 ? 34.450  18.894 4.390   1.00 19.74 ?  221  ARG B C   1 
ATOM   4831 O O   . ARG B 1 221 ? 34.768  19.559 3.407   1.00 20.10 ?  221  ARG B O   1 
ATOM   4832 C CB  . ARG B 1 221 ? 35.584  19.007 6.630   1.00 22.31 ?  221  ARG B CB  1 
ATOM   4833 C CG  . ARG B 1 221 ? 36.918  19.040 5.841   1.00 25.85 ?  221  ARG B CG  1 
ATOM   4834 C CD  . ARG B 1 221 ? 38.073  18.565 6.711   1.00 30.67 ?  221  ARG B CD  1 
ATOM   4835 N NE  . ARG B 1 221 ? 38.459  19.576 7.701   1.00 29.83 ?  221  ARG B NE  1 
ATOM   4836 C CZ  . ARG B 1 221 ? 39.619  19.561 8.333   1.00 33.96 ?  221  ARG B CZ  1 
ATOM   4837 N NH1 . ARG B 1 221 ? 40.497  18.563 8.106   1.00 32.91 ?  221  ARG B NH1 1 
ATOM   4838 N NH2 . ARG B 1 221 ? 39.903  20.528 9.199   1.00 34.16 ?  221  ARG B NH2 1 
ATOM   4839 N N   . LYS B 1 222 ? 34.137  17.608 4.289   1.00 21.07 ?  222  LYS B N   1 
ATOM   4840 C CA  . LYS B 1 222 ? 34.198  16.880 2.983   1.00 20.62 ?  222  LYS B CA  1 
ATOM   4841 C C   . LYS B 1 222 ? 33.298  17.500 1.903   1.00 19.91 ?  222  LYS B C   1 
ATOM   4842 O O   . LYS B 1 222 ? 33.717  17.702 0.746   1.00 19.44 ?  222  LYS B O   1 
ATOM   4843 C CB  . LYS B 1 222 ? 33.940  15.381 3.219   1.00 21.63 ?  222  LYS B CB  1 
ATOM   4844 C CG  . LYS B 1 222 ? 33.860  14.512 1.953   1.00 24.40 ?  222  LYS B CG  1 
ATOM   4845 C CD  . LYS B 1 222 ? 33.618  13.030 2.308   1.00 28.55 ?  222  LYS B CD  1 
ATOM   4846 C CE  . LYS B 1 222 ? 33.534  12.180 1.025   1.00 29.12 ?  222  LYS B CE  1 
ATOM   4847 N NZ  . LYS B 1 222 ? 33.357  10.694 1.254   1.00 30.46 ?  222  LYS B NZ  1 
ATOM   4848 N N   . TYR B 1 223 ? 32.081  17.878 2.286   1.00 20.00 ?  223  TYR B N   1 
ATOM   4849 C CA  . TYR B 1 223 ? 31.153  18.540 1.348   1.00 19.85 ?  223  TYR B CA  1 
ATOM   4850 C C   . TYR B 1 223 ? 31.070  20.045 1.572   1.00 20.46 ?  223  TYR B C   1 
ATOM   4851 O O   . TYR B 1 223 ? 30.238  20.730 1.005   1.00 21.97 ?  223  TYR B O   1 
ATOM   4852 C CB  . TYR B 1 223 ? 29.759  17.882 1.412   1.00 21.19 ?  223  TYR B CB  1 
ATOM   4853 C CG  . TYR B 1 223 ? 29.765  16.441 0.968   1.00 20.23 ?  223  TYR B CG  1 
ATOM   4854 C CD1 . TYR B 1 223 ? 29.519  16.105 -0.361  1.00 19.86 ?  223  TYR B CD1 1 
ATOM   4855 C CD2 . TYR B 1 223 ? 30.027  15.417 1.877   1.00 19.37 ?  223  TYR B CD2 1 
ATOM   4856 C CE1 . TYR B 1 223 ? 29.545  14.753 -0.762  1.00 22.56 ?  223  TYR B CE1 1 
ATOM   4857 C CE2 . TYR B 1 223 ? 30.046  14.078 1.486   1.00 21.22 ?  223  TYR B CE2 1 
ATOM   4858 C CZ  . TYR B 1 223 ? 29.808  13.765 0.170   1.00 22.29 ?  223  TYR B CZ  1 
ATOM   4859 O OH  . TYR B 1 223 ? 29.819  12.435 -0.232  1.00 24.94 ?  223  TYR B OH  1 
ATOM   4860 N N   . ASP B 1 224 ? 31.965  20.564 2.398   1.00 19.78 ?  224  ASP B N   1 
ATOM   4861 C CA  . ASP B 1 224 ? 32.165  21.996 2.568   1.00 19.63 ?  224  ASP B CA  1 
ATOM   4862 C C   . ASP B 1 224 ? 30.901  22.846 2.822   1.00 19.09 ?  224  ASP B C   1 
ATOM   4863 O O   . ASP B 1 224 ? 30.588  23.781 2.082   1.00 19.48 ?  224  ASP B O   1 
ATOM   4864 C CB  . ASP B 1 224 ? 32.999  22.553 1.439   1.00 19.20 ?  224  ASP B CB  1 
ATOM   4865 C CG  . ASP B 1 224 ? 33.842  23.746 1.863   1.00 22.53 ?  224  ASP B CG  1 
ATOM   4866 O OD1 . ASP B 1 224 ? 33.709  24.237 3.015   1.00 21.71 ?  224  ASP B OD1 1 
ATOM   4867 O OD2 . ASP B 1 224 ? 34.660  24.184 1.017   1.00 22.99 ?  224  ASP B OD2 1 
ATOM   4868 N N   . PHE B 1 225 ? 30.215  22.552 3.916   1.00 17.97 ?  225  PHE B N   1 
ATOM   4869 C CA  . PHE B 1 225 ? 29.052  23.349 4.247   1.00 16.79 ?  225  PHE B CA  1 
ATOM   4870 C C   . PHE B 1 225 ? 29.200  23.921 5.659   1.00 16.04 ?  225  PHE B C   1 
ATOM   4871 O O   . PHE B 1 225 ? 30.003  23.454 6.465   1.00 15.16 ?  225  PHE B O   1 
ATOM   4872 C CB  . PHE B 1 225 ? 27.698  22.595 4.012   1.00 14.97 ?  225  PHE B CB  1 
ATOM   4873 C CG  . PHE B 1 225 ? 27.568  21.276 4.762   1.00 16.88 ?  225  PHE B CG  1 
ATOM   4874 C CD1 . PHE B 1 225 ? 27.333  21.252 6.131   1.00 13.85 ?  225  PHE B CD1 1 
ATOM   4875 C CD2 . PHE B 1 225 ? 27.719  20.056 4.083   1.00 18.37 ?  225  PHE B CD2 1 
ATOM   4876 C CE1 . PHE B 1 225 ? 27.218  20.081 6.830   1.00 16.70 ?  225  PHE B CE1 1 
ATOM   4877 C CE2 . PHE B 1 225 ? 27.620  18.845 4.769   1.00 16.15 ?  225  PHE B CE2 1 
ATOM   4878 C CZ  . PHE B 1 225 ? 27.370  18.848 6.148   1.00 19.92 ?  225  PHE B CZ  1 
ATOM   4879 N N   . LEU B 1 226 ? 28.420  24.950 5.947   1.00 16.32 ?  226  LEU B N   1 
ATOM   4880 C CA  . LEU B 1 226 ? 28.429  25.542 7.295   1.00 16.96 ?  226  LEU B CA  1 
ATOM   4881 C C   . LEU B 1 226 ? 27.607  24.699 8.300   1.00 15.87 ?  226  LEU B C   1 
ATOM   4882 O O   . LEU B 1 226 ? 26.668  24.002 7.934   1.00 16.74 ?  226  LEU B O   1 
ATOM   4883 C CB  . LEU B 1 226 ? 27.879  26.974 7.180   1.00 16.50 ?  226  LEU B CB  1 
ATOM   4884 C CG  . LEU B 1 226 ? 28.803  28.153 6.868   1.00 18.95 ?  226  LEU B CG  1 
ATOM   4885 C CD1 . LEU B 1 226 ? 30.251  27.837 6.348   1.00 18.09 ?  226  LEU B CD1 1 
ATOM   4886 C CD2 . LEU B 1 226 ? 28.108  29.344 6.171   1.00 17.58 ?  226  LEU B CD2 1 
ATOM   4887 N N   . ILE B 1 227 ? 27.974  24.763 9.568   1.00 16.03 ?  227  ILE B N   1 
ATOM   4888 C CA  . ILE B 1 227 ? 27.197  24.204 10.648  1.00 15.83 ?  227  ILE B CA  1 
ATOM   4889 C C   . ILE B 1 227 ? 26.611  25.307 11.505  1.00 17.13 ?  227  ILE B C   1 
ATOM   4890 O O   . ILE B 1 227 ? 27.317  26.173 12.039  1.00 17.89 ?  227  ILE B O   1 
ATOM   4891 C CB  . ILE B 1 227 ? 28.055  23.272 11.532  1.00 16.49 ?  227  ILE B CB  1 
ATOM   4892 C CG1 . ILE B 1 227 ? 28.484  22.055 10.670  1.00 12.79 ?  227  ILE B CG1 1 
ATOM   4893 C CG2 . ILE B 1 227 ? 27.278  22.833 12.801  1.00 13.58 ?  227  ILE B CG2 1 
ATOM   4894 C CD1 . ILE B 1 227 ? 29.460  21.118 11.364  1.00 13.80 ?  227  ILE B CD1 1 
ATOM   4895 N N   . ILE B 1 228 ? 25.309  25.282 11.648  1.00 17.09 ?  228  ILE B N   1 
ATOM   4896 C CA  . ILE B 1 228 ? 24.756  26.229 12.556  1.00 17.39 ?  228  ILE B CA  1 
ATOM   4897 C C   . ILE B 1 228 ? 24.272  25.601 13.864  1.00 17.65 ?  228  ILE B C   1 
ATOM   4898 O O   . ILE B 1 228 ? 23.300  24.810 13.897  1.00 17.77 ?  228  ILE B O   1 
ATOM   4899 C CB  . ILE B 1 228 ? 23.805  27.367 11.862  1.00 18.89 ?  228  ILE B CB  1 
ATOM   4900 C CG1 . ILE B 1 228 ? 22.536  27.608 12.607  1.00 18.49 ?  228  ILE B CG1 1 
ATOM   4901 C CG2 . ILE B 1 228 ? 23.834  27.549 10.326  1.00 18.94 ?  228  ILE B CG2 1 
ATOM   4902 C CD1 . ILE B 1 228 ? 22.945  28.485 13.681  1.00 16.75 ?  228  ILE B CD1 1 
ATOM   4903 N N   . GLU B 1 229 ? 25.032  25.897 14.922  1.00 17.22 ?  229  GLU B N   1 
ATOM   4904 C CA  . GLU B 1 229 ? 24.884  25.260 16.238  1.00 18.16 ?  229  GLU B CA  1 
ATOM   4905 C C   . GLU B 1 229 ? 23.963  26.176 17.089  1.00 18.98 ?  229  GLU B C   1 
ATOM   4906 O O   . GLU B 1 229 ? 24.395  27.186 17.641  1.00 18.77 ?  229  GLU B O   1 
ATOM   4907 C CB  . GLU B 1 229 ? 26.269  25.095 16.894  1.00 18.04 ?  229  GLU B CB  1 
ATOM   4908 C CG  . GLU B 1 229 ? 26.273  24.286 18.178  1.00 19.99 ?  229  GLU B CG  1 
ATOM   4909 C CD  . GLU B 1 229 ? 27.687  23.898 18.663  1.00 22.67 ?  229  GLU B CD  1 
ATOM   4910 O OE1 . GLU B 1 229 ? 28.593  24.784 18.613  1.00 19.71 ?  229  GLU B OE1 1 
ATOM   4911 O OE2 . GLU B 1 229 ? 27.866  22.731 19.154  1.00 20.00 ?  229  GLU B OE2 1 
ATOM   4912 N N   . ASP B 1 230 ? 22.688  25.813 17.144  1.00 19.27 ?  230  ASP B N   1 
ATOM   4913 C CA  . ASP B 1 230 ? 21.682  26.509 17.939  1.00 20.55 ?  230  ASP B CA  1 
ATOM   4914 C C   . ASP B 1 230 ? 21.596  25.798 19.289  1.00 19.74 ?  230  ASP B C   1 
ATOM   4915 O O   . ASP B 1 230 ? 21.024  24.740 19.383  1.00 20.00 ?  230  ASP B O   1 
ATOM   4916 C CB  . ASP B 1 230 ? 20.357  26.438 17.185  1.00 19.42 ?  230  ASP B CB  1 
ATOM   4917 C CG  . ASP B 1 230 ? 19.220  27.156 17.905  1.00 23.90 ?  230  ASP B CG  1 
ATOM   4918 O OD1 . ASP B 1 230 ? 19.544  27.895 18.857  1.00 19.59 ?  230  ASP B OD1 1 
ATOM   4919 O OD2 . ASP B 1 230 ? 18.022  26.995 17.457  1.00 24.46 ?  230  ASP B OD2 1 
ATOM   4920 N N   . ASP B 1 231 ? 22.142  26.394 20.338  1.00 20.13 ?  231  ASP B N   1 
ATOM   4921 C CA  . ASP B 1 231 ? 22.444  25.650 21.549  1.00 20.87 ?  231  ASP B CA  1 
ATOM   4922 C C   . ASP B 1 231 ? 21.942  26.380 22.832  1.00 21.53 ?  231  ASP B C   1 
ATOM   4923 O O   . ASP B 1 231 ? 22.725  26.599 23.765  1.00 21.67 ?  231  ASP B O   1 
ATOM   4924 C CB  . ASP B 1 231 ? 23.989  25.373 21.602  1.00 20.61 ?  231  ASP B CB  1 
ATOM   4925 C CG  . ASP B 1 231 ? 24.376  24.066 22.399  1.00 22.11 ?  231  ASP B CG  1 
ATOM   4926 O OD1 . ASP B 1 231 ? 23.472  23.340 22.877  1.00 20.53 ?  231  ASP B OD1 1 
ATOM   4927 O OD2 . ASP B 1 231 ? 25.604  23.797 22.563  1.00 21.73 ?  231  ASP B OD2 1 
ATOM   4928 N N   . PRO B 1 232 ? 20.621  26.705 22.894  1.00 21.64 ?  232  PRO B N   1 
ATOM   4929 C CA  . PRO B 1 232 ? 20.033  27.428 24.009  1.00 22.17 ?  232  PRO B CA  1 
ATOM   4930 C C   . PRO B 1 232 ? 20.013  26.669 25.319  1.00 22.82 ?  232  PRO B C   1 
ATOM   4931 O O   . PRO B 1 232 ? 20.073  27.284 26.378  1.00 22.96 ?  232  PRO B O   1 
ATOM   4932 C CB  . PRO B 1 232 ? 18.600  27.716 23.538  1.00 21.95 ?  232  PRO B CB  1 
ATOM   4933 C CG  . PRO B 1 232 ? 18.328  26.802 22.473  1.00 21.94 ?  232  PRO B CG  1 
ATOM   4934 C CD  . PRO B 1 232 ? 19.609  26.374 21.867  1.00 21.07 ?  232  PRO B CD  1 
ATOM   4935 N N   . TYR B 1 233 ? 19.972  25.342 25.224  1.00 24.08 ?  233  TYR B N   1 
ATOM   4936 C CA  . TYR B 1 233 ? 19.979  24.428 26.376  1.00 23.96 ?  233  TYR B CA  1 
ATOM   4937 C C   . TYR B 1 233 ? 21.358  23.909 26.790  1.00 23.62 ?  233  TYR B C   1 
ATOM   4938 O O   . TYR B 1 233 ? 21.432  22.908 27.513  1.00 23.83 ?  233  TYR B O   1 
ATOM   4939 C CB  . TYR B 1 233 ? 18.992  23.265 26.108  1.00 24.24 ?  233  TYR B CB  1 
ATOM   4940 C CG  . TYR B 1 233 ? 17.624  23.803 25.716  1.00 24.41 ?  233  TYR B CG  1 
ATOM   4941 C CD1 . TYR B 1 233 ? 16.831  24.468 26.646  1.00 23.07 ?  233  TYR B CD1 1 
ATOM   4942 C CD2 . TYR B 1 233 ? 17.145  23.669 24.405  1.00 25.73 ?  233  TYR B CD2 1 
ATOM   4943 C CE1 . TYR B 1 233 ? 15.568  24.976 26.285  1.00 27.04 ?  233  TYR B CE1 1 
ATOM   4944 C CE2 . TYR B 1 233 ? 15.913  24.188 24.020  1.00 24.84 ?  233  TYR B CE2 1 
ATOM   4945 C CZ  . TYR B 1 233 ? 15.118  24.846 24.964  1.00 25.79 ?  233  TYR B CZ  1 
ATOM   4946 O OH  . TYR B 1 233 ? 13.878  25.354 24.575  1.00 28.06 ?  233  TYR B OH  1 
ATOM   4947 N N   . TYR B 1 234 ? 22.419  24.603 26.368  1.00 22.33 ?  234  TYR B N   1 
ATOM   4948 C CA  . TYR B 1 234 ? 23.822  24.218 26.653  1.00 22.83 ?  234  TYR B CA  1 
ATOM   4949 C C   . TYR B 1 234 ? 24.167  24.145 28.138  1.00 23.80 ?  234  TYR B C   1 
ATOM   4950 O O   . TYR B 1 234 ? 24.843  23.206 28.573  1.00 24.52 ?  234  TYR B O   1 
ATOM   4951 C CB  . TYR B 1 234 ? 24.840  25.144 25.972  1.00 21.47 ?  234  TYR B CB  1 
ATOM   4952 C CG  . TYR B 1 234 ? 26.298  24.808 26.298  1.00 21.34 ?  234  TYR B CG  1 
ATOM   4953 C CD1 . TYR B 1 234 ? 26.920  23.692 25.728  1.00 19.73 ?  234  TYR B CD1 1 
ATOM   4954 C CD2 . TYR B 1 234 ? 27.029  25.578 27.209  1.00 20.25 ?  234  TYR B CD2 1 
ATOM   4955 C CE1 . TYR B 1 234 ? 28.276  23.363 26.046  1.00 20.04 ?  234  TYR B CE1 1 
ATOM   4956 C CE2 . TYR B 1 234 ? 28.365  25.254 27.541  1.00 22.64 ?  234  TYR B CE2 1 
ATOM   4957 C CZ  . TYR B 1 234 ? 28.967  24.122 26.946  1.00 22.41 ?  234  TYR B CZ  1 
ATOM   4958 O OH  . TYR B 1 234 ? 30.272  23.803 27.253  1.00 22.99 ?  234  TYR B OH  1 
ATOM   4959 N N   . PHE B 1 235 ? 23.720  25.131 28.907  1.00 25.36 ?  235  PHE B N   1 
ATOM   4960 C CA  . PHE B 1 235 ? 23.999  25.136 30.322  1.00 27.33 ?  235  PHE B CA  1 
ATOM   4961 C C   . PHE B 1 235 ? 22.981  24.282 31.122  1.00 29.07 ?  235  PHE B C   1 
ATOM   4962 O O   . PHE B 1 235 ? 23.101  24.150 32.336  1.00 30.89 ?  235  PHE B O   1 
ATOM   4963 C CB  . PHE B 1 235 ? 24.088  26.566 30.848  1.00 27.42 ?  235  PHE B CB  1 
ATOM   4964 C CG  . PHE B 1 235 ? 25.261  27.361 30.294  1.00 25.48 ?  235  PHE B CG  1 
ATOM   4965 C CD1 . PHE B 1 235 ? 25.051  28.338 29.354  1.00 24.89 ?  235  PHE B CD1 1 
ATOM   4966 C CD2 . PHE B 1 235 ? 26.554  27.136 30.736  1.00 29.17 ?  235  PHE B CD2 1 
ATOM   4967 C CE1 . PHE B 1 235 ? 26.121  29.093 28.830  1.00 26.70 ?  235  PHE B CE1 1 
ATOM   4968 C CE2 . PHE B 1 235 ? 27.633  27.880 30.213  1.00 28.21 ?  235  PHE B CE2 1 
ATOM   4969 C CZ  . PHE B 1 235 ? 27.403  28.852 29.257  1.00 26.50 ?  235  PHE B CZ  1 
ATOM   4970 N N   . LEU B 1 236 ? 22.022  23.670 30.442  1.00 29.34 ?  236  LEU B N   1 
ATOM   4971 C CA  . LEU B 1 236 ? 21.029  22.807 31.078  1.00 30.93 ?  236  LEU B CA  1 
ATOM   4972 C C   . LEU B 1 236 ? 21.276  21.287 30.857  1.00 31.30 ?  236  LEU B C   1 
ATOM   4973 O O   . LEU B 1 236 ? 20.333  20.542 30.655  1.00 30.75 ?  236  LEU B O   1 
ATOM   4974 C CB  . LEU B 1 236 ? 19.629  23.175 30.550  1.00 30.46 ?  236  LEU B CB  1 
ATOM   4975 C CG  . LEU B 1 236 ? 18.814  24.120 31.413  1.00 32.36 ?  236  LEU B CG  1 
ATOM   4976 C CD1 . LEU B 1 236 ? 19.683  25.252 31.911  1.00 34.52 ?  236  LEU B CD1 1 
ATOM   4977 C CD2 . LEU B 1 236 ? 17.525  24.625 30.695  1.00 31.39 ?  236  LEU B CD2 1 
ATOM   4978 N N   . GLN B 1 237 ? 22.539  20.855 30.875  1.00 33.31 ?  237  GLN B N   1 
ATOM   4979 C CA  . GLN B 1 237 ? 22.891  19.441 30.677  1.00 35.34 ?  237  GLN B CA  1 
ATOM   4980 C C   . GLN B 1 237 ? 22.835  18.665 31.997  1.00 36.27 ?  237  GLN B C   1 
ATOM   4981 O O   . GLN B 1 237 ? 23.540  18.980 32.925  1.00 35.83 ?  237  GLN B O   1 
ATOM   4982 C CB  . GLN B 1 237 ? 24.264  19.314 30.010  1.00 35.19 ?  237  GLN B CB  1 
ATOM   4983 C CG  . GLN B 1 237 ? 24.213  19.631 28.514  1.00 35.49 ?  237  GLN B CG  1 
ATOM   4984 C CD  . GLN B 1 237 ? 25.576  19.781 27.894  1.00 35.89 ?  237  GLN B CD  1 
ATOM   4985 O OE1 . GLN B 1 237 ? 25.965  20.880 27.457  1.00 33.89 ?  237  GLN B OE1 1 
ATOM   4986 N NE2 . GLN B 1 237 ? 26.328  18.681 27.857  1.00 33.58 ?  237  GLN B NE2 1 
ATOM   4987 N N   . PHE B 1 238 ? 21.949  17.678 32.072  1.00 39.03 ?  238  PHE B N   1 
ATOM   4988 C CA  . PHE B 1 238 ? 21.732  16.926 33.313  1.00 41.23 ?  238  PHE B CA  1 
ATOM   4989 C C   . PHE B 1 238 ? 22.968  16.074 33.658  1.00 44.24 ?  238  PHE B C   1 
ATOM   4990 O O   . PHE B 1 238 ? 23.345  15.929 34.841  1.00 45.32 ?  238  PHE B O   1 
ATOM   4991 C CB  . PHE B 1 238 ? 20.455  16.086 33.212  1.00 40.47 ?  238  PHE B CB  1 
ATOM   4992 C CG  . PHE B 1 238 ? 19.219  16.898 32.891  1.00 37.32 ?  238  PHE B CG  1 
ATOM   4993 C CD1 . PHE B 1 238 ? 18.394  16.534 31.863  1.00 35.57 ?  238  PHE B CD1 1 
ATOM   4994 C CD2 . PHE B 1 238 ? 18.933  18.057 33.595  1.00 36.69 ?  238  PHE B CD2 1 
ATOM   4995 C CE1 . PHE B 1 238 ? 17.267  17.296 31.542  1.00 37.34 ?  238  PHE B CE1 1 
ATOM   4996 C CE2 . PHE B 1 238 ? 17.822  18.818 33.295  1.00 35.95 ?  238  PHE B CE2 1 
ATOM   4997 C CZ  . PHE B 1 238 ? 16.988  18.446 32.263  1.00 36.39 ?  238  PHE B CZ  1 
ATOM   4998 N N   . ASN B 1 239 ? 23.592  15.540 32.611  1.00 46.62 ?  239  ASN B N   1 
ATOM   4999 C CA  . ASN B 1 239 ? 24.883  14.885 32.681  1.00 49.35 ?  239  ASN B CA  1 
ATOM   5000 C C   . ASN B 1 239 ? 25.910  15.974 32.929  1.00 50.19 ?  239  ASN B C   1 
ATOM   5001 O O   . ASN B 1 239 ? 26.559  16.459 31.984  1.00 50.72 ?  239  ASN B O   1 
ATOM   5002 C CB  . ASN B 1 239 ? 25.158  14.194 31.340  1.00 49.80 ?  239  ASN B CB  1 
ATOM   5003 C CG  . ASN B 1 239 ? 26.410  13.343 31.353  1.00 52.86 ?  239  ASN B CG  1 
ATOM   5004 O OD1 . ASN B 1 239 ? 27.391  13.642 32.052  1.00 56.98 ?  239  ASN B OD1 1 
ATOM   5005 N ND2 . ASN B 1 239 ? 26.393  12.272 30.563  1.00 54.86 ?  239  ASN B ND2 1 
ATOM   5006 N N   . LYS B 1 240 ? 26.053  16.348 34.204  1.00 50.74 ?  240  LYS B N   1 
ATOM   5007 C CA  . LYS B 1 240 ? 26.806  17.538 34.631  1.00 50.71 ?  240  LYS B CA  1 
ATOM   5008 C C   . LYS B 1 240 ? 28.275  17.626 34.132  1.00 50.14 ?  240  LYS B C   1 
ATOM   5009 O O   . LYS B 1 240 ? 29.064  18.457 34.618  1.00 50.56 ?  240  LYS B O   1 
ATOM   5010 C CB  . LYS B 1 240 ? 26.693  17.695 36.162  1.00 51.31 ?  240  LYS B CB  1 
ATOM   5011 C CG  . LYS B 1 240 ? 26.836  19.108 36.672  1.00 52.25 ?  240  LYS B CG  1 
ATOM   5012 C CD  . LYS B 1 240 ? 26.268  19.298 38.087  1.00 53.48 ?  240  LYS B CD  1 
ATOM   5013 C CE  . LYS B 1 240 ? 26.033  20.796 38.360  1.00 54.71 ?  240  LYS B CE  1 
ATOM   5014 N NZ  . LYS B 1 240 ? 25.740  21.170 39.788  1.00 54.47 ?  240  LYS B NZ  1 
ATOM   5015 N N   . PHE B 1 241 ? 28.630  16.783 33.161  1.00 49.17 ?  241  PHE B N   1 
ATOM   5016 C CA  . PHE B 1 241 ? 29.830  16.995 32.323  1.00 48.05 ?  241  PHE B CA  1 
ATOM   5017 C C   . PHE B 1 241 ? 29.453  17.280 30.865  1.00 45.90 ?  241  PHE B C   1 
ATOM   5018 O O   . PHE B 1 241 ? 28.892  16.425 30.170  1.00 45.77 ?  241  PHE B O   1 
ATOM   5019 C CB  . PHE B 1 241 ? 30.855  15.856 32.424  1.00 49.35 ?  241  PHE B CB  1 
ATOM   5020 C CG  . PHE B 1 241 ? 32.111  16.240 33.194  1.00 52.70 ?  241  PHE B CG  1 
ATOM   5021 C CD1 . PHE B 1 241 ? 33.031  15.268 33.600  1.00 54.27 ?  241  PHE B CD1 1 
ATOM   5022 C CD2 . PHE B 1 241 ? 32.364  17.592 33.534  1.00 54.83 ?  241  PHE B CD2 1 
ATOM   5023 C CE1 . PHE B 1 241 ? 34.193  15.637 34.311  1.00 55.04 ?  241  PHE B CE1 1 
ATOM   5024 C CE2 . PHE B 1 241 ? 33.516  17.969 34.252  1.00 54.81 ?  241  PHE B CE2 1 
ATOM   5025 C CZ  . PHE B 1 241 ? 34.431  16.995 34.639  1.00 54.24 ?  241  PHE B CZ  1 
ATOM   5026 N N   . ARG B 1 242 ? 29.760  18.492 30.419  1.00 42.73 ?  242  ARG B N   1 
ATOM   5027 C CA  . ARG B 1 242 ? 29.291  18.960 29.129  1.00 39.88 ?  242  ARG B CA  1 
ATOM   5028 C C   . ARG B 1 242 ? 30.122  18.427 27.954  1.00 37.81 ?  242  ARG B C   1 
ATOM   5029 O O   . ARG B 1 242 ? 31.346  18.496 27.968  1.00 37.16 ?  242  ARG B O   1 
ATOM   5030 C CB  . ARG B 1 242 ? 29.226  20.474 29.127  1.00 39.61 ?  242  ARG B CB  1 
ATOM   5031 C CG  . ARG B 1 242 ? 28.231  21.034 30.135  1.00 40.06 ?  242  ARG B CG  1 
ATOM   5032 C CD  . ARG B 1 242 ? 28.236  22.535 30.121  1.00 42.29 ?  242  ARG B CD  1 
ATOM   5033 N NE  . ARG B 1 242 ? 29.595  23.031 30.325  1.00 46.43 ?  242  ARG B NE  1 
ATOM   5034 C CZ  . ARG B 1 242 ? 30.011  23.582 31.457  1.00 49.50 ?  242  ARG B CZ  1 
ATOM   5035 N NH1 . ARG B 1 242 ? 29.154  23.719 32.464  1.00 49.60 ?  242  ARG B NH1 1 
ATOM   5036 N NH2 . ARG B 1 242 ? 31.271  23.997 31.582  1.00 51.68 ?  242  ARG B NH2 1 
ATOM   5037 N N   . VAL B 1 243 ? 29.437  17.915 26.941  1.00 35.19 ?  243  VAL B N   1 
ATOM   5038 C CA  . VAL B 1 243 ? 30.079  17.425 25.712  1.00 33.86 ?  243  VAL B CA  1 
ATOM   5039 C C   . VAL B 1 243 ? 30.701  18.574 24.888  1.00 31.33 ?  243  VAL B C   1 
ATOM   5040 O O   . VAL B 1 243 ? 30.106  19.633 24.794  1.00 30.31 ?  243  VAL B O   1 
ATOM   5041 C CB  . VAL B 1 243 ? 29.071  16.516 24.893  1.00 34.23 ?  243  VAL B CB  1 
ATOM   5042 C CG1 . VAL B 1 243 ? 27.639  16.922 25.154  1.00 35.86 ?  243  VAL B CG1 1 
ATOM   5043 C CG2 . VAL B 1 243 ? 29.375  16.435 23.398  1.00 33.48 ?  243  VAL B CG2 1 
ATOM   5044 N N   . PRO B 1 244 ? 31.929  18.369 24.328  1.00 29.12 ?  244  PRO B N   1 
ATOM   5045 C CA  . PRO B 1 244 ? 32.512  19.390 23.470  1.00 26.65 ?  244  PRO B CA  1 
ATOM   5046 C C   . PRO B 1 244 ? 31.531  19.858 22.390  1.00 24.07 ?  244  PRO B C   1 
ATOM   5047 O O   . PRO B 1 244 ? 30.779  19.050 21.827  1.00 24.37 ?  244  PRO B O   1 
ATOM   5048 C CB  . PRO B 1 244 ? 33.713  18.676 22.837  1.00 26.08 ?  244  PRO B CB  1 
ATOM   5049 C CG  . PRO B 1 244 ? 34.143  17.688 23.872  1.00 28.34 ?  244  PRO B CG  1 
ATOM   5050 C CD  . PRO B 1 244 ? 32.823  17.195 24.447  1.00 29.86 ?  244  PRO B CD  1 
ATOM   5051 N N   . THR B 1 245 ? 31.543  21.153 22.107  1.00 22.00 ?  245  THR B N   1 
ATOM   5052 C CA  . THR B 1 245 ? 30.639  21.717 21.100  1.00 20.02 ?  245  THR B CA  1 
ATOM   5053 C C   . THR B 1 245 ? 31.274  21.657 19.744  1.00 19.45 ?  245  THR B C   1 
ATOM   5054 O O   . THR B 1 245 ? 32.494  21.464 19.650  1.00 18.99 ?  245  THR B O   1 
ATOM   5055 C CB  . THR B 1 245 ? 30.322  23.191 21.401  1.00 19.12 ?  245  THR B CB  1 
ATOM   5056 O OG1 . THR B 1 245 ? 31.542  23.947 21.483  1.00 19.38 ?  245  THR B OG1 1 
ATOM   5057 C CG2 . THR B 1 245 ? 29.529  23.283 22.735  1.00 19.76 ?  245  THR B CG2 1 
ATOM   5058 N N   . PHE B 1 246 ? 30.470  21.858 18.700  1.00 18.07 ?  246  PHE B N   1 
ATOM   5059 C CA  . PHE B 1 246 ? 31.024  22.067 17.332  1.00 18.93 ?  246  PHE B CA  1 
ATOM   5060 C C   . PHE B 1 246 ? 32.001  23.239 17.283  1.00 18.93 ?  246  PHE B C   1 
ATOM   5061 O O   . PHE B 1 246 ? 33.057  23.159 16.669  1.00 18.01 ?  246  PHE B O   1 
ATOM   5062 C CB  . PHE B 1 246 ? 29.927  22.287 16.311  1.00 17.30 ?  246  PHE B CB  1 
ATOM   5063 C CG  . PHE B 1 246 ? 29.185  21.045 15.940  1.00 16.94 ?  246  PHE B CG  1 
ATOM   5064 C CD1 . PHE B 1 246 ? 27.866  20.897 16.298  1.00 17.86 ?  246  PHE B CD1 1 
ATOM   5065 C CD2 . PHE B 1 246 ? 29.803  20.043 15.174  1.00 16.20 ?  246  PHE B CD2 1 
ATOM   5066 C CE1 . PHE B 1 246 ? 27.138  19.786 15.928  1.00 18.29 ?  246  PHE B CE1 1 
ATOM   5067 C CE2 . PHE B 1 246 ? 29.096  18.884 14.786  1.00 18.15 ?  246  PHE B CE2 1 
ATOM   5068 C CZ  . PHE B 1 246 ? 27.760  18.760 15.145  1.00 20.41 ?  246  PHE B CZ  1 
ATOM   5069 N N   . LEU B 1 247 ? 31.672  24.305 18.002  1.00 18.44 ?  247  LEU B N   1 
ATOM   5070 C CA  . LEU B 1 247 ? 32.587  25.439 18.060  1.00 19.03 ?  247  LEU B CA  1 
ATOM   5071 C C   . LEU B 1 247 ? 33.992  25.031 18.544  1.00 18.18 ?  247  LEU B C   1 
ATOM   5072 O O   . LEU B 1 247 ? 34.998  25.458 17.967  1.00 17.76 ?  247  LEU B O   1 
ATOM   5073 C CB  . LEU B 1 247 ? 32.009  26.553 18.935  1.00 18.19 ?  247  LEU B CB  1 
ATOM   5074 C CG  . LEU B 1 247 ? 32.877  27.814 19.013  1.00 19.63 ?  247  LEU B CG  1 
ATOM   5075 C CD1 . LEU B 1 247 ? 33.242  28.434 17.641  1.00 17.05 ?  247  LEU B CD1 1 
ATOM   5076 C CD2 . LEU B 1 247 ? 32.221  28.816 19.972  1.00 20.18 ?  247  LEU B CD2 1 
ATOM   5077 N N   . SER B 1 248 ? 34.050  24.180 19.557  1.00 18.81 ?  248  SER B N   1 
ATOM   5078 C CA  . SER B 1 248 ? 35.347  23.769 20.134  1.00 20.77 ?  248  SER B CA  1 
ATOM   5079 C C   . SER B 1 248 ? 36.217  22.949 19.146  1.00 21.42 ?  248  SER B C   1 
ATOM   5080 O O   . SER B 1 248 ? 37.426  22.832 19.331  1.00 21.38 ?  248  SER B O   1 
ATOM   5081 C CB  . SER B 1 248 ? 35.132  22.963 21.428  1.00 19.91 ?  248  SER B CB  1 
ATOM   5082 O OG  . SER B 1 248 ? 34.543  21.709 21.103  1.00 21.04 ?  248  SER B OG  1 
ATOM   5083 N N   . MET B 1 249 ? 35.605  22.397 18.095  1.00 22.95 ?  249  MET B N   1 
ATOM   5084 C CA  . MET B 1 249 ? 36.355  21.572 17.147  1.00 23.45 ?  249  MET B CA  1 
ATOM   5085 C C   . MET B 1 249 ? 36.469  22.251 15.763  1.00 22.29 ?  249  MET B C   1 
ATOM   5086 O O   . MET B 1 249 ? 36.939  21.646 14.799  1.00 21.28 ?  249  MET B O   1 
ATOM   5087 C CB  . MET B 1 249 ? 35.780  20.139 17.079  1.00 24.50 ?  249  MET B CB  1 
ATOM   5088 C CG  . MET B 1 249 ? 34.283  20.007 17.123  1.00 25.42 ?  249  MET B CG  1 
ATOM   5089 S SD  . MET B 1 249 ? 33.488  18.350 17.224  1.00 29.78 ?  249  MET B SD  1 
ATOM   5090 C CE  . MET B 1 249 ? 33.298  18.261 15.505  1.00 29.09 ?  249  MET B CE  1 
ATOM   5091 N N   . ASP B 1 250 ? 36.126  23.547 15.710  1.00 19.25 ?  250  ASP B N   1 
ATOM   5092 C CA  . ASP B 1 250 ? 35.997  24.257 14.477  1.00 19.43 ?  250  ASP B CA  1 
ATOM   5093 C C   . ASP B 1 250 ? 37.304  24.669 13.784  1.00 19.79 ?  250  ASP B C   1 
ATOM   5094 O O   . ASP B 1 250 ? 37.560  25.850 13.645  1.00 19.85 ?  250  ASP B O   1 
ATOM   5095 C CB  . ASP B 1 250 ? 35.062  25.470 14.642  1.00 19.47 ?  250  ASP B CB  1 
ATOM   5096 C CG  . ASP B 1 250 ? 34.617  26.010 13.307  1.00 20.22 ?  250  ASP B CG  1 
ATOM   5097 O OD1 . ASP B 1 250 ? 34.729  25.250 12.314  1.00 18.63 ?  250  ASP B OD1 1 
ATOM   5098 O OD2 . ASP B 1 250 ? 34.219  27.180 13.219  1.00 22.42 ?  250  ASP B OD2 1 
ATOM   5099 N N   . VAL B 1 251 ? 38.124  23.709 13.370  1.00 19.29 ?  251  VAL B N   1 
ATOM   5100 C CA  . VAL B 1 251 ? 39.404  23.985 12.695  1.00 20.16 ?  251  VAL B CA  1 
ATOM   5101 C C   . VAL B 1 251 ? 39.176  24.800 11.416  1.00 19.59 ?  251  VAL B C   1 
ATOM   5102 O O   . VAL B 1 251 ? 40.011  25.626 11.058  1.00 20.49 ?  251  VAL B O   1 
ATOM   5103 C CB  . VAL B 1 251 ? 40.152  22.618 12.329  1.00 19.17 ?  251  VAL B CB  1 
ATOM   5104 C CG1 . VAL B 1 251 ? 41.432  22.869 11.575  1.00 22.33 ?  251  VAL B CG1 1 
ATOM   5105 C CG2 . VAL B 1 251 ? 40.471  21.851 13.583  1.00 23.49 ?  251  VAL B CG2 1 
ATOM   5106 N N   . ASP B 1 252 ? 38.063  24.578 10.718  1.00 18.48 ?  252  ASP B N   1 
ATOM   5107 C CA  . ASP B 1 252 ? 37.854  25.253 9.417   1.00 19.22 ?  252  ASP B CA  1 
ATOM   5108 C C   . ASP B 1 252 ? 37.189  26.649 9.445   1.00 18.83 ?  252  ASP B C   1 
ATOM   5109 O O   . ASP B 1 252 ? 37.056  27.272 8.391   1.00 18.67 ?  252  ASP B O   1 
ATOM   5110 C CB  . ASP B 1 252 ? 37.019  24.365 8.444   1.00 19.94 ?  252  ASP B CB  1 
ATOM   5111 C CG  . ASP B 1 252 ? 37.637  22.989 8.224   1.00 23.38 ?  252  ASP B CG  1 
ATOM   5112 O OD1 . ASP B 1 252 ? 38.892  22.870 8.421   1.00 26.41 ?  252  ASP B OD1 1 
ATOM   5113 O OD2 . ASP B 1 252 ? 36.872  22.042 7.889   1.00 22.94 ?  252  ASP B OD2 1 
ATOM   5114 N N   . GLY B 1 253 ? 36.698  27.096 10.607  1.00 17.16 ?  253  GLY B N   1 
ATOM   5115 C CA  . GLY B 1 253 ? 35.896  28.313 10.652  1.00 15.14 ?  253  GLY B CA  1 
ATOM   5116 C C   . GLY B 1 253 ? 34.574  28.146 9.868   1.00 15.84 ?  253  GLY B C   1 
ATOM   5117 O O   . GLY B 1 253 ? 34.173  29.048 9.129   1.00 15.42 ?  253  GLY B O   1 
ATOM   5118 N N   . ARG B 1 254 ? 33.885  27.012 10.041  1.00 15.04 ?  254  ARG B N   1 
ATOM   5119 C CA  . ARG B 1 254 ? 32.609  26.759 9.327   1.00 14.77 ?  254  ARG B CA  1 
ATOM   5120 C C   . ARG B 1 254 ? 31.395  26.749 10.308  1.00 14.76 ?  254  ARG B C   1 
ATOM   5121 O O   . ARG B 1 254 ? 30.281  26.437 9.932   1.00 13.49 ?  254  ARG B O   1 
ATOM   5122 C CB  . ARG B 1 254 ? 32.715  25.410 8.517   1.00 14.16 ?  254  ARG B CB  1 
ATOM   5123 C CG  . ARG B 1 254 ? 32.779  24.121 9.382   1.00 15.24 ?  254  ARG B CG  1 
ATOM   5124 C CD  . ARG B 1 254 ? 32.811  22.800 8.559   1.00 15.08 ?  254  ARG B CD  1 
ATOM   5125 N NE  . ARG B 1 254 ? 33.976  22.759 7.599   1.00 14.45 ?  254  ARG B NE  1 
ATOM   5126 C CZ  . ARG B 1 254 ? 33.973  23.198 6.342   1.00 15.08 ?  254  ARG B CZ  1 
ATOM   5127 N NH1 . ARG B 1 254 ? 32.880  23.747 5.779   1.00 14.07 ?  254  ARG B NH1 1 
ATOM   5128 N NH2 . ARG B 1 254 ? 35.107  23.128 5.633   1.00 16.41 ?  254  ARG B NH2 1 
ATOM   5129 N N   . VAL B 1 255 ? 31.638  27.060 11.588  1.00 15.07 ?  255  VAL B N   1 
ATOM   5130 C CA  . VAL B 1 255 ? 30.595  26.956 12.598  1.00 13.74 ?  255  VAL B CA  1 
ATOM   5131 C C   . VAL B 1 255 ? 30.123  28.344 13.000  1.00 14.46 ?  255  VAL B C   1 
ATOM   5132 O O   . VAL B 1 255 ? 30.936  29.223 13.309  1.00 14.00 ?  255  VAL B O   1 
ATOM   5133 C CB  . VAL B 1 255 ? 31.050  26.166 13.875  1.00 14.45 ?  255  VAL B CB  1 
ATOM   5134 C CG1 . VAL B 1 255 ? 29.880  26.116 14.917  1.00 11.27 ?  255  VAL B CG1 1 
ATOM   5135 C CG2 . VAL B 1 255 ? 31.521  24.735 13.466  1.00 13.70 ?  255  VAL B CG2 1 
ATOM   5136 N N   . ILE B 1 256 ? 28.806  28.542 12.974  1.00 15.08 ?  256  ILE B N   1 
ATOM   5137 C CA  . ILE B 1 256 ? 28.177  29.707 13.622  1.00 15.71 ?  256  ILE B CA  1 
ATOM   5138 C C   . ILE B 1 256 ? 27.351  29.174 14.790  1.00 16.87 ?  256  ILE B C   1 
ATOM   5139 O O   . ILE B 1 256 ? 26.494  28.299 14.632  1.00 17.09 ?  256  ILE B O   1 
ATOM   5140 C CB  . ILE B 1 256 ? 27.195  30.480 12.658  1.00 16.37 ?  256  ILE B CB  1 
ATOM   5141 C CG1 . ILE B 1 256 ? 27.917  30.915 11.372  1.00 16.38 ?  256  ILE B CG1 1 
ATOM   5142 C CG2 . ILE B 1 256 ? 26.610  31.734 13.369  1.00 15.06 ?  256  ILE B CG2 1 
ATOM   5143 C CD1 . ILE B 1 256 ? 26.985  31.115 10.176  1.00 14.49 ?  256  ILE B CD1 1 
ATOM   5144 N N   . ARG B 1 257 ? 27.609  29.711 15.971  1.00 17.88 ?  257  ARG B N   1 
ATOM   5145 C CA  . ARG B 1 257 ? 26.944  29.258 17.183  1.00 17.03 ?  257  ARG B CA  1 
ATOM   5146 C C   . ARG B 1 257 ? 26.069  30.378 17.770  1.00 17.21 ?  257  ARG B C   1 
ATOM   5147 O O   . ARG B 1 257 ? 26.538  31.490 17.956  1.00 16.88 ?  257  ARG B O   1 
ATOM   5148 C CB  . ARG B 1 257 ? 27.993  28.852 18.206  1.00 17.32 ?  257  ARG B CB  1 
ATOM   5149 C CG  . ARG B 1 257 ? 27.407  28.353 19.535  1.00 16.88 ?  257  ARG B CG  1 
ATOM   5150 C CD  . ARG B 1 257 ? 28.544  28.117 20.553  1.00 17.28 ?  257  ARG B CD  1 
ATOM   5151 N NE  . ARG B 1 257 ? 28.032  27.789 21.876  1.00 14.07 ?  257  ARG B NE  1 
ATOM   5152 C CZ  . ARG B 1 257 ? 27.540  26.610 22.242  1.00 19.26 ?  257  ARG B CZ  1 
ATOM   5153 N NH1 . ARG B 1 257 ? 27.469  25.590 21.380  1.00 17.97 ?  257  ARG B NH1 1 
ATOM   5154 N NH2 . ARG B 1 257 ? 27.097  26.448 23.498  1.00 19.66 ?  257  ARG B NH2 1 
ATOM   5155 N N   . ALA B 1 258 ? 24.830  30.023 18.101  1.00 17.05 ?  258  ALA B N   1 
ATOM   5156 C CA  . ALA B 1 258 ? 23.893  30.872 18.844  1.00 18.85 ?  258  ALA B CA  1 
ATOM   5157 C C   . ALA B 1 258 ? 23.782  30.346 20.280  1.00 19.52 ?  258  ALA B C   1 
ATOM   5158 O O   . ALA B 1 258 ? 23.567  29.136 20.519  1.00 19.88 ?  258  ALA B O   1 
ATOM   5159 C CB  . ALA B 1 258 ? 22.549  30.866 18.188  1.00 17.42 ?  258  ALA B CB  1 
ATOM   5160 N N   . ASP B 1 259 ? 23.994  31.247 21.236  1.00 19.37 ?  259  ASP B N   1 
ATOM   5161 C CA  . ASP B 1 259 ? 23.861  30.908 22.658  1.00 20.72 ?  259  ASP B CA  1 
ATOM   5162 C C   . ASP B 1 259 ? 22.735  31.827 23.176  1.00 20.92 ?  259  ASP B C   1 
ATOM   5163 O O   . ASP B 1 259 ? 22.507  32.920 22.626  1.00 19.67 ?  259  ASP B O   1 
ATOM   5164 C CB  . ASP B 1 259 ? 25.136  31.273 23.410  1.00 19.30 ?  259  ASP B CB  1 
ATOM   5165 C CG  . ASP B 1 259 ? 26.137  30.119 23.529  1.00 25.37 ?  259  ASP B CG  1 
ATOM   5166 O OD1 . ASP B 1 259 ? 25.955  29.199 24.401  1.00 28.07 ?  259  ASP B OD1 1 
ATOM   5167 O OD2 . ASP B 1 259 ? 27.156  30.191 22.810  1.00 26.27 ?  259  ASP B OD2 1 
ATOM   5168 N N   . SER B 1 260 ? 22.099  31.401 24.262  1.00 21.45 ?  260  SER B N   1 
ATOM   5169 C CA  . SER B 1 260 ? 21.018  32.127 24.869  1.00 23.27 ?  260  SER B CA  1 
ATOM   5170 C C   . SER B 1 260 ? 21.175  32.251 26.411  1.00 24.02 ?  260  SER B C   1 
ATOM   5171 O O   . SER B 1 260 ? 21.589  31.309 27.104  1.00 22.59 ?  260  SER B O   1 
ATOM   5172 C CB  . SER B 1 260 ? 19.702  31.443 24.531  1.00 23.13 ?  260  SER B CB  1 
ATOM   5173 O OG  . SER B 1 260 ? 18.613  32.141 25.147  1.00 27.97 ?  260  SER B OG  1 
ATOM   5174 N N   . PHE B 1 261 ? 20.844  33.433 26.933  1.00 24.97 ?  261  PHE B N   1 
ATOM   5175 C CA  . PHE B 1 261 ? 20.663  33.598 28.377  1.00 25.36 ?  261  PHE B CA  1 
ATOM   5176 C C   . PHE B 1 261 ? 19.193  33.349 28.777  1.00 24.74 ?  261  PHE B C   1 
ATOM   5177 O O   . PHE B 1 261 ? 18.859  33.435 29.962  1.00 23.26 ?  261  PHE B O   1 
ATOM   5178 C CB  . PHE B 1 261 ? 21.016  35.017 28.807  1.00 26.50 ?  261  PHE B CB  1 
ATOM   5179 C CG  . PHE B 1 261 ? 22.489  35.305 28.918  1.00 28.81 ?  261  PHE B CG  1 
ATOM   5180 C CD1 . PHE B 1 261 ? 23.357  34.446 29.574  1.00 31.33 ?  261  PHE B CD1 1 
ATOM   5181 C CD2 . PHE B 1 261 ? 23.001  36.481 28.389  1.00 31.70 ?  261  PHE B CD2 1 
ATOM   5182 C CE1 . PHE B 1 261 ? 24.725  34.757 29.703  1.00 32.02 ?  261  PHE B CE1 1 
ATOM   5183 C CE2 . PHE B 1 261 ? 24.359  36.776 28.492  1.00 31.59 ?  261  PHE B CE2 1 
ATOM   5184 C CZ  . PHE B 1 261 ? 25.210  35.908 29.176  1.00 31.19 ?  261  PHE B CZ  1 
ATOM   5185 N N   . SER B 1 262 ? 18.314  33.092 27.802  1.00 24.10 ?  262  SER B N   1 
ATOM   5186 C CA  . SER B 1 262 ? 16.875  32.958 28.081  1.00 25.80 ?  262  SER B CA  1 
ATOM   5187 C C   . SER B 1 262 ? 16.468  31.894 29.104  1.00 27.33 ?  262  SER B C   1 
ATOM   5188 O O   . SER B 1 262 ? 15.440  32.040 29.775  1.00 27.91 ?  262  SER B O   1 
ATOM   5189 C CB  . SER B 1 262 ? 16.065  32.689 26.809  1.00 26.16 ?  262  SER B CB  1 
ATOM   5190 O OG  . SER B 1 262 ? 16.069  33.782 25.915  1.00 25.76 ?  262  SER B OG  1 
ATOM   5191 N N   . LYS B 1 263 ? 17.227  30.809 29.201  1.00 27.83 ?  263  LYS B N   1 
ATOM   5192 C CA  . LYS B 1 263 ? 16.804  29.709 30.068  1.00 29.12 ?  263  LYS B CA  1 
ATOM   5193 C C   . LYS B 1 263 ? 17.375  29.838 31.448  1.00 28.95 ?  263  LYS B C   1 
ATOM   5194 O O   . LYS B 1 263 ? 16.802  29.295 32.390  1.00 30.37 ?  263  LYS B O   1 
ATOM   5195 C CB  . LYS B 1 263 ? 17.151  28.337 29.475  1.00 29.38 ?  263  LYS B CB  1 
ATOM   5196 C CG  . LYS B 1 263 ? 16.954  28.237 27.943  1.00 32.42 ?  263  LYS B CG  1 
ATOM   5197 C CD  . LYS B 1 263 ? 15.532  28.620 27.505  1.00 36.62 ?  263  LYS B CD  1 
ATOM   5198 C CE  . LYS B 1 263 ? 15.466  28.824 26.003  1.00 39.74 ?  263  LYS B CE  1 
ATOM   5199 N NZ  . LYS B 1 263 ? 14.046  29.010 25.582  1.00 40.18 ?  263  LYS B NZ  1 
ATOM   5200 N N   . ILE B 1 264 ? 18.478  30.577 31.574  1.00 28.41 ?  264  ILE B N   1 
ATOM   5201 C CA  . ILE B 1 264 ? 19.233  30.636 32.788  1.00 28.69 ?  264  ILE B CA  1 
ATOM   5202 C C   . ILE B 1 264 ? 19.245  31.990 33.480  1.00 29.06 ?  264  ILE B C   1 
ATOM   5203 O O   . ILE B 1 264 ? 19.430  32.064 34.706  1.00 30.10 ?  264  ILE B O   1 
ATOM   5204 C CB  . ILE B 1 264 ? 20.664  30.130 32.579  1.00 29.07 ?  264  ILE B CB  1 
ATOM   5205 C CG1 . ILE B 1 264 ? 21.457  31.030 31.643  1.00 29.37 ?  264  ILE B CG1 1 
ATOM   5206 C CG2 . ILE B 1 264 ? 20.616  28.656 32.092  1.00 30.73 ?  264  ILE B CG2 1 
ATOM   5207 C CD1 . ILE B 1 264 ? 22.956  30.658 31.487  1.00 28.38 ?  264  ILE B CD1 1 
ATOM   5208 N N   . ILE B 1 265 ? 19.036  33.068 32.721  1.00 27.83 ?  265  ILE B N   1 
ATOM   5209 C CA  . ILE B 1 265 ? 19.066  34.383 33.313  1.00 26.35 ?  265  ILE B CA  1 
ATOM   5210 C C   . ILE B 1 265 ? 17.709  35.115 33.119  1.00 26.08 ?  265  ILE B C   1 
ATOM   5211 O O   . ILE B 1 265 ? 17.105  35.538 34.125  1.00 24.59 ?  265  ILE B O   1 
ATOM   5212 C CB  . ILE B 1 265 ? 20.314  35.179 32.911  1.00 27.25 ?  265  ILE B CB  1 
ATOM   5213 C CG1 . ILE B 1 265 ? 21.580  34.453 33.443  1.00 28.15 ?  265  ILE B CG1 1 
ATOM   5214 C CG2 . ILE B 1 265 ? 20.277  36.576 33.526  1.00 26.15 ?  265  ILE B CG2 1 
ATOM   5215 C CD1 . ILE B 1 265 ? 22.901  35.133 33.083  1.00 31.21 ?  265  ILE B CD1 1 
ATOM   5216 N N   . SER B 1 266 ? 17.220  35.226 31.874  1.00 22.44 ?  266  SER B N   1 
ATOM   5217 C CA  . SER B 1 266 ? 15.912  35.818 31.615  1.00 21.19 ?  266  SER B CA  1 
ATOM   5218 C C   . SER B 1 266 ? 15.538  35.726 30.163  1.00 20.99 ?  266  SER B C   1 
ATOM   5219 O O   . SER B 1 266 ? 16.272  36.215 29.290  1.00 20.03 ?  266  SER B O   1 
ATOM   5220 C CB  . SER B 1 266 ? 15.886  37.317 32.013  1.00 21.81 ?  266  SER B CB  1 
ATOM   5221 O OG  . SER B 1 266 ? 14.651  37.908 31.595  1.00 22.54 ?  266  SER B OG  1 
ATOM   5222 N N   . SER B 1 267 ? 14.372  35.155 29.896  1.00 19.96 ?  267  SER B N   1 
ATOM   5223 C CA  . SER B 1 267 ? 13.837  35.168 28.553  1.00 19.73 ?  267  SER B CA  1 
ATOM   5224 C C   . SER B 1 267 ? 13.258  36.560 28.127  1.00 20.26 ?  267  SER B C   1 
ATOM   5225 O O   . SER B 1 267 ? 13.409  36.991 26.974  1.00 19.39 ?  267  SER B O   1 
ATOM   5226 C CB  . SER B 1 267 ? 12.765  34.110 28.466  1.00 20.11 ?  267  SER B CB  1 
ATOM   5227 O OG  . SER B 1 267 ? 11.966  34.133 29.631  1.00 19.60 ?  267  SER B OG  1 
ATOM   5228 N N   . GLY B 1 268 ? 12.596  37.242 29.052  1.00 18.86 ?  268  GLY B N   1 
ATOM   5229 C CA  . GLY B 1 268 ? 11.989  38.554 28.768  1.00 18.85 ?  268  GLY B CA  1 
ATOM   5230 C C   . GLY B 1 268 ? 12.940  39.719 28.567  1.00 18.13 ?  268  GLY B C   1 
ATOM   5231 O O   . GLY B 1 268 ? 12.576  40.677 27.945  1.00 20.20 ?  268  GLY B O   1 
ATOM   5232 N N   . LEU B 1 269 ? 14.168  39.653 29.049  1.00 16.64 ?  269  LEU B N   1 
ATOM   5233 C CA  . LEU B 1 269 ? 15.123  40.709 28.749  1.00 16.54 ?  269  LEU B CA  1 
ATOM   5234 C C   . LEU B 1 269 ? 15.654  40.680 27.272  1.00 17.28 ?  269  LEU B C   1 
ATOM   5235 O O   . LEU B 1 269 ? 16.270  41.641 26.858  1.00 17.48 ?  269  LEU B O   1 
ATOM   5236 C CB  . LEU B 1 269 ? 16.320  40.690 29.707  1.00 17.11 ?  269  LEU B CB  1 
ATOM   5237 C CG  . LEU B 1 269 ? 16.101  40.983 31.220  1.00 18.34 ?  269  LEU B CG  1 
ATOM   5238 C CD1 . LEU B 1 269 ? 17.402  41.038 31.897  1.00 15.28 ?  269  LEU B CD1 1 
ATOM   5239 C CD2 . LEU B 1 269 ? 15.389  42.332 31.448  1.00 13.72 ?  269  LEU B CD2 1 
ATOM   5240 N N   . ARG B 1 270 ? 15.448  39.591 26.519  1.00 17.16 ?  270  ARG B N   1 
ATOM   5241 C CA  . ARG B 1 270 ? 15.837  39.567 25.079  1.00 17.81 ?  270  ARG B CA  1 
ATOM   5242 C C   . ARG B 1 270 ? 17.336  39.885 24.910  1.00 17.98 ?  270  ARG B C   1 
ATOM   5243 O O   . ARG B 1 270 ? 17.696  40.865 24.272  1.00 18.25 ?  270  ARG B O   1 
ATOM   5244 C CB  . ARG B 1 270 ? 15.006  40.570 24.251  1.00 17.17 ?  270  ARG B CB  1 
ATOM   5245 C CG  . ARG B 1 270 ? 13.488  40.312 24.186  1.00 16.30 ?  270  ARG B CG  1 
ATOM   5246 C CD  . ARG B 1 270 ? 13.114  38.809 24.287  1.00 18.47 ?  270  ARG B CD  1 
ATOM   5247 N NE  . ARG B 1 270 ? 13.432  38.121 23.057  1.00 21.77 ?  270  ARG B NE  1 
ATOM   5248 C CZ  . ARG B 1 270 ? 13.919  36.885 22.996  1.00 19.74 ?  270  ARG B CZ  1 
ATOM   5249 N NH1 . ARG B 1 270 ? 14.093  36.143 24.093  1.00 16.28 ?  270  ARG B NH1 1 
ATOM   5250 N NH2 . ARG B 1 270 ? 14.192  36.383 21.818  1.00 20.08 ?  270  ARG B NH2 1 
ATOM   5251 N N   . ILE B 1 271 ? 18.197  39.035 25.467  1.00 18.54 ?  271  ILE B N   1 
ATOM   5252 C CA  . ILE B 1 271 ? 19.674  39.194 25.343  1.00 19.14 ?  271  ILE B CA  1 
ATOM   5253 C C   . ILE B 1 271 ? 20.199  37.817 25.029  1.00 18.87 ?  271  ILE B C   1 
ATOM   5254 O O   . ILE B 1 271 ? 20.053  36.891 25.841  1.00 19.08 ?  271  ILE B O   1 
ATOM   5255 C CB  . ILE B 1 271 ? 20.357  39.667 26.665  1.00 20.24 ?  271  ILE B CB  1 
ATOM   5256 C CG1 . ILE B 1 271 ? 19.733  40.951 27.209  1.00 20.06 ?  271  ILE B CG1 1 
ATOM   5257 C CG2 . ILE B 1 271 ? 21.891  39.859 26.502  1.00 20.18 ?  271  ILE B CG2 1 
ATOM   5258 C CD1 . ILE B 1 271 ? 20.128  42.215 26.390  1.00 23.76 ?  271  ILE B CD1 1 
ATOM   5259 N N   . GLY B 1 272 ? 20.774  37.661 23.834  1.00 18.52 ?  272  GLY B N   1 
ATOM   5260 C CA  . GLY B 1 272 ? 21.494  36.423 23.465  1.00 16.57 ?  272  GLY B CA  1 
ATOM   5261 C C   . GLY B 1 272 ? 22.804  36.803 22.766  1.00 16.44 ?  272  GLY B C   1 
ATOM   5262 O O   . GLY B 1 272 ? 23.119  37.995 22.650  1.00 15.00 ?  272  GLY B O   1 
ATOM   5263 N N   . PHE B 1 273 ? 23.569  35.810 22.322  1.00 14.92 ?  273  PHE B N   1 
ATOM   5264 C CA  . PHE B 1 273 ? 24.826  36.101 21.611  1.00 17.53 ?  273  PHE B CA  1 
ATOM   5265 C C   . PHE B 1 273 ? 25.135  35.137 20.453  1.00 17.28 ?  273  PHE B C   1 
ATOM   5266 O O   . PHE B 1 273 ? 24.707  33.973 20.462  1.00 19.14 ?  273  PHE B O   1 
ATOM   5267 C CB  . PHE B 1 273 ? 26.019  36.319 22.551  1.00 16.89 ?  273  PHE B CB  1 
ATOM   5268 C CG  . PHE B 1 273 ? 26.202  35.240 23.616  1.00 20.00 ?  273  PHE B CG  1 
ATOM   5269 C CD1 . PHE B 1 273 ? 25.344  35.146 24.696  1.00 19.72 ?  273  PHE B CD1 1 
ATOM   5270 C CD2 . PHE B 1 273 ? 27.289  34.381 23.555  1.00 20.71 ?  273  PHE B CD2 1 
ATOM   5271 C CE1 . PHE B 1 273 ? 25.532  34.194 25.690  1.00 21.99 ?  273  PHE B CE1 1 
ATOM   5272 C CE2 . PHE B 1 273 ? 27.509  33.436 24.554  1.00 22.45 ?  273  PHE B CE2 1 
ATOM   5273 C CZ  . PHE B 1 273 ? 26.629  33.339 25.619  1.00 22.27 ?  273  PHE B CZ  1 
ATOM   5274 N N   . LEU B 1 274 ? 25.772  35.666 19.429  1.00 16.41 ?  274  LEU B N   1 
ATOM   5275 C CA  . LEU B 1 274 ? 26.095  34.906 18.224  1.00 17.75 ?  274  LEU B CA  1 
ATOM   5276 C C   . LEU B 1 274 ? 27.595  34.899 18.150  1.00 17.01 ?  274  LEU B C   1 
ATOM   5277 O O   . LEU B 1 274 ? 28.192  35.939 18.376  1.00 15.88 ?  274  LEU B O   1 
ATOM   5278 C CB  . LEU B 1 274 ? 25.516  35.647 16.995  1.00 17.09 ?  274  LEU B CB  1 
ATOM   5279 C CG  . LEU B 1 274 ? 25.359  34.886 15.686  1.00 19.32 ?  274  LEU B CG  1 
ATOM   5280 C CD1 . LEU B 1 274 ? 24.406  33.661 15.779  1.00 17.64 ?  274  LEU B CD1 1 
ATOM   5281 C CD2 . LEU B 1 274 ? 24.904  35.850 14.592  1.00 16.29 ?  274  LEU B CD2 1 
ATOM   5282 N N   . THR B 1 275 ? 28.189  33.725 17.902  1.00 16.71 ?  275  THR B N   1 
ATOM   5283 C CA  . THR B 1 275 ? 29.637  33.571 17.837  1.00 17.10 ?  275  THR B CA  1 
ATOM   5284 C C   . THR B 1 275 ? 29.987  32.861 16.517  1.00 16.92 ?  275  THR B C   1 
ATOM   5285 O O   . THR B 1 275 ? 29.383  31.864 16.174  1.00 15.97 ?  275  THR B O   1 
ATOM   5286 C CB  . THR B 1 275 ? 30.177  32.689 19.010  1.00 17.34 ?  275  THR B CB  1 
ATOM   5287 O OG1 . THR B 1 275 ? 29.705  33.180 20.277  1.00 19.44 ?  275  THR B OG1 1 
ATOM   5288 C CG2 . THR B 1 275 ? 31.745  32.693 19.040  1.00 17.22 ?  275  THR B CG2 1 
ATOM   5289 N N   . GLY B 1 276 ? 30.989  33.353 15.799  1.00 16.84 ?  276  GLY B N   1 
ATOM   5290 C CA  . GLY B 1 276 ? 31.433  32.670 14.575  1.00 17.47 ?  276  GLY B CA  1 
ATOM   5291 C C   . GLY B 1 276 ? 32.419  33.483 13.759  1.00 17.02 ?  276  GLY B C   1 
ATOM   5292 O O   . GLY B 1 276 ? 32.998  34.453 14.283  1.00 15.97 ?  276  GLY B O   1 
ATOM   5293 N N   . PRO B 1 277 ? 32.615  33.096 12.468  1.00 16.56 ?  277  PRO B N   1 
ATOM   5294 C CA  . PRO B 1 277 ? 33.639  33.740 11.613  1.00 16.03 ?  277  PRO B CA  1 
ATOM   5295 C C   . PRO B 1 277 ? 33.357  35.216 11.498  1.00 16.34 ?  277  PRO B C   1 
ATOM   5296 O O   . PRO B 1 277 ? 32.253  35.620 11.148  1.00 16.26 ?  277  PRO B O   1 
ATOM   5297 C CB  . PRO B 1 277 ? 33.436  33.087 10.227  1.00 16.27 ?  277  PRO B CB  1 
ATOM   5298 C CG  . PRO B 1 277 ? 32.665  31.797 10.478  1.00 15.81 ?  277  PRO B CG  1 
ATOM   5299 C CD  . PRO B 1 277 ? 31.878  32.021 11.772  1.00 16.47 ?  277  PRO B CD  1 
ATOM   5300 N N   . LYS B 1 278 ? 34.378  36.016 11.697  1.00 16.40 ?  278  LYS B N   1 
ATOM   5301 C CA  . LYS B 1 278 ? 34.269  37.452 11.617  1.00 16.65 ?  278  LYS B CA  1 
ATOM   5302 C C   . LYS B 1 278 ? 33.559  38.048 10.402  1.00 16.44 ?  278  LYS B C   1 
ATOM   5303 O O   . LYS B 1 278 ? 32.738  38.911 10.586  1.00 17.21 ?  278  LYS B O   1 
ATOM   5304 C CB  . LYS B 1 278 ? 35.655  38.095 11.778  1.00 17.93 ?  278  LYS B CB  1 
ATOM   5305 C CG  . LYS B 1 278 ? 35.572  39.605 12.026  1.00 18.39 ?  278  LYS B CG  1 
ATOM   5306 C CD  . LYS B 1 278 ? 36.933  40.127 12.422  1.00 22.99 ?  278  LYS B CD  1 
ATOM   5307 C CE  . LYS B 1 278 ? 36.744  41.521 13.039  1.00 29.87 ?  278  LYS B CE  1 
ATOM   5308 N NZ  . LYS B 1 278 ? 37.206  42.553 12.067  1.00 31.72 ?  278  LYS B NZ  1 
ATOM   5309 N N   . PRO B 1 279 ? 33.867  37.602 9.163   1.00 16.15 ?  279  PRO B N   1 
ATOM   5310 C CA  . PRO B 1 279 ? 33.106  38.157 8.020   1.00 15.16 ?  279  PRO B CA  1 
ATOM   5311 C C   . PRO B 1 279 ? 31.585  37.901 8.084   1.00 15.91 ?  279  PRO B C   1 
ATOM   5312 O O   . PRO B 1 279 ? 30.836  38.730 7.620   1.00 16.83 ?  279  PRO B O   1 
ATOM   5313 C CB  . PRO B 1 279 ? 33.711  37.444 6.792   1.00 15.62 ?  279  PRO B CB  1 
ATOM   5314 C CG  . PRO B 1 279 ? 35.190  37.011 7.294   1.00 15.30 ?  279  PRO B CG  1 
ATOM   5315 C CD  . PRO B 1 279 ? 34.866  36.586 8.739   1.00 15.70 ?  279  PRO B CD  1 
ATOM   5316 N N   . LEU B 1 280 ? 31.138  36.798 8.677   1.00 14.43 ?  280  LEU B N   1 
ATOM   5317 C CA  . LEU B 1 280 ? 29.696  36.496 8.745   1.00 14.27 ?  280  LEU B CA  1 
ATOM   5318 C C   . LEU B 1 280 ? 29.085  37.299 9.891   1.00 13.68 ?  280  LEU B C   1 
ATOM   5319 O O   . LEU B 1 280 ? 28.032  37.897 9.761   1.00 13.66 ?  280  LEU B O   1 
ATOM   5320 C CB  . LEU B 1 280 ? 29.516  35.002 9.025   1.00 14.53 ?  280  LEU B CB  1 
ATOM   5321 C CG  . LEU B 1 280 ? 29.389  34.048 7.822   1.00 17.98 ?  280  LEU B CG  1 
ATOM   5322 C CD1 . LEU B 1 280 ? 29.791  34.680 6.527   1.00 14.27 ?  280  LEU B CD1 1 
ATOM   5323 C CD2 . LEU B 1 280 ? 29.946  32.677 8.043   1.00 16.68 ?  280  LEU B CD2 1 
ATOM   5324 N N   . ILE B 1 281 ? 29.769  37.316 11.013  1.00 13.12 ?  281  ILE B N   1 
ATOM   5325 C CA  . ILE B 1 281 ? 29.371  38.184 12.150  1.00 14.27 ?  281  ILE B CA  1 
ATOM   5326 C C   . ILE B 1 281 ? 29.231  39.643 11.701  1.00 14.88 ?  281  ILE B C   1 
ATOM   5327 O O   . ILE B 1 281 ? 28.224  40.288 12.026  1.00 14.18 ?  281  ILE B O   1 
ATOM   5328 C CB  . ILE B 1 281 ? 30.354  38.036 13.354  1.00 14.51 ?  281  ILE B CB  1 
ATOM   5329 C CG1 . ILE B 1 281 ? 30.338  36.597 13.872  1.00 14.54 ?  281  ILE B CG1 1 
ATOM   5330 C CG2 . ILE B 1 281 ? 30.059  39.103 14.479  1.00 15.02 ?  281  ILE B CG2 1 
ATOM   5331 C CD1 . ILE B 1 281 ? 28.929  36.085 14.315  1.00 18.48 ?  281  ILE B CD1 1 
ATOM   5332 N N   . GLU B 1 282 ? 30.181  40.138 10.896  1.00 13.85 ?  282  GLU B N   1 
ATOM   5333 C CA  . GLU B 1 282 ? 30.070  41.490 10.366  1.00 15.39 ?  282  GLU B CA  1 
ATOM   5334 C C   . GLU B 1 282 ? 28.793  41.710 9.514   1.00 14.47 ?  282  GLU B C   1 
ATOM   5335 O O   . GLU B 1 282 ? 28.181  42.752 9.617   1.00 11.98 ?  282  GLU B O   1 
ATOM   5336 C CB  . GLU B 1 282 ? 31.309  41.852 9.576   1.00 16.92 ?  282  GLU B CB  1 
ATOM   5337 C CG  . GLU B 1 282 ? 31.057  42.819 8.424   1.00 25.35 ?  282  GLU B CG  1 
ATOM   5338 C CD  . GLU B 1 282 ? 31.875  42.453 7.152   1.00 36.17 ?  282  GLU B CD  1 
ATOM   5339 O OE1 . GLU B 1 282 ? 31.684  41.324 6.490   1.00 32.11 ?  282  GLU B OE1 1 
ATOM   5340 O OE2 . GLU B 1 282 ? 32.686  43.366 6.829   1.00 39.06 ?  282  GLU B OE2 1 
ATOM   5341 N N   . ARG B 1 283 ? 28.396  40.715 8.722   1.00 14.27 ?  283  ARG B N   1 
ATOM   5342 C CA  . ARG B 1 283 ? 27.185  40.819 7.882   1.00 14.62 ?  283  ARG B CA  1 
ATOM   5343 C C   . ARG B 1 283 ? 25.964  40.903 8.782   1.00 13.57 ?  283  ARG B C   1 
ATOM   5344 O O   . ARG B 1 283 ? 25.053  41.666 8.489   1.00 13.78 ?  283  ARG B O   1 
ATOM   5345 C CB  . ARG B 1 283 ? 27.037  39.639 6.901   1.00 14.53 ?  283  ARG B CB  1 
ATOM   5346 C CG  . ARG B 1 283 ? 28.207  39.405 5.824   1.00 16.16 ?  283  ARG B CG  1 
ATOM   5347 C CD  . ARG B 1 283 ? 29.109  40.642 5.571   1.00 26.48 ?  283  ARG B CD  1 
ATOM   5348 N NE  . ARG B 1 283 ? 28.463  41.578 4.730   1.00 22.07 ?  283  ARG B NE  1 
ATOM   5349 C CZ  . ARG B 1 283 ? 28.856  42.809 4.394   1.00 23.30 ?  283  ARG B CZ  1 
ATOM   5350 N NH1 . ARG B 1 283 ? 29.973  43.411 4.824   1.00 22.65 ?  283  ARG B NH1 1 
ATOM   5351 N NH2 . ARG B 1 283 ? 28.056  43.460 3.565   1.00 19.34 ?  283  ARG B NH2 1 
ATOM   5352 N N   . VAL B 1 284 ? 25.953  40.130 9.866   1.00 12.97 ?  284  VAL B N   1 
ATOM   5353 C CA  . VAL B 1 284 ? 24.826  40.162 10.833  1.00 13.15 ?  284  VAL B CA  1 
ATOM   5354 C C   . VAL B 1 284 ? 24.752  41.519 11.566  1.00 13.55 ?  284  VAL B C   1 
ATOM   5355 O O   . VAL B 1 284 ? 23.687  42.128 11.661  1.00 13.73 ?  284  VAL B O   1 
ATOM   5356 C CB  . VAL B 1 284 ? 24.919  38.991 11.844  1.00 14.38 ?  284  VAL B CB  1 
ATOM   5357 C CG1 . VAL B 1 284 ? 23.897  39.161 13.022  1.00 13.12 ?  284  VAL B CG1 1 
ATOM   5358 C CG2 . VAL B 1 284 ? 24.754  37.623 11.121  1.00 12.04 ?  284  VAL B CG2 1 
ATOM   5359 N N   . ILE B 1 285 ? 25.882  42.027 12.055  1.00 12.49 ?  285  ILE B N   1 
ATOM   5360 C CA  . ILE B 1 285 ? 25.898  43.359 12.675  1.00 13.15 ?  285  ILE B CA  1 
ATOM   5361 C C   . ILE B 1 285 ? 25.403  44.475 11.730  1.00 12.74 ?  285  ILE B C   1 
ATOM   5362 O O   . ILE B 1 285 ? 24.670  45.377 12.145  1.00 12.38 ?  285  ILE B O   1 
ATOM   5363 C CB  . ILE B 1 285 ? 27.324  43.722 13.198  1.00 13.08 ?  285  ILE B CB  1 
ATOM   5364 C CG1 . ILE B 1 285 ? 27.757  42.777 14.338  1.00 14.86 ?  285  ILE B CG1 1 
ATOM   5365 C CG2 . ILE B 1 285 ? 27.365  45.167 13.692  1.00 14.81 ?  285  ILE B CG2 1 
ATOM   5366 C CD1 . ILE B 1 285 ? 29.364  42.834 14.570  1.00 13.47 ?  285  ILE B CD1 1 
ATOM   5367 N N   . LEU B 1 286 ? 25.826  44.450 10.470  1.00 12.11 ?  286  LEU B N   1 
ATOM   5368 C CA  . LEU B 1 286 ? 25.315  45.438 9.526   1.00 13.08 ?  286  LEU B CA  1 
ATOM   5369 C C   . LEU B 1 286 ? 23.783  45.311 9.379   1.00 13.54 ?  286  LEU B C   1 
ATOM   5370 O O   . LEU B 1 286 ? 23.112  46.312 9.245   1.00 12.93 ?  286  LEU B O   1 
ATOM   5371 C CB  . LEU B 1 286 ? 26.018  45.316 8.171   1.00 12.41 ?  286  LEU B CB  1 
ATOM   5372 C CG  . LEU B 1 286 ? 27.528  45.667 8.225   1.00 15.53 ?  286  LEU B CG  1 
ATOM   5373 C CD1 . LEU B 1 286 ? 28.210  45.426 6.839   1.00 14.99 ?  286  LEU B CD1 1 
ATOM   5374 C CD2 . LEU B 1 286 ? 27.747  47.097 8.590   1.00 17.00 ?  286  LEU B CD2 1 
ATOM   5375 N N   . HIS B 1 287 ? 23.237  44.092 9.401   1.00 13.08 ?  287  HIS B N   1 
ATOM   5376 C CA  . HIS B 1 287 ? 21.760  43.961 9.308   1.00 14.70 ?  287  HIS B CA  1 
ATOM   5377 C C   . HIS B 1 287 ? 21.071  44.471 10.611  1.00 15.63 ?  287  HIS B C   1 
ATOM   5378 O O   . HIS B 1 287 ? 20.120  45.264 10.603  1.00 15.44 ?  287  HIS B O   1 
ATOM   5379 C CB  . HIS B 1 287 ? 21.347  42.518 8.983   1.00 13.53 ?  287  HIS B CB  1 
ATOM   5380 C CG  . HIS B 1 287 ? 19.921  42.406 8.538   1.00 16.89 ?  287  HIS B CG  1 
ATOM   5381 N ND1 . HIS B 1 287 ? 19.343  41.213 8.148   1.00 18.03 ?  287  HIS B ND1 1 
ATOM   5382 C CD2 . HIS B 1 287 ? 18.958  43.357 8.408   1.00 14.10 ?  287  HIS B CD2 1 
ATOM   5383 C CE1 . HIS B 1 287 ? 18.083  41.439 7.787   1.00 18.53 ?  287  HIS B CE1 1 
ATOM   5384 N NE2 . HIS B 1 287 ? 17.830  42.731 7.948   1.00 14.94 ?  287  HIS B NE2 1 
ATOM   5385 N N   . ILE B 1 288 ? 21.599  44.090 11.750  1.00 17.11 ?  288  ILE B N   1 
ATOM   5386 C CA  . ILE B 1 288 ? 21.080  44.702 12.962  1.00 17.67 ?  288  ILE B CA  1 
ATOM   5387 C C   . ILE B 1 288 ? 21.209  46.243 13.055  1.00 17.62 ?  288  ILE B C   1 
ATOM   5388 O O   . ILE B 1 288 ? 20.289  46.882 13.548  1.00 15.35 ?  288  ILE B O   1 
ATOM   5389 C CB  . ILE B 1 288 ? 21.514  43.995 14.285  1.00 19.15 ?  288  ILE B CB  1 
ATOM   5390 C CG1 . ILE B 1 288 ? 22.545  44.781 14.996  1.00 21.48 ?  288  ILE B CG1 1 
ATOM   5391 C CG2 . ILE B 1 288 ? 21.748  42.495 14.213  1.00 19.46 ?  288  ILE B CG2 1 
ATOM   5392 C CD1 . ILE B 1 288 ? 21.852  45.536 16.009  1.00 23.09 ?  288  ILE B CD1 1 
ATOM   5393 N N   . GLN B 1 289 ? 22.281  46.857 12.543  1.00 16.52 ?  289  GLN B N   1 
ATOM   5394 C CA  . GLN B 1 289 ? 22.320  48.314 12.503  1.00 18.17 ?  289  GLN B CA  1 
ATOM   5395 C C   . GLN B 1 289 ? 21.122  48.999 11.801  1.00 17.98 ?  289  GLN B C   1 
ATOM   5396 O O   . GLN B 1 289 ? 20.821  50.153 12.096  1.00 18.01 ?  289  GLN B O   1 
ATOM   5397 C CB  . GLN B 1 289 ? 23.544  48.817 11.739  1.00 18.40 ?  289  GLN B CB  1 
ATOM   5398 C CG  . GLN B 1 289 ? 24.774  48.763 12.518  1.00 26.01 ?  289  GLN B CG  1 
ATOM   5399 C CD  . GLN B 1 289 ? 25.830  49.671 11.958  1.00 30.56 ?  289  GLN B CD  1 
ATOM   5400 O OE1 . GLN B 1 289 ? 26.161  49.652 10.750  1.00 28.49 ?  289  GLN B OE1 1 
ATOM   5401 N NE2 . GLN B 1 289 ? 26.354  50.491 12.830  1.00 31.48 ?  289  GLN B NE2 1 
ATOM   5402 N N   . VAL B 1 290 ? 20.501  48.338 10.833  1.00 15.55 ?  290  VAL B N   1 
ATOM   5403 C CA  . VAL B 1 290 ? 19.397  48.987 10.116  1.00 15.61 ?  290  VAL B CA  1 
ATOM   5404 C C   . VAL B 1 290 ? 18.041  48.448 10.597  1.00 15.98 ?  290  VAL B C   1 
ATOM   5405 O O   . VAL B 1 290 ? 17.023  48.794 10.018  1.00 15.62 ?  290  VAL B O   1 
ATOM   5406 C CB  . VAL B 1 290 ? 19.537  48.883 8.523   1.00 14.75 ?  290  VAL B CB  1 
ATOM   5407 C CG1 . VAL B 1 290 ? 20.816  49.654 8.032   1.00 14.99 ?  290  VAL B CG1 1 
ATOM   5408 C CG2 . VAL B 1 290 ? 19.558  47.406 8.063   1.00 11.19 ?  290  VAL B CG2 1 
ATOM   5409 N N   . SER B 1 291 ? 18.029  47.601 11.635  1.00 15.70 ?  291  SER B N   1 
ATOM   5410 C CA  . SER B 1 291 ? 16.745  47.075 12.181  1.00 15.51 ?  291  SER B CA  1 
ATOM   5411 C C   . SER B 1 291 ? 16.594  47.454 13.664  1.00 16.92 ?  291  SER B C   1 
ATOM   5412 O O   . SER B 1 291 ? 16.035  48.509 13.975  1.00 17.43 ?  291  SER B O   1 
ATOM   5413 C CB  . SER B 1 291 ? 16.610  45.569 11.964  1.00 16.59 ?  291  SER B CB  1 
ATOM   5414 O OG  . SER B 1 291 ? 17.736  44.823 12.477  1.00 16.01 ?  291  SER B OG  1 
ATOM   5415 N N   . THR B 1 292 ? 17.118  46.644 14.580  1.00 14.93 ?  292  THR B N   1 
ATOM   5416 C CA  . THR B 1 292 ? 16.930  46.983 15.976  1.00 16.61 ?  292  THR B CA  1 
ATOM   5417 C C   . THR B 1 292 ? 17.894  48.052 16.471  1.00 16.74 ?  292  THR B C   1 
ATOM   5418 O O   . THR B 1 292 ? 17.761  48.472 17.608  1.00 17.54 ?  292  THR B O   1 
ATOM   5419 C CB  . THR B 1 292 ? 17.096  45.777 16.853  1.00 16.38 ?  292  THR B CB  1 
ATOM   5420 O OG1 . THR B 1 292 ? 18.283  45.067 16.444  1.00 15.51 ?  292  THR B OG1 1 
ATOM   5421 C CG2 . THR B 1 292 ? 15.846  44.873 16.750  1.00 16.50 ?  292  THR B CG2 1 
ATOM   5422 N N   . LEU B 1 293 ? 18.884  48.439 15.644  1.00 16.67 ?  293  LEU B N   1 
ATOM   5423 C CA  . LEU B 1 293 ? 20.018  49.305 16.030  1.00 16.55 ?  293  LEU B CA  1 
ATOM   5424 C C   . LEU B 1 293 ? 20.943  48.743 17.084  1.00 17.24 ?  293  LEU B C   1 
ATOM   5425 O O   . LEU B 1 293 ? 22.174  48.735 16.911  1.00 17.95 ?  293  LEU B O   1 
ATOM   5426 C CB  . LEU B 1 293 ? 19.565  50.689 16.461  1.00 18.28 ?  293  LEU B CB  1 
ATOM   5427 C CG  . LEU B 1 293 ? 18.725  51.608 15.574  1.00 21.35 ?  293  LEU B CG  1 
ATOM   5428 C CD1 . LEU B 1 293 ? 18.665  52.968 16.347  1.00 21.52 ?  293  LEU B CD1 1 
ATOM   5429 C CD2 . LEU B 1 293 ? 19.329  51.809 14.174  1.00 21.97 ?  293  LEU B CD2 1 
ATOM   5430 N N   . HIS B 1 294 ? 20.386  48.246 18.186  1.00 16.08 ?  294  HIS B N   1 
ATOM   5431 C CA  . HIS B 1 294 ? 21.250  47.656 19.219  1.00 16.05 ?  294  HIS B CA  1 
ATOM   5432 C C   . HIS B 1 294 ? 20.349  46.947 20.227  1.00 16.07 ?  294  HIS B C   1 
ATOM   5433 O O   . HIS B 1 294 ? 19.173  47.239 20.262  1.00 14.68 ?  294  HIS B O   1 
ATOM   5434 C CB  . HIS B 1 294 ? 22.134  48.735 19.866  1.00 14.46 ?  294  HIS B CB  1 
ATOM   5435 C CG  . HIS B 1 294 ? 21.393  49.696 20.741  1.00 12.65 ?  294  HIS B CG  1 
ATOM   5436 N ND1 . HIS B 1 294 ? 21.081  50.981 20.341  1.00 15.00 ?  294  HIS B ND1 1 
ATOM   5437 C CD2 . HIS B 1 294 ? 20.962  49.582 22.018  1.00 9.98  ?  294  HIS B CD2 1 
ATOM   5438 C CE1 . HIS B 1 294 ? 20.394  51.586 21.304  1.00 13.71 ?  294  HIS B CE1 1 
ATOM   5439 N NE2 . HIS B 1 294 ? 20.331  50.769 22.343  1.00 14.58 ?  294  HIS B NE2 1 
ATOM   5440 N N   . PRO B 1 295 ? 20.881  45.977 20.999  1.00 16.73 ?  295  PRO B N   1 
ATOM   5441 C CA  . PRO B 1 295 ? 20.051  45.418 22.041  1.00 16.65 ?  295  PRO B CA  1 
ATOM   5442 C C   . PRO B 1 295 ? 19.921  46.420 23.188  1.00 16.74 ?  295  PRO B C   1 
ATOM   5443 O O   . PRO B 1 295 ? 20.789  47.270 23.366  1.00 16.19 ?  295  PRO B O   1 
ATOM   5444 C CB  . PRO B 1 295 ? 20.777  44.113 22.449  1.00 16.74 ?  295  PRO B CB  1 
ATOM   5445 C CG  . PRO B 1 295 ? 22.169  44.244 21.985  1.00 17.64 ?  295  PRO B CG  1 
ATOM   5446 C CD  . PRO B 1 295 ? 22.232  45.364 20.962  1.00 18.49 ?  295  PRO B CD  1 
ATOM   5447 N N   . SER B 1 296 ? 18.803  46.363 23.898  1.00 16.48 ?  296  SER B N   1 
ATOM   5448 C CA  . SER B 1 296 ? 18.479  47.356 24.922  1.00 17.53 ?  296  SER B CA  1 
ATOM   5449 C C   . SER B 1 296 ? 19.683  47.643 25.811  1.00 16.57 ?  296  SER B C   1 
ATOM   5450 O O   . SER B 1 296 ? 20.271  46.704 26.394  1.00 15.60 ?  296  SER B O   1 
ATOM   5451 C CB  . SER B 1 296 ? 17.356  46.804 25.827  1.00 17.27 ?  296  SER B CB  1 
ATOM   5452 O OG  . SER B 1 296 ? 17.327  47.565 27.024  1.00 21.63 ?  296  SER B OG  1 
ATOM   5453 N N   . THR B 1 297 ? 20.053  48.917 25.955  1.00 16.87 ?  297  THR B N   1 
ATOM   5454 C CA  . THR B 1 297 ? 21.249  49.163 26.736  1.00 17.47 ?  297  THR B CA  1 
ATOM   5455 C C   . THR B 1 297 ? 21.044  48.906 28.252  1.00 18.83 ?  297  THR B C   1 
ATOM   5456 O O   . THR B 1 297 ? 21.938  48.341 28.924  1.00 18.23 ?  297  THR B O   1 
ATOM   5457 C CB  . THR B 1 297 ? 22.109  50.370 26.277  1.00 19.28 ?  297  THR B CB  1 
ATOM   5458 O OG1 . THR B 1 297 ? 22.719  51.076 27.379  1.00 24.05 ?  297  THR B OG1 1 
ATOM   5459 C CG2 . THR B 1 297 ? 21.462  51.245 25.309  1.00 12.93 ?  297  THR B CG2 1 
ATOM   5460 N N   . PHE B 1 298 ? 19.819  49.190 28.730  1.00 18.13 ?  298  PHE B N   1 
ATOM   5461 C CA  . PHE B 1 298 ? 19.451  48.984 30.134  1.00 17.70 ?  298  PHE B CA  1 
ATOM   5462 C C   . PHE B 1 298 ? 19.566  47.486 30.522  1.00 17.27 ?  298  PHE B C   1 
ATOM   5463 O O   . PHE B 1 298 ? 20.091  47.159 31.592  1.00 15.93 ?  298  PHE B O   1 
ATOM   5464 C CB  . PHE B 1 298 ? 17.998  49.454 30.334  1.00 17.53 ?  298  PHE B CB  1 
ATOM   5465 C CG  . PHE B 1 298 ? 17.564  49.553 31.770  1.00 19.54 ?  298  PHE B CG  1 
ATOM   5466 C CD1 . PHE B 1 298 ? 17.212  48.409 32.506  1.00 23.42 ?  298  PHE B CD1 1 
ATOM   5467 C CD2 . PHE B 1 298 ? 17.439  50.800 32.377  1.00 21.53 ?  298  PHE B CD2 1 
ATOM   5468 C CE1 . PHE B 1 298 ? 16.785  48.511 33.862  1.00 22.70 ?  298  PHE B CE1 1 
ATOM   5469 C CE2 . PHE B 1 298 ? 17.008  50.911 33.720  1.00 23.38 ?  298  PHE B CE2 1 
ATOM   5470 C CZ  . PHE B 1 298 ? 16.674  49.756 34.462  1.00 17.99 ?  298  PHE B CZ  1 
ATOM   5471 N N   . ASN B 1 299 ? 19.017  46.602 29.678  1.00 15.57 ?  299  ASN B N   1 
ATOM   5472 C CA  . ASN B 1 299 ? 19.004  45.176 29.968  1.00 15.09 ?  299  ASN B CA  1 
ATOM   5473 C C   . ASN B 1 299 ? 20.430  44.549 29.893  1.00 15.10 ?  299  ASN B C   1 
ATOM   5474 O O   . ASN B 1 299 ? 20.738  43.611 30.646  1.00 15.53 ?  299  ASN B O   1 
ATOM   5475 C CB  . ASN B 1 299 ? 18.066  44.457 29.015  1.00 13.78 ?  299  ASN B CB  1 
ATOM   5476 C CG  . ASN B 1 299 ? 16.606  44.893 29.135  1.00 16.47 ?  299  ASN B CG  1 
ATOM   5477 O OD1 . ASN B 1 299 ? 15.787  44.438 28.323  1.00 18.79 ?  299  ASN B OD1 1 
ATOM   5478 N ND2 . ASN B 1 299 ? 16.239  45.684 30.179  1.00 14.16 ?  299  ASN B ND2 1 
ATOM   5479 N N   . GLN B 1 300 ? 21.271  45.075 28.997  1.00 14.45 ?  300  GLN B N   1 
ATOM   5480 C CA  . GLN B 1 300 ? 22.689  44.672 28.863  1.00 15.46 ?  300  GLN B CA  1 
ATOM   5481 C C   . GLN B 1 300 ? 23.481  45.023 30.093  1.00 17.30 ?  300  GLN B C   1 
ATOM   5482 O O   . GLN B 1 300 ? 24.249  44.199 30.576  1.00 18.09 ?  300  GLN B O   1 
ATOM   5483 C CB  . GLN B 1 300 ? 23.386  45.316 27.666  1.00 13.56 ?  300  GLN B CB  1 
ATOM   5484 C CG  . GLN B 1 300 ? 23.082  44.612 26.322  1.00 15.02 ?  300  GLN B CG  1 
ATOM   5485 C CD  . GLN B 1 300 ? 23.871  45.221 25.226  1.00 11.18 ?  300  GLN B CD  1 
ATOM   5486 O OE1 . GLN B 1 300 ? 24.992  44.810 24.986  1.00 17.26 ?  300  GLN B OE1 1 
ATOM   5487 N NE2 . GLN B 1 300 ? 23.334  46.273 24.597  1.00 11.77 ?  300  GLN B NE2 1 
ATOM   5488 N N   . LEU B 1 301 ? 23.304  46.252 30.570  1.00 17.98 ?  301  LEU B N   1 
ATOM   5489 C CA  . LEU B 1 301 ? 23.884  46.679 31.827  1.00 19.26 ?  301  LEU B CA  1 
ATOM   5490 C C   . LEU B 1 301 ? 23.426  45.864 33.041  1.00 20.06 ?  301  LEU B C   1 
ATOM   5491 O O   . LEU B 1 301 ? 24.263  45.480 33.844  1.00 20.93 ?  301  LEU B O   1 
ATOM   5492 C CB  . LEU B 1 301 ? 23.709  48.194 32.065  1.00 18.45 ?  301  LEU B CB  1 
ATOM   5493 C CG  . LEU B 1 301 ? 24.518  49.116 31.151  1.00 19.69 ?  301  LEU B CG  1 
ATOM   5494 C CD1 . LEU B 1 301 ? 23.917  50.528 31.230  1.00 20.33 ?  301  LEU B CD1 1 
ATOM   5495 C CD2 . LEU B 1 301 ? 26.067  49.129 31.464  1.00 22.57 ?  301  LEU B CD2 1 
ATOM   5496 N N   . MET B 1 302 ? 22.138  45.609 33.190  1.00 19.96 ?  302  MET B N   1 
ATOM   5497 C CA  . MET B 1 302 ? 21.676  44.700 34.244  1.00 22.31 ?  302  MET B CA  1 
ATOM   5498 C C   . MET B 1 302 ? 22.484  43.392 34.223  1.00 21.88 ?  302  MET B C   1 
ATOM   5499 O O   . MET B 1 302 ? 23.033  42.950 35.259  1.00 21.17 ?  302  MET B O   1 
ATOM   5500 C CB  . MET B 1 302 ? 20.184  44.348 34.075  1.00 21.89 ?  302  MET B CB  1 
ATOM   5501 C CG  . MET B 1 302 ? 19.163  45.470 34.402  1.00 25.02 ?  302  MET B CG  1 
ATOM   5502 S SD  . MET B 1 302 ? 17.451  44.943 34.007  1.00 28.55 ?  302  MET B SD  1 
ATOM   5503 C CE  . MET B 1 302 ? 17.317  43.490 35.032  1.00 25.58 ?  302  MET B CE  1 
ATOM   5504 N N   . ILE B 1 303 ? 22.529  42.752 33.056  1.00 20.85 ?  303  ILE B N   1 
ATOM   5505 C CA  . ILE B 1 303 ? 23.144  41.437 32.948  1.00 21.13 ?  303  ILE B CA  1 
ATOM   5506 C C   . ILE B 1 303 ? 24.628  41.514 33.218  1.00 21.36 ?  303  ILE B C   1 
ATOM   5507 O O   . ILE B 1 303 ? 25.156  40.686 33.952  1.00 21.90 ?  303  ILE B O   1 
ATOM   5508 C CB  . ILE B 1 303 ? 22.825  40.736 31.585  1.00 20.74 ?  303  ILE B CB  1 
ATOM   5509 C CG1 . ILE B 1 303 ? 21.367  40.254 31.629  1.00 23.60 ?  303  ILE B CG1 1 
ATOM   5510 C CG2 . ILE B 1 303 ? 23.766  39.492 31.319  1.00 22.15 ?  303  ILE B CG2 1 
ATOM   5511 C CD1 . ILE B 1 303 ? 20.761  39.888 30.263  1.00 22.77 ?  303  ILE B CD1 1 
ATOM   5512 N N   . SER B 1 304 ? 25.275  42.528 32.667  1.00 21.09 ?  304  SER B N   1 
ATOM   5513 C CA  . SER B 1 304 ? 26.711  42.641 32.730  1.00 23.00 ?  304  SER B CA  1 
ATOM   5514 C C   . SER B 1 304 ? 27.232  42.928 34.151  1.00 24.30 ?  304  SER B C   1 
ATOM   5515 O O   . SER B 1 304 ? 28.258  42.350 34.555  1.00 22.82 ?  304  SER B O   1 
ATOM   5516 C CB  . SER B 1 304 ? 27.181  43.695 31.772  1.00 23.10 ?  304  SER B CB  1 
ATOM   5517 O OG  . SER B 1 304 ? 28.580  43.817 31.843  1.00 24.84 ?  304  SER B OG  1 
ATOM   5518 N N   . GLN B 1 305 ? 26.502  43.773 34.899  1.00 25.41 ?  305  GLN B N   1 
ATOM   5519 C CA  . GLN B 1 305 ? 26.744  43.983 36.343  1.00 27.37 ?  305  GLN B CA  1 
ATOM   5520 C C   . GLN B 1 305 ? 26.646  42.657 37.125  1.00 26.36 ?  305  GLN B C   1 
ATOM   5521 O O   . GLN B 1 305 ? 27.511  42.351 37.916  1.00 26.37 ?  305  GLN B O   1 
ATOM   5522 C CB  . GLN B 1 305 ? 25.711  44.944 36.953  1.00 28.45 ?  305  GLN B CB  1 
ATOM   5523 C CG  . GLN B 1 305 ? 25.580  46.267 36.265  1.00 33.62 ?  305  GLN B CG  1 
ATOM   5524 C CD  . GLN B 1 305 ? 26.459  47.349 36.831  1.00 41.15 ?  305  GLN B CD  1 
ATOM   5525 O OE1 . GLN B 1 305 ? 25.961  48.280 37.471  1.00 43.50 ?  305  GLN B OE1 1 
ATOM   5526 N NE2 . GLN B 1 305 ? 27.777  47.261 36.575  1.00 43.20 ?  305  GLN B NE2 1 
ATOM   5527 N N   . LEU B 1 306 ? 25.590  41.887 36.886  1.00 25.82 ?  306  LEU B N   1 
ATOM   5528 C CA  . LEU B 1 306 ? 25.395  40.611 37.541  1.00 25.68 ?  306  LEU B CA  1 
ATOM   5529 C C   . LEU B 1 306 ? 26.591  39.671 37.287  1.00 26.25 ?  306  LEU B C   1 
ATOM   5530 O O   . LEU B 1 306 ? 27.203  39.147 38.218  1.00 25.61 ?  306  LEU B O   1 
ATOM   5531 C CB  . LEU B 1 306 ? 24.135  39.974 37.021  1.00 26.17 ?  306  LEU B CB  1 
ATOM   5532 C CG  . LEU B 1 306 ? 23.820  38.597 37.601  1.00 26.75 ?  306  LEU B CG  1 
ATOM   5533 C CD1 . LEU B 1 306 ? 23.226  38.752 38.980  1.00 28.04 ?  306  LEU B CD1 1 
ATOM   5534 C CD2 . LEU B 1 306 ? 22.904  37.901 36.661  1.00 26.09 ?  306  LEU B CD2 1 
ATOM   5535 N N   . LEU B 1 307 ? 26.939  39.520 36.013  1.00 26.40 ?  307  LEU B N   1 
ATOM   5536 C CA  . LEU B 1 307 ? 27.989  38.620 35.579  1.00 27.26 ?  307  LEU B CA  1 
ATOM   5537 C C   . LEU B 1 307 ? 29.360  39.035 36.111  1.00 27.25 ?  307  LEU B C   1 
ATOM   5538 O O   . LEU B 1 307 ? 30.085  38.181 36.565  1.00 26.95 ?  307  LEU B O   1 
ATOM   5539 C CB  . LEU B 1 307 ? 28.032  38.565 34.062  1.00 26.48 ?  307  LEU B CB  1 
ATOM   5540 C CG  . LEU B 1 307 ? 27.310  37.475 33.277  1.00 27.71 ?  307  LEU B CG  1 
ATOM   5541 C CD1 . LEU B 1 307 ? 26.143  36.833 33.933  1.00 27.31 ?  307  LEU B CD1 1 
ATOM   5542 C CD2 . LEU B 1 307 ? 26.968  38.012 31.902  1.00 22.50 ?  307  LEU B CD2 1 
ATOM   5543 N N   . HIS B 1 308 ? 29.703  40.320 36.031  1.00 27.08 ?  308  HIS B N   1 
ATOM   5544 C CA  . HIS B 1 308 ? 30.958  40.816 36.577  1.00 28.89 ?  308  HIS B CA  1 
ATOM   5545 C C   . HIS B 1 308 ? 31.007  40.722 38.086  1.00 31.01 ?  308  HIS B C   1 
ATOM   5546 O O   . HIS B 1 308 ? 32.082  40.509 38.637  1.00 31.56 ?  308  HIS B O   1 
ATOM   5547 C CB  . HIS B 1 308 ? 31.274  42.245 36.158  1.00 27.86 ?  308  HIS B CB  1 
ATOM   5548 C CG  . HIS B 1 308 ? 31.590  42.380 34.704  1.00 30.53 ?  308  HIS B CG  1 
ATOM   5549 N ND1 . HIS B 1 308 ? 32.883  42.369 34.221  1.00 29.75 ?  308  HIS B ND1 1 
ATOM   5550 C CD2 . HIS B 1 308 ? 30.781  42.475 33.621  1.00 27.06 ?  308  HIS B CD2 1 
ATOM   5551 C CE1 . HIS B 1 308 ? 32.862  42.490 32.906  1.00 29.31 ?  308  HIS B CE1 1 
ATOM   5552 N NE2 . HIS B 1 308 ? 31.599  42.548 32.515  1.00 33.38 ?  308  HIS B NE2 1 
ATOM   5553 N N   . GLU B 1 309 ? 29.866  40.849 38.764  1.00 31.62 ?  309  GLU B N   1 
ATOM   5554 C CA  . GLU B 1 309 ? 29.866  40.699 40.215  1.00 33.42 ?  309  GLU B CA  1 
ATOM   5555 C C   . GLU B 1 309 ? 30.033  39.229 40.617  1.00 33.85 ?  309  GLU B C   1 
ATOM   5556 O O   . GLU B 1 309 ? 30.873  38.924 41.454  1.00 34.22 ?  309  GLU B O   1 
ATOM   5557 C CB  . GLU B 1 309 ? 28.646  41.380 40.847  1.00 33.72 ?  309  GLU B CB  1 
ATOM   5558 C CG  . GLU B 1 309 ? 28.303  40.997 42.284  1.00 37.49 ?  309  GLU B CG  1 
ATOM   5559 C CD  . GLU B 1 309 ? 29.381  41.318 43.326  1.00 43.93 ?  309  GLU B CD  1 
ATOM   5560 O OE1 . GLU B 1 309 ? 30.167  42.292 43.144  1.00 45.23 ?  309  GLU B OE1 1 
ATOM   5561 O OE2 . GLU B 1 309 ? 29.429  40.565 44.341  1.00 45.16 ?  309  GLU B OE2 1 
ATOM   5562 N N   . TRP B 1 310 ? 29.266  38.332 39.992  1.00 33.73 ?  310  TRP B N   1 
ATOM   5563 C CA  . TRP B 1 310 ? 29.379  36.883 40.183  1.00 33.71 ?  310  TRP B CA  1 
ATOM   5564 C C   . TRP B 1 310 ? 30.776  36.313 39.878  1.00 35.26 ?  310  TRP B C   1 
ATOM   5565 O O   . TRP B 1 310 ? 31.219  35.368 40.541  1.00 35.41 ?  310  TRP B O   1 
ATOM   5566 C CB  . TRP B 1 310 ? 28.463  36.169 39.210  1.00 31.61 ?  310  TRP B CB  1 
ATOM   5567 C CG  . TRP B 1 310 ? 27.116  35.899 39.675  1.00 30.59 ?  310  TRP B CG  1 
ATOM   5568 C CD1 . TRP B 1 310 ? 26.633  36.041 40.939  1.00 29.21 ?  310  TRP B CD1 1 
ATOM   5569 C CD2 . TRP B 1 310 ? 26.055  35.370 38.887  1.00 28.88 ?  310  TRP B CD2 1 
ATOM   5570 N NE1 . TRP B 1 310 ? 25.329  35.624 40.984  1.00 31.47 ?  310  TRP B NE1 1 
ATOM   5571 C CE2 . TRP B 1 310 ? 24.943  35.236 39.727  1.00 28.52 ?  310  TRP B CE2 1 
ATOM   5572 C CE3 . TRP B 1 310 ? 25.928  35.028 37.533  1.00 29.02 ?  310  TRP B CE3 1 
ATOM   5573 C CZ2 . TRP B 1 310 ? 23.734  34.760 39.274  1.00 27.93 ?  310  TRP B CZ2 1 
ATOM   5574 C CZ3 . TRP B 1 310 ? 24.719  34.544 37.089  1.00 28.46 ?  310  TRP B CZ3 1 
ATOM   5575 C CH2 . TRP B 1 310 ? 23.644  34.415 37.950  1.00 27.97 ?  310  TRP B CH2 1 
ATOM   5576 N N   . GLY B 1 311 ? 31.420  36.839 38.826  1.00 36.28 ?  311  GLY B N   1 
ATOM   5577 C CA  . GLY B 1 311 ? 32.591  36.207 38.250  1.00 37.93 ?  311  GLY B CA  1 
ATOM   5578 C C   . GLY B 1 311 ? 32.332  34.733 37.916  1.00 39.76 ?  311  GLY B C   1 
ATOM   5579 O O   . GLY B 1 311 ? 31.176  34.276 37.777  1.00 39.02 ?  311  GLY B O   1 
ATOM   5580 N N   . GLU B 1 312 ? 33.399  33.950 37.825  1.00 41.17 ?  312  GLU B N   1 
ATOM   5581 C CA  . GLU B 1 312 ? 33.201  32.581 37.399  1.00 42.47 ?  312  GLU B CA  1 
ATOM   5582 C C   . GLU B 1 312 ? 32.651  31.680 38.508  1.00 42.43 ?  312  GLU B C   1 
ATOM   5583 O O   . GLU B 1 312 ? 31.899  30.737 38.231  1.00 42.46 ?  312  GLU B O   1 
ATOM   5584 C CB  . GLU B 1 312 ? 34.437  32.049 36.672  1.00 43.45 ?  312  GLU B CB  1 
ATOM   5585 C CG  . GLU B 1 312 ? 34.675  32.755 35.275  1.00 47.48 ?  312  GLU B CG  1 
ATOM   5586 C CD  . GLU B 1 312 ? 33.524  32.604 34.211  1.00 49.81 ?  312  GLU B CD  1 
ATOM   5587 O OE1 . GLU B 1 312 ? 33.175  33.645 33.609  1.00 51.74 ?  312  GLU B OE1 1 
ATOM   5588 O OE2 . GLU B 1 312 ? 33.009  31.479 33.936  1.00 49.12 ?  312  GLU B OE2 1 
ATOM   5589 N N   . GLU B 1 313 ? 32.951  32.012 39.763  1.00 42.78 ?  313  GLU B N   1 
ATOM   5590 C CA  . GLU B 1 313 ? 32.392  31.246 40.873  1.00 43.07 ?  313  GLU B CA  1 
ATOM   5591 C C   . GLU B 1 313 ? 30.855  31.450 40.980  1.00 41.77 ?  313  GLU B C   1 
ATOM   5592 O O   . GLU B 1 313 ? 30.093  30.477 41.084  1.00 41.55 ?  313  GLU B O   1 
ATOM   5593 C CB  . GLU B 1 313 ? 33.135  31.528 42.201  1.00 43.74 ?  313  GLU B CB  1 
ATOM   5594 C CG  . GLU B 1 313 ? 34.676  31.607 42.074  1.00 48.55 ?  313  GLU B CG  1 
ATOM   5595 C CD  . GLU B 1 313 ? 35.379  30.290 41.624  1.00 54.24 ?  313  GLU B CD  1 
ATOM   5596 O OE1 . GLU B 1 313 ? 35.348  29.276 42.371  1.00 55.58 ?  313  GLU B OE1 1 
ATOM   5597 O OE2 . GLU B 1 313 ? 36.000  30.278 40.530  1.00 56.14 ?  313  GLU B OE2 1 
ATOM   5598 N N   . GLY B 1 314 ? 30.401  32.703 40.947  1.00 40.31 ?  314  GLY B N   1 
ATOM   5599 C CA  . GLY B 1 314 ? 28.956  32.976 40.932  1.00 37.82 ?  314  GLY B CA  1 
ATOM   5600 C C   . GLY B 1 314 ? 28.259  32.357 39.724  1.00 36.67 ?  314  GLY B C   1 
ATOM   5601 O O   . GLY B 1 314 ? 27.221  31.677 39.858  1.00 36.01 ?  314  GLY B O   1 
ATOM   5602 N N   . PHE B 1 315 ? 28.833  32.564 38.541  1.00 35.47 ?  315  PHE B N   1 
ATOM   5603 C CA  . PHE B 1 315 ? 28.185  32.100 37.319  1.00 34.87 ?  315  PHE B CA  1 
ATOM   5604 C C   . PHE B 1 315 ? 28.009  30.581 37.308  1.00 35.21 ?  315  PHE B C   1 
ATOM   5605 O O   . PHE B 1 315 ? 26.905  30.093 37.083  1.00 34.70 ?  315  PHE B O   1 
ATOM   5606 C CB  . PHE B 1 315 ? 28.900  32.573 36.046  1.00 34.27 ?  315  PHE B CB  1 
ATOM   5607 C CG  . PHE B 1 315 ? 28.178  32.173 34.779  1.00 33.50 ?  315  PHE B CG  1 
ATOM   5608 C CD1 . PHE B 1 315 ? 27.044  32.881 34.349  1.00 33.10 ?  315  PHE B CD1 1 
ATOM   5609 C CD2 . PHE B 1 315 ? 28.579  31.051 34.050  1.00 32.58 ?  315  PHE B CD2 1 
ATOM   5610 C CE1 . PHE B 1 315 ? 26.340  32.489 33.204  1.00 30.51 ?  315  PHE B CE1 1 
ATOM   5611 C CE2 . PHE B 1 315 ? 27.875  30.653 32.902  1.00 31.42 ?  315  PHE B CE2 1 
ATOM   5612 C CZ  . PHE B 1 315 ? 26.762  31.384 32.485  1.00 32.34 ?  315  PHE B CZ  1 
ATOM   5613 N N   . MET B 1 316 ? 29.084  29.824 37.567  1.00 36.41 ?  316  MET B N   1 
ATOM   5614 C CA  . MET B 1 316 ? 28.944  28.351 37.589  1.00 35.97 ?  316  MET B CA  1 
ATOM   5615 C C   . MET B 1 316 ? 28.135  27.879 38.793  1.00 35.70 ?  316  MET B C   1 
ATOM   5616 O O   . MET B 1 316 ? 27.485  26.835 38.730  1.00 36.54 ?  316  MET B O   1 
ATOM   5617 C CB  . MET B 1 316 ? 30.293  27.615 37.444  1.00 35.35 ?  316  MET B CB  1 
ATOM   5618 C CG  . MET B 1 316 ? 30.704  27.230 35.943  1.00 36.48 ?  316  MET B CG  1 
ATOM   5619 S SD  . MET B 1 316 ? 29.586  26.467 34.637  1.00 30.64 ?  316  MET B SD  1 
ATOM   5620 C CE  . MET B 1 316 ? 30.140  27.529 33.420  1.00 23.75 ?  316  MET B CE  1 
ATOM   5621 N N   . ALA B 1 317 ? 28.130  28.652 39.875  1.00 35.25 ?  317  ALA B N   1 
ATOM   5622 C CA  . ALA B 1 317 ? 27.262  28.329 41.011  1.00 35.16 ?  317  ALA B CA  1 
ATOM   5623 C C   . ALA B 1 317 ? 25.788  28.475 40.664  1.00 35.06 ?  317  ALA B C   1 
ATOM   5624 O O   . ALA B 1 317 ? 24.951  27.650 41.069  1.00 35.54 ?  317  ALA B O   1 
ATOM   5625 C CB  . ALA B 1 317 ? 27.606  29.178 42.225  1.00 35.83 ?  317  ALA B CB  1 
ATOM   5626 N N   . HIS B 1 318 ? 25.465  29.528 39.914  1.00 34.40 ?  318  HIS B N   1 
ATOM   5627 C CA  . HIS B 1 318 ? 24.100  29.721 39.422  1.00 32.83 ?  318  HIS B CA  1 
ATOM   5628 C C   . HIS B 1 318 ? 23.659  28.601 38.492  1.00 32.36 ?  318  HIS B C   1 
ATOM   5629 O O   . HIS B 1 318 ? 22.561  28.069 38.643  1.00 32.21 ?  318  HIS B O   1 
ATOM   5630 C CB  . HIS B 1 318 ? 23.952  31.071 38.705  1.00 32.20 ?  318  HIS B CB  1 
ATOM   5631 C CG  . HIS B 1 318 ? 22.604  31.270 38.090  1.00 31.39 ?  318  HIS B CG  1 
ATOM   5632 N ND1 . HIS B 1 318 ? 21.495  31.599 38.839  1.00 28.45 ?  318  HIS B ND1 1 
ATOM   5633 C CD2 . HIS B 1 318 ? 22.183  31.178 36.804  1.00 29.01 ?  318  HIS B CD2 1 
ATOM   5634 C CE1 . HIS B 1 318 ? 20.449  31.714 38.037  1.00 30.63 ?  318  HIS B CE1 1 
ATOM   5635 N NE2 . HIS B 1 318 ? 20.837  31.453 36.799  1.00 28.32 ?  318  HIS B NE2 1 
ATOM   5636 N N   . VAL B 1 319 ? 24.478  28.249 37.505  1.00 33.33 ?  319  VAL B N   1 
ATOM   5637 C CA  . VAL B 1 319 ? 24.034  27.210 36.560  1.00 33.25 ?  319  VAL B CA  1 
ATOM   5638 C C   . VAL B 1 319 ? 23.885  25.856 37.270  1.00 33.75 ?  319  VAL B C   1 
ATOM   5639 O O   . VAL B 1 319 ? 22.894  25.147 37.072  1.00 32.51 ?  319  VAL B O   1 
ATOM   5640 C CB  . VAL B 1 319 ? 24.824  27.184 35.206  1.00 33.67 ?  319  VAL B CB  1 
ATOM   5641 C CG1 . VAL B 1 319 ? 26.150  27.876 35.318  1.00 35.37 ?  319  VAL B CG1 1 
ATOM   5642 C CG2 . VAL B 1 319 ? 25.009  25.774 34.673  1.00 31.69 ?  319  VAL B CG2 1 
ATOM   5643 N N   . ASP B 1 320 ? 24.840  25.522 38.129  1.00 35.01 ?  320  ASP B N   1 
ATOM   5644 C CA  . ASP B 1 320 ? 24.711  24.345 39.005  1.00 36.42 ?  320  ASP B CA  1 
ATOM   5645 C C   . ASP B 1 320 ? 23.364  24.331 39.727  1.00 36.48 ?  320  ASP B C   1 
ATOM   5646 O O   . ASP B 1 320 ? 22.624  23.341 39.680  1.00 36.94 ?  320  ASP B O   1 
ATOM   5647 C CB  . ASP B 1 320 ? 25.882  24.308 40.009  1.00 37.79 ?  320  ASP B CB  1 
ATOM   5648 C CG  . ASP B 1 320 ? 27.246  24.059 39.314  1.00 42.12 ?  320  ASP B CG  1 
ATOM   5649 O OD1 . ASP B 1 320 ? 27.243  23.559 38.159  1.00 47.95 ?  320  ASP B OD1 1 
ATOM   5650 O OD2 . ASP B 1 320 ? 28.326  24.346 39.905  1.00 47.15 ?  320  ASP B OD2 1 
ATOM   5651 N N   . ARG B 1 321 ? 23.008  25.443 40.360  1.00 36.35 ?  321  ARG B N   1 
ATOM   5652 C CA  . ARG B 1 321 ? 21.702  25.506 41.029  1.00 36.58 ?  321  ARG B CA  1 
ATOM   5653 C C   . ARG B 1 321 ? 20.536  25.313 40.079  1.00 35.41 ?  321  ARG B C   1 
ATOM   5654 O O   . ARG B 1 321 ? 19.595  24.618 40.430  1.00 35.16 ?  321  ARG B O   1 
ATOM   5655 C CB  . ARG B 1 321 ? 21.525  26.791 41.839  1.00 36.82 ?  321  ARG B CB  1 
ATOM   5656 C CG  . ARG B 1 321 ? 22.309  26.773 43.162  1.00 40.03 ?  321  ARG B CG  1 
ATOM   5657 C CD  . ARG B 1 321 ? 21.946  27.943 44.066  1.00 42.65 ?  321  ARG B CD  1 
ATOM   5658 N NE  . ARG B 1 321 ? 22.163  29.228 43.407  1.00 44.12 ?  321  ARG B NE  1 
ATOM   5659 C CZ  . ARG B 1 321 ? 23.326  29.864 43.378  1.00 44.46 ?  321  ARG B CZ  1 
ATOM   5660 N NH1 . ARG B 1 321 ? 24.388  29.324 43.984  1.00 45.17 ?  321  ARG B NH1 1 
ATOM   5661 N NH2 . ARG B 1 321 ? 23.428  31.033 42.743  1.00 42.82 ?  321  ARG B NH2 1 
ATOM   5662 N N   . VAL B 1 322 ? 20.587  25.897 38.874  1.00 34.65 ?  322  VAL B N   1 
ATOM   5663 C CA  . VAL B 1 322 ? 19.442  25.716 37.953  1.00 33.41 ?  322  VAL B CA  1 
ATOM   5664 C C   . VAL B 1 322 ? 19.380  24.341 37.278  1.00 33.31 ?  322  VAL B C   1 
ATOM   5665 O O   . VAL B 1 322 ? 18.279  23.811 37.040  1.00 32.69 ?  322  VAL B O   1 
ATOM   5666 C CB  . VAL B 1 322 ? 19.089  26.980 37.006  1.00 33.90 ?  322  VAL B CB  1 
ATOM   5667 C CG1 . VAL B 1 322 ? 20.044  28.154 37.198  1.00 32.26 ?  322  VAL B CG1 1 
ATOM   5668 C CG2 . VAL B 1 322 ? 18.885  26.597 35.570  1.00 30.02 ?  322  VAL B CG2 1 
ATOM   5669 N N   . ILE B 1 323 ? 20.544  23.779 36.968  1.00 33.69 ?  323  ILE B N   1 
ATOM   5670 C CA  . ILE B 1 323 ? 20.627  22.384 36.506  1.00 35.37 ?  323  ILE B CA  1 
ATOM   5671 C C   . ILE B 1 323 ? 19.972  21.469 37.556  1.00 35.50 ?  323  ILE B C   1 
ATOM   5672 O O   . ILE B 1 323 ? 19.107  20.640 37.234  1.00 34.47 ?  323  ILE B O   1 
ATOM   5673 C CB  . ILE B 1 323 ? 22.100  21.940 36.265  1.00 34.96 ?  323  ILE B CB  1 
ATOM   5674 C CG1 . ILE B 1 323 ? 22.669  22.644 35.038  1.00 36.06 ?  323  ILE B CG1 1 
ATOM   5675 C CG2 . ILE B 1 323 ? 22.191  20.432 36.058  1.00 36.79 ?  323  ILE B CG2 1 
ATOM   5676 C CD1 . ILE B 1 323 ? 24.160  22.347 34.794  1.00 35.47 ?  323  ILE B CD1 1 
ATOM   5677 N N   . ASP B 1 324 ? 20.371  21.660 38.816  1.00 36.92 ?  324  ASP B N   1 
ATOM   5678 C CA  . ASP B 1 324 ? 19.829  20.839 39.885  1.00 38.53 ?  324  ASP B CA  1 
ATOM   5679 C C   . ASP B 1 324 ? 18.325  20.945 39.969  1.00 38.40 ?  324  ASP B C   1 
ATOM   5680 O O   . ASP B 1 324 ? 17.642  19.920 40.043  1.00 38.74 ?  324  ASP B O   1 
ATOM   5681 C CB  . ASP B 1 324 ? 20.524  21.120 41.203  1.00 39.66 ?  324  ASP B CB  1 
ATOM   5682 C CG  . ASP B 1 324 ? 21.852  20.385 41.311  1.00 41.78 ?  324  ASP B CG  1 
ATOM   5683 O OD1 . ASP B 1 324 ? 22.247  19.667 40.347  1.00 45.12 ?  324  ASP B OD1 1 
ATOM   5684 O OD2 . ASP B 1 324 ? 22.499  20.511 42.370  1.00 45.89 ?  324  ASP B OD2 1 
ATOM   5685 N N   . PHE B 1 325 ? 17.793  22.170 39.855  1.00 38.38 ?  325  PHE B N   1 
ATOM   5686 C CA  . PHE B 1 325 ? 16.343  22.315 39.782  1.00 36.67 ?  325  PHE B CA  1 
ATOM   5687 C C   . PHE B 1 325 ? 15.700  21.538 38.616  1.00 36.46 ?  325  PHE B C   1 
ATOM   5688 O O   . PHE B 1 325 ? 14.779  20.721 38.833  1.00 35.89 ?  325  PHE B O   1 
ATOM   5689 C CB  . PHE B 1 325 ? 15.895  23.787 39.777  1.00 36.80 ?  325  PHE B CB  1 
ATOM   5690 C CG  . PHE B 1 325 ? 14.414  23.942 39.528  1.00 36.74 ?  325  PHE B CG  1 
ATOM   5691 C CD1 . PHE B 1 325 ? 13.498  23.641 40.536  1.00 36.60 ?  325  PHE B CD1 1 
ATOM   5692 C CD2 . PHE B 1 325 ? 13.935  24.333 38.273  1.00 36.44 ?  325  PHE B CD2 1 
ATOM   5693 C CE1 . PHE B 1 325 ? 12.134  23.752 40.321  1.00 37.65 ?  325  PHE B CE1 1 
ATOM   5694 C CE2 . PHE B 1 325 ? 12.573  24.452 38.045  1.00 37.18 ?  325  PHE B CE2 1 
ATOM   5695 C CZ  . PHE B 1 325 ? 11.659  24.150 39.082  1.00 38.39 ?  325  PHE B CZ  1 
ATOM   5696 N N   . TYR B 1 326 ? 16.158  21.790 37.383  1.00 35.89 ?  326  TYR B N   1 
ATOM   5697 C CA  . TYR B 1 326 ? 15.561  21.133 36.231  1.00 35.96 ?  326  TYR B CA  1 
ATOM   5698 C C   . TYR B 1 326 ? 15.817  19.620 36.260  1.00 36.82 ?  326  TYR B C   1 
ATOM   5699 O O   . TYR B 1 326 ? 15.014  18.850 35.737  1.00 36.65 ?  326  TYR B O   1 
ATOM   5700 C CB  . TYR B 1 326 ? 16.043  21.737 34.894  1.00 35.84 ?  326  TYR B CB  1 
ATOM   5701 C CG  . TYR B 1 326 ? 15.400  23.074 34.533  1.00 32.76 ?  326  TYR B CG  1 
ATOM   5702 C CD1 . TYR B 1 326 ? 14.162  23.119 33.894  1.00 31.19 ?  326  TYR B CD1 1 
ATOM   5703 C CD2 . TYR B 1 326 ? 16.055  24.273 34.800  1.00 30.40 ?  326  TYR B CD2 1 
ATOM   5704 C CE1 . TYR B 1 326 ? 13.565  24.356 33.562  1.00 35.08 ?  326  TYR B CE1 1 
ATOM   5705 C CE2 . TYR B 1 326 ? 15.493  25.504 34.473  1.00 32.87 ?  326  TYR B CE2 1 
ATOM   5706 C CZ  . TYR B 1 326 ? 14.236  25.542 33.862  1.00 34.60 ?  326  TYR B CZ  1 
ATOM   5707 O OH  . TYR B 1 326 ? 13.667  26.756 33.537  1.00 34.17 ?  326  TYR B OH  1 
ATOM   5708 N N   . SER B 1 327 ? 16.924  19.195 36.869  1.00 38.05 ?  327  SER B N   1 
ATOM   5709 C CA  . SER B 1 327 ? 17.208  17.745 37.004  1.00 39.18 ?  327  SER B CA  1 
ATOM   5710 C C   . SER B 1 327 ? 16.152  17.062 37.897  1.00 39.38 ?  327  SER B C   1 
ATOM   5711 O O   . SER B 1 327 ? 15.688  15.955 37.601  1.00 39.31 ?  327  SER B O   1 
ATOM   5712 C CB  . SER B 1 327 ? 18.612  17.530 37.569  1.00 39.58 ?  327  SER B CB  1 
ATOM   5713 O OG  . SER B 1 327 ? 19.157  16.317 37.098  1.00 42.79 ?  327  SER B OG  1 
ATOM   5714 N N   . ASN B 1 328 ? 15.768  17.744 38.974  1.00 39.70 ?  328  ASN B N   1 
ATOM   5715 C CA  . ASN B 1 328 ? 14.716  17.277 39.881  1.00 40.68 ?  328  ASN B CA  1 
ATOM   5716 C C   . ASN B 1 328 ? 13.362  17.250 39.222  1.00 40.63 ?  328  ASN B C   1 
ATOM   5717 O O   . ASN B 1 328 ? 12.581  16.313 39.419  1.00 40.94 ?  328  ASN B O   1 
ATOM   5718 C CB  . ASN B 1 328 ? 14.644  18.180 41.112  1.00 41.13 ?  328  ASN B CB  1 
ATOM   5719 C CG  . ASN B 1 328 ? 15.653  17.805 42.175  1.00 44.73 ?  328  ASN B CG  1 
ATOM   5720 O OD1 . ASN B 1 328 ? 15.766  18.495 43.192  1.00 49.85 ?  328  ASN B OD1 1 
ATOM   5721 N ND2 . ASN B 1 328 ? 16.387  16.700 41.964  1.00 47.60 ?  328  ASN B ND2 1 
ATOM   5722 N N   . GLN B 1 329 ? 13.072  18.285 38.437  1.00 40.48 ?  329  GLN B N   1 
ATOM   5723 C CA  . GLN B 1 329 ? 11.837  18.322 37.654  1.00 40.11 ?  329  GLN B CA  1 
ATOM   5724 C C   . GLN B 1 329 ? 11.795  17.156 36.665  1.00 39.72 ?  329  GLN B C   1 
ATOM   5725 O O   . GLN B 1 329 ? 10.727  16.591 36.389  1.00 39.08 ?  329  GLN B O   1 
ATOM   5726 C CB  . GLN B 1 329 ? 11.717  19.653 36.885  1.00 40.26 ?  329  GLN B CB  1 
ATOM   5727 C CG  . GLN B 1 329 ? 11.559  20.897 37.730  1.00 40.29 ?  329  GLN B CG  1 
ATOM   5728 C CD  . GLN B 1 329 ? 10.244  20.926 38.508  1.00 41.66 ?  329  GLN B CD  1 
ATOM   5729 O OE1 . GLN B 1 329 ? 10.253  20.844 39.734  1.00 44.82 ?  329  GLN B OE1 1 
ATOM   5730 N NE2 . GLN B 1 329 ? 9.116   21.013 37.802  1.00 39.89 ?  329  GLN B NE2 1 
ATOM   5731 N N   . LYS B 1 330 ? 12.961  16.837 36.101  1.00 39.93 ?  330  LYS B N   1 
ATOM   5732 C CA  . LYS B 1 330 ? 13.089  15.750 35.124  1.00 40.28 ?  330  LYS B CA  1 
ATOM   5733 C C   . LYS B 1 330 ? 12.760  14.398 35.776  1.00 40.42 ?  330  LYS B C   1 
ATOM   5734 O O   . LYS B 1 330 ? 12.066  13.585 35.189  1.00 39.70 ?  330  LYS B O   1 
ATOM   5735 C CB  . LYS B 1 330 ? 14.504  15.701 34.531  1.00 40.24 ?  330  LYS B CB  1 
ATOM   5736 C CG  . LYS B 1 330 ? 14.660  14.592 33.490  1.00 40.78 ?  330  LYS B CG  1 
ATOM   5737 C CD  . LYS B 1 330 ? 16.108  14.157 33.263  1.00 42.46 ?  330  LYS B CD  1 
ATOM   5738 C CE  . LYS B 1 330 ? 16.738  13.413 34.443  1.00 43.44 ?  330  LYS B CE  1 
ATOM   5739 N NZ  . LYS B 1 330 ? 17.577  14.323 35.274  1.00 43.96 ?  330  LYS B NZ  1 
ATOM   5740 N N   . ASP B 1 331 ? 13.280  14.179 36.985  1.00 41.25 ?  331  ASP B N   1 
ATOM   5741 C CA  . ASP B 1 331 ? 13.012  12.955 37.743  1.00 42.05 ?  331  ASP B CA  1 
ATOM   5742 C C   . ASP B 1 331 ? 11.537  12.879 38.102  1.00 42.45 ?  331  ASP B C   1 
ATOM   5743 O O   . ASP B 1 331 ? 10.897  11.852 37.912  1.00 43.24 ?  331  ASP B O   1 
ATOM   5744 C CB  . ASP B 1 331 ? 13.890  12.888 38.990  1.00 41.67 ?  331  ASP B CB  1 
ATOM   5745 C CG  . ASP B 1 331 ? 15.362  12.770 38.643  1.00 42.19 ?  331  ASP B CG  1 
ATOM   5746 O OD1 . ASP B 1 331 ? 15.654  12.235 37.546  1.00 41.87 ?  331  ASP B OD1 1 
ATOM   5747 O OD2 . ASP B 1 331 ? 16.220  13.215 39.452  1.00 40.86 ?  331  ASP B OD2 1 
ATOM   5748 N N   . ALA B 1 332 ? 10.984  13.996 38.552  1.00 42.63 ?  332  ALA B N   1 
ATOM   5749 C CA  . ALA B 1 332 ? 9.571   14.047 38.878  1.00 42.67 ?  332  ALA B CA  1 
ATOM   5750 C C   . ALA B 1 332 ? 8.696   13.688 37.693  1.00 42.84 ?  332  ALA B C   1 
ATOM   5751 O O   . ALA B 1 332 ? 7.757   12.928 37.857  1.00 43.47 ?  332  ALA B O   1 
ATOM   5752 C CB  . ALA B 1 332 ? 9.206   15.396 39.446  1.00 42.34 ?  332  ALA B CB  1 
ATOM   5753 N N   . ILE B 1 333 ? 8.995   14.198 36.494  1.00 43.00 ?  333  ILE B N   1 
ATOM   5754 C CA  . ILE B 1 333 ? 8.139   13.912 35.337  1.00 42.99 ?  333  ILE B CA  1 
ATOM   5755 C C   . ILE B 1 333 ? 8.275   12.478 34.800  1.00 43.91 ?  333  ILE B C   1 
ATOM   5756 O O   . ILE B 1 333 ? 7.331   11.936 34.206  1.00 44.36 ?  333  ILE B O   1 
ATOM   5757 C CB  . ILE B 1 333 ? 8.299   14.929 34.167  1.00 42.90 ?  333  ILE B CB  1 
ATOM   5758 C CG1 . ILE B 1 333 ? 7.012   14.963 33.343  1.00 41.92 ?  333  ILE B CG1 1 
ATOM   5759 C CG2 . ILE B 1 333 ? 9.503   14.569 33.263  1.00 41.61 ?  333  ILE B CG2 1 
ATOM   5760 C CD1 . ILE B 1 333 ? 6.877   16.134 32.387  1.00 42.03 ?  333  ILE B CD1 1 
ATOM   5761 N N   . LEU B 1 334 ? 9.450   11.889 34.982  1.00 44.19 ?  334  LEU B N   1 
ATOM   5762 C CA  . LEU B 1 334 ? 9.681   10.535 34.524  1.00 45.46 ?  334  LEU B CA  1 
ATOM   5763 C C   . LEU B 1 334 ? 8.960   9.583  35.485  1.00 46.26 ?  334  LEU B C   1 
ATOM   5764 O O   . LEU B 1 334 ? 8.242   8.686  35.045  1.00 46.53 ?  334  LEU B O   1 
ATOM   5765 C CB  . LEU B 1 334 ? 11.174  10.240 34.454  1.00 45.00 ?  334  LEU B CB  1 
ATOM   5766 C CG  . LEU B 1 334 ? 11.941  10.115 33.124  1.00 45.28 ?  334  LEU B CG  1 
ATOM   5767 C CD1 . LEU B 1 334 ? 11.186  10.448 31.843  1.00 43.27 ?  334  LEU B CD1 1 
ATOM   5768 C CD2 . LEU B 1 334 ? 13.244  10.895 33.231  1.00 44.00 ?  334  LEU B CD2 1 
ATOM   5769 N N   . ALA B 1 335 ? 9.136   9.822  36.786  1.00 47.05 ?  335  ALA B N   1 
ATOM   5770 C CA  . ALA B 1 335 ? 8.384   9.128  37.833  1.00 47.73 ?  335  ALA B CA  1 
ATOM   5771 C C   . ALA B 1 335 ? 6.877   9.217  37.616  1.00 48.28 ?  335  ALA B C   1 
ATOM   5772 O O   . ALA B 1 335 ? 6.157   8.258  37.885  1.00 49.12 ?  335  ALA B O   1 
ATOM   5773 C CB  . ALA B 1 335 ? 8.762   9.663  39.202  1.00 47.28 ?  335  ALA B CB  1 
ATOM   5774 N N   . ALA B 1 336 ? 6.389   10.354 37.118  1.00 48.64 ?  336  ALA B N   1 
ATOM   5775 C CA  . ALA B 1 336 ? 4.982   10.456 36.756  1.00 48.34 ?  336  ALA B CA  1 
ATOM   5776 C C   . ALA B 1 336 ? 4.653   9.757  35.435  1.00 48.57 ?  336  ALA B C   1 
ATOM   5777 O O   . ALA B 1 336 ? 3.550   9.245  35.270  1.00 48.48 ?  336  ALA B O   1 
ATOM   5778 C CB  . ALA B 1 336 ? 4.514   11.909 36.748  1.00 48.80 ?  336  ALA B CB  1 
ATOM   5779 N N   . ALA B 1 337 ? 5.585   9.740  34.488  1.00 49.17 ?  337  ALA B N   1 
ATOM   5780 C CA  . ALA B 1 337 ? 5.362   9.000  33.233  1.00 49.91 ?  337  ALA B CA  1 
ATOM   5781 C C   . ALA B 1 337 ? 5.409   7.479  33.442  1.00 50.60 ?  337  ALA B C   1 
ATOM   5782 O O   . ALA B 1 337 ? 4.659   6.738  32.810  1.00 50.47 ?  337  ALA B O   1 
ATOM   5783 C CB  . ALA B 1 337 ? 6.351   9.423  32.154  1.00 49.87 ?  337  ALA B CB  1 
ATOM   5784 N N   . ASP B 1 338 ? 6.306   7.027  34.315  1.00 51.27 ?  338  ASP B N   1 
ATOM   5785 C CA  . ASP B 1 338 ? 6.360   5.624  34.721  1.00 52.56 ?  338  ASP B CA  1 
ATOM   5786 C C   . ASP B 1 338 ? 5.079   5.184  35.448  1.00 53.71 ?  338  ASP B C   1 
ATOM   5787 O O   . ASP B 1 338 ? 4.549   4.107  35.179  1.00 54.09 ?  338  ASP B O   1 
ATOM   5788 C CB  . ASP B 1 338 ? 7.571   5.379  35.619  1.00 51.97 ?  338  ASP B CB  1 
ATOM   5789 C CG  . ASP B 1 338 ? 8.878   5.497  34.871  1.00 51.84 ?  338  ASP B CG  1 
ATOM   5790 O OD1 . ASP B 1 338 ? 9.909   5.798  35.518  1.00 52.35 ?  338  ASP B OD1 1 
ATOM   5791 O OD2 . ASP B 1 338 ? 8.877   5.287  33.640  1.00 49.54 ?  338  ASP B OD2 1 
ATOM   5792 N N   . LYS B 1 339 ? 4.573   6.034  36.339  1.00 54.71 ?  339  LYS B N   1 
ATOM   5793 C CA  . LYS B 1 339 ? 3.468   5.662  37.212  1.00 55.78 ?  339  LYS B CA  1 
ATOM   5794 C C   . LYS B 1 339 ? 2.117   5.479  36.513  1.00 56.51 ?  339  LYS B C   1 
ATOM   5795 O O   . LYS B 1 339 ? 1.290   4.684  36.982  1.00 56.37 ?  339  LYS B O   1 
ATOM   5796 C CB  . LYS B 1 339 ? 3.331   6.658  38.369  1.00 55.56 ?  339  LYS B CB  1 
ATOM   5797 C CG  . LYS B 1 339 ? 2.218   6.305  39.335  1.00 56.35 ?  339  LYS B CG  1 
ATOM   5798 C CD  . LYS B 1 339 ? 1.969   7.393  40.344  1.00 58.85 ?  339  LYS B CD  1 
ATOM   5799 C CE  . LYS B 1 339 ? 0.796   7.039  41.233  1.00 59.30 ?  339  LYS B CE  1 
ATOM   5800 N NZ  . LYS B 1 339 ? 0.380   8.219  42.036  1.00 59.75 ?  339  LYS B NZ  1 
ATOM   5801 N N   . TRP B 1 340 ? 1.896   6.192  35.407  1.00 57.29 ?  340  TRP B N   1 
ATOM   5802 C CA  . TRP B 1 340 ? 0.565   6.253  34.788  1.00 57.89 ?  340  TRP B CA  1 
ATOM   5803 C C   . TRP B 1 340 ? 0.545   5.898  33.312  1.00 57.72 ?  340  TRP B C   1 
ATOM   5804 O O   . TRP B 1 340 ? -0.534  5.834  32.701  1.00 57.66 ?  340  TRP B O   1 
ATOM   5805 C CB  . TRP B 1 340 ? -0.044  7.658  34.936  1.00 58.92 ?  340  TRP B CB  1 
ATOM   5806 C CG  . TRP B 1 340 ? -0.241  8.136  36.338  1.00 60.23 ?  340  TRP B CG  1 
ATOM   5807 C CD1 . TRP B 1 340 ? 0.530   9.039  37.012  1.00 61.16 ?  340  TRP B CD1 1 
ATOM   5808 C CD2 . TRP B 1 340 ? -1.286  7.750  37.235  1.00 61.29 ?  340  TRP B CD2 1 
ATOM   5809 N NE1 . TRP B 1 340 ? 0.035   9.239  38.276  1.00 61.23 ?  340  TRP B NE1 1 
ATOM   5810 C CE2 . TRP B 1 340 ? -1.079  8.456  38.444  1.00 61.95 ?  340  TRP B CE2 1 
ATOM   5811 C CE3 . TRP B 1 340 ? -2.377  6.874  37.138  1.00 61.88 ?  340  TRP B CE3 1 
ATOM   5812 C CZ2 . TRP B 1 340 ? -1.923  8.313  39.553  1.00 60.57 ?  340  TRP B CZ2 1 
ATOM   5813 C CZ3 . TRP B 1 340 ? -3.214  6.730  38.241  1.00 61.54 ?  340  TRP B CZ3 1 
ATOM   5814 C CH2 . TRP B 1 340 ? -2.979  7.449  39.433  1.00 61.23 ?  340  TRP B CH2 1 
ATOM   5815 N N   . LEU B 1 341 ? 1.721   5.674  32.731  1.00 57.57 ?  341  LEU B N   1 
ATOM   5816 C CA  . LEU B 1 341 ? 1.864   5.695  31.271  1.00 57.25 ?  341  LEU B CA  1 
ATOM   5817 C C   . LEU B 1 341 ? 2.608   4.525  30.633  1.00 56.98 ?  341  LEU B C   1 
ATOM   5818 O O   . LEU B 1 341 ? 2.465   4.287  29.423  1.00 56.18 ?  341  LEU B O   1 
ATOM   5819 C CB  . LEU B 1 341 ? 2.525   7.014  30.840  1.00 57.43 ?  341  LEU B CB  1 
ATOM   5820 C CG  . LEU B 1 341 ? 1.658   8.140  30.276  1.00 57.48 ?  341  LEU B CG  1 
ATOM   5821 C CD1 . LEU B 1 341 ? 0.657   8.645  31.276  1.00 56.84 ?  341  LEU B CD1 1 
ATOM   5822 C CD2 . LEU B 1 341 ? 2.551   9.279  29.796  1.00 58.36 ?  341  LEU B CD2 1 
ATOM   5823 N N   . THR B 1 342 ? 3.398   3.809  31.435  1.00 57.21 ?  342  THR B N   1 
ATOM   5824 C CA  . THR B 1 342 ? 4.210   2.685  30.933  1.00 57.32 ?  342  THR B CA  1 
ATOM   5825 C C   . THR B 1 342 ? 3.338   1.573  30.360  1.00 57.46 ?  342  THR B C   1 
ATOM   5826 O O   . THR B 1 342 ? 2.765   0.768  31.090  1.00 57.99 ?  342  THR B O   1 
ATOM   5827 C CB  . THR B 1 342 ? 5.198   2.143  31.994  1.00 57.35 ?  342  THR B CB  1 
ATOM   5828 O OG1 . THR B 1 342 ? 4.828   2.645  33.282  1.00 57.37 ?  342  THR B OG1 1 
ATOM   5829 C CG2 . THR B 1 342 ? 6.637   2.606  31.688  1.00 57.61 ?  342  THR B CG2 1 
ATOM   5830 N N   . GLY B 1 343 ? 3.237   1.551  29.036  1.00 57.32 ?  343  GLY B N   1 
ATOM   5831 C CA  . GLY B 1 343 ? 2.322   0.667  28.341  1.00 57.00 ?  343  GLY B CA  1 
ATOM   5832 C C   . GLY B 1 343 ? 1.636   1.403  27.210  1.00 57.03 ?  343  GLY B C   1 
ATOM   5833 O O   . GLY B 1 343 ? 1.787   1.044  26.037  1.00 57.16 ?  343  GLY B O   1 
ATOM   5834 N N   . LEU B 1 344 ? 0.900   2.449  27.573  1.00 56.92 ?  344  LEU B N   1 
ATOM   5835 C CA  . LEU B 1 344 ? 0.136   3.264  26.617  1.00 56.86 ?  344  LEU B CA  1 
ATOM   5836 C C   . LEU B 1 344 ? 0.996   4.182  25.728  1.00 56.60 ?  344  LEU B C   1 
ATOM   5837 O O   . LEU B 1 344 ? 0.590   4.521  24.614  1.00 56.82 ?  344  LEU B O   1 
ATOM   5838 C CB  . LEU B 1 344 ? -1.007  4.022  27.327  1.00 56.79 ?  344  LEU B CB  1 
ATOM   5839 C CG  . LEU B 1 344 ? -1.122  4.032  28.869  1.00 57.85 ?  344  LEU B CG  1 
ATOM   5840 C CD1 . LEU B 1 344 ? -2.286  4.894  29.352  1.00 58.02 ?  344  LEU B CD1 1 
ATOM   5841 C CD2 . LEU B 1 344 ? -1.223  2.633  29.503  1.00 58.48 ?  344  LEU B CD2 1 
ATOM   5842 N N   . ALA B 1 345 ? 2.189   4.542  26.199  1.00 56.49 ?  345  ALA B N   1 
ATOM   5843 C CA  . ALA B 1 345 ? 3.095   5.428  25.445  1.00 56.27 ?  345  ALA B CA  1 
ATOM   5844 C C   . ALA B 1 345 ? 4.596   5.057  25.519  1.00 55.96 ?  345  ALA B C   1 
ATOM   5845 O O   . ALA B 1 345 ? 5.013   4.282  26.386  1.00 56.65 ?  345  ALA B O   1 
ATOM   5846 C CB  . ALA B 1 345 ? 2.874   6.880  25.886  1.00 56.18 ?  345  ALA B CB  1 
ATOM   5847 N N   . GLU B 1 346 ? 5.402   5.615  24.613  1.00 55.26 ?  346  GLU B N   1 
ATOM   5848 C CA  . GLU B 1 346 ? 6.867   5.487  24.683  1.00 54.62 ?  346  GLU B CA  1 
ATOM   5849 C C   . GLU B 1 346 ? 7.568   6.848  24.818  1.00 53.09 ?  346  GLU B C   1 
ATOM   5850 O O   . GLU B 1 346 ? 7.087   7.848  24.288  1.00 52.95 ?  346  GLU B O   1 
ATOM   5851 C CB  . GLU B 1 346 ? 7.411   4.782  23.437  1.00 55.49 ?  346  GLU B CB  1 
ATOM   5852 C CG  . GLU B 1 346 ? 6.826   3.410  23.133  1.00 57.91 ?  346  GLU B CG  1 
ATOM   5853 C CD  . GLU B 1 346 ? 6.960   3.049  21.659  1.00 61.37 ?  346  GLU B CD  1 
ATOM   5854 O OE1 . GLU B 1 346 ? 8.041   2.558  21.239  1.00 63.06 ?  346  GLU B OE1 1 
ATOM   5855 O OE2 . GLU B 1 346 ? 5.975   3.258  20.917  1.00 62.40 ?  346  GLU B OE2 1 
ATOM   5856 N N   . TRP B 1 347 ? 8.709   6.873  25.511  1.00 51.51 ?  347  TRP B N   1 
ATOM   5857 C CA  . TRP B 1 347 ? 9.523   8.094  25.658  1.00 49.90 ?  347  TRP B CA  1 
ATOM   5858 C C   . TRP B 1 347 ? 10.994  7.816  25.965  1.00 48.83 ?  347  TRP B C   1 
ATOM   5859 O O   . TRP B 1 347 ? 11.325  6.838  26.644  1.00 48.82 ?  347  TRP B O   1 
ATOM   5860 C CB  . TRP B 1 347 ? 8.964   8.990  26.761  1.00 49.90 ?  347  TRP B CB  1 
ATOM   5861 C CG  . TRP B 1 347 ? 8.981   8.344  28.094  1.00 50.07 ?  347  TRP B CG  1 
ATOM   5862 C CD1 . TRP B 1 347 ? 9.976   8.402  29.032  1.00 50.31 ?  347  TRP B CD1 1 
ATOM   5863 C CD2 . TRP B 1 347 ? 7.952   7.528  28.651  1.00 50.26 ?  347  TRP B CD2 1 
ATOM   5864 N NE1 . TRP B 1 347 ? 9.627   7.677  30.136  1.00 49.83 ?  347  TRP B NE1 1 
ATOM   5865 C CE2 . TRP B 1 347 ? 8.387   7.127  29.930  1.00 51.24 ?  347  TRP B CE2 1 
ATOM   5866 C CE3 . TRP B 1 347 ? 6.699   7.101  28.193  1.00 50.18 ?  347  TRP B CE3 1 
ATOM   5867 C CZ2 . TRP B 1 347 ? 7.607   6.305  30.764  1.00 51.45 ?  347  TRP B CZ2 1 
ATOM   5868 C CZ3 . TRP B 1 347 ? 5.929   6.288  29.014  1.00 50.96 ?  347  TRP B CZ3 1 
ATOM   5869 C CH2 . TRP B 1 347 ? 6.385   5.903  30.289  1.00 50.82 ?  347  TRP B CH2 1 
ATOM   5870 N N   . HIS B 1 348 ? 11.876  8.684  25.475  1.00 46.95 ?  348  HIS B N   1 
ATOM   5871 C CA  . HIS B 1 348 ? 13.281  8.615  25.839  1.00 45.36 ?  348  HIS B CA  1 
ATOM   5872 C C   . HIS B 1 348 ? 13.510  9.549  27.006  1.00 43.93 ?  348  HIS B C   1 
ATOM   5873 O O   . HIS B 1 348 ? 12.806  10.544 27.151  1.00 44.18 ?  348  HIS B O   1 
ATOM   5874 C CB  . HIS B 1 348 ? 14.179  9.030  24.675  1.00 45.67 ?  348  HIS B CB  1 
ATOM   5875 C CG  . HIS B 1 348 ? 14.029  8.179  23.456  1.00 46.36 ?  348  HIS B CG  1 
ATOM   5876 N ND1 . HIS B 1 348 ? 14.450  6.867  23.408  1.00 47.15 ?  348  HIS B ND1 1 
ATOM   5877 C CD2 . HIS B 1 348 ? 13.522  8.458  22.232  1.00 47.18 ?  348  HIS B CD2 1 
ATOM   5878 C CE1 . HIS B 1 348 ? 14.189  6.371  22.211  1.00 47.76 ?  348  HIS B CE1 1 
ATOM   5879 N NE2 . HIS B 1 348 ? 13.634  7.319  21.477  1.00 47.59 ?  348  HIS B NE2 1 
ATOM   5880 N N   . VAL B 1 349 ? 14.480  9.209  27.839  1.00 41.93 ?  349  VAL B N   1 
ATOM   5881 C CA  . VAL B 1 349 ? 14.917  10.055 28.931  1.00 40.75 ?  349  VAL B CA  1 
ATOM   5882 C C   . VAL B 1 349 ? 15.644  11.281 28.324  1.00 39.97 ?  349  VAL B C   1 
ATOM   5883 O O   . VAL B 1 349 ? 16.518  11.112 27.459  1.00 39.38 ?  349  VAL B O   1 
ATOM   5884 C CB  . VAL B 1 349 ? 15.815  9.260  29.917  1.00 40.55 ?  349  VAL B CB  1 
ATOM   5885 C CG1 . VAL B 1 349 ? 16.492  10.178 30.927  1.00 40.39 ?  349  VAL B CG1 1 
ATOM   5886 C CG2 . VAL B 1 349 ? 14.989  8.174  30.646  1.00 39.65 ?  349  VAL B CG2 1 
ATOM   5887 N N   . PRO B 1 350 ? 15.214  12.514 28.697  1.00 39.25 ?  350  PRO B N   1 
ATOM   5888 C CA  . PRO B 1 350 ? 15.890  13.737 28.217  1.00 38.31 ?  350  PRO B CA  1 
ATOM   5889 C C   . PRO B 1 350 ? 17.293  13.923 28.768  1.00 37.33 ?  350  PRO B C   1 
ATOM   5890 O O   . PRO B 1 350 ? 17.501  13.811 29.978  1.00 37.54 ?  350  PRO B O   1 
ATOM   5891 C CB  . PRO B 1 350 ? 14.967  14.866 28.701  1.00 38.32 ?  350  PRO B CB  1 
ATOM   5892 C CG  . PRO B 1 350 ? 13.632  14.212 28.914  1.00 39.00 ?  350  PRO B CG  1 
ATOM   5893 C CD  . PRO B 1 350 ? 14.004  12.850 29.472  1.00 38.66 ?  350  PRO B CD  1 
ATOM   5894 N N   . ALA B 1 351 ? 18.245  14.214 27.877  1.00 36.43 ?  351  ALA B N   1 
ATOM   5895 C CA  . ALA B 1 351 ? 19.624  14.498 28.289  1.00 35.18 ?  351  ALA B CA  1 
ATOM   5896 C C   . ALA B 1 351 ? 19.843  15.948 28.779  1.00 34.27 ?  351  ALA B C   1 
ATOM   5897 O O   . ALA B 1 351 ? 20.779  16.230 29.519  1.00 33.55 ?  351  ALA B O   1 
ATOM   5898 C CB  . ALA B 1 351 ? 20.560  14.174 27.165  1.00 35.90 ?  351  ALA B CB  1 
ATOM   5899 N N   . ALA B 1 352 ? 18.967  16.858 28.355  1.00 33.73 ?  352  ALA B N   1 
ATOM   5900 C CA  . ALA B 1 352 ? 19.061  18.268 28.716  1.00 32.88 ?  352  ALA B CA  1 
ATOM   5901 C C   . ALA B 1 352 ? 17.757  19.009 28.380  1.00 32.55 ?  352  ALA B C   1 
ATOM   5902 O O   . ALA B 1 352 ? 16.850  18.447 27.766  1.00 31.98 ?  352  ALA B O   1 
ATOM   5903 C CB  . ALA B 1 352 ? 20.285  18.941 28.012  1.00 32.51 ?  352  ALA B CB  1 
ATOM   5904 N N   . GLY B 1 353 ? 17.662  20.275 28.784  1.00 32.54 ?  353  GLY B N   1 
ATOM   5905 C CA  . GLY B 1 353 ? 16.496  21.080 28.417  1.00 32.60 ?  353  GLY B CA  1 
ATOM   5906 C C   . GLY B 1 353 ? 15.334  20.966 29.396  1.00 32.87 ?  353  GLY B C   1 
ATOM   5907 O O   . GLY B 1 353 ? 15.538  20.783 30.589  1.00 33.20 ?  353  GLY B O   1 
ATOM   5908 N N   . MET B 1 354 ? 14.117  21.092 28.892  1.00 33.02 ?  354  MET B N   1 
ATOM   5909 C CA  . MET B 1 354 ? 12.952  21.202 29.762  1.00 33.82 ?  354  MET B CA  1 
ATOM   5910 C C   . MET B 1 354 ? 11.752  20.462 29.229  1.00 33.10 ?  354  MET B C   1 
ATOM   5911 O O   . MET B 1 354 ? 10.647  20.709 29.712  1.00 32.83 ?  354  MET B O   1 
ATOM   5912 C CB  . MET B 1 354 ? 12.573  22.685 30.020  1.00 34.36 ?  354  MET B CB  1 
ATOM   5913 C CG  . MET B 1 354 ? 12.677  23.646 28.833  1.00 34.96 ?  354  MET B CG  1 
ATOM   5914 S SD  . MET B 1 354 ? 12.321  25.413 29.259  1.00 36.94 ?  354  MET B SD  1 
ATOM   5915 C CE  . MET B 1 354 ? 13.860  25.932 30.006  1.00 36.69 ?  354  MET B CE  1 
ATOM   5916 N N   . PHE B 1 355 ? 11.961  19.573 28.240  1.00 32.31 ?  355  PHE B N   1 
ATOM   5917 C CA  . PHE B 1 355 ? 10.862  18.858 27.565  1.00 32.65 ?  355  PHE B CA  1 
ATOM   5918 C C   . PHE B 1 355 ? 10.976  17.335 27.615  1.00 32.86 ?  355  PHE B C   1 
ATOM   5919 O O   . PHE B 1 355 ? 12.069  16.771 27.559  1.00 31.76 ?  355  PHE B O   1 
ATOM   5920 C CB  . PHE B 1 355 ? 10.724  19.279 26.086  1.00 33.30 ?  355  PHE B CB  1 
ATOM   5921 C CG  . PHE B 1 355 ? 10.629  20.766 25.884  1.00 33.09 ?  355  PHE B CG  1 
ATOM   5922 C CD1 . PHE B 1 355 ? 9.548   21.476 26.382  1.00 31.83 ?  355  PHE B CD1 1 
ATOM   5923 C CD2 . PHE B 1 355 ? 11.641  21.459 25.225  1.00 33.15 ?  355  PHE B CD2 1 
ATOM   5924 C CE1 . PHE B 1 355 ? 9.466   22.870 26.227  1.00 34.17 ?  355  PHE B CE1 1 
ATOM   5925 C CE2 . PHE B 1 355 ? 11.571  22.853 25.071  1.00 33.41 ?  355  PHE B CE2 1 
ATOM   5926 C CZ  . PHE B 1 355 ? 10.492  23.562 25.569  1.00 32.76 ?  355  PHE B CZ  1 
ATOM   5927 N N   . LEU B 1 356 ? 9.816   16.700 27.703  1.00 33.89 ?  356  LEU B N   1 
ATOM   5928 C CA  . LEU B 1 356 ? 9.633   15.261 27.483  1.00 34.58 ?  356  LEU B CA  1 
ATOM   5929 C C   . LEU B 1 356 ? 8.776   15.074 26.216  1.00 35.32 ?  356  LEU B C   1 
ATOM   5930 O O   . LEU B 1 356 ? 7.753   15.735 26.034  1.00 34.87 ?  356  LEU B O   1 
ATOM   5931 C CB  . LEU B 1 356 ? 8.961   14.633 28.711  1.00 35.17 ?  356  LEU B CB  1 
ATOM   5932 C CG  . LEU B 1 356 ? 8.812   13.108 28.849  1.00 34.57 ?  356  LEU B CG  1 
ATOM   5933 C CD1 . LEU B 1 356 ? 10.166  12.458 29.031  1.00 30.97 ?  356  LEU B CD1 1 
ATOM   5934 C CD2 . LEU B 1 356 ? 7.896   12.820 30.036  1.00 32.63 ?  356  LEU B CD2 1 
ATOM   5935 N N   . TRP B 1 357 ? 9.237   14.207 25.317  1.00 36.05 ?  357  TRP B N   1 
ATOM   5936 C CA  . TRP B 1 357 ? 8.599   13.959 24.026  1.00 36.66 ?  357  TRP B CA  1 
ATOM   5937 C C   . TRP B 1 357 ? 7.954   12.583 24.162  1.00 38.95 ?  357  TRP B C   1 
ATOM   5938 O O   . TRP B 1 357 ? 8.625   11.579 24.416  1.00 38.43 ?  357  TRP B O   1 
ATOM   5939 C CB  . TRP B 1 357 ? 9.699   13.983 22.961  1.00 34.52 ?  357  TRP B CB  1 
ATOM   5940 C CG  . TRP B 1 357 ? 9.378   13.867 21.488  1.00 32.12 ?  357  TRP B CG  1 
ATOM   5941 C CD1 . TRP B 1 357 ? 9.941   12.982 20.631  1.00 30.55 ?  357  TRP B CD1 1 
ATOM   5942 C CD2 . TRP B 1 357 ? 8.519   14.702 20.689  1.00 31.29 ?  357  TRP B CD2 1 
ATOM   5943 N NE1 . TRP B 1 357 ? 9.465   13.171 19.361  1.00 31.48 ?  357  TRP B NE1 1 
ATOM   5944 C CE2 . TRP B 1 357 ? 8.602   14.234 19.365  1.00 31.22 ?  357  TRP B CE2 1 
ATOM   5945 C CE3 . TRP B 1 357 ? 7.688   15.794 20.965  1.00 31.04 ?  357  TRP B CE3 1 
ATOM   5946 C CZ2 . TRP B 1 357 ? 7.892   14.814 18.319  1.00 29.93 ?  357  TRP B CZ2 1 
ATOM   5947 C CZ3 . TRP B 1 357 ? 6.984   16.359 19.938  1.00 30.51 ?  357  TRP B CZ3 1 
ATOM   5948 C CH2 . TRP B 1 357 ? 7.085   15.869 18.624  1.00 31.23 ?  357  TRP B CH2 1 
ATOM   5949 N N   . ILE B 1 358 ? 6.636   12.542 24.020  1.00 42.04 ?  358  ILE B N   1 
ATOM   5950 C CA  . ILE B 1 358 ? 5.889   11.315 24.305  1.00 43.90 ?  358  ILE B CA  1 
ATOM   5951 C C   . ILE B 1 358 ? 5.236   10.789 23.046  1.00 45.03 ?  358  ILE B C   1 
ATOM   5952 O O   . ILE B 1 358 ? 4.475   11.500 22.399  1.00 45.34 ?  358  ILE B O   1 
ATOM   5953 C CB  . ILE B 1 358 ? 4.806   11.551 25.389  1.00 44.10 ?  358  ILE B CB  1 
ATOM   5954 C CG1 . ILE B 1 358 ? 5.358   12.386 26.540  1.00 44.82 ?  358  ILE B CG1 1 
ATOM   5955 C CG2 . ILE B 1 358 ? 4.280   10.222 25.922  1.00 43.92 ?  358  ILE B CG2 1 
ATOM   5956 C CD1 . ILE B 1 358 ? 4.291   12.938 27.462  1.00 44.69 ?  358  ILE B CD1 1 
ATOM   5957 N N   . LYS B 1 359 ? 5.531   9.544  22.693  1.00 47.13 ?  359  LYS B N   1 
ATOM   5958 C CA  . LYS B 1 359 ? 4.780   8.885  21.621  1.00 49.67 ?  359  LYS B CA  1 
ATOM   5959 C C   . LYS B 1 359 ? 3.618   8.108  22.236  1.00 51.17 ?  359  LYS B C   1 
ATOM   5960 O O   . LYS B 1 359 ? 3.835   7.174  23.009  1.00 51.39 ?  359  LYS B O   1 
ATOM   5961 C CB  . LYS B 1 359 ? 5.681   7.945  20.813  1.00 49.39 ?  359  LYS B CB  1 
ATOM   5962 C CG  . LYS B 1 359 ? 5.099   7.514  19.465  1.00 50.07 ?  359  LYS B CG  1 
ATOM   5963 C CD  . LYS B 1 359 ? 6.098   6.631  18.702  1.00 51.18 ?  359  LYS B CD  1 
ATOM   5964 C CE  . LYS B 1 359 ? 5.664   6.360  17.250  1.00 52.80 ?  359  LYS B CE  1 
ATOM   5965 N NZ  . LYS B 1 359 ? 4.833   5.119  17.104  1.00 53.34 ?  359  LYS B NZ  1 
ATOM   5966 N N   . VAL B 1 360 ? 2.391   8.503  21.922  1.00 53.58 ?  360  VAL B N   1 
ATOM   5967 C CA  . VAL B 1 360 ? 1.231   7.723  22.376  1.00 56.01 ?  360  VAL B CA  1 
ATOM   5968 C C   . VAL B 1 360 ? 0.894   6.661  21.327  1.00 57.54 ?  360  VAL B C   1 
ATOM   5969 O O   . VAL B 1 360 ? 0.640   6.961  20.150  1.00 57.11 ?  360  VAL B O   1 
ATOM   5970 C CB  . VAL B 1 360 ? 0.005   8.589  22.839  1.00 55.86 ?  360  VAL B CB  1 
ATOM   5971 C CG1 . VAL B 1 360 ? 0.476   9.765  23.717  1.00 56.17 ?  360  VAL B CG1 1 
ATOM   5972 C CG2 . VAL B 1 360 ? -0.814  9.097  21.665  1.00 56.60 ?  360  VAL B CG2 1 
ATOM   5973 N N   . LYS B 1 361 ? 0.919   5.412  21.785  1.00 60.00 ?  361  LYS B N   1 
ATOM   5974 C CA  . LYS B 1 361 ? 1.039   4.249  20.903  1.00 62.27 ?  361  LYS B CA  1 
ATOM   5975 C C   . LYS B 1 361 ? -0.202  3.894  20.094  1.00 63.90 ?  361  LYS B C   1 
ATOM   5976 O O   . LYS B 1 361 ? -0.081  3.261  19.040  1.00 64.30 ?  361  LYS B O   1 
ATOM   5977 C CB  . LYS B 1 361 ? 1.484   3.033  21.699  1.00 62.04 ?  361  LYS B CB  1 
ATOM   5978 C CG  . LYS B 1 361 ? 2.916   3.110  22.194  1.00 62.66 ?  361  LYS B CG  1 
ATOM   5979 C CD  . LYS B 1 361 ? 3.459   1.724  22.569  1.00 63.72 ?  361  LYS B CD  1 
ATOM   5980 C CE  . LYS B 1 361 ? 3.627   0.818  21.334  1.00 62.89 ?  361  LYS B CE  1 
ATOM   5981 N NZ  . LYS B 1 361 ? 4.436   -0.383 21.671  1.00 63.75 ?  361  LYS B NZ  1 
ATOM   5982 N N   . GLY B 1 362 ? -1.379  4.289  20.580  1.00 65.26 ?  362  GLY B N   1 
ATOM   5983 C CA  . GLY B 1 362 ? -2.634  3.879  19.960  1.00 67.26 ?  362  GLY B CA  1 
ATOM   5984 C C   . GLY B 1 362 ? -2.923  4.446  18.582  1.00 68.71 ?  362  GLY B C   1 
ATOM   5985 O O   . GLY B 1 362 ? -3.078  3.691  17.617  1.00 68.68 ?  362  GLY B O   1 
ATOM   5986 N N   . ILE B 1 363 ? -2.956  5.778  18.497  1.00 70.20 ?  363  ILE B N   1 
ATOM   5987 C CA  . ILE B 1 363 ? -3.566  6.519  17.374  1.00 71.51 ?  363  ILE B CA  1 
ATOM   5988 C C   . ILE B 1 363 ? -2.569  7.188  16.422  1.00 72.10 ?  363  ILE B C   1 
ATOM   5989 O O   . ILE B 1 363 ? -1.409  7.397  16.771  1.00 72.14 ?  363  ILE B O   1 
ATOM   5990 C CB  . ILE B 1 363 ? -4.505  7.622  17.912  1.00 71.86 ?  363  ILE B CB  1 
ATOM   5991 C CG1 . ILE B 1 363 ? -4.953  7.287  19.343  1.00 72.28 ?  363  ILE B CG1 1 
ATOM   5992 C CG2 . ILE B 1 363 ? -5.705  7.844  16.959  1.00 72.04 ?  363  ILE B CG2 1 
ATOM   5993 C CD1 . ILE B 1 363 ? -4.925  8.462  20.272  1.00 72.81 ?  363  ILE B CD1 1 
ATOM   5994 N N   . ASN B 1 364 ? -3.051  7.523  15.225  1.00 73.17 ?  364  ASN B N   1 
ATOM   5995 C CA  . ASN B 1 364 ? -2.248  8.131  14.164  1.00 74.43 ?  364  ASN B CA  1 
ATOM   5996 C C   . ASN B 1 364 ? -1.953  9.602  14.433  1.00 75.13 ?  364  ASN B C   1 
ATOM   5997 O O   . ASN B 1 364 ? -0.871  10.096 14.098  1.00 74.91 ?  364  ASN B O   1 
ATOM   5998 C CB  . ASN B 1 364 ? -2.963  8.019  12.807  1.00 74.47 ?  364  ASN B CB  1 
ATOM   5999 C CG  . ASN B 1 364 ? -3.316  6.585  12.436  1.00 75.35 ?  364  ASN B CG  1 
ATOM   6000 O OD1 . ASN B 1 364 ? -2.435  5.726  12.296  1.00 76.16 ?  364  ASN B OD1 1 
ATOM   6001 N ND2 . ASN B 1 364 ? -4.610  6.322  12.259  1.00 74.87 ?  364  ASN B ND2 1 
ATOM   6002 N N   . ASP B 1 365 ? -2.935  10.289 15.020  1.00 76.12 ?  365  ASP B N   1 
ATOM   6003 C CA  . ASP B 1 365 ? -2.863  11.723 15.280  1.00 77.00 ?  365  ASP B CA  1 
ATOM   6004 C C   . ASP B 1 365 ? -3.352  12.038 16.685  1.00 77.57 ?  365  ASP B C   1 
ATOM   6005 O O   . ASP B 1 365 ? -4.448  11.638 17.080  1.00 77.71 ?  365  ASP B O   1 
ATOM   6006 C CB  . ASP B 1 365 ? -3.694  12.487 14.249  1.00 77.21 ?  365  ASP B CB  1 
ATOM   6007 C CG  . ASP B 1 365 ? -3.352  13.977 14.187  1.00 78.05 ?  365  ASP B CG  1 
ATOM   6008 O OD1 . ASP B 1 365 ? -4.011  14.684 13.393  1.00 78.50 ?  365  ASP B OD1 1 
ATOM   6009 O OD2 . ASP B 1 365 ? -2.438  14.446 14.912  1.00 79.07 ?  365  ASP B OD2 1 
ATOM   6010 N N   . VAL B 1 366 ? -2.530  12.766 17.431  1.00 78.41 ?  366  VAL B N   1 
ATOM   6011 C CA  . VAL B 1 366 ? -2.779  13.024 18.844  1.00 79.04 ?  366  VAL B CA  1 
ATOM   6012 C C   . VAL B 1 366 ? -3.724  14.207 19.053  1.00 79.86 ?  366  VAL B C   1 
ATOM   6013 O O   . VAL B 1 366 ? -4.303  14.348 20.129  1.00 79.96 ?  366  VAL B O   1 
ATOM   6014 C CB  . VAL B 1 366 ? -1.440  13.214 19.617  1.00 78.98 ?  366  VAL B CB  1 
ATOM   6015 C CG1 . VAL B 1 366 ? -0.933  14.659 19.519  1.00 78.54 ?  366  VAL B CG1 1 
ATOM   6016 C CG2 . VAL B 1 366 ? -1.576  12.765 21.059  1.00 78.71 ?  366  VAL B CG2 1 
ATOM   6017 N N   . LYS B 1 367 ? -3.877  15.041 18.019  1.00 81.02 ?  367  LYS B N   1 
ATOM   6018 C CA  . LYS B 1 367 ? -4.743  16.234 18.053  1.00 82.28 ?  367  LYS B CA  1 
ATOM   6019 C C   . LYS B 1 367 ? -6.206  15.924 18.383  1.00 83.31 ?  367  LYS B C   1 
ATOM   6020 O O   . LYS B 1 367 ? -6.925  16.784 18.902  1.00 83.52 ?  367  LYS B O   1 
ATOM   6021 C CB  . LYS B 1 367 ? -4.669  17.009 16.730  1.00 82.16 ?  367  LYS B CB  1 
ATOM   6022 C CG  . LYS B 1 367 ? -3.782  18.255 16.767  1.00 82.12 ?  367  LYS B CG  1 
ATOM   6023 C CD  . LYS B 1 367 ? -3.901  19.114 15.491  1.00 81.78 ?  367  LYS B CD  1 
ATOM   6024 C CE  . LYS B 1 367 ? -5.262  19.824 15.378  1.00 81.51 ?  367  LYS B CE  1 
ATOM   6025 N NZ  . LYS B 1 367 ? -5.184  21.180 14.751  1.00 79.68 ?  367  LYS B NZ  1 
ATOM   6026 N N   . GLU B 1 368 ? -6.636  14.701 18.072  1.00 84.35 ?  368  GLU B N   1 
ATOM   6027 C CA  . GLU B 1 368 ? -7.962  14.225 18.449  1.00 85.47 ?  368  GLU B CA  1 
ATOM   6028 C C   . GLU B 1 368 ? -8.186  14.317 19.955  1.00 86.01 ?  368  GLU B C   1 
ATOM   6029 O O   . GLU B 1 368 ? -9.056  15.062 20.413  1.00 86.06 ?  368  GLU B O   1 
ATOM   6030 C CB  . GLU B 1 368 ? -8.180  12.782 17.972  1.00 85.54 ?  368  GLU B CB  1 
ATOM   6031 C CG  . GLU B 1 368 ? -9.051  12.655 16.723  1.00 86.50 ?  368  GLU B CG  1 
ATOM   6032 C CD  . GLU B 1 368 ? -10.555 12.758 17.015  1.00 87.58 ?  368  GLU B CD  1 
ATOM   6033 O OE1 . GLU B 1 368 ? -11.031 13.845 17.436  1.00 87.87 ?  368  GLU B OE1 1 
ATOM   6034 O OE2 . GLU B 1 368 ? -11.263 11.746 16.804  1.00 87.41 ?  368  GLU B OE2 1 
ATOM   6035 N N   . LEU B 1 369 ? -7.368  13.583 20.709  1.00 86.79 ?  369  LEU B N   1 
ATOM   6036 C CA  . LEU B 1 369 ? -7.576  13.385 22.144  1.00 87.34 ?  369  LEU B CA  1 
ATOM   6037 C C   . LEU B 1 369 ? -6.851  14.354 23.082  1.00 87.74 ?  369  LEU B C   1 
ATOM   6038 O O   . LEU B 1 369 ? -6.876  14.162 24.307  1.00 87.72 ?  369  LEU B O   1 
ATOM   6039 C CB  . LEU B 1 369 ? -7.227  11.940 22.535  1.00 87.40 ?  369  LEU B CB  1 
ATOM   6040 C CG  . LEU B 1 369 ? -5.811  11.343 22.458  1.00 87.29 ?  369  LEU B CG  1 
ATOM   6041 C CD1 . LEU B 1 369 ? -4.682  12.292 22.856  1.00 87.19 ?  369  LEU B CD1 1 
ATOM   6042 C CD2 . LEU B 1 369 ? -5.769  10.108 23.335  1.00 87.27 ?  369  LEU B CD2 1 
ATOM   6043 N N   . ILE B 1 370 ? -6.204  15.378 22.522  1.00 88.16 ?  370  ILE B N   1 
ATOM   6044 C CA  . ILE B 1 370 ? -5.447  16.334 23.341  1.00 88.61 ?  370  ILE B CA  1 
ATOM   6045 C C   . ILE B 1 370 ? -5.986  17.762 23.239  1.00 88.81 ?  370  ILE B C   1 
ATOM   6046 O O   . ILE B 1 370 ? -5.756  18.588 24.126  1.00 88.69 ?  370  ILE B O   1 
ATOM   6047 C CB  . ILE B 1 370 ? -3.906  16.266 23.059  1.00 88.63 ?  370  ILE B CB  1 
ATOM   6048 C CG1 . ILE B 1 370 ? -3.107  16.136 24.372  1.00 88.69 ?  370  ILE B CG1 1 
ATOM   6049 C CG2 . ILE B 1 370 ? -3.433  17.415 22.153  1.00 88.68 ?  370  ILE B CG2 1 
ATOM   6050 C CD1 . ILE B 1 370 ? -3.002  17.397 25.222  1.00 89.27 ?  370  ILE B CD1 1 
ATOM   6051 N N   . GLU B 1 371 ? -6.717  18.037 22.164  1.00 89.15 ?  371  GLU B N   1 
ATOM   6052 C CA  . GLU B 1 371 ? -7.260  19.364 21.934  1.00 89.44 ?  371  GLU B CA  1 
ATOM   6053 C C   . GLU B 1 371 ? -8.730  19.429 22.338  1.00 89.77 ?  371  GLU B C   1 
ATOM   6054 O O   . GLU B 1 371 ? -9.088  20.121 23.292  1.00 89.70 ?  371  GLU B O   1 
ATOM   6055 C CB  . GLU B 1 371 ? -7.076  19.758 20.472  1.00 89.43 ?  371  GLU B CB  1 
ATOM   6056 C CG  . GLU B 1 371 ? -6.605  21.183 20.289  1.00 89.60 ?  371  GLU B CG  1 
ATOM   6057 C CD  . GLU B 1 371 ? -5.753  21.349 19.053  1.00 89.67 ?  371  GLU B CD  1 
ATOM   6058 O OE1 . GLU B 1 371 ? -6.246  21.040 17.948  1.00 89.90 ?  371  GLU B OE1 1 
ATOM   6059 O OE2 . GLU B 1 371 ? -4.591  21.789 19.187  1.00 89.49 ?  371  GLU B OE2 1 
ATOM   6060 N N   . GLU B 1 372 ? -9.571  18.695 21.611  1.00 90.14 ?  372  GLU B N   1 
ATOM   6061 C CA  . GLU B 1 372 ? -11.011 18.642 21.878  1.00 90.44 ?  372  GLU B CA  1 
ATOM   6062 C C   . GLU B 1 372 ? -11.371 17.946 23.201  1.00 90.41 ?  372  GLU B C   1 
ATOM   6063 O O   . GLU B 1 372 ? -12.345 18.322 23.869  1.00 90.35 ?  372  GLU B O   1 
ATOM   6064 C CB  . GLU B 1 372 ? -11.749 17.961 20.712  1.00 90.54 ?  372  GLU B CB  1 
ATOM   6065 C CG  . GLU B 1 372 ? -12.377 18.923 19.693  1.00 91.07 ?  372  GLU B CG  1 
ATOM   6066 C CD  . GLU B 1 372 ? -11.447 19.319 18.550  1.00 91.93 ?  372  GLU B CD  1 
ATOM   6067 O OE1 . GLU B 1 372 ? -11.882 20.124 17.693  1.00 92.58 ?  372  GLU B OE1 1 
ATOM   6068 O OE2 . GLU B 1 372 ? -10.295 18.833 18.492  1.00 92.22 ?  372  GLU B OE2 1 
ATOM   6069 N N   . LYS B 1 373 ? -10.575 16.948 23.580  1.00 90.32 ?  373  LYS B N   1 
ATOM   6070 C CA  . LYS B 1 373 ? -10.967 16.021 24.644  1.00 90.26 ?  373  LYS B CA  1 
ATOM   6071 C C   . LYS B 1 373 ? -10.131 16.145 25.922  1.00 90.03 ?  373  LYS B C   1 
ATOM   6072 O O   . LYS B 1 373 ? -10.585 15.736 26.992  1.00 90.16 ?  373  LYS B O   1 
ATOM   6073 C CB  . LYS B 1 373 ? -10.982 14.571 24.121  1.00 90.34 ?  373  LYS B CB  1 
ATOM   6074 C CG  . LYS B 1 373 ? -11.077 14.469 22.586  1.00 90.87 ?  373  LYS B CG  1 
ATOM   6075 C CD  . LYS B 1 373 ? -12.015 13.383 22.068  1.00 90.93 ?  373  LYS B CD  1 
ATOM   6076 C CE  . LYS B 1 373 ? -12.218 13.552 20.559  1.00 91.09 ?  373  LYS B CE  1 
ATOM   6077 N NZ  . LYS B 1 373 ? -13.554 13.092 20.067  1.00 90.33 ?  373  LYS B NZ  1 
ATOM   6078 N N   . ALA B 1 374 ? -8.930  16.716 25.814  1.00 89.67 ?  374  ALA B N   1 
ATOM   6079 C CA  . ALA B 1 374 ? -8.059  16.945 26.986  1.00 89.20 ?  374  ALA B CA  1 
ATOM   6080 C C   . ALA B 1 374 ? -8.185  18.351 27.587  1.00 88.82 ?  374  ALA B C   1 
ATOM   6081 O O   . ALA B 1 374 ? -7.931  18.548 28.782  1.00 88.47 ?  374  ALA B O   1 
ATOM   6082 C CB  . ALA B 1 374 ? -6.606  16.634 26.656  1.00 89.24 ?  374  ALA B CB  1 
ATOM   6083 N N   . VAL B 1 375 ? -8.561  19.319 26.746  1.00 88.44 ?  375  VAL B N   1 
ATOM   6084 C CA  . VAL B 1 375 ? -8.923  20.670 27.191  1.00 88.08 ?  375  VAL B CA  1 
ATOM   6085 C C   . VAL B 1 375 ? -10.255 20.632 27.948  1.00 87.72 ?  375  VAL B C   1 
ATOM   6086 O O   . VAL B 1 375 ? -10.462 21.388 28.902  1.00 87.89 ?  375  VAL B O   1 
ATOM   6087 C CB  . VAL B 1 375 ? -8.978  21.673 26.002  1.00 88.08 ?  375  VAL B CB  1 
ATOM   6088 C CG1 . VAL B 1 375 ? -9.834  22.902 26.327  1.00 88.14 ?  375  VAL B CG1 1 
ATOM   6089 C CG2 . VAL B 1 375 ? -7.570  22.092 25.590  1.00 88.02 ?  375  VAL B CG2 1 
ATOM   6090 N N   . LYS B 1 376 ? -11.144 19.735 27.530  1.00 87.31 ?  376  LYS B N   1 
ATOM   6091 C CA  . LYS B 1 376 ? -12.419 19.534 28.219  1.00 86.92 ?  376  LYS B CA  1 
ATOM   6092 C C   . LYS B 1 376 ? -12.266 18.606 29.441  1.00 86.27 ?  376  LYS B C   1 
ATOM   6093 O O   . LYS B 1 376 ? -13.254 18.228 30.076  1.00 86.33 ?  376  LYS B O   1 
ATOM   6094 C CB  . LYS B 1 376 ? -13.492 19.027 27.241  1.00 87.14 ?  376  LYS B CB  1 
ATOM   6095 C CG  . LYS B 1 376 ? -14.879 19.610 27.505  1.00 87.55 ?  376  LYS B CG  1 
ATOM   6096 C CD  . LYS B 1 376 ? -15.835 19.407 26.336  1.00 88.95 ?  376  LYS B CD  1 
ATOM   6097 C CE  . LYS B 1 376 ? -15.743 20.538 25.305  1.00 89.66 ?  376  LYS B CE  1 
ATOM   6098 N NZ  . LYS B 1 376 ? -14.630 20.337 24.327  1.00 90.29 ?  376  LYS B NZ  1 
ATOM   6099 N N   . MET B 1 377 ? -11.020 18.240 29.749  1.00 85.37 ?  377  MET B N   1 
ATOM   6100 C CA  . MET B 1 377 ? -10.673 17.585 31.006  1.00 84.31 ?  377  MET B CA  1 
ATOM   6101 C C   . MET B 1 377 ? -10.035 18.613 31.941  1.00 83.08 ?  377  MET B C   1 
ATOM   6102 O O   . MET B 1 377 ? -10.718 19.156 32.810  1.00 83.22 ?  377  MET B O   1 
ATOM   6103 C CB  . MET B 1 377 ? -9.740  16.384 30.783  1.00 84.72 ?  377  MET B CB  1 
ATOM   6104 C CG  . MET B 1 377 ? -10.444 15.048 30.509  1.00 85.91 ?  377  MET B CG  1 
ATOM   6105 S SD  . MET B 1 377 ? -11.348 14.358 31.927  1.00 89.15 ?  377  MET B SD  1 
ATOM   6106 C CE  . MET B 1 377 ? -10.067 13.518 32.855  1.00 87.38 ?  377  MET B CE  1 
ATOM   6107 N N   . GLY B 1 378 ? -8.746  18.898 31.746  1.00 81.59 ?  378  GLY B N   1 
ATOM   6108 C CA  . GLY B 1 378 ? -8.023  19.841 32.610  1.00 79.61 ?  378  GLY B CA  1 
ATOM   6109 C C   . GLY B 1 378 ? -6.509  19.975 32.448  1.00 77.96 ?  378  GLY B C   1 
ATOM   6110 O O   . GLY B 1 378 ? -5.863  20.710 33.204  1.00 78.07 ?  378  GLY B O   1 
ATOM   6111 N N   . VAL B 1 379 ? -5.932  19.270 31.476  1.00 76.10 ?  379  VAL B N   1 
ATOM   6112 C CA  . VAL B 1 379 ? -4.487  19.360 31.217  1.00 73.93 ?  379  VAL B CA  1 
ATOM   6113 C C   . VAL B 1 379 ? -4.195  19.790 29.779  1.00 72.04 ?  379  VAL B C   1 
ATOM   6114 O O   . VAL B 1 379 ? -4.981  19.534 28.862  1.00 71.85 ?  379  VAL B O   1 
ATOM   6115 C CB  . VAL B 1 379 ? -3.698  18.032 31.568  1.00 74.12 ?  379  VAL B CB  1 
ATOM   6116 C CG1 . VAL B 1 379 ? -4.153  17.455 32.900  1.00 74.71 ?  379  VAL B CG1 1 
ATOM   6117 C CG2 . VAL B 1 379 ? -3.812  16.981 30.460  1.00 73.97 ?  379  VAL B CG2 1 
ATOM   6118 N N   . LEU B 1 380 ? -3.054  20.443 29.599  1.00 69.44 ?  380  LEU B N   1 
ATOM   6119 C CA  . LEU B 1 380 ? -2.603  20.847 28.283  1.00 66.73 ?  380  LEU B CA  1 
ATOM   6120 C C   . LEU B 1 380 ? -1.205  20.302 27.994  1.00 64.65 ?  380  LEU B C   1 
ATOM   6121 O O   . LEU B 1 380 ? -0.274  20.486 28.782  1.00 64.70 ?  380  LEU B O   1 
ATOM   6122 C CB  . LEU B 1 380 ? -2.628  22.372 28.164  1.00 66.97 ?  380  LEU B CB  1 
ATOM   6123 C CG  . LEU B 1 380 ? -3.973  22.973 27.754  1.00 67.45 ?  380  LEU B CG  1 
ATOM   6124 C CD1 . LEU B 1 380 ? -4.290  24.207 28.580  1.00 67.59 ?  380  LEU B CD1 1 
ATOM   6125 C CD2 . LEU B 1 380 ? -3.993  23.283 26.253  1.00 68.04 ?  380  LEU B CD2 1 
ATOM   6126 N N   . MET B 1 381 ? -1.091  19.602 26.872  1.00 61.79 ?  381  MET B N   1 
ATOM   6127 C CA  . MET B 1 381 ? 0.188   19.283 26.258  1.00 58.61 ?  381  MET B CA  1 
ATOM   6128 C C   . MET B 1 381 ? 0.128   19.701 24.800  1.00 56.11 ?  381  MET B C   1 
ATOM   6129 O O   . MET B 1 381 ? -0.939  20.007 24.277  1.00 55.57 ?  381  MET B O   1 
ATOM   6130 C CB  . MET B 1 381 ? 0.498   17.798 26.390  1.00 59.03 ?  381  MET B CB  1 
ATOM   6131 C CG  . MET B 1 381 ? 1.060   17.444 27.746  1.00 59.78 ?  381  MET B CG  1 
ATOM   6132 S SD  . MET B 1 381 ? 0.109   16.120 28.480  1.00 63.11 ?  381  MET B SD  1 
ATOM   6133 C CE  . MET B 1 381 ? 1.287   15.450 29.647  1.00 60.52 ?  381  MET B CE  1 
ATOM   6134 N N   . LEU B 1 382 ? 1.278   19.705 24.143  1.00 53.05 ?  382  LEU B N   1 
ATOM   6135 C CA  . LEU B 1 382 ? 1.366   20.223 22.799  1.00 50.19 ?  382  LEU B CA  1 
ATOM   6136 C C   . LEU B 1 382 ? 1.493   19.127 21.738  1.00 48.27 ?  382  LEU B C   1 
ATOM   6137 O O   . LEU B 1 382 ? 2.417   18.318 21.777  1.00 47.57 ?  382  LEU B O   1 
ATOM   6138 C CB  . LEU B 1 382 ? 2.529   21.215 22.727  1.00 50.11 ?  382  LEU B CB  1 
ATOM   6139 C CG  . LEU B 1 382 ? 2.756   22.055 21.489  1.00 50.08 ?  382  LEU B CG  1 
ATOM   6140 C CD1 . LEU B 1 382 ? 1.582   22.987 21.203  1.00 49.27 ?  382  LEU B CD1 1 
ATOM   6141 C CD2 . LEU B 1 382 ? 4.031   22.832 21.714  1.00 50.13 ?  382  LEU B CD2 1 
ATOM   6142 N N   . PRO B 1 383 ? 0.557   19.108 20.782  1.00 46.62 ?  383  PRO B N   1 
ATOM   6143 C CA  . PRO B 1 383 ? 0.634   18.226 19.623  1.00 45.62 ?  383  PRO B CA  1 
ATOM   6144 C C   . PRO B 1 383 ? 1.950   18.423 18.852  1.00 44.68 ?  383  PRO B C   1 
ATOM   6145 O O   . PRO B 1 383 ? 2.330   19.565 18.545  1.00 43.73 ?  383  PRO B O   1 
ATOM   6146 C CB  . PRO B 1 383 ? -0.548  18.687 18.757  1.00 45.51 ?  383  PRO B CB  1 
ATOM   6147 C CG  . PRO B 1 383 ? -1.499  19.297 19.716  1.00 45.15 ?  383  PRO B CG  1 
ATOM   6148 C CD  . PRO B 1 383 ? -0.641  19.965 20.736  1.00 46.57 ?  383  PRO B CD  1 
ATOM   6149 N N   . GLY B 1 384 ? 2.620   17.303 18.550  1.00 43.77 ?  384  GLY B N   1 
ATOM   6150 C CA  . GLY B 1 384 ? 3.901   17.279 17.829  1.00 42.62 ?  384  GLY B CA  1 
ATOM   6151 C C   . GLY B 1 384 ? 3.906   17.810 16.411  1.00 41.97 ?  384  GLY B C   1 
ATOM   6152 O O   . GLY B 1 384 ? 4.987   18.067 15.846  1.00 41.53 ?  384  GLY B O   1 
ATOM   6153 N N   . ASN B 1 385 ? 2.708   17.990 15.841  1.00 40.87 ?  385  ASN B N   1 
ATOM   6154 C CA  . ASN B 1 385 ? 2.516   18.596 14.517  1.00 40.24 ?  385  ASN B CA  1 
ATOM   6155 C C   . ASN B 1 385 ? 3.372   19.853 14.245  1.00 38.61 ?  385  ASN B C   1 
ATOM   6156 O O   . ASN B 1 385 ? 3.847   20.071 13.129  1.00 38.14 ?  385  ASN B O   1 
ATOM   6157 C CB  . ASN B 1 385 ? 1.044   19.002 14.322  1.00 41.18 ?  385  ASN B CB  1 
ATOM   6158 C CG  . ASN B 1 385 ? 0.079   17.841 14.440  1.00 44.71 ?  385  ASN B CG  1 
ATOM   6159 O OD1 . ASN B 1 385 ? -0.121  17.261 15.529  1.00 46.25 ?  385  ASN B OD1 1 
ATOM   6160 N ND2 . ASN B 1 385 ? -0.573  17.517 13.319  1.00 49.30 ?  385  ASN B ND2 1 
ATOM   6161 N N   . ALA B 1 386 ? 3.518   20.708 15.257  1.00 37.41 ?  386  ALA B N   1 
ATOM   6162 C CA  . ALA B 1 386 ? 4.150   22.021 15.072  1.00 35.34 ?  386  ALA B CA  1 
ATOM   6163 C C   . ALA B 1 386 ? 5.640   21.904 14.715  1.00 34.47 ?  386  ALA B C   1 
ATOM   6164 O O   . ALA B 1 386 ? 6.240   22.844 14.157  1.00 33.74 ?  386  ALA B O   1 
ATOM   6165 C CB  . ALA B 1 386 ? 3.946   22.906 16.311  1.00 35.58 ?  386  ALA B CB  1 
ATOM   6166 N N   . PHE B 1 387 ? 6.220   20.729 14.989  1.00 32.95 ?  387  PHE B N   1 
ATOM   6167 C CA  . PHE B 1 387 ? 7.676   20.530 14.848  1.00 31.58 ?  387  PHE B CA  1 
ATOM   6168 C C   . PHE B 1 387 ? 8.151   19.809 13.587  1.00 30.94 ?  387  PHE B C   1 
ATOM   6169 O O   . PHE B 1 387 ? 9.262   19.270 13.547  1.00 30.89 ?  387  PHE B O   1 
ATOM   6170 C CB  . PHE B 1 387 ? 8.190   19.861 16.103  1.00 30.43 ?  387  PHE B CB  1 
ATOM   6171 C CG  . PHE B 1 387 ? 7.722   20.534 17.338  1.00 29.61 ?  387  PHE B CG  1 
ATOM   6172 C CD1 . PHE B 1 387 ? 8.334   21.705 17.768  1.00 28.87 ?  387  PHE B CD1 1 
ATOM   6173 C CD2 . PHE B 1 387 ? 6.643   20.023 18.075  1.00 28.50 ?  387  PHE B CD2 1 
ATOM   6174 C CE1 . PHE B 1 387 ? 7.871   22.376 18.923  1.00 27.10 ?  387  PHE B CE1 1 
ATOM   6175 C CE2 . PHE B 1 387 ? 6.205   20.674 19.227  1.00 25.90 ?  387  PHE B CE2 1 
ATOM   6176 C CZ  . PHE B 1 387 ? 6.832   21.849 19.649  1.00 27.01 ?  387  PHE B CZ  1 
ATOM   6177 N N   . TYR B 1 388 ? 7.318   19.818 12.558  1.00 29.90 ?  388  TYR B N   1 
ATOM   6178 C CA  . TYR B 1 388 ? 7.677   19.210 11.296  1.00 29.88 ?  388  TYR B CA  1 
ATOM   6179 C C   . TYR B 1 388 ? 7.409   20.197 10.207  1.00 30.35 ?  388  TYR B C   1 
ATOM   6180 O O   . TYR B 1 388 ? 6.496   21.021 10.323  1.00 30.50 ?  388  TYR B O   1 
ATOM   6181 C CB  . TYR B 1 388 ? 6.841   17.954 11.027  1.00 29.31 ?  388  TYR B CB  1 
ATOM   6182 C CG  . TYR B 1 388 ? 7.097   16.823 11.983  1.00 30.09 ?  388  TYR B CG  1 
ATOM   6183 C CD1 . TYR B 1 388 ? 6.420   16.763 13.208  1.00 28.79 ?  388  TYR B CD1 1 
ATOM   6184 C CD2 . TYR B 1 388 ? 8.030   15.806 11.672  1.00 28.44 ?  388  TYR B CD2 1 
ATOM   6185 C CE1 . TYR B 1 388 ? 6.665   15.726 14.116  1.00 29.04 ?  388  TYR B CE1 1 
ATOM   6186 C CE2 . TYR B 1 388 ? 8.274   14.757 12.569  1.00 29.50 ?  388  TYR B CE2 1 
ATOM   6187 C CZ  . TYR B 1 388 ? 7.587   14.726 13.781  1.00 27.87 ?  388  TYR B CZ  1 
ATOM   6188 O OH  . TYR B 1 388 ? 7.807   13.705 14.666  1.00 29.49 ?  388  TYR B OH  1 
ATOM   6189 N N   . VAL B 1 389 ? 8.190   20.097 9.134   1.00 30.94 ?  389  VAL B N   1 
ATOM   6190 C CA  . VAL B 1 389 ? 7.980   20.876 7.931   1.00 32.22 ?  389  VAL B CA  1 
ATOM   6191 C C   . VAL B 1 389 ? 6.530   20.740 7.421   1.00 34.30 ?  389  VAL B C   1 
ATOM   6192 O O   . VAL B 1 389 ? 5.896   21.744 7.035   1.00 33.50 ?  389  VAL B O   1 
ATOM   6193 C CB  . VAL B 1 389 ? 8.987   20.453 6.871   1.00 32.16 ?  389  VAL B CB  1 
ATOM   6194 C CG1 . VAL B 1 389 ? 8.695   21.121 5.543   1.00 30.73 ?  389  VAL B CG1 1 
ATOM   6195 C CG2 . VAL B 1 389 ? 10.434  20.780 7.373   1.00 30.34 ?  389  VAL B CG2 1 
ATOM   6196 N N   . ASP B 1 390 ? 6.018   19.506 7.421   1.00 36.13 ?  390  ASP B N   1 
ATOM   6197 C CA  . ASP B 1 390 ? 4.606   19.256 7.096   1.00 39.19 ?  390  ASP B CA  1 
ATOM   6198 C C   . ASP B 1 390 ? 3.845   19.135 8.404   1.00 39.94 ?  390  ASP B C   1 
ATOM   6199 O O   . ASP B 1 390 ? 3.772   18.060 8.993   1.00 39.87 ?  390  ASP B O   1 
ATOM   6200 C CB  . ASP B 1 390 ? 4.457   17.976 6.274   1.00 39.71 ?  390  ASP B CB  1 
ATOM   6201 C CG  . ASP B 1 390 ? 3.082   17.849 5.607   1.00 43.54 ?  390  ASP B CG  1 
ATOM   6202 O OD1 . ASP B 1 390 ? 2.269   18.814 5.613   1.00 48.15 ?  390  ASP B OD1 1 
ATOM   6203 O OD2 . ASP B 1 390 ? 2.819   16.758 5.063   1.00 46.53 ?  390  ASP B OD2 1 
ATOM   6204 N N   . SER B 1 391 ? 3.316   20.258 8.873   1.00 41.76 ?  391  SER B N   1 
ATOM   6205 C CA  . SER B 1 391 ? 2.641   20.306 10.155  1.00 44.11 ?  391  SER B CA  1 
ATOM   6206 C C   . SER B 1 391 ? 1.185   19.868 10.031  1.00 44.95 ?  391  SER B C   1 
ATOM   6207 O O   . SER B 1 391 ? 0.487   19.770 11.039  1.00 45.35 ?  391  SER B O   1 
ATOM   6208 C CB  . SER B 1 391 ? 2.715   21.718 10.745  1.00 44.64 ?  391  SER B CB  1 
ATOM   6209 O OG  . SER B 1 391 ? 1.866   22.607 10.017  1.00 47.46 ?  391  SER B OG  1 
ATOM   6210 N N   . SER B 1 392 ? 0.737   19.605 8.805   1.00 45.92 ?  392  SER B N   1 
ATOM   6211 C CA  . SER B 1 392 ? -0.627  19.122 8.570   1.00 47.40 ?  392  SER B CA  1 
ATOM   6212 C C   . SER B 1 392 ? -0.684  17.612 8.744   1.00 47.67 ?  392  SER B C   1 
ATOM   6213 O O   . SER B 1 392 ? -1.675  17.090 9.248   1.00 48.46 ?  392  SER B O   1 
ATOM   6214 C CB  . SER B 1 392 ? -1.115  19.491 7.168   1.00 47.21 ?  392  SER B CB  1 
ATOM   6215 O OG  . SER B 1 392 ? -0.619  18.559 6.216   1.00 47.58 ?  392  SER B OG  1 
ATOM   6216 N N   . ALA B 1 393 ? 0.376   16.919 8.324   1.00 47.79 ?  393  ALA B N   1 
ATOM   6217 C CA  . ALA B 1 393 ? 0.523   15.487 8.581   1.00 47.93 ?  393  ALA B CA  1 
ATOM   6218 C C   . ALA B 1 393 ? 0.313   15.105 10.064  1.00 48.16 ?  393  ALA B C   1 
ATOM   6219 O O   . ALA B 1 393 ? 0.738   15.830 10.975  1.00 47.88 ?  393  ALA B O   1 
ATOM   6220 C CB  . ALA B 1 393 ? 1.876   14.989 8.093   1.00 48.05 ?  393  ALA B CB  1 
ATOM   6221 N N   . PRO B 1 394 ? -0.354  13.956 10.295  1.00 48.13 ?  394  PRO B N   1 
ATOM   6222 C CA  . PRO B 1 394 ? -0.692  13.426 11.615  1.00 47.69 ?  394  PRO B CA  1 
ATOM   6223 C C   . PRO B 1 394 ? 0.539   13.126 12.464  1.00 46.66 ?  394  PRO B C   1 
ATOM   6224 O O   . PRO B 1 394 ? 1.577   12.709 11.924  1.00 46.79 ?  394  PRO B O   1 
ATOM   6225 C CB  . PRO B 1 394 ? -1.432  12.112 11.284  1.00 48.42 ?  394  PRO B CB  1 
ATOM   6226 C CG  . PRO B 1 394 ? -0.952  11.735 9.897   1.00 48.68 ?  394  PRO B CG  1 
ATOM   6227 C CD  . PRO B 1 394 ? -0.842  13.075 9.216   1.00 48.30 ?  394  PRO B CD  1 
ATOM   6228 N N   . SER B 1 395 ? 0.403   13.315 13.777  1.00 45.12 ?  395  SER B N   1 
ATOM   6229 C CA  . SER B 1 395 ? 1.496   13.097 14.735  1.00 44.09 ?  395  SER B CA  1 
ATOM   6230 C C   . SER B 1 395 ? 1.016   12.442 16.060  1.00 42.94 ?  395  SER B C   1 
ATOM   6231 O O   . SER B 1 395 ? 0.175   12.997 16.761  1.00 43.12 ?  395  SER B O   1 
ATOM   6232 C CB  . SER B 1 395 ? 2.232   14.428 14.991  1.00 43.57 ?  395  SER B CB  1 
ATOM   6233 O OG  . SER B 1 395 ? 3.149   14.342 16.066  1.00 43.31 ?  395  SER B OG  1 
ATOM   6234 N N   . PRO B 1 396 ? 1.539   11.251 16.388  1.00 41.95 ?  396  PRO B N   1 
ATOM   6235 C CA  . PRO B 1 396 ? 1.270   10.573 17.659  1.00 41.26 ?  396  PRO B CA  1 
ATOM   6236 C C   . PRO B 1 396 ? 2.016   11.146 18.857  1.00 40.73 ?  396  PRO B C   1 
ATOM   6237 O O   . PRO B 1 396 ? 1.831   10.660 19.982  1.00 40.14 ?  396  PRO B O   1 
ATOM   6238 C CB  . PRO B 1 396 ? 1.805   9.164  17.409  1.00 41.65 ?  396  PRO B CB  1 
ATOM   6239 C CG  . PRO B 1 396 ? 2.947   9.383  16.478  1.00 42.01 ?  396  PRO B CG  1 
ATOM   6240 C CD  . PRO B 1 396 ? 2.407   10.432 15.520  1.00 42.08 ?  396  PRO B CD  1 
ATOM   6241 N N   . TYR B 1 397 ? 2.873   12.141 18.615  1.00 39.63 ?  397  TYR B N   1 
ATOM   6242 C CA  . TYR B 1 397 ? 3.717   12.710 19.656  1.00 38.48 ?  397  TYR B CA  1 
ATOM   6243 C C   . TYR B 1 397 ? 3.087   13.879 20.400  1.00 37.49 ?  397  TYR B C   1 
ATOM   6244 O O   . TYR B 1 397 ? 2.345   14.654 19.833  1.00 37.26 ?  397  TYR B O   1 
ATOM   6245 C CB  . TYR B 1 397 ? 5.049   13.163 19.043  1.00 39.00 ?  397  TYR B CB  1 
ATOM   6246 C CG  . TYR B 1 397 ? 5.951   12.041 18.565  1.00 38.62 ?  397  TYR B CG  1 
ATOM   6247 C CD1 . TYR B 1 397 ? 6.812   11.391 19.447  1.00 38.10 ?  397  TYR B CD1 1 
ATOM   6248 C CD2 . TYR B 1 397 ? 5.942   11.642 17.250  1.00 37.74 ?  397  TYR B CD2 1 
ATOM   6249 C CE1 . TYR B 1 397 ? 7.658   10.375 19.014  1.00 37.72 ?  397  TYR B CE1 1 
ATOM   6250 C CE2 . TYR B 1 397 ? 6.770   10.625 16.803  1.00 38.52 ?  397  TYR B CE2 1 
ATOM   6251 C CZ  . TYR B 1 397 ? 7.632   10.002 17.691  1.00 39.12 ?  397  TYR B CZ  1 
ATOM   6252 O OH  . TYR B 1 397 ? 8.459   8.974  17.260  1.00 41.37 ?  397  TYR B OH  1 
ATOM   6253 N N   . LEU B 1 398 ? 3.404   13.996 21.682  1.00 37.43 ?  398  LEU B N   1 
ATOM   6254 C CA  . LEU B 1 398 ? 3.099   15.170 22.471  1.00 36.87 ?  398  LEU B CA  1 
ATOM   6255 C C   . LEU B 1 398 ? 4.380   15.684 23.120  1.00 36.38 ?  398  LEU B C   1 
ATOM   6256 O O   . LEU B 1 398 ? 5.202   14.900 23.592  1.00 35.89 ?  398  LEU B O   1 
ATOM   6257 C CB  . LEU B 1 398 ? 2.164   14.811 23.620  1.00 36.90 ?  398  LEU B CB  1 
ATOM   6258 C CG  . LEU B 1 398 ? 0.700   14.593 23.298  1.00 39.65 ?  398  LEU B CG  1 
ATOM   6259 C CD1 . LEU B 1 398 ? 0.028   13.800 24.447  1.00 40.92 ?  398  LEU B CD1 1 
ATOM   6260 C CD2 . LEU B 1 398 ? 0.022   15.952 23.040  1.00 38.10 ?  398  LEU B CD2 1 
ATOM   6261 N N   . ARG B 1 399 ? 4.507   17.005 23.215  1.00 35.62 ?  399  ARG B N   1 
ATOM   6262 C CA  . ARG B 1 399 ? 5.579   17.604 23.974  1.00 34.62 ?  399  ARG B CA  1 
ATOM   6263 C C   . ARG B 1 399 ? 5.034   18.049 25.318  1.00 34.79 ?  399  ARG B C   1 
ATOM   6264 O O   . ARG B 1 399 ? 4.022   18.759 25.372  1.00 35.73 ?  399  ARG B O   1 
ATOM   6265 C CB  . ARG B 1 399 ? 6.180   18.789 23.219  1.00 33.93 ?  399  ARG B CB  1 
ATOM   6266 C CG  . ARG B 1 399 ? 7.466   19.288 23.837  1.00 32.33 ?  399  ARG B CG  1 
ATOM   6267 C CD  . ARG B 1 399 ? 7.847   20.680 23.313  1.00 31.86 ?  399  ARG B CD  1 
ATOM   6268 N NE  . ARG B 1 399 ? 6.961   21.740 23.814  1.00 28.56 ?  399  ARG B NE  1 
ATOM   6269 C CZ  . ARG B 1 399 ? 7.121   23.029 23.531  1.00 30.74 ?  399  ARG B CZ  1 
ATOM   6270 N NH1 . ARG B 1 399 ? 8.140   23.405 22.740  1.00 28.57 ?  399  ARG B NH1 1 
ATOM   6271 N NH2 . ARG B 1 399 ? 6.280   23.947 24.024  1.00 26.34 ?  399  ARG B NH2 1 
ATOM   6272 N N   . ALA B 1 400 ? 5.702   17.623 26.391  1.00 34.51 ?  400  ALA B N   1 
ATOM   6273 C CA  . ALA B 1 400 ? 5.357   18.004 27.769  1.00 34.49 ?  400  ALA B CA  1 
ATOM   6274 C C   . ALA B 1 400 ? 6.523   18.748 28.393  1.00 34.55 ?  400  ALA B C   1 
ATOM   6275 O O   . ALA B 1 400 ? 7.648   18.243 28.398  1.00 34.88 ?  400  ALA B O   1 
ATOM   6276 C CB  . ALA B 1 400 ? 5.039   16.763 28.602  1.00 34.77 ?  400  ALA B CB  1 
ATOM   6277 N N   . SER B 1 401 ? 6.271   19.937 28.936  1.00 34.20 ?  401  SER B N   1 
ATOM   6278 C CA  . SER B 1 401 ? 7.314   20.652 29.638  1.00 33.54 ?  401  SER B CA  1 
ATOM   6279 C C   . SER B 1 401 ? 7.390   20.243 31.115  1.00 33.29 ?  401  SER B C   1 
ATOM   6280 O O   . SER B 1 401 ? 6.358   20.035 31.782  1.00 33.11 ?  401  SER B O   1 
ATOM   6281 C CB  . SER B 1 401 ? 7.096   22.168 29.535  1.00 34.26 ?  401  SER B CB  1 
ATOM   6282 O OG  . SER B 1 401 ? 8.072   22.881 30.300  1.00 34.91 ?  401  SER B OG  1 
ATOM   6283 N N   . PHE B 1 402 ? 8.610   20.152 31.623  1.00 31.87 ?  402  PHE B N   1 
ATOM   6284 C CA  . PHE B 1 402 ? 8.810   19.989 33.052  1.00 32.78 ?  402  PHE B CA  1 
ATOM   6285 C C   . PHE B 1 402 ? 9.472   21.187 33.759  1.00 33.03 ?  402  PHE B C   1 
ATOM   6286 O O   . PHE B 1 402 ? 9.961   21.063 34.862  1.00 32.92 ?  402  PHE B O   1 
ATOM   6287 C CB  . PHE B 1 402 ? 9.520   18.649 33.364  1.00 32.54 ?  402  PHE B CB  1 
ATOM   6288 C CG  . PHE B 1 402 ? 10.860  18.459 32.665  1.00 30.96 ?  402  PHE B CG  1 
ATOM   6289 C CD1 . PHE B 1 402 ? 12.026  18.968 33.216  1.00 31.37 ?  402  PHE B CD1 1 
ATOM   6290 C CD2 . PHE B 1 402 ? 10.942  17.742 31.481  1.00 30.70 ?  402  PHE B CD2 1 
ATOM   6291 C CE1 . PHE B 1 402 ? 13.255  18.750 32.589  1.00 30.61 ?  402  PHE B CE1 1 
ATOM   6292 C CE2 . PHE B 1 402 ? 12.160  17.530 30.859  1.00 29.92 ?  402  PHE B CE2 1 
ATOM   6293 C CZ  . PHE B 1 402 ? 13.304  18.035 31.402  1.00 28.83 ?  402  PHE B CZ  1 
ATOM   6294 N N   . SER B 1 403 ? 9.441   22.361 33.142  1.00 34.77 ?  403  SER B N   1 
ATOM   6295 C CA  . SER B 1 403 ? 10.043  23.557 33.736  1.00 36.93 ?  403  SER B CA  1 
ATOM   6296 C C   . SER B 1 403 ? 9.319   24.075 35.004  1.00 37.59 ?  403  SER B C   1 
ATOM   6297 O O   . SER B 1 403 ? 9.946   24.615 35.905  1.00 37.12 ?  403  SER B O   1 
ATOM   6298 C CB  . SER B 1 403 ? 10.090  24.685 32.691  1.00 36.98 ?  403  SER B CB  1 
ATOM   6299 O OG  . SER B 1 403 ? 8.784   24.979 32.223  1.00 38.75 ?  403  SER B OG  1 
ATOM   6300 N N   . SER B 1 404 ? 8.008   23.897 35.065  1.00 39.95 ?  404  SER B N   1 
ATOM   6301 C CA  . SER B 1 404 ? 7.195   24.687 35.998  1.00 43.08 ?  404  SER B CA  1 
ATOM   6302 C C   . SER B 1 404 ? 6.428   23.876 37.038  1.00 44.18 ?  404  SER B C   1 
ATOM   6303 O O   . SER B 1 404 ? 6.658   24.028 38.255  1.00 44.30 ?  404  SER B O   1 
ATOM   6304 C CB  . SER B 1 404 ? 6.243   25.593 35.206  1.00 43.12 ?  404  SER B CB  1 
ATOM   6305 O OG  . SER B 1 404 ? 6.992   26.616 34.536  1.00 47.68 ?  404  SER B OG  1 
ATOM   6306 N N   . ALA B 1 405 ? 5.543   23.015 36.528  1.00 45.93 ?  405  ALA B N   1 
ATOM   6307 C CA  . ALA B 1 405 ? 4.595   22.219 37.306  1.00 47.72 ?  405  ALA B CA  1 
ATOM   6308 C C   . ALA B 1 405 ? 5.229   21.400 38.422  1.00 49.31 ?  405  ALA B C   1 
ATOM   6309 O O   . ALA B 1 405 ? 6.288   20.794 38.249  1.00 49.24 ?  405  ALA B O   1 
ATOM   6310 C CB  . ALA B 1 405 ? 3.803   21.302 36.377  1.00 47.27 ?  405  ALA B CB  1 
ATOM   6311 N N   . SER B 1 406 ? 4.547   21.384 39.565  1.00 51.39 ?  406  SER B N   1 
ATOM   6312 C CA  . SER B 1 406 ? 4.948   20.599 40.726  1.00 53.28 ?  406  SER B CA  1 
ATOM   6313 C C   . SER B 1 406 ? 4.815   19.097 40.437  1.00 54.25 ?  406  SER B C   1 
ATOM   6314 O O   . SER B 1 406 ? 4.101   18.710 39.512  1.00 53.92 ?  406  SER B O   1 
ATOM   6315 C CB  . SER B 1 406 ? 4.038   20.961 41.900  1.00 53.51 ?  406  SER B CB  1 
ATOM   6316 O OG  . SER B 1 406 ? 2.702   20.605 41.576  1.00 54.25 ?  406  SER B OG  1 
ATOM   6317 N N   . PRO B 1 407 ? 5.512   18.249 41.226  1.00 55.93 ?  407  PRO B N   1 
ATOM   6318 C CA  . PRO B 1 407 ? 5.239   16.800 41.218  1.00 56.90 ?  407  PRO B CA  1 
ATOM   6319 C C   . PRO B 1 407 ? 3.738   16.516 41.335  1.00 57.90 ?  407  PRO B C   1 
ATOM   6320 O O   . PRO B 1 407 ? 3.221   15.636 40.645  1.00 58.13 ?  407  PRO B O   1 
ATOM   6321 C CB  . PRO B 1 407 ? 5.979   16.308 42.458  1.00 56.83 ?  407  PRO B CB  1 
ATOM   6322 C CG  . PRO B 1 407 ? 7.153   17.251 42.574  1.00 56.64 ?  407  PRO B CG  1 
ATOM   6323 C CD  . PRO B 1 407 ? 6.627   18.592 42.137  1.00 56.18 ?  407  PRO B CD  1 
ATOM   6324 N N   . GLU B 1 408 ? 3.061   17.299 42.178  1.00 58.96 ?  408  GLU B N   1 
ATOM   6325 C CA  . GLU B 1 408 ? 1.617   17.218 42.394  1.00 60.11 ?  408  GLU B CA  1 
ATOM   6326 C C   . GLU B 1 408 ? 0.827   17.326 41.096  1.00 60.28 ?  408  GLU B C   1 
ATOM   6327 O O   . GLU B 1 408 ? 0.117   16.393 40.702  1.00 60.34 ?  408  GLU B O   1 
ATOM   6328 C CB  . GLU B 1 408 ? 1.168   18.341 43.327  1.00 60.25 ?  408  GLU B CB  1 
ATOM   6329 C CG  . GLU B 1 408 ? -0.188  18.114 43.956  1.00 61.97 ?  408  GLU B CG  1 
ATOM   6330 C CD  . GLU B 1 408 ? -0.108  17.098 45.071  1.00 64.55 ?  408  GLU B CD  1 
ATOM   6331 O OE1 . GLU B 1 408 ? 0.981   16.981 45.674  1.00 65.81 ?  408  GLU B OE1 1 
ATOM   6332 O OE2 . GLU B 1 408 ? -1.116  16.407 45.337  1.00 66.07 ?  408  GLU B OE2 1 
ATOM   6333 N N   . GLN B 1 409 ? 0.950   18.489 40.460  1.00 60.64 ?  409  GLN B N   1 
ATOM   6334 C CA  . GLN B 1 409 ? 0.297   18.782 39.194  1.00 61.03 ?  409  GLN B CA  1 
ATOM   6335 C C   . GLN B 1 409 ? 0.605   17.740 38.108  1.00 61.28 ?  409  GLN B C   1 
ATOM   6336 O O   . GLN B 1 409 ? -0.305  17.296 37.391  1.00 60.96 ?  409  GLN B O   1 
ATOM   6337 C CB  . GLN B 1 409 ? 0.705   20.176 38.721  1.00 60.92 ?  409  GLN B CB  1 
ATOM   6338 C CG  . GLN B 1 409 ? 0.174   21.298 39.568  1.00 61.30 ?  409  GLN B CG  1 
ATOM   6339 C CD  . GLN B 1 409 ? 0.589   22.651 39.037  1.00 62.55 ?  409  GLN B CD  1 
ATOM   6340 O OE1 . GLN B 1 409 ? 1.773   23.021 39.073  1.00 61.92 ?  409  GLN B OE1 1 
ATOM   6341 N NE2 . GLN B 1 409 ? -0.386  23.402 38.531  1.00 62.24 ?  409  GLN B NE2 1 
ATOM   6342 N N   . MET B 1 410 ? 1.883   17.359 37.998  1.00 61.50 ?  410  MET B N   1 
ATOM   6343 C CA  . MET B 1 410 ? 2.313   16.343 37.037  1.00 61.95 ?  410  MET B CA  1 
ATOM   6344 C C   . MET B 1 410 ? 1.575   15.031 37.240  1.00 62.44 ?  410  MET B C   1 
ATOM   6345 O O   . MET B 1 410 ? 1.051   14.447 36.278  1.00 62.12 ?  410  MET B O   1 
ATOM   6346 C CB  . MET B 1 410 ? 3.803   16.067 37.179  1.00 62.18 ?  410  MET B CB  1 
ATOM   6347 C CG  . MET B 1 410 ? 4.691   17.038 36.470  1.00 61.86 ?  410  MET B CG  1 
ATOM   6348 S SD  . MET B 1 410 ? 6.378   16.791 37.015  1.00 61.28 ?  410  MET B SD  1 
ATOM   6349 C CE  . MET B 1 410 ? 7.163   18.138 36.142  1.00 61.97 ?  410  MET B CE  1 
ATOM   6350 N N   . ASP B 1 411 ? 1.547   14.589 38.502  1.00 63.03 ?  411  ASP B N   1 
ATOM   6351 C CA  . ASP B 1 411 ? 0.888   13.348 38.901  1.00 63.74 ?  411  ASP B CA  1 
ATOM   6352 C C   . ASP B 1 411 ? -0.524  13.309 38.324  1.00 63.85 ?  411  ASP B C   1 
ATOM   6353 O O   . ASP B 1 411 ? -0.899  12.339 37.650  1.00 63.87 ?  411  ASP B O   1 
ATOM   6354 C CB  . ASP B 1 411 ? 0.872   13.211 40.431  1.00 63.96 ?  411  ASP B CB  1 
ATOM   6355 C CG  . ASP B 1 411 ? 0.481   11.807 40.899  1.00 64.59 ?  411  ASP B CG  1 
ATOM   6356 O OD1 . ASP B 1 411 ? -0.691  11.622 41.307  1.00 64.90 ?  411  ASP B OD1 1 
ATOM   6357 O OD2 . ASP B 1 411 ? 1.343   10.897 40.855  1.00 64.18 ?  411  ASP B OD2 1 
ATOM   6358 N N   . VAL B 1 412 ? -1.277  14.387 38.557  1.00 63.97 ?  412  VAL B N   1 
ATOM   6359 C CA  . VAL B 1 412 ? -2.634  14.528 38.020  1.00 64.07 ?  412  VAL B CA  1 
ATOM   6360 C C   . VAL B 1 412 ? -2.635  14.644 36.488  1.00 64.05 ?  412  VAL B C   1 
ATOM   6361 O O   . VAL B 1 412 ? -3.439  14.002 35.812  1.00 64.04 ?  412  VAL B O   1 
ATOM   6362 C CB  . VAL B 1 412 ? -3.380  15.711 38.687  1.00 64.13 ?  412  VAL B CB  1 
ATOM   6363 C CG1 . VAL B 1 412 ? -4.611  16.137 37.883  1.00 64.59 ?  412  VAL B CG1 1 
ATOM   6364 C CG2 . VAL B 1 412 ? -3.775  15.343 40.108  1.00 64.65 ?  412  VAL B CG2 1 
ATOM   6365 N N   . ALA B 1 413 ? -1.720  15.440 35.940  1.00 63.84 ?  413  ALA B N   1 
ATOM   6366 C CA  . ALA B 1 413 ? -1.702  15.665 34.499  1.00 63.68 ?  413  ALA B CA  1 
ATOM   6367 C C   . ALA B 1 413 ? -1.605  14.366 33.699  1.00 63.39 ?  413  ALA B C   1 
ATOM   6368 O O   . ALA B 1 413 ? -2.317  14.193 32.714  1.00 63.03 ?  413  ALA B O   1 
ATOM   6369 C CB  . ALA B 1 413 ? -0.584  16.642 34.107  1.00 63.83 ?  413  ALA B CB  1 
ATOM   6370 N N   . PHE B 1 414 ? -0.724  13.463 34.131  1.00 63.56 ?  414  PHE B N   1 
ATOM   6371 C CA  . PHE B 1 414 ? -0.489  12.192 33.433  1.00 63.75 ?  414  PHE B CA  1 
ATOM   6372 C C   . PHE B 1 414 ? -1.563  11.153 33.763  1.00 64.09 ?  414  PHE B C   1 
ATOM   6373 O O   . PHE B 1 414 ? -1.872  10.286 32.942  1.00 63.82 ?  414  PHE B O   1 
ATOM   6374 C CB  . PHE B 1 414 ? 0.912   11.652 33.741  1.00 63.70 ?  414  PHE B CB  1 
ATOM   6375 C CG  . PHE B 1 414 ? 2.003   12.345 32.975  1.00 63.84 ?  414  PHE B CG  1 
ATOM   6376 C CD1 . PHE B 1 414 ? 2.453   13.601 33.361  1.00 64.20 ?  414  PHE B CD1 1 
ATOM   6377 C CD2 . PHE B 1 414 ? 2.564   11.754 31.857  1.00 63.88 ?  414  PHE B CD2 1 
ATOM   6378 C CE1 . PHE B 1 414 ? 3.449   14.246 32.645  1.00 64.43 ?  414  PHE B CE1 1 
ATOM   6379 C CE2 . PHE B 1 414 ? 3.567   12.396 31.133  1.00 64.04 ?  414  PHE B CE2 1 
ATOM   6380 C CZ  . PHE B 1 414 ? 4.004   13.641 31.526  1.00 63.63 ?  414  PHE B CZ  1 
ATOM   6381 N N   . GLN B 1 415 ? -2.118  11.252 34.969  1.00 64.29 ?  415  GLN B N   1 
ATOM   6382 C CA  . GLN B 1 415 ? -3.333  10.530 35.335  1.00 64.76 ?  415  GLN B CA  1 
ATOM   6383 C C   . GLN B 1 415 ? -4.461  10.821 34.335  1.00 64.42 ?  415  GLN B C   1 
ATOM   6384 O O   . GLN B 1 415 ? -5.023  9.902  33.752  1.00 64.10 ?  415  GLN B O   1 
ATOM   6385 C CB  . GLN B 1 415 ? -3.746  10.917 36.759  1.00 65.00 ?  415  GLN B CB  1 
ATOM   6386 C CG  . GLN B 1 415 ? -5.069  10.334 37.253  1.00 66.79 ?  415  GLN B CG  1 
ATOM   6387 C CD  . GLN B 1 415 ? -5.263  10.554 38.742  1.00 68.58 ?  415  GLN B CD  1 
ATOM   6388 O OE1 . GLN B 1 415 ? -4.293  10.589 39.508  1.00 69.56 ?  415  GLN B OE1 1 
ATOM   6389 N NE2 . GLN B 1 415 ? -6.518  10.702 39.164  1.00 68.98 ?  415  GLN B NE2 1 
ATOM   6390 N N   . VAL B 1 416 ? -4.759  12.105 34.130  1.00 64.41 ?  416  VAL B N   1 
ATOM   6391 C CA  . VAL B 1 416 ? -5.794  12.545 33.193  1.00 64.35 ?  416  VAL B CA  1 
ATOM   6392 C C   . VAL B 1 416 ? -5.514  12.073 31.762  1.00 64.74 ?  416  VAL B C   1 
ATOM   6393 O O   . VAL B 1 416 ? -6.391  11.518 31.100  1.00 64.68 ?  416  VAL B O   1 
ATOM   6394 C CB  . VAL B 1 416 ? -5.964  14.079 33.251  1.00 64.27 ?  416  VAL B CB  1 
ATOM   6395 C CG1 . VAL B 1 416 ? -6.663  14.616 32.010  1.00 63.98 ?  416  VAL B CG1 1 
ATOM   6396 C CG2 . VAL B 1 416 ? -6.722  14.475 34.502  1.00 63.80 ?  416  VAL B CG2 1 
ATOM   6397 N N   . LEU B 1 417 ? -4.286  12.300 31.302  1.00 65.26 ?  417  LEU B N   1 
ATOM   6398 C CA  . LEU B 1 417 ? -3.826  11.871 29.981  1.00 65.71 ?  417  LEU B CA  1 
ATOM   6399 C C   . LEU B 1 417 ? -3.948  10.357 29.831  1.00 65.84 ?  417  LEU B C   1 
ATOM   6400 O O   . LEU B 1 417 ? -4.407  9.869  28.800  1.00 65.62 ?  417  LEU B O   1 
ATOM   6401 C CB  . LEU B 1 417 ? -2.354  12.280 29.788  1.00 65.71 ?  417  LEU B CB  1 
ATOM   6402 C CG  . LEU B 1 417 ? -1.680  12.609 28.445  1.00 65.67 ?  417  LEU B CG  1 
ATOM   6403 C CD1 . LEU B 1 417 ? -0.203  12.202 28.522  1.00 64.74 ?  417  LEU B CD1 1 
ATOM   6404 C CD2 . LEU B 1 417 ? -2.339  11.995 27.203  1.00 65.27 ?  417  LEU B CD2 1 
ATOM   6405 N N   . ALA B 1 418 ? -3.526  9.634  30.866  1.00 66.45 ?  418  ALA B N   1 
ATOM   6406 C CA  . ALA B 1 418 ? -3.541  8.167  30.894  1.00 67.62 ?  418  ALA B CA  1 
ATOM   6407 C C   . ALA B 1 418 ? -4.920  7.576  30.642  1.00 68.27 ?  418  ALA B C   1 
ATOM   6408 O O   . ALA B 1 418 ? -5.044  6.519  30.022  1.00 68.49 ?  418  ALA B O   1 
ATOM   6409 C CB  . ALA B 1 418 ? -2.993  7.655  32.226  1.00 67.46 ?  418  ALA B CB  1 
ATOM   6410 N N   . GLN B 1 419 ? -5.941  8.261  31.146  1.00 69.14 ?  419  GLN B N   1 
ATOM   6411 C CA  . GLN B 1 419 ? -7.328  7.869  30.955  1.00 70.27 ?  419  GLN B CA  1 
ATOM   6412 C C   . GLN B 1 419 ? -7.766  8.168  29.529  1.00 70.88 ?  419  GLN B C   1 
ATOM   6413 O O   . GLN B 1 419 ? -8.308  7.301  28.843  1.00 71.23 ?  419  GLN B O   1 
ATOM   6414 C CB  . GLN B 1 419 ? -8.213  8.614  31.963  1.00 70.47 ?  419  GLN B CB  1 
ATOM   6415 C CG  . GLN B 1 419 ? -9.710  8.567  31.687  1.00 71.08 ?  419  GLN B CG  1 
ATOM   6416 C CD  . GLN B 1 419 ? -10.498 9.582  32.506  1.00 72.05 ?  419  GLN B CD  1 
ATOM   6417 O OE1 . GLN B 1 419 ? -11.714 9.707  32.349  1.00 71.78 ?  419  GLN B OE1 1 
ATOM   6418 N NE2 . GLN B 1 419 ? -9.808  10.315 33.381  1.00 72.52 ?  419  GLN B NE2 1 
ATOM   6419 N N   . LEU B 1 420 ? -7.515  9.397  29.088  1.00 71.66 ?  420  LEU B N   1 
ATOM   6420 C CA  . LEU B 1 420 ? -7.895  9.847  27.755  1.00 72.52 ?  420  LEU B CA  1 
ATOM   6421 C C   . LEU B 1 420 ? -7.387  8.940  26.649  1.00 73.05 ?  420  LEU B C   1 
ATOM   6422 O O   . LEU B 1 420 ? -8.080  8.728  25.653  1.00 72.94 ?  420  LEU B O   1 
ATOM   6423 C CB  . LEU B 1 420 ? -7.410  11.274 27.525  1.00 72.80 ?  420  LEU B CB  1 
ATOM   6424 C CG  . LEU B 1 420 ? -8.365  12.350 28.027  1.00 73.15 ?  420  LEU B CG  1 
ATOM   6425 C CD1 . LEU B 1 420 ? -7.591  13.593 28.378  1.00 73.09 ?  420  LEU B CD1 1 
ATOM   6426 C CD2 . LEU B 1 420 ? -9.451  12.631 26.982  1.00 73.93 ?  420  LEU B CD2 1 
ATOM   6427 N N   . ILE B 1 421 ? -6.179  8.409  26.831  1.00 73.99 ?  421  ILE B N   1 
ATOM   6428 C CA  . ILE B 1 421 ? -5.614  7.444  25.886  1.00 74.99 ?  421  ILE B CA  1 
ATOM   6429 C C   . ILE B 1 421 ? -6.463  6.170  25.886  1.00 75.73 ?  421  ILE B C   1 
ATOM   6430 O O   . ILE B 1 421 ? -6.823  5.667  24.820  1.00 75.47 ?  421  ILE B O   1 
ATOM   6431 C CB  . ILE B 1 421 ? -4.108  7.132  26.174  1.00 74.86 ?  421  ILE B CB  1 
ATOM   6432 C CG1 . ILE B 1 421 ? -3.278  8.424  26.171  1.00 74.82 ?  421  ILE B CG1 1 
ATOM   6433 C CG2 . ILE B 1 421 ? -3.544  6.154  25.140  1.00 74.58 ?  421  ILE B CG2 1 
ATOM   6434 C CD1 . ILE B 1 421 ? -1.882  8.294  26.770  1.00 74.40 ?  421  ILE B CD1 1 
ATOM   6435 N N   . LYS B 1 422 ? -6.820  5.702  27.088  1.00 76.96 ?  422  LYS B N   1 
ATOM   6436 C CA  . LYS B 1 422 ? -7.515  4.413  27.292  1.00 78.14 ?  422  LYS B CA  1 
ATOM   6437 C C   . LYS B 1 422 ? -8.955  4.369  26.779  1.00 78.91 ?  422  LYS B C   1 
ATOM   6438 O O   . LYS B 1 422 ? -9.556  3.297  26.680  1.00 79.02 ?  422  LYS B O   1 
ATOM   6439 C CB  . LYS B 1 422 ? -7.448  3.971  28.767  1.00 77.87 ?  422  LYS B CB  1 
ATOM   6440 C CG  . LYS B 1 422 ? -6.086  3.402  29.159  1.00 77.94 ?  422  LYS B CG  1 
ATOM   6441 C CD  . LYS B 1 422 ? -6.145  2.458  30.360  1.00 78.04 ?  422  LYS B CD  1 
ATOM   6442 C CE  . LYS B 1 422 ? -5.724  3.138  31.661  1.00 77.90 ?  422  LYS B CE  1 
ATOM   6443 N NZ  . LYS B 1 422 ? -5.237  2.147  32.676  1.00 75.89 ?  422  LYS B NZ  1 
ATOM   6444 N N   . GLU B 1 423 ? -9.495  5.531  26.437  1.00 80.13 ?  423  GLU B N   1 
ATOM   6445 C CA  . GLU B 1 423 ? -10.862 5.612  25.945  1.00 81.34 ?  423  GLU B CA  1 
ATOM   6446 C C   . GLU B 1 423 ? -10.944 5.554  24.414  1.00 82.13 ?  423  GLU B C   1 
ATOM   6447 O O   . GLU B 1 423 ? -11.969 5.144  23.861  1.00 82.42 ?  423  GLU B O   1 
ATOM   6448 C CB  . GLU B 1 423 ? -11.569 6.854  26.502  1.00 81.39 ?  423  GLU B CB  1 
ATOM   6449 C CG  . GLU B 1 423 ? -11.593 6.916  28.030  1.00 81.64 ?  423  GLU B CG  1 
ATOM   6450 C CD  . GLU B 1 423 ? -12.932 7.378  28.588  1.00 82.86 ?  423  GLU B CD  1 
ATOM   6451 O OE1 . GLU B 1 423 ? -12.954 8.360  29.369  1.00 82.50 ?  423  GLU B OE1 1 
ATOM   6452 O OE2 . GLU B 1 423 ? -13.967 6.753  28.254  1.00 83.24 ?  423  GLU B OE2 1 
ATOM   6453 N N   . SER B 1 424 ? -9.865  5.945  23.735  1.00 82.99 ?  424  SER B N   1 
ATOM   6454 C CA  . SER B 1 424 ? -9.847  5.982  22.266  1.00 83.77 ?  424  SER B CA  1 
ATOM   6455 C C   . SER B 1 424 ? -9.219  4.718  21.654  1.00 84.38 ?  424  SER B C   1 
ATOM   6456 O O   . SER B 1 424 ? -8.910  4.686  20.455  1.00 84.55 ?  424  SER B O   1 
ATOM   6457 C CB  . SER B 1 424 ? -9.115  7.236  21.762  1.00 83.79 ?  424  SER B CB  1 
ATOM   6458 O OG  . SER B 1 424 ? -9.146  8.286  22.715  1.00 83.73 ?  424  SER B OG  1 
ATOM   6459 N N   . LEU B 1 425 ? -9.045  3.681  22.472  1.00 84.93 ?  425  LEU B N   1 
ATOM   6460 C CA  . LEU B 1 425 ? -8.403  2.433  22.033  1.00 85.52 ?  425  LEU B CA  1 
ATOM   6461 C C   . LEU B 1 425 ? -9.370  1.241  21.932  1.00 85.82 ?  425  LEU B C   1 
ATOM   6462 O O   . LEU B 1 425 ? -9.108  0.282  21.195  1.00 85.94 ?  425  LEU B O   1 
ATOM   6463 C CB  . LEU B 1 425 ? -7.252  2.064  22.976  1.00 85.64 ?  425  LEU B CB  1 
ATOM   6464 C CG  . LEU B 1 425 ? -6.305  3.145  23.505  1.00 85.70 ?  425  LEU B CG  1 
ATOM   6465 C CD1 . LEU B 1 425 ? -5.491  2.593  24.675  1.00 85.82 ?  425  LEU B CD1 1 
ATOM   6466 C CD2 . LEU B 1 425 ? -5.395  3.703  22.414  1.00 85.40 ?  425  LEU B CD2 1 
ATOM   6467 O OXT . LEU B 1 425 ? -10.418 1.184  22.591  1.00 85.97 ?  425  LEU B OXT 1 
HETATM 6468 C C1  . BF5 C 2 .   ? 23.103  57.969 17.600  1.00 40.84 ?  1426 BF5 A C1  1 
HETATM 6469 F F1  . BF5 C 2 .   ? 22.561  59.179 17.665  1.00 41.55 ?  1426 BF5 A F1  1 
HETATM 6470 N N1  . BF5 C 2 .   ? 21.720  57.229 15.663  1.00 40.17 ?  1426 BF5 A N1  1 
HETATM 6471 O O1  . BF5 C 2 .   ? 23.091  54.755 15.859  1.00 40.18 ?  1426 BF5 A O1  1 
HETATM 6472 C C2  . BF5 C 2 .   ? 22.731  57.011 16.657  1.00 40.39 ?  1426 BF5 A C2  1 
HETATM 6473 N N2  . BF5 C 2 .   ? 25.032  54.265 17.798  1.00 40.43 ?  1426 BF5 A N2  1 
HETATM 6474 O O2  . BF5 C 2 .   ? 26.080  57.174 20.505  1.00 41.75 ?  1426 BF5 A O2  1 
HETATM 6475 C C3  . BF5 C 2 .   ? 23.384  55.770 16.736  1.00 40.89 ?  1426 BF5 A C3  1 
HETATM 6476 N N3  . BF5 C 2 .   ? 18.977  57.969 15.086  1.00 36.81 ?  1426 BF5 A N3  1 
HETATM 6477 O O3  . BF5 C 2 .   ? 27.581  55.293 21.784  1.00 43.01 ?  1426 BF5 A O3  1 
HETATM 6478 C C4  . BF5 C 2 .   ? 24.075  57.729 18.568  1.00 40.53 ?  1426 BF5 A C4  1 
HETATM 6479 N N4  . BF5 C 2 .   ? 17.930  58.146 14.152  1.00 35.56 ?  1426 BF5 A N4  1 
HETATM 6480 O O4  . BF5 C 2 .   ? 28.224  53.669 20.476  1.00 43.30 ?  1426 BF5 A O4  1 
HETATM 6481 C C5  . BF5 C 2 .   ? 24.176  53.862 15.542  1.00 39.90 ?  1426 BF5 A C5  1 
HETATM 6482 C C6  . BF5 C 2 .   ? 24.660  53.213 16.834  1.00 40.86 ?  1426 BF5 A C6  1 
HETATM 6483 C C7  . BF5 C 2 .   ? 23.534  52.369 17.438  1.00 38.77 ?  1426 BF5 A C7  1 
HETATM 6484 C C8  . BF5 C 2 .   ? 24.715  56.517 18.630  1.00 40.90 ?  1426 BF5 A C8  1 
HETATM 6485 C C9  . BF5 C 2 .   ? 24.376  55.523 17.716  1.00 40.86 ?  1426 BF5 A C9  1 
HETATM 6486 C C10 . BF5 C 2 .   ? 25.982  54.011 18.734  1.00 40.68 ?  1426 BF5 A C10 1 
HETATM 6487 C C11 . BF5 C 2 .   ? 26.399  54.934 19.698  1.00 39.87 ?  1426 BF5 A C11 1 
HETATM 6488 C C12 . BF5 C 2 .   ? 25.759  56.270 19.680  1.00 41.62 ?  1426 BF5 A C12 1 
HETATM 6489 C C13 . BF5 C 2 .   ? 20.602  56.269 15.904  1.00 37.53 ?  1426 BF5 A C13 1 
HETATM 6490 C C14 . BF5 C 2 .   ? 19.307  56.526 15.141  1.00 38.79 ?  1426 BF5 A C14 1 
HETATM 6491 C C15 . BF5 C 2 .   ? 20.120  58.767 14.607  1.00 37.51 ?  1426 BF5 A C15 1 
HETATM 6492 C C16 . BF5 C 2 .   ? 21.286  58.637 15.572  1.00 37.24 ?  1426 BF5 A C16 1 
HETATM 6493 C C17 . BF5 C 2 .   ? 27.464  54.614 20.717  1.00 40.92 ?  1426 BF5 A C17 1 
HETATM 6494 N N1  . PLP D 3 .   ? 13.642  58.057 11.574  1.00 26.03 ?  1427 PLP A N1  1 
HETATM 6495 C C2  . PLP D 3 .   ? 14.458  59.132 11.687  1.00 29.36 ?  1427 PLP A C2  1 
HETATM 6496 C C2A . PLP D 3 .   ? 14.318  60.306 10.753  1.00 27.66 ?  1427 PLP A C2A 1 
HETATM 6497 C C3  . PLP D 3 .   ? 15.430  59.153 12.674  1.00 28.51 ?  1427 PLP A C3  1 
HETATM 6498 O O3  . PLP D 3 .   ? 16.240  60.236 12.771  1.00 26.85 ?  1427 PLP A O3  1 
HETATM 6499 C C4  . PLP D 3 .   ? 15.552  58.065 13.543  1.00 29.06 ?  1427 PLP A C4  1 
HETATM 6500 C C4A . PLP D 3 .   ? 16.588  58.148 14.627  1.00 28.34 ?  1427 PLP A C4A 1 
HETATM 6501 C C5  . PLP D 3 .   ? 14.685  56.969 13.430  1.00 26.02 ?  1427 PLP A C5  1 
HETATM 6502 C C6  . PLP D 3 .   ? 13.731  57.025 12.418  1.00 25.34 ?  1427 PLP A C6  1 
HETATM 6503 C C5A . PLP D 3 .   ? 14.704  55.684 14.312  1.00 28.73 ?  1427 PLP A C5A 1 
HETATM 6504 O O4P . PLP D 3 .   ? 14.871  55.818 15.742  1.00 23.34 ?  1427 PLP A O4P 1 
HETATM 6505 P P   . PLP D 3 .   ? 14.478  54.733 16.866  1.00 18.83 ?  1427 PLP A P   1 
HETATM 6506 O O1P . PLP D 3 .   ? 14.662  53.395 16.206  1.00 22.42 ?  1427 PLP A O1P 1 
HETATM 6507 O O2P . PLP D 3 .   ? 15.437  55.092 17.979  1.00 20.11 ?  1427 PLP A O2P 1 
HETATM 6508 O O3P . PLP D 3 .   ? 13.027  54.933 17.228  1.00 22.28 ?  1427 PLP A O3P 1 
HETATM 6509 I I   . IOD E 4 .   ? 15.073  42.261 13.617  1.00 20.96 -1 1428 IOD A I   1 
HETATM 6510 C C1  . BF5 F 2 .   ? 6.980   30.759 25.090  1.00 51.83 ?  1426 BF5 B C1  1 
HETATM 6511 F F1  . BF5 F 2 .   ? 7.571   29.883 25.922  1.00 51.93 ?  1426 BF5 B F1  1 
HETATM 6512 N N1  . BF5 F 2 .   ? 8.532   30.338 23.191  1.00 50.52 ?  1426 BF5 B N1  1 
HETATM 6513 O O1  . BF5 F 2 .   ? 7.182   32.182 21.700  1.00 51.77 ?  1426 BF5 B O1  1 
HETATM 6514 C C2  . BF5 F 2 .   ? 7.423   30.991 23.779  1.00 51.37 ?  1426 BF5 B C2  1 
HETATM 6515 N N2  . BF5 F 2 .   ? 4.996   33.609 22.667  1.00 52.01 ?  1426 BF5 B N2  1 
HETATM 6516 O O2  . BF5 F 2 .   ? 3.677   32.957 26.467  1.00 52.82 ?  1426 BF5 B O2  1 
HETATM 6517 C C3  . BF5 F 2 .   ? 6.760   31.933 22.987  1.00 51.50 ?  1426 BF5 B C3  1 
HETATM 6518 N N3  . BF5 F 2 .   ? 11.145  29.442 22.828  1.00 42.61 ?  1426 BF5 B N3  1 
HETATM 6519 O O3  . BF5 F 2 .   ? 2.193   35.339 26.088  1.00 50.37 ?  1426 BF5 B O3  1 
HETATM 6520 C C4  . BF5 F 2 .   ? 5.885   31.467 25.574  1.00 51.71 ?  1426 BF5 B C4  1 
HETATM 6521 N N4  . BF5 F 2 .   ? 12.138  28.853 22.037  1.00 40.58 ?  1426 BF5 B N4  1 
HETATM 6522 O O4  . BF5 F 2 .   ? 1.356   35.262 24.007  1.00 52.42 ?  1426 BF5 B O4  1 
HETATM 6523 C C5  . BF5 F 2 .   ? 6.209   32.615 20.742  1.00 52.07 ?  1426 BF5 B C5  1 
HETATM 6524 C C6  . BF5 F 2 .   ? 5.472   33.851 21.283  1.00 51.77 ?  1426 BF5 B C6  1 
HETATM 6525 C C7  . BF5 F 2 .   ? 6.370   35.093 21.238  1.00 49.80 ?  1426 BF5 B C7  1 
HETATM 6526 C C8  . BF5 F 2 .   ? 5.234   32.395 24.773  1.00 51.72 ?  1426 BF5 B C8  1 
HETATM 6527 C C9  . BF5 F 2 .   ? 5.667   32.644 23.482  1.00 51.41 ?  1426 BF5 B C9  1 
HETATM 6528 C C10 . BF5 F 2 .   ? 3.933   34.304 23.116  1.00 51.66 ?  1426 BF5 B C10 1 
HETATM 6529 C C11 . BF5 F 2 .   ? 3.426   34.148 24.406  1.00 51.87 ?  1426 BF5 B C11 1 
HETATM 6530 C C12 . BF5 F 2 .   ? 4.078   33.164 25.301  1.00 51.94 ?  1426 BF5 B C12 1 
HETATM 6531 C C13 . BF5 F 2 .   ? 9.625   31.326 23.029  1.00 46.76 ?  1426 BF5 B C13 1 
HETATM 6532 C C14 . BF5 F 2 .   ? 10.714  30.690 22.170  1.00 44.12 ?  1426 BF5 B C14 1 
HETATM 6533 C C15 . BF5 F 2 .   ? 10.048  28.470 23.011  1.00 44.31 ?  1426 BF5 B C15 1 
HETATM 6534 C C16 . BF5 F 2 .   ? 9.020   29.137 23.892  1.00 47.13 ?  1426 BF5 B C16 1 
HETATM 6535 C C17 . BF5 F 2 .   ? 2.237   34.965 24.870  1.00 52.11 ?  1426 BF5 B C17 1 
HETATM 6536 N N1  . PLP G 3 .   ? 16.270  27.726 19.624  1.00 32.18 ?  1427 PLP B N1  1 
HETATM 6537 C C2  . PLP G 3 .   ? 15.544  26.813 20.307  1.00 33.31 ?  1427 PLP B C2  1 
HETATM 6538 C C2A . PLP G 3 .   ? 15.720  25.349 20.052  1.00 31.21 ?  1427 PLP B C2A 1 
HETATM 6539 C C3  . PLP G 3 .   ? 14.625  27.228 21.260  1.00 34.10 ?  1427 PLP B C3  1 
HETATM 6540 O O3  . PLP G 3 .   ? 13.901  26.293 21.961  1.00 31.54 ?  1427 PLP B O3  1 
HETATM 6541 C C4  . PLP G 3 .   ? 14.456  28.598 21.470  1.00 33.49 ?  1427 PLP B C4  1 
HETATM 6542 C C4A . PLP G 3 .   ? 13.475  29.019 22.511  1.00 33.94 ?  1427 PLP B C4A 1 
HETATM 6543 C C5  . PLP G 3 .   ? 15.204  29.554 20.760  1.00 33.32 ?  1427 PLP B C5  1 
HETATM 6544 C C6  . PLP G 3 .   ? 16.118  29.056 19.816  1.00 34.43 ?  1427 PLP B C6  1 
HETATM 6545 C C5A . PLP G 3 .   ? 15.045  31.088 20.948  1.00 32.24 ?  1427 PLP B C5A 1 
HETATM 6546 O O4P . PLP G 3 .   ? 15.495  31.595 22.216  1.00 28.53 ?  1427 PLP B O4P 1 
HETATM 6547 P P   . PLP G 3 .   ? 15.766  33.122 22.628  1.00 20.88 ?  1427 PLP B P   1 
HETATM 6548 O O1P . PLP G 3 .   ? 15.513  34.004 21.406  1.00 21.58 ?  1427 PLP B O1P 1 
HETATM 6549 O O2P . PLP G 3 .   ? 14.820  33.412 23.787  1.00 24.21 ?  1427 PLP B O2P 1 
HETATM 6550 O O3P . PLP G 3 .   ? 17.174  33.059 23.078  1.00 21.31 ?  1427 PLP B O3P 1 
HETATM 6551 C C1  . GOL H 5 .   ? 37.080  37.376 3.559   1.00 49.60 ?  1428 GOL B C1  1 
HETATM 6552 O O1  . GOL H 5 .   ? 36.594  36.116 4.011   1.00 47.23 ?  1428 GOL B O1  1 
HETATM 6553 C C2  . GOL H 5 .   ? 36.390  38.621 4.118   1.00 49.31 ?  1428 GOL B C2  1 
HETATM 6554 O O2  . GOL H 5 .   ? 37.393  39.589 4.412   1.00 52.86 ?  1428 GOL B O2  1 
HETATM 6555 C C3  . GOL H 5 .   ? 35.534  39.285 3.040   1.00 49.52 ?  1428 GOL B C3  1 
HETATM 6556 O O3  . GOL H 5 .   ? 34.423  38.514 2.615   1.00 50.39 ?  1428 GOL B O3  1 
HETATM 6557 O O   . HOH I 6 .   ? -6.237  40.652 4.054   1.00 30.30 ?  2001 HOH A O   1 
HETATM 6558 O O   . HOH I 6 .   ? -4.659  39.582 2.231   1.00 42.14 ?  2002 HOH A O   1 
HETATM 6559 O O   . HOH I 6 .   ? 2.797   35.617 -3.426  1.00 39.11 ?  2003 HOH A O   1 
HETATM 6560 O O   . HOH I 6 .   ? -3.837  47.954 -4.519  1.00 43.86 ?  2004 HOH A O   1 
HETATM 6561 O O   . HOH I 6 .   ? 4.262   33.624 -1.335  1.00 25.41 ?  2005 HOH A O   1 
HETATM 6562 O O   . HOH I 6 .   ? 9.992   37.436 -1.911  1.00 24.92 ?  2006 HOH A O   1 
HETATM 6563 O O   . HOH I 6 .   ? 2.671   29.646 3.316   1.00 39.69 ?  2007 HOH A O   1 
HETATM 6564 O O   . HOH I 6 .   ? 9.226   39.839 4.961   1.00 18.39 ?  2008 HOH A O   1 
HETATM 6565 O O   . HOH I 6 .   ? -0.501  33.859 7.021   1.00 32.51 ?  2009 HOH A O   1 
HETATM 6566 O O   . HOH I 6 .   ? 1.005   32.163 4.149   1.00 43.18 ?  2010 HOH A O   1 
HETATM 6567 O O   . HOH I 6 .   ? 8.221   34.112 -6.100  1.00 45.63 ?  2011 HOH A O   1 
HETATM 6568 O O   . HOH I 6 .   ? 5.425   25.368 30.701  1.00 15.11 ?  2012 HOH A O   1 
HETATM 6569 O O   . HOH I 6 .   ? 1.941   40.623 37.561  1.00 27.11 ?  2013 HOH A O   1 
HETATM 6570 O O   . HOH I 6 .   ? -1.275  38.745 26.817  1.00 42.16 ?  2014 HOH A O   1 
HETATM 6571 O O   . HOH I 6 .   ? 9.211   26.137 40.881  1.00 42.24 ?  2015 HOH A O   1 
HETATM 6572 O O   . HOH I 6 .   ? -0.413  39.360 17.347  1.00 32.54 ?  2016 HOH A O   1 
HETATM 6573 O O   . HOH I 6 .   ? -1.559  39.327 -9.655  1.00 51.06 ?  2017 HOH A O   1 
HETATM 6574 O O   . HOH I 6 .   ? 12.320  37.082 39.523  1.00 23.84 ?  2018 HOH A O   1 
HETATM 6575 O O   . HOH I 6 .   ? 10.880  38.145 41.667  1.00 29.17 ?  2019 HOH A O   1 
HETATM 6576 O O   . HOH I 6 .   ? 12.675  34.757 40.243  1.00 44.82 ?  2020 HOH A O   1 
HETATM 6577 O O   . HOH I 6 .   ? -8.086  65.976 4.968   1.00 36.36 ?  2021 HOH A O   1 
HETATM 6578 O O   . HOH I 6 .   ? 14.388  46.691 44.285  1.00 27.29 ?  2022 HOH A O   1 
HETATM 6579 O O   . HOH I 6 .   ? 2.079   66.932 -14.261 1.00 45.98 ?  2023 HOH A O   1 
HETATM 6580 O O   . HOH I 6 .   ? 15.415  53.473 42.372  1.00 37.84 ?  2024 HOH A O   1 
HETATM 6581 O O   . HOH I 6 .   ? 9.531   58.375 41.447  1.00 21.76 ?  2025 HOH A O   1 
HETATM 6582 O O   . HOH I 6 .   ? 13.207  65.268 33.355  1.00 33.74 ?  2026 HOH A O   1 
HETATM 6583 O O   . HOH I 6 .   ? 7.582   62.060 43.067  1.00 33.55 ?  2027 HOH A O   1 
HETATM 6584 O O   . HOH I 6 .   ? 4.938   55.840 37.188  1.00 30.14 ?  2028 HOH A O   1 
HETATM 6585 O O   . HOH I 6 .   ? 3.380   59.791 37.809  1.00 31.27 ?  2029 HOH A O   1 
HETATM 6586 O O   . HOH I 6 .   ? 16.433  41.696 2.635   1.00 28.40 ?  2030 HOH A O   1 
HETATM 6587 O O   . HOH I 6 .   ? 12.149  38.900 1.026   1.00 35.88 ?  2031 HOH A O   1 
HETATM 6588 O O   . HOH I 6 .   ? 9.194   52.046 46.204  1.00 2.69  ?  2032 HOH A O   1 
HETATM 6589 O O   . HOH I 6 .   ? 14.068  41.297 1.583   1.00 21.13 ?  2033 HOH A O   1 
HETATM 6590 O O   . HOH I 6 .   ? 8.601   36.926 -6.140  1.00 41.66 ?  2034 HOH A O   1 
HETATM 6591 O O   . HOH I 6 .   ? 4.529   45.069 42.115  1.00 20.76 ?  2035 HOH A O   1 
HETATM 6592 O O   . HOH I 6 .   ? 7.254   41.981 46.482  1.00 30.31 ?  2036 HOH A O   1 
HETATM 6593 O O   . HOH I 6 .   ? 6.063   34.811 34.749  1.00 35.84 ?  2037 HOH A O   1 
HETATM 6594 O O   . HOH I 6 .   ? 1.664   42.774 36.151  1.00 32.08 ?  2038 HOH A O   1 
HETATM 6595 O O   . HOH I 6 .   ? 3.441   39.113 30.187  1.00 28.49 ?  2039 HOH A O   1 
HETATM 6596 O O   . HOH I 6 .   ? 1.928   40.461 28.567  1.00 25.82 ?  2040 HOH A O   1 
HETATM 6597 O O   . HOH I 6 .   ? 5.862   31.981 33.785  1.00 33.45 ?  2041 HOH A O   1 
HETATM 6598 O O   . HOH I 6 .   ? 5.711   37.838 30.557  1.00 17.71 ?  2042 HOH A O   1 
HETATM 6599 O O   . HOH I 6 .   ? 5.445   41.751 24.486  1.00 18.28 ?  2043 HOH A O   1 
HETATM 6600 O O   . HOH I 6 .   ? 2.065   36.024 20.273  1.00 10.88 ?  2044 HOH A O   1 
HETATM 6601 O O   . HOH I 6 .   ? -4.177  64.673 -7.523  1.00 25.08 ?  2045 HOH A O   1 
HETATM 6602 O O   . HOH I 6 .   ? 1.136   39.213 19.416  1.00 20.94 ?  2046 HOH A O   1 
HETATM 6603 O O   . HOH I 6 .   ? -0.725  41.731 23.207  1.00 19.80 ?  2047 HOH A O   1 
HETATM 6604 O O   . HOH I 6 .   ? -4.447  45.323 24.264  1.00 20.15 ?  2048 HOH A O   1 
HETATM 6605 O O   . HOH I 6 .   ? -5.373  50.216 -18.784 1.00 26.43 ?  2049 HOH A O   1 
HETATM 6606 O O   . HOH I 6 .   ? -0.790  41.685 -7.700  1.00 26.12 ?  2050 HOH A O   1 
HETATM 6607 O O   . HOH I 6 .   ? -5.257  45.735 28.734  1.00 38.80 ?  2051 HOH A O   1 
HETATM 6608 O O   . HOH I 6 .   ? -5.141  47.861 30.237  1.00 34.79 ?  2052 HOH A O   1 
HETATM 6609 O O   . HOH I 6 .   ? -5.894  52.039 28.150  1.00 29.45 ?  2053 HOH A O   1 
HETATM 6610 O O   . HOH I 6 .   ? -3.794  56.920 31.066  1.00 14.76 ?  2054 HOH A O   1 
HETATM 6611 O O   . HOH I 6 .   ? -9.050  52.840 22.399  1.00 41.65 ?  2055 HOH A O   1 
HETATM 6612 O O   . HOH I 6 .   ? -10.658 61.170 19.221  1.00 38.56 ?  2056 HOH A O   1 
HETATM 6613 O O   . HOH I 6 .   ? 1.759   74.567 9.022   1.00 30.17 ?  2057 HOH A O   1 
HETATM 6614 O O   . HOH I 6 .   ? -7.737  63.029 -1.392  1.00 36.65 ?  2058 HOH A O   1 
HETATM 6615 O O   . HOH I 6 .   ? -7.029  64.698 2.902   1.00 32.74 ?  2059 HOH A O   1 
HETATM 6616 O O   . HOH I 6 .   ? -7.669  63.842 15.686  1.00 39.94 ?  2060 HOH A O   1 
HETATM 6617 O O   . HOH I 6 .   ? -5.637  65.207 13.788  1.00 25.96 ?  2061 HOH A O   1 
HETATM 6618 O O   . HOH I 6 .   ? -6.538  64.033 -7.544  1.00 31.59 ?  2062 HOH A O   1 
HETATM 6619 O O   . HOH I 6 .   ? -9.325  61.928 11.537  1.00 13.70 ?  2063 HOH A O   1 
HETATM 6620 O O   . HOH I 6 .   ? -11.769 60.521 10.678  1.00 48.17 ?  2064 HOH A O   1 
HETATM 6621 O O   . HOH I 6 .   ? -7.431  58.586 -12.491 1.00 34.99 ?  2065 HOH A O   1 
HETATM 6622 O O   . HOH I 6 .   ? 0.318   64.964 -14.623 1.00 37.38 ?  2066 HOH A O   1 
HETATM 6623 O O   . HOH I 6 .   ? -12.309 57.871 13.073  1.00 35.03 ?  2067 HOH A O   1 
HETATM 6624 O O   . HOH I 6 .   ? -15.551 50.589 15.669  1.00 50.07 ?  2068 HOH A O   1 
HETATM 6625 O O   . HOH I 6 .   ? -14.670 54.501 3.736   1.00 20.80 ?  2069 HOH A O   1 
HETATM 6626 O O   . HOH I 6 .   ? -12.379 41.377 7.253   1.00 30.69 ?  2070 HOH A O   1 
HETATM 6627 O O   . HOH I 6 .   ? -6.493  42.836 2.647   1.00 28.99 ?  2071 HOH A O   1 
HETATM 6628 O O   . HOH I 6 .   ? -10.091 63.252 5.091   1.00 37.32 ?  2072 HOH A O   1 
HETATM 6629 O O   . HOH I 6 .   ? -5.214  51.809 9.411   1.00 13.70 ?  2073 HOH A O   1 
HETATM 6630 O O   . HOH I 6 .   ? -7.303  46.247 14.552  1.00 23.23 ?  2074 HOH A O   1 
HETATM 6631 O O   . HOH I 6 .   ? -1.606  44.342 17.425  1.00 35.44 ?  2075 HOH A O   1 
HETATM 6632 O O   . HOH I 6 .   ? 7.476   43.676 18.729  1.00 26.03 ?  2076 HOH A O   1 
HETATM 6633 O O   . HOH I 6 .   ? 8.021   51.143 14.397  1.00 30.17 ?  2077 HOH A O   1 
HETATM 6634 O O   . HOH I 6 .   ? 13.602  42.615 21.209  1.00 19.97 ?  2078 HOH A O   1 
HETATM 6635 O O   . HOH I 6 .   ? 9.478   56.984 14.124  1.00 29.86 ?  2079 HOH A O   1 
HETATM 6636 O O   . HOH I 6 .   ? 7.078   31.108 15.256  1.00 29.14 ?  2080 HOH A O   1 
HETATM 6637 O O   . HOH I 6 .   ? 25.959  57.005 26.897  1.00 28.10 ?  2081 HOH A O   1 
HETATM 6638 O O   . HOH I 6 .   ? 32.008  50.896 18.735  1.00 39.70 ?  2082 HOH A O   1 
HETATM 6639 O O   . HOH I 6 .   ? 14.056  42.417 10.093  1.00 27.56 ?  2083 HOH A O   1 
HETATM 6640 O O   . HOH I 6 .   ? 16.927  43.766 4.613   1.00 22.31 ?  2084 HOH A O   1 
HETATM 6641 O O   . HOH I 6 .   ? 10.121  40.076 2.330   1.00 19.12 ?  2085 HOH A O   1 
HETATM 6642 O O   . HOH I 6 .   ? 12.326  42.876 0.610   1.00 13.94 ?  2086 HOH A O   1 
HETATM 6643 O O   . HOH I 6 .   ? 11.828  39.934 -3.431  1.00 41.93 ?  2087 HOH A O   1 
HETATM 6644 O O   . HOH I 6 .   ? 8.396   38.704 -4.126  1.00 29.32 ?  2088 HOH A O   1 
HETATM 6645 O O   . HOH I 6 .   ? 7.292   44.108 -7.227  1.00 31.03 ?  2089 HOH A O   1 
HETATM 6646 O O   . HOH I 6 .   ? 10.464  44.951 -9.259  1.00 31.35 ?  2090 HOH A O   1 
HETATM 6647 O O   . HOH I 6 .   ? 12.918  54.087 -11.737 1.00 25.60 ?  2091 HOH A O   1 
HETATM 6648 O O   . HOH I 6 .   ? 11.443  67.150 3.429   1.00 42.97 ?  2092 HOH A O   1 
HETATM 6649 O O   . HOH I 6 .   ? 13.111  61.878 3.493   1.00 31.37 ?  2093 HOH A O   1 
HETATM 6650 O O   . HOH I 6 .   ? 11.378  63.810 4.825   1.00 38.16 ?  2094 HOH A O   1 
HETATM 6651 O O   . HOH I 6 .   ? 14.576  66.650 -2.449  1.00 23.68 ?  2095 HOH A O   1 
HETATM 6652 O O   . HOH I 6 .   ? 17.525  67.995 -2.044  1.00 37.64 ?  2096 HOH A O   1 
HETATM 6653 O O   . HOH I 6 .   ? 21.605  61.170 -4.677  1.00 22.59 ?  2097 HOH A O   1 
HETATM 6654 O O   . HOH I 6 .   ? 14.466  66.234 2.424   1.00 20.87 ?  2098 HOH A O   1 
HETATM 6655 O O   . HOH I 6 .   ? 14.335  61.271 5.723   1.00 28.06 ?  2099 HOH A O   1 
HETATM 6656 O O   . HOH I 6 .   ? 19.639  83.795 7.370   1.00 44.96 ?  2100 HOH A O   1 
HETATM 6657 O O   . HOH I 6 .   ? 21.547  59.778 11.000  1.00 2.00  ?  2101 HOH A O   1 
HETATM 6658 O O   . HOH I 6 .   ? 20.295  54.127 -0.627  1.00 29.33 ?  2102 HOH A O   1 
HETATM 6659 O O   . HOH I 6 .   ? 23.786  49.300 3.264   1.00 25.55 ?  2103 HOH A O   1 
HETATM 6660 O O   . HOH I 6 .   ? 24.986  51.707 1.439   1.00 42.09 ?  2104 HOH A O   1 
HETATM 6661 O O   . HOH I 6 .   ? 17.846  46.316 4.645   1.00 20.86 ?  2105 HOH A O   1 
HETATM 6662 O O   . HOH I 6 .   ? 14.558  43.429 -2.457  1.00 25.57 ?  2106 HOH A O   1 
HETATM 6663 O O   . HOH I 6 .   ? 18.341  50.338 -3.478  1.00 25.52 ?  2107 HOH A O   1 
HETATM 6664 O O   . HOH I 6 .   ? 18.487  53.733 -6.167  1.00 27.45 ?  2108 HOH A O   1 
HETATM 6665 O O   . HOH I 6 .   ? 13.907  62.620 -9.301  1.00 35.24 ?  2109 HOH A O   1 
HETATM 6666 O O   . HOH I 6 .   ? 16.041  60.239 -8.854  1.00 36.87 ?  2110 HOH A O   1 
HETATM 6667 O O   . HOH I 6 .   ? 14.396  66.276 -7.719  1.00 50.38 ?  2111 HOH A O   1 
HETATM 6668 O O   . HOH I 6 .   ? 14.965  69.345 -3.794  1.00 31.92 ?  2112 HOH A O   1 
HETATM 6669 O O   . HOH I 6 .   ? 14.643  68.855 1.494   1.00 34.05 ?  2113 HOH A O   1 
HETATM 6670 O O   . HOH I 6 .   ? 15.831  70.772 -1.860  1.00 31.63 ?  2114 HOH A O   1 
HETATM 6671 O O   . HOH I 6 .   ? 25.857  58.332 15.053  1.00 27.76 ?  2115 HOH A O   1 
HETATM 6672 O O   . HOH I 6 .   ? 9.753   75.266 -3.926  1.00 32.50 ?  2116 HOH A O   1 
HETATM 6673 O O   . HOH I 6 .   ? 8.362   77.186 -0.604  1.00 40.71 ?  2117 HOH A O   1 
HETATM 6674 O O   . HOH I 6 .   ? 9.593   73.753 7.885   1.00 26.55 ?  2118 HOH A O   1 
HETATM 6675 O O   . HOH I 6 .   ? 4.053   76.099 2.074   1.00 43.87 ?  2119 HOH A O   1 
HETATM 6676 O O   . HOH I 6 .   ? -2.695  65.727 -9.533  1.00 37.05 ?  2120 HOH A O   1 
HETATM 6677 O O   . HOH I 6 .   ? -2.877  66.465 -5.459  1.00 15.54 ?  2121 HOH A O   1 
HETATM 6678 O O   . HOH I 6 .   ? 8.861   62.462 -14.610 1.00 35.15 ?  2122 HOH A O   1 
HETATM 6679 O O   . HOH I 6 .   ? 3.139   62.005 -19.339 1.00 45.47 ?  2123 HOH A O   1 
HETATM 6680 O O   . HOH I 6 .   ? 4.607   67.416 -15.652 1.00 40.83 ?  2124 HOH A O   1 
HETATM 6681 O O   . HOH I 6 .   ? 4.437   54.511 -17.623 1.00 28.02 ?  2125 HOH A O   1 
HETATM 6682 O O   . HOH I 6 .   ? 11.196  55.422 -14.064 1.00 36.77 ?  2126 HOH A O   1 
HETATM 6683 O O   . HOH I 6 .   ? -4.505  54.194 -9.448  1.00 25.58 ?  2127 HOH A O   1 
HETATM 6684 O O   . HOH I 6 .   ? -5.009  49.158 -16.415 1.00 18.39 ?  2128 HOH A O   1 
HETATM 6685 O O   . HOH I 6 .   ? 2.672   53.161 -16.059 1.00 26.13 ?  2129 HOH A O   1 
HETATM 6686 O O   . HOH I 6 .   ? 0.733   45.612 -8.723  1.00 32.91 ?  2130 HOH A O   1 
HETATM 6687 O O   . HOH I 6 .   ? -1.543  44.276 -8.884  1.00 37.47 ?  2131 HOH A O   1 
HETATM 6688 O O   . HOH I 6 .   ? -9.840  47.567 -7.965  1.00 25.50 ?  2132 HOH A O   1 
HETATM 6689 O O   . HOH I 6 .   ? 0.987   43.959 -19.403 1.00 34.09 ?  2133 HOH A O   1 
HETATM 6690 O O   . HOH I 6 .   ? 7.114   46.695 -15.678 1.00 34.15 ?  2134 HOH A O   1 
HETATM 6691 O O   . HOH I 6 .   ? 4.353   42.204 -18.666 1.00 23.38 ?  2135 HOH A O   1 
HETATM 6692 O O   . HOH I 6 .   ? 1.631   38.714 -12.135 1.00 39.64 ?  2136 HOH A O   1 
HETATM 6693 O O   . HOH I 6 .   ? 1.589   47.993 -10.632 1.00 2.00  ?  2137 HOH A O   1 
HETATM 6694 O O   . HOH I 6 .   ? 12.396  49.198 -12.460 1.00 34.64 ?  2138 HOH A O   1 
HETATM 6695 O O   . HOH I 6 .   ? 7.455   49.444 -8.147  1.00 14.50 ?  2139 HOH A O   1 
HETATM 6696 O O   . HOH I 6 .   ? 1.445   52.212 -7.636  1.00 26.74 ?  2140 HOH A O   1 
HETATM 6697 O O   . HOH I 6 .   ? 3.678   48.375 -8.239  1.00 27.87 ?  2141 HOH A O   1 
HETATM 6698 O O   . HOH I 6 .   ? 8.506   66.219 3.500   1.00 20.55 ?  2142 HOH A O   1 
HETATM 6699 O O   . HOH I 6 .   ? 9.398   67.239 6.033   1.00 18.11 ?  2143 HOH A O   1 
HETATM 6700 O O   . HOH I 6 .   ? 3.887   68.433 9.622   1.00 16.15 ?  2144 HOH A O   1 
HETATM 6701 O O   . HOH I 6 .   ? 9.112   63.366 12.780  1.00 13.34 ?  2145 HOH A O   1 
HETATM 6702 O O   . HOH I 6 .   ? 15.390  66.673 13.257  1.00 38.89 ?  2146 HOH A O   1 
HETATM 6703 O O   . HOH I 6 .   ? 13.499  68.702 3.506   1.00 38.78 ?  2147 HOH A O   1 
HETATM 6704 O O   . HOH I 6 .   ? 17.778  73.756 9.489   1.00 26.40 ?  2148 HOH A O   1 
HETATM 6705 O O   . HOH I 6 .   ? 16.552  73.310 5.740   1.00 32.83 ?  2149 HOH A O   1 
HETATM 6706 O O   . HOH I 6 .   ? 15.817  73.370 2.851   1.00 29.59 ?  2150 HOH A O   1 
HETATM 6707 O O   . HOH I 6 .   ? 6.917   74.150 7.612   1.00 30.76 ?  2151 HOH A O   1 
HETATM 6708 O O   . HOH I 6 .   ? 6.794   70.530 12.508  1.00 15.72 ?  2152 HOH A O   1 
HETATM 6709 O O   . HOH I 6 .   ? 1.703   75.025 2.092   1.00 25.84 ?  2153 HOH A O   1 
HETATM 6710 O O   . HOH I 6 .   ? -0.079  74.032 7.925   1.00 24.95 ?  2154 HOH A O   1 
HETATM 6711 O O   . HOH I 6 .   ? -4.371  71.219 -0.141  1.00 34.02 ?  2155 HOH A O   1 
HETATM 6712 O O   . HOH I 6 .   ? 2.657   74.469 -1.624  1.00 32.37 ?  2156 HOH A O   1 
HETATM 6713 O O   . HOH I 6 .   ? -5.386  72.748 4.174   1.00 47.52 ?  2157 HOH A O   1 
HETATM 6714 O O   . HOH I 6 .   ? -5.565  68.059 7.369   1.00 36.04 ?  2158 HOH A O   1 
HETATM 6715 O O   . HOH I 6 .   ? -6.559  65.110 0.437   1.00 32.55 ?  2159 HOH A O   1 
HETATM 6716 O O   . HOH I 6 .   ? -6.842  61.959 -5.705  1.00 26.19 ?  2160 HOH A O   1 
HETATM 6717 O O   . HOH I 6 .   ? -9.543  61.818 1.012   1.00 41.29 ?  2161 HOH A O   1 
HETATM 6718 O O   . HOH I 6 .   ? -6.731  54.791 -5.531  1.00 35.23 ?  2162 HOH A O   1 
HETATM 6719 O O   . HOH I 6 .   ? -12.756 59.558 -0.037  1.00 23.59 ?  2163 HOH A O   1 
HETATM 6720 O O   . HOH I 6 .   ? -1.802  64.440 -11.666 1.00 34.02 ?  2164 HOH A O   1 
HETATM 6721 O O   . HOH I 6 .   ? -6.745  57.224 -10.132 1.00 18.14 ?  2165 HOH A O   1 
HETATM 6722 O O   . HOH I 6 .   ? -0.005  60.316 -15.135 1.00 20.39 ?  2166 HOH A O   1 
HETATM 6723 O O   . HOH I 6 .   ? 0.742   63.499 -12.251 1.00 21.27 ?  2167 HOH A O   1 
HETATM 6724 O O   . HOH I 6 .   ? -5.691  51.881 -8.664  1.00 23.52 ?  2168 HOH A O   1 
HETATM 6725 O O   . HOH I 6 .   ? -5.357  50.657 -2.324  1.00 40.75 ?  2169 HOH A O   1 
HETATM 6726 O O   . HOH I 6 .   ? 5.657   60.057 5.058   1.00 81.67 ?  2170 HOH A O   1 
HETATM 6727 O O   . HOH I 6 .   ? 2.896   64.033 10.282  1.00 20.01 ?  2171 HOH A O   1 
HETATM 6728 O O   . HOH I 6 .   ? 6.584   59.709 17.256  1.00 15.15 ?  2172 HOH A O   1 
HETATM 6729 O O   . HOH I 6 .   ? 8.034   62.260 18.732  1.00 23.96 ?  2173 HOH A O   1 
HETATM 6730 O O   . HOH I 6 .   ? -1.441  66.291 14.679  1.00 13.44 ?  2174 HOH A O   1 
HETATM 6731 O O   . HOH I 6 .   ? 5.318   68.601 19.328  1.00 55.88 ?  2175 HOH A O   1 
HETATM 6732 O O   . HOH I 6 .   ? 4.487   72.817 14.357  1.00 39.61 ?  2176 HOH A O   1 
HETATM 6733 O O   . HOH I 6 .   ? 1.035   66.507 24.186  1.00 2.00  ?  2177 HOH A O   1 
HETATM 6734 O O   . HOH I 6 .   ? -1.292  70.339 18.716  1.00 27.02 ?  2178 HOH A O   1 
HETATM 6735 O O   . HOH I 6 .   ? 2.261   67.089 12.393  1.00 22.30 ?  2179 HOH A O   1 
HETATM 6736 O O   . HOH I 6 .   ? -3.255  64.262 13.520  1.00 14.11 ?  2180 HOH A O   1 
HETATM 6737 O O   . HOH I 6 .   ? -6.962  65.040 9.289   1.00 23.71 ?  2181 HOH A O   1 
HETATM 6738 O O   . HOH I 6 .   ? -8.285  62.404 3.301   1.00 23.82 ?  2182 HOH A O   1 
HETATM 6739 O O   . HOH I 6 .   ? -3.691  53.208 7.963   1.00 17.62 ?  2183 HOH A O   1 
HETATM 6740 O O   . HOH I 6 .   ? -5.875  51.311 -0.150  1.00 36.94 ?  2184 HOH A O   1 
HETATM 6741 O O   . HOH I 6 .   ? 1.421   59.637 17.576  1.00 18.73 ?  2185 HOH A O   1 
HETATM 6742 O O   . HOH I 6 .   ? 10.446  60.222 20.027  1.00 27.21 ?  2186 HOH A O   1 
HETATM 6743 O O   . HOH I 6 .   ? 11.336  54.522 19.646  1.00 37.94 ?  2187 HOH A O   1 
HETATM 6744 O O   . HOH I 6 .   ? 15.247  64.086 24.721  1.00 31.89 ?  2188 HOH A O   1 
HETATM 6745 O O   . HOH I 6 .   ? 13.485  53.571 22.029  1.00 19.12 ?  2189 HOH A O   1 
HETATM 6746 O O   . HOH I 6 .   ? 13.084  46.228 23.463  1.00 35.86 ?  2190 HOH A O   1 
HETATM 6747 O O   . HOH I 6 .   ? 2.652   54.450 15.179  1.00 12.55 ?  2191 HOH A O   1 
HETATM 6748 O O   . HOH I 6 .   ? -1.568  39.800 6.814   1.00 21.12 ?  2192 HOH A O   1 
HETATM 6749 O O   . HOH I 6 .   ? 0.169   38.219 12.945  1.00 43.37 ?  2193 HOH A O   1 
HETATM 6750 O O   . HOH I 6 .   ? -5.892  40.557 9.023   1.00 12.61 ?  2194 HOH A O   1 
HETATM 6751 O O   . HOH I 6 .   ? 6.620   40.224 6.763   1.00 20.29 ?  2195 HOH A O   1 
HETATM 6752 O O   . HOH I 6 .   ? 5.996   33.805 10.862  1.00 31.81 ?  2196 HOH A O   1 
HETATM 6753 O O   . HOH I 6 .   ? 8.659   41.923 6.771   1.00 13.13 ?  2197 HOH A O   1 
HETATM 6754 O O   . HOH I 6 .   ? 9.650   32.080 16.318  1.00 37.48 ?  2198 HOH A O   1 
HETATM 6755 O O   . HOH I 6 .   ? 10.215  43.258 18.557  1.00 22.83 ?  2199 HOH A O   1 
HETATM 6756 O O   . HOH I 6 .   ? 1.111   48.463 33.158  1.00 17.11 ?  2200 HOH A O   1 
HETATM 6757 O O   . HOH I 6 .   ? 3.937   46.761 35.889  1.00 36.18 ?  2201 HOH A O   1 
HETATM 6758 O O   . HOH I 6 .   ? 3.946   53.507 38.682  1.00 32.45 ?  2202 HOH A O   1 
HETATM 6759 O O   . HOH I 6 .   ? 4.185   58.215 35.770  1.00 30.52 ?  2203 HOH A O   1 
HETATM 6760 O O   . HOH I 6 .   ? -0.665  58.369 39.091  1.00 33.12 ?  2204 HOH A O   1 
HETATM 6761 O O   . HOH I 6 .   ? -4.430  66.340 24.661  1.00 42.49 ?  2205 HOH A O   1 
HETATM 6762 O O   . HOH I 6 .   ? -5.646  60.897 31.395  1.00 35.43 ?  2206 HOH A O   1 
HETATM 6763 O O   . HOH I 6 .   ? -2.622  61.342 26.390  1.00 33.15 ?  2207 HOH A O   1 
HETATM 6764 O O   . HOH I 6 .   ? 4.934   64.842 33.769  1.00 33.99 ?  2208 HOH A O   1 
HETATM 6765 O O   . HOH I 6 .   ? 3.311   71.900 24.756  1.00 37.92 ?  2209 HOH A O   1 
HETATM 6766 O O   . HOH I 6 .   ? 11.602  66.750 31.843  1.00 40.12 ?  2210 HOH A O   1 
HETATM 6767 O O   . HOH I 6 .   ? 9.480   74.338 30.770  1.00 35.75 ?  2211 HOH A O   1 
HETATM 6768 O O   . HOH I 6 .   ? 18.610  74.871 26.559  1.00 37.99 ?  2212 HOH A O   1 
HETATM 6769 O O   . HOH I 6 .   ? 17.878  82.963 18.170  1.00 28.44 ?  2213 HOH A O   1 
HETATM 6770 O O   . HOH I 6 .   ? 23.302  86.518 17.340  1.00 38.00 ?  2214 HOH A O   1 
HETATM 6771 O O   . HOH I 6 .   ? 19.027  82.568 12.209  1.00 33.31 ?  2215 HOH A O   1 
HETATM 6772 O O   . HOH I 6 .   ? 32.688  87.091 7.977   1.00 41.07 ?  2216 HOH A O   1 
HETATM 6773 O O   . HOH I 6 .   ? 30.432  88.281 4.988   1.00 41.05 ?  2217 HOH A O   1 
HETATM 6774 O O   . HOH I 6 .   ? 28.545  87.677 1.817   1.00 26.59 ?  2218 HOH A O   1 
HETATM 6775 O O   . HOH I 6 .   ? 20.129  75.645 3.753   1.00 28.38 ?  2219 HOH A O   1 
HETATM 6776 O O   . HOH I 6 .   ? 20.229  81.927 5.773   1.00 26.74 ?  2220 HOH A O   1 
HETATM 6777 O O   . HOH I 6 .   ? 10.685  77.292 10.486  1.00 42.63 ?  2221 HOH A O   1 
HETATM 6778 O O   . HOH I 6 .   ? 12.224  75.040 8.297   1.00 28.21 ?  2222 HOH A O   1 
HETATM 6779 O O   . HOH I 6 .   ? 10.895  76.869 14.832  1.00 32.53 ?  2223 HOH A O   1 
HETATM 6780 O O   . HOH I 6 .   ? 6.960   74.156 14.920  1.00 35.90 ?  2224 HOH A O   1 
HETATM 6781 O O   . HOH I 6 .   ? 15.650  69.489 13.061  1.00 24.97 ?  2225 HOH A O   1 
HETATM 6782 O O   . HOH I 6 .   ? 18.577  75.023 6.207   1.00 23.38 ?  2226 HOH A O   1 
HETATM 6783 O O   . HOH I 6 .   ? 21.435  83.145 0.955   1.00 43.85 ?  2227 HOH A O   1 
HETATM 6784 O O   . HOH I 6 .   ? 31.159  80.888 2.082   1.00 28.65 ?  2228 HOH A O   1 
HETATM 6785 O O   . HOH I 6 .   ? 28.376  71.398 -4.674  1.00 32.51 ?  2229 HOH A O   1 
HETATM 6786 O O   . HOH I 6 .   ? 30.105  71.304 -7.436  1.00 48.95 ?  2230 HOH A O   1 
HETATM 6787 O O   . HOH I 6 .   ? 36.409  67.005 -0.586  1.00 45.82 ?  2231 HOH A O   1 
HETATM 6788 O O   . HOH I 6 .   ? 41.385  66.999 1.524   1.00 49.68 ?  2232 HOH A O   1 
HETATM 6789 O O   . HOH I 6 .   ? 19.797  69.070 -1.295  1.00 27.36 ?  2233 HOH A O   1 
HETATM 6790 O O   . HOH I 6 .   ? 22.615  54.566 -0.423  1.00 31.15 ?  2234 HOH A O   1 
HETATM 6791 O O   . HOH I 6 .   ? 26.346  63.651 -1.568  1.00 21.40 ?  2235 HOH A O   1 
HETATM 6792 O O   . HOH I 6 .   ? 24.319  68.274 -1.158  1.00 24.28 ?  2236 HOH A O   1 
HETATM 6793 O O   . HOH I 6 .   ? 23.609  60.164 13.680  1.00 35.82 ?  2237 HOH A O   1 
HETATM 6794 O O   . HOH I 6 .   ? 24.657  66.538 13.368  1.00 24.67 ?  2238 HOH A O   1 
HETATM 6795 O O   . HOH I 6 .   ? 24.697  69.562 20.215  1.00 30.17 ?  2239 HOH A O   1 
HETATM 6796 O O   . HOH I 6 .   ? 29.017  52.704 18.121  1.00 39.69 ?  2240 HOH A O   1 
HETATM 6797 O O   . HOH I 6 .   ? 25.780  56.605 23.311  1.00 35.19 ?  2241 HOH A O   1 
HETATM 6798 O O   . HOH J 6 .   ? 34.163  27.689 0.560   1.00 48.51 ?  2001 HOH B O   1 
HETATM 6799 O O   . HOH J 6 .   ? 30.745  31.243 -5.609  1.00 32.38 ?  2002 HOH B O   1 
HETATM 6800 O O   . HOH J 6 .   ? 39.368  32.486 1.195   1.00 37.57 ?  2003 HOH B O   1 
HETATM 6801 O O   . HOH J 6 .   ? 33.245  32.571 -4.259  1.00 39.78 ?  2004 HOH B O   1 
HETATM 6802 O O   . HOH J 6 .   ? 18.182  40.520 -3.985  1.00 39.16 ?  2005 HOH B O   1 
HETATM 6803 O O   . HOH J 6 .   ? 33.305  31.815 -1.737  1.00 27.79 ?  2006 HOH B O   1 
HETATM 6804 O O   . HOH J 6 .   ? 28.083  23.291 -0.188  1.00 26.14 ?  2007 HOH B O   1 
HETATM 6805 O O   . HOH J 6 .   ? 19.866  38.574 2.616   1.00 25.48 ?  2008 HOH B O   1 
HETATM 6806 O O   . HOH J 6 .   ? 25.741  42.442 -3.869  1.00 25.61 ?  2009 HOH B O   1 
HETATM 6807 O O   . HOH J 6 .   ? 19.760  38.679 -2.257  1.00 30.22 ?  2010 HOH B O   1 
HETATM 6808 O O   . HOH J 6 .   ? 23.230  40.611 6.364   1.00 14.22 ?  2011 HOH B O   1 
HETATM 6809 O O   . HOH J 6 .   ? 27.039  47.804 -1.957  1.00 28.83 ?  2012 HOH B O   1 
HETATM 6810 O O   . HOH J 6 .   ? 20.654  40.145 4.780   1.00 20.15 ?  2013 HOH B O   1 
HETATM 6811 O O   . HOH J 6 .   ? 30.390  46.394 3.839   1.00 30.84 ?  2014 HOH B O   1 
HETATM 6812 O O   . HOH J 6 .   ? 22.072  47.428 5.245   1.00 22.92 ?  2015 HOH B O   1 
HETATM 6813 O O   . HOH J 6 .   ? 28.461  55.655 36.488  1.00 41.54 ?  2016 HOH B O   1 
HETATM 6814 O O   . HOH J 6 .   ? 28.974  46.216 0.213   1.00 38.30 ?  2017 HOH B O   1 
HETATM 6815 O O   . HOH J 6 .   ? 27.933  65.492 18.759  1.00 45.43 ?  2018 HOH B O   1 
HETATM 6816 O O   . HOH J 6 .   ? 25.490  53.636 41.898  1.00 43.25 ?  2019 HOH B O   1 
HETATM 6817 O O   . HOH J 6 .   ? 19.551  62.581 36.670  1.00 30.01 ?  2020 HOH B O   1 
HETATM 6818 O O   . HOH J 6 .   ? 24.950  65.920 19.770  1.00 41.79 ?  2021 HOH B O   1 
HETATM 6819 O O   . HOH J 6 .   ? 30.362  52.121 24.427  1.00 25.80 ?  2022 HOH B O   1 
HETATM 6820 O O   . HOH J 6 .   ? 28.408  55.566 33.553  1.00 33.65 ?  2023 HOH B O   1 
HETATM 6821 O O   . HOH J 6 .   ? 24.506  59.128 28.289  1.00 30.70 ?  2024 HOH B O   1 
HETATM 6822 O O   . HOH J 6 .   ? 17.985  62.007 32.734  1.00 26.56 ?  2025 HOH B O   1 
HETATM 6823 O O   . HOH J 6 .   ? 31.068  47.503 19.005  1.00 33.30 ?  2026 HOH B O   1 
HETATM 6824 O O   . HOH J 6 .   ? 32.043  50.021 21.629  1.00 35.31 ?  2027 HOH B O   1 
HETATM 6825 O O   . HOH J 6 .   ? 33.461  46.199 21.698  1.00 25.11 ?  2028 HOH B O   1 
HETATM 6826 O O   . HOH J 6 .   ? 37.913  41.419 24.970  1.00 43.83 ?  2029 HOH B O   1 
HETATM 6827 O O   . HOH J 6 .   ? 18.173  59.460 33.462  1.00 22.75 ?  2030 HOH B O   1 
HETATM 6828 O O   . HOH J 6 .   ? 35.276  20.365 26.323  1.00 36.57 ?  2031 HOH B O   1 
HETATM 6829 O O   . HOH J 6 .   ? 37.964  16.902 17.484  1.00 42.20 ?  2032 HOH B O   1 
HETATM 6830 O O   . HOH J 6 .   ? 41.498  23.537 19.579  1.00 40.42 ?  2033 HOH B O   1 
HETATM 6831 O O   . HOH J 6 .   ? 45.823  38.132 11.859  1.00 37.47 ?  2034 HOH B O   1 
HETATM 6832 O O   . HOH J 6 .   ? 14.229  40.670 46.908  1.00 38.09 ?  2035 HOH B O   1 
HETATM 6833 O O   . HOH J 6 .   ? 24.921  41.830 41.476  1.00 30.20 ?  2036 HOH B O   1 
HETATM 6834 O O   . HOH J 6 .   ? 20.206  42.060 46.106  1.00 25.80 ?  2037 HOH B O   1 
HETATM 6835 O O   . HOH J 6 .   ? 20.639  54.028 42.831  1.00 40.28 ?  2038 HOH B O   1 
HETATM 6836 O O   . HOH J 6 .   ? 25.678  53.691 39.414  1.00 35.23 ?  2039 HOH B O   1 
HETATM 6837 O O   . HOH J 6 .   ? 19.667  59.803 35.670  1.00 26.68 ?  2040 HOH B O   1 
HETATM 6838 O O   . HOH J 6 .   ? 17.553  61.298 41.361  1.00 40.55 ?  2041 HOH B O   1 
HETATM 6839 O O   . HOH J 6 .   ? 26.947  53.152 26.188  1.00 23.16 ?  2042 HOH B O   1 
HETATM 6840 O O   . HOH J 6 .   ? 29.113  53.358 33.191  1.00 33.43 ?  2043 HOH B O   1 
HETATM 6841 O O   . HOH J 6 .   ? 28.301  51.158 25.592  1.00 24.84 ?  2044 HOH B O   1 
HETATM 6842 O O   . HOH J 6 .   ? 24.255  61.149 25.685  1.00 31.99 ?  2045 HOH B O   1 
HETATM 6843 O O   . HOH J 6 .   ? 24.567  54.376 26.035  1.00 16.90 ?  2046 HOH B O   1 
HETATM 6844 O O   . HOH J 6 .   ? 24.826  47.931 22.760  1.00 13.74 ?  2047 HOH B O   1 
HETATM 6845 O O   . HOH J 6 .   ? 28.049  50.972 16.314  1.00 2.00  ?  2048 HOH B O   1 
HETATM 6846 O O   . HOH J 6 .   ? 29.117  47.805 17.127  1.00 23.69 ?  2049 HOH B O   1 
HETATM 6847 O O   . HOH J 6 .   ? 31.022  47.613 21.539  1.00 23.77 ?  2050 HOH B O   1 
HETATM 6848 O O   . HOH J 6 .   ? 34.468  44.608 24.214  1.00 30.33 ?  2051 HOH B O   1 
HETATM 6849 O O   . HOH J 6 .   ? 36.874  14.418 -1.208  1.00 29.94 ?  2052 HOH B O   1 
HETATM 6850 O O   . HOH J 6 .   ? 37.576  39.421 26.489  1.00 27.80 ?  2053 HOH B O   1 
HETATM 6851 O O   . HOH J 6 .   ? 35.422  42.524 23.191  1.00 32.79 ?  2054 HOH B O   1 
HETATM 6852 O O   . HOH J 6 .   ? 34.329  38.281 35.690  1.00 8.88  ?  2055 HOH B O   1 
HETATM 6853 O O   . HOH J 6 .   ? 24.180  14.563 26.846  1.00 27.93 ?  2056 HOH B O   1 
HETATM 6854 O O   . HOH J 6 .   ? 40.660  28.102 27.148  1.00 30.92 ?  2057 HOH B O   1 
HETATM 6855 O O   . HOH J 6 .   ? 37.389  16.395 10.406  1.00 45.78 ?  2058 HOH B O   1 
HETATM 6856 O O   . HOH J 6 .   ? 36.416  16.959 15.087  1.00 28.32 ?  2059 HOH B O   1 
HETATM 6857 O O   . HOH J 6 .   ? 35.351  22.052 24.739  1.00 21.20 ?  2060 HOH B O   1 
HETATM 6858 O O   . HOH J 6 .   ? 32.994  22.809 24.206  1.00 16.13 ?  2061 HOH B O   1 
HETATM 6859 O O   . HOH J 6 .   ? 28.680  29.091 25.474  1.00 33.03 ?  2062 HOH B O   1 
HETATM 6860 O O   . HOH J 6 .   ? 37.423  15.127 8.034   1.00 40.66 ?  2063 HOH B O   1 
HETATM 6861 O O   . HOH J 6 .   ? 39.135  23.650 21.248  1.00 22.17 ?  2064 HOH B O   1 
HETATM 6862 O O   . HOH J 6 .   ? 43.770  29.626 23.728  1.00 43.27 ?  2065 HOH B O   1 
HETATM 6863 O O   . HOH J 6 .   ? 42.228  28.176 20.340  1.00 33.12 ?  2066 HOH B O   1 
HETATM 6864 O O   . HOH J 6 .   ? 44.437  29.958 19.265  1.00 28.93 ?  2067 HOH B O   1 
HETATM 6865 O O   . HOH J 6 .   ? 45.681  36.483 13.882  1.00 34.23 ?  2068 HOH B O   1 
HETATM 6866 O O   . HOH J 6 .   ? 44.258  25.743 11.134  1.00 13.51 ?  2069 HOH B O   1 
HETATM 6867 O O   . HOH J 6 .   ? 42.291  38.837 6.879   1.00 30.79 ?  2070 HOH B O   1 
HETATM 6868 O O   . HOH J 6 .   ? 36.423  17.194 20.387  1.00 35.28 ?  2071 HOH B O   1 
HETATM 6869 O O   . HOH J 6 .   ? 45.127  33.174 4.323   1.00 13.27 ?  2072 HOH B O   1 
HETATM 6870 O O   . HOH J 6 .   ? 35.312  31.629 14.265  1.00 17.90 ?  2073 HOH B O   1 
HETATM 6871 O O   . HOH J 6 .   ? 37.227  38.848 15.804  1.00 28.69 ?  2074 HOH B O   1 
HETATM 6872 O O   . HOH J 6 .   ? 39.206  36.057 18.059  1.00 28.32 ?  2075 HOH B O   1 
HETATM 6873 O O   . HOH J 6 .   ? 25.666  41.786 16.841  1.00 33.04 ?  2076 HOH B O   1 
HETATM 6874 O O   . HOH J 6 .   ? 22.789  43.609 18.392  1.00 22.67 ?  2077 HOH B O   1 
HETATM 6875 O O   . HOH J 6 .   ? 22.291  34.873 18.397  1.00 30.60 ?  2078 HOH B O   1 
HETATM 6876 O O   . HOH J 6 .   ? 19.737  43.666 18.322  1.00 23.71 ?  2079 HOH B O   1 
HETATM 6877 O O   . HOH J 6 .   ? 20.683  29.702 21.565  1.00 33.77 ?  2080 HOH B O   1 
HETATM 6878 O O   . HOH J 6 .   ? 15.847  40.297 10.515  1.00 23.93 ?  2081 HOH B O   1 
HETATM 6879 O O   . HOH J 6 .   ? 14.805  40.351 6.240   1.00 33.01 ?  2082 HOH B O   1 
HETATM 6880 O O   . HOH J 6 .   ? 13.069  36.557 6.734   1.00 26.06 ?  2083 HOH B O   1 
HETATM 6881 O O   . HOH J 6 .   ? 17.663  35.317 2.480   1.00 18.38 ?  2084 HOH B O   1 
HETATM 6882 O O   . HOH J 6 .   ? 21.365  36.608 -3.852  1.00 26.55 ?  2085 HOH B O   1 
HETATM 6883 O O   . HOH J 6 .   ? 19.323  28.585 -5.153  1.00 32.57 ?  2086 HOH B O   1 
HETATM 6884 O O   . HOH J 6 .   ? 16.618  20.332 14.135  1.00 32.92 ?  2087 HOH B O   1 
HETATM 6885 O O   . HOH J 6 .   ? 14.882  13.391 11.347  1.00 27.33 ?  2088 HOH B O   1 
HETATM 6886 O O   . HOH J 6 .   ? 15.083  16.165 15.908  1.00 31.86 ?  2089 HOH B O   1 
HETATM 6887 O O   . HOH J 6 .   ? 6.438   28.890 16.213  1.00 37.18 ?  2090 HOH B O   1 
HETATM 6888 O O   . HOH J 6 .   ? 9.182   24.932 7.245   1.00 33.95 ?  2091 HOH B O   1 
HETATM 6889 O O   . HOH J 6 .   ? 6.174   30.932 8.156   1.00 22.44 ?  2092 HOH B O   1 
HETATM 6890 O O   . HOH J 6 .   ? 5.251   28.139 8.131   1.00 36.91 ?  2093 HOH B O   1 
HETATM 6891 O O   . HOH J 6 .   ? 5.789   32.051 13.470  1.00 29.81 ?  2094 HOH B O   1 
HETATM 6892 O O   . HOH J 6 .   ? 7.827   33.562 9.013   1.00 22.52 ?  2095 HOH B O   1 
HETATM 6893 O O   . HOH J 6 .   ? 12.101  34.502 7.868   1.00 18.33 ?  2096 HOH B O   1 
HETATM 6894 O O   . HOH J 6 .   ? 8.073   30.084 -0.087  1.00 39.58 ?  2097 HOH B O   1 
HETATM 6895 O O   . HOH J 6 .   ? 15.419  33.522 0.204   1.00 24.85 ?  2098 HOH B O   1 
HETATM 6896 O O   . HOH J 6 .   ? 10.204  24.788 3.721   1.00 38.02 ?  2099 HOH B O   1 
HETATM 6897 O O   . HOH J 6 .   ? 12.047  12.569 6.257   1.00 31.86 ?  2100 HOH B O   1 
HETATM 6898 O O   . HOH J 6 .   ? 8.236   16.872 4.608   1.00 38.95 ?  2101 HOH B O   1 
HETATM 6899 O O   . HOH J 6 .   ? 19.991  11.883 23.819  1.00 25.67 ?  2102 HOH B O   1 
HETATM 6900 O O   . HOH J 6 .   ? 23.228  8.982  23.483  1.00 36.79 ?  2103 HOH B O   1 
HETATM 6901 O O   . HOH J 6 .   ? 25.505  6.665  11.637  1.00 43.07 ?  2104 HOH B O   1 
HETATM 6902 O O   . HOH J 6 .   ? 31.771  9.560  4.743   1.00 32.63 ?  2105 HOH B O   1 
HETATM 6903 O O   . HOH J 6 .   ? 19.690  6.620  3.733   1.00 40.28 ?  2106 HOH B O   1 
HETATM 6904 O O   . HOH J 6 .   ? 18.494  17.690 -3.800  1.00 24.36 ?  2107 HOH B O   1 
HETATM 6905 O O   . HOH J 6 .   ? 29.538  11.952 -2.902  1.00 23.67 ?  2108 HOH B O   1 
HETATM 6906 O O   . HOH J 6 .   ? 34.296  20.163 -0.765  1.00 28.96 ?  2109 HOH B O   1 
HETATM 6907 O O   . HOH J 6 .   ? 36.145  13.859 -3.699  1.00 29.00 ?  2110 HOH B O   1 
HETATM 6908 O O   . HOH J 6 .   ? 34.375  20.589 -9.121  1.00 31.78 ?  2111 HOH B O   1 
HETATM 6909 O O   . HOH J 6 .   ? 28.657  27.412 -4.773  1.00 39.01 ?  2112 HOH B O   1 
HETATM 6910 O O   . HOH J 6 .   ? 28.153  24.765 -4.915  1.00 2.00  ?  2113 HOH B O   1 
HETATM 6911 O O   . HOH J 6 .   ? 29.663  22.658 -13.769 1.00 33.98 ?  2114 HOH B O   1 
HETATM 6912 O O   . HOH J 6 .   ? 24.665  20.417 -14.273 1.00 53.35 ?  2115 HOH B O   1 
HETATM 6913 O O   . HOH J 6 .   ? 18.831  21.293 -6.098  1.00 33.86 ?  2116 HOH B O   1 
HETATM 6914 O O   . HOH J 6 .   ? 24.022  27.095 -4.552  1.00 33.98 ?  2117 HOH B O   1 
HETATM 6915 O O   . HOH J 6 .   ? 21.989  25.179 -1.756  1.00 19.01 ?  2118 HOH B O   1 
HETATM 6916 O O   . HOH J 6 .   ? 25.972  25.822 -2.701  1.00 33.64 ?  2119 HOH B O   1 
HETATM 6917 O O   . HOH J 6 .   ? 27.382  20.167 24.318  1.00 32.28 ?  2120 HOH B O   1 
HETATM 6918 O O   . HOH J 6 .   ? 23.263  17.224 26.437  1.00 32.14 ?  2121 HOH B O   1 
HETATM 6919 O O   . HOH J 6 .   ? 14.520  21.250 25.674  1.00 38.75 ?  2122 HOH B O   1 
HETATM 6920 O O   . HOH J 6 .   ? 12.016  13.085 25.583  1.00 37.22 ?  2123 HOH B O   1 
HETATM 6921 O O   . HOH J 6 .   ? 13.063  11.807 22.398  1.00 41.10 ?  2124 HOH B O   1 
HETATM 6922 O O   . HOH J 6 .   ? 17.355  11.142 24.773  1.00 36.59 ?  2125 HOH B O   1 
HETATM 6923 O O   . HOH J 6 .   ? 25.047  13.317 24.636  1.00 29.02 ?  2126 HOH B O   1 
HETATM 6924 O O   . HOH J 6 .   ? 26.070  17.456 22.623  1.00 31.03 ?  2127 HOH B O   1 
HETATM 6925 O O   . HOH J 6 .   ? 35.807  15.492 12.778  1.00 26.11 ?  2128 HOH B O   1 
HETATM 6926 O O   . HOH J 6 .   ? 32.206  11.239 9.039   1.00 34.41 ?  2129 HOH B O   1 
HETATM 6927 O O   . HOH J 6 .   ? 34.447  10.172 10.220  1.00 33.62 ?  2130 HOH B O   1 
HETATM 6928 O O   . HOH J 6 .   ? 40.715  16.043 7.181   1.00 33.67 ?  2131 HOH B O   1 
HETATM 6929 O O   . HOH J 6 .   ? 30.877  10.287 2.174   1.00 39.61 ?  2132 HOH B O   1 
HETATM 6930 O O   . HOH J 6 .   ? 28.377  10.759 1.008   1.00 26.51 ?  2133 HOH B O   1 
HETATM 6931 O O   . HOH J 6 .   ? 35.325  22.312 -1.232  1.00 26.19 ?  2134 HOH B O   1 
HETATM 6932 O O   . HOH J 6 .   ? 26.941  21.664 21.373  1.00 26.71 ?  2135 HOH B O   1 
HETATM 6933 O O   . HOH J 6 .   ? 20.815  23.457 23.337  1.00 20.88 ?  2136 HOH B O   1 
HETATM 6934 O O   . HOH J 6 .   ? 22.182  27.424 27.639  1.00 27.05 ?  2137 HOH B O   1 
HETATM 6935 O O   . HOH J 6 .   ? 31.292  21.778 26.224  1.00 19.91 ?  2138 HOH B O   1 
HETATM 6936 O O   . HOH J 6 .   ? 32.315  20.008 31.662  1.00 37.03 ?  2139 HOH B O   1 
HETATM 6937 O O   . HOH J 6 .   ? 36.725  19.798 20.989  1.00 26.83 ?  2140 HOH B O   1 
HETATM 6938 O O   . HOH J 6 .   ? 39.317  20.423 20.169  1.00 38.82 ?  2141 HOH B O   1 
HETATM 6939 O O   . HOH J 6 .   ? 37.869  19.156 14.196  1.00 23.94 ?  2142 HOH B O   1 
HETATM 6940 O O   . HOH J 6 .   ? 33.508  29.574 13.714  1.00 17.67 ?  2143 HOH B O   1 
HETATM 6941 O O   . HOH J 6 .   ? 41.128  24.355 7.560   1.00 28.25 ?  2144 HOH B O   1 
HETATM 6942 O O   . HOH J 6 .   ? 23.413  28.969 25.333  1.00 24.06 ?  2145 HOH B O   1 
HETATM 6943 O O   . HOH J 6 .   ? 19.637  29.928 28.038  1.00 33.25 ?  2146 HOH B O   1 
HETATM 6944 O O   . HOH J 6 .   ? 15.025  28.811 34.052  1.00 27.48 ?  2147 HOH B O   1 
HETATM 6945 O O   . HOH J 6 .   ? 16.776  36.704 26.823  1.00 15.89 ?  2148 HOH B O   1 
HETATM 6946 O O   . HOH J 6 .   ? 17.173  43.305 24.028  1.00 39.28 ?  2149 HOH B O   1 
HETATM 6947 O O   . HOH J 6 .   ? 27.288  32.333 20.670  1.00 13.49 ?  2150 HOH B O   1 
HETATM 6948 O O   . HOH J 6 .   ? 39.008  43.114 9.541   1.00 36.96 ?  2151 HOH B O   1 
HETATM 6949 O O   . HOH J 6 .   ? 35.969  41.026 8.415   1.00 3.06  ?  2152 HOH B O   1 
HETATM 6950 O O   . HOH J 6 .   ? 30.198  45.246 11.119  1.00 34.43 ?  2153 HOH B O   1 
HETATM 6951 O O   . HOH J 6 .   ? 23.784  48.050 6.940   1.00 23.34 ?  2154 HOH B O   1 
HETATM 6952 O O   . HOH J 6 .   ? 21.173  39.193 7.377   1.00 18.37 ?  2155 HOH B O   1 
HETATM 6953 O O   . HOH J 6 .   ? 16.612  45.792 20.408  1.00 18.55 ?  2156 HOH B O   1 
HETATM 6954 O O   . HOH J 6 .   ? 29.213  46.557 33.612  1.00 15.89 ?  2157 HOH B O   1 
HETATM 6955 O O   . HOH J 6 .   ? 35.341  29.857 34.170  1.00 59.82 ?  2158 HOH B O   1 
HETATM 6956 O O   . HOH J 6 .   ? 33.500  27.259 38.101  1.00 36.36 ?  2159 HOH B O   1 
HETATM 6957 O O   . HOH J 6 .   ? 35.937  36.351 32.257  1.00 37.76 ?  2160 HOH B O   1 
HETATM 6958 O O   . HOH J 6 .   ? 11.635  4.323  23.275  1.00 46.03 ?  2161 HOH B O   1 
HETATM 6959 O O   . HOH J 6 .   ? 19.316  10.229 28.313  1.00 41.06 ?  2162 HOH B O   1 
HETATM 6960 O O   . HOH J 6 .   ? 14.391  18.468 26.924  1.00 27.76 ?  2163 HOH B O   1 
HETATM 6961 O O   . HOH J 6 .   ? 10.528  11.683 17.221  1.00 33.00 ?  2164 HOH B O   1 
HETATM 6962 O O   . HOH J 6 .   ? 9.772   11.953 14.629  1.00 33.30 ?  2165 HOH B O   1 
HETATM 6963 O O   . HOH J 6 .   ? 5.011   13.136 13.071  1.00 43.76 ?  2166 HOH B O   1 
HETATM 6964 O O   . HOH J 6 .   ? 7.526   17.205 7.404   1.00 32.52 ?  2167 HOH B O   1 
HETATM 6965 O O   . HOH J 6 .   ? 3.109   16.765 11.372  1.00 30.32 ?  2168 HOH B O   1 
HETATM 6966 O O   . HOH J 6 .   ? 8.344   26.006 20.426  1.00 2.00  ?  2169 HOH B O   1 
HETATM 6967 O O   . HOH J 6 .   ? 5.313   21.663 25.931  1.00 32.16 ?  2170 HOH B O   1 
HETATM 6968 O O   . HOH J 6 .   ? 5.847   22.428 33.929  1.00 38.39 ?  2171 HOH B O   1 
HETATM 6969 O O   . HOH J 6 .   ? -9.566  5.353  32.357  1.00 49.06 ?  2172 HOH B O   1 
HETATM 6970 O O   . HOH J 6 .   ? 34.037  36.369 1.856   1.00 29.68 ?  2173 HOH B O   1 
HETATM 6971 O O   . HOH J 6 .   ? 31.922  39.597 2.752   1.00 47.11 ?  2174 HOH B O   1 
HETATM 6972 O O   . HOH J 6 .   ? 35.951  40.665 0.225   1.00 45.76 ?  2175 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   -1  -1  GLU GLU A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ARG 20  20  ?   ?   ?   A . n 
A 1 21  THR 21  21  ?   ?   ?   A . n 
A 1 22  MET 22  22  ?   ?   ?   A . n 
A 1 23  THR 23  23  ?   ?   ?   A . n 
A 1 24  ASP 24  24  ?   ?   ?   A . n 
A 1 25  ILE 25  25  ?   ?   ?   A . n 
A 1 26  LEU 26  26  ?   ?   ?   A . n 
A 1 27  SER 27  27  ?   ?   ?   A . n 
A 1 28  ARG 28  28  ?   ?   ?   A . n 
A 1 29  GLY 29  29  ?   ?   ?   A . n 
A 1 30  PRO 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  SER 32  32  ?   ?   ?   A . n 
A 1 33  MET 33  33  33  MET MET A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  MET 45  45  45  MET MET A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  MET 67  67  67  MET MET A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 CYS 112 112 112 CYS CYS A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 CYS 122 122 122 CYS CYS A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 MET 127 127 127 MET MET A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 TYR 142 142 142 TYR TYR A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 CYS 154 154 154 CYS CYS A . n 
A 1 155 ASN 155 155 155 ASN ASN A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 ASN 158 158 158 ASN ASN A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 LYS 179 179 179 LYS LYS A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 PHE 193 193 193 PHE PHE A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 ASN 202 202 202 ASN ASN A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ILE 216 216 216 ILE ILE A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TYR 233 233 233 TYR TYR A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 ASN 239 239 239 ASN ASN A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 PHE 241 241 241 PHE PHE A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 THR 245 245 245 THR THR A . n 
A 1 246 PHE 246 246 246 PHE PHE A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 ALA 258 258 258 ALA ALA A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ARG 270 270 270 ARG ARG A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 PHE 273 273 273 PHE PHE A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 ILE 281 281 281 ILE ILE A . n 
A 1 282 GLU 282 282 282 GLU GLU A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 VAL 284 284 284 VAL VAL A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 GLN 289 289 289 GLN GLN A . n 
A 1 290 VAL 290 290 290 VAL VAL A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 HIS 294 294 294 HIS HIS A . n 
A 1 295 PRO 295 295 295 PRO PRO A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 THR 297 297 297 THR THR A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 ASN 299 299 299 ASN ASN A . n 
A 1 300 GLN 300 300 300 GLN GLN A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 MET 302 302 302 MET MET A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 GLN 305 305 305 GLN GLN A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 GLU 309 309 309 GLU GLU A . n 
A 1 310 TRP 310 310 310 TRP TRP A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 GLY 314 314 314 GLY GLY A . n 
A 1 315 PHE 315 315 315 PHE PHE A . n 
A 1 316 MET 316 316 316 MET MET A . n 
A 1 317 ALA 317 317 317 ALA ALA A . n 
A 1 318 HIS 318 318 318 HIS HIS A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 ARG 321 321 321 ARG ARG A . n 
A 1 322 VAL 322 322 322 VAL VAL A . n 
A 1 323 ILE 323 323 323 ILE ILE A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 PHE 325 325 325 PHE PHE A . n 
A 1 326 TYR 326 326 326 TYR TYR A . n 
A 1 327 SER 327 327 327 SER SER A . n 
A 1 328 ASN 328 328 328 ASN ASN A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 LYS 330 330 330 LYS LYS A . n 
A 1 331 ASP 331 331 331 ASP ASP A . n 
A 1 332 ALA 332 332 332 ALA ALA A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 ALA 335 335 335 ALA ALA A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 ASP 338 338 338 ASP ASP A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 TRP 340 340 340 TRP TRP A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 THR 342 342 342 THR THR A . n 
A 1 343 GLY 343 343 343 GLY GLY A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 GLU 346 346 346 GLU GLU A . n 
A 1 347 TRP 347 347 347 TRP TRP A . n 
A 1 348 HIS 348 348 348 HIS HIS A . n 
A 1 349 VAL 349 349 349 VAL VAL A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 ALA 351 351 351 ALA ALA A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 MET 354 354 354 MET MET A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 TRP 357 357 357 TRP TRP A . n 
A 1 358 ILE 358 358 358 ILE ILE A . n 
A 1 359 LYS 359 359 359 LYS LYS A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ILE 363 363 363 ILE ILE A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 LYS 367 367 367 LYS LYS A . n 
A 1 368 GLU 368 368 368 GLU GLU A . n 
A 1 369 LEU 369 369 369 LEU LEU A . n 
A 1 370 ILE 370 370 370 ILE ILE A . n 
A 1 371 GLU 371 371 371 GLU GLU A . n 
A 1 372 GLU 372 372 372 GLU GLU A . n 
A 1 373 LYS 373 373 373 LYS LYS A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 VAL 375 375 375 VAL VAL A . n 
A 1 376 LYS 376 376 376 LYS LYS A . n 
A 1 377 MET 377 377 377 MET MET A . n 
A 1 378 GLY 378 378 378 GLY GLY A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 MET 381 381 381 MET MET A . n 
A 1 382 LEU 382 382 382 LEU LEU A . n 
A 1 383 PRO 383 383 383 PRO PRO A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 ALA 386 386 386 ALA ALA A . n 
A 1 387 PHE 387 387 387 PHE PHE A . n 
A 1 388 TYR 388 388 388 TYR TYR A . n 
A 1 389 VAL 389 389 389 VAL VAL A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 SER 391 391 391 SER SER A . n 
A 1 392 SER 392 392 392 SER SER A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 PRO 394 394 394 PRO PRO A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 PRO 396 396 396 PRO PRO A . n 
A 1 397 TYR 397 397 397 TYR TYR A . n 
A 1 398 LEU 398 398 398 LEU LEU A . n 
A 1 399 ARG 399 399 399 ARG ARG A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 SER 401 401 401 SER SER A . n 
A 1 402 PHE 402 402 402 PHE PHE A . n 
A 1 403 SER 403 403 403 SER SER A . n 
A 1 404 SER 404 404 404 SER SER A . n 
A 1 405 ALA 405 405 405 ALA ALA A . n 
A 1 406 SER 406 406 406 SER SER A . n 
A 1 407 PRO 407 407 407 PRO PRO A . n 
A 1 408 GLU 408 408 408 GLU GLU A . n 
A 1 409 GLN 409 409 409 GLN GLN A . n 
A 1 410 MET 410 410 410 MET MET A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 VAL 412 412 412 VAL VAL A . n 
A 1 413 ALA 413 413 413 ALA ALA A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 VAL 416 416 416 VAL VAL A . n 
A 1 417 LEU 417 417 417 LEU LEU A . n 
A 1 418 ALA 418 418 418 ALA ALA A . n 
A 1 419 GLN 419 419 419 GLN GLN A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 ILE 421 421 421 ILE ILE A . n 
A 1 422 LYS 422 422 422 LYS LYS A . n 
A 1 423 GLU 423 423 423 GLU GLU A . n 
A 1 424 SER 424 424 424 SER SER A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
B 1 1   GLU 1   -1  -1  GLU GLU B . n 
B 1 2   ASN 2   2   2   ASN ASN B . n 
B 1 3   TYR 3   3   3   TYR TYR B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   ARG 5   5   5   ARG ARG B . n 
B 1 6   PHE 6   6   6   PHE PHE B . n 
B 1 7   ILE 7   7   7   ILE ILE B . n 
B 1 8   THR 8   8   8   THR THR B . n 
B 1 9   ALA 9   9   9   ALA ALA B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  SER 11  11  11  SER SER B . n 
B 1 12  ALA 12  12  12  ALA ALA B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  ARG 14  14  14  ARG ARG B . n 
B 1 15  ASN 15  15  15  ASN ASN B . n 
B 1 16  PRO 16  16  16  PRO PRO B . n 
B 1 17  SER 17  17  17  SER SER B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  ARG 20  20  ?   ?   ?   B . n 
B 1 21  THR 21  21  ?   ?   ?   B . n 
B 1 22  MET 22  22  ?   ?   ?   B . n 
B 1 23  THR 23  23  ?   ?   ?   B . n 
B 1 24  ASP 24  24  ?   ?   ?   B . n 
B 1 25  ILE 25  25  ?   ?   ?   B . n 
B 1 26  LEU 26  26  ?   ?   ?   B . n 
B 1 27  SER 27  27  ?   ?   ?   B . n 
B 1 28  ARG 28  28  ?   ?   ?   B . n 
B 1 29  GLY 29  29  ?   ?   ?   B . n 
B 1 30  PRO 30  30  ?   ?   ?   B . n 
B 1 31  LYS 31  31  ?   ?   ?   B . n 
B 1 32  SER 32  32  ?   ?   ?   B . n 
B 1 33  MET 33  33  33  MET MET B . n 
B 1 34  ILE 34  34  34  ILE ILE B . n 
B 1 35  SER 35  35  35  SER SER B . n 
B 1 36  LEU 36  36  36  LEU LEU B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  GLY 39  39  39  GLY GLY B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  ASN 42  42  42  ASN ASN B . n 
B 1 43  PRO 43  43  43  PRO PRO B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  MET 45  45  45  MET MET B . n 
B 1 46  PHE 46  46  46  PHE PHE B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  ALA 51  51  51  ALA ALA B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  GLU 56  56  56  GLU GLU B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  GLN 62  62  62  GLN GLN B . n 
B 1 63  PHE 63  63  63  PHE PHE B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  MET 67  67  67  MET MET B . n 
B 1 68  MET 68  68  68  MET MET B . n 
B 1 69  LYS 69  69  69  LYS LYS B . n 
B 1 70  ARG 70  70  70  ARG ARG B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  GLN 73  73  73  GLN GLN B . n 
B 1 74  TYR 74  74  74  TYR TYR B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  ILE 80  80  80  ILE ILE B . n 
B 1 81  PRO 81  81  81  PRO PRO B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  GLN 89  89  89  GLN GLN B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  GLN 91  91  91  GLN GLN B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  LYS 93  93  93  LYS LYS B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  ASN 96  96  96  ASN ASN B . n 
B 1 97  PRO 97  97  97  PRO PRO B . n 
B 1 98  PRO 98  98  98  PRO PRO B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 HIS 101 101 101 HIS HIS B . n 
B 1 102 TYR 102 102 102 TYR TYR B . n 
B 1 103 PRO 103 103 103 PRO PRO B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 GLN 106 106 106 GLN GLN B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 GLN 108 108 108 GLN GLN B . n 
B 1 109 MET 109 109 109 MET MET B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 CYS 112 112 112 CYS CYS B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 SER 115 115 115 SER SER B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 GLN 118 118 118 GLN GLN B . n 
B 1 119 GLN 119 119 119 GLN GLN B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 LEU 121 121 121 LEU LEU B . n 
B 1 122 CYS 122 122 122 CYS CYS B . n 
B 1 123 LYS 123 123 123 LYS LYS B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 PHE 125 125 125 PHE PHE B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 MET 127 127 127 MET MET B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 ASN 130 130 130 ASN ASN B . n 
B 1 131 PRO 131 131 131 PRO PRO B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 ASN 134 134 134 ASN ASN B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 LEU 137 137 137 LEU LEU B . n 
B 1 138 ASP 138 138 138 ASP ASP B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 PRO 140 140 140 PRO PRO B . n 
B 1 141 ALA 141 141 141 ALA ALA B . n 
B 1 142 TYR 142 142 142 TYR TYR B . n 
B 1 143 SER 143 143 143 SER SER B . n 
B 1 144 GLY 144 144 144 GLY GLY B . n 
B 1 145 THR 145 145 145 THR THR B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 GLN 147 147 147 GLN GLN B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 HIS 150 150 150 HIS HIS B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 GLY 153 153 153 GLY GLY B . n 
B 1 154 CYS 154 154 154 CYS CYS B . n 
B 1 155 ASN 155 155 155 ASN ASN B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 ILE 157 157 157 ILE ILE B . n 
B 1 158 ASN 158 158 158 ASN ASN B . n 
B 1 159 VAL 159 159 159 VAL VAL B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 SER 161 161 161 SER SER B . n 
B 1 162 ASP 162 162 162 ASP ASP B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 VAL 167 167 167 VAL VAL B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 ASP 169 169 169 ASP ASP B . n 
B 1 170 SER 170 170 170 SER SER B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 ARG 172 172 172 ARG ARG B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 SER 176 176 176 SER SER B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 TRP 178 178 178 TRP TRP B . n 
B 1 179 LYS 179 179 179 LYS LYS B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 GLU 181 181 181 GLU GLU B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 LYS 184 184 184 LYS LYS B . n 
B 1 185 ASN 185 185 185 ASN ASN B . n 
B 1 186 PRO 186 186 186 PRO PRO B . n 
B 1 187 GLN 187 187 187 GLN GLN B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 ASN 189 189 189 ASN ASN B . n 
B 1 190 THR 190 190 190 THR THR B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 PHE 193 193 193 PHE PHE B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 TYR 195 195 195 TYR TYR B . n 
B 1 196 THR 196 196 196 THR THR B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 PRO 198 198 198 PRO PRO B . n 
B 1 199 ASN 199 199 199 ASN ASN B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 ASN 201 201 201 ASN ASN B . n 
B 1 202 ASN 202 202 202 ASN ASN B . n 
B 1 203 PRO 203 203 203 PRO PRO B . n 
B 1 204 THR 204 204 204 THR THR B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ASN 206 206 206 ASN ASN B . n 
B 1 207 SER 207 207 207 SER SER B . n 
B 1 208 LEU 208 208 208 LEU LEU B . n 
B 1 209 THR 209 209 209 THR THR B . n 
B 1 210 SER 210 210 210 SER SER B . n 
B 1 211 GLU 211 211 211 GLU GLU B . n 
B 1 212 ARG 212 212 212 ARG ARG B . n 
B 1 213 LYS 213 213 213 LYS LYS B . n 
B 1 214 LYS 214 214 214 LYS LYS B . n 
B 1 215 GLU 215 215 215 GLU GLU B . n 
B 1 216 ILE 216 216 216 ILE ILE B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 GLU 218 218 218 GLU GLU B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 ALA 220 220 220 ALA ALA B . n 
B 1 221 ARG 221 221 221 ARG ARG B . n 
B 1 222 LYS 222 222 222 LYS LYS B . n 
B 1 223 TYR 223 223 223 TYR TYR B . n 
B 1 224 ASP 224 224 224 ASP ASP B . n 
B 1 225 PHE 225 225 225 PHE PHE B . n 
B 1 226 LEU 226 226 226 LEU LEU B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 ILE 228 228 228 ILE ILE B . n 
B 1 229 GLU 229 229 229 GLU GLU B . n 
B 1 230 ASP 230 230 230 ASP ASP B . n 
B 1 231 ASP 231 231 231 ASP ASP B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 TYR 233 233 233 TYR TYR B . n 
B 1 234 TYR 234 234 234 TYR TYR B . n 
B 1 235 PHE 235 235 235 PHE PHE B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 GLN 237 237 237 GLN GLN B . n 
B 1 238 PHE 238 238 238 PHE PHE B . n 
B 1 239 ASN 239 239 239 ASN ASN B . n 
B 1 240 LYS 240 240 240 LYS LYS B . n 
B 1 241 PHE 241 241 241 PHE PHE B . n 
B 1 242 ARG 242 242 242 ARG ARG B . n 
B 1 243 VAL 243 243 243 VAL VAL B . n 
B 1 244 PRO 244 244 244 PRO PRO B . n 
B 1 245 THR 245 245 245 THR THR B . n 
B 1 246 PHE 246 246 246 PHE PHE B . n 
B 1 247 LEU 247 247 247 LEU LEU B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 MET 249 249 249 MET MET B . n 
B 1 250 ASP 250 250 250 ASP ASP B . n 
B 1 251 VAL 251 251 251 VAL VAL B . n 
B 1 252 ASP 252 252 252 ASP ASP B . n 
B 1 253 GLY 253 253 253 GLY GLY B . n 
B 1 254 ARG 254 254 254 ARG ARG B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 ILE 256 256 256 ILE ILE B . n 
B 1 257 ARG 257 257 257 ARG ARG B . n 
B 1 258 ALA 258 258 258 ALA ALA B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 SER 260 260 260 SER SER B . n 
B 1 261 PHE 261 261 261 PHE PHE B . n 
B 1 262 SER 262 262 262 SER SER B . n 
B 1 263 LYS 263 263 263 LYS LYS B . n 
B 1 264 ILE 264 264 264 ILE ILE B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 SER 266 266 266 SER SER B . n 
B 1 267 SER 267 267 267 SER SER B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ARG 270 270 270 ARG ARG B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 PHE 273 273 273 PHE PHE B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 GLY 276 276 276 GLY GLY B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 LYS 278 278 278 LYS LYS B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 LEU 280 280 280 LEU LEU B . n 
B 1 281 ILE 281 281 281 ILE ILE B . n 
B 1 282 GLU 282 282 282 GLU GLU B . n 
B 1 283 ARG 283 283 283 ARG ARG B . n 
B 1 284 VAL 284 284 284 VAL VAL B . n 
B 1 285 ILE 285 285 285 ILE ILE B . n 
B 1 286 LEU 286 286 286 LEU LEU B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 ILE 288 288 288 ILE ILE B . n 
B 1 289 GLN 289 289 289 GLN GLN B . n 
B 1 290 VAL 290 290 290 VAL VAL B . n 
B 1 291 SER 291 291 291 SER SER B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 LEU 293 293 293 LEU LEU B . n 
B 1 294 HIS 294 294 294 HIS HIS B . n 
B 1 295 PRO 295 295 295 PRO PRO B . n 
B 1 296 SER 296 296 296 SER SER B . n 
B 1 297 THR 297 297 297 THR THR B . n 
B 1 298 PHE 298 298 298 PHE PHE B . n 
B 1 299 ASN 299 299 299 ASN ASN B . n 
B 1 300 GLN 300 300 300 GLN GLN B . n 
B 1 301 LEU 301 301 301 LEU LEU B . n 
B 1 302 MET 302 302 302 MET MET B . n 
B 1 303 ILE 303 303 303 ILE ILE B . n 
B 1 304 SER 304 304 304 SER SER B . n 
B 1 305 GLN 305 305 305 GLN GLN B . n 
B 1 306 LEU 306 306 306 LEU LEU B . n 
B 1 307 LEU 307 307 307 LEU LEU B . n 
B 1 308 HIS 308 308 308 HIS HIS B . n 
B 1 309 GLU 309 309 309 GLU GLU B . n 
B 1 310 TRP 310 310 310 TRP TRP B . n 
B 1 311 GLY 311 311 311 GLY GLY B . n 
B 1 312 GLU 312 312 312 GLU GLU B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 GLY 314 314 314 GLY GLY B . n 
B 1 315 PHE 315 315 315 PHE PHE B . n 
B 1 316 MET 316 316 316 MET MET B . n 
B 1 317 ALA 317 317 317 ALA ALA B . n 
B 1 318 HIS 318 318 318 HIS HIS B . n 
B 1 319 VAL 319 319 319 VAL VAL B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 ARG 321 321 321 ARG ARG B . n 
B 1 322 VAL 322 322 322 VAL VAL B . n 
B 1 323 ILE 323 323 323 ILE ILE B . n 
B 1 324 ASP 324 324 324 ASP ASP B . n 
B 1 325 PHE 325 325 325 PHE PHE B . n 
B 1 326 TYR 326 326 326 TYR TYR B . n 
B 1 327 SER 327 327 327 SER SER B . n 
B 1 328 ASN 328 328 328 ASN ASN B . n 
B 1 329 GLN 329 329 329 GLN GLN B . n 
B 1 330 LYS 330 330 330 LYS LYS B . n 
B 1 331 ASP 331 331 331 ASP ASP B . n 
B 1 332 ALA 332 332 332 ALA ALA B . n 
B 1 333 ILE 333 333 333 ILE ILE B . n 
B 1 334 LEU 334 334 334 LEU LEU B . n 
B 1 335 ALA 335 335 335 ALA ALA B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 ALA 337 337 337 ALA ALA B . n 
B 1 338 ASP 338 338 338 ASP ASP B . n 
B 1 339 LYS 339 339 339 LYS LYS B . n 
B 1 340 TRP 340 340 340 TRP TRP B . n 
B 1 341 LEU 341 341 341 LEU LEU B . n 
B 1 342 THR 342 342 342 THR THR B . n 
B 1 343 GLY 343 343 343 GLY GLY B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 ALA 345 345 345 ALA ALA B . n 
B 1 346 GLU 346 346 346 GLU GLU B . n 
B 1 347 TRP 347 347 347 TRP TRP B . n 
B 1 348 HIS 348 348 348 HIS HIS B . n 
B 1 349 VAL 349 349 349 VAL VAL B . n 
B 1 350 PRO 350 350 350 PRO PRO B . n 
B 1 351 ALA 351 351 351 ALA ALA B . n 
B 1 352 ALA 352 352 352 ALA ALA B . n 
B 1 353 GLY 353 353 353 GLY GLY B . n 
B 1 354 MET 354 354 354 MET MET B . n 
B 1 355 PHE 355 355 355 PHE PHE B . n 
B 1 356 LEU 356 356 356 LEU LEU B . n 
B 1 357 TRP 357 357 357 TRP TRP B . n 
B 1 358 ILE 358 358 358 ILE ILE B . n 
B 1 359 LYS 359 359 359 LYS LYS B . n 
B 1 360 VAL 360 360 360 VAL VAL B . n 
B 1 361 LYS 361 361 361 LYS LYS B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 ILE 363 363 363 ILE ILE B . n 
B 1 364 ASN 364 364 364 ASN ASN B . n 
B 1 365 ASP 365 365 365 ASP ASP B . n 
B 1 366 VAL 366 366 366 VAL VAL B . n 
B 1 367 LYS 367 367 367 LYS LYS B . n 
B 1 368 GLU 368 368 368 GLU GLU B . n 
B 1 369 LEU 369 369 369 LEU LEU B . n 
B 1 370 ILE 370 370 370 ILE ILE B . n 
B 1 371 GLU 371 371 371 GLU GLU B . n 
B 1 372 GLU 372 372 372 GLU GLU B . n 
B 1 373 LYS 373 373 373 LYS LYS B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 VAL 375 375 375 VAL VAL B . n 
B 1 376 LYS 376 376 376 LYS LYS B . n 
B 1 377 MET 377 377 377 MET MET B . n 
B 1 378 GLY 378 378 378 GLY GLY B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 MET 381 381 381 MET MET B . n 
B 1 382 LEU 382 382 382 LEU LEU B . n 
B 1 383 PRO 383 383 383 PRO PRO B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 ASN 385 385 385 ASN ASN B . n 
B 1 386 ALA 386 386 386 ALA ALA B . n 
B 1 387 PHE 387 387 387 PHE PHE B . n 
B 1 388 TYR 388 388 388 TYR TYR B . n 
B 1 389 VAL 389 389 389 VAL VAL B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 SER 391 391 391 SER SER B . n 
B 1 392 SER 392 392 392 SER SER B . n 
B 1 393 ALA 393 393 393 ALA ALA B . n 
B 1 394 PRO 394 394 394 PRO PRO B . n 
B 1 395 SER 395 395 395 SER SER B . n 
B 1 396 PRO 396 396 396 PRO PRO B . n 
B 1 397 TYR 397 397 397 TYR TYR B . n 
B 1 398 LEU 398 398 398 LEU LEU B . n 
B 1 399 ARG 399 399 399 ARG ARG B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 SER 401 401 401 SER SER B . n 
B 1 402 PHE 402 402 402 PHE PHE B . n 
B 1 403 SER 403 403 403 SER SER B . n 
B 1 404 SER 404 404 404 SER SER B . n 
B 1 405 ALA 405 405 405 ALA ALA B . n 
B 1 406 SER 406 406 406 SER SER B . n 
B 1 407 PRO 407 407 407 PRO PRO B . n 
B 1 408 GLU 408 408 408 GLU GLU B . n 
B 1 409 GLN 409 409 409 GLN GLN B . n 
B 1 410 MET 410 410 410 MET MET B . n 
B 1 411 ASP 411 411 411 ASP ASP B . n 
B 1 412 VAL 412 412 412 VAL VAL B . n 
B 1 413 ALA 413 413 413 ALA ALA B . n 
B 1 414 PHE 414 414 414 PHE PHE B . n 
B 1 415 GLN 415 415 415 GLN GLN B . n 
B 1 416 VAL 416 416 416 VAL VAL B . n 
B 1 417 LEU 417 417 417 LEU LEU B . n 
B 1 418 ALA 418 418 418 ALA ALA B . n 
B 1 419 GLN 419 419 419 GLN GLN B . n 
B 1 420 LEU 420 420 420 LEU LEU B . n 
B 1 421 ILE 421 421 421 ILE ILE B . n 
B 1 422 LYS 422 422 422 LYS LYS B . n 
B 1 423 GLU 423 423 423 GLU GLU B . n 
B 1 424 SER 424 424 424 SER SER B . n 
B 1 425 LEU 425 425 425 LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 BF5 1   1426 1426 BF5 BF5 A . 
D 3 PLP 1   1427 1427 PLP PLP A . 
E 4 IOD 1   1428 1428 IOD IOD A . 
F 2 BF5 1   1426 1426 BF5 BF5 B . 
G 3 PLP 1   1427 1427 PLP PLP B . 
H 5 GOL 1   1428 1428 GOL GOL B . 
I 6 HOH 1   2001 2001 HOH HOH A . 
I 6 HOH 2   2002 2002 HOH HOH A . 
I 6 HOH 3   2003 2003 HOH HOH A . 
I 6 HOH 4   2004 2004 HOH HOH A . 
I 6 HOH 5   2005 2005 HOH HOH A . 
I 6 HOH 6   2006 2006 HOH HOH A . 
I 6 HOH 7   2007 2007 HOH HOH A . 
I 6 HOH 8   2008 2008 HOH HOH A . 
I 6 HOH 9   2009 2009 HOH HOH A . 
I 6 HOH 10  2010 2010 HOH HOH A . 
I 6 HOH 11  2011 2011 HOH HOH A . 
I 6 HOH 12  2012 2012 HOH HOH A . 
I 6 HOH 13  2013 2013 HOH HOH A . 
I 6 HOH 14  2014 2014 HOH HOH A . 
I 6 HOH 15  2015 2015 HOH HOH A . 
I 6 HOH 16  2016 2016 HOH HOH A . 
I 6 HOH 17  2017 2017 HOH HOH A . 
I 6 HOH 18  2018 2018 HOH HOH A . 
I 6 HOH 19  2019 2019 HOH HOH A . 
I 6 HOH 20  2020 2020 HOH HOH A . 
I 6 HOH 21  2021 2021 HOH HOH A . 
I 6 HOH 22  2022 2022 HOH HOH A . 
I 6 HOH 23  2023 2023 HOH HOH A . 
I 6 HOH 24  2024 2024 HOH HOH A . 
I 6 HOH 25  2025 2025 HOH HOH A . 
I 6 HOH 26  2026 2026 HOH HOH A . 
I 6 HOH 27  2027 2027 HOH HOH A . 
I 6 HOH 28  2028 2028 HOH HOH A . 
I 6 HOH 29  2029 2029 HOH HOH A . 
I 6 HOH 30  2030 2030 HOH HOH A . 
I 6 HOH 31  2031 2031 HOH HOH A . 
I 6 HOH 32  2032 2032 HOH HOH A . 
I 6 HOH 33  2033 2033 HOH HOH A . 
I 6 HOH 34  2034 2034 HOH HOH A . 
I 6 HOH 35  2035 2035 HOH HOH A . 
I 6 HOH 36  2036 2036 HOH HOH A . 
I 6 HOH 37  2037 2037 HOH HOH A . 
I 6 HOH 38  2038 2038 HOH HOH A . 
I 6 HOH 39  2039 2039 HOH HOH A . 
I 6 HOH 40  2040 2040 HOH HOH A . 
I 6 HOH 41  2041 2041 HOH HOH A . 
I 6 HOH 42  2042 2042 HOH HOH A . 
I 6 HOH 43  2043 2043 HOH HOH A . 
I 6 HOH 44  2044 2044 HOH HOH A . 
I 6 HOH 45  2045 2045 HOH HOH A . 
I 6 HOH 46  2046 2046 HOH HOH A . 
I 6 HOH 47  2047 2047 HOH HOH A . 
I 6 HOH 48  2048 2048 HOH HOH A . 
I 6 HOH 49  2049 2049 HOH HOH A . 
I 6 HOH 50  2050 2050 HOH HOH A . 
I 6 HOH 51  2051 2051 HOH HOH A . 
I 6 HOH 52  2052 2052 HOH HOH A . 
I 6 HOH 53  2053 2053 HOH HOH A . 
I 6 HOH 54  2054 2054 HOH HOH A . 
I 6 HOH 55  2055 2055 HOH HOH A . 
I 6 HOH 56  2056 2056 HOH HOH A . 
I 6 HOH 57  2057 2057 HOH HOH A . 
I 6 HOH 58  2058 2058 HOH HOH A . 
I 6 HOH 59  2059 2059 HOH HOH A . 
I 6 HOH 60  2060 2060 HOH HOH A . 
I 6 HOH 61  2061 2061 HOH HOH A . 
I 6 HOH 62  2062 2062 HOH HOH A . 
I 6 HOH 63  2063 2063 HOH HOH A . 
I 6 HOH 64  2064 2064 HOH HOH A . 
I 6 HOH 65  2065 2065 HOH HOH A . 
I 6 HOH 66  2066 2066 HOH HOH A . 
I 6 HOH 67  2067 2067 HOH HOH A . 
I 6 HOH 68  2068 2068 HOH HOH A . 
I 6 HOH 69  2069 2069 HOH HOH A . 
I 6 HOH 70  2070 2070 HOH HOH A . 
I 6 HOH 71  2071 2071 HOH HOH A . 
I 6 HOH 72  2072 2072 HOH HOH A . 
I 6 HOH 73  2073 2073 HOH HOH A . 
I 6 HOH 74  2074 2074 HOH HOH A . 
I 6 HOH 75  2075 2075 HOH HOH A . 
I 6 HOH 76  2076 2076 HOH HOH A . 
I 6 HOH 77  2077 2077 HOH HOH A . 
I 6 HOH 78  2078 2078 HOH HOH A . 
I 6 HOH 79  2079 2079 HOH HOH A . 
I 6 HOH 80  2080 2080 HOH HOH A . 
I 6 HOH 81  2081 2081 HOH HOH A . 
I 6 HOH 82  2082 2082 HOH HOH A . 
I 6 HOH 83  2083 2083 HOH HOH A . 
I 6 HOH 84  2084 2084 HOH HOH A . 
I 6 HOH 85  2085 2085 HOH HOH A . 
I 6 HOH 86  2086 2086 HOH HOH A . 
I 6 HOH 87  2087 2087 HOH HOH A . 
I 6 HOH 88  2088 2088 HOH HOH A . 
I 6 HOH 89  2089 2089 HOH HOH A . 
I 6 HOH 90  2090 2090 HOH HOH A . 
I 6 HOH 91  2091 2091 HOH HOH A . 
I 6 HOH 92  2092 2092 HOH HOH A . 
I 6 HOH 93  2093 2093 HOH HOH A . 
I 6 HOH 94  2094 2094 HOH HOH A . 
I 6 HOH 95  2095 2095 HOH HOH A . 
I 6 HOH 96  2096 2096 HOH HOH A . 
I 6 HOH 97  2097 2097 HOH HOH A . 
I 6 HOH 98  2098 2098 HOH HOH A . 
I 6 HOH 99  2099 2099 HOH HOH A . 
I 6 HOH 100 2100 2100 HOH HOH A . 
I 6 HOH 101 2101 2101 HOH HOH A . 
I 6 HOH 102 2102 2102 HOH HOH A . 
I 6 HOH 103 2103 2103 HOH HOH A . 
I 6 HOH 104 2104 2104 HOH HOH A . 
I 6 HOH 105 2105 2105 HOH HOH A . 
I 6 HOH 106 2106 2106 HOH HOH A . 
I 6 HOH 107 2107 2107 HOH HOH A . 
I 6 HOH 108 2108 2108 HOH HOH A . 
I 6 HOH 109 2109 2109 HOH HOH A . 
I 6 HOH 110 2110 2110 HOH HOH A . 
I 6 HOH 111 2111 2111 HOH HOH A . 
I 6 HOH 112 2112 2112 HOH HOH A . 
I 6 HOH 113 2113 2113 HOH HOH A . 
I 6 HOH 114 2114 2114 HOH HOH A . 
I 6 HOH 115 2115 2115 HOH HOH A . 
I 6 HOH 116 2116 2116 HOH HOH A . 
I 6 HOH 117 2117 2117 HOH HOH A . 
I 6 HOH 118 2118 2118 HOH HOH A . 
I 6 HOH 119 2119 2119 HOH HOH A . 
I 6 HOH 120 2120 2120 HOH HOH A . 
I 6 HOH 121 2121 2121 HOH HOH A . 
I 6 HOH 122 2122 2122 HOH HOH A . 
I 6 HOH 123 2123 2123 HOH HOH A . 
I 6 HOH 124 2124 2124 HOH HOH A . 
I 6 HOH 125 2125 2125 HOH HOH A . 
I 6 HOH 126 2126 2126 HOH HOH A . 
I 6 HOH 127 2127 2127 HOH HOH A . 
I 6 HOH 128 2128 2128 HOH HOH A . 
I 6 HOH 129 2129 2129 HOH HOH A . 
I 6 HOH 130 2130 2130 HOH HOH A . 
I 6 HOH 131 2131 2131 HOH HOH A . 
I 6 HOH 132 2132 2132 HOH HOH A . 
I 6 HOH 133 2133 2133 HOH HOH A . 
I 6 HOH 134 2134 2134 HOH HOH A . 
I 6 HOH 135 2135 2135 HOH HOH A . 
I 6 HOH 136 2136 2136 HOH HOH A . 
I 6 HOH 137 2137 2137 HOH HOH A . 
I 6 HOH 138 2138 2138 HOH HOH A . 
I 6 HOH 139 2139 2139 HOH HOH A . 
I 6 HOH 140 2140 2140 HOH HOH A . 
I 6 HOH 141 2141 2141 HOH HOH A . 
I 6 HOH 142 2142 2142 HOH HOH A . 
I 6 HOH 143 2143 2143 HOH HOH A . 
I 6 HOH 144 2144 2144 HOH HOH A . 
I 6 HOH 145 2145 2145 HOH HOH A . 
I 6 HOH 146 2146 2146 HOH HOH A . 
I 6 HOH 147 2147 2147 HOH HOH A . 
I 6 HOH 148 2148 2148 HOH HOH A . 
I 6 HOH 149 2149 2149 HOH HOH A . 
I 6 HOH 150 2150 2150 HOH HOH A . 
I 6 HOH 151 2151 2151 HOH HOH A . 
I 6 HOH 152 2152 2152 HOH HOH A . 
I 6 HOH 153 2153 2153 HOH HOH A . 
I 6 HOH 154 2154 2154 HOH HOH A . 
I 6 HOH 155 2155 2155 HOH HOH A . 
I 6 HOH 156 2156 2156 HOH HOH A . 
I 6 HOH 157 2157 2157 HOH HOH A . 
I 6 HOH 158 2158 2158 HOH HOH A . 
I 6 HOH 159 2159 2159 HOH HOH A . 
I 6 HOH 160 2160 2160 HOH HOH A . 
I 6 HOH 161 2161 2161 HOH HOH A . 
I 6 HOH 162 2162 2162 HOH HOH A . 
I 6 HOH 163 2163 2163 HOH HOH A . 
I 6 HOH 164 2164 2164 HOH HOH A . 
I 6 HOH 165 2165 2165 HOH HOH A . 
I 6 HOH 166 2166 2166 HOH HOH A . 
I 6 HOH 167 2167 2167 HOH HOH A . 
I 6 HOH 168 2168 2168 HOH HOH A . 
I 6 HOH 169 2169 2169 HOH HOH A . 
I 6 HOH 170 2170 2170 HOH HOH A . 
I 6 HOH 171 2171 2171 HOH HOH A . 
I 6 HOH 172 2172 2172 HOH HOH A . 
I 6 HOH 173 2173 2173 HOH HOH A . 
I 6 HOH 174 2174 2174 HOH HOH A . 
I 6 HOH 175 2175 2175 HOH HOH A . 
I 6 HOH 176 2176 2176 HOH HOH A . 
I 6 HOH 177 2177 2177 HOH HOH A . 
I 6 HOH 178 2178 2178 HOH HOH A . 
I 6 HOH 179 2179 2179 HOH HOH A . 
I 6 HOH 180 2180 2180 HOH HOH A . 
I 6 HOH 181 2181 2181 HOH HOH A . 
I 6 HOH 182 2182 2182 HOH HOH A . 
I 6 HOH 183 2183 2183 HOH HOH A . 
I 6 HOH 184 2184 2184 HOH HOH A . 
I 6 HOH 185 2185 2185 HOH HOH A . 
I 6 HOH 186 2186 2186 HOH HOH A . 
I 6 HOH 187 2187 2187 HOH HOH A . 
I 6 HOH 188 2188 2188 HOH HOH A . 
I 6 HOH 189 2189 2189 HOH HOH A . 
I 6 HOH 190 2190 2190 HOH HOH A . 
I 6 HOH 191 2191 2191 HOH HOH A . 
I 6 HOH 192 2192 2192 HOH HOH A . 
I 6 HOH 193 2193 2193 HOH HOH A . 
I 6 HOH 194 2194 2194 HOH HOH A . 
I 6 HOH 195 2195 2195 HOH HOH A . 
I 6 HOH 196 2196 2196 HOH HOH A . 
I 6 HOH 197 2197 2197 HOH HOH A . 
I 6 HOH 198 2198 2198 HOH HOH A . 
I 6 HOH 199 2199 2199 HOH HOH A . 
I 6 HOH 200 2200 2200 HOH HOH A . 
I 6 HOH 201 2201 2201 HOH HOH A . 
I 6 HOH 202 2202 2202 HOH HOH A . 
I 6 HOH 203 2203 2203 HOH HOH A . 
I 6 HOH 204 2204 2204 HOH HOH A . 
I 6 HOH 205 2205 2205 HOH HOH A . 
I 6 HOH 206 2206 2206 HOH HOH A . 
I 6 HOH 207 2207 2207 HOH HOH A . 
I 6 HOH 208 2208 2208 HOH HOH A . 
I 6 HOH 209 2209 2209 HOH HOH A . 
I 6 HOH 210 2210 2210 HOH HOH A . 
I 6 HOH 211 2211 2211 HOH HOH A . 
I 6 HOH 212 2212 2212 HOH HOH A . 
I 6 HOH 213 2213 2213 HOH HOH A . 
I 6 HOH 214 2214 2214 HOH HOH A . 
I 6 HOH 215 2215 2215 HOH HOH A . 
I 6 HOH 216 2216 2216 HOH HOH A . 
I 6 HOH 217 2217 2217 HOH HOH A . 
I 6 HOH 218 2218 2218 HOH HOH A . 
I 6 HOH 219 2219 2219 HOH HOH A . 
I 6 HOH 220 2220 2220 HOH HOH A . 
I 6 HOH 221 2221 2221 HOH HOH A . 
I 6 HOH 222 2222 2222 HOH HOH A . 
I 6 HOH 223 2223 2223 HOH HOH A . 
I 6 HOH 224 2224 2224 HOH HOH A . 
I 6 HOH 225 2225 2225 HOH HOH A . 
I 6 HOH 226 2226 2226 HOH HOH A . 
I 6 HOH 227 2227 2227 HOH HOH A . 
I 6 HOH 228 2228 2228 HOH HOH A . 
I 6 HOH 229 2229 2229 HOH HOH A . 
I 6 HOH 230 2230 2230 HOH HOH A . 
I 6 HOH 231 2231 2231 HOH HOH A . 
I 6 HOH 232 2232 2232 HOH HOH A . 
I 6 HOH 233 2233 2233 HOH HOH A . 
I 6 HOH 234 2234 2234 HOH HOH A . 
I 6 HOH 235 2235 2235 HOH HOH A . 
I 6 HOH 236 2236 2236 HOH HOH A . 
I 6 HOH 237 2237 2237 HOH HOH A . 
I 6 HOH 238 2238 2238 HOH HOH A . 
I 6 HOH 239 2239 2239 HOH HOH A . 
I 6 HOH 240 2240 2240 HOH HOH A . 
I 6 HOH 241 2241 2241 HOH HOH A . 
J 6 HOH 1   2001 2001 HOH HOH B . 
J 6 HOH 2   2002 2002 HOH HOH B . 
J 6 HOH 3   2003 2003 HOH HOH B . 
J 6 HOH 4   2004 2004 HOH HOH B . 
J 6 HOH 5   2005 2005 HOH HOH B . 
J 6 HOH 6   2006 2006 HOH HOH B . 
J 6 HOH 7   2007 2007 HOH HOH B . 
J 6 HOH 8   2008 2008 HOH HOH B . 
J 6 HOH 9   2009 2009 HOH HOH B . 
J 6 HOH 10  2010 2010 HOH HOH B . 
J 6 HOH 11  2011 2011 HOH HOH B . 
J 6 HOH 12  2012 2012 HOH HOH B . 
J 6 HOH 13  2013 2013 HOH HOH B . 
J 6 HOH 14  2014 2014 HOH HOH B . 
J 6 HOH 15  2015 2015 HOH HOH B . 
J 6 HOH 16  2016 2016 HOH HOH B . 
J 6 HOH 17  2017 2017 HOH HOH B . 
J 6 HOH 18  2018 2018 HOH HOH B . 
J 6 HOH 19  2019 2019 HOH HOH B . 
J 6 HOH 20  2020 2020 HOH HOH B . 
J 6 HOH 21  2021 2021 HOH HOH B . 
J 6 HOH 22  2022 2022 HOH HOH B . 
J 6 HOH 23  2023 2023 HOH HOH B . 
J 6 HOH 24  2024 2024 HOH HOH B . 
J 6 HOH 25  2025 2025 HOH HOH B . 
J 6 HOH 26  2026 2026 HOH HOH B . 
J 6 HOH 27  2027 2027 HOH HOH B . 
J 6 HOH 28  2028 2028 HOH HOH B . 
J 6 HOH 29  2029 2029 HOH HOH B . 
J 6 HOH 30  2030 2030 HOH HOH B . 
J 6 HOH 31  2031 2031 HOH HOH B . 
J 6 HOH 32  2032 2032 HOH HOH B . 
J 6 HOH 33  2033 2033 HOH HOH B . 
J 6 HOH 34  2034 2034 HOH HOH B . 
J 6 HOH 35  2035 2035 HOH HOH B . 
J 6 HOH 36  2036 2036 HOH HOH B . 
J 6 HOH 37  2037 2037 HOH HOH B . 
J 6 HOH 38  2038 2038 HOH HOH B . 
J 6 HOH 39  2039 2039 HOH HOH B . 
J 6 HOH 40  2040 2040 HOH HOH B . 
J 6 HOH 41  2041 2041 HOH HOH B . 
J 6 HOH 42  2042 2042 HOH HOH B . 
J 6 HOH 43  2043 2043 HOH HOH B . 
J 6 HOH 44  2044 2044 HOH HOH B . 
J 6 HOH 45  2045 2045 HOH HOH B . 
J 6 HOH 46  2046 2046 HOH HOH B . 
J 6 HOH 47  2047 2047 HOH HOH B . 
J 6 HOH 48  2048 2048 HOH HOH B . 
J 6 HOH 49  2049 2049 HOH HOH B . 
J 6 HOH 50  2050 2050 HOH HOH B . 
J 6 HOH 51  2051 2051 HOH HOH B . 
J 6 HOH 52  2052 2052 HOH HOH B . 
J 6 HOH 53  2053 2053 HOH HOH B . 
J 6 HOH 54  2054 2054 HOH HOH B . 
J 6 HOH 55  2055 2055 HOH HOH B . 
J 6 HOH 56  2056 2056 HOH HOH B . 
J 6 HOH 57  2057 2057 HOH HOH B . 
J 6 HOH 58  2058 2058 HOH HOH B . 
J 6 HOH 59  2059 2059 HOH HOH B . 
J 6 HOH 60  2060 2060 HOH HOH B . 
J 6 HOH 61  2061 2061 HOH HOH B . 
J 6 HOH 62  2062 2062 HOH HOH B . 
J 6 HOH 63  2063 2063 HOH HOH B . 
J 6 HOH 64  2064 2064 HOH HOH B . 
J 6 HOH 65  2065 2065 HOH HOH B . 
J 6 HOH 66  2066 2066 HOH HOH B . 
J 6 HOH 67  2067 2067 HOH HOH B . 
J 6 HOH 68  2068 2068 HOH HOH B . 
J 6 HOH 69  2069 2069 HOH HOH B . 
J 6 HOH 70  2070 2070 HOH HOH B . 
J 6 HOH 71  2071 2071 HOH HOH B . 
J 6 HOH 72  2072 2072 HOH HOH B . 
J 6 HOH 73  2073 2073 HOH HOH B . 
J 6 HOH 74  2074 2074 HOH HOH B . 
J 6 HOH 75  2075 2075 HOH HOH B . 
J 6 HOH 76  2076 2076 HOH HOH B . 
J 6 HOH 77  2077 2077 HOH HOH B . 
J 6 HOH 78  2078 2078 HOH HOH B . 
J 6 HOH 79  2079 2079 HOH HOH B . 
J 6 HOH 80  2080 2080 HOH HOH B . 
J 6 HOH 81  2081 2081 HOH HOH B . 
J 6 HOH 82  2082 2082 HOH HOH B . 
J 6 HOH 83  2083 2083 HOH HOH B . 
J 6 HOH 84  2084 2084 HOH HOH B . 
J 6 HOH 85  2085 2085 HOH HOH B . 
J 6 HOH 86  2086 2086 HOH HOH B . 
J 6 HOH 87  2087 2087 HOH HOH B . 
J 6 HOH 88  2088 2088 HOH HOH B . 
J 6 HOH 89  2089 2089 HOH HOH B . 
J 6 HOH 90  2090 2090 HOH HOH B . 
J 6 HOH 91  2091 2091 HOH HOH B . 
J 6 HOH 92  2092 2092 HOH HOH B . 
J 6 HOH 93  2093 2093 HOH HOH B . 
J 6 HOH 94  2094 2094 HOH HOH B . 
J 6 HOH 95  2095 2095 HOH HOH B . 
J 6 HOH 96  2096 2096 HOH HOH B . 
J 6 HOH 97  2097 2097 HOH HOH B . 
J 6 HOH 98  2098 2098 HOH HOH B . 
J 6 HOH 99  2099 2099 HOH HOH B . 
J 6 HOH 100 2100 2100 HOH HOH B . 
J 6 HOH 101 2101 2101 HOH HOH B . 
J 6 HOH 102 2102 2102 HOH HOH B . 
J 6 HOH 103 2103 2103 HOH HOH B . 
J 6 HOH 104 2104 2104 HOH HOH B . 
J 6 HOH 105 2105 2105 HOH HOH B . 
J 6 HOH 106 2106 2106 HOH HOH B . 
J 6 HOH 107 2107 2107 HOH HOH B . 
J 6 HOH 108 2108 2108 HOH HOH B . 
J 6 HOH 109 2109 2109 HOH HOH B . 
J 6 HOH 110 2110 2110 HOH HOH B . 
J 6 HOH 111 2111 2111 HOH HOH B . 
J 6 HOH 112 2112 2112 HOH HOH B . 
J 6 HOH 113 2113 2113 HOH HOH B . 
J 6 HOH 114 2114 2114 HOH HOH B . 
J 6 HOH 115 2115 2115 HOH HOH B . 
J 6 HOH 116 2116 2116 HOH HOH B . 
J 6 HOH 117 2117 2117 HOH HOH B . 
J 6 HOH 118 2118 2118 HOH HOH B . 
J 6 HOH 119 2119 2119 HOH HOH B . 
J 6 HOH 120 2120 2120 HOH HOH B . 
J 6 HOH 121 2121 2121 HOH HOH B . 
J 6 HOH 122 2122 2122 HOH HOH B . 
J 6 HOH 123 2123 2123 HOH HOH B . 
J 6 HOH 124 2124 2124 HOH HOH B . 
J 6 HOH 125 2125 2125 HOH HOH B . 
J 6 HOH 126 2126 2126 HOH HOH B . 
J 6 HOH 127 2127 2127 HOH HOH B . 
J 6 HOH 128 2128 2128 HOH HOH B . 
J 6 HOH 129 2129 2129 HOH HOH B . 
J 6 HOH 130 2130 2130 HOH HOH B . 
J 6 HOH 131 2131 2131 HOH HOH B . 
J 6 HOH 132 2132 2132 HOH HOH B . 
J 6 HOH 133 2133 2133 HOH HOH B . 
J 6 HOH 134 2134 2134 HOH HOH B . 
J 6 HOH 135 2135 2135 HOH HOH B . 
J 6 HOH 136 2136 2136 HOH HOH B . 
J 6 HOH 137 2137 2137 HOH HOH B . 
J 6 HOH 138 2138 2138 HOH HOH B . 
J 6 HOH 139 2139 2139 HOH HOH B . 
J 6 HOH 140 2140 2140 HOH HOH B . 
J 6 HOH 141 2141 2141 HOH HOH B . 
J 6 HOH 142 2142 2142 HOH HOH B . 
J 6 HOH 143 2143 2143 HOH HOH B . 
J 6 HOH 144 2144 2144 HOH HOH B . 
J 6 HOH 145 2145 2145 HOH HOH B . 
J 6 HOH 146 2146 2146 HOH HOH B . 
J 6 HOH 147 2147 2147 HOH HOH B . 
J 6 HOH 148 2148 2148 HOH HOH B . 
J 6 HOH 149 2149 2149 HOH HOH B . 
J 6 HOH 150 2150 2150 HOH HOH B . 
J 6 HOH 151 2151 2151 HOH HOH B . 
J 6 HOH 152 2152 2152 HOH HOH B . 
J 6 HOH 153 2153 2153 HOH HOH B . 
J 6 HOH 154 2154 2154 HOH HOH B . 
J 6 HOH 155 2155 2155 HOH HOH B . 
J 6 HOH 156 2156 2156 HOH HOH B . 
J 6 HOH 157 2157 2157 HOH HOH B . 
J 6 HOH 158 2158 2158 HOH HOH B . 
J 6 HOH 159 2159 2159 HOH HOH B . 
J 6 HOH 160 2160 2160 HOH HOH B . 
J 6 HOH 161 2161 2161 HOH HOH B . 
J 6 HOH 162 2162 2162 HOH HOH B . 
J 6 HOH 163 2163 2163 HOH HOH B . 
J 6 HOH 164 2164 2164 HOH HOH B . 
J 6 HOH 165 2165 2165 HOH HOH B . 
J 6 HOH 166 2166 2166 HOH HOH B . 
J 6 HOH 167 2167 2167 HOH HOH B . 
J 6 HOH 168 2168 2168 HOH HOH B . 
J 6 HOH 169 2169 2169 HOH HOH B . 
J 6 HOH 170 2170 2170 HOH HOH B . 
J 6 HOH 171 2171 2171 HOH HOH B . 
J 6 HOH 172 2172 2172 HOH HOH B . 
J 6 HOH 173 2173 2173 HOH HOH B . 
J 6 HOH 174 2174 2174 HOH HOH B . 
J 6 HOH 175 2175 2175 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8950  ? 
1 MORE         -61.1 ? 
1 'SSA (A^2)'  29690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-07-28 
2 'Structure model' 1 1 2011-10-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'       
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
AMoRE  phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2XH1 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, MET 1 TO GLU
ENGINEERED RESIDUE IN CHAIN B, MET 1 TO GLU
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;BF5-PLP: COVALENT LINK BETWEEN THE PLP COFACTOR AND
 THE SYNTHETIC INHIBITOR NAMED BFF-122.
;
_pdbx_entry_details.sequence_details     
;THE SEGMENT 20-32 IS MISSING FROM THE COORDINATES FILE.
THE FIRST RESIDUE IS A GLU THAT REPLACES A MET AS A RESULT
OF CLONING STRATEGY
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    195 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OD2 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ASP 
_pdbx_validate_close_contact.auth_seq_id_2    230 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     211 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLU 
_pdbx_validate_symm_contact.auth_seq_id_2     211 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_565 
_pdbx_validate_symm_contact.dist              1.73 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             282 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             282 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.323 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.071 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 169 ? ? CG A ASP 169 ? ? OD1 A ASP 169 ? ? 112.70 118.30 -5.60  0.90 N 
2 1 NE A ARG 270 ? ? CZ A ARG 270 ? ? NH2 A ARG 270 ? ? 117.16 120.30 -3.14  0.50 N 
3 1 CA A LEU 380 ? ? CB A LEU 380 ? ? CG  A LEU 380 ? ? 130.80 115.30 15.50  2.30 N 
4 1 C  B GLN 106 ? ? N  B GLY 107 ? ? CA  B GLY 107 ? ? 102.46 122.30 -19.84 2.10 Y 
5 1 CA B LEU 137 ? ? CB B LEU 137 ? ? CG  B LEU 137 ? ? 133.45 115.30 18.15  2.30 N 
6 1 NE B ARG 283 ? ? CZ B ARG 283 ? ? NH1 B ARG 283 ? ? 125.37 120.30 5.07   0.50 N 
7 1 NE B ARG 283 ? ? CZ B ARG 283 ? ? NH2 B ARG 283 ? ? 115.68 120.30 -4.62  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 18  ? ? -77.73  21.78   
2  1 ASN A 96  ? ? 28.72   65.30   
3  1 ASP A 162 ? ? -146.93 -154.49 
4  1 ASN A 189 ? ? -98.92  48.74   
5  1 LYS A 240 ? ? 58.04   15.61   
6  1 SER A 266 ? ? -177.86 128.98  
7  1 SER A 291 ? ? -116.80 -90.51  
8  1 LEU A 293 ? ? 77.94   -55.22  
9  1 GLU A 372 ? ? -124.78 -63.13  
10 1 PRO B 18  ? ? -67.83  -166.30 
11 1 TYR B 74  ? ? -48.10  151.46  
12 1 ASN B 96  ? ? 32.82   66.17   
13 1 ASP B 162 ? ? -142.65 -152.72 
14 1 ASN B 189 ? ? -92.06  57.95   
15 1 LYS B 240 ? ? -54.58  13.29   
16 1 ILE B 265 ? ? -120.34 -54.00  
17 1 SER B 266 ? ? -175.23 125.70  
18 1 SER B 291 ? ? -120.84 -87.29  
19 1 LEU B 293 ? ? 63.18   -49.13  
20 1 MET B 354 ? ? -141.74 14.82   
21 1 GLU B 371 ? ? -99.97  -66.21  
22 1 MET B 377 ? ? -102.36 -80.40  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    -1 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    2 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            123.73 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ARG 20 ? A ARG 20 
2  1 Y 1 A THR 21 ? A THR 21 
3  1 Y 1 A MET 22 ? A MET 22 
4  1 Y 1 A THR 23 ? A THR 23 
5  1 Y 1 A ASP 24 ? A ASP 24 
6  1 Y 1 A ILE 25 ? A ILE 25 
7  1 Y 1 A LEU 26 ? A LEU 26 
8  1 Y 1 A SER 27 ? A SER 27 
9  1 Y 1 A ARG 28 ? A ARG 28 
10 1 Y 1 A GLY 29 ? A GLY 29 
11 1 Y 1 A PRO 30 ? A PRO 30 
12 1 Y 1 A LYS 31 ? A LYS 31 
13 1 Y 1 A SER 32 ? A SER 32 
14 1 Y 1 B ARG 20 ? B ARG 20 
15 1 Y 1 B THR 21 ? B THR 21 
16 1 Y 1 B MET 22 ? B MET 22 
17 1 Y 1 B THR 23 ? B THR 23 
18 1 Y 1 B ASP 24 ? B ASP 24 
19 1 Y 1 B ILE 25 ? B ILE 25 
20 1 Y 1 B LEU 26 ? B LEU 26 
21 1 Y 1 B SER 27 ? B SER 27 
22 1 Y 1 B ARG 28 ? B ARG 28 
23 1 Y 1 B GLY 29 ? B GLY 29 
24 1 Y 1 B PRO 30 ? B PRO 30 
25 1 Y 1 B LYS 31 ? B LYS 31 
26 1 Y 1 B SER 32 ? B SER 32 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(3S)-10-(4-AMINOPIPERAZIN-1-YL)-9-FLUORO-7-HYDROXY-3-METHYL-2,3-DIHYDRO-8H-[1,4]OXAZINO[2,3,4-IJ]QUINOLINE-6-CARBOXYLATE' BF5 
3 "PYRIDOXAL-5'-PHOSPHATE"                                                                                                   PLP 
4 'IODIDE ION'                                                                                                               IOD 
5 GLYCEROL                                                                                                                   GOL 
6 water                                                                                                                      HOH 
#