data_2XHC
# 
_entry.id   2XHC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XHC         
PDBE  EBI-44238    
WWPDB D_1290044238 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2XHA 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF DOMAIN 2 OF THERMOTOGA MARITIMA N-UTILIZATION SUBSTANCE G (NUSG)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XHC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stegmann, C.M.' 1 
'Wahl, M.C.'     2 
# 
_citation.id                        primary 
_citation.title                     'An Autoinhibited State in the Structure of Thermotoga Maritima Nusg.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            21 
_citation.page_first                365 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23415559 
_citation.pdbx_database_id_DOI      10.1016/J.STR.2012.12.015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Drogemuller, J.' 1  
primary 'Stegmann, C.M.'  2  
primary 'Mandal, A.'      3  
primary 'Steiner, T.'     4  
primary 'Burmann, B.M.'   5  
primary 'Gottesman, M.E.' 6  
primary 'Wohrl, B.M.'     7  
primary 'Rosch, P.'       8  
primary 'Wahl, M.C.'      9  
primary 'Schweimer, K.'   10 
# 
_cell.entry_id           2XHC 
_cell.length_a           59.750 
_cell.length_b           59.750 
_cell.length_c           310.135 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XHC 
_symmetry.space_group_name_H-M             'P 43 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                95 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TRANSCRIPTION ANTITERMINATION PROTEIN NUSG' 40263.934 1  ? ? ? ? 
2 water   nat water                                        18.015    27 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPEEVVLDATSPSERLILSPKAKLHVNNGKDVNKGDLIAEE
PPIYARRSGVIVDVKNVRKIVVETIDRKYTKTYYIPESAGIEPGLRVGTKVKQGLPLSKNEEYICELDGKIVEIERMKKV
VVQTPDGEQDVYYIPLDVFDRDRIKKGKEVKQGEMLAEARKFFAKVSGRVEVVDYSTRKEIRIYKTKRRKLFPGYVFVEM
IMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIK
EIDPERQELKVNVTIFGRETPVVLHVSEVEKI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPEEVVLDATSPSERLILSPKAKLHVNNGKDVNKGDLIAEE
PPIYARRSGVIVDVKNVRKIVVETIDRKYTKTYYIPESAGIEPGLRVGTKVKQGLPLSKNEEYICELDGKIVEIERMKKV
VVQTPDGEQDVYYIPLDVFDRDRIKKGKEVKQGEMLAEARKFFAKVSGRVEVVDYSTRKEIRIYKTKRRKLFPGYVFVEM
IMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIK
EIDPERQELKVNVTIFGRETPVVLHVSEVEKI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LYS n 
1 4   LYS n 
1 5   TRP n 
1 6   TYR n 
1 7   ILE n 
1 8   VAL n 
1 9   LEU n 
1 10  THR n 
1 11  MET n 
1 12  SER n 
1 13  GLY n 
1 14  TYR n 
1 15  GLU n 
1 16  GLU n 
1 17  LYS n 
1 18  VAL n 
1 19  LYS n 
1 20  GLU n 
1 21  ASN n 
1 22  ILE n 
1 23  GLU n 
1 24  LYS n 
1 25  LYS n 
1 26  VAL n 
1 27  GLU n 
1 28  ALA n 
1 29  THR n 
1 30  GLY n 
1 31  ILE n 
1 32  LYS n 
1 33  ASN n 
1 34  LEU n 
1 35  VAL n 
1 36  GLY n 
1 37  ARG n 
1 38  ILE n 
1 39  VAL n 
1 40  ILE n 
1 41  PRO n 
1 42  GLU n 
1 43  GLU n 
1 44  VAL n 
1 45  VAL n 
1 46  LEU n 
1 47  ASP n 
1 48  ALA n 
1 49  THR n 
1 50  SER n 
1 51  PRO n 
1 52  SER n 
1 53  GLU n 
1 54  ARG n 
1 55  LEU n 
1 56  ILE n 
1 57  LEU n 
1 58  SER n 
1 59  PRO n 
1 60  LYS n 
1 61  ALA n 
1 62  LYS n 
1 63  LEU n 
1 64  HIS n 
1 65  VAL n 
1 66  ASN n 
1 67  ASN n 
1 68  GLY n 
1 69  LYS n 
1 70  ASP n 
1 71  VAL n 
1 72  ASN n 
1 73  LYS n 
1 74  GLY n 
1 75  ASP n 
1 76  LEU n 
1 77  ILE n 
1 78  ALA n 
1 79  GLU n 
1 80  GLU n 
1 81  PRO n 
1 82  PRO n 
1 83  ILE n 
1 84  TYR n 
1 85  ALA n 
1 86  ARG n 
1 87  ARG n 
1 88  SER n 
1 89  GLY n 
1 90  VAL n 
1 91  ILE n 
1 92  VAL n 
1 93  ASP n 
1 94  VAL n 
1 95  LYS n 
1 96  ASN n 
1 97  VAL n 
1 98  ARG n 
1 99  LYS n 
1 100 ILE n 
1 101 VAL n 
1 102 VAL n 
1 103 GLU n 
1 104 THR n 
1 105 ILE n 
1 106 ASP n 
1 107 ARG n 
1 108 LYS n 
1 109 TYR n 
1 110 THR n 
1 111 LYS n 
1 112 THR n 
1 113 TYR n 
1 114 TYR n 
1 115 ILE n 
1 116 PRO n 
1 117 GLU n 
1 118 SER n 
1 119 ALA n 
1 120 GLY n 
1 121 ILE n 
1 122 GLU n 
1 123 PRO n 
1 124 GLY n 
1 125 LEU n 
1 126 ARG n 
1 127 VAL n 
1 128 GLY n 
1 129 THR n 
1 130 LYS n 
1 131 VAL n 
1 132 LYS n 
1 133 GLN n 
1 134 GLY n 
1 135 LEU n 
1 136 PRO n 
1 137 LEU n 
1 138 SER n 
1 139 LYS n 
1 140 ASN n 
1 141 GLU n 
1 142 GLU n 
1 143 TYR n 
1 144 ILE n 
1 145 CYS n 
1 146 GLU n 
1 147 LEU n 
1 148 ASP n 
1 149 GLY n 
1 150 LYS n 
1 151 ILE n 
1 152 VAL n 
1 153 GLU n 
1 154 ILE n 
1 155 GLU n 
1 156 ARG n 
1 157 MET n 
1 158 LYS n 
1 159 LYS n 
1 160 VAL n 
1 161 VAL n 
1 162 VAL n 
1 163 GLN n 
1 164 THR n 
1 165 PRO n 
1 166 ASP n 
1 167 GLY n 
1 168 GLU n 
1 169 GLN n 
1 170 ASP n 
1 171 VAL n 
1 172 TYR n 
1 173 TYR n 
1 174 ILE n 
1 175 PRO n 
1 176 LEU n 
1 177 ASP n 
1 178 VAL n 
1 179 PHE n 
1 180 ASP n 
1 181 ARG n 
1 182 ASP n 
1 183 ARG n 
1 184 ILE n 
1 185 LYS n 
1 186 LYS n 
1 187 GLY n 
1 188 LYS n 
1 189 GLU n 
1 190 VAL n 
1 191 LYS n 
1 192 GLN n 
1 193 GLY n 
1 194 GLU n 
1 195 MET n 
1 196 LEU n 
1 197 ALA n 
1 198 GLU n 
1 199 ALA n 
1 200 ARG n 
1 201 LYS n 
1 202 PHE n 
1 203 PHE n 
1 204 ALA n 
1 205 LYS n 
1 206 VAL n 
1 207 SER n 
1 208 GLY n 
1 209 ARG n 
1 210 VAL n 
1 211 GLU n 
1 212 VAL n 
1 213 VAL n 
1 214 ASP n 
1 215 TYR n 
1 216 SER n 
1 217 THR n 
1 218 ARG n 
1 219 LYS n 
1 220 GLU n 
1 221 ILE n 
1 222 ARG n 
1 223 ILE n 
1 224 TYR n 
1 225 LYS n 
1 226 THR n 
1 227 LYS n 
1 228 ARG n 
1 229 ARG n 
1 230 LYS n 
1 231 LEU n 
1 232 PHE n 
1 233 PRO n 
1 234 GLY n 
1 235 TYR n 
1 236 VAL n 
1 237 PHE n 
1 238 VAL n 
1 239 GLU n 
1 240 MET n 
1 241 ILE n 
1 242 MET n 
1 243 ASN n 
1 244 ASP n 
1 245 GLU n 
1 246 ALA n 
1 247 TYR n 
1 248 ASN n 
1 249 PHE n 
1 250 VAL n 
1 251 ARG n 
1 252 SER n 
1 253 VAL n 
1 254 PRO n 
1 255 TYR n 
1 256 VAL n 
1 257 MET n 
1 258 GLY n 
1 259 PHE n 
1 260 VAL n 
1 261 SER n 
1 262 SER n 
1 263 GLY n 
1 264 GLY n 
1 265 GLN n 
1 266 PRO n 
1 267 VAL n 
1 268 PRO n 
1 269 VAL n 
1 270 LYS n 
1 271 ASP n 
1 272 ARG n 
1 273 GLU n 
1 274 MET n 
1 275 ARG n 
1 276 PRO n 
1 277 ILE n 
1 278 LEU n 
1 279 ARG n 
1 280 LEU n 
1 281 ALA n 
1 282 GLY n 
1 283 LEU n 
1 284 GLU n 
1 285 GLU n 
1 286 TYR n 
1 287 GLU n 
1 288 GLU n 
1 289 LYS n 
1 290 LYS n 
1 291 LYS n 
1 292 PRO n 
1 293 VAL n 
1 294 LYS n 
1 295 VAL n 
1 296 GLU n 
1 297 LEU n 
1 298 GLY n 
1 299 PHE n 
1 300 LYS n 
1 301 VAL n 
1 302 GLY n 
1 303 ASP n 
1 304 MET n 
1 305 VAL n 
1 306 LYS n 
1 307 ILE n 
1 308 ILE n 
1 309 SER n 
1 310 GLY n 
1 311 PRO n 
1 312 PHE n 
1 313 GLU n 
1 314 ASP n 
1 315 PHE n 
1 316 ALA n 
1 317 GLY n 
1 318 VAL n 
1 319 ILE n 
1 320 LYS n 
1 321 GLU n 
1 322 ILE n 
1 323 ASP n 
1 324 PRO n 
1 325 GLU n 
1 326 ARG n 
1 327 GLN n 
1 328 GLU n 
1 329 LEU n 
1 330 LYS n 
1 331 VAL n 
1 332 ASN n 
1 333 VAL n 
1 334 THR n 
1 335 ILE n 
1 336 PHE n 
1 337 GLY n 
1 338 ARG n 
1 339 GLU n 
1 340 THR n 
1 341 PRO n 
1 342 VAL n 
1 343 VAL n 
1 344 LEU n 
1 345 HIS n 
1 346 VAL n 
1 347 SER n 
1 348 GLU n 
1 349 VAL n 
1 350 GLU n 
1 351 LYS n 
1 352 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'THERMOTOGA MARITIMA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NUSG_THEMA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P29397 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XHC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 352 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29397 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  352 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       352 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XHC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.61 
_exptl_crystal.density_percent_sol   66 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             1.05 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XHC 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   23437 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.60 
_reflns.B_iso_Wilson_estimate        56.1 
_reflns.pdbx_redundancy              4.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.57 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        4.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XHC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     20844 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.712 
_refine.ls_d_res_high                            2.450 
_refine.ls_percent_reflns_obs                    95.37 
_refine.ls_R_factor_obs                          0.2204 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2175 
_refine.ls_R_factor_R_free                       0.2767 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1059 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            4.6444 
_refine.aniso_B[2][2]                            4.6444 
_refine.aniso_B[3][3]                            -11.5511 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.377 
_refine.solvent_model_param_bsol                 67.430 
_refine.pdbx_solvent_vdw_probe_radii             0.80 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2XHA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.31 
_refine.pdbx_overall_phase_error                 24.82 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2736 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             27 
_refine_hist.number_atoms_total               2763 
_refine_hist.d_res_high                       2.450 
_refine_hist.d_res_low                        32.712 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 2782 'X-RAY DIFFRACTION' ? 
f_angle_d          1.036  ? ? 3744 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.013 ? ? 1099 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.067  ? ? 421  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 478  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.4501 2.5615  2237 0.2604 89.00 0.3402 . . 137 . . 
'X-RAY DIFFRACTION' . 2.5615 2.6965  2316 0.2547 92.00 0.3403 . . 123 . . 
'X-RAY DIFFRACTION' . 2.6965 2.8654  2359 0.2606 93.00 0.3182 . . 124 . . 
'X-RAY DIFFRACTION' . 2.8654 3.0865  2404 0.2510 95.00 0.3085 . . 131 . . 
'X-RAY DIFFRACTION' . 3.0865 3.3968  2496 0.2363 97.00 0.2888 . . 142 . . 
'X-RAY DIFFRACTION' . 3.3968 3.8876  2581 0.2154 99.00 0.2650 . . 123 . . 
'X-RAY DIFFRACTION' . 3.8876 4.8954  2613 0.1744 99.00 0.2384 . . 147 . . 
'X-RAY DIFFRACTION' . 4.8954 32.7152 2779 0.2081 98.00 0.2639 . . 132 . . 
# 
_struct.entry_id                  2XHC 
_struct.title                     'Crystal Structure of Thermotoga maritima N-utilization Substance G (NusG)' 
_struct.pdbx_descriptor           'TRANSCRIPTION ANTITERMINATION PROTEIN NUSG' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XHC 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR A 14  ? GLY A 30  ? TYR A 14  GLY A 30  1 ? 17 
HELX_P HELX_P2 2 SER A 118 ? GLY A 120 ? SER A 118 GLY A 120 5 ? 3  
HELX_P HELX_P3 3 ASP A 177 ? PHE A 179 ? ASP A 177 PHE A 179 5 ? 3  
HELX_P HELX_P4 4 ASN A 243 ? SER A 252 ? ASN A 243 SER A 252 1 ? 10 
HELX_P HELX_P5 5 LYS A 270 ? ALA A 281 ? LYS A 270 ALA A 281 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 35  ? VAL A 39  ? VAL A 35  VAL A 39  
AA 2 TYR A 235 ? MET A 240 ? TYR A 235 MET A 240 
AA 3 LYS A 4   ? LEU A 9   ? LYS A 4   LEU A 9   
AA 4 GLY A 258 ? PHE A 259 ? GLY A 258 PHE A 259 
AB 1 GLU A 42  ? LEU A 46  ? GLU A 42  LEU A 46  
AB 2 THR A 226 ? LYS A 230 ? THR A 226 LYS A 230 
AC 1 GLU A 53  ? LEU A 57  ? GLU A 53  LEU A 57  
AC 2 LYS A 219 ? TYR A 224 ? LYS A 219 TYR A 224 
AC 3 GLY A 208 ? ASP A 214 ? GLY A 208 ASP A 214 
AC 4 ASP A 70  ? VAL A 71  ? ASP A 70  VAL A 71  
AD 1 LYS A 62  ? LEU A 63  ? LYS A 62  LEU A 63  
AD 2 LEU A 76  ? GLU A 80  ? LEU A 76  GLU A 80  
AD 3 ARG A 200 ? PHE A 203 ? ARG A 200 PHE A 203 
AE 1 ILE A 83  ? TYR A 84  ? ILE A 83  TYR A 84  
AE 2 MET A 195 ? ALA A 197 ? MET A 195 ALA A 197 
AF 1 THR A 110 ? PRO A 116 ? THR A 110 PRO A 116 
AF 2 GLY A 89  ? GLU A 103 ? GLY A 89  GLU A 103 
AG 1 LYS A 130 ? VAL A 131 ? LYS A 130 VAL A 131 
AG 2 GLY A 149 ? GLN A 163 ? GLY A 149 GLN A 163 
AH 1 GLN A 169 ? PRO A 175 ? GLN A 169 PRO A 175 
AH 2 GLY A 149 ? GLN A 163 ? GLY A 149 GLN A 163 
AI 1 GLU A 189 ? VAL A 190 ? GLU A 189 VAL A 190 
AI 2 GLY A 89  ? GLU A 103 ? GLY A 89  GLU A 103 
AJ 1 ARG A 338 ? HIS A 345 ? ARG A 338 HIS A 345 
AJ 2 GLU A 328 ? ILE A 335 ? GLU A 328 ILE A 335 
AJ 3 ALA A 316 ? ASP A 323 ? ALA A 316 ASP A 323 
AJ 4 MET A 304 ? ILE A 307 ? MET A 304 ILE A 307 
AJ 5 VAL A 349 ? GLU A 350 ? VAL A 349 GLU A 350 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 39  ? N VAL A 39  O PHE A 237 ? O PHE A 237 
AA 2 3 N MET A 240 ? N MET A 240 O LYS A 4   ? O LYS A 4   
AA 3 4 N LEU A 9   ? N LEU A 9   O GLY A 258 ? O GLY A 258 
AB 1 2 N VAL A 45  ? N VAL A 45  O LYS A 227 ? O LYS A 227 
AC 1 2 N LEU A 57  ? N LEU A 57  O LYS A 219 ? O LYS A 219 
AC 2 3 N TYR A 224 ? N TYR A 224 O ARG A 209 ? O ARG A 209 
AC 3 4 N GLY A 208 ? N GLY A 208 O VAL A 71  ? O VAL A 71  
AD 1 2 N LYS A 62  ? N LYS A 62  O GLU A 79  ? O GLU A 79  
AD 2 3 N GLU A 80  ? N GLU A 80  O ARG A 200 ? O ARG A 200 
AE 1 2 O ILE A 83  ? O ILE A 83  N LEU A 196 ? N LEU A 196 
AF 1 2 N ILE A 115 ? N ILE A 115 O ARG A 98  ? O ARG A 98  
AG 1 2 N VAL A 131 ? N VAL A 131 O GLY A 149 ? O GLY A 149 
AH 1 2 N ILE A 174 ? N ILE A 174 O LYS A 158 ? O LYS A 158 
AI 1 2 N VAL A 190 ? N VAL A 190 O GLY A 89  ? O GLY A 89  
AJ 1 2 N LEU A 344 ? N LEU A 344 O LEU A 329 ? O LEU A 329 
AJ 2 3 N ASN A 332 ? N ASN A 332 O VAL A 318 ? O VAL A 318 
AJ 3 4 N GLY A 317 ? N GLY A 317 O VAL A 305 ? O VAL A 305 
AJ 4 5 N LYS A 306 ? N LYS A 306 O GLU A 350 ? O GLU A 350 
# 
_database_PDB_matrix.entry_id          2XHC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XHC 
_atom_sites.fract_transf_matrix[1][1]   0.016736 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016736 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003224 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 3   ? 7.078   45.552  44.342 1.00 83.13  ? 3    LYS A N   1 
ATOM   2    C CA  . LYS A 1 3   ? 6.622   46.625  43.471 1.00 79.55  ? 3    LYS A CA  1 
ATOM   3    C C   . LYS A 1 3   ? 7.563   46.784  42.274 1.00 73.87  ? 3    LYS A C   1 
ATOM   4    O O   . LYS A 1 3   ? 7.284   47.546  41.348 1.00 76.09  ? 3    LYS A O   1 
ATOM   5    C CB  . LYS A 1 3   ? 6.516   47.936  44.257 1.00 68.28  ? 3    LYS A CB  1 
ATOM   6    C CG  . LYS A 1 3   ? 5.311   48.793  43.878 1.00 78.01  ? 3    LYS A CG  1 
ATOM   7    C CD  . LYS A 1 3   ? 5.257   50.065  44.716 1.00 82.33  ? 3    LYS A CD  1 
ATOM   8    C CE  . LYS A 1 3   ? 5.249   49.734  46.205 1.00 85.98  ? 3    LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 3   ? 5.504   50.930  47.055 1.00 88.32  ? 3    LYS A NZ  1 
ATOM   10   N N   . LYS A 1 4   ? 8.683   46.066  42.301 1.00 66.09  ? 4    LYS A N   1 
ATOM   11   C CA  . LYS A 1 4   ? 9.653   46.122  41.209 1.00 62.49  ? 4    LYS A CA  1 
ATOM   12   C C   . LYS A 1 4   ? 10.350  44.791  40.943 1.00 62.73  ? 4    LYS A C   1 
ATOM   13   O O   . LYS A 1 4   ? 10.378  43.904  41.802 1.00 62.97  ? 4    LYS A O   1 
ATOM   14   C CB  . LYS A 1 4   ? 10.691  47.214  41.455 1.00 62.51  ? 4    LYS A CB  1 
ATOM   15   C CG  . LYS A 1 4   ? 10.159  48.608  41.204 1.00 75.26  ? 4    LYS A CG  1 
ATOM   16   C CD  . LYS A 1 4   ? 11.258  49.650  41.272 1.00 90.83  ? 4    LYS A CD  1 
ATOM   17   C CE  . LYS A 1 4   ? 10.697  51.038  40.962 1.00 108.93 ? 4    LYS A CE  1 
ATOM   18   N NZ  . LYS A 1 4   ? 11.674  52.140  41.207 1.00 113.90 ? 4    LYS A NZ  1 
ATOM   19   N N   . TRP A 1 5   ? 10.924  44.670  39.748 1.00 61.16  ? 5    TRP A N   1 
ATOM   20   C CA  . TRP A 1 5   ? 11.614  43.449  39.352 1.00 58.43  ? 5    TRP A CA  1 
ATOM   21   C C   . TRP A 1 5   ? 13.070  43.413  39.773 1.00 55.47  ? 5    TRP A C   1 
ATOM   22   O O   . TRP A 1 5   ? 13.804  44.394  39.642 1.00 59.93  ? 5    TRP A O   1 
ATOM   23   C CB  . TRP A 1 5   ? 11.472  43.203  37.844 1.00 60.54  ? 5    TRP A CB  1 
ATOM   24   C CG  . TRP A 1 5   ? 10.075  42.837  37.499 1.00 57.60  ? 5    TRP A CG  1 
ATOM   25   C CD1 . TRP A 1 5   ? 9.091   43.673  37.054 1.00 59.11  ? 5    TRP A CD1 1 
ATOM   26   C CD2 . TRP A 1 5   ? 9.480   41.538  37.620 1.00 57.11  ? 5    TRP A CD2 1 
ATOM   27   N NE1 . TRP A 1 5   ? 7.920   42.969  36.874 1.00 67.14  ? 5    TRP A NE1 1 
ATOM   28   C CE2 . TRP A 1 5   ? 8.132   41.658  37.212 1.00 63.85  ? 5    TRP A CE2 1 
ATOM   29   C CE3 . TRP A 1 5   ? 9.959   40.282  38.017 1.00 44.92  ? 5    TRP A CE3 1 
ATOM   30   C CZ2 . TRP A 1 5   ? 7.256   40.571  37.198 1.00 57.03  ? 5    TRP A CZ2 1 
ATOM   31   C CZ3 . TRP A 1 5   ? 9.089   39.202  38.005 1.00 43.75  ? 5    TRP A CZ3 1 
ATOM   32   C CH2 . TRP A 1 5   ? 7.750   39.355  37.601 1.00 54.38  ? 5    TRP A CH2 1 
ATOM   33   N N   . TYR A 1 6   ? 13.478  42.263  40.291 1.00 44.34  ? 6    TYR A N   1 
ATOM   34   C CA  . TYR A 1 6   ? 14.863  42.059  40.681 1.00 43.34  ? 6    TYR A CA  1 
ATOM   35   C C   . TYR A 1 6   ? 15.250  40.683  40.243 1.00 42.26  ? 6    TYR A C   1 
ATOM   36   O O   . TYR A 1 6   ? 14.403  39.793  40.156 1.00 49.34  ? 6    TYR A O   1 
ATOM   37   C CB  . TYR A 1 6   ? 15.039  42.191  42.207 1.00 48.92  ? 6    TYR A CB  1 
ATOM   38   C CG  . TYR A 1 6   ? 14.662  43.558  42.690 1.00 41.90  ? 6    TYR A CG  1 
ATOM   39   C CD1 . TYR A 1 6   ? 13.328  43.878  42.926 1.00 42.75  ? 6    TYR A CD1 1 
ATOM   40   C CD2 . TYR A 1 6   ? 15.626  44.554  42.851 1.00 39.09  ? 6    TYR A CD2 1 
ATOM   41   C CE1 . TYR A 1 6   ? 12.957  45.148  43.339 1.00 49.33  ? 6    TYR A CE1 1 
ATOM   42   C CE2 . TYR A 1 6   ? 15.261  45.834  43.263 1.00 53.21  ? 6    TYR A CE2 1 
ATOM   43   C CZ  . TYR A 1 6   ? 13.925  46.120  43.505 1.00 53.30  ? 6    TYR A CZ  1 
ATOM   44   O OH  . TYR A 1 6   ? 13.546  47.373  43.918 1.00 65.01  ? 6    TYR A OH  1 
ATOM   45   N N   . ILE A 1 7   ? 16.533  40.505  39.971 1.00 45.12  ? 7    ILE A N   1 
ATOM   46   C CA  . ILE A 1 7   ? 17.034  39.199  39.606 1.00 53.14  ? 7    ILE A CA  1 
ATOM   47   C C   . ILE A 1 7   ? 17.645  38.595  40.849 1.00 55.59  ? 7    ILE A C   1 
ATOM   48   O O   . ILE A 1 7   ? 18.464  39.217  41.526 1.00 51.14  ? 7    ILE A O   1 
ATOM   49   C CB  . ILE A 1 7   ? 18.092  39.270  38.491 1.00 52.35  ? 7    ILE A CB  1 
ATOM   50   C CG1 . ILE A 1 7   ? 17.551  40.029  37.278 1.00 52.11  ? 7    ILE A CG1 1 
ATOM   51   C CG2 . ILE A 1 7   ? 18.513  37.878  38.077 1.00 49.95  ? 7    ILE A CG2 1 
ATOM   52   C CD1 . ILE A 1 7   ? 18.589  40.252  36.181 1.00 39.91  ? 7    ILE A CD1 1 
ATOM   53   N N   . VAL A 1 8   ? 17.210  37.387  41.168 1.00 59.84  ? 8    VAL A N   1 
ATOM   54   C CA  . VAL A 1 8   ? 17.781  36.657  42.273 1.00 57.96  ? 8    VAL A CA  1 
ATOM   55   C C   . VAL A 1 8   ? 18.675  35.600  41.683 1.00 61.32  ? 8    VAL A C   1 
ATOM   56   O O   . VAL A 1 8   ? 18.278  34.888  40.759 1.00 68.27  ? 8    VAL A O   1 
ATOM   57   C CB  . VAL A 1 8   ? 16.696  35.988  43.129 1.00 54.09  ? 8    VAL A CB  1 
ATOM   58   C CG1 . VAL A 1 8   ? 17.321  35.011  44.103 1.00 43.99  ? 8    VAL A CG1 1 
ATOM   59   C CG2 . VAL A 1 8   ? 15.870  37.043  43.857 1.00 47.77  ? 8    VAL A CG2 1 
ATOM   60   N N   . LEU A 1 9   ? 19.888  35.512  42.214 1.00 60.29  ? 9    LEU A N   1 
ATOM   61   C CA  . LEU A 1 9   ? 20.865  34.544  41.746 1.00 58.90  ? 9    LEU A CA  1 
ATOM   62   C C   . LEU A 1 9   ? 20.728  33.212  42.467 1.00 57.49  ? 9    LEU A C   1 
ATOM   63   O O   . LEU A 1 9   ? 20.553  33.163  43.681 1.00 73.34  ? 9    LEU A O   1 
ATOM   64   C CB  . LEU A 1 9   ? 22.274  35.096  41.932 1.00 61.96  ? 9    LEU A CB  1 
ATOM   65   C CG  . LEU A 1 9   ? 22.482  36.466  41.293 1.00 65.41  ? 9    LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 9   ? 23.867  37.007  41.614 1.00 66.93  ? 9    LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 9   ? 22.274  36.368  39.792 1.00 58.90  ? 9    LEU A CD2 1 
ATOM   68   N N   . THR A 1 10  ? 20.798  32.133  41.698 1.00 53.42  ? 10   THR A N   1 
ATOM   69   C CA  . THR A 1 10  ? 20.760  30.779  42.221 1.00 49.25  ? 10   THR A CA  1 
ATOM   70   C C   . THR A 1 10  ? 21.833  30.000  41.484 1.00 59.41  ? 10   THR A C   1 
ATOM   71   O O   . THR A 1 10  ? 22.534  30.546  40.630 1.00 57.88  ? 10   THR A O   1 
ATOM   72   C CB  . THR A 1 10  ? 19.413  30.096  41.935 1.00 59.68  ? 10   THR A CB  1 
ATOM   73   O OG1 . THR A 1 10  ? 19.440  29.504  40.629 1.00 78.31  ? 10   THR A OG1 1 
ATOM   74   C CG2 . THR A 1 10  ? 18.280  31.094  41.998 1.00 58.32  ? 10   THR A CG2 1 
ATOM   75   N N   . MET A 1 11  ? 21.963  28.719  41.800 1.00 61.49  ? 11   MET A N   1 
ATOM   76   C CA  . MET A 1 11  ? 22.850  27.877  41.022 1.00 58.10  ? 11   MET A CA  1 
ATOM   77   C C   . MET A 1 11  ? 22.138  27.523  39.726 1.00 68.99  ? 11   MET A C   1 
ATOM   78   O O   . MET A 1 11  ? 20.917  27.342  39.712 1.00 65.13  ? 11   MET A O   1 
ATOM   79   C CB  . MET A 1 11  ? 23.223  26.614  41.795 1.00 68.62  ? 11   MET A CB  1 
ATOM   80   C CG  . MET A 1 11  ? 23.971  26.889  43.092 1.00 72.30  ? 11   MET A CG  1 
ATOM   81   S SD  . MET A 1 11  ? 24.829  25.437  43.726 1.00 91.49  ? 11   MET A SD  1 
ATOM   82   C CE  . MET A 1 11  ? 23.452  24.405  44.229 1.00 78.61  ? 11   MET A CE  1 
ATOM   83   N N   . SER A 1 12  ? 22.892  27.447  38.633 1.00 72.19  ? 12   SER A N   1 
ATOM   84   C CA  . SER A 1 12  ? 22.306  27.043  37.368 1.00 75.26  ? 12   SER A CA  1 
ATOM   85   C C   . SER A 1 12  ? 21.534  25.749  37.588 1.00 76.75  ? 12   SER A C   1 
ATOM   86   O O   . SER A 1 12  ? 22.062  24.783  38.149 1.00 80.19  ? 12   SER A O   1 
ATOM   87   C CB  . SER A 1 12  ? 23.377  26.867  36.287 1.00 83.87  ? 12   SER A CB  1 
ATOM   88   O OG  . SER A 1 12  ? 23.781  28.122  35.759 1.00 87.42  ? 12   SER A OG  1 
ATOM   89   N N   . GLY A 1 13  ? 20.270  25.751  37.176 1.00 67.73  ? 13   GLY A N   1 
ATOM   90   C CA  . GLY A 1 13  ? 19.422  24.583  37.310 1.00 65.48  ? 13   GLY A CA  1 
ATOM   91   C C   . GLY A 1 13  ? 18.693  24.426  38.633 1.00 64.83  ? 13   GLY A C   1 
ATOM   92   O O   . GLY A 1 13  ? 18.123  23.374  38.883 1.00 59.91  ? 13   GLY A O   1 
ATOM   93   N N   . TYR A 1 14  ? 18.699  25.455  39.479 1.00 74.34  ? 14   TYR A N   1 
ATOM   94   C CA  . TYR A 1 14  ? 17.996  25.394  40.766 1.00 74.45  ? 14   TYR A CA  1 
ATOM   95   C C   . TYR A 1 14  ? 16.864  26.410  40.854 1.00 70.49  ? 14   TYR A C   1 
ATOM   96   O O   . TYR A 1 14  ? 16.224  26.562  41.899 1.00 74.20  ? 14   TYR A O   1 
ATOM   97   C CB  . TYR A 1 14  ? 18.970  25.626  41.918 1.00 81.87  ? 14   TYR A CB  1 
ATOM   98   C CG  . TYR A 1 14  ? 19.842  24.438  42.205 1.00 93.55  ? 14   TYR A CG  1 
ATOM   99   C CD1 . TYR A 1 14  ? 19.520  23.547  43.224 1.00 96.21  ? 14   TYR A CD1 1 
ATOM   100  C CD2 . TYR A 1 14  ? 20.982  24.193  41.450 1.00 95.68  ? 14   TYR A CD2 1 
ATOM   101  C CE1 . TYR A 1 14  ? 20.317  22.450  43.488 1.00 96.81  ? 14   TYR A CE1 1 
ATOM   102  C CE2 . TYR A 1 14  ? 21.784  23.098  41.705 1.00 94.79  ? 14   TYR A CE2 1 
ATOM   103  C CZ  . TYR A 1 14  ? 21.447  22.231  42.725 1.00 96.19  ? 14   TYR A CZ  1 
ATOM   104  O OH  . TYR A 1 14  ? 22.245  21.141  42.981 1.00 99.20  ? 14   TYR A OH  1 
ATOM   105  N N   . GLU A 1 15  ? 16.635  27.105  39.747 1.00 56.85  ? 15   GLU A N   1 
ATOM   106  C CA  . GLU A 1 15  ? 15.679  28.203  39.683 1.00 62.38  ? 15   GLU A CA  1 
ATOM   107  C C   . GLU A 1 15  ? 14.310  27.813  40.230 1.00 61.86  ? 15   GLU A C   1 
ATOM   108  O O   . GLU A 1 15  ? 13.694  28.544  41.006 1.00 58.04  ? 15   GLU A O   1 
ATOM   109  C CB  . GLU A 1 15  ? 15.538  28.690  38.231 1.00 53.74  ? 15   GLU A CB  1 
ATOM   110  C CG  . GLU A 1 15  ? 16.871  28.961  37.531 1.00 57.18  ? 15   GLU A CG  1 
ATOM   111  C CD  . GLU A 1 15  ? 17.614  27.684  37.128 1.00 58.99  ? 15   GLU A CD  1 
ATOM   112  O OE1 . GLU A 1 15  ? 17.026  26.581  37.208 1.00 56.16  ? 15   GLU A OE1 1 
ATOM   113  O OE2 . GLU A 1 15  ? 18.793  27.784  36.732 1.00 58.66  ? 15   GLU A OE2 1 
ATOM   114  N N   . GLU A 1 16  ? 13.843  26.648  39.817 1.00 68.60  ? 16   GLU A N   1 
ATOM   115  C CA  . GLU A 1 16  ? 12.500  26.219  40.136 1.00 66.64  ? 16   GLU A CA  1 
ATOM   116  C C   . GLU A 1 16  ? 12.355  25.983  41.627 1.00 58.36  ? 16   GLU A C   1 
ATOM   117  O O   . GLU A 1 16  ? 11.294  26.233  42.195 1.00 58.48  ? 16   GLU A O   1 
ATOM   118  C CB  . GLU A 1 16  ? 12.162  24.944  39.361 1.00 72.36  ? 16   GLU A CB  1 
ATOM   119  C CG  . GLU A 1 16  ? 10.677  24.750  39.105 1.00 90.88  ? 16   GLU A CG  1 
ATOM   120  C CD  . GLU A 1 16  ? 10.117  25.735  38.086 1.00 103.77 ? 16   GLU A CD  1 
ATOM   121  O OE1 . GLU A 1 16  ? 10.524  25.672  36.901 1.00 107.50 ? 16   GLU A OE1 1 
ATOM   122  O OE2 . GLU A 1 16  ? 9.267   26.569  38.473 1.00 102.53 ? 16   GLU A OE2 1 
ATOM   123  N N   . LYS A 1 17  ? 13.415  25.487  42.256 1.00 63.93  ? 17   LYS A N   1 
ATOM   124  C CA  . LYS A 1 17  ? 13.383  25.221  43.697 1.00 73.17  ? 17   LYS A CA  1 
ATOM   125  C C   . LYS A 1 17  ? 13.279  26.524  44.473 1.00 58.61  ? 17   LYS A C   1 
ATOM   126  O O   . LYS A 1 17  ? 12.539  26.612  45.446 1.00 52.13  ? 17   LYS A O   1 
ATOM   127  C CB  . LYS A 1 17  ? 14.610  24.422  44.154 1.00 83.86  ? 17   LYS A CB  1 
ATOM   128  C CG  . LYS A 1 17  ? 14.538  22.937  43.811 1.00 98.47  ? 17   LYS A CG  1 
ATOM   129  C CD  . LYS A 1 17  ? 15.795  22.177  44.235 1.00 108.45 ? 17   LYS A CD  1 
ATOM   130  C CE  . LYS A 1 17  ? 15.671  20.687  43.906 1.00 114.07 ? 17   LYS A CE  1 
ATOM   131  N NZ  . LYS A 1 17  ? 16.916  19.912  44.184 1.00 116.71 ? 17   LYS A NZ  1 
ATOM   132  N N   . VAL A 1 18  ? 14.016  27.531  44.021 1.00 54.04  ? 18   VAL A N   1 
ATOM   133  C CA  . VAL A 1 18  ? 13.990  28.849  44.647 1.00 58.15  ? 18   VAL A CA  1 
ATOM   134  C C   . VAL A 1 18  ? 12.610  29.506  44.553 1.00 61.39  ? 18   VAL A C   1 
ATOM   135  O O   . VAL A 1 18  ? 12.171  30.173  45.486 1.00 72.66  ? 18   VAL A O   1 
ATOM   136  C CB  . VAL A 1 18  ? 15.059  29.782  44.046 1.00 49.88  ? 18   VAL A CB  1 
ATOM   137  C CG1 . VAL A 1 18  ? 14.905  31.170  44.593 1.00 52.96  ? 18   VAL A CG1 1 
ATOM   138  C CG2 . VAL A 1 18  ? 16.448  29.259  44.346 1.00 53.52  ? 18   VAL A CG2 1 
ATOM   139  N N   . LYS A 1 19  ? 11.919  29.308  43.440 1.00 55.78  ? 19   LYS A N   1 
ATOM   140  C CA  . LYS A 1 19  ? 10.591  29.887  43.280 1.00 62.28  ? 19   LYS A CA  1 
ATOM   141  C C   . LYS A 1 19  ? 9.618   29.217  44.230 1.00 59.15  ? 19   LYS A C   1 
ATOM   142  O O   . LYS A 1 19  ? 8.783   29.872  44.857 1.00 55.73  ? 19   LYS A O   1 
ATOM   143  C CB  . LYS A 1 19  ? 10.089  29.740  41.838 1.00 57.80  ? 19   LYS A CB  1 
ATOM   144  C CG  . LYS A 1 19  ? 8.673   30.269  41.625 1.00 52.39  ? 19   LYS A CG  1 
ATOM   145  C CD  . LYS A 1 19  ? 8.255   30.226  40.155 1.00 64.45  ? 19   LYS A CD  1 
ATOM   146  C CE  . LYS A 1 19  ? 6.820   30.731  39.992 1.00 72.29  ? 19   LYS A CE  1 
ATOM   147  N NZ  . LYS A 1 19  ? 6.295   30.612  38.602 1.00 69.32  ? 19   LYS A NZ  1 
ATOM   148  N N   . GLU A 1 20  ? 9.728   27.899  44.321 1.00 56.84  ? 20   GLU A N   1 
ATOM   149  C CA  . GLU A 1 20  ? 8.897   27.126  45.229 1.00 67.25  ? 20   GLU A CA  1 
ATOM   150  C C   . GLU A 1 20  ? 9.180   27.552  46.669 1.00 60.33  ? 20   GLU A C   1 
ATOM   151  O O   . GLU A 1 20  ? 8.273   27.890  47.415 1.00 60.71  ? 20   GLU A O   1 
ATOM   152  C CB  . GLU A 1 20  ? 9.174   25.631  45.052 1.00 86.41  ? 20   GLU A CB  1 
ATOM   153  C CG  . GLU A 1 20  ? 9.870   24.984  46.246 1.00 107.34 ? 20   GLU A CG  1 
ATOM   154  C CD  . GLU A 1 20  ? 10.464  23.621  45.930 1.00 120.06 ? 20   GLU A CD  1 
ATOM   155  O OE1 . GLU A 1 20  ? 11.096  23.027  46.831 1.00 119.24 ? 20   GLU A OE1 1 
ATOM   156  O OE2 . GLU A 1 20  ? 10.302  23.147  44.784 1.00 125.02 ? 20   GLU A OE2 1 
ATOM   157  N N   . ASN A 1 21  ? 10.450  27.553  47.047 1.00 55.13  ? 21   ASN A N   1 
ATOM   158  C CA  . ASN A 1 21  ? 10.828  27.900  48.399 1.00 62.16  ? 21   ASN A CA  1 
ATOM   159  C C   . ASN A 1 21  ? 10.259  29.247  48.790 1.00 70.92  ? 21   ASN A C   1 
ATOM   160  O O   . ASN A 1 21  ? 9.649   29.394  49.852 1.00 76.34  ? 21   ASN A O   1 
ATOM   161  C CB  . ASN A 1 21  ? 12.345  27.907  48.533 1.00 60.33  ? 21   ASN A CB  1 
ATOM   162  C CG  . ASN A 1 21  ? 12.920  26.519  48.541 1.00 57.74  ? 21   ASN A CG  1 
ATOM   163  O OD1 . ASN A 1 21  ? 12.204  25.554  48.797 1.00 45.38  ? 21   ASN A OD1 1 
ATOM   164  N ND2 . ASN A 1 21  ? 14.220  26.402  48.271 1.00 60.69  ? 21   ASN A ND2 1 
ATOM   165  N N   . ILE A 1 22  ? 10.449  30.226  47.914 1.00 61.99  ? 22   ILE A N   1 
ATOM   166  C CA  . ILE A 1 22  ? 9.987   31.576  48.177 1.00 56.28  ? 22   ILE A CA  1 
ATOM   167  C C   . ILE A 1 22  ? 8.487   31.585  48.366 1.00 61.01  ? 22   ILE A C   1 
ATOM   168  O O   . ILE A 1 22  ? 7.969   32.238  49.271 1.00 60.69  ? 22   ILE A O   1 
ATOM   169  C CB  . ILE A 1 22  ? 10.330  32.494  47.024 1.00 52.20  ? 22   ILE A CB  1 
ATOM   170  C CG1 . ILE A 1 22  ? 11.833  32.781  47.004 1.00 55.56  ? 22   ILE A CG1 1 
ATOM   171  C CG2 . ILE A 1 22  ? 9.546   33.767  47.129 1.00 48.69  ? 22   ILE A CG2 1 
ATOM   172  C CD1 . ILE A 1 22  ? 12.319  33.339  45.667 1.00 48.94  ? 22   ILE A CD1 1 
ATOM   173  N N   . GLU A 1 23  ? 7.794   30.848  47.506 1.00 64.55  ? 23   GLU A N   1 
ATOM   174  C CA  . GLU A 1 23  ? 6.342   30.770  47.565 1.00 67.14  ? 23   GLU A CA  1 
ATOM   175  C C   . GLU A 1 23  ? 5.890   30.113  48.861 1.00 67.94  ? 23   GLU A C   1 
ATOM   176  O O   . GLU A 1 23  ? 4.870   30.494  49.440 1.00 66.61  ? 23   GLU A O   1 
ATOM   177  C CB  . GLU A 1 23  ? 5.795   30.000  46.362 1.00 64.71  ? 23   GLU A CB  1 
ATOM   178  C CG  . GLU A 1 23  ? 6.012   30.698  45.025 1.00 70.52  ? 23   GLU A CG  1 
ATOM   179  C CD  . GLU A 1 23  ? 5.513   29.873  43.836 1.00 82.46  ? 23   GLU A CD  1 
ATOM   180  O OE1 . GLU A 1 23  ? 5.248   28.664  44.019 1.00 76.00  ? 23   GLU A OE1 1 
ATOM   181  O OE2 . GLU A 1 23  ? 5.390   30.434  42.718 1.00 85.88  ? 23   GLU A OE2 1 
ATOM   182  N N   . LYS A 1 24  ? 6.652   29.120  49.308 1.00 64.74  ? 24   LYS A N   1 
ATOM   183  C CA  . LYS A 1 24  ? 6.327   28.414  50.535 1.00 65.20  ? 24   LYS A CA  1 
ATOM   184  C C   . LYS A 1 24  ? 6.568   29.336  51.723 1.00 61.96  ? 24   LYS A C   1 
ATOM   185  O O   . LYS A 1 24  ? 5.693   29.508  52.575 1.00 62.80  ? 24   LYS A O   1 
ATOM   186  C CB  . LYS A 1 24  ? 7.160   27.134  50.681 1.00 65.12  ? 24   LYS A CB  1 
ATOM   187  C CG  . LYS A 1 24  ? 7.190   26.272  49.437 1.00 74.48  ? 24   LYS A CG  1 
ATOM   188  C CD  . LYS A 1 24  ? 7.533   24.820  49.743 1.00 80.22  ? 24   LYS A CD  1 
ATOM   189  C CE  . LYS A 1 24  ? 6.277   23.958  49.749 1.00 88.20  ? 24   LYS A CE  1 
ATOM   190  N NZ  . LYS A 1 24  ? 6.570   22.527  50.041 1.00 99.72  ? 24   LYS A NZ  1 
ATOM   191  N N   . LYS A 1 25  ? 7.755   29.929  51.778 1.00 55.59  ? 25   LYS A N   1 
ATOM   192  C CA  . LYS A 1 25  ? 8.078   30.845  52.867 1.00 57.72  ? 25   LYS A CA  1 
ATOM   193  C C   . LYS A 1 25  ? 6.977   31.886  53.047 1.00 63.58  ? 25   LYS A C   1 
ATOM   194  O O   . LYS A 1 25  ? 6.577   32.187  54.168 1.00 72.68  ? 25   LYS A O   1 
ATOM   195  C CB  . LYS A 1 25  ? 9.428   31.520  52.636 1.00 50.65  ? 25   LYS A CB  1 
ATOM   196  C CG  . LYS A 1 25  ? 9.850   32.439  53.763 1.00 47.77  ? 25   LYS A CG  1 
ATOM   197  C CD  . LYS A 1 25  ? 11.341  32.709  53.732 1.00 51.71  ? 25   LYS A CD  1 
ATOM   198  C CE  . LYS A 1 25  ? 11.726  33.753  54.749 1.00 52.53  ? 25   LYS A CE  1 
ATOM   199  N NZ  . LYS A 1 25  ? 13.179  34.030  54.697 1.00 54.36  ? 25   LYS A NZ  1 
ATOM   200  N N   . VAL A 1 26  ? 6.477   32.410  51.937 1.00 53.24  ? 26   VAL A N   1 
ATOM   201  C CA  . VAL A 1 26  ? 5.390   33.374  51.965 1.00 58.20  ? 26   VAL A CA  1 
ATOM   202  C C   . VAL A 1 26  ? 4.171   32.785  52.649 1.00 69.35  ? 26   VAL A C   1 
ATOM   203  O O   . VAL A 1 26  ? 3.438   33.488  53.351 1.00 78.82  ? 26   VAL A O   1 
ATOM   204  C CB  . VAL A 1 26  ? 4.974   33.780  50.538 1.00 56.01  ? 26   VAL A CB  1 
ATOM   205  C CG1 . VAL A 1 26  ? 3.677   34.593  50.573 1.00 48.18  ? 26   VAL A CG1 1 
ATOM   206  C CG2 . VAL A 1 26  ? 6.101   34.549  49.853 1.00 37.47  ? 26   VAL A CG2 1 
ATOM   207  N N   . GLU A 1 27  ? 3.959   31.490  52.434 1.00 58.09  ? 27   GLU A N   1 
ATOM   208  C CA  . GLU A 1 27  ? 2.795   30.800  52.968 1.00 68.14  ? 27   GLU A CA  1 
ATOM   209  C C   . GLU A 1 27  ? 2.971   30.440  54.440 1.00 65.55  ? 27   GLU A C   1 
ATOM   210  O O   . GLU A 1 27  ? 2.060   30.619  55.249 1.00 62.07  ? 27   GLU A O   1 
ATOM   211  C CB  . GLU A 1 27  ? 2.522   29.530  52.160 1.00 86.00  ? 27   GLU A CB  1 
ATOM   212  C CG  . GLU A 1 27  ? 1.349   28.719  52.673 1.00 103.00 ? 27   GLU A CG  1 
ATOM   213  C CD  . GLU A 1 27  ? 0.045   29.491  52.617 1.00 118.00 ? 27   GLU A CD  1 
ATOM   214  O OE1 . GLU A 1 27  ? -0.071  30.398  51.762 1.00 120.16 ? 27   GLU A OE1 1 
ATOM   215  O OE2 . GLU A 1 27  ? -0.862  29.194  53.428 1.00 123.61 ? 27   GLU A OE2 1 
ATOM   216  N N   . ALA A 1 28  ? 4.146   29.924  54.781 1.00 67.28  ? 28   ALA A N   1 
ATOM   217  C CA  . ALA A 1 28  ? 4.415   29.464  56.137 1.00 70.13  ? 28   ALA A CA  1 
ATOM   218  C C   . ALA A 1 28  ? 4.643   30.627  57.089 1.00 75.24  ? 28   ALA A C   1 
ATOM   219  O O   . ALA A 1 28  ? 4.891   30.427  58.281 1.00 84.67  ? 28   ALA A O   1 
ATOM   220  C CB  . ALA A 1 28  ? 5.624   28.559  56.145 1.00 66.90  ? 28   ALA A CB  1 
ATOM   221  N N   . THR A 1 29  ? 4.544   31.838  56.559 1.00 67.49  ? 29   THR A N   1 
ATOM   222  C CA  . THR A 1 29  ? 5.052   33.013  57.241 1.00 57.90  ? 29   THR A CA  1 
ATOM   223  C C   . THR A 1 29  ? 3.976   34.087  57.313 1.00 66.25  ? 29   THR A C   1 
ATOM   224  O O   . THR A 1 29  ? 3.962   34.913  58.230 1.00 69.21  ? 29   THR A O   1 
ATOM   225  C CB  . THR A 1 29  ? 6.290   33.536  56.490 1.00 63.35  ? 29   THR A CB  1 
ATOM   226  O OG1 . THR A 1 29  ? 7.360   33.752  57.406 1.00 58.60  ? 29   THR A OG1 1 
ATOM   227  C CG2 . THR A 1 29  ? 5.987   34.810  55.698 1.00 62.70  ? 29   THR A CG2 1 
ATOM   228  N N   . GLY A 1 30  ? 3.068   34.064  56.341 1.00 63.75  ? 30   GLY A N   1 
ATOM   229  C CA  . GLY A 1 30  ? 1.954   34.990  56.321 1.00 62.13  ? 30   GLY A CA  1 
ATOM   230  C C   . GLY A 1 30  ? 2.329   36.383  55.854 1.00 65.64  ? 30   GLY A C   1 
ATOM   231  O O   . GLY A 1 30  ? 1.489   37.287  55.828 1.00 69.01  ? 30   GLY A O   1 
ATOM   232  N N   . ILE A 1 31  ? 3.594   36.570  55.495 1.00 62.75  ? 31   ILE A N   1 
ATOM   233  C CA  . ILE A 1 31  ? 4.018   37.834  54.909 1.00 71.37  ? 31   ILE A CA  1 
ATOM   234  C C   . ILE A 1 31  ? 3.713   37.784  53.414 1.00 76.56  ? 31   ILE A C   1 
ATOM   235  O O   . ILE A 1 31  ? 4.404   37.107  52.645 1.00 78.23  ? 31   ILE A O   1 
ATOM   236  C CB  . ILE A 1 31  ? 5.504   38.113  55.169 1.00 70.60  ? 31   ILE A CB  1 
ATOM   237  C CG1 . ILE A 1 31  ? 5.795   38.045  56.676 1.00 70.84  ? 31   ILE A CG1 1 
ATOM   238  C CG2 . ILE A 1 31  ? 5.874   39.475  54.643 1.00 72.97  ? 31   ILE A CG2 1 
ATOM   239  C CD1 . ILE A 1 31  ? 7.264   37.881  57.029 1.00 62.80  ? 31   ILE A CD1 1 
ATOM   240  N N   . LYS A 1 32  ? 2.656   38.484  53.014 1.00 80.25  ? 32   LYS A N   1 
ATOM   241  C CA  . LYS A 1 32  ? 2.127   38.355  51.659 1.00 96.01  ? 32   LYS A CA  1 
ATOM   242  C C   . LYS A 1 32  ? 2.176   39.681  50.906 1.00 94.31  ? 32   LYS A C   1 
ATOM   243  O O   . LYS A 1 32  ? 1.660   39.801  49.794 1.00 95.62  ? 32   LYS A O   1 
ATOM   244  C CB  . LYS A 1 32  ? 0.689   37.828  51.702 1.00 104.81 ? 32   LYS A CB  1 
ATOM   245  C CG  . LYS A 1 32  ? -0.357  38.887  52.028 1.00 116.60 ? 32   LYS A CG  1 
ATOM   246  C CD  . LYS A 1 32  ? -0.067  39.615  53.340 1.00 118.88 ? 32   LYS A CD  1 
ATOM   247  C CE  . LYS A 1 32  ? -1.046  40.766  53.567 1.00 123.33 ? 32   LYS A CE  1 
ATOM   248  N NZ  . LYS A 1 32  ? -0.930  41.357  54.935 1.00 126.26 ? 32   LYS A NZ  1 
ATOM   249  N N   . ASN A 1 33  ? 2.804   40.672  51.524 1.00 88.85  ? 33   ASN A N   1 
ATOM   250  C CA  . ASN A 1 33  ? 2.865   42.015  50.969 1.00 78.96  ? 33   ASN A CA  1 
ATOM   251  C C   . ASN A 1 33  ? 4.216   42.335  50.331 1.00 64.44  ? 33   ASN A C   1 
ATOM   252  O O   . ASN A 1 33  ? 4.405   43.420  49.790 1.00 60.24  ? 33   ASN A O   1 
ATOM   253  C CB  . ASN A 1 33  ? 2.574   43.031  52.078 1.00 76.89  ? 33   ASN A CB  1 
ATOM   254  C CG  . ASN A 1 33  ? 3.353   42.736  53.359 1.00 83.23  ? 33   ASN A CG  1 
ATOM   255  O OD1 . ASN A 1 33  ? 2.969   41.867  54.145 1.00 97.10  ? 33   ASN A OD1 1 
ATOM   256  N ND2 . ASN A 1 33  ? 4.449   43.461  53.573 1.00 70.75  ? 33   ASN A ND2 1 
ATOM   257  N N   . LEU A 1 34  ? 5.162   41.404  50.419 1.00 57.23  ? 34   LEU A N   1 
ATOM   258  C CA  . LEU A 1 34  ? 6.517   41.676  49.952 1.00 57.53  ? 34   LEU A CA  1 
ATOM   259  C C   . LEU A 1 34  ? 6.699   41.226  48.513 1.00 68.00  ? 34   LEU A C   1 
ATOM   260  O O   . LEU A 1 34  ? 7.063   42.013  47.640 1.00 70.16  ? 34   LEU A O   1 
ATOM   261  C CB  . LEU A 1 34  ? 7.555   40.979  50.830 1.00 42.90  ? 34   LEU A CB  1 
ATOM   262  C CG  . LEU A 1 34  ? 7.586   41.358  52.315 1.00 58.65  ? 34   LEU A CG  1 
ATOM   263  C CD1 . LEU A 1 34  ? 8.708   40.619  53.041 1.00 61.80  ? 34   LEU A CD1 1 
ATOM   264  C CD2 . LEU A 1 34  ? 7.733   42.858  52.482 1.00 55.17  ? 34   LEU A CD2 1 
ATOM   265  N N   . VAL A 1 35  ? 6.444   39.948  48.277 1.00 67.31  ? 35   VAL A N   1 
ATOM   266  C CA  . VAL A 1 35  ? 6.703   39.365  46.982 1.00 64.12  ? 35   VAL A CA  1 
ATOM   267  C C   . VAL A 1 35  ? 5.433   39.266  46.158 1.00 67.67  ? 35   VAL A C   1 
ATOM   268  O O   . VAL A 1 35  ? 4.391   38.830  46.649 1.00 71.94  ? 35   VAL A O   1 
ATOM   269  C CB  . VAL A 1 35  ? 7.310   37.980  47.126 1.00 58.72  ? 35   VAL A CB  1 
ATOM   270  C CG1 . VAL A 1 35  ? 7.726   37.453  45.753 1.00 64.85  ? 35   VAL A CG1 1 
ATOM   271  C CG2 . VAL A 1 35  ? 8.495   38.035  48.075 1.00 46.99  ? 35   VAL A CG2 1 
ATOM   272  N N   . GLY A 1 36  ? 5.530   39.691  44.904 1.00 59.00  ? 36   GLY A N   1 
ATOM   273  C CA  . GLY A 1 36  ? 4.451   39.529  43.956 1.00 64.24  ? 36   GLY A CA  1 
ATOM   274  C C   . GLY A 1 36  ? 4.735   38.360  43.033 1.00 66.17  ? 36   GLY A C   1 
ATOM   275  O O   . GLY A 1 36  ? 4.859   37.215  43.484 1.00 69.85  ? 36   GLY A O   1 
ATOM   276  N N   . ARG A 1 37  ? 4.856   38.651  41.741 1.00 62.62  ? 37   ARG A N   1 
ATOM   277  C CA  . ARG A 1 37  ? 5.075   37.620  40.735 1.00 56.61  ? 37   ARG A CA  1 
ATOM   278  C C   . ARG A 1 37  ? 6.531   37.175  40.653 1.00 58.06  ? 37   ARG A C   1 
ATOM   279  O O   . ARG A 1 37  ? 7.459   37.955  40.912 1.00 55.21  ? 37   ARG A O   1 
ATOM   280  C CB  . ARG A 1 37  ? 4.598   38.107  39.370 1.00 64.47  ? 37   ARG A CB  1 
ATOM   281  C CG  . ARG A 1 37  ? 3.089   38.138  39.236 1.00 66.54  ? 37   ARG A CG  1 
ATOM   282  C CD  . ARG A 1 37  ? 2.660   38.859  37.967 1.00 62.49  ? 37   ARG A CD  1 
ATOM   283  N NE  . ARG A 1 37  ? 3.182   40.221  37.925 1.00 65.08  ? 37   ARG A NE  1 
ATOM   284  C CZ  . ARG A 1 37  ? 2.879   41.110  36.984 1.00 78.33  ? 37   ARG A CZ  1 
ATOM   285  N NH1 . ARG A 1 37  ? 2.053   40.782  35.996 1.00 86.33  ? 37   ARG A NH1 1 
ATOM   286  N NH2 . ARG A 1 37  ? 3.404   42.328  37.026 1.00 76.66  ? 37   ARG A NH2 1 
ATOM   287  N N   . ILE A 1 38  ? 6.717   35.909  40.294 1.00 52.75  ? 38   ILE A N   1 
ATOM   288  C CA  . ILE A 1 38  ? 8.045   35.335  40.140 1.00 54.72  ? 38   ILE A CA  1 
ATOM   289  C C   . ILE A 1 38  ? 8.126   34.592  38.816 1.00 63.69  ? 38   ILE A C   1 
ATOM   290  O O   . ILE A 1 38  ? 7.336   33.681  38.558 1.00 65.90  ? 38   ILE A O   1 
ATOM   291  C CB  . ILE A 1 38  ? 8.372   34.344  41.263 1.00 52.78  ? 38   ILE A CB  1 
ATOM   292  C CG1 . ILE A 1 38  ? 8.209   35.017  42.629 1.00 54.46  ? 38   ILE A CG1 1 
ATOM   293  C CG2 . ILE A 1 38  ? 9.785   33.791  41.082 1.00 44.46  ? 38   ILE A CG2 1 
ATOM   294  C CD1 . ILE A 1 38  ? 8.258   34.055  43.793 1.00 48.27  ? 38   ILE A CD1 1 
ATOM   295  N N   . VAL A 1 39  ? 9.099   34.972  37.994 1.00 52.74  ? 39   VAL A N   1 
ATOM   296  C CA  . VAL A 1 39  ? 9.214   34.459  36.644 1.00 55.91  ? 39   VAL A CA  1 
ATOM   297  C C   . VAL A 1 39  ? 10.571  33.799  36.346 1.00 58.75  ? 39   VAL A C   1 
ATOM   298  O O   . VAL A 1 39  ? 11.638  34.345  36.652 1.00 55.74  ? 39   VAL A O   1 
ATOM   299  C CB  . VAL A 1 39  ? 8.959   35.576  35.614 1.00 54.50  ? 39   VAL A CB  1 
ATOM   300  C CG1 . VAL A 1 39  ? 9.305   35.100  34.206 1.00 52.19  ? 39   VAL A CG1 1 
ATOM   301  C CG2 . VAL A 1 39  ? 7.526   36.030  35.683 1.00 55.53  ? 39   VAL A CG2 1 
ATOM   302  N N   . ILE A 1 40  ? 10.504  32.621  35.734 1.00 45.75  ? 40   ILE A N   1 
ATOM   303  C CA  . ILE A 1 40  ? 11.678  31.921  35.258 1.00 46.47  ? 40   ILE A CA  1 
ATOM   304  C C   . ILE A 1 40  ? 11.587  31.810  33.722 1.00 57.93  ? 40   ILE A C   1 
ATOM   305  O O   . ILE A 1 40  ? 10.960  30.892  33.179 1.00 48.56  ? 40   ILE A O   1 
ATOM   306  C CB  . ILE A 1 40  ? 11.799  30.566  35.956 1.00 39.90  ? 40   ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 40  ? 11.981  30.800  37.466 1.00 59.42  ? 40   ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 40  ? 12.962  29.770  35.394 1.00 42.44  ? 40   ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 40  ? 12.055  29.544  38.320 1.00 50.36  ? 40   ILE A CD1 1 
ATOM   310  N N   . PRO A 1 41  ? 12.199  32.780  33.022 1.00 64.83  ? 41   PRO A N   1 
ATOM   311  C CA  . PRO A 1 41  ? 12.035  32.951  31.575 1.00 58.72  ? 41   PRO A CA  1 
ATOM   312  C C   . PRO A 1 41  ? 12.406  31.698  30.823 1.00 53.18  ? 41   PRO A C   1 
ATOM   313  O O   . PRO A 1 41  ? 13.579  31.351  30.736 1.00 54.98  ? 41   PRO A O   1 
ATOM   314  C CB  . PRO A 1 41  ? 13.023  34.073  31.240 1.00 61.68  ? 41   PRO A CB  1 
ATOM   315  C CG  . PRO A 1 41  ? 13.154  34.839  32.523 1.00 64.56  ? 41   PRO A CG  1 
ATOM   316  C CD  . PRO A 1 41  ? 13.098  33.797  33.598 1.00 60.57  ? 41   PRO A CD  1 
ATOM   317  N N   . GLU A 1 42  ? 11.408  31.017  30.281 1.00 55.00  ? 42   GLU A N   1 
ATOM   318  C CA  . GLU A 1 42  ? 11.686  29.857  29.466 1.00 62.80  ? 42   GLU A CA  1 
ATOM   319  C C   . GLU A 1 42  ? 11.310  30.125  28.020 1.00 60.57  ? 42   GLU A C   1 
ATOM   320  O O   . GLU A 1 42  ? 10.470  30.973  27.728 1.00 65.09  ? 42   GLU A O   1 
ATOM   321  C CB  . GLU A 1 42  ? 10.977  28.627  30.015 1.00 68.24  ? 42   GLU A CB  1 
ATOM   322  C CG  . GLU A 1 42  ? 11.511  28.205  31.361 1.00 75.06  ? 42   GLU A CG  1 
ATOM   323  C CD  . GLU A 1 42  ? 11.465  26.714  31.544 1.00 88.64  ? 42   GLU A CD  1 
ATOM   324  O OE1 . GLU A 1 42  ? 12.316  26.015  30.951 1.00 89.16  ? 42   GLU A OE1 1 
ATOM   325  O OE2 . GLU A 1 42  ? 10.570  26.240  32.270 1.00 98.49  ? 42   GLU A OE2 1 
ATOM   326  N N   . GLU A 1 43  ? 11.968  29.420  27.116 1.00 73.79  ? 43   GLU A N   1 
ATOM   327  C CA  . GLU A 1 43  ? 11.688  29.555  25.702 1.00 77.32  ? 43   GLU A CA  1 
ATOM   328  C C   . GLU A 1 43  ? 11.110  28.227  25.274 1.00 79.30  ? 43   GLU A C   1 
ATOM   329  O O   . GLU A 1 43  ? 11.694  27.176  25.534 1.00 84.46  ? 43   GLU A O   1 
ATOM   330  C CB  . GLU A 1 43  ? 12.973  29.871  24.926 1.00 85.33  ? 43   GLU A CB  1 
ATOM   331  C CG  . GLU A 1 43  ? 12.737  30.352  23.498 1.00 99.13  ? 43   GLU A CG  1 
ATOM   332  C CD  . GLU A 1 43  ? 14.027  30.701  22.760 1.00 110.33 ? 43   GLU A CD  1 
ATOM   333  O OE1 . GLU A 1 43  ? 15.087  30.106  23.061 1.00 113.15 ? 43   GLU A OE1 1 
ATOM   334  O OE2 . GLU A 1 43  ? 13.979  31.581  21.875 1.00 109.56 ? 43   GLU A OE2 1 
ATOM   335  N N   . VAL A 1 44  ? 9.943   28.261  24.652 1.00 77.13  ? 44   VAL A N   1 
ATOM   336  C CA  . VAL A 1 44  ? 9.321   27.024  24.225 1.00 83.81  ? 44   VAL A CA  1 
ATOM   337  C C   . VAL A 1 44  ? 9.676   26.737  22.775 1.00 89.73  ? 44   VAL A C   1 
ATOM   338  O O   . VAL A 1 44  ? 9.262   27.454  21.866 1.00 91.63  ? 44   VAL A O   1 
ATOM   339  C CB  . VAL A 1 44  ? 7.794   27.044  24.444 1.00 92.34  ? 44   VAL A CB  1 
ATOM   340  C CG1 . VAL A 1 44  ? 7.493   27.263  25.918 1.00 93.35  ? 44   VAL A CG1 1 
ATOM   341  C CG2 . VAL A 1 44  ? 7.137   28.129  23.610 1.00 99.68  ? 44   VAL A CG2 1 
ATOM   342  N N   . VAL A 1 45  ? 10.464  25.690  22.569 1.00 88.92  ? 45   VAL A N   1 
ATOM   343  C CA  . VAL A 1 45  ? 10.893  25.321  21.230 1.00 90.78  ? 45   VAL A CA  1 
ATOM   344  C C   . VAL A 1 45  ? 10.120  24.106  20.730 1.00 90.65  ? 45   VAL A C   1 
ATOM   345  O O   . VAL A 1 45  ? 9.562   23.345  21.518 1.00 92.89  ? 45   VAL A O   1 
ATOM   346  C CB  . VAL A 1 45  ? 12.395  25.009  21.203 1.00 91.56  ? 45   VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 45  ? 13.135  25.900  22.205 1.00 97.27  ? 45   VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 45  ? 12.636  23.534  21.497 1.00 88.30  ? 45   VAL A CG2 1 
ATOM   349  N N   . LEU A 1 46  ? 10.076  23.932  19.415 1.00 84.69  ? 46   LEU A N   1 
ATOM   350  C CA  . LEU A 1 46  ? 9.482   22.741  18.834 1.00 79.00  ? 46   LEU A CA  1 
ATOM   351  C C   . LEU A 1 46  ? 10.345  21.522  19.141 1.00 83.87  ? 46   LEU A C   1 
ATOM   352  O O   . LEU A 1 46  ? 11.570  21.613  19.187 1.00 91.15  ? 46   LEU A O   1 
ATOM   353  C CB  . LEU A 1 46  ? 9.336   22.901  17.328 1.00 78.52  ? 46   LEU A CB  1 
ATOM   354  C CG  . LEU A 1 46  ? 8.588   21.751  16.661 1.00 86.88  ? 46   LEU A CG  1 
ATOM   355  C CD1 . LEU A 1 46  ? 7.148   21.718  17.164 1.00 83.02  ? 46   LEU A CD1 1 
ATOM   356  C CD2 . LEU A 1 46  ? 8.645   21.870  15.139 1.00 92.10  ? 46   LEU A CD2 1 
ATOM   357  N N   . ASP A 1 47  ? 9.703   20.377  19.341 1.00 90.40  ? 47   ASP A N   1 
ATOM   358  C CA  . ASP A 1 47  ? 10.420  19.168  19.723 1.00 96.14  ? 47   ASP A CA  1 
ATOM   359  C C   . ASP A 1 47  ? 9.741   17.927  19.145 1.00 96.88  ? 47   ASP A C   1 
ATOM   360  O O   . ASP A 1 47  ? 9.842   16.833  19.699 1.00 101.67 ? 47   ASP A O   1 
ATOM   361  C CB  . ASP A 1 47  ? 10.508  19.078  21.253 1.00 102.67 ? 47   ASP A CB  1 
ATOM   362  C CG  . ASP A 1 47  ? 11.326  17.891  21.729 1.00 105.90 ? 47   ASP A CG  1 
ATOM   363  O OD1 . ASP A 1 47  ? 10.723  16.933  22.258 1.00 102.37 ? 47   ASP A OD1 1 
ATOM   364  O OD2 . ASP A 1 47  ? 12.568  17.918  21.577 1.00 108.82 ? 47   ASP A OD2 1 
ATOM   365  N N   . ALA A 1 48  ? 9.052   18.098  18.025 1.00 92.08  ? 48   ALA A N   1 
ATOM   366  C CA  . ALA A 1 48  ? 8.310   16.993  17.436 1.00 87.02  ? 48   ALA A CA  1 
ATOM   367  C C   . ALA A 1 48  ? 8.476   16.955  15.931 1.00 91.15  ? 48   ALA A C   1 
ATOM   368  O O   . ALA A 1 48  ? 8.334   17.970  15.252 1.00 90.78  ? 48   ALA A O   1 
ATOM   369  C CB  . ALA A 1 48  ? 6.835   17.080  17.805 1.00 87.87  ? 48   ALA A CB  1 
ATOM   370  N N   . THR A 1 49  ? 8.772   15.770  15.416 1.00 98.60  ? 49   THR A N   1 
ATOM   371  C CA  . THR A 1 49  ? 8.966   15.587  13.992 1.00 111.49 ? 49   THR A CA  1 
ATOM   372  C C   . THR A 1 49  ? 7.614   15.539  13.283 1.00 113.07 ? 49   THR A C   1 
ATOM   373  O O   . THR A 1 49  ? 7.542   15.646  12.061 1.00 120.96 ? 49   THR A O   1 
ATOM   374  C CB  . THR A 1 49  ? 9.761   14.300  13.711 1.00 113.21 ? 49   THR A CB  1 
ATOM   375  O OG1 . THR A 1 49  ? 9.041   13.176  14.239 1.00 120.34 ? 49   THR A OG1 1 
ATOM   376  C CG2 . THR A 1 49  ? 11.149  14.375  14.368 1.00 94.24  ? 49   THR A CG2 1 
ATOM   377  N N   . SER A 1 50  ? 6.547   15.390  14.062 1.00 103.52 ? 50   SER A N   1 
ATOM   378  C CA  . SER A 1 50  ? 5.195   15.293  13.516 1.00 97.13  ? 50   SER A CA  1 
ATOM   379  C C   . SER A 1 50  ? 4.139   15.386  14.633 1.00 87.68  ? 50   SER A C   1 
ATOM   380  O O   . SER A 1 50  ? 4.458   15.154  15.799 1.00 78.74  ? 50   SER A O   1 
ATOM   381  C CB  . SER A 1 50  ? 5.047   13.993  12.721 1.00 100.58 ? 50   SER A CB  1 
ATOM   382  O OG  . SER A 1 50  ? 5.471   12.878  13.484 1.00 105.22 ? 50   SER A OG  1 
ATOM   383  N N   . PRO A 1 51  ? 2.878   15.711  14.272 1.00 81.74  ? 51   PRO A N   1 
ATOM   384  C CA  . PRO A 1 51  ? 1.774   15.998  15.205 1.00 83.87  ? 51   PRO A CA  1 
ATOM   385  C C   . PRO A 1 51  ? 1.570   14.949  16.288 1.00 76.14  ? 51   PRO A C   1 
ATOM   386  O O   . PRO A 1 51  ? 1.804   13.767  16.058 1.00 78.16  ? 51   PRO A O   1 
ATOM   387  C CB  . PRO A 1 51  ? 0.538   16.006  14.295 1.00 75.80  ? 51   PRO A CB  1 
ATOM   388  C CG  . PRO A 1 51  ? 1.058   16.359  12.968 1.00 77.62  ? 51   PRO A CG  1 
ATOM   389  C CD  . PRO A 1 51  ? 2.419   15.738  12.873 1.00 76.69  ? 51   PRO A CD  1 
ATOM   390  N N   . SER A 1 52  ? 1.113   15.385  17.456 1.00 71.26  ? 52   SER A N   1 
ATOM   391  C CA  . SER A 1 52  ? 0.778   14.457  18.523 1.00 69.53  ? 52   SER A CA  1 
ATOM   392  C C   . SER A 1 52  ? -0.728  14.396  18.615 1.00 76.66  ? 52   SER A C   1 
ATOM   393  O O   . SER A 1 52  ? -1.299  13.481  19.203 1.00 86.68  ? 52   SER A O   1 
ATOM   394  C CB  . SER A 1 52  ? 1.403   14.899  19.837 1.00 74.93  ? 52   SER A CB  1 
ATOM   395  O OG  . SER A 1 52  ? 2.811   14.933  19.696 1.00 81.76  ? 52   SER A OG  1 
ATOM   396  N N   . GLU A 1 53  ? -1.367  15.396  18.026 1.00 68.53  ? 53   GLU A N   1 
ATOM   397  C CA  . GLU A 1 53  ? -2.765  15.294  17.688 1.00 56.28  ? 53   GLU A CA  1 
ATOM   398  C C   . GLU A 1 53  ? -3.003  15.957  16.351 1.00 60.51  ? 53   GLU A C   1 
ATOM   399  O O   . GLU A 1 53  ? -2.413  16.989  16.043 1.00 56.72  ? 53   GLU A O   1 
ATOM   400  C CB  . GLU A 1 53  ? -3.682  15.940  18.730 1.00 53.04  ? 53   GLU A CB  1 
ATOM   401  C CG  . GLU A 1 53  ? -5.086  16.187  18.152 1.00 53.48  ? 53   GLU A CG  1 
ATOM   402  C CD  . GLU A 1 53  ? -6.111  16.703  19.160 1.00 63.99  ? 53   GLU A CD  1 
ATOM   403  O OE1 . GLU A 1 53  ? -5.714  17.287  20.203 1.00 54.37  ? 53   GLU A OE1 1 
ATOM   404  O OE2 . GLU A 1 53  ? -7.321  16.533  18.880 1.00 55.11  ? 53   GLU A OE2 1 
ATOM   405  N N   . ARG A 1 54  ? -3.890  15.359  15.567 1.00 65.38  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? -4.343  15.962  14.332 1.00 71.92  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? -5.853  15.920  14.340 1.00 63.76  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? -6.453  14.863  14.176 1.00 69.66  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? -3.809  15.195  13.127 1.00 71.29  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? -4.217  15.797  11.805 1.00 76.31  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? -3.811  14.892  10.657 1.00 86.49  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? -3.620  15.647  9.426  1.00 89.97  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? -3.468  15.093  8.228  1.00 89.89  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? -3.482  13.772  8.095  1.00 79.12  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? -3.305  15.861  7.160  1.00 94.78  ? 54   ARG A NH2 1 
ATOM   416  N N   . LEU A 1 55  ? -6.472  17.070  14.551 1.00 55.76  ? 55   LEU A N   1 
ATOM   417  C CA  . LEU A 1 55  ? -7.922  17.120  14.593 1.00 58.61  ? 55   LEU A CA  1 
ATOM   418  C C   . LEU A 1 55  ? -8.396  17.642  13.254 1.00 61.15  ? 55   LEU A C   1 
ATOM   419  O O   . LEU A 1 55  ? -7.907  18.673  12.783 1.00 56.42  ? 55   LEU A O   1 
ATOM   420  C CB  . LEU A 1 55  ? -8.406  18.032  15.721 1.00 50.16  ? 55   LEU A CB  1 
ATOM   421  C CG  . LEU A 1 55  ? -9.916  18.070  15.945 1.00 58.12  ? 55   LEU A CG  1 
ATOM   422  C CD1 . LEU A 1 55  ? -10.428 16.727  16.487 1.00 44.28  ? 55   LEU A CD1 1 
ATOM   423  C CD2 . LEU A 1 55  ? -10.292 19.216  16.876 1.00 59.76  ? 55   LEU A CD2 1 
ATOM   424  N N   . ILE A 1 56  ? -9.322  16.915  12.634 1.00 59.58  ? 56   ILE A N   1 
ATOM   425  C CA  . ILE A 1 56  ? -9.912  17.339  11.369 1.00 60.34  ? 56   ILE A CA  1 
ATOM   426  C C   . ILE A 1 56  ? -11.310 17.900  11.608 1.00 59.60  ? 56   ILE A C   1 
ATOM   427  O O   . ILE A 1 56  ? -12.108 17.317  12.341 1.00 62.49  ? 56   ILE A O   1 
ATOM   428  C CB  . ILE A 1 56  ? -9.953  16.198  10.319 1.00 67.07  ? 56   ILE A CB  1 
ATOM   429  C CG1 . ILE A 1 56  ? -8.546  15.902  9.792  1.00 75.10  ? 56   ILE A CG1 1 
ATOM   430  C CG2 . ILE A 1 56  ? -10.819 16.596  9.145  1.00 60.17  ? 56   ILE A CG2 1 
ATOM   431  C CD1 . ILE A 1 56  ? -7.712  15.025  10.697 1.00 81.24  ? 56   ILE A CD1 1 
ATOM   432  N N   . LEU A 1 57  ? -11.589 19.045  10.994 1.00 59.86  ? 57   LEU A N   1 
ATOM   433  C CA  . LEU A 1 57  ? -12.794 19.805  11.283 1.00 52.59  ? 57   LEU A CA  1 
ATOM   434  C C   . LEU A 1 57  ? -13.438 20.375  10.032 1.00 63.86  ? 57   LEU A C   1 
ATOM   435  O O   . LEU A 1 57  ? -12.788 20.585  9.014  1.00 70.85  ? 57   LEU A O   1 
ATOM   436  C CB  . LEU A 1 57  ? -12.453 20.953  12.229 1.00 60.45  ? 57   LEU A CB  1 
ATOM   437  C CG  . LEU A 1 57  ? -11.919 20.521  13.600 1.00 56.40  ? 57   LEU A CG  1 
ATOM   438  C CD1 . LEU A 1 57  ? -11.397 21.716  14.380 1.00 70.55  ? 57   LEU A CD1 1 
ATOM   439  C CD2 . LEU A 1 57  ? -12.990 19.802  14.383 1.00 35.90  ? 57   LEU A CD2 1 
ATOM   440  N N   . SER A 1 58  ? -14.734 20.625  10.120 1.00 73.49  ? 58   SER A N   1 
ATOM   441  C CA  . SER A 1 58  ? -15.445 21.269  9.039  1.00 61.87  ? 58   SER A CA  1 
ATOM   442  C C   . SER A 1 58  ? -14.872 22.649  8.777  1.00 67.30  ? 58   SER A C   1 
ATOM   443  O O   . SER A 1 58  ? -14.358 23.293  9.690  1.00 78.25  ? 58   SER A O   1 
ATOM   444  C CB  . SER A 1 58  ? -16.927 21.393  9.370  1.00 53.55  ? 58   SER A CB  1 
ATOM   445  O OG  . SER A 1 58  ? -17.413 22.664  8.964  1.00 64.32  ? 58   SER A OG  1 
ATOM   446  N N   . PRO A 1 59  ? -14.972 23.112  7.521  1.00 60.22  ? 59   PRO A N   1 
ATOM   447  C CA  . PRO A 1 59  ? -14.532 24.459  7.153  1.00 63.96  ? 59   PRO A CA  1 
ATOM   448  C C   . PRO A 1 59  ? -15.293 25.527  7.944  1.00 68.15  ? 59   PRO A C   1 
ATOM   449  O O   . PRO A 1 59  ? -14.806 26.645  8.090  1.00 75.67  ? 59   PRO A O   1 
ATOM   450  C CB  . PRO A 1 59  ? -14.877 24.545  5.652  1.00 66.44  ? 59   PRO A CB  1 
ATOM   451  C CG  . PRO A 1 59  ? -14.973 23.123  5.194  1.00 57.83  ? 59   PRO A CG  1 
ATOM   452  C CD  . PRO A 1 59  ? -15.569 22.396  6.378  1.00 47.89  ? 59   PRO A CD  1 
ATOM   453  N N   . LYS A 1 60  ? -16.472 25.189  8.454  1.00 74.33  ? 60   LYS A N   1 
ATOM   454  C CA  . LYS A 1 60  ? -17.230 26.144  9.256  1.00 81.70  ? 60   LYS A CA  1 
ATOM   455  C C   . LYS A 1 60  ? -16.956 26.036  10.764 1.00 77.51  ? 60   LYS A C   1 
ATOM   456  O O   . LYS A 1 60  ? -17.683 26.608  11.579 1.00 69.72  ? 60   LYS A O   1 
ATOM   457  C CB  . LYS A 1 60  ? -18.726 26.048  8.960  1.00 89.95  ? 60   LYS A CB  1 
ATOM   458  C CG  . LYS A 1 60  ? -19.158 26.863  7.748  1.00 103.70 ? 60   LYS A CG  1 
ATOM   459  C CD  . LYS A 1 60  ? -20.639 27.222  7.814  1.00 112.52 ? 60   LYS A CD  1 
ATOM   460  C CE  . LYS A 1 60  ? -21.055 28.112  6.647  1.00 115.24 ? 60   LYS A CE  1 
ATOM   461  N NZ  . LYS A 1 60  ? -22.492 28.510  6.737  1.00 114.55 ? 60   LYS A NZ  1 
ATOM   462  N N   . ALA A 1 61  ? -15.893 25.324  11.125 1.00 68.50  ? 61   ALA A N   1 
ATOM   463  C CA  . ALA A 1 61  ? -15.519 25.166  12.526 1.00 63.84  ? 61   ALA A CA  1 
ATOM   464  C C   . ALA A 1 61  ? -14.862 26.425  13.078 1.00 78.88  ? 61   ALA A C   1 
ATOM   465  O O   . ALA A 1 61  ? -13.822 26.855  12.583 1.00 88.52  ? 61   ALA A O   1 
ATOM   466  C CB  . ALA A 1 61  ? -14.576 23.982  12.686 1.00 54.55  ? 61   ALA A CB  1 
ATOM   467  N N   . LYS A 1 62  ? -15.458 27.013  14.110 1.00 77.53  ? 62   LYS A N   1 
ATOM   468  C CA  . LYS A 1 62  ? -14.818 28.126  14.796 1.00 82.90  ? 62   LYS A CA  1 
ATOM   469  C C   . LYS A 1 62  ? -13.575 27.620  15.536 1.00 75.07  ? 62   LYS A C   1 
ATOM   470  O O   . LYS A 1 62  ? -13.664 26.711  16.363 1.00 75.86  ? 62   LYS A O   1 
ATOM   471  C CB  . LYS A 1 62  ? -15.795 28.783  15.777 1.00 97.04  ? 62   LYS A CB  1 
ATOM   472  C CG  . LYS A 1 62  ? -15.305 30.095  16.390 1.00 111.18 ? 62   LYS A CG  1 
ATOM   473  C CD  . LYS A 1 62  ? -15.165 31.193  15.336 1.00 124.02 ? 62   LYS A CD  1 
ATOM   474  C CE  . LYS A 1 62  ? -14.926 32.563  15.969 1.00 129.11 ? 62   LYS A CE  1 
ATOM   475  N NZ  . LYS A 1 62  ? -16.088 33.027  16.785 1.00 128.71 ? 62   LYS A NZ  1 
ATOM   476  N N   . LEU A 1 63  ? -12.417 28.197  15.229 1.00 68.14  ? 63   LEU A N   1 
ATOM   477  C CA  . LEU A 1 63  ? -11.183 27.822  15.913 1.00 71.22  ? 63   LEU A CA  1 
ATOM   478  C C   . LEU A 1 63  ? -10.870 28.781  17.052 1.00 77.96  ? 63   LEU A C   1 
ATOM   479  O O   . LEU A 1 63  ? -10.893 29.997  16.876 1.00 83.01  ? 63   LEU A O   1 
ATOM   480  C CB  . LEU A 1 63  ? -10.004 27.773  14.944 1.00 68.50  ? 63   LEU A CB  1 
ATOM   481  C CG  . LEU A 1 63  ? -10.118 26.748  13.812 1.00 68.71  ? 63   LEU A CG  1 
ATOM   482  C CD1 . LEU A 1 63  ? -8.855  26.736  12.987 1.00 56.77  ? 63   LEU A CD1 1 
ATOM   483  C CD2 . LEU A 1 63  ? -10.417 25.357  14.363 1.00 67.98  ? 63   LEU A CD2 1 
ATOM   484  N N   . HIS A 1 64  ? -10.578 28.230  18.222 1.00 69.46  ? 64   HIS A N   1 
ATOM   485  C CA  . HIS A 1 64  ? -10.218 29.059  19.362 1.00 72.79  ? 64   HIS A CA  1 
ATOM   486  C C   . HIS A 1 64  ? -8.712  29.131  19.527 1.00 73.42  ? 64   HIS A C   1 
ATOM   487  O O   . HIS A 1 64  ? -8.210  29.628  20.527 1.00 77.71  ? 64   HIS A O   1 
ATOM   488  C CB  . HIS A 1 64  ? -10.913 28.565  20.629 1.00 64.58  ? 64   HIS A CB  1 
ATOM   489  C CG  . HIS A 1 64  ? -12.405 28.662  20.551 1.00 77.57  ? 64   HIS A CG  1 
ATOM   490  N ND1 . HIS A 1 64  ? -13.079 29.854  20.693 1.00 78.28  ? 64   HIS A ND1 1 
ATOM   491  C CD2 . HIS A 1 64  ? -13.348 27.723  20.296 1.00 85.91  ? 64   HIS A CD2 1 
ATOM   492  C CE1 . HIS A 1 64  ? -14.376 29.644  20.546 1.00 84.85  ? 64   HIS A CE1 1 
ATOM   493  N NE2 . HIS A 1 64  ? -14.565 28.361  20.305 1.00 87.95  ? 64   HIS A NE2 1 
ATOM   494  N N   . VAL A 1 65  ? -7.994  28.644  18.521 1.00 72.68  ? 65   VAL A N   1 
ATOM   495  C CA  . VAL A 1 65  ? -6.541  28.719  18.522 1.00 79.09  ? 65   VAL A CA  1 
ATOM   496  C C   . VAL A 1 65  ? -6.031  29.240  17.178 1.00 86.86  ? 65   VAL A C   1 
ATOM   497  O O   . VAL A 1 65  ? -6.818  29.624  16.308 1.00 90.13  ? 65   VAL A O   1 
ATOM   498  C CB  . VAL A 1 65  ? -5.914  27.347  18.812 1.00 77.17  ? 65   VAL A CB  1 
ATOM   499  C CG1 . VAL A 1 65  ? -6.587  26.711  20.019 1.00 84.36  ? 65   VAL A CG1 1 
ATOM   500  C CG2 . VAL A 1 65  ? -6.030  26.448  17.594 1.00 68.87  ? 65   VAL A CG2 1 
ATOM   501  N N   . ASN A 1 66  ? -4.712  29.251  17.010 1.00 83.06  ? 66   ASN A N   1 
ATOM   502  C CA  . ASN A 1 66  ? -4.110  29.753  15.782 1.00 81.18  ? 66   ASN A CA  1 
ATOM   503  C C   . ASN A 1 66  ? -2.632  29.403  15.678 1.00 82.50  ? 66   ASN A C   1 
ATOM   504  O O   . ASN A 1 66  ? -1.933  29.329  16.693 1.00 77.92  ? 66   ASN A O   1 
ATOM   505  C CB  . ASN A 1 66  ? -4.296  31.266  15.684 1.00 82.86  ? 66   ASN A CB  1 
ATOM   506  C CG  . ASN A 1 66  ? -3.666  32.004  16.846 1.00 93.30  ? 66   ASN A CG  1 
ATOM   507  O OD1 . ASN A 1 66  ? -4.254  32.112  17.928 1.00 87.61  ? 66   ASN A OD1 1 
ATOM   508  N ND2 . ASN A 1 66  ? -2.457  32.515  16.631 1.00 99.12  ? 66   ASN A ND2 1 
ATOM   509  N N   . ASN A 1 67  ? -2.164  29.190  14.448 1.00 81.51  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? -0.763  28.871  14.189 1.00 79.11  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 0.219   29.468  15.192 1.00 80.21  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 0.109   30.636  15.572 1.00 79.60  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? -0.373  29.298  12.778 1.00 92.59  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? -0.685  28.242  11.753 1.00 97.61  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? -0.743  27.057  12.075 1.00 100.22 ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? -0.887  28.659  10.510 1.00 95.51  ? 67   ASN A ND2 1 
ATOM   517  N N   . GLY A 1 68  ? 1.176   28.652  15.619 1.00 77.79  ? 68   GLY A N   1 
ATOM   518  C CA  . GLY A 1 68  ? 2.188   29.089  16.562 1.00 79.58  ? 68   GLY A CA  1 
ATOM   519  C C   . GLY A 1 68  ? 1.750   29.088  18.016 1.00 78.71  ? 68   GLY A C   1 
ATOM   520  O O   . GLY A 1 68  ? 2.583   29.063  18.911 1.00 85.69  ? 68   GLY A O   1 
ATOM   521  N N   . LYS A 1 69  ? 0.446   29.125  18.260 1.00 78.02  ? 69   LYS A N   1 
ATOM   522  C CA  . LYS A 1 69  ? -0.060  29.163  19.629 1.00 84.95  ? 69   LYS A CA  1 
ATOM   523  C C   . LYS A 1 69  ? 0.324   27.909  20.417 1.00 86.64  ? 69   LYS A C   1 
ATOM   524  O O   . LYS A 1 69  ? 0.398   26.811  19.866 1.00 92.78  ? 69   LYS A O   1 
ATOM   525  C CB  . LYS A 1 69  ? -1.580  29.349  19.638 1.00 82.01  ? 69   LYS A CB  1 
ATOM   526  C CG  . LYS A 1 69  ? -2.171  29.544  21.017 1.00 88.02  ? 69   LYS A CG  1 
ATOM   527  C CD  . LYS A 1 69  ? -3.643  29.892  20.930 1.00 91.52  ? 69   LYS A CD  1 
ATOM   528  C CE  . LYS A 1 69  ? -4.229  30.120  22.307 1.00 94.63  ? 69   LYS A CE  1 
ATOM   529  N NZ  . LYS A 1 69  ? -5.680  30.447  22.232 1.00 97.73  ? 69   LYS A NZ  1 
ATOM   530  N N   . ASP A 1 70  ? 0.571   28.084  21.708 1.00 84.52  ? 70   ASP A N   1 
ATOM   531  C CA  . ASP A 1 70  ? 0.872   26.967  22.592 1.00 77.00  ? 70   ASP A CA  1 
ATOM   532  C C   . ASP A 1 70  ? -0.320  26.684  23.489 1.00 68.79  ? 70   ASP A C   1 
ATOM   533  O O   . ASP A 1 70  ? -0.892  27.603  24.060 1.00 71.73  ? 70   ASP A O   1 
ATOM   534  C CB  . ASP A 1 70  ? 2.098   27.283  23.433 1.00 72.15  ? 70   ASP A CB  1 
ATOM   535  C CG  . ASP A 1 70  ? 3.382   27.143  22.654 1.00 76.25  ? 70   ASP A CG  1 
ATOM   536  O OD1 . ASP A 1 70  ? 4.125   28.142  22.527 1.00 72.11  ? 70   ASP A OD1 1 
ATOM   537  O OD2 . ASP A 1 70  ? 3.651   26.023  22.175 1.00 84.53  ? 70   ASP A OD2 1 
ATOM   538  N N   . VAL A 1 71  ? -0.692  25.413  23.606 1.00 60.70  ? 71   VAL A N   1 
ATOM   539  C CA  . VAL A 1 71  ? -1.889  25.027  24.355 1.00 63.23  ? 71   VAL A CA  1 
ATOM   540  C C   . VAL A 1 71  ? -1.648  23.911  25.384 1.00 67.04  ? 71   VAL A C   1 
ATOM   541  O O   . VAL A 1 71  ? -0.717  23.113  25.250 1.00 69.80  ? 71   VAL A O   1 
ATOM   542  C CB  . VAL A 1 71  ? -3.002  24.561  23.404 1.00 60.46  ? 71   VAL A CB  1 
ATOM   543  C CG1 . VAL A 1 71  ? -3.388  25.684  22.449 1.00 57.48  ? 71   VAL A CG1 1 
ATOM   544  C CG2 . VAL A 1 71  ? -2.545  23.325  22.644 1.00 58.23  ? 71   VAL A CG2 1 
ATOM   545  N N   . ASN A 1 72  ? -2.501  23.860  26.406 1.00 62.61  ? 72   ASN A N   1 
ATOM   546  C CA  . ASN A 1 72  ? -2.434  22.807  27.417 1.00 56.54  ? 72   ASN A CA  1 
ATOM   547  C C   . ASN A 1 72  ? -3.492  21.731  27.221 1.00 51.96  ? 72   ASN A C   1 
ATOM   548  O O   . ASN A 1 72  ? -4.619  22.013  26.777 1.00 43.00  ? 72   ASN A O   1 
ATOM   549  C CB  . ASN A 1 72  ? -2.549  23.391  28.827 1.00 52.66  ? 72   ASN A CB  1 
ATOM   550  C CG  . ASN A 1 72  ? -1.513  24.452  29.093 1.00 64.50  ? 72   ASN A CG  1 
ATOM   551  O OD1 . ASN A 1 72  ? -0.306  24.236  28.882 1.00 69.37  ? 72   ASN A OD1 1 
ATOM   552  N ND2 . ASN A 1 72  ? -1.972  25.623  29.530 1.00 51.04  ? 72   ASN A ND2 1 
ATOM   553  N N   . LYS A 1 73  ? -3.110  20.511  27.594 1.00 44.76  ? 73   LYS A N   1 
ATOM   554  C CA  . LYS A 1 73  ? -3.922  19.304  27.425 1.00 64.09  ? 73   LYS A CA  1 
ATOM   555  C C   . LYS A 1 73  ? -5.438  19.411  27.613 1.00 80.18  ? 73   LYS A C   1 
ATOM   556  O O   . LYS A 1 73  ? -6.164  18.499  27.228 1.00 92.84  ? 73   LYS A O   1 
ATOM   557  C CB  . LYS A 1 73  ? -3.385  18.160  28.295 1.00 65.57  ? 73   LYS A CB  1 
ATOM   558  C CG  . LYS A 1 73  ? -4.059  16.823  28.015 1.00 71.54  ? 73   LYS A CG  1 
ATOM   559  C CD  . LYS A 1 73  ? -3.560  15.708  28.922 1.00 77.42  ? 73   LYS A CD  1 
ATOM   560  C CE  . LYS A 1 73  ? -4.401  14.446  28.731 1.00 85.00  ? 73   LYS A CE  1 
ATOM   561  N NZ  . LYS A 1 73  ? -3.882  13.285  29.509 1.00 95.65  ? 73   LYS A NZ  1 
ATOM   562  N N   . GLY A 1 74  ? -5.947  20.486  28.192 1.00 71.97  ? 74   GLY A N   1 
ATOM   563  C CA  . GLY A 1 74  ? -7.395  20.553  28.318 1.00 62.15  ? 74   GLY A CA  1 
ATOM   564  C C   . GLY A 1 74  ? -8.073  21.696  27.603 1.00 46.01  ? 74   GLY A C   1 
ATOM   565  O O   . GLY A 1 74  ? -9.282  21.829  27.633 1.00 51.18  ? 74   GLY A O   1 
ATOM   566  N N   . ASP A 1 75  ? -7.292  22.539  26.955 1.00 53.04  ? 75   ASP A N   1 
ATOM   567  C CA  . ASP A 1 75  ? -7.846  23.769  26.435 1.00 58.35  ? 75   ASP A CA  1 
ATOM   568  C C   . ASP A 1 75  ? -8.820  23.505  25.310 1.00 52.57  ? 75   ASP A C   1 
ATOM   569  O O   . ASP A 1 75  ? -8.651  22.562  24.535 1.00 57.29  ? 75   ASP A O   1 
ATOM   570  C CB  . ASP A 1 75  ? -6.723  24.689  25.972 1.00 65.14  ? 75   ASP A CB  1 
ATOM   571  C CG  . ASP A 1 75  ? -5.740  24.975  27.077 1.00 61.70  ? 75   ASP A CG  1 
ATOM   572  O OD1 . ASP A 1 75  ? -4.546  25.187  26.781 1.00 67.77  ? 75   ASP A OD1 1 
ATOM   573  O OD2 . ASP A 1 75  ? -6.169  24.977  28.251 1.00 58.59  ? 75   ASP A OD2 1 
ATOM   574  N N   . LEU A 1 76  ? -9.847  24.343  25.246 1.00 45.51  ? 76   LEU A N   1 
ATOM   575  C CA  . LEU A 1 76  ? -10.772 24.363  24.128 1.00 56.94  ? 76   LEU A CA  1 
ATOM   576  C C   . LEU A 1 76  ? -10.016 24.855  22.922 1.00 57.81  ? 76   LEU A C   1 
ATOM   577  O O   . LEU A 1 76  ? -9.474  25.953  22.939 1.00 76.12  ? 76   LEU A O   1 
ATOM   578  C CB  . LEU A 1 76  ? -11.911 25.336  24.421 1.00 59.63  ? 76   LEU A CB  1 
ATOM   579  C CG  . LEU A 1 76  ? -12.941 25.561  23.314 1.00 58.74  ? 76   LEU A CG  1 
ATOM   580  C CD1 . LEU A 1 76  ? -13.713 24.277  23.045 1.00 53.50  ? 76   LEU A CD1 1 
ATOM   581  C CD2 . LEU A 1 76  ? -13.880 26.684  23.716 1.00 55.25  ? 76   LEU A CD2 1 
ATOM   582  N N   . ILE A 1 77  ? -9.971  24.063  21.867 1.00 60.38  ? 77   ILE A N   1 
ATOM   583  C CA  . ILE A 1 77  ? -9.214  24.477  20.694 1.00 63.67  ? 77   ILE A CA  1 
ATOM   584  C C   . ILE A 1 77  ? -10.103 24.748  19.497 1.00 63.74  ? 77   ILE A C   1 
ATOM   585  O O   . ILE A 1 77  ? -9.676  25.364  18.525 1.00 72.06  ? 77   ILE A O   1 
ATOM   586  C CB  . ILE A 1 77  ? -8.121  23.457  20.338 1.00 56.17  ? 77   ILE A CB  1 
ATOM   587  C CG1 . ILE A 1 77  ? -8.736  22.089  20.025 1.00 54.13  ? 77   ILE A CG1 1 
ATOM   588  C CG2 . ILE A 1 77  ? -7.128  23.350  21.486 1.00 45.47  ? 77   ILE A CG2 1 
ATOM   589  C CD1 . ILE A 1 77  ? -7.707  20.996  19.774 1.00 48.79  ? 77   ILE A CD1 1 
ATOM   590  N N   . ALA A 1 78  ? -11.352 24.310  19.572 1.00 60.07  ? 78   ALA A N   1 
ATOM   591  C CA  . ALA A 1 78  ? -12.251 24.508  18.441 1.00 61.39  ? 78   ALA A CA  1 
ATOM   592  C C   . ALA A 1 78  ? -13.686 24.186  18.789 1.00 59.27  ? 78   ALA A C   1 
ATOM   593  O O   . ALA A 1 78  ? -13.965 23.601  19.826 1.00 66.59  ? 78   ALA A O   1 
ATOM   594  C CB  . ALA A 1 78  ? -11.801 23.672  17.255 1.00 50.43  ? 78   ALA A CB  1 
ATOM   595  N N   . GLU A 1 79  ? -14.587 24.551  17.891 1.00 59.53  ? 79   GLU A N   1 
ATOM   596  C CA  . GLU A 1 79  ? -16.011 24.442  18.134 1.00 57.70  ? 79   GLU A CA  1 
ATOM   597  C C   . GLU A 1 79  ? -16.742 24.328  16.802 1.00 63.20  ? 79   GLU A C   1 
ATOM   598  O O   . GLU A 1 79  ? -16.580 25.173  15.920 1.00 65.88  ? 79   GLU A O   1 
ATOM   599  C CB  . GLU A 1 79  ? -16.490 25.690  18.850 1.00 60.29  ? 79   GLU A CB  1 
ATOM   600  C CG  . GLU A 1 79  ? -17.485 25.440  19.950 1.00 83.83  ? 79   GLU A CG  1 
ATOM   601  C CD  . GLU A 1 79  ? -18.060 26.738  20.482 1.00 97.63  ? 79   GLU A CD  1 
ATOM   602  O OE1 . GLU A 1 79  ? -19.304 26.855  20.541 1.00 102.33 ? 79   GLU A OE1 1 
ATOM   603  O OE2 . GLU A 1 79  ? -17.264 27.643  20.824 1.00 92.88  ? 79   GLU A OE2 1 
ATOM   604  N N   . GLU A 1 80  ? -17.535 23.273  16.663 1.00 56.97  ? 80   GLU A N   1 
ATOM   605  C CA  . GLU A 1 80  ? -18.312 23.029  15.462 1.00 65.27  ? 80   GLU A CA  1 
ATOM   606  C C   . GLU A 1 80  ? -19.733 23.529  15.743 1.00 71.08  ? 80   GLU A C   1 
ATOM   607  O O   . GLU A 1 80  ? -20.333 23.189  16.764 1.00 64.26  ? 80   GLU A O   1 
ATOM   608  C CB  . GLU A 1 80  ? -18.300 21.528  15.140 1.00 65.79  ? 80   GLU A CB  1 
ATOM   609  C CG  . GLU A 1 80  ? -18.443 21.163  13.669 1.00 77.84  ? 80   GLU A CG  1 
ATOM   610  C CD  . GLU A 1 80  ? -17.104 20.957  12.953 1.00 82.58  ? 80   GLU A CD  1 
ATOM   611  O OE1 . GLU A 1 80  ? -16.489 19.875  13.100 1.00 82.21  ? 80   GLU A OE1 1 
ATOM   612  O OE2 . GLU A 1 80  ? -16.674 21.875  12.225 1.00 78.30  ? 80   GLU A OE2 1 
ATOM   613  N N   . PRO A 1 81  ? -20.264 24.372  14.854 1.00 72.53  ? 81   PRO A N   1 
ATOM   614  C CA  . PRO A 1 81  ? -21.594 24.968  15.027 1.00 70.41  ? 81   PRO A CA  1 
ATOM   615  C C   . PRO A 1 81  ? -22.708 23.928  15.130 1.00 58.89  ? 81   PRO A C   1 
ATOM   616  O O   . PRO A 1 81  ? -22.484 22.747  14.853 1.00 53.77  ? 81   PRO A O   1 
ATOM   617  C CB  . PRO A 1 81  ? -21.767 25.792  13.749 1.00 70.14  ? 81   PRO A CB  1 
ATOM   618  C CG  . PRO A 1 81  ? -20.386 26.128  13.345 1.00 75.64  ? 81   PRO A CG  1 
ATOM   619  C CD  . PRO A 1 81  ? -19.558 24.927  13.691 1.00 71.62  ? 81   PRO A CD  1 
ATOM   620  N N   . PRO A 1 82  ? -23.908 24.362  15.533 1.00 57.71  ? 82   PRO A N   1 
ATOM   621  C CA  . PRO A 1 82  ? -25.042 23.432  15.570 1.00 59.50  ? 82   PRO A CA  1 
ATOM   622  C C   . PRO A 1 82  ? -25.506 23.168  14.152 1.00 57.02  ? 82   PRO A C   1 
ATOM   623  O O   . PRO A 1 82  ? -25.089 23.871  13.240 1.00 51.29  ? 82   PRO A O   1 
ATOM   624  C CB  . PRO A 1 82  ? -26.122 24.208  16.334 1.00 54.20  ? 82   PRO A CB  1 
ATOM   625  C CG  . PRO A 1 82  ? -25.395 25.341  17.007 1.00 60.69  ? 82   PRO A CG  1 
ATOM   626  C CD  . PRO A 1 82  ? -24.253 25.676  16.094 1.00 60.29  ? 82   PRO A CD  1 
ATOM   627  N N   . ILE A 1 83  ? -26.355 22.169  13.972 1.00 51.76  ? 83   ILE A N   1 
ATOM   628  C CA  . ILE A 1 83  ? -26.893 21.882  12.668 1.00 54.12  ? 83   ILE A CA  1 
ATOM   629  C C   . ILE A 1 83  ? -28.352 22.307  12.605 1.00 60.18  ? 83   ILE A C   1 
ATOM   630  O O   . ILE A 1 83  ? -29.128 22.042  13.524 1.00 59.95  ? 83   ILE A O   1 
ATOM   631  C CB  . ILE A 1 83  ? -26.721 20.396  12.314 1.00 58.05  ? 83   ILE A CB  1 
ATOM   632  C CG1 . ILE A 1 83  ? -25.226 20.027  12.327 1.00 52.22  ? 83   ILE A CG1 1 
ATOM   633  C CG2 . ILE A 1 83  ? -27.346 20.109  10.961 1.00 37.17  ? 83   ILE A CG2 1 
ATOM   634  C CD1 . ILE A 1 83  ? -24.947 18.556  12.083 1.00 47.30  ? 83   ILE A CD1 1 
ATOM   635  N N   . TYR A 1 84  ? -28.718 22.980  11.518 1.00 55.04  ? 84   TYR A N   1 
ATOM   636  C CA  . TYR A 1 84  ? -30.037 23.587  11.417 1.00 51.81  ? 84   TYR A CA  1 
ATOM   637  C C   . TYR A 1 84  ? -30.786 23.118  10.179 1.00 60.71  ? 84   TYR A C   1 
ATOM   638  O O   . TYR A 1 84  ? -30.212 23.038  9.083  1.00 60.96  ? 84   TYR A O   1 
ATOM   639  C CB  . TYR A 1 84  ? -29.915 25.110  11.412 1.00 50.86  ? 84   TYR A CB  1 
ATOM   640  C CG  . TYR A 1 84  ? -29.406 25.683  12.714 1.00 55.87  ? 84   TYR A CG  1 
ATOM   641  C CD1 . TYR A 1 84  ? -30.180 25.632  13.865 1.00 59.98  ? 84   TYR A CD1 1 
ATOM   642  C CD2 . TYR A 1 84  ? -28.150 26.285  12.792 1.00 52.81  ? 84   TYR A CD2 1 
ATOM   643  C CE1 . TYR A 1 84  ? -29.717 26.165  15.071 1.00 65.14  ? 84   TYR A CE1 1 
ATOM   644  C CE2 . TYR A 1 84  ? -27.682 26.818  13.978 1.00 66.32  ? 84   TYR A CE2 1 
ATOM   645  C CZ  . TYR A 1 84  ? -28.469 26.754  15.120 1.00 69.33  ? 84   TYR A CZ  1 
ATOM   646  O OH  . TYR A 1 84  ? -28.003 27.274  16.304 1.00 74.13  ? 84   TYR A OH  1 
ATOM   647  N N   . ALA A 1 85  ? -32.069 22.809  10.343 1.00 53.25  ? 85   ALA A N   1 
ATOM   648  C CA  . ALA A 1 85  ? -32.848 22.359  9.199  1.00 44.63  ? 85   ALA A CA  1 
ATOM   649  C C   . ALA A 1 85  ? -32.960 23.504  8.199  1.00 53.71  ? 85   ALA A C   1 
ATOM   650  O O   . ALA A 1 85  ? -33.351 24.621  8.545  1.00 68.04  ? 85   ALA A O   1 
ATOM   651  C CB  . ALA A 1 85  ? -34.208 21.842  9.616  1.00 41.93  ? 85   ALA A CB  1 
ATOM   652  N N   . ARG A 1 86  ? -32.566 23.236  6.964  1.00 51.12  ? 86   ARG A N   1 
ATOM   653  C CA  . ARG A 1 86  ? -32.531 24.277  5.964  1.00 55.07  ? 86   ARG A CA  1 
ATOM   654  C C   . ARG A 1 86  ? -33.945 24.525  5.479  1.00 63.66  ? 86   ARG A C   1 
ATOM   655  O O   . ARG A 1 86  ? -34.313 25.653  5.145  1.00 69.21  ? 86   ARG A O   1 
ATOM   656  C CB  . ARG A 1 86  ? -31.588 23.885  4.823  1.00 68.65  ? 86   ARG A CB  1 
ATOM   657  C CG  . ARG A 1 86  ? -30.131 23.693  5.277  1.00 70.48  ? 86   ARG A CG  1 
ATOM   658  C CD  . ARG A 1 86  ? -29.205 23.477  4.095  1.00 85.43  ? 86   ARG A CD  1 
ATOM   659  N NE  . ARG A 1 86  ? -29.917 22.895  2.960  1.00 93.77  ? 86   ARG A NE  1 
ATOM   660  C CZ  . ARG A 1 86  ? -30.262 23.571  1.868  1.00 101.94 ? 86   ARG A CZ  1 
ATOM   661  N NH1 . ARG A 1 86  ? -29.942 24.855  1.752  1.00 109.77 ? 86   ARG A NH1 1 
ATOM   662  N NH2 . ARG A 1 86  ? -30.923 22.963  0.887  1.00 97.82  ? 86   ARG A NH2 1 
ATOM   663  N N   . ARG A 1 87  ? -34.747 23.467  5.475  1.00 59.83  ? 87   ARG A N   1 
ATOM   664  C CA  . ARG A 1 87  ? -36.132 23.586  5.065  1.00 58.46  ? 87   ARG A CA  1 
ATOM   665  C C   . ARG A 1 87  ? -37.067 22.748  5.921  1.00 63.67  ? 87   ARG A C   1 
ATOM   666  O O   . ARG A 1 87  ? -36.672 21.719  6.471  1.00 63.52  ? 87   ARG A O   1 
ATOM   667  C CB  . ARG A 1 87  ? -36.286 23.172  3.605  1.00 57.51  ? 87   ARG A CB  1 
ATOM   668  C CG  . ARG A 1 87  ? -35.636 24.108  2.604  1.00 70.76  ? 87   ARG A CG  1 
ATOM   669  C CD  . ARG A 1 87  ? -35.858 23.604  1.179  1.00 64.16  ? 87   ARG A CD  1 
ATOM   670  N NE  . ARG A 1 87  ? -35.153 22.345  0.951  1.00 68.51  ? 87   ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 87  ? -35.192 21.633  -0.173 1.00 64.57  ? 87   ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 87  ? -35.913 22.047  -1.226 1.00 57.38  ? 87   ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 87  ? -34.496 20.501  -0.236 1.00 53.26  ? 87   ARG A NH2 1 
ATOM   674  N N   . SER A 1 88  ? -38.317 23.195  6.004  1.00 68.67  ? 88   SER A N   1 
ATOM   675  C CA  . SER A 1 88  ? -39.368 22.482  6.711  1.00 67.35  ? 88   SER A CA  1 
ATOM   676  C C   . SER A 1 88  ? -39.745 21.200  5.989  1.00 63.07  ? 88   SER A C   1 
ATOM   677  O O   . SER A 1 88  ? -39.760 21.153  4.762  1.00 67.25  ? 88   SER A O   1 
ATOM   678  C CB  . SER A 1 88  ? -40.606 23.366  6.839  1.00 70.29  ? 88   SER A CB  1 
ATOM   679  O OG  . SER A 1 88  ? -40.352 24.460  7.696  1.00 85.05  ? 88   SER A OG  1 
ATOM   680  N N   . GLY A 1 89  ? -40.047 20.160  6.760  1.00 59.64  ? 89   GLY A N   1 
ATOM   681  C CA  . GLY A 1 89  ? -40.471 18.888  6.208  1.00 57.48  ? 89   GLY A CA  1 
ATOM   682  C C   . GLY A 1 89  ? -40.544 17.793  7.258  1.00 64.15  ? 89   GLY A C   1 
ATOM   683  O O   . GLY A 1 89  ? -40.430 18.047  8.459  1.00 64.66  ? 89   GLY A O   1 
ATOM   684  N N   . VAL A 1 90  ? -40.734 16.562  6.802  1.00 59.83  ? 90   VAL A N   1 
ATOM   685  C CA  . VAL A 1 90  ? -40.752 15.426  7.705  1.00 61.89  ? 90   VAL A CA  1 
ATOM   686  C C   . VAL A 1 90  ? -39.565 14.509  7.438  1.00 62.00  ? 90   VAL A C   1 
ATOM   687  O O   . VAL A 1 90  ? -39.152 14.312  6.292  1.00 70.71  ? 90   VAL A O   1 
ATOM   688  C CB  . VAL A 1 90  ? -42.065 14.625  7.590  1.00 62.45  ? 90   VAL A CB  1 
ATOM   689  C CG1 . VAL A 1 90  ? -42.231 14.081  6.175  1.00 44.16  ? 90   VAL A CG1 1 
ATOM   690  C CG2 . VAL A 1 90  ? -42.097 13.497  8.627  1.00 51.89  ? 90   VAL A CG2 1 
ATOM   691  N N   . ILE A 1 91  ? -39.020 13.966  8.516  1.00 60.48  ? 91   ILE A N   1 
ATOM   692  C CA  . ILE A 1 91  ? -37.927 13.016  8.455  1.00 54.62  ? 91   ILE A CA  1 
ATOM   693  C C   . ILE A 1 91  ? -38.415 11.699  7.862  1.00 63.41  ? 91   ILE A C   1 
ATOM   694  O O   . ILE A 1 91  ? -39.285 11.037  8.422  1.00 65.94  ? 91   ILE A O   1 
ATOM   695  C CB  . ILE A 1 91  ? -37.370 12.781  9.863  1.00 51.29  ? 91   ILE A CB  1 
ATOM   696  C CG1 . ILE A 1 91  ? -36.677 14.058  10.352 1.00 43.69  ? 91   ILE A CG1 1 
ATOM   697  C CG2 . ILE A 1 91  ? -36.419 11.600  9.878  1.00 59.87  ? 91   ILE A CG2 1 
ATOM   698  C CD1 . ILE A 1 91  ? -36.084 13.955  11.704 1.00 42.33  ? 91   ILE A CD1 1 
ATOM   699  N N   . VAL A 1 92  ? -37.860 11.323  6.719  1.00 59.62  ? 92   VAL A N   1 
ATOM   700  C CA  . VAL A 1 92  ? -38.302 10.109  6.049  1.00 60.02  ? 92   VAL A CA  1 
ATOM   701  C C   . VAL A 1 92  ? -37.297 8.970   6.201  1.00 61.31  ? 92   VAL A C   1 
ATOM   702  O O   . VAL A 1 92  ? -37.590 7.819   5.887  1.00 68.84  ? 92   VAL A O   1 
ATOM   703  C CB  . VAL A 1 92  ? -38.584 10.354  4.553  1.00 57.62  ? 92   VAL A CB  1 
ATOM   704  C CG1 . VAL A 1 92  ? -39.774 11.274  4.382  1.00 59.47  ? 92   VAL A CG1 1 
ATOM   705  C CG2 . VAL A 1 92  ? -37.354 10.922  3.869  1.00 51.25  ? 92   VAL A CG2 1 
ATOM   706  N N   . ASP A 1 93  ? -36.106 9.288   6.677  1.00 53.11  ? 93   ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -35.121 8.252   6.903  1.00 55.30  ? 93   ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -34.101 8.742   7.887  1.00 50.40  ? 93   ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -33.712 9.909   7.864  1.00 57.37  ? 93   ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -34.431 7.840   5.600  1.00 72.96  ? 93   ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -33.328 6.810   5.823  1.00 84.65  ? 93   ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -33.644 5.608   5.977  1.00 87.44  ? 93   ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -32.142 7.201   5.844  1.00 88.57  ? 93   ASP A OD2 1 
ATOM   714  N N   . VAL A 1 94  ? -33.706 7.839   8.776  1.00 58.09  ? 94   VAL A N   1 
ATOM   715  C CA  . VAL A 1 94  ? -32.610 8.050   9.712  1.00 52.11  ? 94   VAL A CA  1 
ATOM   716  C C   . VAL A 1 94  ? -31.798 6.770   9.613  1.00 53.63  ? 94   VAL A C   1 
ATOM   717  O O   . VAL A 1 94  ? -32.328 5.670   9.785  1.00 68.37  ? 94   VAL A O   1 
ATOM   718  C CB  . VAL A 1 94  ? -33.127 8.247   11.157 1.00 57.39  ? 94   VAL A CB  1 
ATOM   719  C CG1 . VAL A 1 94  ? -31.974 8.441   12.128 1.00 41.22  ? 94   VAL A CG1 1 
ATOM   720  C CG2 . VAL A 1 94  ? -34.099 9.426   11.226 1.00 58.81  ? 94   VAL A CG2 1 
ATOM   721  N N   . LYS A 1 95  ? -30.522 6.898   9.294  1.00 52.63  ? 95   LYS A N   1 
ATOM   722  C CA  . LYS A 1 95  ? -29.728 5.725   8.984  1.00 58.56  ? 95   LYS A CA  1 
ATOM   723  C C   . LYS A 1 95  ? -28.356 5.800   9.622  1.00 52.54  ? 95   LYS A C   1 
ATOM   724  O O   . LYS A 1 95  ? -27.677 6.822   9.546  1.00 59.18  ? 95   LYS A O   1 
ATOM   725  C CB  . LYS A 1 95  ? -29.606 5.553   7.464  1.00 70.82  ? 95   LYS A CB  1 
ATOM   726  C CG  . LYS A 1 95  ? -28.563 4.527   7.035  1.00 78.16  ? 95   LYS A CG  1 
ATOM   727  C CD  . LYS A 1 95  ? -28.277 4.592   5.533  1.00 81.49  ? 95   LYS A CD  1 
ATOM   728  C CE  . LYS A 1 95  ? -29.437 4.067   4.705  1.00 84.28  ? 95   LYS A CE  1 
ATOM   729  N NZ  . LYS A 1 95  ? -29.004 3.787   3.305  1.00 93.11  ? 95   LYS A NZ  1 
ATOM   730  N N   . ASN A 1 96  ? -27.956 4.707   10.260 1.00 49.01  ? 96   ASN A N   1 
ATOM   731  C CA  . ASN A 1 96  ? -26.617 4.621   10.820 1.00 51.92  ? 96   ASN A CA  1 
ATOM   732  C C   . ASN A 1 96  ? -25.593 4.463   9.708  1.00 51.49  ? 96   ASN A C   1 
ATOM   733  O O   . ASN A 1 96  ? -25.752 3.653   8.806  1.00 54.25  ? 96   ASN A O   1 
ATOM   734  C CB  . ASN A 1 96  ? -26.528 3.485   11.832 1.00 55.54  ? 96   ASN A CB  1 
ATOM   735  C CG  . ASN A 1 96  ? -27.336 3.767   13.084 1.00 53.44  ? 96   ASN A CG  1 
ATOM   736  O OD1 . ASN A 1 96  ? -26.961 4.606   13.898 1.00 59.39  ? 96   ASN A OD1 1 
ATOM   737  N ND2 . ASN A 1 96  ? -28.450 3.076   13.237 1.00 51.96  ? 96   ASN A ND2 1 
ATOM   738  N N   . VAL A 1 97  ? -24.545 5.264   9.776  1.00 55.12  ? 97   VAL A N   1 
ATOM   739  C CA  . VAL A 1 97  ? -23.632 5.403   8.666  1.00 55.75  ? 97   VAL A CA  1 
ATOM   740  C C   . VAL A 1 97  ? -22.265 5.754   9.217  1.00 55.38  ? 97   VAL A C   1 
ATOM   741  O O   . VAL A 1 97  ? -22.156 6.589   10.101 1.00 67.76  ? 97   VAL A O   1 
ATOM   742  C CB  . VAL A 1 97  ? -24.146 6.510   7.710  1.00 54.58  ? 97   VAL A CB  1 
ATOM   743  C CG1 . VAL A 1 97  ? -23.047 7.450   7.309  1.00 51.52  ? 97   VAL A CG1 1 
ATOM   744  C CG2 . VAL A 1 97  ? -24.836 5.901   6.505  1.00 57.99  ? 97   VAL A CG2 1 
ATOM   745  N N   . ARG A 1 98  ? -21.225 5.099   8.715  1.00 59.99  ? 98   ARG A N   1 
ATOM   746  C CA  . ARG A 1 98  ? -19.857 5.444   9.091  1.00 62.09  ? 98   ARG A CA  1 
ATOM   747  C C   . ARG A 1 98  ? -19.230 6.390   8.069  1.00 64.58  ? 98   ARG A C   1 
ATOM   748  O O   . ARG A 1 98  ? -19.241 6.115   6.867  1.00 65.17  ? 98   ARG A O   1 
ATOM   749  C CB  . ARG A 1 98  ? -18.994 4.191   9.197  1.00 60.97  ? 98   ARG A CB  1 
ATOM   750  C CG  . ARG A 1 98  ? -17.672 4.433   9.889  1.00 72.38  ? 98   ARG A CG  1 
ATOM   751  C CD  . ARG A 1 98  ? -17.858 4.407   11.394 1.00 85.74  ? 98   ARG A CD  1 
ATOM   752  N NE  . ARG A 1 98  ? -18.445 3.138   11.812 1.00 95.42  ? 98   ARG A NE  1 
ATOM   753  C CZ  . ARG A 1 98  ? -17.738 2.078   12.191 1.00 98.75  ? 98   ARG A CZ  1 
ATOM   754  N NH1 . ARG A 1 98  ? -16.414 2.138   12.220 1.00 95.96  ? 98   ARG A NH1 1 
ATOM   755  N NH2 . ARG A 1 98  ? -18.355 0.959   12.546 1.00 102.76 ? 98   ARG A NH2 1 
ATOM   756  N N   . LYS A 1 99  ? -18.692 7.505   8.549  1.00 57.75  ? 99   LYS A N   1 
ATOM   757  C CA  . LYS A 1 99  ? -17.973 8.432   7.691  1.00 50.09  ? 99   LYS A CA  1 
ATOM   758  C C   . LYS A 1 99  ? -16.494 8.098   7.699  1.00 63.37  ? 99   LYS A C   1 
ATOM   759  O O   . LYS A 1 99  ? -15.856 8.102   8.753  1.00 64.42  ? 99   LYS A O   1 
ATOM   760  C CB  . LYS A 1 99  ? -18.183 9.875   8.142  1.00 51.99  ? 99   LYS A CB  1 
ATOM   761  C CG  . LYS A 1 99  ? -17.220 10.874  7.511  1.00 55.29  ? 99   LYS A CG  1 
ATOM   762  C CD  . LYS A 1 99  ? -17.819 12.274  7.471  1.00 61.91  ? 99   LYS A CD  1 
ATOM   763  C CE  . LYS A 1 99  ? -16.966 13.286  8.212  1.00 63.79  ? 99   LYS A CE  1 
ATOM   764  N NZ  . LYS A 1 99  ? -17.266 14.676  7.756  1.00 61.06  ? 99   LYS A NZ  1 
ATOM   765  N N   . ILE A 1 100 ? -15.954 7.792   6.524  1.00 64.10  ? 100  ILE A N   1 
ATOM   766  C CA  . ILE A 1 100 ? -14.529 7.539   6.402  1.00 59.99  ? 100  ILE A CA  1 
ATOM   767  C C   . ILE A 1 100 ? -13.913 8.528   5.433  1.00 57.14  ? 100  ILE A C   1 
ATOM   768  O O   . ILE A 1 100 ? -14.205 8.530   4.238  1.00 64.14  ? 100  ILE A O   1 
ATOM   769  C CB  . ILE A 1 100 ? -14.226 6.121   5.917  1.00 68.83  ? 100  ILE A CB  1 
ATOM   770  C CG1 . ILE A 1 100 ? -14.963 5.087   6.764  1.00 62.13  ? 100  ILE A CG1 1 
ATOM   771  C CG2 . ILE A 1 100 ? -12.721 5.871   5.948  1.00 67.56  ? 100  ILE A CG2 1 
ATOM   772  C CD1 . ILE A 1 100 ? -14.779 3.671   6.260  1.00 64.56  ? 100  ILE A CD1 1 
ATOM   773  N N   . VAL A 1 101 ? -13.055 9.369   5.972  1.00 55.01  ? 101  VAL A N   1 
ATOM   774  C CA  . VAL A 1 101 ? -12.394 10.399  5.209  1.00 61.81  ? 101  VAL A CA  1 
ATOM   775  C C   . VAL A 1 101 ? -10.976 9.965   4.835  1.00 66.68  ? 101  VAL A C   1 
ATOM   776  O O   . VAL A 1 101 ? -10.131 9.743   5.708  1.00 60.00  ? 101  VAL A O   1 
ATOM   777  C CB  . VAL A 1 101 ? -12.358 11.700  6.013  1.00 59.62  ? 101  VAL A CB  1 
ATOM   778  C CG1 . VAL A 1 101 ? -11.847 12.834  5.158  1.00 58.58  ? 101  VAL A CG1 1 
ATOM   779  C CG2 . VAL A 1 101 ? -13.750 12.016  6.524  1.00 64.91  ? 101  VAL A CG2 1 
ATOM   780  N N   . VAL A 1 102 ? -10.740 9.854   3.525  1.00 71.28  ? 102  VAL A N   1 
ATOM   781  C CA  . VAL A 1 102 ? -9.460  9.428   2.957  1.00 65.47  ? 102  VAL A CA  1 
ATOM   782  C C   . VAL A 1 102 ? -8.649  10.588  2.374  1.00 68.70  ? 102  VAL A C   1 
ATOM   783  O O   . VAL A 1 102 ? -9.134  11.336  1.529  1.00 67.20  ? 102  VAL A O   1 
ATOM   784  C CB  . VAL A 1 102 ? -9.677  8.404   1.840  1.00 58.69  ? 102  VAL A CB  1 
ATOM   785  C CG1 . VAL A 1 102 ? -8.354  7.975   1.243  1.00 65.31  ? 102  VAL A CG1 1 
ATOM   786  C CG2 . VAL A 1 102 ? -10.452 7.202   2.365  1.00 55.66  ? 102  VAL A CG2 1 
ATOM   787  N N   . GLU A 1 103 ? -7.411  10.728  2.832  1.00 70.47  ? 103  GLU A N   1 
ATOM   788  C CA  . GLU A 1 103 ? -6.482  11.697  2.267  1.00 76.44  ? 103  GLU A CA  1 
ATOM   789  C C   . GLU A 1 103 ? -5.584  10.982  1.283  1.00 79.59  ? 103  GLU A C   1 
ATOM   790  O O   . GLU A 1 103 ? -4.942  10.001  1.635  1.00 80.99  ? 103  GLU A O   1 
ATOM   791  C CB  . GLU A 1 103 ? -5.631  12.311  3.369  1.00 72.80  ? 103  GLU A CB  1 
ATOM   792  C CG  . GLU A 1 103 ? -4.677  13.391  2.905  1.00 74.34  ? 103  GLU A CG  1 
ATOM   793  C CD  . GLU A 1 103 ? -3.773  13.864  4.040  1.00 82.53  ? 103  GLU A CD  1 
ATOM   794  O OE1 . GLU A 1 103 ? -3.098  14.908  3.884  1.00 84.36  ? 103  GLU A OE1 1 
ATOM   795  O OE2 . GLU A 1 103 ? -3.739  13.184  5.092  1.00 72.81  ? 103  GLU A OE2 1 
ATOM   796  N N   . THR A 1 104 ? -5.544  11.457  0.046  1.00 81.37  ? 104  THR A N   1 
ATOM   797  C CA  . THR A 1 104 ? -4.758  10.775  -0.976 1.00 89.07  ? 104  THR A CA  1 
ATOM   798  C C   . THR A 1 104 ? -3.372  11.387  -1.133 1.00 86.95  ? 104  THR A C   1 
ATOM   799  O O   . THR A 1 104 ? -3.125  12.510  -0.687 1.00 85.99  ? 104  THR A O   1 
ATOM   800  C CB  . THR A 1 104 ? -5.469  10.789  -2.328 1.00 96.29  ? 104  THR A CB  1 
ATOM   801  O OG1 . THR A 1 104 ? -5.796  12.140  -2.672 1.00 105.44 ? 104  THR A OG1 1 
ATOM   802  C CG2 . THR A 1 104 ? -6.741  9.968   -2.257 1.00 90.62  ? 104  THR A CG2 1 
ATOM   803  N N   . ILE A 1 105 ? -2.472  10.636  -1.763 1.00 113.28 ? 105  ILE A N   1 
ATOM   804  C CA  . ILE A 1 105 ? -1.090  11.069  -1.933 1.00 110.86 ? 105  ILE A CA  1 
ATOM   805  C C   . ILE A 1 105 ? -1.032  12.346  -2.761 1.00 118.31 ? 105  ILE A C   1 
ATOM   806  O O   . ILE A 1 105 ? -0.154  13.188  -2.567 1.00 115.48 ? 105  ILE A O   1 
ATOM   807  C CB  . ILE A 1 105 ? -0.210  9.980   -2.591 1.00 105.04 ? 105  ILE A CB  1 
ATOM   808  C CG1 . ILE A 1 105 ? -0.279  8.665   -1.802 1.00 103.05 ? 105  ILE A CG1 1 
ATOM   809  C CG2 . ILE A 1 105 ? 1.236   10.458  -2.692 1.00 94.34  ? 105  ILE A CG2 1 
ATOM   810  C CD1 . ILE A 1 105 ? -1.621  7.938   -1.868 1.00 92.48  ? 105  ILE A CD1 1 
ATOM   811  N N   . ASP A 1 106 ? -1.982  12.485  -3.680 1.00 132.74 ? 106  ASP A N   1 
ATOM   812  C CA  . ASP A 1 106 ? -2.130  13.712  -4.450 1.00 145.92 ? 106  ASP A CA  1 
ATOM   813  C C   . ASP A 1 106 ? -2.588  14.844  -3.531 1.00 150.08 ? 106  ASP A C   1 
ATOM   814  O O   . ASP A 1 106 ? -3.069  15.876  -3.997 1.00 150.35 ? 106  ASP A O   1 
ATOM   815  C CB  . ASP A 1 106 ? -3.128  13.514  -5.597 1.00 152.88 ? 106  ASP A CB  1 
ATOM   816  C CG  . ASP A 1 106 ? -2.492  13.699  -6.969 1.00 155.46 ? 106  ASP A CG  1 
ATOM   817  O OD1 . ASP A 1 106 ? -1.556  14.518  -7.091 1.00 157.08 ? 106  ASP A OD1 1 
ATOM   818  O OD2 . ASP A 1 106 ? -2.932  13.026  -7.928 1.00 154.94 ? 106  ASP A OD2 1 
ATOM   819  N N   . ARG A 1 107 ? -2.442  14.620  -2.226 1.00 153.59 ? 107  ARG A N   1 
ATOM   820  C CA  . ARG A 1 107 ? -2.705  15.612  -1.176 1.00 149.12 ? 107  ARG A CA  1 
ATOM   821  C C   . ARG A 1 107 ? -3.845  16.587  -1.482 1.00 137.51 ? 107  ARG A C   1 
ATOM   822  O O   . ARG A 1 107 ? -4.739  16.285  -2.272 1.00 138.55 ? 107  ARG A O   1 
ATOM   823  C CB  . ARG A 1 107 ? -1.406  16.361  -0.814 1.00 154.26 ? 107  ARG A CB  1 
ATOM   824  C CG  . ARG A 1 107 ? -1.190  17.734  -1.474 1.00 156.08 ? 107  ARG A CG  1 
ATOM   825  C CD  . ARG A 1 107 ? -1.110  17.675  -2.998 1.00 160.43 ? 107  ARG A CD  1 
ATOM   826  N NE  . ARG A 1 107 ? -1.275  18.999  -3.601 1.00 160.96 ? 107  ARG A NE  1 
ATOM   827  C CZ  . ARG A 1 107 ? -1.347  19.231  -4.911 1.00 161.08 ? 107  ARG A CZ  1 
ATOM   828  N NH1 . ARG A 1 107 ? -1.269  18.227  -5.774 1.00 162.50 ? 107  ARG A NH1 1 
ATOM   829  N NH2 . ARG A 1 107 ? -1.499  20.471  -5.359 1.00 158.18 ? 107  ARG A NH2 1 
ATOM   830  N N   . LYS A 1 108 ? -3.823  17.737  -0.812 1.00 126.49 ? 108  LYS A N   1 
ATOM   831  C CA  . LYS A 1 108 ? -4.652  18.889  -1.176 1.00 117.84 ? 108  LYS A CA  1 
ATOM   832  C C   . LYS A 1 108 ? -6.108  18.790  -0.709 1.00 110.48 ? 108  LYS A C   1 
ATOM   833  O O   . LYS A 1 108 ? -6.549  19.582  0.127  1.00 97.30  ? 108  LYS A O   1 
ATOM   834  C CB  . LYS A 1 108 ? -4.519  19.206  -2.683 1.00 115.40 ? 108  LYS A CB  1 
ATOM   835  C CG  . LYS A 1 108 ? -5.728  18.913  -3.565 1.00 113.76 ? 108  LYS A CG  1 
ATOM   836  C CD  . LYS A 1 108 ? -6.725  20.061  -3.528 1.00 109.93 ? 108  LYS A CD  1 
ATOM   837  C CE  . LYS A 1 108 ? -7.909  19.809  -4.446 1.00 105.63 ? 108  LYS A CE  1 
ATOM   838  N NZ  . LYS A 1 108 ? -9.105  20.592  -4.023 1.00 98.94  ? 108  LYS A NZ  1 
ATOM   839  N N   . TYR A 1 109 ? -6.855  17.829  -1.240 1.00 115.15 ? 109  TYR A N   1 
ATOM   840  C CA  . TYR A 1 109 ? -8.226  17.647  -0.791 1.00 120.21 ? 109  TYR A CA  1 
ATOM   841  C C   . TYR A 1 109 ? -8.602  16.185  -0.608 1.00 119.50 ? 109  TYR A C   1 
ATOM   842  O O   . TYR A 1 109 ? -7.996  15.282  -1.180 1.00 121.23 ? 109  TYR A O   1 
ATOM   843  C CB  . TYR A 1 109 ? -9.231  18.403  -1.671 1.00 132.60 ? 109  TYR A CB  1 
ATOM   844  C CG  . TYR A 1 109 ? -9.766  17.649  -2.870 1.00 148.01 ? 109  TYR A CG  1 
ATOM   845  C CD1 . TYR A 1 109 ? -11.099 17.779  -3.246 1.00 153.93 ? 109  TYR A CD1 1 
ATOM   846  C CD2 . TYR A 1 109 ? -8.946  16.832  -3.639 1.00 156.81 ? 109  TYR A CD2 1 
ATOM   847  C CE1 . TYR A 1 109 ? -11.606 17.106  -4.342 1.00 159.58 ? 109  TYR A CE1 1 
ATOM   848  C CE2 . TYR A 1 109 ? -9.444  16.154  -4.742 1.00 163.02 ? 109  TYR A CE2 1 
ATOM   849  C CZ  . TYR A 1 109 ? -10.777 16.295  -5.088 1.00 164.37 ? 109  TYR A CZ  1 
ATOM   850  O OH  . TYR A 1 109 ? -11.285 15.627  -6.181 1.00 166.20 ? 109  TYR A OH  1 
ATOM   851  N N   . THR A 1 110 ? -9.624  15.978  0.201  1.00 86.03  ? 110  THR A N   1 
ATOM   852  C CA  . THR A 1 110 ? -9.904  14.684  0.779  1.00 82.63  ? 110  THR A CA  1 
ATOM   853  C C   . THR A 1 110 ? -11.116 14.014  0.127  1.00 73.52  ? 110  THR A C   1 
ATOM   854  O O   . THR A 1 110 ? -11.909 14.669  -0.560 1.00 68.67  ? 110  THR A O   1 
ATOM   855  C CB  . THR A 1 110 ? -10.133 14.854  2.290  1.00 82.27  ? 110  THR A CB  1 
ATOM   856  O OG1 . THR A 1 110 ? -9.519  13.773  3.002  1.00 90.05  ? 110  THR A OG1 1 
ATOM   857  C CG2 . THR A 1 110 ? -11.614 14.938  2.602  1.00 81.36  ? 110  THR A CG2 1 
ATOM   858  N N   . LYS A 1 111 ? -11.236 12.703  0.323  1.00 71.56  ? 111  LYS A N   1 
ATOM   859  C CA  . LYS A 1 111 ? -12.384 11.939  -0.173 1.00 70.17  ? 111  LYS A CA  1 
ATOM   860  C C   . LYS A 1 111 ? -13.190 11.411  1.011  1.00 65.57  ? 111  LYS A C   1 
ATOM   861  O O   . LYS A 1 111 ? -12.678 10.661  1.837  1.00 63.98  ? 111  LYS A O   1 
ATOM   862  C CB  . LYS A 1 111 ? -11.921 10.776  -1.057 1.00 65.04  ? 111  LYS A CB  1 
ATOM   863  C CG  . LYS A 1 111 ? -13.036 9.986   -1.706 1.00 71.60  ? 111  LYS A CG  1 
ATOM   864  C CD  . LYS A 1 111 ? -13.853 10.862  -2.641 1.00 82.68  ? 111  LYS A CD  1 
ATOM   865  C CE  . LYS A 1 111 ? -15.351 10.819  -2.301 1.00 86.45  ? 111  LYS A CE  1 
ATOM   866  N NZ  . LYS A 1 111 ? -16.037 9.581   -2.783 1.00 90.70  ? 111  LYS A NZ  1 
ATOM   867  N N   . THR A 1 112 ? -14.444 11.825  1.111  1.00 62.51  ? 112  THR A N   1 
ATOM   868  C CA  . THR A 1 112 ? -15.297 11.362  2.197  1.00 58.66  ? 112  THR A CA  1 
ATOM   869  C C   . THR A 1 112 ? -16.193 10.230  1.730  1.00 62.13  ? 112  THR A C   1 
ATOM   870  O O   . THR A 1 112 ? -16.848 10.343  0.697  1.00 64.66  ? 112  THR A O   1 
ATOM   871  C CB  . THR A 1 112 ? -16.169 12.493  2.752  1.00 57.70  ? 112  THR A CB  1 
ATOM   872  O OG1 . THR A 1 112 ? -15.351 13.396  3.506  1.00 69.52  ? 112  THR A OG1 1 
ATOM   873  C CG2 . THR A 1 112 ? -17.262 11.928  3.660  1.00 59.75  ? 112  THR A CG2 1 
ATOM   874  N N   . TYR A 1 113 ? -16.210 9.134   2.484  1.00 62.35  ? 113  TYR A N   1 
ATOM   875  C CA  . TYR A 1 113 ? -17.150 8.047   2.220  1.00 62.41  ? 113  TYR A CA  1 
ATOM   876  C C   . TYR A 1 113 ? -18.165 7.874   3.347  1.00 66.02  ? 113  TYR A C   1 
ATOM   877  O O   . TYR A 1 113 ? -17.885 8.155   4.519  1.00 65.42  ? 113  TYR A O   1 
ATOM   878  C CB  . TYR A 1 113 ? -16.430 6.719   2.021  1.00 54.82  ? 113  TYR A CB  1 
ATOM   879  C CG  . TYR A 1 113 ? -15.505 6.674   0.845  1.00 74.70  ? 113  TYR A CG  1 
ATOM   880  C CD1 . TYR A 1 113 ? -15.991 6.453   -0.439 1.00 77.65  ? 113  TYR A CD1 1 
ATOM   881  C CD2 . TYR A 1 113 ? -14.130 6.825   1.015  1.00 72.16  ? 113  TYR A CD2 1 
ATOM   882  C CE1 . TYR A 1 113 ? -15.128 6.396   -1.530 1.00 78.89  ? 113  TYR A CE1 1 
ATOM   883  C CE2 . TYR A 1 113 ? -13.272 6.772   -0.061 1.00 80.07  ? 113  TYR A CE2 1 
ATOM   884  C CZ  . TYR A 1 113 ? -13.777 6.555   -1.332 1.00 79.77  ? 113  TYR A CZ  1 
ATOM   885  O OH  . TYR A 1 113 ? -12.917 6.502   -2.401 1.00 93.40  ? 113  TYR A OH  1 
ATOM   886  N N   . TYR A 1 114 ? -19.336 7.380   2.976  1.00 63.66  ? 114  TYR A N   1 
ATOM   887  C CA  . TYR A 1 114 ? -20.384 7.068   3.936  1.00 67.22  ? 114  TYR A CA  1 
ATOM   888  C C   . TYR A 1 114 ? -20.839 5.643   3.723  1.00 70.54  ? 114  TYR A C   1 
ATOM   889  O O   . TYR A 1 114 ? -21.599 5.362   2.798  1.00 75.64  ? 114  TYR A O   1 
ATOM   890  C CB  . TYR A 1 114 ? -21.576 7.978   3.735  1.00 62.33  ? 114  TYR A CB  1 
ATOM   891  C CG  . TYR A 1 114 ? -21.315 9.430   4.027  1.00 67.81  ? 114  TYR A CG  1 
ATOM   892  C CD1 . TYR A 1 114 ? -21.103 9.867   5.323  1.00 61.49  ? 114  TYR A CD1 1 
ATOM   893  C CD2 . TYR A 1 114 ? -21.310 10.372  3.004  1.00 68.40  ? 114  TYR A CD2 1 
ATOM   894  C CE1 . TYR A 1 114 ? -20.881 11.200  5.598  1.00 64.02  ? 114  TYR A CE1 1 
ATOM   895  C CE2 . TYR A 1 114 ? -21.092 11.703  3.264  1.00 66.28  ? 114  TYR A CE2 1 
ATOM   896  C CZ  . TYR A 1 114 ? -20.882 12.114  4.567  1.00 66.26  ? 114  TYR A CZ  1 
ATOM   897  O OH  . TYR A 1 114 ? -20.678 13.446  4.836  1.00 59.66  ? 114  TYR A OH  1 
ATOM   898  N N   . ILE A 1 115 ? -20.373 4.742   4.574  1.00 68.20  ? 115  ILE A N   1 
ATOM   899  C CA  . ILE A 1 115 ? -20.734 3.345   4.447  1.00 66.74  ? 115  ILE A CA  1 
ATOM   900  C C   . ILE A 1 115 ? -21.819 3.016   5.455  1.00 69.97  ? 115  ILE A C   1 
ATOM   901  O O   . ILE A 1 115 ? -21.610 3.133   6.663  1.00 70.46  ? 115  ILE A O   1 
ATOM   902  C CB  . ILE A 1 115 ? -19.520 2.418   4.629  1.00 76.21  ? 115  ILE A CB  1 
ATOM   903  C CG1 . ILE A 1 115 ? -18.437 2.748   3.598  1.00 75.69  ? 115  ILE A CG1 1 
ATOM   904  C CG2 . ILE A 1 115 ? -19.935 0.961   4.497  1.00 80.88  ? 115  ILE A CG2 1 
ATOM   905  C CD1 . ILE A 1 115 ? -17.766 4.091   3.799  1.00 69.61  ? 115  ILE A CD1 1 
ATOM   906  N N   . PRO A 1 116 ? -23.001 2.640   4.951  1.00 74.76  ? 116  PRO A N   1 
ATOM   907  C CA  . PRO A 1 116 ? -24.132 2.236   5.791  1.00 74.12  ? 116  PRO A CA  1 
ATOM   908  C C   . PRO A 1 116 ? -23.671 1.148   6.739  1.00 74.55  ? 116  PRO A C   1 
ATOM   909  O O   . PRO A 1 116 ? -23.084 0.170   6.285  1.00 82.37  ? 116  PRO A O   1 
ATOM   910  C CB  . PRO A 1 116 ? -25.115 1.644   4.782  1.00 75.75  ? 116  PRO A CB  1 
ATOM   911  C CG  . PRO A 1 116 ? -24.805 2.341   3.490  1.00 73.65  ? 116  PRO A CG  1 
ATOM   912  C CD  . PRO A 1 116 ? -23.315 2.572   3.512  1.00 70.29  ? 116  PRO A CD  1 
ATOM   913  N N   . GLU A 1 117 ? -23.915 1.314   8.031  1.00 66.77  ? 117  GLU A N   1 
ATOM   914  C CA  . GLU A 1 117 ? -23.504 0.315   9.007  1.00 75.47  ? 117  GLU A CA  1 
ATOM   915  C C   . GLU A 1 117 ? -24.033 -1.070  8.623  1.00 77.07  ? 117  GLU A C   1 
ATOM   916  O O   . GLU A 1 117 ? -23.349 -2.074  8.809  1.00 73.53  ? 117  GLU A O   1 
ATOM   917  C CB  . GLU A 1 117 ? -23.982 0.701   10.415 1.00 81.40  ? 117  GLU A CB  1 
ATOM   918  C CG  . GLU A 1 117 ? -23.503 2.072   10.903 1.00 89.90  ? 117  GLU A CG  1 
ATOM   919  C CD  . GLU A 1 117 ? -22.042 2.087   11.336 1.00 97.12  ? 117  GLU A CD  1 
ATOM   920  O OE1 . GLU A 1 117 ? -21.371 1.036   11.251 1.00 98.59  ? 117  GLU A OE1 1 
ATOM   921  O OE2 . GLU A 1 117 ? -21.564 3.158   11.768 1.00 100.70 ? 117  GLU A OE2 1 
ATOM   922  N N   . SER A 1 118 ? -25.247 -1.116  8.079  1.00 78.07  ? 118  SER A N   1 
ATOM   923  C CA  . SER A 1 118 ? -25.870 -2.376  7.672  1.00 73.10  ? 118  SER A CA  1 
ATOM   924  C C   . SER A 1 118 ? -25.076 -3.128  6.604  1.00 82.05  ? 118  SER A C   1 
ATOM   925  O O   . SER A 1 118 ? -25.432 -4.245  6.232  1.00 96.71  ? 118  SER A O   1 
ATOM   926  C CB  . SER A 1 118 ? -27.294 -2.130  7.170  1.00 80.07  ? 118  SER A CB  1 
ATOM   927  O OG  . SER A 1 118 ? -27.290 -1.452  5.928  1.00 77.79  ? 118  SER A OG  1 
ATOM   928  N N   . ALA A 1 119 ? -24.013 -2.510  6.101  1.00 72.37  ? 119  ALA A N   1 
ATOM   929  C CA  . ALA A 1 119 ? -23.153 -3.146  5.111  1.00 82.32  ? 119  ALA A CA  1 
ATOM   930  C C   . ALA A 1 119 ? -21.861 -3.643  5.757  1.00 89.22  ? 119  ALA A C   1 
ATOM   931  O O   . ALA A 1 119 ? -20.915 -4.023  5.067  1.00 87.52  ? 119  ALA A O   1 
ATOM   932  C CB  . ALA A 1 119 ? -22.842 -2.177  3.974  1.00 81.25  ? 119  ALA A CB  1 
ATOM   933  N N   . GLY A 1 120 ? -21.833 -3.624  7.087  1.00 94.46  ? 120  GLY A N   1 
ATOM   934  C CA  . GLY A 1 120 ? -20.672 -4.044  7.850  1.00 94.85  ? 120  GLY A CA  1 
ATOM   935  C C   . GLY A 1 120 ? -19.413 -3.271  7.517  1.00 100.95 ? 120  GLY A C   1 
ATOM   936  O O   . GLY A 1 120 ? -18.876 -3.391  6.420  1.00 108.40 ? 120  GLY A O   1 
ATOM   937  N N   . ILE A 1 121 ? -18.932 -2.473  8.463  1.00 101.44 ? 121  ILE A N   1 
ATOM   938  C CA  . ILE A 1 121 ? -17.682 -1.757  8.257  1.00 105.18 ? 121  ILE A CA  1 
ATOM   939  C C   . ILE A 1 121 ? -16.535 -2.745  8.382  1.00 111.99 ? 121  ILE A C   1 
ATOM   940  O O   . ILE A 1 121 ? -16.496 -3.543  9.317  1.00 118.41 ? 121  ILE A O   1 
ATOM   941  C CB  . ILE A 1 121 ? -17.495 -0.619  9.275  1.00 101.45 ? 121  ILE A CB  1 
ATOM   942  C CG1 . ILE A 1 121 ? -18.764 0.237   9.360  1.00 106.36 ? 121  ILE A CG1 1 
ATOM   943  C CG2 . ILE A 1 121 ? -16.278 0.227   8.915  1.00 89.63  ? 121  ILE A CG2 1 
ATOM   944  C CD1 . ILE A 1 121 ? -19.167 0.873   8.046  1.00 106.46 ? 121  ILE A CD1 1 
ATOM   945  N N   . GLU A 1 122 ? -15.608 -2.702  7.434  1.00 110.40 ? 122  GLU A N   1 
ATOM   946  C CA  . GLU A 1 122 ? -14.503 -3.644  7.440  1.00 113.26 ? 122  GLU A CA  1 
ATOM   947  C C   . GLU A 1 122 ? -13.746 -3.550  8.757  1.00 115.14 ? 122  GLU A C   1 
ATOM   948  O O   . GLU A 1 122 ? -13.403 -2.453  9.206  1.00 110.43 ? 122  GLU A O   1 
ATOM   949  C CB  . GLU A 1 122 ? -13.559 -3.383  6.268  1.00 111.98 ? 122  GLU A CB  1 
ATOM   950  C CG  . GLU A 1 122 ? -12.894 -4.639  5.737  1.00 115.02 ? 122  GLU A CG  1 
ATOM   951  C CD  . GLU A 1 122 ? -13.903 -5.627  5.177  1.00 121.18 ? 122  GLU A CD  1 
ATOM   952  O OE1 . GLU A 1 122 ? -14.192 -5.560  3.963  1.00 119.96 ? 122  GLU A OE1 1 
ATOM   953  O OE2 . GLU A 1 122 ? -14.413 -6.465  5.954  1.00 125.50 ? 122  GLU A OE2 1 
ATOM   954  N N   . PRO A 1 123 ? -13.502 -4.703  9.396  1.00 117.11 ? 123  PRO A N   1 
ATOM   955  C CA  . PRO A 1 123 ? -12.678 -4.702  10.603 1.00 115.53 ? 123  PRO A CA  1 
ATOM   956  C C   . PRO A 1 123 ? -11.245 -4.409  10.189 1.00 115.46 ? 123  PRO A C   1 
ATOM   957  O O   . PRO A 1 123 ? -10.782 -4.965  9.194  1.00 120.47 ? 123  PRO A O   1 
ATOM   958  C CB  . PRO A 1 123 ? -12.794 -6.144  11.114 1.00 114.27 ? 123  PRO A CB  1 
ATOM   959  C CG  . PRO A 1 123 ? -13.932 -6.753  10.362 1.00 116.09 ? 123  PRO A CG  1 
ATOM   960  C CD  . PRO A 1 123 ? -13.968 -6.053  9.047  1.00 117.20 ? 123  PRO A CD  1 
ATOM   961  N N   . GLY A 1 124 ? -10.560 -3.539  10.921 1.00 107.14 ? 124  GLY A N   1 
ATOM   962  C CA  . GLY A 1 124 ? -9.188  -3.205  10.591 1.00 105.53 ? 124  GLY A CA  1 
ATOM   963  C C   . GLY A 1 124 ? -9.043  -1.782  10.095 1.00 106.11 ? 124  GLY A C   1 
ATOM   964  O O   . GLY A 1 124 ? -7.934  -1.298  9.869  1.00 106.16 ? 124  GLY A O   1 
ATOM   965  N N   . LEU A 1 125 ? -10.171 -1.106  9.925  1.00 104.65 ? 125  LEU A N   1 
ATOM   966  C CA  . LEU A 1 125 ? -10.159 0.276   9.476  1.00 99.99  ? 125  LEU A CA  1 
ATOM   967  C C   . LEU A 1 125 ? -9.963  1.220   10.654 1.00 94.71  ? 125  LEU A C   1 
ATOM   968  O O   . LEU A 1 125 ? -10.779 1.253   11.576 1.00 97.70  ? 125  LEU A O   1 
ATOM   969  C CB  . LEU A 1 125 ? -11.463 0.613   8.758  1.00 101.34 ? 125  LEU A CB  1 
ATOM   970  C CG  . LEU A 1 125 ? -11.569 0.210   7.290  1.00 104.41 ? 125  LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 125 ? -11.109 -1.222  7.088  1.00 110.05 ? 125  LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 125 ? -12.992 0.411   6.785  1.00 104.52 ? 125  LEU A CD2 1 
ATOM   973  N N   . ARG A 1 126 ? -8.880  1.987   10.615 1.00 84.08  ? 126  ARG A N   1 
ATOM   974  C CA  . ARG A 1 126 ? -8.610  2.986   11.639 1.00 87.77  ? 126  ARG A CA  1 
ATOM   975  C C   . ARG A 1 126 ? -7.993  4.222   11.000 1.00 80.41  ? 126  ARG A C   1 
ATOM   976  O O   . ARG A 1 126 ? -7.470  4.153   9.886  1.00 82.39  ? 126  ARG A O   1 
ATOM   977  C CB  . ARG A 1 126 ? -7.659  2.420   12.704 1.00 100.13 ? 126  ARG A CB  1 
ATOM   978  C CG  . ARG A 1 126 ? -8.216  1.243   13.508 1.00 110.93 ? 126  ARG A CG  1 
ATOM   979  C CD  . ARG A 1 126 ? -7.124  0.543   14.321 1.00 117.55 ? 126  ARG A CD  1 
ATOM   980  N NE  . ARG A 1 126 ? -7.300  0.691   15.767 1.00 120.08 ? 126  ARG A NE  1 
ATOM   981  C CZ  . ARG A 1 126 ? -7.969  -0.164  16.537 1.00 119.39 ? 126  ARG A CZ  1 
ATOM   982  N NH1 . ARG A 1 126 ? -8.539  -1.239  16.006 1.00 118.91 ? 126  ARG A NH1 1 
ATOM   983  N NH2 . ARG A 1 126 ? -8.070  0.055   17.842 1.00 116.07 ? 126  ARG A NH2 1 
ATOM   984  N N   . VAL A 1 127 ? -8.063  5.352   11.699 1.00 74.35  ? 127  VAL A N   1 
ATOM   985  C CA  . VAL A 1 127 ? -7.277  6.514   11.316 1.00 66.01  ? 127  VAL A CA  1 
ATOM   986  C C   . VAL A 1 127 ? -5.824  6.072   11.202 1.00 74.12  ? 127  VAL A C   1 
ATOM   987  O O   . VAL A 1 127 ? -5.259  5.528   12.148 1.00 76.38  ? 127  VAL A O   1 
ATOM   988  C CB  . VAL A 1 127 ? -7.352  7.629   12.366 1.00 61.12  ? 127  VAL A CB  1 
ATOM   989  C CG1 . VAL A 1 127 ? -6.386  8.752   12.009 1.00 60.83  ? 127  VAL A CG1 1 
ATOM   990  C CG2 . VAL A 1 127 ? -8.768  8.156   12.483 1.00 60.25  ? 127  VAL A CG2 1 
ATOM   991  N N   . GLY A 1 128 ? -5.225  6.293   10.041 1.00 79.12  ? 128  GLY A N   1 
ATOM   992  C CA  . GLY A 1 128 ? -3.863  5.863   9.807  1.00 77.19  ? 128  GLY A CA  1 
ATOM   993  C C   . GLY A 1 128 ? -3.769  4.662   8.886  1.00 82.16  ? 128  GLY A C   1 
ATOM   994  O O   . GLY A 1 128 ? -2.688  4.307   8.429  1.00 91.38  ? 128  GLY A O   1 
ATOM   995  N N   . THR A 1 129 ? -4.903  4.031   8.610  1.00 81.94  ? 129  THR A N   1 
ATOM   996  C CA  . THR A 1 129 ? -4.915  2.844   7.764  1.00 81.13  ? 129  THR A CA  1 
ATOM   997  C C   . THR A 1 129 ? -4.770  3.190   6.278  1.00 78.75  ? 129  THR A C   1 
ATOM   998  O O   . THR A 1 129 ? -5.519  4.012   5.740  1.00 73.95  ? 129  THR A O   1 
ATOM   999  C CB  . THR A 1 129 ? -6.214  2.040   7.961  1.00 82.71  ? 129  THR A CB  1 
ATOM   1000 O OG1 . THR A 1 129 ? -6.415  1.787   9.355  1.00 80.76  ? 129  THR A OG1 1 
ATOM   1001 C CG2 . THR A 1 129 ? -6.148  0.718   7.204  1.00 78.32  ? 129  THR A CG2 1 
ATOM   1002 N N   . LYS A 1 130 ? -3.809  2.551   5.620  1.00 80.67  ? 130  LYS A N   1 
ATOM   1003 C CA  . LYS A 1 130 ? -3.625  2.726   4.186  1.00 88.46  ? 130  LYS A CA  1 
ATOM   1004 C C   . LYS A 1 130 ? -4.701  1.961   3.426  1.00 91.52  ? 130  LYS A C   1 
ATOM   1005 O O   . LYS A 1 130 ? -5.069  0.845   3.797  1.00 94.59  ? 130  LYS A O   1 
ATOM   1006 C CB  . LYS A 1 130 ? -2.238  2.247   3.747  1.00 97.32  ? 130  LYS A CB  1 
ATOM   1007 C CG  . LYS A 1 130 ? -1.081  2.965   4.429  1.00 104.62 ? 130  LYS A CG  1 
ATOM   1008 C CD  . LYS A 1 130 ? -0.301  2.029   5.345  1.00 111.22 ? 130  LYS A CD  1 
ATOM   1009 C CE  . LYS A 1 130 ? 0.397   0.927   4.552  1.00 117.54 ? 130  LYS A CE  1 
ATOM   1010 N NZ  . LYS A 1 130 ? 1.220   0.031   5.418  1.00 118.10 ? 130  LYS A NZ  1 
ATOM   1011 N N   . VAL A 1 131 ? -5.208  2.567   2.362  1.00 90.37  ? 131  VAL A N   1 
ATOM   1012 C CA  . VAL A 1 131 ? -6.221  1.926   1.541  1.00 94.78  ? 131  VAL A CA  1 
ATOM   1013 C C   . VAL A 1 131 ? -5.857  2.043   0.068  1.00 96.15  ? 131  VAL A C   1 
ATOM   1014 O O   . VAL A 1 131 ? -5.226  3.013   -0.351 1.00 96.23  ? 131  VAL A O   1 
ATOM   1015 C CB  . VAL A 1 131 ? -7.597  2.556   1.782  1.00 91.86  ? 131  VAL A CB  1 
ATOM   1016 C CG1 . VAL A 1 131 ? -7.877  2.610   3.264  1.00 87.90  ? 131  VAL A CG1 1 
ATOM   1017 C CG2 . VAL A 1 131 ? -7.653  3.955   1.193  1.00 93.51  ? 131  VAL A CG2 1 
ATOM   1018 N N   . LYS A 1 132 ? -6.240  1.048   -0.721 1.00 97.16  ? 132  LYS A N   1 
ATOM   1019 C CA  . LYS A 1 132 ? -5.998  1.123   -2.154 1.00 102.36 ? 132  LYS A CA  1 
ATOM   1020 C C   . LYS A 1 132 ? -7.263  0.827   -2.949 1.00 102.20 ? 132  LYS A C   1 
ATOM   1021 O O   . LYS A 1 132 ? -8.196  0.205   -2.443 1.00 106.96 ? 132  LYS A O   1 
ATOM   1022 C CB  . LYS A 1 132 ? -4.835  0.214   -2.583 1.00 101.99 ? 132  LYS A CB  1 
ATOM   1023 C CG  . LYS A 1 132 ? -4.969  -1.248  -2.188 1.00 106.77 ? 132  LYS A CG  1 
ATOM   1024 C CD  . LYS A 1 132 ? -3.877  -2.100  -2.845 1.00 117.60 ? 132  LYS A CD  1 
ATOM   1025 C CE  . LYS A 1 132 ? -2.474  -1.613  -2.472 1.00 120.80 ? 132  LYS A CE  1 
ATOM   1026 N NZ  . LYS A 1 132 ? -1.383  -2.486  -3.002 1.00 118.16 ? 132  LYS A NZ  1 
ATOM   1027 N N   . GLN A 1 133 ? -7.287  1.294   -4.193 1.00 99.94  ? 133  GLN A N   1 
ATOM   1028 C CA  . GLN A 1 133 ? -8.451  1.133   -5.053 1.00 113.18 ? 133  GLN A CA  1 
ATOM   1029 C C   . GLN A 1 133 ? -8.787  -0.334  -5.260 1.00 112.65 ? 133  GLN A C   1 
ATOM   1030 O O   . GLN A 1 133 ? -7.902  -1.155  -5.490 1.00 113.38 ? 133  GLN A O   1 
ATOM   1031 C CB  . GLN A 1 133 ? -8.210  1.803   -6.402 1.00 124.04 ? 133  GLN A CB  1 
ATOM   1032 C CG  . GLN A 1 133 ? -7.644  3.202   -6.285 1.00 132.93 ? 133  GLN A CG  1 
ATOM   1033 C CD  . GLN A 1 133 ? -7.493  3.877   -7.629 1.00 136.26 ? 133  GLN A CD  1 
ATOM   1034 O OE1 . GLN A 1 133 ? -8.304  3.669   -8.535 1.00 129.59 ? 133  GLN A OE1 1 
ATOM   1035 N NE2 . GLN A 1 133 ? -6.446  4.687   -7.771 1.00 137.88 ? 133  GLN A NE2 1 
ATOM   1036 N N   . GLY A 1 134 ? -10.072 -0.655  -5.179 1.00 110.04 ? 134  GLY A N   1 
ATOM   1037 C CA  . GLY A 1 134 ? -10.523 -2.025  -5.324 1.00 105.95 ? 134  GLY A CA  1 
ATOM   1038 C C   . GLY A 1 134 ? -10.715 -2.687  -3.977 1.00 101.34 ? 134  GLY A C   1 
ATOM   1039 O O   . GLY A 1 134 ? -11.536 -3.591  -3.836 1.00 109.28 ? 134  GLY A O   1 
ATOM   1040 N N   . LEU A 1 135 ? -9.952  -2.240  -2.985 1.00 92.84  ? 135  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 135 ? -10.126 -2.724  -1.624 1.00 98.88  ? 135  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 135 ? -11.480 -2.279  -1.075 1.00 109.37 ? 135  LEU A C   1 
ATOM   1043 O O   . LEU A 1 135 ? -11.779 -1.083  -1.035 1.00 110.88 ? 135  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 135 ? -8.993  -2.227  -0.723 1.00 93.60  ? 135  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 135 ? -9.295  -2.083  0.773  1.00 87.63  ? 135  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 135 ? -8.093  -2.462  1.629  1.00 78.31  ? 135  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 135 ? -9.742  -0.667  1.079  1.00 89.67  ? 135  LEU A CD2 1 
ATOM   1048 N N   . PRO A 1 136 ? -12.311 -3.247  -0.661 1.00 110.94 ? 136  PRO A N   1 
ATOM   1049 C CA  . PRO A 1 136 ? -13.621 -2.908  -0.104 1.00 108.30 ? 136  PRO A CA  1 
ATOM   1050 C C   . PRO A 1 136 ? -13.470 -2.162  1.210  1.00 99.75  ? 136  PRO A C   1 
ATOM   1051 O O   . PRO A 1 136 ? -12.471 -2.322  1.911  1.00 95.19  ? 136  PRO A O   1 
ATOM   1052 C CB  . PRO A 1 136 ? -14.265 -4.276  0.149  1.00 110.05 ? 136  PRO A CB  1 
ATOM   1053 C CG  . PRO A 1 136 ? -13.509 -5.229  -0.715 1.00 113.69 ? 136  PRO A CG  1 
ATOM   1054 C CD  . PRO A 1 136 ? -12.108 -4.703  -0.747 1.00 111.83 ? 136  PRO A CD  1 
ATOM   1055 N N   . LEU A 1 137 ? -14.457 -1.337  1.525  1.00 96.22  ? 137  LEU A N   1 
ATOM   1056 C CA  . LEU A 1 137 ? -14.520 -0.687  2.819  1.00 90.14  ? 137  LEU A CA  1 
ATOM   1057 C C   . LEU A 1 137 ? -15.624 -1.354  3.627  1.00 91.12  ? 137  LEU A C   1 
ATOM   1058 O O   . LEU A 1 137 ? -15.568 -1.409  4.855  1.00 96.72  ? 137  LEU A O   1 
ATOM   1059 C CB  . LEU A 1 137 ? -14.806 0.801   2.646  1.00 83.57  ? 137  LEU A CB  1 
ATOM   1060 C CG  . LEU A 1 137 ? -13.826 1.530   1.728  1.00 72.75  ? 137  LEU A CG  1 
ATOM   1061 C CD1 . LEU A 1 137 ? -14.275 2.962   1.508  1.00 71.77  ? 137  LEU A CD1 1 
ATOM   1062 C CD2 . LEU A 1 137 ? -12.427 1.491   2.314  1.00 77.01  ? 137  LEU A CD2 1 
ATOM   1063 N N   . SER A 1 138 ? -16.624 -1.867  2.918  1.00 88.20  ? 138  SER A N   1 
ATOM   1064 C CA  . SER A 1 138 ? -17.713 -2.610  3.535  1.00 98.35  ? 138  SER A CA  1 
ATOM   1065 C C   . SER A 1 138 ? -17.357 -4.090  3.609  1.00 106.86 ? 138  SER A C   1 
ATOM   1066 O O   . SER A 1 138 ? -16.633 -4.603  2.758  1.00 106.49 ? 138  SER A O   1 
ATOM   1067 C CB  . SER A 1 138 ? -19.009 -2.421  2.741  1.00 98.83  ? 138  SER A CB  1 
ATOM   1068 O OG  . SER A 1 138 ? -18.849 -2.852  1.401  1.00 100.11 ? 138  SER A OG  1 
ATOM   1069 N N   . LYS A 1 139 ? -17.873 -4.769  4.630  1.00 114.37 ? 139  LYS A N   1 
ATOM   1070 C CA  . LYS A 1 139 ? -17.576 -6.181  4.851  1.00 121.72 ? 139  LYS A CA  1 
ATOM   1071 C C   . LYS A 1 139 ? -18.074 -7.044  3.688  1.00 124.87 ? 139  LYS A C   1 
ATOM   1072 O O   . LYS A 1 139 ? -17.557 -8.136  3.442  1.00 128.45 ? 139  LYS A O   1 
ATOM   1073 C CB  . LYS A 1 139 ? -18.163 -6.648  6.192  1.00 123.52 ? 139  LYS A CB  1 
ATOM   1074 C CG  . LYS A 1 139 ? -17.796 -8.074  6.590  1.00 130.95 ? 139  LYS A CG  1 
ATOM   1075 C CD  . LYS A 1 139 ? -18.838 -9.075  6.097  1.00 138.31 ? 139  LYS A CD  1 
ATOM   1076 C CE  . LYS A 1 139 ? -18.361 -10.514 6.248  1.00 141.99 ? 139  LYS A CE  1 
ATOM   1077 N NZ  . LYS A 1 139 ? -17.239 -10.834 5.317  1.00 143.53 ? 139  LYS A NZ  1 
ATOM   1078 N N   . ASN A 1 140 ? -19.071 -6.548  2.966  1.00 120.87 ? 140  ASN A N   1 
ATOM   1079 C CA  . ASN A 1 140 ? -19.560 -7.251  1.789  1.00 124.32 ? 140  ASN A CA  1 
ATOM   1080 C C   . ASN A 1 140 ? -19.136 -6.564  0.498  1.00 127.89 ? 140  ASN A C   1 
ATOM   1081 O O   . ASN A 1 140 ? -18.005 -6.095  0.367  1.00 117.08 ? 140  ASN A O   1 
ATOM   1082 C CB  . ASN A 1 140 ? -21.081 -7.383  1.837  1.00 120.21 ? 140  ASN A CB  1 
ATOM   1083 C CG  . ASN A 1 140 ? -21.762 -6.093  2.234  1.00 117.05 ? 140  ASN A CG  1 
ATOM   1084 O OD1 . ASN A 1 140 ? -21.913 -5.804  3.418  1.00 117.44 ? 140  ASN A OD1 1 
ATOM   1085 N ND2 . ASN A 1 140 ? -22.179 -5.308  1.246  1.00 114.24 ? 140  ASN A ND2 1 
ATOM   1086 N N   . GLU A 1 141 ? -20.053 -6.518  -0.460 1.00 139.13 ? 141  GLU A N   1 
ATOM   1087 C CA  . GLU A 1 141 ? -19.814 -5.807  -1.705 1.00 144.48 ? 141  GLU A CA  1 
ATOM   1088 C C   . GLU A 1 141 ? -20.236 -4.352  -1.554 1.00 134.26 ? 141  GLU A C   1 
ATOM   1089 O O   . GLU A 1 141 ? -20.492 -3.884  -0.445 1.00 132.31 ? 141  GLU A O   1 
ATOM   1090 C CB  . GLU A 1 141 ? -20.565 -6.471  -2.862 1.00 157.63 ? 141  GLU A CB  1 
ATOM   1091 C CG  . GLU A 1 141 ? -21.870 -7.152  -2.462 1.00 165.71 ? 141  GLU A CG  1 
ATOM   1092 C CD  . GLU A 1 141 ? -21.694 -8.635  -2.188 1.00 170.41 ? 141  GLU A CD  1 
ATOM   1093 O OE1 . GLU A 1 141 ? -20.597 -9.168  -2.467 1.00 169.86 ? 141  GLU A OE1 1 
ATOM   1094 O OE2 . GLU A 1 141 ? -22.654 -9.269  -1.699 1.00 172.33 ? 141  GLU A OE2 1 
ATOM   1095 N N   . GLU A 1 142 ? -20.314 -3.643  -2.674 1.00 127.52 ? 142  GLU A N   1 
ATOM   1096 C CA  . GLU A 1 142 ? -20.642 -2.225  -2.665 1.00 116.88 ? 142  GLU A CA  1 
ATOM   1097 C C   . GLU A 1 142 ? -19.571 -1.475  -1.886 1.00 110.98 ? 142  GLU A C   1 
ATOM   1098 O O   . GLU A 1 142 ? -18.741 -2.081  -1.207 1.00 107.57 ? 142  GLU A O   1 
ATOM   1099 C CB  . GLU A 1 142 ? -22.021 -1.981  -2.041 1.00 119.16 ? 142  GLU A CB  1 
ATOM   1100 C CG  . GLU A 1 142 ? -23.120 -2.966  -2.471 1.00 131.18 ? 142  GLU A CG  1 
ATOM   1101 C CD  . GLU A 1 142 ? -23.583 -2.784  -3.917 1.00 136.21 ? 142  GLU A CD  1 
ATOM   1102 O OE1 . GLU A 1 142 ? -24.807 -2.651  -4.138 1.00 136.03 ? 142  GLU A OE1 1 
ATOM   1103 O OE2 . GLU A 1 142 ? -22.730 -2.790  -4.832 1.00 138.23 ? 142  GLU A OE2 1 
ATOM   1104 N N   . TYR A 1 143 ? -19.584 -0.153  -1.995 1.00 105.89 ? 143  TYR A N   1 
ATOM   1105 C CA  . TYR A 1 143 ? -18.672 0.683   -1.224 1.00 89.68  ? 143  TYR A CA  1 
ATOM   1106 C C   . TYR A 1 143 ? -17.251 0.130   -1.232 1.00 93.50  ? 143  TYR A C   1 
ATOM   1107 O O   . TYR A 1 143 ? -16.756 -0.378  -0.223 1.00 92.94  ? 143  TYR A O   1 
ATOM   1108 C CB  . TYR A 1 143 ? -19.186 0.853   0.211  1.00 66.45  ? 143  TYR A CB  1 
ATOM   1109 C CG  . TYR A 1 143 ? -20.660 1.126   0.275  1.00 65.31  ? 143  TYR A CG  1 
ATOM   1110 C CD1 . TYR A 1 143 ? -21.165 2.395   0.019  1.00 72.54  ? 143  TYR A CD1 1 
ATOM   1111 C CD2 . TYR A 1 143 ? -21.563 0.113   0.573  1.00 63.31  ? 143  TYR A CD2 1 
ATOM   1112 C CE1 . TYR A 1 143 ? -22.532 2.644   0.065  1.00 71.80  ? 143  TYR A CE1 1 
ATOM   1113 C CE2 . TYR A 1 143 ? -22.920 0.358   0.627  1.00 63.86  ? 143  TYR A CE2 1 
ATOM   1114 C CZ  . TYR A 1 143 ? -23.405 1.622   0.370  1.00 76.87  ? 143  TYR A CZ  1 
ATOM   1115 O OH  . TYR A 1 143 ? -24.776 1.863   0.425  1.00 76.38  ? 143  TYR A OH  1 
ATOM   1116 N N   . ILE A 1 144 ? -16.608 0.226   -2.388 1.00 94.72  ? 144  ILE A N   1 
ATOM   1117 C CA  . ILE A 1 144 ? -15.201 -0.113  -2.510 1.00 95.05  ? 144  ILE A CA  1 
ATOM   1118 C C   . ILE A 1 144 ? -14.425 1.194   -2.561 1.00 88.83  ? 144  ILE A C   1 
ATOM   1119 O O   . ILE A 1 144 ? -14.971 2.222   -2.960 1.00 87.33  ? 144  ILE A O   1 
ATOM   1120 C CB  . ILE A 1 144 ? -14.939 -0.919  -3.788 1.00 102.01 ? 144  ILE A CB  1 
ATOM   1121 C CG1 . ILE A 1 144 ? -15.199 -0.052  -5.024 1.00 106.35 ? 144  ILE A CG1 1 
ATOM   1122 C CG2 . ILE A 1 144 ? -15.825 -2.156  -3.819 1.00 94.82  ? 144  ILE A CG2 1 
ATOM   1123 C CD1 . ILE A 1 144 ? -14.883 -0.737  -6.343 1.00 107.23 ? 144  ILE A CD1 1 
ATOM   1124 N N   . CYS A 1 145 ? -13.162 1.164   -2.149 1.00 84.75  ? 145  CYS A N   1 
ATOM   1125 C CA  . CYS A 1 145 ? -12.331 2.363   -2.184 1.00 88.07  ? 145  CYS A CA  1 
ATOM   1126 C C   . CYS A 1 145 ? -11.894 2.687   -3.611 1.00 95.57  ? 145  CYS A C   1 
ATOM   1127 O O   . CYS A 1 145 ? -11.319 1.840   -4.294 1.00 100.08 ? 145  CYS A O   1 
ATOM   1128 C CB  . CYS A 1 145 ? -11.098 2.193   -1.296 1.00 92.41  ? 145  CYS A CB  1 
ATOM   1129 S SG  . CYS A 1 145 ? -9.989  3.628   -1.301 1.00 101.64 ? 145  CYS A SG  1 
ATOM   1130 N N   . GLU A 1 146 ? -12.152 3.915   -4.053 1.00 88.87  ? 146  GLU A N   1 
ATOM   1131 C CA  . GLU A 1 146 ? -11.820 4.309   -5.418 1.00 93.76  ? 146  GLU A CA  1 
ATOM   1132 C C   . GLU A 1 146 ? -10.454 4.995   -5.541 1.00 96.11  ? 146  GLU A C   1 
ATOM   1133 O O   . GLU A 1 146 ? -9.989  5.273   -6.645 1.00 96.59  ? 146  GLU A O   1 
ATOM   1134 C CB  . GLU A 1 146 ? -12.924 5.199   -6.003 1.00 91.94  ? 146  GLU A CB  1 
ATOM   1135 C CG  . GLU A 1 146 ? -13.154 6.515   -5.269 1.00 88.95  ? 146  GLU A CG  1 
ATOM   1136 C CD  . GLU A 1 146 ? -14.601 7.004   -5.385 1.00 101.65 ? 146  GLU A CD  1 
ATOM   1137 O OE1 . GLU A 1 146 ? -15.507 6.168   -5.608 1.00 110.73 ? 146  GLU A OE1 1 
ATOM   1138 O OE2 . GLU A 1 146 ? -14.839 8.225   -5.249 1.00 100.77 ? 146  GLU A OE2 1 
ATOM   1139 N N   . LEU A 1 147 ? -9.801  5.248   -4.414 1.00 91.74  ? 147  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 147 ? -8.615  6.089   -4.426 1.00 94.95  ? 147  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 147 ? -7.621  5.721   -3.335 1.00 97.96  ? 147  LEU A C   1 
ATOM   1142 O O   . LEU A 1 147 ? -7.922  5.841   -2.150 1.00 103.69 ? 147  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 147 ? -9.028  7.553   -4.273 1.00 93.72  ? 147  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 147 ? -8.406  8.545   -5.256 1.00 97.64  ? 147  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 147 ? -8.491  8.021   -6.690 1.00 95.12  ? 147  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 147 ? -9.078  9.907   -5.127 1.00 95.27  ? 147  LEU A CD2 1 
ATOM   1147 N N   . ASP A 1 148 ? -6.433  5.280   -3.739 1.00 95.34  ? 148  ASP A N   1 
ATOM   1148 C CA  . ASP A 1 148 ? -5.363  5.014   -2.786 1.00 90.57  ? 148  ASP A CA  1 
ATOM   1149 C C   . ASP A 1 148 ? -5.168  6.217   -1.884 1.00 83.08  ? 148  ASP A C   1 
ATOM   1150 O O   . ASP A 1 148 ? -5.227  7.360   -2.341 1.00 81.44  ? 148  ASP A O   1 
ATOM   1151 C CB  . ASP A 1 148 ? -4.052  4.706   -3.507 1.00 98.74  ? 148  ASP A CB  1 
ATOM   1152 C CG  . ASP A 1 148 ? -4.054  3.343   -4.159 1.00 108.49 ? 148  ASP A CG  1 
ATOM   1153 O OD1 . ASP A 1 148 ? -5.147  2.852   -4.507 1.00 118.72 ? 148  ASP A OD1 1 
ATOM   1154 O OD2 . ASP A 1 148 ? -2.964  2.762   -4.324 1.00 106.67 ? 148  ASP A OD2 1 
ATOM   1155 N N   . GLY A 1 149 ? -4.934  5.949   -0.602 1.00 80.10  ? 149  GLY A N   1 
ATOM   1156 C CA  . GLY A 1 149 ? -4.723  6.991   0.387  1.00 70.33  ? 149  GLY A CA  1 
ATOM   1157 C C   . GLY A 1 149 ? -4.692  6.434   1.799  1.00 68.98  ? 149  GLY A C   1 
ATOM   1158 O O   . GLY A 1 149 ? -4.497  5.234   2.007  1.00 62.50  ? 149  GLY A O   1 
ATOM   1159 N N   . LYS A 1 150 ? -4.875  7.314   2.777  1.00 72.21  ? 150  LYS A N   1 
ATOM   1160 C CA  . LYS A 1 150 ? -4.952  6.907   4.173  1.00 70.63  ? 150  LYS A CA  1 
ATOM   1161 C C   . LYS A 1 150 ? -6.185  7.509   4.817  1.00 66.24  ? 150  LYS A C   1 
ATOM   1162 O O   . LYS A 1 150 ? -6.657  8.579   4.415  1.00 64.64  ? 150  LYS A O   1 
ATOM   1163 C CB  . LYS A 1 150 ? -3.701  7.330   4.947  1.00 72.93  ? 150  LYS A CB  1 
ATOM   1164 C CG  . LYS A 1 150 ? -2.447  6.572   4.560  1.00 90.25  ? 150  LYS A CG  1 
ATOM   1165 C CD  . LYS A 1 150 ? -1.296  6.854   5.528  1.00 99.62  ? 150  LYS A CD  1 
ATOM   1166 C CE  . LYS A 1 150 ? -1.749  6.719   6.978  1.00 99.98  ? 150  LYS A CE  1 
ATOM   1167 N NZ  . LYS A 1 150 ? -0.619  6.474   7.925  1.00 96.80  ? 150  LYS A NZ  1 
ATOM   1168 N N   . ILE A 1 151 ? -6.715  6.816   5.815  1.00 62.32  ? 151  ILE A N   1 
ATOM   1169 C CA  . ILE A 1 151 ? -7.846  7.343   6.555  1.00 62.44  ? 151  ILE A CA  1 
ATOM   1170 C C   . ILE A 1 151 ? -7.324  8.390   7.527  1.00 61.73  ? 151  ILE A C   1 
ATOM   1171 O O   . ILE A 1 151 ? -6.392  8.127   8.282  1.00 58.35  ? 151  ILE A O   1 
ATOM   1172 C CB  . ILE A 1 151 ? -8.560  6.222   7.323  1.00 67.38  ? 151  ILE A CB  1 
ATOM   1173 C CG1 . ILE A 1 151 ? -9.130  5.200   6.339  1.00 65.17  ? 151  ILE A CG1 1 
ATOM   1174 C CG2 . ILE A 1 151 ? -9.632  6.789   8.261  1.00 56.80  ? 151  ILE A CG2 1 
ATOM   1175 C CD1 . ILE A 1 151 ? -9.665  3.956   7.004  1.00 67.96  ? 151  ILE A CD1 1 
ATOM   1176 N N   . VAL A 1 152 ? -7.913  9.581   7.493  1.00 63.16  ? 152  VAL A N   1 
ATOM   1177 C CA  . VAL A 1 152 ? -7.564  10.634  8.447  1.00 61.93  ? 152  VAL A CA  1 
ATOM   1178 C C   . VAL A 1 152 ? -8.725  10.928  9.402  1.00 64.28  ? 152  VAL A C   1 
ATOM   1179 O O   . VAL A 1 152 ? -8.635  11.792  10.269 1.00 55.58  ? 152  VAL A O   1 
ATOM   1180 C CB  . VAL A 1 152 ? -7.166  11.932  7.735  1.00 50.92  ? 152  VAL A CB  1 
ATOM   1181 C CG1 . VAL A 1 152 ? -5.893  11.714  6.924  1.00 61.96  ? 152  VAL A CG1 1 
ATOM   1182 C CG2 . VAL A 1 152 ? -8.308  12.418  6.844  1.00 51.00  ? 152  VAL A CG2 1 
ATOM   1183 N N   . GLU A 1 153 ? -9.827  10.217  9.218  1.00 71.52  ? 153  GLU A N   1 
ATOM   1184 C CA  . GLU A 1 153 ? -10.987 10.381  10.075 1.00 67.83  ? 153  GLU A CA  1 
ATOM   1185 C C   . GLU A 1 153 ? -11.991 9.295   9.777  1.00 70.49  ? 153  GLU A C   1 
ATOM   1186 O O   . GLU A 1 153 ? -12.285 8.994   8.623  1.00 59.42  ? 153  GLU A O   1 
ATOM   1187 C CB  . GLU A 1 153 ? -11.643 11.754  9.896  1.00 67.55  ? 153  GLU A CB  1 
ATOM   1188 C CG  . GLU A 1 153 ? -12.959 11.913  10.658 1.00 80.21  ? 153  GLU A CG  1 
ATOM   1189 C CD  . GLU A 1 153 ? -13.563 13.305  10.518 1.00 93.94  ? 153  GLU A CD  1 
ATOM   1190 O OE1 . GLU A 1 153 ? -12.829 14.244  10.143 1.00 98.54  ? 153  GLU A OE1 1 
ATOM   1191 O OE2 . GLU A 1 153 ? -14.776 13.463  10.777 1.00 95.66  ? 153  GLU A OE2 1 
ATOM   1192 N N   . ILE A 1 154 ? -12.490 8.689   10.842 1.00 75.25  ? 154  ILE A N   1 
ATOM   1193 C CA  . ILE A 1 154 ? -13.591 7.763   10.743 1.00 71.12  ? 154  ILE A CA  1 
ATOM   1194 C C   . ILE A 1 154 ? -14.502 8.050   11.924 1.00 76.20  ? 154  ILE A C   1 
ATOM   1195 O O   . ILE A 1 154 ? -14.049 8.201   13.056 1.00 77.04  ? 154  ILE A O   1 
ATOM   1196 C CB  . ILE A 1 154 ? -13.119 6.302   10.702 1.00 66.65  ? 154  ILE A CB  1 
ATOM   1197 C CG1 . ILE A 1 154 ? -14.228 5.375   11.191 1.00 72.77  ? 154  ILE A CG1 1 
ATOM   1198 C CG2 . ILE A 1 154 ? -11.842 6.125   11.509 1.00 65.46  ? 154  ILE A CG2 1 
ATOM   1199 C CD1 . ILE A 1 154 ? -13.988 3.925   10.846 1.00 84.10  ? 154  ILE A CD1 1 
ATOM   1200 N N   . GLU A 1 155 ? -15.791 8.159   11.645 1.00 75.06  ? 155  GLU A N   1 
ATOM   1201 C CA  . GLU A 1 155 ? -16.712 8.736   12.593 1.00 68.78  ? 155  GLU A CA  1 
ATOM   1202 C C   . GLU A 1 155 ? -18.083 8.132   12.369 1.00 65.76  ? 155  GLU A C   1 
ATOM   1203 O O   . GLU A 1 155 ? -18.510 7.956   11.228 1.00 59.68  ? 155  GLU A O   1 
ATOM   1204 C CB  . GLU A 1 155 ? -16.723 10.250  12.385 1.00 70.86  ? 155  GLU A CB  1 
ATOM   1205 C CG  . GLU A 1 155 ? -17.866 11.018  13.012 1.00 78.08  ? 155  GLU A CG  1 
ATOM   1206 C CD  . GLU A 1 155 ? -17.750 12.509  12.714 1.00 87.57  ? 155  GLU A CD  1 
ATOM   1207 O OE1 . GLU A 1 155 ? -16.616 12.985  12.509 1.00 95.51  ? 155  GLU A OE1 1 
ATOM   1208 O OE2 . GLU A 1 155 ? -18.780 13.207  12.673 1.00 88.77  ? 155  GLU A OE2 1 
ATOM   1209 N N   . ARG A 1 156 ? -18.759 7.778   13.456 1.00 62.48  ? 156  ARG A N   1 
ATOM   1210 C CA  . ARG A 1 156 ? -20.115 7.256   13.346 1.00 58.93  ? 156  ARG A CA  1 
ATOM   1211 C C   . ARG A 1 156 ? -21.086 8.416   13.201 1.00 58.63  ? 156  ARG A C   1 
ATOM   1212 O O   . ARG A 1 156 ? -20.959 9.434   13.879 1.00 57.31  ? 156  ARG A O   1 
ATOM   1213 C CB  . ARG A 1 156 ? -20.478 6.404   14.564 1.00 56.97  ? 156  ARG A CB  1 
ATOM   1214 C CG  . ARG A 1 156 ? -19.505 5.271   14.824 1.00 61.47  ? 156  ARG A CG  1 
ATOM   1215 C CD  . ARG A 1 156 ? -19.940 4.438   16.007 1.00 72.69  ? 156  ARG A CD  1 
ATOM   1216 N NE  . ARG A 1 156 ? -20.711 3.266   15.605 1.00 85.46  ? 156  ARG A NE  1 
ATOM   1217 C CZ  . ARG A 1 156 ? -20.207 2.038   15.514 1.00 85.65  ? 156  ARG A CZ  1 
ATOM   1218 N NH1 . ARG A 1 156 ? -18.931 1.816   15.809 1.00 74.29  ? 156  ARG A NH1 1 
ATOM   1219 N NH2 . ARG A 1 156 ? -20.984 1.029   15.142 1.00 90.97  ? 156  ARG A NH2 1 
ATOM   1220 N N   . MET A 1 157 ? -22.053 8.280   12.306 1.00 46.99  ? 157  MET A N   1 
ATOM   1221 C CA  . MET A 1 157 ? -23.022 9.345   12.123 1.00 47.31  ? 157  MET A CA  1 
ATOM   1222 C C   . MET A 1 157 ? -24.387 8.770   11.899 1.00 46.56  ? 157  MET A C   1 
ATOM   1223 O O   . MET A 1 157 ? -24.549 7.564   11.736 1.00 63.36  ? 157  MET A O   1 
ATOM   1224 C CB  . MET A 1 157 ? -22.644 10.245  10.939 1.00 46.85  ? 157  MET A CB  1 
ATOM   1225 C CG  . MET A 1 157 ? -21.184 10.633  10.924 1.00 52.83  ? 157  MET A CG  1 
ATOM   1226 S SD  . MET A 1 157 ? -20.826 12.080  9.935  1.00 66.56  ? 157  MET A SD  1 
ATOM   1227 C CE  . MET A 1 157 ? -21.449 13.425  10.933 1.00 58.18  ? 157  MET A CE  1 
ATOM   1228 N N   . LYS A 1 158 ? -25.369 9.658   11.904 1.00 41.62  ? 158  LYS A N   1 
ATOM   1229 C CA  . LYS A 1 158 ? -26.718 9.328   11.515 1.00 56.18  ? 158  LYS A CA  1 
ATOM   1230 C C   . LYS A 1 158 ? -26.997 10.104  10.245 1.00 53.56  ? 158  LYS A C   1 
ATOM   1231 O O   . LYS A 1 158 ? -26.808 11.318  10.195 1.00 52.38  ? 158  LYS A O   1 
ATOM   1232 C CB  . LYS A 1 158 ? -27.711 9.766   12.595 1.00 56.30  ? 158  LYS A CB  1 
ATOM   1233 C CG  . LYS A 1 158 ? -27.659 8.945   13.851 1.00 59.34  ? 158  LYS A CG  1 
ATOM   1234 C CD  . LYS A 1 158 ? -28.433 7.653   13.702 1.00 55.16  ? 158  LYS A CD  1 
ATOM   1235 C CE  . LYS A 1 158 ? -28.437 6.907   15.027 1.00 42.66  ? 158  LYS A CE  1 
ATOM   1236 N NZ  . LYS A 1 158 ? -29.341 5.720   15.038 1.00 46.90  ? 158  LYS A NZ  1 
ATOM   1237 N N   . LYS A 1 159 ? -27.435 9.404   9.216  1.00 56.99  ? 159  LYS A N   1 
ATOM   1238 C CA  . LYS A 1 159 ? -27.919 10.068  8.021  1.00 49.36  ? 159  LYS A CA  1 
ATOM   1239 C C   . LYS A 1 159 ? -29.400 10.416  8.174  1.00 51.33  ? 159  LYS A C   1 
ATOM   1240 O O   . LYS A 1 159 ? -30.251 9.534   8.204  1.00 56.35  ? 159  LYS A O   1 
ATOM   1241 C CB  . LYS A 1 159 ? -27.748 9.156   6.833  1.00 37.48  ? 159  LYS A CB  1 
ATOM   1242 C CG  . LYS A 1 159 ? -28.273 9.735   5.565  1.00 41.54  ? 159  LYS A CG  1 
ATOM   1243 C CD  . LYS A 1 159 ? -28.006 8.793   4.412  1.00 47.86  ? 159  LYS A CD  1 
ATOM   1244 C CE  . LYS A 1 159 ? -28.493 9.395   3.097  1.00 44.92  ? 159  LYS A CE  1 
ATOM   1245 N NZ  . LYS A 1 159 ? -28.623 8.313   2.111  1.00 54.56  ? 159  LYS A NZ  1 
ATOM   1246 N N   . VAL A 1 160 ? -29.701 11.706  8.256  1.00 42.75  ? 160  VAL A N   1 
ATOM   1247 C CA  . VAL A 1 160 ? -31.075 12.154  8.341  1.00 47.36  ? 160  VAL A CA  1 
ATOM   1248 C C   . VAL A 1 160 ? -31.569 12.762  7.031  1.00 50.68  ? 160  VAL A C   1 
ATOM   1249 O O   . VAL A 1 160 ? -31.008 13.741  6.532  1.00 55.11  ? 160  VAL A O   1 
ATOM   1250 C CB  . VAL A 1 160 ? -31.241 13.197  9.446  1.00 37.98  ? 160  VAL A CB  1 
ATOM   1251 C CG1 . VAL A 1 160 ? -32.697 13.594  9.541  1.00 30.94  ? 160  VAL A CG1 1 
ATOM   1252 C CG2 . VAL A 1 160 ? -30.711 12.653  10.773 1.00 41.65  ? 160  VAL A CG2 1 
ATOM   1253 N N   . VAL A 1 161 ? -32.633 12.184  6.494  1.00 48.99  ? 161  VAL A N   1 
ATOM   1254 C CA  . VAL A 1 161 ? -33.256 12.689  5.283  1.00 48.19  ? 161  VAL A CA  1 
ATOM   1255 C C   . VAL A 1 161 ? -34.570 13.365  5.604  1.00 48.48  ? 161  VAL A C   1 
ATOM   1256 O O   . VAL A 1 161 ? -35.523 12.724  6.049  1.00 56.25  ? 161  VAL A O   1 
ATOM   1257 C CB  . VAL A 1 161 ? -33.512 11.569  4.251  1.00 56.03  ? 161  VAL A CB  1 
ATOM   1258 C CG1 . VAL A 1 161 ? -34.405 12.076  3.090  1.00 54.67  ? 161  VAL A CG1 1 
ATOM   1259 C CG2 . VAL A 1 161 ? -32.212 11.052  3.716  1.00 41.54  ? 161  VAL A CG2 1 
ATOM   1260 N N   . VAL A 1 162 ? -34.608 14.672  5.387  1.00 46.70  ? 162  VAL A N   1 
ATOM   1261 C CA  . VAL A 1 162 ? -35.833 15.433  5.555  1.00 44.34  ? 162  VAL A CA  1 
ATOM   1262 C C   . VAL A 1 162 ? -36.466 15.642  4.190  1.00 60.28  ? 162  VAL A C   1 
ATOM   1263 O O   . VAL A 1 162 ? -35.801 16.044  3.232  1.00 60.79  ? 162  VAL A O   1 
ATOM   1264 C CB  . VAL A 1 162 ? -35.560 16.791  6.200  1.00 48.13  ? 162  VAL A CB  1 
ATOM   1265 C CG1 . VAL A 1 162 ? -36.827 17.614  6.260  1.00 44.87  ? 162  VAL A CG1 1 
ATOM   1266 C CG2 . VAL A 1 162 ? -34.977 16.594  7.600  1.00 54.55  ? 162  VAL A CG2 1 
ATOM   1267 N N   . GLN A 1 163 ? -37.754 15.353  4.094  1.00 71.59  ? 163  GLN A N   1 
ATOM   1268 C CA  . GLN A 1 163 ? -38.438 15.479  2.823  1.00 56.30  ? 163  GLN A CA  1 
ATOM   1269 C C   . GLN A 1 163 ? -39.478 16.585  2.849  1.00 62.03  ? 163  GLN A C   1 
ATOM   1270 O O   . GLN A 1 163 ? -40.344 16.646  3.723  1.00 66.98  ? 163  GLN A O   1 
ATOM   1271 C CB  . GLN A 1 163 ? -39.055 14.154  2.405  1.00 57.05  ? 163  GLN A CB  1 
ATOM   1272 C CG  . GLN A 1 163 ? -39.798 14.204  1.082  1.00 59.67  ? 163  GLN A CG  1 
ATOM   1273 C CD  . GLN A 1 163 ? -40.120 12.820  0.565  1.00 52.11  ? 163  GLN A CD  1 
ATOM   1274 O OE1 . GLN A 1 163 ? -39.228 11.982  0.393  1.00 55.90  ? 163  GLN A OE1 1 
ATOM   1275 N NE2 . GLN A 1 163 ? -41.392 12.565  0.335  1.00 47.57  ? 163  GLN A NE2 1 
ATOM   1276 N N   . THR A 1 164 ? -39.353 17.464  1.868  1.00 65.48  ? 164  THR A N   1 
ATOM   1277 C CA  . THR A 1 164 ? -40.201 18.626  1.723  1.00 68.18  ? 164  THR A CA  1 
ATOM   1278 C C   . THR A 1 164 ? -41.597 18.185  1.290  1.00 68.61  ? 164  THR A C   1 
ATOM   1279 O O   . THR A 1 164 ? -41.778 17.066  0.807  1.00 76.08  ? 164  THR A O   1 
ATOM   1280 C CB  . THR A 1 164 ? -39.585 19.584  0.681  1.00 74.30  ? 164  THR A CB  1 
ATOM   1281 O OG1 . THR A 1 164 ? -39.593 20.923  1.187  1.00 78.94  ? 164  THR A OG1 1 
ATOM   1282 C CG2 . THR A 1 164 ? -40.337 19.516  -0.638 1.00 71.12  ? 164  THR A CG2 1 
ATOM   1283 N N   . PRO A 1 165 ? -42.595 19.054  1.490  1.00 62.82  ? 165  PRO A N   1 
ATOM   1284 C CA  . PRO A 1 165 ? -43.984 18.736  1.153  1.00 66.46  ? 165  PRO A CA  1 
ATOM   1285 C C   . PRO A 1 165 ? -44.185 18.432  -0.330 1.00 70.78  ? 165  PRO A C   1 
ATOM   1286 O O   . PRO A 1 165 ? -45.069 17.643  -0.676 1.00 74.93  ? 165  PRO A O   1 
ATOM   1287 C CB  . PRO A 1 165 ? -44.727 20.011  1.552  1.00 64.84  ? 165  PRO A CB  1 
ATOM   1288 C CG  . PRO A 1 165 ? -43.887 20.581  2.661  1.00 51.79  ? 165  PRO A CG  1 
ATOM   1289 C CD  . PRO A 1 165 ? -42.487 20.316  2.241  1.00 57.49  ? 165  PRO A CD  1 
ATOM   1290 N N   . ASP A 1 166 ? -43.389 19.040  -1.199 1.00 62.37  ? 166  ASP A N   1 
ATOM   1291 C CA  . ASP A 1 166 ? -43.561 18.776  -2.624 1.00 81.86  ? 166  ASP A CA  1 
ATOM   1292 C C   . ASP A 1 166 ? -42.749 17.567  -3.077 1.00 80.59  ? 166  ASP A C   1 
ATOM   1293 O O   . ASP A 1 166 ? -42.974 17.036  -4.165 1.00 90.42  ? 166  ASP A O   1 
ATOM   1294 C CB  . ASP A 1 166 ? -43.257 20.010  -3.480 1.00 82.86  ? 166  ASP A CB  1 
ATOM   1295 C CG  . ASP A 1 166 ? -41.796 20.383  -3.468 1.00 85.00  ? 166  ASP A CG  1 
ATOM   1296 O OD1 . ASP A 1 166 ? -40.952 19.473  -3.347 1.00 82.60  ? 166  ASP A OD1 1 
ATOM   1297 O OD2 . ASP A 1 166 ? -41.493 21.589  -3.584 1.00 91.45  ? 166  ASP A OD2 1 
ATOM   1298 N N   . GLY A 1 167 ? -41.812 17.132  -2.240 1.00 57.56  ? 167  GLY A N   1 
ATOM   1299 C CA  . GLY A 1 167 ? -41.094 15.899  -2.500 1.00 46.22  ? 167  GLY A CA  1 
ATOM   1300 C C   . GLY A 1 167 ? -39.582 16.003  -2.558 1.00 51.48  ? 167  GLY A C   1 
ATOM   1301 O O   . GLY A 1 167 ? -38.896 14.991  -2.701 1.00 57.54  ? 167  GLY A O   1 
ATOM   1302 N N   . GLU A 1 168 ? -39.043 17.213  -2.467 1.00 43.52  ? 168  GLU A N   1 
ATOM   1303 C CA  . GLU A 1 168 ? -37.591 17.370  -2.492 1.00 51.69  ? 168  GLU A CA  1 
ATOM   1304 C C   . GLU A 1 168 ? -36.975 16.952  -1.150 1.00 59.39  ? 168  GLU A C   1 
ATOM   1305 O O   . GLU A 1 168 ? -37.690 16.725  -0.179 1.00 58.55  ? 168  GLU A O   1 
ATOM   1306 C CB  . GLU A 1 168 ? -37.221 18.806  -2.854 1.00 62.60  ? 168  GLU A CB  1 
ATOM   1307 C CG  . GLU A 1 168 ? -37.875 19.274  -4.150 1.00 60.55  ? 168  GLU A CG  1 
ATOM   1308 C CD  . GLU A 1 168 ? -37.878 20.780  -4.294 1.00 67.86  ? 168  GLU A CD  1 
ATOM   1309 O OE1 . GLU A 1 168 ? -36.836 21.331  -4.716 1.00 61.27  ? 168  GLU A OE1 1 
ATOM   1310 O OE2 . GLU A 1 168 ? -38.920 21.411  -3.979 1.00 71.38  ? 168  GLU A OE2 1 
ATOM   1311 N N   . GLN A 1 169 ? -35.655 16.834  -1.094 1.00 62.15  ? 169  GLN A N   1 
ATOM   1312 C CA  . GLN A 1 169 ? -35.021 16.276  0.094  1.00 55.48  ? 169  GLN A CA  1 
ATOM   1313 C C   . GLN A 1 169 ? -33.746 16.992  0.518  1.00 56.07  ? 169  GLN A C   1 
ATOM   1314 O O   . GLN A 1 169 ? -32.949 17.410  -0.322 1.00 56.75  ? 169  GLN A O   1 
ATOM   1315 C CB  . GLN A 1 169 ? -34.751 14.775  -0.088 1.00 40.95  ? 169  GLN A CB  1 
ATOM   1316 C CG  . GLN A 1 169 ? -36.023 13.931  -0.071 1.00 40.74  ? 169  GLN A CG  1 
ATOM   1317 C CD  . GLN A 1 169 ? -35.749 12.451  -0.314 1.00 44.09  ? 169  GLN A CD  1 
ATOM   1318 O OE1 . GLN A 1 169 ? -34.627 12.062  -0.646 1.00 41.50  ? 169  GLN A OE1 1 
ATOM   1319 N NE2 . GLN A 1 169 ? -36.780 11.621  -0.153 1.00 43.02  ? 169  GLN A NE2 1 
ATOM   1320 N N   . ASP A 1 170 ? -33.590 17.153  1.835  1.00 47.28  ? 170  ASP A N   1 
ATOM   1321 C CA  . ASP A 1 170 ? -32.333 17.586  2.427  1.00 44.91  ? 170  ASP A CA  1 
ATOM   1322 C C   . ASP A 1 170 ? -31.728 16.430  3.216  1.00 49.39  ? 170  ASP A C   1 
ATOM   1323 O O   . ASP A 1 170 ? -32.435 15.668  3.875  1.00 57.21  ? 170  ASP A O   1 
ATOM   1324 C CB  . ASP A 1 170 ? -32.513 18.817  3.321  1.00 48.86  ? 170  ASP A CB  1 
ATOM   1325 C CG  . ASP A 1 170 ? -32.986 20.031  2.545  1.00 64.57  ? 170  ASP A CG  1 
ATOM   1326 O OD1 . ASP A 1 170 ? -32.157 20.626  1.824  1.00 74.39  ? 170  ASP A OD1 1 
ATOM   1327 O OD2 . ASP A 1 170 ? -34.185 20.388  2.648  1.00 61.76  ? 170  ASP A OD2 1 
ATOM   1328 N N   . VAL A 1 171 ? -30.414 16.296  3.110  1.00 45.95  ? 171  VAL A N   1 
ATOM   1329 C CA  . VAL A 1 171 ? -29.696 15.226  3.751  1.00 53.36  ? 171  VAL A CA  1 
ATOM   1330 C C   . VAL A 1 171 ? -28.775 15.861  4.766  1.00 60.17  ? 171  VAL A C   1 
ATOM   1331 O O   . VAL A 1 171 ? -28.031 16.794  4.447  1.00 50.50  ? 171  VAL A O   1 
ATOM   1332 C CB  . VAL A 1 171 ? -28.867 14.433  2.729  1.00 53.45  ? 171  VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 171 ? -28.010 13.389  3.426  1.00 53.58  ? 171  VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 171 ? -29.789 13.773  1.720  1.00 56.60  ? 171  VAL A CG2 1 
ATOM   1335 N N   . TYR A 1 172 ? -28.848 15.394  6.004  1.00 55.81  ? 172  TYR A N   1 
ATOM   1336 C CA  . TYR A 1 172 ? -27.862 15.824  6.976  1.00 51.30  ? 172  TYR A CA  1 
ATOM   1337 C C   . TYR A 1 172 ? -27.170 14.628  7.591  1.00 46.54  ? 172  TYR A C   1 
ATOM   1338 O O   . TYR A 1 172 ? -27.774 13.576  7.789  1.00 54.50  ? 172  TYR A O   1 
ATOM   1339 C CB  . TYR A 1 172 ? -28.503 16.644  8.077  1.00 53.26  ? 172  TYR A CB  1 
ATOM   1340 C CG  . TYR A 1 172 ? -29.480 17.692  7.614  1.00 49.37  ? 172  TYR A CG  1 
ATOM   1341 C CD1 . TYR A 1 172 ? -29.119 19.032  7.568  1.00 44.75  ? 172  TYR A CD1 1 
ATOM   1342 C CD2 . TYR A 1 172 ? -30.773 17.353  7.264  1.00 44.82  ? 172  TYR A CD2 1 
ATOM   1343 C CE1 . TYR A 1 172 ? -30.029 20.007  7.166  1.00 37.59  ? 172  TYR A CE1 1 
ATOM   1344 C CE2 . TYR A 1 172 ? -31.684 18.321  6.876  1.00 48.37  ? 172  TYR A CE2 1 
ATOM   1345 C CZ  . TYR A 1 172 ? -31.298 19.648  6.831  1.00 36.42  ? 172  TYR A CZ  1 
ATOM   1346 O OH  . TYR A 1 172 ? -32.194 20.614  6.441  1.00 58.36  ? 172  TYR A OH  1 
ATOM   1347 N N   . TYR A 1 173 ? -25.894 14.800  7.893  1.00 49.46  ? 173  TYR A N   1 
ATOM   1348 C CA  . TYR A 1 173 ? -25.143 13.782  8.606  1.00 45.90  ? 173  TYR A CA  1 
ATOM   1349 C C   . TYR A 1 173 ? -24.885 14.267  10.034 1.00 50.24  ? 173  TYR A C   1 
ATOM   1350 O O   . TYR A 1 173 ? -24.128 15.213  10.267 1.00 45.61  ? 173  TYR A O   1 
ATOM   1351 C CB  . TYR A 1 173 ? -23.858 13.451  7.845  1.00 51.70  ? 173  TYR A CB  1 
ATOM   1352 C CG  . TYR A 1 173 ? -24.142 12.718  6.546  1.00 55.56  ? 173  TYR A CG  1 
ATOM   1353 C CD1 . TYR A 1 173 ? -24.237 11.335  6.525  1.00 56.49  ? 173  TYR A CD1 1 
ATOM   1354 C CD2 . TYR A 1 173 ? -24.358 13.405  5.355  1.00 55.64  ? 173  TYR A CD2 1 
ATOM   1355 C CE1 . TYR A 1 173 ? -24.519 10.653  5.370  1.00 60.45  ? 173  TYR A CE1 1 
ATOM   1356 C CE2 . TYR A 1 173 ? -24.646 12.714  4.170  1.00 57.32  ? 173  TYR A CE2 1 
ATOM   1357 C CZ  . TYR A 1 173 ? -24.717 11.335  4.197  1.00 57.14  ? 173  TYR A CZ  1 
ATOM   1358 O OH  . TYR A 1 173 ? -24.974 10.594  3.071  1.00 50.56  ? 173  TYR A OH  1 
ATOM   1359 N N   . ILE A 1 174 ? -25.568 13.644  10.986 1.00 61.23  ? 174  ILE A N   1 
ATOM   1360 C CA  . ILE A 1 174 ? -25.414 14.007  12.391 1.00 57.00  ? 174  ILE A CA  1 
ATOM   1361 C C   . ILE A 1 174 ? -24.329 13.173  13.055 1.00 47.24  ? 174  ILE A C   1 
ATOM   1362 O O   . ILE A 1 174 ? -24.395 11.945  13.075 1.00 50.67  ? 174  ILE A O   1 
ATOM   1363 C CB  . ILE A 1 174 ? -26.727 13.823  13.160 1.00 55.41  ? 174  ILE A CB  1 
ATOM   1364 C CG1 . ILE A 1 174 ? -27.861 14.563  12.449 1.00 51.59  ? 174  ILE A CG1 1 
ATOM   1365 C CG2 . ILE A 1 174 ? -26.574 14.317  14.594 1.00 55.10  ? 174  ILE A CG2 1 
ATOM   1366 C CD1 . ILE A 1 174 ? -27.653 16.048  12.414 1.00 56.29  ? 174  ILE A CD1 1 
ATOM   1367 N N   . PRO A 1 175 ? -23.312 13.839  13.597 1.00 48.92  ? 175  PRO A N   1 
ATOM   1368 C CA  . PRO A 1 175 ? -22.343 13.081  14.400 1.00 53.57  ? 175  PRO A CA  1 
ATOM   1369 C C   . PRO A 1 175 ? -23.071 12.353  15.535 1.00 51.64  ? 175  PRO A C   1 
ATOM   1370 O O   . PRO A 1 175 ? -23.798 12.987  16.302 1.00 48.85  ? 175  PRO A O   1 
ATOM   1371 C CB  . PRO A 1 175 ? -21.411 14.169  14.948 1.00 48.61  ? 175  PRO A CB  1 
ATOM   1372 C CG  . PRO A 1 175 ? -21.542 15.320  13.942 1.00 40.28  ? 175  PRO A CG  1 
ATOM   1373 C CD  . PRO A 1 175 ? -23.000 15.277  13.534 1.00 40.85  ? 175  PRO A CD  1 
ATOM   1374 N N   . LEU A 1 176 ? -22.889 11.037  15.609 1.00 50.33  ? 176  LEU A N   1 
ATOM   1375 C CA  . LEU A 1 176 ? -23.586 10.177  16.568 1.00 48.51  ? 176  LEU A CA  1 
ATOM   1376 C C   . LEU A 1 176 ? -23.639 10.715  17.996 1.00 47.50  ? 176  LEU A C   1 
ATOM   1377 O O   . LEU A 1 176 ? -24.692 10.682  18.634 1.00 56.43  ? 176  LEU A O   1 
ATOM   1378 C CB  . LEU A 1 176 ? -22.954 8.783   16.593 1.00 56.11  ? 176  LEU A CB  1 
ATOM   1379 C CG  . LEU A 1 176 ? -23.955 7.633   16.523 1.00 57.85  ? 176  LEU A CG  1 
ATOM   1380 C CD1 . LEU A 1 176 ? -23.361 6.339   17.066 1.00 51.38  ? 176  LEU A CD1 1 
ATOM   1381 C CD2 . LEU A 1 176 ? -25.205 8.004   17.269 1.00 49.18  ? 176  LEU A CD2 1 
ATOM   1382 N N   . ASP A 1 177 ? -22.508 11.199  18.499 1.00 45.69  ? 177  ASP A N   1 
ATOM   1383 C CA  . ASP A 1 177 ? -22.447 11.665  19.876 1.00 59.29  ? 177  ASP A CA  1 
ATOM   1384 C C   . ASP A 1 177 ? -23.365 12.863  20.145 1.00 58.40  ? 177  ASP A C   1 
ATOM   1385 O O   . ASP A 1 177 ? -23.697 13.133  21.300 1.00 59.24  ? 177  ASP A O   1 
ATOM   1386 C CB  . ASP A 1 177 ? -21.002 11.914  20.353 1.00 54.54  ? 177  ASP A CB  1 
ATOM   1387 C CG  . ASP A 1 177 ? -20.279 12.991  19.548 1.00 68.65  ? 177  ASP A CG  1 
ATOM   1388 O OD1 . ASP A 1 177 ? -20.940 13.725  18.790 1.00 61.59  ? 177  ASP A OD1 1 
ATOM   1389 O OD2 . ASP A 1 177 ? -19.041 13.116  19.696 1.00 79.17  ? 177  ASP A OD2 1 
ATOM   1390 N N   . VAL A 1 178 ? -23.796 13.564  19.096 1.00 44.19  ? 178  VAL A N   1 
ATOM   1391 C CA  . VAL A 1 178 ? -24.827 14.592  19.293 1.00 49.67  ? 178  VAL A CA  1 
ATOM   1392 C C   . VAL A 1 178 ? -26.202 14.215  18.756 1.00 52.91  ? 178  VAL A C   1 
ATOM   1393 O O   . VAL A 1 178 ? -27.096 15.066  18.668 1.00 51.02  ? 178  VAL A O   1 
ATOM   1394 C CB  . VAL A 1 178 ? -24.439 15.978  18.748 1.00 52.47  ? 178  VAL A CB  1 
ATOM   1395 C CG1 . VAL A 1 178 ? -23.510 16.660  19.719 1.00 47.85  ? 178  VAL A CG1 1 
ATOM   1396 C CG2 . VAL A 1 178 ? -23.843 15.889  17.330 1.00 49.46  ? 178  VAL A CG2 1 
ATOM   1397 N N   . PHE A 1 179 ? -26.376 12.944  18.406 1.00 47.15  ? 179  PHE A N   1 
ATOM   1398 C CA  . PHE A 1 179 ? -27.647 12.494  17.880 1.00 44.89  ? 179  PHE A CA  1 
ATOM   1399 C C   . PHE A 1 179 ? -28.697 12.530  18.986 1.00 62.35  ? 179  PHE A C   1 
ATOM   1400 O O   . PHE A 1 179 ? -28.461 12.039  20.093 1.00 51.33  ? 179  PHE A O   1 
ATOM   1401 C CB  . PHE A 1 179 ? -27.539 11.079  17.335 1.00 54.17  ? 179  PHE A CB  1 
ATOM   1402 C CG  . PHE A 1 179 ? -28.874 10.433  17.117 1.00 63.78  ? 179  PHE A CG  1 
ATOM   1403 C CD1 . PHE A 1 179 ? -29.661 10.799  16.040 1.00 55.54  ? 179  PHE A CD1 1 
ATOM   1404 C CD2 . PHE A 1 179 ? -29.362 9.490   18.016 1.00 60.58  ? 179  PHE A CD2 1 
ATOM   1405 C CE1 . PHE A 1 179 ? -30.907 10.226  15.851 1.00 60.70  ? 179  PHE A CE1 1 
ATOM   1406 C CE2 . PHE A 1 179 ? -30.607 8.906   17.827 1.00 57.94  ? 179  PHE A CE2 1 
ATOM   1407 C CZ  . PHE A 1 179 ? -31.380 9.277   16.744 1.00 60.85  ? 179  PHE A CZ  1 
ATOM   1408 N N   . ASP A 1 180 ? -29.858 13.102  18.680 1.00 68.27  ? 180  ASP A N   1 
ATOM   1409 C CA  . ASP A 1 180 ? -30.899 13.318  19.679 1.00 53.27  ? 180  ASP A CA  1 
ATOM   1410 C C   . ASP A 1 180 ? -32.191 12.588  19.315 1.00 56.11  ? 180  ASP A C   1 
ATOM   1411 O O   . ASP A 1 180 ? -33.020 13.103  18.553 1.00 51.76  ? 180  ASP A O   1 
ATOM   1412 C CB  . ASP A 1 180 ? -31.162 14.815  19.833 1.00 62.57  ? 180  ASP A CB  1 
ATOM   1413 C CG  . ASP A 1 180 ? -32.215 15.128  20.898 1.00 76.43  ? 180  ASP A CG  1 
ATOM   1414 O OD1 . ASP A 1 180 ? -33.126 14.300  21.141 1.00 77.73  ? 180  ASP A OD1 1 
ATOM   1415 O OD2 . ASP A 1 180 ? -32.135 16.228  21.483 1.00 76.66  ? 180  ASP A OD2 1 
ATOM   1416 N N   . ARG A 1 181 ? -32.357 11.402  19.897 1.00 58.86  ? 181  ARG A N   1 
ATOM   1417 C CA  . ARG A 1 181 ? -33.446 10.479  19.569 1.00 75.11  ? 181  ARG A CA  1 
ATOM   1418 C C   . ARG A 1 181 ? -34.844 11.077  19.477 1.00 75.70  ? 181  ARG A C   1 
ATOM   1419 O O   . ARG A 1 181 ? -35.678 10.596  18.708 1.00 85.40  ? 181  ARG A O   1 
ATOM   1420 C CB  . ARG A 1 181 ? -33.475 9.296   20.544 1.00 87.55  ? 181  ARG A CB  1 
ATOM   1421 C CG  . ARG A 1 181 ? -34.330 8.139   20.034 1.00 102.96 ? 181  ARG A CG  1 
ATOM   1422 C CD  . ARG A 1 181 ? -34.117 6.850   20.814 1.00 109.35 ? 181  ARG A CD  1 
ATOM   1423 N NE  . ARG A 1 181 ? -34.442 5.674   20.007 1.00 108.27 ? 181  ARG A NE  1 
ATOM   1424 C CZ  . ARG A 1 181 ? -34.293 4.413   20.405 1.00 103.84 ? 181  ARG A CZ  1 
ATOM   1425 N NH1 . ARG A 1 181 ? -33.820 4.140   21.615 1.00 104.26 ? 181  ARG A NH1 1 
ATOM   1426 N NH2 . ARG A 1 181 ? -34.615 3.420   19.587 1.00 101.06 ? 181  ARG A NH2 1 
ATOM   1427 N N   . ASP A 1 182 ? -35.124 12.107  20.260 1.00 65.73  ? 182  ASP A N   1 
ATOM   1428 C CA  . ASP A 1 182 ? -36.489 12.611  20.260 1.00 76.05  ? 182  ASP A CA  1 
ATOM   1429 C C   . ASP A 1 182 ? -36.701 13.663  19.185 1.00 73.97  ? 182  ASP A C   1 
ATOM   1430 O O   . ASP A 1 182 ? -37.781 13.744  18.603 1.00 86.11  ? 182  ASP A O   1 
ATOM   1431 C CB  . ASP A 1 182 ? -36.949 13.075  21.657 1.00 99.20  ? 182  ASP A CB  1 
ATOM   1432 C CG  . ASP A 1 182 ? -36.063 14.157  22.249 1.00 110.69 ? 182  ASP A CG  1 
ATOM   1433 O OD1 . ASP A 1 182 ? -35.511 14.971  21.477 1.00 116.81 ? 182  ASP A OD1 1 
ATOM   1434 O OD2 . ASP A 1 182 ? -35.930 14.193  23.495 1.00 104.12 ? 182  ASP A OD2 1 
ATOM   1435 N N   . ARG A 1 183 ? -35.666 14.452  18.909 1.00 69.47  ? 183  ARG A N   1 
ATOM   1436 C CA  . ARG A 1 183 ? -35.703 15.389  17.789 1.00 73.12  ? 183  ARG A CA  1 
ATOM   1437 C C   . ARG A 1 183 ? -35.614 14.654  16.451 1.00 72.78  ? 183  ARG A C   1 
ATOM   1438 O O   . ARG A 1 183 ? -36.295 15.002  15.493 1.00 77.00  ? 183  ARG A O   1 
ATOM   1439 C CB  . ARG A 1 183 ? -34.548 16.394  17.874 1.00 86.77  ? 183  ARG A CB  1 
ATOM   1440 C CG  . ARG A 1 183 ? -34.822 17.632  18.715 1.00 96.47  ? 183  ARG A CG  1 
ATOM   1441 C CD  . ARG A 1 183 ? -33.792 18.723  18.425 1.00 99.28  ? 183  ARG A CD  1 
ATOM   1442 N NE  . ARG A 1 183 ? -33.951 19.899  19.281 1.00 106.54 ? 183  ARG A NE  1 
ATOM   1443 C CZ  . ARG A 1 183 ? -34.896 20.827  19.129 1.00 118.00 ? 183  ARG A CZ  1 
ATOM   1444 N NH1 . ARG A 1 183 ? -34.950 21.859  19.962 1.00 125.12 ? 183  ARG A NH1 1 
ATOM   1445 N NH2 . ARG A 1 183 ? -35.794 20.727  18.155 1.00 115.01 ? 183  ARG A NH2 1 
ATOM   1446 N N   . ILE A 1 184 ? -34.763 13.637  16.399 1.00 72.96  ? 184  ILE A N   1 
ATOM   1447 C CA  . ILE A 1 184 ? -34.386 13.000  15.145 1.00 63.48  ? 184  ILE A CA  1 
ATOM   1448 C C   . ILE A 1 184 ? -34.929 11.581  15.051 1.00 63.98  ? 184  ILE A C   1 
ATOM   1449 O O   . ILE A 1 184 ? -34.291 10.622  15.482 1.00 65.66  ? 184  ILE A O   1 
ATOM   1450 C CB  . ILE A 1 184 ? -32.858 12.961  15.013 1.00 61.36  ? 184  ILE A CB  1 
ATOM   1451 C CG1 . ILE A 1 184 ? -32.287 14.367  15.176 1.00 62.63  ? 184  ILE A CG1 1 
ATOM   1452 C CG2 . ILE A 1 184 ? -32.441 12.357  13.681 1.00 72.47  ? 184  ILE A CG2 1 
ATOM   1453 C CD1 . ILE A 1 184 ? -32.595 15.290  14.022 1.00 66.49  ? 184  ILE A CD1 1 
ATOM   1454 N N   . LYS A 1 185 ? -36.122 11.443  14.495 1.00 69.81  ? 185  LYS A N   1 
ATOM   1455 C CA  . LYS A 1 185 ? -36.666 10.114  14.284 1.00 65.52  ? 185  LYS A CA  1 
ATOM   1456 C C   . LYS A 1 185 ? -37.585 10.085  13.079 1.00 60.09  ? 185  LYS A C   1 
ATOM   1457 O O   . LYS A 1 185 ? -38.300 11.053  12.801 1.00 68.00  ? 185  LYS A O   1 
ATOM   1458 C CB  . LYS A 1 185 ? -37.391 9.613   15.538 1.00 65.59  ? 185  LYS A CB  1 
ATOM   1459 C CG  . LYS A 1 185 ? -38.893 9.802   15.526 1.00 70.56  ? 185  LYS A CG  1 
ATOM   1460 C CD  . LYS A 1 185 ? -39.545 9.114   16.726 1.00 76.63  ? 185  LYS A CD  1 
ATOM   1461 C CE  . LYS A 1 185 ? -39.089 9.722   18.048 1.00 88.46  ? 185  LYS A CE  1 
ATOM   1462 N NZ  . LYS A 1 185 ? -39.824 9.146   19.224 1.00 98.89  ? 185  LYS A NZ  1 
ATOM   1463 N N   . LYS A 1 186 ? -37.561 8.970   12.358 1.00 55.83  ? 186  LYS A N   1 
ATOM   1464 C CA  . LYS A 1 186 ? -38.447 8.810   11.212 1.00 59.33  ? 186  LYS A CA  1 
ATOM   1465 C C   . LYS A 1 186 ? -39.856 9.233   11.587 1.00 60.53  ? 186  LYS A C   1 
ATOM   1466 O O   . LYS A 1 186 ? -40.376 8.828   12.623 1.00 74.88  ? 186  LYS A O   1 
ATOM   1467 C CB  . LYS A 1 186 ? -38.445 7.361   10.715 1.00 75.38  ? 186  LYS A CB  1 
ATOM   1468 C CG  . LYS A 1 186 ? -39.033 7.177   9.316  1.00 88.73  ? 186  LYS A CG  1 
ATOM   1469 C CD  . LYS A 1 186 ? -39.016 5.716   8.886  1.00 92.57  ? 186  LYS A CD  1 
ATOM   1470 C CE  . LYS A 1 186 ? -39.116 5.576   7.372  1.00 94.45  ? 186  LYS A CE  1 
ATOM   1471 N NZ  . LYS A 1 186 ? -40.182 6.439   6.792  1.00 93.86  ? 186  LYS A NZ  1 
ATOM   1472 N N   . GLY A 1 187 ? -40.462 10.064  10.751 1.00 57.26  ? 187  GLY A N   1 
ATOM   1473 C CA  . GLY A 1 187 ? -41.853 10.435  10.917 1.00 49.06  ? 187  GLY A CA  1 
ATOM   1474 C C   . GLY A 1 187 ? -42.067 11.769  11.594 1.00 56.57  ? 187  GLY A C   1 
ATOM   1475 O O   . GLY A 1 187 ? -43.195 12.250  11.682 1.00 61.25  ? 187  GLY A O   1 
ATOM   1476 N N   . LYS A 1 188 ? -40.988 12.371  12.079 1.00 65.53  ? 188  LYS A N   1 
ATOM   1477 C CA  . LYS A 1 188 ? -41.117 13.607  12.832 1.00 57.02  ? 188  LYS A CA  1 
ATOM   1478 C C   . LYS A 1 188 ? -41.052 14.818  11.921 1.00 68.65  ? 188  LYS A C   1 
ATOM   1479 O O   . LYS A 1 188 ? -40.292 14.859  10.945 1.00 70.94  ? 188  LYS A O   1 
ATOM   1480 C CB  . LYS A 1 188 ? -40.046 13.698  13.919 1.00 66.73  ? 188  LYS A CB  1 
ATOM   1481 C CG  . LYS A 1 188 ? -40.484 14.472  15.161 1.00 79.03  ? 188  LYS A CG  1 
ATOM   1482 C CD  . LYS A 1 188 ? -41.688 13.812  15.837 1.00 90.20  ? 188  LYS A CD  1 
ATOM   1483 C CE  . LYS A 1 188 ? -42.583 14.835  16.529 1.00 96.81  ? 188  LYS A CE  1 
ATOM   1484 N NZ  . LYS A 1 188 ? -43.926 14.268  16.875 1.00 98.53  ? 188  LYS A NZ  1 
ATOM   1485 N N   . GLU A 1 189 ? -41.877 15.799  12.247 1.00 68.38  ? 189  GLU A N   1 
ATOM   1486 C CA  . GLU A 1 189 ? -41.886 17.069  11.553 1.00 61.47  ? 189  GLU A CA  1 
ATOM   1487 C C   . GLU A 1 189 ? -40.712 17.916  12.014 1.00 71.60  ? 189  GLU A C   1 
ATOM   1488 O O   . GLU A 1 189 ? -40.539 18.149  13.210 1.00 84.10  ? 189  GLU A O   1 
ATOM   1489 C CB  . GLU A 1 189 ? -43.192 17.802  11.847 1.00 55.12  ? 189  GLU A CB  1 
ATOM   1490 C CG  . GLU A 1 189 ? -43.285 19.168  11.192 1.00 85.97  ? 189  GLU A CG  1 
ATOM   1491 C CD  . GLU A 1 189 ? -43.340 19.095  9.662  1.00 93.35  ? 189  GLU A CD  1 
ATOM   1492 O OE1 . GLU A 1 189 ? -42.495 19.743  9.000  1.00 90.54  ? 189  GLU A OE1 1 
ATOM   1493 O OE2 . GLU A 1 189 ? -44.235 18.400  9.127  1.00 83.50  ? 189  GLU A OE2 1 
ATOM   1494 N N   . VAL A 1 190 ? -39.887 18.358  11.074 1.00 70.64  ? 190  VAL A N   1 
ATOM   1495 C CA  . VAL A 1 190 ? -38.881 19.359  11.390 1.00 68.25  ? 190  VAL A CA  1 
ATOM   1496 C C   . VAL A 1 190 ? -39.264 20.681  10.736 1.00 67.20  ? 190  VAL A C   1 
ATOM   1497 O O   . VAL A 1 190 ? -39.945 20.711  9.713  1.00 69.77  ? 190  VAL A O   1 
ATOM   1498 C CB  . VAL A 1 190 ? -37.464 18.944  10.956 1.00 70.83  ? 190  VAL A CB  1 
ATOM   1499 C CG1 . VAL A 1 190 ? -37.434 17.488  10.532 1.00 75.40  ? 190  VAL A CG1 1 
ATOM   1500 C CG2 . VAL A 1 190 ? -36.979 19.838  9.841  1.00 61.73  ? 190  VAL A CG2 1 
ATOM   1501 N N   . LYS A 1 191 ? -38.823 21.773  11.340 1.00 66.08  ? 191  LYS A N   1 
ATOM   1502 C CA  . LYS A 1 191 ? -39.204 23.102  10.900 1.00 67.52  ? 191  LYS A CA  1 
ATOM   1503 C C   . LYS A 1 191 ? -37.948 23.836  10.475 1.00 68.39  ? 191  LYS A C   1 
ATOM   1504 O O   . LYS A 1 191 ? -36.851 23.533  10.949 1.00 69.47  ? 191  LYS A O   1 
ATOM   1505 C CB  . LYS A 1 191 ? -39.908 23.839  12.041 1.00 81.01  ? 191  LYS A CB  1 
ATOM   1506 C CG  . LYS A 1 191 ? -41.055 23.040  12.659 1.00 94.88  ? 191  LYS A CG  1 
ATOM   1507 C CD  . LYS A 1 191 ? -41.399 23.510  14.073 1.00 113.37 ? 191  LYS A CD  1 
ATOM   1508 C CE  . LYS A 1 191 ? -40.376 23.036  15.109 1.00 120.74 ? 191  LYS A CE  1 
ATOM   1509 N NZ  . LYS A 1 191 ? -40.458 21.574  15.401 1.00 124.44 ? 191  LYS A NZ  1 
ATOM   1510 N N   . GLN A 1 192 ? -38.093 24.780  9.555  1.00 68.12  ? 192  GLN A N   1 
ATOM   1511 C CA  . GLN A 1 192 ? -36.932 25.494  9.050  1.00 65.67  ? 192  GLN A CA  1 
ATOM   1512 C C   . GLN A 1 192 ? -36.349 26.339  10.162 1.00 74.36  ? 192  GLN A C   1 
ATOM   1513 O O   . GLN A 1 192 ? -37.075 27.059  10.845 1.00 83.73  ? 192  GLN A O   1 
ATOM   1514 C CB  . GLN A 1 192 ? -37.334 26.379  7.881  1.00 73.52  ? 192  GLN A CB  1 
ATOM   1515 C CG  . GLN A 1 192 ? -36.194 27.165  7.295  1.00 72.84  ? 192  GLN A CG  1 
ATOM   1516 C CD  . GLN A 1 192 ? -36.670 28.189  6.296  1.00 75.37  ? 192  GLN A CD  1 
ATOM   1517 O OE1 . GLN A 1 192 ? -35.888 29.012  5.821  1.00 77.39  ? 192  GLN A OE1 1 
ATOM   1518 N NE2 . GLN A 1 192 ? -37.967 28.153  5.976  1.00 73.63  ? 192  GLN A NE2 1 
ATOM   1519 N N   . GLY A 1 193 ? -35.039 26.245  10.354 1.00 77.38  ? 193  GLY A N   1 
ATOM   1520 C CA  . GLY A 1 193 ? -34.383 26.975  11.426 1.00 76.43  ? 193  GLY A CA  1 
ATOM   1521 C C   . GLY A 1 193 ? -34.182 26.136  12.679 1.00 70.50  ? 193  GLY A C   1 
ATOM   1522 O O   . GLY A 1 193 ? -33.354 26.466  13.533 1.00 65.77  ? 193  GLY A O   1 
ATOM   1523 N N   . GLU A 1 194 ? -34.936 25.046  12.784 1.00 58.25  ? 194  GLU A N   1 
ATOM   1524 C CA  . GLU A 1 194 ? -34.798 24.128  13.901 1.00 62.45  ? 194  GLU A CA  1 
ATOM   1525 C C   . GLU A 1 194 ? -33.425 23.488  14.016 1.00 64.88  ? 194  GLU A C   1 
ATOM   1526 O O   . GLU A 1 194 ? -32.909 22.903  13.065 1.00 80.88  ? 194  GLU A O   1 
ATOM   1527 C CB  . GLU A 1 194 ? -35.846 23.023  13.846 1.00 70.94  ? 194  GLU A CB  1 
ATOM   1528 C CG  . GLU A 1 194 ? -35.639 22.011  14.960 1.00 75.03  ? 194  GLU A CG  1 
ATOM   1529 C CD  . GLU A 1 194 ? -36.520 20.792  14.825 1.00 81.16  ? 194  GLU A CD  1 
ATOM   1530 O OE1 . GLU A 1 194 ? -36.041 19.690  15.181 1.00 72.72  ? 194  GLU A OE1 1 
ATOM   1531 O OE2 . GLU A 1 194 ? -37.680 20.939  14.373 1.00 83.58  ? 194  GLU A OE2 1 
ATOM   1532 N N   . MET A 1 195 ? -32.845 23.591  15.202 1.00 65.67  ? 195  MET A N   1 
ATOM   1533 C CA  . MET A 1 195 ? -31.593 22.923  15.505 1.00 68.71  ? 195  MET A CA  1 
ATOM   1534 C C   . MET A 1 195 ? -31.829 21.419  15.546 1.00 66.19  ? 195  MET A C   1 
ATOM   1535 O O   . MET A 1 195 ? -32.569 20.921  16.390 1.00 63.86  ? 195  MET A O   1 
ATOM   1536 C CB  . MET A 1 195 ? -31.053 23.408  16.852 1.00 65.69  ? 195  MET A CB  1 
ATOM   1537 C CG  . MET A 1 195 ? -29.678 22.898  17.189 1.00 71.84  ? 195  MET A CG  1 
ATOM   1538 S SD  . MET A 1 195 ? -29.263 23.246  18.917 1.00 69.69  ? 195  MET A SD  1 
ATOM   1539 C CE  . MET A 1 195 ? -28.974 25.013  18.841 1.00 46.96  ? 195  MET A CE  1 
ATOM   1540 N N   . LEU A 1 196 ? -31.205 20.701  14.621 1.00 62.99  ? 196  LEU A N   1 
ATOM   1541 C CA  . LEU A 1 196 ? -31.340 19.253  14.570 1.00 65.00  ? 196  LEU A CA  1 
ATOM   1542 C C   . LEU A 1 196 ? -30.269 18.622  15.441 1.00 63.98  ? 196  LEU A C   1 
ATOM   1543 O O   . LEU A 1 196 ? -30.407 17.483  15.888 1.00 61.38  ? 196  LEU A O   1 
ATOM   1544 C CB  . LEU A 1 196 ? -31.232 18.755  13.127 1.00 59.82  ? 196  LEU A CB  1 
ATOM   1545 C CG  . LEU A 1 196 ? -32.201 19.482  12.194 1.00 56.17  ? 196  LEU A CG  1 
ATOM   1546 C CD1 . LEU A 1 196 ? -32.090 19.001  10.752 1.00 55.95  ? 196  LEU A CD1 1 
ATOM   1547 C CD2 . LEU A 1 196 ? -33.606 19.303  12.699 1.00 57.45  ? 196  LEU A CD2 1 
ATOM   1548 N N   . ALA A 1 197 ? -29.202 19.378  15.685 1.00 54.72  ? 197  ALA A N   1 
ATOM   1549 C CA  . ALA A 1 197 ? -28.155 18.933  16.586 1.00 43.15  ? 197  ALA A CA  1 
ATOM   1550 C C   . ALA A 1 197 ? -27.335 20.107  17.107 1.00 60.84  ? 197  ALA A C   1 
ATOM   1551 O O   . ALA A 1 197 ? -27.105 21.093  16.397 1.00 59.24  ? 197  ALA A O   1 
ATOM   1552 C CB  . ALA A 1 197 ? -27.270 17.920  15.924 1.00 41.41  ? 197  ALA A CB  1 
ATOM   1553 N N   . GLU A 1 198 ? -26.912 19.987  18.362 1.00 59.85  ? 198  GLU A N   1 
ATOM   1554 C CA  . GLU A 1 198 ? -26.129 21.013  19.022 1.00 61.33  ? 198  GLU A CA  1 
ATOM   1555 C C   . GLU A 1 198 ? -24.697 21.095  18.511 1.00 61.22  ? 198  GLU A C   1 
ATOM   1556 O O   . GLU A 1 198 ? -24.207 20.202  17.814 1.00 51.75  ? 198  GLU A O   1 
ATOM   1557 C CB  . GLU A 1 198 ? -26.123 20.773  20.530 1.00 61.68  ? 198  GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 198 ? -27.337 21.367  21.237 1.00 70.16  ? 198  GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 198 ? -27.557 20.787  22.611 1.00 82.55  ? 198  GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 198 ? -26.568 20.658  23.370 1.00 93.20  ? 198  GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 198 ? -28.717 20.448  22.929 1.00 81.64  ? 198  GLU A OE2 1 
ATOM   1562 N N   . ALA A 1 199 ? -24.045 22.192  18.874 1.00 63.59  ? 199  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 199 ? -22.646 22.423  18.576 1.00 71.52  ? 199  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 199 ? -21.770 21.380  19.271 1.00 71.40  ? 199  ALA A C   1 
ATOM   1565 O O   . ALA A 1 199 ? -22.217 20.705  20.196 1.00 60.57  ? 199  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 199 ? -22.260 23.819  19.035 1.00 69.44  ? 199  ALA A CB  1 
ATOM   1567 N N   . ARG A 1 200 ? -20.524 21.254  18.826 1.00 61.79  ? 200  ARG A N   1 
ATOM   1568 C CA  . ARG A 1 200 ? -19.573 20.368  19.478 1.00 59.47  ? 200  ARG A CA  1 
ATOM   1569 C C   . ARG A 1 200 ? -18.330 21.150  19.869 1.00 64.44  ? 200  ARG A C   1 
ATOM   1570 O O   . ARG A 1 200 ? -17.878 22.019  19.125 1.00 65.94  ? 200  ARG A O   1 
ATOM   1571 C CB  . ARG A 1 200 ? -19.172 19.203  18.566 1.00 56.75  ? 200  ARG A CB  1 
ATOM   1572 C CG  . ARG A 1 200 ? -20.299 18.264  18.183 1.00 64.89  ? 200  ARG A CG  1 
ATOM   1573 C CD  . ARG A 1 200 ? -20.408 18.136  16.658 1.00 66.60  ? 200  ARG A CD  1 
ATOM   1574 N NE  . ARG A 1 200 ? -19.278 17.411  16.080 1.00 80.97  ? 200  ARG A NE  1 
ATOM   1575 C CZ  . ARG A 1 200 ? -18.908 17.486  14.803 1.00 75.98  ? 200  ARG A CZ  1 
ATOM   1576 N NH1 . ARG A 1 200 ? -19.564 18.269  13.957 1.00 66.44  ? 200  ARG A NH1 1 
ATOM   1577 N NH2 . ARG A 1 200 ? -17.873 16.783  14.371 1.00 82.29  ? 200  ARG A NH2 1 
ATOM   1578 N N   . LYS A 1 201 ? -17.782 20.841  21.039 1.00 55.07  ? 201  LYS A N   1 
ATOM   1579 C CA  . LYS A 1 201 ? -16.520 21.428  21.461 1.00 55.61  ? 201  LYS A CA  1 
ATOM   1580 C C   . LYS A 1 201 ? -15.385 20.433  21.275 1.00 51.23  ? 201  LYS A C   1 
ATOM   1581 O O   . LYS A 1 201 ? -15.613 19.230  21.134 1.00 50.09  ? 201  LYS A O   1 
ATOM   1582 C CB  . LYS A 1 201 ? -16.576 21.887  22.924 1.00 54.82  ? 201  LYS A CB  1 
ATOM   1583 C CG  . LYS A 1 201 ? -17.504 23.069  23.189 1.00 51.53  ? 201  LYS A CG  1 
ATOM   1584 C CD  . LYS A 1 201 ? -17.240 23.658  24.573 1.00 61.32  ? 201  LYS A CD  1 
ATOM   1585 C CE  . LYS A 1 201 ? -18.048 24.931  24.827 1.00 66.57  ? 201  LYS A CE  1 
ATOM   1586 N NZ  . LYS A 1 201 ? -17.537 25.708  25.998 1.00 68.64  ? 201  LYS A NZ  1 
ATOM   1587 N N   . PHE A 1 202 ? -14.162 20.948  21.281 1.00 47.05  ? 202  PHE A N   1 
ATOM   1588 C CA  . PHE A 1 202 ? -12.980 20.126  21.100 1.00 49.64  ? 202  PHE A CA  1 
ATOM   1589 C C   . PHE A 1 202 ? -11.874 20.680  21.949 1.00 53.11  ? 202  PHE A C   1 
ATOM   1590 O O   . PHE A 1 202 ? -11.622 21.887  21.947 1.00 67.06  ? 202  PHE A O   1 
ATOM   1591 C CB  . PHE A 1 202 ? -12.567 20.096  19.619 1.00 53.69  ? 202  PHE A CB  1 
ATOM   1592 C CG  . PHE A 1 202 ? -13.645 19.575  18.722 1.00 54.04  ? 202  PHE A CG  1 
ATOM   1593 C CD1 . PHE A 1 202 ? -13.653 18.248  18.323 1.00 57.22  ? 202  PHE A CD1 1 
ATOM   1594 C CD2 . PHE A 1 202 ? -14.681 20.401  18.318 1.00 46.82  ? 202  PHE A CD2 1 
ATOM   1595 C CE1 . PHE A 1 202 ? -14.670 17.762  17.517 1.00 57.62  ? 202  PHE A CE1 1 
ATOM   1596 C CE2 . PHE A 1 202 ? -15.698 19.924  17.515 1.00 48.11  ? 202  PHE A CE2 1 
ATOM   1597 C CZ  . PHE A 1 202 ? -15.696 18.604  17.114 1.00 55.10  ? 202  PHE A CZ  1 
ATOM   1598 N N   . PHE A 1 203 ? -11.212 19.795  22.684 1.00 55.68  ? 203  PHE A N   1 
ATOM   1599 C CA  . PHE A 1 203 ? -10.141 20.209  23.577 1.00 49.39  ? 203  PHE A CA  1 
ATOM   1600 C C   . PHE A 1 203 ? -8.854  19.511  23.219 1.00 51.78  ? 203  PHE A C   1 
ATOM   1601 O O   . PHE A 1 203 ? -8.867  18.391  22.708 1.00 57.21  ? 203  PHE A O   1 
ATOM   1602 C CB  . PHE A 1 203 ? -10.508 19.890  25.022 1.00 54.48  ? 203  PHE A CB  1 
ATOM   1603 C CG  . PHE A 1 203 ? -11.877 20.339  25.403 1.00 46.48  ? 203  PHE A CG  1 
ATOM   1604 C CD1 . PHE A 1 203 ? -12.056 21.478  26.177 1.00 51.94  ? 203  PHE A CD1 1 
ATOM   1605 C CD2 . PHE A 1 203 ? -12.991 19.620  24.991 1.00 41.28  ? 203  PHE A CD2 1 
ATOM   1606 C CE1 . PHE A 1 203 ? -13.333 21.894  26.544 1.00 53.97  ? 203  PHE A CE1 1 
ATOM   1607 C CE2 . PHE A 1 203 ? -14.274 20.026  25.353 1.00 51.51  ? 203  PHE A CE2 1 
ATOM   1608 C CZ  . PHE A 1 203 ? -14.444 21.167  26.132 1.00 50.43  ? 203  PHE A CZ  1 
ATOM   1609 N N   . ALA A 1 204 ? -7.738  20.178  23.484 1.00 57.48  ? 204  ALA A N   1 
ATOM   1610 C CA  . ALA A 1 204 ? -6.439  19.623  23.148 1.00 54.44  ? 204  ALA A CA  1 
ATOM   1611 C C   . ALA A 1 204 ? -6.320  18.269  23.818 1.00 55.59  ? 204  ALA A C   1 
ATOM   1612 O O   . ALA A 1 204 ? -6.448  18.178  25.029 1.00 57.57  ? 204  ALA A O   1 
ATOM   1613 C CB  . ALA A 1 204 ? -5.330  20.545  23.623 1.00 56.23  ? 204  ALA A CB  1 
ATOM   1614 N N   . LYS A 1 205 ? -6.103  17.216  23.037 1.00 52.59  ? 205  LYS A N   1 
ATOM   1615 C CA  . LYS A 1 205 ? -5.810  15.908  23.612 1.00 57.76  ? 205  LYS A CA  1 
ATOM   1616 C C   . LYS A 1 205 ? -4.426  15.926  24.253 1.00 64.83  ? 205  LYS A C   1 
ATOM   1617 O O   . LYS A 1 205 ? -4.135  15.142  25.157 1.00 65.16  ? 205  LYS A O   1 
ATOM   1618 C CB  . LYS A 1 205 ? -5.919  14.796  22.559 1.00 47.15  ? 205  LYS A CB  1 
ATOM   1619 C CG  . LYS A 1 205 ? -7.344  14.591  22.081 1.00 57.48  ? 205  LYS A CG  1 
ATOM   1620 C CD  . LYS A 1 205 ? -7.496  13.438  21.094 1.00 52.64  ? 205  LYS A CD  1 
ATOM   1621 C CE  . LYS A 1 205 ? -8.912  13.441  20.526 1.00 56.71  ? 205  LYS A CE  1 
ATOM   1622 N NZ  . LYS A 1 205 ? -9.976  13.340  21.587 1.00 58.81  ? 205  LYS A NZ  1 
ATOM   1623 N N   . VAL A 1 206 ? -3.592  16.853  23.795 1.00 64.76  ? 206  VAL A N   1 
ATOM   1624 C CA  . VAL A 1 206 ? -2.208  16.930  24.230 1.00 61.47  ? 206  VAL A CA  1 
ATOM   1625 C C   . VAL A 1 206 ? -1.761  18.398  24.345 1.00 62.32  ? 206  VAL A C   1 
ATOM   1626 O O   . VAL A 1 206 ? -2.346  19.287  23.729 1.00 75.40  ? 206  VAL A O   1 
ATOM   1627 C CB  . VAL A 1 206 ? -1.294  16.162  23.238 1.00 59.23  ? 206  VAL A CB  1 
ATOM   1628 C CG1 . VAL A 1 206 ? -1.255  16.868  21.886 1.00 63.95  ? 206  VAL A CG1 1 
ATOM   1629 C CG2 . VAL A 1 206 ? 0.105   16.010  23.790 1.00 69.20  ? 206  VAL A CG2 1 
ATOM   1630 N N   . SER A 1 207 ? -0.736  18.646  25.149 1.00 48.70  ? 207  SER A N   1 
ATOM   1631 C CA  . SER A 1 207 ? -0.112  19.966  25.225 1.00 61.90  ? 207  SER A CA  1 
ATOM   1632 C C   . SER A 1 207 ? 0.973   20.125  24.156 1.00 61.40  ? 207  SER A C   1 
ATOM   1633 O O   . SER A 1 207 ? 1.694   19.175  23.850 1.00 58.96  ? 207  SER A O   1 
ATOM   1634 C CB  . SER A 1 207 ? 0.509   20.196  26.614 1.00 55.07  ? 207  SER A CB  1 
ATOM   1635 O OG  . SER A 1 207 ? -0.452  20.009  27.644 1.00 66.05  ? 207  SER A OG  1 
ATOM   1636 N N   . GLY A 1 208 ? 1.101   21.333  23.613 1.00 51.77  ? 208  GLY A N   1 
ATOM   1637 C CA  . GLY A 1 208 ? 2.121   21.616  22.620 1.00 60.76  ? 208  GLY A CA  1 
ATOM   1638 C C   . GLY A 1 208 ? 1.806   22.833  21.772 1.00 71.15  ? 208  GLY A C   1 
ATOM   1639 O O   . GLY A 1 208 ? 0.978   23.661  22.155 1.00 72.77  ? 208  GLY A O   1 
ATOM   1640 N N   . ARG A 1 209 ? 2.477   22.949  20.627 1.00 67.84  ? 209  ARG A N   1 
ATOM   1641 C CA  . ARG A 1 209 ? 2.275   24.075  19.725 1.00 59.97  ? 209  ARG A CA  1 
ATOM   1642 C C   . ARG A 1 209 ? 1.275   23.692  18.648 1.00 69.34  ? 209  ARG A C   1 
ATOM   1643 O O   . ARG A 1 209 ? 1.369   22.606  18.064 1.00 69.83  ? 209  ARG A O   1 
ATOM   1644 C CB  . ARG A 1 209 ? 3.589   24.462  19.053 1.00 64.22  ? 209  ARG A CB  1 
ATOM   1645 C CG  . ARG A 1 209 ? 3.546   25.796  18.320 1.00 61.26  ? 209  ARG A CG  1 
ATOM   1646 C CD  . ARG A 1 209 ? 4.255   26.873  19.124 1.00 75.49  ? 209  ARG A CD  1 
ATOM   1647 N NE  . ARG A 1 209 ? 5.613   27.099  18.651 1.00 83.28  ? 209  ARG A NE  1 
ATOM   1648 C CZ  . ARG A 1 209 ? 6.677   27.227  19.438 1.00 82.46  ? 209  ARG A CZ  1 
ATOM   1649 N NH1 . ARG A 1 209 ? 6.551   27.148  20.759 1.00 82.77  ? 209  ARG A NH1 1 
ATOM   1650 N NH2 . ARG A 1 209 ? 7.872   27.428  18.897 1.00 69.22  ? 209  ARG A NH2 1 
ATOM   1651 N N   . VAL A 1 210 ? 0.322   24.574  18.369 1.00 64.42  ? 210  VAL A N   1 
ATOM   1652 C CA  . VAL A 1 210 ? -0.644  24.273  17.327 1.00 64.98  ? 210  VAL A CA  1 
ATOM   1653 C C   . VAL A 1 210 ? -0.168  24.745  15.970 1.00 76.37  ? 210  VAL A C   1 
ATOM   1654 O O   . VAL A 1 210 ? 0.558   25.734  15.844 1.00 83.91  ? 210  VAL A O   1 
ATOM   1655 C CB  . VAL A 1 210 ? -2.033  24.882  17.587 1.00 62.45  ? 210  VAL A CB  1 
ATOM   1656 C CG1 . VAL A 1 210 ? -2.457  24.655  19.039 1.00 60.08  ? 210  VAL A CG1 1 
ATOM   1657 C CG2 . VAL A 1 210 ? -2.041  26.359  17.231 1.00 60.97  ? 210  VAL A CG2 1 
ATOM   1658 N N   . GLU A 1 211 ? -0.583  24.006  14.955 1.00 75.22  ? 211  GLU A N   1 
ATOM   1659 C CA  . GLU A 1 211 ? -0.466  24.436  13.579 1.00 69.69  ? 211  GLU A CA  1 
ATOM   1660 C C   . GLU A 1 211 ? -1.816  24.117  12.947 1.00 70.78  ? 211  GLU A C   1 
ATOM   1661 O O   . GLU A 1 211 ? -2.308  22.990  13.054 1.00 63.26  ? 211  GLU A O   1 
ATOM   1662 C CB  . GLU A 1 211 ? 0.655   23.679  12.882 1.00 64.75  ? 211  GLU A CB  1 
ATOM   1663 C CG  . GLU A 1 211 ? 0.941   24.166  11.466 1.00 99.95  ? 211  GLU A CG  1 
ATOM   1664 C CD  . GLU A 1 211 ? 0.906   23.046  10.434 1.00 104.24 ? 211  GLU A CD  1 
ATOM   1665 O OE1 . GLU A 1 211 ? 1.272   21.901  10.782 1.00 104.69 ? 211  GLU A OE1 1 
ATOM   1666 O OE2 . GLU A 1 211 ? 0.504   23.312  9.279  1.00 105.60 ? 211  GLU A OE2 1 
ATOM   1667 N N   . VAL A 1 212 ? -2.437  25.117  12.332 1.00 74.54  ? 212  VAL A N   1 
ATOM   1668 C CA  . VAL A 1 212 ? -3.719  24.919  11.669 1.00 78.45  ? 212  VAL A CA  1 
ATOM   1669 C C   . VAL A 1 212 ? -3.615  24.992  10.145 1.00 78.88  ? 212  VAL A C   1 
ATOM   1670 O O   . VAL A 1 212 ? -2.914  25.847  9.592  1.00 77.30  ? 212  VAL A O   1 
ATOM   1671 C CB  . VAL A 1 212 ? -4.766  25.939  12.150 1.00 80.70  ? 212  VAL A CB  1 
ATOM   1672 C CG1 . VAL A 1 212 ? -4.098  27.065  12.918 1.00 84.25  ? 212  VAL A CG1 1 
ATOM   1673 C CG2 . VAL A 1 212 ? -5.568  26.476  10.965 1.00 77.66  ? 212  VAL A CG2 1 
ATOM   1674 N N   . VAL A 1 213 ? -4.309  24.081  9.472  1.00 87.72  ? 213  VAL A N   1 
ATOM   1675 C CA  . VAL A 1 213 ? -4.468  24.175  8.029  1.00 95.19  ? 213  VAL A CA  1 
ATOM   1676 C C   . VAL A 1 213 ? -5.875  24.690  7.746  1.00 95.49  ? 213  VAL A C   1 
ATOM   1677 O O   . VAL A 1 213 ? -6.866  24.119  8.206  1.00 87.83  ? 213  VAL A O   1 
ATOM   1678 C CB  . VAL A 1 213 ? -4.217  22.824  7.312  1.00 99.41  ? 213  VAL A CB  1 
ATOM   1679 C CG1 . VAL A 1 213 ? -3.208  21.991  8.088  1.00 98.04  ? 213  VAL A CG1 1 
ATOM   1680 C CG2 . VAL A 1 213 ? -5.514  22.050  7.113  1.00 100.76 ? 213  VAL A CG2 1 
ATOM   1681 N N   . ASP A 1 214 ? -5.955  25.796  7.015  1.00 99.41  ? 214  ASP A N   1 
ATOM   1682 C CA  . ASP A 1 214 ? -7.238  26.406  6.697  1.00 100.02 ? 214  ASP A CA  1 
ATOM   1683 C C   . ASP A 1 214 ? -7.554  26.260  5.208  1.00 102.00 ? 214  ASP A C   1 
ATOM   1684 O O   . ASP A 1 214 ? -7.084  27.040  4.377  1.00 101.30 ? 214  ASP A O   1 
ATOM   1685 C CB  . ASP A 1 214 ? -7.242  27.882  7.102  1.00 100.77 ? 214  ASP A CB  1 
ATOM   1686 C CG  . ASP A 1 214 ? -8.645  28.430  7.305  1.00 105.56 ? 214  ASP A CG  1 
ATOM   1687 O OD1 . ASP A 1 214 ? -8.775  29.482  7.969  1.00 111.69 ? 214  ASP A OD1 1 
ATOM   1688 O OD2 . ASP A 1 214 ? -9.617  27.809  6.815  1.00 96.99  ? 214  ASP A OD2 1 
ATOM   1689 N N   . TYR A 1 215 ? -8.346  25.248  4.879  1.00 96.29  ? 215  TYR A N   1 
ATOM   1690 C CA  . TYR A 1 215 ? -8.775  25.036  3.507  1.00 97.14  ? 215  TYR A CA  1 
ATOM   1691 C C   . TYR A 1 215 ? -10.269 25.290  3.372  1.00 109.51 ? 215  TYR A C   1 
ATOM   1692 O O   . TYR A 1 215 ? -10.971 25.513  4.365  1.00 117.01 ? 215  TYR A O   1 
ATOM   1693 C CB  . TYR A 1 215 ? -8.463  23.607  3.063  1.00 92.50  ? 215  TYR A CB  1 
ATOM   1694 C CG  . TYR A 1 215 ? -6.993  23.274  3.043  1.00 89.92  ? 215  TYR A CG  1 
ATOM   1695 C CD1 . TYR A 1 215 ? -6.039  24.270  2.887  1.00 98.51  ? 215  TYR A CD1 1 
ATOM   1696 C CD2 . TYR A 1 215 ? -6.558  21.965  3.179  1.00 83.47  ? 215  TYR A CD2 1 
ATOM   1697 C CE1 . TYR A 1 215 ? -4.688  23.971  2.868  1.00 103.59 ? 215  TYR A CE1 1 
ATOM   1698 C CE2 . TYR A 1 215 ? -5.213  21.655  3.157  1.00 90.63  ? 215  TYR A CE2 1 
ATOM   1699 C CZ  . TYR A 1 215 ? -4.281  22.661  3.002  1.00 102.77 ? 215  TYR A CZ  1 
ATOM   1700 O OH  . TYR A 1 215 ? -2.940  22.357  2.984  1.00 109.30 ? 215  TYR A OH  1 
ATOM   1701 N N   . SER A 1 216 ? -10.743 25.252  2.132  1.00 107.48 ? 216  SER A N   1 
ATOM   1702 C CA  . SER A 1 216 ? -12.160 25.371  1.826  1.00 107.12 ? 216  SER A CA  1 
ATOM   1703 C C   . SER A 1 216 ? -12.814 24.011  2.033  1.00 104.35 ? 216  SER A C   1 
ATOM   1704 O O   . SER A 1 216 ? -14.008 23.915  2.338  1.00 99.61  ? 216  SER A O   1 
ATOM   1705 C CB  . SER A 1 216 ? -12.342 25.804  0.369  1.00 114.09 ? 216  SER A CB  1 
ATOM   1706 O OG  . SER A 1 216 ? -11.376 26.773  -0.004 1.00 115.77 ? 216  SER A OG  1 
ATOM   1707 N N   . THR A 1 217 ? -12.012 22.964  1.843  1.00 100.05 ? 217  THR A N   1 
ATOM   1708 C CA  . THR A 1 217 ? -12.440 21.580  2.021  1.00 92.06  ? 217  THR A CA  1 
ATOM   1709 C C   . THR A 1 217 ? -12.533 21.164  3.498  1.00 94.54  ? 217  THR A C   1 
ATOM   1710 O O   . THR A 1 217 ? -13.322 20.277  3.848  1.00 90.76  ? 217  THR A O   1 
ATOM   1711 C CB  . THR A 1 217 ? -11.462 20.621  1.324  1.00 91.90  ? 217  THR A CB  1 
ATOM   1712 O OG1 . THR A 1 217 ? -11.596 19.306  1.882  1.00 91.72  ? 217  THR A OG1 1 
ATOM   1713 C CG2 . THR A 1 217 ? -10.037 21.089  1.535  1.00 94.57  ? 217  THR A CG2 1 
ATOM   1714 N N   . ARG A 1 218 ? -11.731 21.798  4.357  1.00 77.50  ? 218  ARG A N   1 
ATOM   1715 C CA  . ARG A 1 218 ? -11.610 21.346  5.732  1.00 79.98  ? 218  ARG A CA  1 
ATOM   1716 C C   . ARG A 1 218 ? -10.655 22.216  6.529  1.00 87.54  ? 218  ARG A C   1 
ATOM   1717 O O   . ARG A 1 218 ? -9.778  22.879  5.970  1.00 93.01  ? 218  ARG A O   1 
ATOM   1718 C CB  . ARG A 1 218 ? -11.050 19.931  5.752  1.00 74.76  ? 218  ARG A CB  1 
ATOM   1719 C CG  . ARG A 1 218 ? -9.582  19.907  5.404  1.00 73.41  ? 218  ARG A CG  1 
ATOM   1720 C CD  . ARG A 1 218 ? -8.961  18.542  5.602  1.00 86.05  ? 218  ARG A CD  1 
ATOM   1721 N NE  . ARG A 1 218 ? -7.503  18.635  5.653  1.00 100.49 ? 218  ARG A NE  1 
ATOM   1722 C CZ  . ARG A 1 218 ? -6.718  18.744  4.585  1.00 112.17 ? 218  ARG A CZ  1 
ATOM   1723 N NH1 . ARG A 1 218 ? -7.244  18.775  3.365  1.00 110.05 ? 218  ARG A NH1 1 
ATOM   1724 N NH2 . ARG A 1 218 ? -5.402  18.824  4.738  1.00 121.43 ? 218  ARG A NH2 1 
ATOM   1725 N N   . LYS A 1 219 ? -10.818 22.195  7.845  1.00 75.14  ? 219  LYS A N   1 
ATOM   1726 C CA  . LYS A 1 219 ? -9.823  22.780  8.727  1.00 72.87  ? 219  LYS A CA  1 
ATOM   1727 C C   . LYS A 1 219 ? -9.119  21.663  9.478  1.00 72.45  ? 219  LYS A C   1 
ATOM   1728 O O   . LYS A 1 219 ? -9.659  20.566  9.636  1.00 71.13  ? 219  LYS A O   1 
ATOM   1729 C CB  . LYS A 1 219 ? -10.459 23.775  9.696  1.00 68.09  ? 219  LYS A CB  1 
ATOM   1730 C CG  . LYS A 1 219 ? -11.026 25.006  9.017  1.00 71.53  ? 219  LYS A CG  1 
ATOM   1731 C CD  . LYS A 1 219 ? -11.763 25.918  9.983  1.00 67.33  ? 219  LYS A CD  1 
ATOM   1732 C CE  . LYS A 1 219 ? -12.168 27.203  9.279  1.00 76.19  ? 219  LYS A CE  1 
ATOM   1733 N NZ  . LYS A 1 219 ? -12.893 28.144  10.165 1.00 77.11  ? 219  LYS A NZ  1 
ATOM   1734 N N   . GLU A 1 220 ? -7.898  21.933  9.913  1.00 69.60  ? 220  GLU A N   1 
ATOM   1735 C CA  . GLU A 1 220 ? -7.187  21.001  10.769 1.00 65.72  ? 220  GLU A CA  1 
ATOM   1736 C C   . GLU A 1 220 ? -6.529  21.766  11.888 1.00 70.47  ? 220  GLU A C   1 
ATOM   1737 O O   . GLU A 1 220 ? -6.111  22.909  11.704 1.00 63.63  ? 220  GLU A O   1 
ATOM   1738 C CB  . GLU A 1 220 ? -6.117  20.229  10.005 1.00 68.92  ? 220  GLU A CB  1 
ATOM   1739 C CG  . GLU A 1 220 ? -6.633  19.097  9.148  1.00 76.54  ? 220  GLU A CG  1 
ATOM   1740 C CD  . GLU A 1 220 ? -5.497  18.296  8.538  1.00 85.12  ? 220  GLU A CD  1 
ATOM   1741 O OE1 . GLU A 1 220 ? -4.345  18.463  9.006  1.00 83.65  ? 220  GLU A OE1 1 
ATOM   1742 O OE2 . GLU A 1 220 ? -5.750  17.508  7.595  1.00 81.10  ? 220  GLU A OE2 1 
ATOM   1743 N N   . ILE A 1 221 ? -6.473  21.133  13.057 1.00 67.91  ? 221  ILE A N   1 
ATOM   1744 C CA  . ILE A 1 221 ? -5.592  21.562  14.127 1.00 52.61  ? 221  ILE A CA  1 
ATOM   1745 C C   . ILE A 1 221 ? -4.586  20.445  14.358 1.00 56.59  ? 221  ILE A C   1 
ATOM   1746 O O   . ILE A 1 221 ? -4.963  19.297  14.585 1.00 64.77  ? 221  ILE A O   1 
ATOM   1747 C CB  . ILE A 1 221 ? -6.360  21.847  15.425 1.00 54.89  ? 221  ILE A CB  1 
ATOM   1748 C CG1 . ILE A 1 221 ? -7.478  22.868  15.167 1.00 60.70  ? 221  ILE A CG1 1 
ATOM   1749 C CG2 . ILE A 1 221 ? -5.405  22.337  16.506 1.00 51.59  ? 221  ILE A CG2 1 
ATOM   1750 C CD1 . ILE A 1 221 ? -8.106  23.428  16.431 1.00 60.68  ? 221  ILE A CD1 1 
ATOM   1751 N N   . ARG A 1 222 ? -3.305  20.774  14.259 1.00 60.40  ? 222  ARG A N   1 
ATOM   1752 C CA  . ARG A 1 222 ? -2.255  19.831  14.599 1.00 68.41  ? 222  ARG A CA  1 
ATOM   1753 C C   . ARG A 1 222 ? -1.533  20.365  15.821 1.00 67.21  ? 222  ARG A C   1 
ATOM   1754 O O   . ARG A 1 222 ? -1.210  21.550  15.881 1.00 68.91  ? 222  ARG A O   1 
ATOM   1755 C CB  . ARG A 1 222 ? -1.261  19.687  13.450 1.00 71.07  ? 222  ARG A CB  1 
ATOM   1756 C CG  . ARG A 1 222 ? -1.831  19.128  12.141 1.00 70.83  ? 222  ARG A CG  1 
ATOM   1757 C CD  . ARG A 1 222 ? -0.695  19.009  11.134 1.00 78.07  ? 222  ARG A CD  1 
ATOM   1758 N NE  . ARG A 1 222 ? -1.130  18.741  9.769  1.00 90.04  ? 222  ARG A NE  1 
ATOM   1759 C CZ  . ARG A 1 222 ? -0.860  17.619  9.111  1.00 106.06 ? 222  ARG A CZ  1 
ATOM   1760 N NH1 . ARG A 1 222 ? -0.160  16.653  9.693  1.00 106.50 ? 222  ARG A NH1 1 
ATOM   1761 N NH2 . ARG A 1 222 ? -1.288  17.460  7.866  1.00 114.62 ? 222  ARG A NH2 1 
ATOM   1762 N N   . ILE A 1 223 ? -1.290  19.504  16.803 1.00 66.75  ? 223  ILE A N   1 
ATOM   1763 C CA  . ILE A 1 223 ? -0.556  19.920  17.995 1.00 65.30  ? 223  ILE A CA  1 
ATOM   1764 C C   . ILE A 1 223 ? 0.749   19.151  18.120 1.00 64.67  ? 223  ILE A C   1 
ATOM   1765 O O   . ILE A 1 223 ? 0.748   17.918  18.145 1.00 68.58  ? 223  ILE A O   1 
ATOM   1766 C CB  . ILE A 1 223 ? -1.387  19.720  19.270 1.00 55.53  ? 223  ILE A CB  1 
ATOM   1767 C CG1 . ILE A 1 223 ? -2.666  20.558  19.201 1.00 56.17  ? 223  ILE A CG1 1 
ATOM   1768 C CG2 . ILE A 1 223 ? -0.564  20.086  20.491 1.00 49.60  ? 223  ILE A CG2 1 
ATOM   1769 C CD1 . ILE A 1 223 ? -3.711  20.192  20.248 1.00 43.84  ? 223  ILE A CD1 1 
ATOM   1770 N N   . TYR A 1 224 ? 1.858   19.885  18.195 1.00 66.12  ? 224  TYR A N   1 
ATOM   1771 C CA  . TYR A 1 224 ? 3.188   19.274  18.234 1.00 74.81  ? 224  TYR A CA  1 
ATOM   1772 C C   . TYR A 1 224 ? 3.822   19.392  19.602 1.00 69.97  ? 224  TYR A C   1 
ATOM   1773 O O   . TYR A 1 224 ? 3.707   20.421  20.261 1.00 72.43  ? 224  TYR A O   1 
ATOM   1774 C CB  . TYR A 1 224 ? 4.121   19.915  17.206 1.00 74.35  ? 224  TYR A CB  1 
ATOM   1775 C CG  . TYR A 1 224 ? 3.630   19.811  15.792 1.00 68.90  ? 224  TYR A CG  1 
ATOM   1776 C CD1 . TYR A 1 224 ? 4.255   18.971  14.876 1.00 75.67  ? 224  TYR A CD1 1 
ATOM   1777 C CD2 . TYR A 1 224 ? 2.530   20.545  15.368 1.00 67.19  ? 224  TYR A CD2 1 
ATOM   1778 C CE1 . TYR A 1 224 ? 3.800   18.874  13.572 1.00 78.12  ? 224  TYR A CE1 1 
ATOM   1779 C CE2 . TYR A 1 224 ? 2.064   20.450  14.074 1.00 75.76  ? 224  TYR A CE2 1 
ATOM   1780 C CZ  . TYR A 1 224 ? 2.702   19.616  13.179 1.00 78.87  ? 224  TYR A CZ  1 
ATOM   1781 O OH  . TYR A 1 224 ? 2.234   19.536  11.889 1.00 77.12  ? 224  TYR A OH  1 
ATOM   1782 N N   . LYS A 1 225 ? 4.501   18.328  20.014 1.00 73.55  ? 225  LYS A N   1 
ATOM   1783 C CA  . LYS A 1 225 ? 5.213   18.317  21.279 1.00 72.84  ? 225  LYS A CA  1 
ATOM   1784 C C   . LYS A 1 225 ? 6.319   19.359  21.240 1.00 77.18  ? 225  LYS A C   1 
ATOM   1785 O O   . LYS A 1 225 ? 7.120   19.407  20.300 1.00 81.04  ? 225  LYS A O   1 
ATOM   1786 C CB  . LYS A 1 225 ? 5.799   16.932  21.560 1.00 81.64  ? 225  LYS A CB  1 
ATOM   1787 C CG  . LYS A 1 225 ? 6.388   16.775  22.960 1.00 95.97  ? 225  LYS A CG  1 
ATOM   1788 C CD  . LYS A 1 225 ? 7.362   15.598  23.028 1.00 105.65 ? 225  LYS A CD  1 
ATOM   1789 C CE  . LYS A 1 225 ? 8.001   15.464  24.407 1.00 105.13 ? 225  LYS A CE  1 
ATOM   1790 N NZ  . LYS A 1 225 ? 9.147   14.500  24.398 1.00 105.40 ? 225  LYS A NZ  1 
ATOM   1791 N N   . THR A 1 226 ? 6.351   20.208  22.260 1.00 81.96  ? 226  THR A N   1 
ATOM   1792 C CA  . THR A 1 226 ? 7.386   21.226  22.361 1.00 80.78  ? 226  THR A CA  1 
ATOM   1793 C C   . THR A 1 226 ? 8.303   20.922  23.525 1.00 76.03  ? 226  THR A C   1 
ATOM   1794 O O   . THR A 1 226 ? 7.989   20.083  24.370 1.00 72.73  ? 226  THR A O   1 
ATOM   1795 C CB  . THR A 1 226 ? 6.791   22.642  22.523 1.00 75.66  ? 226  THR A CB  1 
ATOM   1796 O OG1 . THR A 1 226 ? 5.915   22.677  23.663 1.00 75.55  ? 226  THR A OG1 1 
ATOM   1797 C CG2 . THR A 1 226 ? 6.018   23.046  21.252 1.00 53.03  ? 226  THR A CG2 1 
ATOM   1798 N N   . LYS A 1 227 ? 9.445   21.601  23.545 1.00 87.61  ? 227  LYS A N   1 
ATOM   1799 C CA  . LYS A 1 227 ? 10.393  21.534  24.650 1.00 90.77  ? 227  LYS A CA  1 
ATOM   1800 C C   . LYS A 1 227 ? 10.496  22.924  25.277 1.00 83.20  ? 227  LYS A C   1 
ATOM   1801 O O   . LYS A 1 227 ? 10.151  23.922  24.646 1.00 81.52  ? 227  LYS A O   1 
ATOM   1802 C CB  . LYS A 1 227 ? 11.767  21.078  24.135 1.00 102.61 ? 227  LYS A CB  1 
ATOM   1803 C CG  . LYS A 1 227 ? 12.814  20.895  25.228 1.00 118.12 ? 227  LYS A CG  1 
ATOM   1804 C CD  . LYS A 1 227 ? 14.199  20.617  24.653 1.00 127.58 ? 227  LYS A CD  1 
ATOM   1805 C CE  . LYS A 1 227 ? 15.273  20.683  25.741 1.00 123.60 ? 227  LYS A CE  1 
ATOM   1806 N NZ  . LYS A 1 227 ? 16.661  20.615  25.191 1.00 121.93 ? 227  LYS A NZ  1 
ATOM   1807 N N   . ARG A 1 228 ? 10.967  23.000  26.515 1.00 84.06  ? 228  ARG A N   1 
ATOM   1808 C CA  . ARG A 1 228 ? 11.182  24.295  27.150 1.00 81.30  ? 228  ARG A CA  1 
ATOM   1809 C C   . ARG A 1 228 ? 12.646  24.464  27.517 1.00 76.56  ? 228  ARG A C   1 
ATOM   1810 O O   . ARG A 1 228 ? 13.256  23.542  28.051 1.00 78.82  ? 228  ARG A O   1 
ATOM   1811 C CB  . ARG A 1 228 ? 10.311  24.428  28.400 1.00 88.17  ? 228  ARG A CB  1 
ATOM   1812 C CG  . ARG A 1 228 ? 9.528   25.730  28.475 1.00 97.15  ? 228  ARG A CG  1 
ATOM   1813 C CD  . ARG A 1 228 ? 8.643   25.791  29.714 1.00 103.97 ? 228  ARG A CD  1 
ATOM   1814 N NE  . ARG A 1 228 ? 8.063   24.491  30.040 1.00 113.68 ? 228  ARG A NE  1 
ATOM   1815 C CZ  . ARG A 1 228 ? 7.073   23.917  29.360 1.00 123.42 ? 228  ARG A CZ  1 
ATOM   1816 N NH1 . ARG A 1 228 ? 6.549   24.524  28.301 1.00 126.98 ? 228  ARG A NH1 1 
ATOM   1817 N NH2 . ARG A 1 228 ? 6.609   22.730  29.736 1.00 120.95 ? 228  ARG A NH2 1 
ATOM   1818 N N   . ARG A 1 229 ? 13.211  25.636  27.229 1.00 76.81  ? 229  ARG A N   1 
ATOM   1819 C CA  . ARG A 1 229 ? 14.597  25.919  27.598 1.00 83.21  ? 229  ARG A CA  1 
ATOM   1820 C C   . ARG A 1 229 ? 14.758  27.223  28.378 1.00 84.59  ? 229  ARG A C   1 
ATOM   1821 O O   . ARG A 1 229 ? 14.453  28.308  27.871 1.00 74.14  ? 229  ARG A O   1 
ATOM   1822 C CB  . ARG A 1 229 ? 15.513  25.929  26.370 1.00 102.33 ? 229  ARG A CB  1 
ATOM   1823 C CG  . ARG A 1 229 ? 15.673  24.568  25.696 1.00 120.43 ? 229  ARG A CG  1 
ATOM   1824 C CD  . ARG A 1 229 ? 16.931  24.502  24.824 1.00 128.59 ? 229  ARG A CD  1 
ATOM   1825 N NE  . ARG A 1 229 ? 16.967  23.293  24.001 1.00 126.16 ? 229  ARG A NE  1 
ATOM   1826 C CZ  . ARG A 1 229 ? 17.985  22.942  23.218 1.00 128.56 ? 229  ARG A CZ  1 
ATOM   1827 N NH1 . ARG A 1 229 ? 19.074  23.701  23.145 1.00 130.39 ? 229  ARG A NH1 1 
ATOM   1828 N NH2 . ARG A 1 229 ? 17.914  21.824  22.508 1.00 127.48 ? 229  ARG A NH2 1 
ATOM   1829 N N   . LYS A 1 230 ? 15.253  27.103  29.610 1.00 64.52  ? 230  LYS A N   1 
ATOM   1830 C CA  . LYS A 1 230 ? 15.542  28.264  30.438 1.00 66.57  ? 230  LYS A CA  1 
ATOM   1831 C C   . LYS A 1 230 ? 16.531  29.180  29.745 1.00 62.56  ? 230  LYS A C   1 
ATOM   1832 O O   . LYS A 1 230 ? 17.679  28.809  29.505 1.00 59.76  ? 230  LYS A O   1 
ATOM   1833 C CB  . LYS A 1 230 ? 16.092  27.843  31.805 1.00 72.00  ? 230  LYS A CB  1 
ATOM   1834 C CG  . LYS A 1 230 ? 15.022  27.603  32.859 1.00 68.08  ? 230  LYS A CG  1 
ATOM   1835 C CD  . LYS A 1 230 ? 15.569  26.792  34.027 1.00 70.07  ? 230  LYS A CD  1 
ATOM   1836 C CE  . LYS A 1 230 ? 14.825  25.457  34.192 1.00 69.01  ? 230  LYS A CE  1 
ATOM   1837 N NZ  . LYS A 1 230 ? 13.394  25.620  34.613 1.00 62.28  ? 230  LYS A NZ  1 
ATOM   1838 N N   . LEU A 1 231 ? 16.070  30.388  29.441 1.00 59.36  ? 231  LEU A N   1 
ATOM   1839 C CA  . LEU A 1 231 ? 16.865  31.383  28.735 1.00 51.39  ? 231  LEU A CA  1 
ATOM   1840 C C   . LEU A 1 231 ? 18.074  31.884  29.534 1.00 58.81  ? 231  LEU A C   1 
ATOM   1841 O O   . LEU A 1 231 ? 19.103  32.231  28.959 1.00 56.60  ? 231  LEU A O   1 
ATOM   1842 C CB  . LEU A 1 231 ? 15.961  32.558  28.352 1.00 50.69  ? 231  LEU A CB  1 
ATOM   1843 C CG  . LEU A 1 231 ? 15.976  33.047  26.902 1.00 55.93  ? 231  LEU A CG  1 
ATOM   1844 C CD1 . LEU A 1 231 ? 16.315  31.926  25.907 1.00 51.98  ? 231  LEU A CD1 1 
ATOM   1845 C CD2 . LEU A 1 231 ? 14.650  33.701  26.564 1.00 47.19  ? 231  LEU A CD2 1 
ATOM   1846 N N   . PHE A 1 232 ? 17.945  31.934  30.861 1.00 66.28  ? 232  PHE A N   1 
ATOM   1847 C CA  . PHE A 1 232 ? 19.004  32.493  31.703 1.00 64.31  ? 232  PHE A CA  1 
ATOM   1848 C C   . PHE A 1 232 ? 19.249  31.667  32.948 1.00 60.82  ? 232  PHE A C   1 
ATOM   1849 O O   . PHE A 1 232 ? 18.763  32.007  34.032 1.00 61.87  ? 232  PHE A O   1 
ATOM   1850 C CB  . PHE A 1 232 ? 18.664  33.922  32.132 1.00 62.88  ? 232  PHE A CB  1 
ATOM   1851 C CG  . PHE A 1 232 ? 18.150  34.778  31.027 1.00 56.07  ? 232  PHE A CG  1 
ATOM   1852 C CD1 . PHE A 1 232 ? 16.789  34.930  30.834 1.00 52.59  ? 232  PHE A CD1 1 
ATOM   1853 C CD2 . PHE A 1 232 ? 19.027  35.435  30.179 1.00 64.56  ? 232  PHE A CD2 1 
ATOM   1854 C CE1 . PHE A 1 232 ? 16.309  35.731  29.812 1.00 60.90  ? 232  PHE A CE1 1 
ATOM   1855 C CE2 . PHE A 1 232 ? 18.558  36.234  29.154 1.00 67.16  ? 232  PHE A CE2 1 
ATOM   1856 C CZ  . PHE A 1 232 ? 17.198  36.385  28.969 1.00 62.07  ? 232  PHE A CZ  1 
ATOM   1857 N N   . PRO A 1 233 ? 20.020  30.589  32.805 1.00 62.30  ? 233  PRO A N   1 
ATOM   1858 C CA  . PRO A 1 233 ? 20.354  29.752  33.958 1.00 61.69  ? 233  PRO A CA  1 
ATOM   1859 C C   . PRO A 1 233 ? 20.794  30.607  35.146 1.00 65.14  ? 233  PRO A C   1 
ATOM   1860 O O   . PRO A 1 233 ? 21.564  31.558  34.971 1.00 66.32  ? 233  PRO A O   1 
ATOM   1861 C CB  . PRO A 1 233 ? 21.529  28.921  33.450 1.00 62.27  ? 233  PRO A CB  1 
ATOM   1862 C CG  . PRO A 1 233 ? 21.304  28.833  31.953 1.00 68.34  ? 233  PRO A CG  1 
ATOM   1863 C CD  . PRO A 1 233 ? 20.692  30.150  31.567 1.00 69.09  ? 233  PRO A CD  1 
ATOM   1864 N N   . GLY A 1 234 ? 20.290  30.277  36.331 1.00 47.01  ? 234  GLY A N   1 
ATOM   1865 C CA  . GLY A 1 234 ? 20.741  30.903  37.556 1.00 57.73  ? 234  GLY A CA  1 
ATOM   1866 C C   . GLY A 1 234 ? 20.083  32.231  37.856 1.00 62.78  ? 234  GLY A C   1 
ATOM   1867 O O   . GLY A 1 234 ? 20.475  32.908  38.803 1.00 68.02  ? 234  GLY A O   1 
ATOM   1868 N N   . TYR A 1 235 ? 19.094  32.614  37.052 1.00 49.62  ? 235  TYR A N   1 
ATOM   1869 C CA  . TYR A 1 235 ? 18.359  33.847  37.308 1.00 48.16  ? 235  TYR A CA  1 
ATOM   1870 C C   . TYR A 1 235 ? 16.933  33.525  37.702 1.00 61.38  ? 235  TYR A C   1 
ATOM   1871 O O   . TYR A 1 235 ? 16.291  32.678  37.087 1.00 59.61  ? 235  TYR A O   1 
ATOM   1872 C CB  . TYR A 1 235 ? 18.329  34.761  36.084 1.00 51.25  ? 235  TYR A CB  1 
ATOM   1873 C CG  . TYR A 1 235 ? 19.565  35.602  35.844 1.00 51.95  ? 235  TYR A CG  1 
ATOM   1874 C CD1 . TYR A 1 235 ? 20.721  35.422  36.592 1.00 52.99  ? 235  TYR A CD1 1 
ATOM   1875 C CD2 . TYR A 1 235 ? 19.565  36.589  34.858 1.00 57.38  ? 235  TYR A CD2 1 
ATOM   1876 C CE1 . TYR A 1 235 ? 21.851  36.201  36.361 1.00 59.80  ? 235  TYR A CE1 1 
ATOM   1877 C CE2 . TYR A 1 235 ? 20.682  37.375  34.622 1.00 59.23  ? 235  TYR A CE2 1 
ATOM   1878 C CZ  . TYR A 1 235 ? 21.823  37.177  35.374 1.00 63.83  ? 235  TYR A CZ  1 
ATOM   1879 O OH  . TYR A 1 235 ? 22.932  37.963  35.144 1.00 58.06  ? 235  TYR A OH  1 
ATOM   1880 N N   . VAL A 1 236 ? 16.443  34.194  38.742 1.00 66.00  ? 236  VAL A N   1 
ATOM   1881 C CA  . VAL A 1 236 ? 15.021  34.163  39.052 1.00 47.70  ? 236  VAL A CA  1 
ATOM   1882 C C   . VAL A 1 236 ? 14.538  35.596  39.167 1.00 50.72  ? 236  VAL A C   1 
ATOM   1883 O O   . VAL A 1 236 ? 15.086  36.384  39.926 1.00 60.88  ? 236  VAL A O   1 
ATOM   1884 C CB  . VAL A 1 236 ? 14.722  33.377  40.329 1.00 49.85  ? 236  VAL A CB  1 
ATOM   1885 C CG1 . VAL A 1 236 ? 13.237  33.458  40.666 1.00 47.29  ? 236  VAL A CG1 1 
ATOM   1886 C CG2 . VAL A 1 236 ? 15.167  31.918  40.167 1.00 41.84  ? 236  VAL A CG2 1 
ATOM   1887 N N   . PHE A 1 237 ? 13.542  35.945  38.367 1.00 58.22  ? 237  PHE A N   1 
ATOM   1888 C CA  . PHE A 1 237 ? 13.020  37.299  38.367 1.00 50.60  ? 237  PHE A CA  1 
ATOM   1889 C C   . PHE A 1 237 ? 11.871  37.325  39.306 1.00 48.51  ? 237  PHE A C   1 
ATOM   1890 O O   . PHE A 1 237 ? 10.887  36.615  39.126 1.00 50.12  ? 237  PHE A O   1 
ATOM   1891 C CB  . PHE A 1 237 ? 12.560  37.712  36.973 1.00 53.28  ? 237  PHE A CB  1 
ATOM   1892 C CG  . PHE A 1 237 ? 13.662  37.730  35.979 1.00 51.37  ? 237  PHE A CG  1 
ATOM   1893 C CD1 . PHE A 1 237 ? 14.169  38.931  35.511 1.00 54.25  ? 237  PHE A CD1 1 
ATOM   1894 C CD2 . PHE A 1 237 ? 14.225  36.541  35.543 1.00 48.19  ? 237  PHE A CD2 1 
ATOM   1895 C CE1 . PHE A 1 237 ? 15.214  38.946  34.600 1.00 62.23  ? 237  PHE A CE1 1 
ATOM   1896 C CE2 . PHE A 1 237 ? 15.267  36.547  34.627 1.00 52.89  ? 237  PHE A CE2 1 
ATOM   1897 C CZ  . PHE A 1 237 ? 15.761  37.750  34.156 1.00 59.23  ? 237  PHE A CZ  1 
ATOM   1898 N N   . VAL A 1 238 ? 12.007  38.143  40.333 1.00 52.74  ? 238  VAL A N   1 
ATOM   1899 C CA  . VAL A 1 238 ? 10.988  38.204  41.342 1.00 55.38  ? 238  VAL A CA  1 
ATOM   1900 C C   . VAL A 1 238 ? 10.550  39.651  41.488 1.00 55.53  ? 238  VAL A C   1 
ATOM   1901 O O   . VAL A 1 238 ? 11.371  40.564  41.518 1.00 54.47  ? 238  VAL A O   1 
ATOM   1902 C CB  . VAL A 1 238 ? 11.512  37.581  42.644 1.00 56.21  ? 238  VAL A CB  1 
ATOM   1903 C CG1 . VAL A 1 238 ? 13.003  37.800  42.739 1.00 58.40  ? 238  VAL A CG1 1 
ATOM   1904 C CG2 . VAL A 1 238 ? 10.770  38.119  43.856 1.00 42.14  ? 238  VAL A CG2 1 
ATOM   1905 N N   . GLU A 1 239 ? 9.238   39.843  41.480 1.00 63.18  ? 239  GLU A N   1 
ATOM   1906 C CA  . GLU A 1 239 ? 8.616   41.145  41.661 1.00 59.82  ? 239  GLU A CA  1 
ATOM   1907 C C   . GLU A 1 239 ? 8.467   41.356  43.166 1.00 63.33  ? 239  GLU A C   1 
ATOM   1908 O O   . GLU A 1 239 ? 7.913   40.503  43.863 1.00 63.52  ? 239  GLU A O   1 
ATOM   1909 C CB  . GLU A 1 239 ? 7.238   41.123  41.012 1.00 57.31  ? 239  GLU A CB  1 
ATOM   1910 C CG  . GLU A 1 239 ? 6.804   42.427  40.398 1.00 70.34  ? 239  GLU A CG  1 
ATOM   1911 C CD  . GLU A 1 239 ? 5.341   42.416  39.989 1.00 73.80  ? 239  GLU A CD  1 
ATOM   1912 O OE1 . GLU A 1 239 ? 4.625   41.456  40.351 1.00 69.54  ? 239  GLU A OE1 1 
ATOM   1913 O OE2 . GLU A 1 239 ? 4.908   43.373  39.310 1.00 76.20  ? 239  GLU A OE2 1 
ATOM   1914 N N   . MET A 1 240 ? 8.957   42.476  43.681 1.00 62.98  ? 240  MET A N   1 
ATOM   1915 C CA  . MET A 1 240 ? 8.952   42.674  45.129 1.00 63.62  ? 240  MET A CA  1 
ATOM   1916 C C   . MET A 1 240 ? 9.287   44.097  45.529 1.00 66.62  ? 240  MET A C   1 
ATOM   1917 O O   . MET A 1 240 ? 10.060  44.783  44.851 1.00 68.61  ? 240  MET A O   1 
ATOM   1918 C CB  . MET A 1 240 ? 9.978   41.744  45.769 1.00 61.68  ? 240  MET A CB  1 
ATOM   1919 C CG  . MET A 1 240 ? 11.353  41.871  45.130 1.00 55.89  ? 240  MET A CG  1 
ATOM   1920 S SD  . MET A 1 240 ? 12.581  40.749  45.824 1.00 54.10  ? 240  MET A SD  1 
ATOM   1921 C CE  . MET A 1 240 ? 12.804  41.509  47.443 1.00 58.86  ? 240  MET A CE  1 
ATOM   1922 N N   . ILE A 1 241 ? 8.713   44.548  46.638 1.00 62.39  ? 241  ILE A N   1 
ATOM   1923 C CA  . ILE A 1 241 ? 9.184   45.787  47.222 1.00 62.62  ? 241  ILE A CA  1 
ATOM   1924 C C   . ILE A 1 241 ? 10.604  45.480  47.638 1.00 56.58  ? 241  ILE A C   1 
ATOM   1925 O O   . ILE A 1 241 ? 10.944  44.323  47.879 1.00 66.43  ? 241  ILE A O   1 
ATOM   1926 C CB  . ILE A 1 241 ? 8.387   46.203  48.467 1.00 69.82  ? 241  ILE A CB  1 
ATOM   1927 C CG1 . ILE A 1 241 ? 8.818   45.373  49.672 1.00 75.98  ? 241  ILE A CG1 1 
ATOM   1928 C CG2 . ILE A 1 241 ? 6.893   46.091  48.216 1.00 67.74  ? 241  ILE A CG2 1 
ATOM   1929 C CD1 . ILE A 1 241 ? 8.239   45.871  50.979 1.00 90.34  ? 241  ILE A CD1 1 
ATOM   1930 N N   . MET A 1 242 ? 11.451  46.494  47.688 1.00 50.78  ? 242  MET A N   1 
ATOM   1931 C CA  . MET A 1 242 ? 12.801  46.278  48.153 1.00 48.75  ? 242  MET A CA  1 
ATOM   1932 C C   . MET A 1 242 ? 13.102  47.131  49.375 1.00 58.42  ? 242  MET A C   1 
ATOM   1933 O O   . MET A 1 242 ? 13.242  48.343  49.275 1.00 65.32  ? 242  MET A O   1 
ATOM   1934 C CB  . MET A 1 242 ? 13.830  46.576  47.069 1.00 42.95  ? 242  MET A CB  1 
ATOM   1935 C CG  . MET A 1 242 ? 15.248  46.296  47.560 1.00 45.27  ? 242  MET A CG  1 
ATOM   1936 S SD  . MET A 1 242 ? 15.462  44.544  47.919 1.00 58.09  ? 242  MET A SD  1 
ATOM   1937 C CE  . MET A 1 242 ? 15.636  43.892  46.260 1.00 46.61  ? 242  MET A CE  1 
ATOM   1938 N N   . ASN A 1 243 ? 13.197  46.478  50.523 1.00 56.51  ? 243  ASN A N   1 
ATOM   1939 C CA  . ASN A 1 243 ? 13.718  47.093  51.734 1.00 55.98  ? 243  ASN A CA  1 
ATOM   1940 C C   . ASN A 1 243 ? 14.390  46.023  52.574 1.00 52.40  ? 243  ASN A C   1 
ATOM   1941 O O   . ASN A 1 243 ? 14.488  44.862  52.147 1.00 54.77  ? 243  ASN A O   1 
ATOM   1942 C CB  . ASN A 1 243 ? 12.606  47.772  52.531 1.00 48.41  ? 243  ASN A CB  1 
ATOM   1943 C CG  . ASN A 1 243 ? 11.437  46.844  52.814 1.00 49.86  ? 243  ASN A CG  1 
ATOM   1944 O OD1 . ASN A 1 243 ? 11.582  45.618  52.857 1.00 51.52  ? 243  ASN A OD1 1 
ATOM   1945 N ND2 . ASN A 1 243 ? 10.264  47.430  52.997 1.00 48.13  ? 243  ASN A ND2 1 
ATOM   1946 N N   . ASP A 1 244 ? 14.842  46.406  53.765 1.00 54.07  ? 244  ASP A N   1 
ATOM   1947 C CA  . ASP A 1 244 ? 15.524  45.475  54.657 1.00 51.91  ? 244  ASP A CA  1 
ATOM   1948 C C   . ASP A 1 244 ? 14.762  44.155  54.717 1.00 48.44  ? 244  ASP A C   1 
ATOM   1949 O O   . ASP A 1 244 ? 15.314  43.105  54.386 1.00 53.63  ? 244  ASP A O   1 
ATOM   1950 C CB  . ASP A 1 244 ? 15.697  46.060  56.062 1.00 50.50  ? 244  ASP A CB  1 
ATOM   1951 C CG  . ASP A 1 244 ? 16.411  47.415  56.063 1.00 66.51  ? 244  ASP A CG  1 
ATOM   1952 O OD1 . ASP A 1 244 ? 17.067  47.760  55.059 1.00 71.81  ? 244  ASP A OD1 1 
ATOM   1953 O OD2 . ASP A 1 244 ? 16.326  48.137  57.087 1.00 80.12  ? 244  ASP A OD2 1 
ATOM   1954 N N   . GLU A 1 245 ? 13.489  44.218  55.099 1.00 41.62  ? 245  GLU A N   1 
ATOM   1955 C CA  . GLU A 1 245 ? 12.668  43.024  55.279 1.00 48.78  ? 245  GLU A CA  1 
ATOM   1956 C C   . GLU A 1 245 ? 12.505  42.178  54.014 1.00 47.98  ? 245  GLU A C   1 
ATOM   1957 O O   . GLU A 1 245 ? 12.737  40.972  54.020 1.00 45.16  ? 245  GLU A O   1 
ATOM   1958 C CB  . GLU A 1 245 ? 11.293  43.404  55.807 1.00 54.89  ? 245  GLU A CB  1 
ATOM   1959 C CG  . GLU A 1 245 ? 10.529  42.213  56.365 1.00 72.19  ? 245  GLU A CG  1 
ATOM   1960 C CD  . GLU A 1 245 ? 9.057   42.508  56.540 1.00 82.14  ? 245  GLU A CD  1 
ATOM   1961 O OE1 . GLU A 1 245 ? 8.337   41.633  57.066 1.00 82.03  ? 245  GLU A OE1 1 
ATOM   1962 O OE2 . GLU A 1 245 ? 8.624   43.615  56.145 1.00 78.01  ? 245  GLU A OE2 1 
ATOM   1963 N N   . ALA A 1 246 ? 12.081  42.808  52.934 1.00 45.23  ? 246  ALA A N   1 
ATOM   1964 C CA  . ALA A 1 246 ? 11.962  42.093  51.664 1.00 48.34  ? 246  ALA A CA  1 
ATOM   1965 C C   . ALA A 1 246 ? 13.306  41.457  51.295 1.00 44.07  ? 246  ALA A C   1 
ATOM   1966 O O   . ALA A 1 246 ? 13.383  40.274  50.991 1.00 46.70  ? 246  ALA A O   1 
ATOM   1967 C CB  . ALA A 1 246 ? 11.485  43.035  50.571 1.00 41.54  ? 246  ALA A CB  1 
ATOM   1968 N N   . TYR A 1 247 ? 14.371  42.248  51.356 1.00 51.82  ? 247  TYR A N   1 
ATOM   1969 C CA  . TYR A 1 247 ? 15.705  41.750  51.053 1.00 42.87  ? 247  TYR A CA  1 
ATOM   1970 C C   . TYR A 1 247 ? 16.015  40.500  51.845 1.00 48.87  ? 247  TYR A C   1 
ATOM   1971 O O   . TYR A 1 247 ? 16.302  39.448  51.270 1.00 47.44  ? 247  TYR A O   1 
ATOM   1972 C CB  . TYR A 1 247 ? 16.776  42.802  51.357 1.00 46.27  ? 247  TYR A CB  1 
ATOM   1973 C CG  . TYR A 1 247 ? 18.171  42.285  51.088 1.00 54.21  ? 247  TYR A CG  1 
ATOM   1974 C CD1 . TYR A 1 247 ? 18.725  42.351  49.807 1.00 56.74  ? 247  TYR A CD1 1 
ATOM   1975 C CD2 . TYR A 1 247 ? 18.929  41.710  52.104 1.00 57.45  ? 247  TYR A CD2 1 
ATOM   1976 C CE1 . TYR A 1 247 ? 20.002  41.862  49.548 1.00 58.72  ? 247  TYR A CE1 1 
ATOM   1977 C CE2 . TYR A 1 247 ? 20.210  41.220  51.856 1.00 68.71  ? 247  TYR A CE2 1 
ATOM   1978 C CZ  . TYR A 1 247 ? 20.740  41.298  50.573 1.00 67.01  ? 247  TYR A CZ  1 
ATOM   1979 O OH  . TYR A 1 247 ? 22.010  40.817  50.326 1.00 65.69  ? 247  TYR A OH  1 
ATOM   1980 N N   . ASN A 1 248 ? 15.984  40.633  53.171 1.00 53.93  ? 248  ASN A N   1 
ATOM   1981 C CA  . ASN A 1 248 ? 16.311  39.526  54.057 1.00 48.08  ? 248  ASN A CA  1 
ATOM   1982 C C   . ASN A 1 248 ? 15.311  38.383  53.879 1.00 49.26  ? 248  ASN A C   1 
ATOM   1983 O O   . ASN A 1 248 ? 15.654  37.211  53.979 1.00 48.57  ? 248  ASN A O   1 
ATOM   1984 C CB  . ASN A 1 248 ? 16.320  39.998  55.506 1.00 43.60  ? 248  ASN A CB  1 
ATOM   1985 C CG  . ASN A 1 248 ? 17.438  40.992  55.797 1.00 57.36  ? 248  ASN A CG  1 
ATOM   1986 O OD1 . ASN A 1 248 ? 18.595  40.769  55.434 1.00 56.53  ? 248  ASN A OD1 1 
ATOM   1987 N ND2 . ASN A 1 248 ? 17.096  42.091  56.476 1.00 51.68  ? 248  ASN A ND2 1 
ATOM   1988 N N   . PHE A 1 249 ? 14.063  38.738  53.615 1.00 49.03  ? 249  PHE A N   1 
ATOM   1989 C CA  . PHE A 1 249 ? 13.046  37.736  53.415 1.00 42.21  ? 249  PHE A CA  1 
ATOM   1990 C C   . PHE A 1 249 ? 13.453  36.806  52.276 1.00 51.85  ? 249  PHE A C   1 
ATOM   1991 O O   . PHE A 1 249 ? 13.528  35.589  52.467 1.00 51.80  ? 249  PHE A O   1 
ATOM   1992 C CB  . PHE A 1 249 ? 11.696  38.377  53.115 1.00 52.48  ? 249  PHE A CB  1 
ATOM   1993 C CG  . PHE A 1 249 ? 10.604  37.379  52.921 1.00 56.85  ? 249  PHE A CG  1 
ATOM   1994 C CD1 . PHE A 1 249 ? 9.850   36.933  54.008 1.00 43.45  ? 249  PHE A CD1 1 
ATOM   1995 C CD2 . PHE A 1 249 ? 10.343  36.863  51.658 1.00 42.74  ? 249  PHE A CD2 1 
ATOM   1996 C CE1 . PHE A 1 249 ? 8.849   35.999  53.837 1.00 48.91  ? 249  PHE A CE1 1 
ATOM   1997 C CE2 . PHE A 1 249 ? 9.350   35.914  51.480 1.00 54.10  ? 249  PHE A CE2 1 
ATOM   1998 C CZ  . PHE A 1 249 ? 8.599   35.480  52.568 1.00 59.27  ? 249  PHE A CZ  1 
ATOM   1999 N N   . VAL A 1 250 ? 13.727  37.371  51.096 1.00 46.35  ? 250  VAL A N   1 
ATOM   2000 C CA  . VAL A 1 250 ? 14.119  36.535  49.957 1.00 49.58  ? 250  VAL A CA  1 
ATOM   2001 C C   . VAL A 1 250 ? 15.576  36.050  50.014 1.00 48.96  ? 250  VAL A C   1 
ATOM   2002 O O   . VAL A 1 250 ? 15.848  34.886  49.737 1.00 51.47  ? 250  VAL A O   1 
ATOM   2003 C CB  . VAL A 1 250 ? 13.724  37.142  48.546 1.00 33.15  ? 250  VAL A CB  1 
ATOM   2004 C CG1 . VAL A 1 250 ? 13.657  38.630  48.595 1.00 52.35  ? 250  VAL A CG1 1 
ATOM   2005 C CG2 . VAL A 1 250 ? 14.717  36.694  47.476 1.00 37.07  ? 250  VAL A CG2 1 
ATOM   2006 N N   . ARG A 1 251 ? 16.503  36.917  50.401 1.00 56.66  ? 251  ARG A N   1 
ATOM   2007 C CA  . ARG A 1 251 ? 17.916  36.525  50.481 1.00 59.85  ? 251  ARG A CA  1 
ATOM   2008 C C   . ARG A 1 251 ? 18.175  35.260  51.309 1.00 56.90  ? 251  ARG A C   1 
ATOM   2009 O O   . ARG A 1 251 ? 19.123  34.507  51.042 1.00 48.52  ? 251  ARG A O   1 
ATOM   2010 C CB  . ARG A 1 251 ? 18.771  37.668  51.037 1.00 58.95  ? 251  ARG A CB  1 
ATOM   2011 C CG  . ARG A 1 251 ? 20.264  37.346  51.139 1.00 57.11  ? 251  ARG A CG  1 
ATOM   2012 C CD  . ARG A 1 251 ? 20.867  37.059  49.764 1.00 63.58  ? 251  ARG A CD  1 
ATOM   2013 N NE  . ARG A 1 251 ? 22.311  36.827  49.808 1.00 66.69  ? 251  ARG A NE  1 
ATOM   2014 C CZ  . ARG A 1 251 ? 22.869  35.621  49.874 1.00 64.71  ? 251  ARG A CZ  1 
ATOM   2015 N NH1 . ARG A 1 251 ? 22.099  34.540  49.911 1.00 63.21  ? 251  ARG A NH1 1 
ATOM   2016 N NH2 . ARG A 1 251 ? 24.193  35.496  49.906 1.00 56.66  ? 251  ARG A NH2 1 
ATOM   2017 N N   . SER A 1 252 ? 17.346  35.021  52.317 1.00 50.80  ? 252  SER A N   1 
ATOM   2018 C CA  . SER A 1 252 ? 17.650  33.945  53.255 1.00 58.96  ? 252  SER A CA  1 
ATOM   2019 C C   . SER A 1 252 ? 16.931  32.658  52.870 1.00 60.41  ? 252  SER A C   1 
ATOM   2020 O O   . SER A 1 252 ? 16.906  31.674  53.625 1.00 54.43  ? 252  SER A O   1 
ATOM   2021 C CB  . SER A 1 252 ? 17.318  34.356  54.690 1.00 45.46  ? 252  SER A CB  1 
ATOM   2022 O OG  . SER A 1 252 ? 15.929  34.565  54.848 1.00 53.11  ? 252  SER A OG  1 
ATOM   2023 N N   . VAL A 1 253 ? 16.338  32.672  51.686 1.00 52.92  ? 253  VAL A N   1 
ATOM   2024 C CA  . VAL A 1 253 ? 15.703  31.475  51.164 1.00 51.91  ? 253  VAL A CA  1 
ATOM   2025 C C   . VAL A 1 253 ? 16.790  30.473  50.800 1.00 54.21  ? 253  VAL A C   1 
ATOM   2026 O O   . VAL A 1 253 ? 17.860  30.857  50.331 1.00 48.91  ? 253  VAL A O   1 
ATOM   2027 C CB  . VAL A 1 253 ? 14.804  31.795  49.969 1.00 54.04  ? 253  VAL A CB  1 
ATOM   2028 C CG1 . VAL A 1 253 ? 14.355  30.522  49.272 1.00 57.11  ? 253  VAL A CG1 1 
ATOM   2029 C CG2 . VAL A 1 253 ? 13.597  32.611  50.449 1.00 47.96  ? 253  VAL A CG2 1 
ATOM   2030 N N   . PRO A 1 254 ? 16.548  29.186  51.086 1.00 57.51  ? 254  PRO A N   1 
ATOM   2031 C CA  . PRO A 1 254 ? 17.495  28.137  50.706 1.00 59.91  ? 254  PRO A CA  1 
ATOM   2032 C C   . PRO A 1 254 ? 17.764  28.166  49.205 1.00 58.88  ? 254  PRO A C   1 
ATOM   2033 O O   . PRO A 1 254 ? 16.833  28.281  48.411 1.00 49.27  ? 254  PRO A O   1 
ATOM   2034 C CB  . PRO A 1 254 ? 16.758  26.861  51.096 1.00 59.57  ? 254  PRO A CB  1 
ATOM   2035 C CG  . PRO A 1 254 ? 15.924  27.275  52.260 1.00 62.79  ? 254  PRO A CG  1 
ATOM   2036 C CD  . PRO A 1 254 ? 15.459  28.667  51.930 1.00 61.06  ? 254  PRO A CD  1 
ATOM   2037 N N   . TYR A 1 255 ? 19.038  28.094  48.841 1.00 65.26  ? 255  TYR A N   1 
ATOM   2038 C CA  . TYR A 1 255 ? 19.465  28.127  47.445 1.00 74.17  ? 255  TYR A CA  1 
ATOM   2039 C C   . TYR A 1 255 ? 19.514  29.514  46.833 1.00 69.84  ? 255  TYR A C   1 
ATOM   2040 O O   . TYR A 1 255 ? 20.078  29.686  45.752 1.00 72.61  ? 255  TYR A O   1 
ATOM   2041 C CB  . TYR A 1 255 ? 18.611  27.212  46.571 1.00 72.89  ? 255  TYR A CB  1 
ATOM   2042 C CG  . TYR A 1 255 ? 18.817  25.748  46.848 1.00 64.90  ? 255  TYR A CG  1 
ATOM   2043 C CD1 . TYR A 1 255 ? 20.053  25.152  46.643 1.00 60.45  ? 255  TYR A CD1 1 
ATOM   2044 C CD2 . TYR A 1 255 ? 17.772  24.959  47.301 1.00 61.38  ? 255  TYR A CD2 1 
ATOM   2045 C CE1 . TYR A 1 255 ? 20.241  23.803  46.879 1.00 65.82  ? 255  TYR A CE1 1 
ATOM   2046 C CE2 . TYR A 1 255 ? 17.948  23.614  47.548 1.00 69.10  ? 255  TYR A CE2 1 
ATOM   2047 C CZ  . TYR A 1 255 ? 19.185  23.038  47.335 1.00 76.58  ? 255  TYR A CZ  1 
ATOM   2048 O OH  . TYR A 1 255 ? 19.365  21.695  47.584 1.00 92.34  ? 255  TYR A OH  1 
ATOM   2049 N N   . VAL A 1 256 ? 18.919  30.504  47.492 1.00 59.53  ? 256  VAL A N   1 
ATOM   2050 C CA  . VAL A 1 256 ? 19.109  31.869  47.019 1.00 50.96  ? 256  VAL A CA  1 
ATOM   2051 C C   . VAL A 1 256 ? 20.552  32.273  47.305 1.00 57.52  ? 256  VAL A C   1 
ATOM   2052 O O   . VAL A 1 256 ? 21.019  32.183  48.442 1.00 57.38  ? 256  VAL A O   1 
ATOM   2053 C CB  . VAL A 1 256 ? 18.113  32.857  47.631 1.00 47.08  ? 256  VAL A CB  1 
ATOM   2054 C CG1 . VAL A 1 256 ? 18.574  34.286  47.384 1.00 47.56  ? 256  VAL A CG1 1 
ATOM   2055 C CG2 . VAL A 1 256 ? 16.715  32.639  47.047 1.00 39.02  ? 256  VAL A CG2 1 
ATOM   2056 N N   . MET A 1 257 ? 21.273  32.678  46.265 1.00 61.69  ? 257  MET A N   1 
ATOM   2057 C CA  . MET A 1 257 ? 22.700  32.959  46.408 1.00 59.05  ? 257  MET A CA  1 
ATOM   2058 C C   . MET A 1 257 ? 22.985  34.442  46.525 1.00 61.91  ? 257  MET A C   1 
ATOM   2059 O O   . MET A 1 257 ? 24.073  34.841  46.949 1.00 69.46  ? 257  MET A O   1 
ATOM   2060 C CB  . MET A 1 257 ? 23.482  32.379  45.233 1.00 58.44  ? 257  MET A CB  1 
ATOM   2061 C CG  . MET A 1 257 ? 23.961  30.965  45.458 1.00 68.31  ? 257  MET A CG  1 
ATOM   2062 S SD  . MET A 1 257 ? 24.640  30.247  43.953 1.00 85.49  ? 257  MET A SD  1 
ATOM   2063 C CE  . MET A 1 257 ? 25.789  29.070  44.661 1.00 143.99 ? 257  MET A CE  1 
ATOM   2064 N N   . GLY A 1 258 ? 22.010  35.259  46.141 1.00 54.80  ? 258  GLY A N   1 
ATOM   2065 C CA  . GLY A 1 258 ? 22.179  36.698  46.165 1.00 45.41  ? 258  GLY A CA  1 
ATOM   2066 C C   . GLY A 1 258 ? 21.299  37.397  45.156 1.00 45.56  ? 258  GLY A C   1 
ATOM   2067 O O   . GLY A 1 258 ? 20.412  36.784  44.568 1.00 55.42  ? 258  GLY A O   1 
ATOM   2068 N N   . PHE A 1 259 ? 21.543  38.689  44.972 1.00 49.70  ? 259  PHE A N   1 
ATOM   2069 C CA  . PHE A 1 259 ? 20.876  39.469  43.949 1.00 60.90  ? 259  PHE A CA  1 
ATOM   2070 C C   . PHE A 1 259 ? 21.900  39.953  42.939 1.00 62.43  ? 259  PHE A C   1 
ATOM   2071 O O   . PHE A 1 259 ? 23.090  40.009  43.224 1.00 56.09  ? 259  PHE A O   1 
ATOM   2072 C CB  . PHE A 1 259 ? 20.186  40.689  44.559 1.00 54.74  ? 259  PHE A CB  1 
ATOM   2073 C CG  . PHE A 1 259 ? 19.014  40.359  45.440 1.00 62.01  ? 259  PHE A CG  1 
ATOM   2074 C CD1 . PHE A 1 259 ? 17.718  40.459  44.959 1.00 62.28  ? 259  PHE A CD1 1 
ATOM   2075 C CD2 . PHE A 1 259 ? 19.205  39.973  46.757 1.00 64.31  ? 259  PHE A CD2 1 
ATOM   2076 C CE1 . PHE A 1 259 ? 16.630  40.172  45.774 1.00 58.76  ? 259  PHE A CE1 1 
ATOM   2077 C CE2 . PHE A 1 259 ? 18.124  39.685  47.575 1.00 63.50  ? 259  PHE A CE2 1 
ATOM   2078 C CZ  . PHE A 1 259 ? 16.835  39.783  47.081 1.00 58.94  ? 259  PHE A CZ  1 
ATOM   2079 N N   . VAL A 1 260 ? 21.434  40.302  41.750 1.00 58.20  ? 260  VAL A N   1 
ATOM   2080 C CA  . VAL A 1 260 ? 22.250  41.104  40.861 1.00 60.19  ? 260  VAL A CA  1 
ATOM   2081 C C   . VAL A 1 260 ? 22.227  42.532  41.383 1.00 58.67  ? 260  VAL A C   1 
ATOM   2082 O O   . VAL A 1 260 ? 21.185  43.191  41.374 1.00 61.42  ? 260  VAL A O   1 
ATOM   2083 C CB  . VAL A 1 260 ? 21.710  41.084  39.428 1.00 53.63  ? 260  VAL A CB  1 
ATOM   2084 C CG1 . VAL A 1 260 ? 22.500  42.068  38.560 1.00 46.55  ? 260  VAL A CG1 1 
ATOM   2085 C CG2 . VAL A 1 260 ? 21.773  39.676  38.878 1.00 47.27  ? 260  VAL A CG2 1 
ATOM   2086 N N   . SER A 1 261 ? 23.366  43.012  41.857 1.00 70.97  ? 261  SER A N   1 
ATOM   2087 C CA  . SER A 1 261 ? 23.422  44.368  42.386 1.00 78.30  ? 261  SER A CA  1 
ATOM   2088 C C   . SER A 1 261 ? 24.792  44.983  42.169 1.00 81.60  ? 261  SER A C   1 
ATOM   2089 O O   . SER A 1 261 ? 25.809  44.303  42.314 1.00 75.18  ? 261  SER A O   1 
ATOM   2090 C CB  . SER A 1 261 ? 23.074  44.381  43.881 1.00 71.99  ? 261  SER A CB  1 
ATOM   2091 O OG  . SER A 1 261 ? 22.962  45.715  44.375 1.00 65.52  ? 261  SER A OG  1 
ATOM   2092 N N   . SER A 1 262 ? 24.809  46.268  41.819 1.00 91.00  ? 262  SER A N   1 
ATOM   2093 C CA  . SER A 1 262 ? 26.051  47.035  41.766 1.00 104.02 ? 262  SER A CA  1 
ATOM   2094 C C   . SER A 1 262 ? 26.713  47.083  43.140 1.00 110.04 ? 262  SER A C   1 
ATOM   2095 O O   . SER A 1 262 ? 27.543  46.239  43.475 1.00 114.70 ? 262  SER A O   1 
ATOM   2096 C CB  . SER A 1 262 ? 25.793  48.461  41.272 1.00 108.41 ? 262  SER A CB  1 
ATOM   2097 O OG  . SER A 1 262 ? 25.620  48.499  39.865 1.00 115.13 ? 262  SER A OG  1 
ATOM   2098 N N   . GLY A 1 263 ? 26.338  48.075  43.938 1.00 107.70 ? 263  GLY A N   1 
ATOM   2099 C CA  . GLY A 1 263 ? 26.929  48.245  45.251 1.00 108.05 ? 263  GLY A CA  1 
ATOM   2100 C C   . GLY A 1 263 ? 26.102  47.630  46.362 1.00 102.99 ? 263  GLY A C   1 
ATOM   2101 O O   . GLY A 1 263 ? 26.285  46.465  46.718 1.00 105.03 ? 263  GLY A O   1 
ATOM   2102 N N   . GLY A 1 264 ? 25.182  48.415  46.911 1.00 92.58  ? 264  GLY A N   1 
ATOM   2103 C CA  . GLY A 1 264 ? 24.397  47.973  48.047 1.00 87.47  ? 264  GLY A CA  1 
ATOM   2104 C C   . GLY A 1 264 ? 23.073  47.351  47.663 1.00 76.26  ? 264  GLY A C   1 
ATOM   2105 O O   . GLY A 1 264 ? 23.034  46.318  46.996 1.00 67.85  ? 264  GLY A O   1 
ATOM   2106 N N   . GLN A 1 265 ? 21.988  47.983  48.099 1.00 73.79  ? 265  GLN A N   1 
ATOM   2107 C CA  . GLN A 1 265 ? 20.639  47.503  47.818 1.00 79.03  ? 265  GLN A CA  1 
ATOM   2108 C C   . GLN A 1 265 ? 20.450  47.200  46.319 1.00 85.25  ? 265  GLN A C   1 
ATOM   2109 O O   . GLN A 1 265 ? 20.740  48.040  45.467 1.00 89.57  ? 265  GLN A O   1 
ATOM   2110 C CB  . GLN A 1 265 ? 19.598  48.513  48.327 1.00 62.95  ? 265  GLN A CB  1 
ATOM   2111 C CG  . GLN A 1 265 ? 18.184  47.958  48.401 1.00 62.62  ? 265  GLN A CG  1 
ATOM   2112 C CD  . GLN A 1 265 ? 17.208  48.908  49.065 1.00 76.33  ? 265  GLN A CD  1 
ATOM   2113 O OE1 . GLN A 1 265 ? 17.185  49.033  50.291 1.00 85.55  ? 265  GLN A OE1 1 
ATOM   2114 N NE2 . GLN A 1 265 ? 16.389  49.578  48.259 1.00 77.18  ? 265  GLN A NE2 1 
ATOM   2115 N N   . PRO A 1 266 ? 19.969  45.985  46.005 1.00 79.11  ? 266  PRO A N   1 
ATOM   2116 C CA  . PRO A 1 266 ? 19.869  45.416  44.654 1.00 78.51  ? 266  PRO A CA  1 
ATOM   2117 C C   . PRO A 1 266 ? 19.207  46.312  43.620 1.00 88.53  ? 266  PRO A C   1 
ATOM   2118 O O   . PRO A 1 266 ? 18.284  47.072  43.922 1.00 89.49  ? 266  PRO A O   1 
ATOM   2119 C CB  . PRO A 1 266 ? 19.019  44.165  44.869 1.00 65.06  ? 266  PRO A CB  1 
ATOM   2120 C CG  . PRO A 1 266 ? 19.335  43.755  46.234 1.00 68.18  ? 266  PRO A CG  1 
ATOM   2121 C CD  . PRO A 1 266 ? 19.501  45.030  47.022 1.00 68.50  ? 266  PRO A CD  1 
ATOM   2122 N N   . VAL A 1 267 ? 19.684  46.174  42.389 1.00 98.18  ? 267  VAL A N   1 
ATOM   2123 C CA  . VAL A 1 267 ? 19.235  46.978  41.260 1.00 98.33  ? 267  VAL A CA  1 
ATOM   2124 C C   . VAL A 1 267 ? 17.957  46.419  40.617 1.00 84.28  ? 267  VAL A C   1 
ATOM   2125 O O   . VAL A 1 267 ? 17.922  45.259  40.217 1.00 87.41  ? 267  VAL A O   1 
ATOM   2126 C CB  . VAL A 1 267 ? 20.365  47.067  40.200 1.00 124.96 ? 267  VAL A CB  1 
ATOM   2127 C CG1 . VAL A 1 267 ? 21.666  47.507  40.858 1.00 128.26 ? 267  VAL A CG1 1 
ATOM   2128 C CG2 . VAL A 1 267 ? 20.572  45.731  39.492 1.00 117.59 ? 267  VAL A CG2 1 
ATOM   2129 N N   . PRO A 1 268 ? 16.904  47.248  40.513 1.00 68.91  ? 268  PRO A N   1 
ATOM   2130 C CA  . PRO A 1 268 ? 15.647  46.855  39.853 1.00 67.74  ? 268  PRO A CA  1 
ATOM   2131 C C   . PRO A 1 268 ? 15.820  46.852  38.337 1.00 63.27  ? 268  PRO A C   1 
ATOM   2132 O O   . PRO A 1 268 ? 16.234  47.871  37.792 1.00 66.55  ? 268  PRO A O   1 
ATOM   2133 C CB  . PRO A 1 268 ? 14.662  47.960  40.265 1.00 65.22  ? 268  PRO A CB  1 
ATOM   2134 C CG  . PRO A 1 268 ? 15.408  48.840  41.257 1.00 73.02  ? 268  PRO A CG  1 
ATOM   2135 C CD  . PRO A 1 268 ? 16.869  48.642  40.971 1.00 70.14  ? 268  PRO A CD  1 
ATOM   2136 N N   . VAL A 1 269 ? 15.524  45.737  37.674 1.00 68.25  ? 269  VAL A N   1 
ATOM   2137 C CA  . VAL A 1 269 ? 15.804  45.594  36.236 1.00 69.92  ? 269  VAL A CA  1 
ATOM   2138 C C   . VAL A 1 269 ? 15.350  46.767  35.361 1.00 54.83  ? 269  VAL A C   1 
ATOM   2139 O O   . VAL A 1 269 ? 14.211  47.228  35.444 1.00 48.40  ? 269  VAL A O   1 
ATOM   2140 C CB  . VAL A 1 269 ? 15.195  44.312  35.659 1.00 66.23  ? 269  VAL A CB  1 
ATOM   2141 C CG1 . VAL A 1 269 ? 15.571  44.185  34.194 1.00 71.96  ? 269  VAL A CG1 1 
ATOM   2142 C CG2 . VAL A 1 269 ? 15.664  43.097  36.449 1.00 51.39  ? 269  VAL A CG2 1 
ATOM   2143 N N   . LYS A 1 270 ? 16.256  47.256  34.525 1.00 65.28  ? 270  LYS A N   1 
ATOM   2144 C CA  . LYS A 1 270 ? 15.905  48.302  33.573 1.00 71.37  ? 270  LYS A CA  1 
ATOM   2145 C C   . LYS A 1 270 ? 14.708  47.849  32.736 1.00 58.68  ? 270  LYS A C   1 
ATOM   2146 O O   . LYS A 1 270 ? 14.677  46.720  32.244 1.00 61.56  ? 270  LYS A O   1 
ATOM   2147 C CB  . LYS A 1 270 ? 17.083  48.588  32.647 1.00 83.90  ? 270  LYS A CB  1 
ATOM   2148 C CG  . LYS A 1 270 ? 18.403  48.853  33.348 1.00 92.34  ? 270  LYS A CG  1 
ATOM   2149 C CD  . LYS A 1 270 ? 19.545  48.884  32.332 1.00 101.57 ? 270  LYS A CD  1 
ATOM   2150 C CE  . LYS A 1 270 ? 20.892  49.126  32.999 1.00 104.66 ? 270  LYS A CE  1 
ATOM   2151 N NZ  . LYS A 1 270 ? 22.025  49.029  32.038 1.00 99.28  ? 270  LYS A NZ  1 
ATOM   2152 N N   . ASP A 1 271 ? 13.728  48.731  32.581 1.00 63.86  ? 271  ASP A N   1 
ATOM   2153 C CA  . ASP A 1 271 ? 12.545  48.462  31.757 1.00 79.36  ? 271  ASP A CA  1 
ATOM   2154 C C   . ASP A 1 271 ? 12.868  47.782  30.428 1.00 75.53  ? 271  ASP A C   1 
ATOM   2155 O O   . ASP A 1 271 ? 12.257  46.778  30.061 1.00 66.96  ? 271  ASP A O   1 
ATOM   2156 C CB  . ASP A 1 271 ? 11.813  49.768  31.468 1.00 91.18  ? 271  ASP A CB  1 
ATOM   2157 C CG  . ASP A 1 271 ? 11.228  50.388  32.710 1.00 102.78 ? 271  ASP A CG  1 
ATOM   2158 O OD1 . ASP A 1 271 ? 11.999  50.961  33.513 1.00 107.44 ? 271  ASP A OD1 1 
ATOM   2159 O OD2 . ASP A 1 271 ? 9.995   50.296  32.884 1.00 106.24 ? 271  ASP A OD2 1 
ATOM   2160 N N   . ARG A 1 272 ? 13.827  48.346  29.706 1.00 81.34  ? 272  ARG A N   1 
ATOM   2161 C CA  . ARG A 1 272 ? 14.209  47.820  28.410 1.00 90.33  ? 272  ARG A CA  1 
ATOM   2162 C C   . ARG A 1 272 ? 14.634  46.362  28.512 1.00 85.07  ? 272  ARG A C   1 
ATOM   2163 O O   . ARG A 1 272 ? 14.320  45.553  27.640 1.00 83.30  ? 272  ARG A O   1 
ATOM   2164 C CB  . ARG A 1 272 ? 15.336  48.663  27.814 1.00 110.32 ? 272  ARG A CB  1 
ATOM   2165 C CG  . ARG A 1 272 ? 14.923  50.085  27.454 1.00 127.66 ? 272  ARG A CG  1 
ATOM   2166 C CD  . ARG A 1 272 ? 16.105  50.919  26.971 1.00 138.35 ? 272  ARG A CD  1 
ATOM   2167 N NE  . ARG A 1 272 ? 15.675  52.172  26.351 1.00 143.31 ? 272  ARG A NE  1 
ATOM   2168 C CZ  . ARG A 1 272 ? 16.500  53.156  26.006 1.00 147.14 ? 272  ARG A CZ  1 
ATOM   2169 N NH1 . ARG A 1 272 ? 16.025  54.261  25.445 1.00 148.30 ? 272  ARG A NH1 1 
ATOM   2170 N NH2 . ARG A 1 272 ? 17.802  53.037  26.226 1.00 148.66 ? 272  ARG A NH2 1 
ATOM   2171 N N   . GLU A 1 273 ? 15.342  46.017  29.580 1.00 83.14  ? 273  GLU A N   1 
ATOM   2172 C CA  . GLU A 1 273 ? 15.857  44.656  29.704 1.00 75.80  ? 273  GLU A CA  1 
ATOM   2173 C C   . GLU A 1 273 ? 14.817  43.657  30.203 1.00 65.57  ? 273  GLU A C   1 
ATOM   2174 O O   . GLU A 1 273 ? 14.936  42.458  29.933 1.00 57.44  ? 273  GLU A O   1 
ATOM   2175 C CB  . GLU A 1 273 ? 17.131  44.615  30.552 1.00 75.09  ? 273  GLU A CB  1 
ATOM   2176 C CG  . GLU A 1 273 ? 18.257  45.462  29.969 1.00 86.46  ? 273  GLU A CG  1 
ATOM   2177 C CD  . GLU A 1 273 ? 19.627  45.090  30.508 1.00 99.86  ? 273  GLU A CD  1 
ATOM   2178 O OE1 . GLU A 1 273 ? 20.062  45.694  31.513 1.00 105.27 ? 273  GLU A OE1 1 
ATOM   2179 O OE2 . GLU A 1 273 ? 20.276  44.197  29.921 1.00 103.02 ? 273  GLU A OE2 1 
ATOM   2180 N N   . MET A 1 274 ? 13.797  44.159  30.899 1.00 59.06  ? 274  MET A N   1 
ATOM   2181 C CA  . MET A 1 274 ? 12.736  43.324  31.475 1.00 59.88  ? 274  MET A CA  1 
ATOM   2182 C C   . MET A 1 274 ? 11.658  42.967  30.458 1.00 55.82  ? 274  MET A C   1 
ATOM   2183 O O   . MET A 1 274 ? 10.993  41.936  30.582 1.00 53.78  ? 274  MET A O   1 
ATOM   2184 C CB  . MET A 1 274 ? 12.053  44.048  32.652 1.00 55.20  ? 274  MET A CB  1 
ATOM   2185 C CG  . MET A 1 274 ? 12.501  43.607  34.033 1.00 62.24  ? 274  MET A CG  1 
ATOM   2186 S SD  . MET A 1 274 ? 12.275  41.849  34.366 1.00 66.70  ? 274  MET A SD  1 
ATOM   2187 C CE  . MET A 1 274 ? 10.515  41.729  34.155 1.00 54.45  ? 274  MET A CE  1 
ATOM   2188 N N   . ARG A 1 275 ? 11.462  43.839  29.475 1.00 54.39  ? 275  ARG A N   1 
ATOM   2189 C CA  . ARG A 1 275 ? 10.374  43.660  28.515 1.00 66.77  ? 275  ARG A CA  1 
ATOM   2190 C C   . ARG A 1 275 ? 10.326  42.269  27.862 1.00 58.68  ? 275  ARG A C   1 
ATOM   2191 O O   . ARG A 1 275 ? 9.262   41.653  27.788 1.00 57.88  ? 275  ARG A O   1 
ATOM   2192 C CB  . ARG A 1 275 ? 10.364  44.779  27.463 1.00 82.83  ? 275  ARG A CB  1 
ATOM   2193 C CG  . ARG A 1 275 ? 11.552  44.782  26.513 1.00 100.60 ? 275  ARG A CG  1 
ATOM   2194 C CD  . ARG A 1 275 ? 11.408  45.833  25.414 1.00 102.05 ? 275  ARG A CD  1 
ATOM   2195 N NE  . ARG A 1 275 ? 10.018  46.001  24.996 1.00 100.71 ? 275  ARG A NE  1 
ATOM   2196 C CZ  . ARG A 1 275 ? 9.631   46.755  23.971 1.00 102.21 ? 275  ARG A CZ  1 
ATOM   2197 N NH1 . ARG A 1 275 ? 10.530  47.406  23.245 1.00 105.20 ? 275  ARG A NH1 1 
ATOM   2198 N NH2 . ARG A 1 275 ? 8.344   46.852  23.668 1.00 94.82  ? 275  ARG A NH2 1 
ATOM   2199 N N   . PRO A 1 276 ? 11.473  41.751  27.406 1.00 56.88  ? 276  PRO A N   1 
ATOM   2200 C CA  . PRO A 1 276 ? 11.376  40.405  26.823 1.00 62.37  ? 276  PRO A CA  1 
ATOM   2201 C C   . PRO A 1 276 ? 10.931  39.381  27.871 1.00 66.49  ? 276  PRO A C   1 
ATOM   2202 O O   . PRO A 1 276 ? 10.204  38.434  27.547 1.00 55.84  ? 276  PRO A O   1 
ATOM   2203 C CB  . PRO A 1 276 ? 12.817  40.104  26.366 1.00 60.28  ? 276  PRO A CB  1 
ATOM   2204 C CG  . PRO A 1 276 ? 13.527  41.426  26.366 1.00 60.77  ? 276  PRO A CG  1 
ATOM   2205 C CD  . PRO A 1 276 ? 12.859  42.248  27.436 1.00 61.49  ? 276  PRO A CD  1 
ATOM   2206 N N   . ILE A 1 277 ? 11.371  39.574  29.116 1.00 68.17  ? 277  ILE A N   1 
ATOM   2207 C CA  . ILE A 1 277 ? 11.037  38.651  30.200 1.00 57.46  ? 277  ILE A CA  1 
ATOM   2208 C C   . ILE A 1 277 ? 9.530   38.584  30.367 1.00 45.78  ? 277  ILE A C   1 
ATOM   2209 O O   . ILE A 1 277 ? 8.933   37.510  30.365 1.00 60.56  ? 277  ILE A O   1 
ATOM   2210 C CB  . ILE A 1 277 ? 11.678  39.069  31.529 1.00 58.07  ? 277  ILE A CB  1 
ATOM   2211 C CG1 . ILE A 1 277 ? 13.201  39.115  31.397 1.00 63.47  ? 277  ILE A CG1 1 
ATOM   2212 C CG2 . ILE A 1 277 ? 11.274  38.110  32.636 1.00 62.48  ? 277  ILE A CG2 1 
ATOM   2213 C CD1 . ILE A 1 277 ? 13.795  37.867  30.802 1.00 63.97  ? 277  ILE A CD1 1 
ATOM   2214 N N   . LEU A 1 278 ? 8.928   39.755  30.490 1.00 42.68  ? 278  LEU A N   1 
ATOM   2215 C CA  . LEU A 1 278 ? 7.485   39.906  30.608 1.00 48.80  ? 278  LEU A CA  1 
ATOM   2216 C C   . LEU A 1 278 ? 6.711   39.289  29.431 1.00 63.25  ? 278  LEU A C   1 
ATOM   2217 O O   . LEU A 1 278 ? 5.733   38.562  29.628 1.00 59.95  ? 278  LEU A O   1 
ATOM   2218 C CB  . LEU A 1 278 ? 7.165   41.397  30.711 1.00 53.24  ? 278  LEU A CB  1 
ATOM   2219 C CG  . LEU A 1 278 ? 7.902   42.157  31.826 1.00 67.93  ? 278  LEU A CG  1 
ATOM   2220 C CD1 . LEU A 1 278 ? 7.900   43.676  31.600 1.00 71.37  ? 278  LEU A CD1 1 
ATOM   2221 C CD2 . LEU A 1 278 ? 7.329   41.819  33.209 1.00 52.86  ? 278  LEU A CD2 1 
ATOM   2222 N N   . ARG A 1 279 ? 7.147   39.586  28.208 1.00 67.01  ? 279  ARG A N   1 
ATOM   2223 C CA  . ARG A 1 279 ? 6.473   39.079  27.015 1.00 63.44  ? 279  ARG A CA  1 
ATOM   2224 C C   . ARG A 1 279 ? 6.572   37.566  26.924 1.00 62.56  ? 279  ARG A C   1 
ATOM   2225 O O   . ARG A 1 279 ? 5.586   36.884  26.660 1.00 63.56  ? 279  ARG A O   1 
ATOM   2226 C CB  . ARG A 1 279 ? 7.043   39.726  25.762 1.00 56.62  ? 279  ARG A CB  1 
ATOM   2227 C CG  . ARG A 1 279 ? 6.670   41.175  25.652 1.00 54.47  ? 279  ARG A CG  1 
ATOM   2228 C CD  . ARG A 1 279 ? 7.349   41.833  24.482 1.00 60.86  ? 279  ARG A CD  1 
ATOM   2229 N NE  . ARG A 1 279 ? 6.777   43.146  24.198 1.00 57.74  ? 279  ARG A NE  1 
ATOM   2230 C CZ  . ARG A 1 279 ? 6.986   43.822  23.071 1.00 61.26  ? 279  ARG A CZ  1 
ATOM   2231 N NH1 . ARG A 1 279 ? 7.746   43.302  22.117 1.00 59.31  ? 279  ARG A NH1 1 
ATOM   2232 N NH2 . ARG A 1 279 ? 6.429   45.015  22.895 1.00 58.85  ? 279  ARG A NH2 1 
ATOM   2233 N N   . LEU A 1 280 ? 7.767   37.040  27.152 1.00 63.12  ? 280  LEU A N   1 
ATOM   2234 C CA  . LEU A 1 280 ? 7.939   35.602  27.249 1.00 52.17  ? 280  LEU A CA  1 
ATOM   2235 C C   . LEU A 1 280 ? 7.005   35.037  28.300 1.00 64.33  ? 280  LEU A C   1 
ATOM   2236 O O   . LEU A 1 280 ? 6.485   33.938  28.141 1.00 73.62  ? 280  LEU A O   1 
ATOM   2237 C CB  . LEU A 1 280 ? 9.376   35.267  27.628 1.00 45.83  ? 280  LEU A CB  1 
ATOM   2238 C CG  . LEU A 1 280 ? 10.368  35.098  26.490 1.00 59.69  ? 280  LEU A CG  1 
ATOM   2239 C CD1 . LEU A 1 280 ? 11.712  34.740  27.066 1.00 61.81  ? 280  LEU A CD1 1 
ATOM   2240 C CD2 . LEU A 1 280 ? 9.880   34.014  25.541 1.00 63.33  ? 280  LEU A CD2 1 
ATOM   2241 N N   . ALA A 1 281 ? 6.801   35.797  29.376 1.00 64.44  ? 281  ALA A N   1 
ATOM   2242 C CA  . ALA A 1 281 ? 6.005   35.338  30.509 1.00 68.17  ? 281  ALA A CA  1 
ATOM   2243 C C   . ALA A 1 281 ? 4.509   35.460  30.254 1.00 74.35  ? 281  ALA A C   1 
ATOM   2244 O O   . ALA A 1 281 ? 3.695   35.030  31.069 1.00 80.51  ? 281  ALA A O   1 
ATOM   2245 C CB  . ALA A 1 281 ? 6.391   36.105  31.777 1.00 66.32  ? 281  ALA A CB  1 
ATOM   2246 N N   . GLY A 1 282 ? 4.144   36.043  29.121 1.00 74.16  ? 282  GLY A N   1 
ATOM   2247 C CA  . GLY A 1 282 ? 2.743   36.263  28.828 1.00 69.25  ? 282  GLY A CA  1 
ATOM   2248 C C   . GLY A 1 282 ? 2.161   37.215  29.852 1.00 65.50  ? 282  GLY A C   1 
ATOM   2249 O O   . GLY A 1 282 ? 0.993   37.126  30.213 1.00 64.82  ? 282  GLY A O   1 
ATOM   2250 N N   . LEU A 1 283 ? 2.996   38.136  30.317 1.00 65.75  ? 283  LEU A N   1 
ATOM   2251 C CA  . LEU A 1 283 ? 2.591   39.113  31.317 1.00 72.41  ? 283  LEU A CA  1 
ATOM   2252 C C   . LEU A 1 283 ? 2.412   40.475  30.669 1.00 76.57  ? 283  LEU A C   1 
ATOM   2253 O O   . LEU A 1 283 ? 1.876   41.404  31.272 1.00 81.29  ? 283  LEU A O   1 
ATOM   2254 C CB  . LEU A 1 283 ? 3.622   39.175  32.447 1.00 69.98  ? 283  LEU A CB  1 
ATOM   2255 C CG  . LEU A 1 283 ? 3.336   38.285  33.659 1.00 70.61  ? 283  LEU A CG  1 
ATOM   2256 C CD1 . LEU A 1 283 ? 2.559   37.039  33.272 1.00 67.69  ? 283  LEU A CD1 1 
ATOM   2257 C CD2 . LEU A 1 283 ? 4.630   37.911  34.340 1.00 72.09  ? 283  LEU A CD2 1 
ATOM   2258 N N   . GLU A 1 284 ? 2.884   40.586  29.435 1.00 91.37  ? 284  GLU A N   1 
ATOM   2259 C CA  . GLU A 1 284 ? 2.599   41.738  28.597 1.00 98.11  ? 284  GLU A CA  1 
ATOM   2260 C C   . GLU A 1 284 ? 2.023   41.227  27.289 1.00 104.62 ? 284  GLU A C   1 
ATOM   2261 O O   . GLU A 1 284 ? 2.552   40.286  26.692 1.00 97.77  ? 284  GLU A O   1 
ATOM   2262 C CB  . GLU A 1 284 ? 3.862   42.546  28.306 1.00 100.46 ? 284  GLU A CB  1 
ATOM   2263 C CG  . GLU A 1 284 ? 4.222   43.584  29.352 1.00 107.37 ? 284  GLU A CG  1 
ATOM   2264 C CD  . GLU A 1 284 ? 5.165   44.639  28.799 1.00 113.41 ? 284  GLU A CD  1 
ATOM   2265 O OE1 . GLU A 1 284 ? 5.302   44.714  27.557 1.00 119.66 ? 284  GLU A OE1 1 
ATOM   2266 O OE2 . GLU A 1 284 ? 5.764   45.390  29.597 1.00 108.67 ? 284  GLU A OE2 1 
ATOM   2267 N N   . GLU A 1 285 ? 0.932   41.841  26.855 1.00 116.75 ? 285  GLU A N   1 
ATOM   2268 C CA  . GLU A 1 285 ? 0.322   41.492  25.583 1.00 123.40 ? 285  GLU A CA  1 
ATOM   2269 C C   . GLU A 1 285 ? 0.929   42.369  24.502 1.00 113.23 ? 285  GLU A C   1 
ATOM   2270 O O   . GLU A 1 285 ? 0.737   43.584  24.506 1.00 110.34 ? 285  GLU A O   1 
ATOM   2271 C CB  . GLU A 1 285 ? -1.187  41.687  25.659 1.00 140.19 ? 285  GLU A CB  1 
ATOM   2272 C CG  . GLU A 1 285 ? -1.805  41.021  26.875 1.00 150.77 ? 285  GLU A CG  1 
ATOM   2273 C CD  . GLU A 1 285 ? -3.295  41.245  26.968 1.00 161.73 ? 285  GLU A CD  1 
ATOM   2274 O OE1 . GLU A 1 285 ? -3.875  41.782  26.000 1.00 166.33 ? 285  GLU A OE1 1 
ATOM   2275 O OE2 . GLU A 1 285 ? -3.884  40.886  28.010 1.00 165.43 ? 285  GLU A OE2 1 
ATOM   2276 N N   . TYR A 1 286 ? 1.668   41.747  23.585 1.00 104.13 ? 286  TYR A N   1 
ATOM   2277 C CA  . TYR A 1 286 ? 2.439   42.487  22.592 1.00 102.10 ? 286  TYR A CA  1 
ATOM   2278 C C   . TYR A 1 286 ? 2.037   42.176  21.150 1.00 111.91 ? 286  TYR A C   1 
ATOM   2279 O O   . TYR A 1 286 ? 1.392   41.165  20.874 1.00 116.18 ? 286  TYR A O   1 
ATOM   2280 C CB  . TYR A 1 286 ? 3.935   42.228  22.782 1.00 93.41  ? 286  TYR A CB  1 
ATOM   2281 C CG  . TYR A 1 286 ? 4.341   40.777  22.614 1.00 85.08  ? 286  TYR A CG  1 
ATOM   2282 C CD1 . TYR A 1 286 ? 4.153   39.864  23.639 1.00 78.53  ? 286  TYR A CD1 1 
ATOM   2283 C CD2 . TYR A 1 286 ? 4.920   40.324  21.434 1.00 81.34  ? 286  TYR A CD2 1 
ATOM   2284 C CE1 . TYR A 1 286 ? 4.524   38.544  23.501 1.00 74.18  ? 286  TYR A CE1 1 
ATOM   2285 C CE2 . TYR A 1 286 ? 5.291   38.999  21.285 1.00 76.11  ? 286  TYR A CE2 1 
ATOM   2286 C CZ  . TYR A 1 286 ? 5.089   38.115  22.325 1.00 83.90  ? 286  TYR A CZ  1 
ATOM   2287 O OH  . TYR A 1 286 ? 5.453   36.793  22.198 1.00 94.77  ? 286  TYR A OH  1 
ATOM   2288 N N   . GLU A 1 287 ? 2.439   43.055  20.238 1.00 112.99 ? 287  GLU A N   1 
ATOM   2289 C CA  . GLU A 1 287 ? 2.132   42.915  18.821 1.00 115.97 ? 287  GLU A CA  1 
ATOM   2290 C C   . GLU A 1 287 ? 2.661   41.596  18.255 1.00 101.43 ? 287  GLU A C   1 
ATOM   2291 O O   . GLU A 1 287 ? 1.941   40.858  17.580 1.00 86.54  ? 287  GLU A O   1 
ATOM   2292 C CB  . GLU A 1 287 ? 2.734   44.092  18.055 1.00 132.50 ? 287  GLU A CB  1 
ATOM   2293 C CG  . GLU A 1 287 ? 2.496   45.442  18.721 1.00 143.82 ? 287  GLU A CG  1 
ATOM   2294 C CD  . GLU A 1 287 ? 3.500   46.498  18.287 1.00 151.15 ? 287  GLU A CD  1 
ATOM   2295 O OE1 . GLU A 1 287 ? 4.605   46.124  17.840 1.00 147.76 ? 287  GLU A OE1 1 
ATOM   2296 O OE2 . GLU A 1 287 ? 3.184   47.702  18.394 1.00 158.01 ? 287  GLU A OE2 1 
ATOM   2297 N N   . LEU A 1 297 ? 15.237  38.167  3.623  1.00 121.48 ? 297  LEU A N   1 
ATOM   2298 C CA  . LEU A 1 297 ? 15.952  37.678  2.449  1.00 126.51 ? 297  LEU A CA  1 
ATOM   2299 C C   . LEU A 1 297 ? 17.417  37.389  2.772  1.00 116.75 ? 297  LEU A C   1 
ATOM   2300 O O   . LEU A 1 297 ? 17.934  37.834  3.801  1.00 116.45 ? 297  LEU A O   1 
ATOM   2301 C CB  . LEU A 1 297 ? 15.859  38.686  1.298  1.00 138.50 ? 297  LEU A CB  1 
ATOM   2302 C CG  . LEU A 1 297 ? 14.481  38.966  0.690  1.00 144.02 ? 297  LEU A CG  1 
ATOM   2303 C CD1 . LEU A 1 297 ? 13.575  39.703  1.667  1.00 143.35 ? 297  LEU A CD1 1 
ATOM   2304 C CD2 . LEU A 1 297 ? 14.628  39.753  -0.602 1.00 148.97 ? 297  LEU A CD2 1 
ATOM   2305 N N   . GLY A 1 298 ? 18.071  36.643  1.883  1.00 100.10 ? 298  GLY A N   1 
ATOM   2306 C CA  . GLY A 1 298 ? 19.470  36.275  2.032  1.00 95.67  ? 298  GLY A CA  1 
ATOM   2307 C C   . GLY A 1 298 ? 20.139  36.589  3.367  1.00 99.62  ? 298  GLY A C   1 
ATOM   2308 O O   . GLY A 1 298 ? 21.008  37.462  3.437  1.00 105.54 ? 298  GLY A O   1 
ATOM   2309 N N   . PHE A 1 299 ? 19.737  35.889  4.428  1.00 83.30  ? 299  PHE A N   1 
ATOM   2310 C CA  . PHE A 1 299 ? 20.454  35.974  5.703  1.00 76.63  ? 299  PHE A CA  1 
ATOM   2311 C C   . PHE A 1 299 ? 21.556  34.934  5.737  1.00 71.12  ? 299  PHE A C   1 
ATOM   2312 O O   . PHE A 1 299 ? 21.390  33.834  5.213  1.00 72.74  ? 299  PHE A O   1 
ATOM   2313 C CB  . PHE A 1 299 ? 19.523  35.751  6.898  1.00 62.15  ? 299  PHE A CB  1 
ATOM   2314 C CG  . PHE A 1 299 ? 18.559  36.867  7.125  1.00 66.21  ? 299  PHE A CG  1 
ATOM   2315 C CD1 . PHE A 1 299 ? 17.194  36.631  7.133  1.00 69.28  ? 299  PHE A CD1 1 
ATOM   2316 C CD2 . PHE A 1 299 ? 19.015  38.161  7.312  1.00 72.80  ? 299  PHE A CD2 1 
ATOM   2317 C CE1 . PHE A 1 299 ? 16.301  37.659  7.342  1.00 78.71  ? 299  PHE A CE1 1 
ATOM   2318 C CE2 . PHE A 1 299 ? 18.126  39.196  7.517  1.00 88.57  ? 299  PHE A CE2 1 
ATOM   2319 C CZ  . PHE A 1 299 ? 16.764  38.945  7.535  1.00 89.22  ? 299  PHE A CZ  1 
ATOM   2320 N N   . LYS A 1 300 ? 22.681  35.281  6.347  1.00 67.10  ? 300  LYS A N   1 
ATOM   2321 C CA  . LYS A 1 300 ? 23.745  34.309  6.544  1.00 76.53  ? 300  LYS A CA  1 
ATOM   2322 C C   . LYS A 1 300 ? 24.178  34.197  8.008  1.00 74.12  ? 300  LYS A C   1 
ATOM   2323 O O   . LYS A 1 300 ? 24.011  35.127  8.800  1.00 66.85  ? 300  LYS A O   1 
ATOM   2324 C CB  . LYS A 1 300 ? 24.941  34.625  5.643  1.00 83.15  ? 300  LYS A CB  1 
ATOM   2325 C CG  . LYS A 1 300 ? 24.643  34.429  4.164  1.00 95.43  ? 300  LYS A CG  1 
ATOM   2326 C CD  . LYS A 1 300 ? 25.873  34.645  3.298  1.00 101.83 ? 300  LYS A CD  1 
ATOM   2327 C CE  . LYS A 1 300 ? 25.549  34.428  1.823  1.00 105.86 ? 300  LYS A CE  1 
ATOM   2328 N NZ  . LYS A 1 300 ? 26.754  34.560  0.951  1.00 107.55 ? 300  LYS A NZ  1 
ATOM   2329 N N   . VAL A 1 301 ? 24.720  33.036  8.356  1.00 66.75  ? 301  VAL A N   1 
ATOM   2330 C CA  . VAL A 1 301 ? 25.346  32.844  9.649  1.00 67.81  ? 301  VAL A CA  1 
ATOM   2331 C C   . VAL A 1 301 ? 26.351  33.960  9.904  1.00 75.66  ? 301  VAL A C   1 
ATOM   2332 O O   . VAL A 1 301 ? 27.160  34.282  9.039  1.00 84.92  ? 301  VAL A O   1 
ATOM   2333 C CB  . VAL A 1 301 ? 26.067  31.497  9.704  1.00 62.01  ? 301  VAL A CB  1 
ATOM   2334 C CG1 . VAL A 1 301 ? 26.884  31.395  10.987 1.00 63.47  ? 301  VAL A CG1 1 
ATOM   2335 C CG2 . VAL A 1 301 ? 25.057  30.348  9.588  1.00 53.62  ? 301  VAL A CG2 1 
ATOM   2336 N N   . GLY A 1 302 ? 26.292  34.563  11.086 1.00 72.46  ? 302  GLY A N   1 
ATOM   2337 C CA  . GLY A 1 302 ? 27.183  35.663  11.416 1.00 65.53  ? 302  GLY A CA  1 
ATOM   2338 C C   . GLY A 1 302 ? 26.649  37.028  11.013 1.00 67.90  ? 302  GLY A C   1 
ATOM   2339 O O   . GLY A 1 302 ? 27.226  38.058  11.366 1.00 62.00  ? 302  GLY A O   1 
ATOM   2340 N N   . ASP A 1 303 ? 25.550  37.041  10.263 1.00 70.61  ? 303  ASP A N   1 
ATOM   2341 C CA  . ASP A 1 303 ? 24.876  38.291  9.923  1.00 72.86  ? 303  ASP A CA  1 
ATOM   2342 C C   . ASP A 1 303 ? 24.345  39.016  11.163 1.00 84.62  ? 303  ASP A C   1 
ATOM   2343 O O   . ASP A 1 303 ? 23.736  38.397  12.045 1.00 82.11  ? 303  ASP A O   1 
ATOM   2344 C CB  . ASP A 1 303 ? 23.715  38.023  8.965  1.00 65.72  ? 303  ASP A CB  1 
ATOM   2345 C CG  . ASP A 1 303 ? 24.153  37.961  7.503  1.00 71.35  ? 303  ASP A CG  1 
ATOM   2346 O OD1 . ASP A 1 303 ? 25.366  37.791  7.231  1.00 69.43  ? 303  ASP A OD1 1 
ATOM   2347 O OD2 . ASP A 1 303 ? 23.268  38.080  6.630  1.00 68.23  ? 303  ASP A OD2 1 
ATOM   2348 N N   . MET A 1 304 ? 24.576  40.325  11.226 1.00 88.99  ? 304  MET A N   1 
ATOM   2349 C CA  . MET A 1 304 ? 23.970  41.156  12.265 1.00 92.66  ? 304  MET A CA  1 
ATOM   2350 C C   . MET A 1 304 ? 22.542  41.513  11.873 1.00 93.15  ? 304  MET A C   1 
ATOM   2351 O O   . MET A 1 304 ? 22.300  42.024  10.779 1.00 102.95 ? 304  MET A O   1 
ATOM   2352 C CB  . MET A 1 304 ? 24.781  42.435  12.490 1.00 97.50  ? 304  MET A CB  1 
ATOM   2353 C CG  . MET A 1 304 ? 25.850  42.321  13.567 1.00 101.37 ? 304  MET A CG  1 
ATOM   2354 S SD  . MET A 1 304 ? 25.173  42.109  15.232 1.00 219.81 ? 304  MET A SD  1 
ATOM   2355 C CE  . MET A 1 304 ? 24.382  43.691  15.523 1.00 84.02  ? 304  MET A CE  1 
ATOM   2356 N N   . VAL A 1 305 ? 21.594  41.233  12.760 1.00 81.22  ? 305  VAL A N   1 
ATOM   2357 C CA  . VAL A 1 305 ? 20.198  41.548  12.497 1.00 77.90  ? 305  VAL A CA  1 
ATOM   2358 C C   . VAL A 1 305 ? 19.570  42.291  13.663 1.00 82.36  ? 305  VAL A C   1 
ATOM   2359 O O   . VAL A 1 305 ? 20.076  42.262  14.781 1.00 82.59  ? 305  VAL A O   1 
ATOM   2360 C CB  . VAL A 1 305 ? 19.357  40.285  12.263 1.00 71.47  ? 305  VAL A CB  1 
ATOM   2361 C CG1 . VAL A 1 305 ? 20.025  39.373  11.232 1.00 73.20  ? 305  VAL A CG1 1 
ATOM   2362 C CG2 . VAL A 1 305 ? 19.124  39.560  13.588 1.00 61.86  ? 305  VAL A CG2 1 
ATOM   2363 N N   . LYS A 1 306 ? 18.454  42.953  13.392 1.00 82.58  ? 306  LYS A N   1 
ATOM   2364 C CA  . LYS A 1 306 ? 17.693  43.596  14.442 1.00 79.46  ? 306  LYS A CA  1 
ATOM   2365 C C   . LYS A 1 306 ? 16.366  42.877  14.592 1.00 83.77  ? 306  LYS A C   1 
ATOM   2366 O O   . LYS A 1 306 ? 15.669  42.624  13.600 1.00 74.41  ? 306  LYS A O   1 
ATOM   2367 C CB  . LYS A 1 306 ? 17.463  45.069  14.118 1.00 81.28  ? 306  LYS A CB  1 
ATOM   2368 C CG  . LYS A 1 306 ? 16.665  45.804  15.174 1.00 82.86  ? 306  LYS A CG  1 
ATOM   2369 C CD  . LYS A 1 306 ? 16.721  47.305  14.963 1.00 91.37  ? 306  LYS A CD  1 
ATOM   2370 C CE  . LYS A 1 306 ? 16.139  48.051  16.159 1.00 103.03 ? 306  LYS A CE  1 
ATOM   2371 N NZ  . LYS A 1 306 ? 16.369  49.526  16.086 1.00 110.51 ? 306  LYS A NZ  1 
ATOM   2372 N N   . ILE A 1 307 ? 16.040  42.520  15.832 1.00 84.88  ? 307  ILE A N   1 
ATOM   2373 C CA  . ILE A 1 307 ? 14.737  41.951  16.138 1.00 76.77  ? 307  ILE A CA  1 
ATOM   2374 C C   . ILE A 1 307 ? 13.726  43.078  16.077 1.00 74.27  ? 307  ILE A C   1 
ATOM   2375 O O   . ILE A 1 307 ? 13.907  44.130  16.694 1.00 75.31  ? 307  ILE A O   1 
ATOM   2376 C CB  . ILE A 1 307 ? 14.682  41.298  17.533 1.00 75.94  ? 307  ILE A CB  1 
ATOM   2377 C CG1 . ILE A 1 307 ? 15.455  39.977  17.556 1.00 77.28  ? 307  ILE A CG1 1 
ATOM   2378 C CG2 . ILE A 1 307 ? 13.248  41.025  17.921 1.00 71.11  ? 307  ILE A CG2 1 
ATOM   2379 C CD1 . ILE A 1 307 ? 16.955  40.134  17.675 1.00 84.84  ? 307  ILE A CD1 1 
ATOM   2380 N N   . ILE A 1 308 ? 12.660  42.860  15.323 1.00 66.93  ? 308  ILE A N   1 
ATOM   2381 C CA  . ILE A 1 308 ? 11.705  43.921  15.065 1.00 75.76  ? 308  ILE A CA  1 
ATOM   2382 C C   . ILE A 1 308 ? 10.345  43.562  15.643 1.00 75.33  ? 308  ILE A C   1 
ATOM   2383 O O   . ILE A 1 308 ? 9.454   44.404  15.756 1.00 74.39  ? 308  ILE A O   1 
ATOM   2384 C CB  . ILE A 1 308 ? 11.598  44.200  13.549 1.00 79.57  ? 308  ILE A CB  1 
ATOM   2385 C CG1 . ILE A 1 308 ? 11.045  42.971  12.816 1.00 71.78  ? 308  ILE A CG1 1 
ATOM   2386 C CG2 . ILE A 1 308 ? 12.964  44.606  12.992 1.00 73.26  ? 308  ILE A CG2 1 
ATOM   2387 C CD1 . ILE A 1 308 ? 11.056  43.095  11.320 1.00 74.73  ? 308  ILE A CD1 1 
ATOM   2388 N N   . SER A 1 309 ? 10.197  42.304  16.027 1.00 72.12  ? 309  SER A N   1 
ATOM   2389 C CA  . SER A 1 309 ? 8.941   41.836  16.587 1.00 70.50  ? 309  SER A CA  1 
ATOM   2390 C C   . SER A 1 309 ? 9.194   40.919  17.780 1.00 62.74  ? 309  SER A C   1 
ATOM   2391 O O   . SER A 1 309 ? 10.295  40.412  17.955 1.00 69.49  ? 309  SER A O   1 
ATOM   2392 C CB  . SER A 1 309 ? 8.150   41.098  15.509 1.00 64.46  ? 309  SER A CB  1 
ATOM   2393 O OG  . SER A 1 309 ? 6.995   40.481  16.045 1.00 70.45  ? 309  SER A OG  1 
ATOM   2394 N N   . GLY A 1 310 ? 8.174   40.706  18.602 1.00 59.33  ? 310  GLY A N   1 
ATOM   2395 C CA  . GLY A 1 310 ? 8.251   39.686  19.635 1.00 68.80  ? 310  GLY A CA  1 
ATOM   2396 C C   . GLY A 1 310 ? 8.867   40.124  20.953 1.00 71.48  ? 310  GLY A C   1 
ATOM   2397 O O   . GLY A 1 310 ? 9.251   41.287  21.120 1.00 55.63  ? 310  GLY A O   1 
ATOM   2398 N N   . PRO A 1 311 ? 8.962   39.181  21.903 1.00 73.87  ? 311  PRO A N   1 
ATOM   2399 C CA  . PRO A 1 311 ? 9.567   39.406  23.215 1.00 69.60  ? 311  PRO A CA  1 
ATOM   2400 C C   . PRO A 1 311 ? 10.798  40.280  23.077 1.00 73.97  ? 311  PRO A C   1 
ATOM   2401 O O   . PRO A 1 311 ? 10.907  41.346  23.697 1.00 74.61  ? 311  PRO A O   1 
ATOM   2402 C CB  . PRO A 1 311 ? 9.996   38.002  23.623 1.00 60.71  ? 311  PRO A CB  1 
ATOM   2403 C CG  . PRO A 1 311 ? 8.966   37.130  23.015 1.00 63.70  ? 311  PRO A CG  1 
ATOM   2404 C CD  . PRO A 1 311 ? 8.610   37.765  21.700 1.00 68.48  ? 311  PRO A CD  1 
ATOM   2405 N N   . PHE A 1 312 ? 11.708  39.825  22.225 1.00 70.86  ? 312  PHE A N   1 
ATOM   2406 C CA  . PHE A 1 312 ? 13.006  40.454  22.069 1.00 68.75  ? 312  PHE A CA  1 
ATOM   2407 C C   . PHE A 1 312 ? 13.039  41.595  21.068 1.00 60.66  ? 312  PHE A C   1 
ATOM   2408 O O   . PHE A 1 312 ? 14.111  42.009  20.627 1.00 62.89  ? 312  PHE A O   1 
ATOM   2409 C CB  . PHE A 1 312 ? 14.052  39.400  21.728 1.00 69.65  ? 312  PHE A CB  1 
ATOM   2410 C CG  . PHE A 1 312 ? 14.445  38.559  22.903 1.00 70.91  ? 312  PHE A CG  1 
ATOM   2411 C CD1 . PHE A 1 312 ? 13.825  37.349  23.145 1.00 70.14  ? 312  PHE A CD1 1 
ATOM   2412 C CD2 . PHE A 1 312 ? 15.422  38.996  23.780 1.00 71.82  ? 312  PHE A CD2 1 
ATOM   2413 C CE1 . PHE A 1 312 ? 14.182  36.582  24.238 1.00 72.70  ? 312  PHE A CE1 1 
ATOM   2414 C CE2 . PHE A 1 312 ? 15.787  38.234  24.870 1.00 71.69  ? 312  PHE A CE2 1 
ATOM   2415 C CZ  . PHE A 1 312 ? 15.164  37.023  25.100 1.00 73.77  ? 312  PHE A CZ  1 
ATOM   2416 N N   . GLU A 1 313 ? 11.865  42.118  20.732 1.00 66.46  ? 313  GLU A N   1 
ATOM   2417 C CA  . GLU A 1 313 ? 11.777  43.294  19.873 1.00 76.03  ? 313  GLU A CA  1 
ATOM   2418 C C   . GLU A 1 313 ? 12.786  44.367  20.282 1.00 83.68  ? 313  GLU A C   1 
ATOM   2419 O O   . GLU A 1 313 ? 13.088  44.537  21.467 1.00 94.79  ? 313  GLU A O   1 
ATOM   2420 C CB  . GLU A 1 313 ? 10.366  43.879  19.902 1.00 69.93  ? 313  GLU A CB  1 
ATOM   2421 C CG  . GLU A 1 313 ? 10.260  45.197  19.165 1.00 78.85  ? 313  GLU A CG  1 
ATOM   2422 C CD  . GLU A 1 313 ? 8.856   45.769  19.157 1.00 90.83  ? 313  GLU A CD  1 
ATOM   2423 O OE1 . GLU A 1 313 ? 7.941   45.135  19.728 1.00 88.42  ? 313  GLU A OE1 1 
ATOM   2424 O OE2 . GLU A 1 313 ? 8.671   46.860  18.572 1.00 98.73  ? 313  GLU A OE2 1 
ATOM   2425 N N   . ASP A 1 314 ? 13.303  45.087  19.293 1.00 72.30  ? 314  ASP A N   1 
ATOM   2426 C CA  . ASP A 1 314 ? 14.196  46.219  19.530 1.00 81.78  ? 314  ASP A CA  1 
ATOM   2427 C C   . ASP A 1 314 ? 15.604  45.814  19.961 1.00 76.57  ? 314  ASP A C   1 
ATOM   2428 O O   . ASP A 1 314 ? 16.431  46.668  20.275 1.00 75.48  ? 314  ASP A O   1 
ATOM   2429 C CB  . ASP A 1 314 ? 13.587  47.203  20.540 1.00 99.56  ? 314  ASP A CB  1 
ATOM   2430 C CG  . ASP A 1 314 ? 12.434  48.007  19.953 1.00 114.56 ? 314  ASP A CG  1 
ATOM   2431 O OD1 . ASP A 1 314 ? 11.532  48.415  20.719 1.00 116.71 ? 314  ASP A OD1 1 
ATOM   2432 O OD2 . ASP A 1 314 ? 12.429  48.233  18.722 1.00 120.65 ? 314  ASP A OD2 1 
ATOM   2433 N N   . PHE A 1 315 ? 15.884  44.516  19.961 1.00 70.98  ? 315  PHE A N   1 
ATOM   2434 C CA  . PHE A 1 315 ? 17.225  44.052  20.297 1.00 75.66  ? 315  PHE A CA  1 
ATOM   2435 C C   . PHE A 1 315 ? 18.075  43.758  19.073 1.00 78.33  ? 315  PHE A C   1 
ATOM   2436 O O   . PHE A 1 315 ? 17.576  43.296  18.046 1.00 75.26  ? 315  PHE A O   1 
ATOM   2437 C CB  . PHE A 1 315 ? 17.164  42.814  21.185 1.00 72.38  ? 315  PHE A CB  1 
ATOM   2438 C CG  . PHE A 1 315 ? 17.233  43.123  22.641 1.00 71.07  ? 315  PHE A CG  1 
ATOM   2439 C CD1 . PHE A 1 315 ? 16.080  43.367  23.366 1.00 59.72  ? 315  PHE A CD1 1 
ATOM   2440 C CD2 . PHE A 1 315 ? 18.453  43.179  23.289 1.00 78.59  ? 315  PHE A CD2 1 
ATOM   2441 C CE1 . PHE A 1 315 ? 16.143  43.657  24.697 1.00 59.64  ? 315  PHE A CE1 1 
ATOM   2442 C CE2 . PHE A 1 315 ? 18.520  43.465  24.635 1.00 75.63  ? 315  PHE A CE2 1 
ATOM   2443 C CZ  . PHE A 1 315 ? 17.365  43.705  25.338 1.00 68.04  ? 315  PHE A CZ  1 
ATOM   2444 N N   . ALA A 1 316 ? 19.367  44.038  19.190 1.00 85.21  ? 316  ALA A N   1 
ATOM   2445 C CA  . ALA A 1 316 ? 20.315  43.663  18.153 1.00 88.40  ? 316  ALA A CA  1 
ATOM   2446 C C   . ALA A 1 316 ? 20.638  42.194  18.336 1.00 83.04  ? 316  ALA A C   1 
ATOM   2447 O O   . ALA A 1 316 ? 20.353  41.620  19.387 1.00 84.74  ? 316  ALA A O   1 
ATOM   2448 C CB  . ALA A 1 316 ? 21.575  44.500  18.255 1.00 94.00  ? 316  ALA A CB  1 
ATOM   2449 N N   . GLY A 1 317 ? 21.229  41.581  17.319 1.00 79.53  ? 317  GLY A N   1 
ATOM   2450 C CA  . GLY A 1 317 ? 21.580  40.178  17.412 1.00 80.48  ? 317  GLY A CA  1 
ATOM   2451 C C   . GLY A 1 317 ? 22.490  39.694  16.307 1.00 81.10  ? 317  GLY A C   1 
ATOM   2452 O O   . GLY A 1 317 ? 22.729  40.397  15.330 1.00 86.86  ? 317  GLY A O   1 
ATOM   2453 N N   . VAL A 1 318 ? 23.004  38.481  16.475 1.00 78.90  ? 318  VAL A N   1 
ATOM   2454 C CA  . VAL A 1 318 ? 23.850  37.853  15.473 1.00 73.40  ? 318  VAL A CA  1 
ATOM   2455 C C   . VAL A 1 318 ? 23.296  36.483  15.109 1.00 74.85  ? 318  VAL A C   1 
ATOM   2456 O O   . VAL A 1 318 ? 23.111  35.628  15.982 1.00 68.79  ? 318  VAL A O   1 
ATOM   2457 C CB  . VAL A 1 318 ? 25.291  37.678  15.971 1.00 75.77  ? 318  VAL A CB  1 
ATOM   2458 C CG1 . VAL A 1 318 ? 26.133  36.968  14.914 1.00 77.56  ? 318  VAL A CG1 1 
ATOM   2459 C CG2 . VAL A 1 318 ? 25.895  39.028  16.319 1.00 82.46  ? 318  VAL A CG2 1 
ATOM   2460 N N   . ILE A 1 319 ? 23.031  36.281  13.820 1.00 69.79  ? 319  ILE A N   1 
ATOM   2461 C CA  . ILE A 1 319 ? 22.555  34.993  13.349 1.00 58.96  ? 319  ILE A CA  1 
ATOM   2462 C C   . ILE A 1 319 ? 23.600  33.943  13.656 1.00 59.01  ? 319  ILE A C   1 
ATOM   2463 O O   . ILE A 1 319 ? 24.800  34.162  13.470 1.00 62.73  ? 319  ILE A O   1 
ATOM   2464 C CB  . ILE A 1 319 ? 22.249  34.992  11.842 1.00 52.72  ? 319  ILE A CB  1 
ATOM   2465 C CG1 . ILE A 1 319 ? 21.103  35.958  11.538 1.00 54.54  ? 319  ILE A CG1 1 
ATOM   2466 C CG2 . ILE A 1 319 ? 21.858  33.594  11.383 1.00 44.63  ? 319  ILE A CG2 1 
ATOM   2467 C CD1 . ILE A 1 319 ? 20.567  35.824  10.146 1.00 66.32  ? 319  ILE A CD1 1 
ATOM   2468 N N   . LYS A 1 320 ? 23.136  32.801  14.136 1.00 45.83  ? 320  LYS A N   1 
ATOM   2469 C CA  . LYS A 1 320 ? 24.036  31.773  14.611 1.00 57.52  ? 320  LYS A CA  1 
ATOM   2470 C C   . LYS A 1 320 ? 23.677  30.461  13.926 1.00 50.83  ? 320  LYS A C   1 
ATOM   2471 O O   . LYS A 1 320 ? 24.542  29.674  13.547 1.00 60.14  ? 320  LYS A O   1 
ATOM   2472 C CB  . LYS A 1 320 ? 23.909  31.658  16.144 1.00 58.88  ? 320  LYS A CB  1 
ATOM   2473 C CG  . LYS A 1 320 ? 25.199  31.330  16.878 1.00 67.59  ? 320  LYS A CG  1 
ATOM   2474 C CD  . LYS A 1 320 ? 26.240  32.443  16.758 1.00 80.67  ? 320  LYS A CD  1 
ATOM   2475 C CE  . LYS A 1 320 ? 27.546  32.060  17.467 1.00 88.42  ? 320  LYS A CE  1 
ATOM   2476 N NZ  . LYS A 1 320 ? 28.502  33.198  17.628 1.00 89.60  ? 320  LYS A NZ  1 
ATOM   2477 N N   . GLU A 1 321 ? 22.381  30.244  13.772 1.00 44.98  ? 321  GLU A N   1 
ATOM   2478 C CA  . GLU A 1 321 ? 21.851  29.034  13.184 1.00 56.32  ? 321  GLU A CA  1 
ATOM   2479 C C   . GLU A 1 321 ? 20.700  29.476  12.292 1.00 65.90  ? 321  GLU A C   1 
ATOM   2480 O O   . GLU A 1 321 ? 19.960  30.395  12.646 1.00 63.76  ? 321  GLU A O   1 
ATOM   2481 C CB  . GLU A 1 321 ? 21.341  28.110  14.284 1.00 69.75  ? 321  GLU A CB  1 
ATOM   2482 C CG  . GLU A 1 321 ? 21.711  26.649  14.140 1.00 78.42  ? 321  GLU A CG  1 
ATOM   2483 C CD  . GLU A 1 321 ? 22.020  26.002  15.482 1.00 74.97  ? 321  GLU A CD  1 
ATOM   2484 O OE1 . GLU A 1 321 ? 21.351  25.011  15.848 1.00 72.29  ? 321  GLU A OE1 1 
ATOM   2485 O OE2 . GLU A 1 321 ? 22.939  26.489  16.171 1.00 79.29  ? 321  GLU A OE2 1 
ATOM   2486 N N   . ILE A 1 322 ? 20.571  28.846  11.127 1.00 67.87  ? 322  ILE A N   1 
ATOM   2487 C CA  . ILE A 1 322 ? 19.516  29.177  10.176 1.00 66.20  ? 322  ILE A CA  1 
ATOM   2488 C C   . ILE A 1 322 ? 18.753  27.916  9.791  1.00 73.01  ? 322  ILE A C   1 
ATOM   2489 O O   . ILE A 1 322 ? 19.353  26.868  9.561  1.00 72.77  ? 322  ILE A O   1 
ATOM   2490 C CB  . ILE A 1 322 ? 20.092  29.813  8.900  1.00 68.68  ? 322  ILE A CB  1 
ATOM   2491 C CG1 . ILE A 1 322 ? 20.542  31.246  9.165  1.00 63.33  ? 322  ILE A CG1 1 
ATOM   2492 C CG2 . ILE A 1 322 ? 19.056  29.813  7.803  1.00 73.62  ? 322  ILE A CG2 1 
ATOM   2493 C CD1 . ILE A 1 322 ? 21.448  31.799  8.084  1.00 65.00  ? 322  ILE A CD1 1 
ATOM   2494 N N   . ASP A 1 323 ? 17.430  28.012  9.729  1.00 86.89  ? 323  ASP A N   1 
ATOM   2495 C CA  . ASP A 1 323 ? 16.603  26.851  9.413  1.00 97.66  ? 323  ASP A CA  1 
ATOM   2496 C C   . ASP A 1 323 ? 15.518  27.160  8.386  1.00 98.30  ? 323  ASP A C   1 
ATOM   2497 O O   . ASP A 1 323 ? 14.341  27.289  8.735  1.00 95.57  ? 323  ASP A O   1 
ATOM   2498 C CB  . ASP A 1 323 ? 15.971  26.273  10.679 1.00 100.77 ? 323  ASP A CB  1 
ATOM   2499 C CG  . ASP A 1 323 ? 15.091  25.073  10.392 1.00 109.09 ? 323  ASP A CG  1 
ATOM   2500 O OD1 . ASP A 1 323 ? 15.111  24.577  9.241  1.00 115.18 ? 323  ASP A OD1 1 
ATOM   2501 O OD2 . ASP A 1 323 ? 14.387  24.623  11.320 1.00 107.89 ? 323  ASP A OD2 1 
ATOM   2502 N N   . PRO A 1 324 ? 15.911  27.252  7.109  1.00 96.65  ? 324  PRO A N   1 
ATOM   2503 C CA  . PRO A 1 324 ? 14.940  27.554  6.057  1.00 107.37 ? 324  PRO A CA  1 
ATOM   2504 C C   . PRO A 1 324 ? 13.923  26.424  5.997  1.00 121.11 ? 324  PRO A C   1 
ATOM   2505 O O   . PRO A 1 324 ? 14.013  25.496  6.805  1.00 129.95 ? 324  PRO A O   1 
ATOM   2506 C CB  . PRO A 1 324 ? 15.800  27.592  4.792  1.00 98.27  ? 324  PRO A CB  1 
ATOM   2507 C CG  . PRO A 1 324 ? 16.950  26.693  5.098  1.00 92.83  ? 324  PRO A CG  1 
ATOM   2508 C CD  . PRO A 1 324 ? 17.224  26.867  6.563  1.00 96.18  ? 324  PRO A CD  1 
ATOM   2509 N N   . GLU A 1 325 ? 12.976  26.490  5.069  1.00 121.93 ? 325  GLU A N   1 
ATOM   2510 C CA  . GLU A 1 325 ? 11.910  25.500  5.029  1.00 127.96 ? 325  GLU A CA  1 
ATOM   2511 C C   . GLU A 1 325 ? 11.348  25.368  6.438  1.00 125.19 ? 325  GLU A C   1 
ATOM   2512 O O   . GLU A 1 325 ? 10.864  24.314  6.843  1.00 127.64 ? 325  GLU A O   1 
ATOM   2513 C CB  . GLU A 1 325 ? 12.425  24.152  4.517  1.00 135.83 ? 325  GLU A CB  1 
ATOM   2514 C CG  . GLU A 1 325 ? 13.017  24.197  3.113  1.00 143.73 ? 325  GLU A CG  1 
ATOM   2515 C CD  . GLU A 1 325 ? 14.532  24.050  3.106  1.00 149.78 ? 325  GLU A CD  1 
ATOM   2516 O OE1 . GLU A 1 325 ? 15.108  23.751  4.173  1.00 152.57 ? 325  GLU A OE1 1 
ATOM   2517 O OE2 . GLU A 1 325 ? 15.148  24.232  2.033  1.00 150.88 ? 325  GLU A OE2 1 
ATOM   2518 N N   . ARG A 1 326 ? 11.457  26.463  7.181  1.00 121.53 ? 326  ARG A N   1 
ATOM   2519 C CA  . ARG A 1 326 ? 10.848  26.613  8.493  1.00 112.18 ? 326  ARG A CA  1 
ATOM   2520 C C   . ARG A 1 326 ? 10.950  28.088  8.832  1.00 104.42 ? 326  ARG A C   1 
ATOM   2521 O O   . ARG A 1 326 ? 10.337  28.565  9.788  1.00 96.54  ? 326  ARG A O   1 
ATOM   2522 C CB  . ARG A 1 326 ? 11.576  25.776  9.541  1.00 107.46 ? 326  ARG A CB  1 
ATOM   2523 C CG  . ARG A 1 326 ? 10.860  25.707  10.886 1.00 101.63 ? 326  ARG A CG  1 
ATOM   2524 C CD  . ARG A 1 326 ? 11.399  24.557  11.712 1.00 101.54 ? 326  ARG A CD  1 
ATOM   2525 N NE  . ARG A 1 326 ? 12.003  23.550  10.846 1.00 110.62 ? 326  ARG A NE  1 
ATOM   2526 C CZ  . ARG A 1 326 ? 11.313  22.700  10.091 1.00 118.12 ? 326  ARG A CZ  1 
ATOM   2527 N NH1 . ARG A 1 326 ? 9.986   22.735  10.100 1.00 121.93 ? 326  ARG A NH1 1 
ATOM   2528 N NH2 . ARG A 1 326 ? 11.948  21.821  9.324  1.00 114.87 ? 326  ARG A NH2 1 
ATOM   2529 N N   . GLN A 1 327 ? 11.737  28.797  8.024  1.00 101.18 ? 327  GLN A N   1 
ATOM   2530 C CA  . GLN A 1 327 ? 11.935  30.237  8.159  1.00 96.14  ? 327  GLN A CA  1 
ATOM   2531 C C   . GLN A 1 327 ? 12.255  30.628  9.603  1.00 91.65  ? 327  GLN A C   1 
ATOM   2532 O O   . GLN A 1 327 ? 11.713  31.601  10.141 1.00 93.40  ? 327  GLN A O   1 
ATOM   2533 C CB  . GLN A 1 327 ? 10.722  31.005  7.620  1.00 96.72  ? 327  GLN A CB  1 
ATOM   2534 C CG  . GLN A 1 327 ? 10.442  30.779  6.130  1.00 102.40 ? 327  GLN A CG  1 
ATOM   2535 C CD  . GLN A 1 327 ? 11.568  31.273  5.223  1.00 105.18 ? 327  GLN A CD  1 
ATOM   2536 O OE1 . GLN A 1 327 ? 11.555  32.417  4.763  1.00 101.37 ? 327  GLN A OE1 1 
ATOM   2537 N NE2 . GLN A 1 327 ? 12.541  30.404  4.958  1.00 106.21 ? 327  GLN A NE2 1 
ATOM   2538 N N   . GLU A 1 328 ? 13.146  29.856  10.219 1.00 85.41  ? 328  GLU A N   1 
ATOM   2539 C CA  . GLU A 1 328 ? 13.546  30.084  11.601 1.00 79.16  ? 328  GLU A CA  1 
ATOM   2540 C C   . GLU A 1 328 ? 14.996  30.537  11.679 1.00 71.79  ? 328  GLU A C   1 
ATOM   2541 O O   . GLU A 1 328 ? 15.798  30.245  10.789 1.00 80.74  ? 328  GLU A O   1 
ATOM   2542 C CB  . GLU A 1 328 ? 13.364  28.808  12.425 1.00 82.26  ? 328  GLU A CB  1 
ATOM   2543 C CG  . GLU A 1 328 ? 12.559  28.996  13.707 1.00 88.08  ? 328  GLU A CG  1 
ATOM   2544 C CD  . GLU A 1 328 ? 11.061  29.066  13.457 1.00 101.52 ? 328  GLU A CD  1 
ATOM   2545 O OE1 . GLU A 1 328 ? 10.655  29.442  12.338 1.00 102.48 ? 328  GLU A OE1 1 
ATOM   2546 O OE2 . GLU A 1 328 ? 10.287  28.739  14.381 1.00 109.34 ? 328  GLU A OE2 1 
ATOM   2547 N N   . LEU A 1 329 ? 15.321  31.247  12.753 1.00 66.90  ? 329  LEU A N   1 
ATOM   2548 C CA  . LEU A 1 329 ? 16.682  31.680  13.027 1.00 69.16  ? 329  LEU A CA  1 
ATOM   2549 C C   . LEU A 1 329 ? 17.028  31.507  14.504 1.00 69.79  ? 329  LEU A C   1 
ATOM   2550 O O   . LEU A 1 329 ? 16.219  31.808  15.385 1.00 66.55  ? 329  LEU A O   1 
ATOM   2551 C CB  . LEU A 1 329 ? 16.846  33.157  12.681 1.00 76.89  ? 329  LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 329 ? 16.643  33.661  11.260 1.00 80.55  ? 329  LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 329 ? 16.566  35.183  11.272 1.00 76.17  ? 329  LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 329 ? 17.767  33.173  10.362 1.00 86.01  ? 329  LEU A CD2 1 
ATOM   2555 N N   . LYS A 1 330 ? 18.239  31.035  14.773 1.00 69.41  ? 330  LYS A N   1 
ATOM   2556 C CA  . LYS A 1 330 ? 18.770  31.096  16.118 1.00 63.76  ? 330  LYS A CA  1 
ATOM   2557 C C   . LYS A 1 330 ? 19.744  32.248  16.152 1.00 66.40  ? 330  LYS A C   1 
ATOM   2558 O O   . LYS A 1 330 ? 20.800  32.182  15.531 1.00 69.81  ? 330  LYS A O   1 
ATOM   2559 C CB  . LYS A 1 330 ? 19.484  29.804  16.510 1.00 60.39  ? 330  LYS A CB  1 
ATOM   2560 C CG  . LYS A 1 330 ? 19.814  29.754  18.003 1.00 67.70  ? 330  LYS A CG  1 
ATOM   2561 C CD  . LYS A 1 330 ? 20.569  28.490  18.391 1.00 76.44  ? 330  LYS A CD  1 
ATOM   2562 C CE  . LYS A 1 330 ? 19.659  27.272  18.418 1.00 79.72  ? 330  LYS A CE  1 
ATOM   2563 N NZ  . LYS A 1 330 ? 20.417  26.044  18.800 1.00 88.43  ? 330  LYS A NZ  1 
ATOM   2564 N N   . VAL A 1 331 ? 19.385  33.314  16.860 1.00 63.34  ? 331  VAL A N   1 
ATOM   2565 C CA  . VAL A 1 331 ? 20.277  34.455  16.964 1.00 58.58  ? 331  VAL A CA  1 
ATOM   2566 C C   . VAL A 1 331 ? 20.714  34.730  18.398 1.00 68.17  ? 331  VAL A C   1 
ATOM   2567 O O   . VAL A 1 331 ? 19.944  34.586  19.349 1.00 70.29  ? 331  VAL A O   1 
ATOM   2568 C CB  . VAL A 1 331 ? 19.696  35.717  16.280 1.00 62.25  ? 331  VAL A CB  1 
ATOM   2569 C CG1 . VAL A 1 331 ? 18.415  35.375  15.536 1.00 67.64  ? 331  VAL A CG1 1 
ATOM   2570 C CG2 . VAL A 1 331 ? 19.480  36.851  17.274 1.00 53.53  ? 331  VAL A CG2 1 
ATOM   2571 N N   . ASN A 1 332 ? 21.979  35.099  18.535 1.00 68.43  ? 332  ASN A N   1 
ATOM   2572 C CA  . ASN A 1 332 ? 22.544  35.439  19.820 1.00 59.69  ? 332  ASN A CA  1 
ATOM   2573 C C   . ASN A 1 332 ? 22.276  36.896  20.135 1.00 64.49  ? 332  ASN A C   1 
ATOM   2574 O O   . ASN A 1 332 ? 22.595  37.784  19.347 1.00 66.54  ? 332  ASN A O   1 
ATOM   2575 C CB  . ASN A 1 332 ? 24.045  35.161  19.829 1.00 61.08  ? 332  ASN A CB  1 
ATOM   2576 C CG  . ASN A 1 332 ? 24.361  33.706  20.090 1.00 69.75  ? 332  ASN A CG  1 
ATOM   2577 O OD1 . ASN A 1 332 ? 23.466  32.915  20.382 1.00 75.44  ? 332  ASN A OD1 1 
ATOM   2578 N ND2 . ASN A 1 332 ? 25.640  33.346  20.003 1.00 73.08  ? 332  ASN A ND2 1 
ATOM   2579 N N   . VAL A 1 333 ? 21.671  37.132  21.288 1.00 64.60  ? 333  VAL A N   1 
ATOM   2580 C CA  . VAL A 1 333 ? 21.385  38.481  21.741 1.00 66.92  ? 333  VAL A CA  1 
ATOM   2581 C C   . VAL A 1 333 ? 22.059  38.711  23.089 1.00 69.77  ? 333  VAL A C   1 
ATOM   2582 O O   . VAL A 1 333 ? 22.270  37.775  23.866 1.00 62.08  ? 333  VAL A O   1 
ATOM   2583 C CB  . VAL A 1 333 ? 19.876  38.705  21.907 1.00 64.07  ? 333  VAL A CB  1 
ATOM   2584 C CG1 . VAL A 1 333 ? 19.316  37.739  22.936 1.00 55.10  ? 333  VAL A CG1 1 
ATOM   2585 C CG2 . VAL A 1 333 ? 19.599  40.141  22.323 1.00 66.49  ? 333  VAL A CG2 1 
ATOM   2586 N N   . THR A 1 334 ? 22.404  39.959  23.361 1.00 65.62  ? 334  THR A N   1 
ATOM   2587 C CA  . THR A 1 334 ? 22.955  40.300  24.648 1.00 69.53  ? 334  THR A CA  1 
ATOM   2588 C C   . THR A 1 334 ? 21.896  40.970  25.505 1.00 74.82  ? 334  THR A C   1 
ATOM   2589 O O   . THR A 1 334 ? 21.372  42.025  25.146 1.00 78.77  ? 334  THR A O   1 
ATOM   2590 C CB  . THR A 1 334 ? 24.169  41.211  24.509 1.00 72.28  ? 334  THR A CB  1 
ATOM   2591 O OG1 . THR A 1 334 ? 25.160  40.534  23.736 1.00 78.53  ? 334  THR A OG1 1 
ATOM   2592 C CG2 . THR A 1 334 ? 24.752  41.517  25.878 1.00 74.48  ? 334  THR A CG2 1 
ATOM   2593 N N   . ILE A 1 335 ? 21.560  40.316  26.614 1.00 67.88  ? 335  ILE A N   1 
ATOM   2594 C CA  . ILE A 1 335 ? 20.749  40.913  27.667 1.00 70.22  ? 335  ILE A CA  1 
ATOM   2595 C C   . ILE A 1 335 ? 21.509  40.656  28.950 1.00 69.53  ? 335  ILE A C   1 
ATOM   2596 O O   . ILE A 1 335 ? 22.149  39.614  29.089 1.00 73.90  ? 335  ILE A O   1 
ATOM   2597 C CB  . ILE A 1 335 ? 19.363  40.249  27.796 1.00 69.70  ? 335  ILE A CB  1 
ATOM   2598 C CG1 . ILE A 1 335 ? 19.067  39.383  26.580 1.00 82.30  ? 335  ILE A CG1 1 
ATOM   2599 C CG2 . ILE A 1 335 ? 18.275  41.287  28.026 1.00 63.41  ? 335  ILE A CG2 1 
ATOM   2600 C CD1 . ILE A 1 335 ? 19.788  38.072  26.618 1.00 88.15  ? 335  ILE A CD1 1 
ATOM   2601 N N   . PHE A 1 336 ? 21.450  41.598  29.883 1.00 71.52  ? 336  PHE A N   1 
ATOM   2602 C CA  . PHE A 1 336 ? 22.130  41.434  31.161 1.00 68.27  ? 336  PHE A CA  1 
ATOM   2603 C C   . PHE A 1 336 ? 23.568  41.049  30.911 1.00 73.13  ? 336  PHE A C   1 
ATOM   2604 O O   . PHE A 1 336 ? 24.141  40.277  31.681 1.00 71.95  ? 336  PHE A O   1 
ATOM   2605 C CB  . PHE A 1 336 ? 21.484  40.323  31.980 1.00 49.24  ? 336  PHE A CB  1 
ATOM   2606 C CG  . PHE A 1 336 ? 19.982  40.326  31.931 1.00 67.20  ? 336  PHE A CG  1 
ATOM   2607 C CD1 . PHE A 1 336 ? 19.255  41.289  32.606 1.00 60.62  ? 336  PHE A CD1 1 
ATOM   2608 C CD2 . PHE A 1 336 ? 19.298  39.362  31.207 1.00 63.79  ? 336  PHE A CD2 1 
ATOM   2609 C CE1 . PHE A 1 336 ? 17.878  41.293  32.562 1.00 64.85  ? 336  PHE A CE1 1 
ATOM   2610 C CE2 . PHE A 1 336 ? 17.919  39.363  31.160 1.00 60.03  ? 336  PHE A CE2 1 
ATOM   2611 C CZ  . PHE A 1 336 ? 17.209  40.328  31.836 1.00 67.48  ? 336  PHE A CZ  1 
ATOM   2612 N N   . GLY A 1 337 ? 24.141  41.562  29.821 1.00 66.00  ? 337  GLY A N   1 
ATOM   2613 C CA  . GLY A 1 337 ? 25.524  41.277  29.493 1.00 61.89  ? 337  GLY A CA  1 
ATOM   2614 C C   . GLY A 1 337 ? 25.732  39.788  29.277 1.00 72.43  ? 337  GLY A C   1 
ATOM   2615 O O   . GLY A 1 337 ? 26.855  39.288  29.331 1.00 77.89  ? 337  GLY A O   1 
ATOM   2616 N N   . ARG A 1 338 ? 24.639  39.076  29.031 1.00 70.15  ? 338  ARG A N   1 
ATOM   2617 C CA  . ARG A 1 338 ? 24.709  37.648  28.762 1.00 71.72  ? 338  ARG A CA  1 
ATOM   2618 C C   . ARG A 1 338 ? 24.424  37.329  27.295 1.00 77.08  ? 338  ARG A C   1 
ATOM   2619 O O   . ARG A 1 338 ? 23.422  37.770  26.718 1.00 63.66  ? 338  ARG A O   1 
ATOM   2620 C CB  . ARG A 1 338 ? 23.753  36.881  29.680 1.00 61.20  ? 338  ARG A CB  1 
ATOM   2621 C CG  . ARG A 1 338 ? 24.109  37.019  31.162 1.00 69.54  ? 338  ARG A CG  1 
ATOM   2622 C CD  . ARG A 1 338 ? 23.186  36.213  32.052 1.00 68.26  ? 338  ARG A CD  1 
ATOM   2623 N NE  . ARG A 1 338 ? 23.412  34.777  31.923 1.00 75.37  ? 338  ARG A NE  1 
ATOM   2624 C CZ  . ARG A 1 338 ? 22.732  33.850  32.592 1.00 84.96  ? 338  ARG A CZ  1 
ATOM   2625 N NH1 . ARG A 1 338 ? 23.002  32.563  32.413 1.00 82.33  ? 338  ARG A NH1 1 
ATOM   2626 N NH2 . ARG A 1 338 ? 21.784  34.209  33.448 1.00 91.60  ? 338  ARG A NH2 1 
ATOM   2627 N N   . GLU A 1 339 ? 25.333  36.567  26.700 1.00 84.48  ? 339  GLU A N   1 
ATOM   2628 C CA  . GLU A 1 339 ? 25.151  36.045  25.357 1.00 83.69  ? 339  GLU A CA  1 
ATOM   2629 C C   . GLU A 1 339 ? 24.010  35.043  25.403 1.00 72.93  ? 339  GLU A C   1 
ATOM   2630 O O   . GLU A 1 339 ? 24.086  34.064  26.138 1.00 72.60  ? 339  GLU A O   1 
ATOM   2631 C CB  . GLU A 1 339 ? 26.436  35.351  24.909 1.00 96.02  ? 339  GLU A CB  1 
ATOM   2632 C CG  . GLU A 1 339 ? 26.415  34.818  23.488 1.00 103.96 ? 339  GLU A CG  1 
ATOM   2633 C CD  . GLU A 1 339 ? 26.555  35.914  22.453 1.00 112.10 ? 339  GLU A CD  1 
ATOM   2634 O OE1 . GLU A 1 339 ? 26.250  37.084  22.775 1.00 114.91 ? 339  GLU A OE1 1 
ATOM   2635 O OE2 . GLU A 1 339 ? 26.977  35.602  21.317 1.00 115.21 ? 339  GLU A OE2 1 
ATOM   2636 N N   . THR A 1 340 ? 22.956  35.275  24.623 1.00 65.14  ? 340  THR A N   1 
ATOM   2637 C CA  . THR A 1 340 ? 21.735  34.487  24.770 1.00 55.53  ? 340  THR A CA  1 
ATOM   2638 C C   . THR A 1 340 ? 21.094  34.102  23.441 1.00 70.37  ? 340  THR A C   1 
ATOM   2639 O O   . THR A 1 340 ? 20.566  34.949  22.723 1.00 69.34  ? 340  THR A O   1 
ATOM   2640 C CB  . THR A 1 340 ? 20.686  35.240  25.614 1.00 57.33  ? 340  THR A CB  1 
ATOM   2641 O OG1 . THR A 1 340 ? 21.253  35.617  26.881 1.00 63.10  ? 340  THR A OG1 1 
ATOM   2642 C CG2 . THR A 1 340 ? 19.421  34.382  25.821 1.00 37.88  ? 340  THR A CG2 1 
ATOM   2643 N N   . PRO A 1 341 ? 21.130  32.808  23.116 1.00 76.06  ? 341  PRO A N   1 
ATOM   2644 C CA  . PRO A 1 341 ? 20.541  32.345  21.862 1.00 76.09  ? 341  PRO A CA  1 
ATOM   2645 C C   . PRO A 1 341 ? 19.032  32.363  21.945 1.00 81.35  ? 341  PRO A C   1 
ATOM   2646 O O   . PRO A 1 341 ? 18.459  31.786  22.871 1.00 86.61  ? 341  PRO A O   1 
ATOM   2647 C CB  . PRO A 1 341 ? 21.038  30.902  21.755 1.00 77.96  ? 341  PRO A CB  1 
ATOM   2648 C CG  . PRO A 1 341 ? 22.238  30.836  22.664 1.00 81.16  ? 341  PRO A CG  1 
ATOM   2649 C CD  . PRO A 1 341 ? 21.893  31.750  23.792 1.00 77.18  ? 341  PRO A CD  1 
ATOM   2650 N N   . VAL A 1 342 ? 18.393  33.025  20.989 1.00 70.17  ? 342  VAL A N   1 
ATOM   2651 C CA  . VAL A 1 342 ? 16.948  33.010  20.924 1.00 66.85  ? 342  VAL A CA  1 
ATOM   2652 C C   . VAL A 1 342 ? 16.482  32.575  19.545 1.00 61.12  ? 342  VAL A C   1 
ATOM   2653 O O   . VAL A 1 342 ? 17.048  32.956  18.529 1.00 64.58  ? 342  VAL A O   1 
ATOM   2654 C CB  . VAL A 1 342 ? 16.325  34.381  21.273 1.00 68.52  ? 342  VAL A CB  1 
ATOM   2655 C CG1 . VAL A 1 342 ? 17.394  35.358  21.674 1.00 66.20  ? 342  VAL A CG1 1 
ATOM   2656 C CG2 . VAL A 1 342 ? 15.531  34.918  20.085 1.00 70.61  ? 342  VAL A CG2 1 
ATOM   2657 N N   . VAL A 1 343 ? 15.430  31.774  19.541 1.00 58.52  ? 343  VAL A N   1 
ATOM   2658 C CA  . VAL A 1 343 ? 14.822  31.265  18.339 1.00 60.79  ? 343  VAL A CA  1 
ATOM   2659 C C   . VAL A 1 343 ? 13.691  32.200  17.952 1.00 62.93  ? 343  VAL A C   1 
ATOM   2660 O O   . VAL A 1 343 ? 13.043  32.778  18.813 1.00 70.46  ? 343  VAL A O   1 
ATOM   2661 C CB  . VAL A 1 343 ? 14.278  29.853  18.592 1.00 56.98  ? 343  VAL A CB  1 
ATOM   2662 C CG1 . VAL A 1 343 ? 13.569  29.315  17.361 1.00 52.12  ? 343  VAL A CG1 1 
ATOM   2663 C CG2 . VAL A 1 343 ? 15.411  28.933  19.000 1.00 53.97  ? 343  VAL A CG2 1 
ATOM   2664 N N   . LEU A 1 344 ? 13.465  32.364  16.656 1.00 65.04  ? 344  LEU A N   1 
ATOM   2665 C CA  . LEU A 1 344 ? 12.439  33.279  16.182 1.00 76.21  ? 344  LEU A CA  1 
ATOM   2666 C C   . LEU A 1 344 ? 12.284  33.184  14.671 1.00 73.40  ? 344  LEU A C   1 
ATOM   2667 O O   . LEU A 1 344 ? 13.100  32.557  14.003 1.00 74.70  ? 344  LEU A O   1 
ATOM   2668 C CB  . LEU A 1 344 ? 12.746  34.715  16.622 1.00 83.97  ? 344  LEU A CB  1 
ATOM   2669 C CG  . LEU A 1 344 ? 14.045  35.420  16.218 1.00 81.06  ? 344  LEU A CG  1 
ATOM   2670 C CD1 . LEU A 1 344 ? 14.194  36.713  17.019 1.00 70.65  ? 344  LEU A CD1 1 
ATOM   2671 C CD2 . LEU A 1 344 ? 15.265  34.539  16.423 1.00 83.06  ? 344  LEU A CD2 1 
ATOM   2672 N N   . HIS A 1 345 ? 11.229  33.790  14.136 1.00 68.30  ? 345  HIS A N   1 
ATOM   2673 C CA  . HIS A 1 345 ? 10.958  33.703  12.704 1.00 77.72  ? 345  HIS A CA  1 
ATOM   2674 C C   . HIS A 1 345 ? 11.679  34.796  11.930 1.00 73.57  ? 345  HIS A C   1 
ATOM   2675 O O   . HIS A 1 345 ? 11.917  35.888  12.454 1.00 72.79  ? 345  HIS A O   1 
ATOM   2676 C CB  . HIS A 1 345 ? 9.456   33.774  12.436 1.00 91.95  ? 345  HIS A CB  1 
ATOM   2677 C CG  . HIS A 1 345 ? 8.670   32.717  13.146 1.00 101.56 ? 345  HIS A CG  1 
ATOM   2678 N ND1 . HIS A 1 345 ? 8.444   32.743  14.504 1.00 103.59 ? 345  HIS A ND1 1 
ATOM   2679 C CD2 . HIS A 1 345 ? 8.068   31.593  12.685 1.00 107.18 ? 345  HIS A CD2 1 
ATOM   2680 C CE1 . HIS A 1 345 ? 7.730   31.688  14.852 1.00 106.30 ? 345  HIS A CE1 1 
ATOM   2681 N NE2 . HIS A 1 345 ? 7.490   30.974  13.765 1.00 110.86 ? 345  HIS A NE2 1 
ATOM   2682 N N   . VAL A 1 346 ? 12.019  34.495  10.680 1.00 67.65  ? 346  VAL A N   1 
ATOM   2683 C CA  . VAL A 1 346 ? 12.740  35.433  9.824  1.00 65.89  ? 346  VAL A CA  1 
ATOM   2684 C C   . VAL A 1 346 ? 11.934  36.712  9.672  1.00 66.67  ? 346  VAL A C   1 
ATOM   2685 O O   . VAL A 1 346 ? 12.485  37.800  9.498  1.00 70.57  ? 346  VAL A O   1 
ATOM   2686 C CB  . VAL A 1 346 ? 13.028  34.824  8.439  1.00 79.43  ? 346  VAL A CB  1 
ATOM   2687 C CG1 . VAL A 1 346 ? 11.762  34.232  7.854  1.00 91.88  ? 346  VAL A CG1 1 
ATOM   2688 C CG2 . VAL A 1 346 ? 13.612  35.868  7.498  1.00 85.06  ? 346  VAL A CG2 1 
ATOM   2689 N N   . SER A 1 347 ? 10.619  36.567  9.773  1.00 71.20  ? 347  SER A N   1 
ATOM   2690 C CA  . SER A 1 347 ? 9.702   37.693  9.701  1.00 81.17  ? 347  SER A CA  1 
ATOM   2691 C C   . SER A 1 347 ? 9.809   38.608  10.924 1.00 83.82  ? 347  SER A C   1 
ATOM   2692 O O   . SER A 1 347 ? 9.054   39.570  11.055 1.00 82.45  ? 347  SER A O   1 
ATOM   2693 C CB  . SER A 1 347 ? 8.274   37.168  9.576  1.00 90.06  ? 347  SER A CB  1 
ATOM   2694 O OG  . SER A 1 347 ? 7.981   36.275  10.644 1.00 94.43  ? 347  SER A OG  1 
ATOM   2695 N N   . GLU A 1 348 ? 10.738  38.308  11.826 1.00 88.21  ? 348  GLU A N   1 
ATOM   2696 C CA  . GLU A 1 348 ? 10.884  39.107  13.037 1.00 78.93  ? 348  GLU A CA  1 
ATOM   2697 C C   . GLU A 1 348 ? 12.214  39.829  13.089 1.00 79.78  ? 348  GLU A C   1 
ATOM   2698 O O   . GLU A 1 348 ? 12.536  40.470  14.086 1.00 91.37  ? 348  GLU A O   1 
ATOM   2699 C CB  . GLU A 1 348 ? 10.743  38.232  14.273 1.00 77.09  ? 348  GLU A CB  1 
ATOM   2700 C CG  . GLU A 1 348 ? 9.551   37.308  14.238 1.00 86.05  ? 348  GLU A CG  1 
ATOM   2701 C CD  . GLU A 1 348 ? 9.271   36.692  15.591 1.00 87.19  ? 348  GLU A CD  1 
ATOM   2702 O OE1 . GLU A 1 348 ? 8.804   37.428  16.488 1.00 82.51  ? 348  GLU A OE1 1 
ATOM   2703 O OE2 . GLU A 1 348 ? 9.527   35.478  15.758 1.00 89.75  ? 348  GLU A OE2 1 
ATOM   2704 N N   . VAL A 1 349 ? 12.987  39.726  12.017 1.00 81.26  ? 349  VAL A N   1 
ATOM   2705 C CA  . VAL A 1 349 ? 14.315  40.323  11.990 1.00 85.74  ? 349  VAL A CA  1 
ATOM   2706 C C   . VAL A 1 349 ? 14.551  41.181  10.750 1.00 89.31  ? 349  VAL A C   1 
ATOM   2707 O O   . VAL A 1 349 ? 13.809  41.095  9.771  1.00 94.87  ? 349  VAL A O   1 
ATOM   2708 C CB  . VAL A 1 349 ? 15.405  39.239  12.069 1.00 84.04  ? 349  VAL A CB  1 
ATOM   2709 C CG1 . VAL A 1 349 ? 15.212  38.391  13.316 1.00 73.31  ? 349  VAL A CG1 1 
ATOM   2710 C CG2 . VAL A 1 349 ? 15.384  38.372  10.816 1.00 83.26  ? 349  VAL A CG2 1 
ATOM   2711 N N   . GLU A 1 350 ? 15.586  42.014  10.812 1.00 93.80  ? 350  GLU A N   1 
ATOM   2712 C CA  . GLU A 1 350 ? 16.047  42.785  9.662  1.00 93.97  ? 350  GLU A CA  1 
ATOM   2713 C C   . GLU A 1 350 ? 17.562  42.713  9.581  1.00 96.42  ? 350  GLU A C   1 
ATOM   2714 O O   . GLU A 1 350 ? 18.238  42.638  10.604 1.00 94.43  ? 350  GLU A O   1 
ATOM   2715 C CB  . GLU A 1 350 ? 15.603  44.236  9.771  1.00 100.01 ? 350  GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 350 ? 14.106  44.424  9.693  1.00 107.21 ? 350  GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 350 ? 13.698  45.865  9.910  1.00 114.31 ? 350  GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 350 ? 12.669  46.285  9.335  1.00 118.89 ? 350  GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 350 ? 14.406  46.575  10.658 1.00 110.11 ? 350  GLU A OE2 1 
ATOM   2720 N N   . LYS A 1 351 ? 18.092  42.751  8.363  1.00 105.70 ? 351  LYS A N   1 
ATOM   2721 C CA  . LYS A 1 351 ? 19.514  42.504  8.141  1.00 113.97 ? 351  LYS A CA  1 
ATOM   2722 C C   . LYS A 1 351 ? 20.401  43.721  8.393  1.00 114.99 ? 351  LYS A C   1 
ATOM   2723 O O   . LYS A 1 351 ? 21.602  43.679  8.123  1.00 123.86 ? 351  LYS A O   1 
ATOM   2724 C CB  . LYS A 1 351 ? 19.752  41.969  6.724  1.00 123.42 ? 351  LYS A CB  1 
ATOM   2725 C CG  . LYS A 1 351 ? 19.175  42.845  5.620  1.00 132.40 ? 351  LYS A CG  1 
ATOM   2726 C CD  . LYS A 1 351 ? 19.448  42.262  4.242  1.00 135.45 ? 351  LYS A CD  1 
ATOM   2727 C CE  . LYS A 1 351 ? 18.914  40.844  4.127  1.00 136.57 ? 351  LYS A CE  1 
ATOM   2728 N NZ  . LYS A 1 351 ? 19.070  40.310  2.747  1.00 140.56 ? 351  LYS A NZ  1 
ATOM   2729 N N   . ILE A 1 352 ? 19.810  44.795  8.910  1.00 103.65 ? 352  ILE A N   1 
ATOM   2730 C CA  . ILE A 1 352 ? 20.551  46.022  9.194  1.00 106.55 ? 352  ILE A CA  1 
ATOM   2731 C C   . ILE A 1 352 ? 20.860  46.807  7.917  1.00 116.27 ? 352  ILE A C   1 
ATOM   2732 O O   . ILE A 1 352 ? 21.994  46.813  7.430  1.00 116.51 ? 352  ILE A O   1 
ATOM   2733 C CB  . ILE A 1 352 ? 21.870  45.740  9.945  1.00 102.60 ? 352  ILE A CB  1 
ATOM   2734 C CG1 . ILE A 1 352 ? 21.613  44.879  11.186 1.00 102.17 ? 352  ILE A CG1 1 
ATOM   2735 C CG2 . ILE A 1 352 ? 22.556  47.044  10.322 1.00 104.13 ? 352  ILE A CG2 1 
ATOM   2736 C CD1 . ILE A 1 352 ? 20.813  45.569  12.266 1.00 101.59 ? 352  ILE A CD1 1 
HETATM 2737 O O   . HOH B 2 .   ? 5.225   43.868  44.772 1.00 58.54  ? 2001 HOH A O   1 
HETATM 2738 O O   . HOH B 2 .   ? 6.860   27.917  37.943 1.00 68.02  ? 2002 HOH A O   1 
HETATM 2739 O O   . HOH B 2 .   ? 18.520  18.916  46.159 1.00 70.49  ? 2003 HOH A O   1 
HETATM 2740 O O   . HOH B 2 .   ? 15.603  31.531  32.113 1.00 54.30  ? 2004 HOH A O   1 
HETATM 2741 O O   . HOH B 2 .   ? 8.989   32.690  30.455 1.00 58.45  ? 2005 HOH A O   1 
HETATM 2742 O O   . HOH B 2 .   ? -22.117 20.398  15.500 1.00 61.38  ? 2006 HOH A O   1 
HETATM 2743 O O   . HOH B 2 .   ? -32.180 25.219  0.669  1.00 63.56  ? 2007 HOH A O   1 
HETATM 2744 O O   . HOH B 2 .   ? -28.654 20.359  4.038  1.00 62.21  ? 2008 HOH A O   1 
HETATM 2745 O O   . HOH B 2 .   ? -30.630 18.568  -1.251 1.00 53.72  ? 2009 HOH A O   1 
HETATM 2746 O O   . HOH B 2 .   ? -25.621 17.056  3.740  1.00 40.36  ? 2010 HOH A O   1 
HETATM 2747 O O   . HOH B 2 .   ? -25.456 8.144   2.485  1.00 60.06  ? 2011 HOH A O   1 
HETATM 2748 O O   . HOH B 2 .   ? -24.810 17.300  6.552  1.00 47.27  ? 2012 HOH A O   1 
HETATM 2749 O O   . HOH B 2 .   ? -17.092 14.280  19.048 1.00 66.66  ? 2013 HOH A O   1 
HETATM 2750 O O   . HOH B 2 .   ? -27.366 17.134  19.435 1.00 55.36  ? 2014 HOH A O   1 
HETATM 2751 O O   . HOH B 2 .   ? -29.646 15.124  16.942 1.00 61.25  ? 2015 HOH A O   1 
HETATM 2752 O O   . HOH B 2 .   ? -36.212 24.216  21.364 1.00 54.53  ? 2016 HOH A O   1 
HETATM 2753 O O   . HOH B 2 .   ? -17.977 16.182  11.357 1.00 63.29  ? 2017 HOH A O   1 
HETATM 2754 O O   . HOH B 2 .   ? 0.679   18.714  30.021 1.00 73.42  ? 2018 HOH A O   1 
HETATM 2755 O O   . HOH B 2 .   ? 0.592   14.109  10.324 1.00 70.65  ? 2019 HOH A O   1 
HETATM 2756 O O   . HOH B 2 .   ? 7.438   45.876  55.006 1.00 66.06  ? 2020 HOH A O   1 
HETATM 2757 O O   . HOH B 2 .   ? 14.493  31.524  54.791 1.00 54.29  ? 2021 HOH A O   1 
HETATM 2758 O O   . HOH B 2 .   ? 20.208  31.584  51.078 1.00 59.84  ? 2022 HOH A O   1 
HETATM 2759 O O   . HOH B 2 .   ? 19.003  41.858  41.699 1.00 53.16  ? 2023 HOH A O   1 
HETATM 2760 O O   . HOH B 2 .   ? 17.698  42.956  40.122 1.00 62.83  ? 2024 HOH A O   1 
HETATM 2761 O O   . HOH B 2 .   ? 18.539  46.898  37.386 1.00 49.76  ? 2025 HOH A O   1 
HETATM 2762 O O   . HOH B 2 .   ? 9.831   46.448  30.419 1.00 64.39  ? 2026 HOH A O   1 
HETATM 2763 O O   . HOH B 2 .   ? 11.461  48.479  8.070  1.00 68.69  ? 2027 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A 3   ? 1.2228 1.0266 0.9093 0.2188  -0.0152 -0.0088 3   LYS A N   
2    C CA  . LYS A 3   ? 1.1941 0.9887 0.8396 0.2432  -0.0138 -0.0036 3   LYS A CA  
3    C C   . LYS A 3   ? 1.1364 0.9045 0.7659 0.2363  -0.0080 -0.0052 3   LYS A C   
4    O O   . LYS A 3   ? 1.1803 0.9374 0.7735 0.2537  -0.0068 -0.0021 3   LYS A O   
5    C CB  . LYS A 3   ? 1.0752 0.8333 0.6857 0.2618  -0.0113 0.0076  3   LYS A CB  
6    C CG  . LYS A 3   ? 1.2055 0.9772 0.7815 0.2948  -0.0158 0.0111  3   LYS A CG  
7    C CD  . LYS A 3   ? 1.2862 1.0168 0.8253 0.3132  -0.0135 0.0220  3   LYS A CD  
8    C CE  . LYS A 3   ? 1.3201 1.0580 0.8888 0.3017  -0.0143 0.0230  3   LYS A CE  
9    N NZ  . LYS A 3   ? 1.3774 1.0664 0.9121 0.3136  -0.0102 0.0339  3   LYS A NZ  
10   N N   . LYS A 4   ? 1.0329 0.7905 0.6878 0.2113  -0.0047 -0.0110 4   LYS A N   
11   C CA  . LYS A 4   ? 0.9975 0.7348 0.6418 0.2011  0.0014  -0.0150 4   LYS A CA  
12   C C   . LYS A 4   ? 0.9801 0.7377 0.6656 0.1773  -0.0001 -0.0269 4   LYS A C   
13   O O   . LYS A 4   ? 0.9669 0.7398 0.6858 0.1660  -0.0047 -0.0309 4   LYS A O   
14   C CB  . LYS A 4   ? 1.0271 0.7090 0.6391 0.1981  0.0108  -0.0088 4   LYS A CB  
15   C CG  . LYS A 4   ? 1.2174 0.8680 0.7741 0.2220  0.0136  0.0019  4   LYS A CG  
16   C CD  . LYS A 4   ? 1.4468 1.0387 0.9656 0.2143  0.0246  0.0066  4   LYS A CD  
17   C CE  . LYS A 4   ? 1.7103 1.2632 1.1653 0.2392  0.0268  0.0174  4   LYS A CE  
18   N NZ  . LYS A 4   ? 1.8089 1.2987 1.2199 0.2309  0.0383  0.0230  4   LYS A NZ  
19   N N   . TRP A 5   ? 0.9631 0.7178 0.6429 0.1703  0.0037  -0.0327 5   TRP A N   
20   C CA  . TRP A 5   ? 0.9106 0.6836 0.6258 0.1500  0.0022  -0.0451 5   TRP A CA  
21   C C   . TRP A 5   ? 0.8790 0.6246 0.6039 0.1327  0.0074  -0.0504 5   TRP A C   
22   O O   . TRP A 5   ? 0.9562 0.6677 0.6532 0.1314  0.0160  -0.0474 5   TRP A O   
23   C CB  . TRP A 5   ? 0.9336 0.7240 0.6425 0.1502  0.0029  -0.0507 5   TRP A CB  
24   C CG  . TRP A 5   ? 0.8819 0.7123 0.5944 0.1633  -0.0041 -0.0500 5   TRP A CG  
25   C CD1 . TRP A 5   ? 0.9099 0.7453 0.5906 0.1857  -0.0052 -0.0429 5   TRP A CD1 
26   C CD2 . TRP A 5   ? 0.8501 0.7222 0.5978 0.1547  -0.0114 -0.0577 5   TRP A CD2 
27   N NE1 . TRP A 5   ? 0.9897 0.8738 0.6875 0.1916  -0.0125 -0.0469 5   TRP A NE1 
28   C CE2 . TRP A 5   ? 0.9273 0.8335 0.6653 0.1710  -0.0157 -0.0557 5   TRP A CE2 
29   C CE3 . TRP A 5   ? 0.6806 0.5625 0.4636 0.1350  -0.0148 -0.0668 5   TRP A CE3 
30   C CZ2 . TRP A 5   ? 0.8170 0.7694 0.5806 0.1648  -0.0218 -0.0630 5   TRP A CZ2 
31   C CZ3 . TRP A 5   ? 0.6459 0.5663 0.4501 0.1294  -0.0213 -0.0728 5   TRP A CZ3 
32   C CH2 . TRP A 5   ? 0.7716 0.7280 0.5666 0.1427  -0.0240 -0.0710 5   TRP A CH2 
33   N N   . TYR A 6   ? 0.7206 0.4810 0.4829 0.1192  0.0020  -0.0592 6   TYR A N   
34   C CA  . TYR A 6   ? 0.7094 0.4517 0.4856 0.1043  0.0049  -0.0674 6   TYR A CA  
35   C C   . TYR A 6   ? 0.6769 0.4430 0.4858 0.0924  -0.0010 -0.0814 6   TYR A C   
36   O O   . TYR A 6   ? 0.7531 0.5444 0.5771 0.0935  -0.0084 -0.0828 6   TYR A O   
37   C CB  . TYR A 6   ? 0.7829 0.5087 0.5669 0.1039  0.0028  -0.0627 6   TYR A CB  
38   C CG  . TYR A 6   ? 0.7138 0.4140 0.4641 0.1161  0.0087  -0.0490 6   TYR A CG  
39   C CD1 . TYR A 6   ? 0.7252 0.4359 0.4632 0.1324  0.0049  -0.0387 6   TYR A CD1 
40   C CD2 . TYR A 6   ? 0.6972 0.3632 0.4249 0.1115  0.0182  -0.0473 6   TYR A CD2 
41   C CE1 . TYR A 6   ? 0.8284 0.5139 0.5322 0.1465  0.0095  -0.0266 6   TYR A CE1 
42   C CE2 . TYR A 6   ? 0.8980 0.5350 0.5889 0.1231  0.0237  -0.0344 6   TYR A CE2 
43   C CZ  . TYR A 6   ? 0.9001 0.5458 0.5790 0.1419  0.0188  -0.0238 6   TYR A CZ  
44   O OH  . TYR A 6   ? 1.0713 0.6870 0.7117 0.1561  0.0232  -0.0115 6   TYR A OH  
45   N N   . ILE A 7   ? 0.7126 0.4711 0.5306 0.0806  0.0024  -0.0928 7   ILE A N   
46   C CA  . ILE A 7   ? 0.7979 0.5756 0.6454 0.0710  -0.0039 -0.1076 7   ILE A CA  
47   C C   . ILE A 7   ? 0.8250 0.5935 0.6936 0.0668  -0.0104 -0.1129 7   ILE A C   
48   O O   . ILE A 7   ? 0.7763 0.5258 0.6410 0.0646  -0.0062 -0.1133 7   ILE A O   
49   C CB  . ILE A 7   ? 0.7874 0.5678 0.6339 0.0616  0.0026  -0.1201 7   ILE A CB  
50   C CG1 . ILE A 7   ? 0.7932 0.5751 0.6116 0.0658  0.0099  -0.1139 7   ILE A CG1 
51   C CG2 . ILE A 7   ? 0.7400 0.5416 0.6161 0.0545  -0.0051 -0.1358 7   ILE A CG2 
52   C CD1 . ILE A 7   ? 0.6413 0.4224 0.4528 0.0544  0.0182  -0.1257 7   ILE A CD1 
53   N N   . VAL A 8   ? 0.8685 0.6489 0.7564 0.0653  -0.0207 -0.1170 8   VAL A N   
54   C CA  . VAL A 8   ? 0.8429 0.6116 0.7477 0.0621  -0.0287 -0.1233 8   VAL A CA  
55   C C   . VAL A 8   ? 0.8764 0.6540 0.7995 0.0560  -0.0340 -0.1412 8   VAL A C   
56   O O   . VAL A 8   ? 0.9572 0.7521 0.8847 0.0537  -0.0365 -0.1460 8   VAL A O   
57   C CB  . VAL A 8   ? 0.7929 0.5619 0.7005 0.0634  -0.0370 -0.1163 8   VAL A CB  
58   C CG1 . VAL A 8   ? 0.6655 0.4189 0.5872 0.0594  -0.0469 -0.1250 8   VAL A CG1 
59   C CG2 . VAL A 8   ? 0.7206 0.4825 0.6119 0.0708  -0.0326 -0.1002 8   VAL A CG2 
60   N N   . LEU A 9   ? 0.8633 0.6307 0.7967 0.0543  -0.0358 -0.1519 9   LEU A N   
61   C CA  . LEU A 9   ? 0.8369 0.6133 0.7876 0.0514  -0.0419 -0.1713 9   LEU A CA  
62   C C   . LEU A 9   ? 0.8192 0.5856 0.7796 0.0535  -0.0562 -0.1768 9   LEU A C   
63   O O   . LEU A 9   ? 1.0272 0.7744 0.9851 0.0561  -0.0613 -0.1707 9   LEU A O   
64   C CB  . LEU A 9   ? 0.8743 0.6494 0.8305 0.0494  -0.0373 -0.1832 9   LEU A CB  
65   C CG  . LEU A 9   ? 0.9228 0.7003 0.8622 0.0442  -0.0219 -0.1782 9   LEU A CG  
66   C CD1 . LEU A 9   ? 0.9409 0.7180 0.8843 0.0389  -0.0165 -0.1910 9   LEU A CD1 
67   C CD2 . LEU A 9   ? 0.8354 0.6314 0.7710 0.0400  -0.0170 -0.1821 9   LEU A CD2 
68   N N   . THR A 10  ? 0.7618 0.5383 0.7297 0.0518  -0.0625 -0.1885 10  THR A N   
69   C CA  . THR A 10  ? 0.7129 0.4745 0.6837 0.0533  -0.0764 -0.1960 10  THR A CA  
70   C C   . THR A 10  ? 0.8344 0.6055 0.8175 0.0554  -0.0818 -0.2171 10  THR A C   
71   O O   . THR A 10  ? 0.8054 0.5973 0.7963 0.0540  -0.0740 -0.2251 10  THR A O   
72   C CB  . THR A 10  ? 0.8475 0.6111 0.8088 0.0477  -0.0790 -0.1878 10  THR A CB  
73   O OG1 . THR A 10  ? 1.0756 0.8582 1.0415 0.0444  -0.0786 -0.1973 10  THR A OG1 
74   C CG2 . THR A 10  ? 0.8304 0.6036 0.7818 0.0461  -0.0697 -0.1693 10  THR A CG2 
75   N N   . MET A 11  ? 0.8666 0.6211 0.8488 0.0587  -0.0953 -0.2268 11  MET A N   
76   C CA  . MET A 11  ? 0.8174 0.5811 0.8089 0.0626  -0.1016 -0.2473 11  MET A CA  
77   C C   . MET A 11  ? 0.9497 0.7319 0.9396 0.0550  -0.0972 -0.2461 11  MET A C   
78   O O   . MET A 11  ? 0.9062 0.6841 0.8844 0.0482  -0.0959 -0.2328 11  MET A O   
79   C CB  . MET A 11  ? 0.9629 0.6965 0.9478 0.0710  -0.1186 -0.2584 11  MET A CB  
80   C CG  . MET A 11  ? 1.0152 0.7305 1.0012 0.0802  -0.1246 -0.2611 11  MET A CG  
81   S SD  . MET A 11  ? 1.2715 0.9552 1.2495 0.0957  -0.1460 -0.2812 11  MET A SD  
82   C CE  . MET A 11  ? 1.1327 0.7739 1.0803 0.0875  -0.1537 -0.2676 11  MET A CE  
83   N N   . SER A 12  ? 0.9785 0.7840 0.9802 0.0553  -0.0944 -0.2608 12  SER A N   
84   C CA  . SER A 12  ? 1.0119 0.8350 1.0125 0.0484  -0.0909 -0.2613 12  SER A CA  
85   C C   . SER A 12  ? 1.0424 0.8438 1.0300 0.0465  -0.1017 -0.2604 12  SER A C   
86   O O   . SER A 12  ? 1.0955 0.8727 1.0787 0.0535  -0.1146 -0.2719 12  SER A O   
87   C CB  . SER A 12  ? 1.1082 0.9553 1.1232 0.0497  -0.0895 -0.2813 12  SER A CB  
88   O OG  . SER A 12  ? 1.1439 1.0134 1.1644 0.0449  -0.0757 -0.2798 12  SER A OG  
89   N N   . GLY A 13  ? 0.9288 0.7376 0.9070 0.0370  -0.0965 -0.2472 13  GLY A N   
90   C CA  . GLY A 13  ? 0.9115 0.7024 0.8741 0.0305  -0.1041 -0.2461 13  GLY A CA  
91   C C   . GLY A 13  ? 0.9182 0.6807 0.8645 0.0275  -0.1088 -0.2348 13  GLY A C   
92   O O   . GLY A 13  ? 0.8689 0.6097 0.7976 0.0204  -0.1159 -0.2361 13  GLY A O   
93   N N   . TYR A 14  ? 1.0380 0.7991 0.9876 0.0313  -0.1044 -0.2241 14  TYR A N   
94   C CA  . TYR A 14  ? 1.0526 0.7888 0.9875 0.0277  -0.1079 -0.2130 14  TYR A CA  
95   C C   . TYR A 14  ? 0.9956 0.7534 0.9292 0.0225  -0.0972 -0.1955 14  TYR A C   
96   O O   . TYR A 14  ? 1.0506 0.7946 0.9741 0.0193  -0.0981 -0.1856 14  TYR A O   
97   C CB  . TYR A 14  ? 1.1541 0.8651 1.0914 0.0382  -0.1142 -0.2162 14  TYR A CB  
98   C CG  . TYR A 14  ? 1.3145 0.9952 1.2447 0.0451  -0.1286 -0.2326 14  TYR A CG  
99   C CD1 . TYR A 14  ? 1.3699 1.0089 1.2768 0.0427  -0.1394 -0.2318 14  TYR A CD1 
100  C CD2 . TYR A 14  ? 1.3330 1.0254 1.2768 0.0546  -0.1318 -0.2499 14  TYR A CD2 
101  C CE1 . TYR A 14  ? 1.3929 0.9982 1.2872 0.0518  -0.1539 -0.2472 14  TYR A CE1 
102  C CE2 . TYR A 14  ? 1.3338 0.9988 1.2692 0.0646  -0.1464 -0.2664 14  TYR A CE2 
103  C CZ  . TYR A 14  ? 1.3755 0.9948 1.2846 0.0642  -0.1579 -0.2646 14  TYR A CZ  
104  O OH  . TYR A 14  ? 1.4292 1.0157 1.3242 0.0767  -0.1737 -0.2812 14  TYR A OH  
105  N N   . GLU A 15  ? 0.8089 0.6000 0.7509 0.0228  -0.0875 -0.1926 15  GLU A N   
106  C CA  . GLU A 15  ? 0.8725 0.6857 0.8119 0.0228  -0.0777 -0.1775 15  GLU A CA  
107  C C   . GLU A 15  ? 0.8695 0.6848 0.7960 0.0136  -0.0790 -0.1693 15  GLU A C   
108  O O   . GLU A 15  ? 0.8222 0.6391 0.7440 0.0155  -0.0758 -0.1578 15  GLU A O   
109  C CB  . GLU A 15  ? 0.7508 0.5961 0.6951 0.0236  -0.0693 -0.1780 15  GLU A CB  
110  C CG  . GLU A 15  ? 0.7899 0.6370 0.7456 0.0285  -0.0670 -0.1889 15  GLU A CG  
111  C CD  . GLU A 15  ? 0.8131 0.6527 0.7755 0.0261  -0.0755 -0.2062 15  GLU A CD  
112  O OE1 . GLU A 15  ? 0.7826 0.6139 0.7374 0.0195  -0.0824 -0.2089 15  GLU A OE1 
113  O OE2 . GLU A 15  ? 0.8046 0.6463 0.7778 0.0304  -0.0753 -0.2181 15  GLU A OE2 
114  N N   . GLU A 16  ? 0.9570 0.7730 0.8765 0.0027  -0.0834 -0.1765 16  GLU A N   
115  C CA  . GLU A 16  ? 0.9336 0.7586 0.8397 -0.0100 -0.0831 -0.1716 16  GLU A CA  
116  C C   . GLU A 16  ? 0.8433 0.6365 0.7374 -0.0144 -0.0885 -0.1677 16  GLU A C   
117  O O   . GLU A 16  ? 0.8435 0.6487 0.7298 -0.0211 -0.0854 -0.1599 16  GLU A O   
118  C CB  . GLU A 16  ? 1.0080 0.8356 0.9058 -0.0233 -0.0863 -0.1819 16  GLU A CB  
119  C CG  . GLU A 16  ? 1.2351 1.0941 1.1237 -0.0371 -0.0815 -0.1784 16  GLU A CG  
120  C CD  . GLU A 16  ? 1.3784 1.2855 1.2787 -0.0292 -0.0727 -0.1728 16  GLU A CD  
121  O OE1 . GLU A 16  ? 1.4184 1.3393 1.3269 -0.0258 -0.0707 -0.1782 16  GLU A OE1 
122  O OE2 . GLU A 16  ? 1.3554 1.2853 1.2548 -0.0255 -0.0681 -0.1634 16  GLU A OE2 
123  N N   . LYS A 17  ? 0.9278 0.6818 0.8194 -0.0101 -0.0969 -0.1743 17  LYS A N   
124  C CA  . LYS A 17  ? 1.0616 0.7796 0.9391 -0.0136 -0.1032 -0.1712 17  LYS A CA  
125  C C   . LYS A 17  ? 0.8716 0.5979 0.7575 -0.0051 -0.0975 -0.1586 17  LYS A C   
126  O O   . LYS A 17  ? 0.7954 0.5145 0.6706 -0.0120 -0.0974 -0.1514 17  LYS A O   
127  C CB  . LYS A 17  ? 1.2137 0.8876 1.0852 -0.0071 -0.1148 -0.1822 17  LYS A CB  
128  C CG  . LYS A 17  ? 1.4139 1.0630 1.2646 -0.0174 -0.1229 -0.1937 17  LYS A CG  
129  C CD  . LYS A 17  ? 1.5579 1.1627 1.4002 -0.0062 -0.1361 -0.2059 17  LYS A CD  
130  C CE  . LYS A 17  ? 1.6488 1.2221 1.4634 -0.0157 -0.1446 -0.2170 17  LYS A CE  
131  N NZ  . LYS A 17  ? 1.6998 1.2308 1.5039 -0.0005 -0.1589 -0.2309 17  LYS A NZ  
132  N N   . VAL A 18  ? 0.8033 0.5440 0.7061 0.0087  -0.0924 -0.1568 18  VAL A N   
133  C CA  . VAL A 18  ? 0.8518 0.5980 0.7597 0.0174  -0.0861 -0.1450 18  VAL A CA  
134  C C   . VAL A 18  ? 0.8840 0.6612 0.7872 0.0148  -0.0785 -0.1338 18  VAL A C   
135  O O   . VAL A 18  ? 1.0290 0.8034 0.9282 0.0170  -0.0765 -0.1242 18  VAL A O   
136  C CB  . VAL A 18  ? 0.7400 0.4939 0.6614 0.0297  -0.0808 -0.1466 18  VAL A CB  
137  C CG1 . VAL A 18  ? 0.7779 0.5356 0.6987 0.0373  -0.0731 -0.1338 18  VAL A CG1 
138  C CG2 . VAL A 18  ? 0.7925 0.5207 0.7202 0.0343  -0.0885 -0.1590 18  VAL A CG2 
139  N N   . LYS A 19  ? 0.8023 0.6110 0.7059 0.0108  -0.0749 -0.1360 19  LYS A N   
140  C CA  . LYS A 19  ? 0.8745 0.7183 0.7737 0.0105  -0.0689 -0.1280 19  LYS A CA  
141  C C   . LYS A 19  ? 0.8395 0.6808 0.7272 -0.0040 -0.0721 -0.1276 19  LYS A C   
142  O O   . LYS A 19  ? 0.7921 0.6490 0.6762 -0.0021 -0.0688 -0.1197 19  LYS A O   
143  C CB  . LYS A 19  ? 0.8048 0.6846 0.7066 0.0095  -0.0651 -0.1321 19  LYS A CB  
144  C CG  . LYS A 19  ? 0.7241 0.6456 0.6209 0.0111  -0.0601 -0.1263 19  LYS A CG  
145  C CD  . LYS A 19  ? 0.8641 0.8214 0.7632 0.0128  -0.0566 -0.1304 19  LYS A CD  
146  C CE  . LYS A 19  ? 0.9502 0.9528 0.8438 0.0167  -0.0530 -0.1264 19  LYS A CE  
147  N NZ  . LYS A 19  ? 0.8995 0.9402 0.7942 0.0179  -0.0505 -0.1313 19  LYS A NZ  
148  N N   . GLU A 20  ? 0.8200 0.6404 0.6992 -0.0190 -0.0784 -0.1369 20  GLU A N   
149  C CA  . GLU A 20  ? 0.9610 0.7710 0.8233 -0.0371 -0.0814 -0.1383 20  GLU A CA  
150  C C   . GLU A 20  ? 0.8848 0.6644 0.7430 -0.0338 -0.0840 -0.1313 20  GLU A C   
151  O O   . GLU A 20  ? 0.8871 0.6799 0.7396 -0.0394 -0.0811 -0.1258 20  GLU A O   
152  C CB  . GLU A 20  ? 1.2186 0.9987 1.0658 -0.0527 -0.0884 -0.1499 20  GLU A CB  
153  C CG  . GLU A 20  ? 1.5080 1.2311 1.3395 -0.0566 -0.0974 -0.1521 20  GLU A CG  
154  C CD  . GLU A 20  ? 1.6871 1.3727 1.5020 -0.0642 -0.1060 -0.1641 20  GLU A CD  
155  O OE1 . GLU A 20  ? 1.6992 1.3342 1.4973 -0.0646 -0.1150 -0.1672 20  GLU A OE1 
156  O OE2 . GLU A 20  ? 1.7428 1.4481 1.5595 -0.0686 -0.1041 -0.1708 20  GLU A OE2 
157  N N   . ASN A 21  ? 0.8301 0.5722 0.6921 -0.0241 -0.0894 -0.1326 21  ASN A N   
158  C CA  . ASN A 21  ? 0.9309 0.6419 0.7890 -0.0207 -0.0926 -0.1268 21  ASN A CA  
159  C C   . ASN A 21  ? 1.0307 0.7676 0.8965 -0.0117 -0.0848 -0.1147 21  ASN A C   
160  O O   . ASN A 21  ? 1.1040 0.8353 0.9613 -0.0179 -0.0847 -0.1094 21  ASN A O   
161  C CB  . ASN A 21  ? 0.9160 0.5946 0.7817 -0.0077 -0.0985 -0.1312 21  ASN A CB  
162  C CG  . ASN A 21  ? 0.8998 0.5421 0.7518 -0.0143 -0.1091 -0.1434 21  ASN A CG  
163  O OD1 . ASN A 21  ? 0.7551 0.3831 0.5859 -0.0309 -0.1125 -0.1465 21  ASN A OD1 
164  N ND2 . ASN A 21  ? 0.9395 0.5657 0.8007 -0.0015 -0.1144 -0.1515 21  ASN A ND2 
165  N N   . ILE A 22  ? 0.9044 0.6676 0.7833 0.0029  -0.0783 -0.1109 22  ILE A N   
166  C CA  . ILE A 22  ? 0.8245 0.6075 0.7061 0.0148  -0.0713 -0.0996 22  ILE A CA  
167  C C   . ILE A 22  ? 0.8758 0.6921 0.7502 0.0073  -0.0685 -0.0971 22  ILE A C   
168  O O   . ILE A 22  ? 0.8717 0.6914 0.7426 0.0103  -0.0665 -0.0897 22  ILE A O   
169  C CB  . ILE A 22  ? 0.7637 0.5667 0.6527 0.0296  -0.0649 -0.0972 22  ILE A CB  
170  C CG1 . ILE A 22  ? 0.8136 0.5877 0.7097 0.0372  -0.0656 -0.0995 22  ILE A CG1 
171  C CG2 . ILE A 22  ? 0.7133 0.5391 0.5976 0.0420  -0.0583 -0.0864 22  ILE A CG2 
172  C CD1 . ILE A 22  ? 0.7229 0.5130 0.6237 0.0458  -0.0598 -0.1016 22  ILE A CD1 
173  N N   . GLU A 23  ? 0.9122 0.7558 0.7847 -0.0029 -0.0682 -0.1045 23  GLU A N   
174  C CA  . GLU A 23  ? 0.9335 0.8176 0.8001 -0.0119 -0.0652 -0.1055 23  GLU A CA  
175  C C   . GLU A 23  ? 0.9538 0.8194 0.8081 -0.0306 -0.0684 -0.1071 23  GLU A C   
176  O O   . GLU A 23  ? 0.9292 0.8218 0.7799 -0.0337 -0.0653 -0.1049 23  GLU A O   
177  C CB  . GLU A 23  ? 0.8923 0.8078 0.7587 -0.0217 -0.0643 -0.1149 23  GLU A CB  
178  C CG  . GLU A 23  ? 0.9544 0.8947 0.8304 -0.0040 -0.0605 -0.1133 23  GLU A CG  
179  C CD  . GLU A 23  ? 1.0956 1.0659 0.9717 -0.0146 -0.0599 -0.1230 23  GLU A CD  
180  O OE1 . GLU A 23  ? 1.0191 0.9817 0.8870 -0.0365 -0.0628 -0.1315 23  GLU A OE1 
181  O OE2 . GLU A 23  ? 1.1275 1.1265 1.0090 -0.0015 -0.0565 -0.1222 23  GLU A OE2 
182  N N   . LYS A 24  ? 0.9318 0.7506 0.7773 -0.0426 -0.0748 -0.1120 24  LYS A N   
183  C CA  . LYS A 24  ? 0.9528 0.7438 0.7806 -0.0617 -0.0785 -0.1138 24  LYS A CA  
184  C C   . LYS A 24  ? 0.9163 0.6907 0.7471 -0.0512 -0.0782 -0.1038 24  LYS A C   
185  O O   . LYS A 24  ? 0.9254 0.7120 0.7489 -0.0604 -0.0759 -0.1016 24  LYS A O   
186  C CB  . LYS A 24  ? 0.9747 0.7127 0.7870 -0.0735 -0.0869 -0.1216 24  LYS A CB  
187  C CG  . LYS A 24  ? 1.0909 0.8381 0.9009 -0.0802 -0.0877 -0.1312 24  LYS A CG  
188  C CD  . LYS A 24  ? 1.1895 0.8858 0.9727 -0.0982 -0.0958 -0.1404 24  LYS A CD  
189  C CE  . LYS A 24  ? 1.2935 1.0043 1.0535 -0.1273 -0.0925 -0.1473 24  LYS A CE  
190  N NZ  . LYS A 24  ? 1.4700 1.1236 1.1954 -0.1464 -0.1001 -0.1561 24  LYS A NZ  
191  N N   . LYS A 25  ? 0.8408 0.5893 0.6821 -0.0331 -0.0801 -0.0987 25  LYS A N   
192  C CA  . LYS A 25  ? 0.8726 0.6038 0.7168 -0.0229 -0.0795 -0.0891 25  LYS A CA  
193  C C   . LYS A 25  ? 0.9318 0.7048 0.7792 -0.0165 -0.0722 -0.0819 25  LYS A C   
194  O O   . LYS A 25  ? 1.0509 0.8178 0.8928 -0.0201 -0.0718 -0.0772 25  LYS A O   
195  C CB  . LYS A 25  ? 0.7857 0.4963 0.6424 -0.0039 -0.0800 -0.0858 25  LYS A CB  
196  C CG  . LYS A 25  ? 0.7557 0.4456 0.6139 0.0055  -0.0790 -0.0765 25  LYS A CG  
197  C CD  . LYS A 25  ? 0.8123 0.4735 0.6789 0.0172  -0.0814 -0.0776 25  LYS A CD  
198  C CE  . LYS A 25  ? 0.8273 0.4729 0.6956 0.0264  -0.0787 -0.0682 25  LYS A CE  
199  N NZ  . LYS A 25  ? 0.8551 0.4785 0.7317 0.0361  -0.0802 -0.0713 25  LYS A NZ  
200  N N   . VAL A 26  ? 0.7843 0.5997 0.6390 -0.0061 -0.0671 -0.0819 26  VAL A N   
201  C CA  . VAL A 26  ? 0.8324 0.6910 0.6879 0.0038  -0.0615 -0.0770 26  VAL A CA  
202  C C   . VAL A 26  ? 0.9687 0.8508 0.8156 -0.0159 -0.0614 -0.0826 26  VAL A C   
203  O O   . VAL A 26  ? 1.0821 0.9849 0.9277 -0.0110 -0.0587 -0.0786 26  VAL A O   
204  C CB  . VAL A 26  ? 0.7890 0.6895 0.6496 0.0166  -0.0577 -0.0789 26  VAL A CB  
205  C CG1 . VAL A 26  ? 0.6742 0.6242 0.5323 0.0270  -0.0538 -0.0769 26  VAL A CG1 
206  C CG2 . VAL A 26  ? 0.5596 0.4391 0.4251 0.0355  -0.0561 -0.0731 26  VAL A CG2 
207  N N   . GLU A 27  ? 0.8299 0.7086 0.6689 -0.0389 -0.0640 -0.0928 27  GLU A N   
208  C CA  . GLU A 27  ? 0.9535 0.8552 0.7804 -0.0632 -0.0628 -0.1008 27  GLU A CA  
209  C C   . GLU A 27  ? 0.9394 0.7983 0.7527 -0.0785 -0.0658 -0.0988 27  GLU A C   
210  O O   . GLU A 27  ? 0.8901 0.7706 0.6977 -0.0884 -0.0629 -0.0999 27  GLU A O   
211  C CB  . GLU A 27  ? 1.1802 1.0891 0.9982 -0.0847 -0.0637 -0.1127 27  GLU A CB  
212  C CG  . GLU A 27  ? 1.3941 1.3245 1.1950 -0.1151 -0.0612 -0.1229 27  GLU A CG  
213  C CD  . GLU A 27  ? 1.5574 1.5591 1.3670 -0.1100 -0.0551 -0.1256 27  GLU A CD  
214  O OE1 . GLU A 27  ? 1.5669 1.6060 1.3927 -0.0843 -0.0532 -0.1221 27  GLU A OE1 
215  O OE2 . GLU A 27  ? 1.6261 1.6462 1.4243 -0.1313 -0.0524 -0.1321 27  GLU A OE2 
216  N N   . ALA A 28  ? 0.9833 0.7826 0.7905 -0.0799 -0.0721 -0.0970 28  ALA A N   
217  C CA  . ALA A 28  ? 1.0410 0.7921 0.8314 -0.0941 -0.0765 -0.0957 28  ALA A CA  
218  C C   . ALA A 28  ? 1.1047 0.8495 0.9043 -0.0778 -0.0751 -0.0845 28  ALA A C   
219  O O   . ALA A 28  ? 1.2411 0.9473 1.0287 -0.0865 -0.0785 -0.0820 28  ALA A O   
220  C CB  . ALA A 28  ? 1.0238 0.7146 0.8035 -0.0965 -0.0851 -0.0986 28  ALA A CB  
221  N N   . THR A 29  ? 0.9888 0.7690 0.8066 -0.0542 -0.0701 -0.0779 29  THR A N   
222  C CA  . THR A 29  ? 0.8693 0.6355 0.6950 -0.0346 -0.0687 -0.0666 29  THR A CA  
223  C C   . THR A 29  ? 0.9569 0.7727 0.7877 -0.0231 -0.0623 -0.0626 29  THR A C   
224  O O   . THR A 29  ? 0.9969 0.8050 0.8278 -0.0145 -0.0608 -0.0547 29  THR A O   
225  C CB  . THR A 29  ? 0.9407 0.6881 0.7781 -0.0138 -0.0694 -0.0621 29  THR A CB  
226  O OG1 . THR A 29  ? 0.8964 0.5967 0.7335 -0.0091 -0.0729 -0.0566 29  THR A OG1 
227  C CG2 . THR A 29  ? 0.9171 0.7017 0.7636 0.0091  -0.0628 -0.0560 29  THR A CG2 
228  N N   . GLY A 30  ? 0.9070 0.7743 0.7408 -0.0219 -0.0591 -0.0689 30  GLY A N   
229  C CA  . GLY A 30  ? 0.8679 0.7882 0.7047 -0.0090 -0.0545 -0.0681 30  GLY A CA  
230  C C   . GLY A 30  ? 0.9096 0.8327 0.7518 0.0235  -0.0520 -0.0577 30  GLY A C   
231  O O   . GLY A 30  ? 0.9399 0.9013 0.7811 0.0401  -0.0492 -0.0561 30  GLY A O   
232  N N   . ILE A 31  ? 0.8859 0.7675 0.7307 0.0326  -0.0531 -0.0516 31  ILE A N   
233  C CA  . ILE A 31  ? 0.9961 0.8753 0.8404 0.0600  -0.0497 -0.0427 31  ILE A CA  
234  C C   . ILE A 31  ? 1.0502 0.9627 0.8960 0.0683  -0.0486 -0.0478 31  ILE A C   
235  O O   . ILE A 31  ? 1.0743 0.9731 0.9249 0.0610  -0.0501 -0.0520 31  ILE A O   
236  C CB  . ILE A 31  ? 1.0041 0.8288 0.8496 0.0641  -0.0501 -0.0357 31  ILE A CB  
237  C CG1 . ILE A 31  ? 1.0185 0.8106 0.8625 0.0546  -0.0521 -0.0316 31  ILE A CG1 
238  C CG2 . ILE A 31  ? 1.0381 0.8575 0.8768 0.0890  -0.0452 -0.0268 31  ILE A CG2 
239  C CD1 . ILE A 31  ? 0.9325 0.6737 0.7797 0.0521  -0.0546 -0.0293 31  ILE A CD1 
240  N N   . LYS A 32  ? 1.0835 1.0411 0.9246 0.0843  -0.0466 -0.0483 32  LYS A N   
241  C CA  . LYS A 32  ? 1.2697 1.2672 1.1113 0.0911  -0.0462 -0.0548 32  LYS A CA  
242  C C   . LYS A 32  ? 1.2513 1.2512 1.0808 0.1223  -0.0438 -0.0471 32  LYS A C   
243  O O   . LYS A 32  ? 1.2579 1.2912 1.0839 0.1335  -0.0438 -0.0513 32  LYS A O   
244  C CB  . LYS A 32  ? 1.3603 1.4176 1.2043 0.0812  -0.0469 -0.0663 32  LYS A CB  
245  C CG  . LYS A 32  ? 1.4988 1.5954 1.3360 0.1033  -0.0460 -0.0651 32  LYS A CG  
246  C CD  . LYS A 32  ? 1.5402 1.6040 1.3725 0.1091  -0.0453 -0.0554 32  LYS A CD  
247  C CE  . LYS A 32  ? 1.5877 1.6877 1.4104 0.1359  -0.0450 -0.0541 32  LYS A CE  
248  N NZ  . LYS A 32  ? 1.6347 1.7091 1.4533 0.1381  -0.0442 -0.0465 32  LYS A NZ  
249  N N   . ASN A 33  ? 1.1982 1.1595 1.0182 0.1356  -0.0417 -0.0360 33  ASN A N   
250  C CA  . ASN A 33  ? 1.0823 1.0353 0.8825 0.1645  -0.0391 -0.0277 33  ASN A CA  
251  C C   . ASN A 33  ? 0.9163 0.8225 0.7099 0.1664  -0.0358 -0.0219 33  ASN A C   
252  O O   . ASN A 33  ? 0.8757 0.7659 0.6475 0.1871  -0.0327 -0.0150 33  ASN A O   
253  C CB  . ASN A 33  ? 1.0641 1.0054 0.8521 0.1789  -0.0380 -0.0194 33  ASN A CB  
254  C CG  . ASN A 33  ? 1.1545 1.0562 0.9518 0.1608  -0.0374 -0.0152 33  ASN A CG  
255  O OD1 . ASN A 33  ? 1.3209 1.2363 1.1320 0.1412  -0.0400 -0.0210 33  ASN A OD1 
256  N ND2 . ASN A 33  ? 1.0163 0.8682 0.8037 0.1666  -0.0339 -0.0057 33  ASN A ND2 
257  N N   . LEU A 34  ? 0.8273 0.7103 0.6370 0.1448  -0.0365 -0.0255 34  LEU A N   
258  C CA  . LEU A 34  ? 0.8460 0.6880 0.6520 0.1443  -0.0331 -0.0224 34  LEU A CA  
259  C C   . LEU A 34  ? 0.9729 0.8294 0.7814 0.1427  -0.0329 -0.0290 34  LEU A C   
260  O O   . LEU A 34  ? 1.0097 0.8546 0.8016 0.1556  -0.0288 -0.0255 34  LEU A O   
261  C CB  . LEU A 34  ? 0.6667 0.4754 0.4879 0.1253  -0.0349 -0.0241 34  LEU A CB  
262  C CG  . LEU A 34  ? 0.8737 0.6613 0.6934 0.1241  -0.0350 -0.0175 34  LEU A CG  
263  C CD1 . LEU A 34  ? 0.9203 0.6742 0.7534 0.1071  -0.0378 -0.0206 34  LEU A CD1 
264  C CD2 . LEU A 34  ? 0.8438 0.6108 0.6417 0.1437  -0.0292 -0.0065 34  LEU A CD2 
265  N N   . VAL A 35  ? 0.9506 0.8300 0.7770 0.1256  -0.0371 -0.0389 35  VAL A N   
266  C CA  . VAL A 35  ? 0.9044 0.7958 0.7360 0.1210  -0.0372 -0.0461 35  VAL A CA  
267  C C   . VAL A 35  ? 0.9338 0.8752 0.7620 0.1283  -0.0384 -0.0506 35  VAL A C   
268  O O   . VAL A 35  ? 0.9752 0.9495 0.8087 0.1229  -0.0411 -0.0548 35  VAL A O   
269  C CB  . VAL A 35  ? 0.8333 0.7145 0.6833 0.0981  -0.0413 -0.0552 35  VAL A CB  
270  C CG1 . VAL A 35  ? 0.9064 0.7962 0.7613 0.0945  -0.0410 -0.0626 35  VAL A CG1 
271  C CG2 . VAL A 35  ? 0.6983 0.5346 0.5523 0.0926  -0.0417 -0.0523 35  VAL A CG2 
272  N N   . GLY A 36  ? 0.8253 0.7731 0.6434 0.1400  -0.0361 -0.0506 36  GLY A N   
273  C CA  . GLY A 36  ? 0.8765 0.8722 0.6920 0.1472  -0.0377 -0.0562 36  GLY A CA  
274  C C   . GLY A 36  ? 0.8918 0.8998 0.7224 0.1296  -0.0388 -0.0662 36  GLY A C   
275  O O   . GLY A 36  ? 0.9332 0.9408 0.7800 0.1079  -0.0415 -0.0729 36  GLY A O   
276  N N   . ARG A 37  ? 0.8475 0.8622 0.6694 0.1391  -0.0370 -0.0671 37  ARG A N   
277  C CA  . ARG A 37  ? 0.7625 0.7915 0.5971 0.1246  -0.0378 -0.0765 37  ARG A CA  
278  C C   . ARG A 37  ? 0.7913 0.7792 0.6353 0.1110  -0.0364 -0.0784 37  ARG A C   
279  O O   . ARG A 37  ? 0.7705 0.7211 0.6061 0.1172  -0.0331 -0.0721 37  ARG A O   
280  C CB  . ARG A 37  ? 0.8582 0.9124 0.6791 0.1403  -0.0365 -0.0773 37  ARG A CB  
281  C CG  . ARG A 37  ? 0.8670 0.9763 0.6848 0.1504  -0.0396 -0.0813 37  ARG A CG  
282  C CD  . ARG A 37  ? 0.8159 0.9441 0.6143 0.1723  -0.0393 -0.0805 37  ARG A CD  
283  N NE  . ARG A 37  ? 0.8719 0.9587 0.6422 0.1940  -0.0365 -0.0691 37  ARG A NE  
284  C CZ  . ARG A 37  ? 1.0484 1.1368 0.7911 0.2173  -0.0365 -0.0658 37  ARG A CZ  
285  N NH1 . ARG A 37  ? 1.1344 1.2683 0.8775 0.2233  -0.0395 -0.0733 37  ARG A NH1 
286  N NH2 . ARG A 37  ? 1.0529 1.0953 0.7645 0.2342  -0.0334 -0.0554 37  ARG A NH2 
287  N N   . ILE A 38  ? 0.7160 0.7122 0.5759 0.0925  -0.0391 -0.0884 38  ILE A N   
288  C CA  . ILE A 38  ? 0.7483 0.7123 0.6184 0.0809  -0.0394 -0.0934 38  ILE A CA  
289  C C   . ILE A 38  ? 0.8537 0.8363 0.7299 0.0737  -0.0395 -0.1025 38  ILE A C   
290  O O   . ILE A 38  ? 0.8702 0.8816 0.7522 0.0633  -0.0423 -0.1092 38  ILE A O   
291  C CB  . ILE A 38  ? 0.7265 0.6705 0.6082 0.0644  -0.0444 -0.0977 38  ILE A CB  
292  C CG1 . ILE A 38  ? 0.7550 0.6828 0.6314 0.0699  -0.0445 -0.0888 38  ILE A CG1 
293  C CG2 . ILE A 38  ? 0.6285 0.5412 0.5197 0.0567  -0.0460 -0.1045 38  ILE A CG2 
294  C CD1 . ILE A 38  ? 0.6801 0.5908 0.5630 0.0539  -0.0499 -0.0925 38  ILE A CD1 
295  N N   . VAL A 39  ? 0.7213 0.6873 0.5952 0.0775  -0.0359 -0.1035 39  VAL A N   
296  C CA  . VAL A 39  ? 0.7545 0.7378 0.6322 0.0729  -0.0351 -0.1114 39  VAL A CA  
297  C C   . VAL A 39  ? 0.7940 0.7539 0.6844 0.0618  -0.0356 -0.1207 39  VAL A C   
298  O O   . VAL A 39  ? 0.7658 0.6971 0.6551 0.0642  -0.0330 -0.1197 39  VAL A O   
299  C CB  . VAL A 39  ? 0.7398 0.7327 0.5985 0.0890  -0.0297 -0.1057 39  VAL A CB  
300  C CG1 . VAL A 39  ? 0.7052 0.7101 0.5677 0.0831  -0.0282 -0.1140 39  VAL A CG1 
301  C CG2 . VAL A 39  ? 0.7458 0.7711 0.5930 0.1020  -0.0310 -0.1002 39  VAL A CG2 
302  N N   . ILE A 40  ? 0.6209 0.5952 0.5221 0.0498  -0.0390 -0.1310 40  ILE A N   
303  C CA  . ILE A 40  ? 0.6314 0.5904 0.5440 0.0414  -0.0404 -0.1420 40  ILE A CA  
304  C C   . ILE A 40  ? 0.7688 0.7513 0.6808 0.0407  -0.0371 -0.1472 40  ILE A C   
305  O O   . ILE A 40  ? 0.6414 0.6460 0.5577 0.0323  -0.0398 -0.1531 40  ILE A O   
306  C CB  . ILE A 40  ? 0.5491 0.4958 0.4711 0.0285  -0.0484 -0.1502 40  ILE A CB  
307  C CG1 . ILE A 40  ? 0.8058 0.7259 0.7262 0.0303  -0.0514 -0.1445 40  ILE A CG1 
308  C CG2 . ILE A 40  ? 0.5821 0.5157 0.5147 0.0228  -0.0513 -0.1635 40  ILE A CG2 
309  C CD1 . ILE A 40  ? 0.6970 0.5969 0.6194 0.0185  -0.0598 -0.1513 40  ILE A CD1 
310  N N   . PRO A 41  ? 0.8611 0.8374 0.7649 0.0482  -0.0306 -0.1450 41  PRO A N   
311  C CA  . PRO A 41  ? 0.7792 0.7754 0.6766 0.0496  -0.0264 -0.1475 41  PRO A CA  
312  C C   . PRO A 41  ? 0.7002 0.7071 0.6135 0.0368  -0.0295 -0.1611 41  PRO A C   
313  O O   . PRO A 41  ? 0.7248 0.7157 0.6484 0.0312  -0.0299 -0.1706 41  PRO A O   
314  C CB  . PRO A 41  ? 0.8284 0.8022 0.7131 0.0546  -0.0190 -0.1454 41  PRO A CB  
315  C CG  . PRO A 41  ? 0.8753 0.8249 0.7528 0.0612  -0.0185 -0.1364 41  PRO A CG  
316  C CD  . PRO A 41  ? 0.8191 0.7665 0.7157 0.0541  -0.0263 -0.1403 41  PRO A CD  
317  N N   . GLU A 42  ? 0.7132 0.7487 0.6279 0.0326  -0.0318 -0.1631 42  GLU A N   
318  C CA  . GLU A 42  ? 0.8049 0.8500 0.7311 0.0206  -0.0342 -0.1755 42  GLU A CA  
319  C C   . GLU A 42  ? 0.7700 0.8414 0.6901 0.0228  -0.0296 -0.1764 42  GLU A C   
320  O O   . GLU A 42  ? 0.8265 0.9146 0.7322 0.0334  -0.0266 -0.1674 42  GLU A O   
321  C CB  . GLU A 42  ? 0.8698 0.9217 0.8011 0.0091  -0.0406 -0.1798 42  GLU A CB  
322  C CG  . GLU A 42  ? 0.9657 0.9853 0.9008 0.0058  -0.0462 -0.1810 42  GLU A CG  
323  C CD  . GLU A 42  ? 1.1399 1.1506 1.0773 -0.0086 -0.0529 -0.1912 42  GLU A CD  
324  O OE1 . GLU A 42  ? 1.1476 1.1485 1.0916 -0.0125 -0.0553 -0.2025 42  GLU A OE1 
325  O OE2 . GLU A 42  ? 1.2664 1.2793 1.1965 -0.0165 -0.0556 -0.1888 42  GLU A OE2 
326  N N   . GLU A 43  ? 0.5579 1.4440 0.8016 -0.3596 0.1055  -0.5079 43  GLU A N   
327  C CA  . GLU A 43  ? 0.6169 1.4787 0.8421 -0.3908 0.1135  -0.4847 43  GLU A CA  
328  C C   . GLU A 43  ? 0.6413 1.5103 0.8614 -0.3653 0.1063  -0.4682 43  GLU A C   
329  O O   . GLU A 43  ? 0.6851 1.6039 0.9200 -0.3446 0.1015  -0.4895 43  GLU A O   
330  C CB  . GLU A 43  ? 0.7018 1.6068 0.9334 -0.4320 0.1270  -0.5108 43  GLU A CB  
331  C CG  . GLU A 43  ? 0.8932 1.7701 1.1033 -0.4715 0.1373  -0.4859 43  GLU A CG  
332  C CD  . GLU A 43  ? 1.0171 1.9415 1.2334 -0.5149 0.1517  -0.5114 43  GLU A CD  
333  O OE1 . GLU A 43  ? 1.0233 2.0153 1.2605 -0.5094 0.1525  -0.5489 43  GLU A OE1 
334  O OE2 . GLU A 43  ? 1.0226 1.9177 1.2224 -0.5548 0.1622  -0.4936 43  GLU A OE2 
335  N N   . VAL A 44  ? 0.6374 1.4558 0.8374 -0.3651 0.1044  -0.4310 44  VAL A N   
336  C CA  . VAL A 44  ? 0.7218 1.5440 0.9185 -0.3422 0.0974  -0.4150 44  VAL A CA  
337  C C   . VAL A 44  ? 0.7928 1.6343 0.9822 -0.3704 0.1056  -0.4138 44  VAL A C   
338  O O   . VAL A 44  ? 0.8345 1.6424 1.0046 -0.3981 0.1128  -0.3918 44  VAL A O   
339  C CB  . VAL A 44  ? 0.8540 1.6186 1.0358 -0.3204 0.0893  -0.3778 44  VAL A CB  
340  C CG1 . VAL A 44  ? 0.8670 1.6227 1.0574 -0.2911 0.0811  -0.3818 44  VAL A CG1 
341  C CG2 . VAL A 44  ? 0.9722 1.6839 1.1311 -0.3490 0.0956  -0.3511 44  VAL A CG2 
342  N N   . VAL A 45  ? 0.7586 1.6566 0.9633 -0.3624 0.1039  -0.4383 45  VAL A N   
343  C CA  . VAL A 45  ? 0.7733 1.7015 0.9743 -0.3866 0.1108  -0.4428 45  VAL A CA  
344  C C   . VAL A 45  ? 0.7732 1.6980 0.9732 -0.3624 0.1016  -0.4269 45  VAL A C   
345  O O   . VAL A 45  ? 0.8027 1.7162 1.0104 -0.3257 0.0897  -0.4209 45  VAL A O   
346  C CB  . VAL A 45  ? 0.7524 1.7535 0.9731 -0.3973 0.1152  -0.4863 45  VAL A CB  
347  C CG1 . VAL A 45  ? 0.8183 1.8286 1.0491 -0.4048 0.1192  -0.5088 45  VAL A CG1 
348  C CG2 . VAL A 45  ? 0.6914 1.7329 0.9306 -0.3606 0.1027  -0.5048 45  VAL A CG2 
349  N N   . LEU A 46  ? 0.6973 1.6327 0.8879 -0.3837 0.1072  -0.4197 46  LEU A N   
350  C CA  . LEU A 46  ? 0.6224 1.5632 0.8159 -0.3634 0.0987  -0.4109 46  LEU A CA  
351  C C   . LEU A 46  ? 0.6564 1.6545 0.8757 -0.3405 0.0901  -0.4454 46  LEU A C   
352  O O   . LEU A 46  ? 0.7276 1.7769 0.9588 -0.3530 0.0948  -0.4788 46  LEU A O   
353  C CB  . LEU A 46  ? 0.6196 1.5663 0.7977 -0.3929 0.1071  -0.3991 46  LEU A CB  
354  C CG  . LEU A 46  ? 0.7240 1.6721 0.9050 -0.3730 0.0983  -0.3886 46  LEU A CG  
355  C CD1 . LEU A 46  ? 0.6993 1.5844 0.8706 -0.3489 0.0902  -0.3540 46  LEU A CD1 
356  C CD2 . LEU A 46  ? 0.7873 1.7567 0.9553 -0.4026 0.1069  -0.3837 46  LEU A CD2 
357  N N   . ASP A 47  ? 0.7391 1.7283 0.9673 -0.3069 0.0771  -0.4378 47  ASP A N   
358  C CA  . ASP A 47  ? 0.7886 1.8232 1.0412 -0.2801 0.0660  -0.4677 47  ASP A CA  
359  C C   . ASP A 47  ? 0.7971 1.8270 1.0568 -0.2596 0.0551  -0.4584 47  ASP A C   
360  O O   . ASP A 47  ? 0.8482 1.8890 1.1258 -0.2276 0.0416  -0.4695 47  ASP A O   
361  C CB  . ASP A 47  ? 0.8714 1.8965 1.1331 -0.2505 0.0579  -0.4723 47  ASP A CB  
362  C CG  . ASP A 47  ? 0.8892 1.9599 1.1744 -0.2214 0.0455  -0.5034 47  ASP A CG  
363  O OD1 . ASP A 47  ? 0.8489 1.8996 1.1410 -0.1880 0.0322  -0.4912 47  ASP A OD1 
364  O OD2 . ASP A 47  ? 0.9039 2.0303 1.2004 -0.2321 0.0488  -0.5399 47  ASP A OD2 
365  N N   . ALA A 48  ? 0.7465 1.7597 0.9925 -0.2780 0.0604  -0.4382 48  ALA A N   
366  C CA  . ALA A 48  ? 0.6822 1.6886 0.9356 -0.2604 0.0504  -0.4289 48  ALA A CA  
367  C C   . ALA A 48  ? 0.7254 1.7633 0.9745 -0.2856 0.0569  -0.4355 48  ALA A C   
368  O O   . ALA A 48  ? 0.7310 1.7596 0.9588 -0.3166 0.0698  -0.4209 48  ALA A O   
369  C CB  . ALA A 48  ? 0.7185 1.6606 0.9595 -0.2464 0.0468  -0.3890 48  ALA A CB  
370  N N   . THR A 49  ? 0.8004 1.8759 1.0699 -0.2712 0.0472  -0.4575 49  THR A N   
371  C CA  . THR A 49  ? 0.9507 2.0657 1.2196 -0.2913 0.0516  -0.4682 49  THR A CA  
372  C C   . THR A 49  ? 0.9888 2.0631 1.2444 -0.2921 0.0513  -0.4348 49  THR A C   
373  O O   . THR A 49  ? 1.0834 2.1815 1.3311 -0.3121 0.0573  -0.4345 49  THR A O   
374  C CB  . THR A 49  ? 0.9437 2.1157 1.2421 -0.2727 0.0392  -0.5076 49  THR A CB  
375  O OG1 . THR A 49  ? 1.0389 2.1795 1.3539 -0.2362 0.0223  -0.5000 49  THR A OG1 
376  C CG2 . THR A 49  ? 0.6836 1.9022 0.9947 -0.2719 0.0394  -0.5438 49  THR A CG2 
377  N N   . SER A 50  ? 0.8878 1.9046 1.1408 -0.2702 0.0445  -0.4070 50  SER A N   
378  C CA  . SER A 50  ? 0.8236 1.8011 1.0659 -0.2674 0.0429  -0.3761 50  SER A CA  
379  C C   . SER A 50  ? 0.7262 1.6420 0.9632 -0.2463 0.0378  -0.3461 50  SER A C   
380  O O   . SER A 50  ? 0.6116 1.5207 0.8593 -0.2273 0.0319  -0.3525 50  SER A O   
381  C CB  . SER A 50  ? 0.8504 1.8562 1.1149 -0.2533 0.0320  -0.3920 50  SER A CB  
382  O OG  . SER A 50  ? 0.8963 1.9128 1.1887 -0.2239 0.0177  -0.4132 50  SER A OG  
383  N N   . PRO A 51  ? 0.6701 1.5448 0.8907 -0.2488 0.0397  -0.3141 51  PRO A N   
384  C CA  . PRO A 51  ? 0.7190 1.5374 0.9302 -0.2333 0.0368  -0.2835 51  PRO A CA  
385  C C   . PRO A 51  ? 0.6174 1.4249 0.8505 -0.2008 0.0239  -0.2854 51  PRO A C   
386  O O   . PRO A 51  ? 0.6277 1.4582 0.8840 -0.1867 0.0143  -0.3026 51  PRO A O   
387  C CB  . PRO A 51  ? 0.6285 1.4238 0.8277 -0.2372 0.0373  -0.2593 51  PRO A CB  
388  C CG  . PRO A 51  ? 0.6430 1.4735 0.8326 -0.2638 0.0457  -0.2700 51  PRO A CG  
389  C CD  . PRO A 51  ? 0.6056 1.4916 0.8166 -0.2650 0.0438  -0.3076 51  PRO A CD  
390  N N   . SER A 52  ? 0.5698 1.3424 0.7955 -0.1890 0.0231  -0.2673 52  SER A N   
391  C CA  . SER A 52  ? 0.5469 1.3055 0.7894 -0.1590 0.0117  -0.2626 52  SER A CA  
392  C C   . SER A 52  ? 0.6539 1.3702 0.8888 -0.1505 0.0094  -0.2300 52  SER A C   
393  O O   . SER A 52  ? 0.7808 1.4829 1.0296 -0.1287 0.0001  -0.2206 52  SER A O   
394  C CB  . SER A 52  ? 0.6154 1.3744 0.8571 -0.1496 0.0119  -0.2684 52  SER A CB  
395  O OG  . SER A 52  ? 0.6846 1.4873 0.9346 -0.1581 0.0140  -0.3012 52  SER A OG  
396  N N   . GLU A 53  ? 0.5650 1.2616 0.7771 -0.1684 0.0180  -0.2126 53  GLU A N   
397  C CA  . GLU A 53  ? 0.4222 1.0887 0.6274 -0.1642 0.0162  -0.1867 53  GLU A CA  
398  C C   . GLU A 53  ? 0.4810 1.1499 0.6682 -0.1874 0.0240  -0.1821 53  GLU A C   
399  O O   . GLU A 53  ? 0.4372 1.1110 0.6069 -0.2079 0.0328  -0.1858 53  GLU A O   
400  C CB  . GLU A 53  ? 0.3984 1.0268 0.5901 -0.1537 0.0164  -0.1612 53  GLU A CB  
401  C CG  . GLU A 53  ? 0.4176 1.0184 0.5959 -0.1557 0.0171  -0.1362 53  GLU A CG  
402  C CD  . GLU A 53  ? 0.5654 1.1329 0.7328 -0.1428 0.0157  -0.1124 53  GLU A CD  
403  O OE1 . GLU A 53  ? 0.4467 1.0093 0.6096 -0.1377 0.0167  -0.1137 53  GLU A OE1 
404  O OE2 . GLU A 53  ? 0.4601 1.0100 0.6239 -0.1376 0.0135  -0.0941 53  GLU A OE2 
405  N N   . ARG A 54  ? 0.5424 1.2079 0.7339 -0.1843 0.0205  -0.1735 54  ARG A N   
406  C CA  . ARG A 54  ? 0.6318 1.2969 0.8040 -0.2026 0.0267  -0.1645 54  ARG A CA  
407  C C   . ARG A 54  ? 0.5415 1.1739 0.7072 -0.1917 0.0234  -0.1388 54  ARG A C   
408  O O   . ARG A 54  ? 0.6085 1.2448 0.7936 -0.1788 0.0162  -0.1393 54  ARG A O   
409  C CB  . ARG A 54  ? 0.6047 1.3127 0.7911 -0.2107 0.0257  -0.1866 54  ARG A CB  
410  C CG  . ARG A 54  ? 0.6733 1.3873 0.8386 -0.2295 0.0324  -0.1777 54  ARG A CG  
411  C CD  . ARG A 54  ? 0.7807 1.5420 0.9637 -0.2335 0.0297  -0.2010 54  ARG A CD  
412  N NE  . ARG A 54  ? 0.8254 1.6077 0.9854 -0.2577 0.0389  -0.1991 54  ARG A NE  
413  C CZ  . ARG A 54  ? 0.8074 1.6324 0.9757 -0.2639 0.0382  -0.2149 54  ARG A CZ  
414  N NH1 . ARG A 54  ? 0.6519 1.5009 0.8532 -0.2473 0.0278  -0.2358 54  ARG A NH1 
415  N NH2 . ARG A 54  ? 0.8711 1.7153 1.0149 -0.2866 0.0474  -0.2097 54  ARG A NH2 
416  N N   . LEU A 55  ? 0.4596 1.0599 0.5992 -0.1966 0.0279  -0.1173 55  LEU A N   
417  C CA  . LEU A 55  ? 0.5077 1.0795 0.6398 -0.1856 0.0245  -0.0941 55  LEU A CA  
418  C C   . LEU A 55  ? 0.5463 1.1190 0.6581 -0.2001 0.0286  -0.0859 55  LEU A C   
419  O O   . LEU A 55  ? 0.4950 1.0648 0.5838 -0.2186 0.0357  -0.0836 55  LEU A O   
420  C CB  . LEU A 55  ? 0.4174 0.9543 0.5343 -0.1777 0.0248  -0.0767 55  LEU A CB  
421  C CG  . LEU A 55  ? 0.5289 1.0399 0.6397 -0.1638 0.0205  -0.0545 55  LEU A CG  
422  C CD1 . LEU A 55  ? 0.3417 0.8606 0.4803 -0.1454 0.0134  -0.0549 55  LEU A CD1 
423  C CD2 . LEU A 55  ? 0.5662 1.0465 0.6579 -0.1589 0.0211  -0.0404 55  LEU A CD2 
424  N N   . ILE A 56  ? 0.5216 1.0997 0.6423 -0.1923 0.0242  -0.0817 56  ILE A N   
425  C CA  . ILE A 56  ? 0.5366 1.1178 0.6381 -0.2024 0.0269  -0.0730 56  ILE A CA  
426  C C   . ILE A 56  ? 0.5446 1.0909 0.6290 -0.1918 0.0244  -0.0483 56  ILE A C   
427  O O   . ILE A 56  ? 0.5797 1.1151 0.6794 -0.1745 0.0187  -0.0425 56  ILE A O   
428  C CB  . ILE A 56  ? 0.6020 1.2210 0.7252 -0.2020 0.0236  -0.0894 56  ILE A CB  
429  C CG1 . ILE A 56  ? 0.6870 1.3462 0.8201 -0.2158 0.0268  -0.1148 56  ILE A CG1 
430  C CG2 . ILE A 56  ? 0.5206 1.1416 0.6239 -0.2074 0.0251  -0.0776 56  ILE A CG2 
431  C CD1 . ILE A 56  ? 0.7512 1.4219 0.9137 -0.2058 0.0219  -0.1342 56  ILE A CD1 
432  N N   . LEU A 57  ? 0.5643 1.0937 0.6165 -0.2024 0.0284  -0.0337 57  LEU A N   
433  C CA  . LEU A 57  ? 0.4909 0.9846 0.5228 -0.1921 0.0254  -0.0114 57  LEU A CA  
434  C C   . LEU A 57  ? 0.6429 1.1344 0.6489 -0.1987 0.0264  0.0008  57  LEU A C   
435  O O   . LEU A 57  ? 0.7289 1.2396 0.7235 -0.2160 0.0315  -0.0036 57  LEU A O   
436  C CB  . LEU A 57  ? 0.6073 1.0679 0.6217 -0.1943 0.0272  -0.0029 57  LEU A CB  
437  C CG  . LEU A 57  ? 0.5482 1.0099 0.5850 -0.1847 0.0257  -0.0129 57  LEU A CG  
438  C CD1 . LEU A 57  ? 0.7417 1.1769 0.7619 -0.1901 0.0281  -0.0092 57  LEU A CD1 
439  C CD2 . LEU A 57  ? 0.2846 0.7414 0.3381 -0.1626 0.0189  -0.0063 57  LEU A CD2 
440  N N   . SER A 58  ? 0.7752 1.2460 0.7712 -0.1842 0.0212  0.0162  58  SER A N   
441  C CA  . SER A 58  ? 0.6394 1.1039 0.6076 -0.1867 0.0206  0.0299  58  SER A CA  
442  C C   . SER A 58  ? 0.7287 1.1661 0.6621 -0.2027 0.0250  0.0423  58  SER A C   
443  O O   . SER A 58  ? 0.8773 1.2893 0.8067 -0.2057 0.0261  0.0441  58  SER A O   
444  C CB  . SER A 58  ? 0.5422 0.9871 0.5055 -0.1661 0.0133  0.0431  58  SER A CB  
445  O OG  . SER A 58  ? 0.7013 1.1154 0.6274 -0.1666 0.0117  0.0616  58  SER A OG  
446  N N   . PRO A 59  ? 0.6456 1.0887 0.5538 -0.2134 0.0271  0.0513  59  PRO A N   
447  C CA  . PRO A 59  ? 0.7149 1.1282 0.5870 -0.2301 0.0309  0.0673  59  PRO A CA  
448  C C   . PRO A 59  ? 0.7926 1.1520 0.6447 -0.2172 0.0242  0.0851  59  PRO A C   
449  O O   . PRO A 59  ? 0.9067 1.2320 0.7362 -0.2295 0.0261  0.0955  59  PRO A O   
450  C CB  . PRO A 59  ? 0.7472 1.1800 0.5973 -0.2368 0.0320  0.0761  59  PRO A CB  
451  C CG  . PRO A 59  ? 0.6100 1.0954 0.4919 -0.2307 0.0317  0.0558  59  PRO A CG  
452  C CD  . PRO A 59  ? 0.4765 0.9543 0.3887 -0.2096 0.0256  0.0476  59  PRO A CD  
453  N N   . LYS A 60  ? 0.8698 1.2229 0.7314 -0.1929 0.0162  0.0872  60  LYS A N   
454  C CA  . LYS A 60  ? 0.9835 1.2915 0.8292 -0.1778 0.0087  0.1005  60  LYS A CA  
455  C C   . LYS A 60  ? 0.9262 1.2248 0.7940 -0.1696 0.0075  0.0909  60  LYS A C   
456  O O   . LYS A 60  ? 0.8387 1.1096 0.7009 -0.1530 0.0003  0.0974  60  LYS A O   
457  C CB  . LYS A 60  ? 1.0908 1.3974 0.9294 -0.1557 0.0001  0.1091  60  LYS A CB  
458  C CG  . LYS A 60  ? 1.2825 1.5738 1.0840 -0.1588 -0.0025 0.1265  60  LYS A CG  
459  C CD  . LYS A 60  ? 1.4044 1.6781 1.1927 -0.1333 -0.0136 0.1365  60  LYS A CD  
460  C CE  . LYS A 60  ? 1.4587 1.7130 1.2068 -0.1342 -0.0176 0.1554  60  LYS A CE  
461  N NZ  . LYS A 60  ? 1.4600 1.6977 1.1946 -0.1070 -0.0299 0.1634  60  LYS A NZ  
462  N N   . ALA A 61  ? 0.7954 1.1196 0.6877 -0.1803 0.0141  0.0747  61  ALA A N   
463  C CA  . ALA A 61  ? 0.7307 1.0513 0.6438 -0.1728 0.0134  0.0651  61  ALA A CA  
464  C C   . ALA A 61  ? 0.9386 1.2239 0.8348 -0.1822 0.0143  0.0685  61  ALA A C   
465  O O   . ALA A 61  ? 1.0641 1.3485 0.9507 -0.2048 0.0211  0.0660  61  ALA A O   
466  C CB  . ALA A 61  ? 0.5898 0.9493 0.5336 -0.1797 0.0188  0.0460  61  ALA A CB  
467  N N   . LYS A 62  ? 0.9310 1.1897 0.8249 -0.1653 0.0073  0.0726  62  LYS A N   
468  C CA  . LYS A 62  ? 1.0127 1.2401 0.8971 -0.1722 0.0071  0.0715  62  LYS A CA  
469  C C   . LYS A 62  ? 0.8971 1.1492 0.8061 -0.1814 0.0138  0.0527  62  LYS A C   
470  O O   . LYS A 62  ? 0.8904 1.1675 0.8244 -0.1671 0.0126  0.0432  62  LYS A O   
471  C CB  . LYS A 62  ? 1.2025 1.4024 1.0824 -0.1487 -0.0033 0.0767  62  LYS A CB  
472  C CG  . LYS A 62  ? 1.3983 1.5597 1.2663 -0.1539 -0.0060 0.0758  62  LYS A CG  
473  C CD  . LYS A 62  ? 1.5848 1.7072 1.4204 -0.1714 -0.0062 0.0905  62  LYS A CD  
474  C CE  . LYS A 62  ? 1.6686 1.7445 1.4925 -0.1732 -0.0119 0.0910  62  LYS A CE  
475  N NZ  . LYS A 62  ? 1.6708 1.7265 1.4931 -0.1435 -0.0254 0.0926  62  LYS A NZ  
476  N N   . LEU A 63  ? 0.8138 1.0601 0.7152 -0.2053 0.0207  0.0478  63  LEU A N   
477  C CA  . LEU A 63  ? 0.8373 1.1082 0.7607 -0.2141 0.0267  0.0279  63  LEU A CA  
478  C C   . LEU A 63  ? 0.9312 1.1763 0.8547 -0.2110 0.0238  0.0224  63  LEU A C   
479  O O   . LEU A 63  ? 1.0152 1.2213 0.9175 -0.2203 0.0221  0.0312  63  LEU A O   
480  C CB  . LEU A 63  ? 0.7974 1.0880 0.7172 -0.2433 0.0368  0.0209  63  LEU A CB  
481  C CG  . LEU A 63  ? 0.7871 1.1126 0.7110 -0.2474 0.0399  0.0207  63  LEU A CG  
482  C CD1 . LEU A 63  ? 0.6277 0.9795 0.5499 -0.2761 0.0499  0.0104  63  LEU A CD1 
483  C CD2 . LEU A 63  ? 0.7570 1.1149 0.7112 -0.2268 0.0364  0.0093  63  LEU A CD2 
484  N N   . HIS A 64  ? 0.8082 1.0751 0.7560 -0.1973 0.0227  0.0077  64  HIS A N   
485  C CA  . HIS A 64  ? 0.8546 1.1052 0.8061 -0.1929 0.0199  -0.0014 64  HIS A CA  
486  C C   . HIS A 64  ? 0.8526 1.1219 0.8152 -0.2134 0.0282  -0.0206 64  HIS A C   
487  O O   . HIS A 64  ? 0.9047 1.1715 0.8764 -0.2104 0.0271  -0.0337 64  HIS A O   
488  C CB  . HIS A 64  ? 0.7406 1.0042 0.7090 -0.1633 0.0128  -0.0046 64  HIS A CB  
489  C CG  . HIS A 64  ? 0.9148 1.1608 0.8720 -0.1439 0.0044  0.0123  64  HIS A CG  
490  N ND1 . HIS A 64  ? 0.9427 1.1498 0.8816 -0.1371 -0.0032 0.0203  64  HIS A ND1 
491  C CD2 . HIS A 64  ? 1.0130 1.2758 0.9753 -0.1303 0.0021  0.0214  64  HIS A CD2 
492  C CE1 . HIS A 64  ? 1.0293 1.2329 0.9618 -0.1190 -0.0099 0.0330  64  HIS A CE1 
493  N NE2 . HIS A 64  ? 1.0524 1.2900 0.9992 -0.1156 -0.0062 0.0340  64  HIS A NE2 
494  N N   . VAL A 65  ? 0.8359 1.1275 0.7982 -0.2342 0.0364  -0.0240 65  VAL A N   
495  C CA  . VAL A 65  ? 0.9064 1.2205 0.8782 -0.2563 0.0450  -0.0434 65  VAL A CA  
496  C C   . VAL A 65  ? 1.0136 1.3211 0.9656 -0.2881 0.0531  -0.0364 65  VAL A C   
497  O O   . VAL A 65  ? 1.0714 1.3527 1.0006 -0.2913 0.0513  -0.0153 65  VAL A O   
498  C CB  . VAL A 65  ? 0.8562 1.2212 0.8547 -0.2484 0.0472  -0.0618 65  VAL A CB  
499  C CG1 . VAL A 65  ? 0.9395 1.3110 0.9546 -0.2166 0.0390  -0.0625 65  VAL A CG1 
500  C CG2 . VAL A 65  ? 0.7436 1.1318 0.7413 -0.2553 0.0501  -0.0574 65  VAL A CG2 
501  N N   . ASN A 66  ? 0.9539 1.2881 0.9138 -0.3113 0.0621  -0.0541 66  ASN A N   
502  C CA  . ASN A 66  ? 0.9362 1.2705 0.8779 -0.3446 0.0712  -0.0484 66  ASN A CA  
503  C C   . ASN A 66  ? 0.9316 1.3132 0.8896 -0.3662 0.0811  -0.0737 66  ASN A C   
504  O O   . ASN A 66  ? 0.8615 1.2593 0.8396 -0.3610 0.0811  -0.0952 66  ASN A O   
505  C CB  . ASN A 66  ? 0.9842 1.2628 0.9012 -0.3600 0.0706  -0.0319 66  ASN A CB  
506  C CG  . ASN A 66  ? 1.1168 1.3820 1.0461 -0.3619 0.0699  -0.0483 66  ASN A CG  
507  O OD1 . ASN A 66  ? 1.0471 1.2960 0.9855 -0.3358 0.0608  -0.0510 66  ASN A OD1 
508  N ND2 . ASN A 66  ? 1.1866 1.4624 1.1172 -0.3932 0.0797  -0.0606 66  ASN A ND2 
509  N N   . ASN A 67  ? 0.9135 1.3209 0.8624 -0.3896 0.0892  -0.0724 67  ASN A N   
510  C CA  . ASN A 67  ? 0.8617 1.3198 0.8244 -0.4123 0.0989  -0.0972 67  ASN A CA  
511  C C   . ASN A 67  ? 0.8705 1.3302 0.8467 -0.4214 0.1021  -0.1178 67  ASN A C   
512  O O   . ASN A 67  ? 0.8818 1.2967 0.8459 -0.4306 0.1019  -0.1084 67  ASN A O   
513  C CB  . ASN A 67  ? 1.0366 1.5044 0.9772 -0.4466 0.1089  -0.0866 67  ASN A CB  
514  C CG  . ASN A 67  ? 1.0871 1.5931 1.0286 -0.4409 0.1087  -0.0853 67  ASN A CG  
515  O OD1 . ASN A 67  ? 1.1011 1.6401 1.0668 -0.4179 0.1033  -0.1017 67  ASN A OD1 
516  N ND2 . ASN A 67  ? 1.0705 1.5724 0.9860 -0.4617 0.1140  -0.0658 67  ASN A ND2 
517  N N   . GLY A 68  ? 0.8138 1.3258 0.8160 -0.4178 0.1042  -0.1475 68  GLY A N   
518  C CA  . GLY A 68  ? 0.8272 1.3514 0.8451 -0.4249 0.1073  -0.1717 68  GLY A CA  
519  C C   . GLY A 68  ? 0.8180 1.3227 0.8497 -0.3934 0.0975  -0.1766 68  GLY A C   
520  O O   . GLY A 68  ? 0.8919 1.4210 0.9429 -0.3901 0.0981  -0.2017 68  GLY A O   
521  N N   . LYS A 69  ? 0.8260 1.2905 0.8478 -0.3700 0.0885  -0.1534 69  LYS A N   
522  C CA  . LYS A 69  ? 0.9153 1.3638 0.9485 -0.3400 0.0792  -0.1563 69  LYS A CA  
523  C C   . LYS A 69  ? 0.9124 1.4074 0.9721 -0.3151 0.0752  -0.1769 69  LYS A C   
524  O O   . LYS A 69  ? 0.9773 1.5035 1.0445 -0.3101 0.0752  -0.1800 69  LYS A O   
525  C CB  . LYS A 69  ? 0.8984 1.3018 0.9158 -0.3197 0.0704  -0.1279 69  LYS A CB  
526  C CG  . LYS A 69  ? 0.9769 1.3639 1.0034 -0.2907 0.0610  -0.1294 69  LYS A CG  
527  C CD  . LYS A 69  ? 1.0417 1.3851 1.0507 -0.2744 0.0527  -0.1027 69  LYS A CD  
528  C CE  . LYS A 69  ? 1.0815 1.4144 1.0997 -0.2460 0.0434  -0.1058 69  LYS A CE  
529  N NZ  . LYS A 69  ? 1.1386 1.4340 1.1407 -0.2289 0.0348  -0.0822 69  LYS A NZ  
530  N N   . ASP A 70  ? 0.8793 1.3787 0.9532 -0.2987 0.0710  -0.1914 70  ASP A N   
531  C CA  . ASP A 70  ? 0.7634 1.3021 0.8601 -0.2721 0.0658  -0.2080 70  ASP A CA  
532  C C   . ASP A 70  ? 0.6661 1.1841 0.7635 -0.2388 0.0556  -0.1916 70  ASP A C   
533  O O   . ASP A 70  ? 0.7169 1.2025 0.8062 -0.2335 0.0523  -0.1832 70  ASP A O   
534  C CB  . ASP A 70  ? 0.6866 1.2553 0.7996 -0.2764 0.0687  -0.2385 70  ASP A CB  
535  C CG  . ASP A 70  ? 0.7235 1.3312 0.8424 -0.3041 0.0782  -0.2603 70  ASP A CG  
536  O OD1 . ASP A 70  ? 0.6727 1.2783 0.7888 -0.3316 0.0859  -0.2718 70  ASP A OD1 
537  O OD2 . ASP A 70  ? 0.8141 1.4560 0.9418 -0.2985 0.0775  -0.2671 70  ASP A OD2 
538  N N   . VAL A 71  ? 0.5537 1.0913 0.6615 -0.2169 0.0504  -0.1875 71  VAL A N   
539  C CA  . VAL A 71  ? 0.5911 1.1124 0.6991 -0.1875 0.0416  -0.1693 71  VAL A CA  
540  C C   . VAL A 71  ? 0.6215 1.1759 0.7497 -0.1604 0.0357  -0.1791 71  VAL A C   
541  O O   . VAL A 71  ? 0.6402 1.2292 0.7825 -0.1614 0.0367  -0.1970 71  VAL A O   
542  C CB  . VAL A 71  ? 0.5662 1.0676 0.6634 -0.1865 0.0398  -0.1448 71  VAL A CB  
543  C CG1 . VAL A 71  ? 0.5483 1.0135 0.6221 -0.2092 0.0441  -0.1310 71  VAL A CG1 
544  C CG2 . VAL A 71  ? 0.5235 1.0562 0.6326 -0.1893 0.0410  -0.1525 71  VAL A CG2 
545  N N   . ASN A 72  ? 0.5683 1.1131 0.6974 -0.1357 0.0289  -0.1669 72  ASN A N   
546  C CA  . ASN A 72  ? 0.4771 1.0492 0.6221 -0.1088 0.0227  -0.1700 72  ASN A CA  
547  C C   . ASN A 72  ? 0.4209 0.9857 0.5676 -0.0940 0.0177  -0.1474 72  ASN A C   
548  O O   . ASN A 72  ? 0.3210 0.8575 0.4554 -0.0957 0.0171  -0.1266 72  ASN A O   
549  C CB  . ASN A 72  ? 0.4258 1.0024 0.5728 -0.0904 0.0188  -0.1740 72  ASN A CB  
550  C CG  . ASN A 72  ? 0.5724 1.1571 0.7211 -0.1045 0.0232  -0.1988 72  ASN A CG  
551  O OD1 . ASN A 72  ? 0.6218 1.2338 0.7802 -0.1155 0.0271  -0.2213 72  ASN A OD1 
552  N ND2 . ASN A 72  ? 0.4125 0.9741 0.5528 -0.1051 0.0221  -0.1964 72  ASN A ND2 
553  N N   . LYS A 73  ? 0.3160 0.9062 0.4784 -0.0788 0.0134  -0.1524 73  LYS A N   
554  C CA  . LYS A 73  ? 0.5599 1.1462 0.7289 -0.0659 0.0082  -0.1340 73  LYS A CA  
555  C C   . LYS A 73  ? 0.7753 1.3363 0.9350 -0.0567 0.0058  -0.1064 73  LYS A C   
556  O O   . LYS A 73  ? 0.9359 1.4908 1.1006 -0.0519 0.0029  -0.0915 73  LYS A O   
557  C CB  . LYS A 73  ? 0.5642 1.1769 0.7503 -0.0444 0.0018  -0.1405 73  LYS A CB  
558  C CG  . LYS A 73  ? 0.6384 1.2454 0.8344 -0.0343 -0.0039 -0.1239 73  LYS A CG  
559  C CD  . LYS A 73  ? 0.7010 1.3284 0.9123 -0.0120 -0.0117 -0.1271 73  LYS A CD  
560  C CE  . LYS A 73  ? 0.7980 1.4123 1.0192 -0.0027 -0.0178 -0.1066 73  LYS A CE  
561  N NZ  . LYS A 73  ? 0.9232 1.5521 1.1590 0.0183  -0.0266 -0.1081 73  LYS A NZ  
562  N N   . GLY A 74  ? 0.6797 1.2275 0.8273 -0.0538 0.0063  -0.1009 74  GLY A N   
563  C CA  . GLY A 74  ? 0.5644 1.0930 0.7039 -0.0445 0.0034  -0.0768 74  GLY A CA  
564  C C   . GLY A 74  ? 0.3762 0.8746 0.4974 -0.0578 0.0058  -0.0696 74  GLY A C   
565  O O   . GLY A 74  ? 0.4492 0.9328 0.5627 -0.0502 0.0030  -0.0519 74  GLY A O   
566  N N   . ASP A 75  ? 0.4707 0.9602 0.5843 -0.0779 0.0106  -0.0833 75  ASP A N   
567  C CA  . ASP A 75  ? 0.5551 1.0123 0.6497 -0.0891 0.0116  -0.0763 75  ASP A CA  
568  C C   . ASP A 75  ? 0.4914 0.9298 0.5761 -0.0952 0.0116  -0.0580 75  ASP A C   
569  O O   . ASP A 75  ? 0.5451 0.9948 0.6370 -0.1015 0.0136  -0.0575 75  ASP A O   
570  C CB  . ASP A 75  ? 0.6449 1.0963 0.7339 -0.1122 0.0174  -0.0936 75  ASP A CB  
571  C CG  . ASP A 75  ? 0.5901 1.0634 0.6907 -0.1065 0.0174  -0.1148 75  ASP A CG  
572  O OD1 . ASP A 75  ? 0.6615 1.1472 0.7664 -0.1240 0.0229  -0.1339 75  ASP A OD1 
573  O OD2 . ASP A 75  ? 0.5461 1.0280 0.6519 -0.0843 0.0120  -0.1133 75  ASP A OD2 
574  N N   . LEU A 76  ? 0.4163 0.8276 0.4852 -0.0915 0.0084  -0.0448 76  LEU A N   
575  C CA  . LEU A 76  ? 0.5723 0.9634 0.6279 -0.0978 0.0081  -0.0288 76  LEU A CA  
576  C C   . LEU A 76  ? 0.5910 0.9703 0.6352 -0.1238 0.0141  -0.0340 76  LEU A C   
577  O O   . LEU A 76  ? 0.8322 1.1940 0.8659 -0.1358 0.0160  -0.0406 76  LEU A O   
578  C CB  . LEU A 76  ? 0.6203 0.9850 0.6602 -0.0868 0.0022  -0.0170 76  LEU A CB  
579  C CG  . LEU A 76  ? 0.6224 0.9641 0.6452 -0.0908 0.0004  -0.0008 76  LEU A CG  
580  C CD1 . LEU A 76  ? 0.5458 0.9071 0.5799 -0.0821 -0.0002 0.0090  76  LEU A CD1 
581  C CD2 . LEU A 76  ? 0.5923 0.9075 0.5996 -0.0786 -0.0069 0.0063  76  LEU A CD2 
582  N N   . ILE A 77  ? 0.6191 1.0091 0.6659 -0.1335 0.0172  -0.0315 77  ILE A N   
583  C CA  . ILE A 77  ? 0.6658 1.0519 0.7014 -0.1592 0.0237  -0.0365 77  ILE A CA  
584  C C   . ILE A 77  ? 0.6798 1.0458 0.6961 -0.1661 0.0234  -0.0195 77  ILE A C   
585  O O   . ILE A 77  ? 0.7939 1.1499 0.7942 -0.1872 0.0282  -0.0183 77  ILE A O   
586  C CB  . ILE A 77  ? 0.5526 0.9751 0.6065 -0.1683 0.0282  -0.0535 77  ILE A CB  
587  C CG1 . ILE A 77  ? 0.5158 0.9562 0.5848 -0.1562 0.0248  -0.0487 77  ILE A CG1 
588  C CG2 . ILE A 77  ? 0.4052 0.8473 0.4752 -0.1622 0.0284  -0.0718 77  ILE A CG2 
589  C CD1 . ILE A 77  ? 0.4293 0.9051 0.5194 -0.1605 0.0265  -0.0674 77  ILE A CD1 
590  N N   . ALA A 78  ? 0.6345 0.9963 0.6516 -0.1485 0.0177  -0.0061 78  ALA A N   
591  C CA  . ALA A 78  ? 0.6621 1.0089 0.6616 -0.1523 0.0166  0.0087  78  ALA A CA  
592  C C   . ALA A 78  ? 0.6362 0.9786 0.6373 -0.1304 0.0096  0.0215  78  ALA A C   
593  O O   . ALA A 78  ? 0.7187 1.0743 0.7369 -0.1140 0.0066  0.0198  78  ALA A O   
594  C CB  . ALA A 78  ? 0.5130 0.8847 0.5185 -0.1665 0.0215  0.0034  78  ALA A CB  
595  N N   . GLU A 79  ? 0.6508 0.9773 0.6337 -0.1307 0.0072  0.0345  79  GLU A N   
596  C CA  . GLU A 79  ? 0.6298 0.9516 0.6109 -0.1110 0.0004  0.0459  79  GLU A CA  
597  C C   . GLU A 79  ? 0.7042 1.0248 0.6724 -0.1149 -0.0002 0.0551  79  GLU A C   
598  O O   . GLU A 79  ? 0.7528 1.0533 0.6971 -0.1270 0.0008  0.0611  79  GLU A O   
599  C CB  . GLU A 79  ? 0.6782 0.9699 0.6425 -0.1003 -0.0057 0.0514  79  GLU A CB  
600  C CG  . GLU A 79  ? 0.9698 1.2707 0.9448 -0.0767 -0.0119 0.0541  79  GLU A CG  
601  C CD  . GLU A 79  ? 1.1601 1.4322 1.1171 -0.0648 -0.0198 0.0577  79  GLU A CD  
602  O OE1 . GLU A 79  ? 1.2222 1.4927 1.1733 -0.0483 -0.0265 0.0653  79  GLU A OE1 
603  O OE2 . GLU A 79  ? 1.1089 1.3610 1.0589 -0.0718 -0.0197 0.0512  79  GLU A OE2 
604  N N   . GLU A 80  ? 0.6124 0.9555 0.5968 -0.1052 -0.0018 0.0565  80  GLU A N   
605  C CA  . GLU A 80  ? 0.7181 1.0671 0.6945 -0.1062 -0.0030 0.0626  80  GLU A CA  
606  C C   . GLU A 80  ? 0.8003 1.1357 0.7649 -0.0873 -0.0106 0.0737  80  GLU A C   
607  O O   . GLU A 80  ? 0.7064 1.0499 0.6852 -0.0724 -0.0138 0.0740  80  GLU A O   
608  C CB  . GLU A 80  ? 0.7035 1.0873 0.7088 -0.1074 -0.0007 0.0540  80  GLU A CB  
609  C CG  . GLU A 80  ? 0.8524 1.2516 0.8538 -0.1167 0.0009  0.0524  80  GLU A CG  
610  C CD  . GLU A 80  ? 0.9065 1.3206 0.9105 -0.1364 0.0072  0.0407  80  GLU A CD  
611  O OE1 . GLU A 80  ? 0.8844 1.3233 0.9160 -0.1390 0.0089  0.0269  80  GLU A OE1 
612  O OE2 . GLU A 80  ? 0.8650 1.2667 0.8432 -0.1494 0.0101  0.0453  80  GLU A OE2 
613  N N   . PRO A 81  ? 0.8342 1.1502 0.7714 -0.0875 -0.0139 0.0830  81  PRO A N   
614  C CA  . PRO A 81  ? 0.8167 1.1191 0.7396 -0.0683 -0.0226 0.0920  81  PRO A CA  
615  C C   . PRO A 81  ? 0.6537 0.9868 0.5971 -0.0551 -0.0247 0.0906  81  PRO A C   
616  O O   . PRO A 81  ? 0.5716 0.9326 0.5386 -0.0621 -0.0198 0.0840  81  PRO A O   
617  C CB  . PRO A 81  ? 0.8306 1.1123 0.7220 -0.0743 -0.0247 0.1016  81  PRO A CB  
618  C CG  . PRO A 81  ? 0.9063 1.1775 0.7901 -0.0972 -0.0175 0.0999  81  PRO A CG  
619  C CD  . PRO A 81  ? 0.8337 1.1381 0.7495 -0.1060 -0.0100 0.0861  81  PRO A CD  
620  N N   . PRO A 82  ? 0.6429 0.9714 0.5785 -0.0362 -0.0324 0.0956  82  PRO A N   
621  C CA  . PRO A 82  ? 0.6490 1.0086 0.6032 -0.0253 -0.0340 0.0942  82  PRO A CA  
622  C C   . PRO A 82  ? 0.6165 0.9867 0.5632 -0.0290 -0.0342 0.0951  82  PRO A C   
623  O O   . PRO A 82  ? 0.5585 0.9097 0.4807 -0.0367 -0.0343 0.0994  82  PRO A O   
624  C CB  . PRO A 82  ? 0.5881 0.9400 0.5312 -0.0041 -0.0428 0.0979  82  PRO A CB  
625  C CG  . PRO A 82  ? 0.6866 1.0056 0.6137 -0.0036 -0.0454 0.0988  82  PRO A CG  
626  C CD  . PRO A 82  ? 0.6933 0.9909 0.6064 -0.0235 -0.0404 0.1004  82  PRO A CD  
627  N N   . ILE A 83  ? 0.5323 0.9341 0.5001 -0.0241 -0.0340 0.0910  83  ILE A N   
628  C CA  . ILE A 83  ? 0.5585 0.9761 0.5217 -0.0253 -0.0349 0.0893  83  ILE A CA  
629  C C   . ILE A 83  ? 0.6373 1.0604 0.5888 -0.0059 -0.0430 0.0922  83  ILE A C   
630  O O   . ILE A 83  ? 0.6251 1.0617 0.5912 0.0053  -0.0453 0.0909  83  ILE A O   
631  C CB  . ILE A 83  ? 0.5855 1.0369 0.5833 -0.0357 -0.0292 0.0788  83  ILE A CB  
632  C CG1 . ILE A 83  ? 0.5096 0.9569 0.5175 -0.0531 -0.0226 0.0737  83  ILE A CG1 
633  C CG2 . ILE A 83  ? 0.3149 0.7877 0.3096 -0.0353 -0.0308 0.0744  83  ILE A CG2 
634  C CD1 . ILE A 83  ? 0.4254 0.9022 0.4696 -0.0619 -0.0188 0.0617  83  ILE A CD1 
635  N N   . TYR A 84  ? 0.5842 0.9988 0.5083 -0.0016 -0.0476 0.0964  84  TYR A N   
636  C CA  . TYR A 84  ? 0.5486 0.9642 0.4559 0.0194  -0.0572 0.0989  84  TYR A CA  
637  C C   . TYR A 84  ? 0.6517 1.0962 0.5588 0.0224  -0.0586 0.0942  84  TYR A C   
638  O O   . TYR A 84  ? 0.6573 1.1035 0.5553 0.0110  -0.0553 0.0949  84  TYR A O   
639  C CB  . TYR A 84  ? 0.5643 0.9355 0.4327 0.0279  -0.0651 0.1097  84  TYR A CB  
640  C CG  . TYR A 84  ? 0.6360 0.9816 0.5052 0.0296  -0.0660 0.1113  84  TYR A CG  
641  C CD1 . TYR A 84  ? 0.6791 1.0378 0.5619 0.0454  -0.0704 0.1066  84  TYR A CD1 
642  C CD2 . TYR A 84  ? 0.6124 0.9248 0.4695 0.0151  -0.0625 0.1164  84  TYR A CD2 
643  C CE1 . TYR A 84  ? 0.7502 1.0904 0.6344 0.0484  -0.0717 0.1065  84  TYR A CE1 
644  C CE2 . TYR A 84  ? 0.7895 1.0813 0.6489 0.0173  -0.0637 0.1155  84  TYR A CE2 
645  C CZ  . TYR A 84  ? 0.8183 1.1246 0.6913 0.0348  -0.0686 0.1103  84  TYR A CZ  
646  O OH  . TYR A 84  ? 0.8832 1.1741 0.7593 0.0381  -0.0702 0.1077  84  TYR A OH  
647  N N   . ALA A 85  ? 0.5448 1.0161 0.4625 0.0377  -0.0633 0.0882  85  ALA A N   
648  C CA  . ALA A 85  ? 0.4243 0.9273 0.3440 0.0421  -0.0652 0.0812  85  ALA A CA  
649  C C   . ALA A 85  ? 0.5614 1.0415 0.4379 0.0515  -0.0727 0.0905  85  ALA A C   
650  O O   . ALA A 85  ? 0.7617 1.2127 0.6106 0.0674  -0.0818 0.0986  85  ALA A O   
651  C CB  . ALA A 85  ? 0.3717 0.9099 0.3117 0.0559  -0.0686 0.0718  85  ALA A CB  
652  N N   . ARG A 86  ? 0.5265 1.0189 0.3969 0.0416  -0.0695 0.0896  86  ARG A N   
653  C CA  . ARG A 86  ? 0.5981 1.0684 0.4260 0.0475  -0.0755 0.1016  86  ARG A CA  
654  C C   . ARG A 86  ? 0.7045 1.1945 0.5198 0.0717  -0.0858 0.0980  86  ARG A C   
655  O O   . ARG A 86  ? 0.7968 1.2589 0.5738 0.0871  -0.0958 0.1096  86  ARG A O   
656  C CB  . ARG A 86  ? 0.7666 1.2498 0.5921 0.0281  -0.0678 0.1016  86  ARG A CB  
657  C CG  . ARG A 86  ? 0.7919 1.2575 0.6285 0.0046  -0.0581 0.1036  86  ARG A CG  
658  C CD  . ARG A 86  ? 0.9789 1.4590 0.8081 -0.0135 -0.0515 0.1037  86  ARG A CD  
659  N NE  . ARG A 86  ? 1.0682 1.5925 0.9019 -0.0069 -0.0534 0.0940  86  ARG A NE  
660  C CZ  . ARG A 86  ? 1.1830 1.7085 0.9816 0.0006  -0.0583 0.1036  86  ARG A CZ  
661  N NH1 . ARG A 86  ? 1.3117 1.7918 1.0674 0.0011  -0.0620 0.1250  86  ARG A NH1 
662  N NH2 . ARG A 86  ? 1.1130 1.6846 0.9193 0.0077  -0.0600 0.0918  86  ARG A NH2 
663  N N   . ARG A 87  ? 0.6290 1.1666 0.4775 0.0751  -0.0840 0.0813  87  ARG A N   
664  C CA  . ARG A 87  ? 0.6048 1.1696 0.4468 0.0978  -0.0932 0.0739  87  ARG A CA  
665  C C   . ARG A 87  ? 0.6462 1.2470 0.5261 0.1031  -0.0921 0.0586  87  ARG A C   
666  O O   . ARG A 87  ? 0.6267 1.2429 0.5440 0.0862  -0.0828 0.0515  87  ARG A O   
667  C CB  . ARG A 87  ? 0.5827 1.1817 0.4208 0.0966  -0.0926 0.0674  87  ARG A CB  
668  C CG  . ARG A 87  ? 0.7747 1.3451 0.5687 0.0953  -0.0953 0.0843  87  ARG A CG  
669  C CD  . ARG A 87  ? 0.6768 1.2912 0.4696 0.0954  -0.0946 0.0758  87  ARG A CD  
670  N NE  . ARG A 87  ? 0.7075 1.3558 0.5398 0.0730  -0.0830 0.0611  87  ARG A NE  
671  C CZ  . ARG A 87  ? 0.6383 1.3327 0.4822 0.0691  -0.0805 0.0478  87  ARG A CZ  
672  N NH1 . ARG A 87  ? 0.5490 1.2647 0.3664 0.0860  -0.0880 0.0482  87  ARG A NH1 
673  N NH2 . ARG A 87  ? 0.4737 1.1939 0.3562 0.0493  -0.0714 0.0330  87  ARG A NH2 
674  N N   . SER A 88  ? 0.7083 1.3231 0.5776 0.1267  -0.1022 0.0537  88  SER A N   
675  C CA  . SER A 88  ? 0.6671 1.3225 0.5692 0.1328  -0.1018 0.0387  88  SER A CA  
676  C C   . SER A 88  ? 0.5840 1.2913 0.5210 0.1227  -0.0954 0.0216  88  SER A C   
677  O O   . SER A 88  ? 0.6356 1.3578 0.5617 0.1245  -0.0970 0.0177  88  SER A O   
678  C CB  . SER A 88  ? 0.7101 1.3714 0.5892 0.1624  -0.1154 0.0356  88  SER A CB  
679  O OG  . SER A 88  ? 0.9203 1.5367 0.7747 0.1725  -0.1222 0.0476  88  SER A OG  
680  N N   . GLY A 89  ? 0.5173 1.2523 0.4964 0.1118  -0.0884 0.0116  89  GLY A N   
681  C CA  . GLY A 89  ? 0.4611 1.2440 0.4790 0.1012  -0.0828 -0.0063 89  GLY A CA  
682  C C   . GLY A 89  ? 0.5252 1.3239 0.5881 0.0847  -0.0743 -0.0111 89  GLY A C   
683  O O   . GLY A 89  ? 0.5381 1.3177 0.6009 0.0844  -0.0731 -0.0011 89  GLY A O   
684  N N   . VAL A 90  ? 0.4458 1.2798 0.5477 0.0710  -0.0688 -0.0264 90  VAL A N   
685  C CA  . VAL A 90  ? 0.4533 1.2991 0.5993 0.0529  -0.0607 -0.0293 90  VAL A CA  
686  C C   . VAL A 90  ? 0.4510 1.2834 0.6213 0.0313  -0.0539 -0.0303 90  VAL A C   
687  O O   . VAL A 90  ? 0.5589 1.3994 0.7284 0.0285  -0.0546 -0.0395 90  VAL A O   
688  C CB  . VAL A 90  ? 0.4318 1.3302 0.6110 0.0529  -0.0603 -0.0477 90  VAL A CB  
689  C CG1 . VAL A 90  ? 0.1854 1.1149 0.3775 0.0515  -0.0617 -0.0670 90  VAL A CG1 
690  C CG2 . VAL A 90  ? 0.2811 1.1869 0.5038 0.0326  -0.0519 -0.0464 90  VAL A CG2 
691  N N   . ILE A 91  ? 0.4308 1.2451 0.6220 0.0173  -0.0479 -0.0213 91  ILE A N   
692  C CA  . ILE A 91  ? 0.3520 1.1534 0.5700 -0.0020 -0.0424 -0.0229 91  ILE A CA  
693  C C   . ILE A 91  ? 0.4362 1.2738 0.6993 -0.0134 -0.0406 -0.0427 91  ILE A C   
694  O O   . ILE A 91  ? 0.4514 1.3108 0.7432 -0.0185 -0.0385 -0.0465 91  ILE A O   
695  C CB  . ILE A 91  ? 0.3152 1.0902 0.5432 -0.0112 -0.0377 -0.0075 91  ILE A CB  
696  C CG1 . ILE A 91  ? 0.2455 0.9831 0.4315 -0.0014 -0.0397 0.0090  91  ILE A CG1 
697  C CG2 . ILE A 91  ? 0.4153 1.1815 0.6778 -0.0302 -0.0331 -0.0113 91  ILE A CG2 
698  C CD1 . ILE A 91  ? 0.2341 0.9483 0.4259 -0.0077 -0.0357 0.0231  91  ILE A CD1 
699  N N   . VAL A 92  ? 0.3829 1.2291 0.6531 -0.0180 -0.0416 -0.0562 92  VAL A N   
700  C CA  . VAL A 92  ? 0.3614 1.2433 0.6756 -0.0275 -0.0413 -0.0787 92  VAL A CA  
701  C C   . VAL A 92  ? 0.3704 1.2379 0.7213 -0.0460 -0.0383 -0.0834 92  VAL A C   
702  O O   . VAL A 92  ? 0.4438 1.3335 0.8383 -0.0565 -0.0383 -0.1010 92  VAL A O   
703  C CB  . VAL A 92  ? 0.3241 1.2383 0.6270 -0.0175 -0.0460 -0.0966 92  VAL A CB  
704  C CG1 . VAL A 92  ? 0.3503 1.2847 0.6244 0.0020  -0.0505 -0.0957 92  VAL A CG1 
705  C CG2 . VAL A 92  ? 0.2601 1.1538 0.5335 -0.0166 -0.0468 -0.0916 92  VAL A CG2 
706  N N   . ASP A 93  ? 0.2844 1.1148 0.6186 -0.0495 -0.0365 -0.0690 93  ASP A N   
707  C CA  . ASP A 93  ? 0.3063 1.1215 0.6732 -0.0645 -0.0349 -0.0731 93  ASP A CA  
708  C C   . ASP A 93  ? 0.2650 1.0392 0.6107 -0.0659 -0.0323 -0.0524 93  ASP A C   
709  O O   . ASP A 93  ? 0.3727 1.1305 0.6765 -0.0571 -0.0324 -0.0410 93  ASP A O   
710  C CB  . ASP A 93  ? 0.5208 1.3532 0.8983 -0.0674 -0.0378 -0.0945 93  ASP A CB  
711  C CG  . ASP A 93  ? 0.6634 1.4793 1.0736 -0.0805 -0.0379 -0.1009 93  ASP A CG  
712  O OD1 . ASP A 93  ? 0.6808 1.5046 1.1368 -0.0900 -0.0392 -0.1124 93  ASP A OD1 
713  O OD2 . ASP A 93  ? 0.7266 1.5215 1.1173 -0.0814 -0.0372 -0.0951 93  ASP A OD2 
714  N N   . VAL A 94  ? 0.3580 1.1155 0.7335 -0.0770 -0.0304 -0.0474 94  VAL A N   
715  C CA  . VAL A 94  ? 0.2981 1.0200 0.6617 -0.0795 -0.0283 -0.0312 94  VAL A CA  
716  C C   . VAL A 94  ? 0.3062 1.0222 0.7093 -0.0914 -0.0299 -0.0429 94  VAL A C   
717  O O   . VAL A 94  ? 0.4769 1.2012 0.9195 -0.0997 -0.0309 -0.0490 94  VAL A O   
718  C CB  . VAL A 94  ? 0.3710 1.0797 0.7300 -0.0780 -0.0251 -0.0100 94  VAL A CB  
719  C CG1 . VAL A 94  ? 0.1811 0.8564 0.5288 -0.0794 -0.0234 0.0050  94  VAL A CG1 
720  C CG2 . VAL A 94  ? 0.3966 1.1162 0.7216 -0.0644 -0.0254 -0.0028 94  VAL A CG2 
721  N N   . LYS A 95  ? 0.3009 1.0038 0.6949 -0.0925 -0.0309 -0.0474 95  LYS A N   
722  C CA  . LYS A 95  ? 0.3640 1.0662 0.7950 -0.1010 -0.0346 -0.0639 95  LYS A CA  
723  C C   . LYS A 95  ? 0.2999 0.9740 0.7223 -0.1023 -0.0343 -0.0563 95  LYS A C   
724  O O   . LYS A 95  ? 0.3988 1.0648 0.7852 -0.0982 -0.0319 -0.0503 95  LYS A O   
725  C CB  . LYS A 95  ? 0.5062 1.2398 0.9447 -0.1007 -0.0381 -0.0901 95  LYS A CB  
726  C CG  . LYS A 95  ? 0.5876 1.3230 1.0591 -0.1069 -0.0431 -0.1107 95  LYS A CG  
727  C CD  . LYS A 95  ? 0.6183 1.3894 1.0887 -0.1052 -0.0460 -0.1359 95  LYS A CD  
728  C CE  . LYS A 95  ? 0.6335 1.4395 1.1292 -0.1045 -0.0488 -0.1542 95  LYS A CE  
729  N NZ  . LYS A 95  ? 0.7291 1.5730 1.2357 -0.1036 -0.0532 -0.1834 95  LYS A NZ  
730  N N   . ASN A 96  ? 0.2492 0.9078 0.7051 -0.1082 -0.0371 -0.0568 96  ASN A N   
731  C CA  . ASN A 96  ? 0.2949 0.9304 0.7474 -0.1083 -0.0382 -0.0534 96  ASN A CA  
732  C C   . ASN A 96  ? 0.2829 0.9334 0.7403 -0.1092 -0.0420 -0.0781 96  ASN A C   
733  O O   . ASN A 96  ? 0.3008 0.9723 0.7884 -0.1121 -0.0470 -0.1005 96  ASN A O   
734  C CB  . ASN A 96  ? 0.3369 0.9507 0.8226 -0.1125 -0.0413 -0.0454 96  ASN A CB  
735  C CG  . ASN A 96  ? 0.3182 0.9192 0.7930 -0.1118 -0.0363 -0.0179 96  ASN A CG  
736  O OD1 . ASN A 96  ? 0.4082 0.9956 0.8526 -0.1063 -0.0325 -0.0010 96  ASN A OD1 
737  N ND2 . ASN A 96  ? 0.2886 0.8968 0.7889 -0.1178 -0.0362 -0.0146 96  ASN A ND2 
738  N N   . VAL A 97  ? 0.3412 0.9840 0.7691 -0.1072 -0.0396 -0.0749 97  VAL A N   
739  C CA  . VAL A 97  ? 0.3437 1.0075 0.7669 -0.1090 -0.0411 -0.0961 97  VAL A CA  
740  C C   . VAL A 97  ? 0.3496 0.9971 0.7576 -0.1092 -0.0399 -0.0929 97  VAL A C   
741  O O   . VAL A 97  ? 0.5228 1.1488 0.9028 -0.1070 -0.0350 -0.0722 97  VAL A O   
742  C CB  . VAL A 97  ? 0.3336 1.0179 0.7223 -0.1074 -0.0368 -0.0951 97  VAL A CB  
743  C CG1 . VAL A 97  ? 0.3053 0.9917 0.6607 -0.1096 -0.0333 -0.0958 97  VAL A CG1 
744  C CG2 . VAL A 97  ? 0.3573 1.0767 0.7693 -0.1079 -0.0407 -0.1168 97  VAL A CG2 
745  N N   . ARG A 98  ? 0.3970 1.0572 0.8251 -0.1113 -0.0448 -0.1154 98  ARG A N   
746  C CA  . ARG A 98  ? 0.4308 1.0833 0.8449 -0.1118 -0.0437 -0.1171 98  ARG A CA  
747  C C   . ARG A 98  ? 0.4641 1.1411 0.8486 -0.1169 -0.0390 -0.1263 98  ARG A C   
748  O O   . ARG A 98  ? 0.4573 1.1672 0.8516 -0.1195 -0.0413 -0.1468 98  ARG A O   
749  C CB  . ARG A 98  ? 0.4034 1.0570 0.8562 -0.1100 -0.0528 -0.1374 98  ARG A CB  
750  C CG  . ARG A 98  ? 0.5554 1.1977 0.9971 -0.1084 -0.0524 -0.1370 98  ARG A CG  
751  C CD  . ARG A 98  ? 0.7378 1.3440 1.1761 -0.1032 -0.0515 -0.1117 98  ARG A CD  
752  N NE  . ARG A 98  ? 0.8525 1.4443 1.3287 -0.1001 -0.0593 -0.1104 98  ARG A NE  
753  C CZ  . ARG A 98  ? 0.8883 1.4697 1.3940 -0.0953 -0.0686 -0.1209 98  ARG A CZ  
754  N NH1 . ARG A 98  ? 0.8520 1.4400 1.3540 -0.0919 -0.0713 -0.1353 98  ARG A NH1 
755  N NH2 . ARG A 98  ? 0.9337 1.4979 1.4729 -0.0940 -0.0756 -0.1170 98  ARG A NH2 
756  N N   . LYS A 99  ? 0.3945 1.0567 0.7430 -0.1190 -0.0324 -0.1111 99  LYS A N   
757  C CA  . LYS A 99  ? 0.3010 0.9821 0.6200 -0.1265 -0.0272 -0.1169 99  LYS A CA  
758  C C   . LYS A 99  ? 0.4617 1.1550 0.7910 -0.1305 -0.0287 -0.1356 99  LYS A C   
759  O O   . LYS A 99  ? 0.4820 1.1539 0.8117 -0.1281 -0.0287 -0.1295 99  LYS A O   
760  C CB  . LYS A 99  ? 0.3477 1.0050 0.6226 -0.1279 -0.0196 -0.0916 99  LYS A CB  
761  C CG  . LYS A 99  ? 0.3964 1.0646 0.6399 -0.1384 -0.0137 -0.0939 99  LYS A CG  
762  C CD  . LYS A 99  ? 0.5010 1.1495 0.7018 -0.1395 -0.0082 -0.0705 99  LYS A CD  
763  C CE  . LYS A 99  ? 0.5418 1.1657 0.7163 -0.1451 -0.0029 -0.0590 99  LYS A CE  
764  N NZ  . LYS A 99  ? 0.5259 1.1363 0.6579 -0.1500 0.0017  -0.0417 99  LYS A NZ  
765  N N   . ILE A 100 ? 0.4550 1.1870 0.7935 -0.1356 -0.0305 -0.1600 100 ILE A N   
766  C CA  . ILE A 100 ? 0.3934 1.1454 0.7404 -0.1398 -0.0319 -0.1810 100 ILE A CA  
767  C C   . ILE A 100 ? 0.3585 1.1389 0.6736 -0.1524 -0.0241 -0.1847 100 ILE A C   
768  O O   . ILE A 100 ? 0.4367 1.2508 0.7497 -0.1562 -0.0238 -0.1951 100 ILE A O   
769  C CB  . ILE A 100 ? 0.4813 1.2598 0.8740 -0.1344 -0.0428 -0.2124 100 ILE A CB  
770  C CG1 . ILE A 100 ? 0.3956 1.1440 0.8212 -0.1238 -0.0510 -0.2068 100 ILE A CG1 
771  C CG2 . ILE A 100 ? 0.4556 1.2541 0.8571 -0.1362 -0.0454 -0.2349 100 ILE A CG2 
772  C CD1 . ILE A 100 ? 0.4037 1.1726 0.8767 -0.1181 -0.0634 -0.2375 100 ILE A CD1 
773  N N   . VAL A 101 ? 0.3439 1.1118 0.6343 -0.1594 -0.0176 -0.1758 101 VAL A N   
774  C CA  . VAL A 101 ? 0.4339 1.2228 0.6916 -0.1744 -0.0090 -0.1753 101 VAL A CA  
775  C C   . VAL A 101 ? 0.4775 1.3058 0.7504 -0.1812 -0.0100 -0.2045 101 VAL A C   
776  O O   . VAL A 101 ? 0.3925 1.2111 0.6760 -0.1787 -0.0117 -0.2112 101 VAL A O   
777  C CB  . VAL A 101 ? 0.4316 1.1815 0.6522 -0.1798 -0.0009 -0.1477 101 VAL A CB  
778  C CG1 . VAL A 101 ? 0.4253 1.1909 0.6096 -0.1972 0.0082  -0.1424 101 VAL A CG1 
779  C CG2 . VAL A 101 ? 0.5144 1.2272 0.7246 -0.1698 -0.0019 -0.1222 101 VAL A CG2 
780  N N   . VAL A 102 ? 0.5194 1.3960 0.7928 -0.1888 -0.0092 -0.2225 102 VAL A N   
781  C CA  . VAL A 102 ? 0.4244 1.3505 0.7128 -0.1956 -0.0105 -0.2540 102 VAL A CA  
782  C C   . VAL A 102 ? 0.4701 1.4190 0.7213 -0.2165 0.0016  -0.2488 102 VAL A C   
783  O O   . VAL A 102 ? 0.4576 1.4156 0.6800 -0.2260 0.0080  -0.2342 102 VAL A O   
784  C CB  . VAL A 102 ? 0.3122 1.2867 0.6310 -0.1899 -0.0187 -0.2828 102 VAL A CB  
785  C CG1 . VAL A 102 ? 0.3719 1.4029 0.7068 -0.1957 -0.0208 -0.3179 102 VAL A CG1 
786  C CG2 . VAL A 102 ? 0.2681 1.2197 0.6269 -0.1715 -0.0310 -0.2894 102 VAL A CG2 
787  N N   . GLU A 103 ? 0.4889 1.4474 0.7410 -0.2238 0.0043  -0.2606 103 GLU A N   
788  C CA  . GLU A 103 ? 0.5650 1.5519 0.7876 -0.2463 0.0157  -0.2605 103 GLU A CA  
789  C C   . GLU A 103 ? 0.5738 1.6320 0.8181 -0.2509 0.0128  -0.2979 103 GLU A C   
790  O O   . GLU A 103 ? 0.5739 1.6501 0.8532 -0.2398 0.0037  -0.3266 103 GLU A O   
791  C CB  . GLU A 103 ? 0.5315 1.4913 0.7434 -0.2528 0.0209  -0.2539 103 GLU A CB  
792  C CG  . GLU A 103 ? 0.5534 1.5364 0.7347 -0.2788 0.0337  -0.2514 103 GLU A CG  
793  C CD  . GLU A 103 ? 0.6656 1.6267 0.8433 -0.2839 0.0377  -0.2511 103 GLU A CD  
794  O OE1 . GLU A 103 ? 0.6961 1.6624 0.8467 -0.3066 0.0490  -0.2435 103 GLU A OE1 
795  O OE2 . GLU A 103 ? 0.5415 1.4809 0.7440 -0.2653 0.0293  -0.2584 103 GLU A OE2 
796  N N   . THR A 104 ? 0.5893 1.6897 0.8128 -0.2661 0.0197  -0.2981 104 THR A N   
797  C CA  . THR A 104 ? 0.6545 1.8310 0.8988 -0.2700 0.0168  -0.3352 104 THR A CA  
798  C C   . THR A 104 ? 0.6202 1.8345 0.8490 -0.2922 0.0268  -0.3458 104 THR A C   
799  O O   . THR A 104 ? 0.6297 1.8122 0.8254 -0.3086 0.0379  -0.3201 104 THR A O   
800  C CB  . THR A 104 ? 0.7363 1.9513 0.9709 -0.2728 0.0177  -0.3345 104 THR A CB  
801  O OG1 . THR A 104 ? 0.8751 2.0709 1.0601 -0.2909 0.0307  -0.2983 104 THR A OG1 
802  C CG2 . THR A 104 ? 0.6644 1.8552 0.9237 -0.2503 0.0064  -0.3338 104 THR A CG2 
803  N N   . ILE A 105 ? 1.1259 1.5424 1.6357 0.0471  0.3538  0.2401  105 ILE A N   
804  C CA  . ILE A 105 ? 1.0888 1.5351 1.5882 0.0519  0.3547  0.2653  105 ILE A CA  
805  C C   . ILE A 105 ? 1.1910 1.6536 1.6508 0.0225  0.3045  0.2648  105 ILE A C   
806  O O   . ILE A 105 ? 1.1469 1.6410 1.5997 0.0268  0.2822  0.2908  105 ILE A O   
807  C CB  . ILE A 105 ? 1.0185 1.4557 1.5167 0.0546  0.4093  0.2598  105 ILE A CB  
808  C CG1 . ILE A 105 ? 0.9865 1.4044 1.5243 0.0832  0.4593  0.2597  105 ILE A CG1 
809  C CG2 . ILE A 105 ? 0.8744 1.3459 1.3640 0.0609  0.4095  0.2869  105 ILE A CG2 
810  C CD1 . ILE A 105 ? 0.8627 1.2431 1.4080 0.0755  0.4702  0.2296  105 ILE A CD1 
811  N N   . ASP A 106 ? 1.3898 1.8303 1.8234 -0.0078 0.2861  0.2353  106 ASP A N   
812  C CA  . ASP A 106 ? 1.5656 2.0172 1.9615 -0.0379 0.2337  0.2324  106 ASP A CA  
813  C C   . ASP A 106 ? 1.6089 2.0786 2.0149 -0.0301 0.1811  0.2482  106 ASP A C   
814  O O   . ASP A 106 ? 1.6198 2.0929 2.0000 -0.0537 0.1312  0.2420  106 ASP A O   
815  C CB  . ASP A 106 ? 1.6732 2.0940 2.0414 -0.0712 0.2278  0.1957  106 ASP A CB  
816  C CG  . ASP A 106 ? 1.7182 2.1428 2.0457 -0.1007 0.2283  0.1882  106 ASP A CG  
817  O OD1 . ASP A 106 ? 1.7342 2.1883 2.0457 -0.1042 0.2070  0.2109  106 ASP A OD1 
818  O OD2 . ASP A 106 ? 1.7258 2.1244 2.0368 -0.1210 0.2497  0.1594  106 ASP A OD2 
819  N N   . ARG A 107 ? 1.6369 2.1177 2.0810 0.0033  0.1932  0.2680  107 ARG A N   
820  C CA  . ARG A 107 ? 1.5677 2.0705 2.0277 0.0169  0.1493  0.2869  107 ARG A CA  
821  C C   . ARG A 107 ? 1.4289 1.9254 1.8704 -0.0071 0.0929  0.2692  107 ARG A C   
822  O O   . ARG A 107 ? 1.4567 1.9255 1.8820 -0.0298 0.0926  0.2386  107 ARG A O   
823  C CB  . ARG A 107 ? 1.6210 2.1610 2.0792 0.0293  0.1360  0.3226  107 ARG A CB  
824  C CG  . ARG A 107 ? 1.6499 2.2083 2.0721 0.0040  0.0810  0.3291  107 ARG A CG  
825  C CD  . ARG A 107 ? 1.7236 2.2677 2.1043 -0.0310 0.0832  0.3086  107 ARG A CD  
826  N NE  . ARG A 107 ? 1.7380 2.2928 2.0848 -0.0586 0.0238  0.3094  107 ARG A NE  
827  C CZ  . ARG A 107 ? 1.7563 2.3009 2.0632 -0.0933 0.0113  0.2924  107 ARG A CZ  
828  N NH1 . ARG A 107 ? 1.7847 2.3091 2.0805 -0.1048 0.0548  0.2722  107 ARG A NH1 
829  N NH2 . ARG A 107 ? 1.7258 2.2803 2.0039 -0.1170 -0.0454 0.2956  107 ARG A NH2 
830  N N   . LYS A 108 ? 1.2795 1.8015 1.7253 -0.0008 0.0454  0.2882  108 LYS A N   
831  C CA  . LYS A 108 ? 1.1770 1.6991 1.6012 -0.0245 -0.0155 0.2764  108 LYS A CA  
832  C C   . LYS A 108 ? 1.0838 1.5877 1.5262 -0.0238 -0.0308 0.2528  108 LYS A C   
833  O O   . LYS A 108 ? 0.9063 1.4261 1.3645 -0.0138 -0.0696 0.2605  108 LYS A O   
834  C CB  . LYS A 108 ? 1.1649 1.6765 1.5431 -0.0615 -0.0295 0.2618  108 LYS A CB  
835  C CG  . LYS A 108 ? 1.1614 1.6393 1.5217 -0.0887 -0.0350 0.2241  108 LYS A CG  
836  C CD  . LYS A 108 ? 1.1156 1.5941 1.4669 -0.1040 -0.0991 0.2145  108 LYS A CD  
837  C CE  . LYS A 108 ? 1.0786 1.5241 1.4109 -0.1322 -0.1064 0.1772  108 LYS A CE  
838  N NZ  . LYS A 108 ? 0.9920 1.4350 1.3323 -0.1362 -0.1573 0.1645  108 LYS A NZ  
839  N N   . TYR A 109 ? 1.1543 1.6260 1.5949 -0.0344 -0.0006 0.2236  109 TYR A N   
840  C CA  . TYR A 109 ? 1.2180 1.6727 1.6769 -0.0334 -0.0110 0.2006  109 TYR A CA  
841  C C   . TYR A 109 ? 1.2103 1.6392 1.6909 -0.0220 0.0462  0.1850  109 TYR A C   
842  O O   . TYR A 109 ? 1.2389 1.6547 1.7125 -0.0234 0.0917  0.1828  109 TYR A O   
843  C CB  . TYR A 109 ? 1.3893 1.8298 1.8192 -0.0662 -0.0587 0.1743  109 TYR A CB  
844  C CG  . TYR A 109 ? 1.6037 2.0098 2.0101 -0.0923 -0.0355 0.1426  109 TYR A CG  
845  C CD1 . TYR A 109 ? 1.6885 2.0728 2.0876 -0.1117 -0.0603 0.1117  109 TYR A CD1 
846  C CD2 . TYR A 109 ? 1.7234 2.1197 2.1149 -0.0978 0.0098  0.1429  109 TYR A CD2 
847  C CE1 . TYR A 109 ? 1.7776 2.1306 2.1550 -0.1360 -0.0400 0.0825  109 TYR A CE1 
848  C CE2 . TYR A 109 ? 1.8195 2.1851 2.1895 -0.1221 0.0305  0.1131  109 TYR A CE2 
849  C CZ  . TYR A 109 ? 1.8463 2.1900 2.2089 -0.1412 0.0055  0.0834  109 TYR A CZ  
850  O OH  . TYR A 109 ? 1.8869 2.2000 2.2280 -0.1655 0.0256  0.0537  109 TYR A OH  
851  N N   . THR A 110 ? 0.6779 1.7915 0.7994 0.1266  -0.0542 0.0263  110 THR A N   
852  C CA  . THR A 110 ? 0.6266 1.7169 0.7962 0.1194  -0.0441 0.0083  110 THR A CA  
853  C C   . THR A 110 ? 0.4803 1.6204 0.6927 0.1183  -0.0363 -0.0253 110 THR A C   
854  O O   . THR A 110 ? 0.4087 1.5923 0.6079 0.1241  -0.0374 -0.0295 110 THR A O   
855  C CB  . THR A 110 ? 0.6559 1.6679 0.8020 0.1185  -0.0387 0.0389  110 THR A CB  
856  O OG1 . THR A 110 ? 0.7580 1.7281 0.9355 0.1103  -0.0353 0.0342  110 THR A OG1 
857  C CG2 . THR A 110 ? 0.6430 1.6563 0.7922 0.1210  -0.0288 0.0372  110 THR A CG2 
858  N N   . LYS A 111 ? 0.4403 1.5742 0.7042 0.1106  -0.0293 -0.0494 111 LYS A N   
859  C CA  . LYS A 111 ? 0.3946 1.5691 0.7027 0.1076  -0.0217 -0.0812 111 LYS A CA  
860  C C   . LYS A 111 ? 0.3485 1.4723 0.6704 0.1024  -0.0108 -0.0734 111 LYS A C   
861  O O   . LYS A 111 ? 0.3394 1.4139 0.6775 0.0957  -0.0082 -0.0695 111 LYS A O   
862  C CB  . LYS A 111 ? 0.2984 1.5141 0.6588 0.1022  -0.0232 -0.1200 111 LYS A CB  
863  C CG  . LYS A 111 ? 0.3505 1.6131 0.7568 0.0987  -0.0172 -0.1550 111 LYS A CG  
864  C CD  . LYS A 111 ? 0.4777 1.7985 0.8652 0.1057  -0.0196 -0.1594 111 LYS A CD  
865  C CE  . LYS A 111 ? 0.5212 1.8440 0.9195 0.1050  -0.0107 -0.1612 111 LYS A CE  
866  N NZ  . LYS A 111 ? 0.5443 1.9005 1.0015 0.0973  -0.0056 -0.1994 111 LYS A NZ  
867  N N   . THR A 112 ? 0.3084 1.4438 0.6228 0.1056  -0.0046 -0.0699 112 THR A N   
868  C CA  . THR A 112 ? 0.2697 1.3625 0.5968 0.1005  0.0066  -0.0627 112 THR A CA  
869  C C   . THR A 112 ? 0.2816 1.4122 0.6667 0.0930  0.0135  -0.0985 112 THR A C   
870  O O   . THR A 112 ? 0.2884 1.4814 0.6870 0.0960  0.0122  -0.1198 112 THR A O   
871  C CB  . THR A 112 ? 0.2774 1.3542 0.5607 0.1088  0.0104  -0.0349 112 THR A CB  
872  O OG1 . THR A 112 ? 0.4624 1.4861 0.6928 0.1138  0.0052  0.0014  112 THR A OG1 
873  C CG2 . THR A 112 ? 0.3053 1.3550 0.6099 0.1032  0.0236  -0.0342 112 THR A CG2 
874  N N   . TYR A 113 ? 0.2859 1.3782 0.7050 0.0826  0.0199  -0.1048 113 TYR A N   
875  C CA  . TYR A 113 ? 0.2597 1.3792 0.7325 0.0739  0.0268  -0.1354 113 TYR A CA  
876  C C   . TYR A 113 ? 0.3176 1.3979 0.7930 0.0687  0.0386  -0.1208 113 TYR A C   
877  O O   . TYR A 113 ? 0.3404 1.3577 0.7874 0.0682  0.0420  -0.0909 113 TYR A O   
878  C CB  . TYR A 113 ? 0.1493 1.2645 0.6690 0.0645  0.0241  -0.1617 113 TYR A CB  
879  C CG  . TYR A 113 ? 0.3836 1.5439 0.9106 0.0686  0.0139  -0.1825 113 TYR A CG  
880  C CD1 . TYR A 113 ? 0.3884 1.6201 0.9418 0.0698  0.0115  -0.2152 113 TYR A CD1 
881  C CD2 . TYR A 113 ? 0.3670 1.4993 0.8753 0.0709  0.0066  -0.1699 113 TYR A CD2 
882  C CE1 . TYR A 113 ? 0.3877 1.6622 0.9473 0.0735  0.0026  -0.2351 113 TYR A CE1 
883  C CE2 . TYR A 113 ? 0.4503 1.6262 0.9660 0.0746  -0.0021 -0.1891 113 TYR A CE2 
884  C CZ  . TYR A 113 ? 0.4143 1.6613 0.9553 0.0759  -0.0037 -0.2219 113 TYR A CZ  
885  O OH  . TYR A 113 ? 0.5701 1.8614 1.1174 0.0796  -0.0118 -0.2412 113 TYR A OH  
886  N N   . TYR A 114 ? 0.2632 1.3820 0.7738 0.0642  0.0449  -0.1428 114 TYR A N   
887  C CA  . TYR A 114 ? 0.3139 1.4046 0.8354 0.0575  0.0569  -0.1338 114 TYR A CA  
888  C C   . TYR A 114 ? 0.3304 1.4366 0.9133 0.0437  0.0604  -0.1659 114 TYR A C   
889  O O   . TYR A 114 ? 0.3653 1.5303 0.9784 0.0425  0.0603  -0.1929 114 TYR A O   
890  C CB  . TYR A 114 ? 0.2468 1.3724 0.7492 0.0660  0.0618  -0.1267 114 TYR A CB  
891  C CG  . TYR A 114 ? 0.3429 1.4506 0.7829 0.0799  0.0587  -0.0937 114 TYR A CG  
892  C CD1 . TYR A 114 ? 0.2974 1.3378 0.7011 0.0813  0.0636  -0.0596 114 TYR A CD1 
893  C CD2 . TYR A 114 ? 0.3416 1.4992 0.7580 0.0916  0.0504  -0.0965 114 TYR A CD2 
894  C CE1 . TYR A 114 ? 0.3549 1.3769 0.7005 0.0942  0.0600  -0.0296 114 TYR A CE1 
895  C CE2 . TYR A 114 ? 0.3399 1.4798 0.6987 0.1041  0.0465  -0.0663 114 TYR A CE2 
896  C CZ  . TYR A 114 ? 0.3742 1.4456 0.6977 0.1055  0.0512  -0.0330 114 TYR A CZ  
897  O OH  . TYR A 114 ? 0.3168 1.3684 0.5817 0.1181  0.0466  -0.0030 114 TYR A OH  
898  N N   . ILE A 115 ? 0.3126 1.3651 0.9138 0.0329  0.0627  -0.1628 115 ILE A N   
899  C CA  . ILE A 115 ? 0.2725 1.3323 0.9312 0.0189  0.0649  -0.1919 115 ILE A CA  
900  C C   . ILE A 115 ? 0.3191 1.3507 0.9887 0.0092  0.0773  -0.1806 115 ILE A C   
901  O O   . ILE A 115 ? 0.3536 1.3232 1.0004 0.0064  0.0825  -0.1525 115 ILE A O   
902  C CB  . ILE A 115 ? 0.3981 1.4209 1.0766 0.0123  0.0581  -0.2004 115 ILE A CB  
903  C CG1 . ILE A 115 ? 0.3840 1.4393 1.0528 0.0220  0.0464  -0.2123 115 ILE A CG1 
904  C CG2 . ILE A 115 ? 0.4355 1.4641 1.1734 -0.0024 0.0593  -0.2310 115 ILE A CG2 
905  C CD1 . ILE A 115 ? 0.3318 1.3715 0.9417 0.0347  0.0429  -0.1805 115 ILE A CD1 
906  N N   . PRO A 116 ? 0.3528 1.4318 1.0561 0.0041  0.0821  -0.2019 116 PRO A N   
907  C CA  . PRO A 116 ? 0.3447 1.4067 1.0650 -0.0065 0.0942  -0.1950 116 PRO A CA  
908  C C   . PRO A 116 ? 0.3634 1.3638 1.1054 -0.0213 0.0960  -0.1919 116 PRO A C   
909  O O   . PRO A 116 ? 0.4502 1.4526 1.2271 -0.0284 0.0884  -0.2164 116 PRO A O   
910  C CB  . PRO A 116 ? 0.3275 1.4561 1.0945 -0.0122 0.0941  -0.2296 116 PRO A CB  
911  C CG  . PRO A 116 ? 0.2862 1.4723 1.0401 0.0013  0.0846  -0.2438 116 PRO A CG  
912  C CD  . PRO A 116 ? 0.2632 1.4170 0.9905 0.0078  0.0757  -0.2344 116 PRO A CD  
913  N N   . GLU A 117 ? 0.2901 1.2359 1.0108 -0.0255 0.1054  -0.1625 117 GLU A N   
914  C CA  . GLU A 117 ? 0.4152 1.2989 1.1535 -0.0401 0.1070  -0.1567 117 GLU A CA  
915  C C   . GLU A 117 ? 0.4079 1.3123 1.2079 -0.0566 0.1064  -0.1893 117 GLU A C   
916  O O   . GLU A 117 ? 0.3655 1.2372 1.1911 -0.0665 0.1006  -0.1999 117 GLU A O   
917  C CB  . GLU A 117 ? 0.5178 1.3487 1.2265 -0.0434 0.1193  -0.1218 117 GLU A CB  
918  C CG  . GLU A 117 ? 0.6556 1.4595 1.3007 -0.0276 0.1198  -0.0879 117 GLU A CG  
919  C CD  . GLU A 117 ? 0.7735 1.5221 1.3947 -0.0255 0.1107  -0.0732 117 GLU A CD  
920  O OE1 . GLU A 117 ? 0.7868 1.5182 1.4411 -0.0353 0.1040  -0.0896 117 GLU A OE1 
921  O OE2 . GLU A 117 ? 0.8450 1.5669 1.4143 -0.0138 0.1098  -0.0450 117 GLU A OE2 
922  N N   . SER A 118 ? 0.3945 1.3533 1.2184 -0.0592 0.1118  -0.2054 118 SER A N   
923  C CA  . SER A 118 ? 0.3042 1.2869 1.1863 -0.0752 0.1110  -0.2364 118 SER A CA  
924  C C   . SER A 118 ? 0.3992 1.4058 1.3127 -0.0756 0.0973  -0.2704 118 SER A C   
925  O O   . SER A 118 ? 0.5636 1.5853 1.5255 -0.0887 0.0944  -0.2981 118 SER A O   
926  C CB  . SER A 118 ? 0.3668 1.4104 1.2652 -0.0758 0.1182  -0.2469 118 SER A CB  
927  O OG  . SER A 118 ? 0.3195 1.4256 1.2105 -0.0616 0.1115  -0.2629 118 SER A OG  
928  N N   . ALA A 119 ? 0.2842 1.2953 1.1702 -0.0613 0.0888  -0.2686 119 ALA A N   
929  C CA  . ALA A 119 ? 0.3943 1.4273 1.3059 -0.0598 0.0762  -0.2994 119 ALA A CA  
930  C C   . ALA A 119 ? 0.5043 1.4742 1.4114 -0.0622 0.0702  -0.2906 119 ALA A C   
931  O O   . ALA A 119 ? 0.4753 1.4551 1.3950 -0.0580 0.0597  -0.3106 119 ALA A O   
932  C CB  . ALA A 119 ? 0.3701 1.4590 1.2580 -0.0427 0.0702  -0.3069 119 ALA A CB  
933  N N   . GLY A 120 ? 0.5982 1.5042 1.4868 -0.0685 0.0769  -0.2603 120 GLY A N   
934  C CA  . GLY A 120 ? 0.6273 1.4679 1.5087 -0.0714 0.0717  -0.2475 120 GLY A CA  
935  C C   . GLY A 120 ? 0.7171 1.5552 1.5635 -0.0558 0.0634  -0.2383 120 GLY A C   
936  O O   . GLY A 120 ? 0.7927 1.6728 1.6533 -0.0489 0.0545  -0.2638 120 GLY A O   
937  N N   . ILE A 121 ? 0.7549 1.5443 1.5551 -0.0505 0.0663  -0.2019 121 ILE A N   
938  C CA  . ILE A 121 ? 0.8164 1.5974 1.5825 -0.0372 0.0580  -0.1902 121 ILE A CA  
939  C C   . ILE A 121 ? 0.9065 1.6515 1.6972 -0.0423 0.0483  -0.2015 121 ILE A C   
940  O O   . ILE A 121 ? 1.0009 1.6914 1.8068 -0.0544 0.0498  -0.1944 121 ILE A O   
941  C CB  . ILE A 121 ? 0.8036 1.5393 1.5118 -0.0306 0.0629  -0.1471 121 ILE A CB  
942  C CG1 . ILE A 121 ? 0.8640 1.6266 1.5508 -0.0269 0.0738  -0.1347 121 ILE A CG1 
943  C CG2 . ILE A 121 ? 0.6656 1.4022 1.3377 -0.0167 0.0536  -0.1359 121 ILE A CG2 
944  C CD1 . ILE A 121 ? 0.8398 1.6792 1.5260 -0.0158 0.0713  -0.1535 121 ILE A CD1 
945  N N   . GLU A 122 ? 0.8744 1.6508 1.6697 -0.0329 0.0383  -0.2193 122 GLU A N   
946  C CA  . GLU A 122 ? 0.9110 1.6598 1.7324 -0.0359 0.0285  -0.2332 122 GLU A CA  
947  C C   . GLU A 122 ? 0.9700 1.6403 1.7644 -0.0387 0.0279  -0.1992 122 GLU A C   
948  O O   . GLU A 122 ? 0.9329 1.5844 1.6786 -0.0305 0.0294  -0.1680 122 GLU A O   
949  C CB  . GLU A 122 ? 0.8792 1.6748 1.7006 -0.0232 0.0189  -0.2524 122 GLU A CB  
950  C CG  . GLU A 122 ? 0.9002 1.7005 1.7697 -0.0266 0.0098  -0.2866 122 GLU A CG  
951  C CD  . GLU A 122 ? 0.9508 1.7843 1.8691 -0.0363 0.0115  -0.3210 122 GLU A CD  
952  O OE1 . GLU A 122 ? 0.9084 1.8084 1.8410 -0.0308 0.0096  -0.3487 122 GLU A OE1 
953  O OE2 . GLU A 122 ? 1.0114 1.8042 1.9528 -0.0501 0.0146  -0.3199 122 GLU A OE2 
954  N N   . PRO A 123 ? 1.0006 1.6231 1.8260 -0.0506 0.0250  -0.2049 123 PRO A N   
955  C CA  . PRO A 123 ? 1.0133 1.5606 1.8158 -0.0535 0.0226  -0.1747 123 PRO A CA  
956  C C   . PRO A 123 ? 1.0161 1.5648 1.8061 -0.0416 0.0115  -0.1746 123 PRO A C   
957  O O   . PRO A 123 ? 1.0556 1.6435 1.8781 -0.0376 0.0040  -0.2067 123 PRO A O   
958  C CB  . PRO A 123 ? 0.9955 1.5034 1.8429 -0.0691 0.0203  -0.1890 123 PRO A CB  
959  C CG  . PRO A 123 ? 0.9883 1.5469 1.8757 -0.0760 0.0244  -0.2205 123 PRO A CG  
960  C CD  . PRO A 123 ? 0.9791 1.6128 1.8610 -0.0623 0.0230  -0.2388 123 PRO A CD  
961  N N   . GLY A 124 ? 0.9396 1.4482 1.6831 -0.0360 0.0105  -0.1396 124 GLY A N   
962  C CA  . GLY A 124 ? 0.9237 1.4326 1.6535 -0.0254 0.0001  -0.1364 124 GLY A CA  
963  C C   . GLY A 124 ? 0.9342 1.4794 1.6181 -0.0122 0.0008  -0.1205 124 GLY A C   
964  O O   . GLY A 124 ? 0.9410 1.4872 1.6055 -0.0034 -0.0072 -0.1123 124 GLY A O   
965  N N   . LEU A 125 ? 0.9114 1.4867 1.5780 -0.0109 0.0099  -0.1157 125 LEU A N   
966  C CA  . LEU A 125 ? 0.8565 1.4648 1.4779 0.0013  0.0104  -0.0998 125 LEU A CA  
967  C C   . LEU A 125 ? 0.8274 1.3770 1.3942 0.0030  0.0128  -0.0554 125 LEU A C   
968  O O   . LEU A 125 ? 0.8810 1.3946 1.4365 -0.0037 0.0217  -0.0380 125 LEU A O   
969  C CB  . LEU A 125 ? 0.8523 1.5193 1.4788 0.0030  0.0184  -0.1144 125 LEU A CB  
970  C CG  . LEU A 125 ? 0.8539 1.5962 1.5170 0.0066  0.0144  -0.1548 125 LEU A CG  
971  C CD1 . LEU A 125 ? 0.9097 1.6454 1.6262 -0.0009 0.0090  -0.1849 125 LEU A CD1 
972  C CD2 . LEU A 125 ? 0.8365 1.6272 1.5078 0.0057  0.0228  -0.1673 125 LEU A CD2 
973  N N   . ARG A 126 ? 0.7071 1.2477 1.2399 0.0116  0.0047  -0.0373 126 ARG A N   
974  C CA  . ARG A 126 ? 0.7901 1.2775 1.2671 0.0144  0.0052  0.0048  126 ARG A CA  
975  C C   . ARG A 126 ? 0.7003 1.2185 1.1366 0.0271  -0.0014 0.0171  126 ARG A C   
976  O O   . ARG A 126 ? 0.7019 1.2727 1.1559 0.0324  -0.0079 -0.0055 126 ARG A O   
977  C CB  . ARG A 126 ? 0.9708 1.3855 1.4481 0.0077  -0.0002 0.0217  126 ARG A CB  
978  C CG  . ARG A 126 ? 1.1100 1.4832 1.6215 -0.0061 0.0056  0.0152  126 ARG A CG  
979  C CD  . ARG A 126 ? 1.2121 1.5222 1.7321 -0.0121 -0.0027 0.0251  126 ARG A CD  
980  N NE  . ARG A 126 ? 1.2789 1.5148 1.7686 -0.0195 0.0018  0.0591  126 ARG A NE  
981  C CZ  . ARG A 126 ? 1.2752 1.4746 1.7865 -0.0323 0.0083  0.0582  126 ARG A CZ  
982  N NH1 . ARG A 126 ? 1.2417 1.4707 1.8057 -0.0395 0.0106  0.0249  126 ARG A NH1 
983  N NH2 . ARG A 126 ? 1.2661 1.3988 1.7452 -0.0384 0.0123  0.0907  126 ARG A NH2 
984  N N   . VAL A 127 ? 0.6527 1.1382 1.0340 0.0315  0.0000  0.0528  127 VAL A N   
985  C CA  . VAL A 127 ? 0.5572 1.0558 0.8953 0.0418  -0.0085 0.0707  127 VAL A CA  
986  C C   . VAL A 127 ? 0.6596 1.1453 1.0111 0.0412  -0.0198 0.0676  127 VAL A C   
987  O O   . VAL A 127 ? 0.7068 1.1328 1.0625 0.0347  -0.0221 0.0802  127 VAL A O   
988  C CB  . VAL A 127 ? 0.5335 0.9783 0.8104 0.0450  -0.0072 0.1130  127 VAL A CB  
989  C CG1 . VAL A 127 ? 0.5416 0.9943 0.7753 0.0540  -0.0182 0.1323  127 VAL A CG1 
990  C CG2 . VAL A 127 ? 0.5232 0.9820 0.7842 0.0474  0.0040  0.1172  127 VAL A CG2 
991  N N   . GLY A 128 ? 0.7016 1.2443 1.0604 0.0479  -0.0269 0.0507  128 GLY A N   
992  C CA  . GLY A 128 ? 0.6724 1.2126 1.0477 0.0483  -0.0372 0.0446  128 GLY A CA  
993  C C   . GLY A 128 ? 0.6997 1.2859 1.1361 0.0464  -0.0378 0.0014  128 GLY A C   
994  O O   . GLY A 128 ? 0.8057 1.4060 1.2602 0.0487  -0.0460 -0.0102 128 GLY A O   
995  N N   . THR A 129 ? 0.6783 1.2885 1.1467 0.0423  -0.0294 -0.0228 129 THR A N   
996  C CA  . THR A 129 ? 0.6349 1.2861 1.1616 0.0399  -0.0301 -0.0650 129 THR A CA  
997  C C   . THR A 129 ? 0.5754 1.3079 1.1090 0.0483  -0.0335 -0.0897 129 THR A C   
998  O O   . THR A 129 ? 0.5087 1.2812 1.0200 0.0528  -0.0297 -0.0879 129 THR A O   
999  C CB  . THR A 129 ? 0.6445 1.2944 1.2037 0.0315  -0.0206 -0.0827 129 THR A CB  
1000 O OG1 . THR A 129 ? 0.6479 1.2235 1.1972 0.0230  -0.0167 -0.0579 129 THR A OG1 
1001 C CG2 . THR A 129 ? 0.5578 1.2400 1.1780 0.0281  -0.0228 -0.1255 129 THR A CG2 
1002 N N   . LYS A 130 ? 0.5813 1.3381 1.1458 0.0507  -0.0406 -0.1128 130 LYS A N   
1003 C CA  . LYS A 130 ? 0.6501 1.4851 1.2258 0.0579  -0.0435 -0.1398 130 LYS A CA  
1004 C C   . LYS A 130 ? 0.6597 1.5406 1.2769 0.0551  -0.0377 -0.1773 130 LYS A C   
1005 O O   . LYS A 130 ? 0.6936 1.5506 1.3499 0.0477  -0.0351 -0.1942 130 LYS A O   
1006 C CB  . LYS A 130 ? 0.7514 1.5981 1.3482 0.0618  -0.0524 -0.1534 130 LYS A CB  
1007 C CG  . LYS A 130 ? 0.8703 1.6756 1.4292 0.0642  -0.0594 -0.1176 130 LYS A CG  
1008 C CD  . LYS A 130 ? 0.9663 1.7106 1.5490 0.0595  -0.0637 -0.1140 130 LYS A CD  
1009 C CE  . LYS A 130 ? 1.0173 1.7959 1.6525 0.0622  -0.0684 -0.1525 130 LYS A CE  
1010 N NZ  . LYS A 130 ? 1.0364 1.7560 1.6949 0.0587  -0.0740 -0.1490 130 LYS A NZ  
1011 N N   . VAL A 131 ? 0.6264 1.5727 1.2346 0.0605  -0.0364 -0.1900 131 VAL A N   
1012 C CA  . VAL A 131 ? 0.6535 1.6490 1.2988 0.0582  -0.0318 -0.2258 131 VAL A CA  
1013 C C   . VAL A 131 ? 0.6416 1.7143 1.2973 0.0655  -0.0363 -0.2542 131 VAL A C   
1014 O O   . VAL A 131 ? 0.6464 1.7425 1.2675 0.0724  -0.0407 -0.2395 131 VAL A O   
1015 C CB  . VAL A 131 ? 0.6226 1.6212 1.2465 0.0562  -0.0237 -0.2129 131 VAL A CB  
1016 C CG1 . VAL A 131 ? 0.6038 1.5264 1.2095 0.0500  -0.0189 -0.1807 131 VAL A CG1 
1017 C CG2 . VAL A 131 ? 0.6460 1.6836 1.2234 0.0649  -0.0254 -0.1963 131 VAL A CG2 
1018 N N   . LYS A 132 ? 0.6256 1.7375 1.3284 0.0635  -0.0356 -0.2947 132 LYS A N   
1019 C CA  . LYS A 132 ? 0.6627 1.8504 1.3759 0.0701  -0.0392 -0.3239 132 LYS A CA  
1020 C C   . LYS A 132 ? 0.6365 1.8741 1.3727 0.0677  -0.0348 -0.3527 132 LYS A C   
1021 O O   . LYS A 132 ? 0.6973 1.9110 1.4558 0.0600  -0.0297 -0.3584 132 LYS A O   
1022 C CB  . LYS A 132 ? 0.6434 1.8404 1.3912 0.0728  -0.0454 -0.3494 132 LYS A CB  
1023 C CG  . LYS A 132 ? 0.6976 1.8626 1.4966 0.0662  -0.0451 -0.3738 132 LYS A CG  
1024 C CD  . LYS A 132 ? 0.8157 2.0027 1.6497 0.0712  -0.0517 -0.4044 132 LYS A CD  
1025 C CE  . LYS A 132 ? 0.8719 2.0360 1.6821 0.0769  -0.0572 -0.3801 132 LYS A CE  
1026 N NZ  . LYS A 132 ? 0.8207 2.0020 1.6669 0.0824  -0.0634 -0.4088 132 LYS A NZ  
1027 N N   . GLN A 133 ? 0.5868 1.8940 1.3165 0.0738  -0.0372 -0.3698 133 GLN A N   
1028 C CA  . GLN A 133 ? 0.7307 2.0911 1.4784 0.0723  -0.0341 -0.3965 133 GLN A CA  
1029 C C   . GLN A 133 ? 0.7040 2.0671 1.5092 0.0661  -0.0336 -0.4351 133 GLN A C   
1030 O O   . GLN A 133 ? 0.7042 2.0662 1.5376 0.0675  -0.0380 -0.4559 133 GLN A O   
1031 C CB  . GLN A 133 ? 0.8488 2.2832 1.5809 0.0800  -0.0382 -0.4102 133 GLN A CB  
1032 C CG  . GLN A 133 ? 0.9806 2.4132 1.6569 0.0860  -0.0410 -0.3737 133 GLN A CG  
1033 C CD  . GLN A 133 ? 1.0035 2.5103 1.6634 0.0923  -0.0452 -0.3865 133 GLN A CD  
1034 O OE1 . GLN A 133 ? 0.8958 2.4546 1.5733 0.0920  -0.0442 -0.4138 133 GLN A OE1 
1035 N NE2 . GLN A 133 ? 1.0335 2.5459 1.6593 0.0975  -0.0503 -0.3665 133 GLN A NE2 
1036 N N   . GLY A 134 ? 0.6638 2.0308 1.4863 0.0594  -0.0285 -0.4444 134 GLY A N   
1037 C CA  . GLY A 134 ? 0.5943 1.9612 1.4702 0.0520  -0.0283 -0.4792 134 GLY A CA  
1038 C C   . GLY A 134 ? 0.5559 1.8486 1.4458 0.0425  -0.0249 -0.4637 134 GLY A C   
1039 O O   . GLY A 134 ? 0.6472 1.9320 1.5729 0.0334  -0.0226 -0.4821 134 GLY A O   
1040 N N   . LEU A 135 ? 0.4760 1.7140 1.3374 0.0440  -0.0251 -0.4293 135 LEU A N   
1041 C CA  . LEU A 135 ? 0.5751 1.7394 1.4424 0.0350  -0.0217 -0.4092 135 LEU A CA  
1042 C C   . LEU A 135 ? 0.7161 1.8704 1.5691 0.0288  -0.0130 -0.3912 135 LEU A C   
1043 O O   . LEU A 135 ? 0.7455 1.9114 1.5562 0.0341  -0.0099 -0.3662 135 LEU A O   
1044 C CB  . LEU A 135 ? 0.5369 1.6473 1.3720 0.0386  -0.0243 -0.3748 135 LEU A CB  
1045 C CG  . LEU A 135 ? 0.4925 1.5287 1.3084 0.0313  -0.0192 -0.3387 135 LEU A CG  
1046 C CD1 . LEU A 135 ? 0.3949 1.3704 1.2102 0.0307  -0.0245 -0.3233 135 LEU A CD1 
1047 C CD2 . LEU A 135 ? 0.5359 1.5725 1.2985 0.0356  -0.0144 -0.3037 135 LEU A CD2 
1048 N N   . PRO A 136 ? 0.7310 1.8646 1.6196 0.0174  -0.0094 -0.4042 136 PRO A N   
1049 C CA  . PRO A 136 ? 0.7036 1.8285 1.5826 0.0108  -0.0005 -0.3881 136 PRO A CA  
1050 C C   . PRO A 136 ? 0.6300 1.6928 1.4672 0.0106  0.0043  -0.3430 136 PRO A C   
1051 O O   . PRO A 136 ? 0.5918 1.6041 1.4208 0.0107  0.0008  -0.3274 136 PRO A O   
1052 C CB  . PRO A 136 ? 0.7148 1.8221 1.6445 -0.0027 0.0008  -0.4117 136 PRO A CB  
1053 C CG  . PRO A 136 ? 0.7405 1.8714 1.7078 -0.0008 -0.0082 -0.4492 136 PRO A CG  
1054 C CD  . PRO A 136 ? 0.7292 1.8502 1.6698 0.0102  -0.0138 -0.4358 136 PRO A CD  
1055 N N   . LEU A 137 ? 0.5926 1.6602 1.4032 0.0107  0.0120  -0.3224 137 LEU A N   
1056 C CA  . LEU A 137 ? 0.5481 1.5562 1.3206 0.0096  0.0178  -0.2811 137 LEU A CA  
1057 C C   . LEU A 137 ? 0.5625 1.5416 1.3580 -0.0034 0.0264  -0.2795 137 LEU A C   
1058 O O   . LEU A 137 ? 0.6589 1.5750 1.4408 -0.0093 0.0307  -0.2530 137 LEU A O   
1059 C CB  . LEU A 137 ? 0.4739 1.5056 1.1957 0.0204  0.0201  -0.2569 137 LEU A CB  
1060 C CG  . LEU A 137 ? 0.3324 1.4012 1.0306 0.0324  0.0115  -0.2590 137 LEU A CG  
1061 C CD1 . LEU A 137 ? 0.3273 1.4218 0.9778 0.0420  0.0132  -0.2370 137 LEU A CD1 
1062 C CD2 . LEU A 137 ? 0.4076 1.4273 1.0913 0.0342  0.0054  -0.2420 137 LEU A CD2 
1063 N N   . SER A 138 ? 0.4982 1.5246 1.3285 -0.0085 0.0288  -0.3080 138 SER A N   
1064 C CA  . SER A 138 ? 0.6234 1.6311 1.4822 -0.0223 0.0364  -0.3112 138 SER A CA  
1065 C C   . SER A 138 ? 0.7228 1.7067 1.6306 -0.0338 0.0312  -0.3364 138 SER A C   
1066 O O   . SER A 138 ? 0.7024 1.7111 1.6326 -0.0301 0.0223  -0.3638 138 SER A O   
1067 C CB  . SER A 138 ? 0.6037 1.6750 1.4765 -0.0228 0.0409  -0.3289 138 SER A CB  
1068 O OG  . SER A 138 ? 0.5906 1.7207 1.4924 -0.0198 0.0330  -0.3666 138 SER A OG  
1069 N N   . LYS A 139 ? 0.8287 1.7644 1.7525 -0.0475 0.0367  -0.3270 139 LYS A N   
1070 C CA  . LYS A 139 ? 0.9174 1.8215 1.8858 -0.0596 0.0314  -0.3472 139 LYS A CA  
1071 C C   . LYS A 139 ? 0.9227 1.8826 1.9394 -0.0638 0.0266  -0.3913 139 LYS A C   
1072 O O   . LYS A 139 ? 0.9592 1.9087 2.0125 -0.0687 0.0184  -0.4166 139 LYS A O   
1073 C CB  . LYS A 139 ? 0.9589 1.8025 1.9316 -0.0747 0.0390  -0.3258 139 LYS A CB  
1074 C CG  . LYS A 139 ? 1.0538 1.8538 2.0680 -0.0881 0.0326  -0.3414 139 LYS A CG  
1075 C CD  . LYS A 139 ? 1.1202 1.9509 2.1839 -0.1013 0.0329  -0.3729 139 LYS A CD  
1076 C CE  . LYS A 139 ? 1.1646 1.9590 2.2716 -0.1126 0.0236  -0.3944 139 LYS A CE  
1077 N NZ  . LYS A 139 ? 1.1727 1.9875 2.2935 -0.1014 0.0113  -0.4213 139 LYS A NZ  
1078 N N   . ASN A 140 ? 0.8524 1.8714 1.8687 -0.0614 0.0311  -0.4008 140 ASN A N   
1079 C CA  . ASN A 140 ? 0.8631 1.9395 1.9211 -0.0644 0.0261  -0.4422 140 ASN A CA  
1080 C C   . ASN A 140 ? 0.8918 2.0316 1.9360 -0.0490 0.0206  -0.4586 140 ASN A C   
1081 O O   . ASN A 140 ? 0.7653 1.8980 1.7849 -0.0378 0.0157  -0.4506 140 ASN A O   
1082 C CB  . ASN A 140 ? 0.7969 1.8976 1.8731 -0.0752 0.0341  -0.4460 140 ASN A CB  
1083 C CG  . ASN A 140 ? 0.7677 1.8779 1.8017 -0.0689 0.0444  -0.4142 140 ASN A CG  
1084 O OD1 . ASN A 140 ? 0.7966 1.8568 1.8087 -0.0729 0.0522  -0.3820 140 ASN A OD1 
1085 N ND2 . ASN A 140 ? 0.7148 1.8890 1.7367 -0.0586 0.0441  -0.4232 140 ASN A ND2 
1086 N N   . GLU A 141 ? 1.0077 2.2103 2.0682 -0.0493 0.0210  -0.4815 141 GLU A N   
1087 C CA  . GLU A 141 ? 1.0591 2.3259 2.1047 -0.0357 0.0164  -0.4961 141 GLU A CA  
1088 C C   . GLU A 141 ? 0.9403 2.2230 1.9378 -0.0264 0.0231  -0.4651 141 GLU A C   
1089 O O   . GLU A 141 ? 0.9387 2.1772 1.9115 -0.0285 0.0307  -0.4316 141 GLU A O   
1090 C CB  . GLU A 141 ? 1.1920 2.5195 2.2779 -0.0403 0.0123  -0.5371 141 GLU A CB  
1091 C CG  . GLU A 141 ? 1.2850 2.6078 2.4033 -0.0561 0.0177  -0.5429 141 GLU A CG  
1092 C CD  . GLU A 141 ? 1.3410 2.6284 2.5054 -0.0697 0.0126  -0.5648 141 GLU A CD  
1093 O OE1 . GLU A 141 ? 1.3351 2.6093 2.5095 -0.0654 0.0043  -0.5806 141 GLU A OE1 
1094 O OE2 . GLU A 141 ? 1.3611 2.6345 2.5521 -0.0847 0.0167  -0.5664 141 GLU A OE2 
1095 N N   . GLU A 142 ? 0.8387 2.1840 1.8224 -0.0159 0.0197  -0.4768 142 GLU A N   
1096 C CA  . GLU A 142 ? 0.7134 2.0773 1.6503 -0.0054 0.0239  -0.4495 142 GLU A CA  
1097 C C   . GLU A 142 ? 0.6698 1.9844 1.5625 0.0025  0.0239  -0.4150 142 GLU A C   
1098 O O   . GLU A 142 ? 0.6415 1.9042 1.5416 -0.0016 0.0221  -0.4097 142 GLU A O   
1099 C CB  . GLU A 142 ? 0.7435 2.1040 1.6801 -0.0119 0.0338  -0.4341 142 GLU A CB  
1100 C CG  . GLU A 142 ? 0.8683 2.2606 1.8554 -0.0243 0.0348  -0.4649 142 GLU A CG  
1101 C CD  . GLU A 142 ? 0.9020 2.3728 1.9005 -0.0191 0.0291  -0.4945 142 GLU A CD  
1102 O OE1 . GLU A 142 ? 0.8843 2.3900 1.8941 -0.0228 0.0332  -0.4992 142 GLU A OE1 
1103 O OE2 . GLU A 142 ? 0.9190 2.4174 1.9159 -0.0117 0.0206  -0.5132 142 GLU A OE2 
1104 N N   . TYR A 143 ? 0.6153 1.9461 1.4618 0.0138  0.0249  -0.3915 143 TYR A N   
1105 C CA  . TYR A 143 ? 0.4411 1.7252 1.2412 0.0212  0.0247  -0.3557 143 TYR A CA  
1106 C C   . TYR A 143 ? 0.4956 1.7538 1.3032 0.0219  0.0173  -0.3625 143 TYR A C   
1107 O O   . TYR A 143 ? 0.5076 1.7043 1.3194 0.0160  0.0186  -0.3490 143 TYR A O   
1108 C CB  . TYR A 143 ? 0.1724 1.3960 0.9566 0.0156  0.0342  -0.3230 143 TYR A CB  
1109 C CG  . TYR A 143 ? 0.1484 1.3967 0.9365 0.0130  0.0424  -0.3209 143 TYR A CG  
1110 C CD1 . TYR A 143 ? 0.2430 1.5205 0.9927 0.0239  0.0441  -0.3040 143 TYR A CD1 
1111 C CD2 . TYR A 143 ? 0.1103 1.3540 0.9412 -0.0006 0.0480  -0.3362 143 TYR A CD2 
1112 C CE1 . TYR A 143 ? 0.2234 1.5260 0.9784 0.0223  0.0516  -0.3028 143 TYR A CE1 
1113 C CE2 . TYR A 143 ? 0.1069 1.3762 0.9433 -0.0033 0.0558  -0.3344 143 TYR A CE2 
1114 C CZ  . TYR A 143 ? 0.2741 1.5736 1.0731 0.0087  0.0577  -0.3180 143 TYR A CZ  
1115 O OH  . TYR A 143 ? 0.2565 1.5831 1.0624 0.0068  0.0655  -0.3166 143 TYR A OH  
1116 N N   . ILE A 144 ? 0.4940 1.8009 1.3039 0.0292  0.0095  -0.3839 144 ILE A N   
1117 C CA  . ILE A 144 ? 0.5028 1.7938 1.3149 0.0325  0.0023  -0.3892 144 ILE A CA  
1118 C C   . ILE A 144 ? 0.4411 1.7338 1.2001 0.0440  -0.0009 -0.3610 144 ILE A C   
1119 O O   . ILE A 144 ? 0.4210 1.7474 1.1499 0.0502  0.0001  -0.3501 144 ILE A O   
1120 C CB  . ILE A 144 ? 0.5598 1.9054 1.4107 0.0331  -0.0043 -0.4334 144 ILE A CB  
1121 C CG1 . ILE A 144 ? 0.5972 2.0150 1.4288 0.0419  -0.0072 -0.4432 144 ILE A CG1 
1122 C CG2 . ILE A 144 ? 0.4507 1.7988 1.3530 0.0214  -0.0021 -0.4622 144 ILE A CG2 
1123 C CD1 . ILE A 144 ? 0.5783 2.0533 1.4425 0.0436  -0.0138 -0.4860 144 ILE A CD1 
1124 N N   . CYS A 145 ? 0.4056 1.6615 1.1531 0.0465  -0.0054 -0.3484 145 CYS A N   
1125 C CA  . CYS A 145 ? 0.4644 1.7197 1.1621 0.0562  -0.0095 -0.3212 145 CYS A CA  
1126 C C   . CYS A 145 ? 0.5364 1.8624 1.2324 0.0639  -0.0161 -0.3434 145 CYS A C   
1127 O O   . CYS A 145 ? 0.5740 1.9245 1.3040 0.0635  -0.0204 -0.3744 145 CYS A O   
1128 C CB  . CYS A 145 ? 0.5428 1.7375 1.2308 0.0558  -0.0127 -0.3010 145 CYS A CB  
1129 S SG  . CYS A 145 ? 0.6811 1.8720 1.3088 0.0663  -0.0189 -0.2664 145 CYS A SG  
1130 N N   . GLU A 146 ? 0.4543 1.8124 1.1098 0.0711  -0.0173 -0.3275 146 GLU A N   
1131 C CA  . GLU A 146 ? 0.4951 1.9222 1.1451 0.0777  -0.0235 -0.3466 146 GLU A CA  
1132 C C   . GLU A 146 ? 0.5371 1.9608 1.1538 0.0842  -0.0303 -0.3287 146 GLU A C   
1133 O O   . GLU A 146 ? 0.5265 2.0051 1.1385 0.0891  -0.0357 -0.3438 146 GLU A O   
1134 C CB  . GLU A 146 ? 0.4643 1.9365 1.0926 0.0814  -0.0223 -0.3438 146 GLU A CB  
1135 C CG  . GLU A 146 ? 0.4546 1.8962 1.0288 0.0862  -0.0210 -0.3010 146 GLU A CG  
1136 C CD  . GLU A 146 ? 0.6098 2.0751 1.1772 0.0872  -0.0165 -0.2990 146 GLU A CD  
1137 O OE1 . GLU A 146 ? 0.7047 2.1898 1.3130 0.0812  -0.0120 -0.3251 146 GLU A OE1 
1138 O OE2 . GLU A 146 ? 0.6144 2.0784 1.1359 0.0939  -0.0178 -0.2713 146 GLU A OE2 
1139 N N   . LEU A 147 ? 0.5106 1.8704 1.1046 0.0837  -0.0302 -0.2967 147 LEU A N   
1140 C CA  . LEU A 147 ? 0.5662 1.9196 1.1218 0.0894  -0.0368 -0.2732 147 LEU A CA  
1141 C C   . LEU A 147 ? 0.6268 1.9131 1.1821 0.0867  -0.0379 -0.2541 147 LEU A C   
1142 O O   . LEU A 147 ? 0.7244 1.9502 1.2653 0.0834  -0.0340 -0.2279 147 LEU A O   
1143 C CB  . LEU A 147 ? 0.5694 1.9222 1.0692 0.0944  -0.0377 -0.2395 147 LEU A CB  
1144 C CG  . LEU A 147 ? 0.6139 2.0159 1.0802 0.1010  -0.0456 -0.2345 147 LEU A CG  
1145 C CD1 . LEU A 147 ? 0.5484 2.0225 1.0432 0.1017  -0.0473 -0.2760 147 LEU A CD1 
1146 C CD2 . LEU A 147 ? 0.6008 2.0027 1.0162 0.1057  -0.0466 -0.2048 147 LEU A CD2 
1147 N N   . ASP A 148 ? 0.5846 1.8824 1.1556 0.0884  -0.0434 -0.2671 148 ASP A N   
1148 C CA  . ASP A 148 ? 0.5448 1.7831 1.1134 0.0868  -0.0462 -0.2481 148 ASP A CA  
1149 C C   . ASP A 148 ? 0.4839 1.6761 0.9965 0.0884  -0.0476 -0.2012 148 ASP A C   
1150 O O   . ASP A 148 ? 0.4671 1.6876 0.9396 0.0933  -0.0505 -0.1855 148 ASP A O   
1151 C CB  . ASP A 148 ? 0.6332 1.9020 1.2163 0.0908  -0.0528 -0.2646 148 ASP A CB  
1152 C CG  . ASP A 148 ? 0.7277 2.0257 1.3689 0.0894  -0.0520 -0.3099 148 ASP A CG  
1153 O OD1 . ASP A 148 ? 0.8416 2.1617 1.5077 0.0863  -0.0475 -0.3333 148 ASP A OD1 
1154 O OD2 . ASP A 148 ? 0.6972 1.9963 1.3595 0.0916  -0.0564 -0.3224 148 ASP A OD2 
1155 N N   . GLY A 149 ? 0.4714 1.5914 0.9807 0.0841  -0.0461 -0.1790 149 GLY A N   
1156 C CA  . GLY A 149 ? 0.3826 1.4500 0.8398 0.0850  -0.0477 -0.1344 149 GLY A CA  
1157 C C   . GLY A 149 ? 0.3897 1.3783 0.8528 0.0787  -0.0444 -0.1167 149 GLY A C   
1158 O O   . GLY A 149 ? 0.2986 1.2705 0.8055 0.0738  -0.0433 -0.1372 149 GLY A O   
1159 N N   . LYS A 150 ? 0.4625 1.4011 0.8799 0.0789  -0.0435 -0.0784 150 LYS A N   
1160 C CA  . LYS A 150 ? 0.4684 1.3305 0.8848 0.0726  -0.0398 -0.0583 150 LYS A CA  
1161 C C   . LYS A 150 ? 0.4296 1.2691 0.8183 0.0720  -0.0319 -0.0388 150 LYS A C   
1162 O O   . LYS A 150 ? 0.4116 1.2791 0.7652 0.0782  -0.0320 -0.0276 150 LYS A O   
1163 C CB  . LYS A 150 ? 0.5251 1.3352 0.9108 0.0731  -0.0475 -0.0267 150 LYS A CB  
1164 C CG  . LYS A 150 ? 0.7303 1.5506 1.1480 0.0729  -0.0547 -0.0441 150 LYS A CG  
1165 C CD  . LYS A 150 ? 0.8781 1.6372 1.2697 0.0718  -0.0619 -0.0115 150 LYS A CD  
1166 C CE  . LYS A 150 ? 0.9134 1.5942 1.2912 0.0656  -0.0573 0.0137  150 LYS A CE  
1167 N NZ  . LYS A 150 ? 0.8955 1.5145 1.2679 0.0624  -0.0641 0.0348  150 LYS A NZ  
1168 N N   . ILE A 151 ? 0.3910 1.1805 0.7961 0.0647  -0.0250 -0.0351 151 ILE A N   
1169 C CA  . ILE A 151 ? 0.4100 1.1731 0.7893 0.0639  -0.0165 -0.0150 151 ILE A CA  
1170 C C   . ILE A 151 ? 0.4392 1.1455 0.7607 0.0671  -0.0201 0.0285  151 ILE A C   
1171 O O   . ILE A 151 ? 0.4152 1.0699 0.7321 0.0636  -0.0246 0.0439  151 ILE A O   
1172 C CB  . ILE A 151 ? 0.4720 1.2001 0.8880 0.0537  -0.0078 -0.0248 151 ILE A CB  
1173 C CG1 . ILE A 151 ? 0.4064 1.1910 0.8789 0.0502  -0.0051 -0.0684 151 ILE A CG1 
1174 C CG2 . ILE A 151 ? 0.3596 1.0531 0.7456 0.0528  0.0016  0.0002  151 ILE A CG2 
1175 C CD1 . ILE A 151 ? 0.4387 1.1903 0.9530 0.0387  0.0013  -0.0811 151 ILE A CD1 
1176 N N   . VAL A 152 ? 0.4689 1.1847 0.7461 0.0740  -0.0188 0.0480  152 VAL A N   
1177 C CA  . VAL A 152 ? 0.4913 1.1513 0.7104 0.0774  -0.0219 0.0897  152 VAL A CA  
1178 C C   . VAL A 152 ? 0.5401 1.1632 0.7389 0.0769  -0.0115 0.1074  152 VAL A C   
1179 O O   . VAL A 152 ? 0.4626 1.0370 0.6123 0.0801  -0.0125 0.1415  152 VAL A O   
1180 C CB  . VAL A 152 ? 0.3558 1.0483 0.5308 0.0869  -0.0309 0.1036  152 VAL A CB  
1181 C CG1 . VAL A 152 ? 0.4805 1.2035 0.6703 0.0870  -0.0412 0.0911  152 VAL A CG1 
1182 C CG2 . VAL A 152 ? 0.3368 1.0900 0.5108 0.0929  -0.0267 0.0887  152 VAL A CG2 
1183 N N   . GLU A 153 ? 0.6107 1.2591 0.8474 0.0730  -0.0015 0.0838  153 GLU A N   
1184 C CA  . GLU A 153 ? 0.5777 1.1976 0.8018 0.0718  0.0097  0.0972  153 GLU A CA  
1185 C C   . GLU A 153 ? 0.5828 1.2337 0.8616 0.0644  0.0193  0.0655  153 GLU A C   
1186 O O   . GLU A 153 ? 0.4105 1.1262 0.7209 0.0657  0.0182  0.0352  153 GLU A O   
1187 C CB  . GLU A 153 ? 0.5843 1.2221 0.7603 0.0831  0.0101  0.1151  153 GLU A CB  
1188 C CG  . GLU A 153 ? 0.7539 1.3728 0.9210 0.0833  0.0229  0.1249  153 GLU A CG  
1189 C CD  . GLU A 153 ? 0.9394 1.5728 1.0571 0.0960  0.0223  0.1435  153 GLU A CD  
1190 O OE1 . GLU A 153 ? 1.0088 1.6468 1.0884 0.1037  0.0113  0.1580  153 GLU A OE1 
1191 O OE2 . GLU A 153 ? 0.9589 1.5998 1.0761 0.0984  0.0326  0.1438  153 GLU A OE2 
1192 N N   . ILE A 154 ? 0.6555 1.2587 0.9452 0.0559  0.0282  0.0731  154 ILE A N   
1193 C CA  . ILE A 154 ? 0.5802 1.2061 0.9160 0.0480  0.0384  0.0487  154 ILE A CA  
1194 C C   . ILE A 154 ? 0.6671 1.2487 0.9796 0.0458  0.0498  0.0728  154 ILE A C   
1195 O O   . ILE A 154 ? 0.7092 1.2245 0.9933 0.0433  0.0502  0.1007  154 ILE A O   
1196 C CB  . ILE A 154 ? 0.5083 1.1257 0.8985 0.0362  0.0365  0.0240  154 ILE A CB  
1197 C CG1 . ILE A 154 ? 0.5765 1.1854 1.0030 0.0248  0.0480  0.0123  154 ILE A CG1 
1198 C CG2 . ILE A 154 ? 0.5193 1.0732 0.8947 0.0331  0.0293  0.0439  154 ILE A CG2 
1199 C CD1 . ILE A 154 ? 0.6974 1.3148 1.1833 0.0139  0.0454  -0.0195 154 ILE A CD1 
1200 N N   . GLU A 155 ? 0.6362 1.2561 0.9597 0.0472  0.0590  0.0624  155 GLU A N   
1201 C CA  . GLU A 155 ? 0.5766 1.1668 0.8698 0.0492  0.0698  0.0864  155 GLU A CA  
1202 C C   . GLU A 155 ? 0.5120 1.1412 0.8456 0.0433  0.0813  0.0646  155 GLU A C   
1203 O O   . GLU A 155 ? 0.4031 1.0979 0.7664 0.0452  0.0795  0.0367  155 GLU A O   
1204 C CB  . GLU A 155 ? 0.6181 1.2191 0.8552 0.0650  0.0657  0.1078  155 GLU A CB  
1205 C CG  . GLU A 155 ? 0.7226 1.3148 0.9294 0.0714  0.0765  0.1264  155 GLU A CG  
1206 C CD  . GLU A 155 ? 0.8579 1.4601 1.0091 0.0877  0.0696  0.1461  155 GLU A CD  
1207 O OE1 . GLU A 155 ? 0.9720 1.5604 1.0965 0.0918  0.0574  0.1570  155 GLU A OE1 
1208 O OE2 . GLU A 155 ? 0.8713 1.4958 1.0056 0.0964  0.0759  0.1507  155 GLU A OE2 
1209 N N   . ARG A 156 ? 0.4831 1.0721 0.8187 0.0353  0.0929  0.0771  156 ARG A N   
1210 C CA  . ARG A 156 ? 0.4145 1.0384 0.7861 0.0290  0.1046  0.0598  156 ARG A CA  
1211 C C   . ARG A 156 ? 0.4111 1.0657 0.7508 0.0423  0.1105  0.0706  156 ARG A C   
1212 O O   . ARG A 156 ? 0.4240 1.0428 0.7109 0.0519  0.1114  0.1007  156 ARG A O   
1213 C CB  . ARG A 156 ? 0.4021 0.9730 0.7893 0.0142  0.1150  0.0690  156 ARG A CB  
1214 C CG  . ARG A 156 ? 0.4622 0.9952 0.8783 0.0012  0.1084  0.0610  156 ARG A CG  
1215 C CD  . ARG A 156 ? 0.6162 1.0984 1.0474 -0.0143 0.1185  0.0704  156 ARG A CD  
1216 N NE  . ARG A 156 ? 0.7468 1.2626 1.2376 -0.0278 0.1231  0.0406  156 ARG A NE  
1217 C CZ  . ARG A 156 ? 0.7394 1.2421 1.2728 -0.0408 0.1173  0.0217  156 ARG A CZ  
1218 N NH1 . ARG A 156 ? 0.6138 1.0712 1.1378 -0.0416 0.1071  0.0296  156 ARG A NH1 
1219 N NH2 . ARG A 156 ? 0.7789 1.3127 1.3646 -0.0531 0.1211  -0.0049 156 ARG A NH2 
1220 N N   . MET A 157 ? 0.2811 0.9318 0.5726 -0.0778 0.0240  -0.1268 157 MET A N   
1221 C CA  . MET A 157 ? 0.2851 0.9441 0.5684 -0.0731 0.0258  -0.1112 157 MET A CA  
1222 C C   . MET A 157 ? 0.2637 0.9373 0.5682 -0.0662 0.0244  -0.0957 157 MET A C   
1223 O O   . MET A 157 ? 0.4689 1.1460 0.7925 -0.0665 0.0214  -0.0973 157 MET A O   
1224 C CB  . MET A 157 ? 0.2832 0.9479 0.5492 -0.0776 0.0272  -0.1222 157 MET A CB  
1225 C CG  . MET A 157 ? 0.3674 1.0241 0.6158 -0.0871 0.0292  -0.1408 157 MET A CG  
1226 S SD  . MET A 157 ? 0.5472 1.2116 0.7701 -0.0945 0.0318  -0.1467 157 MET A SD  
1227 C CE  . MET A 157 ? 0.4487 1.1039 0.6579 -0.0883 0.0317  -0.1256 157 MET A CE  
1228 N N   . LYS A 158 ? 0.1983 0.8821 0.5009 -0.0596 0.0265  -0.0810 158 LYS A N   
1229 C CA  . LYS A 158 ? 0.3697 1.0722 0.6928 -0.0526 0.0262  -0.0674 158 LYS A CA  
1230 C C   . LYS A 158 ? 0.3367 1.0463 0.6522 -0.0513 0.0261  -0.0719 158 LYS A C   
1231 O O   . LYS A 158 ? 0.3289 1.0357 0.6258 -0.0507 0.0279  -0.0729 158 LYS A O   
1232 C CB  . LYS A 158 ? 0.3646 1.0789 0.6957 -0.0439 0.0299  -0.0475 158 LYS A CB  
1233 C CG  . LYS A 158 ? 0.4002 1.1122 0.7421 -0.0454 0.0302  -0.0399 158 LYS A CG  
1234 C CD  . LYS A 158 ? 0.3330 1.0601 0.7027 -0.0455 0.0278  -0.0318 158 LYS A CD  
1235 C CE  . LYS A 158 ? 0.1713 0.8983 0.5514 -0.0480 0.0281  -0.0225 158 LYS A CE  
1236 N NZ  . LYS A 158 ? 0.2087 0.9555 0.6177 -0.0488 0.0257  -0.0103 158 LYS A NZ  
1237 N N   . LYS A 159 ? 0.3723 1.0906 0.7026 -0.0513 0.0236  -0.0744 159 LYS A N   
1238 C CA  . LYS A 159 ? 0.2739 1.0003 0.6012 -0.0491 0.0232  -0.0762 159 LYS A CA  
1239 C C   . LYS A 159 ? 0.2871 1.0313 0.6321 -0.0377 0.0246  -0.0581 159 LYS A C   
1240 O O   . LYS A 159 ? 0.3382 1.0946 0.7082 -0.0339 0.0236  -0.0483 159 LYS A O   
1241 C CB  . LYS A 159 ? 0.1197 0.8480 0.4564 -0.0533 0.0198  -0.0872 159 LYS A CB  
1242 C CG  . LYS A 159 ? 0.1689 0.9049 0.5044 -0.0516 0.0190  -0.0889 159 LYS A CG  
1243 C CD  . LYS A 159 ? 0.2457 0.9831 0.5899 -0.0560 0.0158  -0.1009 159 LYS A CD  
1244 C CE  . LYS A 159 ? 0.2069 0.9508 0.5491 -0.0551 0.0148  -0.1031 159 LYS A CE  
1245 N NZ  . LYS A 159 ? 0.3222 1.0697 0.6811 -0.0559 0.0109  -0.1090 159 LYS A NZ  
1246 N N   . VAL A 160 ? 0.1811 0.9288 0.5144 -0.0321 0.0270  -0.0543 160 VAL A N   
1247 C CA  . VAL A 160 ? 0.2267 0.9951 0.5777 -0.0193 0.0291  -0.0404 160 VAL A CA  
1248 C C   . VAL A 160 ? 0.2667 1.0406 0.6183 -0.0162 0.0267  -0.0448 160 VAL A C   
1249 O O   . VAL A 160 ? 0.3333 1.0980 0.6625 -0.0196 0.0259  -0.0536 160 VAL A O   
1250 C CB  . VAL A 160 ? 0.1094 0.8821 0.4514 -0.0110 0.0335  -0.0325 160 VAL A CB  
1251 C CG1 . VAL A 160 ? 0.0038 0.8040 0.3679 0.0047  0.0368  -0.0205 160 VAL A CG1 
1252 C CG2 . VAL A 160 ? 0.1590 0.9244 0.4993 -0.0146 0.0357  -0.0282 160 VAL A CG2 
1253 N N   . VAL A 161 ? 0.2313 1.0208 0.6095 -0.0102 0.0254  -0.0382 161 VAL A N   
1254 C CA  . VAL A 161 ? 0.2172 1.0126 0.6010 -0.0057 0.0226  -0.0414 161 VAL A CA  
1255 C C   . VAL A 161 ? 0.2067 1.0256 0.6096 0.0106  0.0250  -0.0307 161 VAL A C   
1256 O O   . VAL A 161 ? 0.2887 1.1284 0.7199 0.0178  0.0272  -0.0194 161 VAL A O   
1257 C CB  . VAL A 161 ? 0.3104 1.1061 0.7125 -0.0100 0.0181  -0.0436 161 VAL A CB  
1258 C CG1 . VAL A 161 ? 0.2864 1.0904 0.7004 -0.0030 0.0148  -0.0443 161 VAL A CG1 
1259 C CG2 . VAL A 161 ? 0.1395 0.9162 0.5225 -0.0236 0.0160  -0.0582 161 VAL A CG2 
1260 N N   . VAL A 162 ? 0.1893 1.0076 0.5775 0.0169  0.0247  -0.0351 162 VAL A N   
1261 C CA  . VAL A 162 ? 0.1454 0.9876 0.5516 0.0355  0.0262  -0.0292 162 VAL A CA  
1262 C C   . VAL A 162 ? 0.3424 1.1874 0.7606 0.0392  0.0201  -0.0349 162 VAL A C   
1263 O O   . VAL A 162 ? 0.3616 1.1881 0.7600 0.0300  0.0154  -0.0451 162 VAL A O   
1264 C CB  . VAL A 162 ? 0.2013 1.0419 0.5857 0.0438  0.0283  -0.0311 162 VAL A CB  
1265 C CG1 . VAL A 162 ? 0.1450 1.0118 0.5482 0.0669  0.0287  -0.0287 162 VAL A CG1 
1266 C CG2 . VAL A 162 ? 0.2871 1.1242 0.6612 0.0410  0.0341  -0.0247 162 VAL A CG2 
1267 N N   . GLN A 163 ? 0.4661 1.3358 0.9181 0.0523  0.0199  -0.0283 163 GLN A N   
1268 C CA  . GLN A 163 ? 0.2665 1.1385 0.7342 0.0570  0.0128  -0.0335 163 GLN A CA  
1269 C C   . GLN A 163 ? 0.3274 1.2205 0.8088 0.0791  0.0108  -0.0356 163 GLN A C   
1270 O O   . GLN A 163 ? 0.3733 1.2955 0.8761 0.0949  0.0159  -0.0288 163 GLN A O   
1271 C CB  . GLN A 163 ? 0.2628 1.1436 0.7614 0.0535  0.0112  -0.0267 163 GLN A CB  
1272 C CG  . GLN A 163 ? 0.2893 1.1711 0.8069 0.0583  0.0029  -0.0314 163 GLN A CG  
1273 C CD  . GLN A 163 ? 0.1851 1.0679 0.7271 0.0511  0.0002  -0.0251 163 GLN A CD  
1274 O OE1 . GLN A 163 ? 0.2439 1.1079 0.7721 0.0363  0.0001  -0.0263 163 GLN A OE1 
1275 N NE2 . GLN A 163 ? 0.1072 1.0134 0.6869 0.0625  -0.0026 -0.0189 163 GLN A NE2 
1276 N N   . THR A 164 ? 0.3798 1.2594 0.8486 0.0809  0.0026  -0.0464 164 THR A N   
1277 C CA  . THR A 164 ? 0.4065 1.3000 0.8840 0.1036  -0.0036 -0.0527 164 THR A CA  
1278 C C   . THR A 164 ? 0.3896 1.3076 0.9099 0.1183  -0.0078 -0.0510 164 THR A C   
1279 O O   . THR A 164 ? 0.4782 1.3955 1.0171 0.1073  -0.0077 -0.0456 164 THR A O   
1280 C CB  . THR A 164 ? 0.5010 1.3697 0.9525 0.0982  -0.0139 -0.0647 164 THR A CB  
1281 O OG1 . THR A 164 ? 0.5641 1.4355 0.9996 0.1151  -0.0175 -0.0699 164 THR A OG1 
1282 C CG2 . THR A 164 ? 0.4540 1.3211 0.9270 0.1028  -0.0258 -0.0709 164 THR A CG2 
1283 N N   . PRO A 165 ? 0.3030 1.2438 0.8401 0.1452  -0.0124 -0.0563 165 PRO A N   
1284 C CA  . PRO A 165 ? 0.3250 1.2940 0.9061 0.1621  -0.0171 -0.0564 165 PRO A CA  
1285 C C   . PRO A 165 ? 0.3822 1.3325 0.9745 0.1547  -0.0300 -0.0619 165 PRO A C   
1286 O O   . PRO A 165 ? 0.4169 1.3842 1.0458 0.1573  -0.0318 -0.0573 165 PRO A O   
1287 C CB  . PRO A 165 ? 0.2964 1.2853 0.8820 0.1947  -0.0232 -0.0669 165 PRO A CB  
1288 C CG  . PRO A 165 ? 0.1441 1.1278 0.6960 0.1944  -0.0138 -0.0644 165 PRO A CG  
1289 C CD  . PRO A 165 ? 0.2408 1.1858 0.7579 0.1637  -0.0127 -0.0621 165 PRO A CD  
1290 N N   . ASP A 166 ? 0.2968 1.2140 0.8592 0.1452  -0.0391 -0.0710 166 ASP A N   
1291 C CA  . ASP A 166 ? 0.5466 1.4453 1.1185 0.1382  -0.0518 -0.0764 166 ASP A CA  
1292 C C   . ASP A 166 ? 0.5394 1.4198 1.1028 0.1105  -0.0449 -0.0692 166 ASP A C   
1293 O O   . ASP A 166 ? 0.6633 1.5324 1.2400 0.1044  -0.0528 -0.0708 166 ASP A O   
1294 C CB  . ASP A 166 ? 0.5750 1.4496 1.1235 0.1433  -0.0685 -0.0903 166 ASP A CB  
1295 C CG  . ASP A 166 ? 0.6249 1.4757 1.1290 0.1216  -0.0634 -0.0913 166 ASP A CG  
1296 O OD1 . ASP A 166 ? 0.6009 1.4445 1.0932 0.0985  -0.0505 -0.0843 166 ASP A OD1 
1297 O OD2 . ASP A 166 ? 0.7182 1.5574 1.1991 0.1286  -0.0744 -0.0997 166 ASP A OD2 
1298 N N   . GLY A 167 ? 0.2563 1.1330 0.7976 0.0959  -0.0319 -0.0626 167 GLY A N   
1299 C CA  . GLY A 167 ? 0.1195 0.9820 0.6549 0.0747  -0.0268 -0.0571 167 GLY A CA  
1300 C C   . GLY A 167 ? 0.2082 1.0462 0.7018 0.0549  -0.0225 -0.0623 167 GLY A C   
1301 O O   . GLY A 167 ? 0.2907 1.1180 0.7775 0.0398  -0.0189 -0.0604 167 GLY A O   
1302 N N   . GLU A 168 ? 0.1190 0.9494 0.5853 0.0556  -0.0239 -0.0696 168 GLU A N   
1303 C CA  . GLU A 168 ? 0.2415 1.0530 0.6695 0.0358  -0.0193 -0.0746 168 GLU A CA  
1304 C C   . GLU A 168 ? 0.3418 1.1561 0.7586 0.0314  -0.0088 -0.0680 168 GLU A C   
1305 O O   . GLU A 168 ? 0.3189 1.1508 0.7551 0.0439  -0.0048 -0.0591 168 GLU A O   
1306 C CB  . GLU A 168 ? 0.3903 1.1939 0.7942 0.0359  -0.0254 -0.0832 168 GLU A CB  
1307 C CG  . GLU A 168 ? 0.3618 1.1609 0.7777 0.0415  -0.0394 -0.0900 168 GLU A CG  
1308 C CD  . GLU A 168 ? 0.4611 1.2561 0.8611 0.0493  -0.0508 -0.0969 168 GLU A CD  
1309 O OE1 . GLU A 168 ? 0.3925 1.1744 0.7612 0.0299  -0.0519 -0.1015 168 GLU A OE1 
1310 O OE2 . GLU A 168 ? 0.4959 1.3018 0.9144 0.0752  -0.0603 -0.0980 168 GLU A OE2 
1311 N N   . GLN A 169 ? 0.3920 1.1908 0.7788 0.0136  -0.0048 -0.0729 169 GLN A N   
1312 C CA  . GLN A 169 ? 0.3106 1.1084 0.6889 0.0086  0.0026  -0.0679 169 GLN A CA  
1313 C C   . GLN A 169 ? 0.3343 1.1196 0.6766 -0.0031 0.0058  -0.0739 169 GLN A C   
1314 O O   . GLN A 169 ? 0.3534 1.1287 0.6739 -0.0166 0.0041  -0.0837 169 GLN A O   
1315 C CB  . GLN A 169 ? 0.1243 0.9181 0.5135 -0.0003 0.0037  -0.0669 169 GLN A CB  
1316 C CG  . GLN A 169 ? 0.1037 0.9131 0.5313 0.0109  0.0020  -0.0565 169 GLN A CG  
1317 C CD  . GLN A 169 ? 0.1442 0.9486 0.5826 0.0022  0.0013  -0.0553 169 GLN A CD  
1318 O OE1 . GLN A 169 ? 0.1228 0.9128 0.5411 -0.0106 0.0016  -0.0650 169 GLN A OE1 
1319 N NE2 . GLN A 169 ? 0.1144 0.9337 0.5864 0.0096  0.0000  -0.0441 169 GLN A NE2 
1320 N N   . ASP A 170 ? 0.2237 1.0117 0.5611 0.0016  0.0105  -0.0675 170 ASP A N   
1321 C CA  . ASP A 170 ? 0.2082 0.9834 0.5149 -0.0102 0.0135  -0.0718 170 ASP A CA  
1322 C C   . ASP A 170 ? 0.2662 1.0359 0.5746 -0.0170 0.0173  -0.0700 170 ASP A C   
1323 O O   . ASP A 170 ? 0.3543 1.1337 0.6859 -0.0083 0.0191  -0.0605 170 ASP A O   
1324 C CB  . ASP A 170 ? 0.2602 1.0394 0.5568 0.0011  0.0145  -0.0670 170 ASP A CB  
1325 C CG  . ASP A 170 ? 0.4591 1.2423 0.7519 0.0083  0.0087  -0.0709 170 ASP A CG  
1326 O OD1 . ASP A 170 ? 0.5949 1.3675 0.8640 -0.0071 0.0061  -0.0788 170 ASP A OD1 
1327 O OD2 . ASP A 170 ? 0.4111 1.2098 0.7255 0.0294  0.0061  -0.0670 170 ASP A OD2 
1328 N N   . VAL A 171 ? 0.2348 0.9912 0.5200 -0.0331 0.0183  -0.0801 171 VAL A N   
1329 C CA  . VAL A 171 ? 0.3307 1.0804 0.6166 -0.0396 0.0204  -0.0823 171 VAL A CA  
1330 C C   . VAL A 171 ? 0.4276 1.1677 0.6910 -0.0445 0.0229  -0.0834 171 VAL A C   
1331 O O   . VAL A 171 ? 0.3150 1.0498 0.5542 -0.0537 0.0228  -0.0905 171 VAL A O   
1332 C CB  . VAL A 171 ? 0.3349 1.0803 0.6158 -0.0529 0.0194  -0.0967 171 VAL A CB  
1333 C CG1 . VAL A 171 ? 0.3386 1.0773 0.6199 -0.0585 0.0210  -0.1020 171 VAL A CG1 
1334 C CG2 . VAL A 171 ? 0.3645 1.1176 0.6686 -0.0476 0.0162  -0.0947 171 VAL A CG2 
1335 N N   . TYR A 172 ? 0.3701 1.1087 0.6417 -0.0391 0.0249  -0.0754 172 TYR A N   
1336 C CA  . TYR A 172 ? 0.3237 1.0501 0.5752 -0.0448 0.0267  -0.0774 172 TYR A CA  
1337 C C   . TYR A 172 ? 0.2645 0.9826 0.5213 -0.0507 0.0274  -0.0816 172 TYR A C   
1338 O O   . TYR A 172 ? 0.3558 1.0798 0.6351 -0.0458 0.0271  -0.0757 172 TYR A O   
1339 C CB  . TYR A 172 ? 0.3466 1.0775 0.5994 -0.0316 0.0287  -0.0639 172 TYR A CB  
1340 C CG  . TYR A 172 ? 0.2921 1.0359 0.5479 -0.0196 0.0279  -0.0588 172 TYR A CG  
1341 C CD1 . TYR A 172 ? 0.2424 0.9817 0.4762 -0.0202 0.0266  -0.0607 172 TYR A CD1 
1342 C CD2 . TYR A 172 ? 0.2196 0.9813 0.5019 -0.0070 0.0280  -0.0522 172 TYR A CD2 
1343 C CE1 . TYR A 172 ? 0.1464 0.8978 0.3842 -0.0067 0.0249  -0.0575 172 TYR A CE1 
1344 C CE2 . TYR A 172 ? 0.2585 1.0333 0.5461 0.0067  0.0268  -0.0496 172 TYR A CE2 
1345 C CZ  . TYR A 172 ? 0.1166 0.8856 0.3815 0.0077  0.0249  -0.0529 172 TYR A CZ  
1346 O OH  . TYR A 172 ? 0.3883 1.1701 0.6589 0.0237  0.0222  -0.0523 172 TYR A OH  
1347 N N   . TYR A 173 ? 0.3124 1.0178 0.5492 -0.0616 0.0280  -0.0920 173 TYR A N   
1348 C CA  . TYR A 173 ? 0.2688 0.9650 0.5101 -0.0661 0.0285  -0.0976 173 TYR A CA  
1349 C C   . TYR A 173 ? 0.3300 1.0157 0.5633 -0.0631 0.0299  -0.0894 173 TYR A C   
1350 O O   . TYR A 173 ? 0.2813 0.9584 0.4931 -0.0686 0.0304  -0.0932 173 TYR A O   
1351 C CB  . TYR A 173 ? 0.3472 1.0405 0.5768 -0.0797 0.0289  -0.1184 173 TYR A CB  
1352 C CG  . TYR A 173 ? 0.3882 1.0928 0.6299 -0.0812 0.0277  -0.1263 173 TYR A CG  
1353 C CD1 . TYR A 173 ? 0.3926 1.0987 0.6552 -0.0789 0.0261  -0.1295 173 TYR A CD1 
1354 C CD2 . TYR A 173 ? 0.3892 1.1027 0.6223 -0.0848 0.0276  -0.1297 173 TYR A CD2 
1355 C CE1 . TYR A 173 ? 0.4354 1.1511 0.7101 -0.0793 0.0244  -0.1359 173 TYR A CE1 
1356 C CE2 . TYR A 173 ? 0.4032 1.1264 0.6484 -0.0856 0.0263  -0.1365 173 TYR A CE2 
1357 C CZ  . TYR A 173 ? 0.3937 1.1177 0.6597 -0.0824 0.0247  -0.1395 173 TYR A CZ  
1358 O OH  . TYR A 173 ? 0.3031 1.0358 0.5820 -0.0826 0.0228  -0.1461 173 TYR A OH  
1359 N N   . ILE A 174 ? 0.4625 1.1505 0.7136 -0.0547 0.0307  -0.0771 174 ILE A N   
1360 C CA  . ILE A 174 ? 0.4135 1.0929 0.6594 -0.0511 0.0325  -0.0682 174 ILE A CA  
1361 C C   . ILE A 174 ? 0.2959 0.9590 0.5401 -0.0593 0.0318  -0.0774 174 ILE A C   
1362 O O   . ILE A 174 ? 0.3332 0.9977 0.5945 -0.0605 0.0306  -0.0797 174 ILE A O   
1363 C CB  . ILE A 174 ? 0.3812 1.0763 0.6476 -0.0381 0.0352  -0.0498 174 ILE A CB  
1364 C CG1 . ILE A 174 ? 0.3243 1.0389 0.5970 -0.0277 0.0363  -0.0428 174 ILE A CG1 
1365 C CG2 . ILE A 174 ? 0.3819 1.0701 0.6414 -0.0335 0.0380  -0.0408 174 ILE A CG2 
1366 C CD1 . ILE A 174 ? 0.3922 1.1029 0.6437 -0.0245 0.0365  -0.0432 174 ILE A CD1 
1367 N N   . PRO A 175 ? 0.3287 0.9764 0.5535 -0.0648 0.0321  -0.0831 175 PRO A N   
1368 C CA  . PRO A 175 ? 0.3925 1.0244 0.6185 -0.0705 0.0317  -0.0911 175 PRO A CA  
1369 C C   . PRO A 175 ? 0.3619 0.9944 0.6058 -0.0634 0.0322  -0.0767 175 PRO A C   
1370 O O   . PRO A 175 ? 0.3251 0.9623 0.5689 -0.0552 0.0345  -0.0609 175 PRO A O   
1371 C CB  . PRO A 175 ? 0.3424 0.9593 0.5454 -0.0751 0.0324  -0.0940 175 PRO A CB  
1372 C CG  . PRO A 175 ? 0.2389 0.8652 0.4263 -0.0773 0.0324  -0.0950 175 PRO A CG  
1373 C CD  . PRO A 175 ? 0.2354 0.8791 0.4378 -0.0662 0.0324  -0.0822 175 PRO A CD  
1374 N N   . LEU A 176 ? 0.3405 0.9712 0.6006 -0.0664 0.0305  -0.0823 176 LEU A N   
1375 C CA  . LEU A 176 ? 0.3098 0.9445 0.5889 -0.0623 0.0305  -0.0689 176 LEU A CA  
1376 C C   . LEU A 176 ? 0.3016 0.9283 0.5748 -0.0588 0.0331  -0.0565 176 LEU A C   
1377 O O   . LEU A 176 ? 0.4055 1.0478 0.6907 -0.0518 0.0360  -0.0394 176 LEU A O   
1378 C CB  . LEU A 176 ? 0.4042 1.0310 0.6969 -0.0682 0.0269  -0.0804 176 LEU A CB  
1379 C CG  . LEU A 176 ? 0.4124 1.0552 0.7306 -0.0659 0.0249  -0.0700 176 LEU A CG  
1380 C CD1 . LEU A 176 ? 0.3295 0.9614 0.6615 -0.0707 0.0206  -0.0767 176 LEU A CD1 
1381 C CD2 . LEU A 176 ? 0.2944 0.9541 0.6203 -0.0591 0.0287  -0.0472 176 LEU A CD2 
1382 N N   . ASP A 177 ? 0.2916 0.8966 0.5477 -0.0634 0.0326  -0.0654 177 ASP A N   
1383 C CA  . ASP A 177 ? 0.4694 1.0636 0.7196 -0.0604 0.0345  -0.0547 177 ASP A CA  
1384 C C   . ASP A 177 ? 0.4557 1.0636 0.6998 -0.0501 0.0387  -0.0386 177 ASP A C   
1385 O O   . ASP A 177 ? 0.4659 1.0738 0.7111 -0.0443 0.0420  -0.0260 177 ASP A O   
1386 C CB  . ASP A 177 ? 0.4235 0.9904 0.6582 -0.0675 0.0329  -0.0678 177 ASP A CB  
1387 C CG  . ASP A 177 ? 0.6107 1.1732 0.8246 -0.0715 0.0328  -0.0783 177 ASP A CG  
1388 O OD1 . ASP A 177 ? 0.5180 1.0957 0.7266 -0.0678 0.0336  -0.0731 177 ASP A OD1 
1389 O OD2 . ASP A 177 ? 0.7531 1.2985 0.9567 -0.0786 0.0321  -0.0917 177 ASP A OD2 
1390 N N   . VAL A 178 ? 0.2730 0.8940 0.5120 -0.0467 0.0389  -0.0395 178 VAL A N   
1391 C CA  . VAL A 178 ? 0.3366 0.9755 0.5750 -0.0337 0.0433  -0.0248 178 VAL A CA  
1392 C C   . VAL A 178 ? 0.3604 1.0297 0.6202 -0.0253 0.0462  -0.0159 178 VAL A C   
1393 O O   . VAL A 178 ? 0.3296 1.0179 0.5910 -0.0127 0.0502  -0.0070 178 VAL A O   
1394 C CB  . VAL A 178 ? 0.3815 1.0144 0.5978 -0.0326 0.0420  -0.0289 178 VAL A CB  
1395 C CG1 . VAL A 178 ? 0.3365 0.9466 0.5349 -0.0349 0.0415  -0.0288 178 VAL A CG1 
1396 C CG2 . VAL A 178 ? 0.3467 0.9768 0.5556 -0.0435 0.0378  -0.0448 178 VAL A CG2 
1397 N N   . PHE A 179 ? 0.2798 0.9547 0.5571 -0.0311 0.0442  -0.0186 179 PHE A N   
1398 C CA  . PHE A 179 ? 0.2341 0.9379 0.5338 -0.0246 0.0464  -0.0100 179 PHE A CA  
1399 C C   . PHE A 179 ? 0.4418 1.1699 0.7574 -0.0139 0.0539  0.0076  179 PHE A C   
1400 O O   . PHE A 179 ? 0.3030 1.0257 0.6217 -0.0170 0.0554  0.0127  179 PHE A O   
1401 C CB  . PHE A 179 ? 0.3466 1.0498 0.6618 -0.0335 0.0420  -0.0159 179 PHE A CB  
1402 C CG  . PHE A 179 ? 0.4490 1.1827 0.7915 -0.0280 0.0443  -0.0035 179 PHE A CG  
1403 C CD1 . PHE A 179 ? 0.3367 1.0876 0.6861 -0.0219 0.0447  -0.0027 179 PHE A CD1 
1404 C CD2 . PHE A 179 ? 0.3975 1.1446 0.7598 -0.0292 0.0461  0.0079  179 PHE A CD2 
1405 C CE1 . PHE A 179 ? 0.3828 1.1638 0.7597 -0.0165 0.0471  0.0088  179 PHE A CE1 
1406 C CE2 . PHE A 179 ? 0.3443 1.1237 0.7336 -0.0251 0.0486  0.0202  179 PHE A CE2 
1407 C CZ  . PHE A 179 ? 0.3728 1.1693 0.7701 -0.0184 0.0491  0.0205  179 PHE A CZ  
1408 N N   . ASP A 180 ? 0.5035 1.2606 0.8300 -0.0009 0.0591  0.0160  180 ASP A N   
1409 C CA  . ASP A 180 ? 0.2984 1.0857 0.6400 0.0124  0.0688  0.0310  180 ASP A CA  
1410 C C   . ASP A 180 ? 0.3113 1.1364 0.6842 0.0168  0.0724  0.0396  180 ASP A C   
1411 O O   . ASP A 180 ? 0.2462 1.0925 0.6277 0.0274  0.0745  0.0401  180 ASP A O   
1412 C CB  . ASP A 180 ? 0.4189 1.2122 0.7464 0.0288  0.0739  0.0329  180 ASP A CB  
1413 C CG  . ASP A 180 ? 0.5781 1.4059 0.9199 0.0463  0.0864  0.0462  180 ASP A CG  
1414 O OD1 . ASP A 180 ? 0.5748 1.4346 0.9439 0.0475  0.0918  0.0547  180 ASP A OD1 
1415 O OD2 . ASP A 180 ? 0.5873 1.4122 0.9131 0.0599  0.0913  0.0480  180 ASP A OD2 
1416 N N   . ARG A 181 ? 0.3371 1.1715 0.7280 0.0086  0.0729  0.0465  181 ARG A N   
1417 C CA  . ARG A 181 ? 0.5210 1.3896 0.9433 0.0083  0.0745  0.0552  181 ARG A CA  
1418 C C   . ARG A 181 ? 0.5066 1.4204 0.9495 0.0254  0.0842  0.0638  181 ARG A C   
1419 O O   . ARG A 181 ? 0.6138 1.5513 1.0798 0.0264  0.0834  0.0668  181 ARG A O   
1420 C CB  . ARG A 181 ? 0.6706 1.5476 1.1084 -0.0020 0.0752  0.0644  181 ARG A CB  
1421 C CG  . ARG A 181 ? 0.8464 1.7510 1.3148 -0.0073 0.0730  0.0720  181 ARG A CG  
1422 C CD  . ARG A 181 ? 0.9234 1.8281 1.4034 -0.0214 0.0695  0.0790  181 ARG A CD  
1423 N NE  . ARG A 181 ? 0.9005 1.8125 1.4008 -0.0299 0.0615  0.0812  181 ARG A NE  
1424 C CZ  . ARG A 181 ? 0.8404 1.7519 1.3531 -0.0430 0.0552  0.0868  181 ARG A CZ  
1425 N NH1 . ARG A 181 ? 0.8502 1.7542 1.3571 -0.0502 0.0561  0.0903  181 ARG A NH1 
1426 N NH2 . ARG A 181 ? 0.7971 1.7148 1.3280 -0.0491 0.0474  0.0892  181 ARG A NH2 
1427 N N   . ASP A 182 ? 0.3780 1.3053 0.8142 0.0401  0.0938  0.0674  182 ASP A N   
1428 C CA  . ASP A 182 ? 0.4851 1.4608 0.9438 0.0589  0.1044  0.0738  182 ASP A CA  
1429 C C   . ASP A 182 ? 0.4630 1.4351 0.9126 0.0716  0.1014  0.0645  182 ASP A C   
1430 O O   . ASP A 182 ? 0.5975 1.6038 1.0705 0.0825  0.1046  0.0658  182 ASP A O   
1431 C CB  . ASP A 182 ? 0.7675 1.7715 1.2301 0.0724  0.1190  0.0825  182 ASP A CB  
1432 C CG  . ASP A 182 ? 0.9352 1.9067 1.3637 0.0795  0.1198  0.0776  182 ASP A CG  
1433 O OD1 . ASP A 182 ? 1.0296 1.9728 1.4359 0.0822  0.1121  0.0678  182 ASP A OD1 
1434 O OD2 . ASP A 182 ? 0.8522 1.8274 1.2766 0.0820  0.1283  0.0841  182 ASP A OD2 
1435 N N   . ARG A 183 ? 0.4301 1.3621 0.8471 0.0694  0.0948  0.0549  183 ARG A N   
1436 C CA  . ARG A 183 ? 0.4831 1.4066 0.8886 0.0772  0.0896  0.0451  183 ARG A CA  
1437 C C   . ARG A 183 ? 0.4800 1.3923 0.8931 0.0634  0.0800  0.0390  183 ARG A C   
1438 O O   . ARG A 183 ? 0.5254 1.4516 0.9485 0.0716  0.0783  0.0353  183 ARG A O   
1439 C CB  . ARG A 183 ? 0.6811 1.5662 1.0497 0.0757  0.0850  0.0374  183 ARG A CB  
1440 C CG  . ARG A 183 ? 0.8043 1.7001 1.1609 0.0979  0.0931  0.0401  183 ARG A CG  
1441 C CD  . ARG A 183 ? 0.8635 1.7231 1.1854 0.0968  0.0860  0.0318  183 ARG A CD  
1442 N NE  . ARG A 183 ? 0.9590 1.8236 1.2653 0.1196  0.0930  0.0345  183 ARG A NE  
1443 C CZ  . ARG A 183 ? 1.0948 1.9849 1.4037 0.1468  0.0975  0.0326  183 ARG A CZ  
1444 N NH1 . ARG A 183 ? 1.1910 2.0814 1.4814 0.1702  0.1038  0.0339  183 ARG A NH1 
1445 N NH2 . ARG A 183 ? 1.0420 1.9564 1.3714 0.1529  0.0956  0.0283  183 ARG A NH2 
1446 N N   . ILE A 184 ? 0.4924 1.3793 0.9006 0.0440  0.0736  0.0370  184 ILE A N   
1447 C CA  . ILE A 184 ? 0.3785 1.2471 0.7862 0.0313  0.0644  0.0284  184 ILE A CA  
1448 C C   . ILE A 184 ? 0.3698 1.2550 0.8061 0.0240  0.0633  0.0357  184 ILE A C   
1449 O O   . ILE A 184 ? 0.3965 1.2667 0.8315 0.0114  0.0601  0.0362  184 ILE A O   
1450 C CB  . ILE A 184 ? 0.3758 1.2016 0.7540 0.0164  0.0573  0.0167  184 ILE A CB  
1451 C CG1 . ILE A 184 ? 0.4063 1.2167 0.7568 0.0220  0.0578  0.0113  184 ILE A CG1 
1452 C CG2 . ILE A 184 ? 0.5221 1.3323 0.8990 0.0054  0.0494  0.0059  184 ILE A CG2 
1453 C CD1 . ILE A 184 ? 0.4563 1.2696 0.8006 0.0286  0.0552  0.0047  184 ILE A CD1 
1454 N N   . LYS A 185 ? 0.4241 1.3411 0.8873 0.0323  0.0654  0.0412  185 LYS A N   
1455 C CA  . LYS A 185 ? 0.3548 1.2882 0.8463 0.0248  0.0632  0.0489  185 LYS A CA  
1456 C C   . LYS A 185 ? 0.2733 1.2241 0.7857 0.0307  0.0606  0.0484  185 LYS A C   
1457 O O   . LYS A 185 ? 0.3654 1.3351 0.8832 0.0454  0.0645  0.0469  185 LYS A O   
1458 C CB  . LYS A 185 ? 0.3361 1.3052 0.8509 0.0273  0.0717  0.0640  185 LYS A CB  
1459 C CG  . LYS A 185 ? 0.3704 1.3915 0.9191 0.0414  0.0798  0.0732  185 LYS A CG  
1460 C CD  . LYS A 185 ? 0.4258 1.4861 0.9997 0.0400  0.0885  0.0882  185 LYS A CD  
1461 C CE  . LYS A 185 ? 0.5826 1.6404 1.1381 0.0442  0.0969  0.0895  185 LYS A CE  
1462 N NZ  . LYS A 185 ? 0.6911 1.7937 1.2725 0.0435  0.1076  0.1039  185 LYS A NZ  
1463 N N   . LYS A 186 ? 0.2174 1.1614 0.7424 0.0202  0.0535  0.0489  186 LYS A N   
1464 C CA  . LYS A 186 ? 0.2491 1.2084 0.7968 0.0248  0.0502  0.0495  186 LYS A CA  
1465 C C   . LYS A 186 ? 0.2379 1.2457 0.8163 0.0401  0.0585  0.0594  186 LYS A C   
1466 O O   . LYS A 186 ? 0.4029 1.4419 1.0002 0.0412  0.0655  0.0714  186 LYS A O   
1467 C CB  . LYS A 186 ? 0.4481 1.4029 1.0130 0.0128  0.0427  0.0539  186 LYS A CB  
1468 C CG  . LYS A 186 ? 0.6111 1.5679 1.1923 0.0151  0.0366  0.0513  186 LYS A CG  
1469 C CD  . LYS A 186 ? 0.6556 1.6076 1.2540 0.0041  0.0287  0.0566  186 LYS A CD  
1470 C CE  . LYS A 186 ? 0.6829 1.6205 1.2852 0.0041  0.0209  0.0490  186 LYS A CE  
1471 N NZ  . LYS A 186 ? 0.6625 1.6222 1.2814 0.0170  0.0233  0.0498  186 LYS A NZ  
1472 N N   . GLY A 187 ? 0.1917 1.2081 0.7757 0.0524  0.0580  0.0532  187 GLY A N   
1473 C CA  . GLY A 187 ? 0.0604 1.1257 0.6780 0.0691  0.0649  0.0593  187 GLY A CA  
1474 C C   . GLY A 187 ? 0.1536 1.2348 0.7611 0.0873  0.0733  0.0548  187 GLY A C   
1475 O O   . GLY A 187 ? 0.1901 1.3131 0.8239 0.1054  0.0792  0.0557  187 GLY A O   
1476 N N   . LYS A 188 ? 0.2901 1.3393 0.8605 0.0841  0.0735  0.0491  188 LYS A N   
1477 C CA  . LYS A 188 ? 0.1820 1.2440 0.7404 0.1020  0.0812  0.0458  188 LYS A CA  
1478 C C   . LYS A 188 ? 0.3404 1.3863 0.8816 0.1136  0.0753  0.0324  188 LYS A C   
1479 O O   . LYS A 188 ? 0.3887 1.3972 0.9094 0.1017  0.0657  0.0243  188 LYS A O   
1480 C CB  . LYS A 188 ? 0.3229 1.3606 0.8518 0.0940  0.0843  0.0478  188 LYS A CB  
1481 C CG  . LYS A 188 ? 0.4685 1.5357 0.9985 0.1126  0.0965  0.0518  188 LYS A CG  
1482 C CD  . LYS A 188 ? 0.5777 1.7011 1.1483 0.1195  0.1073  0.0632  188 LYS A CD  
1483 C CE  . LYS A 188 ? 0.6435 1.8103 1.2245 0.1476  0.1197  0.0615  188 LYS A CE  
1484 N NZ  . LYS A 188 ? 0.6286 1.8594 1.2558 0.1560  0.1302  0.0696  188 LYS A NZ  
1485 N N   . GLU A 189 ? 0.3235 1.4007 0.8740 0.1382  0.0811  0.0292  189 GLU A N   
1486 C CA  . GLU A 189 ? 0.2454 1.3107 0.7794 0.1535  0.0749  0.0160  189 GLU A CA  
1487 C C   . GLU A 189 ? 0.4001 1.4296 0.8909 0.1510  0.0738  0.0117  189 GLU A C   
1488 O O   . GLU A 189 ? 0.5588 1.5960 1.0408 0.1575  0.0823  0.0170  189 GLU A O   
1489 C CB  . GLU A 189 ? 0.1403 1.2538 0.7001 0.1850  0.0807  0.0121  189 GLU A CB  
1490 C CG  . GLU A 189 ? 0.5404 1.6426 1.0835 0.2059  0.0721  -0.0032 189 GLU A CG  
1491 C CD  . GLU A 189 ? 0.6391 1.7208 1.1869 0.1978  0.0586  -0.0113 189 GLU A CD  
1492 O OE1 . GLU A 189 ? 0.6273 1.6698 1.1431 0.1912  0.0492  -0.0195 189 GLU A OE1 
1493 O OE2 . GLU A 189 ? 0.4939 1.6002 1.0783 0.1981  0.0573  -0.0092 189 GLU A OE2 
1494 N N   . VAL A 190 ? 0.4094 1.4006 0.8739 0.1407  0.0636  0.0026  190 VAL A N   
1495 C CA  . VAL A 190 ? 0.4018 1.3636 0.8276 0.1409  0.0615  -0.0025 190 VAL A CA  
1496 C C   . VAL A 190 ? 0.3911 1.3540 0.8083 0.1623  0.0547  -0.0142 190 VAL A C   
1497 O O   . VAL A 190 ? 0.4149 1.3865 0.8496 0.1680  0.0481  -0.0206 190 VAL A O   
1498 C CB  . VAL A 190 ? 0.4580 1.3765 0.8569 0.1121  0.0553  -0.0049 190 VAL A CB  
1499 C CG1 . VAL A 190 ? 0.5105 1.4267 0.9278 0.0931  0.0541  -0.0007 190 VAL A CG1 
1500 C CG2 . VAL A 190 ? 0.3576 1.2531 0.7348 0.1096  0.0458  -0.0166 190 VAL A CG2 
1501 N N   . LYS A 191 ? 0.3896 1.3417 0.7792 0.1754  0.0550  -0.0172 191 LYS A N   
1502 C CA  . LYS A 191 ? 0.4115 1.3639 0.7900 0.2015  0.0470  -0.0289 191 LYS A CA  
1503 C C   . LYS A 191 ? 0.4487 1.3607 0.7889 0.1875  0.0385  -0.0340 191 LYS A C   
1504 O O   . LYS A 191 ? 0.4763 1.3661 0.7971 0.1654  0.0420  -0.0281 191 LYS A O   
1505 C CB  . LYS A 191 ? 0.5734 1.5520 0.9525 0.2366  0.0541  -0.0291 191 LYS A CB  
1506 C CG  . LYS A 191 ? 0.7203 1.7460 1.1389 0.2470  0.0659  -0.0225 191 LYS A CG  
1507 C CD  . LYS A 191 ? 0.9480 1.9972 1.3623 0.2730  0.0779  -0.0193 191 LYS A CD  
1508 C CE  . LYS A 191 ? 1.0543 2.0835 1.4496 0.2516  0.0866  -0.0066 191 LYS A CE  
1509 N NZ  . LYS A 191 ? 1.0870 2.1315 1.5096 0.2263  0.0943  0.0059  191 LYS A NZ  
1510 N N   . GLN A 192 ? 0.4515 1.3543 0.7822 0.2000  0.0259  -0.0455 192 GLN A N   
1511 C CA  . GLN A 192 ? 0.4429 1.3121 0.7401 0.1849  0.0172  -0.0501 192 GLN A CA  
1512 C C   . GLN A 192 ? 0.5665 1.4240 0.8347 0.1978  0.0201  -0.0472 192 GLN A C   
1513 O O   . GLN A 192 ? 0.6820 1.5516 0.9478 0.2343  0.0201  -0.0498 192 GLN A O   
1514 C CB  . GLN A 192 ? 0.5452 1.4082 0.8399 0.1997  -0.0001 -0.0627 192 GLN A CB  
1515 C CG  . GLN A 192 ? 0.5572 1.3905 0.8199 0.1833  -0.0112 -0.0668 192 GLN A CG  
1516 C CD  . GLN A 192 ? 0.5942 1.4180 0.8513 0.2045  -0.0358 -0.0783 192 GLN A CD  
1517 O OE1 . GLN A 192 ? 0.6373 1.4371 0.8663 0.1955  -0.0540 -0.0806 192 GLN A OE1 
1518 N NE2 . GLN A 192 ? 0.5586 1.3987 0.8404 0.2321  -0.0426 -0.0849 192 GLN A NE2 
1519 N N   . GLY A 193 ? 0.6206 1.4536 0.8660 0.1697  0.0223  -0.0428 193 GLY A N   
1520 C CA  . GLY A 193 ? 0.6224 1.4411 0.8405 0.1789  0.0252  -0.0389 193 GLY A CA  
1521 C C   . GLY A 193 ? 0.5438 1.3670 0.7679 0.1711  0.0387  -0.0274 193 GLY A C   
1522 O O   . GLY A 193 ? 0.4973 1.3026 0.6991 0.1677  0.0417  -0.0227 193 GLY A O   
1523 N N   . GLU A 194 ? 0.3705 1.2170 0.6256 0.1683  0.0454  -0.0229 194 GLU A N   
1524 C CA  . GLU A 194 ? 0.4188 1.2706 0.6833 0.1596  0.0559  -0.0120 194 GLU A CA  
1525 C C   . GLU A 194 ? 0.4644 1.2861 0.7147 0.1257  0.0542  -0.0094 194 GLU A C   
1526 O O   . GLU A 194 ? 0.6708 1.4799 0.9224 0.1015  0.0485  -0.0142 194 GLU A O   
1527 C CB  . GLU A 194 ? 0.5034 1.3867 0.8054 0.1605  0.0617  -0.0077 194 GLU A CB  
1528 C CG  . GLU A 194 ? 0.5505 1.4380 0.8622 0.1491  0.0708  0.0034  194 GLU A CG  
1529 C CD  . GLU A 194 ? 0.6064 1.5226 0.9547 0.1444  0.0753  0.0086  194 GLU A CD  
1530 O OE1 . GLU A 194 ? 0.5004 1.4080 0.8548 0.1236  0.0767  0.0148  194 GLU A OE1 
1531 O OE2 . GLU A 194 ? 0.6189 1.5662 0.9904 0.1624  0.0764  0.0059  194 GLU A OE2 
1532 N N   . MET A 195 ? 0.4828 1.2930 0.7194 0.1262  0.0591  -0.0028 195 MET A N   
1533 C CA  . MET A 195 ? 0.5337 1.3169 0.7600 0.0977  0.0571  -0.0015 195 MET A CA  
1534 C C   . MET A 195 ? 0.4904 1.2825 0.7421 0.0837  0.0597  0.0018  195 MET A C   
1535 O O   . MET A 195 ? 0.4475 1.2608 0.7179 0.0947  0.0678  0.0102  195 MET A O   
1536 C CB  . MET A 195 ? 0.5059 1.2757 0.7145 0.1054  0.0618  0.0052  195 MET A CB  
1537 C CG  . MET A 195 ? 0.5979 1.3374 0.7942 0.0783  0.0579  0.0043  195 MET A CG  
1538 S SD  . MET A 195 ? 0.5795 1.3059 0.7625 0.0894  0.0647  0.0141  195 MET A SD  
1539 C CE  . MET A 195 ? 0.3069 1.0201 0.4573 0.1078  0.0621  0.0120  195 MET A CE  
1540 N N   . LEU A 196 ? 0.4548 1.2320 0.7065 0.0606  0.0533  -0.0054 196 LEU A N   
1541 C CA  . LEU A 196 ? 0.4718 1.2535 0.7445 0.0487  0.0541  -0.0037 196 LEU A CA  
1542 C C   . LEU A 196 ? 0.4696 1.2284 0.7328 0.0338  0.0538  -0.0033 196 LEU A C   
1543 O O   . LEU A 196 ? 0.4296 1.1929 0.7095 0.0285  0.0558  0.0008  196 LEU A O   
1544 C CB  . LEU A 196 ? 0.4063 1.1835 0.6832 0.0354  0.0478  -0.0131 196 LEU A CB  
1545 C CG  . LEU A 196 ? 0.3512 1.1469 0.6360 0.0494  0.0466  -0.0152 196 LEU A CG  
1546 C CD1 . LEU A 196 ? 0.3492 1.1392 0.6376 0.0363  0.0406  -0.0242 196 LEU A CD1 
1547 C CD2 . LEU A 196 ? 0.3467 1.1763 0.6597 0.0701  0.0533  -0.0061 196 LEU A CD2 
1548 N N   . ALA A 197 ? 0.3691 1.1038 0.6061 0.0274  0.0506  -0.0077 197 ALA A N   
1549 C CA  . ALA A 197 ? 0.2334 0.9453 0.4609 0.0154  0.0499  -0.0084 197 ALA A CA  
1550 C C   . ALA A 197 ? 0.4723 1.1654 0.6740 0.0163  0.0485  -0.0087 197 ALA A C   
1551 O O   . ALA A 197 ? 0.4585 1.1483 0.6442 0.0159  0.0449  -0.0135 197 ALA A O   
1552 C CB  . ALA A 197 ? 0.2170 0.9127 0.4437 -0.0050 0.0445  -0.0202 197 ALA A CB  
1553 N N   . GLU A 198 ? 0.4649 1.1460 0.6631 0.0171  0.0512  -0.0030 198 GLU A N   
1554 C CA  . GLU A 198 ? 0.4977 1.1594 0.6731 0.0186  0.0501  -0.0016 198 GLU A CA  
1555 C C   . GLU A 198 ? 0.5110 1.1470 0.6679 -0.0041 0.0426  -0.0141 198 GLU A C   
1556 O O   . GLU A 198 ? 0.3911 1.0226 0.5524 -0.0199 0.0394  -0.0251 198 GLU A O   
1557 C CB  . GLU A 198 ? 0.5030 1.1589 0.6817 0.0262  0.0559  0.0082  198 GLU A CB  
1558 C CG  . GLU A 198 ? 0.6003 1.2804 0.7849 0.0541  0.0660  0.0207  198 GLU A CG  
1559 C CD  . GLU A 198 ? 0.7532 1.4359 0.9475 0.0600  0.0740  0.0304  198 GLU A CD  
1560 O OE1 . GLU A 198 ? 0.9005 1.5560 1.0845 0.0495  0.0716  0.0300  198 GLU A OE1 
1561 O OE2 . GLU A 198 ? 0.7250 1.4386 0.9382 0.0745  0.0830  0.0380  198 GLU A OE2 
1562 N N   . ALA A 199 ? 0.5528 1.1744 0.6888 -0.0040 0.0407  -0.0126 199 ALA A N   
1563 C CA  . ALA A 199 ? 0.6667 1.2666 0.7841 -0.0256 0.0349  -0.0233 199 ALA A CA  
1564 C C   . ALA A 199 ? 0.6701 1.2512 0.7917 -0.0375 0.0345  -0.0291 199 ALA A C   
1565 O O   . ALA A 199 ? 0.5279 1.1095 0.6638 -0.0287 0.0382  -0.0219 199 ALA A O   
1566 C CB  . ALA A 199 ? 0.6507 1.2403 0.7473 -0.0211 0.0336  -0.0170 199 ALA A CB  
1567 N N   . ARG A 200 ? 0.5573 1.1240 0.6665 -0.0571 0.0310  -0.0429 200 ARG A N   
1568 C CA  . ARG A 200 ? 0.5332 1.0812 0.6450 -0.0664 0.0310  -0.0510 200 ARG A CA  
1569 C C   . ARG A 200 ? 0.6101 1.1376 0.7007 -0.0780 0.0289  -0.0547 200 ARG A C   
1570 O O   . ARG A 200 ? 0.6340 1.1642 0.7071 -0.0884 0.0271  -0.0586 200 ARG A O   
1571 C CB  . ARG A 200 ? 0.4939 1.0474 0.6150 -0.0772 0.0313  -0.0676 200 ARG A CB  
1572 C CG  . ARG A 200 ? 0.5837 1.1552 0.7268 -0.0684 0.0327  -0.0642 200 ARG A CG  
1573 C CD  . ARG A 200 ? 0.5999 1.1875 0.7431 -0.0748 0.0322  -0.0748 200 ARG A CD  
1574 N NE  . ARG A 200 ? 0.7838 1.3673 0.9254 -0.0887 0.0325  -0.0941 200 ARG A NE  
1575 C CZ  . ARG A 200 ? 0.7187 1.3142 0.8538 -0.0985 0.0331  -0.1069 200 ARG A CZ  
1576 N NH1 . ARG A 200 ? 0.5959 1.2044 0.7242 -0.0974 0.0323  -0.1018 200 ARG A NH1 
1577 N NH2 . ARG A 200 ? 0.7980 1.3943 0.9346 -0.1091 0.0351  -0.1255 200 ARG A NH2 
1578 N N   . LYS A 201 ? 0.4976 1.0049 0.5898 -0.0775 0.0292  -0.0529 201 LYS A N   
1579 C CA  . LYS A 201 ? 0.5175 1.0036 0.5918 -0.0895 0.0275  -0.0573 201 LYS A CA  
1580 C C   . LYS A 201 ? 0.4632 0.9415 0.5419 -0.1021 0.0293  -0.0759 201 LYS A C   
1581 O O   . LYS A 201 ? 0.4405 0.9249 0.5378 -0.0992 0.0308  -0.0833 201 LYS A O   
1582 C CB  . LYS A 201 ? 0.5146 0.9815 0.5866 -0.0797 0.0271  -0.0429 201 LYS A CB  
1583 C CG  . LYS A 201 ? 0.4720 0.9475 0.5383 -0.0641 0.0276  -0.0255 201 LYS A CG  
1584 C CD  . LYS A 201 ? 0.6056 1.0592 0.6651 -0.0562 0.0286  -0.0135 201 LYS A CD  
1585 C CE  . LYS A 201 ? 0.6728 1.1333 0.7230 -0.0357 0.0328  0.0024  201 LYS A CE  
1586 N NZ  . LYS A 201 ? 0.7142 1.1458 0.7479 -0.0295 0.0362  0.0125  201 LYS A NZ  
1587 N N   . PHE A 202 ? 0.4195 0.8863 0.4821 -0.1158 0.0296  -0.0832 202 PHE A N   
1588 C CA  . PHE A 202 ? 0.4509 0.9153 0.5200 -0.1260 0.0332  -0.1020 202 PHE A CA  
1589 C C   . PHE A 202 ? 0.5063 0.9484 0.5634 -0.1334 0.0333  -0.1007 202 PHE A C   
1590 O O   . PHE A 202 ? 0.6922 1.1287 0.7269 -0.1415 0.0316  -0.0918 202 PHE A O   
1591 C CB  . PHE A 202 ? 0.4952 0.9847 0.5602 -0.1390 0.0367  -0.1175 202 PHE A CB  
1592 C CG  . PHE A 202 ? 0.4889 0.9989 0.5654 -0.1322 0.0361  -0.1183 202 PHE A CG  
1593 C CD1 . PHE A 202 ? 0.5187 1.0388 0.6167 -0.1295 0.0382  -0.1320 202 PHE A CD1 
1594 C CD2 . PHE A 202 ? 0.3975 0.9163 0.4653 -0.1273 0.0332  -0.1046 202 PHE A CD2 
1595 C CE1 . PHE A 202 ? 0.5145 1.0517 0.6230 -0.1235 0.0373  -0.1310 202 PHE A CE1 
1596 C CE2 . PHE A 202 ? 0.4035 0.9407 0.4837 -0.1203 0.0330  -0.1043 202 PHE A CE2 
1597 C CZ  . PHE A 202 ? 0.4827 1.0284 0.5824 -0.1190 0.0350  -0.1169 202 PHE A CZ  
1598 N N   . PHE A 203 ? 0.5382 0.9665 0.6108 -0.1312 0.0347  -0.1090 203 PHE A N   
1599 C CA  . PHE A 203 ? 0.4686 0.8739 0.5341 -0.1369 0.0346  -0.1074 203 PHE A CA  
1600 C C   . PHE A 203 ? 0.4911 0.9050 0.5712 -0.1461 0.0392  -0.1288 203 PHE A C   
1601 O O   . PHE A 203 ? 0.5475 0.9772 0.6492 -0.1430 0.0414  -0.1447 203 PHE A O   
1602 C CB  . PHE A 203 ? 0.5393 0.9178 0.6128 -0.1244 0.0313  -0.0957 203 PHE A CB  
1603 C CG  . PHE A 203 ? 0.4394 0.8184 0.5081 -0.1127 0.0283  -0.0770 203 PHE A CG  
1604 C CD1 . PHE A 203 ? 0.5197 0.8826 0.5714 -0.1101 0.0252  -0.0598 203 PHE A CD1 
1605 C CD2 . PHE A 203 ? 0.3622 0.7603 0.4459 -0.1037 0.0288  -0.0762 203 PHE A CD2 
1606 C CE1 . PHE A 203 ? 0.5423 0.9127 0.5957 -0.0959 0.0242  -0.0434 203 PHE A CE1 
1607 C CE2 . PHE A 203 ? 0.4892 0.8945 0.5736 -0.0912 0.0279  -0.0585 203 PHE A CE2 
1608 C CZ  . PHE A 203 ? 0.4840 0.8775 0.5548 -0.0858 0.0264  -0.0427 203 PHE A CZ  
1609 N N   . ALA A 204 ? 0.5695 0.9748 0.6398 -0.1577 0.0401  -0.1291 204 ALA A N   
1610 C CA  . ALA A 204 ? 0.5202 0.9398 0.6083 -0.1672 0.0444  -0.1501 204 ALA A CA  
1611 C C   . ALA A 204 ? 0.5272 0.9376 0.6475 -0.1539 0.0430  -0.1611 204 ALA A C   
1612 O O   . ALA A 204 ? 0.5611 0.9418 0.6844 -0.1448 0.0385  -0.1495 204 ALA A O   
1613 C CB  . ALA A 204 ? 0.5516 0.9580 0.6267 -0.1809 0.0433  -0.1440 204 ALA A CB  
1614 N N   . LYS A 205 ? 0.4729 0.9084 0.6170 -0.1534 0.0462  -0.1832 205 LYS A N   
1615 C CA  . LYS A 205 ? 0.5299 0.9578 0.7070 -0.1431 0.0437  -0.1961 205 LYS A CA  
1616 C C   . LYS A 205 ? 0.6166 1.0366 0.8099 -0.1473 0.0423  -0.2053 205 LYS A C   
1617 O O   . LYS A 205 ? 0.6191 1.0203 0.8362 -0.1378 0.0370  -0.2087 205 LYS A O   
1618 C CB  . LYS A 205 ? 0.3782 0.8360 0.5774 -0.1416 0.0461  -0.2181 205 LYS A CB  
1619 C CG  . LYS A 205 ? 0.5110 0.9727 0.7001 -0.1355 0.0450  -0.2072 205 LYS A CG  
1620 C CD  . LYS A 205 ? 0.4337 0.9214 0.6449 -0.1336 0.0460  -0.2269 205 LYS A CD  
1621 C CE  . LYS A 205 ? 0.4875 0.9809 0.6863 -0.1295 0.0446  -0.2132 205 LYS A CE  
1622 N NZ  . LYS A 205 ? 0.5240 0.9914 0.7191 -0.1192 0.0396  -0.1903 205 LYS A NZ  
1623 N N   . VAL A 206 ? 0.6152 1.0495 0.7958 -0.1628 0.0458  -0.2080 206 VAL A N   
1624 C CA  . VAL A 206 ? 0.5679 1.0017 0.7659 -0.1700 0.0441  -0.2183 206 VAL A CA  
1625 C C   . VAL A 206 ? 0.5920 1.0174 0.7583 -0.1864 0.0438  -0.2013 206 VAL A C   
1626 O O   . VAL A 206 ? 0.7662 1.1981 0.9005 -0.1953 0.0469  -0.1887 206 VAL A O   
1627 C CB  . VAL A 206 ? 0.5149 0.9918 0.7438 -0.1770 0.0490  -0.2518 206 VAL A CB  
1628 C CG1 . VAL A 206 ? 0.5695 1.0835 0.7768 -0.1956 0.0575  -0.2573 206 VAL A CG1 
1629 C CG2 . VAL A 206 ? 0.6313 1.1093 0.8886 -0.1812 0.0449  -0.2662 206 VAL A CG2 
1630 N N   . SER A 207 ? 0.4220 0.8309 0.5975 -0.1908 0.0382  -0.1999 207 SER A N   
1631 C CA  . SER A 207 ? 0.6013 1.0021 0.7487 -0.2101 0.0359  -0.1855 207 SER A CA  
1632 C C   . SER A 207 ? 0.5777 1.0225 0.7329 -0.2325 0.0422  -0.2072 207 SER A C   
1633 O O   . SER A 207 ? 0.5245 0.9976 0.7181 -0.2307 0.0448  -0.2353 207 SER A O   
1634 C CB  . SER A 207 ? 0.5275 0.8863 0.6787 -0.2064 0.0240  -0.1725 207 SER A CB  
1635 O OG  . SER A 207 ? 0.6813 1.0021 0.8260 -0.1874 0.0185  -0.1540 207 SER A OG  
1636 N N   . GLY A 208 ? 0.4656 0.9166 0.5848 -0.2551 0.0438  -0.1945 208 GLY A N   
1637 C CA  . GLY A 208 ? 0.5645 1.0584 0.6856 -0.2816 0.0499  -0.2126 208 GLY A CA  
1638 C C   . GLY A 208 ? 0.7089 1.2110 0.7836 -0.3057 0.0527  -0.1967 208 GLY A C   
1639 O O   . GLY A 208 ? 0.7530 1.2194 0.7924 -0.3031 0.0468  -0.1689 208 GLY A O   
1640 N N   . ARG A 209 ? 0.6511 1.2005 0.7259 -0.3305 0.0608  -0.2152 209 ARG A N   
1641 C CA  . ARG A 209 ? 0.5631 1.1226 0.5930 -0.3582 0.0629  -0.2017 209 ARG A CA  
1642 C C   . ARG A 209 ? 0.6741 1.2600 0.7007 -0.3513 0.0707  -0.2093 209 ARG A C   
1643 O O   . ARG A 209 ? 0.6568 1.2790 0.7172 -0.3423 0.0783  -0.2368 209 ARG A O   
1644 C CB  . ARG A 209 ? 0.6044 1.2027 0.6330 -0.3941 0.0671  -0.2171 209 ARG A CB  
1645 C CG  . ARG A 209 ? 0.5851 1.1828 0.5596 -0.4295 0.0657  -0.1981 209 ARG A CG  
1646 C CD  . ARG A 209 ? 0.7889 1.3461 0.7333 -0.4504 0.0528  -0.1754 209 ARG A CD  
1647 N NE  . ARG A 209 ? 0.8738 1.4684 0.8221 -0.4858 0.0559  -0.1918 209 ARG A NE  
1648 C CZ  . ARG A 209 ? 0.8636 1.4455 0.8242 -0.4940 0.0479  -0.1931 209 ARG A CZ  
1649 N NH1 . ARG A 209 ? 0.8826 1.4114 0.8509 -0.4687 0.0357  -0.1780 209 ARG A NH1 
1650 N NH2 . ARG A 209 ? 0.6803 1.3039 0.6460 -0.5286 0.0517  -0.2103 209 ARG A NH2 
1651 N N   . VAL A 210 ? 0.6314 1.1980 0.6181 -0.3558 0.0674  -0.1856 210 VAL A N   
1652 C CA  . VAL A 210 ? 0.6321 1.2218 0.6153 -0.3501 0.0728  -0.1917 210 VAL A CA  
1653 C C   . VAL A 210 ? 0.7690 1.4002 0.7326 -0.3842 0.0797  -0.2018 210 VAL A C   
1654 O O   . VAL A 210 ? 0.8748 1.5044 0.8089 -0.4161 0.0778  -0.1923 210 VAL A O   
1655 C CB  . VAL A 210 ? 0.6210 1.1750 0.5770 -0.3357 0.0656  -0.1648 210 VAL A CB  
1656 C CG1 . VAL A 210 ? 0.6014 1.1121 0.5692 -0.3080 0.0582  -0.1510 210 VAL A CG1 
1657 C CG2 . VAL A 210 ? 0.6238 1.1628 0.5301 -0.3652 0.0605  -0.1421 210 VAL A CG2 
1658 N N   . GLU A 211 ? 0.7376 1.4042 0.7163 -0.3789 0.0869  -0.2210 211 GLU A N   
1659 C CA  . GLU A 211 ? 0.6626 1.3661 0.6191 -0.4086 0.0932  -0.2283 211 GLU A CA  
1660 C C   . GLU A 211 ? 0.6775 1.3800 0.6317 -0.3898 0.0923  -0.2249 211 GLU A C   
1661 O O   . GLU A 211 ? 0.5701 1.2760 0.5573 -0.3612 0.0930  -0.2381 211 GLU A O   
1662 C CB  . GLU A 211 ? 0.5716 1.3307 0.5580 -0.4235 0.1039  -0.2632 211 GLU A CB  
1663 C CG  . GLU A 211 ? 1.0113 1.8131 0.9732 -0.4603 0.1114  -0.2722 211 GLU A CG  
1664 C CD  . GLU A 211 ? 1.0389 1.8899 1.0318 -0.4540 0.1206  -0.3044 211 GLU A CD  
1665 O OE1 . GLU A 211 ? 1.0248 1.8901 1.0630 -0.4324 0.1229  -0.3280 211 GLU A OE1 
1666 O OE2 . GLU A 211 ? 1.0560 1.9288 1.0273 -0.4712 0.1243  -0.3056 211 GLU A OE2 
1667 N N   . VAL A 212 ? 0.7414 1.4349 0.6559 -0.4066 0.0892  -0.2061 212 VAL A N   
1668 C CA  . VAL A 212 ? 0.7917 1.4850 0.7039 -0.3911 0.0873  -0.2023 212 VAL A CA  
1669 C C   . VAL A 212 ? 0.7880 1.5220 0.6872 -0.4173 0.0944  -0.2156 212 VAL A C   
1670 O O   . VAL A 212 ? 0.7744 1.5208 0.6420 -0.4554 0.0971  -0.2127 212 VAL A O   
1671 C CB  . VAL A 212 ? 0.8451 1.4943 0.7269 -0.3844 0.0768  -0.1705 212 VAL A CB  
1672 C CG1 . VAL A 212 ? 0.9109 1.5289 0.7616 -0.4052 0.0713  -0.1502 212 VAL A CG1 
1673 C CG2 . VAL A 212 ? 0.8119 1.4701 0.6685 -0.3978 0.0760  -0.1638 212 VAL A CG2 
1674 N N   . VAL A 213 ? 0.8861 1.6390 0.8081 -0.3989 0.0966  -0.2297 213 VAL A N   
1675 C CA  . VAL A 213 ? 0.9743 1.7598 0.8825 -0.4200 0.1018  -0.2388 213 VAL A CA  
1676 C C   . VAL A 213 ? 0.9932 1.7525 0.8825 -0.4090 0.0937  -0.2169 213 VAL A C   
1677 O O   . VAL A 213 ? 0.8952 1.6357 0.8064 -0.3746 0.0879  -0.2120 213 VAL A O   
1678 C CB  . VAL A 213 ? 1.0011 1.8288 0.9472 -0.4107 0.1096  -0.2710 213 VAL A CB  
1679 C CG1 . VAL A 213 ? 0.9683 1.8072 0.9496 -0.4011 0.1135  -0.2910 213 VAL A CG1 
1680 C CG2 . VAL A 213 ? 1.0157 1.8318 0.9809 -0.3783 0.1042  -0.2691 213 VAL A CG2 
1681 N N   . ASP A 214 ? 1.0575 1.8142 0.9053 -0.4403 0.0929  -0.2033 214 ASP A N   
1682 C CA  . ASP A 214 ? 1.0780 1.8102 0.9122 -0.4334 0.0845  -0.1819 214 ASP A CA  
1683 C C   . ASP A 214 ? 1.0949 1.8561 0.9245 -0.4494 0.0889  -0.1917 214 ASP A C   
1684 O O   . ASP A 214 ? 1.0938 1.8641 0.8911 -0.4897 0.0915  -0.1883 214 ASP A O   
1685 C CB  . ASP A 214 ? 1.1124 1.8057 0.9109 -0.4567 0.0756  -0.1524 214 ASP A CB  
1686 C CG  . ASP A 214 ? 1.1835 1.8428 0.9846 -0.4372 0.0644  -0.1293 214 ASP A CG  
1687 O OD1 . ASP A 214 ? 1.2815 1.9007 1.0616 -0.4457 0.0553  -0.1057 214 ASP A OD1 
1688 O OD2 . ASP A 214 ? 1.0632 1.7348 0.8871 -0.4138 0.0644  -0.1353 214 ASP A OD2 
1689 N N   . TYR A 215 ? 1.0088 1.7819 0.8679 -0.4197 0.0892  -0.2034 215 TYR A N   
1690 C CA  . TYR A 215 ? 1.0120 1.8093 0.8698 -0.4301 0.0925  -0.2118 215 TYR A CA  
1691 C C   . TYR A 215 ? 1.1751 1.9475 1.0382 -0.4087 0.0830  -0.1927 215 TYR A C   
1692 O O   . TYR A 215 ? 1.2776 2.0192 1.1492 -0.3836 0.0747  -0.1762 215 TYR A O   
1693 C CB  . TYR A 215 ? 0.9297 1.7633 0.8215 -0.4159 0.0999  -0.2418 215 TYR A CB  
1694 C CG  . TYR A 215 ? 0.8837 1.7513 0.7815 -0.4372 0.1099  -0.2649 215 TYR A CG  
1695 C CD1 . TYR A 215 ? 1.0016 1.8774 0.8639 -0.4779 0.1146  -0.2613 215 TYR A CD1 
1696 C CD2 . TYR A 215 ? 0.7804 1.6717 0.7195 -0.4183 0.1143  -0.2902 215 TYR A CD2 
1697 C CE1 . TYR A 215 ? 1.0509 1.9628 0.9223 -0.4982 0.1241  -0.2838 215 TYR A CE1 
1698 C CE2 . TYR A 215 ? 0.8558 1.7824 0.8054 -0.4369 0.1237  -0.3137 215 TYR A CE2 
1699 C CZ  . TYR A 215 ? 1.0160 1.9554 0.9336 -0.4764 0.1290  -0.3111 215 TYR A CZ  
1700 O OH  . TYR A 215 ? 1.0807 2.0597 1.0123 -0.4956 0.1385  -0.3358 215 TYR A OH  
1701 N N   . SER A 216 ? 1.1457 1.9339 1.0042 -0.4192 0.0849  -0.1963 216 SER A N   
1702 C CA  . SER A 216 ? 1.1442 1.9155 1.0104 -0.3989 0.0774  -0.1824 216 SER A CA  
1703 C C   . SER A 216 ? 1.0947 1.8737 0.9964 -0.3586 0.0764  -0.1957 216 SER A C   
1704 O O   . SER A 216 ? 1.0353 1.7962 0.9533 -0.3306 0.0686  -0.1837 216 SER A O   
1705 C CB  . SER A 216 ? 1.2353 2.0190 1.0805 -0.4285 0.0802  -0.1820 216 SER A CB  
1706 O OG  . SER A 216 ? 1.2695 2.0532 1.0762 -0.4757 0.0836  -0.1772 216 SER A OG  
1707 N N   . THR A 217 ? 1.0246 1.8309 0.9459 -0.3585 0.0835  -0.2195 217 THR A N   
1708 C CA  . THR A 217 ? 0.9081 1.7192 0.8704 -0.3266 0.0817  -0.2313 217 THR A CA  
1709 C C   . THR A 217 ? 0.9411 1.7273 0.9236 -0.2996 0.0765  -0.2252 217 THR A C   
1710 O O   . THR A 217 ? 0.8875 1.6632 0.8978 -0.2715 0.0715  -0.2237 217 THR A O   
1711 C CB  . THR A 217 ? 0.8885 1.7376 0.8654 -0.3380 0.0910  -0.2600 217 THR A CB  
1712 O OG1 . THR A 217 ? 0.8748 1.7213 0.8891 -0.3091 0.0887  -0.2705 217 THR A OG1 
1713 C CG2 . THR A 217 ? 0.9225 1.7889 0.8819 -0.3668 0.0991  -0.2705 217 THR A CG2 
1714 N N   . ARG A 218 ? 0.7339 1.5096 0.7010 -0.3104 0.0777  -0.2206 218 ARG A N   
1715 C CA  . ARG A 218 ? 0.7662 1.5208 0.7518 -0.2888 0.0743  -0.2177 218 ARG A CA  
1716 C C   . ARG A 218 ? 0.8727 1.6165 0.8368 -0.3056 0.0760  -0.2117 218 ARG A C   
1717 O O   . ARG A 218 ? 0.9446 1.7053 0.8841 -0.3370 0.0820  -0.2164 218 ARG A O   
1718 C CB  . ARG A 218 ? 0.6837 1.4556 0.7010 -0.2789 0.0787  -0.2410 218 ARG A CB  
1719 C CG  . ARG A 218 ? 0.6581 1.4604 0.6709 -0.3045 0.0885  -0.2624 218 ARG A CG  
1720 C CD  . ARG A 218 ? 0.8013 1.6195 0.8489 -0.2928 0.0919  -0.2865 218 ARG A CD  
1721 N NE  . ARG A 218 ? 0.9757 1.8197 1.0230 -0.3143 0.1006  -0.3053 218 ARG A NE  
1722 C CZ  . ARG A 218 ? 1.1117 1.9978 1.1524 -0.3412 0.1096  -0.3245 218 ARG A CZ  
1723 N NH1 . ARG A 218 ? 1.0816 1.9861 1.1135 -0.3498 0.1111  -0.3268 218 ARG A NH1 
1724 N NH2 . ARG A 218 ? 1.2195 2.1310 1.2634 -0.3605 0.1173  -0.3417 218 ARG A NH2 
1725 N N   . LYS A 219 ? 0.7222 1.4378 0.6950 -0.2863 0.0708  -0.2007 219 LYS A N   
1726 C CA  . LYS A 219 ? 0.7019 1.4058 0.6609 -0.2986 0.0724  -0.1969 219 LYS A CA  
1727 C C   . LYS A 219 ? 0.6859 1.3918 0.6750 -0.2852 0.0754  -0.2132 219 LYS A C   
1728 O O   . LYS A 219 ? 0.6605 1.3642 0.6777 -0.2623 0.0733  -0.2198 219 LYS A O   
1729 C CB  . LYS A 219 ? 0.6589 1.3270 0.6012 -0.2900 0.0639  -0.1708 219 LYS A CB  
1730 C CG  . LYS A 219 ? 0.7148 1.3779 0.6251 -0.3068 0.0605  -0.1544 219 LYS A CG  
1731 C CD  . LYS A 219 ? 0.6743 1.3040 0.5801 -0.2949 0.0511  -0.1292 219 LYS A CD  
1732 C CE  . LYS A 219 ? 0.7966 1.4184 0.6799 -0.3172 0.0470  -0.1119 219 LYS A CE  
1733 N NZ  . LYS A 219 ? 0.8197 1.4101 0.7002 -0.3067 0.0379  -0.0891 219 LYS A NZ  
1734 N N   . GLU A 220 ? 0.6504 1.3603 0.6337 -0.3015 0.0802  -0.2194 220 GLU A N   
1735 C CA  . GLU A 220 ? 0.5925 1.3000 0.6044 -0.2890 0.0822  -0.2333 220 GLU A CA  
1736 C C   . GLU A 220 ? 0.6653 1.3485 0.6639 -0.2951 0.0805  -0.2204 220 GLU A C   
1737 O O   . GLU A 220 ? 0.5892 1.2717 0.5568 -0.3196 0.0812  -0.2097 220 GLU A O   
1738 C CB  . GLU A 220 ? 0.6128 1.3621 0.6436 -0.3029 0.0915  -0.2637 220 GLU A CB  
1739 C CG  . GLU A 220 ? 0.6945 1.4649 0.7489 -0.2908 0.0925  -0.2805 220 GLU A CG  
1740 C CD  . GLU A 220 ? 0.7812 1.5942 0.8586 -0.3026 0.1013  -0.3132 220 GLU A CD  
1741 O OE1 . GLU A 220 ? 0.7577 1.5807 0.8399 -0.3149 0.1059  -0.3232 220 GLU A OE1 
1742 O OE2 . GLU A 220 ? 0.7170 1.5551 0.8095 -0.2996 0.1034  -0.3295 220 GLU A OE2 
1743 N N   . ILE A 221 ? 0.6332 1.2935 0.6537 -0.2741 0.0774  -0.2200 221 ILE A N   
1744 C CA  . ILE A 221 ? 0.4468 1.0882 0.4638 -0.2791 0.0770  -0.2141 221 ILE A CA  
1745 C C   . ILE A 221 ? 0.4798 1.1382 0.5320 -0.2754 0.0820  -0.2398 221 ILE A C   
1746 O O   . ILE A 221 ? 0.5753 1.2302 0.6556 -0.2543 0.0804  -0.2497 221 ILE A O   
1747 C CB  . ILE A 221 ? 0.4918 1.0891 0.5047 -0.2581 0.0684  -0.1907 221 ILE A CB  
1748 C CG1 . ILE A 221 ? 0.5792 1.1634 0.5639 -0.2583 0.0625  -0.1681 221 ILE A CG1 
1749 C CG2 . ILE A 221 ? 0.4588 1.0346 0.4667 -0.2647 0.0674  -0.1836 221 ILE A CG2 
1750 C CD1 . ILE A 221 ? 0.5945 1.1400 0.5710 -0.2428 0.0544  -0.1450 221 ILE A CD1 
1751 N N   . ARG A 222 ? 0.5217 1.2000 0.5730 -0.2977 0.0875  -0.2510 222 ARG A N   
1752 C CA  . ARG A 222 ? 0.6056 1.3003 0.6935 -0.2943 0.0912  -0.2759 222 ARG A CA  
1753 C C   . ARG A 222 ? 0.6005 1.2672 0.6861 -0.2967 0.0876  -0.2640 222 ARG A C   
1754 O O   . ARG A 222 ? 0.6350 1.2939 0.6896 -0.3175 0.0866  -0.2475 222 ARG A O   
1755 C CB  . ARG A 222 ? 0.6183 1.3673 0.7146 -0.3193 0.1007  -0.3035 222 ARG A CB  
1756 C CG  . ARG A 222 ? 0.6033 1.3845 0.7033 -0.3197 0.1048  -0.3182 222 ARG A CG  
1757 C CD  . ARG A 222 ? 0.6725 1.5108 0.7828 -0.3464 0.1149  -0.3476 222 ARG A CD  
1758 N NE  . ARG A 222 ? 0.8144 1.6865 0.9204 -0.3542 0.1195  -0.3598 222 ARG A NE  
1759 C CZ  . ARG A 222 ? 0.9942 1.9029 1.1329 -0.3486 0.1238  -0.3903 222 ARG A CZ  
1760 N NH1 . ARG A 222 ? 0.9837 1.9001 1.1628 -0.3350 0.1234  -0.4126 222 ARG A NH1 
1761 N NH2 . ARG A 222 ? 1.0953 2.0325 1.2272 -0.3567 0.1274  -0.3990 222 ARG A NH2 
1762 N N   . ILE A 223 ? 0.5901 1.2389 0.7070 -0.2765 0.0842  -0.2710 223 ILE A N   
1763 C CA  . ILE A 223 ? 0.5803 1.2015 0.6992 -0.2775 0.0797  -0.2609 223 ILE A CA  
1764 C C   . ILE A 223 ? 0.5505 1.1972 0.7095 -0.2810 0.0824  -0.2899 223 ILE A C   
1765 O O   . ILE A 223 ? 0.5850 1.2408 0.7800 -0.2637 0.0822  -0.3107 223 ILE A O   
1766 C CB  . ILE A 223 ? 0.4729 1.0442 0.5928 -0.2515 0.0713  -0.2402 223 ILE A CB  
1767 C CG1 . ILE A 223 ? 0.5004 1.0498 0.5839 -0.2480 0.0678  -0.2131 223 ILE A CG1 
1768 C CG2 . ILE A 223 ? 0.4060 0.9486 0.5301 -0.2526 0.0657  -0.2310 223 ILE A CG2 
1769 C CD1 . ILE A 223 ? 0.3559 0.8669 0.4431 -0.2221 0.0610  -0.1968 223 ILE A CD1 
1770 N N   . TYR A 224 ? 0.5669 1.2252 0.7203 -0.3042 0.0835  -0.2914 224 TYR A N   
1771 C CA  . TYR A 224 ? 0.6530 1.3427 0.8465 -0.3109 0.0856  -0.3214 224 TYR A CA  
1772 C C   . TYR A 224 ? 0.5995 1.2527 0.8064 -0.3037 0.0762  -0.3120 224 TYR A C   
1773 O O   . TYR A 224 ? 0.6537 1.2700 0.8283 -0.3104 0.0702  -0.2829 224 TYR A O   
1774 C CB  . TYR A 224 ? 0.6339 1.3737 0.8173 -0.3466 0.0938  -0.3358 224 TYR A CB  
1775 C CG  . TYR A 224 ? 0.5558 1.3355 0.7266 -0.3572 0.1029  -0.3472 224 TYR A CG  
1776 C CD1 . TYR A 224 ? 0.6114 1.4483 0.8153 -0.3637 0.1110  -0.3849 224 TYR A CD1 
1777 C CD2 . TYR A 224 ? 0.5549 1.3155 0.6826 -0.3602 0.1022  -0.3213 224 TYR A CD2 
1778 C CE1 . TYR A 224 ? 0.6347 1.5072 0.8264 -0.3739 0.1185  -0.3949 224 TYR A CE1 
1779 C CE2 . TYR A 224 ? 0.6557 1.4502 0.7724 -0.3697 0.1090  -0.3310 224 TYR A CE2 
1780 C CZ  . TYR A 224 ? 0.6666 1.5162 0.8141 -0.3770 0.1172  -0.3670 224 TYR A CZ  
1781 O OH  . TYR A 224 ? 0.6376 1.5196 0.7731 -0.3871 0.1233  -0.3758 224 TYR A OH  
1782 N N   . LYS A 225 ? 0.6255 1.2884 0.8808 -0.2901 0.0735  -0.3375 225 LYS A N   
1783 C CA  . LYS A 225 ? 0.6206 1.2516 0.8954 -0.2830 0.0628  -0.3327 225 LYS A CA  
1784 C C   . LYS A 225 ? 0.6754 1.3195 0.9374 -0.3130 0.0622  -0.3303 225 LYS A C   
1785 O O   . LYS A 225 ? 0.7029 1.4009 0.9755 -0.3357 0.0703  -0.3547 225 LYS A O   
1786 C CB  . LYS A 225 ? 0.7078 1.3531 1.0408 -0.2646 0.0587  -0.3652 225 LYS A CB  
1787 C CG  . LYS A 225 ? 0.8950 1.5002 1.2511 -0.2523 0.0444  -0.3592 225 LYS A CG  
1788 C CD  . LYS A 225 ? 0.9880 1.6207 1.4055 -0.2427 0.0391  -0.3983 225 LYS A CD  
1789 C CE  . LYS A 225 ? 0.9870 1.5788 1.4286 -0.2312 0.0221  -0.3926 225 LYS A CE  
1790 N NZ  . LYS A 225 ? 0.9589 1.5834 1.4624 -0.2259 0.0149  -0.4337 225 LYS A NZ  
1791 N N   . THR A 226 ? 0.7606 1.3555 0.9979 -0.3147 0.0519  -0.3004 226 THR A N   
1792 C CA  . THR A 226 ? 0.7502 1.3476 0.9716 -0.3440 0.0476  -0.2941 226 THR A CA  
1793 C C   . THR A 226 ? 0.6873 1.2595 0.9418 -0.3349 0.0341  -0.2991 226 THR A C   
1794 O O   . THR A 226 ? 0.6464 1.1895 0.9274 -0.3058 0.0268  -0.3001 226 THR A O   
1795 C CB  . THR A 226 ? 0.7197 1.2768 0.8783 -0.3592 0.0429  -0.2542 226 THR A CB  
1796 O OG1 . THR A 226 ? 0.7429 1.2391 0.8885 -0.3332 0.0328  -0.2273 226 THR A OG1 
1797 C CG2 . THR A 226 ? 0.4344 1.0203 0.5601 -0.3731 0.0546  -0.2510 226 THR A CG2 
1798 N N   . LYS A 227 ? 0.8307 1.4147 1.0835 -0.3616 0.0297  -0.3025 227 LYS A N   
1799 C CA  . LYS A 227 ? 0.8716 1.4276 1.1499 -0.3573 0.0137  -0.3040 227 LYS A CA  
1800 C C   . LYS A 227 ? 0.8105 1.3150 1.0357 -0.3762 0.0011  -0.2666 227 LYS A C   
1801 O O   . LYS A 227 ? 0.8051 1.3113 0.9809 -0.3999 0.0061  -0.2480 227 LYS A O   
1802 C CB  . LYS A 227 ? 0.9849 1.6019 1.3120 -0.3736 0.0169  -0.3447 227 LYS A CB  
1803 C CG  . LYS A 227 ? 1.1778 1.7705 1.5398 -0.3677 -0.0013 -0.3517 227 LYS A CG  
1804 C CD  . LYS A 227 ? 1.2601 1.9188 1.6685 -0.3884 0.0018  -0.3926 227 LYS A CD  
1805 C CE  . LYS A 227 ? 1.2101 1.8401 1.6461 -0.3872 -0.0190 -0.3953 227 LYS A CE  
1806 N NZ  . LYS A 227 ? 1.1528 1.8492 1.6307 -0.4124 -0.0166 -0.4335 227 LYS A NZ  
1807 N N   . ARG A 228 ? 0.8355 1.2904 1.0680 -0.3662 -0.0174 -0.2554 228 ARG A N   
1808 C CA  . ARG A 228 ? 0.8357 1.2367 1.0166 -0.3846 -0.0330 -0.2217 228 ARG A CA  
1809 C C   . ARG A 228 ? 0.7662 1.1721 0.9705 -0.4023 -0.0456 -0.2351 228 ARG A C   
1810 O O   . ARG A 228 ? 0.7747 1.1868 1.0333 -0.3842 -0.0524 -0.2580 228 ARG A O   
1811 C CB  . ARG A 228 ? 0.9568 1.2813 1.1120 -0.3577 -0.0476 -0.1899 228 ARG A CB  
1812 C CG  . ARG A 228 ? 1.1105 1.3879 1.1929 -0.3701 -0.0531 -0.1517 228 ARG A CG  
1813 C CD  . ARG A 228 ? 1.2282 1.4347 1.2874 -0.3425 -0.0668 -0.1245 228 ARG A CD  
1814 N NE  . ARG A 228 ? 1.3320 1.5502 1.4370 -0.3096 -0.0601 -0.1389 228 ARG A NE  
1815 C CZ  . ARG A 228 ? 1.4408 1.6923 1.5562 -0.2974 -0.0426 -0.1467 228 ARG A CZ  
1816 N NH1 . ARG A 228 ? 1.4870 1.7653 1.5725 -0.3139 -0.0300 -0.1421 228 ARG A NH1 
1817 N NH2 . ARG A 228 ? 1.3954 1.6510 1.5494 -0.2696 -0.0397 -0.1587 228 ARG A NH2 
1818 N N   . ARG A 229 ? 0.7843 1.1865 0.9475 -0.4385 -0.0505 -0.2210 229 ARG A N   
1819 C CA  . ARG A 229 ? 0.8592 1.2630 1.0395 -0.4587 -0.0642 -0.2308 229 ARG A CA  
1820 C C   . ARG A 229 ? 0.9226 1.2515 1.0399 -0.4756 -0.0869 -0.1920 229 ARG A C   
1821 O O   . ARG A 229 ? 0.8146 1.1309 0.8713 -0.5030 -0.0863 -0.1687 229 ARG A O   
1822 C CB  . ARG A 229 ? 1.0653 1.5539 1.2689 -0.4938 -0.0487 -0.2625 229 ARG A CB  
1823 C CG  . ARG A 229 ? 1.2469 1.8092 1.5199 -0.4775 -0.0312 -0.3084 229 ARG A CG  
1824 C CD  . ARG A 229 ? 1.3114 1.9544 1.6201 -0.5106 -0.0220 -0.3456 229 ARG A CD  
1825 N NE  . ARG A 229 ? 1.2375 1.9531 1.6028 -0.4973 -0.0045 -0.3897 229 ARG A NE  
1826 C CZ  . ARG A 229 ? 1.2267 2.0224 1.6356 -0.5186 0.0052  -0.4312 229 ARG A CZ  
1827 N NH1 . ARG A 229 ? 1.2438 2.0615 1.6490 -0.5561 0.0004  -0.4345 229 ARG A NH1 
1828 N NH2 . ARG A 229 ? 1.1778 2.0321 1.6339 -0.5031 0.0189  -0.4704 229 ARG A NH2 
1829 N N   . LYS A 230 ? 0.7033 0.8896 0.8584 0.1442  -0.0513 -0.1683 230 LYS A N   
1830 C CA  . LYS A 230 ? 0.7430 0.9075 0.8789 0.1387  -0.0529 -0.1550 230 LYS A CA  
1831 C C   . LYS A 230 ? 0.6852 0.8692 0.8224 0.1351  -0.0522 -0.1510 230 LYS A C   
1832 O O   . LYS A 230 ? 0.6389 0.8395 0.7924 0.1344  -0.0567 -0.1555 230 LYS A O   
1833 C CB  . LYS A 230 ? 0.8224 0.9587 0.9546 0.1362  -0.0614 -0.1519 230 LYS A CB  
1834 C CG  . LYS A 230 ? 0.7888 0.8928 0.9052 0.1360  -0.0599 -0.1487 230 LYS A CG  
1835 C CD  . LYS A 230 ? 0.8220 0.9024 0.9379 0.1356  -0.0687 -0.1479 230 LYS A CD  
1836 C CE  . LYS A 230 ? 0.8090 0.8803 0.9326 0.1399  -0.0669 -0.1555 230 LYS A CE  
1837 N NZ  . LYS A 230 ? 0.7351 0.7881 0.8432 0.1380  -0.0587 -0.1531 230 LYS A NZ  
1838 N N   . LEU A 231 ? 0.6514 0.8325 0.7714 0.1330  -0.0458 -0.1422 231 LEU A N   
1839 C CA  . LEU A 231 ? 0.5465 0.7425 0.6637 0.1284  -0.0427 -0.1368 231 LEU A CA  
1840 C C   . LEU A 231 ? 0.6456 0.8288 0.7602 0.1191  -0.0486 -0.1316 231 LEU A C   
1841 O O   . LEU A 231 ? 0.6078 0.8113 0.7313 0.1142  -0.0482 -0.1317 231 LEU A O   
1842 C CB  . LEU A 231 ? 0.5473 0.7357 0.6432 0.1296  -0.0341 -0.1269 231 LEU A CB  
1843 C CG  . LEU A 231 ? 0.6036 0.8214 0.7002 0.1321  -0.0272 -0.1259 231 LEU A CG  
1844 C CD1 . LEU A 231 ? 0.5335 0.7879 0.6537 0.1361  -0.0285 -0.1395 231 LEU A CD1 
1845 C CD2 . LEU A 231 ? 0.5002 0.7127 0.5800 0.1390  -0.0206 -0.1188 231 LEU A CD2 
1846 N N   . PHE A 232 ? 0.7551 0.9060 0.8571 0.1159  -0.0539 -0.1273 232 PHE A N   
1847 C CA  . PHE A 232 ? 0.7364 0.8742 0.8328 0.1059  -0.0604 -0.1224 232 PHE A CA  
1848 C C   . PHE A 232 ? 0.6977 0.8174 0.7959 0.1062  -0.0711 -0.1244 232 PHE A C   
1849 O O   . PHE A 232 ? 0.7293 0.8158 0.8057 0.1031  -0.0725 -0.1188 232 PHE A O   
1850 C CB  . PHE A 232 ? 0.7372 0.8468 0.8051 0.0983  -0.0548 -0.1116 232 PHE A CB  
1851 C CG  . PHE A 232 ? 0.6505 0.7694 0.7106 0.1004  -0.0434 -0.1069 232 PHE A CG  
1852 C CD1 . PHE A 232 ? 0.6136 0.7228 0.6617 0.1090  -0.0362 -0.1041 232 PHE A CD1 
1853 C CD2 . PHE A 232 ? 0.7500 0.8885 0.8147 0.0939  -0.0398 -0.1047 232 PHE A CD2 
1854 C CE1 . PHE A 232 ? 0.7186 0.8370 0.7584 0.1127  -0.0267 -0.0984 232 PHE A CE1 
1855 C CE2 . PHE A 232 ? 0.7841 0.9290 0.8385 0.0965  -0.0292 -0.0988 232 PHE A CE2 
1856 C CZ  . PHE A 232 ? 0.7274 0.8622 0.7689 0.1066  -0.0233 -0.0952 232 PHE A CZ  
1857 N N   . PRO A 233 ? 0.7013 0.8418 0.8239 0.1106  -0.0784 -0.1321 233 PRO A N   
1858 C CA  . PRO A 233 ? 0.6985 0.8225 0.8230 0.1125  -0.0896 -0.1328 233 PRO A CA  
1859 C C   . PRO A 233 ? 0.7574 0.8565 0.8611 0.1021  -0.0962 -0.1245 233 PRO A C   
1860 O O   . PRO A 233 ? 0.7698 0.8781 0.8720 0.0925  -0.0964 -0.1215 233 PRO A O   
1861 C CB  . PRO A 233 ? 0.6847 0.8413 0.8400 0.1171  -0.0960 -0.1404 233 PRO A CB  
1862 C CG  . PRO A 233 ? 0.7466 0.9335 0.9164 0.1214  -0.0858 -0.1472 233 PRO A CG  
1863 C CD  . PRO A 233 ? 0.7655 0.9455 0.9142 0.1144  -0.0763 -0.1400 233 PRO A CD  
1864 N N   . GLY A 234 ? 0.5442 0.6113 0.6305 0.1029  -0.1008 -0.1212 234 GLY A N   
1865 C CA  . GLY A 234 ? 0.6951 0.7380 0.7605 0.0934  -0.1087 -0.1148 234 GLY A CA  
1866 C C   . GLY A 234 ? 0.7777 0.7943 0.8134 0.0846  -0.1001 -0.1086 234 GLY A C   
1867 O O   . GLY A 234 ? 0.8575 0.8535 0.8735 0.0747  -0.1054 -0.1044 234 GLY A O   
1868 N N   . TYR A 235 ? 0.6120 0.6293 0.6441 0.0886  -0.0870 -0.1082 235 TYR A N   
1869 C CA  . TYR A 235 ? 0.6120 0.6021 0.6159 0.0834  -0.0774 -0.1018 235 TYR A CA  
1870 C C   . TYR A 235 ? 0.7911 0.7593 0.7817 0.0911  -0.0701 -0.1008 235 TYR A C   
1871 O O   . TYR A 235 ? 0.7581 0.7422 0.7646 0.1005  -0.0667 -0.1053 235 TYR A O   
1872 C CB  . TYR A 235 ? 0.6443 0.6514 0.6516 0.0823  -0.0672 -0.0999 235 TYR A CB  
1873 C CG  . TYR A 235 ? 0.6489 0.6665 0.6584 0.0700  -0.0698 -0.0982 235 TYR A CG  
1874 C CD1 . TYR A 235 ? 0.6594 0.6799 0.6742 0.0612  -0.0824 -0.1001 235 TYR A CD1 
1875 C CD2 . TYR A 235 ? 0.7161 0.7416 0.7224 0.0670  -0.0594 -0.0944 235 TYR A CD2 
1876 C CE1 . TYR A 235 ? 0.7399 0.7733 0.7591 0.0482  -0.0843 -0.0995 235 TYR A CE1 
1877 C CE2 . TYR A 235 ? 0.7360 0.7703 0.7442 0.0539  -0.0601 -0.0928 235 TYR A CE2 
1878 C CZ  . TYR A 235 ? 0.7900 0.8293 0.8058 0.0437  -0.0724 -0.0960 235 TYR A CZ  
1879 O OH  . TYR A 235 ? 0.7118 0.7626 0.7314 0.0289  -0.0728 -0.0954 235 TYR A OH  
1880 N N   . VAL A 236 ? 0.8714 0.8035 0.8329 0.0864  -0.0672 -0.0959 236 VAL A N   
1881 C CA  . VAL A 236 ? 0.6510 0.5630 0.5985 0.0930  -0.0571 -0.0943 236 VAL A CA  
1882 C C   . VAL A 236 ? 0.7053 0.5941 0.6278 0.0896  -0.0466 -0.0883 236 VAL A C   
1883 O O   . VAL A 236 ? 0.8488 0.7139 0.7505 0.0796  -0.0491 -0.0855 236 VAL A O   
1884 C CB  . VAL A 236 ? 0.6905 0.5778 0.6258 0.0928  -0.0619 -0.0945 236 VAL A CB  
1885 C CG1 . VAL A 236 ? 0.6696 0.5371 0.5903 0.0982  -0.0494 -0.0930 236 VAL A CG1 
1886 C CG2 . VAL A 236 ? 0.5742 0.4814 0.5341 0.0978  -0.0713 -0.0998 236 VAL A CG2 
1887 N N   . PHE A 237 ? 0.7969 0.6933 0.7217 0.0983  -0.0351 -0.0867 237 PHE A N   
1888 C CA  . PHE A 237 ? 0.7153 0.5895 0.6176 0.0982  -0.0239 -0.0802 237 PHE A CA  
1889 C C   . PHE A 237 ? 0.7046 0.5505 0.5882 0.1025  -0.0165 -0.0790 237 PHE A C   
1890 O O   . PHE A 237 ? 0.7175 0.5749 0.6121 0.1117  -0.0123 -0.0814 237 PHE A O   
1891 C CB  . PHE A 237 ? 0.7372 0.6361 0.6513 0.1071  -0.0158 -0.0777 237 PHE A CB  
1892 C CG  . PHE A 237 ? 0.6976 0.6252 0.6289 0.1026  -0.0210 -0.0787 237 PHE A CG  
1893 C CD1 . PHE A 237 ? 0.7400 0.6611 0.6601 0.0970  -0.0160 -0.0726 237 PHE A CD1 
1894 C CD2 . PHE A 237 ? 0.6378 0.5971 0.5959 0.1035  -0.0299 -0.0861 237 PHE A CD2 
1895 C CE1 . PHE A 237 ? 0.8265 0.7752 0.7626 0.0916  -0.0195 -0.0736 237 PHE A CE1 
1896 C CE2 . PHE A 237 ? 0.6824 0.6700 0.6573 0.0996  -0.0336 -0.0878 237 PHE A CE2 
1897 C CZ  . PHE A 237 ? 0.7677 0.7511 0.7318 0.0932  -0.0283 -0.0815 237 PHE A CZ  
1898 N N   . VAL A 238 ? 0.7801 0.5890 0.6349 0.0949  -0.0145 -0.0761 238 VAL A N   
1899 C CA  . VAL A 238 ? 0.8303 0.6097 0.6643 0.0979  -0.0066 -0.0754 238 VAL A CA  
1900 C C   . VAL A 238 ? 0.8506 0.6004 0.6589 0.0987  0.0059  -0.0702 238 VAL A C   
1901 O O   . VAL A 238 ? 0.8467 0.5815 0.6413 0.0892  0.0046  -0.0682 238 VAL A O   
1902 C CB  . VAL A 238 ? 0.8519 0.6114 0.6725 0.0886  -0.0164 -0.0780 238 VAL A CB  
1903 C CG1 . VAL A 238 ? 0.8787 0.6411 0.6990 0.0762  -0.0295 -0.0787 238 VAL A CG1 
1904 C CG2 . VAL A 238 ? 0.6983 0.4169 0.4858 0.0870  -0.0074 -0.0765 238 VAL A CG2 
1905 N N   . GLU A 239 ? 0.9508 0.6947 0.7551 0.1105  0.0186  -0.0684 239 GLU A N   
1906 C CA  . GLU A 239 ? 0.9262 0.6401 0.7066 0.1150  0.0325  -0.0634 239 GLU A CA  
1907 C C   . GLU A 239 ? 0.9948 0.6671 0.7443 0.1078  0.0357  -0.0656 239 GLU A C   
1908 O O   . GLU A 239 ? 0.9973 0.6688 0.7474 0.1093  0.0357  -0.0688 239 GLU A O   
1909 C CB  . GLU A 239 ? 0.8841 0.6159 0.6776 0.1326  0.0439  -0.0610 239 GLU A CB  
1910 C CG  . GLU A 239 ? 1.0563 0.7771 0.8392 0.1423  0.0557  -0.0535 239 GLU A CG  
1911 C CD  . GLU A 239 ? 1.0909 0.8281 0.8850 0.1610  0.0667  -0.0511 239 GLU A CD  
1912 O OE1 . GLU A 239 ? 1.0277 0.7799 0.8347 0.1639  0.0668  -0.0563 239 GLU A OE1 
1913 O OE2 . GLU A 239 ? 1.1234 0.8585 0.9133 0.1726  0.0754  -0.0438 239 GLU A OE2 
1914 N N   . MET A 240 ? 1.0118 0.6483 0.7329 0.0991  0.0390  -0.0642 240 MET A N   
1915 C CA  . MET A 240 ? 1.0438 0.6407 0.7328 0.0902  0.0407  -0.0675 240 MET A CA  
1916 C C   . MET A 240 ? 1.1064 0.6619 0.7631 0.0823  0.0481  -0.0666 240 MET A C   
1917 O O   . MET A 240 ? 1.1303 0.6875 0.7891 0.0762  0.0458  -0.0643 240 MET A O   
1918 C CB  . MET A 240 ? 1.0163 0.6201 0.7073 0.0767  0.0231  -0.0718 240 MET A CB  
1919 C CG  . MET A 240 ? 0.9323 0.5547 0.6365 0.0660  0.0100  -0.0719 240 MET A CG  
1920 S SD  . MET A 240 ? 0.9029 0.5390 0.6138 0.0533  -0.0118 -0.0762 240 MET A SD  
1921 C CE  . MET A 240 ? 0.9959 0.5810 0.6594 0.0389  -0.0116 -0.0790 240 MET A CE  
1922 N N   . ILE A 241 ? 1.0761 0.5926 0.7017 0.0814  0.0580  -0.0690 241 ILE A N   
1923 C CA  . ILE A 241 ? 1.1053 0.5778 0.6962 0.0700  0.0632  -0.0707 241 ILE A CA  
1924 C C   . ILE A 241 ? 1.0287 0.5049 0.6163 0.0496  0.0446  -0.0750 241 ILE A C   
1925 O O   . ILE A 241 ? 1.1403 0.6411 0.7428 0.0469  0.0309  -0.0768 241 ILE A O   
1926 C CB  . ILE A 241 ? 1.2225 0.6522 0.7783 0.0713  0.0762  -0.0744 241 ILE A CB  
1927 C CG1 . ILE A 241 ? 1.3075 0.7309 0.8487 0.0584  0.0645  -0.0802 241 ILE A CG1 
1928 C CG2 . ILE A 241 ? 1.1901 0.6273 0.7564 0.0928  0.0923  -0.0712 241 ILE A CG2 
1929 C CD1 . ILE A 241 ? 1.5183 0.8958 1.0186 0.0557  0.0766  -0.0849 241 ILE A CD1 
1930 N N   . MET A 242 ? 0.9688 0.4221 0.5384 0.0353  0.0438  -0.0765 242 MET A N   
1931 C CA  . MET A 242 ? 0.9426 0.4009 0.5088 0.0149  0.0260  -0.0813 242 MET A CA  
1932 C C   . MET A 242 ? 1.0954 0.5058 0.6184 -0.0012 0.0283  -0.0879 242 MET A C   
1933 O O   . MET A 242 ? 1.1996 0.5791 0.7030 -0.0081 0.0383  -0.0888 242 MET A O   
1934 C CB  . MET A 242 ? 0.8531 0.3368 0.4419 0.0071  0.0190  -0.0790 242 MET A CB  
1935 C CG  . MET A 242 ? 0.8784 0.3736 0.4681 -0.0137 -0.0004 -0.0846 242 MET A CG  
1936 S SD  . MET A 242 ? 1.0196 0.5539 0.6336 -0.0084 -0.0192 -0.0857 242 MET A SD  
1937 C CE  . MET A 242 ? 0.8398 0.4280 0.5031 0.0036  -0.0218 -0.0807 242 MET A CE  
1938 N N   . ASN A 243 ? 1.0789 0.4823 0.5858 -0.0074 0.0192  -0.0925 243 ASN A N   
1939 C CA  . ASN A 243 ? 1.0983 0.4636 0.5650 -0.0261 0.0160  -0.1002 243 ASN A CA  
1940 C C   . ASN A 243 ? 1.0475 0.4302 0.5135 -0.0347 -0.0047 -0.1028 243 ASN A C   
1941 O O   . ASN A 243 ? 1.0537 0.4757 0.5516 -0.0260 -0.0154 -0.0985 243 ASN A O   
1942 C CB  . ASN A 243 ? 1.0307 0.3483 0.4603 -0.0199 0.0359  -0.1030 243 ASN A CB  
1943 C CG  . ASN A 243 ? 1.0442 0.3705 0.4799 -0.0019 0.0426  -0.0998 243 ASN A CG  
1944 O OD1 . ASN A 243 ? 1.0478 0.4060 0.5038 0.0008  0.0296  -0.0975 243 ASN A OD1 
1945 N ND2 . ASN A 243 ? 1.0372 0.3351 0.4563 0.0105  0.0640  -0.0997 243 ASN A ND2 
1946 N N   . ASP A 244 ? 1.0912 0.4437 0.5197 -0.0512 -0.0103 -0.1099 244 ASP A N   
1947 C CA  . ASP A 244 ? 1.0613 0.4273 0.4838 -0.0597 -0.0310 -0.1117 244 ASP A CA  
1948 C C   . ASP A 244 ? 1.0055 0.3908 0.4442 -0.0420 -0.0316 -0.1055 244 ASP A C   
1949 O O   . ASP A 244 ? 1.0488 0.4719 0.5170 -0.0387 -0.0477 -0.1016 244 ASP A O   
1950 C CB  . ASP A 244 ? 1.0744 0.3982 0.4461 -0.0760 -0.0322 -0.1200 244 ASP A CB  
1951 C CG  . ASP A 244 ? 1.2917 0.5912 0.6441 -0.0958 -0.0301 -0.1279 244 ASP A CG  
1952 O OD1 . ASP A 244 ? 1.3420 0.6638 0.7225 -0.1003 -0.0330 -0.1264 244 ASP A OD1 
1953 O OD2 . ASP A 244 ? 1.4933 0.7501 0.8009 -0.1081 -0.0248 -0.1361 244 ASP A OD2 
1954 N N   . GLU A 245 ? 0.9338 0.2933 0.3544 -0.0306 -0.0131 -0.1047 245 GLU A N   
1955 C CA  . GLU A 245 ? 1.0165 0.3889 0.4479 -0.0162 -0.0111 -0.0996 245 GLU A CA  
1956 C C   . GLU A 245 ? 0.9749 0.3920 0.4562 -0.0018 -0.0133 -0.0935 245 GLU A C   
1957 O O   . GLU A 245 ? 0.9245 0.3668 0.4246 0.0020  -0.0258 -0.0902 245 GLU A O   
1958 C CB  . GLU A 245 ? 1.1136 0.4525 0.5196 -0.0070 0.0122  -0.1007 245 GLU A CB  
1959 C CG  . GLU A 245 ? 1.3311 0.6750 0.7369 0.0020  0.0142  -0.0970 245 GLU A CG  
1960 C CD  . GLU A 245 ? 1.4674 0.7910 0.8625 0.0144  0.0394  -0.0974 245 GLU A CD  
1961 O OE1 . GLU A 245 ? 1.4670 0.7909 0.8587 0.0201  0.0443  -0.0950 245 GLU A OE1 
1962 O OE2 . GLU A 245 ? 1.4219 0.7296 0.8127 0.0186  0.0548  -0.0997 245 GLU A OE2 
1963 N N   . ALA A 246 ? 0.9308 0.3560 0.4318 0.0066  -0.0008 -0.0920 246 ALA A N   
1964 C CA  . ALA A 246 ? 0.9406 0.4090 0.4873 0.0191  -0.0031 -0.0873 246 ALA A CA  
1965 C C   . ALA A 246 ? 0.8673 0.3692 0.4381 0.0111  -0.0252 -0.0871 246 ALA A C   
1966 O O   . ALA A 246 ? 0.8819 0.4134 0.4791 0.0181  -0.0342 -0.0846 246 ALA A O   
1967 C CB  . ALA A 246 ? 0.8494 0.3200 0.4088 0.0274  0.0117  -0.0853 246 ALA A CB  
1968 N N   . TYR A 247 ? 0.9704 0.4667 0.5319 -0.0042 -0.0334 -0.0902 247 TYR A N   
1969 C CA  . TYR A 247 ? 0.8381 0.3678 0.4228 -0.0126 -0.0541 -0.0907 247 TYR A CA  
1970 C C   . TYR A 247 ? 0.9107 0.4506 0.4955 -0.0117 -0.0701 -0.0897 247 TYR A C   
1971 O O   . TYR A 247 ? 0.8698 0.4447 0.4878 -0.0034 -0.0795 -0.0869 247 TYR A O   
1972 C CB  . TYR A 247 ? 0.8916 0.4083 0.4584 -0.0329 -0.0609 -0.0958 247 TYR A CB  
1973 C CG  . TYR A 247 ? 0.9705 0.5259 0.5635 -0.0417 -0.0824 -0.0967 247 TYR A CG  
1974 C CD1 . TYR A 247 ? 0.9786 0.5691 0.6082 -0.0404 -0.0834 -0.0953 247 TYR A CD1 
1975 C CD2 . TYR A 247 ? 1.0141 0.5729 0.5958 -0.0502 -0.1016 -0.0987 247 TYR A CD2 
1976 C CE1 . TYR A 247 ? 0.9820 0.6109 0.6383 -0.0476 -0.1021 -0.0967 247 TYR A CE1 
1977 C CE2 . TYR A 247 ? 1.1347 0.7326 0.7434 -0.0564 -0.1216 -0.0994 247 TYR A CE2 
1978 C CZ  . TYR A 247 ? 1.0885 0.7219 0.7356 -0.0551 -0.1213 -0.0988 247 TYR A CZ  
1979 O OH  . TYR A 247 ? 1.0487 0.7229 0.7244 -0.0606 -0.1400 -0.1001 247 TYR A OH  
1980 N N   . ASN A 248 ? 0.9986 0.5064 0.5443 -0.0201 -0.0730 -0.0919 248 ASN A N   
1981 C CA  . ASN A 248 ? 0.9255 0.4374 0.4640 -0.0199 -0.0886 -0.0896 248 ASN A CA  
1982 C C   . ASN A 248 ? 0.9330 0.4521 0.4866 -0.0029 -0.0812 -0.0843 248 ASN A C   
1983 O O   . ASN A 248 ? 0.9130 0.4509 0.4818 0.0024  -0.0941 -0.0806 248 ASN A O   
1984 C CB  . ASN A 248 ? 0.8987 0.3710 0.3869 -0.0322 -0.0904 -0.0929 248 ASN A CB  
1985 C CG  . ASN A 248 ? 1.0797 0.5470 0.5525 -0.0519 -0.1012 -0.0994 248 ASN A CG  
1986 O OD1 . ASN A 248 ? 1.0503 0.5503 0.5473 -0.0580 -0.1191 -0.0998 248 ASN A OD1 
1987 N ND2 . ASN A 248 ? 1.0351 0.4612 0.4675 -0.0624 -0.0898 -0.1053 248 ASN A ND2 
1988 N N   . PHE A 249 ? 0.9365 0.4402 0.4861 0.0057  -0.0599 -0.0842 249 PHE A N   
1989 C CA  . PHE A 249 ? 0.8425 0.3541 0.4073 0.0198  -0.0511 -0.0805 249 PHE A CA  
1990 C C   . PHE A 249 ? 0.9345 0.4895 0.5460 0.0283  -0.0602 -0.0785 249 PHE A C   
1991 O O   . PHE A 249 ? 0.9268 0.4924 0.5491 0.0334  -0.0686 -0.0755 249 PHE A O   
1992 C CB  . PHE A 249 ? 0.9790 0.4758 0.5393 0.0281  -0.0271 -0.0813 249 PHE A CB  
1993 C CG  . PHE A 249 ? 1.0253 0.5325 0.6024 0.0408  -0.0174 -0.0787 249 PHE A CG  
1994 C CD1 . PHE A 249 ? 0.8731 0.3545 0.4233 0.0408  -0.0097 -0.0775 249 PHE A CD1 
1995 C CD2 . PHE A 249 ? 0.8206 0.3638 0.4395 0.0513  -0.0157 -0.0778 249 PHE A CD2 
1996 C CE1 . PHE A 249 ? 0.9334 0.4248 0.5000 0.0503  0.0000  -0.0755 249 PHE A CE1 
1997 C CE2 . PHE A 249 ? 0.9555 0.5094 0.5906 0.0608  -0.0072 -0.0766 249 PHE A CE2 
1998 C CZ  . PHE A 249 ? 1.0380 0.5661 0.6479 0.0599  0.0009  -0.0754 249 PHE A CZ  
1999 N N   . VAL A 250 ? 0.8485 0.4266 0.4861 0.0299  -0.0580 -0.0800 250 VAL A N   
2000 C CA  . VAL A 250 ? 0.8610 0.4808 0.5419 0.0377  -0.0654 -0.0792 250 VAL A CA  
2001 C C   . VAL A 250 ? 0.8415 0.4831 0.5358 0.0314  -0.0872 -0.0795 250 VAL A C   
2002 O O   . VAL A 250 ? 0.8576 0.5220 0.5762 0.0388  -0.0963 -0.0782 250 VAL A O   
2003 C CB  . VAL A 250 ? 0.6375 0.2783 0.3438 0.0445  -0.0535 -0.0800 250 VAL A CB  
2004 C CG1 . VAL A 250 ? 0.8961 0.5133 0.5797 0.0375  -0.0436 -0.0808 250 VAL A CG1 
2005 C CG2 . VAL A 250 ? 0.6611 0.3430 0.4044 0.0456  -0.0653 -0.0809 250 VAL A CG2 
2006 N N   . ARG A 251 ? 0.9466 0.5812 0.6253 0.0178  -0.0956 -0.0816 251 ARG A N   
2007 C CA  . ARG A 251 ? 0.9738 0.6332 0.6669 0.0114  -0.1169 -0.0822 251 ARG A CA  
2008 C C   . ARG A 251 ? 0.9373 0.5973 0.6273 0.0164  -0.1314 -0.0787 251 ARG A C   
2009 O O   . ARG A 251 ? 0.8125 0.5026 0.5284 0.0194  -0.1473 -0.0779 251 ARG A O   
2010 C CB  . ARG A 251 ? 0.9745 0.6210 0.6444 -0.0068 -0.1236 -0.0858 251 ARG A CB  
2011 C CG  . ARG A 251 ? 0.9354 0.6122 0.6221 -0.0146 -0.1463 -0.0871 251 ARG A CG  
2012 C CD  . ARG A 251 ? 0.9868 0.7085 0.7204 -0.0091 -0.1486 -0.0878 251 ARG A CD  
2013 N NE  . ARG A 251 ? 1.0088 0.7632 0.7619 -0.0164 -0.1689 -0.0897 251 ARG A NE  
2014 C CZ  . ARG A 251 ? 0.9676 0.7479 0.7431 -0.0064 -0.1840 -0.0873 251 ARG A CZ  
2015 N NH1 . ARG A 251 ? 0.9497 0.7233 0.7288 0.0096  -0.1805 -0.0832 251 ARG A NH1 
2016 N NH2 . ARG A 251 ? 0.8484 0.6612 0.6432 -0.0125 -0.2022 -0.0891 251 ARG A NH2 
2017 N N   . SER A 252 ? 0.8820 0.5084 0.5399 0.0178  -0.1255 -0.0760 252 SER A N   
2018 C CA  . SER A 252 ? 0.9910 0.6114 0.6378 0.0208  -0.1396 -0.0713 252 SER A CA  
2019 C C   . SER A 252 ? 1.0002 0.6274 0.6677 0.0358  -0.1339 -0.0675 252 SER A C   
2020 O O   . SER A 252 ? 0.9322 0.5477 0.5883 0.0403  -0.1410 -0.0622 252 SER A O   
2021 C CB  . SER A 252 ? 0.8507 0.4297 0.4467 0.0119  -0.1384 -0.0702 252 SER A CB  
2022 O OG  . SER A 252 ? 0.9629 0.5143 0.5410 0.0157  -0.1165 -0.0702 252 SER A OG  
2023 N N   . VAL A 253 ? 0.8895 0.5349 0.5862 0.0430  -0.1208 -0.0703 253 VAL A N   
2024 C CA  . VAL A 253 ? 0.8653 0.5213 0.5858 0.0555  -0.1153 -0.0689 253 VAL A CA  
2025 C C   . VAL A 253 ? 0.8752 0.5597 0.6249 0.0616  -0.1331 -0.0678 253 VAL A C   
2026 O O   . VAL A 253 ? 0.7937 0.5039 0.5610 0.0582  -0.1442 -0.0703 253 VAL A O   
2027 C CB  . VAL A 253 ? 0.8795 0.5507 0.6231 0.0612  -0.0980 -0.0730 253 VAL A CB  
2028 C CG1 . VAL A 253 ? 0.9023 0.5916 0.6760 0.0724  -0.0950 -0.0736 253 VAL A CG1 
2029 C CG2 . VAL A 253 ? 0.8220 0.4632 0.5368 0.0585  -0.0796 -0.0730 253 VAL A CG2 
2030 N N   . PRO A 254 ? 0.9179 0.5960 0.6714 0.0703  -0.1356 -0.0639 254 PRO A N   
2031 C CA  . PRO A 254 ? 0.9303 0.6332 0.7128 0.0790  -0.1506 -0.0629 254 PRO A CA  
2032 C C   . PRO A 254 ? 0.8900 0.6320 0.7153 0.0838  -0.1475 -0.0698 254 PRO A C   
2033 O O   . PRO A 254 ? 0.7629 0.5096 0.5996 0.0862  -0.1317 -0.0739 254 PRO A O   
2034 C CB  . PRO A 254 ? 0.9345 0.6167 0.7121 0.0873  -0.1457 -0.0585 254 PRO A CB  
2035 C CG  . PRO A 254 ? 1.0031 0.6459 0.7369 0.0798  -0.1370 -0.0543 254 PRO A CG  
2036 C CD  . PRO A 254 ? 0.9831 0.6270 0.7098 0.0716  -0.1249 -0.0597 254 PRO A CD  
2037 N N   . TYR A 255 ? 0.9535 0.7249 0.8013 0.0851  -0.1627 -0.0711 255 TYR A N   
2038 C CA  . TYR A 255 ? 1.0401 0.8507 0.9275 0.0891  -0.1607 -0.0777 255 TYR A CA  
2039 C C   . TYR A 255 ? 0.9812 0.8035 0.8689 0.0790  -0.1534 -0.0815 255 TYR A C   
2040 O O   . TYR A 255 ? 0.9953 0.8512 0.9125 0.0801  -0.1535 -0.0861 255 TYR A O   
2041 C CB  . TYR A 255 ? 1.0144 0.8312 0.9237 0.0996  -0.1485 -0.0814 255 TYR A CB  
2042 C CG  . TYR A 255 ? 0.9116 0.7238 0.8306 0.1107  -0.1561 -0.0790 255 TYR A CG  
2043 C CD1 . TYR A 255 ? 0.8391 0.6757 0.7821 0.1179  -0.1714 -0.0793 255 TYR A CD1 
2044 C CD2 . TYR A 255 ? 0.8814 0.6644 0.7864 0.1142  -0.1470 -0.0765 255 TYR A CD2 
2045 C CE1 . TYR A 255 ? 0.9068 0.7360 0.8583 0.1299  -0.1777 -0.0766 255 TYR A CE1 
2046 C CE2 . TYR A 255 ? 0.9797 0.7538 0.8918 0.1241  -0.1528 -0.0737 255 TYR A CE2 
2047 C CZ  . TYR A 255 ? 1.0597 0.8555 0.9944 0.1328  -0.1682 -0.0736 255 TYR A CZ  
2048 O OH  . TYR A 255 ? 1.2613 1.0450 1.2023 0.1444  -0.1734 -0.0702 255 TYR A OH  
2049 N N   . VAL A 256 ? 0.8713 0.6649 0.7257 0.0694  -0.1458 -0.0797 256 VAL A N   
2050 C CA  . VAL A 256 ? 0.7616 0.5616 0.6131 0.0593  -0.1401 -0.0824 256 VAL A CA  
2051 C C   . VAL A 256 ? 0.8379 0.6546 0.6930 0.0497  -0.1571 -0.0830 256 VAL A C   
2052 O O   . VAL A 256 ? 0.8482 0.6499 0.6819 0.0447  -0.1698 -0.0802 256 VAL A O   
2053 C CB  . VAL A 256 ? 0.7368 0.4999 0.5519 0.0524  -0.1266 -0.0810 256 VAL A CB  
2054 C CG1 . VAL A 256 ? 0.7456 0.5090 0.5525 0.0401  -0.1239 -0.0831 256 VAL A CG1 
2055 C CG2 . VAL A 256 ? 0.6349 0.3927 0.4550 0.0617  -0.1083 -0.0816 256 VAL A CG2 
2056 N N   . MET A 257 ? 0.8703 0.7203 0.7532 0.0471  -0.1576 -0.0869 257 MET A N   
2057 C CA  . MET A 257 ? 0.8251 0.6993 0.7191 0.0381  -0.1735 -0.0884 257 MET A CA  
2058 C C   . MET A 257 ? 0.8708 0.7353 0.7461 0.0202  -0.1698 -0.0902 257 MET A C   
2059 O O   . MET A 257 ? 0.9625 0.8390 0.8377 0.0083  -0.1832 -0.0918 257 MET A O   
2060 C CB  . MET A 257 ? 0.7871 0.7075 0.7259 0.0457  -0.1772 -0.0920 257 MET A CB  
2061 C CG  . MET A 257 ? 0.9004 0.8360 0.8590 0.0594  -0.1906 -0.0909 257 MET A CG  
2062 S SD  . MET A 257 ? 1.0839 1.0701 1.0944 0.0707  -0.1897 -0.0968 257 MET A SD  
2063 C CE  . MET A 257 ? 1.8131 1.8171 1.8407 0.0810  -0.2124 -0.0946 257 MET A CE  
2064 N N   . GLY A 258 ? 0.7930 0.6360 0.6531 0.0183  -0.1517 -0.0901 258 GLY A N   
2065 C CA  . GLY A 258 ? 0.6854 0.5137 0.5264 0.0023  -0.1451 -0.0916 258 GLY A CA  
2066 C C   . GLY A 258 ? 0.6891 0.5111 0.5311 0.0058  -0.1250 -0.0908 258 GLY A C   
2067 O O   . GLY A 258 ? 0.8085 0.6351 0.6621 0.0203  -0.1162 -0.0895 258 GLY A O   
2068 N N   . PHE A 259 ? 0.7496 0.5603 0.5785 -0.0077 -0.1180 -0.0916 259 PHE A N   
2069 C CA  . PHE A 259 ? 0.8927 0.6988 0.7225 -0.0046 -0.1000 -0.0895 259 PHE A CA  
2070 C C   . PHE A 259 ? 0.8937 0.7312 0.7471 -0.0135 -0.1006 -0.0908 259 PHE A C   
2071 O O   . PHE A 259 ? 0.8048 0.6595 0.6669 -0.0263 -0.1133 -0.0941 259 PHE A O   
2072 C CB  . PHE A 259 ? 0.8437 0.6025 0.6339 -0.0121 -0.0875 -0.0881 259 PHE A CB  
2073 C CG  . PHE A 259 ? 0.9544 0.6813 0.7202 -0.0028 -0.0821 -0.0867 259 PHE A CG  
2074 C CD1 . PHE A 259 ? 0.9625 0.6783 0.7255 0.0110  -0.0657 -0.0834 259 PHE A CD1 
2075 C CD2 . PHE A 259 ? 0.9966 0.7056 0.7415 -0.0082 -0.0932 -0.0884 259 PHE A CD2 
2076 C CE1 . PHE A 259 ? 0.9340 0.6225 0.6760 0.0187  -0.0593 -0.0825 259 PHE A CE1 
2077 C CE2 . PHE A 259 ? 1.0043 0.6833 0.7252 -0.0006 -0.0865 -0.0869 259 PHE A CE2 
2078 C CZ  . PHE A 259 ? 0.9499 0.6192 0.6705 0.0125  -0.0690 -0.0843 259 PHE A CZ  
2079 N N   . VAL A 260 ? 0.8336 0.6802 0.6976 -0.0068 -0.0868 -0.0881 260 VAL A N   
2080 C CA  . VAL A 260 ? 0.8491 0.7133 0.7245 -0.0181 -0.0826 -0.0879 260 VAL A CA  
2081 C C   . VAL A 260 ? 0.8551 0.6781 0.6961 -0.0341 -0.0745 -0.0866 260 VAL A C   
2082 O O   . VAL A 260 ? 0.9092 0.6983 0.7264 -0.0284 -0.0602 -0.0824 260 VAL A O   
2083 C CB  . VAL A 260 ? 0.7539 0.6375 0.6462 -0.0058 -0.0698 -0.0844 260 VAL A CB  
2084 C CG1 . VAL A 260 ? 0.6588 0.5536 0.5562 -0.0190 -0.0630 -0.0827 260 VAL A CG1 
2085 C CG2 . VAL A 260 ? 0.6489 0.5723 0.5747 0.0086  -0.0771 -0.0876 260 VAL A CG2 
2086 N N   . SER A 261 ? 1.0106 0.8364 0.8493 -0.0541 -0.0835 -0.0906 261 SER A N   
2087 C CA  . SER A 261 ? 1.1284 0.9130 0.9335 -0.0718 -0.0759 -0.0910 261 SER A CA  
2088 C C   . SER A 261 ? 1.1602 0.9639 0.9764 -0.0946 -0.0810 -0.0949 261 SER A C   
2089 O O   . SER A 261 ? 1.0576 0.8998 0.8993 -0.0999 -0.0972 -0.0995 261 SER A O   
2090 C CB  . SER A 261 ? 1.0716 0.8196 0.8442 -0.0757 -0.0823 -0.0942 261 SER A CB  
2091 O OG  . SER A 261 ? 1.0168 0.7191 0.7534 -0.0912 -0.0723 -0.0955 261 SER A OG  
2092 N N   . SER A 262 ? 1.2945 1.0712 1.0921 -0.1077 -0.0667 -0.0928 262 SER A N   
2093 C CA  . SER A 262 ? 1.4549 1.2408 1.2565 -0.1338 -0.0694 -0.0972 262 SER A CA  
2094 C C   . SER A 262 ? 1.5391 1.3158 1.3262 -0.1515 -0.0856 -0.1057 262 SER A C   
2095 O O   . SER A 262 ? 1.5768 1.3932 1.3882 -0.1536 -0.1043 -0.1104 262 SER A O   
2096 C CB  . SER A 262 ? 1.5320 1.2786 1.3087 -0.1447 -0.0492 -0.0928 262 SER A CB  
2097 O OG  . SER A 262 ? 1.6041 1.3707 1.3994 -0.1344 -0.0369 -0.0852 262 SER A OG  
2098 N N   . GLY A 263 ? 1.5406 1.2647 1.2869 -0.1636 -0.0784 -0.1079 263 GLY A N   
2099 C CA  . GLY A 263 ? 1.5556 1.2672 1.2825 -0.1823 -0.0928 -0.1168 263 GLY A CA  
2100 C C   . GLY A 263 ? 1.5075 1.1951 1.2107 -0.1687 -0.0994 -0.1174 263 GLY A C   
2101 O O   . GLY A 263 ? 1.5169 1.2354 1.2382 -0.1579 -0.1159 -0.1176 263 GLY A O   
2102 N N   . GLY A 264 ? 1.4082 1.0393 1.0703 -0.1687 -0.0856 -0.1174 264 GLY A N   
2103 C CA  . GLY A 264 ? 1.3616 0.9654 0.9963 -0.1588 -0.0896 -0.1187 264 GLY A CA  
2104 C C   . GLY A 264 ? 1.2206 0.8182 0.8585 -0.1303 -0.0785 -0.1106 264 GLY A C   
2105 O O   . GLY A 264 ? 1.0894 0.7271 0.7613 -0.1141 -0.0839 -0.1061 264 GLY A O   
2106 N N   . GLN A 265 ? 1.2178 0.7653 0.8205 -0.1245 -0.0625 -0.1097 265 GLN A N   
2107 C CA  . GLN A 265 ? 1.2866 0.8261 0.8901 -0.0986 -0.0505 -0.1028 265 GLN A CA  
2108 C C   . GLN A 265 ? 1.3416 0.9158 0.9818 -0.0835 -0.0437 -0.0951 265 GLN A C   
2109 O O   . GLN A 265 ? 1.3956 0.9679 1.0400 -0.0901 -0.0341 -0.0926 265 GLN A O   
2110 C CB  . GLN A 265 ? 1.1162 0.5971 0.6786 -0.0962 -0.0311 -0.1031 265 GLN A CB  
2111 C CG  . GLN A 265 ? 1.1161 0.5878 0.6752 -0.0714 -0.0208 -0.0981 265 GLN A CG  
2112 C CD  . GLN A 265 ? 1.3223 0.7374 0.8404 -0.0688 -0.0024 -0.0996 265 GLN A CD  
2113 O OE1 . GLN A 265 ? 1.4596 0.8452 0.9456 -0.0780 -0.0052 -0.1064 265 GLN A OE1 
2114 N NE2 . GLN A 265 ? 1.3382 0.7380 0.8564 -0.0553 0.0165  -0.0933 265 GLN A NE2 
2115 N N   . PRO A 266 ? 1.2454 0.8502 0.9104 -0.0641 -0.0486 -0.0916 266 PRO A N   
2116 C CA  . PRO A 266 ? 1.2119 0.8572 0.9141 -0.0498 -0.0461 -0.0863 266 PRO A CA  
2117 C C   . PRO A 266 ? 1.3443 0.9762 1.0433 -0.0422 -0.0268 -0.0797 266 PRO A C   
2118 O O   . PRO A 266 ? 1.3796 0.9703 1.0504 -0.0371 -0.0123 -0.0774 266 PRO A O   
2119 C CB  . PRO A 266 ? 1.0337 0.6918 0.7464 -0.0302 -0.0496 -0.0848 266 PRO A CB  
2120 C CG  . PRO A 266 ? 1.0838 0.7284 0.7783 -0.0384 -0.0626 -0.0896 266 PRO A CG  
2121 C CD  . PRO A 266 ? 1.1153 0.7158 0.7714 -0.0559 -0.0571 -0.0933 266 PRO A CD  
2122 N N   . VAL A 267 ? 1.4446 1.1129 1.1730 -0.0403 -0.0266 -0.0765 267 VAL A N   
2123 C CA  . VAL A 267 ? 1.4488 1.1108 1.1766 -0.0336 -0.0101 -0.0690 267 VAL A CA  
2124 C C   . VAL A 267 ? 1.2636 0.9367 1.0019 -0.0080 -0.0022 -0.0633 267 VAL A C   
2125 O O   . VAL A 267 ? 1.2807 0.9930 1.0473 0.0023  -0.0106 -0.0647 267 VAL A O   
2126 C CB  . VAL A 267 ? 1.7651 1.4637 1.5189 -0.0442 -0.0132 -0.0681 267 VAL A CB  
2127 C CG1 . VAL A 267 ? 1.8098 1.5050 1.5583 -0.0706 -0.0228 -0.0750 267 VAL A CG1 
2128 C CG2 . VAL A 267 ? 1.6406 1.3939 1.4335 -0.0322 -0.0234 -0.0693 267 VAL A CG2 
2129 N N   . PRO A 268 ? 1.0877 0.7268 0.8037 0.0025  0.0141  -0.0574 268 PRO A N   
2130 C CA  . PRO A 268 ? 1.0655 0.7169 0.7915 0.0265  0.0222  -0.0517 268 PRO A CA  
2131 C C   . PRO A 268 ? 0.9897 0.6756 0.7386 0.0332  0.0253  -0.0456 268 PRO A C   
2132 O O   . PRO A 268 ? 1.0396 0.7112 0.7778 0.0256  0.0335  -0.0402 268 PRO A O   
2133 C CB  . PRO A 268 ? 1.0612 0.6627 0.7540 0.0335  0.0388  -0.0471 268 PRO A CB  
2134 C CG  . PRO A 268 ? 1.1838 0.7436 0.8470 0.0118  0.0388  -0.0520 268 PRO A CG  
2135 C CD  . PRO A 268 ? 1.1323 0.7198 0.8129 -0.0079 0.0260  -0.0558 268 PRO A CD  
2136 N N   . VAL A 269 ? 1.0289 0.7577 0.8068 0.0461  0.0195  -0.0466 269 VAL A N   
2137 C CA  . VAL A 269 ? 1.0299 0.7965 0.8302 0.0511  0.0206  -0.0425 269 VAL A CA  
2138 C C   . VAL A 269 ? 0.8498 0.5991 0.6343 0.0577  0.0358  -0.0314 269 VAL A C   
2139 O O   . VAL A 269 ? 0.7813 0.5076 0.5501 0.0723  0.0459  -0.0258 269 VAL A O   
2140 C CB  . VAL A 269 ? 0.9601 0.7682 0.7883 0.0673  0.0153  -0.0455 269 VAL A CB  
2141 C CG1 . VAL A 269 ? 1.0129 0.8596 0.8615 0.0707  0.0164  -0.0425 269 VAL A CG1 
2142 C CG2 . VAL A 269 ? 0.7615 0.5854 0.6056 0.0622  0.0008  -0.0552 269 VAL A CG2 
2143 N N   . LYS A 270 ? 0.9771 0.7375 0.7658 0.0473  0.0379  -0.0278 270 LYS A N   
2144 C CA  . LYS A 270 ? 1.0638 0.8100 0.8378 0.0539  0.0520  -0.0157 270 LYS A CA  
2145 C C   . LYS A 270 ? 0.8915 0.6620 0.6759 0.0788  0.0553  -0.0105 270 LYS A C   
2146 O O   . LYS A 270 ? 0.9041 0.7191 0.7157 0.0853  0.0466  -0.0160 270 LYS A O   
2147 C CB  . LYS A 270 ? 1.2126 0.9793 0.9959 0.0395  0.0526  -0.0133 270 LYS A CB  
2148 C CG  . LYS A 270 ? 1.3234 1.0803 1.1050 0.0131  0.0469  -0.0204 270 LYS A CG  
2149 C CD  . LYS A 270 ? 1.4233 1.2133 1.2226 0.0003  0.0469  -0.0194 270 LYS A CD  
2150 C CE  . LYS A 270 ? 1.4626 1.2496 1.2645 -0.0269 0.0405  -0.0271 270 LYS A CE  
2151 N NZ  . LYS A 270 ? 1.3741 1.2001 1.1981 -0.0392 0.0403  -0.0275 270 LYS A NZ  
2152 N N   . ASP A 271 ? 0.9740 0.7153 0.7369 0.0929  0.0677  -0.0003 271 ASP A N   
2153 C CA  . ASP A 271 ? 1.1599 0.9244 0.9310 0.1171  0.0711  0.0059  271 ASP A CA  
2154 C C   . ASP A 271 ? 1.0860 0.9027 0.8813 0.1207  0.0658  0.0063  271 ASP A C   
2155 O O   . ASP A 271 ? 0.9577 0.8120 0.7744 0.1329  0.0595  0.0014  271 ASP A O   
2156 C CB  . ASP A 271 ? 1.3312 1.0583 1.0748 0.1297  0.0861  0.0200  271 ASP A CB  
2157 C CG  . ASP A 271 ? 1.5028 1.1798 1.2227 0.1314  0.0932  0.0191  271 ASP A CG  
2158 O OD1 . ASP A 271 ? 1.5800 1.2202 1.2821 0.1124  0.0950  0.0155  271 ASP A OD1 
2159 O OD2 . ASP A 271 ? 1.5470 1.2232 1.2666 0.1514  0.0972  0.0212  271 ASP A OD2 
2160 N N   . ARG A 272 ? 1.1606 0.9786 0.9514 0.1089  0.0693  0.0116  272 ARG A N   
2161 C CA  . ARG A 272 ? 1.2524 1.1173 1.0623 0.1111  0.0663  0.0123  272 ARG A CA  
2162 C C   . ARG A 272 ? 1.1606 1.0689 1.0028 0.1069  0.0526  -0.0026 272 ARG A C   
2163 O O   . ARG A 272 ? 1.1180 1.0679 0.9790 0.1174  0.0486  -0.0055 272 ARG A O   
2164 C CB  . ARG A 272 ? 1.5121 1.3680 1.3115 0.0946  0.0731  0.0190  272 ARG A CB  
2165 C CG  . ARG A 272 ? 1.7565 1.5706 1.5234 0.1003  0.0881  0.0358  272 ARG A CG  
2166 C CD  . ARG A 272 ? 1.9001 1.7011 1.6555 0.0803  0.0959  0.0418  272 ARG A CD  
2167 N NE  . ARG A 272 ? 1.9848 1.7507 1.7098 0.0885  0.1108  0.0598  272 ARG A NE  
2168 C CZ  . ARG A 272 ? 2.0481 1.7880 1.7547 0.0721  0.1215  0.0681  272 ARG A CZ  
2169 N NH1 . ARG A 272 ? 2.0842 1.7891 1.7615 0.0820  0.1354  0.0857  272 ARG A NH1 
2170 N NH2 . ARG A 272 ? 2.0606 1.8095 1.7785 0.0458  0.1186  0.0592  272 ARG A NH2 
2171 N N   . GLU A 273 ? 1.1379 1.0358 0.9853 0.0919  0.0452  -0.0122 273 GLU A N   
2172 C CA  . GLU A 273 ? 1.0223 0.9582 0.8995 0.0882  0.0323  -0.0254 273 GLU A CA  
2173 C C   . GLU A 273 ? 0.8862 0.8309 0.7741 0.1021  0.0264  -0.0321 273 GLU A C   
2174 O O   . GLU A 273 ? 0.7629 0.7436 0.6761 0.1049  0.0179  -0.0414 273 GLU A O   
2175 C CB  . GLU A 273 ? 1.0147 0.9424 0.8959 0.0672  0.0251  -0.0324 273 GLU A CB  
2176 C CG  . GLU A 273 ? 1.1604 1.0878 1.0370 0.0510  0.0307  -0.0276 273 GLU A CG  
2177 C CD  . GLU A 273 ? 1.3201 1.2612 1.2129 0.0316  0.0209  -0.0370 273 GLU A CD  
2178 O OE1 . GLU A 273 ? 1.4043 1.3135 1.2821 0.0169  0.0196  -0.0381 273 GLU A OE1 
2179 O OE2 . GLU A 273 ? 1.3362 1.3211 1.2572 0.0312  0.0144  -0.0438 273 GLU A OE2 
2180 N N   . MET A 274 ? 0.8213 0.7329 0.6900 0.1105  0.0321  -0.0276 274 MET A N   
2181 C CA  . MET A 274 ? 0.8276 0.7436 0.7041 0.1222  0.0287  -0.0333 274 MET A CA  
2182 C C   . MET A 274 ? 0.7621 0.7090 0.6499 0.1408  0.0314  -0.0310 274 MET A C   
2183 O O   . MET A 274 ? 0.7236 0.6916 0.6283 0.1481  0.0265  -0.0388 274 MET A O   
2184 C CB  . MET A 274 ? 0.7924 0.6613 0.6436 0.1239  0.0352  -0.0298 274 MET A CB  
2185 C CG  . MET A 274 ? 0.8894 0.7381 0.7371 0.1115  0.0278  -0.0382 274 MET A CG  
2186 S SD  . MET A 274 ? 0.9257 0.8070 0.8014 0.1150  0.0159  -0.0501 274 MET A SD  
2187 C CE  . MET A 274 ? 0.7688 0.6550 0.6452 0.1356  0.0246  -0.0474 274 MET A CE  
2188 N N   . ARG A 275 ? 0.7470 0.6955 0.6239 0.1480  0.0393  -0.0201 275 ARG A N   
2189 C CA  . ARG A 275 ? 0.8921 0.8691 0.7760 0.1667  0.0417  -0.0164 275 ARG A CA  
2190 C C   . ARG A 275 ? 0.7631 0.7901 0.6764 0.1691  0.0325  -0.0282 275 ARG A C   
2191 O O   . ARG A 275 ? 0.7429 0.7890 0.6674 0.1809  0.0309  -0.0323 275 ARG A O   
2192 C CB  . ARG A 275 ? 1.1025 1.0755 0.9691 0.1733  0.0504  -0.0018 275 ARG A CB  
2193 C CG  . ARG A 275 ? 1.3191 1.3129 1.1905 0.1620  0.0491  -0.0013 275 ARG A CG  
2194 C CD  . ARG A 275 ? 1.3450 1.3353 1.1972 0.1702  0.0584  0.0145  275 ARG A CD  
2195 N NE  . ARG A 275 ? 1.3267 1.3256 1.1744 0.1927  0.0610  0.0218  275 ARG A NE  
2196 C CZ  . ARG A 275 ? 1.3494 1.3520 1.1820 0.2054  0.0673  0.0361  275 ARG A CZ  
2197 N NH1 . ARG A 275 ? 1.3940 1.3903 1.2130 0.1966  0.0728  0.0448  275 ARG A NH1 
2198 N NH2 . ARG A 275 ? 1.2525 1.2664 1.0838 0.2268  0.0680  0.0421  275 ARG A NH2 
2199 N N   . PRO A 276 ? 0.7286 0.7771 0.6554 0.1575  0.0270  -0.0345 276 PRO A N   
2200 C CA  . PRO A 276 ? 0.7746 0.8669 0.7282 0.1606  0.0193  -0.0469 276 PRO A CA  
2201 C C   . PRO A 276 ? 0.8240 0.9119 0.7904 0.1601  0.0132  -0.0578 276 PRO A C   
2202 O O   . PRO A 276 ? 0.6744 0.7895 0.6576 0.1674  0.0099  -0.0659 276 PRO A O   
2203 C CB  . PRO A 276 ? 0.7387 0.8482 0.7035 0.1475  0.0155  -0.0520 276 PRO A CB  
2204 C CG  . PRO A 276 ? 0.7614 0.8433 0.7045 0.1389  0.0227  -0.0400 276 PRO A CG  
2205 C CD  . PRO A 276 ? 0.7928 0.8295 0.7140 0.1412  0.0274  -0.0326 276 PRO A CD  
2206 N N   . ILE A 277 ? 0.8598 0.9132 0.8169 0.1505  0.0118  -0.0579 277 ILE A N   
2207 C CA  . ILE A 277 ? 0.7246 0.7691 0.6897 0.1489  0.0065  -0.0666 277 ILE A CA  
2208 C C   . ILE A 277 ? 0.5776 0.6211 0.5407 0.1618  0.0115  -0.0655 277 ILE A C   
2209 O O   . ILE A 277 ? 0.7522 0.8160 0.7328 0.1655  0.0081  -0.0746 277 ILE A O   
2210 C CB  . ILE A 277 ? 0.7509 0.7554 0.7001 0.1372  0.0049  -0.0650 277 ILE A CB  
2211 C CG1 . ILE A 277 ? 0.8157 0.8258 0.7702 0.1235  -0.0009 -0.0668 277 ILE A CG1 
2212 C CG2 . ILE A 277 ? 0.8085 0.8028 0.7628 0.1364  0.0000  -0.0725 277 ILE A CG2 
2213 C CD1 . ILE A 277 ? 0.7998 0.8483 0.7826 0.1229  -0.0091 -0.0772 277 ILE A CD1 
2214 N N   . LEU A 278 ? 0.5531 0.5731 0.4954 0.1685  0.0203  -0.0545 278 LEU A N   
2215 C CA  . LEU A 278 ? 0.6313 0.6514 0.5713 0.1826  0.0265  -0.0518 278 LEU A CA  
2216 C C   . LEU A 278 ? 0.7921 0.8592 0.7521 0.1938  0.0246  -0.0554 278 LEU A C   
2217 O O   . LEU A 278 ? 0.7407 0.8232 0.7140 0.1994  0.0242  -0.0620 278 LEU A O   
2218 C CB  . LEU A 278 ? 0.7071 0.6950 0.6209 0.1894  0.0367  -0.0380 278 LEU A CB  
2219 C CG  . LEU A 278 ? 0.9172 0.8563 0.8076 0.1773  0.0396  -0.0348 278 LEU A CG  
2220 C CD1 . LEU A 278 ? 0.9796 0.8880 0.8441 0.1817  0.0499  -0.0213 278 LEU A CD1 
2221 C CD2 . LEU A 278 ? 0.7363 0.6507 0.6214 0.1757  0.0410  -0.0401 278 LEU A CD2 
2222 N N   . ARG A 279 ? 0.8316 0.9216 0.7927 0.1961  0.0238  -0.0514 279 ARG A N   
2223 C CA  . ARG A 279 ? 0.7660 0.9017 0.7427 0.2062  0.0214  -0.0548 279 ARG A CA  
2224 C C   . ARG A 279 ? 0.7367 0.9014 0.7389 0.1999  0.0135  -0.0715 279 ARG A C   
2225 O O   . ARG A 279 ? 0.7356 0.9269 0.7526 0.2063  0.0120  -0.0785 279 ARG A O   
2226 C CB  . ARG A 279 ? 0.6772 0.8283 0.6458 0.2086  0.0226  -0.0466 279 ARG A CB  
2227 C CG  . ARG A 279 ? 0.6667 0.7927 0.6104 0.2187  0.0313  -0.0292 279 ARG A CG  
2228 C CD  . ARG A 279 ? 0.7481 0.8839 0.6805 0.2189  0.0334  -0.0198 279 ARG A CD  
2229 N NE  . ARG A 279 ? 0.7232 0.8387 0.6321 0.2324  0.0419  -0.0022 279 ARG A NE  
2230 C CZ  . ARG A 279 ? 0.7690 0.8940 0.6646 0.2381  0.0451  0.0095  279 ARG A CZ  
2231 N NH1 . ARG A 279 ? 0.7310 0.8877 0.6349 0.2307  0.0410  0.0043  279 ARG A NH1 
2232 N NH2 . ARG A 279 ? 0.7537 0.8556 0.6266 0.2518  0.0531  0.0266  279 ARG A NH2 
2233 N N   . LEU A 280 ? 0.7436 0.9029 0.7516 0.1872  0.0085  -0.0780 280 LEU A N   
2234 C CA  . LEU A 280 ? 0.5913 0.7692 0.6217 0.1813  0.0018  -0.0934 280 LEU A CA  
2235 C C   . LEU A 280 ? 0.7487 0.9125 0.7833 0.1821  0.0025  -0.0982 280 LEU A C   
2236 O O   . LEU A 280 ? 0.8529 1.0384 0.9058 0.1821  -0.0002 -0.1097 280 LEU A O   
2237 C CB  . LEU A 280 ? 0.5139 0.6800 0.5475 0.1691  -0.0032 -0.0974 280 LEU A CB  
2238 C CG  . LEU A 280 ? 0.6769 0.8713 0.7196 0.1661  -0.0056 -0.1009 280 LEU A CG  
2239 C CD1 . LEU A 280 ? 0.7056 0.8884 0.7544 0.1548  -0.0107 -0.1050 280 LEU A CD1 
2240 C CD2 . LEU A 280 ? 0.7032 0.9374 0.7656 0.1707  -0.0083 -0.1136 280 LEU A CD2 
2241 N N   . ALA A 281 ? 0.7686 0.8948 0.7851 0.1818  0.0072  -0.0897 281 ALA A N   
2242 C CA  . ALA A 281 ? 0.8217 0.9297 0.8387 0.1811  0.0094  -0.0932 281 ALA A CA  
2243 C C   . ALA A 281 ? 0.8925 1.0182 0.9144 0.1929  0.0153  -0.0923 281 ALA A C   
2244 O O   . ALA A 281 ? 0.9722 1.0894 0.9974 0.1928  0.0187  -0.0960 281 ALA A O   
2245 C CB  . ALA A 281 ? 0.8217 0.8827 0.8154 0.1758  0.0126  -0.0856 281 ALA A CB  
2246 N N   . GLY A 282 ? 0.8810 1.0330 0.9036 0.2031  0.0167  -0.0870 282 GLY A N   
2247 C CA  . GLY A 282 ? 0.8101 0.9828 0.8381 0.2160  0.0213  -0.0849 282 GLY A CA  
2248 C C   . GLY A 282 ? 0.7806 0.9174 0.7906 0.2220  0.0304  -0.0750 282 GLY A C   
2249 O O   . GLY A 282 ? 0.7674 0.9114 0.7841 0.2291  0.0354  -0.0762 282 GLY A O   
2250 N N   . LEU A 283 ? 0.8042 0.9025 0.7914 0.2184  0.0331  -0.0658 283 LEU A N   
2251 C CA  . LEU A 283 ? 0.9091 0.9671 0.8751 0.2229  0.0424  -0.0571 283 LEU A CA  
2252 C C   . LEU A 283 ? 0.9696 1.0207 0.9190 0.2361  0.0485  -0.0427 283 LEU A C   
2253 O O   . LEU A 283 ? 1.0449 1.0665 0.9774 0.2444  0.0579  -0.0346 283 LEU A O   
2254 C CB  . LEU A 283 ? 0.8981 0.9131 0.8476 0.2080  0.0414  -0.0581 283 LEU A CB  
2255 C CG  . LEU A 283 ? 0.9095 0.9105 0.8628 0.2000  0.0413  -0.0669 283 LEU A CG  
2256 C CD1 . LEU A 283 ? 0.8504 0.8905 0.8311 0.2017  0.0382  -0.0774 283 LEU A CD1 
2257 C CD2 . LEU A 283 ? 0.9386 0.9160 0.8844 0.1841  0.0340  -0.0705 283 LEU A CD2 
2258 N N   . GLU A 284 ? 1.2138 1.3167 0.9412 0.4019  0.0011  0.0880  284 GLU A N   
2259 C CA  . GLU A 284 ? 1.3342 1.3815 1.0120 0.4144  0.0169  0.0922  284 GLU A CA  
2260 C C   . GLU A 284 ? 1.3938 1.4817 1.0995 0.4176  0.0141  0.1075  284 GLU A C   
2261 O O   . GLU A 284 ? 1.2785 1.4053 1.0311 0.3917  0.0025  0.1001  284 GLU A O   
2262 C CB  . GLU A 284 ? 1.3953 1.3780 1.0436 0.3860  0.0242  0.0690  284 GLU A CB  
2263 C CG  . GLU A 284 ? 1.5206 1.4406 1.1184 0.3887  0.0344  0.0532  284 GLU A CG  
2264 C CD  . GLU A 284 ? 1.6341 1.4798 1.1952 0.3666  0.0474  0.0361  284 GLU A CD  
2265 O OE1 . GLU A 284 ? 1.7130 1.5533 1.2801 0.3590  0.0519  0.0433  284 GLU A OE1 
2266 O OE2 . GLU A 284 ? 1.6023 1.3972 1.1294 0.3562  0.0536  0.0152  284 GLU A OE2 
2267 N N   . GLU A 285 ? 1.5592 1.6409 1.2358 0.4503  0.0254  0.1286  285 GLU A N   
2268 C CA  . GLU A 285 ? 1.6229 1.7465 1.3192 0.4557  0.0238  0.1432  285 GLU A CA  
2269 C C   . GLU A 285 ? 1.5215 1.5955 1.1850 0.4467  0.0365  0.1385  285 GLU A C   
2270 O O   . GLU A 285 ? 1.5227 1.5370 1.1326 0.4670  0.0553  0.1461  285 GLU A O   
2271 C CB  . GLU A 285 ? 1.8301 1.9828 1.5136 0.4973  0.0296  0.1717  285 GLU A CB  
2272 C CG  . GLU A 285 ? 1.9425 2.1354 1.6506 0.5104  0.0206  0.1794  285 GLU A CG  
2273 C CD  . GLU A 285 ? 2.0753 2.2995 1.7702 0.5522  0.0270  0.2094  285 GLU A CD  
2274 O OE1 . GLU A 285 ? 2.1407 2.3657 1.8136 0.5697  0.0366  0.2247  285 GLU A OE1 
2275 O OE2 . GLU A 285 ? 2.1089 2.3609 1.8158 0.5689  0.0229  0.2195  285 GLU A OE2 
2276 N N   . TYR A 286 ? 1.3872 1.4854 1.0839 0.4171  0.0277  0.1266  286 TYR A N   
2277 C CA  . TYR A 286 ? 1.3844 1.4391 1.0557 0.4039  0.0388  0.1209  286 TYR A CA  
2278 C C   . TYR A 286 ? 1.4873 1.5897 1.1749 0.4076  0.0375  0.1320  286 TYR A C   
2279 O O   . TYR A 286 ? 1.5040 1.6777 1.2327 0.4094  0.0240  0.1362  286 TYR A O   
2280 C CB  . TYR A 286 ? 1.2764 1.3086 0.9641 0.3632  0.0320  0.0943  286 TYR A CB  
2281 C CG  . TYR A 286 ? 1.1282 1.2257 0.8787 0.3379  0.0122  0.0826  286 TYR A CG  
2282 C CD1 . TYR A 286 ? 1.0210 1.1556 0.8071 0.3362  -0.0005 0.0797  286 TYR A CD1 
2283 C CD2 . TYR A 286 ? 1.0650 1.1862 0.8394 0.3172  0.0080  0.0753  286 TYR A CD2 
2284 C CE1 . TYR A 286 ? 0.9283 1.1171 0.7733 0.3144  -0.0153 0.0705  286 TYR A CE1 
2285 C CE2 . TYR A 286 ? 0.9616 1.1374 0.7928 0.2953  -0.0077 0.0633  286 TYR A CE2 
2286 C CZ  . TYR A 286 ? 1.0380 1.2450 0.9049 0.2939  -0.0186 0.0613  286 TYR A CZ  
2287 O OH  . TYR A 286 ? 1.1398 1.3962 1.0649 0.2735  -0.0313 0.0510  286 TYR A OH  
2288 N N   . GLU A 287 ? 1.5246 1.5884 1.1802 0.4078  0.0522  0.1362  287 GLU A N   
2289 C CA  . GLU A 287 ? 1.5448 1.6528 1.2087 0.4133  0.0533  0.1472  287 GLU A CA  
2290 C C   . GLU A 287 ? 1.3213 1.4915 1.0413 0.3822  0.0333  0.1282  287 GLU A C   
2291 O O   . GLU A 287 ? 1.0999 1.3401 0.8482 0.3884  0.0238  0.1331  287 GLU A O   
2292 C CB  . GLU A 287 ? 1.7877 1.8366 1.4099 0.4146  0.0740  0.1538  287 GLU A CB  
2293 C CG  . GLU A 287 ? 1.9767 1.9445 1.5435 0.4385  0.0967  0.1665  287 GLU A CG  
2294 C CD  . GLU A 287 ? 2.1051 1.9979 1.6398 0.4253  0.1159  0.1635  287 GLU A CD  
2295 O OE1 . GLU A 287 ? 2.0534 1.9501 1.6107 0.3908  0.1081  0.1459  287 GLU A OE1 
2296 O OE2 . GLU A 287 ? 2.2289 2.0579 1.7168 0.4497  0.1400  0.1797  287 GLU A OE2 
2297 N N   . LEU A 297 ? 1.4228 1.9003 1.2926 0.1559  0.0354  0.0009  297 LEU A N   
2298 C CA  . LEU A 297 ? 1.4659 1.9942 1.3468 0.1511  0.0352  -0.0096 297 LEU A CA  
2299 C C   . LEU A 297 ? 1.3443 1.8467 1.2449 0.1225  0.0354  -0.0200 297 LEU A C   
2300 O O   . LEU A 297 ? 1.3611 1.8041 1.2594 0.1071  0.0384  -0.0139 297 LEU A O   
2301 C CB  . LEU A 297 ? 1.6236 2.1692 1.4696 0.1731  0.0517  0.0183  297 LEU A CB  
2302 C CG  . LEU A 297 ? 1.6853 2.2758 1.5109 0.2053  0.0532  0.0317  297 LEU A CG  
2303 C CD1 . LEU A 297 ? 1.7005 2.2402 1.5060 0.2184  0.0580  0.0507  297 LEU A CD1 
2304 C CD2 . LEU A 297 ? 1.7466 2.3691 1.5445 0.2259  0.0696  0.0576  297 LEU A CD2 
2305 N N   . GLY A 298 ? 1.1110 1.6621 1.0300 0.1163  0.0322  -0.0362 298 GLY A N   
2306 C CA  . GLY A 298 ? 1.0521 1.5916 0.9915 0.0920  0.0328  -0.0453 298 GLY A CA  
2307 C C   . GLY A 298 ? 1.1215 1.5972 1.0665 0.0702  0.0335  -0.0408 298 GLY A C   
2308 O O   . GLY A 298 ? 1.2136 1.6534 1.1432 0.0591  0.0448  -0.0234 298 GLY A O   
2309 N N   . PHE A 299 ? 0.9108 1.3754 0.8788 0.0635  0.0218  -0.0563 299 PHE A N   
2310 C CA  . PHE A 299 ? 0.8383 1.2564 0.8169 0.0421  0.0203  -0.0564 299 PHE A CA  
2311 C C   . PHE A 299 ? 0.7479 1.1909 0.7635 0.0233  0.0152  -0.0741 299 PHE A C   
2312 O O   . PHE A 299 ? 0.7446 1.2329 0.7864 0.0277  0.0087  -0.0935 299 PHE A O   
2313 C CB  . PHE A 299 ? 0.6597 1.0564 0.6452 0.0462  0.0115  -0.0609 299 PHE A CB  
2314 C CG  . PHE A 299 ? 0.7354 1.0970 0.6831 0.0636  0.0182  -0.0413 299 PHE A CG  
2315 C CD1 . PHE A 299 ? 0.7685 1.1497 0.7141 0.0847  0.0124  -0.0422 299 PHE A CD1 
2316 C CD2 . PHE A 299 ? 0.8473 1.1563 0.7623 0.0590  0.0316  -0.0216 299 PHE A CD2 
2317 C CE1 . PHE A 299 ? 0.9099 1.2604 0.8202 0.1038  0.0201  -0.0221 299 PHE A CE1 
2318 C CE2 . PHE A 299 ? 1.0712 1.3432 0.9509 0.0773  0.0405  -0.0031 299 PHE A CE2 
2319 C CZ  . PHE A 299 ? 1.0733 1.3669 0.9498 0.1012  0.0349  -0.0023 299 PHE A CZ  
2320 N N   . LYS A 300 ? 0.7055 1.1201 0.7237 0.0023  0.0191  -0.0678 300 LYS A N   
2321 C CA  . LYS A 300 ? 0.8053 1.2433 0.8594 -0.0144 0.0152  -0.0813 300 LYS A CA  
2322 C C   . LYS A 300 ? 0.7786 1.1890 0.8484 -0.0316 0.0104  -0.0822 300 LYS A C   
2323 O O   . LYS A 300 ? 0.7087 1.0757 0.7556 -0.0367 0.0122  -0.0712 300 LYS A O   
2324 C CB  . LYS A 300 ? 0.8856 1.3390 0.9347 -0.0237 0.0247  -0.0732 300 LYS A CB  
2325 C CG  . LYS A 300 ? 1.0293 1.5261 1.0707 -0.0057 0.0283  -0.0763 300 LYS A CG  
2326 C CD  . LYS A 300 ? 1.1040 1.6214 1.1436 -0.0136 0.0379  -0.0676 300 LYS A CD  
2327 C CE  . LYS A 300 ? 1.1416 1.7085 1.1721 0.0066  0.0413  -0.0716 300 LYS A CE  
2328 N NZ  . LYS A 300 ? 1.1543 1.7474 1.1847 0.0011  0.0509  -0.0627 300 LYS A NZ  
2329 N N   . VAL A 301 ? 0.6632 1.1009 0.7721 -0.0390 0.0052  -0.0955 301 VAL A N   
2330 C CA  . VAL A 301 ? 0.6747 1.0999 0.8019 -0.0551 0.0017  -0.0946 301 VAL A CA  
2331 C C   . VAL A 301 ? 0.7903 1.1893 0.8950 -0.0754 0.0079  -0.0805 301 VAL A C   
2332 O O   . VAL A 301 ? 0.9061 1.3162 1.0040 -0.0823 0.0153  -0.0743 301 VAL A O   
2333 C CB  . VAL A 301 ? 0.5731 1.0375 0.7454 -0.0593 0.0000  -0.1061 301 VAL A CB  
2334 C CG1 . VAL A 301 ? 0.5874 1.0474 0.7769 -0.0758 -0.0020 -0.1006 301 VAL A CG1 
2335 C CG2 . VAL A 301 ? 0.4511 0.9358 0.6505 -0.0426 -0.0053 -0.1221 301 VAL A CG2 
2336 N N   . GLY A 302 ? 0.7649 1.1300 0.8581 -0.0853 0.0054  -0.0760 302 GLY A N   
2337 C CA  . GLY A 302 ? 0.6938 1.0303 0.7659 -0.1078 0.0112  -0.0662 302 GLY A CA  
2338 C C   . GLY A 302 ? 0.7543 1.0431 0.7826 -0.1037 0.0202  -0.0548 302 GLY A C   
2339 O O   . GLY A 302 ? 0.6979 0.9516 0.7061 -0.1229 0.0264  -0.0478 302 GLY A O   
2340 N N   . ASP A 303 ? 0.7932 1.0818 0.8077 -0.0787 0.0220  -0.0527 303 ASP A N   
2341 C CA  . ASP A 303 ? 0.8502 1.0946 0.8235 -0.0685 0.0322  -0.0388 303 ASP A CA  
2342 C C   . ASP A 303 ? 1.0234 1.2162 0.9757 -0.0710 0.0315  -0.0384 303 ASP A C   
2343 O O   . ASP A 303 ? 0.9850 1.1844 0.9503 -0.0638 0.0211  -0.0480 303 ASP A O   
2344 C CB  . ASP A 303 ? 0.7549 1.0214 0.7207 -0.0386 0.0325  -0.0368 303 ASP A CB  
2345 C CG  . ASP A 303 ? 0.8144 1.1164 0.7802 -0.0333 0.0398  -0.0307 303 ASP A CG  
2346 O OD1 . ASP A 303 ? 0.7794 1.0984 0.7601 -0.0514 0.0423  -0.0309 303 ASP A OD1 
2347 O OD2 . ASP A 303 ? 0.7748 1.0922 0.7253 -0.0096 0.0431  -0.0251 303 ASP A OD2 
2348 N N   . MET A 304 ? 1.1068 1.2476 1.0270 -0.0807 0.0439  -0.0273 304 MET A N   
2349 C CA  . MET A 304 ? 1.1808 1.2659 1.0739 -0.0795 0.0464  -0.0275 304 MET A CA  
2350 C C   . MET A 304 ? 1.2012 1.2692 1.0688 -0.0461 0.0518  -0.0170 304 MET A C   
2351 O O   . MET A 304 ? 1.3321 1.3971 1.1826 -0.0322 0.0638  -0.0015 304 MET A O   
2352 C CB  . MET A 304 ? 1.2679 1.2990 1.1376 -0.1046 0.0595  -0.0220 304 MET A CB  
2353 C CG  . MET A 304 ? 1.3108 1.3442 1.1965 -0.1381 0.0516  -0.0365 304 MET A CG  
2354 S SD  . MET A 304 ? 2.8168 2.8359 2.6990 -0.1344 0.0392  -0.0527 304 MET A SD  
2355 C CE  . MET A 304 ? 1.1438 1.0749 0.9738 -0.1264 0.0557  -0.0470 304 MET A CE  
2356 N N   . VAL A 305 ? 1.0526 1.1147 0.9185 -0.0317 0.0436  -0.0235 305 VAL A N   
2357 C CA  . VAL A 305 ? 1.0222 1.0727 0.8649 0.0007  0.0481  -0.0127 305 VAL A CA  
2358 C C   . VAL A 305 ? 1.1058 1.1022 0.9213 0.0066  0.0513  -0.0127 305 VAL A C   
2359 O O   . VAL A 305 ? 1.1118 1.0932 0.9329 -0.0126 0.0451  -0.0256 305 VAL A O   
2360 C CB  . VAL A 305 ? 0.9116 1.0213 0.7825 0.0200  0.0343  -0.0194 305 VAL A CB  
2361 C CG1 . VAL A 305 ? 0.9047 1.0704 0.8062 0.0128  0.0296  -0.0256 305 VAL A CG1 
2362 C CG2 . VAL A 305 ? 0.7803 0.8975 0.6724 0.0163  0.0206  -0.0328 305 VAL A CG2 
2363 N N   . LYS A 306 ? 1.1270 1.0984 0.9123 0.0350  0.0614  0.0021  306 LYS A N   
2364 C CA  . LYS A 306 ? 1.1125 1.0360 0.8706 0.0470  0.0652  0.0028  306 LYS A CA  
2365 C C   . LYS A 306 ? 1.1518 1.1126 0.9184 0.0768  0.0552  0.0055  306 LYS A C   
2366 O O   . LYS A 306 ? 1.0208 1.0169 0.7894 0.0985  0.0565  0.0169  306 LYS A O   
2367 C CB  . LYS A 306 ? 1.1729 1.0287 0.8865 0.0573  0.0887  0.0204  306 LYS A CB  
2368 C CG  . LYS A 306 ? 1.2221 1.0227 0.9037 0.0721  0.0953  0.0206  306 LYS A CG  
2369 C CD  . LYS A 306 ? 1.3699 1.0917 1.0099 0.0751  0.1215  0.0345  306 LYS A CD  
2370 C CE  . LYS A 306 ? 1.5492 1.2088 1.1569 0.0843  0.1287  0.0285  306 LYS A CE  
2371 N NZ  . LYS A 306 ? 1.6858 1.2578 1.2554 0.0809  0.1560  0.0370  306 LYS A NZ  
2372 N N   . ILE A 307 ? 1.1643 1.1231 0.9378 0.0771  0.0450  -0.0052 307 ILE A N   
2373 C CA  . ILE A 307 ? 1.0495 1.0378 0.8298 0.1049  0.0370  -0.0008 307 ILE A CA  
2374 C C   . ILE A 307 ? 1.0478 0.9909 0.7831 0.1338  0.0530  0.0174  307 ILE A C   
2375 O O   . ILE A 307 ? 1.0937 0.9722 0.7954 0.1307  0.0653  0.0180  307 ILE A O   
2376 C CB  . ILE A 307 ? 1.0286 1.0281 0.8288 0.0991  0.0234  -0.0140 307 ILE A CB  
2377 C CG1 . ILE A 307 ? 1.0100 1.0652 0.8610 0.0783  0.0083  -0.0277 307 ILE A CG1 
2378 C CG2 . ILE A 307 ? 0.9621 0.9790 0.7606 0.1302  0.0195  -0.0049 307 ILE A CG2 
2379 C CD1 . ILE A 307 ? 1.1077 1.1508 0.9650 0.0451  0.0091  -0.0386 307 ILE A CD1 
2380 N N   . ILE A 308 ? 0.9434 0.9216 0.6781 0.1619  0.0537  0.0319  308 ILE A N   
2381 C CA  . ILE A 308 ? 1.0809 1.0241 0.7737 0.1931  0.0712  0.0541  308 ILE A CA  
2382 C C   . ILE A 308 ? 1.0670 1.0350 0.7602 0.2219  0.0645  0.0608  308 ILE A C   
2383 O O   . ILE A 308 ? 1.0771 1.0144 0.7350 0.2507  0.0783  0.0789  308 ILE A O   
2384 C CB  . ILE A 308 ? 1.1241 1.0902 0.8091 0.2058  0.0819  0.0718  308 ILE A CB  
2385 C CG1 . ILE A 308 ? 0.9846 1.0376 0.7050 0.2137  0.0654  0.0681  308 ILE A CG1 
2386 C CG2 . ILE A 308 ? 1.0528 0.9936 0.7374 0.1779  0.0901  0.0680  308 ILE A CG2 
2387 C CD1 . ILE A 308 ? 1.0113 1.1002 0.7279 0.2232  0.0729  0.0809  308 ILE A CD1 
2388 N N   . SER A 309 ? 0.9940 1.0175 0.7289 0.2145  0.0445  0.0474  309 SER A N   
2389 C CA  . SER A 309 ? 0.9604 1.0150 0.7033 0.2387  0.0367  0.0539  309 SER A CA  
2390 C C   . SER A 309 ? 0.8454 0.9166 0.6220 0.2231  0.0208  0.0372  309 SER A C   
2391 O O   . SER A 309 ? 0.9212 0.9967 0.7226 0.1942  0.0135  0.0205  309 SER A O   
2392 C CB  . SER A 309 ? 0.8525 0.9783 0.6183 0.2528  0.0297  0.0608  309 SER A CB  
2393 O OG  . SER A 309 ? 0.9097 1.0746 0.6924 0.2712  0.0201  0.0654  309 SER A OG  
2394 N N   . GLY A 310 ? 0.7974 0.8813 0.5756 0.2439  0.0165  0.0441  310 GLY A N   
2395 C CA  . GLY A 310 ? 0.8944 1.0083 0.7112 0.2337  0.0015  0.0330  310 GLY A CA  
2396 C C   . GLY A 310 ? 0.9484 1.0183 0.7491 0.2235  0.0029  0.0239  310 GLY A C   
2397 O O   . GLY A 310 ? 0.7827 0.7912 0.5400 0.2220  0.0159  0.0231  310 GLY A O   
2398 N N   . PRO A 311 ? 0.9555 1.0586 0.7925 0.2163  -0.0097 0.0167  311 PRO A N   
2399 C CA  . PRO A 311 ? 0.9125 0.9909 0.7409 0.2061  -0.0111 0.0068  311 PRO A CA  
2400 C C   . PRO A 311 ? 0.9942 1.0216 0.7948 0.1811  -0.0033 -0.0065 311 PRO A C   
2401 O O   . PRO A 311 ? 1.0348 1.0074 0.7925 0.1831  0.0063  -0.0104 311 PRO A O   
2402 C CB  . PRO A 311 ? 0.7614 0.8970 0.6484 0.1909  -0.0255 0.0000  311 PRO A CB  
2403 C CG  . PRO A 311 ? 0.7717 0.9567 0.6917 0.2067  -0.0309 0.0109  311 PRO A CG  
2404 C CD  . PRO A 311 ? 0.8460 1.0166 0.7395 0.2146  -0.0228 0.0166  311 PRO A CD  
2405 N N   . PHE A 312 ? 0.9403 0.9860 0.7660 0.1574  -0.0065 -0.0138 312 PHE A N   
2406 C CA  . PHE A 312 ? 0.9307 0.9403 0.7410 0.1289  -0.0010 -0.0261 312 PHE A CA  
2407 C C   . PHE A 312 ? 0.8579 0.8181 0.6288 0.1315  0.0150  -0.0192 312 PHE A C   
2408 O O   . PHE A 312 ? 0.8954 0.8333 0.6607 0.1068  0.0202  -0.0264 312 PHE A O   
2409 C CB  . PHE A 312 ? 0.9111 0.9667 0.7686 0.1028  -0.0112 -0.0358 312 PHE A CB  
2410 C CG  . PHE A 312 ? 0.9048 0.9949 0.7946 0.0937  -0.0226 -0.0434 312 PHE A CG  
2411 C CD1 . PHE A 312 ? 0.8630 1.0063 0.7959 0.1064  -0.0321 -0.0375 312 PHE A CD1 
2412 C CD2 . PHE A 312 ? 0.9264 0.9980 0.8043 0.0726  -0.0230 -0.0556 312 PHE A CD2 
2413 C CE1 . PHE A 312 ? 0.8738 1.0505 0.8379 0.1008  -0.0402 -0.0404 312 PHE A CE1 
2414 C CE2 . PHE A 312 ? 0.9019 1.0127 0.8091 0.0667  -0.0327 -0.0601 312 PHE A CE2 
2415 C CZ  . PHE A 312 ? 0.8964 1.0594 0.8470 0.0823  -0.0406 -0.0508 312 PHE A CZ  
2416 N N   . GLU A 313 ? 0.9454 0.8903 0.6895 0.1625  0.0241  -0.0028 313 GLU A N   
2417 C CA  . GLU A 313 ? 1.0967 0.9917 0.8004 0.1710  0.0429  0.0087  313 GLU A CA  
2418 C C   . GLU A 313 ? 1.2266 1.0531 0.8998 0.1477  0.0546  -0.0028 313 GLU A C   
2419 O O   . GLU A 313 ? 1.3770 1.1822 1.0423 0.1372  0.0512  -0.0174 313 GLU A O   
2420 C CB  . GLU A 313 ? 1.0355 0.9141 0.7075 0.2106  0.0533  0.0282  313 GLU A CB  
2421 C CG  . GLU A 313 ? 1.1830 1.0026 0.8102 0.2230  0.0766  0.0432  313 GLU A CG  
2422 C CD  . GLU A 313 ? 1.3492 1.1566 0.9452 0.2656  0.0888  0.0658  313 GLU A CD  
2423 O OE1 . GLU A 313 ? 1.3010 1.1482 0.9103 0.2845  0.0779  0.0694  313 GLU A OE1 
2424 O OE2 . GLU A 313 ? 1.4777 1.2367 1.0368 0.2811  0.1107  0.0822  313 GLU A OE2 
2425 N N   . ASP A 314 ? 1.0982 0.8935 0.7554 0.1393  0.0687  0.0038  314 ASP A N   
2426 C CA  . ASP A 314 ? 1.2517 0.9763 0.8794 0.1167  0.0833  -0.0049 314 ASP A CA  
2427 C C   . ASP A 314 ? 1.1724 0.9110 0.8258 0.0746  0.0718  -0.0271 314 ASP A C   
2428 O O   . ASP A 314 ? 1.1824 0.8691 0.8164 0.0500  0.0812  -0.0384 314 ASP A O   
2429 C CB  . ASP A 314 ? 1.5128 1.1725 1.0975 0.1325  0.0956  -0.0073 314 ASP A CB  
2430 C CG  . ASP A 314 ? 1.7258 1.3516 1.2755 0.1718  0.1156  0.0182  314 ASP A CG  
2431 O OD1 . ASP A 314 ? 1.7710 1.3696 1.2937 0.1976  0.1215  0.0214  314 ASP A OD1 
2432 O OD2 . ASP A 314 ? 1.8018 1.4317 1.3507 0.1787  0.1262  0.0366  314 ASP A OD2 
2433 N N   . PHE A 315 ? 1.0631 0.8725 0.7613 0.0660  0.0525  -0.0330 315 PHE A N   
2434 C CA  . PHE A 315 ? 1.1056 0.9379 0.8312 0.0291  0.0422  -0.0503 315 PHE A CA  
2435 C C   . PHE A 315 ? 1.1237 0.9812 0.8713 0.0120  0.0433  -0.0458 315 PHE A C   
2436 O O   . PHE A 315 ? 1.0701 0.9595 0.8298 0.0296  0.0433  -0.0330 315 PHE A O   
2437 C CB  . PHE A 315 ? 1.0316 0.9240 0.7944 0.0292  0.0227  -0.0590 315 PHE A CB  
2438 C CG  . PHE A 315 ? 1.0264 0.8999 0.7741 0.0235  0.0192  -0.0730 315 PHE A CG  
2439 C CD1 . PHE A 315 ? 0.8956 0.7525 0.6209 0.0524  0.0209  -0.0686 315 PHE A CD1 
2440 C CD2 . PHE A 315 ? 1.1178 0.9952 0.8731 -0.0100 0.0141  -0.0905 315 PHE A CD2 
2441 C CE1 . PHE A 315 ? 0.9045 0.7473 0.6140 0.0487  0.0179  -0.0826 315 PHE A CE1 
2442 C CE2 . PHE A 315 ? 1.0888 0.9557 0.8291 -0.0152 0.0102  -0.1054 315 PHE A CE2 
2443 C CZ  . PHE A 315 ? 1.0067 0.8554 0.7233 0.0146  0.0122  -0.1020 315 PHE A CZ  
2444 N N   . ALA A 316 ? 1.2129 1.0594 0.9652 -0.0226 0.0443  -0.0570 316 ALA A N   
2445 C CA  . ALA A 316 ? 1.2346 1.1124 1.0117 -0.0410 0.0440  -0.0537 316 ALA A CA  
2446 C C   . ALA A 316 ? 1.1263 1.0780 0.9509 -0.0456 0.0255  -0.0609 316 ALA A C   
2447 O O   . ALA A 316 ? 1.1366 1.1091 0.9742 -0.0414 0.0143  -0.0690 316 ALA A O   
2448 C CB  . ALA A 316 ? 1.3209 1.1630 1.0877 -0.0771 0.0521  -0.0618 316 ALA A CB  
2449 N N   . GLY A 317 ? 1.0598 1.0512 0.9107 -0.0528 0.0238  -0.0571 317 GLY A N   
2450 C CA  . GLY A 317 ? 1.0345 1.0916 0.9317 -0.0564 0.0095  -0.0636 317 GLY A CA  
2451 C C   . GLY A 317 ? 1.0227 1.1150 0.9437 -0.0691 0.0105  -0.0617 317 GLY A C   
2452 O O   . GLY A 317 ? 1.1087 1.1805 1.0111 -0.0716 0.0219  -0.0529 317 GLY A O   
2453 N N   . VAL A 318 ? 0.9630 1.1091 0.9258 -0.0755 0.0000  -0.0685 318 VAL A N   
2454 C CA  . VAL A 318 ? 0.8716 1.0569 0.8603 -0.0846 0.0007  -0.0680 318 VAL A CA  
2455 C C   . VAL A 318 ? 0.8616 1.0960 0.8864 -0.0663 -0.0070 -0.0719 318 VAL A C   
2456 O O   . VAL A 318 ? 0.7679 1.0257 0.8200 -0.0629 -0.0155 -0.0771 318 VAL A O   
2457 C CB  . VAL A 318 ? 0.8883 1.0939 0.8968 -0.1142 -0.0019 -0.0731 318 VAL A CB  
2458 C CG1 . VAL A 318 ? 0.8874 1.1362 0.9232 -0.1199 -0.0002 -0.0714 318 VAL A CG1 
2459 C CG2 . VAL A 318 ? 0.9998 1.1578 0.9755 -0.1373 0.0057  -0.0725 318 VAL A CG2 
2460 N N   . ILE A 319 ? 0.7918 1.0427 0.8173 -0.0547 -0.0032 -0.0694 319 ILE A N   
2461 C CA  . ILE A 319 ? 0.6279 0.9244 0.6878 -0.0405 -0.0094 -0.0771 319 ILE A CA  
2462 C C   . ILE A 319 ? 0.6023 0.9358 0.7040 -0.0550 -0.0134 -0.0846 319 ILE A C   
2463 O O   . ILE A 319 ? 0.6471 0.9858 0.7504 -0.0736 -0.0093 -0.0826 319 ILE A O   
2464 C CB  . ILE A 319 ? 0.5457 0.8599 0.5975 -0.0282 -0.0045 -0.0760 319 ILE A CB  
2465 C CG1 . ILE A 319 ? 0.5917 0.8764 0.6042 -0.0090 0.0005  -0.0653 319 ILE A CG1 
2466 C CG2 . ILE A 319 ? 0.4145 0.7766 0.5047 -0.0180 -0.0111 -0.0895 319 ILE A CG2 
2467 C CD1 . ILE A 319 ? 0.7329 1.0472 0.7398 0.0079  0.0035  -0.0642 319 ILE A CD1 
2468 N N   . LYS A 320 ? 0.4147 0.7749 0.5518 -0.0456 -0.0199 -0.0913 320 LYS A N   
2469 C CA  . LYS A 320 ? 0.5377 0.9311 0.7166 -0.0555 -0.0217 -0.0952 320 LYS A CA  
2470 C C   . LYS A 320 ? 0.4289 0.8570 0.6455 -0.0434 -0.0222 -0.1056 320 LYS A C   
2471 O O   . LYS A 320 ? 0.5277 0.9841 0.7731 -0.0493 -0.0188 -0.1103 320 LYS A O   
2472 C CB  . LYS A 320 ? 0.5528 0.9424 0.7418 -0.0569 -0.0270 -0.0913 320 LYS A CB  
2473 C CG  . LYS A 320 ? 0.6478 1.0613 0.8592 -0.0741 -0.0268 -0.0884 320 LYS A CG  
2474 C CD  . LYS A 320 ? 0.8290 1.2256 1.0104 -0.0967 -0.0234 -0.0854 320 LYS A CD  
2475 C CE  . LYS A 320 ? 0.9072 1.3386 1.1136 -0.1144 -0.0240 -0.0823 320 LYS A CE  
2476 N NZ  . LYS A 320 ? 0.9366 1.3526 1.1151 -0.1403 -0.0223 -0.0805 320 LYS A NZ  
2477 N N   . GLU A 321 ? 0.3556 0.7814 0.5720 -0.0267 -0.0258 -0.1097 321 GLU A N   
2478 C CA  . GLU A 321 ? 0.4774 0.9329 0.7295 -0.0167 -0.0268 -0.1228 321 GLU A CA  
2479 C C   . GLU A 321 ? 0.6086 1.0609 0.8345 -0.0031 -0.0287 -0.1265 321 GLU A C   
2480 O O   . GLU A 321 ? 0.6008 1.0277 0.7941 0.0043  -0.0305 -0.1163 321 GLU A O   
2481 C CB  . GLU A 321 ? 0.6318 1.0961 0.9223 -0.0109 -0.0303 -0.1221 321 GLU A CB  
2482 C CG  . GLU A 321 ? 0.7138 1.2081 1.0579 -0.0113 -0.0264 -0.1324 321 GLU A CG  
2483 C CD  . GLU A 321 ? 0.6559 1.1576 1.0352 -0.0118 -0.0253 -0.1219 321 GLU A CD  
2484 O OE1 . GLU A 321 ? 0.6050 1.1180 1.0235 -0.0031 -0.0247 -0.1243 321 GLU A OE1 
2485 O OE2 . GLU A 321 ? 0.7150 1.2141 1.0836 -0.0212 -0.0245 -0.1106 321 GLU A OE2 
2486 N N   . ILE A 322 ? 0.6198 1.1003 0.8586 0.0010  -0.0276 -0.1411 322 ILE A N   
2487 C CA  . ILE A 322 ? 0.6028 1.0934 0.8192 0.0143  -0.0296 -0.1456 322 ILE A CA  
2488 C C   . ILE A 322 ? 0.6650 1.1891 0.9201 0.0199  -0.0338 -0.1660 322 ILE A C   
2489 O O   . ILE A 322 ? 0.6435 1.1863 0.9350 0.0131  -0.0311 -0.1810 322 ILE A O   
2490 C CB  . ILE A 322 ? 0.6412 1.1404 0.8280 0.0137  -0.0238 -0.1451 322 ILE A CB  
2491 C CG1 . ILE A 322 ? 0.6004 1.0617 0.7443 0.0096  -0.0185 -0.1237 322 ILE A CG1 
2492 C CG2 . ILE A 322 ? 0.6987 1.2259 0.8727 0.0287  -0.0260 -0.1536 322 ILE A CG2 
2493 C CD1 . ILE A 322 ? 0.6261 1.0945 0.7493 0.0048  -0.0104 -0.1193 322 ILE A CD1 
2494 N N   . ASP A 323 ? 0.8405 1.3722 1.0887 0.0320  -0.0393 -0.1667 323 ASP A N   
2495 C CA  . ASP A 323 ? 0.9534 1.5175 1.2399 0.0345  -0.0438 -0.1872 323 ASP A CA  
2496 C C   . ASP A 323 ? 0.9591 1.5524 1.2236 0.0462  -0.0481 -0.1941 323 ASP A C   
2497 O O   . ASP A 323 ? 0.9234 1.5219 1.1857 0.0557  -0.0536 -0.1883 323 ASP A O   
2498 C CB  . ASP A 323 ? 0.9849 1.5396 1.3043 0.0356  -0.0473 -0.1815 323 ASP A CB  
2499 C CG  . ASP A 323 ? 1.0654 1.6508 1.4286 0.0355  -0.0508 -0.2023 323 ASP A CG  
2500 O OD1 . ASP A 323 ? 1.1306 1.7442 1.5015 0.0323  -0.0505 -0.2253 323 ASP A OD1 
2501 O OD2 . ASP A 323 ? 1.0420 1.6245 1.4327 0.0379  -0.0534 -0.1961 323 ASP A OD2 
2502 N N   . PRO A 324 ? 0.9350 1.5534 1.1840 0.0466  -0.0455 -0.2058 324 PRO A N   
2503 C CA  . PRO A 324 ? 1.0656 1.7217 1.2923 0.0589  -0.0493 -0.2119 324 PRO A CA  
2504 C C   . PRO A 324 ? 1.2149 1.9051 1.4816 0.0569  -0.0570 -0.2356 324 PRO A C   
2505 O O   . PRO A 324 ? 1.3168 1.9939 1.6269 0.0470  -0.0574 -0.2435 324 PRO A O   
2506 C CB  . PRO A 324 ? 0.9468 1.6271 1.1598 0.0572  -0.0441 -0.2232 324 PRO A CB  
2507 C CG  . PRO A 324 ? 0.8702 1.5380 1.1190 0.0421  -0.0399 -0.2361 324 PRO A CG  
2508 C CD  . PRO A 324 ? 0.9244 1.5470 1.1831 0.0364  -0.0390 -0.2165 324 PRO A CD  
2509 N N   . GLU A 325 ? 1.2143 1.9498 1.4688 0.0657  -0.0622 -0.2458 325 GLU A N   
2510 C CA  . GLU A 325 ? 1.2665 2.0370 1.5585 0.0616  -0.0702 -0.2683 325 GLU A CA  
2511 C C   . GLU A 325 ? 1.2342 1.9741 1.5482 0.0612  -0.0725 -0.2517 325 GLU A C   
2512 O O   . GLU A 325 ? 1.2464 1.9956 1.6077 0.0519  -0.0757 -0.2673 325 GLU A O   
2513 C CB  . GLU A 325 ? 1.3454 2.1339 1.6816 0.0455  -0.0688 -0.3055 325 GLU A CB  
2514 C CG  . GLU A 325 ? 1.4409 2.2638 1.7565 0.0467  -0.0663 -0.3246 325 GLU A CG  
2515 C CD  . GLU A 325 ? 1.5262 2.3198 1.8449 0.0399  -0.0565 -0.3247 325 GLU A CD  
2516 O OE1 . GLU A 325 ? 1.5676 2.3188 1.9105 0.0325  -0.0521 -0.3140 325 GLU A OE1 
2517 O OE2 . GLU A 325 ? 1.5392 2.3571 1.8366 0.0430  -0.0529 -0.3342 325 GLU A OE2 
2518 N N   . ARG A 326 ? 1.2121 1.9142 1.4914 0.0715  -0.0696 -0.2197 326 ARG A N   
2519 C CA  . ARG A 326 ? 1.0997 1.7755 1.3871 0.0764  -0.0716 -0.1995 326 ARG A CA  
2520 C C   . ARG A 326 ? 1.0314 1.6724 1.2639 0.0906  -0.0671 -0.1689 326 ARG A C   
2521 O O   . ARG A 326 ? 0.9421 1.5617 1.1644 0.1004  -0.0680 -0.1488 326 ARG A O   
2522 C CB  . ARG A 326 ? 1.0355 1.6820 1.3656 0.0632  -0.0685 -0.2017 326 ARG A CB  
2523 C CG  . ARG A 326 ? 0.9615 1.5916 1.3084 0.0687  -0.0710 -0.1835 326 ARG A CG  
2524 C CD  . ARG A 326 ? 0.9458 1.5648 1.3476 0.0564  -0.0675 -0.1897 326 ARG A CD  
2525 N NE  . ARG A 326 ? 1.0441 1.6808 1.4782 0.0428  -0.0642 -0.2184 326 ARG A NE  
2526 C CZ  . ARG A 326 ? 1.1175 1.7894 1.5810 0.0369  -0.0674 -0.2440 326 ARG A CZ  
2527 N NH1 . ARG A 326 ? 1.1562 1.8538 1.6227 0.0426  -0.0748 -0.2427 326 ARG A NH1 
2528 N NH2 . ARG A 326 ? 1.0639 1.7468 1.5537 0.0251  -0.0628 -0.2720 326 ARG A NH2 
2529 N N   . GLN A 327 ? 1.0037 1.6388 1.2019 0.0916  -0.0612 -0.1660 327 GLN A N   
2530 C CA  . GLN A 327 ? 0.9692 1.5684 1.1151 0.1033  -0.0540 -0.1387 327 GLN A CA  
2531 C C   . GLN A 327 ? 0.9313 1.4770 1.0742 0.1003  -0.0517 -0.1218 327 GLN A C   
2532 O O   . GLN A 327 ? 0.9735 1.4920 1.0832 0.1142  -0.0488 -0.1005 327 GLN A O   
2533 C CB  . GLN A 327 ? 0.9797 1.6032 1.0919 0.1256  -0.0542 -0.1245 327 GLN A CB  
2534 C CG  . GLN A 327 ? 1.0331 1.7168 1.1410 0.1305  -0.0561 -0.1392 327 GLN A CG  
2535 C CD  . GLN A 327 ? 1.0778 1.7569 1.1617 0.1277  -0.0475 -0.1382 327 GLN A CD  
2536 O OE1 . GLN A 327 ? 1.0468 1.7172 1.0875 0.1428  -0.0386 -0.1154 327 GLN A OE1 
2537 N NE2 . GLN A 327 ? 1.0791 1.7643 1.1923 0.1094  -0.0485 -0.1613 327 GLN A NE2 
2538 N N   . GLU A 328 ? 0.8448 1.3781 1.0223 0.0833  -0.0522 -0.1318 328 GLU A N   
2539 C CA  . GLU A 328 ? 0.7785 1.2714 0.9578 0.0789  -0.0509 -0.1188 328 GLU A CA  
2540 C C   . GLU A 328 ? 0.6992 1.1634 0.8651 0.0648  -0.0445 -0.1158 328 GLU A C   
2541 O O   . GLU A 328 ? 0.8051 1.2852 0.9775 0.0557  -0.0417 -0.1271 328 GLU A O   
2542 C CB  . GLU A 328 ? 0.7948 1.3019 1.0287 0.0724  -0.0559 -0.1279 328 GLU A CB  
2543 C CG  . GLU A 328 ? 0.8733 1.3651 1.1081 0.0827  -0.0587 -0.1115 328 GLU A CG  
2544 C CD  . GLU A 328 ? 1.0372 1.5533 1.2669 0.0991  -0.0635 -0.1076 328 GLU A CD  
2545 O OE1 . GLU A 328 ? 1.0502 1.5866 1.2570 0.1058  -0.0635 -0.1115 328 GLU A OE1 
2546 O OE2 . GLU A 328 ? 1.1284 1.6482 1.3778 0.1062  -0.0669 -0.0991 328 GLU A OE2 
2547 N N   . LEU A 329 ? 0.6566 1.0814 0.8038 0.0627  -0.0422 -0.1014 329 LEU A N   
2548 C CA  . LEU A 329 ? 0.6970 1.0965 0.8344 0.0464  -0.0371 -0.0985 329 LEU A CA  
2549 C C   . LEU A 329 ? 0.7055 1.0882 0.8582 0.0394  -0.0395 -0.0935 329 LEU A C   
2550 O O   . LEU A 329 ? 0.6725 1.0406 0.8155 0.0504  -0.0420 -0.0846 329 LEU A O   
2551 C CB  . LEU A 329 ? 0.8248 1.1882 0.9087 0.0492  -0.0293 -0.0848 329 LEU A CB  
2552 C CG  . LEU A 329 ? 0.8753 1.2512 0.9339 0.0581  -0.0237 -0.0824 329 LEU A CG  
2553 C CD1 . LEU A 329 ? 0.8524 1.1823 0.8595 0.0650  -0.0136 -0.0632 329 LEU A CD1 
2554 C CD2 . LEU A 329 ? 0.9309 1.3309 1.0062 0.0439  -0.0215 -0.0933 329 LEU A CD2 
2555 N N   . LYS A 330 ? 0.6908 1.0798 0.8666 0.0226  -0.0382 -0.0982 330 LYS A N   
2556 C CA  . LYS A 330 ? 0.6213 0.9976 0.8037 0.0147  -0.0394 -0.0917 330 LYS A CA  
2557 C C   . LYS A 330 ? 0.6774 1.0231 0.8225 0.0002  -0.0346 -0.0870 330 LYS A C   
2558 O O   . LYS A 330 ? 0.7157 1.0708 0.8660 -0.0139 -0.0310 -0.0907 330 LYS A O   
2559 C CB  . LYS A 330 ? 0.5503 0.9588 0.7853 0.0066  -0.0401 -0.0970 330 LYS A CB  
2560 C CG  . LYS A 330 ? 0.6400 1.0468 0.8854 0.0034  -0.0420 -0.0878 330 LYS A CG  
2561 C CD  . LYS A 330 ? 0.7215 1.1629 1.0200 -0.0018 -0.0400 -0.0885 330 LYS A CD  
2562 C CE  . LYS A 330 ? 0.7407 1.2039 1.0844 0.0115  -0.0403 -0.0909 330 LYS A CE  
2563 N NZ  . LYS A 330 ? 0.8237 1.3160 1.2205 0.0083  -0.0348 -0.0892 330 LYS A NZ  
2564 N N   . VAL A 331 ? 0.6634 0.9721 0.7713 0.0034  -0.0337 -0.0792 331 VAL A N   
2565 C CA  . VAL A 331 ? 0.6261 0.9004 0.6994 -0.0132 -0.0281 -0.0765 331 VAL A CA  
2566 C C   . VAL A 331 ? 0.7527 1.0149 0.8225 -0.0236 -0.0310 -0.0764 331 VAL A C   
2567 O O   . VAL A 331 ? 0.7792 1.0406 0.8510 -0.0107 -0.0354 -0.0739 331 VAL A O   
2568 C CB  . VAL A 331 ? 0.7024 0.9357 0.7271 -0.0039 -0.0200 -0.0692 331 VAL A CB  
2569 C CG1 . VAL A 331 ? 0.7645 1.0149 0.7907 0.0206  -0.0213 -0.0664 331 VAL A CG1 
2570 C CG2 . VAL A 331 ? 0.6211 0.8050 0.6077 -0.0041 -0.0166 -0.0648 331 VAL A CG2 
2571 N N   . ASN A 332 ? 0.7583 1.0172 0.8245 -0.0474 -0.0288 -0.0792 332 ASN A N   
2572 C CA  . ASN A 332 ? 0.6514 0.9047 0.7120 -0.0614 -0.0319 -0.0817 332 ASN A CA  
2573 C C   . ASN A 332 ? 0.7485 0.9440 0.7576 -0.0648 -0.0265 -0.0826 332 ASN A C   
2574 O O   . ASN A 332 ? 0.7945 0.9569 0.7767 -0.0742 -0.0180 -0.0814 332 ASN A O   
2575 C CB  . ASN A 332 ? 0.6522 0.9345 0.7341 -0.0870 -0.0320 -0.0846 332 ASN A CB  
2576 C CG  . ASN A 332 ? 0.7257 1.0645 0.8600 -0.0824 -0.0366 -0.0829 332 ASN A CG  
2577 O OD1 . ASN A 332 ? 0.7853 1.1393 0.9416 -0.0622 -0.0398 -0.0803 332 ASN A OD1 
2578 N ND2 . ASN A 332 ? 0.7500 1.1206 0.9062 -0.1007 -0.0356 -0.0829 332 ASN A ND2 
2579 N N   . VAL A 333 ? 0.7586 0.9413 0.7546 -0.0557 -0.0300 -0.0840 333 VAL A N   
2580 C CA  . VAL A 333 ? 0.8238 0.9484 0.7706 -0.0575 -0.0238 -0.0875 333 VAL A CA  
2581 C C   . VAL A 333 ? 0.8594 0.9891 0.8024 -0.0754 -0.0289 -0.0982 333 VAL A C   
2582 O O   . VAL A 333 ? 0.7342 0.9141 0.7103 -0.0741 -0.0379 -0.0982 333 VAL A O   
2583 C CB  . VAL A 333 ? 0.8025 0.9037 0.7283 -0.0259 -0.0220 -0.0804 333 VAL A CB  
2584 C CG1 . VAL A 333 ? 0.6656 0.8078 0.6200 -0.0105 -0.0321 -0.0786 333 VAL A CG1 
2585 C CG2 . VAL A 333 ? 0.8728 0.9079 0.7458 -0.0259 -0.0126 -0.0839 333 VAL A CG2 
2586 N N   . THR A 334 ? 0.8369 0.9162 0.7402 -0.0921 -0.0223 -0.1074 334 THR A N   
2587 C CA  . THR A 334 ? 0.8886 0.9711 0.7823 -0.1096 -0.0272 -0.1215 334 THR A CA  
2588 C C   . THR A 334 ? 0.9813 1.0234 0.8382 -0.0896 -0.0248 -0.1258 334 THR A C   
2589 O O   . THR A 334 ? 1.0662 1.0436 0.8831 -0.0835 -0.0132 -0.1264 334 THR A O   
2590 C CB  . THR A 334 ? 0.9373 0.9948 0.8144 -0.1470 -0.0219 -0.1335 334 THR A CB  
2591 O OG1 . THR A 334 ? 0.9899 1.0914 0.9026 -0.1632 -0.0241 -0.1274 334 THR A OG1 
2592 C CG2 . THR A 334 ? 0.9639 1.0338 0.8322 -0.1671 -0.0286 -0.1514 334 THR A CG2 
2593 N N   . ILE A 335 ? 0.8749 0.9573 0.7469 -0.0766 -0.0345 -0.1265 335 ILE A N   
2594 C CA  . ILE A 335 ? 0.9251 0.9796 0.7632 -0.0604 -0.0337 -0.1332 335 ILE A CA  
2595 C C   . ILE A 335 ? 0.8976 0.9977 0.7464 -0.0765 -0.0437 -0.1460 335 ILE A C   
2596 O O   . ILE A 335 ? 0.9162 1.0828 0.8090 -0.0829 -0.0521 -0.1397 335 ILE A O   
2597 C CB  . ILE A 335 ? 0.9096 0.9804 0.7585 -0.0209 -0.0360 -0.1167 335 ILE A CB  
2598 C CG1 . ILE A 335 ? 1.0497 1.1443 0.9330 -0.0102 -0.0360 -0.1003 335 ILE A CG1 
2599 C CG2 . ILE A 335 ? 0.8672 0.8758 0.6664 0.0011  -0.0266 -0.1176 335 ILE A CG2 
2600 C CD1 . ILE A 335 ? 1.0824 1.2463 1.0207 -0.0194 -0.0452 -0.0961 335 ILE A CD1 
2601 N N   . PHE A 336 ? 0.9472 1.0141 0.7560 -0.0821 -0.0418 -0.1640 336 PHE A N   
2602 C CA  . PHE A 336 ? 0.8881 1.0033 0.7025 -0.0966 -0.0517 -0.1783 336 PHE A CA  
2603 C C   . PHE A 336 ? 0.9240 1.0853 0.7694 -0.1312 -0.0571 -0.1821 336 PHE A C   
2604 O O   . PHE A 336 ? 0.8747 1.1091 0.7501 -0.1355 -0.0671 -0.1806 336 PHE A O   
2605 C CB  . PHE A 336 ? 0.6156 0.7954 0.4601 -0.0663 -0.0606 -0.1629 336 PHE A CB  
2606 C CG  . PHE A 336 ? 0.8574 1.0079 0.6878 -0.0274 -0.0559 -0.1493 336 PHE A CG  
2607 C CD1 . PHE A 336 ? 0.8064 0.9087 0.5881 -0.0139 -0.0507 -0.1609 336 PHE A CD1 
2608 C CD2 . PHE A 336 ? 0.7949 0.9676 0.6611 -0.0046 -0.0563 -0.1258 336 PHE A CD2 
2609 C CE1 . PHE A 336 ? 0.8716 0.9518 0.6406 0.0232  -0.0459 -0.1461 336 PHE A CE1 
2610 C CE2 . PHE A 336 ? 0.7579 0.9102 0.6129 0.0296  -0.0525 -0.1127 336 PHE A CE2 
2611 C CZ  . PHE A 336 ? 0.8832 0.9910 0.6898 0.0444  -0.0474 -0.1212 336 PHE A CZ  
2612 N N   . GLY A 337 ? 0.8482 0.9713 0.6882 -0.1535 -0.0495 -0.1840 337 GLY A N   
2613 C CA  . GLY A 337 ? 0.7731 0.9377 0.6409 -0.1867 -0.0533 -0.1863 337 GLY A CA  
2614 C C   . GLY A 337 ? 0.8627 1.1039 0.7856 -0.1732 -0.0604 -0.1654 337 GLY A C   
2615 O O   . GLY A 337 ? 0.9033 1.2002 0.8560 -0.1941 -0.0654 -0.1644 337 GLY A O   
2616 N N   . ARG A 338 ? 0.8280 1.0719 0.7655 -0.1380 -0.0599 -0.1485 338 ARG A N   
2617 C CA  . ARG A 338 ? 0.8092 1.1158 0.8001 -0.1234 -0.0640 -0.1294 338 ARG A CA  
2618 C C   . ARG A 338 ? 0.8798 1.1650 0.8839 -0.1156 -0.0576 -0.1182 338 ARG A C   
2619 O O   . ARG A 338 ? 0.7342 0.9697 0.7147 -0.0984 -0.0520 -0.1155 338 ARG A O   
2620 C CB  . ARG A 338 ? 0.6593 0.9992 0.6668 -0.0912 -0.0687 -0.1183 338 ARG A CB  
2621 C CG  . ARG A 338 ? 0.7545 1.1330 0.7546 -0.0963 -0.0757 -0.1272 338 ARG A CG  
2622 C CD  . ARG A 338 ? 0.7188 1.1357 0.7390 -0.0625 -0.0791 -0.1122 338 ARG A CD  
2623 N NE  . ARG A 338 ? 0.7677 1.2481 0.8478 -0.0511 -0.0800 -0.0906 338 ARG A NE  
2624 C CZ  . ARG A 338 ? 0.8649 1.3869 0.9761 -0.0227 -0.0811 -0.0723 338 ARG A CZ  
2625 N NH1 . ARG A 338 ? 0.7959 1.3690 0.9633 -0.0142 -0.0790 -0.0530 338 ARG A NH1 
2626 N NH2 . ARG A 338 ? 0.9606 1.4723 1.0476 -0.0021 -0.0828 -0.0725 338 ARG A NH2 
2627 N N   . GLU A 339 ? 0.9472 1.2742 0.9886 -0.1275 -0.0581 -0.1117 339 GLU A N   
2628 C CA  . GLU A 339 ? 0.9325 1.2542 0.9930 -0.1190 -0.0531 -0.1022 339 GLU A CA  
2629 C C   . GLU A 339 ? 0.7815 1.1211 0.8684 -0.0863 -0.0548 -0.0905 339 GLU A C   
2630 O O   . GLU A 339 ? 0.7482 1.1387 0.8716 -0.0771 -0.0589 -0.0828 339 GLU A O   
2631 C CB  . GLU A 339 ? 1.0603 1.4308 1.1573 -0.1372 -0.0531 -0.0983 339 GLU A CB  
2632 C CG  . GLU A 339 ? 1.1550 1.5241 1.2709 -0.1310 -0.0476 -0.0917 339 GLU A CG  
2633 C CD  . GLU A 339 ? 1.2873 1.6047 1.3673 -0.1445 -0.0406 -0.0964 339 GLU A CD  
2634 O OE1 . GLU A 339 ? 1.3534 1.6210 1.3915 -0.1511 -0.0383 -0.1037 339 GLU A OE1 
2635 O OE2 . GLU A 339 ? 1.3190 1.6456 1.4131 -0.1476 -0.0360 -0.0923 339 GLU A OE2 
2636 N N   . THR A 340 ? 0.7010 1.0022 0.7717 -0.0688 -0.0508 -0.0879 340 THR A N   
2637 C CA  . THR A 340 ? 0.5681 0.8827 0.6591 -0.0393 -0.0529 -0.0783 340 THR A CA  
2638 C C   . THR A 340 ? 0.7555 1.0617 0.8567 -0.0272 -0.0493 -0.0745 340 THR A C   
2639 O O   . THR A 340 ? 0.7684 1.0321 0.8342 -0.0230 -0.0447 -0.0760 340 THR A O   
2640 C CB  . THR A 340 ? 0.6138 0.8959 0.6684 -0.0226 -0.0537 -0.0788 340 THR A CB  
2641 O OG1 . THR A 340 ? 0.6873 0.9802 0.7298 -0.0336 -0.0575 -0.0856 340 THR A OG1 
2642 C CG2 . THR A 340 ? 0.3523 0.6551 0.4320 0.0074  -0.0560 -0.0666 340 THR A CG2 
2643 N N   . PRO A 341 ? 0.7970 1.1457 0.9473 -0.0209 -0.0505 -0.0697 341 PRO A N   
2644 C CA  . PRO A 341 ? 0.7934 1.1414 0.9561 -0.0110 -0.0480 -0.0700 341 PRO A CA  
2645 C C   . PRO A 341 ? 0.8668 1.2028 1.0213 0.0133  -0.0496 -0.0650 341 PRO A C   
2646 O O   . PRO A 341 ? 0.9194 1.2756 1.0958 0.0265  -0.0529 -0.0581 341 PRO A O   
2647 C CB  . PRO A 341 ? 0.7818 1.1781 1.0023 -0.0118 -0.0478 -0.0683 341 PRO A CB  
2648 C CG  . PRO A 341 ? 0.8108 1.2309 1.0421 -0.0272 -0.0485 -0.0659 341 PRO A CG  
2649 C CD  . PRO A 341 ? 0.7788 1.1787 0.9750 -0.0253 -0.0523 -0.0649 341 PRO A CD  
2650 N N   . VAL A 342 ? 0.7448 1.0523 0.8688 0.0202  -0.0465 -0.0662 342 VAL A N   
2651 C CA  . VAL A 342 ? 0.7063 1.0097 0.8241 0.0438  -0.0478 -0.0602 342 VAL A CA  
2652 C C   . VAL A 342 ? 0.6248 0.9428 0.7545 0.0493  -0.0467 -0.0636 342 VAL A C   
2653 O O   . VAL A 342 ? 0.6767 0.9858 0.7913 0.0396  -0.0426 -0.0685 342 VAL A O   
2654 C CB  . VAL A 342 ? 0.7619 1.0179 0.8238 0.0541  -0.0441 -0.0555 342 VAL A CB  
2655 C CG1 . VAL A 342 ? 0.7540 0.9769 0.7843 0.0341  -0.0404 -0.0612 342 VAL A CG1 
2656 C CG2 . VAL A 342 ? 0.8026 1.0415 0.8386 0.0671  -0.0391 -0.0519 342 VAL A CG2 
2657 N N   . VAL A 343 ? 0.5740 0.9179 0.7315 0.0648  -0.0505 -0.0611 343 VAL A N   
2658 C CA  . VAL A 343 ? 0.5907 0.9564 0.7627 0.0705  -0.0511 -0.0670 343 VAL A CA  
2659 C C   . VAL A 343 ? 0.6377 0.9854 0.7679 0.0890  -0.0496 -0.0589 343 VAL A C   
2660 O O   . VAL A 343 ? 0.7469 1.0754 0.8549 0.1023  -0.0494 -0.0481 343 VAL A O   
2661 C CB  . VAL A 343 ? 0.5103 0.9154 0.7393 0.0749  -0.0553 -0.0695 343 VAL A CB  
2662 C CG1 . VAL A 343 ? 0.4350 0.8659 0.6794 0.0789  -0.0568 -0.0797 343 VAL A CG1 
2663 C CG2 . VAL A 343 ? 0.4527 0.8746 0.7234 0.0600  -0.0538 -0.0740 343 VAL A CG2 
2664 N N   . LEU A 344 ? 0.6654 1.0221 0.7838 0.0917  -0.0475 -0.0631 344 LEU A N   
2665 C CA  . LEU A 344 ? 0.8242 1.1691 0.9023 0.1113  -0.0442 -0.0524 344 LEU A CA  
2666 C C   . LEU A 344 ? 0.7804 1.1524 0.8560 0.1132  -0.0429 -0.0587 344 LEU A C   
2667 O O   . LEU A 344 ? 0.7827 1.1742 0.8815 0.0979  -0.0438 -0.0724 344 LEU A O   
2668 C CB  . LEU A 344 ? 0.9585 1.2482 0.9837 0.1139  -0.0357 -0.0415 344 LEU A CB  
2669 C CG  . LEU A 344 ? 0.9392 1.1983 0.9423 0.0950  -0.0283 -0.0449 344 LEU A CG  
2670 C CD1 . LEU A 344 ? 0.8416 1.0430 0.7996 0.0962  -0.0204 -0.0365 344 LEU A CD1 
2671 C CD2 . LEU A 344 ? 0.9453 1.2238 0.9869 0.0711  -0.0329 -0.0576 344 LEU A CD2 
2672 N N   . HIS A 345 ? 0.7233 1.1009 0.7707 0.1336  -0.0405 -0.0480 345 HIS A N   
2673 C CA  . HIS A 345 ? 0.8318 1.2455 0.8757 0.1385  -0.0398 -0.0529 345 HIS A CA  
2674 C C   . HIS A 345 ? 0.8024 1.1883 0.8046 0.1379  -0.0286 -0.0448 345 HIS A C   
2675 O O   . HIS A 345 ? 0.8217 1.1562 0.7876 0.1412  -0.0197 -0.0306 345 HIS A O   
2676 C CB  . HIS A 345 ? 1.0039 1.4491 1.0405 0.1618  -0.0425 -0.0436 345 HIS A CB  
2677 C CG  . HIS A 345 ? 1.1012 1.5765 1.1811 0.1621  -0.0526 -0.0496 345 HIS A CG  
2678 N ND1 . HIS A 345 ? 1.1335 1.5838 1.2185 0.1660  -0.0537 -0.0399 345 HIS A ND1 
2679 C CD2 . HIS A 345 ? 1.1404 1.6695 1.2623 0.1581  -0.0613 -0.0645 345 HIS A CD2 
2680 C CE1 . HIS A 345 ? 1.1406 1.6282 1.2699 0.1657  -0.0620 -0.0453 345 HIS A CE1 
2681 N NE2 . HIS A 345 ? 1.1751 1.7087 1.3283 0.1596  -0.0665 -0.0611 345 HIS A NE2 
2682 N N   . VAL A 346 ? 0.7140 1.1342 0.7224 0.1335  -0.0282 -0.0542 346 VAL A N   
2683 C CA  . VAL A 346 ? 0.7092 1.1111 0.6833 0.1330  -0.0168 -0.0450 346 VAL A CA  
2684 C C   . VAL A 346 ? 0.7428 1.1209 0.6694 0.1577  -0.0058 -0.0199 346 VAL A C   
2685 O O   . VAL A 346 ? 0.8178 1.1535 0.7100 0.1583  0.0076  -0.0052 346 VAL A O   
2686 C CB  . VAL A 346 ? 0.8580 1.3131 0.8469 0.1296  -0.0188 -0.0589 346 VAL A CB  
2687 C CG1 . VAL A 346 ? 0.9922 1.5054 0.9934 0.1451  -0.0267 -0.0656 346 VAL A CG1 
2688 C CG2 . VAL A 346 ? 0.9460 1.3882 0.8976 0.1342  -0.0055 -0.0438 346 VAL A CG2 
2689 N N   . SER A 347 ? 0.7914 1.1962 0.7179 0.1781  -0.0103 -0.0140 347 SER A N   
2690 C CA  . SER A 347 ? 0.9378 1.3250 0.8214 0.2060  0.0008  0.0119  347 SER A CA  
2691 C C   . SER A 347 ? 1.0047 1.3189 0.8611 0.2086  0.0094  0.0249  347 SER A C   
2692 O O   . SER A 347 ? 1.0079 1.2967 0.8280 0.2329  0.0206  0.0465  347 SER A O   
2693 C CB  . SER A 347 ? 1.0276 1.4704 0.9238 0.2256  -0.0079 0.0137  347 SER A CB  
2694 O OG  . SER A 347 ? 1.0697 1.5166 1.0014 0.2162  -0.0203 0.0013  347 SER A OG  
2695 N N   . GLU A 348 ? 1.0650 1.3477 0.9386 0.1845  0.0049  0.0113  348 GLU A N   
2696 C CA  . GLU A 348 ? 0.9771 1.1956 0.8262 0.1841  0.0115  0.0184  348 GLU A CA  
2697 C C   . GLU A 348 ? 1.0106 1.1781 0.8427 0.1624  0.0211  0.0162  348 GLU A C   
2698 O O   . GLU A 348 ? 1.1814 1.2953 0.9949 0.1558  0.0260  0.0166  348 GLU A O   
2699 C CB  . GLU A 348 ? 0.9400 1.1675 0.8214 0.1761  -0.0018 0.0063  348 GLU A CB  
2700 C CG  . GLU A 348 ? 1.0253 1.3090 0.9353 0.1911  -0.0128 0.0058  348 GLU A CG  
2701 C CD  . GLU A 348 ? 1.0313 1.3151 0.9663 0.1891  -0.0217 0.0017  348 GLU A CD  
2702 O OE1 . GLU A 348 ? 0.9937 1.2412 0.9001 0.2038  -0.0164 0.0137  348 GLU A OE1 
2703 O OE2 . GLU A 348 ? 1.0358 1.3556 1.0188 0.1742  -0.0326 -0.0128 348 GLU A OE2 
2704 N N   . VAL A 349 ? 1.0207 1.2073 0.8595 0.1507  0.0238  0.0131  349 VAL A N   
2705 C CA  . VAL A 349 ? 1.0944 1.2405 0.9229 0.1272  0.0323  0.0114  349 VAL A CA  
2706 C C   . VAL A 349 ? 1.1511 1.2895 0.9529 0.1346  0.0482  0.0281  349 VAL A C   
2707 O O   . VAL A 349 ? 1.2095 1.3885 1.0067 0.1564  0.0501  0.0378  349 VAL A O   
2708 C CB  . VAL A 349 ? 1.0483 1.2257 0.9191 0.0990  0.0201  -0.0094 349 VAL A CB  
2709 C CG1 . VAL A 349 ? 0.8997 1.0864 0.7991 0.0932  0.0066  -0.0221 349 VAL A CG1 
2710 C CG2 . VAL A 349 ? 1.0094 1.2495 0.9045 0.1020  0.0148  -0.0160 349 VAL A CG2 
2711 N N   . GLU A 350 ? 1.2298 1.3191 1.0151 0.1162  0.0601  0.0320  350 GLU A N   
2712 C CA  . GLU A 350 ? 1.2411 1.3225 1.0070 0.1187  0.0765  0.0489  350 GLU A CA  
2713 C C   . GLU A 350 ? 1.2693 1.3430 1.0513 0.0849  0.0766  0.0392  350 GLU A C   
2714 O O   . GLU A 350 ? 1.2499 1.2965 1.0415 0.0608  0.0709  0.0253  350 GLU A O   
2715 C CB  . GLU A 350 ? 1.3544 1.3698 1.0757 0.1356  0.0984  0.0723  350 GLU A CB  
2716 C CG  . GLU A 350 ? 1.4482 1.4752 1.1501 0.1734  0.1018  0.0878  350 GLU A CG  
2717 C CD  . GLU A 350 ? 1.5771 1.5316 1.2347 0.1917  0.1260  0.1114  350 GLU A CD  
2718 O OE1 . GLU A 350 ? 1.6378 1.6053 1.2741 0.2265  0.1369  0.1346  350 GLU A OE1 
2719 O OE2 . GLU A 350 ? 1.5513 1.4367 1.1957 0.1713  0.1349  0.1062  350 GLU A OE2 
2720 N N   . LYS A 351 ? 1.3765 1.4788 1.1610 0.0843  0.0835  0.0476  351 LYS A N   
2721 C CA  . LYS A 351 ? 1.4715 1.5823 1.2764 0.0543  0.0822  0.0392  351 LYS A CA  
2722 C C   . LYS A 351 ? 1.5132 1.5586 1.2972 0.0342  0.0991  0.0506  351 LYS A C   
2723 O O   . LYS A 351 ? 1.6186 1.6707 1.4170 0.0093  0.1007  0.0480  351 LYS A O   
2724 C CB  . LYS A 351 ? 1.5657 1.7399 1.3836 0.0620  0.0821  0.0422  351 LYS A CB  
2725 C CG  . LYS A 351 ? 1.6889 1.8653 1.4764 0.0892  0.0997  0.0694  351 LYS A CG  
2726 C CD  . LYS A 351 ? 1.6997 1.9468 1.5001 0.0969  0.0983  0.0698  351 LYS A CD  
2727 C CE  . LYS A 351 ? 1.6822 1.9951 1.5118 0.1024  0.0775  0.0440  351 LYS A CE  
2728 N NZ  . LYS A 351 ? 1.7065 2.0896 1.5445 0.1123  0.0768  0.0415  351 LYS A NZ  
2729 N N   . ILE A 352 ? 1.4015 1.3839 1.1526 0.0446  0.1125  0.0628  352 ILE A N   
2730 C CA  . ILE A 352 ? 1.4689 1.3804 1.1990 0.0249  0.1308  0.0717  352 ILE A CA  
2731 C C   . ILE A 352 ? 1.5982 1.5048 1.3147 0.0328  0.1523  0.0989  352 ILE A C   
2732 O O   . ILE A 352 ? 1.5923 1.5109 1.3236 0.0096  0.1555  0.1004  352 ILE A O   
2733 C CB  . ILE A 352 ? 1.4131 1.3191 1.1661 -0.0170 0.1211  0.0510  352 ILE A CB  
2734 C CG1 . ILE A 352 ? 1.3970 1.3179 1.1670 -0.0229 0.1002  0.0267  352 ILE A CG1 
2735 C CG2 . ILE A 352 ? 1.4649 1.2953 1.1964 -0.0403 0.1396  0.0568  352 ILE A CG2 
2736 C CD1 . ILE A 352 ? 1.4186 1.2810 1.1603 -0.0134 0.1044  0.0241  352 ILE A CD1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   TRP 5   5   5   TRP TRP A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  MET 11  11  11  MET MET A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 CYS 145 145 145 CYS CYS A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 MET 157 157 157 MET MET A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 PHE 179 179 179 PHE PHE A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ASP 214 214 214 ASP ASP A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 TYR 224 224 224 TYR TYR A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 LYS 230 230 230 LYS LYS A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 PHE 232 232 232 PHE PHE A . n 
A 1 233 PRO 233 233 233 PRO PRO A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 PHE 237 237 237 PHE PHE A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 MET 240 240 240 MET MET A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 ASN 243 243 243 ASN ASN A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 TYR 247 247 247 TYR TYR A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 PHE 249 249 249 PHE PHE A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 ARG 251 251 251 ARG ARG A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 PRO 254 254 254 PRO PRO A . n 
A 1 255 TYR 255 255 255 TYR TYR A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 MET 257 257 257 MET MET A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 PHE 259 259 259 PHE PHE A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 PRO 268 268 268 PRO PRO A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 ASP 271 271 271 ASP ASP A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 ARG 275 275 275 ARG ARG A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 ILE 277 277 277 ILE ILE A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 GLU 284 284 284 GLU GLU A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TYR 286 286 286 TYR TYR A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLU 288 288 ?   ?   ?   A . n 
A 1 289 LYS 289 289 ?   ?   ?   A . n 
A 1 290 LYS 290 290 ?   ?   ?   A . n 
A 1 291 LYS 291 291 ?   ?   ?   A . n 
A 1 292 PRO 292 292 ?   ?   ?   A . n 
A 1 293 VAL 293 293 ?   ?   ?   A . n 
A 1 294 LYS 294 294 ?   ?   ?   A . n 
A 1 295 VAL 295 295 ?   ?   ?   A . n 
A 1 296 GLU 296 296 ?   ?   ?   A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 MET 304 304 304 MET MET A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 ILE 307 307 307 ILE ILE A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 PRO 311 311 311 PRO PRO A . n 
A 1 312 PHE 312 312 312 PHE PHE A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ASP 314 314 314 ASP ASP A . n 
A 1 315 PHE 315 315 315 PHE PHE A . n 
A 1 316 ALA 316 316 316 ALA ALA A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LYS 320 320 320 LYS LYS A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 PRO 324 324 324 PRO PRO A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 ARG 326 326 326 ARG ARG A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 LYS 330 330 330 LYS LYS A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 ASN 332 332 332 ASN ASN A . n 
A 1 333 VAL 333 333 333 VAL VAL A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 ILE 335 335 335 ILE ILE A . n 
A 1 336 PHE 336 336 336 PHE PHE A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 ARG 338 338 338 ARG ARG A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 THR 340 340 340 THR THR A . n 
A 1 341 PRO 341 341 341 PRO PRO A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 HIS 345 345 345 HIS HIS A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 VAL 349 349 349 VAL VAL A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 LYS 351 351 351 LYS LYS A . n 
A 1 352 ILE 352 352 352 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  2001 2001 HOH HOH A . 
B 2 HOH 2  2002 2002 HOH HOH A . 
B 2 HOH 3  2003 2003 HOH HOH A . 
B 2 HOH 4  2004 2004 HOH HOH A . 
B 2 HOH 5  2005 2005 HOH HOH A . 
B 2 HOH 6  2006 2006 HOH HOH A . 
B 2 HOH 7  2007 2007 HOH HOH A . 
B 2 HOH 8  2008 2008 HOH HOH A . 
B 2 HOH 9  2009 2009 HOH HOH A . 
B 2 HOH 10 2010 2010 HOH HOH A . 
B 2 HOH 11 2011 2011 HOH HOH A . 
B 2 HOH 12 2012 2012 HOH HOH A . 
B 2 HOH 13 2013 2013 HOH HOH A . 
B 2 HOH 14 2014 2014 HOH HOH A . 
B 2 HOH 15 2015 2015 HOH HOH A . 
B 2 HOH 16 2016 2016 HOH HOH A . 
B 2 HOH 17 2017 2017 HOH HOH A . 
B 2 HOH 18 2018 2018 HOH HOH A . 
B 2 HOH 19 2019 2019 HOH HOH A . 
B 2 HOH 20 2020 2020 HOH HOH A . 
B 2 HOH 21 2021 2021 HOH HOH A . 
B 2 HOH 22 2022 2022 HOH HOH A . 
B 2 HOH 23 2023 2023 HOH HOH A . 
B 2 HOH 24 2024 2024 HOH HOH A . 
B 2 HOH 25 2025 2025 HOH HOH A . 
B 2 HOH 26 2026 2026 HOH HOH A . 
B 2 HOH 27 2027 2027 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-06-29 
2 'Structure model' 1 1 2013-02-27 
3 'Structure model' 1 2 2013-04-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'       
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 10.7086  33.6386 44.1568 0.5524  0.3987 0.4467 0.0493  -0.0535 -0.0987 0.0614 0.5628 3.5133 0.2524 
0.0443  1.3418  0.1268  0.4106 -0.1735 0.0325  0.0155  -0.1270 0.0460  -0.6094 -0.1724 
'X-RAY DIFFRACTION' 2 ? refined -12.9507 19.5529 13.8710 0.2385  0.7052 0.2941 -0.1663 0.0195  -0.0092 3.0326 0.4330 2.4210 
-0.3702 0.6922  1.1347  -0.1341 0.4728 -0.0692 -0.1933 0.3837  -0.1044 -0.5542 0.3027  -0.3222 
'X-RAY DIFFRACTION' 3 ? refined -4.5078  15.9204 -3.1596 0.7238  1.1814 1.1289 -0.0456 0.1103  0.2276  0.8929 0.2714 0.6430 0.4886 
0.6289  0.3423  -1.2473 0.4909 -0.8040 -0.7848 0.0854  0.0529  0.4451  0.4732  0.5010  
'X-RAY DIFFRACTION' 4 ? refined -13.7061 2.6175  3.8730  0.1305  1.0943 0.7619 0.0323  0.0185  -0.1910 0.7402 0.7726 1.1495 0.1555 
0.6136  -0.0896 0.0724  1.1111 -1.2280 0.3540  -0.1480 0.2033  0.1508  -0.4199 -0.0770 
'X-RAY DIFFRACTION' 5 ? refined -20.2400 18.1780 13.2944 -0.5388 0.6271 0.1418 -0.1647 0.1026  -0.0911 0.3539 1.9061 2.4470 0.3775 
2.0444  0.7681  -0.1950 0.3020 -0.4022 0.1966  0.3683  0.1728  -1.1470 -0.1801 -0.2795 
'X-RAY DIFFRACTION' 6 ? refined 15.2180  39.8444 40.5866 0.4826  0.2779 0.3201 0.0601  -0.0313 -0.0748 1.5738 1.5393 2.3031 0.1183 
-0.5604 0.2169  0.2211  0.1722 0.0618  0.4794  -0.0627 -0.1660 -0.5291 0.2608  -0.1477 
'X-RAY DIFFRACTION' 7 ? refined 16.4539  37.0201 16.0334 0.4333  0.6228 0.3919 0.0563  -0.0134 -0.0472 3.9974 0.6042 3.0537 
-0.8495 -1.4728 -0.8454 0.1993  0.3856 0.0889  -0.0472 0.0564  -0.1791 -1.0798 -0.1028 -0.1360 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 3:42)'    
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 43:104)'  
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 105:109)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 110:156)' 
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 157:229)' 
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 230:283)' 
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 284:352)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX    refinement       '(PHENIX.REFINE)' ? 1 
DENZO     'data reduction' .                 ? 2 
SCALEPACK 'data scaling'   .                 ? 3 
PHASER    phasing          .                 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 41  ? ? -56.52  108.51  
2  1 ASP A 47  ? ? -147.42 27.35   
3  1 ASN A 67  ? ? -29.93  135.87  
4  1 LYS A 73  ? ? -36.63  -14.38  
5  1 ASP A 106 ? ? -67.89  16.07   
6  1 ARG A 107 ? ? 33.47   -158.05 
7  1 LYS A 108 ? ? 79.28   -65.15  
8  1 ASN A 140 ? ? -106.72 -139.66 
9  1 GLU A 142 ? ? 61.64   167.76  
10 1 TYR A 143 ? ? 44.53   70.75   
11 1 GLU A 153 ? ? -170.71 133.11  
12 1 TYR A 255 ? ? 79.96   -13.67  
13 1 SER A 262 ? ? -60.91  -88.25  
14 1 PRO A 324 ? ? -63.07  -177.83 
15 1 GLU A 325 ? ? 48.65   28.28   
16 1 ARG A 326 ? ? -167.38 -11.33  
17 1 SER A 347 ? ? -69.20  3.31    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LYS 2   ? A LYS 2   
3  1 Y 1 A GLU 288 ? A GLU 288 
4  1 Y 1 A LYS 289 ? A LYS 289 
5  1 Y 1 A LYS 290 ? A LYS 290 
6  1 Y 1 A LYS 291 ? A LYS 291 
7  1 Y 1 A PRO 292 ? A PRO 292 
8  1 Y 1 A VAL 293 ? A VAL 293 
9  1 Y 1 A LYS 294 ? A LYS 294 
10 1 Y 1 A VAL 295 ? A VAL 295 
11 1 Y 1 A GLU 296 ? A GLU 296 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#