data_2XI4
# 
_entry.id   2XI4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XI4         
PDBE  EBI-44354    
WWPDB D_1290044354 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO)TRIFLUOROACETOPHENONE' 
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 2VQ6 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2- PAM' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)- GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9"-(1",2",3",4"- TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2WG0 unspecified 'AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (OBTAINED BY IN CRYSTALLO AGING)' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 2J4F unspecified 'TORPEDO ACETYLCHOLINESTERASE - HG HEAVY-ATOM DERIVATIVE' 
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL-PHOSPHORO- FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLAMMONIUM' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 2VJC unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 150K
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJB unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET D AT 100K
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2WFZ unspecified 'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN' 
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VJD unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET C AT 150K
;
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH N-9-(1',2',3',4'-TETRAHYDROACRIDINYL)- 1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 2WG1 unspecified 'TERNARY COMPLEX OF THE AGED CONJUGATE OF TORPEDO CALIFORNICA ACEYLCHOLINESTERASE WITH SOMAN AND 2-PAM' 
PDB 2VT6 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 9400000 GY' 
PDB 2W9I unspecified 'ACHE IN COMPLEX WITH METHYLENE BLUE' 
PDB 2WG2 unspecified 'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (ALTERNATIVE REFINEMENT)' 
PDB 2VT7 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 800000 GY' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)- HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7-HEPTYLENE-BIS-N ,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL) AMINO ]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2W6C unspecified 'ACHE IN COMPLEX WITH A BIS-(-)-NOR-MEPTAZINOL DERIVATIVE' 
PDB 2VJA unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 100K
;
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 2V96 unspecified 
'STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL-ARSENOCHOLINE AT 100K' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)-HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI-ALZHEIMER DRUG , E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 2VA9 unspecified 
;STRUCTURE OF NATIVE TCACHE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE DURING THE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL) AMINO ]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5 -FLUORO-2-METHYL-3-(3-TRIFLUOROACETYLBENZYLTHIOMETHYL) QUINOLINE
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3-PROPYLENE-BIS-N ,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 2V98 unspecified 
;STRUCTURE OF THE COMPLEX OF TCACHE WITH 1-(2- NITROPHENYL)-2,2,2-TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE, DURING HTE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VB4 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2- PAM' 
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)-HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 2V97 unspecified 
;STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XI4 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sanson, B.'      1 
'Colletier, J.P.' 2 
'Xu, Y.'          3 
'Lang, P.T.'      4 
'Jiang, H.'       5 
'Silman, I.'      6 
'Sussman, J.L.'   7 
'Weik, M.'        8 
# 
_citation.id                        primary 
_citation.title                     
'Backdoor Opening Mechanism in Acetylcholinesterase Based on X-Ray Crystallography and Molecular Dynamics Simulations.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            20 
_citation.page_first                1114 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21594947 
_citation.pdbx_database_id_DOI      10.1002/PRO.661 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sanson, B.'      1 ? 
primary 'Colletier, J.P.' 2 ? 
primary 'Xu, Y.'          3 ? 
primary 'Lang, P.T.'      4 ? 
primary 'Jiang, H.'       5 ? 
primary 'Silman, I.'      6 ? 
primary 'Sussman, J.L.'   7 ? 
primary 'Weik, M.'        8 ? 
# 
_cell.entry_id           2XI4 
_cell.length_a           91.730 
_cell.length_b           107.030 
_cell.length_c           150.730 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XI4 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE    60736.516 2   3.1.1.7 ? 'RESIDUES 22-558' ? 
2 non-polymer syn 'AFLATOXIN B1'          312.274   2   ?       ? ?                 ? 
3 non-polymer syn 'CHLORIDE ION'          35.453    4   ?       ? ?                 ? 
4 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   6   ?       ? ?                 ? 
5 non-polymer syn 'TRIETHYLENE GLYCOL'    150.173   2   ?       ? ?                 ? 
6 non-polymer man N-ACETYL-D-GLUCOSAMINE  221.208   5   ?       ? ?                 ? 
7 non-polymer syn 'POTASSIUM ION'         39.098    1   ?       ? ?                 ? 
8 water       nat water                   18.015    744 ?       ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2XI4 A 1 ? 537 ? P04058 22 ? 558 ? 1 537 
2 1 2XI4 B 1 ? 537 ? P04058 22 ? 558 ? 1 537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AFT non-polymer         . 'AFLATOXIN B1'          ? 'C17 H12 O6'     312.274 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'          ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION'         ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE  ? 'C8 H15 N O6'    221.208 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3'      106.120 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'    ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XI4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.density_percent_sol   60.2 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;ACHE WAS CRYSTALLIZED IN 34% PEG200, 150 MM MES, PH 6, 4 DEG. C. THE CRYSTAL WAS SOAKED FOR 15 H IN 100 MICROMOLAR AFLATOXIN B1, 10% ETOH, 36% PEG200, 150MM MES, PH 5.8, 4 DEG C.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2007-09-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XI4 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.22 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   65334 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.07 
_reflns.B_iso_Wilson_estimate        38.486 
_reflns.pdbx_redundancy              6.05 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.35 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.42 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.57 
_reflns_shell.pdbx_redundancy        5.94 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XI4 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     62177 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.22 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.18244 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17988 
_refine.ls_R_factor_R_free                       0.23366 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  3156 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               37.284 
_refine.aniso_B[1][1]                            -1.42 
_refine.aniso_B[2][2]                            3.85 
_refine.aniso_B[3][3]                            -2.43 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1W75' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.264 
_refine.pdbx_overall_ESU_R_Free                  0.214 
_refine.overall_SU_ML                            0.148 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.367 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8450 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         183 
_refine_hist.number_atoms_solvent             744 
_refine_hist.number_atoms_total               9377 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        46.22 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 9024  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.491  1.966  ? 12273 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.435  5.000  ? 1103  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.086 24.009 ? 429   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.569 15.000 ? 1443  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.754 15.000 ? 51    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.104  0.200  ? 1285  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 6997  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.664  1.500  ? 5349  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.225  2.000  ? 8668  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.199  3.000  ? 3675  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.439  4.500  ? 3583  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             4612 
_refine_ls_shell.R_factor_R_work                  0.207 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.291 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             242 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XI4 
_struct.title                     
'Torpedo californica Acetylcholinesterase in Complex with Aflatoxin B1 (Orthorhombic Space Group)' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XI4 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;ACETYLCHOLINESTERASE BACKDOOR, MYCOTOXIN, ALZHEIMER DISEASE, CELL JUNCTION, GPI-ANCHOR, HYDROLASE, NEUROTRANSMITTER CLEAVAGE, NEUROTRANSMITTER DEGRADATION, SERINE ESTERASE, SYNAPSE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 2 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 5 ? 
S N N 4 ? 
T N N 4 ? 
U N N 6 ? 
V N N 6 ? 
W N N 8 ? 
X N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  PRO A 213 ? PHE A 219 ? PRO A 213 PHE A 219 5 ? 7  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 TYR A 442 ? PHE A 448 ? TYR A 442 PHE A 448 1 ? 7  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
HELX_P HELX_P27 27 VAL B 40  ? ARG B 44  ? VAL B 40  ARG B 44  5 ? 5  
HELX_P HELX_P28 28 PHE B 78  ? MET B 83  ? PHE B 78  MET B 83  1 ? 6  
HELX_P HELX_P29 29 LEU B 127 ? ASN B 131 ? LEU B 127 ASN B 131 5 ? 5  
HELX_P HELX_P30 30 GLY B 132 ? GLU B 140 ? GLY B 132 GLU B 140 1 ? 9  
HELX_P HELX_P31 31 VAL B 150 ? LEU B 156 ? VAL B 150 LEU B 156 1 ? 7  
HELX_P HELX_P32 32 ASN B 167 ? ILE B 184 ? ASN B 167 ILE B 184 1 ? 18 
HELX_P HELX_P33 33 GLN B 185 ? PHE B 187 ? GLN B 185 PHE B 187 5 ? 3  
HELX_P HELX_P34 34 SER B 200 ? SER B 212 ? SER B 200 SER B 212 1 ? 13 
HELX_P HELX_P35 35 SER B 215 ? PHE B 219 ? SER B 215 PHE B 219 5 ? 5  
HELX_P HELX_P36 36 VAL B 238 ? LEU B 252 ? VAL B 238 LEU B 252 1 ? 15 
HELX_P HELX_P37 37 SER B 258 ? GLU B 268 ? SER B 258 GLU B 268 1 ? 11 
HELX_P HELX_P38 38 LYS B 270 ? GLU B 278 ? LYS B 270 GLU B 278 1 ? 9  
HELX_P HELX_P39 39 TRP B 279 ? LEU B 282 ? TRP B 279 LEU B 282 5 ? 4  
HELX_P HELX_P40 40 SER B 304 ? GLY B 312 ? SER B 304 GLY B 312 1 ? 9  
HELX_P HELX_P41 41 GLY B 328 ? ALA B 336 ? GLY B 328 ALA B 336 1 ? 9  
HELX_P HELX_P42 42 SER B 348 ? VAL B 360 ? SER B 348 VAL B 360 1 ? 13 
HELX_P HELX_P43 43 ASN B 364 ? TYR B 375 ? ASN B 364 TYR B 375 1 ? 12 
HELX_P HELX_P44 44 ASN B 383 ? VAL B 400 ? ASN B 383 VAL B 400 1 ? 18 
HELX_P HELX_P45 45 VAL B 400 ? LYS B 413 ? VAL B 400 LYS B 413 1 ? 14 
HELX_P HELX_P46 46 PRO B 433 ? GLY B 437 ? PRO B 433 GLY B 437 5 ? 5  
HELX_P HELX_P47 47 GLU B 443 ? PHE B 448 ? GLU B 443 PHE B 448 1 ? 6  
HELX_P HELX_P48 48 GLY B 449 ? VAL B 453 ? GLY B 449 VAL B 453 5 ? 5  
HELX_P HELX_P49 49 VAL B 453 ? ASN B 457 ? VAL B 453 ASN B 457 5 ? 5  
HELX_P HELX_P50 50 THR B 459 ? GLY B 480 ? THR B 459 GLY B 480 1 ? 22 
HELX_P HELX_P51 51 ARG B 517 ? GLN B 526 ? ARG B 517 GLN B 526 1 ? 10 
HELX_P HELX_P52 52 GLN B 526 ? ASN B 533 ? GLN B 526 ASN B 533 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG  ? ? A CYS 67   A CYS 94   1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG  ? ? A CYS 254  A CYS 265  1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG  ? ? A CYS 402  A CYS 521  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf4 disulf ?   ? B CYS 67  SG  ? ? ? 1_555 B CYS 94  SG  ? ? B CYS 67   B CYS 94   1_555 ? ? ? ? ? ? ? 2.075 ? 
disulf5 disulf ?   ? B CYS 254 SG  ? ? ? 1_555 B CYS 265 SG  ? ? B CYS 254  B CYS 265  1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf6 disulf ?   ? B CYS 402 SG  ? ? ? 1_555 B CYS 521 SG  ? ? B CYS 402  B CYS 521  1_555 ? ? ? ? ? ? ? 2.011 ? 
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 J NAG .   C1  ? ? A ASN 59   A NAG 1007 1_555 ? ? ? ? ? ? ? 1.443 ? 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 K NAG .   C1  ? ? A ASN 416  A NAG 1008 1_555 ? ? ? ? ? ? ? 1.453 ? 
covale3 covale one ? A ASN 457 ND2 ? ? ? 1_555 L NAG .   C1  ? ? A ASN 457  A NAG 1009 1_555 ? ? ? ? ? ? ? 1.446 ? 
metalc1 metalc ?   ? M K   .   K   ? ? ? 1_555 A GLU 260 OE1 ? ? A K   1010 A GLU 260  1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc2 metalc ?   ? M K   .   K   ? ? ? 1_555 B GLU 508 OE1 ? ? A K   1010 B GLU 508  3_755 ? ? ? ? ? ? ? 2.274 ? 
metalc3 metalc ?   ? M K   .   K   ? ? ? 1_555 B GLU 508 OE2 ? ? A K   1010 B GLU 508  3_755 ? ? ? ? ? ? ? 2.259 ? 
metalc4 metalc ?   ? M K   .   K   ? ? ? 1_555 A GLU 163 OE1 ? ? A K   1010 A GLU 163  1_555 ? ? ? ? ? ? ? 2.727 ? 
covale4 covale one ? B ASN 59  ND2 ? ? ? 1_555 U NAG .   C1  ? ? B ASN 59   B NAG 1008 1_555 ? ? ? ? ? ? ? 1.450 ? 
covale5 covale one ? B ASN 416 ND2 ? ? ? 1_555 V NAG .   C1  ? ? B ASN 416  B NAG 1009 1_555 ? ? ? ? ? ? ? 1.430 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 1 8.25 
2 SER 103 B . ? SER 103 B PRO 104 B ? PRO 104 B 1 2.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
BA 1  LEU B 7   ? THR B 10  ? LEU B 7   THR B 10  
BA 2  GLY B 13  ? MET B 16  ? GLY B 13  MET B 16  
BA 3  VAL B 57  ? ASN B 59  ? VAL B 57  ASN B 59  
BB 1  THR B 18  ? VAL B 22  ? THR B 18  VAL B 22  
BB 2  SER B 25  ? PRO B 34  ? SER B 25  PRO B 34  
BB 3  TYR B 96  ? PRO B 102 ? TYR B 96  PRO B 102 
BB 4  VAL B 142 ? SER B 145 ? VAL B 142 SER B 145 
BB 5  THR B 109 ? ILE B 115 ? THR B 109 ILE B 115 
BB 6  GLY B 189 ? GLU B 199 ? GLY B 189 GLU B 199 
BB 7  ARG B 221 ? GLN B 225 ? ARG B 221 GLN B 225 
BB 8  GLN B 318 ? ASN B 324 ? GLN B 318 ASN B 324 
BB 9  GLY B 417 ? PHE B 423 ? GLY B 417 PHE B 423 
BB 10 LYS B 501 ? LEU B 505 ? LYS B 501 LEU B 505 
BB 11 VAL B 512 ? GLN B 514 ? VAL B 512 GLN B 514 
BC 1  VAL B 236 ? SER B 237 ? VAL B 236 SER B 237 
BC 2  VAL B 295 ? ILE B 296 ? VAL B 295 ILE B 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
BA 1  2  N THR B 10  ? N THR B 10  O GLY B 13  ? O GLY B 13  
BA 2  3  N MET B 16  ? N MET B 16  O TRP B 58  ? O TRP B 58  
BB 1  2  N VAL B 22  ? N VAL B 22  O SER B 25  ? O SER B 25  
BB 2  3  N ILE B 33  ? N ILE B 33  O LEU B 97  ? O LEU B 97  
BB 3  4  N TRP B 100 ? N TRP B 100 O LEU B 143 ? O LEU B 143 
BB 4  5  N VAL B 142 ? N VAL B 142 O THR B 110 ? O THR B 110 
BB 5  6  O THR B 109 ? O THR B 109 N ASP B 190 ? N ASP B 190 
BB 6  7  N ILE B 196 ? N ILE B 196 O ARG B 221 ? O ARG B 221 
BB 7  8  N ALA B 222 ? N ALA B 222 O GLN B 318 ? O GLN B 318 
BB 8  9  N ILE B 319 ? N ILE B 319 O GLY B 417 ? O GLY B 417 
BB 9  10 N PHE B 422 ? N PHE B 422 O ILE B 503 ? O ILE B 503 
BB 10 11 N PHE B 502 ? N PHE B 502 O HIS B 513 ? O HIS B 513 
BC 1  2  O VAL B 236 ? O VAL B 236 N ILE B 296 ? N ILE B 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL B 1001'  
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL B 1002'  
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1001'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE K A 1010'   
AC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE AFT A 1000' 
AC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE AFT B 1000' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PEG B 1003' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PGE B 1004' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PEG A 1003' 
BC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PEG A 1004' 
BC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PEG B 1005' 
BC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE PEG A 1005' 
BC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PGE A 1006' 
BC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE PEG B 1006' 
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NAG A 1007' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NAG A 1008' 
BC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NAG B 1008' 
BC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NAG B 1009' 
CC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NAG A 1009' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 1  THR B 497 ? THR B 497  . ? 1_555 ? 
2   AC2 1  TYR B 134 ? TYR B 134  . ? 1_555 ? 
3   AC3 1  LEU A 23  ? LEU A 23   . ? 1_555 ? 
4   AC4 4  GLU A 163 ? GLU A 163  . ? 1_555 ? 
5   AC4 4  GLU A 260 ? GLU A 260  . ? 1_555 ? 
6   AC4 4  HIS A 264 ? HIS A 264  . ? 1_555 ? 
7   AC4 4  GLU B 508 ? GLU B 508  . ? 3_755 ? 
8   AC5 12 TYR A 70  ? TYR A 70   . ? 1_555 ? 
9   AC5 12 TYR A 121 ? TYR A 121  . ? 1_555 ? 
10  AC5 12 TRP A 279 ? TRP A 279  . ? 1_555 ? 
11  AC5 12 SER A 286 ? SER A 286  . ? 1_555 ? 
12  AC5 12 ILE A 287 ? ILE A 287  . ? 1_555 ? 
13  AC5 12 PHE A 288 ? PHE A 288  . ? 1_555 ? 
14  AC5 12 ARG A 289 ? ARG A 289  . ? 1_555 ? 
15  AC5 12 PHE A 290 ? PHE A 290  . ? 1_555 ? 
16  AC5 12 PHE A 330 ? PHE A 330  . ? 1_555 ? 
17  AC5 12 TYR A 334 ? TYR A 334  . ? 1_555 ? 
18  AC5 12 HOH W .   ? HOH A 2001 . ? 1_555 ? 
19  AC5 12 HOH W .   ? HOH A 2002 . ? 1_555 ? 
20  AC6 15 TYR B 70  ? TYR B 70   . ? 1_555 ? 
21  AC6 15 TYR B 121 ? TYR B 121  . ? 1_555 ? 
22  AC6 15 TRP B 279 ? TRP B 279  . ? 1_555 ? 
23  AC6 15 SER B 286 ? SER B 286  . ? 1_555 ? 
24  AC6 15 ILE B 287 ? ILE B 287  . ? 1_555 ? 
25  AC6 15 PHE B 288 ? PHE B 288  . ? 1_555 ? 
26  AC6 15 ARG B 289 ? ARG B 289  . ? 1_555 ? 
27  AC6 15 PHE B 290 ? PHE B 290  . ? 1_555 ? 
28  AC6 15 PHE B 330 ? PHE B 330  . ? 1_555 ? 
29  AC6 15 TYR B 334 ? TYR B 334  . ? 1_555 ? 
30  AC6 15 HOH X .   ? HOH B 2001 . ? 1_555 ? 
31  AC6 15 HOH X .   ? HOH B 2002 . ? 1_555 ? 
32  AC6 15 HOH X .   ? HOH B 2003 . ? 1_555 ? 
33  AC6 15 HOH X .   ? HOH B 2004 . ? 1_555 ? 
34  AC6 15 HOH X .   ? HOH B 2005 . ? 1_555 ? 
35  AC7 3  TRP B 100 ? TRP B 100  . ? 1_555 ? 
36  AC7 3  ASN B 131 ? ASN B 131  . ? 1_555 ? 
37  AC7 3  HOH X .   ? HOH B 2374 . ? 1_555 ? 
38  AC8 6  GLY B 118 ? GLY B 118  . ? 1_555 ? 
39  AC8 6  TYR B 121 ? TYR B 121  . ? 1_555 ? 
40  AC8 6  GLU B 199 ? GLU B 199  . ? 1_555 ? 
41  AC8 6  PHE B 330 ? PHE B 330  . ? 1_555 ? 
42  AC8 6  HIS B 440 ? HIS B 440  . ? 1_555 ? 
43  AC8 6  HOH X .   ? HOH B 2376 . ? 1_555 ? 
44  AC9 3  SER A 55  ? SER A 55   . ? 1_555 ? 
45  AC9 3  VAL A 57  ? VAL A 57   . ? 1_555 ? 
46  AC9 3  HOH W .   ? HOH A 2340 . ? 1_555 ? 
47  BC1 9  GLY A 80  ? GLY A 80   . ? 1_555 ? 
48  BC1 9  MET A 83  ? MET A 83   . ? 1_555 ? 
49  BC1 9  TRP A 84  ? TRP A 84   . ? 1_555 ? 
50  BC1 9  TRP A 432 ? TRP A 432  . ? 1_555 ? 
51  BC1 9  HIS A 440 ? HIS A 440  . ? 1_555 ? 
52  BC1 9  GLY A 441 ? GLY A 441  . ? 1_555 ? 
53  BC1 9  TYR A 442 ? TYR A 442  . ? 1_555 ? 
54  BC1 9  GLU A 445 ? GLU A 445  . ? 1_555 ? 
55  BC1 9  HOH W .   ? HOH A 2341 . ? 1_555 ? 
56  BC2 9  MET B 405 ? MET B 405  . ? 1_555 ? 
57  BC2 9  HIS B 406 ? HIS B 406  . ? 1_555 ? 
58  BC2 9  ASN B 409 ? ASN B 409  . ? 1_555 ? 
59  BC2 9  LEU B 516 ? LEU B 516  . ? 1_555 ? 
60  BC2 9  VAL B 518 ? VAL B 518  . ? 1_555 ? 
61  BC2 9  CYS B 521 ? CYS B 521  . ? 1_555 ? 
62  BC2 9  ASN B 525 ? ASN B 525  . ? 1_555 ? 
63  BC2 9  HOH X .   ? HOH B 2349 . ? 1_555 ? 
64  BC2 9  HOH X .   ? HOH B 2377 . ? 1_555 ? 
65  BC3 7  HIS A 406 ? HIS A 406  . ? 1_555 ? 
66  BC3 7  ASN A 409 ? ASN A 409  . ? 1_555 ? 
67  BC3 7  CYS A 521 ? CYS A 521  . ? 1_555 ? 
68  BC3 7  VAL A 522 ? VAL A 522  . ? 1_555 ? 
69  BC3 7  ASN A 525 ? ASN A 525  . ? 1_555 ? 
70  BC3 7  GLN A 526 ? GLN A 526  . ? 1_555 ? 
71  BC3 7  HOH W .   ? HOH A 2342 . ? 1_555 ? 
72  BC4 9  TRP A 84  ? TRP A 84   . ? 1_555 ? 
73  BC4 9  GLY A 118 ? GLY A 118  . ? 1_555 ? 
74  BC4 9  TYR A 121 ? TYR A 121  . ? 1_555 ? 
75  BC4 9  GLU A 199 ? GLU A 199  . ? 1_555 ? 
76  BC4 9  PHE A 331 ? PHE A 331  . ? 1_555 ? 
77  BC4 9  HIS A 440 ? HIS A 440  . ? 1_555 ? 
78  BC4 9  HOH W .   ? HOH A 2095 . ? 1_555 ? 
79  BC4 9  HOH W .   ? HOH A 2148 . ? 1_555 ? 
80  BC4 9  HOH W .   ? HOH A 2343 . ? 1_555 ? 
81  BC5 1  ASN B 483 ? ASN B 483  . ? 1_555 ? 
82  BC6 4  ASN A 59  ? ASN A 59   . ? 1_555 ? 
83  BC6 4  SER A 61  ? SER A 61   . ? 1_555 ? 
84  BC6 4  HOH W .   ? HOH A 2345 . ? 1_555 ? 
85  BC6 4  HOH W .   ? HOH A 2346 . ? 1_555 ? 
86  BC7 5  ASN A 416 ? ASN A 416  . ? 1_555 ? 
87  BC7 5  HOH W .   ? HOH A 2347 . ? 1_555 ? 
88  BC7 5  HOH W .   ? HOH A 2348 . ? 1_555 ? 
89  BC7 5  HOH W .   ? HOH A 2350 . ? 1_555 ? 
90  BC7 5  HOH W .   ? HOH A 2351 . ? 1_555 ? 
91  BC8 7  ASN B 59  ? ASN B 59   . ? 1_555 ? 
92  BC8 7  SER B 61  ? SER B 61   . ? 1_555 ? 
93  BC8 7  THR B 62  ? THR B 62   . ? 1_555 ? 
94  BC8 7  HOH X .   ? HOH B 2382 . ? 1_555 ? 
95  BC8 7  HOH X .   ? HOH B 2383 . ? 1_555 ? 
96  BC8 7  HOH X .   ? HOH B 2384 . ? 1_555 ? 
97  BC8 7  HOH X .   ? HOH B 2385 . ? 1_555 ? 
98  BC9 7  ASN B 416 ? ASN B 416  . ? 1_555 ? 
99  BC9 7  HOH X .   ? HOH B 2387 . ? 1_555 ? 
100 BC9 7  HOH X .   ? HOH B 2389 . ? 1_555 ? 
101 BC9 7  HOH X .   ? HOH B 2390 . ? 1_555 ? 
102 BC9 7  HOH X .   ? HOH B 2391 . ? 1_555 ? 
103 BC9 7  HOH X .   ? HOH B 2392 . ? 1_555 ? 
104 BC9 7  HOH X .   ? HOH B 2393 . ? 1_555 ? 
105 CC1 1  ASN A 457 ? ASN A 457  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XI4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XI4 
_atom_sites.fract_transf_matrix[1][1]   0.010902 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009343 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006634 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
K  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? 72.217  42.792 -9.043  1.00 65.31 ? 4    SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? 70.801  42.519 -8.665  1.00 65.34 ? 4    SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? 70.745  42.496 -7.148  1.00 62.27 ? 4    SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? 70.563  43.539 -6.505  1.00 60.59 ? 4    SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? 70.340  41.181 -9.259  1.00 68.06 ? 4    SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? 69.006  40.865 -8.878  1.00 70.42 ? 4    SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? 70.914  41.301 -6.584  1.00 60.89 ? 5    GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? 71.228  41.137 -5.173  1.00 57.35 ? 5    GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? 72.362  42.088 -4.755  1.00 54.35 ? 5    GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? 72.379  42.596 -3.627  1.00 52.13 ? 5    GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? 71.638  39.687 -4.946  1.00 58.52 ? 5    GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? 72.075  39.310 -3.544  1.00 56.97 ? 5    GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? 72.268  37.802 -3.377  1.00 59.98 ? 5    GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? 72.665  37.129 -4.360  1.00 61.21 ? 5    GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? 72.018  37.294 -2.259  1.00 59.45 ? 5    GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? 73.292  42.317 -5.683  1.00 53.62 ? 6    LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? 74.490  43.115 -5.454  1.00 50.86 ? 6    LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? 74.363  44.560 -5.911  1.00 49.67 ? 6    LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? 75.241  45.380 -5.637  1.00 47.72 ? 6    LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? 75.686  42.484 -6.165  1.00 52.05 ? 6    LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? 76.276  41.171 -5.631  1.00 53.04 ? 6    LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? 77.407  40.727 -6.556  1.00 55.68 ? 6    LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? 76.786  41.287 -4.175  1.00 51.37 ? 6    LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? 73.280  44.869 -6.613  1.00 50.38 ? 7    LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? 73.041  46.227 -7.108  1.00 50.04 ? 7    LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? 71.897  46.835 -6.304  1.00 49.23 ? 7    LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? 70.758  46.412 -6.404  1.00 50.46 ? 7    LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? 72.778  46.231 -8.628  1.00 51.90 ? 7    LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? 72.492  47.539 -9.399  1.00 52.12 ? 7    LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? 73.602  48.553 -9.231  1.00 49.89 ? 7    LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? 72.229  47.289 -10.878 1.00 54.34 ? 7    LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? 72.212  47.803 -5.461  1.00 47.81 ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? 71.218  48.353 -4.554  1.00 47.40 ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? 71.096  49.846 -4.835  1.00 47.44 ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? 72.098  50.573 -4.863  1.00 47.25 ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? 71.596  48.073 -3.054  1.00 45.61 ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? 70.658  48.767 -2.091  1.00 44.34 ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? 71.577  46.578 -2.773  1.00 46.72 ? 8    VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? 69.872  50.293 -5.053  1.00 48.28 ? 9    ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? 69.589  51.712 -5.246  1.00 48.88 ? 9    ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? 69.307  52.369 -3.891  1.00 47.30 ? 9    ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? 68.303  52.076 -3.243  1.00 47.85 ? 9    ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? 68.400  51.901 -6.209  1.00 50.76 ? 9    ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? 68.236  53.334 -6.664  1.00 53.27 ? 9    ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? 69.091  54.190 -6.371  1.00 54.99 ? 9    ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? 67.138  53.618 -7.378  1.00 51.42 ? 9    ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? 70.198  53.249 -3.463  1.00 45.63 ? 10   THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? 70.036  53.896 -2.175  1.00 44.29 ? 10   THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? 69.555  55.300 -2.453  1.00 45.59 ? 10   THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? 69.437  55.685 -3.603  1.00 46.64 ? 10   THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? 71.367  53.978 -1.381  1.00 41.95 ? 10   THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? 72.144  55.065 -1.892  1.00 41.20 ? 10   THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? 72.167  52.689 -1.512  1.00 40.29 ? 10   THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? 69.314  56.064 -1.394  1.00 45.70 ? 11   LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? 68.768  57.413 -1.516  1.00 47.85 ? 11   LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? 69.737  58.418 -2.123  1.00 47.46 ? 11   LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? 69.294  59.399 -2.674  1.00 49.38 ? 11   LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? 68.238  57.914 -0.160  1.00 47.56 ? 11   LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? 66.920  57.239 0.188   1.00 51.03 ? 11   LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? 66.159  57.973 1.259   1.00 54.41 ? 11   LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? 64.768  57.352 1.420   1.00 57.25 ? 11   LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? 64.789  56.341 2.514   1.00 59.56 ? 11   LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? 71.040  58.174 -2.036  1.00 45.86 ? 12   SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? 72.028  59.084 -2.614  1.00 46.71 ? 12   SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? 72.618  58.555 -3.921  1.00 46.88 ? 12   SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? 73.468  59.211 -4.540  1.00 48.18 ? 12   SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? 73.160  59.390 -1.622  1.00 45.73 ? 12   SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? 72.783  59.105 -0.275  1.00 48.47 ? 12   SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? 72.152  57.386 -4.355  1.00 46.22 ? 13   GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? 72.620  56.779 -5.597  1.00 45.99 ? 13   GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? 72.794  55.284 -5.535  1.00 44.39 ? 13   GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? 72.574  54.672 -4.498  1.00 43.50 ? 13   GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? 73.199  54.703 -6.653  1.00 44.80 ? 14   LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? 73.384  53.259 -6.782  1.00 44.05 ? 14   LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? 74.756  52.778 -6.290  1.00 42.66 ? 14   LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? 75.769  53.456 -6.495  1.00 41.28 ? 14   LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? 73.232  52.843 -8.243  1.00 45.90 ? 14   LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? 71.861  53.052 -8.862  1.00 48.02 ? 14   LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? 71.968  53.055 -10.414 1.00 49.62 ? 14   LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 14  ? 70.714  52.591 -11.080 1.00 50.35 ? 14   LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 14  ? 70.883  52.655 -12.586 1.00 53.43 ? 14   LYS A NZ  1 
ATOM   82   N  N   . VAL A 1 15  ? 74.750  51.583 -5.676  1.00 41.90 ? 15   VAL A N   1 
ATOM   83   C  CA  A VAL A 1 15  ? 75.937  50.916 -5.133  0.50 41.17 ? 15   VAL A CA  1 
ATOM   84   C  CA  B VAL A 1 15  ? 75.968  50.929 -5.190  0.50 40.92 ? 15   VAL A CA  1 
ATOM   85   C  C   . VAL A 1 15  ? 76.060  49.483 -5.697  1.00 42.34 ? 15   VAL A C   1 
ATOM   86   O  O   . VAL A 1 15  ? 75.077  48.754 -5.761  1.00 42.52 ? 15   VAL A O   1 
ATOM   87   C  CB  A VAL A 1 15  ? 75.857  50.857 -3.569  0.50 39.40 ? 15   VAL A CB  1 
ATOM   88   C  CB  B VAL A 1 15  ? 76.099  50.966 -3.624  0.50 39.04 ? 15   VAL A CB  1 
ATOM   89   C  CG1 A VAL A 1 15  ? 76.888  49.909 -2.999  0.50 39.01 ? 15   VAL A CG1 1 
ATOM   90   C  CG1 B VAL A 1 15  ? 76.127  52.407 -3.101  0.50 37.18 ? 15   VAL A CG1 1 
ATOM   91   C  CG2 A VAL A 1 15  ? 76.002  52.251 -2.949  0.50 37.62 ? 15   VAL A CG2 1 
ATOM   92   C  CG2 B VAL A 1 15  ? 74.989  50.163 -2.948  0.50 37.63 ? 15   VAL A CG2 1 
ATOM   93   N  N   . MET A 1 16  ? 77.258  49.076 -6.092  1.00 43.46 ? 16   MET A N   1 
ATOM   94   C  CA  . MET A 1 16  ? 77.465  47.731 -6.566  1.00 45.45 ? 16   MET A CA  1 
ATOM   95   C  C   . MET A 1 16  ? 78.338  47.038 -5.549  1.00 44.66 ? 16   MET A C   1 
ATOM   96   O  O   . MET A 1 16  ? 79.503  47.387 -5.394  1.00 44.23 ? 16   MET A O   1 
ATOM   97   C  CB  . MET A 1 16  ? 78.142  47.717 -7.933  1.00 47.92 ? 16   MET A CB  1 
ATOM   98   C  CG  . MET A 1 16  ? 78.477  46.314 -8.477  1.00 52.16 ? 16   MET A CG  1 
ATOM   99   S  SD  . MET A 1 16  ? 77.072  45.423 -9.175  1.00 62.13 ? 16   MET A SD  1 
ATOM   100  C  CE  . MET A 1 16  ? 77.011  46.120 -10.834 1.00 62.98 ? 16   MET A CE  1 
ATOM   101  N  N   . GLY A 1 17  ? 77.781  46.042 -4.865  1.00 44.56 ? 17   GLY A N   1 
ATOM   102  C  CA  . GLY A 1 17  ? 78.550  45.288 -3.908  1.00 44.92 ? 17   GLY A CA  1 
ATOM   103  C  C   . GLY A 1 17  ? 79.331  44.168 -4.558  1.00 47.11 ? 17   GLY A C   1 
ATOM   104  O  O   . GLY A 1 17  ? 79.434  44.095 -5.787  1.00 49.15 ? 17   GLY A O   1 
ATOM   105  N  N   . THR A 1 18  ? 79.869  43.280 -3.720  1.00 46.65 ? 18   THR A N   1 
ATOM   106  C  CA  . THR A 1 18  ? 80.629  42.119 -4.200  1.00 47.32 ? 18   THR A CA  1 
ATOM   107  C  C   . THR A 1 18  ? 80.285  40.841 -3.402  1.00 47.19 ? 18   THR A C   1 
ATOM   108  O  O   . THR A 1 18  ? 80.025  40.910 -2.190  1.00 46.09 ? 18   THR A O   1 
ATOM   109  C  CB  . THR A 1 18  ? 82.166  42.435 -4.215  1.00 47.20 ? 18   THR A CB  1 
ATOM   110  O  OG1 . THR A 1 18  ? 82.881  41.312 -4.726  1.00 49.17 ? 18   THR A OG1 1 
ATOM   111  C  CG2 . THR A 1 18  ? 82.710  42.827 -2.802  1.00 43.77 ? 18   THR A CG2 1 
ATOM   112  N  N   . ARG A 1 19  ? 80.246  39.692 -4.078  1.00 48.27 ? 19   ARG A N   1 
ATOM   113  C  CA  A ARG A 1 19  ? 79.999  38.421 -3.405  0.50 48.63 ? 19   ARG A CA  1 
ATOM   114  C  CA  B ARG A 1 19  ? 80.007  38.410 -3.421  0.50 48.61 ? 19   ARG A CA  1 
ATOM   115  C  C   . ARG A 1 19  ? 81.294  37.943 -2.771  1.00 48.37 ? 19   ARG A C   1 
ATOM   116  O  O   . ARG A 1 19  ? 82.294  37.780 -3.452  1.00 49.64 ? 19   ARG A O   1 
ATOM   117  C  CB  A ARG A 1 19  ? 79.433  37.369 -4.381  0.50 50.94 ? 19   ARG A CB  1 
ATOM   118  C  CB  B ARG A 1 19  ? 79.522  37.353 -4.430  0.50 50.91 ? 19   ARG A CB  1 
ATOM   119  C  CG  A ARG A 1 19  ? 78.733  36.202 -3.696  0.50 50.83 ? 19   ARG A CG  1 
ATOM   120  C  CG  B ARG A 1 19  ? 78.773  36.205 -3.787  0.50 50.59 ? 19   ARG A CG  1 
ATOM   121  C  CD  A ARG A 1 19  ? 77.741  35.491 -4.624  0.50 52.44 ? 19   ARG A CD  1 
ATOM   122  C  CD  B ARG A 1 19  ? 78.715  34.960 -4.672  0.50 52.28 ? 19   ARG A CD  1 
ATOM   123  N  NE  A ARG A 1 19  ? 77.198  34.264 -4.042  0.50 51.35 ? 19   ARG A NE  1 
ATOM   124  N  NE  B ARG A 1 19  ? 77.772  33.982 -4.143  0.50 50.71 ? 19   ARG A NE  1 
ATOM   125  C  CZ  A ARG A 1 19  ? 76.104  34.203 -3.285  0.50 50.53 ? 19   ARG A CZ  1 
ATOM   126  C  CZ  B ARG A 1 19  ? 77.677  32.726 -4.566  0.50 53.06 ? 19   ARG A CZ  1 
ATOM   127  N  NH1 A ARG A 1 19  ? 75.423  35.307 -2.999  0.50 47.62 ? 19   ARG A NH1 1 
ATOM   128  N  NH1 B ARG A 1 19  ? 78.482  32.285 -5.523  0.50 54.19 ? 19   ARG A NH1 1 
ATOM   129  N  NH2 A ARG A 1 19  ? 75.689  33.029 -2.811  0.50 51.42 ? 19   ARG A NH2 1 
ATOM   130  N  NH2 B ARG A 1 19  ? 76.779  31.908 -4.022  0.50 52.06 ? 19   ARG A NH2 1 
ATOM   131  N  N   . VAL A 1 20  ? 81.272  37.747 -1.452  1.00 47.39 ? 20   VAL A N   1 
ATOM   132  C  CA  . VAL A 1 20  ? 82.476  37.350 -0.719  1.00 47.87 ? 20   VAL A CA  1 
ATOM   133  C  C   . VAL A 1 20  ? 82.381  35.929 -0.154  1.00 49.23 ? 20   VAL A C   1 
ATOM   134  O  O   . VAL A 1 20  ? 81.304  35.494 0.261   1.00 49.40 ? 20   VAL A O   1 
ATOM   135  C  CB  . VAL A 1 20  ? 82.835  38.336 0.428   1.00 45.33 ? 20   VAL A CB  1 
ATOM   136  C  CG1 . VAL A 1 20  ? 83.147  39.701 -0.141  1.00 46.23 ? 20   VAL A CG1 1 
ATOM   137  C  CG2 . VAL A 1 20  ? 81.709  38.467 1.415   1.00 44.92 ? 20   VAL A CG2 1 
ATOM   138  N  N   . PRO A 1 21  ? 83.511  35.199 -0.124  1.00 50.45 ? 21   PRO A N   1 
ATOM   139  C  CA  . PRO A 1 21  ? 83.372  33.883 0.494   1.00 51.94 ? 21   PRO A CA  1 
ATOM   140  C  C   . PRO A 1 21  ? 83.453  33.985 2.024   1.00 50.01 ? 21   PRO A C   1 
ATOM   141  O  O   . PRO A 1 21  ? 84.139  34.861 2.561   1.00 48.78 ? 21   PRO A O   1 
ATOM   142  C  CB  . PRO A 1 21  ? 84.553  33.084 -0.085  1.00 53.87 ? 21   PRO A CB  1 
ATOM   143  C  CG  . PRO A 1 21  ? 85.350  34.089 -0.952  1.00 54.48 ? 21   PRO A CG  1 
ATOM   144  C  CD  . PRO A 1 21  ? 84.885  35.455 -0.588  1.00 50.21 ? 21   PRO A CD  1 
ATOM   145  N  N   . VAL A 1 22  ? 82.736  33.101 2.705   1.00 50.43 ? 22   VAL A N   1 
ATOM   146  C  CA  . VAL A 1 22  ? 82.711  33.041 4.169   1.00 48.71 ? 22   VAL A CA  1 
ATOM   147  C  C   . VAL A 1 22  ? 82.388  31.588 4.587   1.00 50.40 ? 22   VAL A C   1 
ATOM   148  O  O   . VAL A 1 22  ? 81.390  31.027 4.141   1.00 51.38 ? 22   VAL A O   1 
ATOM   149  C  CB  . VAL A 1 22  ? 81.698  34.103 4.756   1.00 46.73 ? 22   VAL A CB  1 
ATOM   150  C  CG1 . VAL A 1 22  ? 80.282  33.885 4.237   1.00 46.51 ? 22   VAL A CG1 1 
ATOM   151  C  CG2 . VAL A 1 22  ? 81.719  34.133 6.289   1.00 45.81 ? 22   VAL A CG2 1 
ATOM   152  N  N   . LEU A 1 23  ? 83.263  30.970 5.384   1.00 51.06 ? 23   LEU A N   1 
ATOM   153  C  CA  . LEU A 1 23  ? 83.071  29.590 5.910   1.00 52.90 ? 23   LEU A CA  1 
ATOM   154  C  C   . LEU A 1 23  ? 82.302  28.560 5.011   1.00 55.86 ? 23   LEU A C   1 
ATOM   155  O  O   . LEU A 1 23  ? 81.257  27.994 5.411   1.00 56.83 ? 23   LEU A O   1 
ATOM   156  C  CB  . LEU A 1 23  ? 82.457  29.635 7.319   1.00 51.38 ? 23   LEU A CB  1 
ATOM   157  C  CG  . LEU A 1 23  ? 82.940  30.714 8.293   1.00 49.70 ? 23   LEU A CG  1 
ATOM   158  C  CD1 . LEU A 1 23  ? 82.010  30.795 9.502   1.00 48.47 ? 23   LEU A CD1 1 
ATOM   159  C  CD2 . LEU A 1 23  ? 84.414  30.529 8.718   1.00 48.99 ? 23   LEU A CD2 1 
ATOM   160  N  N   . SER A 1 24  ? 82.848  28.285 3.826   1.00 57.47 ? 24   SER A N   1 
ATOM   161  C  CA  . SER A 1 24  ? 82.220  27.378 2.833   1.00 60.61 ? 24   SER A CA  1 
ATOM   162  C  C   . SER A 1 24  ? 80.800  27.796 2.453   1.00 60.16 ? 24   SER A C   1 
ATOM   163  O  O   . SER A 1 24  ? 79.911  26.946 2.314   1.00 62.79 ? 24   SER A O   1 
ATOM   164  C  CB  . SER A 1 24  ? 82.210  25.892 3.277   1.00 63.30 ? 24   SER A CB  1 
ATOM   165  O  OG  . SER A 1 24  ? 82.921  25.676 4.480   1.00 63.79 ? 24   SER A OG  1 
ATOM   166  N  N   . SER A 1 25  ? 80.606  29.105 2.290   1.00 57.69 ? 25   SER A N   1 
ATOM   167  C  CA  . SER A 1 25  ? 79.352  29.705 1.827   1.00 56.64 ? 25   SER A CA  1 
ATOM   168  C  C   . SER A 1 25  ? 79.683  31.122 1.326   1.00 54.70 ? 25   SER A C   1 
ATOM   169  O  O   . SER A 1 25  ? 80.857  31.469 1.177   1.00 54.55 ? 25   SER A O   1 
ATOM   170  C  CB  . SER A 1 25  ? 78.309  29.724 2.951   1.00 55.71 ? 25   SER A CB  1 
ATOM   171  O  OG  . SER A 1 25  ? 77.003  29.969 2.453   1.00 54.34 ? 25   SER A OG  1 
ATOM   172  N  N   . HIS A 1 26  ? 78.676  31.945 1.058   1.00 53.55 ? 26   HIS A N   1 
ATOM   173  C  CA  . HIS A 1 26  ? 78.946  33.293 0.541   1.00 52.07 ? 26   HIS A CA  1 
ATOM   174  C  C   . HIS A 1 26  ? 78.020  34.317 1.169   1.00 49.74 ? 26   HIS A C   1 
ATOM   175  O  O   . HIS A 1 26  ? 76.992  33.954 1.737   1.00 50.39 ? 26   HIS A O   1 
ATOM   176  C  CB  . HIS A 1 26  ? 78.826  33.342 -0.994  1.00 53.64 ? 26   HIS A CB  1 
ATOM   177  C  CG  . HIS A 1 26  ? 79.769  32.421 -1.707  1.00 57.42 ? 26   HIS A CG  1 
ATOM   178  N  ND1 . HIS A 1 26  ? 79.540  31.062 -1.824  1.00 61.65 ? 26   HIS A ND1 1 
ATOM   179  C  CD2 . HIS A 1 26  ? 80.937  32.661 -2.352  1.00 58.40 ? 26   HIS A CD2 1 
ATOM   180  C  CE1 . HIS A 1 26  ? 80.534  30.506 -2.497  1.00 63.42 ? 26   HIS A CE1 1 
ATOM   181  N  NE2 . HIS A 1 26  ? 81.396  31.453 -2.826  1.00 60.90 ? 26   HIS A NE2 1 
ATOM   182  N  N   . ILE A 1 27  ? 78.400  35.590 1.101   1.00 47.30 ? 27   ILE A N   1 
ATOM   183  C  CA  . ILE A 1 27  ? 77.417  36.679 1.252   1.00 45.30 ? 27   ILE A CA  1 
ATOM   184  C  C   . ILE A 1 27  ? 77.780  37.994 0.555   1.00 42.95 ? 27   ILE A C   1 
ATOM   185  O  O   . ILE A 1 27  ? 78.799  38.096 -0.121  1.00 43.51 ? 27   ILE A O   1 
ATOM   186  C  CB  . ILE A 1 27  ? 76.962  36.941 2.720   1.00 44.31 ? 27   ILE A CB  1 
ATOM   187  C  CG1 . ILE A 1 27  ? 78.108  37.422 3.591   1.00 41.56 ? 27   ILE A CG1 1 
ATOM   188  C  CG2 . ILE A 1 27  ? 76.153  35.693 3.306   1.00 46.49 ? 27   ILE A CG2 1 
ATOM   189  C  CD1 . ILE A 1 27  ? 77.586  37.931 4.903   1.00 42.34 ? 27   ILE A CD1 1 
ATOM   190  N  N   . SER A 1 28  ? 76.912  38.975 0.719   1.00 40.47 ? 28   SER A N   1 
ATOM   191  C  CA  . SER A 1 28  ? 77.052  40.255 0.052   1.00 39.37 ? 28   SER A CA  1 
ATOM   192  C  C   . SER A 1 28  ? 77.816  41.263 0.892   1.00 36.86 ? 28   SER A C   1 
ATOM   193  O  O   . SER A 1 28  ? 77.505  41.471 2.069   1.00 35.44 ? 28   SER A O   1 
ATOM   194  C  CB  . SER A 1 28  ? 75.684  40.801 -0.312  1.00 39.37 ? 28   SER A CB  1 
ATOM   195  O  OG  . SER A 1 28  ? 75.026  39.905 -1.186  1.00 39.78 ? 28   SER A OG  1 
ATOM   196  N  N   . ALA A 1 29  ? 78.827  41.867 0.281   1.00 35.47 ? 29   ALA A N   1 
ATOM   197  C  CA  . ALA A 1 29  ? 79.561  42.924 0.944   1.00 33.79 ? 29   ALA A CA  1 
ATOM   198  C  C   . ALA A 1 29  ? 79.524  44.203 0.110   1.00 34.09 ? 29   ALA A C   1 
ATOM   199  O  O   . ALA A 1 29  ? 79.751  44.179 -1.110  1.00 35.10 ? 29   ALA A O   1 
ATOM   200  C  CB  . ALA A 1 29  ? 80.985  42.521 1.234   1.00 33.27 ? 29   ALA A CB  1 
ATOM   201  N  N   . PHE A 1 30  ? 79.217  45.303 0.791   1.00 31.94 ? 30   PHE A N   1 
ATOM   202  C  CA  . PHE A 1 30  ? 79.184  46.628 0.175   1.00 32.29 ? 30   PHE A CA  1 
ATOM   203  C  C   . PHE A 1 30  ? 80.186  47.473 0.963   1.00 30.84 ? 30   PHE A C   1 
ATOM   204  O  O   . PHE A 1 30  ? 79.911  47.869 2.099   1.00 29.42 ? 30   PHE A O   1 
ATOM   205  C  CB  . PHE A 1 30  ? 77.779  47.219 0.296   1.00 32.13 ? 30   PHE A CB  1 
ATOM   206  C  CG  . PHE A 1 30  ? 76.713  46.408 -0.388  1.00 31.96 ? 30   PHE A CG  1 
ATOM   207  C  CD1 . PHE A 1 30  ? 76.415  46.623 -1.723  1.00 29.84 ? 30   PHE A CD1 1 
ATOM   208  C  CD2 . PHE A 1 30  ? 76.010  45.423 0.304   1.00 32.25 ? 30   PHE A CD2 1 
ATOM   209  C  CE1 . PHE A 1 30  ? 75.437  45.881 -2.351  1.00 32.92 ? 30   PHE A CE1 1 
ATOM   210  C  CE2 . PHE A 1 30  ? 75.021  44.676 -0.342  1.00 31.53 ? 30   PHE A CE2 1 
ATOM   211  C  CZ  . PHE A 1 30  ? 74.750  44.908 -1.658  1.00 31.73 ? 30   PHE A CZ  1 
ATOM   212  N  N   . LEU A 1 31  ? 81.368  47.652 0.396   1.00 30.91 ? 31   LEU A N   1 
ATOM   213  C  CA  . LEU A 1 31  ? 82.484  48.236 1.112   1.00 29.95 ? 31   LEU A CA  1 
ATOM   214  C  C   . LEU A 1 31  ? 82.782  49.643 0.635   1.00 29.82 ? 31   LEU A C   1 
ATOM   215  O  O   . LEU A 1 31  ? 82.779  49.927 -0.569  1.00 31.08 ? 31   LEU A O   1 
ATOM   216  C  CB  . LEU A 1 31  ? 83.733  47.360 0.953   1.00 29.96 ? 31   LEU A CB  1 
ATOM   217  C  CG  . LEU A 1 31  ? 83.608  45.853 1.304   1.00 30.34 ? 31   LEU A CG  1 
ATOM   218  C  CD1 . LEU A 1 31  ? 84.865  45.119 0.852   1.00 30.01 ? 31   LEU A CD1 1 
ATOM   219  C  CD2 . LEU A 1 31  ? 83.335  45.593 2.794   1.00 26.25 ? 31   LEU A CD2 1 
ATOM   220  N  N   . GLY A 1 32  ? 83.073  50.525 1.583   1.00 29.60 ? 32   GLY A N   1 
ATOM   221  C  CA  . GLY A 1 32  ? 83.451  51.927 1.239   1.00 28.87 ? 32   GLY A CA  1 
ATOM   222  C  C   . GLY A 1 32  ? 82.309  52.716 0.645   1.00 29.18 ? 32   GLY A C   1 
ATOM   223  O  O   . GLY A 1 32  ? 82.472  53.303 -0.400  1.00 31.73 ? 32   GLY A O   1 
ATOM   224  N  N   . ILE A 1 33  ? 81.137  52.687 1.283   1.00 28.22 ? 33   ILE A N   1 
ATOM   225  C  CA  . ILE A 1 33  ? 79.985  53.441 0.834   1.00 28.78 ? 33   ILE A CA  1 
ATOM   226  C  C   . ILE A 1 33  ? 80.087  54.809 1.469   1.00 27.68 ? 33   ILE A C   1 
ATOM   227  O  O   . ILE A 1 33  ? 80.182  54.903 2.683   1.00 26.78 ? 33   ILE A O   1 
ATOM   228  C  CB  . ILE A 1 33  ? 78.618  52.776 1.240   1.00 29.21 ? 33   ILE A CB  1 
ATOM   229  C  CG1 . ILE A 1 33  ? 78.345  51.534 0.378   1.00 31.79 ? 33   ILE A CG1 1 
ATOM   230  C  CG2 . ILE A 1 33  ? 77.435  53.743 1.011   1.00 29.59 ? 33   ILE A CG2 1 
ATOM   231  C  CD1 . ILE A 1 33  ? 77.350  50.584 0.963   1.00 32.44 ? 33   ILE A CD1 1 
ATOM   232  N  N   . PRO A 1 34  ? 80.082  55.875 0.663   1.00 28.17 ? 34   PRO A N   1 
ATOM   233  C  CA  . PRO A 1 34  ? 80.180  57.242 1.231   1.00 27.62 ? 34   PRO A CA  1 
ATOM   234  C  C   . PRO A 1 34  ? 78.928  57.667 2.012   1.00 27.24 ? 34   PRO A C   1 
ATOM   235  O  O   . PRO A 1 34  ? 77.830  57.641 1.473   1.00 28.27 ? 34   PRO A O   1 
ATOM   236  C  CB  . PRO A 1 34  ? 80.367  58.126 -0.005  1.00 28.35 ? 34   PRO A CB  1 
ATOM   237  C  CG  . PRO A 1 34  ? 79.758  57.348 -1.145  1.00 30.17 ? 34   PRO A CG  1 
ATOM   238  C  CD  . PRO A 1 34  ? 79.836  55.875 -0.794  1.00 30.03 ? 34   PRO A CD  1 
ATOM   239  N  N   . PHE A 1 35  ? 79.069  58.041 3.275   1.00 26.91 ? 35   PHE A N   1 
ATOM   240  C  CA  . PHE A 1 35  ? 77.912  58.608 4.005   1.00 27.79 ? 35   PHE A CA  1 
ATOM   241  C  C   . PHE A 1 35  ? 77.998  60.136 4.205   1.00 28.45 ? 35   PHE A C   1 
ATOM   242  O  O   . PHE A 1 35  ? 77.045  60.776 4.671   1.00 29.84 ? 35   PHE A O   1 
ATOM   243  C  CB  . PHE A 1 35  ? 77.628  57.852 5.312   1.00 26.45 ? 35   PHE A CB  1 
ATOM   244  C  CG  . PHE A 1 35  ? 78.709  58.005 6.375   1.00 26.65 ? 35   PHE A CG  1 
ATOM   245  C  CD1 . PHE A 1 35  ? 78.692  59.079 7.265   1.00 25.74 ? 35   PHE A CD1 1 
ATOM   246  C  CD2 . PHE A 1 35  ? 79.741  57.090 6.473   1.00 24.32 ? 35   PHE A CD2 1 
ATOM   247  C  CE1 . PHE A 1 35  ? 79.692  59.225 8.238   1.00 26.35 ? 35   PHE A CE1 1 
ATOM   248  C  CE2 . PHE A 1 35  ? 80.733  57.232 7.439   1.00 24.03 ? 35   PHE A CE2 1 
ATOM   249  C  CZ  . PHE A 1 35  ? 80.718  58.278 8.315   1.00 23.55 ? 35   PHE A CZ  1 
ATOM   250  N  N   . ALA A 1 36  ? 79.114  60.749 3.811   1.00 29.02 ? 36   ALA A N   1 
ATOM   251  C  CA  . ALA A 1 36  ? 79.255  62.215 4.002   1.00 29.24 ? 36   ALA A CA  1 
ATOM   252  C  C   . ALA A 1 36  ? 80.103  62.821 2.910   1.00 30.84 ? 36   ALA A C   1 
ATOM   253  O  O   . ALA A 1 36  ? 80.860  62.104 2.252   1.00 31.19 ? 36   ALA A O   1 
ATOM   254  C  CB  . ALA A 1 36  ? 79.881  62.510 5.373   1.00 27.01 ? 36   ALA A CB  1 
ATOM   255  N  N   . GLU A 1 37  ? 79.993  64.136 2.711   1.00 32.31 ? 37   GLU A N   1 
ATOM   256  C  CA  . GLU A 1 37  ? 80.973  64.842 1.884   1.00 33.78 ? 37   GLU A CA  1 
ATOM   257  C  C   . GLU A 1 37  ? 82.383  64.652 2.502   1.00 33.25 ? 37   GLU A C   1 
ATOM   258  O  O   . GLU A 1 37  ? 82.506  64.588 3.744   1.00 32.59 ? 37   GLU A O   1 
ATOM   259  C  CB  . GLU A 1 37  ? 80.623  66.335 1.762   1.00 36.03 ? 37   GLU A CB  1 
ATOM   260  C  CG  . GLU A 1 37  ? 79.433  66.650 0.834   1.00 36.80 ? 37   GLU A CG  1 
ATOM   261  C  CD  . GLU A 1 37  ? 79.692  66.162 -0.562  1.00 40.27 ? 37   GLU A CD  1 
ATOM   262  O  OE1 . GLU A 1 37  ? 80.546  66.737 -1.271  1.00 42.66 ? 37   GLU A OE1 1 
ATOM   263  O  OE2 . GLU A 1 37  ? 79.056  65.178 -0.962  1.00 42.71 ? 37   GLU A OE2 1 
ATOM   264  N  N   . PRO A 1 38  ? 83.435  64.524 1.659   1.00 33.33 ? 38   PRO A N   1 
ATOM   265  C  CA  . PRO A 1 38  ? 84.788  64.495 2.232   1.00 32.46 ? 38   PRO A CA  1 
ATOM   266  C  C   . PRO A 1 38  ? 85.092  65.778 3.023   1.00 33.34 ? 38   PRO A C   1 
ATOM   267  O  O   . PRO A 1 38  ? 84.954  66.871 2.486   1.00 34.38 ? 38   PRO A O   1 
ATOM   268  C  CB  . PRO A 1 38  ? 85.699  64.405 1.004   1.00 33.35 ? 38   PRO A CB  1 
ATOM   269  C  CG  . PRO A 1 38  ? 84.832  63.885 -0.108  1.00 34.93 ? 38   PRO A CG  1 
ATOM   270  C  CD  . PRO A 1 38  ? 83.445  64.409 0.184   1.00 34.33 ? 38   PRO A CD  1 
ATOM   271  N  N   . PRO A 1 39  ? 85.506  65.640 4.295   1.00 32.77 ? 39   PRO A N   1 
ATOM   272  C  CA  . PRO A 1 39  ? 85.744  66.768 5.172   1.00 32.84 ? 39   PRO A CA  1 
ATOM   273  C  C   . PRO A 1 39  ? 87.158  67.302 5.006   1.00 34.47 ? 39   PRO A C   1 
ATOM   274  O  O   . PRO A 1 39  ? 87.964  67.306 5.965   1.00 33.42 ? 39   PRO A O   1 
ATOM   275  C  CB  . PRO A 1 39  ? 85.517  66.175 6.563   1.00 31.53 ? 39   PRO A CB  1 
ATOM   276  C  CG  . PRO A 1 39  ? 85.880  64.742 6.425   1.00 31.04 ? 39   PRO A CG  1 
ATOM   277  C  CD  . PRO A 1 39  ? 85.653  64.343 4.992   1.00 31.07 ? 39   PRO A CD  1 
ATOM   278  N  N   . VAL A 1 40  ? 87.433  67.786 3.795   1.00 35.71 ? 40   VAL A N   1 
ATOM   279  C  CA  . VAL A 1 40  ? 88.753  68.167 3.385   1.00 36.36 ? 40   VAL A CA  1 
ATOM   280  C  C   . VAL A 1 40  ? 88.796  69.679 3.118   1.00 38.36 ? 40   VAL A C   1 
ATOM   281  O  O   . VAL A 1 40  ? 87.750  70.314 3.015   1.00 38.70 ? 40   VAL A O   1 
ATOM   282  C  CB  . VAL A 1 40  ? 89.150  67.383 2.123   1.00 37.55 ? 40   VAL A CB  1 
ATOM   283  C  CG1 . VAL A 1 40  ? 89.164  65.843 2.393   1.00 36.37 ? 40   VAL A CG1 1 
ATOM   284  C  CG2 . VAL A 1 40  ? 88.199  67.727 0.927   1.00 38.43 ? 40   VAL A CG2 1 
ATOM   285  N  N   . GLY A 1 41  ? 89.995  70.246 2.992   1.00 38.77 ? 41   GLY A N   1 
ATOM   286  C  CA  . GLY A 1 41  ? 90.143  71.673 2.623   1.00 41.66 ? 41   GLY A CA  1 
ATOM   287  C  C   . GLY A 1 41  ? 89.573  72.581 3.697   1.00 41.80 ? 41   GLY A C   1 
ATOM   288  O  O   . GLY A 1 41  ? 89.941  72.487 4.878   1.00 40.54 ? 41   GLY A O   1 
ATOM   289  N  N   . ASN A 1 42  ? 88.639  73.433 3.313   1.00 43.38 ? 42   ASN A N   1 
ATOM   290  C  CA  . ASN A 1 42  ? 88.046  74.362 4.292   1.00 44.31 ? 42   ASN A CA  1 
ATOM   291  C  C   . ASN A 1 42  ? 87.065  73.667 5.246   1.00 41.82 ? 42   ASN A C   1 
ATOM   292  O  O   . ASN A 1 42  ? 86.585  74.242 6.227   1.00 41.83 ? 42   ASN A O   1 
ATOM   293  C  CB  . ASN A 1 42  ? 87.530  75.692 3.634   1.00 46.96 ? 42   ASN A CB  1 
ATOM   294  C  CG  . ASN A 1 42  ? 86.163  75.565 2.916   1.00 50.27 ? 42   ASN A CG  1 
ATOM   295  O  OD1 . ASN A 1 42  ? 85.259  74.880 3.389   1.00 54.88 ? 42   ASN A OD1 1 
ATOM   296  N  ND2 . ASN A 1 42  ? 86.000  76.292 1.791   1.00 55.17 ? 42   ASN A ND2 1 
ATOM   297  N  N   . MET A 1 43  ? 86.826  72.392 4.978   1.00 40.16 ? 43   MET A N   1 
ATOM   298  C  CA  A MET A 1 43  ? 85.882  71.585 5.737   0.50 37.93 ? 43   MET A CA  1 
ATOM   299  C  CA  B MET A 1 43  ? 85.875  71.653 5.785   0.50 38.98 ? 43   MET A CA  1 
ATOM   300  C  C   . MET A 1 43  ? 86.568  70.863 6.897   1.00 36.84 ? 43   MET A C   1 
ATOM   301  O  O   . MET A 1 43  ? 85.907  70.239 7.737   1.00 36.22 ? 43   MET A O   1 
ATOM   302  C  CB  A MET A 1 43  ? 85.209  70.559 4.818   0.50 37.53 ? 43   MET A CB  1 
ATOM   303  C  CB  B MET A 1 43  ? 85.018  70.751 4.903   0.50 39.34 ? 43   MET A CB  1 
ATOM   304  C  CG  A MET A 1 43  ? 84.254  71.129 3.775   0.50 36.51 ? 43   MET A CG  1 
ATOM   305  C  CG  B MET A 1 43  ? 83.532  70.817 5.227   0.50 41.74 ? 43   MET A CG  1 
ATOM   306  S  SD  A MET A 1 43  ? 83.121  69.858 3.149   0.50 35.03 ? 43   MET A SD  1 
ATOM   307  S  SD  B MET A 1 43  ? 82.658  71.854 4.064   0.50 49.80 ? 43   MET A SD  1 
ATOM   308  C  CE  A MET A 1 43  ? 82.159  69.525 4.617   0.50 30.39 ? 43   MET A CE  1 
ATOM   309  C  CE  B MET A 1 43  ? 82.788  73.478 4.825   0.50 49.20 ? 43   MET A CE  1 
ATOM   310  N  N   . ARG A 1 44  ? 87.900  70.905 6.946   1.00 36.19 ? 44   ARG A N   1 
ATOM   311  C  CA  . ARG A 1 44  ? 88.601  70.237 8.057   1.00 33.75 ? 44   ARG A CA  1 
ATOM   312  C  C   . ARG A 1 44  ? 88.096  70.850 9.379   1.00 32.53 ? 44   ARG A C   1 
ATOM   313  O  O   . ARG A 1 44  ? 87.921  72.038 9.454   1.00 32.79 ? 44   ARG A O   1 
ATOM   314  C  CB  . ARG A 1 44  ? 90.137  70.345 7.914   1.00 33.82 ? 44   ARG A CB  1 
ATOM   315  C  CG  . ARG A 1 44  ? 90.934  69.665 9.066   1.00 31.73 ? 44   ARG A CG  1 
ATOM   316  C  CD  . ARG A 1 44  ? 92.430  69.969 9.004   1.00 29.51 ? 44   ARG A CD  1 
ATOM   317  N  NE  . ARG A 1 44  ? 93.083  69.338 7.854   1.00 31.59 ? 44   ARG A NE  1 
ATOM   318  C  CZ  . ARG A 1 44  ? 94.326  69.608 7.450   1.00 34.72 ? 44   ARG A CZ  1 
ATOM   319  N  NH1 . ARG A 1 44  ? 95.064  70.500 8.088   1.00 34.81 ? 44   ARG A NH1 1 
ATOM   320  N  NH2 . ARG A 1 44  ? 94.836  68.995 6.395   1.00 35.52 ? 44   ARG A NH2 1 
ATOM   321  N  N   . PHE A 1 45  ? 87.811  70.015 10.387  1.00 31.22 ? 45   PHE A N   1 
ATOM   322  C  CA  . PHE A 1 45  ? 87.289  70.462 11.723  1.00 31.27 ? 45   PHE A CA  1 
ATOM   323  C  C   . PHE A 1 45  ? 85.787  70.784 11.824  1.00 31.87 ? 45   PHE A C   1 
ATOM   324  O  O   . PHE A 1 45  ? 85.272  70.922 12.933  1.00 31.36 ? 45   PHE A O   1 
ATOM   325  C  CB  . PHE A 1 45  ? 88.071  71.663 12.298  1.00 31.49 ? 45   PHE A CB  1 
ATOM   326  C  CG  . PHE A 1 45  ? 89.566  71.477 12.312  1.00 31.17 ? 45   PHE A CG  1 
ATOM   327  C  CD1 . PHE A 1 45  ? 90.141  70.322 12.838  1.00 27.86 ? 45   PHE A CD1 1 
ATOM   328  C  CD2 . PHE A 1 45  ? 90.399  72.452 11.791  1.00 28.92 ? 45   PHE A CD2 1 
ATOM   329  C  CE1 . PHE A 1 45  ? 91.546  70.161 12.852  1.00 28.49 ? 45   PHE A CE1 1 
ATOM   330  C  CE2 . PHE A 1 45  ? 91.791  72.316 11.819  1.00 28.78 ? 45   PHE A CE2 1 
ATOM   331  C  CZ  . PHE A 1 45  ? 92.373  71.152 12.351  1.00 26.22 ? 45   PHE A CZ  1 
ATOM   332  N  N   . ARG A 1 46  ? 85.105  70.917 10.685  1.00 33.36 ? 46   ARG A N   1 
ATOM   333  C  CA  . ARG A 1 46  ? 83.693  71.255 10.655  1.00 35.40 ? 46   ARG A CA  1 
ATOM   334  C  C   . ARG A 1 46  ? 82.779  70.035 10.755  1.00 34.89 ? 46   ARG A C   1 
ATOM   335  O  O   . ARG A 1 46  ? 83.178  68.893 10.450  1.00 33.41 ? 46   ARG A O   1 
ATOM   336  C  CB  . ARG A 1 46  ? 83.375  72.032 9.382   1.00 37.81 ? 46   ARG A CB  1 
ATOM   337  C  CG  . ARG A 1 46  ? 84.072  73.436 9.321   1.00 43.79 ? 46   ARG A CG  1 
ATOM   338  C  CD  . ARG A 1 46  ? 83.609  74.266 8.137   1.00 49.81 ? 46   ARG A CD  1 
ATOM   339  N  NE  . ARG A 1 46  ? 82.164  74.490 8.197   1.00 57.24 ? 46   ARG A NE  1 
ATOM   340  C  CZ  . ARG A 1 46  ? 81.588  75.691 8.326   1.00 62.53 ? 46   ARG A CZ  1 
ATOM   341  N  NH1 . ARG A 1 46  ? 82.329  76.809 8.384   1.00 62.26 ? 46   ARG A NH1 1 
ATOM   342  N  NH2 . ARG A 1 46  ? 80.259  75.775 8.384   1.00 63.31 ? 46   ARG A NH2 1 
ATOM   343  N  N   . ARG A 1 47  ? 81.546  70.282 11.186  1.00 35.98 ? 47   ARG A N   1 
ATOM   344  C  CA  . ARG A 1 47  ? 80.498  69.270 11.171  1.00 36.23 ? 47   ARG A CA  1 
ATOM   345  C  C   . ARG A 1 47  ? 80.424  68.643 9.788   1.00 35.43 ? 47   ARG A C   1 
ATOM   346  O  O   . ARG A 1 47  ? 80.589  69.332 8.798   1.00 35.07 ? 47   ARG A O   1 
ATOM   347  C  CB  . ARG A 1 47  ? 79.142  69.902 11.532  1.00 38.81 ? 47   ARG A CB  1 
ATOM   348  C  CG  . ARG A 1 47  ? 79.160  70.646 12.885  1.00 42.91 ? 47   ARG A CG  1 
ATOM   349  C  CD  . ARG A 1 47  ? 77.863  71.397 13.139  1.00 52.01 ? 47   ARG A CD  1 
ATOM   350  N  NE  . ARG A 1 47  ? 78.026  72.467 14.135  1.00 58.14 ? 47   ARG A NE  1 
ATOM   351  C  CZ  . ARG A 1 47  ? 77.916  72.302 15.457  1.00 59.27 ? 47   ARG A CZ  1 
ATOM   352  N  NH1 . ARG A 1 47  ? 77.648  71.107 15.976  1.00 58.12 ? 47   ARG A NH1 1 
ATOM   353  N  NH2 . ARG A 1 47  ? 78.071  73.345 16.264  1.00 61.97 ? 47   ARG A NH2 1 
ATOM   354  N  N   . PRO A 1 48  ? 80.186  67.315 9.723   1.00 34.42 ? 48   PRO A N   1 
ATOM   355  C  CA  . PRO A 1 48  ? 79.993  66.642 8.456   1.00 34.16 ? 48   PRO A CA  1 
ATOM   356  C  C   . PRO A 1 48  ? 78.752  67.184 7.734   1.00 35.67 ? 48   PRO A C   1 
ATOM   357  O  O   . PRO A 1 48  ? 77.803  67.624 8.379   1.00 34.74 ? 48   PRO A O   1 
ATOM   358  C  CB  . PRO A 1 48  ? 79.780  65.183 8.866   1.00 33.16 ? 48   PRO A CB  1 
ATOM   359  C  CG  . PRO A 1 48  ? 79.227  65.255 10.229  1.00 33.35 ? 48   PRO A CG  1 
ATOM   360  C  CD  . PRO A 1 48  ? 79.950  66.406 10.859  1.00 33.56 ? 48   PRO A CD  1 
ATOM   361  N  N   . GLU A 1 49  ? 78.816  67.212 6.401   1.00 37.43 ? 49   GLU A N   1 
ATOM   362  C  CA  . GLU A 1 49  ? 77.660  67.492 5.544   1.00 39.37 ? 49   GLU A CA  1 
ATOM   363  C  C   . GLU A 1 49  ? 77.242  66.163 4.908   1.00 38.18 ? 49   GLU A C   1 
ATOM   364  O  O   . GLU A 1 49  ? 78.106  65.343 4.569   1.00 36.78 ? 49   GLU A O   1 
ATOM   365  C  CB  . GLU A 1 49  ? 78.012  68.490 4.435   1.00 41.01 ? 49   GLU A CB  1 
ATOM   366  C  CG  . GLU A 1 49  ? 78.331  69.938 4.871   1.00 47.51 ? 49   GLU A CG  1 
ATOM   367  C  CD  . GLU A 1 49  ? 77.212  70.617 5.670   1.00 53.70 ? 49   GLU A CD  1 
ATOM   368  O  OE1 . GLU A 1 49  ? 76.023  70.364 5.374   1.00 57.19 ? 49   GLU A OE1 1 
ATOM   369  O  OE2 . GLU A 1 49  ? 77.524  71.412 6.593   1.00 56.58 ? 49   GLU A OE2 1 
ATOM   370  N  N   . PRO A 1 50  ? 75.931  65.944 4.731   1.00 38.77 ? 50   PRO A N   1 
ATOM   371  C  CA  . PRO A 1 50  ? 75.535  64.719 4.032   1.00 38.66 ? 50   PRO A CA  1 
ATOM   372  C  C   . PRO A 1 50  ? 76.135  64.615 2.616   1.00 39.61 ? 50   PRO A C   1 
ATOM   373  O  O   . PRO A 1 50  ? 76.350  65.641 1.917   1.00 39.67 ? 50   PRO A O   1 
ATOM   374  C  CB  . PRO A 1 50  ? 74.001  64.818 3.959   1.00 40.27 ? 50   PRO A CB  1 
ATOM   375  C  CG  . PRO A 1 50  ? 73.626  65.840 5.016   1.00 40.93 ? 50   PRO A CG  1 
ATOM   376  C  CD  . PRO A 1 50  ? 74.776  66.808 5.046   1.00 39.59 ? 50   PRO A CD  1 
ATOM   377  N  N   . LYS A 1 51  ? 76.398  63.366 2.222   1.00 38.82 ? 51   LYS A N   1 
ATOM   378  C  CA  . LYS A 1 51  ? 76.945  63.051 0.924   1.00 40.23 ? 51   LYS A CA  1 
ATOM   379  C  C   . LYS A 1 51  ? 75.938  63.444 -0.141  1.00 42.70 ? 51   LYS A C   1 
ATOM   380  O  O   . LYS A 1 51  ? 74.794  62.990 -0.111  1.00 43.06 ? 51   LYS A O   1 
ATOM   381  C  CB  . LYS A 1 51  ? 77.267  61.558 0.823   1.00 39.27 ? 51   LYS A CB  1 
ATOM   382  C  CG  . LYS A 1 51  ? 77.821  61.125 -0.533  1.00 39.62 ? 51   LYS A CG  1 
ATOM   383  C  CD  . LYS A 1 51  ? 79.147  61.811 -0.882  1.00 36.30 ? 51   LYS A CD  1 
ATOM   384  C  CE  . LYS A 1 51  ? 79.695  61.255 -2.183  1.00 36.07 ? 51   LYS A CE  1 
ATOM   385  N  NZ  . LYS A 1 51  ? 81.004  61.820 -2.572  1.00 34.83 ? 51   LYS A NZ  1 
ATOM   386  N  N   . LYS A 1 52  ? 76.364  64.315 -1.055  1.00 44.73 ? 52   LYS A N   1 
ATOM   387  C  CA  . LYS A 1 52  ? 75.557  64.690 -2.219  1.00 47.25 ? 52   LYS A CA  1 
ATOM   388  C  C   . LYS A 1 52  ? 75.363  63.509 -3.169  1.00 47.35 ? 52   LYS A C   1 
ATOM   389  O  O   . LYS A 1 52  ? 76.284  62.716 -3.373  1.00 46.57 ? 52   LYS A O   1 
ATOM   390  C  CB  . LYS A 1 52  ? 76.206  65.860 -2.939  1.00 48.92 ? 52   LYS A CB  1 
ATOM   391  C  CG  . LYS A 1 52  ? 75.526  67.199 -2.618  1.00 52.86 ? 52   LYS A CG  1 
ATOM   392  C  CD  . LYS A 1 52  ? 76.520  68.322 -2.303  1.00 56.32 ? 52   LYS A CD  1 
ATOM   393  C  CE  . LYS A 1 52  ? 77.621  68.422 -3.357  1.00 57.24 ? 52   LYS A CE  1 
ATOM   394  N  NZ  . LYS A 1 52  ? 78.462  69.633 -3.172  1.00 58.87 ? 52   LYS A NZ  1 
ATOM   395  N  N   . PRO A 1 53  ? 74.147  63.354 -3.713  1.00 48.43 ? 53   PRO A N   1 
ATOM   396  C  CA  . PRO A 1 53  ? 73.868  62.283 -4.682  1.00 49.15 ? 53   PRO A CA  1 
ATOM   397  C  C   . PRO A 1 53  ? 74.838  62.182 -5.870  1.00 49.87 ? 53   PRO A C   1 
ATOM   398  O  O   . PRO A 1 53  ? 75.236  63.202 -6.448  1.00 50.83 ? 53   PRO A O   1 
ATOM   399  C  CB  . PRO A 1 53  ? 72.458  62.631 -5.172  1.00 50.82 ? 53   PRO A CB  1 
ATOM   400  C  CG  . PRO A 1 53  ? 71.800  63.184 -3.946  1.00 50.38 ? 53   PRO A CG  1 
ATOM   401  C  CD  . PRO A 1 53  ? 72.900  63.922 -3.167  1.00 48.82 ? 53   PRO A CD  1 
ATOM   402  N  N   . TRP A 1 54  ? 75.206  60.953 -6.229  1.00 49.20 ? 54   TRP A N   1 
ATOM   403  C  CA  . TRP A 1 54  ? 76.022  60.717 -7.430  1.00 50.22 ? 54   TRP A CA  1 
ATOM   404  C  C   . TRP A 1 54  ? 75.176  59.965 -8.468  1.00 51.93 ? 54   TRP A C   1 
ATOM   405  O  O   . TRP A 1 54  ? 74.224  59.250 -8.112  1.00 51.71 ? 54   TRP A O   1 
ATOM   406  C  CB  . TRP A 1 54  ? 77.284  59.897 -7.084  1.00 48.63 ? 54   TRP A CB  1 
ATOM   407  C  CG  . TRP A 1 54  ? 76.937  58.535 -6.519  1.00 46.76 ? 54   TRP A CG  1 
ATOM   408  C  CD1 . TRP A 1 54  ? 76.731  57.373 -7.226  1.00 46.12 ? 54   TRP A CD1 1 
ATOM   409  C  CD2 . TRP A 1 54  ? 76.691  58.212 -5.141  1.00 42.83 ? 54   TRP A CD2 1 
ATOM   410  N  NE1 . TRP A 1 54  ? 76.393  56.351 -6.364  1.00 44.83 ? 54   TRP A NE1 1 
ATOM   411  C  CE2 . TRP A 1 54  ? 76.361  56.837 -5.083  1.00 41.82 ? 54   TRP A CE2 1 
ATOM   412  C  CE3 . TRP A 1 54  ? 76.719  58.951 -3.952  1.00 41.01 ? 54   TRP A CE3 1 
ATOM   413  C  CZ2 . TRP A 1 54  ? 76.067  56.189 -3.881  1.00 40.84 ? 54   TRP A CZ2 1 
ATOM   414  C  CZ3 . TRP A 1 54  ? 76.439  58.318 -2.766  1.00 38.43 ? 54   TRP A CZ3 1 
ATOM   415  C  CH2 . TRP A 1 54  ? 76.115  56.939 -2.732  1.00 39.24 ? 54   TRP A CH2 1 
ATOM   416  N  N   . SER A 1 55  ? 75.516  60.126 -9.743  1.00 53.85 ? 55   SER A N   1 
ATOM   417  C  CA  . SER A 1 55  ? 74.940  59.279 -10.773 1.00 55.55 ? 55   SER A CA  1 
ATOM   418  C  C   . SER A 1 55  ? 75.920  58.161 -11.146 1.00 55.34 ? 55   SER A C   1 
ATOM   419  O  O   . SER A 1 55  ? 77.087  58.180 -10.750 1.00 54.65 ? 55   SER A O   1 
ATOM   420  C  CB  . SER A 1 55  ? 74.532  60.100 -12.000 1.00 58.16 ? 55   SER A CB  1 
ATOM   421  O  OG  . SER A 1 55  ? 75.589  60.949 -12.383 1.00 58.51 ? 55   SER A OG  1 
ATOM   422  N  N   . GLY A 1 56  ? 75.435  57.187 -11.909 1.00 56.43 ? 56   GLY A N   1 
ATOM   423  C  CA  . GLY A 1 56  ? 76.204  55.981 -12.196 1.00 55.87 ? 56   GLY A CA  1 
ATOM   424  C  C   . GLY A 1 56  ? 76.302  55.125 -10.949 1.00 53.05 ? 56   GLY A C   1 
ATOM   425  O  O   . GLY A 1 56  ? 75.741  55.452 -9.907  1.00 51.58 ? 56   GLY A O   1 
ATOM   426  N  N   . VAL A 1 57  ? 77.044  54.038 -11.057 1.00 52.09 ? 57   VAL A N   1 
ATOM   427  C  CA  . VAL A 1 57  ? 77.091  53.054 -10.014 1.00 49.69 ? 57   VAL A CA  1 
ATOM   428  C  C   . VAL A 1 57  ? 78.365  53.198 -9.212  1.00 47.91 ? 57   VAL A C   1 
ATOM   429  O  O   . VAL A 1 57  ? 79.450  53.075 -9.763  1.00 48.35 ? 57   VAL A O   1 
ATOM   430  C  CB  . VAL A 1 57  ? 77.019  51.636 -10.626 1.00 51.39 ? 57   VAL A CB  1 
ATOM   431  C  CG1 . VAL A 1 57  ? 76.941  50.570 -9.538  1.00 49.56 ? 57   VAL A CG1 1 
ATOM   432  C  CG2 . VAL A 1 57  ? 75.828  51.527 -11.588 1.00 52.06 ? 57   VAL A CG2 1 
ATOM   433  N  N   . TRP A 1 58  ? 78.222  53.442 -7.907  1.00 45.78 ? 58   TRP A N   1 
ATOM   434  C  CA  . TRP A 1 58  ? 79.345  53.403 -6.959  1.00 44.82 ? 58   TRP A CA  1 
ATOM   435  C  C   . TRP A 1 58  ? 79.944  51.999 -6.825  1.00 44.80 ? 58   TRP A C   1 
ATOM   436  O  O   . TRP A 1 58  ? 79.244  51.042 -6.479  1.00 44.15 ? 58   TRP A O   1 
ATOM   437  C  CB  . TRP A 1 58  ? 78.928  53.914 -5.571  1.00 43.06 ? 58   TRP A CB  1 
ATOM   438  C  CG  . TRP A 1 58  ? 80.116  54.230 -4.716  1.00 41.58 ? 58   TRP A CG  1 
ATOM   439  C  CD1 . TRP A 1 58  ? 80.843  53.347 -3.976  1.00 40.88 ? 58   TRP A CD1 1 
ATOM   440  C  CD2 . TRP A 1 58  ? 80.734  55.512 -4.533  1.00 40.05 ? 58   TRP A CD2 1 
ATOM   441  N  NE1 . TRP A 1 58  ? 81.873  53.993 -3.340  1.00 38.47 ? 58   TRP A NE1 1 
ATOM   442  C  CE2 . TRP A 1 58  ? 81.834  55.324 -3.664  1.00 39.16 ? 58   TRP A CE2 1 
ATOM   443  C  CE3 . TRP A 1 58  ? 80.456  56.803 -5.001  1.00 39.45 ? 58   TRP A CE3 1 
ATOM   444  C  CZ2 . TRP A 1 58  ? 82.671  56.384 -3.258  1.00 35.94 ? 58   TRP A CZ2 1 
ATOM   445  C  CZ3 . TRP A 1 58  ? 81.297  57.860 -4.599  1.00 39.56 ? 58   TRP A CZ3 1 
ATOM   446  C  CH2 . TRP A 1 58  ? 82.388  57.633 -3.738  1.00 37.70 ? 58   TRP A CH2 1 
ATOM   447  N  N   . ASN A 1 59  ? 81.239  51.892 -7.105  1.00 45.48 ? 59   ASN A N   1 
ATOM   448  C  CA  . ASN A 1 59  ? 81.965  50.639 -6.925  1.00 46.74 ? 59   ASN A CA  1 
ATOM   449  C  C   . ASN A 1 59  ? 82.206  50.444 -5.428  1.00 43.22 ? 59   ASN A C   1 
ATOM   450  O  O   . ASN A 1 59  ? 83.013  51.156 -4.831  1.00 40.76 ? 59   ASN A O   1 
ATOM   451  C  CB  . ASN A 1 59  ? 83.297  50.653 -7.705  1.00 48.86 ? 59   ASN A CB  1 
ATOM   452  C  CG  . ASN A 1 59  ? 83.907  49.253 -7.876  1.00 56.39 ? 59   ASN A CG  1 
ATOM   453  O  OD1 . ASN A 1 59  ? 83.385  48.265 -7.340  1.00 59.16 ? 59   ASN A OD1 1 
ATOM   454  N  ND2 . ASN A 1 59  ? 85.019  49.169 -8.631  1.00 66.06 ? 59   ASN A ND2 1 
ATOM   455  N  N   . ALA A 1 60  ? 81.459  49.519 -4.836  1.00 41.71 ? 60   ALA A N   1 
ATOM   456  C  CA  . ALA A 1 60  ? 81.568  49.228 -3.414  1.00 40.69 ? 60   ALA A CA  1 
ATOM   457  C  C   . ALA A 1 60  ? 82.122  47.824 -3.184  1.00 41.04 ? 60   ALA A C   1 
ATOM   458  O  O   . ALA A 1 60  ? 81.583  47.052 -2.374  1.00 40.49 ? 60   ALA A O   1 
ATOM   459  C  CB  . ALA A 1 60  ? 80.211  49.380 -2.729  1.00 39.61 ? 60   ALA A CB  1 
ATOM   460  N  N   . SER A 1 61  ? 83.190  47.496 -3.899  1.00 41.76 ? 61   SER A N   1 
ATOM   461  C  CA  . SER A 1 61  ? 83.760  46.162 -3.844  1.00 42.94 ? 61   SER A CA  1 
ATOM   462  C  C   . SER A 1 61  ? 85.026  46.111 -2.988  1.00 42.24 ? 61   SER A C   1 
ATOM   463  O  O   . SER A 1 61  ? 85.615  45.043 -2.794  1.00 43.51 ? 61   SER A O   1 
ATOM   464  C  CB  . SER A 1 61  ? 84.064  45.669 -5.267  1.00 45.49 ? 61   SER A CB  1 
ATOM   465  O  OG  . SER A 1 61  ? 85.176  46.375 -5.804  1.00 47.47 ? 61   SER A OG  1 
ATOM   466  N  N   . THR A 1 62  ? 85.405  47.258 -2.432  1.00 40.55 ? 62   THR A N   1 
ATOM   467  C  CA  . THR A 1 62  ? 86.745  47.480 -1.916  1.00 39.79 ? 62   THR A CA  1 
ATOM   468  C  C   . THR A 1 62  ? 86.672  48.337 -0.663  1.00 37.05 ? 62   THR A C   1 
ATOM   469  O  O   . THR A 1 62  ? 85.956  49.333 -0.649  1.00 36.81 ? 62   THR A O   1 
ATOM   470  C  CB  . THR A 1 62  ? 87.569  48.227 -2.993  1.00 41.13 ? 62   THR A CB  1 
ATOM   471  O  OG1 . THR A 1 62  ? 87.813  47.357 -4.095  1.00 45.36 ? 62   THR A OG1 1 
ATOM   472  C  CG2 . THR A 1 62  ? 88.881  48.698 -2.481  1.00 42.27 ? 62   THR A CG2 1 
ATOM   473  N  N   . TYR A 1 63  ? 87.432  47.981 0.367   1.00 35.46 ? 63   TYR A N   1 
ATOM   474  C  CA  . TYR A 1 63  ? 87.576  48.825 1.554   1.00 33.94 ? 63   TYR A CA  1 
ATOM   475  C  C   . TYR A 1 63  ? 88.022  50.280 1.215   1.00 33.43 ? 63   TYR A C   1 
ATOM   476  O  O   . TYR A 1 63  ? 88.809  50.498 0.300   1.00 34.42 ? 63   TYR A O   1 
ATOM   477  C  CB  . TYR A 1 63  ? 88.595  48.195 2.499   1.00 34.04 ? 63   TYR A CB  1 
ATOM   478  C  CG  . TYR A 1 63  ? 88.051  47.148 3.446   1.00 34.14 ? 63   TYR A CG  1 
ATOM   479  C  CD1 . TYR A 1 63  ? 86.817  47.337 4.081   1.00 33.28 ? 63   TYR A CD1 1 
ATOM   480  C  CD2 . TYR A 1 63  ? 88.790  45.983 3.754   1.00 34.79 ? 63   TYR A CD2 1 
ATOM   481  C  CE1 . TYR A 1 63  ? 86.314  46.406 4.984   1.00 31.33 ? 63   TYR A CE1 1 
ATOM   482  C  CE2 . TYR A 1 63  ? 88.289  45.037 4.682   1.00 34.63 ? 63   TYR A CE2 1 
ATOM   483  C  CZ  . TYR A 1 63  ? 87.043  45.280 5.289   1.00 32.83 ? 63   TYR A CZ  1 
ATOM   484  O  OH  . TYR A 1 63  ? 86.472  44.420 6.185   1.00 37.05 ? 63   TYR A OH  1 
ATOM   485  N  N   . PRO A 1 64  ? 87.498  51.278 1.942   1.00 32.30 ? 64   PRO A N   1 
ATOM   486  C  CA  . PRO A 1 64  ? 87.922  52.694 1.741   1.00 31.73 ? 64   PRO A CA  1 
ATOM   487  C  C   . PRO A 1 64  ? 89.229  53.031 2.463   1.00 31.89 ? 64   PRO A C   1 
ATOM   488  O  O   . PRO A 1 64  ? 89.744  52.195 3.228   1.00 31.14 ? 64   PRO A O   1 
ATOM   489  C  CB  . PRO A 1 64  ? 86.802  53.468 2.450   1.00 29.85 ? 64   PRO A CB  1 
ATOM   490  C  CG  . PRO A 1 64  ? 86.516  52.579 3.643   1.00 28.99 ? 64   PRO A CG  1 
ATOM   491  C  CD  . PRO A 1 64  ? 86.472  51.167 3.009   1.00 29.68 ? 64   PRO A CD  1 
ATOM   492  N  N   . ASN A 1 65  ? 89.707  54.269 2.255   1.00 32.57 ? 65   ASN A N   1 
ATOM   493  C  CA  . ASN A 1 65  ? 90.803  54.867 2.992   1.00 32.03 ? 65   ASN A CA  1 
ATOM   494  C  C   . ASN A 1 65  ? 90.486  54.917 4.472   1.00 30.95 ? 65   ASN A C   1 
ATOM   495  O  O   . ASN A 1 65  ? 89.310  55.030 4.864   1.00 29.33 ? 65   ASN A O   1 
ATOM   496  C  CB  . ASN A 1 65  ? 91.066  56.309 2.522   1.00 33.80 ? 65   ASN A CB  1 
ATOM   497  C  CG  . ASN A 1 65  ? 91.604  56.392 1.074   1.00 38.40 ? 65   ASN A CG  1 
ATOM   498  O  OD1 . ASN A 1 65  ? 92.501  55.643 0.689   1.00 43.41 ? 65   ASN A OD1 1 
ATOM   499  N  ND2 . ASN A 1 65  ? 91.041  57.313 0.271   1.00 41.56 ? 65   ASN A ND2 1 
ATOM   500  N  N   . ASN A 1 66  ? 91.538  54.869 5.301   1.00 29.94 ? 66   ASN A N   1 
ATOM   501  C  CA  . ASN A 1 66  ? 91.363  55.061 6.730   1.00 28.95 ? 66   ASN A CA  1 
ATOM   502  C  C   . ASN A 1 66  ? 91.574  56.531 7.035   1.00 28.83 ? 66   ASN A C   1 
ATOM   503  O  O   . ASN A 1 66  ? 92.210  57.239 6.243   1.00 29.62 ? 66   ASN A O   1 
ATOM   504  C  CB  . ASN A 1 66  ? 92.346  54.194 7.515   1.00 28.85 ? 66   ASN A CB  1 
ATOM   505  C  CG  . ASN A 1 66  ? 92.198  52.716 7.188   1.00 30.25 ? 66   ASN A CG  1 
ATOM   506  O  OD1 . ASN A 1 66  ? 93.179  51.984 7.125   1.00 29.51 ? 66   ASN A OD1 1 
ATOM   507  N  ND2 . ASN A 1 66  ? 90.959  52.277 6.966   1.00 31.16 ? 66   ASN A ND2 1 
ATOM   508  N  N   . CYS A 1 67  ? 91.052  56.994 8.167   1.00 27.75 ? 67   CYS A N   1 
ATOM   509  C  CA  . CYS A 1 67  ? 91.242  58.385 8.529   1.00 28.46 ? 67   CYS A CA  1 
ATOM   510  C  C   . CYS A 1 67  ? 92.678  58.632 8.975   1.00 28.99 ? 67   CYS A C   1 
ATOM   511  O  O   . CYS A 1 67  ? 93.393  57.697 9.420   1.00 28.63 ? 67   CYS A O   1 
ATOM   512  C  CB  . CYS A 1 67  ? 90.238  58.809 9.613   1.00 28.22 ? 67   CYS A CB  1 
ATOM   513  S  SG  . CYS A 1 67  ? 88.491  58.741 9.074   1.00 30.30 ? 67   CYS A SG  1 
ATOM   514  N  N   . GLN A 1 68  ? 93.091  59.895 8.835   1.00 29.11 ? 68   GLN A N   1 
ATOM   515  C  CA  . GLN A 1 68  ? 94.399  60.361 9.281   1.00 28.80 ? 68   GLN A CA  1 
ATOM   516  C  C   . GLN A 1 68  ? 94.557  60.138 10.785  1.00 28.38 ? 68   GLN A C   1 
ATOM   517  O  O   . GLN A 1 68  ? 93.687  60.519 11.575  1.00 27.12 ? 68   GLN A O   1 
ATOM   518  C  CB  . GLN A 1 68  ? 94.603  61.843 8.886   1.00 29.36 ? 68   GLN A CB  1 
ATOM   519  C  CG  . GLN A 1 68  ? 94.703  62.034 7.353   1.00 28.46 ? 68   GLN A CG  1 
ATOM   520  C  CD  . GLN A 1 68  ? 96.102  61.745 6.777   1.00 31.50 ? 68   GLN A CD  1 
ATOM   521  O  OE1 . GLN A 1 68  ? 96.976  61.250 7.477   1.00 31.49 ? 68   GLN A OE1 1 
ATOM   522  N  NE2 . GLN A 1 68  ? 96.312  62.074 5.484   1.00 31.07 ? 68   GLN A NE2 1 
ATOM   523  N  N   . GLN A 1 69  ? 95.657  59.483 11.170  1.00 27.91 ? 69   GLN A N   1 
ATOM   524  C  CA  . GLN A 1 69  ? 95.866  59.132 12.557  1.00 26.79 ? 69   GLN A CA  1 
ATOM   525  C  C   . GLN A 1 69  ? 97.326  58.829 12.906  1.00 27.45 ? 69   GLN A C   1 
ATOM   526  O  O   . GLN A 1 69  ? 98.126  58.469 12.055  1.00 27.73 ? 69   GLN A O   1 
ATOM   527  C  CB  . GLN A 1 69  ? 95.016  57.898 12.876  1.00 26.41 ? 69   GLN A CB  1 
ATOM   528  C  CG  . GLN A 1 69  ? 95.383  56.606 12.085  1.00 25.96 ? 69   GLN A CG  1 
ATOM   529  C  CD  . GLN A 1 69  ? 94.314  55.547 12.258  1.00 26.66 ? 69   GLN A CD  1 
ATOM   530  O  OE1 . GLN A 1 69  ? 94.419  54.712 13.130  1.00 26.95 ? 69   GLN A OE1 1 
ATOM   531  N  NE2 . GLN A 1 69  ? 93.225  55.640 11.472  1.00 24.33 ? 69   GLN A NE2 1 
ATOM   532  N  N   . TYR A 1 70  ? 97.640  58.939 14.184  1.00 27.73 ? 70   TYR A N   1 
ATOM   533  C  CA  . TYR A 1 70  ? 98.907  58.465 14.695  1.00 28.48 ? 70   TYR A CA  1 
ATOM   534  C  C   . TYR A 1 70  ? 98.992  56.964 14.430  1.00 28.31 ? 70   TYR A C   1 
ATOM   535  O  O   . TYR A 1 70  ? 98.017  56.261 14.560  1.00 26.68 ? 70   TYR A O   1 
ATOM   536  C  CB  . TYR A 1 70  ? 99.008  58.753 16.196  1.00 28.38 ? 70   TYR A CB  1 
ATOM   537  C  CG  . TYR A 1 70  ? 100.220 58.124 16.879  1.00 29.65 ? 70   TYR A CG  1 
ATOM   538  C  CD1 . TYR A 1 70  ? 101.428 58.798 16.969  1.00 32.90 ? 70   TYR A CD1 1 
ATOM   539  C  CD2 . TYR A 1 70  ? 100.129 56.863 17.448  1.00 33.46 ? 70   TYR A CD2 1 
ATOM   540  C  CE1 . TYR A 1 70  ? 102.523 58.228 17.609  1.00 35.26 ? 70   TYR A CE1 1 
ATOM   541  C  CE2 . TYR A 1 70  ? 101.224 56.264 18.078  1.00 34.89 ? 70   TYR A CE2 1 
ATOM   542  C  CZ  . TYR A 1 70  ? 102.402 56.944 18.155  1.00 36.80 ? 70   TYR A CZ  1 
ATOM   543  O  OH  . TYR A 1 70  ? 103.462 56.341 18.798  1.00 38.99 ? 70   TYR A OH  1 
ATOM   544  N  N   . VAL A 1 71  ? 100.181 56.498 14.067  1.00 29.19 ? 71   VAL A N   1 
ATOM   545  C  CA  . VAL A 1 71  ? 100.400 55.124 13.764  1.00 30.06 ? 71   VAL A CA  1 
ATOM   546  C  C   . VAL A 1 71  ? 101.438 54.598 14.760  1.00 31.10 ? 71   VAL A C   1 
ATOM   547  O  O   . VAL A 1 71  ? 102.551 55.126 14.873  1.00 31.76 ? 71   VAL A O   1 
ATOM   548  C  CB  . VAL A 1 71  ? 100.955 54.974 12.331  1.00 31.69 ? 71   VAL A CB  1 
ATOM   549  C  CG1 . VAL A 1 71  ? 101.499 53.549 12.087  1.00 32.58 ? 71   VAL A CG1 1 
ATOM   550  C  CG2 . VAL A 1 71  ? 99.868  55.309 11.313  1.00 31.78 ? 71   VAL A CG2 1 
ATOM   551  N  N   . ASP A 1 72  ? 101.086 53.519 15.435  1.00 30.15 ? 72   ASP A N   1 
ATOM   552  C  CA  . ASP A 1 72  ? 101.951 52.927 16.443  1.00 30.59 ? 72   ASP A CA  1 
ATOM   553  C  C   . ASP A 1 72  ? 103.079 52.130 15.795  1.00 31.00 ? 72   ASP A C   1 
ATOM   554  O  O   . ASP A 1 72  ? 102.812 51.141 15.139  1.00 32.84 ? 72   ASP A O   1 
ATOM   555  C  CB  . ASP A 1 72  ? 101.091 52.032 17.359  1.00 28.84 ? 72   ASP A CB  1 
ATOM   556  C  CG  . ASP A 1 72  ? 101.924 51.187 18.312  1.00 33.49 ? 72   ASP A CG  1 
ATOM   557  O  OD1 . ASP A 1 72  ? 103.073 51.569 18.671  1.00 35.13 ? 72   ASP A OD1 1 
ATOM   558  O  OD2 . ASP A 1 72  ? 101.407 50.124 18.718  1.00 37.25 ? 72   ASP A OD2 1 
ATOM   559  N  N   . GLU A 1 73  ? 104.320 52.529 16.017  1.00 31.04 ? 73   GLU A N   1 
ATOM   560  C  CA  A GLU A 1 73  ? 105.495 51.889 15.454  0.50 32.64 ? 73   GLU A CA  1 
ATOM   561  C  CA  B GLU A 1 73  ? 105.439 51.776 15.460  0.50 32.91 ? 73   GLU A CA  1 
ATOM   562  C  C   . GLU A 1 73  ? 106.412 51.330 16.559  1.00 33.45 ? 73   GLU A C   1 
ATOM   563  O  O   . GLU A 1 73  ? 107.581 51.012 16.310  1.00 34.27 ? 73   GLU A O   1 
ATOM   564  C  CB  A GLU A 1 73  ? 106.300 52.908 14.607  0.50 33.80 ? 73   GLU A CB  1 
ATOM   565  C  CB  B GLU A 1 73  ? 106.161 52.569 14.343  0.50 34.61 ? 73   GLU A CB  1 
ATOM   566  C  CG  A GLU A 1 73  ? 105.680 53.324 13.256  0.50 33.42 ? 73   GLU A CG  1 
ATOM   567  C  CG  B GLU A 1 73  ? 105.494 52.486 12.943  0.50 35.48 ? 73   GLU A CG  1 
ATOM   568  C  CD  A GLU A 1 73  ? 106.665 54.090 12.383  0.50 34.60 ? 73   GLU A CD  1 
ATOM   569  C  CD  B GLU A 1 73  ? 105.437 51.059 12.384  0.50 39.05 ? 73   GLU A CD  1 
ATOM   570  O  OE1 A GLU A 1 73  ? 107.521 53.445 11.733  0.50 37.72 ? 73   GLU A OE1 1 
ATOM   571  O  OE1 B GLU A 1 73  ? 106.519 50.471 12.068  0.50 39.27 ? 73   GLU A OE1 1 
ATOM   572  O  OE2 A GLU A 1 73  ? 106.593 55.333 12.347  0.50 31.65 ? 73   GLU A OE2 1 
ATOM   573  O  OE2 B GLU A 1 73  ? 104.298 50.537 12.253  0.50 36.82 ? 73   GLU A OE2 1 
ATOM   574  N  N   . GLN A 1 74  ? 105.919 51.268 17.785  1.00 32.52 ? 74   GLN A N   1 
ATOM   575  C  CA  . GLN A 1 74  ? 106.741 50.785 18.882  1.00 33.69 ? 74   GLN A CA  1 
ATOM   576  C  C   . GLN A 1 74  ? 107.264 49.381 18.679  1.00 34.30 ? 74   GLN A C   1 
ATOM   577  O  O   . GLN A 1 74  ? 108.423 49.106 19.056  1.00 35.67 ? 74   GLN A O   1 
ATOM   578  C  CB  . GLN A 1 74  ? 106.007 50.841 20.207  1.00 33.75 ? 74   GLN A CB  1 
ATOM   579  C  CG  . GLN A 1 74  ? 106.851 50.325 21.347  1.00 38.59 ? 74   GLN A CG  1 
ATOM   580  C  CD  . GLN A 1 74  ? 106.854 51.306 22.436  1.00 46.88 ? 74   GLN A CD  1 
ATOM   581  O  OE1 . GLN A 1 74  ? 107.623 52.276 22.401  1.00 50.75 ? 74   GLN A OE1 1 
ATOM   582  N  NE2 . GLN A 1 74  ? 105.963 51.105 23.425  1.00 47.43 ? 74   GLN A NE2 1 
ATOM   583  N  N   . PHE A 1 75  ? 106.452 48.501 18.083  1.00 33.23 ? 75   PHE A N   1 
ATOM   584  C  CA  . PHE A 1 75  ? 106.918 47.125 17.825  1.00 35.23 ? 75   PHE A CA  1 
ATOM   585  C  C   . PHE A 1 75  ? 106.735 46.750 16.373  1.00 36.95 ? 75   PHE A C   1 
ATOM   586  O  O   . PHE A 1 75  ? 105.772 46.067 16.005  1.00 36.15 ? 75   PHE A O   1 
ATOM   587  C  CB  . PHE A 1 75  ? 106.217 46.092 18.701  1.00 34.50 ? 75   PHE A CB  1 
ATOM   588  C  CG  . PHE A 1 75  ? 106.275 46.393 20.155  1.00 34.20 ? 75   PHE A CG  1 
ATOM   589  C  CD1 . PHE A 1 75  ? 107.464 46.219 20.872  1.00 37.02 ? 75   PHE A CD1 1 
ATOM   590  C  CD2 . PHE A 1 75  ? 105.146 46.843 20.813  1.00 30.38 ? 75   PHE A CD2 1 
ATOM   591  C  CE1 . PHE A 1 75  ? 107.511 46.497 22.236  1.00 37.33 ? 75   PHE A CE1 1 
ATOM   592  C  CE2 . PHE A 1 75  ? 105.186 47.116 22.164  1.00 33.13 ? 75   PHE A CE2 1 
ATOM   593  C  CZ  . PHE A 1 75  ? 106.360 46.961 22.874  1.00 33.82 ? 75   PHE A CZ  1 
ATOM   594  N  N   . PRO A 1 76  ? 107.683 47.171 15.535  1.00 39.54 ? 76   PRO A N   1 
ATOM   595  C  CA  . PRO A 1 76  ? 107.482 46.959 14.111  1.00 40.82 ? 76   PRO A CA  1 
ATOM   596  C  C   . PRO A 1 76  ? 107.532 45.471 13.782  1.00 42.00 ? 76   PRO A C   1 
ATOM   597  O  O   . PRO A 1 76  ? 108.436 44.762 14.226  1.00 43.60 ? 76   PRO A O   1 
ATOM   598  C  CB  . PRO A 1 76  ? 108.653 47.717 13.468  1.00 43.19 ? 76   PRO A CB  1 
ATOM   599  C  CG  . PRO A 1 76  ? 109.341 48.492 14.641  1.00 43.49 ? 76   PRO A CG  1 
ATOM   600  C  CD  . PRO A 1 76  ? 109.024 47.694 15.856  1.00 40.49 ? 76   PRO A CD  1 
ATOM   601  N  N   . GLY A 1 77  ? 106.536 45.000 13.052  1.00 41.79 ? 77   GLY A N   1 
ATOM   602  C  CA  . GLY A 1 77  ? 106.557 43.609 12.589  1.00 44.46 ? 77   GLY A CA  1 
ATOM   603  C  C   . GLY A 1 77  ? 105.693 42.716 13.470  1.00 43.70 ? 77   GLY A C   1 
ATOM   604  O  O   . GLY A 1 77  ? 105.366 41.585 13.089  1.00 44.38 ? 77   GLY A O   1 
ATOM   605  N  N   . PHE A 1 78  ? 105.330 43.244 14.642  1.00 41.50 ? 78   PHE A N   1 
ATOM   606  C  CA  . PHE A 1 78  ? 104.673 42.482 15.693  1.00 40.27 ? 78   PHE A CA  1 
ATOM   607  C  C   . PHE A 1 78  ? 103.165 42.529 15.494  1.00 38.93 ? 78   PHE A C   1 
ATOM   608  O  O   . PHE A 1 78  ? 102.579 43.594 15.475  1.00 36.47 ? 78   PHE A O   1 
ATOM   609  C  CB  . PHE A 1 78  ? 105.075 43.044 17.058  1.00 39.06 ? 78   PHE A CB  1 
ATOM   610  C  CG  . PHE A 1 78  ? 104.362 42.420 18.206  1.00 37.92 ? 78   PHE A CG  1 
ATOM   611  C  CD1 . PHE A 1 78  ? 104.482 41.039 18.458  1.00 39.41 ? 78   PHE A CD1 1 
ATOM   612  C  CD2 . PHE A 1 78  ? 103.595 43.186 19.057  1.00 35.13 ? 78   PHE A CD2 1 
ATOM   613  C  CE1 . PHE A 1 78  ? 103.830 40.447 19.515  1.00 37.18 ? 78   PHE A CE1 1 
ATOM   614  C  CE2 . PHE A 1 78  ? 102.924 42.587 20.123  1.00 34.97 ? 78   PHE A CE2 1 
ATOM   615  C  CZ  . PHE A 1 78  ? 103.059 41.196 20.346  1.00 33.70 ? 78   PHE A CZ  1 
ATOM   616  N  N   . SER A 1 79  ? 102.530 41.373 15.326  1.00 40.60 ? 79   SER A N   1 
ATOM   617  C  CA  . SER A 1 79  ? 101.099 41.375 14.963  1.00 40.19 ? 79   SER A CA  1 
ATOM   618  C  C   . SER A 1 79  ? 100.212 41.988 16.017  1.00 37.98 ? 79   SER A C   1 
ATOM   619  O  O   . SER A 1 79  ? 99.148  42.512 15.705  1.00 36.68 ? 79   SER A O   1 
ATOM   620  C  CB  . SER A 1 79  ? 100.605 39.963 14.651  1.00 41.81 ? 79   SER A CB  1 
ATOM   621  O  OG  . SER A 1 79  ? 100.700 39.132 15.807  1.00 45.57 ? 79   SER A OG  1 
ATOM   622  N  N   . GLY A 1 80  ? 100.639 41.922 17.273  1.00 38.14 ? 80   GLY A N   1 
ATOM   623  C  CA  . GLY A 1 80  ? 99.797  42.350 18.376  1.00 36.77 ? 80   GLY A CA  1 
ATOM   624  C  C   . GLY A 1 80  ? 99.613  43.863 18.426  1.00 36.71 ? 80   GLY A C   1 
ATOM   625  O  O   . GLY A 1 80  ? 98.582  44.353 18.898  1.00 35.40 ? 80   GLY A O   1 
ATOM   626  N  N   . SER A 1 81  ? 100.622 44.620 17.997  1.00 36.69 ? 81   SER A N   1 
ATOM   627  C  CA  . SER A 1 81  ? 100.425 46.046 17.891  1.00 35.88 ? 81   SER A CA  1 
ATOM   628  C  C   . SER A 1 81  ? 99.911  46.386 16.478  1.00 35.63 ? 81   SER A C   1 
ATOM   629  O  O   . SER A 1 81  ? 99.060  47.268 16.326  1.00 33.67 ? 81   SER A O   1 
ATOM   630  C  CB  . SER A 1 81  ? 101.712 46.786 18.220  1.00 35.91 ? 81   SER A CB  1 
ATOM   631  O  OG  . SER A 1 81  ? 102.789 46.194 17.511  1.00 40.52 ? 81   SER A OG  1 
ATOM   632  N  N   . GLU A 1 82  ? 100.406 45.676 15.462  1.00 36.97 ? 82   GLU A N   1 
ATOM   633  C  CA  . GLU A 1 82  ? 100.158 46.069 14.061  1.00 38.11 ? 82   GLU A CA  1 
ATOM   634  C  C   . GLU A 1 82  ? 98.729  45.833 13.565  1.00 37.55 ? 82   GLU A C   1 
ATOM   635  O  O   . GLU A 1 82  ? 98.253  46.552 12.674  1.00 37.37 ? 82   GLU A O   1 
ATOM   636  C  CB  . GLU A 1 82  ? 101.242 45.559 13.101  1.00 39.92 ? 82   GLU A CB  1 
ATOM   637  C  CG  . GLU A 1 82  ? 102.584 46.084 13.566  1.00 43.27 ? 82   GLU A CG  1 
ATOM   638  C  CD  . GLU A 1 82  ? 103.625 46.256 12.503  1.00 51.23 ? 82   GLU A CD  1 
ATOM   639  O  OE1 . GLU A 1 82  ? 103.884 45.276 11.757  1.00 56.51 ? 82   GLU A OE1 1 
ATOM   640  O  OE2 . GLU A 1 82  ? 104.244 47.356 12.470  1.00 53.08 ? 82   GLU A OE2 1 
ATOM   641  N  N   . MET A 1 83  ? 98.031  44.885 14.195  1.00 36.88 ? 83   MET A N   1 
ATOM   642  C  CA  . MET A 1 83  ? 96.640  44.579 13.862  1.00 36.31 ? 83   MET A CA  1 
ATOM   643  C  C   . MET A 1 83  ? 95.722  45.772 14.055  1.00 34.00 ? 83   MET A C   1 
ATOM   644  O  O   . MET A 1 83  ? 94.651  45.778 13.504  1.00 33.24 ? 83   MET A O   1 
ATOM   645  C  CB  . MET A 1 83  ? 96.103  43.399 14.679  1.00 36.86 ? 83   MET A CB  1 
ATOM   646  C  CG  . MET A 1 83  ? 95.898  43.716 16.165  1.00 39.57 ? 83   MET A CG  1 
ATOM   647  S  SD  . MET A 1 83  ? 95.116  42.364 17.115  1.00 50.08 ? 83   MET A SD  1 
ATOM   648  C  CE  . MET A 1 83  ? 96.126  40.972 16.634  1.00 46.87 ? 83   MET A CE  1 
ATOM   649  N  N   . TRP A 1 84  ? 96.151  46.766 14.833  1.00 32.90 ? 84   TRP A N   1 
ATOM   650  C  CA  . TRP A 1 84  ? 95.322  47.905 15.184  1.00 31.19 ? 84   TRP A CA  1 
ATOM   651  C  C   . TRP A 1 84  ? 95.581  49.084 14.280  1.00 31.00 ? 84   TRP A C   1 
ATOM   652  O  O   . TRP A 1 84  ? 94.780  49.998 14.255  1.00 31.56 ? 84   TRP A O   1 
ATOM   653  C  CB  . TRP A 1 84  ? 95.530  48.339 16.660  1.00 30.79 ? 84   TRP A CB  1 
ATOM   654  C  CG  . TRP A 1 84  ? 95.235  47.263 17.640  1.00 33.98 ? 84   TRP A CG  1 
ATOM   655  C  CD1 . TRP A 1 84  ? 96.146  46.613 18.454  1.00 37.92 ? 84   TRP A CD1 1 
ATOM   656  C  CD2 . TRP A 1 84  ? 93.954  46.647 17.902  1.00 34.49 ? 84   TRP A CD2 1 
ATOM   657  N  NE1 . TRP A 1 84  ? 95.502  45.630 19.200  1.00 39.20 ? 84   TRP A NE1 1 
ATOM   658  C  CE2 . TRP A 1 84  ? 94.166  45.627 18.883  1.00 36.86 ? 84   TRP A CE2 1 
ATOM   659  C  CE3 . TRP A 1 84  ? 92.663  46.826 17.383  1.00 32.76 ? 84   TRP A CE3 1 
ATOM   660  C  CZ2 . TRP A 1 84  ? 93.122  44.827 19.377  1.00 34.57 ? 84   TRP A CZ2 1 
ATOM   661  C  CZ3 . TRP A 1 84  ? 91.619  46.009 17.872  1.00 34.13 ? 84   TRP A CZ3 1 
ATOM   662  C  CH2 . TRP A 1 84  ? 91.863  45.025 18.860  1.00 32.60 ? 84   TRP A CH2 1 
ATOM   663  N  N   . ASN A 1 85  ? 96.714  49.082 13.569  1.00 31.61 ? 85   ASN A N   1 
ATOM   664  C  CA  . ASN A 1 85  ? 97.126  50.193 12.707  1.00 30.70 ? 85   ASN A CA  1 
ATOM   665  C  C   . ASN A 1 85  ? 96.391  50.167 11.356  1.00 29.68 ? 85   ASN A C   1 
ATOM   666  O  O   . ASN A 1 85  ? 95.966  49.108 10.905  1.00 29.00 ? 85   ASN A O   1 
ATOM   667  C  CB  . ASN A 1 85  ? 98.635  50.110 12.393  1.00 31.72 ? 85   ASN A CB  1 
ATOM   668  C  CG  . ASN A 1 85  ? 99.512  50.380 13.607  1.00 34.45 ? 85   ASN A CG  1 
ATOM   669  O  OD1 . ASN A 1 85  ? 99.121  51.095 14.553  1.00 36.53 ? 85   ASN A OD1 1 
ATOM   670  N  ND2 . ASN A 1 85  ? 100.723 49.833 13.575  1.00 33.54 ? 85   ASN A ND2 1 
ATOM   671  N  N   . PRO A 1 86  ? 96.307  51.326 10.687  1.00 28.79 ? 86   PRO A N   1 
ATOM   672  C  CA  . PRO A 1 86  ? 95.646  51.336 9.385   1.00 29.66 ? 86   PRO A CA  1 
ATOM   673  C  C   . PRO A 1 86  ? 96.143  50.243 8.426   1.00 30.34 ? 86   PRO A C   1 
ATOM   674  O  O   . PRO A 1 86  ? 97.342  50.082 8.254   1.00 31.63 ? 86   PRO A O   1 
ATOM   675  C  CB  . PRO A 1 86  ? 95.986  52.737 8.838   1.00 29.50 ? 86   PRO A CB  1 
ATOM   676  C  CG  . PRO A 1 86  ? 96.138  53.574 10.057  1.00 29.17 ? 86   PRO A CG  1 
ATOM   677  C  CD  . PRO A 1 86  ? 96.758  52.678 11.091  1.00 27.55 ? 86   PRO A CD  1 
ATOM   678  N  N   . ASN A 1 87  ? 95.233  49.518 7.790   1.00 30.19 ? 87   ASN A N   1 
ATOM   679  C  CA  . ASN A 1 87  ? 95.665  48.636 6.678   1.00 32.35 ? 87   ASN A CA  1 
ATOM   680  C  C   . ASN A 1 87  ? 95.329  49.180 5.317   1.00 33.34 ? 87   ASN A C   1 
ATOM   681  O  O   . ASN A 1 87  ? 95.347  48.440 4.354   1.00 35.08 ? 87   ASN A O   1 
ATOM   682  C  CB  . ASN A 1 87  ? 95.068  47.239 6.785   1.00 31.54 ? 87   ASN A CB  1 
ATOM   683  C  CG  . ASN A 1 87  ? 93.563  47.280 6.984   1.00 31.79 ? 87   ASN A CG  1 
ATOM   684  O  OD1 . ASN A 1 87  ? 92.965  48.371 7.167   1.00 27.67 ? 87   ASN A OD1 1 
ATOM   685  N  ND2 . ASN A 1 87  ? 92.942  46.099 7.003   1.00 28.56 ? 87   ASN A ND2 1 
ATOM   686  N  N   . ARG A 1 88  ? 95.021  50.469 5.231   1.00 33.36 ? 88   ARG A N   1 
ATOM   687  C  CA  A ARG A 1 88  ? 94.703  51.092 3.945   0.50 33.69 ? 88   ARG A CA  1 
ATOM   688  C  CA  B ARG A 1 88  ? 94.691  51.105 3.948   0.50 34.30 ? 88   ARG A CA  1 
ATOM   689  C  C   . ARG A 1 88  ? 95.393  52.444 3.907   1.00 33.96 ? 88   ARG A C   1 
ATOM   690  O  O   . ARG A 1 88  ? 95.868  52.923 4.930   1.00 33.70 ? 88   ARG A O   1 
ATOM   691  C  CB  A ARG A 1 88  ? 93.181  51.221 3.795   0.50 32.63 ? 88   ARG A CB  1 
ATOM   692  C  CB  B ARG A 1 88  ? 93.185  51.328 3.855   0.50 33.33 ? 88   ARG A CB  1 
ATOM   693  C  CG  A ARG A 1 88  ? 92.450  49.857 3.633   0.50 31.40 ? 88   ARG A CG  1 
ATOM   694  C  CG  B ARG A 1 88  ? 92.553  50.842 2.564   0.50 36.68 ? 88   ARG A CG  1 
ATOM   695  C  CD  A ARG A 1 88  ? 93.055  49.111 2.457   0.50 33.23 ? 88   ARG A CD  1 
ATOM   696  C  CD  B ARG A 1 88  ? 92.759  49.364 2.351   0.50 36.35 ? 88   ARG A CD  1 
ATOM   697  N  NE  A ARG A 1 88  ? 92.301  47.937 2.022   0.50 34.27 ? 88   ARG A NE  1 
ATOM   698  N  NE  B ARG A 1 88  ? 91.769  48.803 1.439   0.50 37.31 ? 88   ARG A NE  1 
ATOM   699  C  CZ  A ARG A 1 88  ? 92.567  46.678 2.376   0.50 32.80 ? 88   ARG A CZ  1 
ATOM   700  C  CZ  B ARG A 1 88  ? 91.850  48.811 0.109   0.50 39.91 ? 88   ARG A CZ  1 
ATOM   701  N  NH1 A ARG A 1 88  ? 93.572  46.394 3.195   0.50 28.71 ? 88   ARG A NH1 1 
ATOM   702  N  NH1 B ARG A 1 88  ? 92.882  49.371 -0.518  0.50 42.12 ? 88   ARG A NH1 1 
ATOM   703  N  NH2 A ARG A 1 88  ? 91.804  45.698 1.905   0.50 34.42 ? 88   ARG A NH2 1 
ATOM   704  N  NH2 B ARG A 1 88  ? 90.883  48.258 -0.603  0.50 38.89 ? 88   ARG A NH2 1 
ATOM   705  N  N   . GLU A 1 89  ? 95.477  53.062 2.745   1.00 35.47 ? 89   GLU A N   1 
ATOM   706  C  CA  . GLU A 1 89  ? 95.989  54.439 2.731   1.00 36.44 ? 89   GLU A CA  1 
ATOM   707  C  C   . GLU A 1 89  ? 95.197  55.356 3.690   1.00 33.09 ? 89   GLU A C   1 
ATOM   708  O  O   . GLU A 1 89  ? 93.970  55.268 3.788   1.00 32.39 ? 89   GLU A O   1 
ATOM   709  C  CB  . GLU A 1 89  ? 95.991  55.034 1.333   1.00 38.18 ? 89   GLU A CB  1 
ATOM   710  C  CG  . GLU A 1 89  ? 96.736  54.178 0.292   1.00 45.91 ? 89   GLU A CG  1 
ATOM   711  C  CD  . GLU A 1 89  ? 98.264  54.375 0.264   1.00 53.88 ? 89   GLU A CD  1 
ATOM   712  O  OE1 . GLU A 1 89  ? 98.906  54.435 1.347   1.00 55.53 ? 89   GLU A OE1 1 
ATOM   713  O  OE2 . GLU A 1 89  ? 98.826  54.438 -0.864  1.00 58.77 ? 89   GLU A OE2 1 
ATOM   714  N  N   . MET A 1 90  ? 95.901  56.229 4.394   1.00 31.22 ? 90   MET A N   1 
ATOM   715  C  CA  . MET A 1 90  ? 95.209  57.236 5.182   1.00 30.25 ? 90   MET A CA  1 
ATOM   716  C  C   . MET A 1 90  ? 94.827  58.453 4.322   1.00 30.57 ? 90   MET A C   1 
ATOM   717  O  O   . MET A 1 90  ? 95.556  58.832 3.426   1.00 30.49 ? 90   MET A O   1 
ATOM   718  C  CB  . MET A 1 90  ? 96.064  57.673 6.369   1.00 30.24 ? 90   MET A CB  1 
ATOM   719  C  CG  . MET A 1 90  ? 96.157  56.610 7.449   1.00 27.42 ? 90   MET A CG  1 
ATOM   720  S  SD  . MET A 1 90  ? 97.166  57.150 8.832   1.00 30.51 ? 90   MET A SD  1 
ATOM   721  C  CE  . MET A 1 90  ? 98.803  57.303 8.143   1.00 24.23 ? 90   MET A CE  1 
ATOM   722  N  N   . SER A 1 91  ? 93.657  59.027 4.583   1.00 29.47 ? 91   SER A N   1 
ATOM   723  C  CA  . SER A 1 91  ? 93.235  60.244 3.890   1.00 29.63 ? 91   SER A CA  1 
ATOM   724  C  C   . SER A 1 91  ? 92.161  60.912 4.730   1.00 27.89 ? 91   SER A C   1 
ATOM   725  O  O   . SER A 1 91  ? 91.457  60.257 5.446   1.00 26.33 ? 91   SER A O   1 
ATOM   726  C  CB  . SER A 1 91  ? 92.750  59.922 2.481   1.00 30.60 ? 91   SER A CB  1 
ATOM   727  O  OG  . SER A 1 91  ? 91.953  60.938 1.973   1.00 33.21 ? 91   SER A OG  1 
ATOM   728  N  N   . GLU A 1 92  ? 92.103  62.237 4.683   1.00 28.55 ? 92   GLU A N   1 
ATOM   729  C  CA  . GLU A 1 92  ? 91.067  63.011 5.321   1.00 27.09 ? 92   GLU A CA  1 
ATOM   730  C  C   . GLU A 1 92  ? 89.746  62.684 4.640   1.00 27.46 ? 92   GLU A C   1 
ATOM   731  O  O   . GLU A 1 92  ? 88.680  62.788 5.243   1.00 26.71 ? 92   GLU A O   1 
ATOM   732  C  CB  . GLU A 1 92  ? 91.371  64.499 5.185   1.00 27.84 ? 92   GLU A CB  1 
ATOM   733  C  CG  . GLU A 1 92  ? 92.400  64.976 6.158   1.00 28.16 ? 92   GLU A CG  1 
ATOM   734  C  CD  . GLU A 1 92  ? 92.471  66.476 6.170   1.00 33.92 ? 92   GLU A CD  1 
ATOM   735  O  OE1 . GLU A 1 92  ? 93.211  67.046 5.334   1.00 33.45 ? 92   GLU A OE1 1 
ATOM   736  O  OE2 . GLU A 1 92  ? 91.759  67.089 7.005   1.00 34.94 ? 92   GLU A OE2 1 
ATOM   737  N  N   . ASP A 1 93  ? 89.820  62.266 3.384   1.00 28.41 ? 93   ASP A N   1 
ATOM   738  C  CA  . ASP A 1 93  ? 88.639  61.778 2.703   1.00 29.66 ? 93   ASP A CA  1 
ATOM   739  C  C   . ASP A 1 93  ? 88.392  60.317 3.182   1.00 28.40 ? 93   ASP A C   1 
ATOM   740  O  O   . ASP A 1 93  ? 88.805  59.385 2.552   1.00 29.04 ? 93   ASP A O   1 
ATOM   741  C  CB  . ASP A 1 93  ? 88.839  61.890 1.181   1.00 30.15 ? 93   ASP A CB  1 
ATOM   742  C  CG  . ASP A 1 93  ? 87.654  61.311 0.383   1.00 32.26 ? 93   ASP A CG  1 
ATOM   743  O  OD1 . ASP A 1 93  ? 86.671  60.812 0.987   1.00 29.93 ? 93   ASP A OD1 1 
ATOM   744  O  OD2 . ASP A 1 93  ? 87.714  61.356 -0.858  1.00 35.43 ? 93   ASP A OD2 1 
ATOM   745  N  N   . CYS A 1 94  ? 87.715  60.137 4.308   1.00 28.97 ? 94   CYS A N   1 
ATOM   746  C  CA  . CYS A 1 94  ? 87.633  58.808 4.920   1.00 28.71 ? 94   CYS A CA  1 
ATOM   747  C  C   . CYS A 1 94  ? 86.261  58.464 5.475   1.00 28.01 ? 94   CYS A C   1 
ATOM   748  O  O   . CYS A 1 94  ? 86.105  57.453 6.165   1.00 26.80 ? 94   CYS A O   1 
ATOM   749  C  CB  . CYS A 1 94  ? 88.672  58.711 6.061   1.00 28.75 ? 94   CYS A CB  1 
ATOM   750  S  SG  . CYS A 1 94  ? 88.426  59.941 7.411   1.00 28.20 ? 94   CYS A SG  1 
ATOM   751  N  N   . LEU A 1 95  ? 85.249  59.297 5.211   1.00 28.26 ? 95   LEU A N   1 
ATOM   752  C  CA  . LEU A 1 95  ? 83.946  59.022 5.851   1.00 27.14 ? 95   LEU A CA  1 
ATOM   753  C  C   . LEU A 1 95  ? 83.123  58.025 5.034   1.00 27.49 ? 95   LEU A C   1 
ATOM   754  O  O   . LEU A 1 95  ? 82.275  58.405 4.213   1.00 28.67 ? 95   LEU A O   1 
ATOM   755  C  CB  . LEU A 1 95  ? 83.172  60.304 6.183   1.00 27.00 ? 95   LEU A CB  1 
ATOM   756  C  CG  . LEU A 1 95  ? 83.892  61.272 7.145   1.00 27.34 ? 95   LEU A CG  1 
ATOM   757  C  CD1 . LEU A 1 95  ? 82.977  62.452 7.432   1.00 21.26 ? 95   LEU A CD1 1 
ATOM   758  C  CD2 . LEU A 1 95  ? 84.273  60.536 8.457   1.00 22.18 ? 95   LEU A CD2 1 
ATOM   759  N  N   . TYR A 1 96  ? 83.393  56.744 5.261   1.00 26.85 ? 96   TYR A N   1 
ATOM   760  C  CA  . TYR A 1 96  ? 82.733  55.661 4.527   1.00 27.29 ? 96   TYR A CA  1 
ATOM   761  C  C   . TYR A 1 96  ? 82.208  54.615 5.497   1.00 26.52 ? 96   TYR A C   1 
ATOM   762  O  O   . TYR A 1 96  ? 82.653  54.568 6.648   1.00 26.32 ? 96   TYR A O   1 
ATOM   763  C  CB  . TYR A 1 96  ? 83.717  55.039 3.527   1.00 28.17 ? 96   TYR A CB  1 
ATOM   764  C  CG  . TYR A 1 96  ? 84.223  56.027 2.516   1.00 28.06 ? 96   TYR A CG  1 
ATOM   765  C  CD1 . TYR A 1 96  ? 85.313  56.841 2.802   1.00 29.31 ? 96   TYR A CD1 1 
ATOM   766  C  CD2 . TYR A 1 96  ? 83.591  56.179 1.279   1.00 28.43 ? 96   TYR A CD2 1 
ATOM   767  C  CE1 . TYR A 1 96  ? 85.790  57.795 1.851   1.00 28.93 ? 96   TYR A CE1 1 
ATOM   768  C  CE2 . TYR A 1 96  ? 84.051  57.119 0.329   1.00 29.42 ? 96   TYR A CE2 1 
ATOM   769  C  CZ  . TYR A 1 96  ? 85.132  57.926 0.626   1.00 30.73 ? 96   TYR A CZ  1 
ATOM   770  O  OH  . TYR A 1 96  ? 85.569  58.852 -0.295  1.00 30.98 ? 96   TYR A OH  1 
ATOM   771  N  N   . LEU A 1 97  ? 81.236  53.815 5.059   1.00 26.94 ? 97   LEU A N   1 
ATOM   772  C  CA  . LEU A 1 97  ? 80.781  52.658 5.852   1.00 26.31 ? 97   LEU A CA  1 
ATOM   773  C  C   . LEU A 1 97  ? 80.785  51.373 5.043   1.00 26.91 ? 97   LEU A C   1 
ATOM   774  O  O   . LEU A 1 97  ? 80.835  51.408 3.815   1.00 26.85 ? 97   LEU A O   1 
ATOM   775  C  CB  . LEU A 1 97  ? 79.406  52.922 6.500   1.00 26.04 ? 97   LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 97  ? 78.213  53.338 5.624   1.00 28.53 ? 97   LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 97  ? 77.472  52.124 5.112   1.00 28.14 ? 97   LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 97  ? 77.251  54.215 6.436   1.00 27.94 ? 97   LEU A CD2 1 
ATOM   779  N  N   . ASN A 1 98  ? 80.738  50.236 5.741   1.00 26.98 ? 98   ASN A N   1 
ATOM   780  C  CA  . ASN A 1 98  ? 80.737  48.925 5.093   1.00 28.11 ? 98   ASN A CA  1 
ATOM   781  C  C   . ASN A 1 98  ? 79.579  48.079 5.571   1.00 28.64 ? 98   ASN A C   1 
ATOM   782  O  O   . ASN A 1 98  ? 79.183  48.133 6.742   1.00 28.02 ? 98   ASN A O   1 
ATOM   783  C  CB  . ASN A 1 98  ? 82.023  48.162 5.374   1.00 28.34 ? 98   ASN A CB  1 
ATOM   784  C  CG  . ASN A 1 98  ? 83.246  49.035 5.285   1.00 28.04 ? 98   ASN A CG  1 
ATOM   785  O  OD1 . ASN A 1 98  ? 83.676  49.400 4.202   1.00 30.03 ? 98   ASN A OD1 1 
ATOM   786  N  ND2 . ASN A 1 98  ? 83.844  49.325 6.430   1.00 26.03 ? 98   ASN A ND2 1 
ATOM   787  N  N   . ILE A 1 99  ? 79.033  47.285 4.659   1.00 29.77 ? 99   ILE A N   1 
ATOM   788  C  CA  . ILE A 1 99  ? 77.861  46.476 4.988   1.00 30.39 ? 99   ILE A CA  1 
ATOM   789  C  C   . ILE A 1 99  ? 78.057  45.037 4.553   1.00 31.74 ? 99   ILE A C   1 
ATOM   790  O  O   . ILE A 1 99  ? 78.510  44.754 3.452   1.00 32.93 ? 99   ILE A O   1 
ATOM   791  C  CB  . ILE A 1 99  ? 76.543  47.016 4.360   1.00 30.62 ? 99   ILE A CB  1 
ATOM   792  C  CG1 . ILE A 1 99  ? 76.471  48.543 4.484   1.00 28.46 ? 99   ILE A CG1 1 
ATOM   793  C  CG2 . ILE A 1 99  ? 75.356  46.384 5.058   1.00 29.49 ? 99   ILE A CG2 1 
ATOM   794  C  CD1 . ILE A 1 99  ? 75.180  49.159 3.959   1.00 32.06 ? 99   ILE A CD1 1 
ATOM   795  N  N   . TRP A 1 100 ? 77.720  44.126 5.443   1.00 32.51 ? 100  TRP A N   1 
ATOM   796  C  CA  . TRP A 1 100 ? 77.685  42.702 5.085   1.00 32.83 ? 100  TRP A CA  1 
ATOM   797  C  C   . TRP A 1 100 ? 76.236  42.301 5.165   1.00 33.30 ? 100  TRP A C   1 
ATOM   798  O  O   . TRP A 1 100 ? 75.589  42.508 6.201   1.00 32.48 ? 100  TRP A O   1 
ATOM   799  C  CB  . TRP A 1 100 ? 78.568  41.907 6.037   1.00 31.62 ? 100  TRP A CB  1 
ATOM   800  C  CG  . TRP A 1 100 ? 80.009  42.081 5.736   1.00 30.96 ? 100  TRP A CG  1 
ATOM   801  C  CD1 . TRP A 1 100 ? 80.761  41.340 4.844   1.00 34.70 ? 100  TRP A CD1 1 
ATOM   802  C  CD2 . TRP A 1 100 ? 80.886  43.044 6.287   1.00 28.99 ? 100  TRP A CD2 1 
ATOM   803  N  NE1 . TRP A 1 100 ? 82.057  41.780 4.839   1.00 35.35 ? 100  TRP A NE1 1 
ATOM   804  C  CE2 . TRP A 1 100 ? 82.158  42.839 5.700   1.00 31.56 ? 100  TRP A CE2 1 
ATOM   805  C  CE3 . TRP A 1 100 ? 80.721  44.097 7.201   1.00 30.42 ? 100  TRP A CE3 1 
ATOM   806  C  CZ2 . TRP A 1 100 ? 83.268  43.627 6.015   1.00 32.34 ? 100  TRP A CZ2 1 
ATOM   807  C  CZ3 . TRP A 1 100 ? 81.828  44.865 7.529   1.00 29.91 ? 100  TRP A CZ3 1 
ATOM   808  C  CH2 . TRP A 1 100 ? 83.087  44.631 6.930   1.00 29.06 ? 100  TRP A CH2 1 
ATOM   809  N  N   . VAL A 1 101 ? 75.709  41.796 4.049   1.00 35.44 ? 101  VAL A N   1 
ATOM   810  C  CA  . VAL A 1 101 ? 74.311  41.348 3.973   1.00 36.65 ? 101  VAL A CA  1 
ATOM   811  C  C   . VAL A 1 101 ? 74.201  39.831 3.730   1.00 38.67 ? 101  VAL A C   1 
ATOM   812  O  O   . VAL A 1 101 ? 74.786  39.314 2.776   1.00 40.19 ? 101  VAL A O   1 
ATOM   813  C  CB  . VAL A 1 101 ? 73.541  42.110 2.870   1.00 37.21 ? 101  VAL A CB  1 
ATOM   814  C  CG1 . VAL A 1 101 ? 72.063  41.682 2.820   1.00 37.19 ? 101  VAL A CG1 1 
ATOM   815  C  CG2 . VAL A 1 101 ? 73.636  43.586 3.102   1.00 35.39 ? 101  VAL A CG2 1 
ATOM   816  N  N   . PRO A 1 102 ? 73.447  39.108 4.585   1.00 39.55 ? 102  PRO A N   1 
ATOM   817  C  CA  . PRO A 1 102 ? 73.230  37.673 4.355   1.00 41.59 ? 102  PRO A CA  1 
ATOM   818  C  C   . PRO A 1 102 ? 72.662  37.370 2.975   1.00 44.56 ? 102  PRO A C   1 
ATOM   819  O  O   . PRO A 1 102 ? 71.875  38.160 2.432   1.00 45.20 ? 102  PRO A O   1 
ATOM   820  C  CB  . PRO A 1 102 ? 72.205  37.310 5.426   1.00 41.73 ? 102  PRO A CB  1 
ATOM   821  C  CG  . PRO A 1 102 ? 72.536  38.217 6.544   1.00 39.41 ? 102  PRO A CG  1 
ATOM   822  C  CD  . PRO A 1 102 ? 72.852  39.539 5.866   1.00 37.97 ? 102  PRO A CD  1 
ATOM   823  N  N   . SER A 1 103 ? 73.065  36.235 2.409   1.00 46.83 ? 103  SER A N   1 
ATOM   824  C  CA  . SER A 1 103 ? 72.643  35.852 1.078   1.00 49.60 ? 103  SER A CA  1 
ATOM   825  C  C   . SER A 1 103 ? 71.946  34.491 1.152   1.00 52.59 ? 103  SER A C   1 
ATOM   826  O  O   . SER A 1 103 ? 72.568  33.516 1.564   1.00 53.49 ? 103  SER A O   1 
ATOM   827  C  CB  . SER A 1 103 ? 73.844  35.805 0.123   1.00 49.81 ? 103  SER A CB  1 
ATOM   828  O  OG  . SER A 1 103 ? 73.446  35.477 -1.202  1.00 51.05 ? 103  SER A OG  1 
ATOM   829  N  N   . PRO A 1 104 ? 70.667  34.411 0.712   1.00 54.59 ? 104  PRO A N   1 
ATOM   830  C  CA  . PRO A 1 104 ? 69.930  35.478 0.006   1.00 54.62 ? 104  PRO A CA  1 
ATOM   831  C  C   . PRO A 1 104 ? 69.498  36.586 0.943   1.00 52.49 ? 104  PRO A C   1 
ATOM   832  O  O   . PRO A 1 104 ? 69.410  36.354 2.152   1.00 51.37 ? 104  PRO A O   1 
ATOM   833  C  CB  . PRO A 1 104 ? 68.698  34.750 -0.556  1.00 57.04 ? 104  PRO A CB  1 
ATOM   834  C  CG  . PRO A 1 104 ? 68.463  33.629 0.416   1.00 58.44 ? 104  PRO A CG  1 
ATOM   835  C  CD  . PRO A 1 104 ? 69.827  33.216 0.938   1.00 56.55 ? 104  PRO A CD  1 
ATOM   836  N  N   . ARG A 1 105 ? 69.242  37.773 0.381   1.00 52.44 ? 105  ARG A N   1 
ATOM   837  C  CA  . ARG A 1 105 ? 68.885  38.965 1.166   1.00 51.18 ? 105  ARG A CA  1 
ATOM   838  C  C   . ARG A 1 105 ? 67.684  38.699 2.076   1.00 52.20 ? 105  ARG A C   1 
ATOM   839  O  O   . ARG A 1 105 ? 66.602  38.302 1.614   1.00 54.41 ? 105  ARG A O   1 
ATOM   840  C  CB  . ARG A 1 105 ? 68.609  40.174 0.273   1.00 50.52 ? 105  ARG A CB  1 
ATOM   841  C  CG  . ARG A 1 105 ? 68.507  41.485 1.049   1.00 49.45 ? 105  ARG A CG  1 
ATOM   842  C  CD  . ARG A 1 105 ? 68.029  42.622 0.172   1.00 50.19 ? 105  ARG A CD  1 
ATOM   843  N  NE  . ARG A 1 105 ? 68.994  42.953 -0.870  1.00 48.65 ? 105  ARG A NE  1 
ATOM   844  C  CZ  . ARG A 1 105 ? 68.680  43.508 -2.033  1.00 51.36 ? 105  ARG A CZ  1 
ATOM   845  N  NH1 . ARG A 1 105 ? 67.409  43.778 -2.324  1.00 51.45 ? 105  ARG A NH1 1 
ATOM   846  N  NH2 . ARG A 1 105 ? 69.641  43.770 -2.914  1.00 52.35 ? 105  ARG A NH2 1 
ATOM   847  N  N   . PRO A 1 106 ? 67.877  38.903 3.378   1.00 51.41 ? 106  PRO A N   1 
ATOM   848  C  CA  . PRO A 1 106 ? 66.793  38.764 4.329   1.00 52.50 ? 106  PRO A CA  1 
ATOM   849  C  C   . PRO A 1 106 ? 65.736  39.854 4.083   1.00 53.21 ? 106  PRO A C   1 
ATOM   850  O  O   . PRO A 1 106 ? 66.021  40.862 3.422   1.00 51.96 ? 106  PRO A O   1 
ATOM   851  C  CB  . PRO A 1 106 ? 67.495  38.993 5.673   1.00 50.25 ? 106  PRO A CB  1 
ATOM   852  C  CG  . PRO A 1 106 ? 68.620  39.896 5.331   1.00 49.17 ? 106  PRO A CG  1 
ATOM   853  C  CD  . PRO A 1 106 ? 69.108  39.406 4.018   1.00 49.55 ? 106  PRO A CD  1 
ATOM   854  N  N   . LYS A 1 107 ? 64.529  39.643 4.612   1.00 55.23 ? 107  LYS A N   1 
ATOM   855  C  CA  . LYS A 1 107 ? 63.430  40.572 4.363   1.00 56.09 ? 107  LYS A CA  1 
ATOM   856  C  C   . LYS A 1 107 ? 63.608  41.871 5.115   1.00 53.82 ? 107  LYS A C   1 
ATOM   857  O  O   . LYS A 1 107 ? 63.701  42.946 4.493   1.00 54.69 ? 107  LYS A O   1 
ATOM   858  C  CB  . LYS A 1 107 ? 62.064  39.958 4.647   1.00 57.80 ? 107  LYS A CB  1 
ATOM   859  C  CG  . LYS A 1 107 ? 61.372  39.522 3.386   1.00 61.33 ? 107  LYS A CG  1 
ATOM   860  C  CD  . LYS A 1 107 ? 59.873  39.745 3.463   1.00 64.40 ? 107  LYS A CD  1 
ATOM   861  C  CE  . LYS A 1 107 ? 59.160  39.072 2.293   1.00 68.78 ? 107  LYS A CE  1 
ATOM   862  N  NZ  . LYS A 1 107 ? 59.638  39.653 1.003   1.00 70.65 ? 107  LYS A NZ  1 
ATOM   863  N  N   . SER A 1 108 ? 63.660  41.790 6.433   1.00 51.44 ? 108  SER A N   1 
ATOM   864  C  CA  . SER A 1 108 ? 63.766  43.001 7.200   1.00 49.33 ? 108  SER A CA  1 
ATOM   865  C  C   . SER A 1 108 ? 64.421  42.707 8.544   1.00 47.53 ? 108  SER A C   1 
ATOM   866  O  O   . SER A 1 108 ? 63.748  42.688 9.589   1.00 47.77 ? 108  SER A O   1 
ATOM   867  C  CB  . SER A 1 108 ? 62.385  43.605 7.389   1.00 50.28 ? 108  SER A CB  1 
ATOM   868  O  OG  . SER A 1 108 ? 62.541  44.920 7.840   1.00 51.01 ? 108  SER A OG  1 
ATOM   869  N  N   . THR A 1 109 ? 65.731  42.481 8.525   1.00 44.70 ? 109  THR A N   1 
ATOM   870  C  CA  . THR A 1 109 ? 66.350  41.848 9.680   1.00 43.76 ? 109  THR A CA  1 
ATOM   871  C  C   . THR A 1 109 ? 67.059  42.822 10.630  1.00 40.57 ? 109  THR A C   1 
ATOM   872  O  O   . THR A 1 109 ? 67.312  43.977 10.268  1.00 39.69 ? 109  THR A O   1 
ATOM   873  C  CB  . THR A 1 109 ? 67.275  40.646 9.263   1.00 44.25 ? 109  THR A CB  1 
ATOM   874  O  OG1 . THR A 1 109 ? 67.538  39.815 10.410  1.00 44.85 ? 109  THR A OG1 1 
ATOM   875  C  CG2 . THR A 1 109 ? 68.590  41.150 8.691   1.00 42.70 ? 109  THR A CG2 1 
ATOM   876  N  N   . THR A 1 110 ? 67.353  42.349 11.842  1.00 38.32 ? 110  THR A N   1 
ATOM   877  C  CA  . THR A 1 110 ? 68.180  43.079 12.828  1.00 35.21 ? 110  THR A CA  1 
ATOM   878  C  C   . THR A 1 110 ? 69.458  43.601 12.219  1.00 32.79 ? 110  THR A C   1 
ATOM   879  O  O   . THR A 1 110 ? 70.123  42.874 11.486  1.00 32.30 ? 110  THR A O   1 
ATOM   880  C  CB  . THR A 1 110 ? 68.536  42.153 13.976  1.00 35.57 ? 110  THR A CB  1 
ATOM   881  O  OG1 . THR A 1 110 ? 67.325  41.724 14.597  1.00 38.43 ? 110  THR A OG1 1 
ATOM   882  C  CG2 . THR A 1 110 ? 69.421  42.832 15.029  1.00 34.46 ? 110  THR A CG2 1 
ATOM   883  N  N   . VAL A 1 111 ? 69.783  44.863 12.521  1.00 30.89 ? 111  VAL A N   1 
ATOM   884  C  CA  . VAL A 1 111 ? 70.984  45.552 12.012  1.00 29.13 ? 111  VAL A CA  1 
ATOM   885  C  C   . VAL A 1 111 ? 71.919  45.777 13.202  1.00 28.69 ? 111  VAL A C   1 
ATOM   886  O  O   . VAL A 1 111 ? 71.448  46.138 14.275  1.00 27.82 ? 111  VAL A O   1 
ATOM   887  C  CB  . VAL A 1 111 ? 70.624  46.944 11.425  1.00 28.92 ? 111  VAL A CB  1 
ATOM   888  C  CG1 . VAL A 1 111 ? 71.860  47.697 10.975  1.00 25.66 ? 111  VAL A CG1 1 
ATOM   889  C  CG2 . VAL A 1 111 ? 69.624  46.825 10.275  1.00 30.13 ? 111  VAL A CG2 1 
ATOM   890  N  N   . MET A 1 112 ? 73.224  45.526 13.029  1.00 28.08 ? 112  MET A N   1 
ATOM   891  C  CA  . MET A 1 112 ? 74.206  45.848 14.060  1.00 27.51 ? 112  MET A CA  1 
ATOM   892  C  C   . MET A 1 112 ? 75.238  46.768 13.415  1.00 27.42 ? 112  MET A C   1 
ATOM   893  O  O   . MET A 1 112 ? 75.770  46.457 12.324  1.00 28.48 ? 112  MET A O   1 
ATOM   894  C  CB  . MET A 1 112 ? 74.892  44.578 14.616  1.00 28.12 ? 112  MET A CB  1 
ATOM   895  C  CG  . MET A 1 112 ? 73.935  43.564 15.287  1.00 28.78 ? 112  MET A CG  1 
ATOM   896  S  SD  . MET A 1 112 ? 74.757  42.074 15.922  1.00 29.39 ? 112  MET A SD  1 
ATOM   897  C  CE  . MET A 1 112 ? 75.409  42.555 17.529  1.00 24.50 ? 112  MET A CE  1 
ATOM   898  N  N   . VAL A 1 113 ? 75.504  47.900 14.059  1.00 26.18 ? 113  VAL A N   1 
ATOM   899  C  CA  . VAL A 1 113 ? 76.430  48.906 13.555  1.00 25.34 ? 113  VAL A CA  1 
ATOM   900  C  C   . VAL A 1 113 ? 77.614  49.002 14.504  1.00 25.21 ? 113  VAL A C   1 
ATOM   901  O  O   . VAL A 1 113 ? 77.464  49.323 15.701  1.00 24.70 ? 113  VAL A O   1 
ATOM   902  C  CB  . VAL A 1 113 ? 75.756  50.269 13.480  1.00 25.60 ? 113  VAL A CB  1 
ATOM   903  C  CG1 . VAL A 1 113 ? 76.713  51.322 12.978  1.00 26.00 ? 113  VAL A CG1 1 
ATOM   904  C  CG2 . VAL A 1 113 ? 74.560  50.212 12.588  1.00 26.68 ? 113  VAL A CG2 1 
ATOM   905  N  N   . TRP A 1 114 ? 78.779  48.664 13.975  1.00 25.38 ? 114  TRP A N   1 
ATOM   906  C  CA  . TRP A 1 114 ? 80.006  48.605 14.745  1.00 25.10 ? 114  TRP A CA  1 
ATOM   907  C  C   . TRP A 1 114 ? 80.685  49.950 14.757  1.00 24.73 ? 114  TRP A C   1 
ATOM   908  O  O   . TRP A 1 114 ? 80.882  50.568 13.689  1.00 24.42 ? 114  TRP A O   1 
ATOM   909  C  CB  . TRP A 1 114 ? 80.951  47.546 14.152  1.00 25.45 ? 114  TRP A CB  1 
ATOM   910  C  CG  . TRP A 1 114 ? 82.312  47.549 14.809  1.00 24.51 ? 114  TRP A CG  1 
ATOM   911  C  CD1 . TRP A 1 114 ? 83.504  47.987 14.254  1.00 22.49 ? 114  TRP A CD1 1 
ATOM   912  C  CD2 . TRP A 1 114 ? 82.632  47.091 16.143  1.00 24.25 ? 114  TRP A CD2 1 
ATOM   913  N  NE1 . TRP A 1 114 ? 84.544  47.848 15.187  1.00 25.04 ? 114  TRP A NE1 1 
ATOM   914  C  CE2 . TRP A 1 114 ? 84.034  47.300 16.342  1.00 23.87 ? 114  TRP A CE2 1 
ATOM   915  C  CE3 . TRP A 1 114 ? 81.869  46.569 17.201  1.00 23.56 ? 114  TRP A CE3 1 
ATOM   916  C  CZ2 . TRP A 1 114 ? 84.682  46.975 17.542  1.00 22.06 ? 114  TRP A CZ2 1 
ATOM   917  C  CZ3 . TRP A 1 114 ? 82.520  46.241 18.406  1.00 22.86 ? 114  TRP A CZ3 1 
ATOM   918  C  CH2 . TRP A 1 114 ? 83.919  46.435 18.558  1.00 23.39 ? 114  TRP A CH2 1 
ATOM   919  N  N   . ILE A 1 115 ? 81.060  50.400 15.951  1.00 23.87 ? 115  ILE A N   1 
ATOM   920  C  CA  . ILE A 1 115 ? 81.821  51.641 16.064  1.00 23.66 ? 115  ILE A CA  1 
ATOM   921  C  C   . ILE A 1 115 ? 83.216  51.391 16.644  1.00 23.66 ? 115  ILE A C   1 
ATOM   922  O  O   . ILE A 1 115 ? 83.331  51.114 17.833  1.00 23.01 ? 115  ILE A O   1 
ATOM   923  C  CB  . ILE A 1 115 ? 81.106  52.682 16.961  1.00 24.14 ? 115  ILE A CB  1 
ATOM   924  C  CG1 . ILE A 1 115 ? 79.655  52.940 16.488  1.00 21.85 ? 115  ILE A CG1 1 
ATOM   925  C  CG2 . ILE A 1 115 ? 81.918  53.954 16.996  1.00 21.28 ? 115  ILE A CG2 1 
ATOM   926  C  CD1 . ILE A 1 115 ? 78.913  53.910 17.453  1.00 19.36 ? 115  ILE A CD1 1 
ATOM   927  N  N   . TYR A 1 116 ? 84.266  51.478 15.820  1.00 23.11 ? 116  TYR A N   1 
ATOM   928  C  CA  . TYR A 1 116 ? 85.617  51.152 16.305  1.00 23.10 ? 116  TYR A CA  1 
ATOM   929  C  C   . TYR A 1 116 ? 86.166  52.020 17.471  1.00 23.15 ? 116  TYR A C   1 
ATOM   930  O  O   . TYR A 1 116 ? 85.816  53.194 17.621  1.00 22.54 ? 116  TYR A O   1 
ATOM   931  C  CB  . TYR A 1 116 ? 86.618  51.073 15.135  1.00 22.81 ? 116  TYR A CB  1 
ATOM   932  C  CG  . TYR A 1 116 ? 86.804  52.360 14.349  1.00 24.90 ? 116  TYR A CG  1 
ATOM   933  C  CD1 . TYR A 1 116 ? 87.368  53.487 14.946  1.00 22.48 ? 116  TYR A CD1 1 
ATOM   934  C  CD2 . TYR A 1 116 ? 86.450  52.436 12.977  1.00 22.83 ? 116  TYR A CD2 1 
ATOM   935  C  CE1 . TYR A 1 116 ? 87.529  54.692 14.215  1.00 22.13 ? 116  TYR A CE1 1 
ATOM   936  C  CE2 . TYR A 1 116 ? 86.636  53.605 12.254  1.00 20.63 ? 116  TYR A CE2 1 
ATOM   937  C  CZ  . TYR A 1 116 ? 87.161  54.724 12.884  1.00 21.72 ? 116  TYR A CZ  1 
ATOM   938  O  OH  . TYR A 1 116 ? 87.359  55.872 12.184  1.00 21.13 ? 116  TYR A OH  1 
ATOM   939  N  N   . GLY A 1 117 ? 87.031  51.436 18.298  1.00 24.04 ? 117  GLY A N   1 
ATOM   940  C  CA  . GLY A 1 117 ? 87.750  52.198 19.334  1.00 23.44 ? 117  GLY A CA  1 
ATOM   941  C  C   . GLY A 1 117 ? 89.115  52.663 18.854  1.00 24.81 ? 117  GLY A C   1 
ATOM   942  O  O   . GLY A 1 117 ? 89.343  52.796 17.626  1.00 25.90 ? 117  GLY A O   1 
ATOM   943  N  N   . GLY A 1 118 ? 90.032  52.918 19.789  1.00 24.51 ? 118  GLY A N   1 
ATOM   944  C  CA  . GLY A 1 118 ? 91.321  53.528 19.440  1.00 25.39 ? 118  GLY A CA  1 
ATOM   945  C  C   . GLY A 1 118 ? 91.524  54.912 20.066  1.00 25.65 ? 118  GLY A C   1 
ATOM   946  O  O   . GLY A 1 118 ? 92.295  55.704 19.541  1.00 27.65 ? 118  GLY A O   1 
ATOM   947  N  N   . GLY A 1 119 ? 90.831  55.204 21.170  1.00 24.29 ? 119  GLY A N   1 
ATOM   948  C  CA  . GLY A 1 119 ? 91.135  56.342 22.054  1.00 23.41 ? 119  GLY A CA  1 
ATOM   949  C  C   . GLY A 1 119 ? 90.753  57.733 21.529  1.00 23.96 ? 119  GLY A C   1 
ATOM   950  O  O   . GLY A 1 119 ? 91.205  58.753 22.060  1.00 22.89 ? 119  GLY A O   1 
ATOM   951  N  N   . PHE A 1 120 ? 89.892  57.749 20.503  1.00 23.28 ? 120  PHE A N   1 
ATOM   952  C  CA  . PHE A 1 120 ? 89.538  58.932 19.732  1.00 23.81 ? 120  PHE A CA  1 
ATOM   953  C  C   . PHE A 1 120 ? 90.678  59.539 18.921  1.00 24.33 ? 120  PHE A C   1 
ATOM   954  O  O   . PHE A 1 120 ? 90.496  60.634 18.347  1.00 26.22 ? 120  PHE A O   1 
ATOM   955  C  CB  . PHE A 1 120 ? 88.842  59.991 20.590  1.00 22.41 ? 120  PHE A CB  1 
ATOM   956  C  CG  . PHE A 1 120 ? 87.570  59.497 21.211  1.00 22.14 ? 120  PHE A CG  1 
ATOM   957  C  CD1 . PHE A 1 120 ? 86.454  59.254 20.429  1.00 20.08 ? 120  PHE A CD1 1 
ATOM   958  C  CD2 . PHE A 1 120 ? 87.505  59.237 22.572  1.00 18.84 ? 120  PHE A CD2 1 
ATOM   959  C  CE1 . PHE A 1 120 ? 85.264  58.784 21.014  1.00 22.61 ? 120  PHE A CE1 1 
ATOM   960  C  CE2 . PHE A 1 120 ? 86.329  58.797 23.174  1.00 19.01 ? 120  PHE A CE2 1 
ATOM   961  C  CZ  . PHE A 1 120 ? 85.198  58.554 22.380  1.00 21.38 ? 120  PHE A CZ  1 
ATOM   962  N  N   . TYR A 1 121 ? 91.827  58.851 18.874  1.00 23.88 ? 121  TYR A N   1 
ATOM   963  C  CA  . TYR A 1 121 ? 93.027  59.336 18.142  1.00 24.00 ? 121  TYR A CA  1 
ATOM   964  C  C   . TYR A 1 121 ? 93.421  58.369 17.005  1.00 24.74 ? 121  TYR A C   1 
ATOM   965  O  O   . TYR A 1 121 ? 94.318  58.690 16.214  1.00 26.36 ? 121  TYR A O   1 
ATOM   966  C  CB  . TYR A 1 121 ? 94.231  59.539 19.092  1.00 23.27 ? 121  TYR A CB  1 
ATOM   967  C  CG  . TYR A 1 121 ? 94.883  58.220 19.554  1.00 25.28 ? 121  TYR A CG  1 
ATOM   968  C  CD1 . TYR A 1 121 ? 95.822  57.555 18.751  1.00 25.76 ? 121  TYR A CD1 1 
ATOM   969  C  CD2 . TYR A 1 121 ? 94.532  57.634 20.770  1.00 23.88 ? 121  TYR A CD2 1 
ATOM   970  C  CE1 . TYR A 1 121 ? 96.393  56.381 19.152  1.00 26.95 ? 121  TYR A CE1 1 
ATOM   971  C  CE2 . TYR A 1 121 ? 95.079  56.455 21.179  1.00 25.44 ? 121  TYR A CE2 1 
ATOM   972  C  CZ  . TYR A 1 121 ? 96.013  55.825 20.371  1.00 30.40 ? 121  TYR A CZ  1 
ATOM   973  O  OH  . TYR A 1 121 ? 96.570  54.631 20.781  1.00 34.20 ? 121  TYR A OH  1 
ATOM   974  N  N   . SER A 1 122 ? 92.802  57.181 16.952  1.00 23.91 ? 122  SER A N   1 
ATOM   975  C  CA  . SER A 1 122 ? 93.080  56.167 15.924  1.00 24.62 ? 122  SER A CA  1 
ATOM   976  C  C   . SER A 1 122 ? 91.882  55.241 15.724  1.00 24.31 ? 122  SER A C   1 
ATOM   977  O  O   . SER A 1 122 ? 90.874  55.403 16.376  1.00 24.64 ? 122  SER A O   1 
ATOM   978  C  CB  . SER A 1 122 ? 94.288  55.303 16.331  1.00 25.31 ? 122  SER A CB  1 
ATOM   979  O  OG  . SER A 1 122 ? 93.986  54.643 17.541  1.00 25.06 ? 122  SER A OG  1 
ATOM   980  N  N   . GLY A 1 123 ? 92.022  54.246 14.851  1.00 24.48 ? 123  GLY A N   1 
ATOM   981  C  CA  . GLY A 1 123 ? 90.937  53.327 14.531  1.00 24.48 ? 123  GLY A CA  1 
ATOM   982  C  C   . GLY A 1 123 ? 90.637  53.300 13.037  1.00 24.62 ? 123  GLY A C   1 
ATOM   983  O  O   . GLY A 1 123 ? 90.896  54.260 12.338  1.00 24.69 ? 123  GLY A O   1 
ATOM   984  N  N   . SER A 1 124 ? 90.112  52.178 12.540  1.00 25.36 ? 124  SER A N   1 
ATOM   985  C  CA  . SER A 1 124 ? 89.684  52.044 11.122  1.00 24.68 ? 124  SER A CA  1 
ATOM   986  C  C   . SER A 1 124 ? 88.632  50.950 11.096  1.00 25.51 ? 124  SER A C   1 
ATOM   987  O  O   . SER A 1 124 ? 88.664  50.027 11.927  1.00 25.43 ? 124  SER A O   1 
ATOM   988  C  CB  . SER A 1 124 ? 90.819  51.596 10.225  1.00 25.24 ? 124  SER A CB  1 
ATOM   989  O  OG  . SER A 1 124 ? 92.038  52.159 10.590  1.00 24.89 ? 124  SER A OG  1 
ATOM   990  N  N   . SER A 1 125 ? 87.721  51.051 10.141  1.00 25.22 ? 125  SER A N   1 
ATOM   991  C  CA  . SER A 1 125 ? 86.623  50.140 10.039  1.00 25.46 ? 125  SER A CA  1 
ATOM   992  C  C   . SER A 1 125 ? 87.113  48.868 9.321   1.00 26.74 ? 125  SER A C   1 
ATOM   993  O  O   . SER A 1 125 ? 86.415  47.872 9.330   1.00 26.78 ? 125  SER A O   1 
ATOM   994  C  CB  . SER A 1 125 ? 85.495  50.811 9.250   1.00 24.26 ? 125  SER A CB  1 
ATOM   995  O  OG  . SER A 1 125 ? 85.980  51.084 7.945   1.00 28.06 ? 125  SER A OG  1 
ATOM   996  N  N   . THR A 1 126 ? 88.331  48.921 8.755   1.00 27.20 ? 126  THR A N   1 
ATOM   997  C  CA  . THR A 1 126 ? 88.801  47.954 7.768   1.00 28.22 ? 126  THR A CA  1 
ATOM   998  C  C   . THR A 1 126 ? 89.779  46.907 8.310   1.00 29.26 ? 126  THR A C   1 
ATOM   999  O  O   . THR A 1 126 ? 90.358  46.117 7.522   1.00 29.42 ? 126  THR A O   1 
ATOM   1000 C  CB  . THR A 1 126 ? 89.547  48.660 6.652   1.00 29.30 ? 126  THR A CB  1 
ATOM   1001 O  OG1 . THR A 1 126 ? 90.653  49.338 7.239   1.00 29.26 ? 126  THR A OG1 1 
ATOM   1002 C  CG2 . THR A 1 126 ? 88.635  49.676 5.919   1.00 28.67 ? 126  THR A CG2 1 
ATOM   1003 N  N   . LEU A 1 127 ? 89.961  46.904 9.636   1.00 28.15 ? 127  LEU A N   1 
ATOM   1004 C  CA  . LEU A 1 127 ? 90.868  45.988 10.295  1.00 29.27 ? 127  LEU A CA  1 
ATOM   1005 C  C   . LEU A 1 127 ? 90.381  44.545 10.139  1.00 30.06 ? 127  LEU A C   1 
ATOM   1006 O  O   . LEU A 1 127 ? 89.167  44.273 10.180  1.00 29.45 ? 127  LEU A O   1 
ATOM   1007 C  CB  . LEU A 1 127 ? 91.029  46.336 11.777  1.00 27.72 ? 127  LEU A CB  1 
ATOM   1008 C  CG  . LEU A 1 127 ? 91.526  47.772 12.103  1.00 28.65 ? 127  LEU A CG  1 
ATOM   1009 C  CD1 . LEU A 1 127 ? 91.639  47.950 13.638  1.00 27.62 ? 127  LEU A CD1 1 
ATOM   1010 C  CD2 . LEU A 1 127 ? 92.856  48.118 11.428  1.00 22.85 ? 127  LEU A CD2 1 
ATOM   1011 N  N   . ASP A 1 128 ? 91.338  43.645 9.978   1.00 31.38 ? 128  ASP A N   1 
ATOM   1012 C  CA  . ASP A 1 128 ? 91.057  42.218 9.924   1.00 33.48 ? 128  ASP A CA  1 
ATOM   1013 C  C   . ASP A 1 128 ? 90.097  41.797 11.026  1.00 33.06 ? 128  ASP A C   1 
ATOM   1014 O  O   . ASP A 1 128 ? 89.135  41.081 10.725  1.00 34.03 ? 128  ASP A O   1 
ATOM   1015 C  CB  . ASP A 1 128 ? 92.356  41.396 9.972   1.00 35.04 ? 128  ASP A CB  1 
ATOM   1016 C  CG  . ASP A 1 128 ? 93.184  41.532 8.696   1.00 38.95 ? 128  ASP A CG  1 
ATOM   1017 O  OD1 . ASP A 1 128 ? 92.724  42.184 7.715   1.00 40.64 ? 128  ASP A OD1 1 
ATOM   1018 O  OD2 . ASP A 1 128 ? 94.305  40.986 8.662   1.00 43.84 ? 128  ASP A OD2 1 
ATOM   1019 N  N   . VAL A 1 129 ? 90.326  42.249 12.272  1.00 31.20 ? 129  VAL A N   1 
ATOM   1020 C  CA  . VAL A 1 129 ? 89.456  41.852 13.389  1.00 30.97 ? 129  VAL A CA  1 
ATOM   1021 C  C   . VAL A 1 129 ? 88.050  42.396 13.341  1.00 30.05 ? 129  VAL A C   1 
ATOM   1022 O  O   . VAL A 1 129 ? 87.222  42.042 14.185  1.00 30.72 ? 129  VAL A O   1 
ATOM   1023 C  CB  . VAL A 1 129 ? 90.015  42.184 14.848  1.00 30.56 ? 129  VAL A CB  1 
ATOM   1024 C  CG1 . VAL A 1 129 ? 90.925  41.117 15.328  1.00 32.96 ? 129  VAL A CG1 1 
ATOM   1025 C  CG2 . VAL A 1 129 ? 90.648  43.599 14.959  1.00 27.82 ? 129  VAL A CG2 1 
ATOM   1026 N  N   . TYR A 1 130 ? 87.756  43.279 12.399  1.00 30.28 ? 130  TYR A N   1 
ATOM   1027 C  CA  . TYR A 1 130 ? 86.391  43.834 12.316  1.00 28.45 ? 130  TYR A CA  1 
ATOM   1028 C  C   . TYR A 1 130 ? 85.740  43.324 11.055  1.00 28.66 ? 130  TYR A C   1 
ATOM   1029 O  O   . TYR A 1 130 ? 84.745  43.863 10.602  1.00 28.83 ? 130  TYR A O   1 
ATOM   1030 C  CB  . TYR A 1 130 ? 86.390  45.383 12.284  1.00 27.93 ? 130  TYR A CB  1 
ATOM   1031 C  CG  . TYR A 1 130 ? 87.070  46.115 13.421  1.00 27.05 ? 130  TYR A CG  1 
ATOM   1032 C  CD1 . TYR A 1 130 ? 87.160  45.548 14.709  1.00 26.16 ? 130  TYR A CD1 1 
ATOM   1033 C  CD2 . TYR A 1 130 ? 87.596  47.403 13.221  1.00 24.26 ? 130  TYR A CD2 1 
ATOM   1034 C  CE1 . TYR A 1 130 ? 87.776  46.240 15.770  1.00 24.85 ? 130  TYR A CE1 1 
ATOM   1035 C  CE2 . TYR A 1 130 ? 88.222  48.082 14.264  1.00 25.63 ? 130  TYR A CE2 1 
ATOM   1036 C  CZ  . TYR A 1 130 ? 88.294  47.503 15.541  1.00 25.98 ? 130  TYR A CZ  1 
ATOM   1037 O  OH  . TYR A 1 130 ? 88.919  48.170 16.569  1.00 25.92 ? 130  TYR A OH  1 
ATOM   1038 N  N   . ASN A 1 131 ? 86.314  42.303 10.440  1.00 29.92 ? 131  ASN A N   1 
ATOM   1039 C  CA  . ASN A 1 131 ? 85.671  41.750 9.261   1.00 30.28 ? 131  ASN A CA  1 
ATOM   1040 C  C   . ASN A 1 131 ? 84.280  41.208 9.634   1.00 30.36 ? 131  ASN A C   1 
ATOM   1041 O  O   . ASN A 1 131 ? 84.164  40.236 10.414  1.00 30.39 ? 131  ASN A O   1 
ATOM   1042 C  CB  . ASN A 1 131 ? 86.524  40.657 8.702   1.00 31.56 ? 131  ASN A CB  1 
ATOM   1043 C  CG  . ASN A 1 131 ? 86.151  40.308 7.290   1.00 34.56 ? 131  ASN A CG  1 
ATOM   1044 O  OD1 . ASN A 1 131 ? 84.975  40.442 6.866   1.00 32.49 ? 131  ASN A OD1 1 
ATOM   1045 N  ND2 . ASN A 1 131 ? 87.155  39.848 6.531   1.00 34.84 ? 131  ASN A ND2 1 
ATOM   1046 N  N   . GLY A 1 132 ? 83.240  41.837 9.089   1.00 29.60 ? 132  GLY A N   1 
ATOM   1047 C  CA  . GLY A 1 132 ? 81.857  41.551 9.502   1.00 29.67 ? 132  GLY A CA  1 
ATOM   1048 C  C   . GLY A 1 132 ? 81.217  40.271 8.956   1.00 31.70 ? 132  GLY A C   1 
ATOM   1049 O  O   . GLY A 1 132 ? 80.115  39.898 9.379   1.00 32.46 ? 132  GLY A O   1 
ATOM   1050 N  N   . LYS A 1 133 ? 81.893  39.594 8.032   1.00 31.37 ? 133  LYS A N   1 
ATOM   1051 C  CA  . LYS A 1 133 ? 81.250  38.552 7.255   1.00 33.89 ? 133  LYS A CA  1 
ATOM   1052 C  C   . LYS A 1 133 ? 80.876  37.327 8.117   1.00 34.25 ? 133  LYS A C   1 
ATOM   1053 O  O   . LYS A 1 133 ? 79.882  36.656 7.856   1.00 34.22 ? 133  LYS A O   1 
ATOM   1054 C  CB  . LYS A 1 133 ? 82.115  38.131 6.045   1.00 34.60 ? 133  LYS A CB  1 
ATOM   1055 C  CG  . LYS A 1 133 ? 83.425  37.440 6.387   1.00 35.92 ? 133  LYS A CG  1 
ATOM   1056 C  CD  . LYS A 1 133 ? 84.248  37.234 5.129   1.00 38.63 ? 133  LYS A CD  1 
ATOM   1057 C  CE  . LYS A 1 133 ? 85.399  36.263 5.344   1.00 42.28 ? 133  LYS A CE  1 
ATOM   1058 N  NZ  . LYS A 1 133 ? 86.299  36.124 4.140   1.00 44.10 ? 133  LYS A NZ  1 
ATOM   1059 N  N   . TYR A 1 134 ? 81.658  37.085 9.162   1.00 33.87 ? 134  TYR A N   1 
ATOM   1060 C  CA  . TYR A 1 134 ? 81.429  35.932 10.019  1.00 35.30 ? 134  TYR A CA  1 
ATOM   1061 C  C   . TYR A 1 134 ? 80.173  36.095 10.872  1.00 35.17 ? 134  TYR A C   1 
ATOM   1062 O  O   . TYR A 1 134 ? 79.335  35.178 10.917  1.00 37.34 ? 134  TYR A O   1 
ATOM   1063 C  CB  . TYR A 1 134 ? 82.658  35.627 10.871  1.00 33.96 ? 134  TYR A CB  1 
ATOM   1064 C  CG  . TYR A 1 134 ? 83.919  35.513 10.048  1.00 35.17 ? 134  TYR A CG  1 
ATOM   1065 C  CD1 . TYR A 1 134 ? 84.129  34.433 9.190   1.00 35.58 ? 134  TYR A CD1 1 
ATOM   1066 C  CD2 . TYR A 1 134 ? 84.895  36.509 10.103  1.00 32.95 ? 134  TYR A CD2 1 
ATOM   1067 C  CE1 . TYR A 1 134 ? 85.309  34.340 8.423   1.00 36.59 ? 134  TYR A CE1 1 
ATOM   1068 C  CE2 . TYR A 1 134 ? 86.057  36.417 9.359   1.00 31.24 ? 134  TYR A CE2 1 
ATOM   1069 C  CZ  . TYR A 1 134 ? 86.263  35.336 8.524   1.00 34.29 ? 134  TYR A CZ  1 
ATOM   1070 O  OH  . TYR A 1 134 ? 87.428  35.292 7.777   1.00 32.94 ? 134  TYR A OH  1 
ATOM   1071 N  N   . LEU A 1 135 ? 80.047  37.242 11.532  1.00 33.72 ? 135  LEU A N   1 
ATOM   1072 C  CA  . LEU A 1 135 ? 78.898  37.555 12.399  1.00 33.69 ? 135  LEU A CA  1 
ATOM   1073 C  C   . LEU A 1 135 ? 77.658  37.718 11.526  1.00 34.46 ? 135  LEU A C   1 
ATOM   1074 O  O   . LEU A 1 135 ? 76.575  37.213 11.846  1.00 36.10 ? 135  LEU A O   1 
ATOM   1075 C  CB  . LEU A 1 135 ? 79.195  38.833 13.206  1.00 32.41 ? 135  LEU A CB  1 
ATOM   1076 C  CG  . LEU A 1 135 ? 78.147  39.583 14.046  1.00 31.78 ? 135  LEU A CG  1 
ATOM   1077 C  CD1 . LEU A 1 135 ? 77.454  38.638 15.006  1.00 31.78 ? 135  LEU A CD1 1 
ATOM   1078 C  CD2 . LEU A 1 135 ? 78.864  40.676 14.813  1.00 28.79 ? 135  LEU A CD2 1 
ATOM   1079 N  N   . ALA A 1 136 ? 77.812  38.361 10.382  1.00 34.15 ? 136  ALA A N   1 
ATOM   1080 C  CA  . ALA A 1 136 ? 76.665  38.531 9.493   1.00 34.88 ? 136  ALA A CA  1 
ATOM   1081 C  C   . ALA A 1 136 ? 76.099  37.184 9.015   1.00 36.94 ? 136  ALA A C   1 
ATOM   1082 O  O   . ALA A 1 136 ? 74.875  36.948 9.091   1.00 37.58 ? 136  ALA A O   1 
ATOM   1083 C  CB  . ALA A 1 136 ? 76.999  39.467 8.325   1.00 34.09 ? 136  ALA A CB  1 
ATOM   1084 N  N   . TYR A 1 137 ? 76.985  36.292 8.558   1.00 37.88 ? 137  TYR A N   1 
ATOM   1085 C  CA  . TYR A 1 137 ? 76.564  34.967 8.084   1.00 39.54 ? 137  TYR A CA  1 
ATOM   1086 C  C   . TYR A 1 137 ? 76.039  34.117 9.223   1.00 39.51 ? 137  TYR A C   1 
ATOM   1087 O  O   . TYR A 1 137 ? 74.936  33.584 9.157   1.00 39.65 ? 137  TYR A O   1 
ATOM   1088 C  CB  . TYR A 1 137 ? 77.699  34.256 7.346   1.00 40.88 ? 137  TYR A CB  1 
ATOM   1089 C  CG  . TYR A 1 137 ? 77.469  32.768 7.044   1.00 45.19 ? 137  TYR A CG  1 
ATOM   1090 C  CD1 . TYR A 1 137 ? 76.660  32.353 5.972   1.00 47.50 ? 137  TYR A CD1 1 
ATOM   1091 C  CD2 . TYR A 1 137 ? 78.103  31.778 7.797   1.00 46.65 ? 137  TYR A CD2 1 
ATOM   1092 C  CE1 . TYR A 1 137 ? 76.463  30.980 5.691   1.00 49.33 ? 137  TYR A CE1 1 
ATOM   1093 C  CE2 . TYR A 1 137 ? 77.913  30.403 7.512   1.00 49.99 ? 137  TYR A CE2 1 
ATOM   1094 C  CZ  . TYR A 1 137 ? 77.097  30.017 6.460   1.00 50.84 ? 137  TYR A CZ  1 
ATOM   1095 O  OH  . TYR A 1 137 ? 76.925  28.664 6.191   1.00 52.78 ? 137  TYR A OH  1 
ATOM   1096 N  N   . THR A 1 138 ? 76.817  34.029 10.292  1.00 39.33 ? 138  THR A N   1 
ATOM   1097 C  CA  . THR A 1 138 ? 76.471  33.106 11.356  1.00 40.67 ? 138  THR A CA  1 
ATOM   1098 C  C   . THR A 1 138 ? 75.163  33.513 12.001  1.00 40.36 ? 138  THR A C   1 
ATOM   1099 O  O   . THR A 1 138 ? 74.301  32.688 12.215  1.00 41.95 ? 138  THR A O   1 
ATOM   1100 C  CB  . THR A 1 138 ? 77.591  33.009 12.395  1.00 40.65 ? 138  THR A CB  1 
ATOM   1101 O  OG1 . THR A 1 138 ? 78.812  32.668 11.722  1.00 41.64 ? 138  THR A OG1 1 
ATOM   1102 C  CG2 . THR A 1 138 ? 77.264  31.960 13.450  1.00 40.07 ? 138  THR A CG2 1 
ATOM   1103 N  N   . GLU A 1 139 ? 75.006  34.794 12.298  1.00 38.89 ? 139  GLU A N   1 
ATOM   1104 C  CA  . GLU A 1 139 ? 73.832  35.211 13.064  1.00 38.75 ? 139  GLU A CA  1 
ATOM   1105 C  C   . GLU A 1 139 ? 72.686  35.741 12.210  1.00 38.56 ? 139  GLU A C   1 
ATOM   1106 O  O   . GLU A 1 139 ? 71.625  36.076 12.735  1.00 38.60 ? 139  GLU A O   1 
ATOM   1107 C  CB  . GLU A 1 139 ? 74.239  36.157 14.186  1.00 37.03 ? 139  GLU A CB  1 
ATOM   1108 C  CG  . GLU A 1 139 ? 75.016  35.381 15.301  1.00 39.38 ? 139  GLU A CG  1 
ATOM   1109 C  CD  . GLU A 1 139 ? 74.178  34.257 15.893  1.00 43.39 ? 139  GLU A CD  1 
ATOM   1110 O  OE1 . GLU A 1 139 ? 73.022  34.528 16.284  1.00 44.52 ? 139  GLU A OE1 1 
ATOM   1111 O  OE2 . GLU A 1 139 ? 74.644  33.099 15.937  1.00 45.99 ? 139  GLU A OE2 1 
ATOM   1112 N  N   . GLU A 1 140 ? 72.893  35.706 10.893  1.00 38.56 ? 140  GLU A N   1 
ATOM   1113 C  CA  A GLU A 1 140 ? 71.894  36.194 9.930   0.50 39.38 ? 140  GLU A CA  1 
ATOM   1114 C  CA  B GLU A 1 140 ? 71.947  36.225 9.913   0.50 38.96 ? 140  GLU A CA  1 
ATOM   1115 C  C   . GLU A 1 140 ? 71.431  37.621 10.270  1.00 37.52 ? 140  GLU A C   1 
ATOM   1116 O  O   . GLU A 1 140 ? 70.225  37.877 10.348  1.00 37.84 ? 140  GLU A O   1 
ATOM   1117 C  CB  A GLU A 1 140 ? 70.700  35.221 9.817   0.50 40.99 ? 140  GLU A CB  1 
ATOM   1118 C  CB  B GLU A 1 140 ? 70.842  35.213 9.623   0.50 40.35 ? 140  GLU A CB  1 
ATOM   1119 C  CG  A GLU A 1 140 ? 69.559  35.656 8.856   0.50 43.45 ? 140  GLU A CG  1 
ATOM   1120 C  CG  B GLU A 1 140 ? 71.270  34.170 8.584   0.50 41.78 ? 140  GLU A CG  1 
ATOM   1121 C  CD  A GLU A 1 140 ? 69.545  34.924 7.511   0.50 46.83 ? 140  GLU A CD  1 
ATOM   1122 C  CD  B GLU A 1 140 ? 70.522  32.854 8.742   0.50 42.06 ? 140  GLU A CD  1 
ATOM   1123 O  OE1 A GLU A 1 140 ? 69.504  33.667 7.489   0.50 48.59 ? 140  GLU A OE1 1 
ATOM   1124 O  OE1 B GLU A 1 140 ? 70.490  32.051 7.782   0.50 44.89 ? 140  GLU A OE1 1 
ATOM   1125 O  OE2 A GLU A 1 140 ? 69.530  35.612 6.468   0.50 47.44 ? 140  GLU A OE2 1 
ATOM   1126 O  OE2 B GLU A 1 140 ? 69.965  32.641 9.829   0.50 39.41 ? 140  GLU A OE2 1 
ATOM   1127 N  N   . VAL A 1 141 ? 72.391  38.522 10.490  1.00 35.89 ? 141  VAL A N   1 
ATOM   1128 C  CA  . VAL A 1 141 ? 72.109  39.942 10.742  1.00 34.12 ? 141  VAL A CA  1 
ATOM   1129 C  C   . VAL A 1 141 ? 72.725  40.753 9.613   1.00 34.24 ? 141  VAL A C   1 
ATOM   1130 O  O   . VAL A 1 141 ? 73.599  40.261 8.921   1.00 34.26 ? 141  VAL A O   1 
ATOM   1131 C  CB  . VAL A 1 141 ? 72.726  40.458 12.096  1.00 32.84 ? 141  VAL A CB  1 
ATOM   1132 C  CG1 . VAL A 1 141 ? 72.136  39.739 13.278  1.00 32.97 ? 141  VAL A CG1 1 
ATOM   1133 C  CG2 . VAL A 1 141 ? 74.254  40.361 12.115  1.00 31.46 ? 141  VAL A CG2 1 
ATOM   1134 N  N   . VAL A 1 142 ? 72.302  42.011 9.454   1.00 34.34 ? 142  VAL A N   1 
ATOM   1135 C  CA  . VAL A 1 142 ? 72.999  42.933 8.569   1.00 33.38 ? 142  VAL A CA  1 
ATOM   1136 C  C   . VAL A 1 142 ? 74.002  43.744 9.411   1.00 31.87 ? 142  VAL A C   1 
ATOM   1137 O  O   . VAL A 1 142 ? 73.613  44.515 10.293  1.00 31.56 ? 142  VAL A O   1 
ATOM   1138 C  CB  . VAL A 1 142 ? 72.011  43.861 7.834   1.00 33.74 ? 142  VAL A CB  1 
ATOM   1139 C  CG1 . VAL A 1 142 ? 72.762  45.005 7.153   1.00 31.39 ? 142  VAL A CG1 1 
ATOM   1140 C  CG2 . VAL A 1 142 ? 71.171  43.075 6.841   1.00 35.19 ? 142  VAL A CG2 1 
ATOM   1141 N  N   . LEU A 1 143 ? 75.289  43.553 9.136   1.00 31.18 ? 143  LEU A N   1 
ATOM   1142 C  CA  . LEU A 1 143 ? 76.349  44.202 9.895   1.00 29.34 ? 143  LEU A CA  1 
ATOM   1143 C  C   . LEU A 1 143 ? 76.971  45.412 9.156   1.00 27.91 ? 143  LEU A C   1 
ATOM   1144 O  O   . LEU A 1 143 ? 77.534  45.280 8.079   1.00 28.26 ? 143  LEU A O   1 
ATOM   1145 C  CB  . LEU A 1 143 ? 77.437  43.191 10.206  1.00 30.76 ? 143  LEU A CB  1 
ATOM   1146 C  CG  . LEU A 1 143 ? 78.474  43.572 11.258  1.00 32.28 ? 143  LEU A CG  1 
ATOM   1147 C  CD1 . LEU A 1 143 ? 77.867  43.318 12.615  1.00 34.45 ? 143  LEU A CD1 1 
ATOM   1148 C  CD2 . LEU A 1 143 ? 79.591  42.668 11.077  1.00 36.45 ? 143  LEU A CD2 1 
ATOM   1149 N  N   . VAL A 1 144 ? 76.868  46.582 9.760   1.00 26.71 ? 144  VAL A N   1 
ATOM   1150 C  CA  . VAL A 1 144 ? 77.523  47.775 9.246   1.00 26.33 ? 144  VAL A CA  1 
ATOM   1151 C  C   . VAL A 1 144 ? 78.708  48.125 10.126  1.00 25.67 ? 144  VAL A C   1 
ATOM   1152 O  O   . VAL A 1 144 ? 78.620  48.042 11.350  1.00 24.66 ? 144  VAL A O   1 
ATOM   1153 C  CB  . VAL A 1 144 ? 76.560  48.960 9.299   1.00 25.99 ? 144  VAL A CB  1 
ATOM   1154 C  CG1 . VAL A 1 144 ? 77.215  50.202 8.741   1.00 25.06 ? 144  VAL A CG1 1 
ATOM   1155 C  CG2 . VAL A 1 144 ? 75.221  48.597 8.559   1.00 27.94 ? 144  VAL A CG2 1 
ATOM   1156 N  N   . SER A 1 145 ? 79.822  48.515 9.507   1.00 26.23 ? 145  SER A N   1 
ATOM   1157 C  CA  . SER A 1 145 ? 80.864  49.235 10.242  1.00 26.13 ? 145  SER A CA  1 
ATOM   1158 C  C   . SER A 1 145 ? 80.956  50.647 9.692   1.00 26.12 ? 145  SER A C   1 
ATOM   1159 O  O   . SER A 1 145 ? 81.127  50.838 8.499   1.00 27.58 ? 145  SER A O   1 
ATOM   1160 C  CB  . SER A 1 145 ? 82.220  48.527 10.201  1.00 24.92 ? 145  SER A CB  1 
ATOM   1161 O  OG  . SER A 1 145 ? 82.623  48.293 8.863   1.00 28.54 ? 145  SER A OG  1 
ATOM   1162 N  N   . LEU A 1 146 ? 80.855  51.627 10.571  1.00 25.26 ? 146  LEU A N   1 
ATOM   1163 C  CA  . LEU A 1 146 ? 81.002  53.041 10.171  1.00 25.25 ? 146  LEU A CA  1 
ATOM   1164 C  C   . LEU A 1 146 ? 82.454  53.484 10.380  1.00 25.37 ? 146  LEU A C   1 
ATOM   1165 O  O   . LEU A 1 146 ? 83.308  52.716 10.853  1.00 25.82 ? 146  LEU A O   1 
ATOM   1166 C  CB  . LEU A 1 146 ? 79.986  53.939 10.901  1.00 22.62 ? 146  LEU A CB  1 
ATOM   1167 C  CG  . LEU A 1 146 ? 79.860  53.916 12.445  1.00 22.07 ? 146  LEU A CG  1 
ATOM   1168 C  CD1 . LEU A 1 146 ? 81.110  54.514 13.104  1.00 22.62 ? 146  LEU A CD1 1 
ATOM   1169 C  CD2 . LEU A 1 146 ? 78.630  54.681 12.975  1.00 19.58 ? 146  LEU A CD2 1 
ATOM   1170 N  N   . SER A 1 147 ? 82.756  54.707 9.980   1.00 26.32 ? 147  SER A N   1 
ATOM   1171 C  CA  . SER A 1 147 ? 84.019  55.334 10.378  1.00 26.17 ? 147  SER A CA  1 
ATOM   1172 C  C   . SER A 1 147 ? 83.740  56.755 10.879  1.00 25.95 ? 147  SER A C   1 
ATOM   1173 O  O   . SER A 1 147 ? 82.615  57.278 10.750  1.00 25.53 ? 147  SER A O   1 
ATOM   1174 C  CB  . SER A 1 147 ? 85.000  55.345 9.206   1.00 26.89 ? 147  SER A CB  1 
ATOM   1175 O  OG  . SER A 1 147 ? 84.494  56.149 8.144   1.00 32.76 ? 147  SER A OG  1 
ATOM   1176 N  N   . TYR A 1 148 ? 84.752  57.373 11.483  1.00 25.22 ? 148  TYR A N   1 
ATOM   1177 C  CA  . TYR A 1 148 ? 84.610  58.726 11.981  1.00 23.81 ? 148  TYR A CA  1 
ATOM   1178 C  C   . TYR A 1 148 ? 86.016  59.309 12.137  1.00 23.63 ? 148  TYR A C   1 
ATOM   1179 O  O   . TYR A 1 148 ? 86.980  58.570 12.413  1.00 23.06 ? 148  TYR A O   1 
ATOM   1180 C  CB  . TYR A 1 148 ? 83.836  58.741 13.314  1.00 22.65 ? 148  TYR A CB  1 
ATOM   1181 C  CG  . TYR A 1 148 ? 84.472  57.936 14.430  1.00 23.68 ? 148  TYR A CG  1 
ATOM   1182 C  CD1 . TYR A 1 148 ? 84.267  56.556 14.537  1.00 22.92 ? 148  TYR A CD1 1 
ATOM   1183 C  CD2 . TYR A 1 148 ? 85.267  58.559 15.399  1.00 22.52 ? 148  TYR A CD2 1 
ATOM   1184 C  CE1 . TYR A 1 148 ? 84.853  55.830 15.568  1.00 22.46 ? 148  TYR A CE1 1 
ATOM   1185 C  CE2 . TYR A 1 148 ? 85.857  57.839 16.435  1.00 21.10 ? 148  TYR A CE2 1 
ATOM   1186 C  CZ  . TYR A 1 148 ? 85.663  56.484 16.497  1.00 21.93 ? 148  TYR A CZ  1 
ATOM   1187 O  OH  . TYR A 1 148 ? 86.234  55.803 17.539  1.00 23.01 ? 148  TYR A OH  1 
ATOM   1188 N  N   . ARG A 1 149 ? 86.126  60.631 11.983  1.00 23.46 ? 149  ARG A N   1 
ATOM   1189 C  CA  . ARG A 1 149 ? 87.387  61.327 12.189  1.00 22.87 ? 149  ARG A CA  1 
ATOM   1190 C  C   . ARG A 1 149 ? 87.906  61.241 13.626  1.00 22.18 ? 149  ARG A C   1 
ATOM   1191 O  O   . ARG A 1 149 ? 87.127  61.295 14.572  1.00 20.50 ? 149  ARG A O   1 
ATOM   1192 C  CB  . ARG A 1 149 ? 87.262  62.781 11.767  1.00 24.25 ? 149  ARG A CB  1 
ATOM   1193 C  CG  . ARG A 1 149 ? 87.033  62.971 10.281  1.00 23.97 ? 149  ARG A CG  1 
ATOM   1194 C  CD  . ARG A 1 149 ? 86.663  64.424 10.070  1.00 24.34 ? 149  ARG A CD  1 
ATOM   1195 N  NE  . ARG A 1 149 ? 85.242  64.708 10.307  1.00 24.42 ? 149  ARG A NE  1 
ATOM   1196 C  CZ  . ARG A 1 149 ? 84.728  65.937 10.200  1.00 25.08 ? 149  ARG A CZ  1 
ATOM   1197 N  NH1 . ARG A 1 149 ? 85.514  66.966 9.865   1.00 21.77 ? 149  ARG A NH1 1 
ATOM   1198 N  NH2 . ARG A 1 149 ? 83.443  66.143 10.417  1.00 23.78 ? 149  ARG A NH2 1 
ATOM   1199 N  N   . VAL A 1 150 ? 89.234  61.096 13.758  1.00 21.61 ? 150  VAL A N   1 
ATOM   1200 C  CA  . VAL A 1 150 ? 89.886  60.911 15.046  1.00 21.55 ? 150  VAL A CA  1 
ATOM   1201 C  C   . VAL A 1 150 ? 90.982  61.961 15.197  1.00 23.60 ? 150  VAL A C   1 
ATOM   1202 O  O   . VAL A 1 150 ? 91.284  62.681 14.233  1.00 24.73 ? 150  VAL A O   1 
ATOM   1203 C  CB  . VAL A 1 150 ? 90.431  59.471 15.187  1.00 20.08 ? 150  VAL A CB  1 
ATOM   1204 C  CG1 . VAL A 1 150 ? 89.245  58.468 15.169  1.00 17.55 ? 150  VAL A CG1 1 
ATOM   1205 C  CG2 . VAL A 1 150 ? 91.430  59.123 14.073  1.00 21.04 ? 150  VAL A CG2 1 
ATOM   1206 N  N   . GLY A 1 151 ? 91.557  62.081 16.392  1.00 23.83 ? 151  GLY A N   1 
ATOM   1207 C  CA  . GLY A 1 151 ? 92.576  63.096 16.589  1.00 25.03 ? 151  GLY A CA  1 
ATOM   1208 C  C   . GLY A 1 151 ? 91.993  64.504 16.451  1.00 25.63 ? 151  GLY A C   1 
ATOM   1209 O  O   . GLY A 1 151 ? 90.749  64.718 16.543  1.00 25.22 ? 151  GLY A O   1 
ATOM   1210 N  N   . ALA A 1 152 ? 92.897  65.461 16.221  1.00 26.36 ? 152  ALA A N   1 
ATOM   1211 C  CA  . ALA A 1 152 ? 92.547  66.847 15.981  1.00 27.11 ? 152  ALA A CA  1 
ATOM   1212 C  C   . ALA A 1 152 ? 91.423  66.963 14.969  1.00 27.57 ? 152  ALA A C   1 
ATOM   1213 O  O   . ALA A 1 152 ? 90.504  67.754 15.167  1.00 28.45 ? 152  ALA A O   1 
ATOM   1214 C  CB  . ALA A 1 152 ? 93.775  67.643 15.516  1.00 28.12 ? 152  ALA A CB  1 
ATOM   1215 N  N   . PHE A 1 153 ? 91.506  66.168 13.904  1.00 27.06 ? 153  PHE A N   1 
ATOM   1216 C  CA  . PHE A 1 153 ? 90.590  66.255 12.760  1.00 27.45 ? 153  PHE A CA  1 
ATOM   1217 C  C   . PHE A 1 153 ? 89.157  66.016 13.199  1.00 26.89 ? 153  PHE A C   1 
ATOM   1218 O  O   . PHE A 1 153 ? 88.215  66.569 12.616  1.00 28.25 ? 153  PHE A O   1 
ATOM   1219 C  CB  . PHE A 1 153 ? 90.966  65.207 11.689  1.00 26.39 ? 153  PHE A CB  1 
ATOM   1220 C  CG  . PHE A 1 153 ? 92.410  65.278 11.265  1.00 27.80 ? 153  PHE A CG  1 
ATOM   1221 C  CD1 . PHE A 1 153 ? 92.814  66.147 10.267  1.00 26.32 ? 153  PHE A CD1 1 
ATOM   1222 C  CD2 . PHE A 1 153 ? 93.369  64.477 11.871  1.00 29.31 ? 153  PHE A CD2 1 
ATOM   1223 C  CE1 . PHE A 1 153 ? 94.146  66.232 9.897   1.00 28.72 ? 153  PHE A CE1 1 
ATOM   1224 C  CE2 . PHE A 1 153 ? 94.708  64.572 11.489  1.00 29.03 ? 153  PHE A CE2 1 
ATOM   1225 C  CZ  . PHE A 1 153 ? 95.087  65.465 10.516  1.00 26.20 ? 153  PHE A CZ  1 
ATOM   1226 N  N   . GLY A 1 154 ? 88.984  65.194 14.221  1.00 25.33 ? 154  GLY A N   1 
ATOM   1227 C  CA  . GLY A 1 154 ? 87.642  64.816 14.657  1.00 24.77 ? 154  GLY A CA  1 
ATOM   1228 C  C   . GLY A 1 154 ? 87.230  65.525 15.929  1.00 24.48 ? 154  GLY A C   1 
ATOM   1229 O  O   . GLY A 1 154 ? 86.038  65.653 16.219  1.00 24.67 ? 154  GLY A O   1 
ATOM   1230 N  N   . PHE A 1 155 ? 88.215  65.963 16.713  1.00 23.71 ? 155  PHE A N   1 
ATOM   1231 C  CA  . PHE A 1 155 ? 87.898  66.489 18.030  1.00 24.07 ? 155  PHE A CA  1 
ATOM   1232 C  C   . PHE A 1 155 ? 88.551  67.789 18.474  1.00 24.67 ? 155  PHE A C   1 
ATOM   1233 O  O   . PHE A 1 155 ? 88.386  68.166 19.616  1.00 23.97 ? 155  PHE A O   1 
ATOM   1234 C  CB  . PHE A 1 155 ? 88.081  65.391 19.070  1.00 22.54 ? 155  PHE A CB  1 
ATOM   1235 C  CG  . PHE A 1 155 ? 87.159  64.225 18.818  1.00 23.47 ? 155  PHE A CG  1 
ATOM   1236 C  CD1 . PHE A 1 155 ? 85.812  64.298 19.209  1.00 21.66 ? 155  PHE A CD1 1 
ATOM   1237 C  CD2 . PHE A 1 155 ? 87.604  63.101 18.123  1.00 21.93 ? 155  PHE A CD2 1 
ATOM   1238 C  CE1 . PHE A 1 155 ? 84.915  63.270 18.918  1.00 23.05 ? 155  PHE A CE1 1 
ATOM   1239 C  CE2 . PHE A 1 155 ? 86.701  62.026 17.838  1.00 24.88 ? 155  PHE A CE2 1 
ATOM   1240 C  CZ  . PHE A 1 155 ? 85.355  62.123 18.240  1.00 23.09 ? 155  PHE A CZ  1 
ATOM   1241 N  N   . LEU A 1 156 ? 89.302  68.441 17.599  1.00 25.57 ? 156  LEU A N   1 
ATOM   1242 C  CA  . LEU A 1 156 ? 89.779  69.801 17.903  1.00 28.46 ? 156  LEU A CA  1 
ATOM   1243 C  C   . LEU A 1 156 ? 88.590  70.613 18.335  1.00 29.44 ? 156  LEU A C   1 
ATOM   1244 O  O   . LEU A 1 156 ? 87.586  70.671 17.618  1.00 30.38 ? 156  LEU A O   1 
ATOM   1245 C  CB  . LEU A 1 156 ? 90.381  70.456 16.667  1.00 29.04 ? 156  LEU A CB  1 
ATOM   1246 C  CG  . LEU A 1 156 ? 91.020  71.796 16.994  1.00 32.26 ? 156  LEU A CG  1 
ATOM   1247 C  CD1 . LEU A 1 156 ? 92.466  71.538 17.483  1.00 31.22 ? 156  LEU A CD1 1 
ATOM   1248 C  CD2 . LEU A 1 156 ? 90.947  72.698 15.765  1.00 32.56 ? 156  LEU A CD2 1 
ATOM   1249 N  N   . ALA A 1 157 ? 88.657  71.236 19.501  1.00 30.47 ? 157  ALA A N   1 
ATOM   1250 C  CA  . ALA A 1 157 ? 87.440  71.873 20.007  1.00 31.67 ? 157  ALA A CA  1 
ATOM   1251 C  C   . ALA A 1 157 ? 87.659  73.317 20.401  1.00 33.64 ? 157  ALA A C   1 
ATOM   1252 O  O   . ALA A 1 157 ? 88.393  73.582 21.362  1.00 34.18 ? 157  ALA A O   1 
ATOM   1253 C  CB  . ALA A 1 157 ? 86.900  71.097 21.177  1.00 30.72 ? 157  ALA A CB  1 
ATOM   1254 N  N   . LEU A 1 158 ? 87.046  74.252 19.661  1.00 35.01 ? 158  LEU A N   1 
ATOM   1255 C  CA  . LEU A 1 158 ? 87.041  75.681 20.085  1.00 37.32 ? 158  LEU A CA  1 
ATOM   1256 C  C   . LEU A 1 158 ? 85.624  76.161 20.216  1.00 38.53 ? 158  LEU A C   1 
ATOM   1257 O  O   . LEU A 1 158 ? 85.064  76.726 19.288  1.00 39.32 ? 158  LEU A O   1 
ATOM   1258 C  CB  . LEU A 1 158 ? 87.792  76.556 19.103  1.00 38.53 ? 158  LEU A CB  1 
ATOM   1259 C  CG  . LEU A 1 158 ? 89.269  76.214 19.165  1.00 37.98 ? 158  LEU A CG  1 
ATOM   1260 C  CD1 . LEU A 1 158 ? 89.810  76.173 17.755  1.00 39.32 ? 158  LEU A CD1 1 
ATOM   1261 C  CD2 . LEU A 1 158 ? 90.051  77.175 20.104  1.00 33.95 ? 158  LEU A CD2 1 
ATOM   1262 N  N   . HIS A 1 159 ? 85.041  75.875 21.372  1.00 38.94 ? 159  HIS A N   1 
ATOM   1263 C  CA  . HIS A 1 159 ? 83.655  76.131 21.639  1.00 40.86 ? 159  HIS A CA  1 
ATOM   1264 C  C   . HIS A 1 159 ? 83.306  77.601 21.351  1.00 43.72 ? 159  HIS A C   1 
ATOM   1265 O  O   . HIS A 1 159 ? 84.062  78.540 21.701  1.00 44.08 ? 159  HIS A O   1 
ATOM   1266 C  CB  . HIS A 1 159 ? 83.356  75.733 23.087  1.00 41.47 ? 159  HIS A CB  1 
ATOM   1267 C  CG  . HIS A 1 159 ? 81.906  75.814 23.455  1.00 44.87 ? 159  HIS A CG  1 
ATOM   1268 N  ND1 . HIS A 1 159 ? 81.359  76.904 24.110  1.00 48.21 ? 159  HIS A ND1 1 
ATOM   1269 C  CD2 . HIS A 1 159 ? 80.886  74.948 23.243  1.00 44.23 ? 159  HIS A CD2 1 
ATOM   1270 C  CE1 . HIS A 1 159 ? 80.066  76.699 24.293  1.00 49.27 ? 159  HIS A CE1 1 
ATOM   1271 N  NE2 . HIS A 1 159 ? 79.757  75.514 23.783  1.00 48.12 ? 159  HIS A NE2 1 
ATOM   1272 N  N   . GLY A 1 160 ? 82.187  77.788 20.662  1.00 44.97 ? 160  GLY A N   1 
ATOM   1273 C  CA  . GLY A 1 160 ? 81.727  79.127 20.322  1.00 48.95 ? 160  GLY A CA  1 
ATOM   1274 C  C   . GLY A 1 160 ? 81.917  79.358 18.842  1.00 50.34 ? 160  GLY A C   1 
ATOM   1275 O  O   . GLY A 1 160 ? 81.094  80.023 18.197  1.00 51.81 ? 160  GLY A O   1 
ATOM   1276 N  N   . SER A 1 161 ? 83.001  78.796 18.308  1.00 49.80 ? 161  SER A N   1 
ATOM   1277 C  CA  . SER A 1 161 ? 83.285  78.813 16.877  1.00 50.92 ? 161  SER A CA  1 
ATOM   1278 C  C   . SER A 1 161 ? 82.405  77.814 16.114  1.00 49.75 ? 161  SER A C   1 
ATOM   1279 O  O   . SER A 1 161 ? 82.218  76.679 16.559  1.00 48.41 ? 161  SER A O   1 
ATOM   1280 C  CB  . SER A 1 161 ? 84.754  78.448 16.645  1.00 50.30 ? 161  SER A CB  1 
ATOM   1281 O  OG  . SER A 1 161 ? 85.053  78.459 15.257  1.00 53.30 ? 161  SER A OG  1 
ATOM   1282 N  N   . GLN A 1 162 ? 81.880  78.221 14.962  1.00 50.60 ? 162  GLN A N   1 
ATOM   1283 C  CA  . GLN A 1 162 ? 81.168  77.269 14.112  1.00 49.15 ? 162  GLN A CA  1 
ATOM   1284 C  C   . GLN A 1 162 ? 82.146  76.533 13.190  1.00 48.06 ? 162  GLN A C   1 
ATOM   1285 O  O   . GLN A 1 162 ? 81.787  75.568 12.504  1.00 47.71 ? 162  GLN A O   1 
ATOM   1286 C  CB  . GLN A 1 162 ? 80.031  77.945 13.351  0.50 50.53 ? 162  GLN A CB  1 
ATOM   1287 C  CG  . GLN A 1 162 ? 79.007  78.633 14.257  0.50 51.93 ? 162  GLN A CG  1 
ATOM   1288 C  CD  . GLN A 1 162 ? 78.578  77.790 15.459  0.50 51.24 ? 162  GLN A CD  1 
ATOM   1289 O  OE1 . GLN A 1 162 ? 78.457  76.561 15.379  0.50 49.55 ? 162  GLN A OE1 1 
ATOM   1290 N  NE2 . GLN A 1 162 ? 78.345  78.457 16.583  0.50 52.37 ? 162  GLN A NE2 1 
ATOM   1291 N  N   . GLU A 1 163 ? 83.396  76.979 13.226  1.00 47.61 ? 163  GLU A N   1 
ATOM   1292 C  CA  . GLU A 1 163 ? 84.464  76.476 12.384  1.00 46.21 ? 163  GLU A CA  1 
ATOM   1293 C  C   . GLU A 1 163 ? 85.178  75.250 12.966  1.00 43.31 ? 163  GLU A C   1 
ATOM   1294 O  O   . GLU A 1 163 ? 85.540  74.336 12.224  1.00 42.45 ? 163  GLU A O   1 
ATOM   1295 C  CB  . GLU A 1 163 ? 85.494  77.561 12.230  1.00 48.25 ? 163  GLU A CB  1 
ATOM   1296 C  CG  . GLU A 1 163 ? 85.930  77.741 10.842  1.00 52.70 ? 163  GLU A CG  1 
ATOM   1297 C  CD  . GLU A 1 163 ? 84.976  78.570 10.049  0.80 55.82 ? 163  GLU A CD  1 
ATOM   1298 O  OE1 . GLU A 1 163 ? 85.038  79.810 10.226  0.80 59.05 ? 163  GLU A OE1 1 
ATOM   1299 O  OE2 . GLU A 1 163 ? 84.203  77.987 9.240   0.80 56.11 ? 163  GLU A OE2 1 
ATOM   1300 N  N   . ALA A 1 164 ? 85.436  75.253 14.273  1.00 40.99 ? 164  ALA A N   1 
ATOM   1301 C  CA  . ALA A 1 164 ? 85.957  74.047 14.954  1.00 37.41 ? 164  ALA A CA  1 
ATOM   1302 C  C   . ALA A 1 164 ? 85.199  73.874 16.239  1.00 35.61 ? 164  ALA A C   1 
ATOM   1303 O  O   . ALA A 1 164 ? 85.755  74.114 17.302  1.00 35.32 ? 164  ALA A O   1 
ATOM   1304 C  CB  . ALA A 1 164 ? 87.465  74.178 15.231  1.00 37.09 ? 164  ALA A CB  1 
ATOM   1305 N  N   . PRO A 1 165 ? 83.905  73.491 16.145  1.00 34.98 ? 165  PRO A N   1 
ATOM   1306 C  CA  . PRO A 1 165 ? 83.008  73.400 17.300  1.00 34.78 ? 165  PRO A CA  1 
ATOM   1307 C  C   . PRO A 1 165 ? 83.345  72.284 18.274  1.00 33.79 ? 165  PRO A C   1 
ATOM   1308 O  O   . PRO A 1 165 ? 82.916  72.329 19.440  1.00 34.56 ? 165  PRO A O   1 
ATOM   1309 C  CB  . PRO A 1 165 ? 81.639  73.115 16.660  1.00 34.77 ? 165  PRO A CB  1 
ATOM   1310 C  CG  . PRO A 1 165 ? 81.971  72.447 15.368  1.00 33.47 ? 165  PRO A CG  1 
ATOM   1311 C  CD  . PRO A 1 165 ? 83.202  73.144 14.893  1.00 34.77 ? 165  PRO A CD  1 
ATOM   1312 N  N   . GLY A 1 166 ? 84.084  71.285 17.808  1.00 32.13 ? 166  GLY A N   1 
ATOM   1313 C  CA  . GLY A 1 166 ? 84.342  70.113 18.637  1.00 31.39 ? 166  GLY A CA  1 
ATOM   1314 C  C   . GLY A 1 166 ? 83.301  69.045 18.377  1.00 30.20 ? 166  GLY A C   1 
ATOM   1315 O  O   . GLY A 1 166 ? 82.252  69.321 17.789  1.00 31.20 ? 166  GLY A O   1 
ATOM   1316 N  N   . ASN A 1 167 ? 83.594  67.827 18.818  1.00 28.64 ? 167  ASN A N   1 
ATOM   1317 C  CA  . ASN A 1 167 ? 82.681  66.693 18.678  1.00 26.91 ? 167  ASN A CA  1 
ATOM   1318 C  C   . ASN A 1 167 ? 82.381  66.233 17.267  1.00 26.63 ? 167  ASN A C   1 
ATOM   1319 O  O   . ASN A 1 167 ? 81.554  65.356 17.094  1.00 27.77 ? 167  ASN A O   1 
ATOM   1320 C  CB  . ASN A 1 167 ? 81.393  66.946 19.446  1.00 27.16 ? 167  ASN A CB  1 
ATOM   1321 C  CG  . ASN A 1 167 ? 81.624  66.917 20.944  1.00 28.07 ? 167  ASN A CG  1 
ATOM   1322 O  OD1 . ASN A 1 167 ? 82.552  66.261 21.417  1.00 27.30 ? 167  ASN A OD1 1 
ATOM   1323 N  ND2 . ASN A 1 167 ? 80.804  67.636 21.696  1.00 27.19 ? 167  ASN A ND2 1 
ATOM   1324 N  N   . VAL A 1 168 ? 83.065  66.750 16.250  1.00 25.89 ? 168  VAL A N   1 
ATOM   1325 C  CA  . VAL A 1 168 ? 82.646  66.416 14.884  1.00 24.35 ? 168  VAL A CA  1 
ATOM   1326 C  C   . VAL A 1 168 ? 82.790  64.933 14.533  1.00 23.28 ? 168  VAL A C   1 
ATOM   1327 O  O   . VAL A 1 168 ? 82.008  64.407 13.738  1.00 22.95 ? 168  VAL A O   1 
ATOM   1328 C  CB  . VAL A 1 168 ? 83.246  67.346 13.805  1.00 24.13 ? 168  VAL A CB  1 
ATOM   1329 C  CG1 . VAL A 1 168 ? 82.926  68.834 14.148  1.00 25.48 ? 168  VAL A CG1 1 
ATOM   1330 C  CG2 . VAL A 1 168 ? 84.746  67.101 13.636  1.00 23.35 ? 168  VAL A CG2 1 
ATOM   1331 N  N   . GLY A 1 169 ? 83.793  64.263 15.112  1.00 23.15 ? 169  GLY A N   1 
ATOM   1332 C  CA  . GLY A 1 169 ? 83.913  62.799 14.991  1.00 21.13 ? 169  GLY A CA  1 
ATOM   1333 C  C   . GLY A 1 169 ? 82.639  62.125 15.501  1.00 22.19 ? 169  GLY A C   1 
ATOM   1334 O  O   . GLY A 1 169 ? 82.226  61.130 14.915  1.00 22.94 ? 169  GLY A O   1 
ATOM   1335 N  N   . LEU A 1 170 ? 82.007  62.655 16.567  1.00 22.09 ? 170  LEU A N   1 
ATOM   1336 C  CA  . LEU A 1 170 ? 80.775  62.064 17.109  1.00 23.56 ? 170  LEU A CA  1 
ATOM   1337 C  C   . LEU A 1 170 ? 79.608  62.321 16.143  1.00 24.32 ? 170  LEU A C   1 
ATOM   1338 O  O   . LEU A 1 170 ? 78.733  61.473 15.935  1.00 24.84 ? 170  LEU A O   1 
ATOM   1339 C  CB  . LEU A 1 170 ? 80.445  62.574 18.518  1.00 23.24 ? 170  LEU A CB  1 
ATOM   1340 C  CG  . LEU A 1 170 ? 81.208  61.966 19.701  1.00 24.01 ? 170  LEU A CG  1 
ATOM   1341 C  CD1 . LEU A 1 170 ? 80.975  62.752 21.039  1.00 21.04 ? 170  LEU A CD1 1 
ATOM   1342 C  CD2 . LEU A 1 170 ? 80.855  60.519 19.909  1.00 18.59 ? 170  LEU A CD2 1 
ATOM   1343 N  N   . LEU A 1 171 ? 79.666  63.450 15.473  1.00 24.58 ? 171  LEU A N   1 
ATOM   1344 C  CA  . LEU A 1 171 ? 78.649  63.751 14.515  1.00 26.00 ? 171  LEU A CA  1 
ATOM   1345 C  C   . LEU A 1 171 ? 78.832  62.928 13.273  1.00 25.24 ? 171  LEU A C   1 
ATOM   1346 O  O   . LEU A 1 171 ? 77.841  62.616 12.641  1.00 25.82 ? 171  LEU A O   1 
ATOM   1347 C  CB  . LEU A 1 171 ? 78.601  65.268 14.190  1.00 26.69 ? 171  LEU A CB  1 
ATOM   1348 C  CG  . LEU A 1 171 ? 78.195  66.206 15.334  1.00 28.94 ? 171  LEU A CG  1 
ATOM   1349 C  CD1 . LEU A 1 171 ? 78.479  67.728 14.993  1.00 26.53 ? 171  LEU A CD1 1 
ATOM   1350 C  CD2 . LEU A 1 171 ? 76.716  66.011 15.750  1.00 25.41 ? 171  LEU A CD2 1 
ATOM   1351 N  N   . ASP A 1 172 ? 80.081  62.596 12.904  1.00 25.25 ? 172  ASP A N   1 
ATOM   1352 C  CA  . ASP A 1 172 ? 80.319  61.669 11.786  1.00 25.68 ? 172  ASP A CA  1 
ATOM   1353 C  C   . ASP A 1 172 ? 79.602  60.351 12.092  1.00 25.53 ? 172  ASP A C   1 
ATOM   1354 O  O   . ASP A 1 172 ? 78.913  59.806 11.226  1.00 27.34 ? 172  ASP A O   1 
ATOM   1355 C  CB  . ASP A 1 172 ? 81.815  61.355 11.509  1.00 24.43 ? 172  ASP A CB  1 
ATOM   1356 C  CG  . ASP A 1 172 ? 82.646  62.593 11.156  1.00 27.17 ? 172  ASP A CG  1 
ATOM   1357 O  OD1 . ASP A 1 172 ? 82.088  63.683 10.815  1.00 28.92 ? 172  ASP A OD1 1 
ATOM   1358 O  OD2 . ASP A 1 172 ? 83.896  62.481 11.270  1.00 27.64 ? 172  ASP A OD2 1 
ATOM   1359 N  N   . GLN A 1 173 ? 79.767  59.830 13.300  1.00 24.28 ? 173  GLN A N   1 
ATOM   1360 C  CA  . GLN A 1 173 ? 79.119  58.554 13.658  1.00 24.32 ? 173  GLN A CA  1 
ATOM   1361 C  C   . GLN A 1 173 ? 77.591  58.697 13.498  1.00 25.73 ? 173  GLN A C   1 
ATOM   1362 O  O   . GLN A 1 173 ? 76.931  57.821 12.929  1.00 26.11 ? 173  GLN A O   1 
ATOM   1363 C  CB  . GLN A 1 173 ? 79.446  58.146 15.112  1.00 22.83 ? 173  GLN A CB  1 
ATOM   1364 C  CG  . GLN A 1 173 ? 80.933  58.026 15.424  1.00 20.16 ? 173  GLN A CG  1 
ATOM   1365 C  CD  . GLN A 1 173 ? 81.181  57.708 16.893  1.00 23.76 ? 173  GLN A CD  1 
ATOM   1366 O  OE1 . GLN A 1 173 ? 80.223  57.510 17.655  1.00 22.77 ? 173  GLN A OE1 1 
ATOM   1367 N  NE2 . GLN A 1 173 ? 82.467  57.657 17.304  1.00 20.45 ? 173  GLN A NE2 1 
ATOM   1368 N  N   . ARG A 1 174 ? 77.048  59.819 13.982  1.00 26.15 ? 174  ARG A N   1 
ATOM   1369 C  CA  . ARG A 1 174 ? 75.617  60.056 13.947  1.00 27.05 ? 174  ARG A CA  1 
ATOM   1370 C  C   . ARG A 1 174 ? 75.125  60.211 12.516  1.00 27.85 ? 174  ARG A C   1 
ATOM   1371 O  O   . ARG A 1 174 ? 74.057  59.726 12.160  1.00 28.97 ? 174  ARG A O   1 
ATOM   1372 C  CB  . ARG A 1 174 ? 75.240  61.284 14.750  1.00 27.70 ? 174  ARG A CB  1 
ATOM   1373 C  CG  . ARG A 1 174 ? 73.766  61.648 14.555  1.00 30.02 ? 174  ARG A CG  1 
ATOM   1374 C  CD  . ARG A 1 174 ? 73.493  63.051 15.089  1.00 30.31 ? 174  ARG A CD  1 
ATOM   1375 N  NE  . ARG A 1 174 ? 73.671  63.091 16.534  1.00 27.62 ? 174  ARG A NE  1 
ATOM   1376 C  CZ  . ARG A 1 174 ? 73.637  64.188 17.273  1.00 30.06 ? 174  ARG A CZ  1 
ATOM   1377 N  NH1 . ARG A 1 174 ? 73.428  65.391 16.714  1.00 28.68 ? 174  ARG A NH1 1 
ATOM   1378 N  NH2 . ARG A 1 174 ? 73.777  64.064 18.589  1.00 29.63 ? 174  ARG A NH2 1 
ATOM   1379 N  N   . MET A 1 175 ? 75.917  60.850 11.676  1.00 27.47 ? 175  MET A N   1 
ATOM   1380 C  CA  . MET A 1 175 ? 75.533  60.899 10.283  1.00 28.35 ? 175  MET A CA  1 
ATOM   1381 C  C   . MET A 1 175 ? 75.542  59.518 9.614   1.00 26.92 ? 175  MET A C   1 
ATOM   1382 O  O   . MET A 1 175 ? 74.732  59.269 8.725   1.00 27.77 ? 175  MET A O   1 
ATOM   1383 C  CB  . MET A 1 175 ? 76.398  61.845 9.487   1.00 28.17 ? 175  MET A CB  1 
ATOM   1384 C  CG  . MET A 1 175 ? 75.678  62.162 8.178   1.00 34.41 ? 175  MET A CG  1 
ATOM   1385 S  SD  . MET A 1 175 ? 76.043  63.811 7.635   1.00 43.28 ? 175  MET A SD  1 
ATOM   1386 C  CE  . MET A 1 175 ? 77.526  63.378 6.881   1.00 34.92 ? 175  MET A CE  1 
ATOM   1387 N  N   . ALA A 1 176 ? 76.460  58.642 10.002  1.00 25.71 ? 176  ALA A N   1 
ATOM   1388 C  CA  . ALA A 1 176 ? 76.438  57.255 9.452   1.00 25.87 ? 176  ALA A CA  1 
ATOM   1389 C  C   . ALA A 1 176 ? 75.217  56.509 9.975   1.00 25.92 ? 176  ALA A C   1 
ATOM   1390 O  O   . ALA A 1 176 ? 74.560  55.786 9.232   1.00 26.82 ? 176  ALA A O   1 
ATOM   1391 C  CB  . ALA A 1 176 ? 77.751  56.497 9.757   1.00 24.38 ? 176  ALA A CB  1 
ATOM   1392 N  N   . LEU A 1 177 ? 74.876  56.742 11.240  1.00 26.06 ? 177  LEU A N   1 
ATOM   1393 C  CA  . LEU A 1 177 ? 73.609  56.233 11.797  1.00 27.46 ? 177  LEU A CA  1 
ATOM   1394 C  C   . LEU A 1 177 ? 72.354  56.713 11.047  1.00 28.09 ? 177  LEU A C   1 
ATOM   1395 O  O   . LEU A 1 177 ? 71.408  55.940 10.819  1.00 29.37 ? 177  LEU A O   1 
ATOM   1396 C  CB  . LEU A 1 177 ? 73.490  56.540 13.301  1.00 27.02 ? 177  LEU A CB  1 
ATOM   1397 C  CG  . LEU A 1 177 ? 74.536  55.862 14.230  1.00 27.83 ? 177  LEU A CG  1 
ATOM   1398 C  CD1 . LEU A 1 177 ? 74.236  56.116 15.730  1.00 26.36 ? 177  LEU A CD1 1 
ATOM   1399 C  CD2 . LEU A 1 177 ? 74.730  54.321 13.947  1.00 28.08 ? 177  LEU A CD2 1 
ATOM   1400 N  N   . GLN A 1 178 ? 72.346  57.982 10.664  1.00 27.80 ? 178  GLN A N   1 
ATOM   1401 C  CA  . GLN A 1 178 ? 71.218  58.565 9.967   1.00 28.17 ? 178  GLN A CA  1 
ATOM   1402 C  C   . GLN A 1 178 ? 71.098  57.891 8.624   1.00 27.90 ? 178  GLN A C   1 
ATOM   1403 O  O   . GLN A 1 178 ? 69.998  57.538 8.192   1.00 28.63 ? 178  GLN A O   1 
ATOM   1404 C  CB  . GLN A 1 178 ? 71.429  60.059 9.774   1.00 29.19 ? 178  GLN A CB  1 
ATOM   1405 C  CG  . GLN A 1 178 ? 70.313  60.783 8.947   1.00 30.66 ? 178  GLN A CG  1 
ATOM   1406 C  CD  . GLN A 1 178 ? 69.027  60.887 9.733   1.00 32.04 ? 178  GLN A CD  1 
ATOM   1407 O  OE1 . GLN A 1 178 ? 69.026  61.421 10.824  1.00 31.63 ? 178  GLN A OE1 1 
ATOM   1408 N  NE2 . GLN A 1 178 ? 67.924  60.356 9.182   1.00 32.66 ? 178  GLN A NE2 1 
ATOM   1409 N  N   . TRP A 1 179 ? 72.242  57.676 7.986   1.00 26.99 ? 179  TRP A N   1 
ATOM   1410 C  CA  . TRP A 1 179 ? 72.311  56.996 6.688   1.00 27.64 ? 179  TRP A CA  1 
ATOM   1411 C  C   . TRP A 1 179 ? 71.755  55.544 6.760   1.00 28.07 ? 179  TRP A C   1 
ATOM   1412 O  O   . TRP A 1 179 ? 71.129  55.044 5.819   1.00 28.28 ? 179  TRP A O   1 
ATOM   1413 C  CB  . TRP A 1 179 ? 73.771  57.009 6.180   1.00 27.02 ? 179  TRP A CB  1 
ATOM   1414 C  CG  . TRP A 1 179 ? 73.874  56.540 4.780   1.00 28.28 ? 179  TRP A CG  1 
ATOM   1415 C  CD1 . TRP A 1 179 ? 73.988  57.318 3.668   1.00 28.94 ? 179  TRP A CD1 1 
ATOM   1416 C  CD2 . TRP A 1 179 ? 73.839  55.174 4.321   1.00 27.89 ? 179  TRP A CD2 1 
ATOM   1417 N  NE1 . TRP A 1 179 ? 74.038  56.520 2.543   1.00 31.56 ? 179  TRP A NE1 1 
ATOM   1418 C  CE2 . TRP A 1 179 ? 73.939  55.205 2.918   1.00 31.31 ? 179  TRP A CE2 1 
ATOM   1419 C  CE3 . TRP A 1 179 ? 73.767  53.938 4.964   1.00 28.26 ? 179  TRP A CE3 1 
ATOM   1420 C  CZ2 . TRP A 1 179 ? 73.955  54.039 2.134   1.00 33.45 ? 179  TRP A CZ2 1 
ATOM   1421 C  CZ3 . TRP A 1 179 ? 73.770  52.771 4.178   1.00 31.06 ? 179  TRP A CZ3 1 
ATOM   1422 C  CH2 . TRP A 1 179 ? 73.854  52.841 2.780   1.00 31.86 ? 179  TRP A CH2 1 
ATOM   1423 N  N   . VAL A 1 180 ? 71.997  54.880 7.883   1.00 27.48 ? 180  VAL A N   1 
ATOM   1424 C  CA  . VAL A 1 180 ? 71.514  53.518 8.116   1.00 28.19 ? 180  VAL A CA  1 
ATOM   1425 C  C   . VAL A 1 180 ? 69.987  53.600 8.286   1.00 29.65 ? 180  VAL A C   1 
ATOM   1426 O  O   . VAL A 1 180 ? 69.215  52.813 7.699   1.00 31.38 ? 180  VAL A O   1 
ATOM   1427 C  CB  . VAL A 1 180 ? 72.267  52.872 9.349   1.00 27.02 ? 180  VAL A CB  1 
ATOM   1428 C  CG1 . VAL A 1 180 ? 71.534  51.641 9.941   1.00 28.49 ? 180  VAL A CG1 1 
ATOM   1429 C  CG2 . VAL A 1 180 ? 73.723  52.500 8.960   1.00 27.01 ? 180  VAL A CG2 1 
ATOM   1430 N  N   . HIS A 1 181 ? 69.547  54.578 9.064   1.00 28.98 ? 181  HIS A N   1 
ATOM   1431 C  CA  . HIS A 1 181 ? 68.124  54.828 9.227   1.00 30.14 ? 181  HIS A CA  1 
ATOM   1432 C  C   . HIS A 1 181 ? 67.440  55.109 7.900   1.00 32.02 ? 181  HIS A C   1 
ATOM   1433 O  O   . HIS A 1 181 ? 66.318  54.663 7.681   1.00 33.59 ? 181  HIS A O   1 
ATOM   1434 C  CB  . HIS A 1 181 ? 67.933  56.011 10.143  1.00 29.51 ? 181  HIS A CB  1 
ATOM   1435 C  CG  . HIS A 1 181 ? 66.511  56.394 10.340  1.00 31.41 ? 181  HIS A CG  1 
ATOM   1436 N  ND1 . HIS A 1 181 ? 65.742  55.862 11.346  1.00 34.43 ? 181  HIS A ND1 1 
ATOM   1437 C  CD2 . HIS A 1 181 ? 65.718  57.273 9.679   1.00 32.15 ? 181  HIS A CD2 1 
ATOM   1438 C  CE1 . HIS A 1 181 ? 64.536  56.409 11.308  1.00 34.16 ? 181  HIS A CE1 1 
ATOM   1439 N  NE2 . HIS A 1 181 ? 64.498  57.267 10.305  1.00 33.71 ? 181  HIS A NE2 1 
ATOM   1440 N  N   . ASP A 1 182 ? 68.106  55.856 7.015   1.00 32.63 ? 182  ASP A N   1 
ATOM   1441 C  CA  . ASP A 1 182 ? 67.511  56.223 5.728   1.00 34.08 ? 182  ASP A CA  1 
ATOM   1442 C  C   . ASP A 1 182 ? 67.616  55.160 4.629   1.00 34.72 ? 182  ASP A C   1 
ATOM   1443 O  O   . ASP A 1 182 ? 66.791  55.122 3.711   1.00 36.71 ? 182  ASP A O   1 
ATOM   1444 C  CB  . ASP A 1 182 ? 68.124  57.550 5.232   1.00 34.92 ? 182  ASP A CB  1 
ATOM   1445 C  CG  . ASP A 1 182 ? 67.685  58.739 6.059   1.00 34.99 ? 182  ASP A CG  1 
ATOM   1446 O  OD1 . ASP A 1 182 ? 66.701  58.618 6.808   1.00 37.58 ? 182  ASP A OD1 1 
ATOM   1447 O  OD2 . ASP A 1 182 ? 68.320  59.795 5.960   1.00 37.04 ? 182  ASP A OD2 1 
ATOM   1448 N  N   . ASN A 1 183 ? 68.623  54.299 4.713   1.00 34.04 ? 183  ASN A N   1 
ATOM   1449 C  CA  . ASN A 1 183 ? 68.954  53.388 3.610   1.00 34.30 ? 183  ASN A CA  1 
ATOM   1450 C  C   . ASN A 1 183 ? 69.025  51.889 3.941   1.00 33.45 ? 183  ASN A C   1 
ATOM   1451 O  O   . ASN A 1 183 ? 68.955  51.052 3.033   1.00 34.55 ? 183  ASN A O   1 
ATOM   1452 C  CB  . ASN A 1 183 ? 70.264  53.820 2.950   1.00 33.47 ? 183  ASN A CB  1 
ATOM   1453 C  CG  . ASN A 1 183 ? 70.176  55.191 2.344   1.00 35.41 ? 183  ASN A CG  1 
ATOM   1454 O  OD1 . ASN A 1 183 ? 69.671  55.354 1.241   1.00 41.36 ? 183  ASN A OD1 1 
ATOM   1455 N  ND2 . ASN A 1 183 ? 70.666  56.192 3.056   1.00 32.75 ? 183  ASN A ND2 1 
ATOM   1456 N  N   . ILE A 1 184 ? 69.154  51.530 5.208   1.00 32.08 ? 184  ILE A N   1 
ATOM   1457 C  CA  . ILE A 1 184 ? 69.389  50.105 5.499   1.00 31.69 ? 184  ILE A CA  1 
ATOM   1458 C  C   . ILE A 1 184 ? 68.227  49.210 5.029   1.00 33.59 ? 184  ILE A C   1 
ATOM   1459 O  O   . ILE A 1 184 ? 68.449  48.031 4.723   1.00 34.61 ? 184  ILE A O   1 
ATOM   1460 C  CB  . ILE A 1 184 ? 69.879  49.822 6.970   1.00 29.63 ? 184  ILE A CB  1 
ATOM   1461 C  CG1 . ILE A 1 184 ? 70.850  48.631 7.011   1.00 29.00 ? 184  ILE A CG1 1 
ATOM   1462 C  CG2 . ILE A 1 184 ? 68.714  49.662 7.962   1.00 28.75 ? 184  ILE A CG2 1 
ATOM   1463 C  CD1 . ILE A 1 184 ? 72.194  48.845 6.291   1.00 28.07 ? 184  ILE A CD1 1 
ATOM   1464 N  N   . GLN A 1 185 ? 67.018  49.770 4.909   1.00 34.38 ? 185  GLN A N   1 
ATOM   1465 C  CA  . GLN A 1 185 ? 65.885  48.994 4.384   1.00 37.03 ? 185  GLN A CA  1 
ATOM   1466 C  C   . GLN A 1 185 ? 66.147  48.508 2.964   1.00 38.46 ? 185  GLN A C   1 
ATOM   1467 O  O   . GLN A 1 185 ? 65.526  47.555 2.516   1.00 40.56 ? 185  GLN A O   1 
ATOM   1468 C  CB  . GLN A 1 185 ? 64.563  49.775 4.400   1.00 37.96 ? 185  GLN A CB  1 
ATOM   1469 C  CG  . GLN A 1 185 ? 64.492  50.870 3.340   1.00 39.33 ? 185  GLN A CG  1 
ATOM   1470 C  CD  . GLN A 1 185 ? 63.440  51.900 3.662   1.00 43.36 ? 185  GLN A CD  1 
ATOM   1471 O  OE1 . GLN A 1 185 ? 63.477  52.532 4.724   1.00 42.24 ? 185  GLN A OE1 1 
ATOM   1472 N  NE2 . GLN A 1 185 ? 62.477  52.069 2.751   1.00 43.95 ? 185  GLN A NE2 1 
ATOM   1473 N  N   . PHE A 1 186 ? 67.056  49.161 2.252   1.00 38.57 ? 186  PHE A N   1 
ATOM   1474 C  CA  . PHE A 1 186 ? 67.357  48.738 0.882   1.00 40.48 ? 186  PHE A CA  1 
ATOM   1475 C  C   . PHE A 1 186 ? 68.248  47.512 0.798   1.00 40.68 ? 186  PHE A C   1 
ATOM   1476 O  O   . PHE A 1 186 ? 68.292  46.848 -0.237  1.00 41.25 ? 186  PHE A O   1 
ATOM   1477 C  CB  . PHE A 1 186 ? 67.899  49.913 0.097   1.00 39.84 ? 186  PHE A CB  1 
ATOM   1478 C  CG  . PHE A 1 186 ? 66.918  51.041 0.039   1.00 41.46 ? 186  PHE A CG  1 
ATOM   1479 C  CD1 . PHE A 1 186 ? 65.623  50.800 -0.407  1.00 41.53 ? 186  PHE A CD1 1 
ATOM   1480 C  CD2 . PHE A 1 186 ? 67.256  52.319 0.504   1.00 40.18 ? 186  PHE A CD2 1 
ATOM   1481 C  CE1 . PHE A 1 186 ? 64.673  51.829 -0.445  1.00 43.78 ? 186  PHE A CE1 1 
ATOM   1482 C  CE2 . PHE A 1 186 ? 66.323  53.348 0.476   1.00 41.71 ? 186  PHE A CE2 1 
ATOM   1483 C  CZ  . PHE A 1 186 ? 65.021  53.099 0.003   1.00 42.29 ? 186  PHE A CZ  1 
ATOM   1484 N  N   . PHE A 1 187 ? 68.927  47.223 1.917   1.00 39.47 ? 187  PHE A N   1 
ATOM   1485 C  CA  . PHE A 1 187 ? 69.797  46.070 2.045   1.00 39.53 ? 187  PHE A CA  1 
ATOM   1486 C  C   . PHE A 1 187 ? 69.145  44.949 2.868   1.00 40.37 ? 187  PHE A C   1 
ATOM   1487 O  O   . PHE A 1 187 ? 69.836  44.114 3.431   1.00 40.35 ? 187  PHE A O   1 
ATOM   1488 C  CB  . PHE A 1 187 ? 71.111  46.512 2.696   1.00 37.08 ? 187  PHE A CB  1 
ATOM   1489 C  CG  . PHE A 1 187 ? 71.823  47.578 1.930   1.00 36.41 ? 187  PHE A CG  1 
ATOM   1490 C  CD1 . PHE A 1 187 ? 71.470  48.920 2.082   1.00 35.42 ? 187  PHE A CD1 1 
ATOM   1491 C  CD2 . PHE A 1 187 ? 72.845  47.255 1.039   1.00 36.88 ? 187  PHE A CD2 1 
ATOM   1492 C  CE1 . PHE A 1 187 ? 72.116  49.912 1.356   1.00 33.48 ? 187  PHE A CE1 1 
ATOM   1493 C  CE2 . PHE A 1 187 ? 73.512  48.263 0.307   1.00 34.05 ? 187  PHE A CE2 1 
ATOM   1494 C  CZ  . PHE A 1 187 ? 73.139  49.580 0.466   1.00 33.97 ? 187  PHE A CZ  1 
ATOM   1495 N  N   . GLY A 1 188 ? 67.820  44.946 2.952   1.00 41.89 ? 188  GLY A N   1 
ATOM   1496 C  CA  . GLY A 1 188 ? 67.092  43.954 3.749   1.00 42.93 ? 188  GLY A CA  1 
ATOM   1497 C  C   . GLY A 1 188 ? 67.193  44.175 5.256   1.00 42.21 ? 188  GLY A C   1 
ATOM   1498 O  O   . GLY A 1 188 ? 66.910  43.255 6.055   1.00 42.32 ? 188  GLY A O   1 
ATOM   1499 N  N   . GLY A 1 189 ? 67.588  45.388 5.656   1.00 40.10 ? 189  GLY A N   1 
ATOM   1500 C  CA  . GLY A 1 189 ? 67.711  45.705 7.083   1.00 38.90 ? 189  GLY A CA  1 
ATOM   1501 C  C   . GLY A 1 189 ? 66.487  46.374 7.671   1.00 39.17 ? 189  GLY A C   1 
ATOM   1502 O  O   . GLY A 1 189 ? 65.797  47.125 6.988   1.00 40.35 ? 189  GLY A O   1 
ATOM   1503 N  N   . ASP A 1 190 ? 66.216  46.121 8.943   1.00 38.77 ? 190  ASP A N   1 
ATOM   1504 C  CA  . ASP A 1 190 ? 65.134  46.792 9.645   1.00 39.33 ? 190  ASP A CA  1 
ATOM   1505 C  C   . ASP A 1 190 ? 65.660  48.030 10.390  1.00 38.27 ? 190  ASP A C   1 
ATOM   1506 O  O   . ASP A 1 190 ? 66.329  47.929 11.430  1.00 36.41 ? 190  ASP A O   1 
ATOM   1507 C  CB  . ASP A 1 190 ? 64.452  45.832 10.604  1.00 39.77 ? 190  ASP A CB  1 
ATOM   1508 C  CG  . ASP A 1 190 ? 63.326  46.471 11.385  1.00 42.63 ? 190  ASP A CG  1 
ATOM   1509 O  OD1 . ASP A 1 190 ? 62.925  47.633 11.094  1.00 44.70 ? 190  ASP A OD1 1 
ATOM   1510 O  OD2 . ASP A 1 190 ? 62.815  45.780 12.297  1.00 45.83 ? 190  ASP A OD2 1 
ATOM   1511 N  N   . PRO A 1 191 ? 65.336  49.224 9.872   1.00 38.73 ? 191  PRO A N   1 
ATOM   1512 C  CA  . PRO A 1 191 ? 65.880  50.443 10.499  1.00 37.28 ? 191  PRO A CA  1 
ATOM   1513 C  C   . PRO A 1 191 ? 65.320  50.711 11.912  1.00 37.45 ? 191  PRO A C   1 
ATOM   1514 O  O   . PRO A 1 191 ? 65.887  51.511 12.664  1.00 36.55 ? 191  PRO A O   1 
ATOM   1515 C  CB  . PRO A 1 191 ? 65.453  51.538 9.532   1.00 37.74 ? 191  PRO A CB  1 
ATOM   1516 C  CG  . PRO A 1 191 ? 64.149  50.997 8.939   1.00 39.63 ? 191  PRO A CG  1 
ATOM   1517 C  CD  . PRO A 1 191 ? 64.471  49.535 8.721   1.00 39.58 ? 191  PRO A CD  1 
ATOM   1518 N  N   . LYS A 1 192 ? 64.217  50.057 12.266  1.00 38.72 ? 192  LYS A N   1 
ATOM   1519 C  CA  . LYS A 1 192 ? 63.698  50.156 13.632  1.00 38.78 ? 192  LYS A CA  1 
ATOM   1520 C  C   . LYS A 1 192 ? 64.309  49.133 14.608  1.00 37.53 ? 192  LYS A C   1 
ATOM   1521 O  O   . LYS A 1 192 ? 63.938  49.111 15.781  1.00 38.72 ? 192  LYS A O   1 
ATOM   1522 C  CB  . LYS A 1 192 ? 62.190  49.990 13.633  1.00 40.93 ? 192  LYS A CB  1 
ATOM   1523 C  CG  . LYS A 1 192 ? 61.510  50.606 12.432  1.00 43.58 ? 192  LYS A CG  1 
ATOM   1524 C  CD  . LYS A 1 192 ? 60.053  50.112 12.312  1.00 47.04 ? 192  LYS A CD  1 
ATOM   1525 C  CE  . LYS A 1 192 ? 59.052  51.169 12.834  1.00 50.19 ? 192  LYS A CE  1 
ATOM   1526 N  NZ  . LYS A 1 192 ? 59.348  51.731 14.176  1.00 49.70 ? 192  LYS A NZ  1 
ATOM   1527 N  N   . THR A 1 193 ? 65.232  48.297 14.133  1.00 35.72 ? 193  THR A N   1 
ATOM   1528 C  CA  . THR A 1 193 ? 65.886  47.290 14.986  1.00 33.81 ? 193  THR A CA  1 
ATOM   1529 C  C   . THR A 1 193 ? 67.416  47.373 14.821  1.00 31.73 ? 193  THR A C   1 
ATOM   1530 O  O   . THR A 1 193 ? 68.100  46.379 14.536  1.00 30.92 ? 193  THR A O   1 
ATOM   1531 C  CB  . THR A 1 193 ? 65.296  45.848 14.728  1.00 35.37 ? 193  THR A CB  1 
ATOM   1532 O  OG1 . THR A 1 193 ? 63.863  45.929 14.685  1.00 36.41 ? 193  THR A OG1 1 
ATOM   1533 C  CG2 . THR A 1 193 ? 65.690  44.823 15.823  1.00 34.06 ? 193  THR A CG2 1 
ATOM   1534 N  N   . VAL A 1 194 ? 67.947  48.577 15.018  1.00 29.89 ? 194  VAL A N   1 
ATOM   1535 C  CA  . VAL A 1 194 ? 69.382  48.823 14.920  1.00 28.07 ? 194  VAL A CA  1 
ATOM   1536 C  C   . VAL A 1 194 ? 70.038  48.776 16.298  1.00 28.25 ? 194  VAL A C   1 
ATOM   1537 O  O   . VAL A 1 194 ? 69.634  49.507 17.221  1.00 29.95 ? 194  VAL A O   1 
ATOM   1538 C  CB  . VAL A 1 194 ? 69.681  50.211 14.286  1.00 26.92 ? 194  VAL A CB  1 
ATOM   1539 C  CG1 . VAL A 1 194 ? 71.167  50.450 14.252  1.00 23.98 ? 194  VAL A CG1 1 
ATOM   1540 C  CG2 . VAL A 1 194 ? 69.120  50.287 12.878  1.00 26.56 ? 194  VAL A CG2 1 
ATOM   1541 N  N   . THR A 1 195 ? 71.059  47.938 16.436  1.00 27.48 ? 195  THR A N   1 
ATOM   1542 C  CA  . THR A 1 195 ? 71.936  47.950 17.608  1.00 25.74 ? 195  THR A CA  1 
ATOM   1543 C  C   . THR A 1 195 ? 73.264  48.606 17.281  1.00 24.99 ? 195  THR A C   1 
ATOM   1544 O  O   . THR A 1 195 ? 73.898  48.248 16.302  1.00 24.86 ? 195  THR A O   1 
ATOM   1545 C  CB  . THR A 1 195 ? 72.205  46.526 18.123  1.00 25.60 ? 195  THR A CB  1 
ATOM   1546 O  OG1 . THR A 1 195 ? 71.018  46.041 18.744  1.00 26.51 ? 195  THR A OG1 1 
ATOM   1547 C  CG2 . THR A 1 195 ? 73.315  46.493 19.201  1.00 24.12 ? 195  THR A CG2 1 
ATOM   1548 N  N   . ILE A 1 196 ? 73.710  49.536 18.116  1.00 24.09 ? 196  ILE A N   1 
ATOM   1549 C  CA  . ILE A 1 196 ? 75.047  50.060 17.926  1.00 23.99 ? 196  ILE A CA  1 
ATOM   1550 C  C   . ILE A 1 196 ? 75.958  49.358 18.911  1.00 24.62 ? 196  ILE A C   1 
ATOM   1551 O  O   . ILE A 1 196 ? 75.565  49.088 20.062  1.00 25.87 ? 196  ILE A O   1 
ATOM   1552 C  CB  . ILE A 1 196 ? 75.106  51.618 18.073  1.00 23.60 ? 196  ILE A CB  1 
ATOM   1553 C  CG1 . ILE A 1 196 ? 74.368  52.125 19.323  1.00 22.83 ? 196  ILE A CG1 1 
ATOM   1554 C  CG2 . ILE A 1 196 ? 74.456  52.275 16.903  1.00 23.81 ? 196  ILE A CG2 1 
ATOM   1555 C  CD1 . ILE A 1 196 ? 74.632  53.643 19.619  1.00 20.05 ? 196  ILE A CD1 1 
ATOM   1556 N  N   . PHE A 1 197 ? 77.162  49.023 18.468  1.00 24.17 ? 197  PHE A N   1 
ATOM   1557 C  CA  . PHE A 1 197 ? 78.105  48.444 19.363  1.00 23.49 ? 197  PHE A CA  1 
ATOM   1558 C  C   . PHE A 1 197 ? 79.522  48.847 19.030  1.00 22.73 ? 197  PHE A C   1 
ATOM   1559 O  O   . PHE A 1 197 ? 79.842  49.146 17.884  1.00 22.21 ? 197  PHE A O   1 
ATOM   1560 C  CB  . PHE A 1 197 ? 77.935  46.909 19.475  1.00 25.23 ? 197  PHE A CB  1 
ATOM   1561 C  CG  . PHE A 1 197 ? 78.334  46.116 18.253  1.00 25.28 ? 197  PHE A CG  1 
ATOM   1562 C  CD1 . PHE A 1 197 ? 77.859  46.441 16.983  1.00 25.28 ? 197  PHE A CD1 1 
ATOM   1563 C  CD2 . PHE A 1 197 ? 79.095  44.940 18.401  1.00 26.55 ? 197  PHE A CD2 1 
ATOM   1564 C  CE1 . PHE A 1 197 ? 78.183  45.664 15.863  1.00 25.07 ? 197  PHE A CE1 1 
ATOM   1565 C  CE2 . PHE A 1 197 ? 79.424  44.147 17.285  1.00 25.29 ? 197  PHE A CE2 1 
ATOM   1566 C  CZ  . PHE A 1 197 ? 78.949  44.504 16.010  1.00 22.95 ? 197  PHE A CZ  1 
ATOM   1567 N  N   . GLY A 1 198 ? 80.367  48.862 20.053  1.00 22.40 ? 198  GLY A N   1 
ATOM   1568 C  CA  . GLY A 1 198 ? 81.764  49.223 19.855  1.00 22.05 ? 198  GLY A CA  1 
ATOM   1569 C  C   . GLY A 1 198 ? 82.587  48.999 21.097  1.00 22.29 ? 198  GLY A C   1 
ATOM   1570 O  O   . GLY A 1 198 ? 82.060  48.768 22.182  1.00 22.69 ? 198  GLY A O   1 
ATOM   1571 N  N   . GLU A 1 199 ? 83.896  49.089 20.943  1.00 22.34 ? 199  GLU A N   1 
ATOM   1572 C  CA  . GLU A 1 199 ? 84.755  48.740 22.021  1.00 22.46 ? 199  GLU A CA  1 
ATOM   1573 C  C   . GLU A 1 199 ? 85.643  49.907 22.385  1.00 22.95 ? 199  GLU A C   1 
ATOM   1574 O  O   . GLU A 1 199 ? 86.067  50.699 21.509  1.00 23.42 ? 199  GLU A O   1 
ATOM   1575 C  CB  . GLU A 1 199 ? 85.546  47.460 21.673  1.00 22.79 ? 199  GLU A CB  1 
ATOM   1576 C  CG  . GLU A 1 199 ? 86.500  46.996 22.743  1.00 21.04 ? 199  GLU A CG  1 
ATOM   1577 C  CD  . GLU A 1 199 ? 87.843  47.628 22.575  1.00 23.23 ? 199  GLU A CD  1 
ATOM   1578 O  OE1 . GLU A 1 199 ? 88.062  48.266 21.519  1.00 22.20 ? 199  GLU A OE1 1 
ATOM   1579 O  OE2 . GLU A 1 199 ? 88.666  47.548 23.509  1.00 25.44 ? 199  GLU A OE2 1 
ATOM   1580 N  N   . SER A 1 200 ? 85.873  50.037 23.688  1.00 22.18 ? 200  SER A N   1 
ATOM   1581 C  CA  . SER A 1 200 ? 86.772  51.014 24.202  1.00 23.41 ? 200  SER A CA  1 
ATOM   1582 C  C   . SER A 1 200 ? 86.247  52.422 23.819  1.00 23.63 ? 200  SER A C   1 
ATOM   1583 O  O   . SER A 1 200 ? 85.117  52.777 24.228  1.00 24.54 ? 200  SER A O   1 
ATOM   1584 C  CB  . SER A 1 200 ? 88.203  50.710 23.725  1.00 23.46 ? 200  SER A CB  1 
ATOM   1585 O  OG  . SER A 1 200 ? 89.112  51.550 24.426  1.00 26.48 ? 200  SER A OG  1 
ATOM   1586 N  N   . ALA A 1 201 ? 86.973  53.203 23.020  1.00 22.96 ? 201  ALA A N   1 
ATOM   1587 C  CA  . ALA A 1 201 ? 86.391  54.497 22.604  1.00 23.75 ? 201  ALA A CA  1 
ATOM   1588 C  C   . ALA A 1 201 ? 85.081  54.308 21.829  1.00 23.16 ? 201  ALA A C   1 
ATOM   1589 O  O   . ALA A 1 201 ? 84.191  55.142 21.900  1.00 24.08 ? 201  ALA A O   1 
ATOM   1590 C  CB  . ALA A 1 201 ? 87.394  55.368 21.802  1.00 22.89 ? 201  ALA A CB  1 
ATOM   1591 N  N   . GLY A 1 202 ? 84.957  53.208 21.109  1.00 23.67 ? 202  GLY A N   1 
ATOM   1592 C  CA  . GLY A 1 202 ? 83.705  52.894 20.407  1.00 22.26 ? 202  GLY A CA  1 
ATOM   1593 C  C   . GLY A 1 202 ? 82.590  52.600 21.378  1.00 22.40 ? 202  GLY A C   1 
ATOM   1594 O  O   . GLY A 1 202 ? 81.412  52.894 21.096  1.00 22.87 ? 202  GLY A O   1 
ATOM   1595 N  N   . GLY A 1 203 ? 82.939  52.007 22.525  1.00 22.16 ? 203  GLY A N   1 
ATOM   1596 C  CA  . GLY A 1 203 ? 81.957  51.801 23.614  1.00 21.96 ? 203  GLY A CA  1 
ATOM   1597 C  C   . GLY A 1 203 ? 81.609  53.123 24.325  1.00 21.99 ? 203  GLY A C   1 
ATOM   1598 O  O   . GLY A 1 203 ? 80.438  53.392 24.623  1.00 22.99 ? 203  GLY A O   1 
ATOM   1599 N  N   . ALA A 1 204 ? 82.620  53.936 24.649  1.00 21.20 ? 204  ALA A N   1 
ATOM   1600 C  CA  . ALA A 1 204 ? 82.343  55.285 25.114  1.00 22.27 ? 204  ALA A CA  1 
ATOM   1601 C  C   . ALA A 1 204 ? 81.379  56.004 24.121  1.00 22.36 ? 204  ALA A C   1 
ATOM   1602 O  O   . ALA A 1 204 ? 80.370  56.587 24.544  1.00 22.20 ? 204  ALA A O   1 
ATOM   1603 C  CB  . ALA A 1 204 ? 83.678  56.094 25.294  1.00 21.56 ? 204  ALA A CB  1 
ATOM   1604 N  N   . SER A 1 205 ? 81.697  55.934 22.808  1.00 21.68 ? 205  SER A N   1 
ATOM   1605 C  CA  . SER A 1 205 ? 80.868  56.512 21.743  1.00 22.60 ? 205  SER A CA  1 
ATOM   1606 C  C   . SER A 1 205 ? 79.408  56.035 21.802  1.00 23.83 ? 205  SER A C   1 
ATOM   1607 O  O   . SER A 1 205 ? 78.471  56.862 21.781  1.00 25.71 ? 205  SER A O   1 
ATOM   1608 C  CB  . SER A 1 205 ? 81.450  56.171 20.376  1.00 22.56 ? 205  SER A CB  1 
ATOM   1609 O  OG  . SER A 1 205 ? 82.654  56.873 20.132  1.00 22.58 ? 205  SER A OG  1 
ATOM   1610 N  N   . VAL A 1 206 ? 79.210  54.714 21.882  1.00 23.41 ? 206  VAL A N   1 
ATOM   1611 C  CA  . VAL A 1 206 ? 77.887  54.133 22.038  1.00 24.12 ? 206  VAL A CA  1 
ATOM   1612 C  C   . VAL A 1 206 ? 77.121  54.774 23.217  1.00 25.41 ? 206  VAL A C   1 
ATOM   1613 O  O   . VAL A 1 206 ? 75.954  55.138 23.073  1.00 26.93 ? 206  VAL A O   1 
ATOM   1614 C  CB  . VAL A 1 206 ? 77.931  52.571 22.230  1.00 24.84 ? 206  VAL A CB  1 
ATOM   1615 C  CG1 . VAL A 1 206 ? 76.599  52.039 22.737  1.00 23.76 ? 206  VAL A CG1 1 
ATOM   1616 C  CG2 . VAL A 1 206 ? 78.319  51.840 20.919  1.00 22.93 ? 206  VAL A CG2 1 
ATOM   1617 N  N   . GLY A 1 207 ? 77.752  54.870 24.382  1.00 24.67 ? 207  GLY A N   1 
ATOM   1618 C  CA  . GLY A 1 207 ? 77.117  55.485 25.511  1.00 24.91 ? 207  GLY A CA  1 
ATOM   1619 C  C   . GLY A 1 207 ? 76.912  56.992 25.273  1.00 26.12 ? 207  GLY A C   1 
ATOM   1620 O  O   . GLY A 1 207 ? 76.013  57.584 25.844  1.00 26.68 ? 207  GLY A O   1 
ATOM   1621 N  N   . MET A 1 208 ? 77.746  57.628 24.460  1.00 25.16 ? 208  MET A N   1 
ATOM   1622 C  CA  . MET A 1 208 ? 77.504  59.057 24.184  1.00 26.72 ? 208  MET A CA  1 
ATOM   1623 C  C   . MET A 1 208 ? 76.247  59.300 23.357  1.00 27.34 ? 208  MET A C   1 
ATOM   1624 O  O   . MET A 1 208 ? 75.543  60.313 23.566  1.00 28.20 ? 208  MET A O   1 
ATOM   1625 C  CB  . MET A 1 208 ? 78.733  59.739 23.567  1.00 25.66 ? 208  MET A CB  1 
ATOM   1626 C  CG  . MET A 1 208 ? 79.858  59.835 24.600  1.00 25.21 ? 208  MET A CG  1 
ATOM   1627 S  SD  . MET A 1 208 ? 81.462  60.168 23.876  1.00 27.45 ? 208  MET A SD  1 
ATOM   1628 C  CE  . MET A 1 208 ? 82.427  60.463 25.386  1.00 26.45 ? 208  MET A CE  1 
ATOM   1629 N  N   . HIS A 1 209 ? 75.965  58.377 22.442  1.00 27.31 ? 209  HIS A N   1 
ATOM   1630 C  CA  . HIS A 1 209 ? 74.772  58.463 21.627  1.00 28.38 ? 209  HIS A CA  1 
ATOM   1631 C  C   . HIS A 1 209 ? 73.536  58.119 22.430  1.00 30.43 ? 209  HIS A C   1 
ATOM   1632 O  O   . HIS A 1 209 ? 72.441  58.516 22.047  1.00 31.68 ? 209  HIS A O   1 
ATOM   1633 C  CB  . HIS A 1 209 ? 74.849  57.546 20.414  1.00 27.85 ? 209  HIS A CB  1 
ATOM   1634 C  CG  . HIS A 1 209 ? 75.872  57.974 19.410  1.00 27.65 ? 209  HIS A CG  1 
ATOM   1635 N  ND1 . HIS A 1 209 ? 75.751  59.125 18.672  1.00 29.43 ? 209  HIS A ND1 1 
ATOM   1636 C  CD2 . HIS A 1 209 ? 77.048  57.419 19.042  1.00 26.06 ? 209  HIS A CD2 1 
ATOM   1637 C  CE1 . HIS A 1 209 ? 76.791  59.251 17.869  1.00 28.40 ? 209  HIS A CE1 1 
ATOM   1638 N  NE2 . HIS A 1 209 ? 77.602  58.234 18.085  1.00 26.79 ? 209  HIS A NE2 1 
ATOM   1639 N  N   . ILE A 1 210 ? 73.701  57.379 23.524  1.00 30.50 ? 210  ILE A N   1 
ATOM   1640 C  CA  . ILE A 1 210 ? 72.582  57.086 24.417  1.00 31.50 ? 210  ILE A CA  1 
ATOM   1641 C  C   . ILE A 1 210 ? 72.237  58.350 25.175  1.00 33.88 ? 210  ILE A C   1 
ATOM   1642 O  O   . ILE A 1 210 ? 71.054  58.687 25.398  1.00 35.49 ? 210  ILE A O   1 
ATOM   1643 C  CB  . ILE A 1 210 ? 72.925  55.918 25.413  1.00 31.19 ? 210  ILE A CB  1 
ATOM   1644 C  CG1 . ILE A 1 210 ? 72.922  54.574 24.666  1.00 29.70 ? 210  ILE A CG1 1 
ATOM   1645 C  CG2 . ILE A 1 210 ? 71.979  55.923 26.640  1.00 27.35 ? 210  ILE A CG2 1 
ATOM   1646 C  CD1 . ILE A 1 210 ? 73.304  53.349 25.540  1.00 30.56 ? 210  ILE A CD1 1 
ATOM   1647 N  N   . LEU A 1 211 ? 73.281  59.058 25.568  1.00 34.23 ? 211  LEU A N   1 
ATOM   1648 C  CA  . LEU A 1 211 ? 73.101  60.291 26.275  1.00 35.94 ? 211  LEU A CA  1 
ATOM   1649 C  C   . LEU A 1 211 ? 72.609  61.436 25.371  1.00 36.46 ? 211  LEU A C   1 
ATOM   1650 O  O   . LEU A 1 211 ? 71.779  62.227 25.775  1.00 39.51 ? 211  LEU A O   1 
ATOM   1651 C  CB  . LEU A 1 211 ? 74.384  60.644 27.017  1.00 35.54 ? 211  LEU A CB  1 
ATOM   1652 C  CG  . LEU A 1 211 ? 74.743  59.731 28.199  1.00 35.11 ? 211  LEU A CG  1 
ATOM   1653 C  CD1 . LEU A 1 211 ? 76.181  59.958 28.537  1.00 36.09 ? 211  LEU A CD1 1 
ATOM   1654 C  CD2 . LEU A 1 211 ? 73.910  60.002 29.446  1.00 35.73 ? 211  LEU A CD2 1 
ATOM   1655 N  N   . SER A 1 212 ? 73.042  61.485 24.124  1.00 35.44 ? 212  SER A N   1 
ATOM   1656 C  CA  . SER A 1 212 ? 72.790  62.678 23.296  1.00 34.50 ? 212  SER A CA  1 
ATOM   1657 C  C   . SER A 1 212 ? 71.393  62.705 22.656  1.00 34.89 ? 212  SER A C   1 
ATOM   1658 O  O   . SER A 1 212 ? 71.078  61.835 21.835  1.00 34.05 ? 212  SER A O   1 
ATOM   1659 C  CB  . SER A 1 212 ? 73.849  62.754 22.206  1.00 32.72 ? 212  SER A CB  1 
ATOM   1660 O  OG  . SER A 1 212 ? 73.690  63.912 21.431  1.00 34.67 ? 212  SER A OG  1 
ATOM   1661 N  N   . PRO A 1 213 ? 70.564  63.718 22.998  1.00 35.88 ? 213  PRO A N   1 
ATOM   1662 C  CA  . PRO A 1 213 ? 69.184  63.759 22.434  1.00 36.71 ? 213  PRO A CA  1 
ATOM   1663 C  C   . PRO A 1 213 ? 69.144  63.724 20.881  1.00 36.26 ? 213  PRO A C   1 
ATOM   1664 O  O   . PRO A 1 213 ? 68.303  63.034 20.315  1.00 36.24 ? 213  PRO A O   1 
ATOM   1665 C  CB  . PRO A 1 213 ? 68.573  65.047 23.000  1.00 38.85 ? 213  PRO A CB  1 
ATOM   1666 C  CG  . PRO A 1 213 ? 69.513  65.546 24.081  1.00 39.08 ? 213  PRO A CG  1 
ATOM   1667 C  CD  . PRO A 1 213 ? 70.862  64.839 23.909  1.00 36.70 ? 213  PRO A CD  1 
ATOM   1668 N  N   . GLY A 1 214 ? 70.074  64.397 20.195  1.00 35.76 ? 214  GLY A N   1 
ATOM   1669 C  CA  . GLY A 1 214 ? 70.192  64.265 18.716  1.00 35.75 ? 214  GLY A CA  1 
ATOM   1670 C  C   . GLY A 1 214 ? 70.538  62.885 18.120  1.00 35.25 ? 214  GLY A C   1 
ATOM   1671 O  O   . GLY A 1 214 ? 70.441  62.695 16.901  1.00 35.30 ? 214  GLY A O   1 
ATOM   1672 N  N   . SER A 1 215 ? 70.946  61.917 18.958  1.00 34.12 ? 215  SER A N   1 
ATOM   1673 C  CA  . SER A 1 215 ? 71.314  60.581 18.469  1.00 33.20 ? 215  SER A CA  1 
ATOM   1674 C  C   . SER A 1 215 ? 70.280  59.523 18.805  1.00 34.23 ? 215  SER A C   1 
ATOM   1675 O  O   . SER A 1 215 ? 70.274  58.425 18.216  1.00 33.78 ? 215  SER A O   1 
ATOM   1676 C  CB  . SER A 1 215 ? 72.638  60.119 19.096  1.00 32.20 ? 215  SER A CB  1 
ATOM   1677 O  OG  . SER A 1 215 ? 73.777  60.710 18.499  1.00 30.21 ? 215  SER A OG  1 
ATOM   1678 N  N   . ARG A 1 216 ? 69.431  59.839 19.776  1.00 35.61 ? 216  ARG A N   1 
ATOM   1679 C  CA  . ARG A 1 216 ? 68.575  58.842 20.403  1.00 38.13 ? 216  ARG A CA  1 
ATOM   1680 C  C   . ARG A 1 216 ? 67.652  58.062 19.482  1.00 38.15 ? 216  ARG A C   1 
ATOM   1681 O  O   . ARG A 1 216 ? 67.411  56.872 19.718  1.00 38.97 ? 216  ARG A O   1 
ATOM   1682 C  CB  . ARG A 1 216 ? 67.768  59.461 21.537  1.00 40.59 ? 216  ARG A CB  1 
ATOM   1683 C  CG  . ARG A 1 216 ? 68.632  59.697 22.771  1.00 45.62 ? 216  ARG A CG  1 
ATOM   1684 C  CD  . ARG A 1 216 ? 67.826  60.435 23.844  1.00 51.81 ? 216  ARG A CD  1 
ATOM   1685 N  NE  . ARG A 1 216 ? 68.734  61.113 24.765  1.00 53.40 ? 216  ARG A NE  1 
ATOM   1686 C  CZ  . ARG A 1 216 ? 68.349  61.961 25.707  1.00 55.50 ? 216  ARG A CZ  1 
ATOM   1687 N  NH1 . ARG A 1 216 ? 67.058  62.230 25.863  1.00 59.00 ? 216  ARG A NH1 1 
ATOM   1688 N  NH2 . ARG A 1 216 ? 69.256  62.531 26.494  1.00 55.09 ? 216  ARG A NH2 1 
ATOM   1689 N  N   . ASP A 1 217 ? 67.158  58.697 18.428  1.00 37.80 ? 217  ASP A N   1 
ATOM   1690 C  CA  . ASP A 1 217 ? 66.140  58.055 17.599  1.00 38.32 ? 217  ASP A CA  1 
ATOM   1691 C  C   . ASP A 1 217 ? 66.701  57.320 16.387  1.00 36.84 ? 217  ASP A C   1 
ATOM   1692 O  O   . ASP A 1 217 ? 65.960  56.841 15.519  1.00 36.86 ? 217  ASP A O   1 
ATOM   1693 C  CB  . ASP A 1 217 ? 65.071  59.071 17.233  1.00 39.18 ? 217  ASP A CB  1 
ATOM   1694 C  CG  . ASP A 1 217 ? 64.229  59.446 18.446  1.00 42.44 ? 217  ASP A CG  1 
ATOM   1695 O  OD1 . ASP A 1 217 ? 63.608  58.521 19.054  1.00 43.07 ? 217  ASP A OD1 1 
ATOM   1696 O  OD2 . ASP A 1 217 ? 64.202  60.645 18.804  1.00 43.15 ? 217  ASP A OD2 1 
ATOM   1697 N  N   . LEU A 1 218 ? 68.021  57.222 16.364  1.00 34.60 ? 218  LEU A N   1 
ATOM   1698 C  CA  . LEU A 1 218 ? 68.720  56.615 15.250  1.00 33.77 ? 218  LEU A CA  1 
ATOM   1699 C  C   . LEU A 1 218 ? 69.182  55.198 15.549  1.00 33.08 ? 218  LEU A C   1 
ATOM   1700 O  O   . LEU A 1 218 ? 69.876  54.611 14.720  1.00 33.13 ? 218  LEU A O   1 
ATOM   1701 C  CB  . LEU A 1 218 ? 69.911  57.484 14.855  1.00 32.78 ? 218  LEU A CB  1 
ATOM   1702 C  CG  . LEU A 1 218 ? 69.581  58.881 14.333  1.00 32.84 ? 218  LEU A CG  1 
ATOM   1703 C  CD1 . LEU A 1 218 ? 70.894  59.554 13.968  1.00 29.97 ? 218  LEU A CD1 1 
ATOM   1704 C  CD2 . LEU A 1 218 ? 68.707  58.725 13.112  1.00 31.83 ? 218  LEU A CD2 1 
ATOM   1705 N  N   . PHE A 1 219 ? 68.811  54.664 16.722  1.00 32.17 ? 219  PHE A N   1 
ATOM   1706 C  CA  . PHE A 1 219 ? 69.084  53.258 17.086  1.00 31.02 ? 219  PHE A CA  1 
ATOM   1707 C  C   . PHE A 1 219 ? 68.082  52.736 18.135  1.00 32.12 ? 219  PHE A C   1 
ATOM   1708 O  O   . PHE A 1 219 ? 67.406  53.512 18.816  1.00 31.77 ? 219  PHE A O   1 
ATOM   1709 C  CB  . PHE A 1 219 ? 70.558  53.032 17.538  1.00 29.26 ? 219  PHE A CB  1 
ATOM   1710 C  CG  . PHE A 1 219 ? 70.910  53.746 18.805  1.00 29.14 ? 219  PHE A CG  1 
ATOM   1711 C  CD1 . PHE A 1 219 ? 71.164  55.120 18.795  1.00 28.85 ? 219  PHE A CD1 1 
ATOM   1712 C  CD2 . PHE A 1 219 ? 70.931  53.070 20.015  1.00 29.21 ? 219  PHE A CD2 1 
ATOM   1713 C  CE1 . PHE A 1 219 ? 71.431  55.813 19.965  1.00 29.01 ? 219  PHE A CE1 1 
ATOM   1714 C  CE2 . PHE A 1 219 ? 71.215  53.756 21.196  1.00 32.05 ? 219  PHE A CE2 1 
ATOM   1715 C  CZ  . PHE A 1 219 ? 71.476  55.137 21.166  1.00 30.03 ? 219  PHE A CZ  1 
ATOM   1716 N  N   . ARG A 1 220 ? 67.978  51.412 18.217  1.00 32.62 ? 220  ARG A N   1 
ATOM   1717 C  CA  . ARG A 1 220 ? 67.039  50.745 19.087  1.00 34.05 ? 220  ARG A CA  1 
ATOM   1718 C  C   . ARG A 1 220 ? 67.674  50.402 20.452  1.00 33.97 ? 220  ARG A C   1 
ATOM   1719 O  O   . ARG A 1 220 ? 67.033  50.657 21.497  1.00 34.80 ? 220  ARG A O   1 
ATOM   1720 C  CB  . ARG A 1 220 ? 66.477  49.489 18.390  1.00 35.53 ? 220  ARG A CB  1 
ATOM   1721 C  CG  . ARG A 1 220 ? 65.550  48.599 19.236  1.00 38.03 ? 220  ARG A CG  1 
ATOM   1722 C  CD  . ARG A 1 220 ? 64.225  49.332 19.480  1.00 43.60 ? 220  ARG A CD  1 
ATOM   1723 N  NE  . ARG A 1 220 ? 63.234  48.516 20.171  1.00 46.24 ? 220  ARG A NE  1 
ATOM   1724 C  CZ  . ARG A 1 220 ? 62.393  47.674 19.568  1.00 47.94 ? 220  ARG A CZ  1 
ATOM   1725 N  NH1 . ARG A 1 220 ? 62.438  47.519 18.247  1.00 45.59 ? 220  ARG A NH1 1 
ATOM   1726 N  NH2 . ARG A 1 220 ? 61.509  46.983 20.297  1.00 48.68 ? 220  ARG A NH2 1 
ATOM   1727 N  N   . ARG A 1 221 ? 68.909  49.862 20.425  1.00 31.38 ? 221  ARG A N   1 
ATOM   1728 C  CA  . ARG A 1 221 ? 69.538  49.152 21.566  1.00 31.21 ? 221  ARG A CA  1 
ATOM   1729 C  C   . ARG A 1 221 ? 71.044  49.287 21.471  1.00 29.32 ? 221  ARG A C   1 
ATOM   1730 O  O   . ARG A 1 221 ? 71.562  49.526 20.386  1.00 27.54 ? 221  ARG A O   1 
ATOM   1731 C  CB  . ARG A 1 221 ? 69.245  47.647 21.478  1.00 31.64 ? 221  ARG A CB  1 
ATOM   1732 C  CG  . ARG A 1 221 ? 67.944  47.281 21.988  1.00 37.69 ? 221  ARG A CG  1 
ATOM   1733 C  CD  . ARG A 1 221 ? 67.805  45.795 22.068  1.00 41.89 ? 221  ARG A CD  1 
ATOM   1734 N  NE  . ARG A 1 221 ? 67.207  45.288 20.853  1.00 41.41 ? 221  ARG A NE  1 
ATOM   1735 C  CZ  . ARG A 1 221 ? 65.918  45.083 20.663  1.00 38.06 ? 221  ARG A CZ  1 
ATOM   1736 N  NH1 . ARG A 1 221 ? 65.010  45.329 21.600  1.00 38.47 ? 221  ARG A NH1 1 
ATOM   1737 N  NH2 . ARG A 1 221 ? 65.555  44.623 19.502  1.00 38.83 ? 221  ARG A NH2 1 
ATOM   1738 N  N   . ALA A 1 222 ? 71.750  49.038 22.574  1.00 28.95 ? 222  ALA A N   1 
ATOM   1739 C  CA  . ALA A 1 222 ? 73.196  49.302 22.633  1.00 27.84 ? 222  ALA A CA  1 
ATOM   1740 C  C   . ALA A 1 222 ? 74.034  48.242 23.358  1.00 27.66 ? 222  ALA A C   1 
ATOM   1741 O  O   . ALA A 1 222 ? 73.593  47.652 24.376  1.00 28.55 ? 222  ALA A O   1 
ATOM   1742 C  CB  . ALA A 1 222 ? 73.445  50.651 23.261  1.00 26.98 ? 222  ALA A CB  1 
ATOM   1743 N  N   . ILE A 1 223 ? 75.247  48.041 22.831  1.00 26.58 ? 223  ILE A N   1 
ATOM   1744 C  CA  . ILE A 1 223 ? 76.278  47.211 23.444  1.00 26.94 ? 223  ILE A CA  1 
ATOM   1745 C  C   . ILE A 1 223 ? 77.547  48.014 23.623  1.00 26.93 ? 223  ILE A C   1 
ATOM   1746 O  O   . ILE A 1 223 ? 77.986  48.683 22.688  1.00 27.34 ? 223  ILE A O   1 
ATOM   1747 C  CB  . ILE A 1 223 ? 76.552  45.956 22.600  1.00 27.56 ? 223  ILE A CB  1 
ATOM   1748 C  CG1 . ILE A 1 223 ? 75.256  45.173 22.415  1.00 26.67 ? 223  ILE A CG1 1 
ATOM   1749 C  CG2 . ILE A 1 223 ? 77.685  45.067 23.225  1.00 27.39 ? 223  ILE A CG2 1 
ATOM   1750 C  CD1 . ILE A 1 223 ? 75.451  43.891 21.700  1.00 27.47 ? 223  ILE A CD1 1 
ATOM   1751 N  N   . LEU A 1 224 ? 78.099  47.996 24.836  1.00 27.05 ? 224  LEU A N   1 
ATOM   1752 C  CA  . LEU A 1 224 ? 79.305  48.738 25.150  1.00 26.01 ? 224  LEU A CA  1 
ATOM   1753 C  C   . LEU A 1 224 ? 80.369  47.788 25.630  1.00 26.11 ? 224  LEU A C   1 
ATOM   1754 O  O   . LEU A 1 224 ? 80.170  47.132 26.655  1.00 26.05 ? 224  LEU A O   1 
ATOM   1755 C  CB  . LEU A 1 224 ? 79.018  49.753 26.271  1.00 26.97 ? 224  LEU A CB  1 
ATOM   1756 C  CG  . LEU A 1 224 ? 78.013  50.893 25.978  1.00 28.54 ? 224  LEU A CG  1 
ATOM   1757 C  CD1 . LEU A 1 224 ? 76.562  50.398 26.044  1.00 26.78 ? 224  LEU A CD1 1 
ATOM   1758 C  CD2 . LEU A 1 224 ? 78.222  52.030 26.952  1.00 23.72 ? 224  LEU A CD2 1 
ATOM   1759 N  N   . GLN A 1 225 ? 81.498  47.712 24.917  1.00 25.03 ? 225  GLN A N   1 
ATOM   1760 C  CA  . GLN A 1 225 ? 82.562  46.770 25.295  1.00 24.95 ? 225  GLN A CA  1 
ATOM   1761 C  C   . GLN A 1 225 ? 83.741  47.533 25.840  1.00 24.18 ? 225  GLN A C   1 
ATOM   1762 O  O   . GLN A 1 225 ? 84.341  48.334 25.103  1.00 22.72 ? 225  GLN A O   1 
ATOM   1763 C  CB  . GLN A 1 225 ? 83.005  45.867 24.109  1.00 26.10 ? 225  GLN A CB  1 
ATOM   1764 C  CG  . GLN A 1 225 ? 81.948  44.849 23.651  1.00 24.80 ? 225  GLN A CG  1 
ATOM   1765 C  CD  . GLN A 1 225 ? 82.096  44.388 22.199  1.00 27.05 ? 225  GLN A CD  1 
ATOM   1766 O  OE1 . GLN A 1 225 ? 81.089  44.197 21.498  1.00 28.18 ? 225  GLN A OE1 1 
ATOM   1767 N  NE2 . GLN A 1 225 ? 83.338  44.176 21.745  1.00 23.60 ? 225  GLN A NE2 1 
ATOM   1768 N  N   . SER A 1 226 ? 84.070  47.289 27.116  1.00 23.46 ? 226  SER A N   1 
ATOM   1769 C  CA  . SER A 1 226 ? 85.247  47.917 27.732  1.00 23.50 ? 226  SER A CA  1 
ATOM   1770 C  C   . SER A 1 226 ? 85.280  49.450 27.540  1.00 22.54 ? 226  SER A C   1 
ATOM   1771 O  O   . SER A 1 226 ? 86.340  50.029 27.246  1.00 21.96 ? 226  SER A O   1 
ATOM   1772 C  CB  . SER A 1 226 ? 86.543  47.361 27.126  1.00 22.14 ? 226  SER A CB  1 
ATOM   1773 O  OG  . SER A 1 226 ? 86.549  45.963 27.076  1.00 23.70 ? 226  SER A OG  1 
ATOM   1774 N  N   . GLY A 1 227 ? 84.137  50.100 27.654  1.00 22.12 ? 227  GLY A N   1 
ATOM   1775 C  CA  . GLY A 1 227 ? 84.101  51.558 27.491  1.00 22.79 ? 227  GLY A CA  1 
ATOM   1776 C  C   . GLY A 1 227 ? 82.744  52.035 27.931  1.00 23.86 ? 227  GLY A C   1 
ATOM   1777 O  O   . GLY A 1 227 ? 81.762  51.298 27.794  1.00 24.32 ? 227  GLY A O   1 
ATOM   1778 N  N   . SER A 1 228 ? 82.703  53.214 28.552  1.00 23.93 ? 228  SER A N   1 
ATOM   1779 C  CA  . SER A 1 228 ? 81.461  53.872 28.863  1.00 24.32 ? 228  SER A CA  1 
ATOM   1780 C  C   . SER A 1 228 ? 81.709  55.398 28.698  1.00 25.14 ? 228  SER A C   1 
ATOM   1781 O  O   . SER A 1 228 ? 82.855  55.816 28.634  1.00 24.78 ? 228  SER A O   1 
ATOM   1782 C  CB  . SER A 1 228 ? 80.976  53.491 30.273  1.00 25.69 ? 228  SER A CB  1 
ATOM   1783 O  OG  . SER A 1 228 ? 81.914  53.850 31.273  1.00 24.85 ? 228  SER A OG  1 
ATOM   1784 N  N   . PRO A 1 229 ? 80.641  56.212 28.601  1.00 26.06 ? 229  PRO A N   1 
ATOM   1785 C  CA  . PRO A 1 229 ? 80.770  57.637 28.200  1.00 26.40 ? 229  PRO A CA  1 
ATOM   1786 C  C   . PRO A 1 229 ? 81.496  58.508 29.223  1.00 26.18 ? 229  PRO A C   1 
ATOM   1787 O  O   . PRO A 1 229 ? 82.195  59.441 28.853  1.00 25.55 ? 229  PRO A O   1 
ATOM   1788 C  CB  . PRO A 1 229 ? 79.304  58.100 28.033  1.00 26.96 ? 229  PRO A CB  1 
ATOM   1789 C  CG  . PRO A 1 229 ? 78.509  57.175 28.888  1.00 29.01 ? 229  PRO A CG  1 
ATOM   1790 C  CD  . PRO A 1 229 ? 79.228  55.819 28.761  1.00 27.20 ? 229  PRO A CD  1 
ATOM   1791 N  N   . ASN A 1 230 ? 81.348  58.145 30.488  1.00 26.86 ? 230  ASN A N   1 
ATOM   1792 C  CA  . ASN A 1 230 ? 81.968  58.792 31.619  1.00 27.44 ? 230  ASN A CA  1 
ATOM   1793 C  C   . ASN A 1 230 ? 83.438  58.391 31.897  1.00 27.55 ? 230  ASN A C   1 
ATOM   1794 O  O   . ASN A 1 230 ? 84.032  58.839 32.877  1.00 28.26 ? 230  ASN A O   1 
ATOM   1795 C  CB  . ASN A 1 230 ? 81.085  58.534 32.867  1.00 28.20 ? 230  ASN A CB  1 
ATOM   1796 C  CG  . ASN A 1 230 ? 80.975  57.016 33.216  1.00 28.69 ? 230  ASN A CG  1 
ATOM   1797 O  OD1 . ASN A 1 230 ? 80.721  56.180 32.358  1.00 26.65 ? 230  ASN A OD1 1 
ATOM   1798 N  ND2 . ASN A 1 230 ? 81.218  56.682 34.474  1.00 27.26 ? 230  ASN A ND2 1 
ATOM   1799 N  N   . CYS A 1 231 ? 84.050  57.554 31.065  1.00 27.38 ? 231  CYS A N   1 
ATOM   1800 C  CA  . CYS A 1 231 ? 85.478  57.261 31.276  1.00 27.94 ? 231  CYS A CA  1 
ATOM   1801 C  C   . CYS A 1 231 ? 86.291  58.574 31.409  1.00 29.09 ? 231  CYS A C   1 
ATOM   1802 O  O   . CYS A 1 231 ? 86.043  59.531 30.679  1.00 29.65 ? 231  CYS A O   1 
ATOM   1803 C  CB  . CYS A 1 231 ? 86.057  56.381 30.164  1.00 27.15 ? 231  CYS A CB  1 
ATOM   1804 S  SG  . CYS A 1 231 ? 85.472  54.637 30.277  1.00 24.63 ? 231  CYS A SG  1 
ATOM   1805 N  N   . PRO A 1 232 ? 87.263  58.609 32.340  1.00 29.86 ? 232  PRO A N   1 
ATOM   1806 C  CA  . PRO A 1 232 ? 88.042  59.816 32.601  1.00 30.35 ? 232  PRO A CA  1 
ATOM   1807 C  C   . PRO A 1 232 ? 88.856  60.259 31.396  1.00 29.01 ? 232  PRO A C   1 
ATOM   1808 O  O   . PRO A 1 232 ? 89.239  61.416 31.306  1.00 29.50 ? 232  PRO A O   1 
ATOM   1809 C  CB  . PRO A 1 232 ? 88.992  59.376 33.741  1.00 32.18 ? 232  PRO A CB  1 
ATOM   1810 C  CG  . PRO A 1 232 ? 89.112  57.894 33.561  1.00 31.39 ? 232  PRO A CG  1 
ATOM   1811 C  CD  . PRO A 1 232 ? 87.736  57.463 33.144  1.00 29.96 ? 232  PRO A CD  1 
ATOM   1812 N  N   . TRP A 1 233 ? 89.146  59.347 30.480  1.00 26.75 ? 233  TRP A N   1 
ATOM   1813 C  CA  . TRP A 1 233 ? 89.903  59.727 29.295  1.00 25.98 ? 233  TRP A CA  1 
ATOM   1814 C  C   . TRP A 1 233 ? 88.978  60.084 28.119  1.00 25.53 ? 233  TRP A C   1 
ATOM   1815 O  O   . TRP A 1 233 ? 89.463  60.461 27.053  1.00 24.30 ? 233  TRP A O   1 
ATOM   1816 C  CB  . TRP A 1 233 ? 90.805  58.583 28.872  1.00 24.90 ? 233  TRP A CB  1 
ATOM   1817 C  CG  . TRP A 1 233 ? 90.075  57.275 28.817  1.00 24.94 ? 233  TRP A CG  1 
ATOM   1818 C  CD1 . TRP A 1 233 ? 89.984  56.372 29.823  1.00 26.20 ? 233  TRP A CD1 1 
ATOM   1819 C  CD2 . TRP A 1 233 ? 89.264  56.765 27.742  1.00 22.56 ? 233  TRP A CD2 1 
ATOM   1820 N  NE1 . TRP A 1 233 ? 89.214  55.306 29.436  1.00 27.61 ? 233  TRP A NE1 1 
ATOM   1821 C  CE2 . TRP A 1 233 ? 88.768  55.508 28.160  1.00 22.91 ? 233  TRP A CE2 1 
ATOM   1822 C  CE3 . TRP A 1 233 ? 88.968  57.212 26.441  1.00 22.32 ? 233  TRP A CE3 1 
ATOM   1823 C  CZ2 . TRP A 1 233 ? 87.964  54.687 27.343  1.00 20.42 ? 233  TRP A CZ2 1 
ATOM   1824 C  CZ3 . TRP A 1 233 ? 88.173  56.388 25.608  1.00 22.50 ? 233  TRP A CZ3 1 
ATOM   1825 C  CH2 . TRP A 1 233 ? 87.658  55.143 26.088  1.00 22.11 ? 233  TRP A CH2 1 
ATOM   1826 N  N   . ALA A 1 234 ? 87.662  59.928 28.306  1.00 25.07 ? 234  ALA A N   1 
ATOM   1827 C  CA  . ALA A 1 234 ? 86.749  59.967 27.161  1.00 24.32 ? 234  ALA A CA  1 
ATOM   1828 C  C   . ALA A 1 234 ? 86.153  61.341 26.827  1.00 24.94 ? 234  ALA A C   1 
ATOM   1829 O  O   . ALA A 1 234 ? 85.556  61.503 25.755  1.00 24.46 ? 234  ALA A O   1 
ATOM   1830 C  CB  . ALA A 1 234 ? 85.655  58.884 27.274  1.00 22.90 ? 234  ALA A CB  1 
ATOM   1831 N  N   . SER A 1 235 ? 86.330  62.326 27.716  1.00 26.30 ? 235  SER A N   1 
ATOM   1832 C  CA  . SER A 1 235 ? 85.867  63.703 27.460  1.00 26.85 ? 235  SER A CA  1 
ATOM   1833 C  C   . SER A 1 235 ? 86.712  64.722 28.191  1.00 27.52 ? 235  SER A C   1 
ATOM   1834 O  O   . SER A 1 235 ? 87.470  64.359 29.089  1.00 27.82 ? 235  SER A O   1 
ATOM   1835 C  CB  . SER A 1 235 ? 84.377  63.887 27.792  1.00 27.39 ? 235  SER A CB  1 
ATOM   1836 O  OG  . SER A 1 235 ? 84.127  63.706 29.182  1.00 30.53 ? 235  SER A OG  1 
ATOM   1837 N  N   . VAL A 1 236 ? 86.624  65.975 27.743  1.00 27.79 ? 236  VAL A N   1 
ATOM   1838 C  CA  . VAL A 1 236 ? 87.242  67.112 28.400  1.00 29.56 ? 236  VAL A CA  1 
ATOM   1839 C  C   . VAL A 1 236 ? 86.220  68.253 28.503  1.00 30.88 ? 236  VAL A C   1 
ATOM   1840 O  O   . VAL A 1 236 ? 85.180  68.225 27.841  1.00 31.31 ? 236  VAL A O   1 
ATOM   1841 C  CB  . VAL A 1 236 ? 88.532  67.620 27.654  1.00 29.66 ? 236  VAL A CB  1 
ATOM   1842 C  CG1 . VAL A 1 236 ? 89.712  66.669 27.881  1.00 28.20 ? 236  VAL A CG1 1 
ATOM   1843 C  CG2 . VAL A 1 236 ? 88.283  67.841 26.161  1.00 28.51 ? 236  VAL A CG2 1 
ATOM   1844 N  N   . SER A 1 237 ? 86.493  69.229 29.359  1.00 32.00 ? 237  SER A N   1 
ATOM   1845 C  CA  . SER A 1 237 ? 85.663  70.430 29.442  1.00 33.58 ? 237  SER A CA  1 
ATOM   1846 C  C   . SER A 1 237 ? 85.886  71.315 28.223  1.00 33.35 ? 237  SER A C   1 
ATOM   1847 O  O   . SER A 1 237 ? 86.923  71.213 27.545  1.00 32.33 ? 237  SER A O   1 
ATOM   1848 C  CB  . SER A 1 237 ? 86.076  71.229 30.661  1.00 35.10 ? 237  SER A CB  1 
ATOM   1849 O  OG  . SER A 1 237 ? 87.393  71.713 30.456  1.00 36.78 ? 237  SER A OG  1 
ATOM   1850 N  N   . VAL A 1 238 ? 84.962  72.233 27.950  1.00 34.43 ? 238  VAL A N   1 
ATOM   1851 C  CA  . VAL A 1 238 ? 85.243  73.147 26.828  1.00 34.52 ? 238  VAL A CA  1 
ATOM   1852 C  C   . VAL A 1 238 ? 86.520  73.957 27.041  1.00 35.33 ? 238  VAL A C   1 
ATOM   1853 O  O   . VAL A 1 238 ? 87.212  74.265 26.082  1.00 35.72 ? 238  VAL A O   1 
ATOM   1854 C  CB  . VAL A 1 238 ? 84.058  74.036 26.364  1.00 36.03 ? 238  VAL A CB  1 
ATOM   1855 C  CG1 . VAL A 1 238 ? 82.851  73.197 26.054  1.00 34.30 ? 238  VAL A CG1 1 
ATOM   1856 C  CG2 . VAL A 1 238 ? 83.760  75.143 27.340  1.00 37.43 ? 238  VAL A CG2 1 
ATOM   1857 N  N   . ALA A 1 239 ? 86.837  74.285 28.290  1.00 36.04 ? 239  ALA A N   1 
ATOM   1858 C  CA  . ALA A 1 239 ? 88.031  75.061 28.578  1.00 37.44 ? 239  ALA A CA  1 
ATOM   1859 C  C   . ALA A 1 239 ? 89.327  74.266 28.307  1.00 36.14 ? 239  ALA A C   1 
ATOM   1860 O  O   . ALA A 1 239 ? 90.327  74.831 27.813  1.00 36.75 ? 239  ALA A O   1 
ATOM   1861 C  CB  . ALA A 1 239 ? 87.991  75.630 30.029  1.00 38.80 ? 239  ALA A CB  1 
ATOM   1862 N  N   . GLU A 1 240 ? 89.285  72.962 28.585  1.00 34.64 ? 240  GLU A N   1 
ATOM   1863 C  CA  . GLU A 1 240 ? 90.438  72.095 28.395  1.00 33.02 ? 240  GLU A CA  1 
ATOM   1864 C  C   . GLU A 1 240 ? 90.654  71.804 26.916  1.00 31.81 ? 240  GLU A C   1 
ATOM   1865 O  O   . GLU A 1 240 ? 91.780  71.897 26.444  1.00 31.75 ? 240  GLU A O   1 
ATOM   1866 C  CB  . GLU A 1 240 ? 90.327  70.818 29.261  1.00 32.11 ? 240  GLU A CB  1 
ATOM   1867 C  CG  . GLU A 1 240 ? 91.449  69.799 29.097  1.00 29.73 ? 240  GLU A CG  1 
ATOM   1868 C  CD  . GLU A 1 240 ? 92.848  70.316 29.436  1.00 33.80 ? 240  GLU A CD  1 
ATOM   1869 O  OE1 . GLU A 1 240 ? 93.015  71.334 30.164  1.00 37.57 ? 240  GLU A OE1 1 
ATOM   1870 O  OE2 . GLU A 1 240 ? 93.809  69.684 28.953  1.00 32.63 ? 240  GLU A OE2 1 
ATOM   1871 N  N   . GLY A 1 241 ? 89.582  71.461 26.193  1.00 31.50 ? 241  GLY A N   1 
ATOM   1872 C  CA  . GLY A 1 241 ? 89.627  71.359 24.724  1.00 30.15 ? 241  GLY A CA  1 
ATOM   1873 C  C   . GLY A 1 241 ? 90.168  72.642 24.097  1.00 32.18 ? 241  GLY A C   1 
ATOM   1874 O  O   . GLY A 1 241 ? 91.016  72.601 23.202  1.00 31.96 ? 241  GLY A O   1 
ATOM   1875 N  N   . ARG A 1 242 ? 89.703  73.795 24.581  1.00 33.79 ? 242  ARG A N   1 
ATOM   1876 C  CA  . ARG A 1 242 ? 90.207  75.092 24.081  1.00 35.52 ? 242  ARG A CA  1 
ATOM   1877 C  C   . ARG A 1 242 ? 91.715  75.218 24.324  1.00 36.23 ? 242  ARG A C   1 
ATOM   1878 O  O   . ARG A 1 242 ? 92.482  75.526 23.396  1.00 36.10 ? 242  ARG A O   1 
ATOM   1879 C  CB  . ARG A 1 242 ? 89.434  76.288 24.689  1.00 36.88 ? 242  ARG A CB  1 
ATOM   1880 C  CG  . ARG A 1 242 ? 89.975  77.682 24.290  1.00 40.92 ? 242  ARG A CG  1 
ATOM   1881 C  CD  . ARG A 1 242 ? 88.951  78.863 24.560  1.00 42.92 ? 242  ARG A CD  1 
ATOM   1882 N  NE  . ARG A 1 242 ? 87.832  78.799 23.607  1.00 45.00 ? 242  ARG A NE  1 
ATOM   1883 C  CZ  . ARG A 1 242 ? 87.838  79.335 22.384  1.00 44.11 ? 242  ARG A CZ  1 
ATOM   1884 N  NH1 . ARG A 1 242 ? 88.898  80.036 21.955  1.00 45.54 ? 242  ARG A NH1 1 
ATOM   1885 N  NH2 . ARG A 1 242 ? 86.783  79.166 21.590  1.00 42.71 ? 242  ARG A NH2 1 
ATOM   1886 N  N   . ARG A 1 243 ? 92.153  74.954 25.557  1.00 37.11 ? 243  ARG A N   1 
ATOM   1887 C  CA  . ARG A 1 243 ? 93.585  75.047 25.880  1.00 38.20 ? 243  ARG A CA  1 
ATOM   1888 C  C   . ARG A 1 243 ? 94.411  74.145 24.954  1.00 36.59 ? 243  ARG A C   1 
ATOM   1889 O  O   . ARG A 1 243 ? 95.448  74.566 24.424  1.00 37.86 ? 243  ARG A O   1 
ATOM   1890 C  CB  . ARG A 1 243 ? 93.841  74.677 27.340  1.00 39.34 ? 243  ARG A CB  1 
ATOM   1891 C  CG  . ARG A 1 243 ? 95.221  75.096 27.862  1.00 42.53 ? 243  ARG A CG  1 
ATOM   1892 C  CD  . ARG A 1 243 ? 95.620  74.380 29.179  1.00 46.34 ? 243  ARG A CD  1 
ATOM   1893 N  NE  . ARG A 1 243 ? 95.519  72.915 29.117  1.00 45.31 ? 243  ARG A NE  1 
ATOM   1894 C  CZ  . ARG A 1 243 ? 96.326  72.117 28.421  1.00 46.68 ? 243  ARG A CZ  1 
ATOM   1895 N  NH1 . ARG A 1 243 ? 97.334  72.610 27.701  1.00 48.11 ? 243  ARG A NH1 1 
ATOM   1896 N  NH2 . ARG A 1 243 ? 96.129  70.805 28.454  1.00 44.16 ? 243  ARG A NH2 1 
ATOM   1897 N  N   . ARG A 1 244 ? 93.931  72.930 24.726  1.00 33.65 ? 244  ARG A N   1 
ATOM   1898 C  CA  . ARG A 1 244 ? 94.677  71.977 23.928  1.00 32.44 ? 244  ARG A CA  1 
ATOM   1899 C  C   . ARG A 1 244 ? 94.765  72.429 22.467  1.00 32.64 ? 244  ARG A C   1 
ATOM   1900 O  O   . ARG A 1 244 ? 95.807  72.301 21.809  1.00 31.74 ? 244  ARG A O   1 
ATOM   1901 C  CB  . ARG A 1 244 ? 94.064  70.576 24.058  1.00 30.83 ? 244  ARG A CB  1 
ATOM   1902 C  CG  . ARG A 1 244 ? 94.164  70.012 25.470  1.00 31.07 ? 244  ARG A CG  1 
ATOM   1903 C  CD  . ARG A 1 244 ? 93.761  68.549 25.507  1.00 30.30 ? 244  ARG A CD  1 
ATOM   1904 N  NE  . ARG A 1 244 ? 93.700  68.033 26.881  1.00 31.87 ? 244  ARG A NE  1 
ATOM   1905 C  CZ  . ARG A 1 244 ? 93.371  66.778 27.192  1.00 31.37 ? 244  ARG A CZ  1 
ATOM   1906 N  NH1 . ARG A 1 244 ? 93.067  65.912 26.233  1.00 25.16 ? 244  ARG A NH1 1 
ATOM   1907 N  NH2 . ARG A 1 244 ? 93.344  66.387 28.461  1.00 31.61 ? 244  ARG A NH2 1 
ATOM   1908 N  N   . ALA A 1 245 ? 93.676  72.995 21.968  1.00 33.06 ? 245  ALA A N   1 
ATOM   1909 C  CA  . ALA A 1 245 ? 93.668  73.506 20.609  1.00 34.02 ? 245  ALA A CA  1 
ATOM   1910 C  C   . ALA A 1 245 ? 94.599  74.719 20.447  1.00 36.28 ? 245  ALA A C   1 
ATOM   1911 O  O   . ALA A 1 245 ? 95.229  74.906 19.402  1.00 37.69 ? 245  ALA A O   1 
ATOM   1912 C  CB  . ALA A 1 245 ? 92.234  73.818 20.182  1.00 33.70 ? 245  ALA A CB  1 
ATOM   1913 N  N   . VAL A 1 246 ? 94.710  75.547 21.469  1.00 37.34 ? 246  VAL A N   1 
ATOM   1914 C  CA  . VAL A 1 246 ? 95.591  76.711 21.342  1.00 39.46 ? 246  VAL A CA  1 
ATOM   1915 C  C   . VAL A 1 246 ? 97.039  76.186 21.406  1.00 39.69 ? 246  VAL A C   1 
ATOM   1916 O  O   . VAL A 1 246 ? 97.926  76.636 20.675  1.00 40.50 ? 246  VAL A O   1 
ATOM   1917 C  CB  . VAL A 1 246 ? 95.278  77.802 22.420  1.00 40.89 ? 246  VAL A CB  1 
ATOM   1918 C  CG1 . VAL A 1 246 ? 96.230  79.044 22.308  1.00 43.04 ? 246  VAL A CG1 1 
ATOM   1919 C  CG2 . VAL A 1 246 ? 93.810  78.265 22.312  1.00 39.70 ? 246  VAL A CG2 1 
ATOM   1920 N  N   . GLU A 1 247 ? 97.250  75.181 22.246  1.00 38.85 ? 247  GLU A N   1 
ATOM   1921 C  CA  . GLU A 1 247 ? 98.570  74.595 22.414  1.00 39.13 ? 247  GLU A CA  1 
ATOM   1922 C  C   . GLU A 1 247 ? 98.989  73.860 21.126  1.00 37.89 ? 247  GLU A C   1 
ATOM   1923 O  O   . GLU A 1 247 ? 100.170 73.888 20.754  1.00 38.41 ? 247  GLU A O   1 
ATOM   1924 C  CB  . GLU A 1 247 ? 98.578  73.687 23.649  1.00 38.91 ? 247  GLU A CB  1 
ATOM   1925 C  CG  . GLU A 1 247 ? 99.924  73.124 24.045  1.00 42.52 ? 247  GLU A CG  1 
ATOM   1926 C  CD  . GLU A 1 247 ? 100.921 74.202 24.464  1.00 49.37 ? 247  GLU A CD  1 
ATOM   1927 O  OE1 . GLU A 1 247 ? 100.495 75.325 24.831  1.00 52.57 ? 247  GLU A OE1 1 
ATOM   1928 O  OE2 . GLU A 1 247 ? 102.143 73.923 24.410  1.00 51.62 ? 247  GLU A OE2 1 
ATOM   1929 N  N   . LEU A 1 248 ? 98.022  73.247 20.433  1.00 35.32 ? 248  LEU A N   1 
ATOM   1930 C  CA  . LEU A 1 248 ? 98.283  72.663 19.111  1.00 34.74 ? 248  LEU A CA  1 
ATOM   1931 C  C   . LEU A 1 248 ? 98.799  73.695 18.113  1.00 36.24 ? 248  LEU A C   1 
ATOM   1932 O  O   . LEU A 1 248 ? 99.782  73.457 17.410  1.00 36.69 ? 248  LEU A O   1 
ATOM   1933 C  CB  . LEU A 1 248 ? 97.046  71.976 18.535  1.00 32.86 ? 248  LEU A CB  1 
ATOM   1934 C  CG  . LEU A 1 248 ? 97.395  71.133 17.291  1.00 32.75 ? 248  LEU A CG  1 
ATOM   1935 C  CD1 . LEU A 1 248 ? 98.252  69.910 17.649  1.00 32.10 ? 248  LEU A CD1 1 
ATOM   1936 C  CD2 . LEU A 1 248 ? 96.161  70.719 16.459  1.00 30.25 ? 248  LEU A CD2 1 
ATOM   1937 N  N   . GLY A 1 249 ? 98.114  74.831 18.048  1.00 37.33 ? 249  GLY A N   1 
ATOM   1938 C  CA  . GLY A 1 249 ? 98.547  75.955 17.232  1.00 39.27 ? 249  GLY A CA  1 
ATOM   1939 C  C   . GLY A 1 249 ? 99.869  76.516 17.677  1.00 41.39 ? 249  GLY A C   1 
ATOM   1940 O  O   . GLY A 1 249 ? 100.678 76.911 16.842  1.00 42.44 ? 249  GLY A O   1 
ATOM   1941 N  N   . ARG A 1 250 ? 100.088 76.580 18.993  1.00 41.97 ? 250  ARG A N   1 
ATOM   1942 C  CA  . ARG A 1 250 ? 101.353 77.089 19.507  1.00 44.08 ? 250  ARG A CA  1 
ATOM   1943 C  C   . ARG A 1 250 ? 102.497 76.242 18.978  1.00 43.92 ? 250  ARG A C   1 
ATOM   1944 O  O   . ARG A 1 250 ? 103.495 76.787 18.469  1.00 45.47 ? 250  ARG A O   1 
ATOM   1945 C  CB  . ARG A 1 250 ? 101.387 77.136 21.039  1.00 44.46 ? 250  ARG A CB  1 
ATOM   1946 C  CG  . ARG A 1 250 ? 102.610 77.893 21.583  1.00 48.37 ? 250  ARG A CG  1 
ATOM   1947 C  CD  . ARG A 1 250 ? 102.556 78.149 23.111  1.00 53.13 ? 250  ARG A CD  1 
ATOM   1948 N  NE  . ARG A 1 250 ? 101.602 79.207 23.489  1.00 55.07 ? 250  ARG A NE  1 
ATOM   1949 C  CZ  . ARG A 1 250 ? 100.362 79.005 23.945  1.00 55.47 ? 250  ARG A CZ  1 
ATOM   1950 N  NH1 . ARG A 1 250 ? 99.867  77.767 24.112  1.00 54.08 ? 250  ARG A NH1 1 
ATOM   1951 N  NH2 . ARG A 1 250 ? 99.610  80.054 24.255  1.00 56.56 ? 250  ARG A NH2 1 
ATOM   1952 N  N   . ASN A 1 251 ? 102.315 74.921 19.064  1.00 41.85 ? 251  ASN A N   1 
ATOM   1953 C  CA  . ASN A 1 251 ? 103.298 73.935 18.625  1.00 41.87 ? 251  ASN A CA  1 
ATOM   1954 C  C   . ASN A 1 251 ? 103.669 74.114 17.171  1.00 42.15 ? 251  ASN A C   1 
ATOM   1955 O  O   . ASN A 1 251 ? 104.814 73.925 16.800  1.00 43.31 ? 251  ASN A O   1 
ATOM   1956 C  CB  . ASN A 1 251 ? 102.789 72.493 18.868  1.00 40.47 ? 251  ASN A CB  1 
ATOM   1957 C  CG  . ASN A 1 251 ? 103.213 71.938 20.231  1.00 41.93 ? 251  ASN A CG  1 
ATOM   1958 O  OD1 . ASN A 1 251 ? 104.254 71.302 20.324  1.00 45.53 ? 251  ASN A OD1 1 
ATOM   1959 N  ND2 . ASN A 1 251 ? 102.418 72.189 21.292  1.00 40.09 ? 251  ASN A ND2 1 
ATOM   1960 N  N   . LEU A 1 252 ? 102.707 74.539 16.365  1.00 42.10 ? 252  LEU A N   1 
ATOM   1961 C  CA  . LEU A 1 252 ? 102.888 74.625 14.930  1.00 43.42 ? 252  LEU A CA  1 
ATOM   1962 C  C   . LEU A 1 252 ? 103.108 76.046 14.420  1.00 46.27 ? 252  LEU A C   1 
ATOM   1963 O  O   . LEU A 1 252 ? 102.914 76.313 13.223  1.00 47.63 ? 252  LEU A O   1 
ATOM   1964 C  CB  . LEU A 1 252 ? 101.686 73.993 14.236  1.00 41.94 ? 252  LEU A CB  1 
ATOM   1965 C  CG  . LEU A 1 252 ? 101.507 72.510 14.565  1.00 40.25 ? 252  LEU A CG  1 
ATOM   1966 C  CD1 . LEU A 1 252 ? 100.124 72.011 14.124  1.00 37.02 ? 252  LEU A CD1 1 
ATOM   1967 C  CD2 . LEU A 1 252 ? 102.630 71.721 13.901  1.00 40.88 ? 252  LEU A CD2 1 
ATOM   1968 N  N   . ASN A 1 253 ? 103.494 76.945 15.330  1.00 47.64 ? 253  ASN A N   1 
ATOM   1969 C  CA  . ASN A 1 253 ? 103.776 78.363 15.019  1.00 50.78 ? 253  ASN A CA  1 
ATOM   1970 C  C   . ASN A 1 253 ? 102.617 79.098 14.344  1.00 50.71 ? 253  ASN A C   1 
ATOM   1971 O  O   . ASN A 1 253 ? 102.795 79.842 13.381  1.00 52.64 ? 253  ASN A O   1 
ATOM   1972 C  CB  . ASN A 1 253 ? 105.061 78.493 14.209  1.00 52.36 ? 253  ASN A CB  1 
ATOM   1973 C  CG  . ASN A 1 253 ? 106.035 79.414 14.853  1.00 57.37 ? 253  ASN A CG  1 
ATOM   1974 O  OD1 . ASN A 1 253 ? 106.276 80.551 14.372  1.00 62.22 ? 253  ASN A OD1 1 
ATOM   1975 N  ND2 . ASN A 1 253 ? 106.618 78.956 15.972  1.00 58.52 ? 253  ASN A ND2 1 
ATOM   1976 N  N   . CYS A 1 254 ? 101.422 78.858 14.861  1.00 49.53 ? 254  CYS A N   1 
ATOM   1977 C  CA  . CYS A 1 254 ? 100.212 79.476 14.343  1.00 49.62 ? 254  CYS A CA  1 
ATOM   1978 C  C   . CYS A 1 254 ? 99.947  80.835 14.993  1.00 51.00 ? 254  CYS A C   1 
ATOM   1979 O  O   . CYS A 1 254 ? 100.382 81.102 16.128  1.00 50.81 ? 254  CYS A O   1 
ATOM   1980 C  CB  . CYS A 1 254 ? 99.000  78.547 14.539  1.00 47.59 ? 254  CYS A CB  1 
ATOM   1981 S  SG  . CYS A 1 254 ? 98.881  77.183 13.327  1.00 47.30 ? 254  CYS A SG  1 
ATOM   1982 N  N   . ASN A 1 255 ? 99.241  81.685 14.248  1.00 51.58 ? 255  ASN A N   1 
ATOM   1983 C  CA  . ASN A 1 255 ? 98.626  82.863 14.805  1.00 52.80 ? 255  ASN A CA  1 
ATOM   1984 C  C   . ASN A 1 255 ? 97.573  82.482 15.827  1.00 50.98 ? 255  ASN A C   1 
ATOM   1985 O  O   . ASN A 1 255 ? 96.657  81.738 15.506  1.00 50.25 ? 255  ASN A O   1 
ATOM   1986 C  CB  . ASN A 1 255 ? 97.972  83.673 13.691  1.00 54.21 ? 255  ASN A CB  1 
ATOM   1987 C  CG  . ASN A 1 255 ? 97.542  85.057 14.150  1.00 55.79 ? 255  ASN A CG  1 
ATOM   1988 O  OD1 . ASN A 1 255 ? 97.103  85.258 15.290  1.00 53.41 ? 255  ASN A OD1 1 
ATOM   1989 N  ND2 . ASN A 1 255 ? 97.657  86.021 13.250  1.00 58.89 ? 255  ASN A ND2 1 
ATOM   1990 N  N   . LEU A 1 256 ? 97.685  83.007 17.040  1.00 51.77 ? 256  LEU A N   1 
ATOM   1991 C  CA  . LEU A 1 256 ? 96.712  82.711 18.091  1.00 51.43 ? 256  LEU A CA  1 
ATOM   1992 C  C   . LEU A 1 256 ? 95.754  83.863 18.513  1.00 53.30 ? 256  LEU A C   1 
ATOM   1993 O  O   . LEU A 1 256 ? 94.939  83.678 19.424  1.00 52.97 ? 256  LEU A O   1 
ATOM   1994 C  CB  . LEU A 1 256 ? 97.423  82.091 19.319  1.00 51.15 ? 256  LEU A CB  1 
ATOM   1995 C  CG  . LEU A 1 256 ? 98.478  80.983 19.073  1.00 51.22 ? 256  LEU A CG  1 
ATOM   1996 C  CD1 . LEU A 1 256 ? 99.172  80.530 20.359  1.00 52.31 ? 256  LEU A CD1 1 
ATOM   1997 C  CD2 . LEU A 1 256 ? 97.898  79.760 18.359  1.00 46.01 ? 256  LEU A CD2 1 
ATOM   1998 N  N   . ASN A 1 257 ? 95.805  85.021 17.843  1.00 55.07 ? 257  ASN A N   1 
ATOM   1999 C  CA  . ASN A 1 257 ? 94.908  86.156 18.197  1.00 57.01 ? 257  ASN A CA  1 
ATOM   2000 C  C   . ASN A 1 257 ? 93.405  85.953 18.157  1.00 56.42 ? 257  ASN A C   1 
ATOM   2001 O  O   . ASN A 1 257 ? 92.656  86.709 18.777  1.00 57.88 ? 257  ASN A O   1 
ATOM   2002 C  CB  . ASN A 1 257 ? 95.266  87.392 17.398  1.00 59.41 ? 257  ASN A CB  1 
ATOM   2003 C  CG  . ASN A 1 257 ? 96.686  87.743 17.579  1.00 60.22 ? 257  ASN A CG  1 
ATOM   2004 O  OD1 . ASN A 1 257 ? 97.258  87.452 18.635  1.00 59.52 ? 257  ASN A OD1 1 
ATOM   2005 N  ND2 . ASN A 1 257 ? 97.301  88.310 16.552  1.00 60.40 ? 257  ASN A ND2 1 
ATOM   2006 N  N   . SER A 1 258 ? 92.969  84.920 17.451  1.00 54.69 ? 258  SER A N   1 
ATOM   2007 C  CA  . SER A 1 258 ? 91.552  84.643 17.322  1.00 53.76 ? 258  SER A CA  1 
ATOM   2008 C  C   . SER A 1 258 ? 91.345  83.194 16.944  1.00 50.59 ? 258  SER A C   1 
ATOM   2009 O  O   . SER A 1 258 ? 92.142  82.626 16.208  1.00 49.68 ? 258  SER A O   1 
ATOM   2010 C  CB  . SER A 1 258 ? 90.913  85.583 16.275  1.00 55.49 ? 258  SER A CB  1 
ATOM   2011 O  OG  . SER A 1 258 ? 91.467  85.413 14.976  1.00 54.84 ? 258  SER A OG  1 
ATOM   2012 N  N   . ASP A 1 259 ? 90.272  82.606 17.460  1.00 49.72 ? 259  ASP A N   1 
ATOM   2013 C  CA  . ASP A 1 259 ? 89.795  81.285 17.024  1.00 47.60 ? 259  ASP A CA  1 
ATOM   2014 C  C   . ASP A 1 259 ? 89.878  81.140 15.515  1.00 47.80 ? 259  ASP A C   1 
ATOM   2015 O  O   . ASP A 1 259 ? 90.418  80.169 14.991  1.00 46.73 ? 259  ASP A O   1 
ATOM   2016 C  CB  . ASP A 1 259 ? 88.346  81.110 17.435  1.00 46.86 ? 259  ASP A CB  1 
ATOM   2017 C  CG  . ASP A 1 259 ? 88.188  80.825 18.904  1.00 48.22 ? 259  ASP A CG  1 
ATOM   2018 O  OD1 . ASP A 1 259 ? 89.206  80.805 19.653  1.00 48.91 ? 259  ASP A OD1 1 
ATOM   2019 O  OD2 . ASP A 1 259 ? 87.026  80.610 19.312  1.00 49.17 ? 259  ASP A OD2 1 
ATOM   2020 N  N   . GLU A 1 260 ? 89.348  82.133 14.820  1.00 49.46 ? 260  GLU A N   1 
ATOM   2021 C  CA  . GLU A 1 260 ? 89.336  82.157 13.371  1.00 50.17 ? 260  GLU A CA  1 
ATOM   2022 C  C   . GLU A 1 260 ? 90.750  82.125 12.715  1.00 50.09 ? 260  GLU A C   1 
ATOM   2023 O  O   . GLU A 1 260 ? 90.954  81.448 11.697  1.00 49.61 ? 260  GLU A O   1 
ATOM   2024 C  CB  . GLU A 1 260 ? 88.529  83.381 12.956  1.00 52.99 ? 260  GLU A CB  1 
ATOM   2025 C  CG  . GLU A 1 260 ? 88.687  83.821 11.549  1.00 56.87 ? 260  GLU A CG  1 
ATOM   2026 C  CD  . GLU A 1 260 ? 87.447  83.577 10.724  0.80 59.82 ? 260  GLU A CD  1 
ATOM   2027 O  OE1 . GLU A 1 260 ? 86.940  82.427 10.733  0.80 57.02 ? 260  GLU A OE1 1 
ATOM   2028 O  OE2 . GLU A 1 260 ? 87.008  84.535 10.031  0.80 64.94 ? 260  GLU A OE2 1 
ATOM   2029 N  N   . GLU A 1 261 ? 91.714  82.853 13.285  1.00 50.35 ? 261  GLU A N   1 
ATOM   2030 C  CA  . GLU A 1 261 ? 93.088  82.849 12.781  1.00 49.96 ? 261  GLU A CA  1 
ATOM   2031 C  C   . GLU A 1 261 ? 93.789  81.521 13.086  1.00 47.13 ? 261  GLU A C   1 
ATOM   2032 O  O   . GLU A 1 261 ? 94.529  80.992 12.257  1.00 46.55 ? 261  GLU A O   1 
ATOM   2033 C  CB  . GLU A 1 261 ? 93.885  84.024 13.360  1.00 51.91 ? 261  GLU A CB  1 
ATOM   2034 C  CG  . GLU A 1 261 ? 93.835  85.268 12.498  1.00 56.91 ? 261  GLU A CG  1 
ATOM   2035 C  CD  . GLU A 1 261 ? 94.130  86.569 13.255  1.00 62.26 ? 261  GLU A CD  1 
ATOM   2036 O  OE1 . GLU A 1 261 ? 93.503  86.822 14.316  1.00 64.00 ? 261  GLU A OE1 1 
ATOM   2037 O  OE2 . GLU A 1 261 ? 94.983  87.352 12.769  1.00 64.47 ? 261  GLU A OE2 1 
ATOM   2038 N  N   . LEU A 1 262 ? 93.546  80.991 14.280  1.00 44.95 ? 262  LEU A N   1 
ATOM   2039 C  CA  . LEU A 1 262 ? 94.130  79.728 14.706  1.00 42.59 ? 262  LEU A CA  1 
ATOM   2040 C  C   . LEU A 1 262 ? 93.643  78.623 13.791  1.00 41.16 ? 262  LEU A C   1 
ATOM   2041 O  O   . LEU A 1 262 ? 94.440  77.845 13.256  1.00 39.55 ? 262  LEU A O   1 
ATOM   2042 C  CB  . LEU A 1 262 ? 93.751  79.448 16.154  1.00 41.11 ? 262  LEU A CB  1 
ATOM   2043 C  CG  . LEU A 1 262 ? 94.003  78.065 16.766  1.00 38.92 ? 262  LEU A CG  1 
ATOM   2044 C  CD1 . LEU A 1 262 ? 95.462  77.603 16.544  1.00 40.15 ? 262  LEU A CD1 1 
ATOM   2045 C  CD2 . LEU A 1 262 ? 93.659  78.075 18.277  1.00 35.18 ? 262  LEU A CD2 1 
ATOM   2046 N  N   . ILE A 1 263 ? 92.329  78.610 13.583  1.00 41.27 ? 263  ILE A N   1 
ATOM   2047 C  CA  . ILE A 1 263 ? 91.669  77.600 12.784  1.00 40.84 ? 263  ILE A CA  1 
ATOM   2048 C  C   . ILE A 1 263 ? 92.139  77.603 11.327  1.00 41.57 ? 263  ILE A C   1 
ATOM   2049 O  O   . ILE A 1 263 ? 92.369  76.533 10.760  1.00 39.68 ? 263  ILE A O   1 
ATOM   2050 C  CB  . ILE A 1 263 ? 90.129  77.717 12.896  1.00 40.81 ? 263  ILE A CB  1 
ATOM   2051 C  CG1 . ILE A 1 263 ? 89.683  77.174 14.246  1.00 40.86 ? 263  ILE A CG1 1 
ATOM   2052 C  CG2 . ILE A 1 263 ? 89.437  76.963 11.778  1.00 39.95 ? 263  ILE A CG2 1 
ATOM   2053 C  CD1 . ILE A 1 263 ? 88.279  77.565 14.631  1.00 41.13 ? 263  ILE A CD1 1 
ATOM   2054 N  N   . HIS A 1 264 ? 92.320  78.788 10.744  1.00 43.63 ? 264  HIS A N   1 
ATOM   2055 C  CA  . HIS A 1 264 ? 92.804  78.889 9.370   1.00 45.44 ? 264  HIS A CA  1 
ATOM   2056 C  C   . HIS A 1 264 ? 94.265  78.535 9.190   1.00 45.86 ? 264  HIS A C   1 
ATOM   2057 O  O   . HIS A 1 264 ? 94.650  78.054 8.130   1.00 46.04 ? 264  HIS A O   1 
ATOM   2058 C  CB  . HIS A 1 264 ? 92.591  80.292 8.798   1.00 48.84 ? 264  HIS A CB  1 
ATOM   2059 C  CG  . HIS A 1 264 ? 91.157  80.649 8.610   1.00 50.95 ? 264  HIS A CG  1 
ATOM   2060 N  ND1 . HIS A 1 264 ? 90.497  81.520 9.447   1.00 56.24 ? 264  HIS A ND1 1 
ATOM   2061 C  CD2 . HIS A 1 264 ? 90.245  80.236 7.699   1.00 52.95 ? 264  HIS A CD2 1 
ATOM   2062 C  CE1 . HIS A 1 264 ? 89.247  81.651 9.046   1.00 55.10 ? 264  HIS A CE1 1 
ATOM   2063 N  NE2 . HIS A 1 264 ? 89.063  80.875 7.995   1.00 53.40 ? 264  HIS A NE2 1 
ATOM   2064 N  N   . CYS A 1 265 ? 95.087  78.831 10.189  1.00 46.93 ? 265  CYS A N   1 
ATOM   2065 C  CA  . CYS A 1 265 ? 96.474  78.387 10.180  1.00 48.46 ? 265  CYS A CA  1 
ATOM   2066 C  C   . CYS A 1 265 ? 96.535  76.840 10.177  1.00 46.05 ? 265  CYS A C   1 
ATOM   2067 O  O   . CYS A 1 265 ? 97.230  76.224 9.350   1.00 45.78 ? 265  CYS A O   1 
ATOM   2068 C  CB  . CYS A 1 265 ? 97.246  78.979 11.376  1.00 49.59 ? 265  CYS A CB  1 
ATOM   2069 S  SG  . CYS A 1 265 ? 98.957  78.301 11.597  1.00 53.40 ? 265  CYS A SG  1 
ATOM   2070 N  N   . LEU A 1 266 ? 95.774  76.230 11.083  1.00 44.67 ? 266  LEU A N   1 
ATOM   2071 C  CA  . LEU A 1 266 ? 95.770  74.785 11.266  1.00 42.82 ? 266  LEU A CA  1 
ATOM   2072 C  C   . LEU A 1 266 ? 95.192  74.023 10.075  1.00 42.70 ? 266  LEU A C   1 
ATOM   2073 O  O   . LEU A 1 266 ? 95.490  72.853 9.874   1.00 41.41 ? 266  LEU A O   1 
ATOM   2074 C  CB  . LEU A 1 266 ? 94.969  74.441 12.507  1.00 41.59 ? 266  LEU A CB  1 
ATOM   2075 C  CG  . LEU A 1 266 ? 95.556  74.712 13.889  1.00 41.49 ? 266  LEU A CG  1 
ATOM   2076 C  CD1 . LEU A 1 266 ? 94.508  74.313 14.885  1.00 37.97 ? 266  LEU A CD1 1 
ATOM   2077 C  CD2 . LEU A 1 266 ? 96.846  73.924 14.123  1.00 39.27 ? 266  LEU A CD2 1 
ATOM   2078 N  N   . ARG A 1 267 ? 94.348  74.692 9.293   1.00 44.36 ? 267  ARG A N   1 
ATOM   2079 C  CA  . ARG A 1 267 ? 93.786  74.098 8.079   1.00 44.09 ? 267  ARG A CA  1 
ATOM   2080 C  C   . ARG A 1 267 ? 94.762  74.076 6.922   1.00 45.71 ? 267  ARG A C   1 
ATOM   2081 O  O   . ARG A 1 267 ? 94.582  73.266 6.013   1.00 45.96 ? 267  ARG A O   1 
ATOM   2082 C  CB  . ARG A 1 267 ? 92.595  74.891 7.605   1.00 44.67 ? 267  ARG A CB  1 
ATOM   2083 C  CG  . ARG A 1 267 ? 91.350  74.626 8.341   1.00 42.73 ? 267  ARG A CG  1 
ATOM   2084 C  CD  . ARG A 1 267 ? 90.262  75.143 7.472   1.00 45.28 ? 267  ARG A CD  1 
ATOM   2085 N  NE  . ARG A 1 267 ? 89.001  74.962 8.134   1.00 45.79 ? 267  ARG A NE  1 
ATOM   2086 C  CZ  . ARG A 1 267 ? 88.115  75.929 8.308   1.00 46.74 ? 267  ARG A CZ  1 
ATOM   2087 N  NH1 . ARG A 1 267 ? 88.345  77.140 7.836   1.00 44.32 ? 267  ARG A NH1 1 
ATOM   2088 N  NH2 . ARG A 1 267 ? 86.985  75.644 8.945   1.00 48.63 ? 267  ARG A NH2 1 
ATOM   2089 N  N   . GLU A 1 268 ? 95.750  74.981 6.931   1.00 46.37 ? 268  GLU A N   1 
ATOM   2090 C  CA  . GLU A 1 268 ? 96.815  74.975 5.930   1.00 47.82 ? 268  GLU A CA  1 
ATOM   2091 C  C   . GLU A 1 268 ? 97.821  73.859 6.166   1.00 46.40 ? 268  GLU A C   1 
ATOM   2092 O  O   . GLU A 1 268 ? 98.551  73.470 5.260   1.00 47.50 ? 268  GLU A O   1 
ATOM   2093 C  CB  . GLU A 1 268 ? 97.591  76.308 5.908   1.00 50.03 ? 268  GLU A CB  1 
ATOM   2094 C  CG  . GLU A 1 268 ? 96.777  77.557 5.578   1.00 53.62 ? 268  GLU A CG  1 
ATOM   2095 C  CD  . GLU A 1 268 ? 96.440  77.707 4.090   1.00 59.03 ? 268  GLU A CD  1 
ATOM   2096 O  OE1 . GLU A 1 268 ? 95.748  76.815 3.535   1.00 55.80 ? 268  GLU A OE1 1 
ATOM   2097 O  OE2 . GLU A 1 268 ? 96.844  78.747 3.485   1.00 62.12 ? 268  GLU A OE2 1 
ATOM   2098 N  N   . LYS A 1 269 ? 97.913  73.387 7.398   1.00 44.63 ? 269  LYS A N   1 
ATOM   2099 C  CA  . LYS A 1 269 ? 98.925  72.403 7.741   1.00 43.71 ? 269  LYS A CA  1 
ATOM   2100 C  C   . LYS A 1 269 ? 98.614  71.082 7.059   1.00 42.19 ? 269  LYS A C   1 
ATOM   2101 O  O   . LYS A 1 269 ? 97.441  70.714 6.927   1.00 40.71 ? 269  LYS A O   1 
ATOM   2102 C  CB  . LYS A 1 269 ? 98.983  72.201 9.266   1.00 42.56 ? 269  LYS A CB  1 
ATOM   2103 C  CG  . LYS A 1 269 ? 99.309  73.457 10.072  1.00 43.90 ? 269  LYS A CG  1 
ATOM   2104 C  CD  . LYS A 1 269 ? 100.735 73.981 9.806   1.00 45.03 ? 269  LYS A CD  1 
ATOM   2105 C  CE  . LYS A 1 269 ? 100.947 75.308 10.472  1.00 47.28 ? 269  LYS A CE  1 
ATOM   2106 N  NZ  . LYS A 1 269 ? 102.280 75.929 10.109  1.00 49.34 ? 269  LYS A NZ  1 
ATOM   2107 N  N   . LYS A 1 270 ? 99.662  70.396 6.597   1.00 42.39 ? 270  LYS A N   1 
ATOM   2108 C  CA  A LYS A 1 270 ? 99.583  68.992 6.166   0.50 41.12 ? 270  LYS A CA  1 
ATOM   2109 C  CA  B LYS A 1 270 ? 99.480  69.022 6.149   0.50 41.05 ? 270  LYS A CA  1 
ATOM   2110 C  C   . LYS A 1 270 ? 99.102  68.141 7.336   1.00 38.95 ? 270  LYS A C   1 
ATOM   2111 O  O   . LYS A 1 270 ? 99.500  68.408 8.470   1.00 38.10 ? 270  LYS A O   1 
ATOM   2112 C  CB  A LYS A 1 270 ? 100.971 68.474 5.764   0.50 42.29 ? 270  LYS A CB  1 
ATOM   2113 C  CB  B LYS A 1 270 ? 100.708 68.494 5.394   0.50 42.41 ? 270  LYS A CB  1 
ATOM   2114 C  CG  A LYS A 1 270 ? 101.561 69.023 4.470   0.50 44.45 ? 270  LYS A CG  1 
ATOM   2115 C  CG  B LYS A 1 270 ? 100.536 68.537 3.873   0.50 43.53 ? 270  LYS A CG  1 
ATOM   2116 C  CD  A LYS A 1 270 ? 103.024 68.607 4.333   0.50 45.44 ? 270  LYS A CD  1 
ATOM   2117 C  CD  B LYS A 1 270 ? 101.805 68.992 3.163   0.50 47.12 ? 270  LYS A CD  1 
ATOM   2118 C  CE  A LYS A 1 270 ? 103.948 69.497 5.178   0.50 47.47 ? 270  LYS A CE  1 
ATOM   2119 C  CE  B LYS A 1 270 ? 102.834 67.885 3.018   0.50 47.42 ? 270  LYS A CE  1 
ATOM   2120 N  NZ  A LYS A 1 270 ? 105.293 68.899 5.474   0.50 46.93 ? 270  LYS A NZ  1 
ATOM   2121 N  NZ  B LYS A 1 270 ? 104.074 68.403 2.350   0.50 49.17 ? 270  LYS A NZ  1 
ATOM   2122 N  N   . PRO A 1 271 ? 98.289  67.093 7.071   1.00 37.97 ? 271  PRO A N   1 
ATOM   2123 C  CA  . PRO A 1 271 ? 97.837  66.205 8.141   1.00 36.20 ? 271  PRO A CA  1 
ATOM   2124 C  C   . PRO A 1 271 ? 98.908  65.700 9.123   1.00 36.41 ? 271  PRO A C   1 
ATOM   2125 O  O   . PRO A 1 271 ? 98.686  65.720 10.349  1.00 35.36 ? 271  PRO A O   1 
ATOM   2126 C  CB  . PRO A 1 271 ? 97.257  65.014 7.375   1.00 35.85 ? 271  PRO A CB  1 
ATOM   2127 C  CG  . PRO A 1 271 ? 96.765  65.598 6.089   1.00 37.00 ? 271  PRO A CG  1 
ATOM   2128 C  CD  . PRO A 1 271 ? 97.686  66.733 5.766   1.00 37.47 ? 271  PRO A CD  1 
ATOM   2129 N  N   . GLN A 1 272 ? 100.035 65.224 8.605   1.00 36.99 ? 272  GLN A N   1 
ATOM   2130 C  CA  . GLN A 1 272 ? 101.075 64.600 9.451   1.00 37.05 ? 272  GLN A CA  1 
ATOM   2131 C  C   . GLN A 1 272 ? 101.723 65.617 10.394  1.00 37.57 ? 272  GLN A C   1 
ATOM   2132 O  O   . GLN A 1 272 ? 102.198 65.253 11.479  1.00 36.18 ? 272  GLN A O   1 
ATOM   2133 C  CB  . GLN A 1 272 ? 102.140 63.899 8.570   1.00 38.67 ? 272  GLN A CB  1 
ATOM   2134 C  CG  . GLN A 1 272 ? 103.003 62.819 9.268   1.00 39.73 ? 272  GLN A CG  1 
ATOM   2135 C  CD  . GLN A 1 272 ? 102.215 61.841 10.168  1.00 36.69 ? 272  GLN A CD  1 
ATOM   2136 O  OE1 . GLN A 1 272 ? 101.138 61.368 9.814   1.00 35.46 ? 272  GLN A OE1 1 
ATOM   2137 N  NE2 . GLN A 1 272 ? 102.768 61.559 11.340  1.00 33.64 ? 272  GLN A NE2 1 
ATOM   2138 N  N   . GLU A 1 273 ? 101.735 66.888 9.966   1.00 38.16 ? 273  GLU A N   1 
ATOM   2139 C  CA  . GLU A 1 273 ? 102.170 67.984 10.808  1.00 38.75 ? 273  GLU A CA  1 
ATOM   2140 C  C   . GLU A 1 273 ? 101.321 68.103 12.068  1.00 38.05 ? 273  GLU A C   1 
ATOM   2141 O  O   . GLU A 1 273 ? 101.855 68.339 13.130  1.00 39.08 ? 273  GLU A O   1 
ATOM   2142 C  CB  . GLU A 1 273 ? 102.130 69.299 10.051  1.00 40.15 ? 273  GLU A CB  1 
ATOM   2143 C  CG  . GLU A 1 273 ? 103.275 69.525 9.050   1.00 41.76 ? 273  GLU A CG  1 
ATOM   2144 C  CD  . GLU A 1 273 ? 103.192 70.916 8.426   1.00 43.42 ? 273  GLU A CD  1 
ATOM   2145 O  OE1 . GLU A 1 273 ? 102.275 71.139 7.604   1.00 43.99 ? 273  GLU A OE1 1 
ATOM   2146 O  OE2 . GLU A 1 273 ? 104.031 71.781 8.765   1.00 43.82 ? 273  GLU A OE2 1 
ATOM   2147 N  N   . LEU A 1 274 ? 100.005 67.968 11.950  1.00 36.61 ? 274  LEU A N   1 
ATOM   2148 C  CA  . LEU A 1 274 ? 99.114  67.887 13.122  1.00 35.84 ? 274  LEU A CA  1 
ATOM   2149 C  C   . LEU A 1 274 ? 99.420  66.646 13.985  1.00 33.91 ? 274  LEU A C   1 
ATOM   2150 O  O   . LEU A 1 274 ? 99.534  66.725 15.220  1.00 32.92 ? 274  LEU A O   1 
ATOM   2151 C  CB  . LEU A 1 274 ? 97.643  67.850 12.671  1.00 34.64 ? 274  LEU A CB  1 
ATOM   2152 C  CG  . LEU A 1 274 ? 96.930  69.214 12.443  1.00 38.39 ? 274  LEU A CG  1 
ATOM   2153 C  CD1 . LEU A 1 274 ? 97.770  70.201 11.728  1.00 38.47 ? 274  LEU A CD1 1 
ATOM   2154 C  CD2 . LEU A 1 274 ? 95.545  69.072 11.731  1.00 37.19 ? 274  LEU A CD2 1 
ATOM   2155 N  N   . ILE A 1 275 ? 99.589  65.509 13.322  1.00 32.85 ? 275  ILE A N   1 
ATOM   2156 C  CA  . ILE A 1 275 ? 99.800  64.249 14.033  1.00 31.29 ? 275  ILE A CA  1 
ATOM   2157 C  C   . ILE A 1 275 ? 101.135 64.234 14.782  1.00 31.94 ? 275  ILE A C   1 
ATOM   2158 O  O   . ILE A 1 275 ? 101.162 63.887 15.950  1.00 31.97 ? 275  ILE A O   1 
ATOM   2159 C  CB  . ILE A 1 275 ? 99.662  63.047 13.102  1.00 30.46 ? 275  ILE A CB  1 
ATOM   2160 C  CG1 . ILE A 1 275 ? 98.206  62.950 12.627  1.00 29.32 ? 275  ILE A CG1 1 
ATOM   2161 C  CG2 . ILE A 1 275 ? 100.087 61.782 13.836  1.00 29.89 ? 275  ILE A CG2 1 
ATOM   2162 C  CD1 . ILE A 1 275 ? 98.033  62.318 11.253  1.00 30.63 ? 275  ILE A CD1 1 
ATOM   2163 N  N   . ASP A 1 276 ? 102.218 64.668 14.147  1.00 33.26 ? 276  ASP A N   1 
ATOM   2164 C  CA  . ASP A 1 276 ? 103.531 64.736 14.816  1.00 35.15 ? 276  ASP A CA  1 
ATOM   2165 C  C   . ASP A 1 276 ? 103.541 65.465 16.166  1.00 34.90 ? 276  ASP A C   1 
ATOM   2166 O  O   . ASP A 1 276 ? 104.411 65.220 16.999  1.00 35.60 ? 276  ASP A O   1 
ATOM   2167 C  CB  . ASP A 1 276 ? 104.589 65.394 13.894  1.00 37.50 ? 276  ASP A CB  1 
ATOM   2168 C  CG  . ASP A 1 276 ? 104.957 64.526 12.685  1.00 39.27 ? 276  ASP A CG  1 
ATOM   2169 O  OD1 . ASP A 1 276 ? 104.684 63.306 12.658  1.00 40.40 ? 276  ASP A OD1 1 
ATOM   2170 O  OD2 . ASP A 1 276 ? 105.510 65.082 11.738  1.00 43.63 ? 276  ASP A OD2 1 
ATOM   2171 N  N   . VAL A 1 277 ? 102.623 66.408 16.374  1.00 34.30 ? 277  VAL A N   1 
ATOM   2172 C  CA  . VAL A 1 277 ? 102.686 67.209 17.600  1.00 33.67 ? 277  VAL A CA  1 
ATOM   2173 C  C   . VAL A 1 277 ? 101.505 66.959 18.509  1.00 33.86 ? 277  VAL A C   1 
ATOM   2174 O  O   . VAL A 1 277 ? 101.428 67.545 19.586  1.00 34.97 ? 277  VAL A O   1 
ATOM   2175 C  CB  . VAL A 1 277 ? 102.868 68.737 17.330  1.00 35.68 ? 277  VAL A CB  1 
ATOM   2176 C  CG1 . VAL A 1 277 ? 104.189 69.025 16.552  1.00 35.38 ? 277  VAL A CG1 1 
ATOM   2177 C  CG2 . VAL A 1 277 ? 101.668 69.346 16.643  1.00 30.51 ? 277  VAL A CG2 1 
ATOM   2178 N  N   . GLU A 1 278 ? 100.616 66.057 18.082  1.00 33.27 ? 278  GLU A N   1 
ATOM   2179 C  CA  . GLU A 1 278 ? 99.358  65.749 18.752  1.00 32.67 ? 278  GLU A CA  1 
ATOM   2180 C  C   . GLU A 1 278 ? 99.543  65.448 20.244  1.00 33.21 ? 278  GLU A C   1 
ATOM   2181 O  O   . GLU A 1 278 ? 98.807  65.973 21.079  1.00 34.06 ? 278  GLU A O   1 
ATOM   2182 C  CB  . GLU A 1 278 ? 98.673  64.577 18.034  1.00 31.81 ? 278  GLU A CB  1 
ATOM   2183 C  CG  . GLU A 1 278 ? 97.317  64.186 18.618  1.00 33.10 ? 278  GLU A CG  1 
ATOM   2184 C  CD  . GLU A 1 278 ? 96.761  62.856 18.101  1.00 33.45 ? 278  GLU A CD  1 
ATOM   2185 O  OE1 . GLU A 1 278 ? 96.930  62.539 16.914  1.00 33.11 ? 278  GLU A OE1 1 
ATOM   2186 O  OE2 . GLU A 1 278 ? 96.093  62.147 18.886  1.00 32.23 ? 278  GLU A OE2 1 
ATOM   2187 N  N   . TRP A 1 279 ? 100.517 64.612 20.588  1.00 33.19 ? 279  TRP A N   1 
ATOM   2188 C  CA  . TRP A 1 279 ? 100.692 64.177 21.981  1.00 33.07 ? 279  TRP A CA  1 
ATOM   2189 C  C   . TRP A 1 279 ? 101.236 65.282 22.874  1.00 33.67 ? 279  TRP A C   1 
ATOM   2190 O  O   . TRP A 1 279 ? 101.145 65.197 24.094  1.00 33.71 ? 279  TRP A O   1 
ATOM   2191 C  CB  . TRP A 1 279 ? 101.595 62.920 22.072  1.00 33.75 ? 279  TRP A CB  1 
ATOM   2192 C  CG  . TRP A 1 279 ? 100.984 61.740 21.339  1.00 35.21 ? 279  TRP A CG  1 
ATOM   2193 C  CD1 . TRP A 1 279 ? 101.260 61.333 20.059  1.00 36.44 ? 279  TRP A CD1 1 
ATOM   2194 C  CD2 . TRP A 1 279 ? 99.959  60.871 21.822  1.00 34.85 ? 279  TRP A CD2 1 
ATOM   2195 N  NE1 . TRP A 1 279 ? 100.485 60.254 19.731  1.00 36.15 ? 279  TRP A NE1 1 
ATOM   2196 C  CE2 . TRP A 1 279 ? 99.675  59.948 20.792  1.00 35.94 ? 279  TRP A CE2 1 
ATOM   2197 C  CE3 . TRP A 1 279 ? 99.263  60.767 23.039  1.00 36.80 ? 279  TRP A CE3 1 
ATOM   2198 C  CZ2 . TRP A 1 279 ? 98.718  58.926 20.938  1.00 35.41 ? 279  TRP A CZ2 1 
ATOM   2199 C  CZ3 . TRP A 1 279 ? 98.306  59.737 23.190  1.00 32.00 ? 279  TRP A CZ3 1 
ATOM   2200 C  CH2 . TRP A 1 279 ? 98.043  58.842 22.138  1.00 35.32 ? 279  TRP A CH2 1 
ATOM   2201 N  N   . ASN A 1 280 ? 101.787 66.328 22.270  1.00 33.72 ? 280  ASN A N   1 
ATOM   2202 C  CA  . ASN A 1 280 ? 102.385 67.413 23.048  1.00 34.67 ? 280  ASN A CA  1 
ATOM   2203 C  C   . ASN A 1 280 ? 101.404 68.273 23.817  1.00 33.95 ? 280  ASN A C   1 
ATOM   2204 O  O   . ASN A 1 280 ? 101.825 68.977 24.712  1.00 35.43 ? 280  ASN A O   1 
ATOM   2205 C  CB  . ASN A 1 280 ? 103.215 68.353 22.154  1.00 36.37 ? 280  ASN A CB  1 
ATOM   2206 C  CG  . ASN A 1 280 ? 104.341 67.634 21.408  1.00 36.72 ? 280  ASN A CG  1 
ATOM   2207 O  OD1 . ASN A 1 280 ? 104.645 66.465 21.672  1.00 36.52 ? 280  ASN A OD1 1 
ATOM   2208 N  ND2 . ASN A 1 280 ? 104.964 68.344 20.471  1.00 35.05 ? 280  ASN A ND2 1 
ATOM   2209 N  N   . VAL A 1 281 ? 100.122 68.261 23.466  1.00 32.39 ? 281  VAL A N   1 
ATOM   2210 C  CA  . VAL A 1 281 ? 99.179  69.222 24.072  1.00 33.35 ? 281  VAL A CA  1 
ATOM   2211 C  C   . VAL A 1 281 ? 98.606  68.740 25.403  1.00 33.96 ? 281  VAL A C   1 
ATOM   2212 O  O   . VAL A 1 281 ? 97.913  69.502 26.098  1.00 34.49 ? 281  VAL A O   1 
ATOM   2213 C  CB  . VAL A 1 281 ? 98.009  69.627 23.121  1.00 31.92 ? 281  VAL A CB  1 
ATOM   2214 C  CG1 . VAL A 1 281 ? 98.551  70.103 21.766  1.00 30.47 ? 281  VAL A CG1 1 
ATOM   2215 C  CG2 . VAL A 1 281 ? 97.061  68.479 22.951  1.00 33.10 ? 281  VAL A CG2 1 
ATOM   2216 N  N   . LEU A 1 282 ? 98.884  67.469 25.740  1.00 33.44 ? 282  LEU A N   1 
ATOM   2217 C  CA  . LEU A 1 282 ? 98.385  66.875 26.974  1.00 33.61 ? 282  LEU A CA  1 
ATOM   2218 C  C   . LEU A 1 282 ? 98.924  67.641 28.188  1.00 34.71 ? 282  LEU A C   1 
ATOM   2219 O  O   . LEU A 1 282 ? 100.068 68.045 28.204  1.00 36.17 ? 282  LEU A O   1 
ATOM   2220 C  CB  . LEU A 1 282 ? 98.733  65.375 27.072  1.00 31.80 ? 282  LEU A CB  1 
ATOM   2221 C  CG  . LEU A 1 282 ? 97.902  64.331 26.305  1.00 31.64 ? 282  LEU A CG  1 
ATOM   2222 C  CD1 . LEU A 1 282 ? 98.594  62.978 26.327  1.00 29.39 ? 282  LEU A CD1 1 
ATOM   2223 C  CD2 . LEU A 1 282 ? 96.452  64.161 26.852  1.00 31.58 ? 282  LEU A CD2 1 
ATOM   2224 N  N   . PRO A 1 283 ? 98.099  67.814 29.221  1.00 35.66 ? 283  PRO A N   1 
ATOM   2225 C  CA  . PRO A 1 283 ? 98.578  68.587 30.360  1.00 37.52 ? 283  PRO A CA  1 
ATOM   2226 C  C   . PRO A 1 283 ? 99.560  67.854 31.279  1.00 38.85 ? 283  PRO A C   1 
ATOM   2227 O  O   . PRO A 1 283 ? 100.189 68.514 32.072  1.00 40.30 ? 283  PRO A O   1 
ATOM   2228 C  CB  . PRO A 1 283 ? 97.287  68.912 31.131  1.00 38.00 ? 283  PRO A CB  1 
ATOM   2229 C  CG  . PRO A 1 283 ? 96.374  67.767 30.810  1.00 35.14 ? 283  PRO A CG  1 
ATOM   2230 C  CD  . PRO A 1 283 ? 96.682  67.403 29.373  1.00 34.48 ? 283  PRO A CD  1 
ATOM   2231 N  N   . PHE A 1 284 ? 99.675  66.521 31.209  1.00 38.83 ? 284  PHE A N   1 
ATOM   2232 C  CA  . PHE A 1 284 ? 100.603 65.804 32.103  1.00 40.00 ? 284  PHE A CA  1 
ATOM   2233 C  C   . PHE A 1 284 ? 101.284 64.609 31.445  1.00 39.31 ? 284  PHE A C   1 
ATOM   2234 O  O   . PHE A 1 284 ? 100.774 64.041 30.449  1.00 38.36 ? 284  PHE A O   1 
ATOM   2235 C  CB  . PHE A 1 284 ? 99.905  65.218 33.346  1.00 40.55 ? 284  PHE A CB  1 
ATOM   2236 C  CG  . PHE A 1 284 ? 98.744  65.995 33.849  1.00 43.29 ? 284  PHE A CG  1 
ATOM   2237 C  CD1 . PHE A 1 284 ? 98.938  67.116 34.670  1.00 48.46 ? 284  PHE A CD1 1 
ATOM   2238 C  CD2 . PHE A 1 284 ? 97.440  65.584 33.538  1.00 44.46 ? 284  PHE A CD2 1 
ATOM   2239 C  CE1 . PHE A 1 284 ? 97.842  67.846 35.160  1.00 50.59 ? 284  PHE A CE1 1 
ATOM   2240 C  CE2 . PHE A 1 284 ? 96.327  66.283 34.022  1.00 47.86 ? 284  PHE A CE2 1 
ATOM   2241 C  CZ  . PHE A 1 284 ? 96.528  67.430 34.838  1.00 49.64 ? 284  PHE A CZ  1 
ATOM   2242 N  N   . ASP A 1 285 ? 102.410 64.201 32.044  1.00 39.43 ? 285  ASP A N   1 
ATOM   2243 C  CA  . ASP A 1 285 ? 102.919 62.845 31.874  1.00 38.24 ? 285  ASP A CA  1 
ATOM   2244 C  C   . ASP A 1 285 ? 101.844 61.921 32.386  1.00 36.55 ? 285  ASP A C   1 
ATOM   2245 O  O   . ASP A 1 285 ? 101.358 62.066 33.511  1.00 37.20 ? 285  ASP A O   1 
ATOM   2246 C  CB  . ASP A 1 285 ? 104.195 62.610 32.681  1.00 40.28 ? 285  ASP A CB  1 
ATOM   2247 C  CG  . ASP A 1 285 ? 105.385 63.402 32.154  1.00 43.40 ? 285  ASP A CG  1 
ATOM   2248 O  OD1 . ASP A 1 285 ? 105.274 64.076 31.121  1.00 44.70 ? 285  ASP A OD1 1 
ATOM   2249 O  OD2 . ASP A 1 285 ? 106.452 63.352 32.783  1.00 49.88 ? 285  ASP A OD2 1 
ATOM   2250 N  N   . SER A 1 286 ? 101.469 60.956 31.573  1.00 33.72 ? 286  SER A N   1 
ATOM   2251 C  CA  . SER A 1 286 ? 100.282 60.213 31.877  1.00 32.30 ? 286  SER A CA  1 
ATOM   2252 C  C   . SER A 1 286 ? 100.262 58.936 31.060  1.00 30.52 ? 286  SER A C   1 
ATOM   2253 O  O   . SER A 1 286 ? 101.079 58.740 30.163  1.00 31.47 ? 286  SER A O   1 
ATOM   2254 C  CB  . SER A 1 286 ? 99.066  61.078 31.511  1.00 31.29 ? 286  SER A CB  1 
ATOM   2255 O  OG  . SER A 1 286 ? 98.879  61.046 30.108  1.00 30.72 ? 286  SER A OG  1 
ATOM   2256 N  N   . ILE A 1 287 ? 99.318  58.071 31.365  1.00 29.07 ? 287  ILE A N   1 
ATOM   2257 C  CA  . ILE A 1 287 ? 98.997  56.956 30.480  1.00 27.45 ? 287  ILE A CA  1 
ATOM   2258 C  C   . ILE A 1 287 ? 97.495  56.828 30.414  1.00 25.70 ? 287  ILE A C   1 
ATOM   2259 O  O   . ILE A 1 287 ? 96.800  57.218 31.350  1.00 26.41 ? 287  ILE A O   1 
ATOM   2260 C  CB  . ILE A 1 287 ? 99.608  55.667 30.951  1.00 27.89 ? 287  ILE A CB  1 
ATOM   2261 C  CG1 . ILE A 1 287 ? 99.111  55.300 32.345  1.00 29.32 ? 287  ILE A CG1 1 
ATOM   2262 C  CG2 . ILE A 1 287 ? 101.120 55.742 30.927  1.00 28.75 ? 287  ILE A CG2 1 
ATOM   2263 C  CD1 . ILE A 1 287 ? 99.393  53.841 32.703  1.00 30.11 ? 287  ILE A CD1 1 
ATOM   2264 N  N   . PHE A 1 288 ? 96.995  56.286 29.317  1.00 24.41 ? 288  PHE A N   1 
ATOM   2265 C  CA  . PHE A 1 288 ? 95.580  56.158 29.091  1.00 24.03 ? 288  PHE A CA  1 
ATOM   2266 C  C   . PHE A 1 288 ? 94.966  57.573 29.082  1.00 25.96 ? 288  PHE A C   1 
ATOM   2267 O  O   . PHE A 1 288 ? 93.866  57.789 29.651  1.00 26.08 ? 288  PHE A O   1 
ATOM   2268 C  CB  . PHE A 1 288 ? 94.915  55.301 30.178  1.00 24.23 ? 288  PHE A CB  1 
ATOM   2269 C  CG  . PHE A 1 288 ? 93.848  54.351 29.652  1.00 23.40 ? 288  PHE A CG  1 
ATOM   2270 C  CD1 . PHE A 1 288 ? 92.876  54.782 28.750  1.00 23.99 ? 288  PHE A CD1 1 
ATOM   2271 C  CD2 . PHE A 1 288 ? 93.830  53.022 30.054  1.00 22.79 ? 288  PHE A CD2 1 
ATOM   2272 C  CE1 . PHE A 1 288 ? 91.899  53.892 28.248  1.00 21.98 ? 288  PHE A CE1 1 
ATOM   2273 C  CE2 . PHE A 1 288 ? 92.868  52.145 29.564  1.00 19.77 ? 288  PHE A CE2 1 
ATOM   2274 C  CZ  . PHE A 1 288 ? 91.914  52.565 28.657  1.00 19.38 ? 288  PHE A CZ  1 
ATOM   2275 N  N   . ARG A 1 289 ? 95.699  58.537 28.514  1.00 25.20 ? 289  ARG A N   1 
ATOM   2276 C  CA  . ARG A 1 289 ? 95.136  59.862 28.242  1.00 26.26 ? 289  ARG A CA  1 
ATOM   2277 C  C   . ARG A 1 289 ? 95.353  60.259 26.792  1.00 26.20 ? 289  ARG A C   1 
ATOM   2278 O  O   . ARG A 1 289 ? 96.477  60.141 26.270  1.00 26.74 ? 289  ARG A O   1 
ATOM   2279 C  CB  . ARG A 1 289 ? 95.722  60.946 29.193  1.00 26.84 ? 289  ARG A CB  1 
ATOM   2280 C  CG  . ARG A 1 289 ? 95.231  60.853 30.639  1.00 25.92 ? 289  ARG A CG  1 
ATOM   2281 C  CD  . ARG A 1 289 ? 93.723  60.909 30.738  1.00 26.00 ? 289  ARG A CD  1 
ATOM   2282 N  NE  . ARG A 1 289 ? 93.326  60.837 32.137  1.00 28.29 ? 289  ARG A NE  1 
ATOM   2283 C  CZ  . ARG A 1 289 ? 93.038  59.712 32.813  1.00 31.08 ? 289  ARG A CZ  1 
ATOM   2284 N  NH1 . ARG A 1 289 ? 93.071  58.504 32.215  1.00 27.53 ? 289  ARG A NH1 1 
ATOM   2285 N  NH2 . ARG A 1 289 ? 92.719  59.800 34.113  1.00 29.35 ? 289  ARG A NH2 1 
ATOM   2286 N  N   . PHE A 1 290 ? 94.290  60.730 26.130  1.00 25.75 ? 290  PHE A N   1 
ATOM   2287 C  CA  . PHE A 1 290 ? 94.414  61.079 24.709  1.00 25.92 ? 290  PHE A CA  1 
ATOM   2288 C  C   . PHE A 1 290 ? 94.084  62.569 24.457  1.00 26.61 ? 290  PHE A C   1 
ATOM   2289 O  O   . PHE A 1 290 ? 93.308  63.183 25.196  1.00 26.45 ? 290  PHE A O   1 
ATOM   2290 C  CB  . PHE A 1 290 ? 93.603  60.114 23.884  1.00 24.63 ? 290  PHE A CB  1 
ATOM   2291 C  CG  . PHE A 1 290 ? 93.637  58.714 24.432  1.00 26.36 ? 290  PHE A CG  1 
ATOM   2292 C  CD1 . PHE A 1 290 ? 94.798  57.934 24.330  1.00 29.21 ? 290  PHE A CD1 1 
ATOM   2293 C  CD2 . PHE A 1 290 ? 92.551  58.201 25.123  1.00 24.48 ? 290  PHE A CD2 1 
ATOM   2294 C  CE1 . PHE A 1 290 ? 94.851  56.645 24.878  1.00 29.63 ? 290  PHE A CE1 1 
ATOM   2295 C  CE2 . PHE A 1 290 ? 92.599  56.924 25.651  1.00 27.13 ? 290  PHE A CE2 1 
ATOM   2296 C  CZ  . PHE A 1 290 ? 93.758  56.142 25.526  1.00 27.88 ? 290  PHE A CZ  1 
ATOM   2297 N  N   . SER A 1 291 ? 94.704  63.143 23.434  1.00 26.65 ? 291  SER A N   1 
ATOM   2298 C  CA  . SER A 1 291 ? 94.704  64.597 23.268  1.00 27.07 ? 291  SER A CA  1 
ATOM   2299 C  C   . SER A 1 291 ? 93.355  65.228 22.862  1.00 26.84 ? 291  SER A C   1 
ATOM   2300 O  O   . SER A 1 291 ? 92.906  66.188 23.501  1.00 27.07 ? 291  SER A O   1 
ATOM   2301 C  CB  . SER A 1 291 ? 95.784  64.988 22.275  1.00 27.32 ? 291  SER A CB  1 
ATOM   2302 O  OG  . SER A 1 291 ? 97.056  64.978 22.906  1.00 26.82 ? 291  SER A OG  1 
ATOM   2303 N  N   . PHE A 1 292 ? 92.724  64.681 21.815  1.00 25.27 ? 292  PHE A N   1 
ATOM   2304 C  CA  . PHE A 1 292 ? 91.530  65.286 21.228  1.00 24.29 ? 292  PHE A CA  1 
ATOM   2305 C  C   . PHE A 1 292 ? 90.386  64.289 21.328  1.00 23.82 ? 292  PHE A C   1 
ATOM   2306 O  O   . PHE A 1 292 ? 90.359  63.262 20.638  1.00 22.07 ? 292  PHE A O   1 
ATOM   2307 C  CB  . PHE A 1 292 ? 91.801  65.735 19.782  1.00 24.09 ? 292  PHE A CB  1 
ATOM   2308 C  CG  . PHE A 1 292 ? 92.882  66.781 19.690  1.00 24.07 ? 292  PHE A CG  1 
ATOM   2309 C  CD1 . PHE A 1 292 ? 92.618  68.110 20.055  1.00 24.40 ? 292  PHE A CD1 1 
ATOM   2310 C  CD2 . PHE A 1 292 ? 94.162  66.442 19.273  1.00 24.31 ? 292  PHE A CD2 1 
ATOM   2311 C  CE1 . PHE A 1 292 ? 93.623  69.071 20.045  1.00 25.08 ? 292  PHE A CE1 1 
ATOM   2312 C  CE2 . PHE A 1 292 ? 95.185  67.403 19.227  1.00 22.25 ? 292  PHE A CE2 1 
ATOM   2313 C  CZ  . PHE A 1 292 ? 94.905  68.725 19.616  1.00 26.79 ? 292  PHE A CZ  1 
ATOM   2314 N  N   . VAL A 1 293 ? 89.458  64.612 22.221  1.00 23.52 ? 293  VAL A N   1 
ATOM   2315 C  CA  . VAL A 1 293 ? 88.378  63.723 22.576  1.00 22.89 ? 293  VAL A CA  1 
ATOM   2316 C  C   . VAL A 1 293 ? 87.093  64.565 22.636  1.00 23.23 ? 293  VAL A C   1 
ATOM   2317 O  O   . VAL A 1 293 ? 87.174  65.773 22.552  1.00 23.08 ? 293  VAL A O   1 
ATOM   2318 C  CB  . VAL A 1 293 ? 88.671  63.039 23.932  1.00 22.23 ? 293  VAL A CB  1 
ATOM   2319 C  CG1 . VAL A 1 293 ? 89.966  62.207 23.836  1.00 21.68 ? 293  VAL A CG1 1 
ATOM   2320 C  CG2 . VAL A 1 293 ? 88.769  64.090 25.028  1.00 22.86 ? 293  VAL A CG2 1 
ATOM   2321 N  N   . PRO A 1 294 ? 85.914  63.915 22.745  1.00 23.28 ? 294  PRO A N   1 
ATOM   2322 C  CA  . PRO A 1 294 ? 84.625  64.632 22.913  1.00 24.66 ? 294  PRO A CA  1 
ATOM   2323 C  C   . PRO A 1 294 ? 84.701  65.735 23.972  1.00 26.83 ? 294  PRO A C   1 
ATOM   2324 O  O   . PRO A 1 294 ? 85.415  65.583 24.964  1.00 27.84 ? 294  PRO A O   1 
ATOM   2325 C  CB  . PRO A 1 294 ? 83.678  63.524 23.379  1.00 22.69 ? 294  PRO A CB  1 
ATOM   2326 C  CG  . PRO A 1 294 ? 84.189  62.294 22.652  1.00 23.19 ? 294  PRO A CG  1 
ATOM   2327 C  CD  . PRO A 1 294 ? 85.714  62.450 22.610  1.00 22.46 ? 294  PRO A CD  1 
ATOM   2328 N  N   . VAL A 1 295 ? 83.976  66.832 23.766  1.00 28.98 ? 295  VAL A N   1 
ATOM   2329 C  CA  . VAL A 1 295 ? 83.892  67.926 24.747  1.00 30.53 ? 295  VAL A CA  1 
ATOM   2330 C  C   . VAL A 1 295 ? 82.470  68.037 25.269  1.00 31.24 ? 295  VAL A C   1 
ATOM   2331 O  O   . VAL A 1 295 ? 81.521  67.883 24.497  1.00 32.01 ? 295  VAL A O   1 
ATOM   2332 C  CB  . VAL A 1 295 ? 84.231  69.313 24.142  1.00 31.79 ? 295  VAL A CB  1 
ATOM   2333 C  CG1 . VAL A 1 295 ? 85.713  69.615 24.258  1.00 33.45 ? 295  VAL A CG1 1 
ATOM   2334 C  CG2 . VAL A 1 295 ? 83.723  69.439 22.712  1.00 29.31 ? 295  VAL A CG2 1 
ATOM   2335 N  N   . ILE A 1 296 ? 82.335  68.342 26.552  1.00 31.04 ? 296  ILE A N   1 
ATOM   2336 C  CA  . ILE A 1 296 ? 81.051  68.558 27.152  1.00 32.66 ? 296  ILE A CA  1 
ATOM   2337 C  C   . ILE A 1 296 ? 80.701  70.005 26.820  1.00 35.43 ? 296  ILE A C   1 
ATOM   2338 O  O   . ILE A 1 296 ? 81.160  70.938 27.507  1.00 34.76 ? 296  ILE A O   1 
ATOM   2339 C  CB  . ILE A 1 296 ? 81.132  68.314 28.692  1.00 33.72 ? 296  ILE A CB  1 
ATOM   2340 C  CG1 . ILE A 1 296 ? 81.770  66.932 28.985  1.00 31.72 ? 296  ILE A CG1 1 
ATOM   2341 C  CG2 . ILE A 1 296 ? 79.753  68.441 29.334  1.00 33.40 ? 296  ILE A CG2 1 
ATOM   2342 C  CD1 . ILE A 1 296 ? 81.144  65.785 28.192  1.00 28.34 ? 296  ILE A CD1 1 
ATOM   2343 N  N   . ASP A 1 297 ? 79.909  70.169 25.749  1.00 36.78 ? 297  ASP A N   1 
ATOM   2344 C  CA  . ASP A 1 297 ? 79.743  71.456 25.032  1.00 39.35 ? 297  ASP A CA  1 
ATOM   2345 C  C   . ASP A 1 297 ? 78.392  72.175 25.221  1.00 41.64 ? 297  ASP A C   1 
ATOM   2346 O  O   . ASP A 1 297 ? 78.258  73.375 24.905  1.00 43.57 ? 297  ASP A O   1 
ATOM   2347 C  CB  . ASP A 1 297 ? 79.957  71.203 23.532  1.00 38.55 ? 297  ASP A CB  1 
ATOM   2348 C  CG  . ASP A 1 297 ? 78.981  70.168 22.970  1.00 38.48 ? 297  ASP A CG  1 
ATOM   2349 O  OD1 . ASP A 1 297 ? 78.321  69.449 23.769  1.00 36.62 ? 297  ASP A OD1 1 
ATOM   2350 O  OD2 . ASP A 1 297 ? 78.867  70.088 21.725  1.00 39.37 ? 297  ASP A OD2 1 
ATOM   2351 N  N   . GLY A 1 298 ? 77.395  71.436 25.704  1.00 41.89 ? 298  GLY A N   1 
ATOM   2352 C  CA  . GLY A 1 298 ? 76.052  71.969 25.932  1.00 44.11 ? 298  GLY A CA  1 
ATOM   2353 C  C   . GLY A 1 298 ? 75.113  71.792 24.754  1.00 44.76 ? 298  GLY A C   1 
ATOM   2354 O  O   . GLY A 1 298 ? 74.013  72.375 24.729  1.00 46.63 ? 298  GLY A O   1 
ATOM   2355 N  N   . GLU A 1 299 ? 75.546  70.983 23.789  1.00 43.29 ? 299  GLU A N   1 
ATOM   2356 C  CA  . GLU A 1 299 ? 74.871  70.803 22.505  1.00 44.01 ? 299  GLU A CA  1 
ATOM   2357 C  C   . GLU A 1 299 ? 74.737  69.299 22.222  1.00 41.66 ? 299  GLU A C   1 
ATOM   2358 O  O   . GLU A 1 299 ? 73.647  68.725 22.312  1.00 42.36 ? 299  GLU A O   1 
ATOM   2359 C  CB  . GLU A 1 299 ? 75.685  71.518 21.405  1.00 44.68 ? 299  GLU A CB  1 
ATOM   2360 C  CG  . GLU A 1 299 ? 75.113  71.484 19.978  1.00 49.29 ? 299  GLU A CG  1 
ATOM   2361 C  CD  . GLU A 1 299 ? 75.253  72.837 19.253  1.00 58.34 ? 299  GLU A CD  1 
ATOM   2362 O  OE1 . GLU A 1 299 ? 76.116  73.664 19.675  1.00 60.86 ? 299  GLU A OE1 1 
ATOM   2363 O  OE2 . GLU A 1 299 ? 74.484  73.078 18.274  1.00 60.93 ? 299  GLU A OE2 1 
ATOM   2364 N  N   . PHE A 1 300 ? 75.842  68.647 21.900  1.00 38.86 ? 300  PHE A N   1 
ATOM   2365 C  CA  . PHE A 1 300 ? 75.803  67.204 21.803  1.00 36.48 ? 300  PHE A CA  1 
ATOM   2366 C  C   . PHE A 1 300 ? 75.367  66.618 23.158  1.00 36.58 ? 300  PHE A C   1 
ATOM   2367 O  O   . PHE A 1 300 ? 74.480  65.758 23.216  1.00 36.96 ? 300  PHE A O   1 
ATOM   2368 C  CB  . PHE A 1 300 ? 77.144  66.653 21.340  1.00 34.54 ? 300  PHE A CB  1 
ATOM   2369 C  CG  . PHE A 1 300 ? 77.069  65.264 20.848  1.00 31.93 ? 300  PHE A CG  1 
ATOM   2370 C  CD1 . PHE A 1 300 ? 77.124  64.196 21.748  1.00 27.31 ? 300  PHE A CD1 1 
ATOM   2371 C  CD2 . PHE A 1 300 ? 76.923  65.006 19.481  1.00 27.48 ? 300  PHE A CD2 1 
ATOM   2372 C  CE1 . PHE A 1 300 ? 77.055  62.868 21.285  1.00 25.30 ? 300  PHE A CE1 1 
ATOM   2373 C  CE2 . PHE A 1 300 ? 76.841  63.701 19.015  1.00 26.15 ? 300  PHE A CE2 1 
ATOM   2374 C  CZ  . PHE A 1 300 ? 76.892  62.615 19.930  1.00 24.86 ? 300  PHE A CZ  1 
ATOM   2375 N  N   . PHE A 1 301 ? 75.962  67.127 24.230  1.00 36.00 ? 301  PHE A N   1 
ATOM   2376 C  CA  . PHE A 1 301 ? 75.589  66.780 25.589  1.00 36.57 ? 301  PHE A CA  1 
ATOM   2377 C  C   . PHE A 1 301 ? 74.958  68.036 26.215  1.00 38.88 ? 301  PHE A C   1 
ATOM   2378 O  O   . PHE A 1 301 ? 75.670  69.004 26.450  1.00 40.03 ? 301  PHE A O   1 
ATOM   2379 C  CB  . PHE A 1 301 ? 76.836  66.383 26.407  1.00 34.89 ? 301  PHE A CB  1 
ATOM   2380 C  CG  . PHE A 1 301 ? 77.690  65.354 25.744  1.00 32.97 ? 301  PHE A CG  1 
ATOM   2381 C  CD1 . PHE A 1 301 ? 77.291  64.010 25.709  1.00 29.69 ? 301  PHE A CD1 1 
ATOM   2382 C  CD2 . PHE A 1 301 ? 78.885  65.730 25.114  1.00 31.49 ? 301  PHE A CD2 1 
ATOM   2383 C  CE1 . PHE A 1 301 ? 78.094  63.034 25.070  1.00 27.72 ? 301  PHE A CE1 1 
ATOM   2384 C  CE2 . PHE A 1 301 ? 79.689  64.773 24.487  1.00 30.27 ? 301  PHE A CE2 1 
ATOM   2385 C  CZ  . PHE A 1 301 ? 79.279  63.405 24.477  1.00 28.90 ? 301  PHE A CZ  1 
ATOM   2386 N  N   . PRO A 1 302 ? 73.644  68.020 26.513  1.00 39.88 ? 302  PRO A N   1 
ATOM   2387 C  CA  . PRO A 1 302 ? 73.023  69.239 27.053  1.00 42.08 ? 302  PRO A CA  1 
ATOM   2388 C  C   . PRO A 1 302 ? 73.617  69.700 28.384  1.00 42.73 ? 302  PRO A C   1 
ATOM   2389 O  O   . PRO A 1 302 ? 73.685  70.897 28.622  1.00 44.01 ? 302  PRO A O   1 
ATOM   2390 C  CB  . PRO A 1 302 ? 71.548  68.846 27.231  1.00 43.10 ? 302  PRO A CB  1 
ATOM   2391 C  CG  . PRO A 1 302 ? 71.556  67.357 27.250  1.00 41.66 ? 302  PRO A CG  1 
ATOM   2392 C  CD  . PRO A 1 302 ? 72.659  66.946 26.327  1.00 39.62 ? 302  PRO A CD  1 
ATOM   2393 N  N   . THR A 1 303 ? 74.026  68.759 29.244  1.00 41.74 ? 303  THR A N   1 
ATOM   2394 C  CA  . THR A 1 303 ? 74.610  69.089 30.563  1.00 41.75 ? 303  THR A CA  1 
ATOM   2395 C  C   . THR A 1 303 ? 75.701  68.059 30.883  1.00 39.62 ? 303  THR A C   1 
ATOM   2396 O  O   . THR A 1 303 ? 75.989  67.219 30.053  1.00 36.78 ? 303  THR A O   1 
ATOM   2397 C  CB  . THR A 1 303 ? 73.565  69.117 31.709  1.00 44.05 ? 303  THR A CB  1 
ATOM   2398 O  OG1 . THR A 1 303 ? 72.934  67.840 31.812  1.00 43.86 ? 303  THR A OG1 1 
ATOM   2399 C  CG2 . THR A 1 303 ? 72.471  70.226 31.506  1.00 46.23 ? 303  THR A CG2 1 
ATOM   2400 N  N   . SER A 1 304 ? 76.334  68.161 32.058  1.00 39.51 ? 304  SER A N   1 
ATOM   2401 C  CA  . SER A 1 304 ? 77.400  67.242 32.440  1.00 37.64 ? 304  SER A CA  1 
ATOM   2402 C  C   . SER A 1 304 ? 76.911  65.797 32.326  1.00 36.20 ? 304  SER A C   1 
ATOM   2403 O  O   . SER A 1 304 ? 75.716  65.556 32.435  1.00 36.48 ? 304  SER A O   1 
ATOM   2404 C  CB  . SER A 1 304 ? 77.863  67.518 33.861  1.00 38.36 ? 304  SER A CB  1 
ATOM   2405 O  OG  . SER A 1 304 ? 76.883  67.098 34.785  1.00 40.09 ? 304  SER A OG  1 
ATOM   2406 N  N   . LEU A 1 305 ? 77.815  64.855 32.063  1.00 34.09 ? 305  LEU A N   1 
ATOM   2407 C  CA  . LEU A 1 305 ? 77.392  63.461 31.950  1.00 33.90 ? 305  LEU A CA  1 
ATOM   2408 C  C   . LEU A 1 305 ? 76.842  62.969 33.275  1.00 35.82 ? 305  LEU A C   1 
ATOM   2409 O  O   . LEU A 1 305 ? 75.908  62.193 33.290  1.00 35.40 ? 305  LEU A O   1 
ATOM   2410 C  CB  . LEU A 1 305 ? 78.501  62.544 31.461  1.00 32.08 ? 305  LEU A CB  1 
ATOM   2411 C  CG  . LEU A 1 305 ? 79.279  63.025 30.224  1.00 30.83 ? 305  LEU A CG  1 
ATOM   2412 C  CD1 . LEU A 1 305 ? 80.461  62.111 29.927  1.00 28.11 ? 305  LEU A CD1 1 
ATOM   2413 C  CD2 . LEU A 1 305 ? 78.368  63.177 29.010  1.00 27.13 ? 305  LEU A CD2 1 
ATOM   2414 N  N   . GLU A 1 306 ? 77.384  63.461 34.388  1.00 37.71 ? 306  GLU A N   1 
ATOM   2415 C  CA  . GLU A 1 306 ? 76.912  62.985 35.661  1.00 40.25 ? 306  GLU A CA  1 
ATOM   2416 C  C   . GLU A 1 306 ? 75.458  63.420 35.873  1.00 42.29 ? 306  GLU A C   1 
ATOM   2417 O  O   . GLU A 1 306 ? 74.604  62.580 36.149  1.00 43.47 ? 306  GLU A O   1 
ATOM   2418 C  CB  . GLU A 1 306 ? 77.851  63.371 36.813  1.00 41.38 ? 306  GLU A CB  1 
ATOM   2419 C  CG  . GLU A 1 306 ? 77.521  62.743 38.180  1.00 44.65 ? 306  GLU A CG  1 
ATOM   2420 C  CD  . GLU A 1 306 ? 77.511  61.187 38.180  1.00 48.81 ? 306  GLU A CD  1 
ATOM   2421 O  OE1 . GLU A 1 306 ? 78.030  60.537 37.234  1.00 46.47 ? 306  GLU A OE1 1 
ATOM   2422 O  OE2 . GLU A 1 306 ? 76.970  60.605 39.152  1.00 51.73 ? 306  GLU A OE2 1 
ATOM   2423 N  N   . SER A 1 307 ? 75.155  64.698 35.676  1.00 43.04 ? 307  SER A N   1 
ATOM   2424 C  CA  . SER A 1 307 ? 73.785  65.185 35.910  1.00 45.21 ? 307  SER A CA  1 
ATOM   2425 C  C   . SER A 1 307 ? 72.750  64.531 34.981  1.00 44.58 ? 307  SER A C   1 
ATOM   2426 O  O   . SER A 1 307 ? 71.622  64.271 35.410  1.00 45.90 ? 307  SER A O   1 
ATOM   2427 C  CB  . SER A 1 307 ? 73.697  66.715 35.810  1.00 46.14 ? 307  SER A CB  1 
ATOM   2428 O  OG  . SER A 1 307 ? 74.085  67.149 34.515  1.00 45.78 ? 307  SER A OG  1 
ATOM   2429 N  N   . MET A 1 308 ? 73.140  64.276 33.729  1.00 42.49 ? 308  MET A N   1 
ATOM   2430 C  CA  . MET A 1 308 ? 72.321  63.510 32.790  1.00 42.44 ? 308  MET A CA  1 
ATOM   2431 C  C   . MET A 1 308 ? 72.013  62.111 33.328  1.00 42.40 ? 308  MET A C   1 
ATOM   2432 O  O   . MET A 1 308 ? 70.850  61.689 33.340  1.00 43.33 ? 308  MET A O   1 
ATOM   2433 C  CB  . MET A 1 308 ? 72.974  63.405 31.399  1.00 40.46 ? 308  MET A CB  1 
ATOM   2434 C  CG  . MET A 1 308 ? 72.945  64.710 30.590  1.00 42.50 ? 308  MET A CG  1 
ATOM   2435 S  SD  . MET A 1 308 ? 73.696  64.552 28.946  1.00 42.72 ? 308  MET A SD  1 
ATOM   2436 C  CE  . MET A 1 308 ? 72.298  63.835 28.090  1.00 41.29 ? 308  MET A CE  1 
ATOM   2437 N  N   . LEU A 1 309 ? 73.046  61.404 33.777  1.00 41.45 ? 309  LEU A N   1 
ATOM   2438 C  CA  . LEU A 1 309 ? 72.880  60.058 34.325  1.00 41.82 ? 309  LEU A CA  1 
ATOM   2439 C  C   . LEU A 1 309 ? 71.952  60.021 35.548  1.00 44.68 ? 309  LEU A C   1 
ATOM   2440 O  O   . LEU A 1 309 ? 71.137  59.092 35.678  1.00 45.41 ? 309  LEU A O   1 
ATOM   2441 C  CB  . LEU A 1 309 ? 74.235  59.415 34.642  1.00 39.83 ? 309  LEU A CB  1 
ATOM   2442 C  CG  . LEU A 1 309 ? 74.988  58.838 33.450  1.00 37.25 ? 309  LEU A CG  1 
ATOM   2443 C  CD1 . LEU A 1 309 ? 76.366  58.420 33.886  1.00 37.69 ? 309  LEU A CD1 1 
ATOM   2444 C  CD2 . LEU A 1 309 ? 74.255  57.636 32.859  1.00 35.57 ? 309  LEU A CD2 1 
ATOM   2445 N  N   . ASN A 1 310 ? 72.060  61.028 36.427  1.00 46.49 ? 310  ASN A N   1 
ATOM   2446 C  CA  . ASN A 1 310 ? 71.249  61.093 37.662  1.00 49.23 ? 310  ASN A CA  1 
ATOM   2447 C  C   . ASN A 1 310 ? 69.787  61.448 37.441  1.00 50.62 ? 310  ASN A C   1 
ATOM   2448 O  O   . ASN A 1 310 ? 68.922  61.036 38.235  1.00 53.17 ? 310  ASN A O   1 
ATOM   2449 C  CB  . ASN A 1 310 ? 71.825  62.104 38.675  1.00 50.72 ? 310  ASN A CB  1 
ATOM   2450 C  CG  . ASN A 1 310 ? 73.114  61.634 39.305  1.00 52.65 ? 310  ASN A CG  1 
ATOM   2451 O  OD1 . ASN A 1 310 ? 73.413  60.442 39.315  1.00 54.60 ? 310  ASN A OD1 1 
ATOM   2452 N  ND2 . ASN A 1 310 ? 73.903  62.576 39.823  1.00 54.00 ? 310  ASN A ND2 1 
ATOM   2453 N  N   . SER A 1 311 ? 69.517  62.252 36.412  1.00 49.75 ? 311  SER A N   1 
ATOM   2454 C  CA  . SER A 1 311 ? 68.156  62.713 36.113  1.00 50.93 ? 311  SER A CA  1 
ATOM   2455 C  C   . SER A 1 311 ? 67.424  61.790 35.138  1.00 49.43 ? 311  SER A C   1 
ATOM   2456 O  O   . SER A 1 311 ? 66.228  61.950 34.897  1.00 51.96 ? 311  SER A O   1 
ATOM   2457 C  CB  . SER A 1 311 ? 68.180  64.145 35.556  1.00 51.37 ? 311  SER A CB  1 
ATOM   2458 O  OG  . SER A 1 311 ? 68.757  64.172 34.254  1.00 50.63 ? 311  SER A OG  1 
ATOM   2459 N  N   . GLY A 1 312 ? 68.137  60.829 34.580  1.00 46.73 ? 312  GLY A N   1 
ATOM   2460 C  CA  . GLY A 1 312 ? 67.584  59.937 33.572  1.00 45.34 ? 312  GLY A CA  1 
ATOM   2461 C  C   . GLY A 1 312 ? 67.319  60.572 32.216  1.00 44.76 ? 312  GLY A C   1 
ATOM   2462 O  O   . GLY A 1 312 ? 66.475  60.082 31.468  1.00 44.13 ? 312  GLY A O   1 
ATOM   2463 N  N   . ASN A 1 313 ? 68.029  61.666 31.918  1.00 44.34 ? 313  ASN A N   1 
ATOM   2464 C  CA  . ASN A 1 313 ? 68.014  62.329 30.619  1.00 44.28 ? 313  ASN A CA  1 
ATOM   2465 C  C   . ASN A 1 313 ? 68.842  61.555 29.636  1.00 41.54 ? 313  ASN A C   1 
ATOM   2466 O  O   . ASN A 1 313 ? 69.954  61.953 29.350  1.00 41.35 ? 313  ASN A O   1 
ATOM   2467 C  CB  . ASN A 1 313 ? 68.664  63.713 30.740  1.00 45.84 ? 313  ASN A CB  1 
ATOM   2468 C  CG  . ASN A 1 313 ? 68.352  64.635 29.551  1.00 48.12 ? 313  ASN A CG  1 
ATOM   2469 O  OD1 . ASN A 1 313 ? 67.691  64.238 28.581  1.00 50.72 ? 313  ASN A OD1 1 
ATOM   2470 N  ND2 . ASN A 1 313 ? 68.818  65.884 29.640  1.00 49.92 ? 313  ASN A ND2 1 
ATOM   2471 N  N   . PHE A 1 314 ? 68.343  60.417 29.160  1.00 39.92 ? 314  PHE A N   1 
ATOM   2472 C  CA  . PHE A 1 314 ? 69.085  59.610 28.187  1.00 36.65 ? 314  PHE A CA  1 
ATOM   2473 C  C   . PHE A 1 314 ? 68.132  58.634 27.579  1.00 36.30 ? 314  PHE A C   1 
ATOM   2474 O  O   . PHE A 1 314 ? 67.005  58.500 28.059  1.00 36.50 ? 314  PHE A O   1 
ATOM   2475 C  CB  . PHE A 1 314 ? 70.308  58.883 28.808  1.00 35.64 ? 314  PHE A CB  1 
ATOM   2476 C  CG  . PHE A 1 314 ? 70.018  58.111 30.090  1.00 36.31 ? 314  PHE A CG  1 
ATOM   2477 C  CD1 . PHE A 1 314 ? 69.403  56.855 30.058  1.00 36.25 ? 314  PHE A CD1 1 
ATOM   2478 C  CD2 . PHE A 1 314 ? 70.396  58.629 31.328  1.00 35.35 ? 314  PHE A CD2 1 
ATOM   2479 C  CE1 . PHE A 1 314 ? 69.148  56.143 31.246  1.00 35.59 ? 314  PHE A CE1 1 
ATOM   2480 C  CE2 . PHE A 1 314 ? 70.164  57.919 32.502  1.00 35.43 ? 314  PHE A CE2 1 
ATOM   2481 C  CZ  . PHE A 1 314 ? 69.539  56.677 32.461  1.00 35.03 ? 314  PHE A CZ  1 
ATOM   2482 N  N   . LYS A 1 315 ? 68.572  57.919 26.546  1.00 34.66 ? 315  LYS A N   1 
ATOM   2483 C  CA  . LYS A 1 315 ? 67.690  56.904 25.937  1.00 34.74 ? 315  LYS A CA  1 
ATOM   2484 C  C   . LYS A 1 315 ? 67.428  55.742 26.908  1.00 35.09 ? 315  LYS A C   1 
ATOM   2485 O  O   . LYS A 1 315 ? 68.353  55.167 27.469  1.00 34.72 ? 315  LYS A O   1 
ATOM   2486 C  CB  . LYS A 1 315 ? 68.254  56.400 24.620  1.00 33.34 ? 315  LYS A CB  1 
ATOM   2487 C  CG  . LYS A 1 315 ? 67.328  55.522 23.832  1.00 32.91 ? 315  LYS A CG  1 
ATOM   2488 C  CD  . LYS A 1 315 ? 68.071  55.044 22.556  1.00 30.92 ? 315  LYS A CD  1 
ATOM   2489 C  CE  . LYS A 1 315 ? 67.274  53.984 21.752  1.00 29.69 ? 315  LYS A CE  1 
ATOM   2490 N  NZ  . LYS A 1 315 ? 66.140  54.561 20.989  1.00 31.86 ? 315  LYS A NZ  1 
ATOM   2491 N  N   . LYS A 1 316 ? 66.156  55.426 27.083  1.00 36.91 ? 316  LYS A N   1 
ATOM   2492 C  CA  . LYS A 1 316 ? 65.690  54.344 27.937  1.00 38.18 ? 316  LYS A CA  1 
ATOM   2493 C  C   . LYS A 1 316 ? 65.501  53.109 27.095  1.00 36.70 ? 316  LYS A C   1 
ATOM   2494 O  O   . LYS A 1 316 ? 64.544  53.020 26.327  1.00 38.00 ? 316  LYS A O   1 
ATOM   2495 C  CB  . LYS A 1 316 ? 64.353  54.740 28.557  1.00 40.42 ? 316  LYS A CB  1 
ATOM   2496 C  CG  . LYS A 1 316 ? 64.473  55.356 29.939  1.00 46.41 ? 316  LYS A CG  1 
ATOM   2497 C  CD  . LYS A 1 316 ? 64.913  56.808 29.953  1.00 49.78 ? 316  LYS A CD  1 
ATOM   2498 C  CE  . LYS A 1 316 ? 64.300  57.501 31.157  1.00 54.27 ? 316  LYS A CE  1 
ATOM   2499 N  NZ  . LYS A 1 316 ? 64.273  58.981 30.978  1.00 57.55 ? 316  LYS A NZ  1 
ATOM   2500 N  N   . THR A 1 317 ? 66.410  52.156 27.196  1.00 34.23 ? 317  THR A N   1 
ATOM   2501 C  CA  . THR A 1 317 ? 66.285  50.987 26.328  1.00 33.39 ? 317  THR A CA  1 
ATOM   2502 C  C   . THR A 1 317 ? 66.976  49.779 26.973  1.00 32.29 ? 317  THR A C   1 
ATOM   2503 O  O   . THR A 1 317 ? 67.161  49.771 28.183  1.00 31.93 ? 317  THR A O   1 
ATOM   2504 C  CB  . THR A 1 317 ? 66.745  51.304 24.864  1.00 31.65 ? 317  THR A CB  1 
ATOM   2505 O  OG1 . THR A 1 317 ? 66.445  50.203 24.014  1.00 33.01 ? 317  THR A OG1 1 
ATOM   2506 C  CG2 . THR A 1 317 ? 68.244  51.586 24.775  1.00 31.36 ? 317  THR A CG2 1 
ATOM   2507 N  N   . GLN A 1 318 ? 67.322  48.754 26.201  1.00 31.82 ? 318  GLN A N   1 
ATOM   2508 C  CA  . GLN A 1 318 ? 68.122  47.664 26.766  1.00 31.28 ? 318  GLN A CA  1 
ATOM   2509 C  C   . GLN A 1 318 ? 69.586  47.884 26.420  1.00 29.36 ? 318  GLN A C   1 
ATOM   2510 O  O   . GLN A 1 318 ? 69.906  48.348 25.314  1.00 28.61 ? 318  GLN A O   1 
ATOM   2511 C  CB  . GLN A 1 318 ? 67.649  46.271 26.313  1.00 31.75 ? 318  GLN A CB  1 
ATOM   2512 C  CG  . GLN A 1 318 ? 66.167  46.009 26.506  1.00 34.80 ? 318  GLN A CG  1 
ATOM   2513 C  CD  . GLN A 1 318 ? 65.322  46.673 25.417  1.00 36.68 ? 318  GLN A CD  1 
ATOM   2514 O  OE1 . GLN A 1 318 ? 65.776  46.853 24.282  1.00 37.12 ? 318  GLN A OE1 1 
ATOM   2515 N  NE2 . GLN A 1 318 ? 64.095  47.033 25.758  1.00 37.58 ? 318  GLN A NE2 1 
ATOM   2516 N  N   . ILE A 1 319 ? 70.471  47.604 27.386  1.00 28.79 ? 319  ILE A N   1 
ATOM   2517 C  CA  . ILE A 1 319 ? 71.914  47.651 27.128  1.00 27.46 ? 319  ILE A CA  1 
ATOM   2518 C  C   . ILE A 1 319 ? 72.567  46.350 27.577  1.00 28.04 ? 319  ILE A C   1 
ATOM   2519 O  O   . ILE A 1 319 ? 72.121  45.723 28.541  1.00 28.40 ? 319  ILE A O   1 
ATOM   2520 C  CB  . ILE A 1 319 ? 72.602  48.847 27.805  1.00 26.65 ? 319  ILE A CB  1 
ATOM   2521 C  CG1 . ILE A 1 319 ? 72.489  48.769 29.342  1.00 25.26 ? 319  ILE A CG1 1 
ATOM   2522 C  CG2 . ILE A 1 319 ? 72.053  50.160 27.234  1.00 25.83 ? 319  ILE A CG2 1 
ATOM   2523 C  CD1 . ILE A 1 319 ? 73.447  49.716 30.095  1.00 26.72 ? 319  ILE A CD1 1 
ATOM   2524 N  N   . LEU A 1 320 ? 73.646  45.982 26.888  1.00 28.28 ? 320  LEU A N   1 
ATOM   2525 C  CA  . LEU A 1 320 ? 74.465  44.816 27.242  1.00 28.11 ? 320  LEU A CA  1 
ATOM   2526 C  C   . LEU A 1 320 ? 75.912  45.279 27.189  1.00 27.63 ? 320  LEU A C   1 
ATOM   2527 O  O   . LEU A 1 320 ? 76.350  45.851 26.189  1.00 28.41 ? 320  LEU A O   1 
ATOM   2528 C  CB  . LEU A 1 320 ? 74.178  43.624 26.280  1.00 28.37 ? 320  LEU A CB  1 
ATOM   2529 C  CG  . LEU A 1 320 ? 74.983  42.309 26.363  1.00 26.26 ? 320  LEU A CG  1 
ATOM   2530 C  CD1 . LEU A 1 320 ? 74.162  41.123 25.782  1.00 25.45 ? 320  LEU A CD1 1 
ATOM   2531 C  CD2 . LEU A 1 320 ? 76.439  42.405 25.749  1.00 19.79 ? 320  LEU A CD2 1 
ATOM   2532 N  N   . LEU A 1 321 ? 76.671  45.030 28.254  1.00 27.41 ? 321  LEU A N   1 
ATOM   2533 C  CA  . LEU A 1 321 ? 77.977  45.639 28.358  1.00 26.07 ? 321  LEU A CA  1 
ATOM   2534 C  C   . LEU A 1 321 ? 78.847  44.866 29.304  1.00 26.22 ? 321  LEU A C   1 
ATOM   2535 O  O   . LEU A 1 321 ? 78.364  44.050 30.071  1.00 26.53 ? 321  LEU A O   1 
ATOM   2536 C  CB  . LEU A 1 321 ? 77.872  47.107 28.799  1.00 25.47 ? 321  LEU A CB  1 
ATOM   2537 C  CG  . LEU A 1 321 ? 77.430  47.486 30.223  1.00 26.27 ? 321  LEU A CG  1 
ATOM   2538 C  CD1 . LEU A 1 321 ? 77.406  49.014 30.360  1.00 26.68 ? 321  LEU A CD1 1 
ATOM   2539 C  CD2 . LEU A 1 321 ? 76.058  46.908 30.598  1.00 25.54 ? 321  LEU A CD2 1 
ATOM   2540 N  N   . GLY A 1 322 ? 80.144  45.149 29.263  1.00 25.44 ? 322  GLY A N   1 
ATOM   2541 C  CA  . GLY A 1 322 ? 81.078  44.417 30.084  1.00 26.39 ? 322  GLY A CA  1 
ATOM   2542 C  C   . GLY A 1 322 ? 82.493  44.821 29.810  1.00 26.03 ? 322  GLY A C   1 
ATOM   2543 O  O   . GLY A 1 322 ? 82.750  45.782 29.044  1.00 25.84 ? 322  GLY A O   1 
ATOM   2544 N  N   . VAL A 1 323 ? 83.398  44.088 30.458  1.00 25.21 ? 323  VAL A N   1 
ATOM   2545 C  CA  . VAL A 1 323 ? 84.791  44.444 30.556  1.00 23.73 ? 323  VAL A CA  1 
ATOM   2546 C  C   . VAL A 1 323 ? 85.651  43.185 30.511  1.00 25.15 ? 323  VAL A C   1 
ATOM   2547 O  O   . VAL A 1 323 ? 85.150  42.070 30.720  1.00 25.04 ? 323  VAL A O   1 
ATOM   2548 C  CB  . VAL A 1 323 ? 85.088  45.261 31.854  1.00 24.45 ? 323  VAL A CB  1 
ATOM   2549 C  CG1 . VAL A 1 323 ? 84.371  46.650 31.815  1.00 23.98 ? 323  VAL A CG1 1 
ATOM   2550 C  CG2 . VAL A 1 323 ? 84.694  44.504 33.113  1.00 21.54 ? 323  VAL A CG2 1 
ATOM   2551 N  N   . ASN A 1 324 ? 86.924  43.374 30.176  1.00 24.69 ? 324  ASN A N   1 
ATOM   2552 C  CA  . ASN A 1 324 ? 87.891  42.315 30.226  1.00 25.90 ? 324  ASN A CA  1 
ATOM   2553 C  C   . ASN A 1 324 ? 88.636  42.320 31.551  1.00 26.38 ? 324  ASN A C   1 
ATOM   2554 O  O   . ASN A 1 324 ? 88.659  43.326 32.280  1.00 25.12 ? 324  ASN A O   1 
ATOM   2555 C  CB  . ASN A 1 324 ? 88.893  42.445 29.070  1.00 25.70 ? 324  ASN A CB  1 
ATOM   2556 C  CG  . ASN A 1 324 ? 88.238  42.291 27.702  1.00 27.63 ? 324  ASN A CG  1 
ATOM   2557 O  OD1 . ASN A 1 324 ? 87.007  42.095 27.593  1.00 26.66 ? 324  ASN A OD1 1 
ATOM   2558 N  ND2 . ASN A 1 324 ? 89.054  42.413 26.639  1.00 24.83 ? 324  ASN A ND2 1 
ATOM   2559 N  N   . LYS A 1 325 ? 89.246  41.186 31.864  1.00 27.56 ? 325  LYS A N   1 
ATOM   2560 C  CA  . LYS A 1 325 ? 89.973  41.054 33.112  1.00 28.83 ? 325  LYS A CA  1 
ATOM   2561 C  C   . LYS A 1 325 ? 91.115  42.053 33.253  1.00 29.23 ? 325  LYS A C   1 
ATOM   2562 O  O   . LYS A 1 325 ? 91.282  42.603 34.343  1.00 29.76 ? 325  LYS A O   1 
ATOM   2563 C  CB  . LYS A 1 325 ? 90.482  39.620 33.331  1.00 29.46 ? 325  LYS A CB  1 
ATOM   2564 C  CG  . LYS A 1 325 ? 91.186  39.386 34.681  1.00 30.46 ? 325  LYS A CG  1 
ATOM   2565 C  CD  . LYS A 1 325 ? 91.508  37.892 34.875  1.00 37.14 ? 325  LYS A CD  1 
ATOM   2566 C  CE  . LYS A 1 325 ? 92.976  37.605 35.290  1.00 43.09 ? 325  LYS A CE  1 
ATOM   2567 N  NZ  . LYS A 1 325 ? 93.943  37.521 34.094  1.00 42.02 ? 325  LYS A NZ  1 
ATOM   2568 N  N   . ASP A 1 326 ? 91.886  42.284 32.188  1.00 28.85 ? 326  ASP A N   1 
ATOM   2569 C  CA  . ASP A 1 326 ? 93.095  43.089 32.308  1.00 30.31 ? 326  ASP A CA  1 
ATOM   2570 C  C   . ASP A 1 326 ? 93.118  44.233 31.305  1.00 29.78 ? 326  ASP A C   1 
ATOM   2571 O  O   . ASP A 1 326 ? 93.977  44.295 30.415  1.00 29.58 ? 326  ASP A O   1 
ATOM   2572 C  CB  . ASP A 1 326 ? 94.351  42.234 32.163  1.00 31.17 ? 326  ASP A CB  1 
ATOM   2573 C  CG  . ASP A 1 326 ? 94.372  41.064 33.148  1.00 34.76 ? 326  ASP A CG  1 
ATOM   2574 O  OD1 . ASP A 1 326 ? 94.781  41.258 34.316  1.00 37.55 ? 326  ASP A OD1 1 
ATOM   2575 O  OD2 . ASP A 1 326 ? 93.955  39.949 32.760  1.00 34.19 ? 326  ASP A OD2 1 
ATOM   2576 N  N   . GLU A 1 327 ? 92.176  45.151 31.485  1.00 29.05 ? 327  GLU A N   1 
ATOM   2577 C  CA  . GLU A 1 327 ? 92.077  46.301 30.613  1.00 28.81 ? 327  GLU A CA  1 
ATOM   2578 C  C   . GLU A 1 327 ? 93.345  47.129 30.638  1.00 28.31 ? 327  GLU A C   1 
ATOM   2579 O  O   . GLU A 1 327 ? 93.696  47.670 29.635  1.00 30.07 ? 327  GLU A O   1 
ATOM   2580 C  CB  . GLU A 1 327 ? 90.861  47.132 30.995  1.00 28.87 ? 327  GLU A CB  1 
ATOM   2581 C  CG  . GLU A 1 327 ? 89.531  46.392 30.903  1.00 30.00 ? 327  GLU A CG  1 
ATOM   2582 C  CD  . GLU A 1 327 ? 88.998  46.235 29.477  1.00 32.01 ? 327  GLU A CD  1 
ATOM   2583 O  OE1 . GLU A 1 327 ? 89.696  46.595 28.527  1.00 28.96 ? 327  GLU A OE1 1 
ATOM   2584 O  OE2 . GLU A 1 327 ? 87.872  45.708 29.307  1.00 35.24 ? 327  GLU A OE2 1 
ATOM   2585 N  N   . GLY A 1 328 ? 94.063  47.197 31.759  1.00 27.88 ? 328  GLY A N   1 
ATOM   2586 C  CA  . GLY A 1 328 ? 95.140  48.173 31.889  1.00 26.41 ? 328  GLY A CA  1 
ATOM   2587 C  C   . GLY A 1 328 ? 96.492  47.887 31.251  1.00 26.99 ? 328  GLY A C   1 
ATOM   2588 O  O   . GLY A 1 328 ? 97.282  48.828 31.045  1.00 25.13 ? 328  GLY A O   1 
ATOM   2589 N  N   . SER A 1 329 ? 96.751  46.601 30.916  1.00 26.09 ? 329  SER A N   1 
ATOM   2590 C  CA  . SER A 1 329 ? 98.106  46.121 30.718  1.00 26.74 ? 329  SER A CA  1 
ATOM   2591 C  C   . SER A 1 329 ? 98.753  46.666 29.447  1.00 27.63 ? 329  SER A C   1 
ATOM   2592 O  O   . SER A 1 329 ? 99.935  47.031 29.435  1.00 27.03 ? 329  SER A O   1 
ATOM   2593 C  CB  . SER A 1 329 ? 98.188  44.568 30.797  1.00 27.01 ? 329  SER A CB  1 
ATOM   2594 O  OG  . SER A 1 329 ? 97.522  43.951 29.720  1.00 24.91 ? 329  SER A OG  1 
ATOM   2595 N  N   . PHE A 1 330 ? 97.970  46.741 28.388  1.00 27.96 ? 330  PHE A N   1 
ATOM   2596 C  CA  . PHE A 1 330 ? 98.451  47.353 27.177  1.00 30.12 ? 330  PHE A CA  1 
ATOM   2597 C  C   . PHE A 1 330 ? 99.019  48.743 27.441  1.00 30.56 ? 330  PHE A C   1 
ATOM   2598 O  O   . PHE A 1 330 ? 100.071 49.126 26.883  1.00 30.88 ? 330  PHE A O   1 
ATOM   2599 C  CB  . PHE A 1 330 ? 97.300  47.465 26.201  1.00 31.09 ? 330  PHE A CB  1 
ATOM   2600 C  CG  . PHE A 1 330 ? 97.691  47.983 24.875  1.00 35.45 ? 330  PHE A CG  1 
ATOM   2601 C  CD1 . PHE A 1 330 ? 98.380  47.167 23.967  1.00 38.30 ? 330  PHE A CD1 1 
ATOM   2602 C  CD2 . PHE A 1 330 ? 97.390  49.301 24.518  1.00 39.94 ? 330  PHE A CD2 1 
ATOM   2603 C  CE1 . PHE A 1 330 ? 98.731  47.640 22.700  1.00 41.24 ? 330  PHE A CE1 1 
ATOM   2604 C  CE2 . PHE A 1 330 ? 97.747  49.807 23.232  1.00 41.64 ? 330  PHE A CE2 1 
ATOM   2605 C  CZ  . PHE A 1 330 ? 98.405  48.974 22.324  1.00 43.20 ? 330  PHE A CZ  1 
ATOM   2606 N  N   . PHE A 1 331 ? 98.346  49.511 28.289  1.00 29.78 ? 331  PHE A N   1 
ATOM   2607 C  CA  . PHE A 1 331 ? 98.783  50.906 28.473  1.00 31.09 ? 331  PHE A CA  1 
ATOM   2608 C  C   . PHE A 1 331 ? 100.035 51.046 29.345  1.00 32.10 ? 331  PHE A C   1 
ATOM   2609 O  O   . PHE A 1 331 ? 100.855 51.927 29.107  1.00 34.24 ? 331  PHE A O   1 
ATOM   2610 C  CB  . PHE A 1 331 ? 97.618  51.806 28.916  1.00 30.29 ? 331  PHE A CB  1 
ATOM   2611 C  CG  . PHE A 1 331 ? 96.500  51.842 27.896  1.00 32.37 ? 331  PHE A CG  1 
ATOM   2612 C  CD1 . PHE A 1 331 ? 95.467  50.901 27.935  1.00 31.05 ? 331  PHE A CD1 1 
ATOM   2613 C  CD2 . PHE A 1 331 ? 96.539  52.753 26.836  1.00 32.72 ? 331  PHE A CD2 1 
ATOM   2614 C  CE1 . PHE A 1 331 ? 94.453  50.912 26.949  1.00 31.51 ? 331  PHE A CE1 1 
ATOM   2615 C  CE2 . PHE A 1 331 ? 95.552  52.756 25.859  1.00 34.06 ? 331  PHE A CE2 1 
ATOM   2616 C  CZ  . PHE A 1 331 ? 94.492  51.840 25.930  1.00 32.10 ? 331  PHE A CZ  1 
ATOM   2617 N  N   . LEU A 1 332 ? 100.211 50.156 30.308  1.00 31.89 ? 332  LEU A N   1 
ATOM   2618 C  CA  . LEU A 1 332 ? 101.435 50.159 31.115  1.00 33.53 ? 332  LEU A CA  1 
ATOM   2619 C  C   . LEU A 1 332 ? 102.639 49.895 30.238  1.00 35.13 ? 332  LEU A C   1 
ATOM   2620 O  O   . LEU A 1 332 ? 103.693 50.544 30.352  1.00 35.46 ? 332  LEU A O   1 
ATOM   2621 C  CB  . LEU A 1 332 ? 101.347 49.122 32.247  1.00 32.27 ? 332  LEU A CB  1 
ATOM   2622 C  CG  . LEU A 1 332 ? 100.366 49.635 33.295  1.00 31.83 ? 332  LEU A CG  1 
ATOM   2623 C  CD1 . LEU A 1 332 ? 99.811  48.508 34.131  1.00 31.70 ? 332  LEU A CD1 1 
ATOM   2624 C  CD2 . LEU A 1 332 ? 101.010 50.729 34.165  1.00 29.86 ? 332  LEU A CD2 1 
ATOM   2625 N  N   . LEU A 1 333 ? 102.442 48.966 29.310  1.00 36.66 ? 333  LEU A N   1 
ATOM   2626 C  CA  . LEU A 1 333 ? 103.519 48.493 28.459  1.00 39.05 ? 333  LEU A CA  1 
ATOM   2627 C  C   . LEU A 1 333 ? 104.067 49.677 27.646  1.00 40.32 ? 333  LEU A C   1 
ATOM   2628 O  O   . LEU A 1 333 ? 105.271 49.808 27.394  1.00 42.21 ? 333  LEU A O   1 
ATOM   2629 C  CB  . LEU A 1 333 ? 102.990 47.364 27.571  1.00 38.52 ? 333  LEU A CB  1 
ATOM   2630 C  CG  . LEU A 1 333 ? 103.983 46.905 26.540  1.00 40.14 ? 333  LEU A CG  1 
ATOM   2631 C  CD1 . LEU A 1 333 ? 105.200 46.406 27.277  1.00 41.74 ? 333  LEU A CD1 1 
ATOM   2632 C  CD2 . LEU A 1 333 ? 103.392 45.838 25.680  1.00 39.06 ? 333  LEU A CD2 1 
ATOM   2633 N  N   . TYR A 1 334 ? 103.182 50.590 27.296  1.00 39.68 ? 334  TYR A N   1 
ATOM   2634 C  CA  . TYR A 1 334 ? 103.592 51.674 26.408  1.00 40.08 ? 334  TYR A CA  1 
ATOM   2635 C  C   . TYR A 1 334 ? 104.229 52.814 27.145  1.00 40.95 ? 334  TYR A C   1 
ATOM   2636 O  O   . TYR A 1 334 ? 105.227 53.359 26.669  1.00 43.91 ? 334  TYR A O   1 
ATOM   2637 C  CB  . TYR A 1 334 ? 102.403 52.158 25.548  1.00 38.78 ? 334  TYR A CB  1 
ATOM   2638 C  CG  . TYR A 1 334 ? 102.289 51.320 24.333  1.00 36.35 ? 334  TYR A CG  1 
ATOM   2639 C  CD1 . TYR A 1 334 ? 101.866 50.003 24.429  1.00 36.07 ? 334  TYR A CD1 1 
ATOM   2640 C  CD2 . TYR A 1 334 ? 102.679 51.809 23.085  1.00 34.78 ? 334  TYR A CD2 1 
ATOM   2641 C  CE1 . TYR A 1 334 ? 101.792 49.188 23.297  1.00 34.56 ? 334  TYR A CE1 1 
ATOM   2642 C  CE2 . TYR A 1 334 ? 102.606 51.011 21.951  1.00 34.32 ? 334  TYR A CE2 1 
ATOM   2643 C  CZ  . TYR A 1 334 ? 102.152 49.702 22.073  1.00 33.63 ? 334  TYR A CZ  1 
ATOM   2644 O  OH  . TYR A 1 334 ? 102.072 48.899 20.982  1.00 34.62 ? 334  TYR A OH  1 
ATOM   2645 N  N   . GLY A 1 335 ? 103.691 53.150 28.315  1.00 39.34 ? 335  GLY A N   1 
ATOM   2646 C  CA  . GLY A 1 335 ? 104.076 54.381 28.985  1.00 39.57 ? 335  GLY A CA  1 
ATOM   2647 C  C   . GLY A 1 335 ? 104.660 54.311 30.386  1.00 39.65 ? 335  GLY A C   1 
ATOM   2648 O  O   . GLY A 1 335 ? 105.137 55.323 30.877  1.00 41.58 ? 335  GLY A O   1 
ATOM   2649 N  N   . ALA A 1 336 ? 104.648 53.149 31.042  1.00 37.77 ? 336  ALA A N   1 
ATOM   2650 C  CA  . ALA A 1 336 ? 105.099 53.090 32.431  1.00 36.27 ? 336  ALA A CA  1 
ATOM   2651 C  C   . ALA A 1 336 ? 106.492 52.464 32.581  1.00 36.94 ? 336  ALA A C   1 
ATOM   2652 O  O   . ALA A 1 336 ? 106.855 51.525 31.848  1.00 37.20 ? 336  ALA A O   1 
ATOM   2653 C  CB  . ALA A 1 336 ? 104.089 52.377 33.286  1.00 34.98 ? 336  ALA A CB  1 
ATOM   2654 N  N   . PRO A 1 337 ? 107.282 52.974 33.527  1.00 36.72 ? 337  PRO A N   1 
ATOM   2655 C  CA  . PRO A 1 337 ? 108.655 52.422 33.654  1.00 38.69 ? 337  PRO A CA  1 
ATOM   2656 C  C   . PRO A 1 337 ? 108.689 51.034 34.281  1.00 39.01 ? 337  PRO A C   1 
ATOM   2657 O  O   . PRO A 1 337 ? 107.917 50.760 35.192  1.00 38.20 ? 337  PRO A O   1 
ATOM   2658 C  CB  . PRO A 1 337 ? 109.356 53.412 34.583  1.00 39.38 ? 337  PRO A CB  1 
ATOM   2659 C  CG  . PRO A 1 337 ? 108.231 54.063 35.367  1.00 37.57 ? 337  PRO A CG  1 
ATOM   2660 C  CD  . PRO A 1 337 ? 107.012 54.066 34.480  1.00 35.79 ? 337  PRO A CD  1 
ATOM   2661 N  N   . GLY A 1 338 ? 109.581 50.173 33.788  1.00 40.94 ? 338  GLY A N   1 
ATOM   2662 C  CA  . GLY A 1 338 ? 109.734 48.819 34.304  1.00 41.07 ? 338  GLY A CA  1 
ATOM   2663 C  C   . GLY A 1 338 ? 109.012 47.744 33.511  1.00 41.08 ? 338  GLY A C   1 
ATOM   2664 O  O   . GLY A 1 338 ? 109.296 46.548 33.683  1.00 41.76 ? 338  GLY A O   1 
ATOM   2665 N  N   . PHE A 1 339 ? 108.088 48.144 32.640  1.00 40.01 ? 339  PHE A N   1 
ATOM   2666 C  CA  . PHE A 1 339 ? 107.333 47.168 31.820  1.00 40.08 ? 339  PHE A CA  1 
ATOM   2667 C  C   . PHE A 1 339 ? 107.997 46.877 30.480  1.00 41.68 ? 339  PHE A C   1 
ATOM   2668 O  O   . PHE A 1 339 ? 108.644 47.759 29.911  1.00 43.08 ? 339  PHE A O   1 
ATOM   2669 C  CB  . PHE A 1 339 ? 105.885 47.597 31.596  1.00 37.24 ? 339  PHE A CB  1 
ATOM   2670 C  CG  . PHE A 1 339 ? 105.084 47.685 32.856  1.00 36.09 ? 339  PHE A CG  1 
ATOM   2671 C  CD1 . PHE A 1 339 ? 105.149 48.814 33.662  1.00 34.60 ? 339  PHE A CD1 1 
ATOM   2672 C  CD2 . PHE A 1 339 ? 104.230 46.649 33.223  1.00 34.85 ? 339  PHE A CD2 1 
ATOM   2673 C  CE1 . PHE A 1 339 ? 104.379 48.897 34.844  1.00 32.67 ? 339  PHE A CE1 1 
ATOM   2674 C  CE2 . PHE A 1 339 ? 103.470 46.717 34.393  1.00 31.41 ? 339  PHE A CE2 1 
ATOM   2675 C  CZ  . PHE A 1 339 ? 103.551 47.848 35.201  1.00 31.57 ? 339  PHE A CZ  1 
ATOM   2676 N  N   . SER A 1 340 ? 107.797 45.644 29.992  1.00 42.17 ? 340  SER A N   1 
ATOM   2677 C  CA  A SER A 1 340 ? 108.424 45.158 28.763  0.50 43.56 ? 340  SER A CA  1 
ATOM   2678 C  CA  B SER A 1 340 ? 108.425 45.154 28.768  0.50 43.58 ? 340  SER A CA  1 
ATOM   2679 C  C   . SER A 1 340 ? 107.620 44.021 28.151  1.00 43.25 ? 340  SER A C   1 
ATOM   2680 O  O   . SER A 1 340 ? 107.028 43.213 28.860  1.00 42.88 ? 340  SER A O   1 
ATOM   2681 C  CB  A SER A 1 340 ? 109.847 44.678 29.041  0.50 45.32 ? 340  SER A CB  1 
ATOM   2682 C  CB  B SER A 1 340 ? 109.836 44.662 29.060  0.50 45.33 ? 340  SER A CB  1 
ATOM   2683 O  OG  A SER A 1 340 ? 110.507 44.340 27.836  0.50 47.89 ? 340  SER A OG  1 
ATOM   2684 O  OG  B SER A 1 340 ? 110.281 43.809 28.028  0.50 47.89 ? 340  SER A OG  1 
ATOM   2685 N  N   . LYS A 1 341 ? 107.608 43.967 26.824  1.00 44.09 ? 341  LYS A N   1 
ATOM   2686 C  CA  . LYS A 1 341 ? 106.917 42.899 26.083  1.00 44.24 ? 341  LYS A CA  1 
ATOM   2687 C  C   . LYS A 1 341 ? 107.676 41.583 26.316  1.00 45.78 ? 341  LYS A C   1 
ATOM   2688 O  O   . LYS A 1 341 ? 107.090 40.503 26.344  1.00 45.82 ? 341  LYS A O   1 
ATOM   2689 C  CB  . LYS A 1 341 ? 106.881 43.224 24.571  1.00 43.42 ? 341  LYS A CB  1 
ATOM   2690 C  CG  . LYS A 1 341 ? 105.763 42.541 23.812  1.00 42.84 ? 341  LYS A CG  1 
ATOM   2691 C  CD  . LYS A 1 341 ? 105.717 42.858 22.296  1.00 42.78 ? 341  LYS A CD  1 
ATOM   2692 C  CE  . LYS A 1 341 ? 107.027 42.658 21.572  1.00 44.46 ? 341  LYS A CE  1 
ATOM   2693 N  NZ  . LYS A 1 341 ? 107.310 41.220 21.360  1.00 48.32 ? 341  LYS A NZ  1 
ATOM   2694 N  N   . ASP A 1 342 ? 108.980 41.704 26.501  1.00 47.28 ? 342  ASP A N   1 
ATOM   2695 C  CA  . ASP A 1 342 ? 109.874 40.553 26.415  1.00 50.46 ? 342  ASP A CA  1 
ATOM   2696 C  C   . ASP A 1 342 ? 110.344 40.005 27.766  1.00 50.58 ? 342  ASP A C   1 
ATOM   2697 O  O   . ASP A 1 342 ? 111.261 39.177 27.847  1.00 52.92 ? 342  ASP A O   1 
ATOM   2698 C  CB  . ASP A 1 342 ? 111.045 40.895 25.487  1.00 52.55 ? 342  ASP A CB  1 
ATOM   2699 C  CG  . ASP A 1 342 ? 110.568 41.438 24.143  1.00 54.19 ? 342  ASP A CG  1 
ATOM   2700 O  OD1 . ASP A 1 342 ? 109.841 40.710 23.411  1.00 54.82 ? 342  ASP A OD1 1 
ATOM   2701 O  OD2 . ASP A 1 342 ? 110.902 42.604 23.833  1.00 55.81 ? 342  ASP A OD2 1 
ATOM   2702 N  N   . SER A 1 343 ? 109.684 40.450 28.820  1.00 48.51 ? 343  SER A N   1 
ATOM   2703 C  CA  . SER A 1 343 ? 109.988 39.984 30.153  1.00 49.18 ? 343  SER A CA  1 
ATOM   2704 C  C   . SER A 1 343 ? 108.713 39.915 30.988  1.00 47.07 ? 343  SER A C   1 
ATOM   2705 O  O   . SER A 1 343 ? 107.674 40.423 30.579  1.00 45.40 ? 343  SER A O   1 
ATOM   2706 C  CB  . SER A 1 343 ? 111.026 40.910 30.808  1.00 49.90 ? 343  SER A CB  1 
ATOM   2707 O  OG  . SER A 1 343 ? 110.387 42.000 31.476  1.00 47.77 ? 343  SER A OG  1 
ATOM   2708 N  N   . GLU A 1 344 ? 108.821 39.284 32.154  1.00 47.44 ? 344  GLU A N   1 
ATOM   2709 C  CA  . GLU A 1 344 ? 107.744 39.141 33.124  1.00 46.08 ? 344  GLU A CA  1 
ATOM   2710 C  C   . GLU A 1 344 ? 107.356 40.455 33.804  1.00 43.41 ? 344  GLU A C   1 
ATOM   2711 O  O   . GLU A 1 344 ? 106.315 40.522 34.477  1.00 42.48 ? 344  GLU A O   1 
ATOM   2712 C  CB  . GLU A 1 344 ? 108.165 38.149 34.207  1.00 48.29 ? 344  GLU A CB  1 
ATOM   2713 C  CG  . GLU A 1 344 ? 108.157 36.708 33.739  1.00 53.61 ? 344  GLU A CG  1 
ATOM   2714 C  CD  . GLU A 1 344 ? 108.192 35.721 34.897  1.00 61.19 ? 344  GLU A CD  1 
ATOM   2715 O  OE1 . GLU A 1 344 ? 108.411 36.149 36.063  1.00 62.05 ? 344  GLU A OE1 1 
ATOM   2716 O  OE2 . GLU A 1 344 ? 107.989 34.509 34.632  1.00 64.31 ? 344  GLU A OE2 1 
ATOM   2717 N  N   . SER A 1 345 ? 108.207 41.472 33.660  1.00 41.89 ? 345  SER A N   1 
ATOM   2718 C  CA  . SER A 1 345 ? 107.898 42.845 34.058  1.00 39.36 ? 345  SER A CA  1 
ATOM   2719 C  C   . SER A 1 345 ? 107.611 42.977 35.547  1.00 38.42 ? 345  SER A C   1 
ATOM   2720 O  O   . SER A 1 345 ? 106.638 43.614 35.940  1.00 35.58 ? 345  SER A O   1 
ATOM   2721 C  CB  . SER A 1 345 ? 106.729 43.441 33.238  1.00 36.97 ? 345  SER A CB  1 
ATOM   2722 O  OG  . SER A 1 345 ? 107.046 43.556 31.857  1.00 37.11 ? 345  SER A OG  1 
ATOM   2723 N  N   . LYS A 1 346 ? 108.481 42.372 36.350  1.00 39.94 ? 346  LYS A N   1 
ATOM   2724 C  CA  . LYS A 1 346 ? 108.431 42.510 37.800  1.00 40.62 ? 346  LYS A CA  1 
ATOM   2725 C  C   . LYS A 1 346 ? 108.743 43.959 38.143  1.00 40.16 ? 346  LYS A C   1 
ATOM   2726 O  O   . LYS A 1 346 ? 109.772 44.519 37.725  1.00 41.14 ? 346  LYS A O   1 
ATOM   2727 C  CB  . LYS A 1 346 ? 109.405 41.557 38.492  1.00 42.03 ? 346  LYS A CB  1 
ATOM   2728 C  CG  . LYS A 1 346 ? 109.001 40.082 38.363  1.00 45.43 ? 346  LYS A CG  1 
ATOM   2729 C  CD  . LYS A 1 346 ? 110.018 39.146 39.017  1.00 51.08 ? 346  LYS A CD  1 
ATOM   2730 C  CE  . LYS A 1 346 ? 109.697 37.691 38.723  1.00 54.67 ? 346  LYS A CE  1 
ATOM   2731 N  NZ  . LYS A 1 346 ? 110.458 36.818 39.674  1.00 60.00 ? 346  LYS A NZ  1 
ATOM   2732 N  N   . ILE A 1 347 ? 107.844 44.562 38.902  1.00 38.41 ? 347  ILE A N   1 
ATOM   2733 C  CA  . ILE A 1 347 ? 107.902 45.991 39.132  1.00 37.89 ? 347  ILE A CA  1 
ATOM   2734 C  C   . ILE A 1 347 ? 108.515 46.335 40.511  1.00 38.18 ? 347  ILE A C   1 
ATOM   2735 O  O   . ILE A 1 347 ? 108.009 45.928 41.557  1.00 37.41 ? 347  ILE A O   1 
ATOM   2736 C  CB  . ILE A 1 347 ? 106.471 46.615 38.912  1.00 35.99 ? 347  ILE A CB  1 
ATOM   2737 C  CG1 . ILE A 1 347 ? 106.019 46.450 37.447  1.00 36.22 ? 347  ILE A CG1 1 
ATOM   2738 C  CG2 . ILE A 1 347 ? 106.419 48.086 39.283  1.00 35.00 ? 347  ILE A CG2 1 
ATOM   2739 C  CD1 . ILE A 1 347 ? 107.013 46.989 36.372  1.00 32.65 ? 347  ILE A CD1 1 
ATOM   2740 N  N   . SER A 1 348 ? 109.605 47.087 40.508  1.00 39.32 ? 348  SER A N   1 
ATOM   2741 C  CA  . SER A 1 348 ? 110.163 47.600 41.762  1.00 40.84 ? 348  SER A CA  1 
ATOM   2742 C  C   . SER A 1 348 ? 109.175 48.576 42.424  1.00 40.32 ? 348  SER A C   1 
ATOM   2743 O  O   . SER A 1 348 ? 108.253 49.078 41.791  1.00 39.26 ? 348  SER A O   1 
ATOM   2744 C  CB  . SER A 1 348 ? 111.464 48.334 41.503  1.00 41.61 ? 348  SER A CB  1 
ATOM   2745 O  OG  . SER A 1 348 ? 111.160 49.631 41.018  1.00 41.58 ? 348  SER A OG  1 
ATOM   2746 N  N   . ARG A 1 349 ? 109.408 48.855 43.695  1.00 41.30 ? 349  ARG A N   1 
ATOM   2747 C  CA  . ARG A 1 349 ? 108.628 49.820 44.462  1.00 40.71 ? 349  ARG A CA  1 
ATOM   2748 C  C   . ARG A 1 349 ? 108.751 51.255 43.918  1.00 39.80 ? 349  ARG A C   1 
ATOM   2749 O  O   . ARG A 1 349 ? 107.758 51.984 43.830  1.00 38.41 ? 349  ARG A O   1 
ATOM   2750 C  CB  . ARG A 1 349 ? 109.108 49.783 45.920  1.00 41.70 ? 349  ARG A CB  1 
ATOM   2751 C  CG  . ARG A 1 349 ? 108.259 50.558 46.840  1.00 44.41 ? 349  ARG A CG  1 
ATOM   2752 C  CD  . ARG A 1 349 ? 107.292 49.627 47.482  1.00 47.55 ? 349  ARG A CD  1 
ATOM   2753 N  NE  . ARG A 1 349 ? 105.962 50.184 47.546  1.00 46.59 ? 349  ARG A NE  1 
ATOM   2754 C  CZ  . ARG A 1 349 ? 104.890 49.541 47.106  1.00 46.06 ? 349  ARG A CZ  1 
ATOM   2755 N  NH1 . ARG A 1 349 ? 105.016 48.336 46.573  1.00 48.83 ? 349  ARG A NH1 1 
ATOM   2756 N  NH2 . ARG A 1 349 ? 103.701 50.096 47.202  1.00 43.83 ? 349  ARG A NH2 1 
ATOM   2757 N  N   . GLU A 1 350 ? 109.976 51.677 43.601  1.00 41.34 ? 350  GLU A N   1 
ATOM   2758 C  CA  . GLU A 1 350 ? 110.198 52.955 42.904  1.00 41.37 ? 350  GLU A CA  1 
ATOM   2759 C  C   . GLU A 1 350 ? 109.314 53.086 41.630  1.00 40.42 ? 350  GLU A C   1 
ATOM   2760 O  O   . GLU A 1 350 ? 108.618 54.088 41.467  1.00 39.62 ? 350  GLU A O   1 
ATOM   2761 C  CB  . GLU A 1 350 ? 111.687 53.161 42.577  1.00 42.94 ? 350  GLU A CB  1 
ATOM   2762 C  CG  . GLU A 1 350 ? 112.040 54.621 42.236  0.50 42.83 ? 350  GLU A CG  1 
ATOM   2763 C  CD  . GLU A 1 350 ? 113.481 54.822 41.834  0.50 43.42 ? 350  GLU A CD  1 
ATOM   2764 O  OE1 . GLU A 1 350 ? 113.854 54.373 40.741  0.50 42.45 ? 350  GLU A OE1 1 
ATOM   2765 O  OE2 . GLU A 1 350 ? 114.237 55.452 42.601  0.50 45.67 ? 350  GLU A OE2 1 
ATOM   2766 N  N   . ASP A 1 351 ? 109.317 52.063 40.765  1.00 40.52 ? 351  ASP A N   1 
ATOM   2767 C  CA  . ASP A 1 351 ? 108.537 52.081 39.505  1.00 39.76 ? 351  ASP A CA  1 
ATOM   2768 C  C   . ASP A 1 351 ? 107.025 51.976 39.706  1.00 38.53 ? 351  ASP A C   1 
ATOM   2769 O  O   . ASP A 1 351 ? 106.226 52.470 38.869  1.00 37.84 ? 351  ASP A O   1 
ATOM   2770 C  CB  . ASP A 1 351 ? 108.984 50.958 38.557  1.00 40.00 ? 351  ASP A CB  1 
ATOM   2771 C  CG  . ASP A 1 351 ? 110.333 51.238 37.892  1.00 40.57 ? 351  ASP A CG  1 
ATOM   2772 O  OD1 . ASP A 1 351 ? 110.849 52.382 38.000  1.00 35.68 ? 351  ASP A OD1 1 
ATOM   2773 O  OD2 . ASP A 1 351 ? 110.850 50.302 37.231  1.00 38.78 ? 351  ASP A OD2 1 
ATOM   2774 N  N   . PHE A 1 352 ? 106.619 51.323 40.792  1.00 37.92 ? 352  PHE A N   1 
ATOM   2775 C  CA  . PHE A 1 352 ? 105.199 51.288 41.146  1.00 36.56 ? 352  PHE A CA  1 
ATOM   2776 C  C   . PHE A 1 352 ? 104.762 52.712 41.512  1.00 36.81 ? 352  PHE A C   1 
ATOM   2777 O  O   . PHE A 1 352 ? 103.755 53.197 41.020  1.00 35.90 ? 352  PHE A O   1 
ATOM   2778 C  CB  . PHE A 1 352 ? 104.946 50.310 42.295  1.00 35.71 ? 352  PHE A CB  1 
ATOM   2779 C  CG  . PHE A 1 352 ? 103.526 50.283 42.786  1.00 32.19 ? 352  PHE A CG  1 
ATOM   2780 C  CD1 . PHE A 1 352 ? 103.103 51.154 43.801  1.00 32.66 ? 352  PHE A CD1 1 
ATOM   2781 C  CD2 . PHE A 1 352 ? 102.618 49.359 42.270  1.00 30.09 ? 352  PHE A CD2 1 
ATOM   2782 C  CE1 . PHE A 1 352 ? 101.781 51.117 44.284  1.00 30.86 ? 352  PHE A CE1 1 
ATOM   2783 C  CE2 . PHE A 1 352 ? 101.293 49.289 42.741  1.00 26.09 ? 352  PHE A CE2 1 
ATOM   2784 C  CZ  . PHE A 1 352 ? 100.870 50.185 43.740  1.00 28.58 ? 352  PHE A CZ  1 
ATOM   2785 N  N   . MET A 1 353 ? 105.527 53.380 42.371  1.00 38.19 ? 353  MET A N   1 
ATOM   2786 C  CA  . MET A 1 353 ? 105.211 54.776 42.728  1.00 38.70 ? 353  MET A CA  1 
ATOM   2787 C  C   . MET A 1 353 ? 105.072 55.651 41.483  1.00 37.44 ? 353  MET A C   1 
ATOM   2788 O  O   . MET A 1 353 ? 104.098 56.386 41.333  1.00 36.89 ? 353  MET A O   1 
ATOM   2789 C  CB  . MET A 1 353 ? 106.251 55.379 43.693  1.00 40.34 ? 353  MET A CB  1 
ATOM   2790 C  CG  . MET A 1 353 ? 106.282 54.717 45.081  1.00 45.22 ? 353  MET A CG  1 
ATOM   2791 S  SD  . MET A 1 353 ? 107.370 55.468 46.343  1.00 51.68 ? 353  MET A SD  1 
ATOM   2792 C  CE  . MET A 1 353 ? 109.031 55.296 45.646  1.00 52.41 ? 353  MET A CE  1 
ATOM   2793 N  N   . SER A 1 354 ? 106.042 55.561 40.587  1.00 37.49 ? 354  SER A N   1 
ATOM   2794 C  CA  A SER A 1 354 ? 106.030 56.428 39.429  0.50 37.92 ? 354  SER A CA  1 
ATOM   2795 C  CA  B SER A 1 354 ? 106.071 56.379 39.378  0.50 36.95 ? 354  SER A CA  1 
ATOM   2796 C  C   . SER A 1 354 ? 104.871 56.070 38.490  1.00 36.49 ? 354  SER A C   1 
ATOM   2797 O  O   . SER A 1 354 ? 104.285 56.962 37.867  1.00 36.95 ? 354  SER A O   1 
ATOM   2798 C  CB  A SER A 1 354 ? 107.400 56.465 38.733  0.50 39.29 ? 354  SER A CB  1 
ATOM   2799 C  CB  B SER A 1 354 ? 107.384 56.167 38.608  0.50 37.99 ? 354  SER A CB  1 
ATOM   2800 O  OG  A SER A 1 354 ? 107.498 55.482 37.733  0.50 39.67 ? 354  SER A OG  1 
ATOM   2801 O  OG  B SER A 1 354 ? 108.453 56.905 39.176  0.50 34.32 ? 354  SER A OG  1 
ATOM   2802 N  N   . GLY A 1 355 ? 104.511 54.788 38.445  1.00 35.53 ? 355  GLY A N   1 
ATOM   2803 C  CA  . GLY A 1 355 ? 103.344 54.311 37.730  1.00 33.64 ? 355  GLY A CA  1 
ATOM   2804 C  C   . GLY A 1 355 ? 101.991 54.772 38.270  1.00 33.67 ? 355  GLY A C   1 
ATOM   2805 O  O   . GLY A 1 355 ? 101.088 55.047 37.470  1.00 33.60 ? 355  GLY A O   1 
ATOM   2806 N  N   . VAL A 1 356 ? 101.793 54.865 39.588  1.00 33.12 ? 356  VAL A N   1 
ATOM   2807 C  CA  . VAL A 1 356 ? 100.480 55.340 40.025  1.00 32.44 ? 356  VAL A CA  1 
ATOM   2808 C  C   . VAL A 1 356 ? 100.321 56.823 39.695  1.00 33.29 ? 356  VAL A C   1 
ATOM   2809 O  O   . VAL A 1 356 ? 99.240  57.258 39.334  1.00 32.05 ? 356  VAL A O   1 
ATOM   2810 C  CB  . VAL A 1 356 ? 100.079 55.024 41.533  1.00 32.90 ? 356  VAL A CB  1 
ATOM   2811 C  CG1 . VAL A 1 356 ? 101.004 54.082 42.162  1.00 32.60 ? 356  VAL A CG1 1 
ATOM   2812 C  CG2 . VAL A 1 356 ? 99.935  56.271 42.389  1.00 33.34 ? 356  VAL A CG2 1 
ATOM   2813 N  N   . LYS A 1 357 ? 101.408 57.585 39.814  1.00 35.07 ? 357  LYS A N   1 
ATOM   2814 C  CA  . LYS A 1 357 ? 101.404 58.965 39.393  1.00 36.37 ? 357  LYS A CA  1 
ATOM   2815 C  C   . LYS A 1 357 ? 100.997 59.100 37.902  1.00 35.99 ? 357  LYS A C   1 
ATOM   2816 O  O   . LYS A 1 357 ? 100.132 59.909 37.587  1.00 35.40 ? 357  LYS A O   1 
ATOM   2817 C  CB  . LYS A 1 357 ? 102.761 59.589 39.650  1.00 38.32 ? 357  LYS A CB  1 
ATOM   2818 C  CG  . LYS A 1 357 ? 102.903 60.993 39.088  1.00 41.50 ? 357  LYS A CG  1 
ATOM   2819 C  CD  . LYS A 1 357 ? 102.584 62.072 40.115  1.00 44.78 ? 357  LYS A CD  1 
ATOM   2820 C  CE  . LYS A 1 357 ? 103.252 63.389 39.731  1.00 48.52 ? 357  LYS A CE  1 
ATOM   2821 N  NZ  . LYS A 1 357 ? 102.904 64.469 40.700  1.00 51.32 ? 357  LYS A NZ  1 
ATOM   2822 N  N   . LEU A 1 358 ? 101.593 58.303 37.006  1.00 35.39 ? 358  LEU A N   1 
ATOM   2823 C  CA  . LEU A 1 358 ? 101.250 58.378 35.567  1.00 35.25 ? 358  LEU A CA  1 
ATOM   2824 C  C   . LEU A 1 358 ? 99.781  57.965 35.313  1.00 34.18 ? 358  LEU A C   1 
ATOM   2825 O  O   . LEU A 1 358 ? 99.130  58.513 34.414  1.00 33.86 ? 358  LEU A O   1 
ATOM   2826 C  CB  . LEU A 1 358 ? 102.192 57.498 34.716  1.00 35.08 ? 358  LEU A CB  1 
ATOM   2827 C  CG  . LEU A 1 358 ? 103.696 57.849 34.594  1.00 37.69 ? 358  LEU A CG  1 
ATOM   2828 C  CD1 . LEU A 1 358 ? 104.506 56.674 34.018  1.00 34.51 ? 358  LEU A CD1 1 
ATOM   2829 C  CD2 . LEU A 1 358 ? 103.915 59.099 33.717  1.00 33.59 ? 358  LEU A CD2 1 
ATOM   2830 N  N   . SER A 1 359 ? 99.291  57.025 36.136  1.00 33.17 ? 359  SER A N   1 
ATOM   2831 C  CA  . SER A 1 359 ? 97.963  56.431 36.037  1.00 33.07 ? 359  SER A CA  1 
ATOM   2832 C  C   . SER A 1 359 ? 96.860  57.320 36.539  1.00 33.22 ? 359  SER A C   1 
ATOM   2833 O  O   . SER A 1 359 ? 95.718  57.166 36.115  1.00 33.83 ? 359  SER A O   1 
ATOM   2834 C  CB  . SER A 1 359 ? 97.877  55.126 36.852  1.00 31.84 ? 359  SER A CB  1 
ATOM   2835 O  OG  . SER A 1 359 ? 98.822  54.195 36.395  1.00 31.46 ? 359  SER A OG  1 
ATOM   2836 N  N   . VAL A 1 360 ? 97.169  58.175 37.499  1.00 33.95 ? 360  VAL A N   1 
ATOM   2837 C  CA  . VAL A 1 360 ? 96.164  59.068 38.092  1.00 34.82 ? 360  VAL A CA  1 
ATOM   2838 C  C   . VAL A 1 360 ? 96.753  60.469 38.107  1.00 36.56 ? 360  VAL A C   1 
ATOM   2839 O  O   . VAL A 1 360 ? 96.978  61.047 39.175  1.00 38.10 ? 360  VAL A O   1 
ATOM   2840 C  CB  . VAL A 1 360 ? 95.743  58.596 39.520  1.00 34.18 ? 360  VAL A CB  1 
ATOM   2841 C  CG1 . VAL A 1 360 ? 94.393  59.159 39.915  1.00 34.78 ? 360  VAL A CG1 1 
ATOM   2842 C  CG2 . VAL A 1 360 ? 95.621  57.061 39.555  1.00 34.18 ? 360  VAL A CG2 1 
ATOM   2843 N  N   . PRO A 1 361 ? 96.987  61.031 36.912  1.00 37.02 ? 361  PRO A N   1 
ATOM   2844 C  CA  . PRO A 1 361 ? 97.744  62.251 36.713  1.00 39.59 ? 361  PRO A CA  1 
ATOM   2845 C  C   . PRO A 1 361 ? 97.082  63.500 37.321  1.00 41.50 ? 361  PRO A C   1 
ATOM   2846 O  O   . PRO A 1 361 ? 97.768  64.505 37.603  1.00 42.36 ? 361  PRO A O   1 
ATOM   2847 C  CB  . PRO A 1 361 ? 97.793  62.369 35.189  1.00 39.39 ? 361  PRO A CB  1 
ATOM   2848 C  CG  . PRO A 1 361 ? 96.588  61.695 34.722  1.00 37.44 ? 361  PRO A CG  1 
ATOM   2849 C  CD  . PRO A 1 361 ? 96.333  60.591 35.668  1.00 36.68 ? 361  PRO A CD  1 
ATOM   2850 N  N   . HIS A 1 362 ? 95.765  63.419 37.501  1.00 41.83 ? 362  HIS A N   1 
ATOM   2851 C  CA  . HIS A 1 362 ? 94.966  64.454 38.142  1.00 44.67 ? 362  HIS A CA  1 
ATOM   2852 C  C   . HIS A 1 362 ? 95.005  64.419 39.692  1.00 45.57 ? 362  HIS A C   1 
ATOM   2853 O  O   . HIS A 1 362 ? 94.508  65.351 40.355  1.00 47.15 ? 362  HIS A O   1 
ATOM   2854 C  CB  . HIS A 1 362 ? 93.513  64.399 37.614  1.00 45.01 ? 362  HIS A CB  1 
ATOM   2855 C  CG  . HIS A 1 362 ? 92.808  63.093 37.870  1.00 45.93 ? 362  HIS A CG  1 
ATOM   2856 N  ND1 . HIS A 1 362 ? 93.078  61.937 37.160  1.00 46.24 ? 362  HIS A ND1 1 
ATOM   2857 C  CD2 . HIS A 1 362 ? 91.836  62.766 38.759  1.00 47.00 ? 362  HIS A CD2 1 
ATOM   2858 C  CE1 . HIS A 1 362 ? 92.309  60.959 37.606  1.00 46.79 ? 362  HIS A CE1 1 
ATOM   2859 N  NE2 . HIS A 1 362 ? 91.539  61.437 38.570  1.00 46.50 ? 362  HIS A NE2 1 
ATOM   2860 N  N   . ALA A 1 363 ? 95.594  63.367 40.278  1.00 44.50 ? 363  ALA A N   1 
ATOM   2861 C  CA  . ALA A 1 363 ? 95.608  63.249 41.750  1.00 43.65 ? 363  ALA A CA  1 
ATOM   2862 C  C   . ALA A 1 363 ? 96.666  64.132 42.377  1.00 44.12 ? 363  ALA A C   1 
ATOM   2863 O  O   . ALA A 1 363 ? 97.766  64.224 41.844  1.00 45.01 ? 363  ALA A O   1 
ATOM   2864 C  CB  . ALA A 1 363 ? 95.822  61.795 42.183  1.00 42.29 ? 363  ALA A CB  1 
ATOM   2865 N  N   . ASN A 1 364 ? 96.344  64.754 43.515  1.00 43.45 ? 364  ASN A N   1 
ATOM   2866 C  CA  . ASN A 1 364 ? 97.371  65.330 44.385  1.00 43.57 ? 364  ASN A CA  1 
ATOM   2867 C  C   . ASN A 1 364 ? 98.136  64.240 45.140  1.00 42.18 ? 364  ASN A C   1 
ATOM   2868 O  O   . ASN A 1 364 ? 97.886  63.038 44.954  1.00 39.91 ? 364  ASN A O   1 
ATOM   2869 C  CB  . ASN A 1 364 ? 96.783  66.359 45.372  1.00 45.14 ? 364  ASN A CB  1 
ATOM   2870 C  CG  . ASN A 1 364 ? 95.703  65.783 46.287  1.00 45.21 ? 364  ASN A CG  1 
ATOM   2871 O  OD1 . ASN A 1 364 ? 95.424  64.580 46.282  1.00 46.96 ? 364  ASN A OD1 1 
ATOM   2872 N  ND2 . ASN A 1 364 ? 95.082  66.652 47.073  1.00 46.05 ? 364  ASN A ND2 1 
ATOM   2873 N  N   . ASP A 1 365 ? 99.060  64.645 46.002  1.00 42.29 ? 365  ASP A N   1 
ATOM   2874 C  CA  . ASP A 1 365 ? 99.863  63.662 46.713  1.00 42.00 ? 365  ASP A CA  1 
ATOM   2875 C  C   . ASP A 1 365 ? 99.045  62.759 47.671  1.00 40.15 ? 365  ASP A C   1 
ATOM   2876 O  O   . ASP A 1 365 ? 99.367  61.574 47.834  1.00 37.76 ? 365  ASP A O   1 
ATOM   2877 C  CB  . ASP A 1 365 ? 101.021 64.339 47.444  1.00 44.32 ? 365  ASP A CB  1 
ATOM   2878 C  CG  . ASP A 1 365 ? 102.161 64.736 46.503  1.00 49.11 ? 365  ASP A CG  1 
ATOM   2879 O  OD1 . ASP A 1 365 ? 102.044 64.557 45.253  1.00 49.89 ? 365  ASP A OD1 1 
ATOM   2880 O  OD2 . ASP A 1 365 ? 103.177 65.262 47.025  1.00 55.50 ? 365  ASP A OD2 1 
ATOM   2881 N  N   . LEU A 1 366 ? 98.019  63.343 48.305  1.00 39.93 ? 366  LEU A N   1 
ATOM   2882 C  CA  . LEU A 1 366 ? 97.134  62.613 49.217  1.00 39.09 ? 366  LEU A CA  1 
ATOM   2883 C  C   . LEU A 1 366 ? 96.380  61.517 48.456  1.00 37.08 ? 366  LEU A C   1 
ATOM   2884 O  O   . LEU A 1 366 ? 96.301  60.408 48.925  1.00 37.14 ? 366  LEU A O   1 
ATOM   2885 C  CB  . LEU A 1 366 ? 96.157  63.553 49.922  1.00 39.20 ? 366  LEU A CB  1 
ATOM   2886 C  CG  . LEU A 1 366 ? 95.253  62.908 50.976  1.00 39.99 ? 366  LEU A CG  1 
ATOM   2887 C  CD1 . LEU A 1 366 ? 96.073  62.497 52.188  1.00 41.00 ? 366  LEU A CD1 1 
ATOM   2888 C  CD2 . LEU A 1 366 ? 94.132  63.821 51.430  1.00 39.87 ? 366  LEU A CD2 1 
ATOM   2889 N  N   . GLY A 1 367 ? 95.864  61.832 47.275  1.00 36.20 ? 367  GLY A N   1 
ATOM   2890 C  CA  . GLY A 1 367 ? 95.173  60.855 46.427  1.00 34.90 ? 367  GLY A CA  1 
ATOM   2891 C  C   . GLY A 1 367 ? 96.078  59.763 45.893  1.00 34.00 ? 367  GLY A C   1 
ATOM   2892 O  O   . GLY A 1 367 ? 95.657  58.580 45.767  1.00 33.73 ? 367  GLY A O   1 
ATOM   2893 N  N   . LEU A 1 368 ? 97.322  60.131 45.588  1.00 33.51 ? 368  LEU A N   1 
ATOM   2894 C  CA  . LEU A 1 368 ? 98.311  59.128 45.199  1.00 33.24 ? 368  LEU A CA  1 
ATOM   2895 C  C   . LEU A 1 368 ? 98.578  58.143 46.330  1.00 32.71 ? 368  LEU A C   1 
ATOM   2896 O  O   . LEU A 1 368 ? 98.654  56.962 46.094  1.00 32.05 ? 368  LEU A O   1 
ATOM   2897 C  CB  . LEU A 1 368 ? 99.617  59.758 44.680  1.00 33.66 ? 368  LEU A CB  1 
ATOM   2898 C  CG  . LEU A 1 368 ? 99.438  60.624 43.436  1.00 34.08 ? 368  LEU A CG  1 
ATOM   2899 C  CD1 . LEU A 1 368 ? 100.689 61.474 43.227  1.00 38.53 ? 368  LEU A CD1 1 
ATOM   2900 C  CD2 . LEU A 1 368 ? 99.111  59.858 42.176  1.00 30.78 ? 368  LEU A CD2 1 
ATOM   2901 N  N   . ASP A 1 369 ? 98.716  58.643 47.547  1.00 33.77 ? 369  ASP A N   1 
ATOM   2902 C  CA  . ASP A 1 369 ? 98.899  57.803 48.716  1.00 34.48 ? 369  ASP A CA  1 
ATOM   2903 C  C   . ASP A 1 369 ? 97.677  56.917 48.938  1.00 33.16 ? 369  ASP A C   1 
ATOM   2904 O  O   . ASP A 1 369 ? 97.810  55.739 49.303  1.00 32.75 ? 369  ASP A O   1 
ATOM   2905 C  CB  . ASP A 1 369 ? 99.083  58.664 49.965  1.00 36.29 ? 369  ASP A CB  1 
ATOM   2906 C  CG  . ASP A 1 369 ? 100.461 59.323 50.043  1.00 41.09 ? 369  ASP A CG  1 
ATOM   2907 O  OD1 . ASP A 1 369 ? 101.358 59.029 49.195  1.00 43.79 ? 369  ASP A OD1 1 
ATOM   2908 O  OD2 . ASP A 1 369 ? 100.637 60.148 50.972  1.00 44.46 ? 369  ASP A OD2 1 
ATOM   2909 N  N   . ALA A 1 370 ? 96.499  57.498 48.734  1.00 31.51 ? 370  ALA A N   1 
ATOM   2910 C  CA  . ALA A 1 370 ? 95.270  56.773 48.858  1.00 31.22 ? 370  ALA A CA  1 
ATOM   2911 C  C   . ALA A 1 370 ? 95.222  55.574 47.875  1.00 30.15 ? 370  ALA A C   1 
ATOM   2912 O  O   . ALA A 1 370 ? 94.952  54.442 48.288  1.00 29.72 ? 370  ALA A O   1 
ATOM   2913 C  CB  . ALA A 1 370 ? 94.075  57.720 48.677  1.00 30.94 ? 370  ALA A CB  1 
ATOM   2914 N  N   . VAL A 1 371 ? 95.515  55.833 46.602  1.00 30.09 ? 371  VAL A N   1 
ATOM   2915 C  CA  . VAL A 1 371 ? 95.600  54.792 45.567  1.00 29.64 ? 371  VAL A CA  1 
ATOM   2916 C  C   . VAL A 1 371 ? 96.633  53.773 45.977  1.00 29.94 ? 371  VAL A C   1 
ATOM   2917 O  O   . VAL A 1 371 ? 96.363  52.584 45.985  1.00 30.09 ? 371  VAL A O   1 
ATOM   2918 C  CB  . VAL A 1 371 ? 95.993  55.362 44.156  1.00 28.66 ? 371  VAL A CB  1 
ATOM   2919 C  CG1 . VAL A 1 371 ? 96.228  54.257 43.176  1.00 28.34 ? 371  VAL A CG1 1 
ATOM   2920 C  CG2 . VAL A 1 371 ? 94.912  56.253 43.618  1.00 29.68 ? 371  VAL A CG2 1 
ATOM   2921 N  N   . THR A 1 372 ? 97.820  54.247 46.323  1.00 30.84 ? 372  THR A N   1 
ATOM   2922 C  CA  . THR A 1 372 ? 98.914  53.364 46.689  1.00 31.13 ? 372  THR A CA  1 
ATOM   2923 C  C   . THR A 1 372 ? 98.504  52.423 47.821  1.00 31.96 ? 372  THR A C   1 
ATOM   2924 O  O   . THR A 1 372 ? 98.724  51.221 47.741  1.00 31.22 ? 372  THR A O   1 
ATOM   2925 C  CB  . THR A 1 372 ? 100.122 54.190 47.088  1.00 32.37 ? 372  THR A CB  1 
ATOM   2926 O  OG1 . THR A 1 372 ? 100.579 54.892 45.933  1.00 29.09 ? 372  THR A OG1 1 
ATOM   2927 C  CG2 . THR A 1 372 ? 101.255 53.306 47.658  1.00 32.59 ? 372  THR A CG2 1 
ATOM   2928 N  N   . LEU A 1 373 ? 97.873  52.969 48.857  1.00 32.43 ? 373  LEU A N   1 
ATOM   2929 C  CA  . LEU A 1 373 ? 97.533  52.161 50.025  1.00 33.09 ? 373  LEU A CA  1 
ATOM   2930 C  C   . LEU A 1 373 ? 96.479  51.109 49.661  1.00 32.55 ? 373  LEU A C   1 
ATOM   2931 O  O   . LEU A 1 373 ? 96.486  49.988 50.198  1.00 31.52 ? 373  LEU A O   1 
ATOM   2932 C  CB  . LEU A 1 373 ? 97.029  53.034 51.190  1.00 33.95 ? 373  LEU A CB  1 
ATOM   2933 C  CG  . LEU A 1 373 ? 96.447  52.271 52.398  1.00 34.88 ? 373  LEU A CG  1 
ATOM   2934 C  CD1 . LEU A 1 373 ? 97.449  51.248 53.033  1.00 36.71 ? 373  LEU A CD1 1 
ATOM   2935 C  CD2 . LEU A 1 373 ? 95.939  53.208 53.465  1.00 35.56 ? 373  LEU A CD2 1 
ATOM   2936 N  N   . GLN A 1 374 ? 95.580  51.503 48.761  1.00 30.99 ? 374  GLN A N   1 
ATOM   2937 C  CA  . GLN A 1 374 ? 94.480  50.681 48.349  1.00 31.62 ? 374  GLN A CA  1 
ATOM   2938 C  C   . GLN A 1 374 ? 94.925  49.438 47.529  1.00 32.15 ? 374  GLN A C   1 
ATOM   2939 O  O   . GLN A 1 374 ? 94.261  48.412 47.551  1.00 31.96 ? 374  GLN A O   1 
ATOM   2940 C  CB  . GLN A 1 374 ? 93.515  51.559 47.560  1.00 31.26 ? 374  GLN A CB  1 
ATOM   2941 C  CG  . GLN A 1 374 ? 92.178  50.946 47.268  1.00 34.00 ? 374  GLN A CG  1 
ATOM   2942 C  CD  . GLN A 1 374 ? 91.296  50.759 48.510  1.00 39.92 ? 374  GLN A CD  1 
ATOM   2943 O  OE1 . GLN A 1 374 ? 90.263  50.064 48.435  1.00 44.52 ? 374  GLN A OE1 1 
ATOM   2944 N  NE2 . GLN A 1 374 ? 91.679  51.373 49.645  1.00 38.03 ? 374  GLN A NE2 1 
ATOM   2945 N  N   . TYR A 1 375 ? 96.061  49.538 46.835  1.00 32.33 ? 375  TYR A N   1 
ATOM   2946 C  CA  . TYR A 1 375 ? 96.552  48.464 45.985  1.00 32.28 ? 375  TYR A CA  1 
ATOM   2947 C  C   . TYR A 1 375 ? 97.898  47.837 46.423  1.00 33.94 ? 375  TYR A C   1 
ATOM   2948 O  O   . TYR A 1 375 ? 98.446  47.021 45.674  1.00 34.24 ? 375  TYR A O   1 
ATOM   2949 C  CB  . TYR A 1 375 ? 96.654  48.973 44.529  1.00 31.72 ? 375  TYR A CB  1 
ATOM   2950 C  CG  . TYR A 1 375 ? 95.302  49.148 43.853  1.00 28.64 ? 375  TYR A CG  1 
ATOM   2951 C  CD1 . TYR A 1 375 ? 94.525  50.294 44.074  1.00 25.21 ? 375  TYR A CD1 1 
ATOM   2952 C  CD2 . TYR A 1 375 ? 94.803  48.174 43.012  1.00 24.97 ? 375  TYR A CD2 1 
ATOM   2953 C  CE1 . TYR A 1 375 ? 93.282  50.452 43.472  1.00 23.14 ? 375  TYR A CE1 1 
ATOM   2954 C  CE2 . TYR A 1 375 ? 93.550  48.330 42.398  1.00 24.81 ? 375  TYR A CE2 1 
ATOM   2955 C  CZ  . TYR A 1 375 ? 92.800  49.475 42.631  1.00 24.07 ? 375  TYR A CZ  1 
ATOM   2956 O  OH  . TYR A 1 375 ? 91.562  49.624 42.012  1.00 25.57 ? 375  TYR A OH  1 
ATOM   2957 N  N   . THR A 1 376 ? 98.411  48.215 47.608  1.00 33.80 ? 376  THR A N   1 
ATOM   2958 C  CA  . THR A 1 376 ? 99.643  47.654 48.164  1.00 34.27 ? 376  THR A CA  1 
ATOM   2959 C  C   . THR A 1 376 ? 99.383  46.676 49.312  1.00 35.72 ? 376  THR A C   1 
ATOM   2960 O  O   . THR A 1 376 ? 98.617  46.963 50.261  1.00 36.10 ? 376  THR A O   1 
ATOM   2961 C  CB  . THR A 1 376 ? 100.591 48.778 48.655  1.00 35.06 ? 376  THR A CB  1 
ATOM   2962 O  OG1 . THR A 1 376 ? 100.869 49.644 47.555  1.00 33.49 ? 376  THR A OG1 1 
ATOM   2963 C  CG2 . THR A 1 376 ? 101.921 48.230 49.206  1.00 33.79 ? 376  THR A CG2 1 
ATOM   2964 N  N   . ASP A 1 377 ? 100.037 45.518 49.230  1.00 36.58 ? 377  ASP A N   1 
ATOM   2965 C  CA  . ASP A 1 377 ? 99.996  44.519 50.305  1.00 37.55 ? 377  ASP A CA  1 
ATOM   2966 C  C   . ASP A 1 377 ? 101.238 44.755 51.177  1.00 38.82 ? 377  ASP A C   1 
ATOM   2967 O  O   . ASP A 1 377 ? 102.373 44.434 50.775  1.00 39.09 ? 377  ASP A O   1 
ATOM   2968 C  CB  . ASP A 1 377 ? 99.904  43.090 49.705  1.00 37.83 ? 377  ASP A CB  1 
ATOM   2969 C  CG  . ASP A 1 377 ? 100.235 41.955 50.718  1.00 39.08 ? 377  ASP A CG  1 
ATOM   2970 O  OD1 . ASP A 1 377 ? 100.178 42.127 51.951  1.00 38.83 ? 377  ASP A OD1 1 
ATOM   2971 O  OD2 . ASP A 1 377 ? 100.564 40.851 50.255  1.00 40.77 ? 377  ASP A OD2 1 
ATOM   2972 N  N   . TRP A 1 378 ? 101.020 45.335 52.360  1.00 39.04 ? 378  TRP A N   1 
ATOM   2973 C  CA  . TRP A 1 378 ? 102.116 45.713 53.257  1.00 40.34 ? 378  TRP A CA  1 
ATOM   2974 C  C   . TRP A 1 378 ? 102.718 44.557 54.036  1.00 42.44 ? 378  TRP A C   1 
ATOM   2975 O  O   . TRP A 1 378 ? 103.680 44.745 54.767  1.00 43.11 ? 378  TRP A O   1 
ATOM   2976 C  CB  . TRP A 1 378 ? 101.742 46.901 54.171  1.00 40.32 ? 378  TRP A CB  1 
ATOM   2977 C  CG  . TRP A 1 378 ? 101.732 48.211 53.407  1.00 39.69 ? 378  TRP A CG  1 
ATOM   2978 C  CD1 . TRP A 1 378 ? 100.654 48.950 53.067  1.00 38.05 ? 378  TRP A CD1 1 
ATOM   2979 C  CD2 . TRP A 1 378 ? 102.869 48.879 52.845  1.00 42.78 ? 378  TRP A CD2 1 
ATOM   2980 N  NE1 . TRP A 1 378 ? 101.039 50.052 52.330  1.00 38.54 ? 378  TRP A NE1 1 
ATOM   2981 C  CE2 . TRP A 1 378 ? 102.396 50.028 52.181  1.00 41.49 ? 378  TRP A CE2 1 
ATOM   2982 C  CE3 . TRP A 1 378 ? 104.247 48.612 52.836  1.00 47.56 ? 378  TRP A CE3 1 
ATOM   2983 C  CZ2 . TRP A 1 378 ? 103.250 50.914 51.505  1.00 45.11 ? 378  TRP A CZ2 1 
ATOM   2984 C  CZ3 . TRP A 1 378 ? 105.106 49.506 52.164  1.00 50.12 ? 378  TRP A CZ3 1 
ATOM   2985 C  CH2 . TRP A 1 378 ? 104.596 50.638 51.507  1.00 47.15 ? 378  TRP A CH2 1 
ATOM   2986 N  N   . MET A 1 379 ? 102.182 43.347 53.871  1.00 43.46 ? 379  MET A N   1 
ATOM   2987 C  CA  . MET A 1 379 ? 102.917 42.178 54.364  1.00 46.14 ? 379  MET A CA  1 
ATOM   2988 C  C   . MET A 1 379 ? 104.009 41.736 53.371  1.00 46.05 ? 379  MET A C   1 
ATOM   2989 O  O   . MET A 1 379 ? 104.848 40.909 53.708  1.00 47.51 ? 379  MET A O   1 
ATOM   2990 C  CB  . MET A 1 379 ? 101.980 41.015 54.661  1.00 47.24 ? 379  MET A CB  1 
ATOM   2991 C  CG  . MET A 1 379 ? 101.081 41.209 55.858  1.00 51.20 ? 379  MET A CG  1 
ATOM   2992 S  SD  . MET A 1 379 ? 99.717  40.022 55.792  1.00 61.14 ? 379  MET A SD  1 
ATOM   2993 C  CE  . MET A 1 379 ? 100.531 38.562 56.468  1.00 60.64 ? 379  MET A CE  1 
ATOM   2994 N  N   . ASP A 1 380 ? 103.989 42.297 52.159  1.00 45.14 ? 380  ASP A N   1 
ATOM   2995 C  CA  . ASP A 1 380 ? 104.813 41.818 51.049  1.00 45.96 ? 380  ASP A CA  1 
ATOM   2996 C  C   . ASP A 1 380 ? 105.043 42.893 49.974  1.00 45.29 ? 380  ASP A C   1 
ATOM   2997 O  O   . ASP A 1 380 ? 104.819 42.638 48.789  1.00 44.98 ? 380  ASP A O   1 
ATOM   2998 C  CB  . ASP A 1 380 ? 104.110 40.608 50.406  1.00 45.93 ? 380  ASP A CB  1 
ATOM   2999 C  CG  . ASP A 1 380 ? 105.034 39.784 49.481  1.00 45.51 ? 380  ASP A CG  1 
ATOM   3000 O  OD1 . ASP A 1 380 ? 106.272 39.842 49.600  1.00 46.12 ? 380  ASP A OD1 1 
ATOM   3001 O  OD2 . ASP A 1 380 ? 104.494 39.065 48.628  1.00 43.73 ? 380  ASP A OD2 1 
ATOM   3002 N  N   . ASP A 1 381 ? 105.486 44.087 50.372  1.00 45.61 ? 381  ASP A N   1 
ATOM   3003 C  CA  . ASP A 1 381 ? 105.457 45.261 49.472  1.00 44.90 ? 381  ASP A CA  1 
ATOM   3004 C  C   . ASP A 1 381 ? 106.543 45.300 48.377  1.00 45.57 ? 381  ASP A C   1 
ATOM   3005 O  O   . ASP A 1 381 ? 106.409 46.060 47.403  1.00 44.67 ? 381  ASP A O   1 
ATOM   3006 C  CB  . ASP A 1 381 ? 105.534 46.539 50.294  1.00 44.94 ? 381  ASP A CB  1 
ATOM   3007 C  CG  . ASP A 1 381 ? 106.798 46.598 51.129  1.00 47.74 ? 381  ASP A CG  1 
ATOM   3008 O  OD1 . ASP A 1 381 ? 106.941 45.788 52.077  1.00 45.59 ? 381  ASP A OD1 1 
ATOM   3009 O  OD2 . ASP A 1 381 ? 107.659 47.442 50.811  1.00 51.95 ? 381  ASP A OD2 1 
ATOM   3010 N  N   . ASN A 1 382 ? 107.617 44.527 48.557  1.00 46.84 ? 382  ASN A N   1 
ATOM   3011 C  CA  . ASN A 1 382 ? 108.693 44.434 47.569  1.00 47.99 ? 382  ASN A CA  1 
ATOM   3012 C  C   . ASN A 1 382 ? 108.539 43.241 46.618  1.00 47.85 ? 382  ASN A C   1 
ATOM   3013 O  O   . ASN A 1 382 ? 109.494 42.836 45.959  1.00 49.49 ? 382  ASN A O   1 
ATOM   3014 C  CB  . ASN A 1 382 ? 110.066 44.390 48.250  1.00 49.98 ? 382  ASN A CB  1 
ATOM   3015 C  CG  . ASN A 1 382 ? 110.482 45.744 48.797  1.00 51.37 ? 382  ASN A CG  1 
ATOM   3016 O  OD1 . ASN A 1 382 ? 110.491 46.754 48.073  1.00 54.53 ? 382  ASN A OD1 1 
ATOM   3017 N  ND2 . ASN A 1 382 ? 110.818 45.779 50.071  1.00 49.75 ? 382  ASN A ND2 1 
ATOM   3018 N  N   . ASN A 1 383 ? 107.339 42.674 46.581  1.00 45.93 ? 383  ASN A N   1 
ATOM   3019 C  CA  . ASN A 1 383 ? 107.012 41.650 45.631  1.00 45.10 ? 383  ASN A CA  1 
ATOM   3020 C  C   . ASN A 1 383 ? 106.696 42.305 44.273  1.00 43.24 ? 383  ASN A C   1 
ATOM   3021 O  O   . ASN A 1 383 ? 105.670 42.977 44.103  1.00 40.19 ? 383  ASN A O   1 
ATOM   3022 C  CB  . ASN A 1 383 ? 105.822 40.844 46.134  1.00 44.62 ? 383  ASN A CB  1 
ATOM   3023 C  CG  . ASN A 1 383 ? 105.488 39.682 45.235  1.00 46.02 ? 383  ASN A CG  1 
ATOM   3024 O  OD1 . ASN A 1 383 ? 105.610 39.770 44.008  1.00 45.62 ? 383  ASN A OD1 1 
ATOM   3025 N  ND2 . ASN A 1 383 ? 105.062 38.568 45.839  1.00 49.39 ? 383  ASN A ND2 1 
ATOM   3026 N  N   . GLY A 1 384 ? 107.607 42.089 43.323  1.00 43.62 ? 384  GLY A N   1 
ATOM   3027 C  CA  . GLY A 1 384 ? 107.547 42.686 41.991  1.00 41.56 ? 384  GLY A CA  1 
ATOM   3028 C  C   . GLY A 1 384 ? 106.367 42.201 41.186  1.00 40.39 ? 384  GLY A C   1 
ATOM   3029 O  O   . GLY A 1 384 ? 105.860 42.950 40.367  1.00 38.27 ? 384  GLY A O   1 
ATOM   3030 N  N   . ILE A 1 385 ? 105.943 40.949 41.407  1.00 40.27 ? 385  ILE A N   1 
ATOM   3031 C  CA  . ILE A 1 385 ? 104.756 40.392 40.756  1.00 39.54 ? 385  ILE A CA  1 
ATOM   3032 C  C   . ILE A 1 385 ? 103.468 41.047 41.263  1.00 38.13 ? 385  ILE A C   1 
ATOM   3033 O  O   . ILE A 1 385 ? 102.614 41.411 40.457  1.00 37.28 ? 385  ILE A O   1 
ATOM   3034 C  CB  . ILE A 1 385 ? 104.714 38.825 40.855  1.00 41.68 ? 385  ILE A CB  1 
ATOM   3035 C  CG1 . ILE A 1 385 ? 105.593 38.212 39.753  1.00 44.07 ? 385  ILE A CG1 1 
ATOM   3036 C  CG2 . ILE A 1 385 ? 103.278 38.256 40.786  1.00 39.63 ? 385  ILE A CG2 1 
ATOM   3037 C  CD1 . ILE A 1 385 ? 105.559 36.687 39.704  1.00 50.22 ? 385  ILE A CD1 1 
ATOM   3038 N  N   . LYS A 1 386 ? 103.329 41.214 42.582  1.00 37.93 ? 386  LYS A N   1 
ATOM   3039 C  CA  . LYS A 1 386 ? 102.159 41.917 43.141  1.00 36.75 ? 386  LYS A CA  1 
ATOM   3040 C  C   . LYS A 1 386 ? 102.177 43.407 42.807  1.00 35.37 ? 386  LYS A C   1 
ATOM   3041 O  O   . LYS A 1 386 ? 101.122 44.024 42.669  1.00 34.11 ? 386  LYS A O   1 
ATOM   3042 C  CB  . LYS A 1 386 ? 102.039 41.722 44.667  1.00 37.63 ? 386  LYS A CB  1 
ATOM   3043 C  CG  . LYS A 1 386 ? 101.602 40.321 45.145  1.00 38.22 ? 386  LYS A CG  1 
ATOM   3044 C  CD  . LYS A 1 386 ? 101.858 40.187 46.639  1.00 40.37 ? 386  LYS A CD  1 
ATOM   3045 C  CE  . LYS A 1 386 ? 101.171 38.990 47.254  1.00 42.79 ? 386  LYS A CE  1 
ATOM   3046 N  NZ  . LYS A 1 386 ? 101.734 38.772 48.645  1.00 46.08 ? 386  LYS A NZ  1 
ATOM   3047 N  N   . ASN A 1 387 ? 103.374 43.979 42.688  1.00 35.59 ? 387  ASN A N   1 
ATOM   3048 C  CA  . ASN A 1 387 ? 103.498 45.348 42.212  1.00 35.14 ? 387  ASN A CA  1 
ATOM   3049 C  C   . ASN A 1 387 ? 103.049 45.510 40.739  1.00 34.21 ? 387  ASN A C   1 
ATOM   3050 O  O   . ASN A 1 387 ? 102.394 46.483 40.400  1.00 33.59 ? 387  ASN A O   1 
ATOM   3051 C  CB  . ASN A 1 387 ? 104.918 45.883 42.410  1.00 35.48 ? 387  ASN A CB  1 
ATOM   3052 C  CG  . ASN A 1 387 ? 105.250 46.125 43.875  1.00 36.79 ? 387  ASN A CG  1 
ATOM   3053 O  OD1 . ASN A 1 387 ? 104.369 46.144 44.717  1.00 37.65 ? 387  ASN A OD1 1 
ATOM   3054 N  ND2 . ASN A 1 387 ? 106.532 46.308 44.181  1.00 36.38 ? 387  ASN A ND2 1 
ATOM   3055 N  N   . ARG A 1 388 ? 103.406 44.563 39.878  1.00 33.92 ? 388  ARG A N   1 
ATOM   3056 C  CA  . ARG A 1 388 ? 102.987 44.615 38.496  1.00 33.36 ? 388  ARG A CA  1 
ATOM   3057 C  C   . ARG A 1 388 ? 101.464 44.456 38.405  1.00 32.73 ? 388  ARG A C   1 
ATOM   3058 O  O   . ARG A 1 388 ? 100.793 45.287 37.806  1.00 31.93 ? 388  ARG A O   1 
ATOM   3059 C  CB  . ARG A 1 388 ? 103.727 43.569 37.660  1.00 34.91 ? 388  ARG A CB  1 
ATOM   3060 C  CG  . ARG A 1 388 ? 103.178 43.302 36.267  1.00 33.07 ? 388  ARG A CG  1 
ATOM   3061 C  CD  . ARG A 1 388 ? 103.663 41.968 35.791  1.00 31.99 ? 388  ARG A CD  1 
ATOM   3062 N  NE  . ARG A 1 388 ? 102.850 40.855 36.293  1.00 33.53 ? 388  ARG A NE  1 
ATOM   3063 C  CZ  . ARG A 1 388 ? 103.286 39.589 36.374  1.00 35.10 ? 388  ARG A CZ  1 
ATOM   3064 N  NH1 . ARG A 1 388 ? 104.531 39.262 36.013  1.00 33.34 ? 388  ARG A NH1 1 
ATOM   3065 N  NH2 . ARG A 1 388 ? 102.490 38.648 36.849  1.00 34.35 ? 388  ARG A NH2 1 
ATOM   3066 N  N   . ASP A 1 389 ? 100.922 43.407 39.018  1.00 33.17 ? 389  ASP A N   1 
ATOM   3067 C  CA  . ASP A 1 389 ? 99.487  43.156 38.936  1.00 32.71 ? 389  ASP A CA  1 
ATOM   3068 C  C   . ASP A 1 389 ? 98.695  44.299 39.566  1.00 30.89 ? 389  ASP A C   1 
ATOM   3069 O  O   . ASP A 1 389 ? 97.584  44.574 39.146  1.00 29.73 ? 389  ASP A O   1 
ATOM   3070 C  CB  . ASP A 1 389 ? 99.113  41.847 39.651  1.00 33.55 ? 389  ASP A CB  1 
ATOM   3071 C  CG  . ASP A 1 389 ? 99.845  40.619 39.092  1.00 37.81 ? 389  ASP A CG  1 
ATOM   3072 O  OD1 . ASP A 1 389 ? 100.434 40.669 37.984  1.00 41.79 ? 389  ASP A OD1 1 
ATOM   3073 O  OD2 . ASP A 1 389 ? 99.839  39.589 39.794  1.00 43.09 ? 389  ASP A OD2 1 
ATOM   3074 N  N   . GLY A 1 390 ? 99.256  44.916 40.606  1.00 31.10 ? 390  GLY A N   1 
ATOM   3075 C  CA  . GLY A 1 390 ? 98.599  46.009 41.311  1.00 30.60 ? 390  GLY A CA  1 
ATOM   3076 C  C   . GLY A 1 390 ? 98.420  47.215 40.407  1.00 29.63 ? 390  GLY A C   1 
ATOM   3077 O  O   . GLY A 1 390 ? 97.354  47.795 40.374  1.00 29.22 ? 390  GLY A O   1 
ATOM   3078 N  N   . LEU A 1 391 ? 99.468  47.548 39.651  1.00 30.21 ? 391  LEU A N   1 
ATOM   3079 C  CA  . LEU A 1 391 ? 99.462  48.618 38.660  1.00 30.26 ? 391  LEU A CA  1 
ATOM   3080 C  C   . LEU A 1 391 ? 98.500  48.336 37.502  1.00 29.91 ? 391  LEU A C   1 
ATOM   3081 O  O   . LEU A 1 391 ? 97.729  49.190 37.076  1.00 28.53 ? 391  LEU A O   1 
ATOM   3082 C  CB  . LEU A 1 391 ? 100.877 48.784 38.125  1.00 31.41 ? 391  LEU A CB  1 
ATOM   3083 C  CG  . LEU A 1 391 ? 101.387 50.212 38.093  1.00 32.67 ? 391  LEU A CG  1 
ATOM   3084 C  CD1 . LEU A 1 391 ? 100.945 50.935 39.330  1.00 34.47 ? 391  LEU A CD1 1 
ATOM   3085 C  CD2 . LEU A 1 391 ? 102.921 50.249 37.997  1.00 34.91 ? 391  LEU A CD2 1 
ATOM   3086 N  N   . ASP A 1 392 ? 98.533  47.112 37.013  1.00 30.28 ? 392  ASP A N   1 
ATOM   3087 C  CA  . ASP A 1 392 ? 97.609  46.683 35.990  1.00 30.22 ? 392  ASP A CA  1 
ATOM   3088 C  C   . ASP A 1 392 ? 96.168  46.914 36.478  1.00 28.93 ? 392  ASP A C   1 
ATOM   3089 O  O   . ASP A 1 392 ? 95.343  47.492 35.745  1.00 29.32 ? 392  ASP A O   1 
ATOM   3090 C  CB  . ASP A 1 392 ? 97.919  45.215 35.619  1.00 32.47 ? 392  ASP A CB  1 
ATOM   3091 C  CG  . ASP A 1 392 ? 97.165  44.730 34.383  1.00 36.95 ? 392  ASP A CG  1 
ATOM   3092 O  OD1 . ASP A 1 392 ? 96.513  45.530 33.677  1.00 38.95 ? 392  ASP A OD1 1 
ATOM   3093 O  OD2 . ASP A 1 392 ? 97.229  43.504 34.108  1.00 45.29 ? 392  ASP A OD2 1 
ATOM   3094 N  N   . ASP A 1 393 ? 95.862  46.539 37.716  1.00 27.80 ? 393  ASP A N   1 
ATOM   3095 C  CA  . ASP A 1 393 ? 94.499  46.734 38.257  1.00 26.97 ? 393  ASP A CA  1 
ATOM   3096 C  C   . ASP A 1 393 ? 94.146  48.221 38.432  1.00 25.65 ? 393  ASP A C   1 
ATOM   3097 O  O   . ASP A 1 393 ? 93.004  48.639 38.152  1.00 25.23 ? 393  ASP A O   1 
ATOM   3098 C  CB  . ASP A 1 393 ? 94.315  45.982 39.590  1.00 27.74 ? 393  ASP A CB  1 
ATOM   3099 C  CG  . ASP A 1 393 ? 94.354  44.468 39.418  1.00 30.23 ? 393  ASP A CG  1 
ATOM   3100 O  OD1 . ASP A 1 393 ? 94.066  43.994 38.319  1.00 36.12 ? 393  ASP A OD1 1 
ATOM   3101 O  OD2 . ASP A 1 393 ? 94.628  43.729 40.385  1.00 35.62 ? 393  ASP A OD2 1 
ATOM   3102 N  N   . ILE A 1 394 ? 95.108  49.018 38.879  1.00 24.39 ? 394  ILE A N   1 
ATOM   3103 C  CA  . ILE A 1 394 ? 94.872  50.461 38.996  1.00 23.80 ? 394  ILE A CA  1 
ATOM   3104 C  C   . ILE A 1 394 ? 94.452  51.038 37.662  1.00 23.43 ? 394  ILE A C   1 
ATOM   3105 O  O   . ILE A 1 394 ? 93.393  51.673 37.550  1.00 24.47 ? 394  ILE A O   1 
ATOM   3106 C  CB  . ILE A 1 394 ? 96.091  51.194 39.523  1.00 24.34 ? 394  ILE A CB  1 
ATOM   3107 C  CG1 . ILE A 1 394 ? 96.213  50.956 41.037  1.00 21.68 ? 394  ILE A CG1 1 
ATOM   3108 C  CG2 . ILE A 1 394 ? 96.005  52.667 39.149  1.00 22.06 ? 394  ILE A CG2 1 
ATOM   3109 C  CD1 . ILE A 1 394 ? 97.625  51.183 41.548  1.00 22.77 ? 394  ILE A CD1 1 
ATOM   3110 N  N   . VAL A 1 395 ? 95.221  50.741 36.628  1.00 24.03 ? 395  VAL A N   1 
ATOM   3111 C  CA  . VAL A 1 395 ? 94.953  51.312 35.332  1.00 23.59 ? 395  VAL A CA  1 
ATOM   3112 C  C   . VAL A 1 395 ? 93.621  50.833 34.783  1.00 23.42 ? 395  VAL A C   1 
ATOM   3113 O  O   . VAL A 1 395 ? 92.839  51.648 34.311  1.00 24.15 ? 395  VAL A O   1 
ATOM   3114 C  CB  . VAL A 1 395 ? 96.109  51.049 34.343  1.00 24.14 ? 395  VAL A CB  1 
ATOM   3115 C  CG1 . VAL A 1 395 ? 95.740  51.547 32.935  1.00 22.56 ? 395  VAL A CG1 1 
ATOM   3116 C  CG2 . VAL A 1 395 ? 97.374  51.769 34.825  1.00 23.39 ? 395  VAL A CG2 1 
ATOM   3117 N  N   . GLY A 1 396 ? 93.348  49.528 34.898  1.00 22.82 ? 396  GLY A N   1 
ATOM   3118 C  CA  . GLY A 1 396 ? 92.119  48.942 34.448  1.00 22.10 ? 396  GLY A CA  1 
ATOM   3119 C  C   . GLY A 1 396 ? 90.930  49.366 35.277  1.00 24.06 ? 396  GLY A C   1 
ATOM   3120 O  O   . GLY A 1 396 ? 89.880  49.644 34.708  1.00 24.37 ? 396  GLY A O   1 
ATOM   3121 N  N   . ASP A 1 397 ? 91.079  49.447 36.615  1.00 24.42 ? 397  ASP A N   1 
ATOM   3122 C  CA  . ASP A 1 397 ? 89.952  49.800 37.466  1.00 24.22 ? 397  ASP A CA  1 
ATOM   3123 C  C   . ASP A 1 397 ? 89.631  51.262 37.249  1.00 24.07 ? 397  ASP A C   1 
ATOM   3124 O  O   . ASP A 1 397 ? 88.484  51.617 37.016  1.00 24.21 ? 397  ASP A O   1 
ATOM   3125 C  CB  . ASP A 1 397 ? 90.206  49.514 38.955  1.00 25.05 ? 397  ASP A CB  1 
ATOM   3126 C  CG  . ASP A 1 397 ? 90.341  47.995 39.291  1.00 27.65 ? 397  ASP A CG  1 
ATOM   3127 O  OD1 . ASP A 1 397 ? 89.839  47.135 38.529  1.00 26.31 ? 397  ASP A OD1 1 
ATOM   3128 O  OD2 . ASP A 1 397 ? 90.947  47.677 40.357  1.00 29.18 ? 397  ASP A OD2 1 
ATOM   3129 N  N   . HIS A 1 398 ? 90.652  52.116 37.293  1.00 25.04 ? 398  HIS A N   1 
ATOM   3130 C  CA  . HIS A 1 398 ? 90.438  53.569 37.169  1.00 24.44 ? 398  HIS A CA  1 
ATOM   3131 C  C   . HIS A 1 398 ? 89.827  53.964 35.825  1.00 24.06 ? 398  HIS A C   1 
ATOM   3132 O  O   . HIS A 1 398 ? 88.865  54.720 35.786  1.00 24.85 ? 398  HIS A O   1 
ATOM   3133 C  CB  . HIS A 1 398 ? 91.751  54.309 37.386  1.00 25.08 ? 398  HIS A CB  1 
ATOM   3134 C  CG  . HIS A 1 398 ? 91.683  55.774 37.069  1.00 25.38 ? 398  HIS A CG  1 
ATOM   3135 N  ND1 . HIS A 1 398 ? 90.789  56.628 37.673  1.00 25.80 ? 398  HIS A ND1 1 
ATOM   3136 C  CD2 . HIS A 1 398 ? 92.410  56.533 36.219  1.00 27.18 ? 398  HIS A CD2 1 
ATOM   3137 C  CE1 . HIS A 1 398 ? 90.957  57.852 37.199  1.00 28.58 ? 398  HIS A CE1 1 
ATOM   3138 N  NE2 . HIS A 1 398 ? 91.945  57.821 36.321  1.00 28.17 ? 398  HIS A NE2 1 
ATOM   3139 N  N   . ASN A 1 399 ? 90.378  53.427 34.739  1.00 23.31 ? 399  ASN A N   1 
ATOM   3140 C  CA  . ASN A 1 399 ? 90.044  53.849 33.406  1.00 23.91 ? 399  ASN A CA  1 
ATOM   3141 C  C   . ASN A 1 399 ? 88.891  53.162 32.712  1.00 24.22 ? 399  ASN A C   1 
ATOM   3142 O  O   . ASN A 1 399 ? 88.297  53.765 31.834  1.00 24.72 ? 399  ASN A O   1 
ATOM   3143 C  CB  . ASN A 1 399 ? 91.264  53.678 32.508  1.00 24.66 ? 399  ASN A CB  1 
ATOM   3144 C  CG  . ASN A 1 399 ? 92.302  54.719 32.758  1.00 24.94 ? 399  ASN A CG  1 
ATOM   3145 O  OD1 . ASN A 1 399 ? 92.100  55.875 32.445  1.00 24.82 ? 399  ASN A OD1 1 
ATOM   3146 N  ND2 . ASN A 1 399 ? 93.417  54.316 33.331  1.00 26.25 ? 399  ASN A ND2 1 
ATOM   3147 N  N   . VAL A 1 400 ? 88.612  51.887 33.032  1.00 25.06 ? 400  VAL A N   1 
ATOM   3148 C  CA  . VAL A 1 400 ? 87.580  51.158 32.327  1.00 24.50 ? 400  VAL A CA  1 
ATOM   3149 C  C   . VAL A 1 400 ? 86.518  50.546 33.220  1.00 25.50 ? 400  VAL A C   1 
ATOM   3150 O  O   . VAL A 1 400 ? 85.344  50.847 33.095  1.00 26.82 ? 400  VAL A O   1 
ATOM   3151 C  CB  . VAL A 1 400 ? 88.199  50.075 31.447  1.00 25.57 ? 400  VAL A CB  1 
ATOM   3152 C  CG1 . VAL A 1 400 ? 87.101  49.228 30.773  1.00 22.31 ? 400  VAL A CG1 1 
ATOM   3153 C  CG2 . VAL A 1 400 ? 89.172  50.723 30.407  1.00 22.53 ? 400  VAL A CG2 1 
ATOM   3154 N  N   . ILE A 1 401 ? 86.930  49.675 34.124  1.00 25.94 ? 401  ILE A N   1 
ATOM   3155 C  CA  . ILE A 1 401 ? 85.988  48.895 34.889  1.00 25.04 ? 401  ILE A CA  1 
ATOM   3156 C  C   . ILE A 1 401 ? 85.085  49.707 35.797  1.00 24.78 ? 401  ILE A C   1 
ATOM   3157 O  O   . ILE A 1 401 ? 83.878  49.616 35.709  1.00 25.88 ? 401  ILE A O   1 
ATOM   3158 C  CB  . ILE A 1 401 ? 86.685  47.830 35.711  1.00 25.15 ? 401  ILE A CB  1 
ATOM   3159 C  CG1 . ILE A 1 401 ? 87.451  46.887 34.786  1.00 25.43 ? 401  ILE A CG1 1 
ATOM   3160 C  CG2 . ILE A 1 401 ? 85.636  47.054 36.536  1.00 23.31 ? 401  ILE A CG2 1 
ATOM   3161 C  CD1 . ILE A 1 401 ? 87.781  45.519 35.446  1.00 23.55 ? 401  ILE A CD1 1 
ATOM   3162 N  N   . CYS A 1 402 ? 85.669  50.476 36.687  1.00 25.03 ? 402  CYS A N   1 
ATOM   3163 C  CA  . CYS A 1 402 ? 84.873  51.286 37.608  1.00 26.19 ? 402  CYS A CA  1 
ATOM   3164 C  C   . CYS A 1 402 ? 83.987  52.370 36.961  1.00 25.96 ? 402  CYS A C   1 
ATOM   3165 O  O   . CYS A 1 402 ? 82.849  52.531 37.390  1.00 27.74 ? 402  CYS A O   1 
ATOM   3166 C  CB  . CYS A 1 402 ? 85.734  51.825 38.769  1.00 26.24 ? 402  CYS A CB  1 
ATOM   3167 S  SG  . CYS A 1 402 ? 86.448  50.439 39.728  1.00 26.69 ? 402  CYS A SG  1 
ATOM   3168 N  N   . PRO A 1 403 ? 84.476  53.101 35.940  1.00 25.75 ? 403  PRO A N   1 
ATOM   3169 C  CA  . PRO A 1 403 ? 83.539  53.990 35.197  1.00 26.24 ? 403  PRO A CA  1 
ATOM   3170 C  C   . PRO A 1 403 ? 82.375  53.244 34.559  1.00 26.32 ? 403  PRO A C   1 
ATOM   3171 O  O   . PRO A 1 403 ? 81.257  53.771 34.496  1.00 27.15 ? 403  PRO A O   1 
ATOM   3172 C  CB  . PRO A 1 403 ? 84.398  54.564 34.073  1.00 25.75 ? 403  PRO A CB  1 
ATOM   3173 C  CG  . PRO A 1 403 ? 85.802  54.507 34.613  1.00 25.47 ? 403  PRO A CG  1 
ATOM   3174 C  CD  . PRO A 1 403 ? 85.885  53.375 35.591  1.00 25.83 ? 403  PRO A CD  1 
ATOM   3175 N  N   . LEU A 1 404 ? 82.640  52.037 34.058  1.00 26.24 ? 404  LEU A N   1 
ATOM   3176 C  CA  . LEU A 1 404 ? 81.593  51.239 33.438  1.00 26.17 ? 404  LEU A CA  1 
ATOM   3177 C  C   . LEU A 1 404 ? 80.607  50.817 34.518  1.00 27.55 ? 404  LEU A C   1 
ATOM   3178 O  O   . LEU A 1 404 ? 79.393  50.929 34.300  1.00 28.27 ? 404  LEU A O   1 
ATOM   3179 C  CB  . LEU A 1 404 ? 82.152  50.030 32.663  1.00 26.46 ? 404  LEU A CB  1 
ATOM   3180 C  CG  . LEU A 1 404 ? 81.056  49.191 31.961  1.00 26.51 ? 404  LEU A CG  1 
ATOM   3181 C  CD1 . LEU A 1 404 ? 81.459  48.722 30.557  1.00 24.42 ? 404  LEU A CD1 1 
ATOM   3182 C  CD2 . LEU A 1 404 ? 80.590  48.020 32.863  1.00 25.93 ? 404  LEU A CD2 1 
ATOM   3183 N  N   . MET A 1 405 ? 81.113  50.372 35.683  1.00 27.92 ? 405  MET A N   1 
ATOM   3184 C  CA  . MET A 1 405 ? 80.224  49.994 36.808  1.00 29.10 ? 405  MET A CA  1 
ATOM   3185 C  C   . MET A 1 405 ? 79.358  51.167 37.293  1.00 30.00 ? 405  MET A C   1 
ATOM   3186 O  O   . MET A 1 405 ? 78.188  50.970 37.598  1.00 31.39 ? 405  MET A O   1 
ATOM   3187 C  CB  . MET A 1 405 ? 80.979  49.349 37.981  1.00 29.02 ? 405  MET A CB  1 
ATOM   3188 C  CG  . MET A 1 405 ? 81.633  48.000 37.680  1.00 28.77 ? 405  MET A CG  1 
ATOM   3189 S  SD  . MET A 1 405 ? 80.469  46.885 36.863  1.00 30.01 ? 405  MET A SD  1 
ATOM   3190 C  CE  . MET A 1 405 ? 79.237  46.725 38.186  1.00 24.97 ? 405  MET A CE  1 
ATOM   3191 N  N   . HIS A 1 406 ? 79.918  52.373 37.348  1.00 29.49 ? 406  HIS A N   1 
ATOM   3192 C  CA  . HIS A 1 406 ? 79.132  53.581 37.671  1.00 31.03 ? 406  HIS A CA  1 
ATOM   3193 C  C   . HIS A 1 406 ? 78.047  53.800 36.631  1.00 32.07 ? 406  HIS A C   1 
ATOM   3194 O  O   . HIS A 1 406 ? 76.921  54.177 36.963  1.00 33.64 ? 406  HIS A O   1 
ATOM   3195 C  CB  . HIS A 1 406 ? 80.026  54.819 37.659  1.00 29.98 ? 406  HIS A CB  1 
ATOM   3196 C  CG  . HIS A 1 406 ? 79.344  56.072 38.111  1.00 32.67 ? 406  HIS A CG  1 
ATOM   3197 N  ND1 . HIS A 1 406 ? 78.955  56.282 39.420  1.00 31.29 ? 406  HIS A ND1 1 
ATOM   3198 C  CD2 . HIS A 1 406 ? 79.014  57.202 37.436  1.00 34.20 ? 406  HIS A CD2 1 
ATOM   3199 C  CE1 . HIS A 1 406 ? 78.419  57.480 39.534  1.00 32.76 ? 406  HIS A CE1 1 
ATOM   3200 N  NE2 . HIS A 1 406 ? 78.449  58.063 38.345  1.00 36.54 ? 406  HIS A NE2 1 
ATOM   3201 N  N   . PHE A 1 407 ? 78.411  53.623 35.358  1.00 31.76 ? 407  PHE A N   1 
ATOM   3202 C  CA  . PHE A 1 407 ? 77.464  53.830 34.282  1.00 31.99 ? 407  PHE A CA  1 
ATOM   3203 C  C   . PHE A 1 407 ? 76.352  52.777 34.377  1.00 32.72 ? 407  PHE A C   1 
ATOM   3204 O  O   . PHE A 1 407 ? 75.173  53.113 34.287  1.00 34.29 ? 407  PHE A O   1 
ATOM   3205 C  CB  . PHE A 1 407 ? 78.155  53.809 32.910  1.00 30.57 ? 407  PHE A CB  1 
ATOM   3206 C  CG  . PHE A 1 407 ? 77.201  53.919 31.757  1.00 29.13 ? 407  PHE A CG  1 
ATOM   3207 C  CD1 . PHE A 1 407 ? 76.707  55.165 31.357  1.00 25.90 ? 407  PHE A CD1 1 
ATOM   3208 C  CD2 . PHE A 1 407 ? 76.784  52.777 31.084  1.00 25.01 ? 407  PHE A CD2 1 
ATOM   3209 C  CE1 . PHE A 1 407 ? 75.811  55.265 30.313  1.00 28.63 ? 407  PHE A CE1 1 
ATOM   3210 C  CE2 . PHE A 1 407 ? 75.887  52.863 30.019  1.00 28.05 ? 407  PHE A CE2 1 
ATOM   3211 C  CZ  . PHE A 1 407 ? 75.394  54.101 29.627  1.00 27.56 ? 407  PHE A CZ  1 
ATOM   3212 N  N   . VAL A 1 408 ? 76.725  51.522 34.585  1.00 32.89 ? 408  VAL A N   1 
ATOM   3213 C  CA  . VAL A 1 408 ? 75.743  50.443 34.662  1.00 33.97 ? 408  VAL A CA  1 
ATOM   3214 C  C   . VAL A 1 408 ? 74.794  50.631 35.860  1.00 35.02 ? 408  VAL A C   1 
ATOM   3215 O  O   . VAL A 1 408 ? 73.586  50.449 35.732  1.00 35.93 ? 408  VAL A O   1 
ATOM   3216 C  CB  . VAL A 1 408 ? 76.409  49.032 34.643  1.00 34.37 ? 408  VAL A CB  1 
ATOM   3217 C  CG1 . VAL A 1 408 ? 76.957  48.672 35.980  1.00 35.66 ? 408  VAL A CG1 1 
ATOM   3218 C  CG2 . VAL A 1 408 ? 75.385  47.967 34.257  1.00 36.16 ? 408  VAL A CG2 1 
ATOM   3219 N  N   . ASN A 1 409 ? 75.322  51.049 37.007  1.00 34.96 ? 409  ASN A N   1 
ATOM   3220 C  CA  . ASN A 1 409 ? 74.453  51.329 38.139  1.00 36.78 ? 409  ASN A CA  1 
ATOM   3221 C  C   . ASN A 1 409 ? 73.537  52.528 37.902  1.00 37.38 ? 409  ASN A C   1 
ATOM   3222 O  O   . ASN A 1 409 ? 72.362  52.500 38.264  1.00 39.04 ? 409  ASN A O   1 
ATOM   3223 C  CB  . ASN A 1 409 ? 75.244  51.459 39.446  1.00 37.28 ? 409  ASN A CB  1 
ATOM   3224 C  CG  . ASN A 1 409 ? 75.636  50.103 40.026  1.00 39.68 ? 409  ASN A CG  1 
ATOM   3225 O  OD1 . ASN A 1 409 ? 74.765  49.338 40.485  1.00 44.31 ? 409  ASN A OD1 1 
ATOM   3226 N  ND2 . ASN A 1 409 ? 76.937  49.779 39.988  1.00 35.25 ? 409  ASN A ND2 1 
ATOM   3227 N  N   . LYS A 1 410 ? 74.046  53.561 37.256  1.00 36.87 ? 410  LYS A N   1 
ATOM   3228 C  CA  . LYS A 1 410 ? 73.227  54.742 37.028  1.00 37.80 ? 410  LYS A CA  1 
ATOM   3229 C  C   . LYS A 1 410 ? 72.204  54.457 35.954  1.00 38.07 ? 410  LYS A C   1 
ATOM   3230 O  O   . LYS A 1 410 ? 71.033  54.841 36.092  1.00 40.05 ? 410  LYS A O   1 
ATOM   3231 C  CB  . LYS A 1 410 ? 74.080  55.924 36.628  1.00 37.43 ? 410  LYS A CB  1 
ATOM   3232 C  CG  . LYS A 1 410 ? 74.930  56.460 37.740  1.00 38.16 ? 410  LYS A CG  1 
ATOM   3233 C  CD  . LYS A 1 410 ? 74.089  57.293 38.685  1.00 39.96 ? 410  LYS A CD  1 
ATOM   3234 C  CE  . LYS A 1 410 ? 74.892  57.662 39.939  1.00 41.64 ? 410  LYS A CE  1 
ATOM   3235 N  NZ  . LYS A 1 410 ? 74.061  58.469 40.890  1.00 41.86 ? 410  LYS A NZ  1 
ATOM   3236 N  N   . TYR A 1 411 ? 72.621  53.743 34.915  1.00 35.94 ? 411  TYR A N   1 
ATOM   3237 C  CA  . TYR A 1 411 ? 71.716  53.444 33.806  1.00 35.61 ? 411  TYR A CA  1 
ATOM   3238 C  C   . TYR A 1 411 ? 70.531  52.592 34.266  1.00 36.75 ? 411  TYR A C   1 
ATOM   3239 O  O   . TYR A 1 411 ? 69.381  52.829 33.898  1.00 37.67 ? 411  TYR A O   1 
ATOM   3240 C  CB  . TYR A 1 411 ? 72.428  52.728 32.657  1.00 33.62 ? 411  TYR A CB  1 
ATOM   3241 C  CG  . TYR A 1 411 ? 71.551  52.695 31.427  1.00 34.22 ? 411  TYR A CG  1 
ATOM   3242 C  CD1 . TYR A 1 411 ? 71.476  53.796 30.594  1.00 31.76 ? 411  TYR A CD1 1 
ATOM   3243 C  CD2 . TYR A 1 411 ? 70.773  51.573 31.117  1.00 33.29 ? 411  TYR A CD2 1 
ATOM   3244 C  CE1 . TYR A 1 411 ? 70.645  53.792 29.496  1.00 33.80 ? 411  TYR A CE1 1 
ATOM   3245 C  CE2 . TYR A 1 411 ? 69.956  51.556 30.010  1.00 31.88 ? 411  TYR A CE2 1 
ATOM   3246 C  CZ  . TYR A 1 411 ? 69.885  52.682 29.215  1.00 32.77 ? 411  TYR A CZ  1 
ATOM   3247 O  OH  . TYR A 1 411 ? 69.079  52.718 28.106  1.00 36.20 ? 411  TYR A OH  1 
ATOM   3248 N  N   . THR A 1 412 ? 70.822  51.608 35.095  1.00 36.47 ? 412  THR A N   1 
ATOM   3249 C  CA  . THR A 1 412 ? 69.838  50.591 35.413  1.00 37.37 ? 412  THR A CA  1 
ATOM   3250 C  C   . THR A 1 412 ? 68.621  51.147 36.151  1.00 39.04 ? 412  THR A C   1 
ATOM   3251 O  O   . THR A 1 412 ? 67.518  50.621 36.018  1.00 40.75 ? 412  THR A O   1 
ATOM   3252 C  CB  . THR A 1 412 ? 70.539  49.441 36.127  1.00 36.49 ? 412  THR A CB  1 
ATOM   3253 O  OG1 . THR A 1 412 ? 71.472  48.905 35.199  1.00 35.28 ? 412  THR A OG1 1 
ATOM   3254 C  CG2 . THR A 1 412 ? 69.584  48.339 36.543  1.00 36.66 ? 412  THR A CG2 1 
ATOM   3255 N  N   . LYS A 1 413 ? 68.832  52.223 36.903  1.00 39.79 ? 413  LYS A N   1 
ATOM   3256 C  CA  . LYS A 1 413 ? 67.770  52.916 37.637  1.00 41.41 ? 413  LYS A CA  1 
ATOM   3257 C  C   . LYS A 1 413 ? 66.657  53.358 36.704  1.00 41.97 ? 413  LYS A C   1 
ATOM   3258 O  O   . LYS A 1 413 ? 65.499  53.427 37.113  1.00 44.77 ? 413  LYS A O   1 
ATOM   3259 C  CB  . LYS A 1 413 ? 68.353  54.128 38.374  1.00 41.85 ? 413  LYS A CB  1 
ATOM   3260 C  CG  . LYS A 1 413 ? 67.439  54.802 39.398  1.00 45.40 ? 413  LYS A CG  1 
ATOM   3261 N  N   . PHE A 1 414 ? 67.000  53.640 35.450  1.00 39.90 ? 414  PHE A N   1 
ATOM   3262 C  CA  . PHE A 1 414 ? 66.047  54.194 34.508  1.00 39.66 ? 414  PHE A CA  1 
ATOM   3263 C  C   . PHE A 1 414 ? 65.769  53.351 33.271  1.00 38.80 ? 414  PHE A C   1 
ATOM   3264 O  O   . PHE A 1 414 ? 64.697  53.474 32.680  1.00 40.07 ? 414  PHE A O   1 
ATOM   3265 C  CB  . PHE A 1 414 ? 66.522  55.562 34.059  1.00 39.08 ? 414  PHE A CB  1 
ATOM   3266 C  CG  . PHE A 1 414 ? 66.329  56.635 35.078  1.00 39.99 ? 414  PHE A CG  1 
ATOM   3267 C  CD1 . PHE A 1 414 ? 65.077  57.230 35.248  1.00 43.30 ? 414  PHE A CD1 1 
ATOM   3268 C  CD2 . PHE A 1 414 ? 67.395  57.069 35.851  1.00 38.32 ? 414  PHE A CD2 1 
ATOM   3269 C  CE1 . PHE A 1 414 ? 64.881  58.245 36.179  1.00 44.97 ? 414  PHE A CE1 1 
ATOM   3270 C  CE2 . PHE A 1 414 ? 67.220  58.082 36.781  1.00 42.60 ? 414  PHE A CE2 1 
ATOM   3271 C  CZ  . PHE A 1 414 ? 65.950  58.669 36.955  1.00 43.84 ? 414  PHE A CZ  1 
ATOM   3272 N  N   . GLY A 1 415 ? 66.709  52.504 32.876  1.00 36.85 ? 415  GLY A N   1 
ATOM   3273 C  CA  . GLY A 1 415 ? 66.614  51.806 31.585  1.00 36.61 ? 415  GLY A CA  1 
ATOM   3274 C  C   . GLY A 1 415 ? 65.615  50.652 31.569  1.00 38.74 ? 415  GLY A C   1 
ATOM   3275 O  O   . GLY A 1 415 ? 64.866  50.459 32.520  1.00 39.38 ? 415  GLY A O   1 
ATOM   3276 N  N   . ASN A 1 416 ? 65.617  49.865 30.501  1.00 38.11 ? 416  ASN A N   1 
ATOM   3277 C  CA  . ASN A 1 416 ? 64.631  48.825 30.361  1.00 40.67 ? 416  ASN A CA  1 
ATOM   3278 C  C   . ASN A 1 416 ? 65.236  47.404 30.356  1.00 39.66 ? 416  ASN A C   1 
ATOM   3279 O  O   . ASN A 1 416 ? 64.582  46.426 29.978  1.00 41.25 ? 416  ASN A O   1 
ATOM   3280 C  CB  . ASN A 1 416 ? 63.764  49.103 29.122  1.00 42.20 ? 416  ASN A CB  1 
ATOM   3281 C  CG  . ASN A 1 416 ? 62.570  48.164 29.012  1.00 48.49 ? 416  ASN A CG  1 
ATOM   3282 O  OD1 . ASN A 1 416 ? 62.440  47.464 28.009  1.00 48.24 ? 416  ASN A OD1 1 
ATOM   3283 N  ND2 . ASN A 1 416 ? 61.697  48.146 30.040  1.00 58.67 ? 416  ASN A ND2 1 
ATOM   3284 N  N   . GLY A 1 417 ? 66.472  47.282 30.818  1.00 37.23 ? 417  GLY A N   1 
ATOM   3285 C  CA  . GLY A 1 417 ? 67.086  45.975 30.956  1.00 36.46 ? 417  GLY A CA  1 
ATOM   3286 C  C   . GLY A 1 417 ? 68.572  46.034 30.732  1.00 34.76 ? 417  GLY A C   1 
ATOM   3287 O  O   . GLY A 1 417 ? 69.023  46.441 29.647  1.00 34.21 ? 417  GLY A O   1 
ATOM   3288 N  N   . THR A 1 418 ? 69.332  45.642 31.748  1.00 33.92 ? 418  THR A N   1 
ATOM   3289 C  CA  . THR A 1 418 ? 70.793  45.646 31.665  1.00 32.33 ? 418  THR A CA  1 
ATOM   3290 C  C   . THR A 1 418 ? 71.342  44.217 31.712  1.00 32.23 ? 418  THR A C   1 
ATOM   3291 O  O   . THR A 1 418 ? 70.903  43.427 32.533  1.00 32.67 ? 418  THR A O   1 
ATOM   3292 C  CB  . THR A 1 418 ? 71.357  46.453 32.823  1.00 32.26 ? 418  THR A CB  1 
ATOM   3293 O  OG1 . THR A 1 418 ? 70.917  47.818 32.688  1.00 33.44 ? 418  THR A OG1 1 
ATOM   3294 C  CG2 . THR A 1 418 ? 72.894  46.387 32.845  1.00 29.42 ? 418  THR A CG2 1 
ATOM   3295 N  N   . TYR A 1 419 ? 72.269  43.885 30.813  1.00 31.05 ? 419  TYR A N   1 
ATOM   3296 C  CA  . TYR A 1 419 ? 73.014  42.627 30.891  1.00 30.93 ? 419  TYR A CA  1 
ATOM   3297 C  C   . TYR A 1 419 ? 74.516  42.907 30.969  1.00 29.99 ? 419  TYR A C   1 
ATOM   3298 O  O   . TYR A 1 419 ? 75.083  43.521 30.069  1.00 28.88 ? 419  TYR A O   1 
ATOM   3299 C  CB  . TYR A 1 419 ? 72.698  41.699 29.708  1.00 30.95 ? 419  TYR A CB  1 
ATOM   3300 C  CG  . TYR A 1 419 ? 71.246  41.303 29.663  1.00 32.54 ? 419  TYR A CG  1 
ATOM   3301 C  CD1 . TYR A 1 419 ? 70.778  40.199 30.387  1.00 31.54 ? 419  TYR A CD1 1 
ATOM   3302 C  CD2 . TYR A 1 419 ? 70.310  42.076 28.953  1.00 31.81 ? 419  TYR A CD2 1 
ATOM   3303 C  CE1 . TYR A 1 419 ? 69.439  39.865 30.389  1.00 32.16 ? 419  TYR A CE1 1 
ATOM   3304 C  CE2 . TYR A 1 419 ? 68.944  41.732 28.949  1.00 32.52 ? 419  TYR A CE2 1 
ATOM   3305 C  CZ  . TYR A 1 419 ? 68.526  40.632 29.664  1.00 33.67 ? 419  TYR A CZ  1 
ATOM   3306 O  OH  . TYR A 1 419 ? 67.184  40.294 29.651  1.00 38.16 ? 419  TYR A OH  1 
ATOM   3307 N  N   . LEU A 1 420 ? 75.143  42.429 32.044  1.00 30.39 ? 420  LEU A N   1 
ATOM   3308 C  CA  . LEU A 1 420 ? 76.554  42.664 32.333  1.00 29.12 ? 420  LEU A CA  1 
ATOM   3309 C  C   . LEU A 1 420 ? 77.408  41.381 32.231  1.00 29.78 ? 420  LEU A C   1 
ATOM   3310 O  O   . LEU A 1 420 ? 77.000  40.298 32.710  1.00 30.14 ? 420  LEU A O   1 
ATOM   3311 C  CB  . LEU A 1 420 ? 76.681  43.295 33.727  1.00 28.92 ? 420  LEU A CB  1 
ATOM   3312 C  CG  . LEU A 1 420 ? 78.065  43.728 34.229  1.00 29.97 ? 420  LEU A CG  1 
ATOM   3313 C  CD1 . LEU A 1 420 ? 78.704  44.834 33.328  1.00 22.86 ? 420  LEU A CD1 1 
ATOM   3314 C  CD2 . LEU A 1 420 ? 77.949  44.205 35.665  1.00 30.89 ? 420  LEU A CD2 1 
ATOM   3315 N  N   . TYR A 1 421 ? 78.579  41.511 31.595  1.00 28.21 ? 421  TYR A N   1 
ATOM   3316 C  CA  . TYR A 1 421 ? 79.530  40.409 31.451  1.00 28.49 ? 421  TYR A CA  1 
ATOM   3317 C  C   . TYR A 1 421 ? 80.939  40.792 31.951  1.00 27.69 ? 421  TYR A C   1 
ATOM   3318 O  O   . TYR A 1 421 ? 81.307  41.981 32.021  1.00 26.65 ? 421  TYR A O   1 
ATOM   3319 C  CB  . TYR A 1 421 ? 79.607  39.895 29.996  1.00 28.25 ? 421  TYR A CB  1 
ATOM   3320 C  CG  . TYR A 1 421 ? 80.301  40.839 29.037  1.00 28.97 ? 421  TYR A CG  1 
ATOM   3321 C  CD1 . TYR A 1 421 ? 81.684  40.855 28.948  1.00 29.69 ? 421  TYR A CD1 1 
ATOM   3322 C  CD2 . TYR A 1 421 ? 79.569  41.712 28.202  1.00 29.97 ? 421  TYR A CD2 1 
ATOM   3323 C  CE1 . TYR A 1 421 ? 82.347  41.708 28.070  1.00 29.65 ? 421  TYR A CE1 1 
ATOM   3324 C  CE2 . TYR A 1 421 ? 80.231  42.602 27.308  1.00 28.86 ? 421  TYR A CE2 1 
ATOM   3325 C  CZ  . TYR A 1 421 ? 81.639  42.576 27.264  1.00 31.06 ? 421  TYR A CZ  1 
ATOM   3326 O  OH  . TYR A 1 421 ? 82.373  43.401 26.445  1.00 28.98 ? 421  TYR A OH  1 
ATOM   3327 N  N   . PHE A 1 422 ? 81.708  39.767 32.305  1.00 27.57 ? 422  PHE A N   1 
ATOM   3328 C  CA  . PHE A 1 422 ? 83.091  39.921 32.688  1.00 27.22 ? 422  PHE A CA  1 
ATOM   3329 C  C   . PHE A 1 422 ? 83.873  38.964 31.819  1.00 27.88 ? 422  PHE A C   1 
ATOM   3330 O  O   . PHE A 1 422 ? 83.776  37.740 31.988  1.00 29.24 ? 422  PHE A O   1 
ATOM   3331 C  CB  . PHE A 1 422 ? 83.294  39.589 34.163  1.00 27.90 ? 422  PHE A CB  1 
ATOM   3332 C  CG  . PHE A 1 422 ? 84.696  39.842 34.645  1.00 27.92 ? 422  PHE A CG  1 
ATOM   3333 C  CD1 . PHE A 1 422 ? 85.188  41.143 34.735  1.00 28.04 ? 422  PHE A CD1 1 
ATOM   3334 C  CD2 . PHE A 1 422 ? 85.537  38.773 34.992  1.00 30.00 ? 422  PHE A CD2 1 
ATOM   3335 C  CE1 . PHE A 1 422 ? 86.514  41.395 35.181  1.00 29.53 ? 422  PHE A CE1 1 
ATOM   3336 C  CE2 . PHE A 1 422 ? 86.855  39.014 35.455  1.00 31.54 ? 422  PHE A CE2 1 
ATOM   3337 C  CZ  . PHE A 1 422 ? 87.338  40.336 35.538  1.00 30.44 ? 422  PHE A CZ  1 
ATOM   3338 N  N   . PHE A 1 423 ? 84.620  39.504 30.870  1.00 27.40 ? 423  PHE A N   1 
ATOM   3339 C  CA  . PHE A 1 423 ? 85.327  38.648 29.927  1.00 28.40 ? 423  PHE A CA  1 
ATOM   3340 C  C   . PHE A 1 423 ? 86.713  38.279 30.436  1.00 28.32 ? 423  PHE A C   1 
ATOM   3341 O  O   . PHE A 1 423 ? 87.570  39.126 30.567  1.00 27.51 ? 423  PHE A O   1 
ATOM   3342 C  CB  . PHE A 1 423 ? 85.408  39.290 28.548  1.00 26.60 ? 423  PHE A CB  1 
ATOM   3343 C  CG  . PHE A 1 423 ? 86.057  38.422 27.525  1.00 27.47 ? 423  PHE A CG  1 
ATOM   3344 C  CD1 . PHE A 1 423 ? 87.436  38.432 27.347  1.00 27.06 ? 423  PHE A CD1 1 
ATOM   3345 C  CD2 . PHE A 1 423 ? 85.295  37.598 26.721  1.00 26.16 ? 423  PHE A CD2 1 
ATOM   3346 C  CE1 . PHE A 1 423 ? 88.033  37.618 26.374  1.00 27.96 ? 423  PHE A CE1 1 
ATOM   3347 C  CE2 . PHE A 1 423 ? 85.878  36.800 25.763  1.00 28.23 ? 423  PHE A CE2 1 
ATOM   3348 C  CZ  . PHE A 1 423 ? 87.245  36.796 25.587  1.00 26.92 ? 423  PHE A CZ  1 
ATOM   3349 N  N   . ASN A 1 424 ? 86.939  37.004 30.709  1.00 30.41 ? 424  ASN A N   1 
ATOM   3350 C  CA  . ASN A 1 424 ? 88.200  36.618 31.323  1.00 32.32 ? 424  ASN A CA  1 
ATOM   3351 C  C   . ASN A 1 424 ? 88.880  35.374 30.765  1.00 34.45 ? 424  ASN A C   1 
ATOM   3352 O  O   . ASN A 1 424 ? 89.627  34.694 31.488  1.00 35.07 ? 424  ASN A O   1 
ATOM   3353 C  CB  . ASN A 1 424 ? 88.046  36.515 32.840  1.00 32.48 ? 424  ASN A CB  1 
ATOM   3354 C  CG  . ASN A 1 424 ? 87.129  35.395 33.254  1.00 35.77 ? 424  ASN A CG  1 
ATOM   3355 O  OD1 . ASN A 1 424 ? 86.450  34.784 32.417  1.00 36.99 ? 424  ASN A OD1 1 
ATOM   3356 N  ND2 . ASN A 1 424 ? 87.108  35.102 34.560  1.00 36.21 ? 424  ASN A ND2 1 
ATOM   3357 N  N   . HIS A 1 425 ? 88.662  35.105 29.482  1.00 35.64 ? 425  HIS A N   1 
ATOM   3358 C  CA  . HIS A 1 425 ? 89.303  33.961 28.831  1.00 39.14 ? 425  HIS A CA  1 
ATOM   3359 C  C   . HIS A 1 425 ? 90.804  34.146 28.527  1.00 41.19 ? 425  HIS A C   1 
ATOM   3360 O  O   . HIS A 1 425 ? 91.200  35.119 27.883  1.00 39.66 ? 425  HIS A O   1 
ATOM   3361 C  CB  . HIS A 1 425 ? 88.583  33.590 27.542  1.00 38.49 ? 425  HIS A CB  1 
ATOM   3362 C  CG  . HIS A 1 425 ? 89.301  32.544 26.753  1.00 39.84 ? 425  HIS A CG  1 
ATOM   3363 N  ND1 . HIS A 1 425 ? 89.481  31.254 27.217  1.00 43.69 ? 425  HIS A ND1 1 
ATOM   3364 C  CD2 . HIS A 1 425 ? 89.908  32.600 25.544  1.00 37.57 ? 425  HIS A CD2 1 
ATOM   3365 C  CE1 . HIS A 1 425 ? 90.147  30.557 26.311  1.00 43.13 ? 425  HIS A CE1 1 
ATOM   3366 N  NE2 . HIS A 1 425 ? 90.421  31.353 25.289  1.00 40.71 ? 425  HIS A NE2 1 
ATOM   3367 N  N   . ARG A 1 426 ? 91.618  33.190 28.981  1.00 45.27 ? 426  ARG A N   1 
ATOM   3368 C  CA  . ARG A 1 426 ? 93.038  33.131 28.603  1.00 48.27 ? 426  ARG A CA  1 
ATOM   3369 C  C   . ARG A 1 426 ? 93.234  32.568 27.184  1.00 49.69 ? 426  ARG A C   1 
ATOM   3370 O  O   . ARG A 1 426 ? 92.968  31.377 26.944  1.00 51.45 ? 426  ARG A O   1 
ATOM   3371 C  CB  . ARG A 1 426 ? 93.865  32.290 29.596  1.00 50.30 ? 426  ARG A CB  1 
ATOM   3372 C  CG  . ARG A 1 426 ? 95.350  32.170 29.148  1.00 54.26 ? 426  ARG A CG  1 
ATOM   3373 C  CD  . ARG A 1 426 ? 96.294  31.576 30.191  1.00 60.47 ? 426  ARG A CD  1 
ATOM   3374 N  NE  . ARG A 1 426 ? 97.387  30.886 29.498  1.00 66.77 ? 426  ARG A NE  1 
ATOM   3375 C  CZ  . ARG A 1 426 ? 98.238  30.022 30.060  1.00 71.50 ? 426  ARG A CZ  1 
ATOM   3376 N  NH1 . ARG A 1 426 ? 98.158  29.734 31.362  1.00 71.55 ? 426  ARG A NH1 1 
ATOM   3377 N  NH2 . ARG A 1 426 ? 99.175  29.436 29.309  1.00 73.53 ? 426  ARG A NH2 1 
ATOM   3378 N  N   . ALA A 1 427 ? 93.724  33.415 26.276  1.00 49.21 ? 427  ALA A N   1 
ATOM   3379 C  CA  . ALA A 1 427 ? 94.125  33.032 24.911  1.00 50.87 ? 427  ALA A CA  1 
ATOM   3380 C  C   . ALA A 1 427 ? 94.834  31.697 24.784  1.00 53.99 ? 427  ALA A C   1 
ATOM   3381 O  O   . ALA A 1 427 ? 95.606  31.281 25.682  1.00 54.69 ? 427  ALA A O   1 
ATOM   3382 C  CB  . ALA A 1 427 ? 95.012  34.084 24.326  1.00 50.06 ? 427  ALA A CB  1 
ATOM   3383 N  N   . SER A 1 428 ? 94.603  31.047 23.648  1.00 55.57 ? 428  SER A N   1 
ATOM   3384 C  CA  . SER A 1 428 ? 95.434  29.904 23.275  1.00 59.26 ? 428  SER A CA  1 
ATOM   3385 C  C   . SER A 1 428 ? 96.657  30.365 22.487  1.00 59.92 ? 428  SER A C   1 
ATOM   3386 O  O   . SER A 1 428 ? 97.771  30.152 22.949  1.00 60.95 ? 428  SER A O   1 
ATOM   3387 C  CB  . SER A 1 428 ? 94.630  28.804 22.590  1.00 60.31 ? 428  SER A CB  1 
ATOM   3388 O  OG  . SER A 1 428 ? 93.996  28.058 23.611  1.00 61.09 ? 428  SER A OG  1 
ATOM   3389 N  N   . ASN A 1 429 ? 96.463  31.008 21.330  1.00 59.77 ? 429  ASN A N   1 
ATOM   3390 C  CA  A ASN A 1 429 ? 97.562  31.675 20.641  0.50 59.89 ? 429  ASN A CA  1 
ATOM   3391 C  CA  B ASN A 1 429 ? 97.603  31.653 20.666  0.50 60.25 ? 429  ASN A CA  1 
ATOM   3392 C  C   . ASN A 1 429 ? 98.036  32.911 21.433  1.00 58.65 ? 429  ASN A C   1 
ATOM   3393 O  O   . ASN A 1 429 ? 97.503  34.013 21.240  1.00 56.82 ? 429  ASN A O   1 
ATOM   3394 C  CB  A ASN A 1 429 ? 97.224  32.012 19.158  0.50 59.61 ? 429  ASN A CB  1 
ATOM   3395 C  CB  B ASN A 1 429 ? 97.339  31.970 19.186  0.50 60.33 ? 429  ASN A CB  1 
ATOM   3396 C  CG  A ASN A 1 429 ? 95.748  32.399 18.923  0.50 57.01 ? 429  ASN A CG  1 
ATOM   3397 C  CG  B ASN A 1 429 ? 98.623  32.322 18.426  0.50 61.44 ? 429  ASN A CG  1 
ATOM   3398 O  OD1 A ASN A 1 429 ? 95.140  33.107 19.713  0.50 52.92 ? 429  ASN A OD1 1 
ATOM   3399 O  OD1 B ASN A 1 429 ? 99.719  31.882 18.791  0.50 61.68 ? 429  ASN A OD1 1 
ATOM   3400 N  ND2 A ASN A 1 429 ? 95.188  31.937 17.808  0.50 55.69 ? 429  ASN A ND2 1 
ATOM   3401 N  ND2 B ASN A 1 429 ? 98.488  33.117 17.369  0.50 60.43 ? 429  ASN A ND2 1 
ATOM   3402 N  N   . LEU A 1 430 ? 99.014  32.729 22.331  1.00 59.04 ? 430  LEU A N   1 
ATOM   3403 C  CA  . LEU A 1 430 ? 99.549  33.875 23.086  1.00 57.53 ? 430  LEU A CA  1 
ATOM   3404 C  C   . LEU A 1 430 ? 100.478 34.744 22.218  1.00 56.50 ? 430  LEU A C   1 
ATOM   3405 O  O   . LEU A 1 430 ? 101.627 34.366 21.936  1.00 58.21 ? 430  LEU A O   1 
ATOM   3406 C  CB  . LEU A 1 430 ? 100.252 33.440 24.383  1.00 58.48 ? 430  LEU A CB  1 
ATOM   3407 C  CG  . LEU A 1 430 ? 99.431  33.213 25.663  1.00 58.26 ? 430  LEU A CG  1 
ATOM   3408 C  CD1 . LEU A 1 430 ? 100.336 32.473 26.682  1.00 60.07 ? 430  LEU A CD1 1 
ATOM   3409 C  CD2 . LEU A 1 430 ? 98.830  34.500 26.264  1.00 55.25 ? 430  LEU A CD2 1 
ATOM   3410 N  N   . VAL A 1 431 ? 99.955  35.898 21.790  1.00 53.35 ? 431  VAL A N   1 
ATOM   3411 C  CA  . VAL A 1 431 ? 100.725 36.878 21.021  1.00 51.32 ? 431  VAL A CA  1 
ATOM   3412 C  C   . VAL A 1 431 ? 101.590 37.716 21.989  1.00 49.39 ? 431  VAL A C   1 
ATOM   3413 O  O   . VAL A 1 431 ? 102.817 37.741 21.904  1.00 49.87 ? 431  VAL A O   1 
ATOM   3414 C  CB  . VAL A 1 431 ? 99.777  37.823 20.258  1.00 50.50 ? 431  VAL A CB  1 
ATOM   3415 C  CG1 . VAL A 1 431 ? 100.484 38.414 19.026  1.00 51.65 ? 431  VAL A CG1 1 
ATOM   3416 C  CG2 . VAL A 1 431 ? 98.454  37.111 19.878  1.00 50.49 ? 431  VAL A CG2 1 
ATOM   3417 N  N   . TRP A 1 432 ? 100.915 38.413 22.897  1.00 45.86 ? 432  TRP A N   1 
ATOM   3418 C  CA  . TRP A 1 432 ? 101.545 39.137 23.977  1.00 44.36 ? 432  TRP A CA  1 
ATOM   3419 C  C   . TRP A 1 432 ? 101.995 38.200 25.115  1.00 44.20 ? 432  TRP A C   1 
ATOM   3420 O  O   . TRP A 1 432 ? 101.508 37.084 25.224  1.00 44.42 ? 432  TRP A O   1 
ATOM   3421 C  CB  . TRP A 1 432 ? 100.551 40.136 24.525  1.00 42.54 ? 432  TRP A CB  1 
ATOM   3422 C  CG  . TRP A 1 432 ? 100.099 41.141 23.538  1.00 41.90 ? 432  TRP A CG  1 
ATOM   3423 C  CD1 . TRP A 1 432 ? 98.994  41.066 22.742  1.00 41.26 ? 432  TRP A CD1 1 
ATOM   3424 C  CD2 . TRP A 1 432 ? 100.742 42.380 23.221  1.00 41.07 ? 432  TRP A CD2 1 
ATOM   3425 N  NE1 . TRP A 1 432 ? 98.902  42.191 21.952  1.00 39.71 ? 432  TRP A NE1 1 
ATOM   3426 C  CE2 . TRP A 1 432 ? 99.952  43.020 22.232  1.00 40.21 ? 432  TRP A CE2 1 
ATOM   3427 C  CE3 . TRP A 1 432 ? 101.897 43.021 23.682  1.00 40.39 ? 432  TRP A CE3 1 
ATOM   3428 C  CZ2 . TRP A 1 432 ? 100.285 44.274 21.692  1.00 40.78 ? 432  TRP A CZ2 1 
ATOM   3429 C  CZ3 . TRP A 1 432 ? 102.233 44.271 23.138  1.00 40.43 ? 432  TRP A CZ3 1 
ATOM   3430 C  CH2 . TRP A 1 432 ? 101.424 44.887 22.164  1.00 39.81 ? 432  TRP A CH2 1 
ATOM   3431 N  N   . PRO A 1 433 ? 102.909 38.665 25.977  1.00 43.47 ? 433  PRO A N   1 
ATOM   3432 C  CA  . PRO A 1 433 ? 103.343 37.855 27.119  1.00 43.77 ? 433  PRO A CA  1 
ATOM   3433 C  C   . PRO A 1 433 ? 102.221 37.644 28.170  1.00 42.56 ? 433  PRO A C   1 
ATOM   3434 O  O   . PRO A 1 433 ? 101.210 38.359 28.185  1.00 41.43 ? 433  PRO A O   1 
ATOM   3435 C  CB  . PRO A 1 433 ? 104.472 38.689 27.706  1.00 43.78 ? 433  PRO A CB  1 
ATOM   3436 C  CG  . PRO A 1 433 ? 104.020 40.127 27.418  1.00 42.32 ? 433  PRO A CG  1 
ATOM   3437 C  CD  . PRO A 1 433 ? 103.467 40.032 26.027  1.00 42.57 ? 433  PRO A CD  1 
ATOM   3438 N  N   . GLU A 1 434 ? 102.411 36.651 29.024  1.00 43.38 ? 434  GLU A N   1 
ATOM   3439 C  CA  . GLU A 1 434 ? 101.447 36.227 30.042  1.00 42.59 ? 434  GLU A CA  1 
ATOM   3440 C  C   . GLU A 1 434 ? 101.055 37.266 31.063  1.00 39.35 ? 434  GLU A C   1 
ATOM   3441 O  O   . GLU A 1 434 ? 99.904  37.314 31.496  1.00 37.32 ? 434  GLU A O   1 
ATOM   3442 C  CB  . GLU A 1 434 ? 102.059 35.073 30.832  1.00 45.31 ? 434  GLU A CB  1 
ATOM   3443 C  CG  . GLU A 1 434 ? 101.886 33.755 30.183  1.00 52.88 ? 434  GLU A CG  1 
ATOM   3444 C  CD  . GLU A 1 434 ? 100.854 32.902 30.907  1.00 60.93 ? 434  GLU A CD  1 
ATOM   3445 O  OE1 . GLU A 1 434 ? 99.687  33.382 31.067  1.00 58.68 ? 434  GLU A OE1 1 
ATOM   3446 O  OE2 . GLU A 1 434 ? 101.236 31.752 31.299  1.00 62.73 ? 434  GLU A OE2 1 
ATOM   3447 N  N   . TRP A 1 435 ? 102.030 38.050 31.508  1.00 38.62 ? 435  TRP A N   1 
ATOM   3448 C  CA  . TRP A 1 435 ? 101.766 39.042 32.540  1.00 36.53 ? 435  TRP A CA  1 
ATOM   3449 C  C   . TRP A 1 435 ? 100.645 39.963 32.134  1.00 34.25 ? 435  TRP A C   1 
ATOM   3450 O  O   . TRP A 1 435 ? 99.909  40.440 32.965  1.00 33.19 ? 435  TRP A O   1 
ATOM   3451 C  CB  . TRP A 1 435 ? 103.020 39.822 32.917  1.00 37.33 ? 435  TRP A CB  1 
ATOM   3452 C  CG  . TRP A 1 435 ? 103.538 40.827 31.933  1.00 37.88 ? 435  TRP A CG  1 
ATOM   3453 C  CD1 . TRP A 1 435 ? 104.605 40.669 31.084  1.00 39.51 ? 435  TRP A CD1 1 
ATOM   3454 C  CD2 . TRP A 1 435 ? 103.080 42.181 31.756  1.00 36.37 ? 435  TRP A CD2 1 
ATOM   3455 N  NE1 . TRP A 1 435 ? 104.813 41.821 30.361  1.00 39.55 ? 435  TRP A NE1 1 
ATOM   3456 C  CE2 . TRP A 1 435 ? 103.892 42.768 30.750  1.00 37.42 ? 435  TRP A CE2 1 
ATOM   3457 C  CE3 . TRP A 1 435 ? 102.052 42.948 32.336  1.00 35.87 ? 435  TRP A CE3 1 
ATOM   3458 C  CZ2 . TRP A 1 435 ? 103.703 44.100 30.296  1.00 35.09 ? 435  TRP A CZ2 1 
ATOM   3459 C  CZ3 . TRP A 1 435 ? 101.863 44.278 31.886  1.00 37.43 ? 435  TRP A CZ3 1 
ATOM   3460 C  CH2 . TRP A 1 435 ? 102.693 44.833 30.865  1.00 33.45 ? 435  TRP A CH2 1 
ATOM   3461 N  N   . MET A 1 436 ? 100.489 40.183 30.837  1.00 32.92 ? 436  MET A N   1 
ATOM   3462 C  CA  . MET A 1 436 ? 99.464  41.100 30.368  1.00 29.71 ? 436  MET A CA  1 
ATOM   3463 C  C   . MET A 1 436 ? 98.039  40.512 30.471  1.00 28.80 ? 436  MET A C   1 
ATOM   3464 O  O   . MET A 1 436 ? 97.076  41.251 30.368  1.00 25.25 ? 436  MET A O   1 
ATOM   3465 C  CB  . MET A 1 436 ? 99.781  41.523 28.926  1.00 29.77 ? 436  MET A CB  1 
ATOM   3466 C  CG  . MET A 1 436 ? 101.072 42.311 28.796  1.00 30.19 ? 436  MET A CG  1 
ATOM   3467 S  SD  . MET A 1 436 ? 101.480 42.909 27.118  1.00 36.51 ? 436  MET A SD  1 
ATOM   3468 C  CE  . MET A 1 436 ? 100.076 43.951 26.703  1.00 29.87 ? 436  MET A CE  1 
ATOM   3469 N  N   . GLY A 1 437 ? 97.901  39.180 30.620  1.00 29.12 ? 437  GLY A N   1 
ATOM   3470 C  CA  . GLY A 1 437 ? 96.576  38.619 30.889  1.00 28.88 ? 437  GLY A CA  1 
ATOM   3471 C  C   . GLY A 1 437 ? 95.563  38.828 29.763  1.00 28.84 ? 437  GLY A C   1 
ATOM   3472 O  O   . GLY A 1 437 ? 95.901  38.686 28.585  1.00 28.80 ? 437  GLY A O   1 
ATOM   3473 N  N   . VAL A 1 438 ? 94.318  39.126 30.117  1.00 28.12 ? 438  VAL A N   1 
ATOM   3474 C  CA  . VAL A 1 438 ? 93.256  39.187 29.127  1.00 29.40 ? 438  VAL A CA  1 
ATOM   3475 C  C   . VAL A 1 438 ? 93.206  40.653 28.589  1.00 30.42 ? 438  VAL A C   1 
ATOM   3476 O  O   . VAL A 1 438 ? 92.604  41.552 29.187  1.00 28.77 ? 438  VAL A O   1 
ATOM   3477 C  CB  . VAL A 1 438 ? 91.901  38.704 29.708  1.00 29.28 ? 438  VAL A CB  1 
ATOM   3478 C  CG1 . VAL A 1 438 ? 90.821  38.681 28.643  1.00 27.49 ? 438  VAL A CG1 1 
ATOM   3479 C  CG2 . VAL A 1 438 ? 92.036  37.288 30.419  1.00 31.58 ? 438  VAL A CG2 1 
ATOM   3480 N  N   . ILE A 1 439 ? 93.870  40.862 27.461  1.00 32.73 ? 439  ILE A N   1 
ATOM   3481 C  CA  . ILE A 1 439 ? 94.217  42.193 27.004  1.00 34.54 ? 439  ILE A CA  1 
ATOM   3482 C  C   . ILE A 1 439 ? 93.044  42.999 26.399  1.00 34.71 ? 439  ILE A C   1 
ATOM   3483 O  O   . ILE A 1 439 ? 92.122  42.457 25.769  1.00 35.03 ? 439  ILE A O   1 
ATOM   3484 C  CB  . ILE A 1 439 ? 95.407  42.107 26.050  1.00 35.15 ? 439  ILE A CB  1 
ATOM   3485 C  CG1 . ILE A 1 439 ? 96.501  41.324 26.738  1.00 36.40 ? 439  ILE A CG1 1 
ATOM   3486 C  CG2 . ILE A 1 439 ? 95.968  43.501 25.729  1.00 37.59 ? 439  ILE A CG2 1 
ATOM   3487 C  CD1 . ILE A 1 439 ? 97.557  40.814 25.832  1.00 38.20 ? 439  ILE A CD1 1 
ATOM   3488 N  N   . HIS A 1 440 ? 93.061  44.295 26.682  1.00 34.94 ? 440  HIS A N   1 
ATOM   3489 C  CA  . HIS A 1 440 ? 92.357  45.307 25.902  1.00 35.08 ? 440  HIS A CA  1 
ATOM   3490 C  C   . HIS A 1 440 ? 92.074  44.852 24.447  1.00 34.04 ? 440  HIS A C   1 
ATOM   3491 O  O   . HIS A 1 440 ? 93.000  44.509 23.722  1.00 34.45 ? 440  HIS A O   1 
ATOM   3492 C  CB  . HIS A 1 440 ? 93.286  46.504 25.850  1.00 36.85 ? 440  HIS A CB  1 
ATOM   3493 C  CG  . HIS A 1 440 ? 92.831  47.583 24.930  1.00 39.53 ? 440  HIS A CG  1 
ATOM   3494 N  ND1 . HIS A 1 440 ? 91.753  48.389 25.219  1.00 42.03 ? 440  HIS A ND1 1 
ATOM   3495 C  CD2 . HIS A 1 440 ? 93.317  48.008 23.741  1.00 43.93 ? 440  HIS A CD2 1 
ATOM   3496 C  CE1 . HIS A 1 440 ? 91.586  49.263 24.243  1.00 42.52 ? 440  HIS A CE1 1 
ATOM   3497 N  NE2 . HIS A 1 440 ? 92.520  49.052 23.333  1.00 44.09 ? 440  HIS A NE2 1 
ATOM   3498 N  N   . GLY A 1 441 ? 90.814  44.832 24.033  1.00 31.82 ? 441  GLY A N   1 
ATOM   3499 C  CA  . GLY A 1 441 ? 90.501  44.467 22.656  1.00 30.91 ? 441  GLY A CA  1 
ATOM   3500 C  C   . GLY A 1 441 ? 90.396  42.973 22.329  1.00 31.09 ? 441  GLY A C   1 
ATOM   3501 O  O   . GLY A 1 441 ? 89.920  42.635 21.267  1.00 30.65 ? 441  GLY A O   1 
ATOM   3502 N  N   . TYR A 1 442 ? 90.806  42.076 23.229  1.00 30.99 ? 442  TYR A N   1 
ATOM   3503 C  CA  . TYR A 1 442 ? 90.848  40.635 22.903  1.00 31.92 ? 442  TYR A CA  1 
ATOM   3504 C  C   . TYR A 1 442 ? 89.485  40.011 22.726  1.00 30.89 ? 442  TYR A C   1 
ATOM   3505 O  O   . TYR A 1 442 ? 89.356  39.104 21.971  1.00 32.80 ? 442  TYR A O   1 
ATOM   3506 C  CB  . TYR A 1 442 ? 91.659  39.837 23.927  1.00 33.77 ? 442  TYR A CB  1 
ATOM   3507 C  CG  . TYR A 1 442 ? 91.755  38.298 23.735  1.00 38.21 ? 442  TYR A CG  1 
ATOM   3508 C  CD1 . TYR A 1 442 ? 92.011  37.724 22.486  1.00 41.00 ? 442  TYR A CD1 1 
ATOM   3509 C  CD2 . TYR A 1 442 ? 91.666  37.428 24.838  1.00 41.33 ? 442  TYR A CD2 1 
ATOM   3510 C  CE1 . TYR A 1 442 ? 92.106  36.327 22.321  1.00 43.34 ? 442  TYR A CE1 1 
ATOM   3511 C  CE2 . TYR A 1 442 ? 91.783  36.022 24.689  1.00 42.74 ? 442  TYR A CE2 1 
ATOM   3512 C  CZ  . TYR A 1 442 ? 91.999  35.477 23.431  1.00 46.13 ? 442  TYR A CZ  1 
ATOM   3513 O  OH  . TYR A 1 442 ? 92.145  34.086 23.272  1.00 47.09 ? 442  TYR A OH  1 
ATOM   3514 N  N   . GLU A 1 443 ? 88.459  40.519 23.388  1.00 29.68 ? 443  GLU A N   1 
ATOM   3515 C  CA  . GLU A 1 443 ? 87.129  39.972 23.227  1.00 28.84 ? 443  GLU A CA  1 
ATOM   3516 C  C   . GLU A 1 443 ? 86.574  40.194 21.811  1.00 28.84 ? 443  GLU A C   1 
ATOM   3517 O  O   . GLU A 1 443 ? 85.710  39.432 21.364  1.00 29.03 ? 443  GLU A O   1 
ATOM   3518 C  CB  . GLU A 1 443 ? 86.187  40.507 24.304  1.00 27.79 ? 443  GLU A CB  1 
ATOM   3519 C  CG  . GLU A 1 443 ? 85.477  41.844 23.964  1.00 28.20 ? 443  GLU A CG  1 
ATOM   3520 C  CD  . GLU A 1 443 ? 86.419  43.033 23.802  1.00 29.76 ? 443  GLU A CD  1 
ATOM   3521 O  OE1 . GLU A 1 443 ? 87.637  42.934 24.126  1.00 28.30 ? 443  GLU A OE1 1 
ATOM   3522 O  OE2 . GLU A 1 443 ? 85.922  44.081 23.340  1.00 27.96 ? 443  GLU A OE2 1 
ATOM   3523 N  N   . ILE A 1 444 ? 87.083  41.216 21.120  1.00 27.25 ? 444  ILE A N   1 
ATOM   3524 C  CA  . ILE A 1 444 ? 86.649  41.562 19.766  1.00 27.11 ? 444  ILE A CA  1 
ATOM   3525 C  C   . ILE A 1 444 ? 86.760  40.374 18.778  1.00 28.68 ? 444  ILE A C   1 
ATOM   3526 O  O   . ILE A 1 444 ? 85.788  40.028 18.098  1.00 29.42 ? 444  ILE A O   1 
ATOM   3527 C  CB  . ILE A 1 444 ? 87.386  42.846 19.200  1.00 26.53 ? 444  ILE A CB  1 
ATOM   3528 C  CG1 . ILE A 1 444 ? 87.071  44.067 20.062  1.00 25.34 ? 444  ILE A CG1 1 
ATOM   3529 C  CG2 . ILE A 1 444 ? 86.965  43.106 17.745  1.00 24.84 ? 444  ILE A CG2 1 
ATOM   3530 C  CD1 . ILE A 1 444 ? 87.987  45.322 19.796  1.00 24.95 ? 444  ILE A CD1 1 
ATOM   3531 N  N   . GLU A 1 445 ? 87.919  39.742 18.709  1.00 29.67 ? 445  GLU A N   1 
ATOM   3532 C  CA  . GLU A 1 445 ? 88.063  38.466 17.944  1.00 31.84 ? 445  GLU A CA  1 
ATOM   3533 C  C   . GLU A 1 445 ? 86.883  37.497 18.134  1.00 31.58 ? 445  GLU A C   1 
ATOM   3534 O  O   . GLU A 1 445 ? 86.443  36.846 17.203  1.00 32.74 ? 445  GLU A O   1 
ATOM   3535 C  CB  . GLU A 1 445 ? 89.333  37.731 18.348  1.00 32.11 ? 445  GLU A CB  1 
ATOM   3536 C  CG  . GLU A 1 445 ? 90.521  38.627 18.344  1.00 36.17 ? 445  GLU A CG  1 
ATOM   3537 C  CD  . GLU A 1 445 ? 91.754  38.017 18.971  1.00 37.18 ? 445  GLU A CD  1 
ATOM   3538 O  OE1 . GLU A 1 445 ? 91.817  36.794 19.135  1.00 41.48 ? 445  GLU A OE1 1 
ATOM   3539 O  OE2 . GLU A 1 445 ? 92.672  38.779 19.294  1.00 38.52 ? 445  GLU A OE2 1 
ATOM   3540 N  N   . PHE A 1 446 ? 86.349  37.448 19.342  1.00 30.77 ? 446  PHE A N   1 
ATOM   3541 C  CA  . PHE A 1 446 ? 85.284  36.509 19.666  1.00 30.59 ? 446  PHE A CA  1 
ATOM   3542 C  C   . PHE A 1 446 ? 83.933  36.995 19.195  1.00 29.89 ? 446  PHE A C   1 
ATOM   3543 O  O   . PHE A 1 446 ? 83.112  36.205 18.721  1.00 31.29 ? 446  PHE A O   1 
ATOM   3544 C  CB  . PHE A 1 446 ? 85.308  36.201 21.166  1.00 29.60 ? 446  PHE A CB  1 
ATOM   3545 C  CG  . PHE A 1 446 ? 86.461  35.342 21.548  1.00 29.96 ? 446  PHE A CG  1 
ATOM   3546 C  CD1 . PHE A 1 446 ? 87.729  35.906 21.797  1.00 27.35 ? 446  PHE A CD1 1 
ATOM   3547 C  CD2 . PHE A 1 446 ? 86.323  33.948 21.570  1.00 29.10 ? 446  PHE A CD2 1 
ATOM   3548 C  CE1 . PHE A 1 446 ? 88.799  35.091 22.129  1.00 31.00 ? 446  PHE A CE1 1 
ATOM   3549 C  CE2 . PHE A 1 446 ? 87.412  33.124 21.855  1.00 28.20 ? 446  PHE A CE2 1 
ATOM   3550 C  CZ  . PHE A 1 446 ? 88.639  33.676 22.149  1.00 30.39 ? 446  PHE A CZ  1 
ATOM   3551 N  N   . VAL A 1 447 ? 83.727  38.301 19.316  1.00 28.58 ? 447  VAL A N   1 
ATOM   3552 C  CA  . VAL A 1 447 ? 82.523  38.977 18.877  1.00 26.92 ? 447  VAL A CA  1 
ATOM   3553 C  C   . VAL A 1 447 ? 82.355  38.914 17.359  1.00 27.33 ? 447  VAL A C   1 
ATOM   3554 O  O   . VAL A 1 447 ? 81.236  38.845 16.879  1.00 27.64 ? 447  VAL A O   1 
ATOM   3555 C  CB  . VAL A 1 447 ? 82.542  40.447 19.391  1.00 26.93 ? 447  VAL A CB  1 
ATOM   3556 C  CG1 . VAL A 1 447 ? 81.377  41.304 18.790  1.00 25.34 ? 447  VAL A CG1 1 
ATOM   3557 C  CG2 . VAL A 1 447 ? 82.486  40.432 20.940  1.00 25.19 ? 447  VAL A CG2 1 
ATOM   3558 N  N   . PHE A 1 448 ? 83.460  38.947 16.619  1.00 27.03 ? 448  PHE A N   1 
ATOM   3559 C  CA  . PHE A 1 448 ? 83.437  38.919 15.171  1.00 28.25 ? 448  PHE A CA  1 
ATOM   3560 C  C   . PHE A 1 448 ? 83.703  37.510 14.603  1.00 30.66 ? 448  PHE A C   1 
ATOM   3561 O  O   . PHE A 1 448 ? 83.848  37.342 13.395  1.00 32.05 ? 448  PHE A O   1 
ATOM   3562 C  CB  . PHE A 1 448 ? 84.442  39.937 14.586  1.00 28.52 ? 448  PHE A CB  1 
ATOM   3563 C  CG  . PHE A 1 448 ? 83.932  41.364 14.610  1.00 27.23 ? 448  PHE A CG  1 
ATOM   3564 C  CD1 . PHE A 1 448 ? 84.025  42.119 15.755  1.00 24.37 ? 448  PHE A CD1 1 
ATOM   3565 C  CD2 . PHE A 1 448 ? 83.303  41.914 13.490  1.00 27.99 ? 448  PHE A CD2 1 
ATOM   3566 C  CE1 . PHE A 1 448 ? 83.525  43.450 15.797  1.00 27.59 ? 448  PHE A CE1 1 
ATOM   3567 C  CE2 . PHE A 1 448 ? 82.802  43.229 13.518  1.00 30.86 ? 448  PHE A CE2 1 
ATOM   3568 C  CZ  . PHE A 1 448 ? 82.921  43.998 14.682  1.00 27.93 ? 448  PHE A CZ  1 
ATOM   3569 N  N   . GLY A 1 449 ? 83.760  36.505 15.470  1.00 30.41 ? 449  GLY A N   1 
ATOM   3570 C  CA  . GLY A 1 449 ? 83.829  35.136 15.009  1.00 31.79 ? 449  GLY A CA  1 
ATOM   3571 C  C   . GLY A 1 449 ? 85.115  34.739 14.327  1.00 32.36 ? 449  GLY A C   1 
ATOM   3572 O  O   . GLY A 1 449 ? 85.072  33.971 13.427  1.00 34.38 ? 449  GLY A O   1 
ATOM   3573 N  N   . LEU A 1 450 ? 86.266  35.229 14.765  1.00 31.89 ? 450  LEU A N   1 
ATOM   3574 C  CA  . LEU A 1 450 ? 87.520  34.821 14.159  1.00 33.01 ? 450  LEU A CA  1 
ATOM   3575 C  C   . LEU A 1 450 ? 87.876  33.396 14.600  1.00 34.79 ? 450  LEU A C   1 
ATOM   3576 O  O   . LEU A 1 450 ? 88.530  32.664 13.838  1.00 34.87 ? 450  LEU A O   1 
ATOM   3577 C  CB  . LEU A 1 450 ? 88.662  35.786 14.499  1.00 32.27 ? 450  LEU A CB  1 
ATOM   3578 C  CG  . LEU A 1 450 ? 88.761  37.180 13.823  1.00 35.24 ? 450  LEU A CG  1 
ATOM   3579 C  CD1 . LEU A 1 450 ? 90.193  37.739 13.940  1.00 36.45 ? 450  LEU A CD1 1 
ATOM   3580 C  CD2 . LEU A 1 450 ? 88.377  37.144 12.356  1.00 37.96 ? 450  LEU A CD2 1 
ATOM   3581 N  N   . PRO A 1 451 ? 87.446  32.991 15.821  1.00 34.94 ? 451  PRO A N   1 
ATOM   3582 C  CA  . PRO A 1 451 ? 87.722  31.589 16.176  1.00 37.74 ? 451  PRO A CA  1 
ATOM   3583 C  C   . PRO A 1 451 ? 87.065  30.581 15.241  1.00 39.76 ? 451  PRO A C   1 
ATOM   3584 O  O   . PRO A 1 451 ? 87.512  29.469 15.205  1.00 42.45 ? 451  PRO A O   1 
ATOM   3585 C  CB  . PRO A 1 451 ? 87.268  31.485 17.642  1.00 36.70 ? 451  PRO A CB  1 
ATOM   3586 C  CG  . PRO A 1 451 ? 87.494  32.961 18.155  1.00 34.80 ? 451  PRO A CG  1 
ATOM   3587 C  CD  . PRO A 1 451 ? 86.942  33.750 16.984  1.00 33.63 ? 451  PRO A CD  1 
ATOM   3588 N  N   . LEU A 1 452 ? 86.096  30.987 14.421  1.00 40.06 ? 452  LEU A N   1 
ATOM   3589 C  CA  . LEU A 1 452 ? 85.498  30.058 13.448  1.00 42.22 ? 452  LEU A CA  1 
ATOM   3590 C  C   . LEU A 1 452 ? 86.372  29.709 12.233  1.00 44.21 ? 452  LEU A C   1 
ATOM   3591 O  O   . LEU A 1 452 ? 86.084  28.766 11.489  1.00 47.26 ? 452  LEU A O   1 
ATOM   3592 C  CB  . LEU A 1 452 ? 84.128  30.568 12.986  1.00 41.21 ? 452  LEU A CB  1 
ATOM   3593 C  CG  . LEU A 1 452 ? 82.944  30.225 13.889  1.00 39.22 ? 452  LEU A CG  1 
ATOM   3594 C  CD1 . LEU A 1 452 ? 82.983  30.990 15.185  1.00 36.58 ? 452  LEU A CD1 1 
ATOM   3595 C  CD2 . LEU A 1 452 ? 81.641  30.456 13.171  1.00 39.32 ? 452  LEU A CD2 1 
ATOM   3596 N  N   . VAL A 1 453 ? 87.451  30.454 12.051  1.00 44.05 ? 453  VAL A N   1 
ATOM   3597 C  CA  . VAL A 1 453 ? 88.285  30.338 10.873  1.00 45.08 ? 453  VAL A CA  1 
ATOM   3598 C  C   . VAL A 1 453 ? 89.368  29.356 11.226  1.00 47.97 ? 453  VAL A C   1 
ATOM   3599 O  O   . VAL A 1 453 ? 90.283  29.681 11.990  1.00 47.18 ? 453  VAL A O   1 
ATOM   3600 C  CB  . VAL A 1 453 ? 88.907  31.726 10.505  1.00 43.86 ? 453  VAL A CB  1 
ATOM   3601 C  CG1 . VAL A 1 453 ? 89.746  31.665 9.206   1.00 43.54 ? 453  VAL A CG1 1 
ATOM   3602 C  CG2 . VAL A 1 453 ? 87.827  32.806 10.428  1.00 39.25 ? 453  VAL A CG2 1 
ATOM   3603 N  N   . LYS A 1 454 ? 89.260  28.144 10.682  1.00 51.53 ? 454  LYS A N   1 
ATOM   3604 C  CA  . LYS A 1 454 ? 90.202  27.077 10.994  1.00 55.04 ? 454  LYS A CA  1 
ATOM   3605 C  C   . LYS A 1 454 ? 91.682  27.491 10.798  1.00 55.41 ? 454  LYS A C   1 
ATOM   3606 O  O   . LYS A 1 454 ? 92.545  27.098 11.593  1.00 56.04 ? 454  LYS A O   1 
ATOM   3607 C  CB  . LYS A 1 454 ? 89.875  25.796 10.190  1.00 58.53 ? 454  LYS A CB  1 
ATOM   3608 C  CG  . LYS A 1 454 ? 88.386  25.313 10.263  1.00 61.38 ? 454  LYS A CG  1 
ATOM   3609 C  CD  . LYS A 1 454 ? 87.961  24.749 11.642  1.00 63.03 ? 454  LYS A CD  1 
ATOM   3610 N  N   . GLU A 1 455 ? 91.964  28.281 9.757   1.00 55.27 ? 455  GLU A N   1 
ATOM   3611 C  CA  . GLU A 1 455 ? 93.338  28.740 9.450   1.00 56.18 ? 455  GLU A CA  1 
ATOM   3612 C  C   . GLU A 1 455 ? 93.918  29.644 10.552  1.00 53.66 ? 455  GLU A C   1 
ATOM   3613 O  O   . GLU A 1 455 ? 95.113  29.943 10.552  1.00 54.00 ? 455  GLU A O   1 
ATOM   3614 C  CB  . GLU A 1 455 ? 93.400  29.494 8.111   1.00 56.32 ? 455  GLU A CB  1 
ATOM   3615 C  CG  . GLU A 1 455 ? 92.910  28.728 6.881   1.00 61.89 ? 455  GLU A CG  1 
ATOM   3616 C  CD  . GLU A 1 455 ? 91.380  28.626 6.786   1.00 64.69 ? 455  GLU A CD  1 
ATOM   3617 O  OE1 . GLU A 1 455 ? 90.663  29.619 7.072   1.00 62.71 ? 455  GLU A OE1 1 
ATOM   3618 O  OE2 . GLU A 1 455 ? 90.898  27.535 6.412   1.00 67.47 ? 455  GLU A OE2 1 
ATOM   3619 N  N   . LEU A 1 456 ? 93.076  30.070 11.489  1.00 51.25 ? 456  LEU A N   1 
ATOM   3620 C  CA  . LEU A 1 456 ? 93.541  30.975 12.527  1.00 49.61 ? 456  LEU A CA  1 
ATOM   3621 C  C   . LEU A 1 456 ? 93.958  30.256 13.803  1.00 50.52 ? 456  LEU A C   1 
ATOM   3622 O  O   . LEU A 1 456 ? 94.473  30.872 14.729  1.00 49.48 ? 456  LEU A O   1 
ATOM   3623 C  CB  . LEU A 1 456 ? 92.537  32.105 12.785  1.00 46.44 ? 456  LEU A CB  1 
ATOM   3624 C  CG  . LEU A 1 456 ? 92.188  33.052 11.623  1.00 45.53 ? 456  LEU A CG  1 
ATOM   3625 C  CD1 . LEU A 1 456 ? 91.311  34.208 12.127  1.00 41.78 ? 456  LEU A CD1 1 
ATOM   3626 C  CD2 . LEU A 1 456 ? 93.404  33.607 10.888  1.00 43.86 ? 456  LEU A CD2 1 
ATOM   3627 N  N   . ASN A 1 457 ? 93.752  28.944 13.848  1.00 53.43 ? 457  ASN A N   1 
ATOM   3628 C  CA  . ASN A 1 457 ? 94.359  28.107 14.897  1.00 55.63 ? 457  ASN A CA  1 
ATOM   3629 C  C   . ASN A 1 457 ? 93.965  28.485 16.340  1.00 52.83 ? 457  ASN A C   1 
ATOM   3630 O  O   . ASN A 1 457 ? 94.821  28.470 17.241  1.00 53.36 ? 457  ASN A O   1 
ATOM   3631 C  CB  . ASN A 1 457 ? 95.896  28.084 14.750  1.00 58.41 ? 457  ASN A CB  1 
ATOM   3632 C  CG  . ASN A 1 457 ? 96.361  27.450 13.436  1.00 67.60 ? 457  ASN A CG  1 
ATOM   3633 O  OD1 . ASN A 1 457 ? 95.652  26.637 12.837  1.00 69.95 ? 457  ASN A OD1 1 
ATOM   3634 N  ND2 . ASN A 1 457 ? 97.568  27.823 12.989  1.00 79.86 ? 457  ASN A ND2 1 
ATOM   3635 N  N   . TYR A 1 458 ? 92.693  28.862 16.538  1.00 49.09 ? 458  TYR A N   1 
ATOM   3636 C  CA  . TYR A 1 458 ? 92.075  28.862 17.851  1.00 46.62 ? 458  TYR A CA  1 
ATOM   3637 C  C   . TYR A 1 458 ? 91.702  27.412 18.250  1.00 48.43 ? 458  TYR A C   1 
ATOM   3638 O  O   . TYR A 1 458 ? 91.697  26.483 17.413  1.00 49.77 ? 458  TYR A O   1 
ATOM   3639 C  CB  . TYR A 1 458 ? 90.814  29.727 17.866  1.00 44.77 ? 458  TYR A CB  1 
ATOM   3640 C  CG  . TYR A 1 458 ? 91.020  31.217 17.659  1.00 41.96 ? 458  TYR A CG  1 
ATOM   3641 C  CD1 . TYR A 1 458 ? 91.098  31.754 16.373  1.00 42.43 ? 458  TYR A CD1 1 
ATOM   3642 C  CD2 . TYR A 1 458 ? 91.119  32.088 18.754  1.00 39.54 ? 458  TYR A CD2 1 
ATOM   3643 C  CE1 . TYR A 1 458 ? 91.272  33.129 16.182  1.00 42.36 ? 458  TYR A CE1 1 
ATOM   3644 C  CE2 . TYR A 1 458 ? 91.291  33.448 18.585  1.00 38.93 ? 458  TYR A CE2 1 
ATOM   3645 C  CZ  . TYR A 1 458 ? 91.363  33.959 17.290  1.00 40.68 ? 458  TYR A CZ  1 
ATOM   3646 O  OH  . TYR A 1 458 ? 91.543  35.294 17.091  1.00 41.60 ? 458  TYR A OH  1 
ATOM   3647 N  N   . THR A 1 459 ? 91.387  27.215 19.524  1.00 46.94 ? 459  THR A N   1 
ATOM   3648 C  CA  . THR A 1 459 ? 90.987  25.888 19.969  1.00 48.85 ? 459  THR A CA  1 
ATOM   3649 C  C   . THR A 1 459 ? 89.505  25.681 19.709  1.00 48.44 ? 459  THR A C   1 
ATOM   3650 O  O   . THR A 1 459 ? 88.760  26.634 19.461  1.00 46.69 ? 459  THR A O   1 
ATOM   3651 C  CB  . THR A 1 459 ? 91.236  25.678 21.480  1.00 48.87 ? 459  THR A CB  1 
ATOM   3652 O  OG1 . THR A 1 459 ? 90.488  26.653 22.209  1.00 45.81 ? 459  THR A OG1 1 
ATOM   3653 C  CG2 . THR A 1 459 ? 92.714  25.792 21.822  1.00 47.99 ? 459  THR A CG2 1 
ATOM   3654 N  N   . ALA A 1 460 ? 89.079  24.431 19.823  1.00 49.58 ? 460  ALA A N   1 
ATOM   3655 C  CA  . ALA A 1 460 ? 87.674  24.085 19.734  1.00 49.22 ? 460  ALA A CA  1 
ATOM   3656 C  C   . ALA A 1 460 ? 86.846  24.809 20.781  1.00 46.45 ? 460  ALA A C   1 
ATOM   3657 O  O   . ALA A 1 460 ? 85.748  25.268 20.488  1.00 44.25 ? 460  ALA A O   1 
ATOM   3658 C  CB  . ALA A 1 460 ? 87.503  22.590 19.877  1.00 52.06 ? 460  ALA A CB  1 
ATOM   3659 N  N   . GLU A 1 461 ? 87.373  24.892 21.999  1.00 46.40 ? 461  GLU A N   1 
ATOM   3660 C  CA  . GLU A 1 461 ? 86.693  25.602 23.078  1.00 46.07 ? 461  GLU A CA  1 
ATOM   3661 C  C   . GLU A 1 461 ? 86.576  27.089 22.760  1.00 43.46 ? 461  GLU A C   1 
ATOM   3662 O  O   . GLU A 1 461 ? 85.662  27.761 23.232  1.00 42.17 ? 461  GLU A O   1 
ATOM   3663 C  CB  . GLU A 1 461 ? 87.391  25.412 24.435  1.00 46.77 ? 461  GLU A CB  1 
ATOM   3664 C  CG  . GLU A 1 461 ? 87.503  23.953 24.952  1.00 52.84 ? 461  GLU A CG  1 
ATOM   3665 C  CD  . GLU A 1 461 ? 86.155  23.283 25.223  0.50 55.29 ? 461  GLU A CD  1 
ATOM   3666 O  OE1 . GLU A 1 461 ? 85.296  23.248 24.316  0.50 55.51 ? 461  GLU A OE1 1 
ATOM   3667 O  OE2 . GLU A 1 461 ? 85.965  22.761 26.345  0.50 57.87 ? 461  GLU A OE2 1 
ATOM   3668 N  N   . GLU A 1 462 ? 87.494  27.611 21.955  1.00 42.92 ? 462  GLU A N   1 
ATOM   3669 C  CA  . GLU A 1 462 ? 87.408  29.031 21.594  1.00 40.78 ? 462  GLU A CA  1 
ATOM   3670 C  C   . GLU A 1 462 ? 86.373  29.292 20.499  1.00 40.35 ? 462  GLU A C   1 
ATOM   3671 O  O   . GLU A 1 462 ? 85.668  30.316 20.552  1.00 38.28 ? 462  GLU A O   1 
ATOM   3672 C  CB  . GLU A 1 462 ? 88.787  29.603 21.260  1.00 40.06 ? 462  GLU A CB  1 
ATOM   3673 C  CG  . GLU A 1 462 ? 89.599  29.814 22.504  1.00 39.37 ? 462  GLU A CG  1 
ATOM   3674 C  CD  . GLU A 1 462 ? 91.072  30.018 22.236  1.00 42.02 ? 462  GLU A CD  1 
ATOM   3675 O  OE1 . GLU A 1 462 ? 91.567  29.489 21.220  1.00 47.36 ? 462  GLU A OE1 1 
ATOM   3676 O  OE2 . GLU A 1 462 ? 91.739  30.712 23.044  1.00 41.21 ? 462  GLU A OE2 1 
ATOM   3677 N  N   . GLU A 1 463 ? 86.283  28.367 19.531  1.00 41.64 ? 463  GLU A N   1 
ATOM   3678 C  CA  . GLU A 1 463 ? 85.246  28.415 18.509  1.00 42.09 ? 463  GLU A CA  1 
ATOM   3679 C  C   . GLU A 1 463 ? 83.893  28.428 19.191  1.00 42.44 ? 463  GLU A C   1 
ATOM   3680 O  O   . GLU A 1 463 ? 83.052  29.320 18.923  1.00 42.26 ? 463  GLU A O   1 
ATOM   3681 C  CB  . GLU A 1 463 ? 85.325  27.246 17.540  1.00 44.68 ? 463  GLU A CB  1 
ATOM   3682 C  CG  . GLU A 1 463 ? 84.394  27.389 16.360  1.00 46.51 ? 463  GLU A CG  1 
ATOM   3683 C  CD  . GLU A 1 463 ? 84.548  26.299 15.331  1.00 53.13 ? 463  GLU A CD  1 
ATOM   3684 O  OE1 . GLU A 1 463 ? 85.690  25.841 15.037  1.00 52.83 ? 463  GLU A OE1 1 
ATOM   3685 O  OE2 . GLU A 1 463 ? 83.495  25.912 14.795  1.00 56.64 ? 463  GLU A OE2 1 
ATOM   3686 N  N   . ALA A 1 464 ? 83.704  27.485 20.106  1.00 43.11 ? 464  ALA A N   1 
ATOM   3687 C  CA  . ALA A 1 464 ? 82.464  27.373 20.853  1.00 43.12 ? 464  ALA A CA  1 
ATOM   3688 C  C   . ALA A 1 464 ? 82.139  28.610 21.681  1.00 40.47 ? 464  ALA A C   1 
ATOM   3689 O  O   . ALA A 1 464 ? 80.980  28.980 21.785  1.00 40.42 ? 464  ALA A O   1 
ATOM   3690 C  CB  . ALA A 1 464 ? 82.466  26.101 21.725  1.00 44.97 ? 464  ALA A CB  1 
ATOM   3691 N  N   . LEU A 1 465 ? 83.146  29.249 22.271  1.00 38.87 ? 465  LEU A N   1 
ATOM   3692 C  CA  . LEU A 1 465 ? 82.909  30.487 23.008  1.00 37.01 ? 465  LEU A CA  1 
ATOM   3693 C  C   . LEU A 1 465 ? 82.551  31.653 22.077  1.00 35.70 ? 465  LEU A C   1 
ATOM   3694 O  O   . LEU A 1 465 ? 81.639  32.455 22.379  1.00 34.91 ? 465  LEU A O   1 
ATOM   3695 C  CB  . LEU A 1 465 ? 84.123  30.861 23.868  1.00 36.39 ? 465  LEU A CB  1 
ATOM   3696 C  CG  . LEU A 1 465 ? 84.119  32.228 24.550  1.00 33.43 ? 465  LEU A CG  1 
ATOM   3697 C  CD1 . LEU A 1 465 ? 83.025  32.319 25.650  1.00 31.16 ? 465  LEU A CD1 1 
ATOM   3698 C  CD2 . LEU A 1 465 ? 85.511  32.529 25.150  1.00 32.42 ? 465  LEU A CD2 1 
ATOM   3699 N  N   . SER A 1 466 ? 83.273  31.764 20.963  1.00 35.43 ? 466  SER A N   1 
ATOM   3700 C  CA  . SER A 1 466 ? 82.955  32.786 19.968  1.00 35.07 ? 466  SER A CA  1 
ATOM   3701 C  C   . SER A 1 466 ? 81.514  32.646 19.507  1.00 35.85 ? 466  SER A C   1 
ATOM   3702 O  O   . SER A 1 466 ? 80.805  33.641 19.414  1.00 35.15 ? 466  SER A O   1 
ATOM   3703 C  CB  . SER A 1 466 ? 83.856  32.665 18.751  1.00 35.71 ? 466  SER A CB  1 
ATOM   3704 O  OG  . SER A 1 466 ? 83.504  33.665 17.815  1.00 34.80 ? 466  SER A OG  1 
ATOM   3705 N  N   . ARG A 1 467 ? 81.079  31.406 19.248  1.00 37.88 ? 467  ARG A N   1 
ATOM   3706 C  CA  . ARG A 1 467 ? 79.715  31.154 18.787  1.00 38.65 ? 467  ARG A CA  1 
ATOM   3707 C  C   . ARG A 1 467 ? 78.701  31.540 19.834  1.00 38.33 ? 467  ARG A C   1 
ATOM   3708 O  O   . ARG A 1 467 ? 77.649  32.092 19.481  1.00 38.24 ? 467  ARG A O   1 
ATOM   3709 C  CB  . ARG A 1 467 ? 79.501  29.693 18.384  1.00 40.59 ? 467  ARG A CB  1 
ATOM   3710 C  CG  . ARG A 1 467 ? 80.248  29.301 17.137  1.00 41.96 ? 467  ARG A CG  1 
ATOM   3711 C  CD  . ARG A 1 467 ? 79.822  27.931 16.669  1.00 43.78 ? 467  ARG A CD  1 
ATOM   3712 N  NE  . ARG A 1 467 ? 80.510  27.538 15.442  1.00 46.20 ? 467  ARG A NE  1 
ATOM   3713 C  CZ  . ARG A 1 467 ? 80.055  27.771 14.212  1.00 47.48 ? 467  ARG A CZ  1 
ATOM   3714 N  NH1 . ARG A 1 467 ? 78.904  28.415 14.024  1.00 46.48 ? 467  ARG A NH1 1 
ATOM   3715 N  NH2 . ARG A 1 467 ? 80.760  27.369 13.161  1.00 47.44 ? 467  ARG A NH2 1 
ATOM   3716 N  N   . ARG A 1 468 ? 79.011  31.237 21.101  1.00 37.63 ? 468  ARG A N   1 
ATOM   3717 C  CA  . ARG A 1 468 ? 78.160  31.619 22.245  1.00 37.74 ? 468  ARG A CA  1 
ATOM   3718 C  C   . ARG A 1 468 ? 78.047  33.154 22.333  1.00 34.85 ? 468  ARG A C   1 
ATOM   3719 O  O   . ARG A 1 468 ? 76.967  33.704 22.545  1.00 34.63 ? 468  ARG A O   1 
ATOM   3720 C  CB  . ARG A 1 468 ? 78.749  31.081 23.568  1.00 38.42 ? 468  ARG A CB  1 
ATOM   3721 C  CG  . ARG A 1 468 ? 77.801  30.255 24.438  1.00 42.75 ? 468  ARG A CG  1 
ATOM   3722 C  CD  . ARG A 1 468 ? 78.530  29.617 25.657  1.00 44.88 ? 468  ARG A CD  1 
ATOM   3723 N  NE  . ARG A 1 468 ? 78.402  30.475 26.823  1.00 49.17 ? 468  ARG A NE  1 
ATOM   3724 C  CZ  . ARG A 1 468 ? 79.403  30.861 27.612  1.00 52.70 ? 468  ARG A CZ  1 
ATOM   3725 N  NH1 . ARG A 1 468 ? 80.643  30.426 27.395  1.00 54.86 ? 468  ARG A NH1 1 
ATOM   3726 N  NH2 . ARG A 1 468 ? 79.156  31.673 28.642  1.00 53.01 ? 468  ARG A NH2 1 
ATOM   3727 N  N   . ILE A 1 469 ? 79.180  33.829 22.224  1.00 32.76 ? 469  ILE A N   1 
ATOM   3728 C  CA  . ILE A 1 469 ? 79.189  35.274 22.284  1.00 30.67 ? 469  ILE A CA  1 
ATOM   3729 C  C   . ILE A 1 469 ? 78.429  35.903 21.090  1.00 31.43 ? 469  ILE A C   1 
ATOM   3730 O  O   . ILE A 1 469 ? 77.579  36.760 21.299  1.00 30.94 ? 469  ILE A O   1 
ATOM   3731 C  CB  . ILE A 1 469 ? 80.613  35.813 22.394  1.00 29.01 ? 469  ILE A CB  1 
ATOM   3732 C  CG1 . ILE A 1 469 ? 81.200  35.418 23.768  1.00 28.49 ? 469  ILE A CG1 1 
ATOM   3733 C  CG2 . ILE A 1 469 ? 80.619  37.359 22.189  1.00 25.69 ? 469  ILE A CG2 1 
ATOM   3734 C  CD1 . ILE A 1 469 ? 82.695  35.620 23.912  1.00 27.98 ? 469  ILE A CD1 1 
ATOM   3735 N  N   . MET A 1 470 ? 78.692  35.447 19.862  1.00 32.49 ? 470  MET A N   1 
ATOM   3736 C  CA  . MET A 1 470 ? 77.992  36.013 18.704  1.00 33.63 ? 470  MET A CA  1 
ATOM   3737 C  C   . MET A 1 470 ? 76.491  35.879 18.865  1.00 34.39 ? 470  MET A C   1 
ATOM   3738 O  O   . MET A 1 470 ? 75.756  36.817 18.593  1.00 33.77 ? 470  MET A O   1 
ATOM   3739 C  CB  . MET A 1 470 ? 78.437  35.360 17.399  1.00 34.15 ? 470  MET A CB  1 
ATOM   3740 C  CG  . MET A 1 470 ? 79.778  35.901 16.909  1.00 34.70 ? 470  MET A CG  1 
ATOM   3741 S  SD  . MET A 1 470 ? 80.205  35.249 15.295  1.00 38.37 ? 470  MET A SD  1 
ATOM   3742 C  CE  . MET A 1 470 ? 80.026  33.509 15.561  1.00 36.44 ? 470  MET A CE  1 
ATOM   3743 N  N   . HIS A 1 471 ? 76.060  34.717 19.351  1.00 35.82 ? 471  HIS A N   1 
ATOM   3744 C  CA  . HIS A 1 471 ? 74.644  34.429 19.513  1.00 36.60 ? 471  HIS A CA  1 
ATOM   3745 C  C   . HIS A 1 471 ? 73.997  35.220 20.635  1.00 35.74 ? 471  HIS A C   1 
ATOM   3746 O  O   . HIS A 1 471 ? 72.890  35.719 20.447  1.00 35.30 ? 471  HIS A O   1 
ATOM   3747 C  CB  . HIS A 1 471 ? 74.384  32.934 19.697  1.00 39.03 ? 471  HIS A CB  1 
ATOM   3748 C  CG  . HIS A 1 471 ? 72.951  32.565 19.510  1.00 41.35 ? 471  HIS A CG  1 
ATOM   3749 N  ND1 . HIS A 1 471 ? 72.297  32.719 18.304  1.00 43.15 ? 471  HIS A ND1 1 
ATOM   3750 C  CD2 . HIS A 1 471 ? 72.031  32.103 20.382  1.00 42.90 ? 471  HIS A CD2 1 
ATOM   3751 C  CE1 . HIS A 1 471 ? 71.045  32.328 18.431  1.00 45.34 ? 471  HIS A CE1 1 
ATOM   3752 N  NE2 . HIS A 1 471 ? 70.857  31.950 19.682  1.00 47.61 ? 471  HIS A NE2 1 
ATOM   3753 N  N   . TYR A 1 472 ? 74.667  35.336 21.786  1.00 34.43 ? 472  TYR A N   1 
ATOM   3754 C  CA  . TYR A 1 472 ? 74.258  36.322 22.799  1.00 34.25 ? 472  TYR A CA  1 
ATOM   3755 C  C   . TYR A 1 472 ? 74.114  37.746 22.196  1.00 32.85 ? 472  TYR A C   1 
ATOM   3756 O  O   . TYR A 1 472 ? 73.127  38.435 22.451  1.00 33.19 ? 472  TYR A O   1 
ATOM   3757 C  CB  . TYR A 1 472 ? 75.271  36.422 23.960  1.00 33.41 ? 472  TYR A CB  1 
ATOM   3758 C  CG  . TYR A 1 472 ? 75.327  35.267 24.936  1.00 35.84 ? 472  TYR A CG  1 
ATOM   3759 C  CD1 . TYR A 1 472 ? 74.183  34.594 25.339  1.00 37.94 ? 472  TYR A CD1 1 
ATOM   3760 C  CD2 . TYR A 1 472 ? 76.545  34.888 25.502  1.00 36.82 ? 472  TYR A CD2 1 
ATOM   3761 C  CE1 . TYR A 1 472 ? 74.262  33.529 26.240  1.00 41.09 ? 472  TYR A CE1 1 
ATOM   3762 C  CE2 . TYR A 1 472 ? 76.636  33.869 26.411  1.00 37.78 ? 472  TYR A CE2 1 
ATOM   3763 C  CZ  . TYR A 1 472 ? 75.501  33.188 26.778  1.00 41.05 ? 472  TYR A CZ  1 
ATOM   3764 O  OH  . TYR A 1 472 ? 75.621  32.172 27.679  1.00 42.24 ? 472  TYR A OH  1 
ATOM   3765 N  N   . TRP A 1 473 ? 75.121  38.206 21.458  1.00 31.48 ? 473  TRP A N   1 
ATOM   3766 C  CA  . TRP A 1 473 ? 75.102  39.568 20.911  1.00 31.26 ? 473  TRP A CA  1 
ATOM   3767 C  C   . TRP A 1 473 ? 73.935  39.791 19.937  1.00 31.91 ? 473  TRP A C   1 
ATOM   3768 O  O   . TRP A 1 473 ? 73.235  40.800 20.019  1.00 32.12 ? 473  TRP A O   1 
ATOM   3769 C  CB  . TRP A 1 473 ? 76.413  39.870 20.163  1.00 30.04 ? 473  TRP A CB  1 
ATOM   3770 C  CG  . TRP A 1 473 ? 77.485  40.614 20.925  1.00 29.28 ? 473  TRP A CG  1 
ATOM   3771 C  CD1 . TRP A 1 473 ? 78.202  41.697 20.478  1.00 28.55 ? 473  TRP A CD1 1 
ATOM   3772 C  CD2 . TRP A 1 473 ? 77.973  40.328 22.245  1.00 28.03 ? 473  TRP A CD2 1 
ATOM   3773 N  NE1 . TRP A 1 473 ? 79.121  42.084 21.432  1.00 28.34 ? 473  TRP A NE1 1 
ATOM   3774 C  CE2 . TRP A 1 473 ? 78.999  41.263 22.524  1.00 26.39 ? 473  TRP A CE2 1 
ATOM   3775 C  CE3 . TRP A 1 473 ? 77.665  39.354 23.206  1.00 27.83 ? 473  TRP A CE3 1 
ATOM   3776 C  CZ2 . TRP A 1 473 ? 79.702  41.269 23.734  1.00 26.69 ? 473  TRP A CZ2 1 
ATOM   3777 C  CZ3 . TRP A 1 473 ? 78.356  39.363 24.411  1.00 29.23 ? 473  TRP A CZ3 1 
ATOM   3778 C  CH2 . TRP A 1 473 ? 79.382  40.305 24.662  1.00 27.03 ? 473  TRP A CH2 1 
ATOM   3779 N  N   . ALA A 1 474 ? 73.755  38.850 19.015  1.00 32.28 ? 474  ALA A N   1 
ATOM   3780 C  CA  . ALA A 1 474 ? 72.768  38.985 17.955  1.00 32.84 ? 474  ALA A CA  1 
ATOM   3781 C  C   . ALA A 1 474 ? 71.368  38.807 18.504  1.00 34.08 ? 474  ALA A C   1 
ATOM   3782 O  O   . ALA A 1 474 ? 70.448  39.525 18.099  1.00 34.83 ? 474  ALA A O   1 
ATOM   3783 C  CB  . ALA A 1 474 ? 73.035  38.004 16.859  1.00 32.68 ? 474  ALA A CB  1 
ATOM   3784 N  N   . THR A 1 475 ? 71.215  37.866 19.443  1.00 34.37 ? 475  THR A N   1 
ATOM   3785 C  CA  . THR A 1 475 ? 69.924  37.603 20.056  1.00 33.95 ? 475  THR A CA  1 
ATOM   3786 C  C   . THR A 1 475 ? 69.539  38.847 20.851  1.00 32.97 ? 475  THR A C   1 
ATOM   3787 O  O   . THR A 1 475 ? 68.390  39.300 20.786  1.00 32.62 ? 475  THR A O   1 
ATOM   3788 C  CB  . THR A 1 475 ? 69.941  36.352 20.954  1.00 34.46 ? 475  THR A CB  1 
ATOM   3789 O  OG1 . THR A 1 475 ? 70.237  35.211 20.140  1.00 36.65 ? 475  THR A OG1 1 
ATOM   3790 C  CG2 . THR A 1 475 ? 68.583  36.128 21.663  1.00 33.46 ? 475  THR A CG2 1 
ATOM   3791 N  N   . PHE A 1 476 ? 70.507  39.417 21.564  1.00 31.44 ? 476  PHE A N   1 
ATOM   3792 C  CA  . PHE A 1 476 ? 70.249  40.675 22.261  1.00 31.08 ? 476  PHE A CA  1 
ATOM   3793 C  C   . PHE A 1 476 ? 69.809  41.736 21.266  1.00 31.20 ? 476  PHE A C   1 
ATOM   3794 O  O   . PHE A 1 476 ? 68.790  42.404 21.471  1.00 31.78 ? 476  PHE A O   1 
ATOM   3795 C  CB  . PHE A 1 476 ? 71.465  41.170 23.033  1.00 29.63 ? 476  PHE A CB  1 
ATOM   3796 C  CG  . PHE A 1 476 ? 71.299  42.543 23.557  1.00 26.72 ? 476  PHE A CG  1 
ATOM   3797 C  CD1 . PHE A 1 476 ? 70.547  42.774 24.702  1.00 28.63 ? 476  PHE A CD1 1 
ATOM   3798 C  CD2 . PHE A 1 476 ? 71.842  43.629 22.879  1.00 26.64 ? 476  PHE A CD2 1 
ATOM   3799 C  CE1 . PHE A 1 476 ? 70.374  44.096 25.197  1.00 27.16 ? 476  PHE A CE1 1 
ATOM   3800 C  CE2 . PHE A 1 476 ? 71.676  44.921 23.354  1.00 24.46 ? 476  PHE A CE2 1 
ATOM   3801 C  CZ  . PHE A 1 476 ? 70.942  45.149 24.525  1.00 24.11 ? 476  PHE A CZ  1 
ATOM   3802 N  N   . ALA A 1 477 ? 70.552  41.857 20.167  1.00 31.23 ? 477  ALA A N   1 
ATOM   3803 C  CA  . ALA A 1 477 ? 70.218  42.831 19.117  1.00 31.89 ? 477  ALA A CA  1 
ATOM   3804 C  C   . ALA A 1 477 ? 68.781  42.633 18.594  1.00 34.04 ? 477  ALA A C   1 
ATOM   3805 O  O   . ALA A 1 477 ? 68.029  43.607 18.389  1.00 32.87 ? 477  ALA A O   1 
ATOM   3806 C  CB  . ALA A 1 477 ? 71.269  42.806 17.976  1.00 30.63 ? 477  ALA A CB  1 
ATOM   3807 N  N   . LYS A 1 478 ? 68.369  41.371 18.447  1.00 36.45 ? 478  LYS A N   1 
ATOM   3808 C  CA  . LYS A 1 478 ? 67.006  41.088 17.958  1.00 39.04 ? 478  LYS A CA  1 
ATOM   3809 C  C   . LYS A 1 478 ? 65.885  41.383 18.964  1.00 39.23 ? 478  LYS A C   1 
ATOM   3810 O  O   . LYS A 1 478 ? 64.788  41.758 18.566  1.00 40.17 ? 478  LYS A O   1 
ATOM   3811 C  CB  . LYS A 1 478 ? 66.894  39.645 17.441  1.00 41.33 ? 478  LYS A CB  1 
ATOM   3812 C  CG  . LYS A 1 478 ? 67.728  39.406 16.180  1.00 45.85 ? 478  LYS A CG  1 
ATOM   3813 C  CD  . LYS A 1 478 ? 68.288  37.978 16.020  1.00 51.39 ? 478  LYS A CD  1 
ATOM   3814 C  CE  . LYS A 1 478 ? 68.994  37.885 14.672  1.00 53.23 ? 478  LYS A CE  1 
ATOM   3815 N  NZ  . LYS A 1 478 ? 69.124  36.481 14.160  1.00 58.45 ? 478  LYS A NZ  1 
ATOM   3816 N  N   . THR A 1 479 ? 66.147  41.237 20.257  1.00 38.77 ? 479  THR A N   1 
ATOM   3817 C  CA  . THR A 1 479 ? 65.032  41.112 21.197  1.00 40.21 ? 479  THR A CA  1 
ATOM   3818 C  C   . THR A 1 479 ? 65.155  41.949 22.447  1.00 39.92 ? 479  THR A C   1 
ATOM   3819 O  O   . THR A 1 479 ? 64.182  42.113 23.175  1.00 41.45 ? 479  THR A O   1 
ATOM   3820 C  CB  . THR A 1 479 ? 64.853  39.643 21.685  1.00 41.81 ? 479  THR A CB  1 
ATOM   3821 O  OG1 . THR A 1 479 ? 65.997  39.255 22.457  1.00 40.13 ? 479  THR A OG1 1 
ATOM   3822 C  CG2 . THR A 1 479 ? 64.637  38.668 20.503  1.00 41.74 ? 479  THR A CG2 1 
ATOM   3823 N  N   . GLY A 1 480 ? 66.357  42.442 22.718  1.00 37.87 ? 480  GLY A N   1 
ATOM   3824 C  CA  . GLY A 1 480 ? 66.634  43.130 23.973  1.00 36.66 ? 480  GLY A CA  1 
ATOM   3825 C  C   . GLY A 1 480 ? 67.065  42.168 25.074  1.00 36.40 ? 480  GLY A C   1 
ATOM   3826 O  O   . GLY A 1 480 ? 67.177  42.566 26.234  1.00 36.16 ? 480  GLY A O   1 
ATOM   3827 N  N   . ASN A 1 481 ? 67.313  40.912 24.711  1.00 36.15 ? 481  ASN A N   1 
ATOM   3828 C  CA  . ASN A 1 481 ? 67.633  39.862 25.679  1.00 37.22 ? 481  ASN A CA  1 
ATOM   3829 C  C   . ASN A 1 481 ? 68.612  38.874 25.046  1.00 36.53 ? 481  ASN A C   1 
ATOM   3830 O  O   . ASN A 1 481 ? 68.302  38.309 24.025  1.00 37.25 ? 481  ASN A O   1 
ATOM   3831 C  CB  . ASN A 1 481 ? 66.342  39.163 26.108  1.00 39.52 ? 481  ASN A CB  1 
ATOM   3832 C  CG  . ASN A 1 481 ? 66.571  38.035 27.112  1.00 41.06 ? 481  ASN A CG  1 
ATOM   3833 O  OD1 . ASN A 1 481 ? 67.652  37.448 27.189  1.00 40.23 ? 481  ASN A OD1 1 
ATOM   3834 N  ND2 . ASN A 1 481 ? 65.540  37.732 27.885  1.00 40.14 ? 481  ASN A ND2 1 
ATOM   3835 N  N   . PRO A 1 482 ? 69.822  38.706 25.617  1.00 35.99 ? 482  PRO A N   1 
ATOM   3836 C  CA  . PRO A 1 482 ? 70.814  37.791 25.008  1.00 36.76 ? 482  PRO A CA  1 
ATOM   3837 C  C   . PRO A 1 482 ? 70.388  36.312 25.053  1.00 39.63 ? 482  PRO A C   1 
ATOM   3838 O  O   . PRO A 1 482 ? 70.928  35.482 24.311  1.00 39.39 ? 482  PRO A O   1 
ATOM   3839 C  CB  . PRO A 1 482 ? 72.074  38.013 25.862  1.00 35.03 ? 482  PRO A CB  1 
ATOM   3840 C  CG  . PRO A 1 482 ? 71.591  38.497 27.149  1.00 34.54 ? 482  PRO A CG  1 
ATOM   3841 C  CD  . PRO A 1 482 ? 70.301  39.249 26.900  1.00 35.12 ? 482  PRO A CD  1 
ATOM   3842 N  N   . ASN A 1 483 ? 69.411  36.007 25.904  1.00 42.40 ? 483  ASN A N   1 
ATOM   3843 C  CA  . ASN A 1 483 ? 68.916  34.638 26.080  1.00 46.85 ? 483  ASN A CA  1 
ATOM   3844 C  C   . ASN A 1 483 ? 67.838  34.246 25.091  1.00 50.49 ? 483  ASN A C   1 
ATOM   3845 O  O   . ASN A 1 483 ? 66.920  35.012 24.842  1.00 51.32 ? 483  ASN A O   1 
ATOM   3846 C  CB  . ASN A 1 483 ? 68.344  34.472 27.479  1.00 46.99 ? 483  ASN A CB  1 
ATOM   3847 C  CG  . ASN A 1 483 ? 69.353  34.791 28.556  1.00 44.87 ? 483  ASN A CG  1 
ATOM   3848 O  OD1 . ASN A 1 483 ? 70.382  34.136 28.679  1.00 40.41 ? 483  ASN A OD1 1 
ATOM   3849 N  ND2 . ASN A 1 483 ? 69.064  35.809 29.332  1.00 45.25 ? 483  ASN A ND2 1 
ATOM   3850 N  N   . GLU A 1 484 ? 67.946  33.044 24.541  1.00 54.75 ? 484  GLU A N   1 
ATOM   3851 C  CA  . GLU A 1 484 ? 66.925  32.507 23.671  1.00 59.20 ? 484  GLU A CA  1 
ATOM   3852 C  C   . GLU A 1 484 ? 65.961  31.732 24.544  1.00 63.22 ? 484  GLU A C   1 
ATOM   3853 O  O   . GLU A 1 484 ? 66.376  30.772 25.196  1.00 64.07 ? 484  GLU A O   1 
ATOM   3854 C  CB  . GLU A 1 484 ? 67.566  31.559 22.686  1.00 59.88 ? 484  GLU A CB  1 
ATOM   3855 C  CG  . GLU A 1 484 ? 66.867  31.494 21.371  1.00 63.66 ? 484  GLU A CG  1 
ATOM   3856 C  CD  . GLU A 1 484 ? 67.857  31.238 20.259  1.00 67.51 ? 484  GLU A CD  1 
ATOM   3857 O  OE1 . GLU A 1 484 ? 68.725  30.345 20.449  1.00 69.02 ? 484  GLU A OE1 1 
ATOM   3858 O  OE2 . GLU A 1 484 ? 67.783  31.939 19.212  1.00 68.08 ? 484  GLU A OE2 1 
ATOM   3859 N  N   . PRO A 1 485 ? 64.679  32.148 24.578  1.00 66.06 ? 485  PRO A N   1 
ATOM   3860 C  CA  . PRO A 1 485 ? 63.657  31.491 25.425  1.00 69.88 ? 485  PRO A CA  1 
ATOM   3861 C  C   . PRO A 1 485 ? 63.720  29.942 25.348  1.00 73.58 ? 485  PRO A C   1 
ATOM   3862 O  O   . PRO A 1 485 ? 63.520  29.369 24.273  1.00 74.70 ? 485  PRO A O   1 
ATOM   3863 C  CB  . PRO A 1 485 ? 62.323  32.035 24.873  1.00 70.80 ? 485  PRO A CB  1 
ATOM   3864 C  CG  . PRO A 1 485 ? 62.691  32.907 23.634  1.00 68.32 ? 485  PRO A CG  1 
ATOM   3865 C  CD  . PRO A 1 485 ? 64.129  33.284 23.811  1.00 65.13 ? 485  PRO A CD  1 
ATOM   3866 N  N   . HIS A 1 486 ? 64.024  29.307 26.489  1.00 75.90 ? 486  HIS A N   1 
ATOM   3867 C  CA  . HIS A 1 486 ? 64.311  27.845 26.649  1.00 79.13 ? 486  HIS A CA  1 
ATOM   3868 C  C   . HIS A 1 486 ? 65.818  27.449 26.604  1.00 78.75 ? 486  HIS A C   1 
ATOM   3869 O  O   . HIS A 1 486 ? 66.636  28.136 25.977  1.00 76.41 ? 486  HIS A O   1 
ATOM   3870 C  CB  . HIS A 1 486 ? 63.455  26.956 25.731  1.00 81.42 ? 486  HIS A CB  1 
ATOM   3871 C  CG  . HIS A 1 486 ? 63.000  25.682 26.382  1.00 84.77 ? 486  HIS A CG  1 
ATOM   3872 N  N   . SER A 1 487 ? 66.173  26.354 27.291  1.00 81.45 ? 487  SER A N   1 
ATOM   3873 C  CA  . SER A 1 487 ? 67.578  25.889 27.399  1.00 81.25 ? 487  SER A CA  1 
ATOM   3874 C  C   . SER A 1 487 ? 67.970  24.953 26.252  1.00 82.59 ? 487  SER A C   1 
ATOM   3875 O  O   . SER A 1 487 ? 68.073  25.366 25.091  1.00 81.25 ? 487  SER A O   1 
ATOM   3876 C  CB  . SER A 1 487 ? 67.824  25.175 28.742  1.00 83.03 ? 487  SER A CB  1 
ATOM   3877 O  OG  . SER A 1 487 ? 69.210  24.936 28.964  1.00 81.65 ? 487  SER A OG  1 
ATOM   3878 N  N   . SER A 1 490 ? 70.824  27.623 30.161  1.00 58.71 ? 490  SER A N   1 
ATOM   3879 C  CA  . SER A 1 490 ? 71.285  28.324 31.367  1.00 58.16 ? 490  SER A CA  1 
ATOM   3880 C  C   . SER A 1 490 ? 71.420  29.850 31.102  1.00 54.66 ? 490  SER A C   1 
ATOM   3881 O  O   . SER A 1 490 ? 72.108  30.278 30.176  1.00 52.72 ? 490  SER A O   1 
ATOM   3882 C  CB  . SER A 1 490 ? 72.602  27.725 31.911  1.00 58.60 ? 490  SER A CB  1 
ATOM   3883 O  OG  . SER A 1 490 ? 73.753  28.432 31.417  1.00 58.31 ? 490  SER A OG  1 
ATOM   3884 N  N   . LYS A 1 491 ? 70.771  30.646 31.945  1.00 53.54 ? 491  LYS A N   1 
ATOM   3885 C  CA  . LYS A 1 491 ? 70.454  32.023 31.621  1.00 51.41 ? 491  LYS A CA  1 
ATOM   3886 C  C   . LYS A 1 491 ? 71.406  33.064 32.182  1.00 48.09 ? 491  LYS A C   1 
ATOM   3887 O  O   . LYS A 1 491 ? 71.861  32.975 33.322  1.00 48.55 ? 491  LYS A O   1 
ATOM   3888 C  CB  . LYS A 1 491 ? 69.021  32.358 32.055  1.00 53.10 ? 491  LYS A CB  1 
ATOM   3889 C  CG  . LYS A 1 491 ? 67.948  31.424 31.485  1.00 58.86 ? 491  LYS A CG  1 
ATOM   3890 C  CD  . LYS A 1 491 ? 67.884  31.529 29.963  1.00 63.21 ? 491  LYS A CD  1 
ATOM   3891 C  CE  . LYS A 1 491 ? 66.850  30.576 29.347  1.00 67.53 ? 491  LYS A CE  1 
ATOM   3892 N  NZ  . LYS A 1 491 ? 66.700  30.928 27.887  1.00 68.28 ? 491  LYS A NZ  1 
ATOM   3893 N  N   . TRP A 1 492 ? 71.690  34.044 31.337  1.00 44.52 ? 492  TRP A N   1 
ATOM   3894 C  CA  . TRP A 1 492 ? 72.390  35.262 31.703  1.00 42.45 ? 492  TRP A CA  1 
ATOM   3895 C  C   . TRP A 1 492 ? 71.320  36.142 32.342  1.00 42.90 ? 492  TRP A C   1 
ATOM   3896 O  O   . TRP A 1 492 ? 70.364  36.536 31.676  1.00 43.53 ? 492  TRP A O   1 
ATOM   3897 C  CB  . TRP A 1 492 ? 72.943  35.916 30.433  1.00 39.49 ? 492  TRP A CB  1 
ATOM   3898 C  CG  . TRP A 1 492 ? 73.770  37.175 30.605  1.00 35.29 ? 492  TRP A CG  1 
ATOM   3899 C  CD1 . TRP A 1 492 ? 73.831  38.002 31.699  1.00 32.92 ? 492  TRP A CD1 1 
ATOM   3900 C  CD2 . TRP A 1 492 ? 74.635  37.745 29.627  1.00 30.85 ? 492  TRP A CD2 1 
ATOM   3901 N  NE1 . TRP A 1 492 ? 74.680  39.045 31.465  1.00 29.92 ? 492  TRP A NE1 1 
ATOM   3902 C  CE2 . TRP A 1 492 ? 75.202  38.911 30.199  1.00 29.95 ? 492  TRP A CE2 1 
ATOM   3903 C  CE3 . TRP A 1 492 ? 74.995  37.383 28.321  1.00 28.91 ? 492  TRP A CE3 1 
ATOM   3904 C  CZ2 . TRP A 1 492 ? 76.094  39.726 29.499  1.00 24.55 ? 492  TRP A CZ2 1 
ATOM   3905 C  CZ3 . TRP A 1 492 ? 75.883  38.202 27.618  1.00 29.17 ? 492  TRP A CZ3 1 
ATOM   3906 C  CH2 . TRP A 1 492 ? 76.432  39.352 28.211  1.00 24.15 ? 492  TRP A CH2 1 
ATOM   3907 N  N   . PRO A 1 493 ? 71.442  36.420 33.644  1.00 42.81 ? 493  PRO A N   1 
ATOM   3908 C  CA  . PRO A 1 493 ? 70.310  37.129 34.246  1.00 43.05 ? 493  PRO A CA  1 
ATOM   3909 C  C   . PRO A 1 493 ? 70.448  38.644 34.076  1.00 41.22 ? 493  PRO A C   1 
ATOM   3910 O  O   . PRO A 1 493 ? 71.543  39.142 33.887  1.00 39.17 ? 493  PRO A O   1 
ATOM   3911 C  CB  . PRO A 1 493 ? 70.407  36.744 35.717  1.00 43.99 ? 493  PRO A CB  1 
ATOM   3912 C  CG  . PRO A 1 493 ? 71.949  36.522 35.934  1.00 43.51 ? 493  PRO A CG  1 
ATOM   3913 C  CD  . PRO A 1 493 ? 72.446  35.966 34.632  1.00 42.72 ? 493  PRO A CD  1 
ATOM   3914 N  N   . LEU A 1 494 ? 69.318  39.347 34.126  1.00 41.83 ? 494  LEU A N   1 
ATOM   3915 C  CA  . LEU A 1 494 ? 69.285  40.797 34.191  1.00 40.13 ? 494  LEU A CA  1 
ATOM   3916 C  C   . LEU A 1 494 ? 70.114  41.289 35.345  1.00 39.39 ? 494  LEU A C   1 
ATOM   3917 O  O   . LEU A 1 494 ? 69.969  40.817 36.490  1.00 40.89 ? 494  LEU A O   1 
ATOM   3918 C  CB  . LEU A 1 494 ? 67.849  41.282 34.416  1.00 41.30 ? 494  LEU A CB  1 
ATOM   3919 C  CG  . LEU A 1 494 ? 66.945  41.411 33.192  1.00 41.23 ? 494  LEU A CG  1 
ATOM   3920 C  CD1 . LEU A 1 494 ? 65.472  41.353 33.594  1.00 39.36 ? 494  LEU A CD1 1 
ATOM   3921 C  CD2 . LEU A 1 494 ? 67.282  42.700 32.502  1.00 38.23 ? 494  LEU A CD2 1 
ATOM   3922 N  N   . PHE A 1 495 ? 70.972  42.251 35.055  1.00 37.39 ? 495  PHE A N   1 
ATOM   3923 C  CA  . PHE A 1 495 ? 71.572  43.047 36.102  1.00 37.44 ? 495  PHE A CA  1 
ATOM   3924 C  C   . PHE A 1 495 ? 70.480  43.932 36.759  1.00 38.87 ? 495  PHE A C   1 
ATOM   3925 O  O   . PHE A 1 495 ? 69.809  44.704 36.081  1.00 38.46 ? 495  PHE A O   1 
ATOM   3926 C  CB  . PHE A 1 495 ? 72.721  43.883 35.527  1.00 35.27 ? 495  PHE A CB  1 
ATOM   3927 C  CG  . PHE A 1 495 ? 73.310  44.845 36.504  1.00 34.29 ? 495  PHE A CG  1 
ATOM   3928 C  CD1 . PHE A 1 495 ? 72.628  46.011 36.844  1.00 32.70 ? 495  PHE A CD1 1 
ATOM   3929 C  CD2 . PHE A 1 495 ? 74.547  44.587 37.089  1.00 35.06 ? 495  PHE A CD2 1 
ATOM   3930 C  CE1 . PHE A 1 495 ? 73.147  46.893 37.776  1.00 33.15 ? 495  PHE A CE1 1 
ATOM   3931 C  CE2 . PHE A 1 495 ? 75.099  45.481 38.010  1.00 34.38 ? 495  PHE A CE2 1 
ATOM   3932 C  CZ  . PHE A 1 495 ? 74.386  46.642 38.349  1.00 35.22 ? 495  PHE A CZ  1 
ATOM   3933 N  N   . THR A 1 496 ? 70.281  43.817 38.064  1.00 40.30 ? 496  THR A N   1 
ATOM   3934 C  CA  . THR A 1 496 ? 69.281  44.671 38.698  1.00 42.74 ? 496  THR A CA  1 
ATOM   3935 C  C   . THR A 1 496 ? 69.944  45.520 39.760  1.00 43.45 ? 496  THR A C   1 
ATOM   3936 O  O   . THR A 1 496 ? 70.968  45.135 40.297  1.00 43.33 ? 496  THR A O   1 
ATOM   3937 C  CB  . THR A 1 496 ? 68.151  43.867 39.377  1.00 44.92 ? 496  THR A CB  1 
ATOM   3938 O  OG1 . THR A 1 496 ? 68.698  43.154 40.498  1.00 44.93 ? 496  THR A OG1 1 
ATOM   3939 C  CG2 . THR A 1 496 ? 67.468  42.914 38.387  1.00 44.00 ? 496  THR A CG2 1 
ATOM   3940 N  N   . THR A 1 497 ? 69.333  46.656 40.081  1.00 45.27 ? 497  THR A N   1 
ATOM   3941 C  CA  . THR A 1 497 ? 69.849  47.584 41.091  1.00 45.55 ? 497  THR A CA  1 
ATOM   3942 C  C   . THR A 1 497 ? 70.143  46.859 42.391  1.00 46.65 ? 497  THR A C   1 
ATOM   3943 O  O   . THR A 1 497 ? 71.174  47.099 43.033  1.00 45.72 ? 497  THR A O   1 
ATOM   3944 C  CB  . THR A 1 497 ? 68.817  48.724 41.367  1.00 47.18 ? 497  THR A CB  1 
ATOM   3945 O  OG1 . THR A 1 497 ? 68.490  49.386 40.133  1.00 46.33 ? 497  THR A OG1 1 
ATOM   3946 C  CG2 . THR A 1 497 ? 69.375  49.735 42.352  1.00 46.70 ? 497  THR A CG2 1 
ATOM   3947 N  N   . LYS A 1 498 ? 69.230  45.969 42.774  1.00 48.81 ? 498  LYS A N   1 
ATOM   3948 C  CA  . LYS A 1 498 ? 69.360  45.268 44.040  1.00 50.32 ? 498  LYS A CA  1 
ATOM   3949 C  C   . LYS A 1 498 ? 70.461  44.223 43.993  1.00 49.03 ? 498  LYS A C   1 
ATOM   3950 O  O   . LYS A 1 498 ? 71.344  44.215 44.854  1.00 48.86 ? 498  LYS A O   1 
ATOM   3951 C  CB  . LYS A 1 498 ? 68.032  44.632 44.478  1.00 52.67 ? 498  LYS A CB  1 
ATOM   3952 C  CG  . LYS A 1 498 ? 68.053  44.115 45.909  1.00 56.36 ? 498  LYS A CG  1 
ATOM   3953 C  CD  . LYS A 1 498 ? 66.656  44.155 46.531  1.00 62.03 ? 498  LYS A CD  1 
ATOM   3954 C  CE  . LYS A 1 498 ? 66.730  44.065 48.050  1.00 65.48 ? 498  LYS A CE  1 
ATOM   3955 N  NZ  . LYS A 1 498 ? 66.260  42.742 48.544  1.00 69.72 ? 498  LYS A NZ  1 
ATOM   3956 N  N   . GLU A 1 499 ? 70.397  43.331 43.007  1.00 48.26 ? 499  GLU A N   1 
ATOM   3957 C  CA  . GLU A 1 499 ? 71.222  42.135 43.056  1.00 47.39 ? 499  GLU A CA  1 
ATOM   3958 C  C   . GLU A 1 499 ? 72.548  42.221 42.316  1.00 44.50 ? 499  GLU A C   1 
ATOM   3959 O  O   . GLU A 1 499 ? 73.505  41.547 42.700  1.00 43.41 ? 499  GLU A O   1 
ATOM   3960 C  CB  . GLU A 1 499 ? 70.431  40.926 42.617  1.00 49.49 ? 499  GLU A CB  1 
ATOM   3961 C  CG  . GLU A 1 499 ? 69.602  40.332 43.716  1.00 54.69 ? 499  GLU A CG  1 
ATOM   3962 C  CD  . GLU A 1 499 ? 68.296  39.899 43.175  1.00 62.80 ? 499  GLU A CD  1 
ATOM   3963 O  OE1 . GLU A 1 499 ? 67.539  40.809 42.738  1.00 66.87 ? 499  GLU A OE1 1 
ATOM   3964 O  OE2 . GLU A 1 499 ? 68.041  38.667 43.146  1.00 66.13 ? 499  GLU A OE2 1 
ATOM   3965 N  N   . GLN A 1 500 ? 72.590  43.045 41.269  1.00 42.19 ? 500  GLN A N   1 
ATOM   3966 C  CA  . GLN A 1 500 ? 73.838  43.409 40.580  1.00 39.94 ? 500  GLN A CA  1 
ATOM   3967 C  C   . GLN A 1 500 ? 74.586  42.196 40.003  1.00 38.50 ? 500  GLN A C   1 
ATOM   3968 O  O   . GLN A 1 500 ? 75.809  42.116 40.064  1.00 36.29 ? 500  GLN A O   1 
ATOM   3969 C  CB  . GLN A 1 500 ? 74.724  44.284 41.500  1.00 39.81 ? 500  GLN A CB  1 
ATOM   3970 C  CG  . GLN A 1 500 ? 73.993  45.575 41.920  1.00 42.10 ? 500  GLN A CG  1 
ATOM   3971 C  CD  . GLN A 1 500 ? 74.665  46.351 43.038  1.00 44.48 ? 500  GLN A CD  1 
ATOM   3972 O  OE1 . GLN A 1 500 ? 75.859  46.621 42.995  1.00 45.56 ? 500  GLN A OE1 1 
ATOM   3973 N  NE2 . GLN A 1 500 ? 73.884  46.746 44.033  1.00 46.65 ? 500  GLN A NE2 1 
ATOM   3974 N  N   . LYS A 1 501 ? 73.821  41.266 39.435  1.00 38.14 ? 501  LYS A N   1 
ATOM   3975 C  CA  . LYS A 1 501 ? 74.380  40.048 38.854  1.00 38.11 ? 501  LYS A CA  1 
ATOM   3976 C  C   . LYS A 1 501 ? 74.998  40.312 37.494  1.00 36.64 ? 501  LYS A C   1 
ATOM   3977 O  O   . LYS A 1 501 ? 74.479  41.111 36.702  1.00 36.05 ? 501  LYS A O   1 
ATOM   3978 C  CB  . LYS A 1 501 ? 73.309  38.944 38.728  1.00 39.96 ? 501  LYS A CB  1 
ATOM   3979 C  CG  . LYS A 1 501 ? 72.671  38.524 40.047  1.00 41.44 ? 501  LYS A CG  1 
ATOM   3980 C  CD  . LYS A 1 501 ? 71.356  37.772 39.839  1.00 45.07 ? 501  LYS A CD  1 
ATOM   3981 C  CE  . LYS A 1 501 ? 70.907  37.045 41.126  1.00 47.36 ? 501  LYS A CE  1 
ATOM   3982 N  NZ  . LYS A 1 501 ? 69.587  36.357 40.895  1.00 49.40 ? 501  LYS A NZ  1 
ATOM   3983 N  N   . PHE A 1 502 ? 76.116  39.632 37.245  1.00 35.51 ? 502  PHE A N   1 
ATOM   3984 C  CA  . PHE A 1 502 ? 76.781  39.608 35.950  1.00 33.23 ? 502  PHE A CA  1 
ATOM   3985 C  C   . PHE A 1 502 ? 77.252  38.170 35.739  1.00 34.50 ? 502  PHE A C   1 
ATOM   3986 O  O   . PHE A 1 502 ? 77.207  37.377 36.682  1.00 34.72 ? 502  PHE A O   1 
ATOM   3987 C  CB  . PHE A 1 502 ? 77.974  40.565 35.920  1.00 31.24 ? 502  PHE A CB  1 
ATOM   3988 C  CG  . PHE A 1 502 ? 79.105  40.203 36.862  1.00 30.10 ? 502  PHE A CG  1 
ATOM   3989 C  CD1 . PHE A 1 502 ? 79.071  40.585 38.208  1.00 28.15 ? 502  PHE A CD1 1 
ATOM   3990 C  CD2 . PHE A 1 502 ? 80.212  39.506 36.397  1.00 28.47 ? 502  PHE A CD2 1 
ATOM   3991 C  CE1 . PHE A 1 502 ? 80.134  40.258 39.082  1.00 29.97 ? 502  PHE A CE1 1 
ATOM   3992 C  CE2 . PHE A 1 502 ? 81.277  39.186 37.246  1.00 27.36 ? 502  PHE A CE2 1 
ATOM   3993 C  CZ  . PHE A 1 502 ? 81.238  39.577 38.595  1.00 28.59 ? 502  PHE A CZ  1 
ATOM   3994 N  N   . ILE A 1 503 ? 77.677  37.845 34.513  1.00 33.95 ? 503  ILE A N   1 
ATOM   3995 C  CA  . ILE A 1 503 ? 78.253  36.545 34.211  1.00 35.47 ? 503  ILE A CA  1 
ATOM   3996 C  C   . ILE A 1 503 ? 79.713  36.651 33.768  1.00 34.50 ? 503  ILE A C   1 
ATOM   3997 O  O   . ILE A 1 503 ? 80.112  37.671 33.181  1.00 32.38 ? 503  ILE A O   1 
ATOM   3998 C  CB  . ILE A 1 503 ? 77.491  35.827 33.107  1.00 36.65 ? 503  ILE A CB  1 
ATOM   3999 C  CG1 . ILE A 1 503 ? 77.521  36.634 31.800  1.00 34.97 ? 503  ILE A CG1 1 
ATOM   4000 C  CG2 . ILE A 1 503 ? 76.054  35.493 33.570  1.00 39.19 ? 503  ILE A CG2 1 
ATOM   4001 C  CD1 . ILE A 1 503 ? 77.305  35.755 30.554  1.00 37.50 ? 503  ILE A CD1 1 
ATOM   4002 N  N   . ASP A 1 504 ? 80.494  35.599 34.041  1.00 34.79 ? 504  ASP A N   1 
ATOM   4003 C  CA  . ASP A 1 504 ? 81.791  35.454 33.395  1.00 35.27 ? 504  ASP A CA  1 
ATOM   4004 C  C   . ASP A 1 504 ? 81.563  34.952 31.971  1.00 36.03 ? 504  ASP A C   1 
ATOM   4005 O  O   . ASP A 1 504 ? 80.581  34.253 31.706  1.00 37.16 ? 504  ASP A O   1 
ATOM   4006 C  CB  . ASP A 1 504 ? 82.739  34.520 34.158  1.00 36.00 ? 504  ASP A CB  1 
ATOM   4007 C  CG  . ASP A 1 504 ? 83.099  35.035 35.554  1.00 37.45 ? 504  ASP A CG  1 
ATOM   4008 O  OD1 . ASP A 1 504 ? 82.939  36.242 35.841  1.00 40.09 ? 504  ASP A OD1 1 
ATOM   4009 O  OD2 . ASP A 1 504 ? 83.545  34.218 36.402  1.00 45.19 ? 504  ASP A OD2 1 
ATOM   4010 N  N   . LEU A 1 505 ? 82.442  35.348 31.058  1.00 35.44 ? 505  LEU A N   1 
ATOM   4011 C  CA  . LEU A 1 505 ? 82.425  34.866 29.689  1.00 36.48 ? 505  LEU A CA  1 
ATOM   4012 C  C   . LEU A 1 505 ? 83.779  34.241 29.451  1.00 37.49 ? 505  LEU A C   1 
ATOM   4013 O  O   . LEU A 1 505 ? 84.796  34.955 29.341  1.00 37.11 ? 505  LEU A O   1 
ATOM   4014 C  CB  . LEU A 1 505 ? 82.233  36.001 28.697  1.00 35.27 ? 505  LEU A CB  1 
ATOM   4015 C  CG  . LEU A 1 505 ? 80.795  36.371 28.369  1.00 37.41 ? 505  LEU A CG  1 
ATOM   4016 C  CD1 . LEU A 1 505 ? 80.788  37.619 27.513  1.00 35.18 ? 505  LEU A CD1 1 
ATOM   4017 C  CD2 . LEU A 1 505 ? 80.060  35.211 27.678  1.00 36.37 ? 505  LEU A CD2 1 
ATOM   4018 N  N   . ASN A 1 506 ? 83.797  32.909 29.419  1.00 38.43 ? 506  ASN A N   1 
ATOM   4019 C  CA  . ASN A 1 506 ? 84.994  32.159 29.146  1.00 39.30 ? 506  ASN A CA  1 
ATOM   4020 C  C   . ASN A 1 506 ? 84.573  30.754 28.683  1.00 41.19 ? 506  ASN A C   1 
ATOM   4021 O  O   . ASN A 1 506 ? 83.398  30.523 28.386  1.00 40.56 ? 506  ASN A O   1 
ATOM   4022 C  CB  . ASN A 1 506 ? 85.900  32.108 30.382  1.00 39.45 ? 506  ASN A CB  1 
ATOM   4023 C  CG  . ASN A 1 506 ? 85.194  31.528 31.602  1.00 41.15 ? 506  ASN A CG  1 
ATOM   4024 O  OD1 . ASN A 1 506 ? 84.637  30.430 31.545  1.00 45.62 ? 506  ASN A OD1 1 
ATOM   4025 N  ND2 . ASN A 1 506 ? 85.208  32.268 32.713  1.00 39.64 ? 506  ASN A ND2 1 
ATOM   4026 N  N   . THR A 1 507 ? 85.518  29.826 28.638  1.00 43.06 ? 507  THR A N   1 
ATOM   4027 C  CA  . THR A 1 507 ? 85.212  28.524 28.069  1.00 46.76 ? 507  THR A CA  1 
ATOM   4028 C  C   . THR A 1 507 ? 84.556  27.591 29.073  1.00 48.90 ? 507  THR A C   1 
ATOM   4029 O  O   . THR A 1 507 ? 84.079  26.554 28.692  1.00 51.80 ? 507  THR A O   1 
ATOM   4030 C  CB  . THR A 1 507 ? 86.432  27.867 27.409  1.00 47.27 ? 507  THR A CB  1 
ATOM   4031 O  OG1 . THR A 1 507 ? 87.438  27.630 28.395  1.00 49.66 ? 507  THR A OG1 1 
ATOM   4032 C  CG2 . THR A 1 507 ? 86.990  28.751 26.297  1.00 44.98 ? 507  THR A CG2 1 
ATOM   4033 N  N   . GLU A 1 508 ? 84.513  27.971 30.344  1.00 50.28 ? 508  GLU A N   1 
ATOM   4034 C  CA  . GLU A 1 508 ? 83.859  27.164 31.390  1.00 53.84 ? 508  GLU A CA  1 
ATOM   4035 C  C   . GLU A 1 508 ? 82.341  27.365 31.344  1.00 54.62 ? 508  GLU A C   1 
ATOM   4036 O  O   . GLU A 1 508 ? 81.866  28.339 30.726  1.00 52.78 ? 508  GLU A O   1 
ATOM   4037 C  CB  . GLU A 1 508 ? 84.339  27.562 32.796  1.00 53.83 ? 508  GLU A CB  1 
ATOM   4038 C  CG  . GLU A 1 508 ? 85.772  27.258 33.163  1.00 56.56 ? 508  GLU A CG  1 
ATOM   4039 C  CD  . GLU A 1 508 ? 86.059  27.619 34.627  1.00 59.35 ? 508  GLU A CD  1 
ATOM   4040 O  OE1 . GLU A 1 508 ? 86.013  28.822 34.968  1.00 59.44 ? 508  GLU A OE1 1 
ATOM   4041 O  OE2 . GLU A 1 508 ? 86.320  26.703 35.446  1.00 62.66 ? 508  GLU A OE2 1 
ATOM   4042 N  N   . PRO A 1 509 ? 81.571  26.453 31.995  1.00 57.85 ? 509  PRO A N   1 
ATOM   4043 C  CA  . PRO A 1 509 ? 80.123  26.664 32.120  1.00 58.66 ? 509  PRO A CA  1 
ATOM   4044 C  C   . PRO A 1 509 ? 79.825  27.995 32.812  1.00 57.32 ? 509  PRO A C   1 
ATOM   4045 O  O   . PRO A 1 509 ? 80.576  28.415 33.704  1.00 56.35 ? 509  PRO A O   1 
ATOM   4046 C  CB  . PRO A 1 509 ? 79.674  25.498 32.990  1.00 60.86 ? 509  PRO A CB  1 
ATOM   4047 C  CG  . PRO A 1 509 ? 80.672  24.424 32.688  1.00 63.07 ? 509  PRO A CG  1 
ATOM   4048 C  CD  . PRO A 1 509 ? 81.974  25.128 32.521  1.00 60.33 ? 509  PRO A CD  1 
ATOM   4049 N  N   . MET A 1 510 ? 78.740  28.639 32.382  1.00 57.42 ? 510  MET A N   1 
ATOM   4050 C  CA  . MET A 1 510 ? 78.376  29.980 32.833  1.00 56.37 ? 510  MET A CA  1 
ATOM   4051 C  C   . MET A 1 510 ? 78.277  30.027 34.355  1.00 56.62 ? 510  MET A C   1 
ATOM   4052 O  O   . MET A 1 510 ? 77.553  29.237 34.957  1.00 59.20 ? 510  MET A O   1 
ATOM   4053 C  CB  . MET A 1 510 ? 77.049  30.414 32.189  1.00 56.62 ? 510  MET A CB  1 
ATOM   4054 C  CG  . MET A 1 510 ? 76.643  31.880 32.433  1.00 56.37 ? 510  MET A CG  1 
ATOM   4055 S  SD  . MET A 1 510 ? 74.825  32.112 32.397  1.00 62.00 ? 510  MET A SD  1 
ATOM   4056 C  CE  . MET A 1 510 ? 74.567  32.267 30.638  1.00 58.10 ? 510  MET A CE  1 
ATOM   4057 N  N   . LYS A 1 511 ? 79.019  30.939 34.972  1.00 54.52 ? 511  LYS A N   1 
ATOM   4058 C  CA  . LYS A 1 511 ? 78.880  31.175 36.409  1.00 54.27 ? 511  LYS A CA  1 
ATOM   4059 C  C   . LYS A 1 511 ? 78.381  32.601 36.668  1.00 51.49 ? 511  LYS A C   1 
ATOM   4060 O  O   . LYS A 1 511 ? 78.795  33.549 36.010  1.00 49.58 ? 511  LYS A O   1 
ATOM   4061 C  CB  . LYS A 1 511 ? 80.166  30.813 37.166  1.00 54.20 ? 511  LYS A CB  1 
ATOM   4062 C  CG  . LYS A 1 511 ? 80.234  29.301 37.471  1.00 59.74 ? 511  LYS A CG  1 
ATOM   4063 C  CD  . LYS A 1 511 ? 81.506  28.894 38.222  1.00 62.48 ? 511  LYS A CD  1 
ATOM   4064 N  N   . VAL A 1 512 ? 77.441  32.731 37.591  1.00 51.21 ? 512  VAL A N   1 
ATOM   4065 C  CA  . VAL A 1 512 ? 76.853  34.015 37.901  1.00 48.69 ? 512  VAL A CA  1 
ATOM   4066 C  C   . VAL A 1 512 ? 77.445  34.566 39.194  1.00 47.75 ? 512  VAL A C   1 
ATOM   4067 O  O   . VAL A 1 512 ? 77.462  33.884 40.231  1.00 48.69 ? 512  VAL A O   1 
ATOM   4068 C  CB  . VAL A 1 512 ? 75.319  33.909 38.048  1.00 50.44 ? 512  VAL A CB  1 
ATOM   4069 C  CG1 . VAL A 1 512 ? 74.697  35.295 38.302  1.00 47.74 ? 512  VAL A CG1 1 
ATOM   4070 C  CG2 . VAL A 1 512 ? 74.702  33.246 36.799  1.00 50.91 ? 512  VAL A CG2 1 
ATOM   4071 N  N   . HIS A 1 513 ? 77.901  35.814 39.115  1.00 44.89 ? 513  HIS A N   1 
ATOM   4072 C  CA  . HIS A 1 513 ? 78.383  36.559 40.269  1.00 43.79 ? 513  HIS A CA  1 
ATOM   4073 C  C   . HIS A 1 513 ? 77.609  37.854 40.463  1.00 42.51 ? 513  HIS A C   1 
ATOM   4074 O  O   . HIS A 1 513 ? 76.754  38.239 39.644  1.00 41.73 ? 513  HIS A O   1 
ATOM   4075 C  CB  . HIS A 1 513 ? 79.851  36.925 40.109  1.00 42.67 ? 513  HIS A CB  1 
ATOM   4076 C  CG  . HIS A 1 513 ? 80.714  35.799 39.657  1.00 44.39 ? 513  HIS A CG  1 
ATOM   4077 N  ND1 . HIS A 1 513 ? 81.124  34.793 40.504  1.00 47.86 ? 513  HIS A ND1 1 
ATOM   4078 C  CD2 . HIS A 1 513 ? 81.254  35.522 38.450  1.00 45.23 ? 513  HIS A CD2 1 
ATOM   4079 C  CE1 . HIS A 1 513 ? 81.879  33.940 39.834  1.00 49.20 ? 513  HIS A CE1 1 
ATOM   4080 N  NE2 . HIS A 1 513 ? 81.973  34.360 38.586  1.00 47.33 ? 513  HIS A NE2 1 
ATOM   4081 N  N   . GLN A 1 514 ? 77.975  38.542 41.539  1.00 41.22 ? 514  GLN A N   1 
ATOM   4082 C  CA  . GLN A 1 514 ? 77.332  39.769 41.971  1.00 40.31 ? 514  GLN A CA  1 
ATOM   4083 C  C   . GLN A 1 514 ? 78.366  40.834 42.322  1.00 37.91 ? 514  GLN A C   1 
ATOM   4084 O  O   . GLN A 1 514 ? 79.429  40.528 42.865  1.00 37.50 ? 514  GLN A O   1 
ATOM   4085 C  CB  . GLN A 1 514 ? 76.438  39.476 43.193  1.00 41.54 ? 514  GLN A CB  1 
ATOM   4086 C  CG  . GLN A 1 514 ? 75.167  38.755 42.819  1.00 44.53 ? 514  GLN A CG  1 
ATOM   4087 C  CD  . GLN A 1 514 ? 74.320  38.348 44.014  1.00 49.53 ? 514  GLN A CD  1 
ATOM   4088 O  OE1 . GLN A 1 514 ? 74.734  37.535 44.843  1.00 54.35 ? 514  GLN A OE1 1 
ATOM   4089 N  NE2 . GLN A 1 514 ? 73.124  38.890 44.092  1.00 49.66 ? 514  GLN A NE2 1 
ATOM   4090 N  N   . ARG A 1 515 ? 78.044  42.083 42.009  1.00 36.57 ? 515  ARG A N   1 
ATOM   4091 C  CA  . ARG A 1 515 ? 78.855  43.238 42.416  1.00 35.22 ? 515  ARG A CA  1 
ATOM   4092 C  C   . ARG A 1 515 ? 80.276  43.141 41.846  1.00 34.26 ? 515  ARG A C   1 
ATOM   4093 O  O   . ARG A 1 515 ? 81.231  42.893 42.586  1.00 34.59 ? 515  ARG A O   1 
ATOM   4094 C  CB  . ARG A 1 515 ? 78.872  43.354 43.959  1.00 35.85 ? 515  ARG A CB  1 
ATOM   4095 C  CG  . ARG A 1 515 ? 77.465  43.324 44.609  1.00 37.51 ? 515  ARG A CG  1 
ATOM   4096 C  CD  . ARG A 1 515 ? 77.494  43.865 46.028  1.00 40.60 ? 515  ARG A CD  1 
ATOM   4097 N  NE  . ARG A 1 515 ? 76.152  44.103 46.554  1.00 43.84 ? 515  ARG A NE  1 
ATOM   4098 C  CZ  . ARG A 1 515 ? 75.884  44.678 47.726  1.00 48.40 ? 515  ARG A CZ  1 
ATOM   4099 N  NH1 . ARG A 1 515 ? 76.866  45.084 48.547  1.00 49.33 ? 515  ARG A NH1 1 
ATOM   4100 N  NH2 . ARG A 1 515 ? 74.620  44.840 48.093  1.00 51.22 ? 515  ARG A NH2 1 
ATOM   4101 N  N   . LEU A 1 516 ? 80.410  43.282 40.528  1.00 32.97 ? 516  LEU A N   1 
ATOM   4102 C  CA  . LEU A 1 516 ? 81.726  43.247 39.897  1.00 31.75 ? 516  LEU A CA  1 
ATOM   4103 C  C   . LEU A 1 516 ? 82.665  44.281 40.521  1.00 31.67 ? 516  LEU A C   1 
ATOM   4104 O  O   . LEU A 1 516 ? 82.375  45.493 40.541  1.00 30.66 ? 516  LEU A O   1 
ATOM   4105 C  CB  . LEU A 1 516 ? 81.601  43.429 38.390  1.00 31.10 ? 516  LEU A CB  1 
ATOM   4106 C  CG  . LEU A 1 516 ? 82.812  43.620 37.473  1.00 31.16 ? 516  LEU A CG  1 
ATOM   4107 C  CD1 . LEU A 1 516 ? 83.853  42.642 37.786  1.00 33.70 ? 516  LEU A CD1 1 
ATOM   4108 C  CD2 . LEU A 1 516 ? 82.345  43.390 36.033  1.00 34.86 ? 516  LEU A CD2 1 
ATOM   4109 N  N   . ARG A 1 517 ? 83.771  43.787 41.074  1.00 31.35 ? 517  ARG A N   1 
ATOM   4110 C  CA  . ARG A 1 517 ? 84.784  44.637 41.680  1.00 31.32 ? 517  ARG A CA  1 
ATOM   4111 C  C   . ARG A 1 517 ? 84.230  45.774 42.532  1.00 29.85 ? 517  ARG A C   1 
ATOM   4112 O  O   . ARG A 1 517 ? 84.701  46.900 42.442  1.00 28.55 ? 517  ARG A O   1 
ATOM   4113 C  CB  . ARG A 1 517 ? 85.774  45.157 40.597  1.00 31.88 ? 517  ARG A CB  1 
ATOM   4114 C  CG  . ARG A 1 517 ? 86.824  44.068 40.308  1.00 36.70 ? 517  ARG A CG  1 
ATOM   4115 C  CD  . ARG A 1 517 ? 87.830  44.435 39.271  1.00 39.62 ? 517  ARG A CD  1 
ATOM   4116 N  NE  . ARG A 1 517 ? 88.996  45.067 39.886  1.00 43.94 ? 517  ARG A NE  1 
ATOM   4117 C  CZ  . ARG A 1 517 ? 89.897  44.434 40.641  1.00 42.75 ? 517  ARG A CZ  1 
ATOM   4118 N  NH1 . ARG A 1 517 ? 89.747  43.123 40.913  1.00 41.75 ? 517  ARG A NH1 1 
ATOM   4119 N  NH2 . ARG A 1 517 ? 90.932  45.120 41.139  1.00 33.72 ? 517  ARG A NH2 1 
ATOM   4120 N  N   . VAL A 1 518 ? 83.230  45.457 43.358  1.00 29.53 ? 518  VAL A N   1 
ATOM   4121 C  CA  . VAL A 1 518 ? 82.542  46.435 44.196  1.00 27.59 ? 518  VAL A CA  1 
ATOM   4122 C  C   . VAL A 1 518 ? 83.514  47.175 45.125  1.00 28.08 ? 518  VAL A C   1 
ATOM   4123 O  O   . VAL A 1 518 ? 83.447  48.411 45.225  1.00 27.57 ? 518  VAL A O   1 
ATOM   4124 C  CB  . VAL A 1 518 ? 81.317  45.828 44.959  1.00 28.53 ? 518  VAL A CB  1 
ATOM   4125 C  CG1 . VAL A 1 518 ? 81.713  44.775 46.001  1.00 26.20 ? 518  VAL A CG1 1 
ATOM   4126 C  CG2 . VAL A 1 518 ? 80.531  46.922 45.655  1.00 29.88 ? 518  VAL A CG2 1 
ATOM   4127 N  N   . GLN A 1 519 ? 84.443  46.444 45.753  1.00 27.49 ? 519  GLN A N   1 
ATOM   4128 C  CA  . GLN A 1 519 ? 85.375  47.056 46.702  1.00 28.28 ? 519  GLN A CA  1 
ATOM   4129 C  C   . GLN A 1 519 ? 86.256  48.157 46.075  1.00 27.81 ? 519  GLN A C   1 
ATOM   4130 O  O   . GLN A 1 519 ? 86.304  49.282 46.570  1.00 27.69 ? 519  GLN A O   1 
ATOM   4131 C  CB  . GLN A 1 519 ? 86.255  46.007 47.399  1.00 29.31 ? 519  GLN A CB  1 
ATOM   4132 C  CG  . GLN A 1 519 ? 86.957  46.530 48.627  1.00 29.76 ? 519  GLN A CG  1 
ATOM   4133 C  CD  . GLN A 1 519 ? 86.010  46.701 49.820  1.00 36.51 ? 519  GLN A CD  1 
ATOM   4134 O  OE1 . GLN A 1 519 ? 85.003  45.949 49.985  1.00 38.34 ? 519  GLN A OE1 1 
ATOM   4135 N  NE2 . GLN A 1 519 ? 86.328  47.673 50.674  1.00 33.00 ? 519  GLN A NE2 1 
ATOM   4136 N  N   . MET A 1 520 ? 86.942  47.857 44.988  1.00 27.02 ? 520  MET A N   1 
ATOM   4137 C  CA  A MET A 1 520 ? 87.775  48.875 44.342  0.50 25.90 ? 520  MET A CA  1 
ATOM   4138 C  CA  B MET A 1 520 ? 87.782  48.856 44.325  0.50 26.85 ? 520  MET A CA  1 
ATOM   4139 C  C   . MET A 1 520 ? 86.930  49.966 43.689  1.00 26.76 ? 520  MET A C   1 
ATOM   4140 O  O   . MET A 1 520 ? 87.350  51.143 43.600  1.00 27.13 ? 520  MET A O   1 
ATOM   4141 C  CB  A MET A 1 520 ? 88.683  48.227 43.303  0.50 23.95 ? 520  MET A CB  1 
ATOM   4142 C  CB  B MET A 1 520 ? 88.657  48.171 43.269  0.50 25.65 ? 520  MET A CB  1 
ATOM   4143 C  CG  A MET A 1 520 ? 89.752  47.336 43.907  0.50 23.32 ? 520  MET A CG  1 
ATOM   4144 C  CG  B MET A 1 520 ? 89.384  46.900 43.764  0.50 29.23 ? 520  MET A CG  1 
ATOM   4145 S  SD  A MET A 1 520 ? 90.705  48.141 45.202  0.50 19.97 ? 520  MET A SD  1 
ATOM   4146 S  SD  B MET A 1 520 ? 88.503  45.329 43.431  0.50 35.22 ? 520  MET A SD  1 
ATOM   4147 C  CE  A MET A 1 520 ? 89.844  47.606 46.663  0.50 18.28 ? 520  MET A CE  1 
ATOM   4148 C  CE  B MET A 1 520 ? 89.483  44.131 44.330  0.50 32.00 ? 520  MET A CE  1 
ATOM   4149 N  N   . CYS A 1 521 ? 85.736  49.602 43.220  1.00 26.66 ? 521  CYS A N   1 
ATOM   4150 C  CA  . CYS A 1 521 ? 84.919  50.574 42.560  1.00 28.19 ? 521  CYS A CA  1 
ATOM   4151 C  C   . CYS A 1 521 ? 84.260  51.588 43.509  1.00 28.54 ? 521  CYS A C   1 
ATOM   4152 O  O   . CYS A 1 521 ? 84.013  52.716 43.103  1.00 29.10 ? 521  CYS A O   1 
ATOM   4153 C  CB  . CYS A 1 521 ? 83.952  49.927 41.539  1.00 27.53 ? 521  CYS A CB  1 
ATOM   4154 S  SG  . CYS A 1 521 ? 84.851  49.227 40.114  1.00 31.66 ? 521  CYS A SG  1 
ATOM   4155 N  N   . VAL A 1 522 ? 83.999  51.214 44.760  1.00 29.17 ? 522  VAL A N   1 
ATOM   4156 C  CA  . VAL A 1 522 ? 83.645  52.225 45.746  1.00 30.00 ? 522  VAL A CA  1 
ATOM   4157 C  C   . VAL A 1 522 ? 84.856  53.192 45.959  1.00 30.15 ? 522  VAL A C   1 
ATOM   4158 O  O   . VAL A 1 522 ? 84.679  54.398 46.118  1.00 31.12 ? 522  VAL A O   1 
ATOM   4159 C  CB  . VAL A 1 522 ? 83.221  51.593 47.085  1.00 31.41 ? 522  VAL A CB  1 
ATOM   4160 C  CG1 . VAL A 1 522 ? 83.186  52.624 48.189  1.00 32.47 ? 522  VAL A CG1 1 
ATOM   4161 C  CG2 . VAL A 1 522 ? 81.864  50.881 46.981  1.00 31.66 ? 522  VAL A CG2 1 
ATOM   4162 N  N   . PHE A 1 523 ? 86.082  52.671 45.965  1.00 28.17 ? 523  PHE A N   1 
ATOM   4163 C  CA  . PHE A 1 523 ? 87.234  53.551 46.093  1.00 27.75 ? 523  PHE A CA  1 
ATOM   4164 C  C   . PHE A 1 523 ? 87.280  54.575 44.937  1.00 28.06 ? 523  PHE A C   1 
ATOM   4165 O  O   . PHE A 1 523 ? 87.499  55.780 45.171  1.00 28.67 ? 523  PHE A O   1 
ATOM   4166 C  CB  . PHE A 1 523 ? 88.546  52.764 46.201  1.00 25.86 ? 523  PHE A CB  1 
ATOM   4167 C  CG  . PHE A 1 523 ? 89.781  53.616 46.085  1.00 25.22 ? 523  PHE A CG  1 
ATOM   4168 C  CD1 . PHE A 1 523 ? 90.289  54.283 47.196  1.00 26.15 ? 523  PHE A CD1 1 
ATOM   4169 C  CD2 . PHE A 1 523 ? 90.430  53.767 44.862  1.00 24.49 ? 523  PHE A CD2 1 
ATOM   4170 C  CE1 . PHE A 1 523 ? 91.423  55.097 47.094  1.00 27.96 ? 523  PHE A CE1 1 
ATOM   4171 C  CE2 . PHE A 1 523 ? 91.566  54.601 44.736  1.00 26.31 ? 523  PHE A CE2 1 
ATOM   4172 C  CZ  . PHE A 1 523 ? 92.064  55.252 45.844  1.00 28.03 ? 523  PHE A CZ  1 
ATOM   4173 N  N   . TRP A 1 524 ? 87.094  54.088 43.716  1.00 26.98 ? 524  TRP A N   1 
ATOM   4174 C  CA  . TRP A 1 524 ? 87.265  54.921 42.532  1.00 28.01 ? 524  TRP A CA  1 
ATOM   4175 C  C   . TRP A 1 524 ? 86.068  55.827 42.258  1.00 29.49 ? 524  TRP A C   1 
ATOM   4176 O  O   . TRP A 1 524 ? 86.249  56.928 41.762  1.00 29.14 ? 524  TRP A O   1 
ATOM   4177 C  CB  . TRP A 1 524 ? 87.616  54.104 41.282  1.00 25.65 ? 524  TRP A CB  1 
ATOM   4178 C  CG  . TRP A 1 524 ? 89.029  53.486 41.331  1.00 27.44 ? 524  TRP A CG  1 
ATOM   4179 C  CD1 . TRP A 1 524 ? 89.341  52.177 41.594  1.00 23.62 ? 524  TRP A CD1 1 
ATOM   4180 C  CD2 . TRP A 1 524 ? 90.287  54.167 41.128  1.00 25.59 ? 524  TRP A CD2 1 
ATOM   4181 N  NE1 . TRP A 1 524 ? 90.705  52.000 41.538  1.00 26.67 ? 524  TRP A NE1 1 
ATOM   4182 C  CE2 . TRP A 1 524 ? 91.313  53.199 41.271  1.00 25.95 ? 524  TRP A CE2 1 
ATOM   4183 C  CE3 . TRP A 1 524 ? 90.642  55.492 40.830  1.00 25.28 ? 524  TRP A CE3 1 
ATOM   4184 C  CZ2 . TRP A 1 524 ? 92.689  53.517 41.138  1.00 22.96 ? 524  TRP A CZ2 1 
ATOM   4185 C  CZ3 . TRP A 1 524 ? 92.001  55.807 40.694  1.00 25.45 ? 524  TRP A CZ3 1 
ATOM   4186 C  CH2 . TRP A 1 524 ? 93.003  54.819 40.846  1.00 23.64 ? 524  TRP A CH2 1 
ATOM   4187 N  N   . ASN A 1 525 ? 84.863  55.357 42.582  1.00 30.41 ? 525  ASN A N   1 
ATOM   4188 C  CA  . ASN A 1 525 ? 83.659  56.100 42.263  1.00 31.10 ? 525  ASN A CA  1 
ATOM   4189 C  C   . ASN A 1 525 ? 83.130  56.962 43.402  1.00 33.03 ? 525  ASN A C   1 
ATOM   4190 O  O   . ASN A 1 525 ? 82.374  57.900 43.145  1.00 34.05 ? 525  ASN A O   1 
ATOM   4191 C  CB  . ASN A 1 525 ? 82.565  55.157 41.735  1.00 29.85 ? 525  ASN A CB  1 
ATOM   4192 C  CG  . ASN A 1 525 ? 82.976  54.465 40.455  1.00 30.69 ? 525  ASN A CG  1 
ATOM   4193 O  OD1 . ASN A 1 525 ? 83.945  54.888 39.788  1.00 31.11 ? 525  ASN A OD1 1 
ATOM   4194 N  ND2 . ASN A 1 525 ? 82.262  53.398 40.091  1.00 28.02 ? 525  ASN A ND2 1 
ATOM   4195 N  N   . GLN A 1 526 ? 83.508  56.673 44.645  1.00 33.17 ? 526  GLN A N   1 
ATOM   4196 C  CA  . GLN A 1 526 ? 82.943  57.435 45.776  1.00 35.99 ? 526  GLN A CA  1 
ATOM   4197 C  C   . GLN A 1 526 ? 84.033  58.126 46.567  1.00 35.45 ? 526  GLN A C   1 
ATOM   4198 O  O   . GLN A 1 526 ? 84.004  59.350 46.732  1.00 37.25 ? 526  GLN A O   1 
ATOM   4199 C  CB  . GLN A 1 526 ? 82.093  56.554 46.726  1.00 36.89 ? 526  GLN A CB  1 
ATOM   4200 C  CG  . GLN A 1 526 ? 80.597  56.452 46.420  1.00 42.80 ? 526  GLN A CG  1 
ATOM   4201 C  CD  . GLN A 1 526 ? 80.258  55.783 45.069  1.00 46.79 ? 526  GLN A CD  1 
ATOM   4202 O  OE1 . GLN A 1 526 ? 80.554  54.586 44.830  1.00 49.57 ? 526  GLN A OE1 1 
ATOM   4203 N  NE2 . GLN A 1 526 ? 79.602  56.549 44.193  1.00 46.53 ? 526  GLN A NE2 1 
ATOM   4204 N  N   . PHE A 1 527 ? 85.010  57.366 47.038  1.00 33.25 ? 527  PHE A N   1 
ATOM   4205 C  CA  . PHE A 1 527 ? 85.970  57.948 47.966  1.00 32.32 ? 527  PHE A CA  1 
ATOM   4206 C  C   . PHE A 1 527 ? 87.017  58.822 47.289  1.00 32.32 ? 527  PHE A C   1 
ATOM   4207 O  O   . PHE A 1 527 ? 87.178  59.971 47.692  1.00 33.70 ? 527  PHE A O   1 
ATOM   4208 C  CB  . PHE A 1 527 ? 86.618  56.875 48.869  1.00 31.04 ? 527  PHE A CB  1 
ATOM   4209 C  CG  . PHE A 1 527 ? 87.632  57.418 49.810  1.00 28.05 ? 527  PHE A CG  1 
ATOM   4210 C  CD1 . PHE A 1 527 ? 87.232  58.072 50.971  1.00 26.30 ? 527  PHE A CD1 1 
ATOM   4211 C  CD2 . PHE A 1 527 ? 88.980  57.276 49.530  1.00 24.57 ? 527  PHE A CD2 1 
ATOM   4212 C  CE1 . PHE A 1 527 ? 88.150  58.560 51.844  1.00 27.43 ? 527  PHE A CE1 1 
ATOM   4213 C  CE2 . PHE A 1 527 ? 89.935  57.787 50.386  1.00 25.13 ? 527  PHE A CE2 1 
ATOM   4214 C  CZ  . PHE A 1 527 ? 89.534  58.420 51.544  1.00 27.28 ? 527  PHE A CZ  1 
ATOM   4215 N  N   . LEU A 1 528 ? 87.718  58.327 46.275  1.00 31.32 ? 528  LEU A N   1 
ATOM   4216 C  CA  . LEU A 1 528 ? 88.750  59.183 45.663  1.00 32.77 ? 528  LEU A CA  1 
ATOM   4217 C  C   . LEU A 1 528 ? 88.196  60.549 45.220  1.00 34.26 ? 528  LEU A C   1 
ATOM   4218 O  O   . LEU A 1 528 ? 88.736  61.565 45.642  1.00 35.45 ? 528  LEU A O   1 
ATOM   4219 C  CB  . LEU A 1 528 ? 89.538  58.513 44.532  1.00 31.12 ? 528  LEU A CB  1 
ATOM   4220 C  CG  . LEU A 1 528 ? 90.842  59.169 44.017  1.00 31.80 ? 528  LEU A CG  1 
ATOM   4221 C  CD1 . LEU A 1 528 ? 91.863  59.486 45.111  1.00 32.66 ? 528  LEU A CD1 1 
ATOM   4222 C  CD2 . LEU A 1 528 ? 91.470  58.261 43.003  1.00 29.60 ? 528  LEU A CD2 1 
ATOM   4223 N  N   . PRO A 1 529 ? 87.110  60.578 44.412  1.00 35.10 ? 529  PRO A N   1 
ATOM   4224 C  CA  . PRO A 1 529 ? 86.560  61.883 43.946  1.00 36.75 ? 529  PRO A CA  1 
ATOM   4225 C  C   . PRO A 1 529 ? 86.257  62.832 45.083  1.00 39.08 ? 529  PRO A C   1 
ATOM   4226 O  O   . PRO A 1 529 ? 86.549  64.014 44.984  1.00 41.40 ? 529  PRO A O   1 
ATOM   4227 C  CB  . PRO A 1 529 ? 85.274  61.482 43.209  1.00 35.99 ? 529  PRO A CB  1 
ATOM   4228 C  CG  . PRO A 1 529 ? 85.612  60.081 42.656  1.00 33.93 ? 529  PRO A CG  1 
ATOM   4229 C  CD  . PRO A 1 529 ? 86.350  59.447 43.841  1.00 34.25 ? 529  PRO A CD  1 
ATOM   4230 N  N   . LYS A 1 530 ? 85.703  62.312 46.176  1.00 40.33 ? 530  LYS A N   1 
ATOM   4231 C  CA  . LYS A 1 530 ? 85.446  63.114 47.360  1.00 41.53 ? 530  LYS A CA  1 
ATOM   4232 C  C   . LYS A 1 530 ? 86.767  63.561 48.001  1.00 41.93 ? 530  LYS A C   1 
ATOM   4233 O  O   . LYS A 1 530 ? 86.901  64.709 48.437  1.00 43.19 ? 530  LYS A O   1 
ATOM   4234 C  CB  . LYS A 1 530 ? 84.538  62.345 48.332  1.00 42.08 ? 530  LYS A CB  1 
ATOM   4235 C  CG  . LYS A 1 530 ? 84.321  63.009 49.684  1.00 46.88 ? 530  LYS A CG  1 
ATOM   4236 C  CD  . LYS A 1 530 ? 82.990  62.565 50.321  1.00 52.71 ? 530  LYS A CD  1 
ATOM   4237 C  CE  . LYS A 1 530 ? 82.814  63.167 51.709  1.00 56.13 ? 530  LYS A CE  1 
ATOM   4238 N  NZ  . LYS A 1 530 ? 81.538  62.728 52.369  1.00 60.24 ? 530  LYS A NZ  1 
ATOM   4239 N  N   . LEU A 1 531 ? 87.761  62.680 48.050  1.00 40.43 ? 531  LEU A N   1 
ATOM   4240 C  CA  . LEU A 1 531 ? 89.058  63.107 48.562  1.00 41.20 ? 531  LEU A CA  1 
ATOM   4241 C  C   . LEU A 1 531 ? 89.621  64.250 47.687  1.00 42.29 ? 531  LEU A C   1 
ATOM   4242 O  O   . LEU A 1 531 ? 90.021  65.282 48.215  1.00 43.04 ? 531  LEU A O   1 
ATOM   4243 C  CB  . LEU A 1 531 ? 90.037  61.948 48.646  1.00 39.64 ? 531  LEU A CB  1 
ATOM   4244 C  CG  . LEU A 1 531 ? 91.444  62.232 49.140  1.00 39.02 ? 531  LEU A CG  1 
ATOM   4245 C  CD1 . LEU A 1 531 ? 91.944  61.061 49.966  1.00 37.03 ? 531  LEU A CD1 1 
ATOM   4246 C  CD2 . LEU A 1 531 ? 92.371  62.483 47.970  1.00 36.00 ? 531  LEU A CD2 1 
ATOM   4247 N  N   . LEU A 1 532 ? 89.636  64.052 46.369  1.00 41.27 ? 532  LEU A N   1 
ATOM   4248 C  CA  . LEU A 1 532 ? 90.101  65.086 45.441  1.00 43.25 ? 532  LEU A CA  1 
ATOM   4249 C  C   . LEU A 1 532 ? 89.232  66.357 45.481  1.00 45.35 ? 532  LEU A C   1 
ATOM   4250 O  O   . LEU A 1 532 ? 89.778  67.450 45.496  1.00 46.86 ? 532  LEU A O   1 
ATOM   4251 C  CB  . LEU A 1 532 ? 90.284  64.538 44.007  1.00 41.57 ? 532  LEU A CB  1 
ATOM   4252 C  CG  . LEU A 1 532 ? 91.268  63.347 43.908  1.00 40.42 ? 532  LEU A CG  1 
ATOM   4253 C  CD1 . LEU A 1 532 ? 91.293  62.660 42.517  1.00 37.55 ? 532  LEU A CD1 1 
ATOM   4254 C  CD2 . LEU A 1 532 ? 92.660  63.767 44.343  1.00 39.19 ? 532  LEU A CD2 1 
ATOM   4255 N  N   . ASN A 1 533 ? 87.902  66.235 45.526  1.00 46.47 ? 533  ASN A N   1 
ATOM   4256 C  CA  . ASN A 1 533 ? 87.083  67.429 45.807  1.00 49.53 ? 533  ASN A CA  1 
ATOM   4257 C  C   . ASN A 1 533 ? 87.460  68.161 47.096  1.00 51.03 ? 533  ASN A C   1 
ATOM   4258 O  O   . ASN A 1 533 ? 87.413  69.400 47.148  1.00 54.13 ? 533  ASN A O   1 
ATOM   4259 C  CB  . ASN A 1 533 ? 85.573  67.157 45.794  1.00 50.21 ? 533  ASN A CB  1 
ATOM   4260 C  CG  . ASN A 1 533 ? 84.757  68.454 45.779  1.00 54.80 ? 533  ASN A CG  1 
ATOM   4261 O  OD1 . ASN A 1 533 ? 84.695  69.151 44.755  1.00 58.87 ? 533  ASN A OD1 1 
ATOM   4262 N  ND2 . ASN A 1 533 ? 84.142  68.795 46.915  1.00 57.25 ? 533  ASN A ND2 1 
ATOM   4263 N  N   . ALA A 1 534 ? 87.850  67.420 48.130  1.00 50.19 ? 534  ALA A N   1 
ATOM   4264 C  CA  . ALA A 1 534 ? 88.138  68.031 49.434  1.00 51.17 ? 534  ALA A CA  1 
ATOM   4265 C  C   . ALA A 1 534 ? 89.538  68.620 49.644  1.00 51.57 ? 534  ALA A C   1 
ATOM   4266 O  O   . ALA A 1 534 ? 89.700  69.513 50.481  1.00 53.50 ? 534  ALA A O   1 
ATOM   4267 C  CB  . ALA A 1 534 ? 87.800  67.062 50.577  1.00 50.82 ? 534  ALA A CB  1 
ATOM   4268 N  N   . THR A 1 535 ? 90.544  68.149 48.914  1.00 49.79 ? 535  THR A N   1 
ATOM   4269 C  CA  . THR A 1 535 ? 91.938  68.448 49.302  1.00 50.87 ? 535  THR A CA  1 
ATOM   4270 C  C   . THR A 1 535 ? 92.833  69.047 48.226  1.00 51.09 ? 535  THR A C   1 
ATOM   4271 O  O   . THR A 1 535 ? 92.443  69.123 47.066  1.00 51.65 ? 535  THR A O   1 
ATOM   4272 C  CB  . THR A 1 535 ? 92.629  67.208 49.888  1.00 49.56 ? 535  THR A CB  1 
ATOM   4273 O  OG1 . THR A 1 535 ? 92.456  66.085 48.995  1.00 48.98 ? 535  THR A OG1 1 
ATOM   4274 C  CG2 . THR A 1 535 ? 92.030  66.894 51.233  1.00 49.43 ? 535  THR A CG2 1 
ATOM   4275 N  N   . SER B 1 4   ? 114.996 40.061 112.130 1.00 66.84 ? 4    SER B N   1 
ATOM   4276 C  CA  . SER B 1 4   ? 113.526 39.935 111.899 1.00 65.40 ? 4    SER B CA  1 
ATOM   4277 C  C   . SER B 1 4   ? 113.100 40.330 110.484 1.00 61.94 ? 4    SER B C   1 
ATOM   4278 O  O   . SER B 1 4   ? 113.126 41.507 110.087 1.00 61.28 ? 4    SER B O   1 
ATOM   4279 C  CB  . SER B 1 4   ? 112.712 40.713 112.945 1.00 66.52 ? 4    SER B CB  1 
ATOM   4280 O  OG  . SER B 1 4   ? 111.356 40.863 112.516 1.00 66.31 ? 4    SER B OG  1 
ATOM   4281 N  N   . GLU B 1 5   ? 112.668 39.312 109.760 1.00 59.75 ? 5    GLU B N   1 
ATOM   4282 C  CA  . GLU B 1 5   ? 112.258 39.394 108.382 1.00 56.37 ? 5    GLU B CA  1 
ATOM   4283 C  C   . GLU B 1 5   ? 111.147 40.411 108.095 1.00 53.92 ? 5    GLU B C   1 
ATOM   4284 O  O   . GLU B 1 5   ? 111.130 41.038 107.042 1.00 52.25 ? 5    GLU B O   1 
ATOM   4285 C  CB  . GLU B 1 5   ? 111.780 38.006 107.987 1.00 56.72 ? 5    GLU B CB  1 
ATOM   4286 C  CG  . GLU B 1 5   ? 111.688 37.749 106.518 1.00 54.25 ? 5    GLU B CG  1 
ATOM   4287 C  CD  . GLU B 1 5   ? 111.572 36.272 106.246 1.00 53.83 ? 5    GLU B CD  1 
ATOM   4288 O  OE1 . GLU B 1 5   ? 111.284 35.526 107.202 1.00 54.47 ? 5    GLU B OE1 1 
ATOM   4289 O  OE2 . GLU B 1 5   ? 111.772 35.863 105.096 1.00 50.09 ? 5    GLU B OE2 1 
ATOM   4290 N  N   . LEU B 1 6   ? 110.220 40.558 109.028 1.00 53.82 ? 6    LEU B N   1 
ATOM   4291 C  CA  . LEU B 1 6   ? 109.018 41.339 108.809 1.00 51.59 ? 6    LEU B CA  1 
ATOM   4292 C  C   . LEU B 1 6   ? 109.159 42.777 109.249 1.00 50.74 ? 6    LEU B C   1 
ATOM   4293 O  O   . LEU B 1 6   ? 108.282 43.594 108.971 1.00 49.36 ? 6    LEU B O   1 
ATOM   4294 C  CB  . LEU B 1 6   ? 107.832 40.707 109.545 1.00 52.85 ? 6    LEU B CB  1 
ATOM   4295 C  CG  . LEU B 1 6   ? 107.335 39.343 109.062 1.00 54.01 ? 6    LEU B CG  1 
ATOM   4296 C  CD1 . LEU B 1 6   ? 106.179 38.827 109.937 1.00 55.68 ? 6    LEU B CD1 1 
ATOM   4297 C  CD2 . LEU B 1 6   ? 106.941 39.396 107.588 1.00 52.22 ? 6    LEU B CD2 1 
ATOM   4298 N  N   . LEU B 1 7   ? 110.250 43.081 109.939 1.00 51.74 ? 7    LEU B N   1 
ATOM   4299 C  CA  . LEU B 1 7   ? 110.492 44.410 110.477 1.00 52.09 ? 7    LEU B CA  1 
ATOM   4300 C  C   . LEU B 1 7   ? 111.611 45.068 109.682 1.00 50.94 ? 7    LEU B C   1 
ATOM   4301 O  O   . LEU B 1 7   ? 112.774 44.652 109.749 1.00 51.51 ? 7    LEU B O   1 
ATOM   4302 C  CB  . LEU B 1 7   ? 110.844 44.337 111.968 1.00 54.92 ? 7    LEU B CB  1 
ATOM   4303 C  CG  . LEU B 1 7   ? 111.164 45.648 112.713 1.00 57.55 ? 7    LEU B CG  1 
ATOM   4304 C  CD1 . LEU B 1 7   ? 110.055 46.703 112.553 1.00 58.17 ? 7    LEU B CD1 1 
ATOM   4305 C  CD2 . LEU B 1 7   ? 111.482 45.419 114.204 1.00 60.00 ? 7    LEU B CD2 1 
ATOM   4306 N  N   . VAL B 1 8   ? 111.240 46.085 108.908 1.00 48.73 ? 8    VAL B N   1 
ATOM   4307 C  CA  . VAL B 1 8   ? 112.185 46.760 108.031 1.00 47.42 ? 8    VAL B CA  1 
ATOM   4308 C  C   . VAL B 1 8   ? 112.316 48.231 108.409 1.00 47.54 ? 8    VAL B C   1 
ATOM   4309 O  O   . VAL B 1 8   ? 111.323 48.933 108.538 1.00 47.25 ? 8    VAL B O   1 
ATOM   4310 C  CB  . VAL B 1 8   ? 111.777 46.611 106.540 1.00 44.98 ? 8    VAL B CB  1 
ATOM   4311 C  CG1 . VAL B 1 8   ? 112.702 47.396 105.654 1.00 44.02 ? 8    VAL B CG1 1 
ATOM   4312 C  CG2 . VAL B 1 8   ? 111.793 45.149 106.128 1.00 43.78 ? 8    VAL B CG2 1 
ATOM   4313 N  N   . ASN B 1 9   ? 113.545 48.690 108.570 1.00 48.38 ? 9    ASN B N   1 
ATOM   4314 C  CA  . ASN B 1 9   ? 113.801 50.105 108.771 1.00 49.49 ? 9    ASN B CA  1 
ATOM   4315 C  C   . ASN B 1 9   ? 114.077 50.780 107.458 1.00 47.60 ? 9    ASN B C   1 
ATOM   4316 O  O   . ASN B 1 9   ? 115.134 50.593 106.873 1.00 47.91 ? 9    ASN B O   1 
ATOM   4317 C  CB  . ASN B 1 9   ? 114.984 50.329 109.719 1.00 52.07 ? 9    ASN B CB  1 
ATOM   4318 C  CG  . ASN B 1 9   ? 114.963 51.710 110.357 1.00 55.18 ? 9    ASN B CG  1 
ATOM   4319 O  OD1 . ASN B 1 9   ? 114.025 52.500 110.143 1.00 56.35 ? 9    ASN B OD1 1 
ATOM   4320 N  ND2 . ASN B 1 9   ? 115.993 52.009 111.166 1.00 58.42 ? 9    ASN B ND2 1 
ATOM   4321 N  N   . THR B 1 10  ? 113.108 51.550 106.988 1.00 46.57 ? 10   THR B N   1 
ATOM   4322 C  CA  . THR B 1 10  ? 113.248 52.265 105.733 1.00 45.29 ? 10   THR B CA  1 
ATOM   4323 C  C   . THR B 1 10  ? 113.753 53.659 106.061 1.00 47.02 ? 10   THR B C   1 
ATOM   4324 O  O   . THR B 1 10  ? 113.874 54.009 107.243 1.00 48.67 ? 10   THR B O   1 
ATOM   4325 C  CB  . THR B 1 10  ? 111.918 52.348 104.973 1.00 43.51 ? 10   THR B CB  1 
ATOM   4326 O  OG1 . THR B 1 10  ? 111.115 53.415 105.499 1.00 42.94 ? 10   THR B OG1 1 
ATOM   4327 C  CG2 . THR B 1 10  ? 111.157 51.040 105.084 1.00 43.02 ? 10   THR B CG2 1 
ATOM   4328 N  N   . LYS B 1 11  ? 114.029 54.457 105.029 1.00 46.94 ? 11   LYS B N   1 
ATOM   4329 C  CA  . LYS B 1 11  ? 114.610 55.789 105.221 1.00 48.71 ? 11   LYS B CA  1 
ATOM   4330 C  C   . LYS B 1 11  ? 113.662 56.796 105.864 1.00 49.36 ? 11   LYS B C   1 
ATOM   4331 O  O   . LYS B 1 11  ? 114.107 57.762 106.479 1.00 51.33 ? 11   LYS B O   1 
ATOM   4332 C  CB  . LYS B 1 11  ? 115.256 56.316 103.927 1.00 48.31 ? 11   LYS B CB  1 
ATOM   4333 C  CG  . LYS B 1 11  ? 116.643 55.647 103.674 1.00 49.86 ? 11   LYS B CG  1 
ATOM   4334 C  CD  . LYS B 1 11  ? 117.290 56.110 102.375 1.00 51.43 ? 11   LYS B CD  1 
ATOM   4335 C  CE  . LYS B 1 11  ? 118.493 55.265 102.024 1.00 51.88 ? 11   LYS B CE  1 
ATOM   4336 N  NZ  . LYS B 1 11  ? 119.738 55.582 102.800 1.00 56.98 ? 11   LYS B NZ  1 
ATOM   4337 N  N   . SER B 1 12  ? 112.360 56.556 105.770 1.00 48.55 ? 12   SER B N   1 
ATOM   4338 C  CA  . SER B 1 12  ? 111.399 57.431 106.453 1.00 49.18 ? 12   SER B CA  1 
ATOM   4339 C  C   . SER B 1 12  ? 110.758 56.871 107.770 1.00 49.80 ? 12   SER B C   1 
ATOM   4340 O  O   . SER B 1 12  ? 109.887 57.517 108.374 1.00 50.75 ? 12   SER B O   1 
ATOM   4341 C  CB  . SER B 1 12  ? 110.338 57.950 105.469 1.00 47.68 ? 12   SER B CB  1 
ATOM   4342 O  OG  . SER B 1 12  ? 110.300 57.166 104.273 1.00 49.89 ? 12   SER B OG  1 
ATOM   4343 N  N   . GLY B 1 13  ? 111.207 55.701 108.222 1.00 48.97 ? 13   GLY B N   1 
ATOM   4344 C  CA  . GLY B 1 13  ? 110.709 55.099 109.454 1.00 48.84 ? 13   GLY B CA  1 
ATOM   4345 C  C   . GLY B 1 13  ? 110.593 53.588 109.361 1.00 47.76 ? 13   GLY B C   1 
ATOM   4346 O  O   . GLY B 1 13  ? 110.836 52.995 108.326 1.00 46.12 ? 13   GLY B O   1 
ATOM   4347 N  N   . LYS B 1 14  ? 110.204 52.954 110.454 1.00 48.82 ? 14   LYS B N   1 
ATOM   4348 C  CA  . LYS B 1 14  ? 110.106 51.509 110.456 1.00 47.90 ? 14   LYS B CA  1 
ATOM   4349 C  C   . LYS B 1 14  ? 108.776 51.031 109.878 1.00 46.42 ? 14   LYS B C   1 
ATOM   4350 O  O   . LYS B 1 14  ? 107.762 51.723 109.951 1.00 45.95 ? 14   LYS B O   1 
ATOM   4351 C  CB  . LYS B 1 14  ? 110.331 50.966 111.860 1.00 50.00 ? 14   LYS B CB  1 
ATOM   4352 C  CG  . LYS B 1 14  ? 111.772 51.119 112.333 1.00 51.37 ? 14   LYS B CG  1 
ATOM   4353 C  CD  . LYS B 1 14  ? 111.922 50.793 113.805 1.00 53.66 ? 14   LYS B CD  1 
ATOM   4354 C  CE  . LYS B 1 14  ? 112.887 51.741 114.445 1.00 54.28 ? 14   LYS B CE  1 
ATOM   4355 N  NZ  . LYS B 1 14  ? 112.944 51.482 115.894 1.00 58.37 ? 14   LYS B NZ  1 
ATOM   4356 N  N   . VAL B 1 15  ? 108.805 49.827 109.324 1.00 45.32 ? 15   VAL B N   1 
ATOM   4357 C  CA  . VAL B 1 15  ? 107.665 49.219 108.698 1.00 44.43 ? 15   VAL B CA  1 
ATOM   4358 C  C   . VAL B 1 15  ? 107.557 47.787 109.208 1.00 45.80 ? 15   VAL B C   1 
ATOM   4359 O  O   . VAL B 1 15  ? 108.557 47.073 109.302 1.00 46.41 ? 15   VAL B O   1 
ATOM   4360 C  CB  . VAL B 1 15  ? 107.822 49.289 107.153 1.00 42.79 ? 15   VAL B CB  1 
ATOM   4361 C  CG1 . VAL B 1 15  ? 107.264 48.087 106.489 1.00 42.83 ? 15   VAL B CG1 1 
ATOM   4362 C  CG2 . VAL B 1 15  ? 107.207 50.578 106.593 1.00 40.00 ? 15   VAL B CG2 1 
ATOM   4363 N  N   . MET B 1 16  ? 106.343 47.377 109.571 1.00 46.54 ? 16   MET B N   1 
ATOM   4364 C  CA  . MET B 1 16  ? 106.083 45.986 109.959 1.00 48.11 ? 16   MET B CA  1 
ATOM   4365 C  C   . MET B 1 16  ? 105.096 45.326 108.985 1.00 46.78 ? 16   MET B C   1 
ATOM   4366 O  O   . MET B 1 16  ? 103.935 45.740 108.892 1.00 46.19 ? 16   MET B O   1 
ATOM   4367 C  CB  . MET B 1 16  ? 105.569 45.931 111.406 1.00 50.09 ? 16   MET B CB  1 
ATOM   4368 C  CG  . MET B 1 16  ? 105.011 44.616 111.864 1.00 53.74 ? 16   MET B CG  1 
ATOM   4369 S  SD  . MET B 1 16  ? 106.289 43.458 112.343 1.00 62.57 ? 16   MET B SD  1 
ATOM   4370 C  CE  . MET B 1 16  ? 105.401 42.622 113.635 1.00 62.57 ? 16   MET B CE  1 
ATOM   4371 N  N   . GLY B 1 17  ? 105.570 44.304 108.270 1.00 46.57 ? 17   GLY B N   1 
ATOM   4372 C  CA  . GLY B 1 17  ? 104.747 43.534 107.353 1.00 45.78 ? 17   GLY B CA  1 
ATOM   4373 C  C   . GLY B 1 17  ? 104.119 42.307 107.985 1.00 48.11 ? 17   GLY B C   1 
ATOM   4374 O  O   . GLY B 1 17  ? 104.103 42.150 109.221 1.00 50.78 ? 17   GLY B O   1 
ATOM   4375 N  N   . THR B 1 18  ? 103.620 41.422 107.132 1.00 47.51 ? 18   THR B N   1 
ATOM   4376 C  CA  . THR B 1 18  ? 102.855 40.262 107.560 1.00 49.38 ? 18   THR B CA  1 
ATOM   4377 C  C   . THR B 1 18  ? 103.227 39.052 106.712 1.00 49.23 ? 18   THR B C   1 
ATOM   4378 O  O   . THR B 1 18  ? 103.438 39.173 105.514 1.00 48.01 ? 18   THR B O   1 
ATOM   4379 C  CB  . THR B 1 18  ? 101.316 40.525 107.452 1.00 49.31 ? 18   THR B CB  1 
ATOM   4380 O  OG1 . THR B 1 18  ? 100.589 39.375 107.894 1.00 52.13 ? 18   THR B OG1 1 
ATOM   4381 C  CG2 . THR B 1 18  ? 100.879 40.862 106.015 1.00 46.48 ? 18   THR B CG2 1 
ATOM   4382 N  N   . ARG B 1 19  ? 103.312 37.890 107.343 1.00 51.38 ? 19   ARG B N   1 
ATOM   4383 C  CA  . ARG B 1 19  ? 103.549 36.643 106.642 1.00 51.35 ? 19   ARG B CA  1 
ATOM   4384 C  C   . ARG B 1 19  ? 102.238 36.227 105.997 1.00 50.96 ? 19   ARG B C   1 
ATOM   4385 O  O   . ARG B 1 19  ? 101.238 36.070 106.678 1.00 52.00 ? 19   ARG B O   1 
ATOM   4386 C  CB  . ARG B 1 19  ? 104.067 35.605 107.642 1.00 53.79 ? 19   ARG B CB  1 
ATOM   4387 C  CG  . ARG B 1 19  ? 104.175 34.182 107.153 1.00 55.52 ? 19   ARG B CG  1 
ATOM   4388 C  CD  . ARG B 1 19  ? 105.260 33.460 107.943 1.00 60.51 ? 19   ARG B CD  1 
ATOM   4389 N  NE  . ARG B 1 19  ? 106.455 33.265 107.124 1.00 61.94 ? 19   ARG B NE  1 
ATOM   4390 C  CZ  . ARG B 1 19  ? 106.986 32.077 106.825 1.00 64.43 ? 19   ARG B CZ  1 
ATOM   4391 N  NH1 . ARG B 1 19  ? 106.442 30.955 107.311 1.00 65.63 ? 19   ARG B NH1 1 
ATOM   4392 N  NH2 . ARG B 1 19  ? 108.062 32.010 106.037 1.00 62.92 ? 19   ARG B NH2 1 
ATOM   4393 N  N   . VAL B 1 20  ? 102.242 36.096 104.671 1.00 49.91 ? 20   VAL B N   1 
ATOM   4394 C  CA  . VAL B 1 20  ? 101.054 35.691 103.924 1.00 50.02 ? 20   VAL B CA  1 
ATOM   4395 C  C   . VAL B 1 20  ? 101.259 34.297 103.293 1.00 51.77 ? 20   VAL B C   1 
ATOM   4396 O  O   . VAL B 1 20  ? 102.377 33.952 102.884 1.00 52.05 ? 20   VAL B O   1 
ATOM   4397 C  CB  . VAL B 1 20  ? 100.576 36.767 102.854 1.00 48.09 ? 20   VAL B CB  1 
ATOM   4398 C  CG1 . VAL B 1 20  ? 100.510 38.192 103.451 1.00 46.47 ? 20   VAL B CG1 1 
ATOM   4399 C  CG2 . VAL B 1 20  ? 101.416 36.753 101.610 1.00 45.55 ? 20   VAL B CG2 1 
ATOM   4400 N  N   . PRO B 1 21  ? 100.186 33.479 103.233 1.00 52.74 ? 21   PRO B N   1 
ATOM   4401 C  CA  . PRO B 1 21  ? 100.370 32.182 102.593 1.00 53.28 ? 21   PRO B CA  1 
ATOM   4402 C  C   . PRO B 1 21  ? 100.303 32.299 101.068 1.00 50.99 ? 21   PRO B C   1 
ATOM   4403 O  O   . PRO B 1 21  ? 99.656  33.209 100.535 1.00 49.40 ? 21   PRO B O   1 
ATOM   4404 C  CB  . PRO B 1 21  ? 99.197  31.355 103.133 1.00 54.97 ? 21   PRO B CB  1 
ATOM   4405 C  CG  . PRO B 1 21  ? 98.111  32.357 103.354 1.00 54.99 ? 21   PRO B CG  1 
ATOM   4406 C  CD  . PRO B 1 21  ? 98.802  33.673 103.713 1.00 53.61 ? 21   PRO B CD  1 
ATOM   4407 N  N   . VAL B 1 22  ? 100.978 31.383 100.385 1.00 50.90 ? 22   VAL B N   1 
ATOM   4408 C  CA  . VAL B 1 22  ? 100.972 31.321 98.924  1.00 48.90 ? 22   VAL B CA  1 
ATOM   4409 C  C   . VAL B 1 22  ? 101.270 29.886 98.497  1.00 50.74 ? 22   VAL B C   1 
ATOM   4410 O  O   . VAL B 1 22  ? 102.280 29.310 98.899  1.00 51.92 ? 22   VAL B O   1 
ATOM   4411 C  CB  . VAL B 1 22  ? 101.983 32.333 98.271  1.00 47.08 ? 22   VAL B CB  1 
ATOM   4412 C  CG1 . VAL B 1 22  ? 103.398 32.211 98.880  1.00 45.52 ? 22   VAL B CG1 1 
ATOM   4413 C  CG2 . VAL B 1 22  ? 102.004 32.183 96.738  1.00 44.28 ? 22   VAL B CG2 1 
ATOM   4414 N  N   . LEU B 1 23  ? 100.365 29.299 97.716  1.00 50.95 ? 23   LEU B N   1 
ATOM   4415 C  CA  . LEU B 1 23  ? 100.572 27.965 97.145  1.00 51.81 ? 23   LEU B CA  1 
ATOM   4416 C  C   . LEU B 1 23  ? 101.315 27.025 98.113  1.00 53.93 ? 23   LEU B C   1 
ATOM   4417 O  O   . LEU B 1 23  ? 102.345 26.432 97.767  1.00 54.52 ? 23   LEU B O   1 
ATOM   4418 C  CB  . LEU B 1 23  ? 101.295 28.070 95.784  1.00 50.18 ? 23   LEU B CB  1 
ATOM   4419 C  CG  . LEU B 1 23  ? 100.921 29.201 94.798  1.00 47.26 ? 23   LEU B CG  1 
ATOM   4420 C  CD1 . LEU B 1 23  ? 101.812 29.206 93.566  1.00 45.14 ? 23   LEU B CD1 1 
ATOM   4421 C  CD2 . LEU B 1 23  ? 99.475  29.164 94.370  1.00 48.18 ? 23   LEU B CD2 1 
ATOM   4422 N  N   . SER B 1 24  ? 100.797 26.921 99.334  1.00 55.02 ? 24   SER B N   1 
ATOM   4423 C  CA  . SER B 1 24  ? 101.365 26.036 100.387 1.00 57.72 ? 24   SER B CA  1 
ATOM   4424 C  C   . SER B 1 24  ? 102.808 26.344 100.797 1.00 57.21 ? 24   SER B C   1 
ATOM   4425 O  O   . SER B 1 24  ? 103.521 25.490 101.321 1.00 59.99 ? 24   SER B O   1 
ATOM   4426 C  CB  . SER B 1 24  ? 101.194 24.540 100.030 1.00 60.06 ? 24   SER B CB  1 
ATOM   4427 O  OG  . SER B 1 24  ? 102.114 24.149 99.017  1.00 59.24 ? 24   SER B OG  1 
ATOM   4428 N  N   . SER B 1 25  ? 103.234 27.569 100.538 1.00 55.05 ? 25   SER B N   1 
ATOM   4429 C  CA  . SER B 1 25  ? 104.439 28.106 101.128 1.00 54.49 ? 25   SER B CA  1 
ATOM   4430 C  C   . SER B 1 25  ? 104.074 29.464 101.703 1.00 53.61 ? 25   SER B C   1 
ATOM   4431 O  O   . SER B 1 25  ? 102.891 29.786 101.894 1.00 53.71 ? 25   SER B O   1 
ATOM   4432 C  CB  . SER B 1 25  ? 105.549 28.230 100.090 1.00 53.75 ? 25   SER B CB  1 
ATOM   4433 O  OG  . SER B 1 25  ? 106.789 28.493 100.715 1.00 52.10 ? 25   SER B OG  1 
ATOM   4434 N  N   . HIS B 1 26  ? 105.078 30.276 101.976 1.00 52.59 ? 26   HIS B N   1 
ATOM   4435 C  CA  . HIS B 1 26  ? 104.815 31.559 102.573 1.00 52.12 ? 26   HIS B CA  1 
ATOM   4436 C  C   . HIS B 1 26  ? 105.738 32.586 101.950 1.00 50.47 ? 26   HIS B C   1 
ATOM   4437 O  O   . HIS B 1 26  ? 106.783 32.218 101.417 1.00 51.04 ? 26   HIS B O   1 
ATOM   4438 C  CB  . HIS B 1 26  ? 105.014 31.475 104.093 1.00 53.70 ? 26   HIS B CB  1 
ATOM   4439 C  CG  . HIS B 1 26  ? 104.022 30.578 104.772 1.00 56.82 ? 26   HIS B CG  1 
ATOM   4440 N  ND1 . HIS B 1 26  ? 104.278 29.246 105.034 1.00 60.03 ? 26   HIS B ND1 1 
ATOM   4441 C  CD2 . HIS B 1 26  ? 102.762 30.814 105.213 1.00 57.05 ? 26   HIS B CD2 1 
ATOM   4442 C  CE1 . HIS B 1 26  ? 103.222 28.705 105.618 1.00 62.47 ? 26   HIS B CE1 1 
ATOM   4443 N  NE2 . HIS B 1 26  ? 102.288 29.636 105.737 1.00 61.65 ? 26   HIS B NE2 1 
ATOM   4444 N  N   . ILE B 1 27  ? 105.321 33.850 101.954 1.00 48.72 ? 27   ILE B N   1 
ATOM   4445 C  CA  . ILE B 1 27  ? 106.256 34.968 101.806 1.00 47.80 ? 27   ILE B CA  1 
ATOM   4446 C  C   . ILE B 1 27  ? 105.808 36.206 102.577 1.00 46.81 ? 27   ILE B C   1 
ATOM   4447 O  O   . ILE B 1 27  ? 104.776 36.176 103.245 1.00 47.79 ? 27   ILE B O   1 
ATOM   4448 C  CB  . ILE B 1 27  ? 106.632 35.316 100.341 1.00 46.48 ? 27   ILE B CB  1 
ATOM   4449 C  CG1 . ILE B 1 27  ? 105.431 35.738 99.517  1.00 44.68 ? 27   ILE B CG1 1 
ATOM   4450 C  CG2 . ILE B 1 27  ? 107.406 34.146 99.684  1.00 48.59 ? 27   ILE B CG2 1 
ATOM   4451 C  CD1 . ILE B 1 27  ? 105.870 36.256 98.131  1.00 44.47 ? 27   ILE B CD1 1 
ATOM   4452 N  N   . SER B 1 28  ? 106.613 37.266 102.499 1.00 44.78 ? 28   SER B N   1 
ATOM   4453 C  CA  . SER B 1 28  ? 106.423 38.461 103.283 1.00 43.40 ? 28   SER B CA  1 
ATOM   4454 C  C   . SER B 1 28  ? 105.707 39.493 102.432 1.00 41.63 ? 28   SER B C   1 
ATOM   4455 O  O   . SER B 1 28  ? 106.029 39.668 101.238 1.00 39.14 ? 28   SER B O   1 
ATOM   4456 C  CB  . SER B 1 28  ? 107.784 39.010 103.723 1.00 43.96 ? 28   SER B CB  1 
ATOM   4457 O  OG  . SER B 1 28  ? 108.482 38.096 104.571 1.00 46.60 ? 28   SER B OG  1 
ATOM   4458 N  N   . ALA B 1 29  ? 104.741 40.180 103.044 1.00 40.64 ? 29   ALA B N   1 
ATOM   4459 C  CA  . ALA B 1 29  ? 104.040 41.235 102.351 1.00 39.45 ? 29   ALA B CA  1 
ATOM   4460 C  C   . ALA B 1 29  ? 104.099 42.508 103.172 1.00 39.29 ? 29   ALA B C   1 
ATOM   4461 O  O   . ALA B 1 29  ? 103.870 42.488 104.385 1.00 41.92 ? 29   ALA B O   1 
ATOM   4462 C  CB  . ALA B 1 29  ? 102.582 40.825 102.070 1.00 39.03 ? 29   ALA B CB  1 
ATOM   4463 N  N   . PHE B 1 30  ? 104.397 43.612 102.521 1.00 36.88 ? 30   PHE B N   1 
ATOM   4464 C  CA  . PHE B 1 30  ? 104.340 44.918 103.183 1.00 36.45 ? 30   PHE B CA  1 
ATOM   4465 C  C   . PHE B 1 30  ? 103.305 45.707 102.415 1.00 35.59 ? 30   PHE B C   1 
ATOM   4466 O  O   . PHE B 1 30  ? 103.522 46.081 101.240 1.00 34.76 ? 30   PHE B O   1 
ATOM   4467 C  CB  . PHE B 1 30  ? 105.723 45.565 103.156 1.00 35.91 ? 30   PHE B CB  1 
ATOM   4468 C  CG  . PHE B 1 30  ? 106.817 44.673 103.732 1.00 36.84 ? 30   PHE B CG  1 
ATOM   4469 C  CD1 . PHE B 1 30  ? 107.405 43.679 102.966 1.00 36.05 ? 30   PHE B CD1 1 
ATOM   4470 C  CD2 . PHE B 1 30  ? 107.218 44.807 105.053 1.00 37.70 ? 30   PHE B CD2 1 
ATOM   4471 C  CE1 . PHE B 1 30  ? 108.379 42.845 103.499 1.00 37.06 ? 30   PHE B CE1 1 
ATOM   4472 C  CE2 . PHE B 1 30  ? 108.206 43.998 105.588 1.00 39.53 ? 30   PHE B CE2 1 
ATOM   4473 C  CZ  . PHE B 1 30  ? 108.789 43.009 104.801 1.00 38.61 ? 30   PHE B CZ  1 
ATOM   4474 N  N   . LEU B 1 31  ? 102.143 45.885 103.025 1.00 36.02 ? 31   LEU B N   1 
ATOM   4475 C  CA  . LEU B 1 31  ? 101.002 46.419 102.283 1.00 36.05 ? 31   LEU B CA  1 
ATOM   4476 C  C   . LEU B 1 31  ? 100.703 47.808 102.776 1.00 36.16 ? 31   LEU B C   1 
ATOM   4477 O  O   . LEU B 1 31  ? 100.739 48.042 103.969 1.00 38.56 ? 31   LEU B O   1 
ATOM   4478 C  CB  . LEU B 1 31  ? 99.769  45.535 102.456 1.00 36.30 ? 31   LEU B CB  1 
ATOM   4479 C  CG  . LEU B 1 31  ? 99.950  44.032 102.229 1.00 37.27 ? 31   LEU B CG  1 
ATOM   4480 C  CD1 . LEU B 1 31  ? 98.628  43.348 102.521 1.00 38.49 ? 31   LEU B CD1 1 
ATOM   4481 C  CD2 . LEU B 1 31  ? 100.425 43.736 100.821 1.00 35.90 ? 31   LEU B CD2 1 
ATOM   4482 N  N   . GLY B 1 32  ? 100.429 48.739 101.869 1.00 35.05 ? 32   GLY B N   1 
ATOM   4483 C  CA  . GLY B 1 32  ? 100.050 50.086 102.276 1.00 34.88 ? 32   GLY B CA  1 
ATOM   4484 C  C   . GLY B 1 32  ? 101.144 50.917 102.930 1.00 35.53 ? 32   GLY B C   1 
ATOM   4485 O  O   . GLY B 1 32  ? 100.875 51.597 103.914 1.00 36.38 ? 32   GLY B O   1 
ATOM   4486 N  N   . ILE B 1 33  ? 102.364 50.871 102.380 1.00 34.61 ? 33   ILE B N   1 
ATOM   4487 C  CA  . ILE B 1 33  ? 103.460 51.762 102.801 1.00 35.09 ? 33   ILE B CA  1 
ATOM   4488 C  C   . ILE B 1 33  ? 103.267 53.136 102.146 1.00 34.10 ? 33   ILE B C   1 
ATOM   4489 O  O   . ILE B 1 33  ? 103.117 53.234 100.921 1.00 33.73 ? 33   ILE B O   1 
ATOM   4490 C  CB  . ILE B 1 33  ? 104.874 51.179 102.404 1.00 34.76 ? 33   ILE B CB  1 
ATOM   4491 C  CG1 . ILE B 1 33  ? 105.134 49.855 103.140 1.00 36.81 ? 33   ILE B CG1 1 
ATOM   4492 C  CG2 . ILE B 1 33  ? 105.999 52.192 102.684 1.00 34.36 ? 33   ILE B CG2 1 
ATOM   4493 C  CD1 . ILE B 1 33  ? 106.410 49.142 102.735 1.00 37.65 ? 33   ILE B CD1 1 
ATOM   4494 N  N   . PRO B 1 34  ? 103.261 54.202 102.941 1.00 34.89 ? 34   PRO B N   1 
ATOM   4495 C  CA  . PRO B 1 34  ? 103.110 55.521 102.337 1.00 33.95 ? 34   PRO B CA  1 
ATOM   4496 C  C   . PRO B 1 34  ? 104.370 55.968 101.651 1.00 34.06 ? 34   PRO B C   1 
ATOM   4497 O  O   . PRO B 1 34  ? 105.458 55.797 102.207 1.00 35.74 ? 34   PRO B O   1 
ATOM   4498 C  CB  . PRO B 1 34  ? 102.859 56.423 103.547 1.00 35.96 ? 34   PRO B CB  1 
ATOM   4499 C  CG  . PRO B 1 34  ? 103.439 55.694 104.709 1.00 36.68 ? 34   PRO B CG  1 
ATOM   4500 C  CD  . PRO B 1 34  ? 103.256 54.252 104.418 1.00 36.17 ? 34   PRO B CD  1 
ATOM   4501 N  N   . PHE B 1 35  ? 104.252 56.533 100.456 1.00 32.19 ? 35   PHE B N   1 
ATOM   4502 C  CA  . PHE B 1 35  ? 105.427 57.103 99.809  1.00 31.86 ? 35   PHE B CA  1 
ATOM   4503 C  C   . PHE B 1 35  ? 105.325 58.620 99.604  1.00 31.71 ? 35   PHE B C   1 
ATOM   4504 O  O   . PHE B 1 35  ? 106.262 59.215 99.126  1.00 32.82 ? 35   PHE B O   1 
ATOM   4505 C  CB  . PHE B 1 35  ? 105.767 56.385 98.493  1.00 30.63 ? 35   PHE B CB  1 
ATOM   4506 C  CG  . PHE B 1 35  ? 104.725 56.573 97.417  1.00 29.79 ? 35   PHE B CG  1 
ATOM   4507 C  CD1 . PHE B 1 35  ? 104.736 57.713 96.604  1.00 26.78 ? 35   PHE B CD1 1 
ATOM   4508 C  CD2 . PHE B 1 35  ? 103.716 55.641 97.258  1.00 26.84 ? 35   PHE B CD2 1 
ATOM   4509 C  CE1 . PHE B 1 35  ? 103.765 57.887 95.625  1.00 29.53 ? 35   PHE B CE1 1 
ATOM   4510 C  CE2 . PHE B 1 35  ? 102.727 55.825 96.282  1.00 27.86 ? 35   PHE B CE2 1 
ATOM   4511 C  CZ  . PHE B 1 35  ? 102.745 56.935 95.466  1.00 26.23 ? 35   PHE B CZ  1 
ATOM   4512 N  N   . ALA B 1 36  ? 104.213 59.241 99.984  1.00 32.05 ? 36   ALA B N   1 
ATOM   4513 C  CA  . ALA B 1 36  ? 104.028 60.694 99.837  1.00 33.01 ? 36   ALA B CA  1 
ATOM   4514 C  C   . ALA B 1 36  ? 103.165 61.229 100.952 1.00 35.17 ? 36   ALA B C   1 
ATOM   4515 O  O   . ALA B 1 36  ? 102.456 60.469 101.596 1.00 35.34 ? 36   ALA B O   1 
ATOM   4516 C  CB  . ALA B 1 36  ? 103.380 61.014 98.510  1.00 31.44 ? 36   ALA B CB  1 
ATOM   4517 N  N   . GLU B 1 37  ? 103.209 62.546 101.183 1.00 37.71 ? 37   GLU B N   1 
ATOM   4518 C  CA  . GLU B 1 37  ? 102.238 63.184 102.073 1.00 39.19 ? 37   GLU B CA  1 
ATOM   4519 C  C   . GLU B 1 37  ? 100.810 63.012 101.509 1.00 38.99 ? 37   GLU B C   1 
ATOM   4520 O  O   . GLU B 1 37  ? 100.623 63.005 100.297 1.00 38.53 ? 37   GLU B O   1 
ATOM   4521 C  CB  . GLU B 1 37  ? 102.582 64.662 102.271 1.00 41.03 ? 37   GLU B CB  1 
ATOM   4522 C  CG  . GLU B 1 37  ? 103.819 64.927 103.166 1.00 42.64 ? 37   GLU B CG  1 
ATOM   4523 C  CD  . GLU B 1 37  ? 103.583 64.517 104.610 1.00 45.87 ? 37   GLU B CD  1 
ATOM   4524 O  OE1 . GLU B 1 37  ? 102.802 65.204 105.311 1.00 48.05 ? 37   GLU B OE1 1 
ATOM   4525 O  OE2 . GLU B 1 37  ? 104.173 63.501 105.042 1.00 48.89 ? 37   GLU B OE2 1 
ATOM   4526 N  N   . PRO B 1 38  ? 99.802  62.861 102.380 1.00 39.72 ? 38   PRO B N   1 
ATOM   4527 C  CA  . PRO B 1 38  ? 98.440  62.789 101.858 1.00 39.41 ? 38   PRO B CA  1 
ATOM   4528 C  C   . PRO B 1 38  ? 98.080  64.045 101.034 1.00 39.52 ? 38   PRO B C   1 
ATOM   4529 O  O   . PRO B 1 38  ? 98.004  65.133 101.594 1.00 41.31 ? 38   PRO B O   1 
ATOM   4530 C  CB  . PRO B 1 38  ? 97.584  62.716 103.137 1.00 40.72 ? 38   PRO B CB  1 
ATOM   4531 C  CG  . PRO B 1 38  ? 98.493  62.109 104.152 1.00 41.72 ? 38   PRO B CG  1 
ATOM   4532 C  CD  . PRO B 1 38  ? 99.849  62.685 103.847 1.00 40.99 ? 38   PRO B CD  1 
ATOM   4533 N  N   . PRO B 1 39  ? 97.848  63.901 99.710  1.00 38.21 ? 39   PRO B N   1 
ATOM   4534 C  CA  . PRO B 1 39  ? 97.642  65.091 98.857  1.00 37.95 ? 39   PRO B CA  1 
ATOM   4535 C  C   . PRO B 1 39  ? 96.230  65.604 98.990  1.00 39.27 ? 39   PRO B C   1 
ATOM   4536 O  O   . PRO B 1 39  ? 95.432  65.529 98.031  1.00 38.94 ? 39   PRO B O   1 
ATOM   4537 C  CB  . PRO B 1 39  ? 97.882  64.566 97.453  1.00 35.84 ? 39   PRO B CB  1 
ATOM   4538 C  CG  . PRO B 1 39  ? 97.494  63.140 97.528  1.00 35.37 ? 39   PRO B CG  1 
ATOM   4539 C  CD  . PRO B 1 39  ? 97.686  62.651 98.955  1.00 35.76 ? 39   PRO B CD  1 
ATOM   4540 N  N   . VAL B 1 40  ? 95.942  66.127 100.180 1.00 40.73 ? 40   VAL B N   1 
ATOM   4541 C  CA  . VAL B 1 40  ? 94.591  66.421 100.609 1.00 41.65 ? 40   VAL B CA  1 
ATOM   4542 C  C   . VAL B 1 40  ? 94.551  67.889 100.948 1.00 43.42 ? 40   VAL B C   1 
ATOM   4543 O  O   . VAL B 1 40  ? 95.610  68.510 101.096 1.00 44.36 ? 40   VAL B O   1 
ATOM   4544 C  CB  . VAL B 1 40  ? 94.172  65.557 101.850 1.00 42.57 ? 40   VAL B CB  1 
ATOM   4545 C  CG1 . VAL B 1 40  ? 94.243  64.067 101.544 1.00 40.22 ? 40   VAL B CG1 1 
ATOM   4546 C  CG2 . VAL B 1 40  ? 95.033  65.885 103.094 1.00 43.62 ? 40   VAL B CG2 1 
ATOM   4547 N  N   . GLY B 1 41  ? 93.346  68.445 101.060 1.00 44.11 ? 41   GLY B N   1 
ATOM   4548 C  CA  . GLY B 1 41  ? 93.158  69.858 101.423 1.00 46.33 ? 41   GLY B CA  1 
ATOM   4549 C  C   . GLY B 1 41  ? 93.721  70.813 100.381 1.00 46.48 ? 41   GLY B C   1 
ATOM   4550 O  O   . GLY B 1 41  ? 93.445  70.672 99.175  1.00 44.32 ? 41   GLY B O   1 
ATOM   4551 N  N   . ASN B 1 42  ? 94.518  71.779 100.839 1.00 48.04 ? 42   ASN B N   1 
ATOM   4552 C  CA  . ASN B 1 42  ? 95.140  72.754 99.928  1.00 49.13 ? 42   ASN B CA  1 
ATOM   4553 C  C   . ASN B 1 42  ? 96.175  72.130 98.979  1.00 47.06 ? 42   ASN B C   1 
ATOM   4554 O  O   . ASN B 1 42  ? 96.731  72.825 98.130  1.00 47.48 ? 42   ASN B O   1 
ATOM   4555 C  CB  . ASN B 1 42  ? 95.692  73.998 100.680 1.00 51.74 ? 42   ASN B CB  1 
ATOM   4556 C  CG  . ASN B 1 42  ? 96.982  73.710 101.501 1.00 54.23 ? 42   ASN B CG  1 
ATOM   4557 O  OD1 . ASN B 1 42  ? 97.432  72.554 101.637 1.00 55.62 ? 42   ASN B OD1 1 
ATOM   4558 N  ND2 . ASN B 1 42  ? 97.579  74.779 102.043 1.00 55.48 ? 42   ASN B ND2 1 
ATOM   4559 N  N   . MET B 1 43  ? 96.383  70.812 99.093  1.00 45.72 ? 43   MET B N   1 
ATOM   4560 C  CA  A MET B 1 43  ? 97.330  70.086 98.232  0.50 43.44 ? 43   MET B CA  1 
ATOM   4561 C  CA  B MET B 1 43  ? 97.326  70.109 98.222  0.50 44.16 ? 43   MET B CA  1 
ATOM   4562 C  C   . MET B 1 43  ? 96.652  69.309 97.112  1.00 41.99 ? 43   MET B C   1 
ATOM   4563 O  O   . MET B 1 43  ? 97.316  68.638 96.329  1.00 40.22 ? 43   MET B O   1 
ATOM   4564 C  CB  A MET B 1 43  ? 98.217  69.154 99.057  0.50 43.23 ? 43   MET B CB  1 
ATOM   4565 C  CB  B MET B 1 43  ? 98.260  69.230 99.043  0.50 44.31 ? 43   MET B CB  1 
ATOM   4566 C  CG  A MET B 1 43  ? 99.402  69.846 99.694  0.50 43.36 ? 43   MET B CG  1 
ATOM   4567 C  CG  B MET B 1 43  ? 99.615  69.094 98.413  0.50 46.15 ? 43   MET B CG  1 
ATOM   4568 S  SD  A MET B 1 43  ? 100.185 68.793 100.918 0.50 45.30 ? 43   MET B SD  1 
ATOM   4569 S  SD  B MET B 1 43  ? 100.903 69.340 99.618  0.50 50.53 ? 43   MET B SD  1 
ATOM   4570 C  CE  A MET B 1 43  ? 100.656 67.374 99.941  0.50 39.62 ? 43   MET B CE  1 
ATOM   4571 C  CE  B MET B 1 43  ? 100.818 71.120 99.851  0.50 51.66 ? 43   MET B CE  1 
ATOM   4572 N  N   . ARG B 1 44  ? 95.329  69.401 97.021  1.00 41.65 ? 44   ARG B N   1 
ATOM   4573 C  CA  . ARG B 1 44  ? 94.650  68.711 95.941  1.00 40.38 ? 44   ARG B CA  1 
ATOM   4574 C  C   . ARG B 1 44  ? 95.093  69.363 94.632  1.00 39.98 ? 44   ARG B C   1 
ATOM   4575 O  O   . ARG B 1 44  ? 95.121  70.595 94.516  1.00 40.86 ? 44   ARG B O   1 
ATOM   4576 C  CB  . ARG B 1 44  ? 93.119  68.764 96.105  1.00 40.64 ? 44   ARG B CB  1 
ATOM   4577 C  CG  . ARG B 1 44  ? 92.339  68.210 94.898  1.00 38.84 ? 44   ARG B CG  1 
ATOM   4578 C  CD  . ARG B 1 44  ? 90.830  68.487 95.011  1.00 38.23 ? 44   ARG B CD  1 
ATOM   4579 N  NE  . ARG B 1 44  ? 90.206  67.735 96.085  1.00 35.53 ? 44   ARG B NE  1 
ATOM   4580 C  CZ  . ARG B 1 44  ? 89.000  67.978 96.574  1.00 36.72 ? 44   ARG B CZ  1 
ATOM   4581 N  NH1 . ARG B 1 44  ? 88.261  68.977 96.108  1.00 38.69 ? 44   ARG B NH1 1 
ATOM   4582 N  NH2 . ARG B 1 44  ? 88.529  67.216 97.540  1.00 37.36 ? 44   ARG B NH2 1 
ATOM   4583 N  N   . PHE B 1 45  ? 95.450  68.521 93.667  1.00 37.78 ? 45   PHE B N   1 
ATOM   4584 C  CA  . PHE B 1 45  ? 95.927  68.947 92.338  1.00 37.67 ? 45   PHE B CA  1 
ATOM   4585 C  C   . PHE B 1 45  ? 97.410  69.286 92.296  1.00 38.73 ? 45   PHE B C   1 
ATOM   4586 O  O   . PHE B 1 45  ? 97.945  69.438 91.204  1.00 39.12 ? 45   PHE B O   1 
ATOM   4587 C  CB  . PHE B 1 45  ? 95.149  70.142 91.759  1.00 38.30 ? 45   PHE B CB  1 
ATOM   4588 C  CG  . PHE B 1 45  ? 93.656  69.982 91.755  1.00 36.98 ? 45   PHE B CG  1 
ATOM   4589 C  CD1 . PHE B 1 45  ? 93.053  68.866 91.181  1.00 34.78 ? 45   PHE B CD1 1 
ATOM   4590 C  CD2 . PHE B 1 45  ? 92.854  70.963 92.286  1.00 36.85 ? 45   PHE B CD2 1 
ATOM   4591 C  CE1 . PHE B 1 45  ? 91.676  68.722 91.163  1.00 34.69 ? 45   PHE B CE1 1 
ATOM   4592 C  CE2 . PHE B 1 45  ? 91.455  70.844 92.255  1.00 39.02 ? 45   PHE B CE2 1 
ATOM   4593 C  CZ  . PHE B 1 45  ? 90.871  69.698 91.685  1.00 36.39 ? 45   PHE B CZ  1 
ATOM   4594 N  N   . ARG B 1 46  ? 98.064  69.435 93.453  1.00 40.27 ? 46   ARG B N   1 
ATOM   4595 C  CA  . ARG B 1 46  ? 99.475  69.831 93.494  1.00 41.80 ? 46   ARG B CA  1 
ATOM   4596 C  C   . ARG B 1 46  ? 100.371 68.645 93.267  1.00 41.14 ? 46   ARG B C   1 
ATOM   4597 O  O   . ARG B 1 46  ? 99.951  67.493 93.447  1.00 39.84 ? 46   ARG B O   1 
ATOM   4598 C  CB  . ARG B 1 46  ? 99.874  70.448 94.850  1.00 43.51 ? 46   ARG B CB  1 
ATOM   4599 C  CG  . ARG B 1 46  ? 99.540  71.953 95.032  1.00 47.14 ? 46   ARG B CG  1 
ATOM   4600 C  CD  . ARG B 1 46  ? 100.313 72.587 96.217  1.00 49.80 ? 46   ARG B CD  1 
ATOM   4601 N  N   . ARG B 1 47  ? 101.616 68.949 92.892  1.00 41.89 ? 47   ARG B N   1 
ATOM   4602 C  CA  A ARG B 1 47  ? 102.675 67.951 92.822  0.50 41.18 ? 47   ARG B CA  1 
ATOM   4603 C  CA  B ARG B 1 47  ? 102.682 67.958 92.826  0.50 41.17 ? 47   ARG B CA  1 
ATOM   4604 C  C   . ARG B 1 47  ? 102.795 67.275 94.184  1.00 40.94 ? 47   ARG B C   1 
ATOM   4605 O  O   . ARG B 1 47  ? 102.642 67.928 95.215  1.00 42.83 ? 47   ARG B O   1 
ATOM   4606 C  CB  A ARG B 1 47  ? 104.013 68.598 92.444  0.50 42.16 ? 47   ARG B CB  1 
ATOM   4607 C  CB  B ARG B 1 47  ? 104.011 68.633 92.475  0.50 42.18 ? 47   ARG B CB  1 
ATOM   4608 C  CG  A ARG B 1 47  ? 104.001 69.401 91.132  0.50 44.16 ? 47   ARG B CG  1 
ATOM   4609 C  CG  B ARG B 1 47  ? 104.004 69.393 91.143  0.50 43.98 ? 47   ARG B CG  1 
ATOM   4610 C  CD  A ARG B 1 47  ? 105.399 69.928 90.799  0.50 45.81 ? 47   ARG B CD  1 
ATOM   4611 C  CD  B ARG B 1 47  ? 105.168 70.380 91.057  0.50 46.30 ? 47   ARG B CD  1 
ATOM   4612 N  NE  A ARG B 1 47  ? 105.366 71.082 89.902  0.50 47.95 ? 47   ARG B NE  1 
ATOM   4613 N  NE  B ARG B 1 47  ? 105.031 71.475 92.014  0.50 47.58 ? 47   ARG B NE  1 
ATOM   4614 C  CZ  A ARG B 1 47  ? 105.401 70.988 88.578  0.50 46.80 ? 47   ARG B CZ  1 
ATOM   4615 C  CZ  B ARG B 1 47  ? 105.538 71.464 93.244  0.50 49.13 ? 47   ARG B CZ  1 
ATOM   4616 N  NH1 A ARG B 1 47  ? 105.455 69.796 88.004  0.50 42.07 ? 47   ARG B NH1 1 
ATOM   4617 N  NH1 B ARG B 1 47  ? 106.224 70.413 93.677  0.50 48.62 ? 47   ARG B NH1 1 
ATOM   4618 N  NH2 A ARG B 1 47  ? 105.381 72.085 87.832  0.50 47.39 ? 47   ARG B NH2 1 
ATOM   4619 N  NH2 B ARG B 1 47  ? 105.362 72.510 94.042  0.50 50.89 ? 47   ARG B NH2 1 
ATOM   4620 N  N   . PRO B 1 48  ? 103.084 65.966 94.196  1.00 39.44 ? 48   PRO B N   1 
ATOM   4621 C  CA  . PRO B 1 48  ? 103.233 65.285 95.481  1.00 39.26 ? 48   PRO B CA  1 
ATOM   4622 C  C   . PRO B 1 48  ? 104.514 65.706 96.217  1.00 40.84 ? 48   PRO B C   1 
ATOM   4623 O  O   . PRO B 1 48  ? 105.483 66.172 95.602  1.00 40.74 ? 48   PRO B O   1 
ATOM   4624 C  CB  . PRO B 1 48  ? 103.323 63.813 95.080  1.00 37.18 ? 48   PRO B CB  1 
ATOM   4625 C  CG  . PRO B 1 48  ? 104.000 63.864 93.744  1.00 36.29 ? 48   PRO B CG  1 
ATOM   4626 C  CD  . PRO B 1 48  ? 103.472 65.093 93.065  1.00 37.45 ? 48   PRO B CD  1 
ATOM   4627 N  N   . GLU B 1 49  ? 104.489 65.534 97.535  1.00 42.04 ? 49   GLU B N   1 
ATOM   4628 C  CA  . GLU B 1 49  ? 105.573 65.902 98.418  1.00 43.91 ? 49   GLU B CA  1 
ATOM   4629 C  C   . GLU B 1 49  ? 106.013 64.604 99.080  1.00 42.95 ? 49   GLU B C   1 
ATOM   4630 O  O   . GLU B 1 49  ? 105.170 63.724 99.318  1.00 41.27 ? 49   GLU B O   1 
ATOM   4631 C  CB  . GLU B 1 49  ? 105.075 66.879 99.470  1.00 45.50 ? 49   GLU B CB  1 
ATOM   4632 C  CG  . GLU B 1 49  ? 106.026 68.028 99.735  1.00 52.97 ? 49   GLU B CG  1 
ATOM   4633 C  CD  . GLU B 1 49  ? 106.249 68.895 98.507  1.00 58.10 ? 49   GLU B CD  1 
ATOM   4634 O  OE1 . GLU B 1 49  ? 105.254 69.425 97.960  1.00 58.57 ? 49   GLU B OE1 1 
ATOM   4635 O  OE2 . GLU B 1 49  ? 107.426 69.039 98.096  1.00 60.79 ? 49   GLU B OE2 1 
ATOM   4636 N  N   . PRO B 1 50  ? 107.324 64.473 99.389  1.00 43.33 ? 50   PRO B N   1 
ATOM   4637 C  CA  . PRO B 1 50  ? 107.760 63.179 99.942  1.00 43.20 ? 50   PRO B CA  1 
ATOM   4638 C  C   . PRO B 1 50  ? 107.139 62.981 101.332 1.00 44.18 ? 50   PRO B C   1 
ATOM   4639 O  O   . PRO B 1 50  ? 106.897 63.969 102.044 1.00 45.53 ? 50   PRO B O   1 
ATOM   4640 C  CB  . PRO B 1 50  ? 109.295 63.303 100.014 1.00 43.55 ? 50   PRO B CB  1 
ATOM   4641 C  CG  . PRO B 1 50  ? 109.631 64.493 99.128  1.00 44.70 ? 50   PRO B CG  1 
ATOM   4642 C  CD  . PRO B 1 50  ? 108.446 65.416 99.225  1.00 44.31 ? 50   PRO B CD  1 
ATOM   4643 N  N   . LYS B 1 51  ? 106.844 61.732 101.677 1.00 43.13 ? 51   LYS B N   1 
ATOM   4644 C  CA  . LYS B 1 51  ? 106.262 61.398 102.973 1.00 44.23 ? 51   LYS B CA  1 
ATOM   4645 C  C   . LYS B 1 51  ? 107.238 61.767 104.068 1.00 46.46 ? 51   LYS B C   1 
ATOM   4646 O  O   . LYS B 1 51  ? 108.388 61.320 104.031 1.00 46.28 ? 51   LYS B O   1 
ATOM   4647 C  CB  . LYS B 1 51  ? 105.939 59.901 103.064 1.00 43.04 ? 51   LYS B CB  1 
ATOM   4648 C  CG  . LYS B 1 51  ? 105.484 59.408 104.439 1.00 42.56 ? 51   LYS B CG  1 
ATOM   4649 C  CD  . LYS B 1 51  ? 104.129 60.000 104.863 1.00 40.19 ? 51   LYS B CD  1 
ATOM   4650 C  CE  . LYS B 1 51  ? 103.643 59.405 106.184 1.00 42.13 ? 51   LYS B CE  1 
ATOM   4651 N  NZ  . LYS B 1 51  ? 102.238 59.820 106.569 1.00 43.06 ? 51   LYS B NZ  1 
ATOM   4652 N  N   . LYS B 1 52  ? 106.770 62.562 105.037 1.00 47.93 ? 52   LYS B N   1 
ATOM   4653 C  CA  . LYS B 1 52  ? 107.579 62.921 106.201 1.00 50.91 ? 52   LYS B CA  1 
ATOM   4654 C  C   . LYS B 1 52  ? 107.874 61.718 107.080 1.00 51.25 ? 52   LYS B C   1 
ATOM   4655 O  O   . LYS B 1 52  ? 106.983 60.902 107.324 1.00 50.86 ? 52   LYS B O   1 
ATOM   4656 C  CB  . LYS B 1 52  ? 106.898 64.011 107.027 1.00 52.78 ? 52   LYS B CB  1 
ATOM   4657 C  CG  . LYS B 1 52  ? 106.830 65.334 106.308 1.00 55.05 ? 52   LYS B CG  1 
ATOM   4658 C  CD  . LYS B 1 52  ? 106.245 66.397 107.199 1.00 61.06 ? 52   LYS B CD  1 
ATOM   4659 C  CE  . LYS B 1 52  ? 105.823 67.611 106.365 1.00 63.11 ? 52   LYS B CE  1 
ATOM   4660 N  NZ  . LYS B 1 52  ? 105.054 68.586 107.208 1.00 65.69 ? 52   LYS B NZ  1 
ATOM   4661 N  N   . PRO B 1 53  ? 109.133 61.589 107.540 1.00 52.34 ? 53   PRO B N   1 
ATOM   4662 C  CA  . PRO B 1 53  ? 109.462 60.523 108.477 1.00 53.14 ? 53   PRO B CA  1 
ATOM   4663 C  C   . PRO B 1 53  ? 108.516 60.488 109.688 1.00 54.18 ? 53   PRO B C   1 
ATOM   4664 O  O   . PRO B 1 53  ? 108.254 61.518 110.316 1.00 55.86 ? 53   PRO B O   1 
ATOM   4665 C  CB  . PRO B 1 53  ? 110.907 60.854 108.919 1.00 54.82 ? 53   PRO B CB  1 
ATOM   4666 C  CG  . PRO B 1 53  ? 111.285 62.147 108.199 1.00 55.47 ? 53   PRO B CG  1 
ATOM   4667 C  CD  . PRO B 1 53  ? 110.349 62.232 107.020 1.00 53.10 ? 53   PRO B CD  1 
ATOM   4668 N  N   . TRP B 1 54  ? 108.023 59.292 109.989 1.00 53.41 ? 54   TRP B N   1 
ATOM   4669 C  CA  . TRP B 1 54  ? 107.160 59.036 111.132 1.00 54.18 ? 54   TRP B CA  1 
ATOM   4670 C  C   . TRP B 1 54  ? 107.954 58.339 112.261 1.00 55.82 ? 54   TRP B C   1 
ATOM   4671 O  O   . TRP B 1 54  ? 108.934 57.628 112.008 1.00 54.88 ? 54   TRP B O   1 
ATOM   4672 C  CB  . TRP B 1 54  ? 105.966 58.161 110.699 1.00 52.31 ? 54   TRP B CB  1 
ATOM   4673 C  CG  . TRP B 1 54  ? 106.387 56.772 110.274 1.00 49.91 ? 54   TRP B CG  1 
ATOM   4674 C  CD1 . TRP B 1 54  ? 106.542 55.680 111.081 1.00 50.89 ? 54   TRP B CD1 1 
ATOM   4675 C  CD2 . TRP B 1 54  ? 106.726 56.338 108.948 1.00 47.19 ? 54   TRP B CD2 1 
ATOM   4676 N  NE1 . TRP B 1 54  ? 106.960 54.591 110.334 1.00 49.66 ? 54   TRP B NE1 1 
ATOM   4677 C  CE2 . TRP B 1 54  ? 107.068 54.968 109.024 1.00 46.42 ? 54   TRP B CE2 1 
ATOM   4678 C  CE3 . TRP B 1 54  ? 106.765 56.969 107.699 1.00 46.77 ? 54   TRP B CE3 1 
ATOM   4679 C  CZ2 . TRP B 1 54  ? 107.457 54.224 107.896 1.00 44.64 ? 54   TRP B CZ2 1 
ATOM   4680 C  CZ3 . TRP B 1 54  ? 107.139 56.216 106.572 1.00 44.15 ? 54   TRP B CZ3 1 
ATOM   4681 C  CH2 . TRP B 1 54  ? 107.483 54.863 106.686 1.00 42.91 ? 54   TRP B CH2 1 
ATOM   4682 N  N   . SER B 1 55  ? 107.513 58.540 113.498 1.00 57.49 ? 55   SER B N   1 
ATOM   4683 C  CA  . SER B 1 55  ? 108.021 57.759 114.611 1.00 59.61 ? 55   SER B CA  1 
ATOM   4684 C  C   . SER B 1 55  ? 107.261 56.425 114.731 1.00 58.84 ? 55   SER B C   1 
ATOM   4685 O  O   . SER B 1 55  ? 106.144 56.310 114.235 1.00 57.76 ? 55   SER B O   1 
ATOM   4686 C  CB  . SER B 1 55  ? 107.865 58.557 115.898 1.00 62.11 ? 55   SER B CB  1 
ATOM   4687 O  OG  . SER B 1 55  ? 109.020 58.394 116.690 1.00 65.05 ? 55   SER B OG  1 
ATOM   4688 N  N   . GLY B 1 56  ? 107.860 55.430 115.389 1.00 59.49 ? 56   GLY B N   1 
ATOM   4689 C  CA  . GLY B 1 56  ? 107.190 54.141 115.632 1.00 58.72 ? 56   GLY B CA  1 
ATOM   4690 C  C   . GLY B 1 56  ? 107.203 53.160 114.460 1.00 56.26 ? 56   GLY B C   1 
ATOM   4691 O  O   . GLY B 1 56  ? 107.921 53.340 113.477 1.00 54.77 ? 56   GLY B O   1 
ATOM   4692 N  N   . VAL B 1 57  ? 106.399 52.111 114.576 1.00 55.69 ? 57   VAL B N   1 
ATOM   4693 C  CA  . VAL B 1 57  ? 106.361 51.050 113.596 1.00 53.58 ? 57   VAL B CA  1 
ATOM   4694 C  C   . VAL B 1 57  ? 105.078 51.197 112.755 1.00 52.45 ? 57   VAL B C   1 
ATOM   4695 O  O   . VAL B 1 57  ? 103.956 51.156 113.293 1.00 52.63 ? 57   VAL B O   1 
ATOM   4696 C  CB  . VAL B 1 57  ? 106.440 49.651 114.270 1.00 54.79 ? 57   VAL B CB  1 
ATOM   4697 C  CG1 . VAL B 1 57  ? 106.400 48.557 113.234 1.00 52.61 ? 57   VAL B CG1 1 
ATOM   4698 C  CG2 . VAL B 1 57  ? 107.715 49.512 115.150 1.00 56.68 ? 57   VAL B CG2 1 
ATOM   4699 N  N   . TRP B 1 58  ? 105.253 51.392 111.446 1.00 50.18 ? 58   TRP B N   1 
ATOM   4700 C  CA  . TRP B 1 58  ? 104.111 51.498 110.546 1.00 49.19 ? 58   TRP B CA  1 
ATOM   4701 C  C   . TRP B 1 58  ? 103.538 50.108 110.346 1.00 49.61 ? 58   TRP B C   1 
ATOM   4702 O  O   . TRP B 1 58  ? 104.231 49.201 109.849 1.00 49.15 ? 58   TRP B O   1 
ATOM   4703 C  CB  . TRP B 1 58  ? 104.497 52.097 109.194 1.00 46.92 ? 58   TRP B CB  1 
ATOM   4704 C  CG  . TRP B 1 58  ? 103.306 52.453 108.383 1.00 45.44 ? 58   TRP B CG  1 
ATOM   4705 C  CD1 . TRP B 1 58  ? 102.541 51.603 107.625 1.00 44.44 ? 58   TRP B CD1 1 
ATOM   4706 C  CD2 . TRP B 1 58  ? 102.715 53.743 108.252 1.00 44.59 ? 58   TRP B CD2 1 
ATOM   4707 N  NE1 . TRP B 1 58  ? 101.517 52.291 107.019 1.00 42.41 ? 58   TRP B NE1 1 
ATOM   4708 C  CE2 . TRP B 1 58  ? 101.594 53.607 107.393 1.00 44.45 ? 58   TRP B CE2 1 
ATOM   4709 C  CE3 . TRP B 1 58  ? 103.027 55.009 108.762 1.00 46.67 ? 58   TRP B CE3 1 
ATOM   4710 C  CZ2 . TRP B 1 58  ? 100.774 54.694 107.040 1.00 43.57 ? 58   TRP B CZ2 1 
ATOM   4711 C  CZ3 . TRP B 1 58  ? 102.213 56.093 108.413 1.00 47.36 ? 58   TRP B CZ3 1 
ATOM   4712 C  CH2 . TRP B 1 58  ? 101.093 55.922 107.561 1.00 45.46 ? 58   TRP B CH2 1 
ATOM   4713 N  N   . ASN B 1 59  ? 102.288 49.932 110.756 1.00 50.39 ? 59   ASN B N   1 
ATOM   4714 C  CA  . ASN B 1 59  ? 101.601 48.690 110.518 1.00 51.15 ? 59   ASN B CA  1 
ATOM   4715 C  C   . ASN B 1 59  ? 101.318 48.549 109.011 1.00 48.46 ? 59   ASN B C   1 
ATOM   4716 O  O   . ASN B 1 59  ? 100.451 49.245 108.470 1.00 47.08 ? 59   ASN B O   1 
ATOM   4717 C  CB  . ASN B 1 59  ? 100.319 48.615 111.356 1.00 53.53 ? 59   ASN B CB  1 
ATOM   4718 C  CG  . ASN B 1 59  ? 99.709  47.236 111.338 1.00 59.08 ? 59   ASN B CG  1 
ATOM   4719 O  OD1 . ASN B 1 59  ? 100.008 46.444 110.438 1.00 58.48 ? 59   ASN B OD1 1 
ATOM   4720 N  ND2 . ASN B 1 59  ? 98.854  46.932 112.319 1.00 69.38 ? 59   ASN B ND2 1 
ATOM   4721 N  N   . ALA B 1 60  ? 102.083 47.685 108.339 1.00 46.75 ? 60   ALA B N   1 
ATOM   4722 C  CA  . ALA B 1 60  ? 101.938 47.474 106.892 1.00 45.22 ? 60   ALA B CA  1 
ATOM   4723 C  C   . ALA B 1 60  ? 101.433 46.052 106.578 1.00 45.16 ? 60   ALA B C   1 
ATOM   4724 O  O   . ALA B 1 60  ? 101.952 45.333 105.713 1.00 44.12 ? 60   ALA B O   1 
ATOM   4725 C  CB  . ALA B 1 60  ? 103.248 47.795 106.143 1.00 43.42 ? 60   ALA B CB  1 
ATOM   4726 N  N   . SER B 1 61  ? 100.387 45.676 107.298 1.00 45.93 ? 61   SER B N   1 
ATOM   4727 C  CA  . SER B 1 61  ? 99.824  44.342 107.216 1.00 46.38 ? 61   SER B CA  1 
ATOM   4728 C  C   . SER B 1 61  ? 98.509  44.330 106.440 1.00 44.77 ? 61   SER B C   1 
ATOM   4729 O  O   . SER B 1 61  ? 97.960  43.257 106.177 1.00 44.53 ? 61   SER B O   1 
ATOM   4730 C  CB  . SER B 1 61  ? 99.561  43.847 108.632 1.00 48.74 ? 61   SER B CB  1 
ATOM   4731 O  OG  . SER B 1 61  ? 98.616  44.739 109.220 1.00 50.35 ? 61   SER B OG  1 
ATOM   4732 N  N   . THR B 1 62  ? 97.978  45.510 106.112 1.00 43.09 ? 62   THR B N   1 
ATOM   4733 C  CA  . THR B 1 62  ? 96.731  45.560 105.354 1.00 42.12 ? 62   THR B CA  1 
ATOM   4734 C  C   . THR B 1 62  ? 96.799  46.524 104.169 1.00 39.84 ? 62   THR B C   1 
ATOM   4735 O  O   . THR B 1 62  ? 97.573  47.488 104.173 1.00 39.90 ? 62   THR B O   1 
ATOM   4736 C  CB  . THR B 1 62  ? 95.471  45.829 106.234 1.00 43.69 ? 62   THR B CB  1 
ATOM   4737 O  OG1 . THR B 1 62  ? 95.349  47.223 106.516 1.00 46.28 ? 62   THR B OG1 1 
ATOM   4738 C  CG2 . THR B 1 62  ? 95.503  45.058 107.548 1.00 46.08 ? 62   THR B CG2 1 
ATOM   4739 N  N   . TYR B 1 63  ? 96.009  46.229 103.137 1.00 37.86 ? 63   TYR B N   1 
ATOM   4740 C  CA  . TYR B 1 63  ? 95.916  47.076 101.962 1.00 35.53 ? 63   TYR B CA  1 
ATOM   4741 C  C   . TYR B 1 63  ? 95.434  48.490 102.333 1.00 34.80 ? 63   TYR B C   1 
ATOM   4742 O  O   . TYR B 1 63  ? 94.611  48.649 103.223 1.00 35.67 ? 63   TYR B O   1 
ATOM   4743 C  CB  . TYR B 1 63  ? 94.945  46.455 100.957 1.00 35.16 ? 63   TYR B CB  1 
ATOM   4744 C  CG  . TYR B 1 63  ? 95.534  45.492 99.955  1.00 34.29 ? 63   TYR B CG  1 
ATOM   4745 C  CD1 . TYR B 1 63  ? 96.835  45.667 99.457  1.00 34.24 ? 63   TYR B CD1 1 
ATOM   4746 C  CD2 . TYR B 1 63  ? 94.766  44.418 99.453  1.00 34.82 ? 63   TYR B CD2 1 
ATOM   4747 C  CE1 . TYR B 1 63  ? 97.362  44.803 98.497  1.00 32.63 ? 63   TYR B CE1 1 
ATOM   4748 C  CE2 . TYR B 1 63  ? 95.294  43.546 98.494  1.00 34.58 ? 63   TYR B CE2 1 
ATOM   4749 C  CZ  . TYR B 1 63  ? 96.585  43.748 98.027  1.00 33.17 ? 63   TYR B CZ  1 
ATOM   4750 O  OH  . TYR B 1 63  ? 97.112  42.918 97.079  1.00 34.08 ? 63   TYR B OH  1 
ATOM   4751 N  N   . PRO B 1 64  ? 95.965  49.518 101.655 1.00 33.44 ? 64   PRO B N   1 
ATOM   4752 C  CA  . PRO B 1 64  ? 95.566  50.902 101.918 1.00 33.07 ? 64   PRO B CA  1 
ATOM   4753 C  C   . PRO B 1 64  ? 94.275  51.238 101.184 1.00 33.07 ? 64   PRO B C   1 
ATOM   4754 O  O   . PRO B 1 64  ? 93.784  50.424 100.393 1.00 31.09 ? 64   PRO B O   1 
ATOM   4755 C  CB  . PRO B 1 64  ? 96.682  51.695 101.235 1.00 31.60 ? 64   PRO B CB  1 
ATOM   4756 C  CG  . PRO B 1 64  ? 97.037  50.833 100.050 1.00 30.79 ? 64   PRO B CG  1 
ATOM   4757 C  CD  . PRO B 1 64  ? 96.918  49.414 100.524 1.00 31.27 ? 64   PRO B CD  1 
ATOM   4758 N  N   . ASN B 1 65  ? 93.795  52.462 101.406 1.00 33.92 ? 65   ASN B N   1 
ATOM   4759 C  CA  . ASN B 1 65  ? 92.727  53.079 100.626 1.00 34.16 ? 65   ASN B CA  1 
ATOM   4760 C  C   . ASN B 1 65  ? 93.009  53.229 99.106  1.00 32.73 ? 65   ASN B C   1 
ATOM   4761 O  O   . ASN B 1 65  ? 94.174  53.394 98.682  1.00 30.51 ? 65   ASN B O   1 
ATOM   4762 C  CB  . ASN B 1 65  ? 92.457  54.468 101.189 1.00 35.37 ? 65   ASN B CB  1 
ATOM   4763 C  CG  . ASN B 1 65  ? 91.937  54.432 102.619 1.00 39.20 ? 65   ASN B CG  1 
ATOM   4764 O  OD1 . ASN B 1 65  ? 91.219  53.509 103.017 1.00 39.03 ? 65   ASN B OD1 1 
ATOM   4765 N  ND2 . ASN B 1 65  ? 92.305  55.455 103.402 1.00 42.78 ? 65   ASN B ND2 1 
ATOM   4766 N  N   . ASN B 1 66  ? 91.932  53.220 98.312  1.00 31.41 ? 66   ASN B N   1 
ATOM   4767 C  CA  . ASN B 1 66  ? 92.035  53.471 96.890  1.00 30.17 ? 66   ASN B CA  1 
ATOM   4768 C  C   . ASN B 1 66  ? 91.779  54.940 96.633  1.00 30.79 ? 66   ASN B C   1 
ATOM   4769 O  O   . ASN B 1 66  ? 91.065  55.600 97.410  1.00 31.64 ? 66   ASN B O   1 
ATOM   4770 C  CB  . ASN B 1 66  ? 91.004  52.644 96.141  1.00 30.39 ? 66   ASN B CB  1 
ATOM   4771 C  CG  . ASN B 1 66  ? 91.209  51.164 96.327  1.00 32.02 ? 66   ASN B CG  1 
ATOM   4772 O  OD1 . ASN B 1 66  ? 90.253  50.400 96.404  1.00 34.60 ? 66   ASN B OD1 1 
ATOM   4773 N  ND2 . ASN B 1 66  ? 92.479  50.751 96.424  1.00 30.98 ? 66   ASN B ND2 1 
ATOM   4774 N  N   . CYS B 1 67  ? 92.359  55.453 95.548  1.00 29.72 ? 67   CYS B N   1 
ATOM   4775 C  CA  . CYS B 1 67  ? 92.180  56.855 95.160  1.00 29.59 ? 67   CYS B CA  1 
ATOM   4776 C  C   . CYS B 1 67  ? 90.733  57.117 94.732  1.00 29.55 ? 67   CYS B C   1 
ATOM   4777 O  O   . CYS B 1 67  ? 90.020  56.182 94.306  1.00 29.45 ? 67   CYS B O   1 
ATOM   4778 C  CB  . CYS B 1 67  ? 93.160  57.194 94.039  1.00 29.04 ? 67   CYS B CB  1 
ATOM   4779 S  SG  . CYS B 1 67  ? 94.925  57.132 94.605  1.00 31.03 ? 67   CYS B SG  1 
ATOM   4780 N  N   . GLN B 1 68  ? 90.307  58.366 94.881  1.00 29.23 ? 68   GLN B N   1 
ATOM   4781 C  CA  . GLN B 1 68  ? 88.958  58.796 94.527  1.00 30.50 ? 68   GLN B CA  1 
ATOM   4782 C  C   . GLN B 1 68  ? 88.737  58.639 93.036  1.00 29.74 ? 68   GLN B C   1 
ATOM   4783 O  O   . GLN B 1 68  ? 89.580  59.039 92.230  1.00 29.35 ? 68   GLN B O   1 
ATOM   4784 C  CB  . GLN B 1 68  ? 88.699  60.236 94.997  1.00 31.11 ? 68   GLN B CB  1 
ATOM   4785 C  CG  . GLN B 1 68  ? 88.714  60.391 96.530  1.00 31.80 ? 68   GLN B CG  1 
ATOM   4786 C  CD  . GLN B 1 68  ? 87.379  60.052 97.180  1.00 36.22 ? 68   GLN B CD  1 
ATOM   4787 O  OE1 . GLN B 1 68  ? 86.470  59.574 96.521  1.00 38.48 ? 68   GLN B OE1 1 
ATOM   4788 N  NE2 . GLN B 1 68  ? 87.252  60.323 98.482  1.00 38.41 ? 68   GLN B NE2 1 
ATOM   4789 N  N   . GLN B 1 69  ? 87.642  57.991 92.658  1.00 29.69 ? 69   GLN B N   1 
ATOM   4790 C  CA  . GLN B 1 69  ? 87.465  57.679 91.259  1.00 29.15 ? 69   GLN B CA  1 
ATOM   4791 C  C   . GLN B 1 69  ? 86.036  57.335 90.925  1.00 30.23 ? 69   GLN B C   1 
ATOM   4792 O  O   . GLN B 1 69  ? 85.271  56.896 91.779  1.00 31.26 ? 69   GLN B O   1 
ATOM   4793 C  CB  . GLN B 1 69  ? 88.381  56.522 90.861  1.00 28.33 ? 69   GLN B CB  1 
ATOM   4794 C  CG  . GLN B 1 69  ? 88.013  55.140 91.422  1.00 27.56 ? 69   GLN B CG  1 
ATOM   4795 C  CD  . GLN B 1 69  ? 89.173  54.174 91.311  1.00 27.79 ? 69   GLN B CD  1 
ATOM   4796 O  OE1 . GLN B 1 69  ? 89.168  53.305 90.456  1.00 24.88 ? 69   GLN B OE1 1 
ATOM   4797 N  NE2 . GLN B 1 69  ? 90.197  54.339 92.182  1.00 25.62 ? 69   GLN B NE2 1 
ATOM   4798 N  N   . TYR B 1 70  ? 85.688  57.543 89.666  1.00 30.11 ? 70   TYR B N   1 
ATOM   4799 C  CA  . TYR B 1 70  ? 84.453  57.038 89.105  1.00 31.05 ? 70   TYR B CA  1 
ATOM   4800 C  C   . TYR B 1 70  ? 84.368  55.518 89.341  1.00 31.67 ? 70   TYR B C   1 
ATOM   4801 O  O   . TYR B 1 70  ? 85.352  54.811 89.128  1.00 29.96 ? 70   TYR B O   1 
ATOM   4802 C  CB  . TYR B 1 70  ? 84.456  57.319 87.594  1.00 30.77 ? 70   TYR B CB  1 
ATOM   4803 C  CG  . TYR B 1 70  ? 83.282  56.713 86.876  1.00 29.86 ? 70   TYR B CG  1 
ATOM   4804 C  CD1 . TYR B 1 70  ? 83.355  55.422 86.348  1.00 30.05 ? 70   TYR B CD1 1 
ATOM   4805 C  CD2 . TYR B 1 70  ? 82.126  57.422 86.708  1.00 31.57 ? 70   TYR B CD2 1 
ATOM   4806 C  CE1 . TYR B 1 70  ? 82.271  54.849 85.696  1.00 30.86 ? 70   TYR B CE1 1 
ATOM   4807 C  CE2 . TYR B 1 70  ? 81.026  56.872 86.052  1.00 33.68 ? 70   TYR B CE2 1 
ATOM   4808 C  CZ  . TYR B 1 70  ? 81.111  55.595 85.547  1.00 34.07 ? 70   TYR B CZ  1 
ATOM   4809 O  OH  . TYR B 1 70  ? 80.019  55.063 84.913  1.00 37.68 ? 70   TYR B OH  1 
ATOM   4810 N  N   . VAL B 1 71  ? 83.184  55.037 89.725  1.00 32.78 ? 71   VAL B N   1 
ATOM   4811 C  CA  . VAL B 1 71  ? 82.961  53.636 90.001  1.00 33.58 ? 71   VAL B CA  1 
ATOM   4812 C  C   . VAL B 1 71  ? 81.957  53.086 88.988  1.00 34.56 ? 71   VAL B C   1 
ATOM   4813 O  O   . VAL B 1 71  ? 80.867  53.607 88.814  1.00 34.81 ? 71   VAL B O   1 
ATOM   4814 C  CB  . VAL B 1 71  ? 82.441  53.416 91.448  1.00 34.93 ? 71   VAL B CB  1 
ATOM   4815 C  CG1 . VAL B 1 71  ? 81.955  51.961 91.656  1.00 34.78 ? 71   VAL B CG1 1 
ATOM   4816 C  CG2 . VAL B 1 71  ? 83.537  53.749 92.467  1.00 34.78 ? 71   VAL B CG2 1 
ATOM   4817 N  N   . ASP B 1 72  ? 82.320  51.992 88.339  1.00 35.23 ? 72   ASP B N   1 
ATOM   4818 C  CA  . ASP B 1 72  ? 81.482  51.469 87.280  1.00 36.44 ? 72   ASP B CA  1 
ATOM   4819 C  C   . ASP B 1 72  ? 80.361  50.609 87.830  1.00 37.40 ? 72   ASP B C   1 
ATOM   4820 O  O   . ASP B 1 72  ? 80.614  49.617 88.470  1.00 39.06 ? 72   ASP B O   1 
ATOM   4821 C  CB  . ASP B 1 72  ? 82.309  50.654 86.287  1.00 34.91 ? 72   ASP B CB  1 
ATOM   4822 C  CG  . ASP B 1 72  ? 81.431  49.901 85.316  1.00 39.14 ? 72   ASP B CG  1 
ATOM   4823 O  OD1 . ASP B 1 72  ? 80.347  50.447 84.958  1.00 39.87 ? 72   ASP B OD1 1 
ATOM   4824 O  OD2 . ASP B 1 72  ? 81.797  48.763 84.937  1.00 40.70 ? 72   ASP B OD2 1 
ATOM   4825 N  N   . GLU B 1 73  ? 79.123  50.945 87.534  1.00 38.44 ? 73   GLU B N   1 
ATOM   4826 C  CA  . GLU B 1 73  ? 78.036  50.085 87.959  1.00 40.33 ? 73   GLU B CA  1 
ATOM   4827 C  C   . GLU B 1 73  ? 76.995  49.830 86.883  1.00 40.11 ? 73   GLU B C   1 
ATOM   4828 O  O   . GLU B 1 73  ? 75.815  49.708 87.182  1.00 40.91 ? 73   GLU B O   1 
ATOM   4829 C  CB  . GLU B 1 73  ? 77.385  50.602 89.244  1.00 42.32 ? 73   GLU B CB  1 
ATOM   4830 C  CG  . GLU B 1 73  ? 77.214  52.093 89.318  1.00 45.88 ? 73   GLU B CG  1 
ATOM   4831 C  CD  . GLU B 1 73  ? 77.093  52.579 90.768  1.00 53.82 ? 73   GLU B CD  1 
ATOM   4832 O  OE1 . GLU B 1 73  ? 77.600  51.865 91.666  1.00 55.78 ? 73   GLU B OE1 1 
ATOM   4833 O  OE2 . GLU B 1 73  ? 76.497  53.669 91.006  1.00 55.66 ? 73   GLU B OE2 1 
ATOM   4834 N  N   . GLN B 1 74  ? 77.464  49.728 85.640  1.00 38.82 ? 74   GLN B N   1 
ATOM   4835 C  CA  . GLN B 1 74  ? 76.678  49.246 84.505  1.00 39.23 ? 74   GLN B CA  1 
ATOM   4836 C  C   . GLN B 1 74  ? 76.074  47.883 84.781  1.00 39.07 ? 74   GLN B C   1 
ATOM   4837 O  O   . GLN B 1 74  ? 74.904  47.652 84.473  1.00 39.11 ? 74   GLN B O   1 
ATOM   4838 C  CB  . GLN B 1 74  ? 77.558  49.087 83.257  1.00 38.77 ? 74   GLN B CB  1 
ATOM   4839 C  CG  . GLN B 1 74  ? 76.758  48.944 81.967  1.00 42.74 ? 74   GLN B CG  1 
ATOM   4840 C  CD  . GLN B 1 74  ? 76.637  50.297 81.274  1.00 49.04 ? 74   GLN B CD  1 
ATOM   4841 O  OE1 . GLN B 1 74  ? 75.980  51.222 81.787  1.00 51.78 ? 74   GLN B OE1 1 
ATOM   4842 N  NE2 . GLN B 1 74  ? 77.303  50.437 80.120  1.00 47.11 ? 74   GLN B NE2 1 
ATOM   4843 N  N   . PHE B 1 75  ? 76.887  46.993 85.360  1.00 37.72 ? 75   PHE B N   1 
ATOM   4844 C  CA  . PHE B 1 75  ? 76.485  45.610 85.592  1.00 38.59 ? 75   PHE B CA  1 
ATOM   4845 C  C   . PHE B 1 75  ? 76.607  45.217 87.079  1.00 39.62 ? 75   PHE B C   1 
ATOM   4846 O  O   . PHE B 1 75  ? 77.533  44.498 87.473  1.00 37.96 ? 75   PHE B O   1 
ATOM   4847 C  CB  . PHE B 1 75  ? 77.318  44.669 84.736  1.00 37.66 ? 75   PHE B CB  1 
ATOM   4848 C  CG  . PHE B 1 75  ? 77.305  44.989 83.267  1.00 36.64 ? 75   PHE B CG  1 
ATOM   4849 C  CD1 . PHE B 1 75  ? 76.149  44.790 82.494  1.00 38.53 ? 75   PHE B CD1 1 
ATOM   4850 C  CD2 . PHE B 1 75  ? 78.448  45.467 82.654  1.00 34.03 ? 75   PHE B CD2 1 
ATOM   4851 C  CE1 . PHE B 1 75  ? 76.163  45.074 81.127  1.00 39.59 ? 75   PHE B CE1 1 
ATOM   4852 C  CE2 . PHE B 1 75  ? 78.476  45.749 81.284  1.00 35.50 ? 75   PHE B CE2 1 
ATOM   4853 C  CZ  . PHE B 1 75  ? 77.354  45.568 80.526  1.00 36.09 ? 75   PHE B CZ  1 
ATOM   4854 N  N   . PRO B 1 76  ? 75.641  45.664 87.908  1.00 41.45 ? 76   PRO B N   1 
ATOM   4855 C  CA  . PRO B 1 76  ? 75.712  45.440 89.364  1.00 41.88 ? 76   PRO B CA  1 
ATOM   4856 C  C   . PRO B 1 76  ? 75.741  43.959 89.713  1.00 42.84 ? 76   PRO B C   1 
ATOM   4857 O  O   . PRO B 1 76  ? 74.895  43.177 89.242  1.00 43.90 ? 76   PRO B O   1 
ATOM   4858 C  CB  . PRO B 1 76  ? 74.425  46.094 89.873  1.00 44.17 ? 76   PRO B CB  1 
ATOM   4859 C  CG  . PRO B 1 76  ? 74.061  47.119 88.793  1.00 43.85 ? 76   PRO B CG  1 
ATOM   4860 C  CD  . PRO B 1 76  ? 74.434  46.425 87.522  1.00 41.94 ? 76   PRO B CD  1 
ATOM   4861 N  N   . GLY B 1 77  ? 76.732  43.566 90.510  1.00 43.02 ? 77   GLY B N   1 
ATOM   4862 C  CA  . GLY B 1 77  ? 76.871  42.161 90.931  1.00 44.48 ? 77   GLY B CA  1 
ATOM   4863 C  C   . GLY B 1 77  ? 77.676  41.317 89.940  1.00 43.97 ? 77   GLY B C   1 
ATOM   4864 O  O   . GLY B 1 77  ? 77.915  40.144 90.169  1.00 45.36 ? 77   GLY B O   1 
ATOM   4865 N  N   . PHE B 1 78  ? 78.115  41.917 88.840  1.00 41.95 ? 78   PHE B N   1 
ATOM   4866 C  CA  . PHE B 1 78  ? 78.761  41.151 87.783  1.00 40.50 ? 78   PHE B CA  1 
ATOM   4867 C  C   . PHE B 1 78  ? 80.268  41.228 87.935  1.00 38.69 ? 78   PHE B C   1 
ATOM   4868 O  O   . PHE B 1 78  ? 80.855  42.309 87.926  1.00 36.75 ? 78   PHE B O   1 
ATOM   4869 C  CB  . PHE B 1 78  ? 78.274  41.634 86.420  1.00 39.74 ? 78   PHE B CB  1 
ATOM   4870 C  CG  . PHE B 1 78  ? 78.950  40.986 85.261  1.00 38.91 ? 78   PHE B CG  1 
ATOM   4871 C  CD1 . PHE B 1 78  ? 78.737  39.626 84.977  1.00 39.29 ? 78   PHE B CD1 1 
ATOM   4872 C  CD2 . PHE B 1 78  ? 79.788  41.740 84.435  1.00 37.05 ? 78   PHE B CD2 1 
ATOM   4873 C  CE1 . PHE B 1 78  ? 79.365  39.018 83.878  1.00 39.76 ? 78   PHE B CE1 1 
ATOM   4874 C  CE2 . PHE B 1 78  ? 80.442  41.151 83.341  1.00 37.45 ? 78   PHE B CE2 1 
ATOM   4875 C  CZ  . PHE B 1 78  ? 80.220  39.779 83.048  1.00 37.20 ? 78   PHE B CZ  1 
ATOM   4876 N  N   . SER B 1 79  ? 80.893  40.071 88.112  1.00 40.15 ? 79   SER B N   1 
ATOM   4877 C  CA  . SER B 1 79  ? 82.323  40.021 88.472  1.00 39.77 ? 79   SER B CA  1 
ATOM   4878 C  C   . SER B 1 79  ? 83.252  40.530 87.389  1.00 37.97 ? 79   SER B C   1 
ATOM   4879 O  O   . SER B 1 79  ? 84.369  40.965 87.683  1.00 37.33 ? 79   SER B O   1 
ATOM   4880 C  CB  . SER B 1 79  ? 82.722  38.594 88.865  1.00 40.97 ? 79   SER B CB  1 
ATOM   4881 O  OG  . SER B 1 79  ? 82.444  37.681 87.796  1.00 44.17 ? 79   SER B OG  1 
ATOM   4882 N  N   . GLY B 1 80  ? 82.812  40.470 86.131  1.00 38.20 ? 80   GLY B N   1 
ATOM   4883 C  CA  . GLY B 1 80  ? 83.636  40.956 85.024  1.00 36.15 ? 80   GLY B CA  1 
ATOM   4884 C  C   . GLY B 1 80  ? 83.887  42.459 85.040  1.00 35.72 ? 80   GLY B C   1 
ATOM   4885 O  O   . GLY B 1 80  ? 84.954  42.907 84.634  1.00 33.71 ? 80   GLY B O   1 
ATOM   4886 N  N   . SER B 1 81  ? 82.882  43.244 85.438  1.00 36.50 ? 81   SER B N   1 
ATOM   4887 C  CA  . SER B 1 81  ? 83.066  44.695 85.612  1.00 36.99 ? 81   SER B CA  1 
ATOM   4888 C  C   . SER B 1 81  ? 83.531  45.005 87.036  1.00 37.07 ? 81   SER B C   1 
ATOM   4889 O  O   . SER B 1 81  ? 84.395  45.845 87.223  1.00 36.76 ? 81   SER B O   1 
ATOM   4890 C  CB  . SER B 1 81  ? 81.787  45.481 85.309  1.00 37.05 ? 81   SER B CB  1 
ATOM   4891 O  OG  . SER B 1 81  ? 80.673  44.890 85.958  1.00 40.94 ? 81   SER B OG  1 
ATOM   4892 N  N   . GLU B 1 82  ? 82.993  44.286 88.018  1.00 38.23 ? 82   GLU B N   1 
ATOM   4893 C  CA  . GLU B 1 82  ? 83.223  44.624 89.406  1.00 38.55 ? 82   GLU B CA  1 
ATOM   4894 C  C   . GLU B 1 82  ? 84.644  44.322 89.866  1.00 38.05 ? 82   GLU B C   1 
ATOM   4895 O  O   . GLU B 1 82  ? 85.134  44.977 90.805  1.00 37.92 ? 82   GLU B O   1 
ATOM   4896 C  CB  . GLU B 1 82  ? 82.138  44.050 90.336  1.00 40.37 ? 82   GLU B CB  1 
ATOM   4897 C  CG  . GLU B 1 82  ? 80.896  44.976 90.357  1.00 43.05 ? 82   GLU B CG  1 
ATOM   4898 C  CD  . GLU B 1 82  ? 79.716  44.442 91.140  1.00 50.36 ? 82   GLU B CD  1 
ATOM   4899 O  OE1 . GLU B 1 82  ? 79.864  43.422 91.857  1.00 54.45 ? 82   GLU B OE1 1 
ATOM   4900 O  OE2 . GLU B 1 82  ? 78.620  45.056 91.058  1.00 52.24 ? 82   GLU B OE2 1 
ATOM   4901 N  N   . MET B 1 83  ? 85.324  43.395 89.183  1.00 36.67 ? 83   MET B N   1 
ATOM   4902 C  CA  . MET B 1 83  ? 86.705  43.076 89.554  1.00 36.34 ? 83   MET B CA  1 
ATOM   4903 C  C   . MET B 1 83  ? 87.652  44.272 89.383  1.00 34.32 ? 83   MET B C   1 
ATOM   4904 O  O   . MET B 1 83  ? 88.734  44.264 89.937  1.00 34.42 ? 83   MET B O   1 
ATOM   4905 C  CB  . MET B 1 83  ? 87.236  41.828 88.814  1.00 36.35 ? 83   MET B CB  1 
ATOM   4906 C  CG  . MET B 1 83  ? 87.317  41.963 87.281  1.00 39.29 ? 83   MET B CG  1 
ATOM   4907 S  SD  . MET B 1 83  ? 88.081  40.485 86.547  1.00 44.49 ? 83   MET B SD  1 
ATOM   4908 C  CE  . MET B 1 83  ? 89.791  40.939 86.530  1.00 40.79 ? 83   MET B CE  1 
ATOM   4909 N  N   . TRP B 1 84  ? 87.235  45.296 88.644  1.00 33.06 ? 84   TRP B N   1 
ATOM   4910 C  CA  . TRP B 1 84  ? 88.092  46.444 88.321  1.00 31.72 ? 84   TRP B CA  1 
ATOM   4911 C  C   . TRP B 1 84  ? 87.809  47.641 89.233  1.00 31.83 ? 84   TRP B C   1 
ATOM   4912 O  O   . TRP B 1 84  ? 88.616  48.552 89.341  1.00 31.71 ? 84   TRP B O   1 
ATOM   4913 C  CB  . TRP B 1 84  ? 87.975  46.815 86.819  1.00 30.87 ? 84   TRP B CB  1 
ATOM   4914 C  CG  . TRP B 1 84  ? 88.263  45.623 85.868  1.00 32.26 ? 84   TRP B CG  1 
ATOM   4915 C  CD1 . TRP B 1 84  ? 87.342  44.897 85.134  1.00 34.68 ? 84   TRP B CD1 1 
ATOM   4916 C  CD2 . TRP B 1 84  ? 89.547  45.030 85.577  1.00 30.00 ? 84   TRP B CD2 1 
ATOM   4917 N  NE1 . TRP B 1 84  ? 87.980  43.899 84.418  1.00 33.16 ? 84   TRP B NE1 1 
ATOM   4918 C  CE2 . TRP B 1 84  ? 89.327  43.965 84.664  1.00 29.93 ? 84   TRP B CE2 1 
ATOM   4919 C  CE3 . TRP B 1 84  ? 90.865  45.315 85.983  1.00 30.35 ? 84   TRP B CE3 1 
ATOM   4920 C  CZ2 . TRP B 1 84  ? 90.380  43.181 84.145  1.00 30.32 ? 84   TRP B CZ2 1 
ATOM   4921 C  CZ3 . TRP B 1 84  ? 91.915  44.527 85.489  1.00 31.08 ? 84   TRP B CZ3 1 
ATOM   4922 C  CH2 . TRP B 1 84  ? 91.659  43.455 84.579  1.00 29.57 ? 84   TRP B CH2 1 
ATOM   4923 N  N   . ASN B 1 85  ? 86.664  47.628 89.909  1.00 32.70 ? 85   ASN B N   1 
ATOM   4924 C  CA  . ASN B 1 85  ? 86.295  48.685 90.835  1.00 32.63 ? 85   ASN B CA  1 
ATOM   4925 C  C   . ASN B 1 85  ? 87.113  48.643 92.153  1.00 32.10 ? 85   ASN B C   1 
ATOM   4926 O  O   . ASN B 1 85  ? 87.604  47.600 92.524  1.00 31.88 ? 85   ASN B O   1 
ATOM   4927 C  CB  . ASN B 1 85  ? 84.807  48.555 91.186  1.00 34.69 ? 85   ASN B CB  1 
ATOM   4928 C  CG  . ASN B 1 85  ? 83.878  48.940 90.024  1.00 36.79 ? 85   ASN B CG  1 
ATOM   4929 O  OD1 . ASN B 1 85  ? 84.151  49.900 89.273  1.00 37.93 ? 85   ASN B OD1 1 
ATOM   4930 N  ND2 . ASN B 1 85  ? 82.753  48.210 89.897  1.00 34.73 ? 85   ASN B ND2 1 
ATOM   4931 N  N   . PRO B 1 86  ? 87.231  49.785 92.862  1.00 31.35 ? 86   PRO B N   1 
ATOM   4932 C  CA  . PRO B 1 86  ? 87.907  49.780 94.164  1.00 32.12 ? 86   PRO B CA  1 
ATOM   4933 C  C   . PRO B 1 86  ? 87.304  48.724 95.092  1.00 33.33 ? 86   PRO B C   1 
ATOM   4934 O  O   . PRO B 1 86  ? 86.077  48.592 95.163  1.00 34.20 ? 86   PRO B O   1 
ATOM   4935 C  CB  . PRO B 1 86  ? 87.631  51.177 94.724  1.00 32.01 ? 86   PRO B CB  1 
ATOM   4936 C  CG  . PRO B 1 86  ? 87.383  52.015 93.488  1.00 32.41 ? 86   PRO B CG  1 
ATOM   4937 C  CD  . PRO B 1 86  ? 86.724  51.119 92.495  1.00 30.06 ? 86   PRO B CD  1 
ATOM   4938 N  N   . ASN B 1 87  ? 88.168  47.953 95.742  1.00 33.10 ? 87   ASN B N   1 
ATOM   4939 C  CA  . ASN B 1 87  ? 87.743  46.980 96.734  1.00 35.46 ? 87   ASN B CA  1 
ATOM   4940 C  C   . ASN B 1 87  ? 88.095  47.502 98.103  1.00 36.62 ? 87   ASN B C   1 
ATOM   4941 O  O   . ASN B 1 87  ? 88.009  46.761 99.094  1.00 38.30 ? 87   ASN B O   1 
ATOM   4942 C  CB  . ASN B 1 87  ? 88.391  45.583 96.505  1.00 35.53 ? 87   ASN B CB  1 
ATOM   4943 C  CG  . ASN B 1 87  ? 89.933  45.638 96.416  1.00 35.30 ? 87   ASN B CG  1 
ATOM   4944 O  OD1 . ASN B 1 87  ? 90.528  46.711 96.332  1.00 33.29 ? 87   ASN B OD1 1 
ATOM   4945 N  ND2 . ASN B 1 87  ? 90.572  44.462 96.416  1.00 36.61 ? 87   ASN B ND2 1 
ATOM   4946 N  N   . ARG B 1 88  ? 88.545  48.757 98.155  1.00 36.09 ? 88   ARG B N   1 
ATOM   4947 C  CA  . ARG B 1 88  ? 88.750  49.416 99.444  1.00 38.53 ? 88   ARG B CA  1 
ATOM   4948 C  C   . ARG B 1 88  ? 87.972  50.676 99.495  1.00 38.65 ? 88   ARG B C   1 
ATOM   4949 O  O   . ARG B 1 88  ? 87.473  51.167 98.475  1.00 37.99 ? 88   ARG B O   1 
ATOM   4950 C  CB  . ARG B 1 88  ? 90.219  49.780 99.708  1.00 38.06 ? 88   ARG B CB  1 
ATOM   4951 C  CG  . ARG B 1 88  ? 91.119  48.616 99.836  1.00 39.77 ? 88   ARG B CG  1 
ATOM   4952 C  CD  . ARG B 1 88  ? 90.895  47.993 101.171 1.00 46.75 ? 88   ARG B CD  1 
ATOM   4953 N  NE  . ARG B 1 88  ? 90.912  46.559 100.997 1.00 51.57 ? 88   ARG B NE  1 
ATOM   4954 C  CZ  . ARG B 1 88  ? 91.305  45.707 101.923 1.00 55.62 ? 88   ARG B CZ  1 
ATOM   4955 N  NH1 . ARG B 1 88  ? 91.716  46.164 103.101 1.00 57.79 ? 88   ARG B NH1 1 
ATOM   4956 N  NH2 . ARG B 1 88  ? 91.293  44.401 101.656 1.00 57.02 ? 88   ARG B NH2 1 
ATOM   4957 N  N   . GLU B 1 89  ? 87.918  51.228 100.689 1.00 40.40 ? 89   GLU B N   1 
ATOM   4958 C  CA  . GLU B 1 89  ? 87.391  52.553 100.840 1.00 42.03 ? 89   GLU B CA  1 
ATOM   4959 C  C   . GLU B 1 89  ? 88.227  53.483 99.971  1.00 39.51 ? 89   GLU B C   1 
ATOM   4960 O  O   . GLU B 1 89  ? 89.457  53.354 99.894  1.00 38.76 ? 89   GLU B O   1 
ATOM   4961 C  CB  . GLU B 1 89  ? 87.446  53.002 102.295 1.00 44.24 ? 89   GLU B CB  1 
ATOM   4962 C  CG  . GLU B 1 89  ? 86.713  54.300 102.508 1.00 49.92 ? 89   GLU B CG  1 
ATOM   4963 C  CD  . GLU B 1 89  ? 86.386  54.550 103.953 1.00 59.42 ? 89   GLU B CD  1 
ATOM   4964 O  OE1 . GLU B 1 89  ? 86.055  53.573 104.681 1.00 64.32 ? 89   GLU B OE1 1 
ATOM   4965 O  OE2 . GLU B 1 89  ? 86.458  55.734 104.357 1.00 61.59 ? 89   GLU B OE2 1 
ATOM   4966 N  N   . MET B 1 90  ? 87.534  54.400 99.306  1.00 38.53 ? 90   MET B N   1 
ATOM   4967 C  CA  . MET B 1 90  ? 88.165  55.434 98.516  1.00 36.53 ? 90   MET B CA  1 
ATOM   4968 C  C   . MET B 1 90  ? 88.511  56.617 99.392  1.00 37.19 ? 90   MET B C   1 
ATOM   4969 O  O   . MET B 1 90  ? 87.747  56.997 100.268 1.00 38.12 ? 90   MET B O   1 
ATOM   4970 C  CB  . MET B 1 90  ? 87.246  55.866 97.377  1.00 36.47 ? 90   MET B CB  1 
ATOM   4971 C  CG  . MET B 1 90  ? 87.281  54.918 96.191  1.00 33.61 ? 90   MET B CG  1 
ATOM   4972 S  SD  . MET B 1 90  ? 86.211  55.465 94.861  1.00 36.10 ? 90   MET B SD  1 
ATOM   4973 C  CE  . MET B 1 90  ? 84.581  55.639 95.591  1.00 33.46 ? 90   MET B CE  1 
ATOM   4974 N  N   . SER B 1 91  ? 89.687  57.182 99.170  1.00 36.17 ? 91   SER B N   1 
ATOM   4975 C  CA  . SER B 1 91  ? 90.086  58.391 99.881  1.00 37.17 ? 91   SER B CA  1 
ATOM   4976 C  C   . SER B 1 91  ? 91.070  59.197 99.016  1.00 36.29 ? 91   SER B C   1 
ATOM   4977 O  O   . SER B 1 91  ? 91.770  58.641 98.169  1.00 34.96 ? 91   SER B O   1 
ATOM   4978 C  CB  . SER B 1 91  ? 90.702  58.002 101.229 1.00 37.68 ? 91   SER B CB  1 
ATOM   4979 O  OG  . SER B 1 91  ? 91.277  59.107 101.894 1.00 39.18 ? 91   SER B OG  1 
ATOM   4980 N  N   . GLU B 1 92  ? 91.117  60.506 99.207  1.00 36.63 ? 92   GLU B N   1 
ATOM   4981 C  CA  . GLU B 1 92  ? 92.208  61.283 98.625  1.00 36.27 ? 92   GLU B CA  1 
ATOM   4982 C  C   . GLU B 1 92  ? 93.533  60.912 99.308  1.00 36.29 ? 92   GLU B C   1 
ATOM   4983 O  O   . GLU B 1 92  ? 94.591  61.027 98.717  1.00 36.05 ? 92   GLU B O   1 
ATOM   4984 C  CB  . GLU B 1 92  ? 91.939  62.795 98.750  1.00 37.30 ? 92   GLU B CB  1 
ATOM   4985 C  CG  . GLU B 1 92  ? 90.928  63.346 97.756  1.00 37.91 ? 92   GLU B CG  1 
ATOM   4986 C  CD  . GLU B 1 92  ? 90.874  64.871 97.791  1.00 43.72 ? 92   GLU B CD  1 
ATOM   4987 O  OE1 . GLU B 1 92  ? 90.108  65.438 98.615  1.00 43.63 ? 92   GLU B OE1 1 
ATOM   4988 O  OE2 . GLU B 1 92  ? 91.607  65.504 96.998  1.00 42.85 ? 92   GLU B OE2 1 
ATOM   4989 N  N   . ASP B 1 93  ? 93.478  60.457 100.553 1.00 37.63 ? 93   ASP B N   1 
ATOM   4990 C  CA  . ASP B 1 93  ? 94.670  59.971 101.235 1.00 38.06 ? 93   ASP B CA  1 
ATOM   4991 C  C   . ASP B 1 93  ? 94.961  58.556 100.704 1.00 36.42 ? 93   ASP B C   1 
ATOM   4992 O  O   . ASP B 1 93  ? 94.557  57.578 101.298 1.00 37.24 ? 93   ASP B O   1 
ATOM   4993 C  CB  . ASP B 1 93  ? 94.440  60.002 102.763 1.00 39.77 ? 93   ASP B CB  1 
ATOM   4994 C  CG  . ASP B 1 93  ? 95.650  59.518 103.570 1.00 40.88 ? 93   ASP B CG  1 
ATOM   4995 O  OD1 . ASP B 1 93  ? 96.690  59.181 102.967 1.00 43.56 ? 93   ASP B OD1 1 
ATOM   4996 O  OD2 . ASP B 1 93  ? 95.570  59.484 104.822 1.00 43.58 ? 93   ASP B OD2 1 
ATOM   4997 N  N   . CYS B 1 94  ? 95.679  58.463 99.584  1.00 35.71 ? 94   CYS B N   1 
ATOM   4998 C  CA  . CYS B 1 94  ? 95.777  57.210 98.814  1.00 34.02 ? 94   CYS B CA  1 
ATOM   4999 C  C   . CYS B 1 94  ? 97.142  56.860 98.224  1.00 32.38 ? 94   CYS B C   1 
ATOM   5000 O  O   . CYS B 1 94  ? 97.261  55.868 97.485  1.00 30.69 ? 94   CYS B O   1 
ATOM   5001 C  CB  . CYS B 1 94  ? 94.720  57.197 97.681  1.00 33.79 ? 94   CYS B CB  1 
ATOM   5002 S  SG  . CYS B 1 94  ? 94.967  58.347 96.287  1.00 36.16 ? 94   CYS B SG  1 
ATOM   5003 N  N   . LEU B 1 95  ? 98.175  57.637 98.547  1.00 32.92 ? 95   LEU B N   1 
ATOM   5004 C  CA  . LEU B 1 95  ? 99.490  57.421 97.916  1.00 32.29 ? 95   LEU B CA  1 
ATOM   5005 C  C   . LEU B 1 95  ? 100.352 56.414 98.692  1.00 33.08 ? 95   LEU B C   1 
ATOM   5006 O  O   . LEU B 1 95  ? 101.186 56.794 99.515  1.00 34.12 ? 95   LEU B O   1 
ATOM   5007 C  CB  . LEU B 1 95  ? 100.234 58.727 97.691  1.00 32.34 ? 95   LEU B CB  1 
ATOM   5008 C  CG  . LEU B 1 95  ? 99.513  59.689 96.735  1.00 32.04 ? 95   LEU B CG  1 
ATOM   5009 C  CD1 . LEU B 1 95  ? 100.389 60.921 96.464  1.00 29.05 ? 95   LEU B CD1 1 
ATOM   5010 C  CD2 . LEU B 1 95  ? 99.096  58.976 95.442  1.00 26.71 ? 95   LEU B CD2 1 
ATOM   5011 N  N   . TYR B 1 96  ? 100.134 55.130 98.411  1.00 31.68 ? 96   TYR B N   1 
ATOM   5012 C  CA  . TYR B 1 96  ? 100.744 54.074 99.175  1.00 31.97 ? 96   TYR B CA  1 
ATOM   5013 C  C   . TYR B 1 96  ? 101.295 53.057 98.204  1.00 30.27 ? 96   TYR B C   1 
ATOM   5014 O  O   . TYR B 1 96  ? 100.891 53.025 97.047  1.00 29.04 ? 96   TYR B O   1 
ATOM   5015 C  CB  . TYR B 1 96  ? 99.712  53.428 100.108 1.00 33.27 ? 96   TYR B CB  1 
ATOM   5016 C  CG  . TYR B 1 96  ? 99.217  54.363 101.184 1.00 35.13 ? 96   TYR B CG  1 
ATOM   5017 C  CD1 . TYR B 1 96  ? 99.927  54.529 102.370 1.00 36.65 ? 96   TYR B CD1 1 
ATOM   5018 C  CD2 . TYR B 1 96  ? 98.047  55.096 101.012 1.00 36.39 ? 96   TYR B CD2 1 
ATOM   5019 C  CE1 . TYR B 1 96  ? 99.482  55.417 103.360 1.00 38.39 ? 96   TYR B CE1 1 
ATOM   5020 C  CE2 . TYR B 1 96  ? 97.596  55.990 101.993 1.00 37.14 ? 96   TYR B CE2 1 
ATOM   5021 C  CZ  . TYR B 1 96  ? 98.321  56.138 103.163 1.00 38.96 ? 96   TYR B CZ  1 
ATOM   5022 O  OH  . TYR B 1 96  ? 97.888  57.018 104.128 1.00 42.34 ? 96   TYR B OH  1 
ATOM   5023 N  N   . LEU B 1 97  ? 102.232 52.234 98.650  1.00 29.81 ? 97   LEU B N   1 
ATOM   5024 C  CA  . LEU B 1 97  ? 102.716 51.175 97.769  1.00 27.99 ? 97   LEU B CA  1 
ATOM   5025 C  C   . LEU B 1 97  ? 102.720 49.868 98.536  1.00 28.67 ? 97   LEU B C   1 
ATOM   5026 O  O   . LEU B 1 97  ? 102.689 49.875 99.774  1.00 30.19 ? 97   LEU B O   1 
ATOM   5027 C  CB  . LEU B 1 97  ? 104.082 51.541 97.147  1.00 26.60 ? 97   LEU B CB  1 
ATOM   5028 C  CG  . LEU B 1 97  ? 105.283 51.896 98.038  1.00 27.27 ? 97   LEU B CG  1 
ATOM   5029 C  CD1 . LEU B 1 97  ? 105.923 50.638 98.651  1.00 25.84 ? 97   LEU B CD1 1 
ATOM   5030 C  CD2 . LEU B 1 97  ? 106.340 52.680 97.254  1.00 28.28 ? 97   LEU B CD2 1 
ATOM   5031 N  N   . ASN B 1 98  ? 102.753 48.754 97.805  1.00 28.63 ? 98   ASN B N   1 
ATOM   5032 C  CA  . ASN B 1 98  ? 102.704 47.424 98.386  1.00 29.82 ? 98   ASN B CA  1 
ATOM   5033 C  C   . ASN B 1 98  ? 103.892 46.630 97.920  1.00 30.70 ? 98   ASN B C   1 
ATOM   5034 O  O   . ASN B 1 98  ? 104.305 46.759 96.747  1.00 31.28 ? 98   ASN B O   1 
ATOM   5035 C  CB  . ASN B 1 98  ? 101.444 46.678 97.949  1.00 29.46 ? 98   ASN B CB  1 
ATOM   5036 C  CG  . ASN B 1 98  ? 100.200 47.444 98.208  1.00 28.46 ? 98   ASN B CG  1 
ATOM   5037 O  OD1 . ASN B 1 98  ? 99.855  47.713 99.344  1.00 31.78 ? 98   ASN B OD1 1 
ATOM   5038 N  ND2 . ASN B 1 98  ? 99.491  47.794 97.144  1.00 28.96 ? 98   ASN B ND2 1 
ATOM   5039 N  N   . ILE B 1 99  ? 104.427 45.781 98.799  1.00 31.07 ? 99   ILE B N   1 
ATOM   5040 C  CA  . ILE B 1 99  ? 105.620 45.017 98.445  1.00 31.38 ? 99   ILE B CA  1 
ATOM   5041 C  C   . ILE B 1 99  ? 105.509 43.553 98.863  1.00 33.15 ? 99   ILE B C   1 
ATOM   5042 O  O   . ILE B 1 99  ? 105.194 43.248 100.012 1.00 34.73 ? 99   ILE B O   1 
ATOM   5043 C  CB  . ILE B 1 99  ? 106.902 45.586 99.081  1.00 31.52 ? 99   ILE B CB  1 
ATOM   5044 C  CG1 . ILE B 1 99  ? 106.888 47.133 99.100  1.00 30.97 ? 99   ILE B CG1 1 
ATOM   5045 C  CG2 . ILE B 1 99  ? 108.137 44.972 98.381  1.00 31.06 ? 99   ILE B CG2 1 
ATOM   5046 C  CD1 . ILE B 1 99  ? 108.207 47.805 99.500  1.00 30.38 ? 99   ILE B CD1 1 
ATOM   5047 N  N   . TRP B 1 100 ? 105.779 42.658 97.925  1.00 33.29 ? 100  TRP B N   1 
ATOM   5048 C  CA  . TRP B 1 100 ? 105.913 41.233 98.231  1.00 34.61 ? 100  TRP B CA  1 
ATOM   5049 C  C   . TRP B 1 100 ? 107.378 40.825 98.080  1.00 35.08 ? 100  TRP B C   1 
ATOM   5050 O  O   . TRP B 1 100 ? 107.995 41.075 97.034  1.00 34.72 ? 100  TRP B O   1 
ATOM   5051 C  CB  . TRP B 1 100 ? 105.025 40.411 97.292  1.00 34.21 ? 100  TRP B CB  1 
ATOM   5052 C  CG  . TRP B 1 100 ? 103.514 40.589 97.545  1.00 34.85 ? 100  TRP B CG  1 
ATOM   5053 C  CD1 . TRP B 1 100 ? 102.718 39.804 98.340  1.00 35.83 ? 100  TRP B CD1 1 
ATOM   5054 C  CD2 . TRP B 1 100 ? 102.665 41.598 97.007  1.00 32.87 ? 100  TRP B CD2 1 
ATOM   5055 N  NE1 . TRP B 1 100 ? 101.427 40.263 98.328  1.00 36.48 ? 100  TRP B NE1 1 
ATOM   5056 C  CE2 . TRP B 1 100 ? 101.360 41.357 97.507  1.00 35.11 ? 100  TRP B CE2 1 
ATOM   5057 C  CE3 . TRP B 1 100 ? 102.872 42.681 96.143  1.00 33.75 ? 100  TRP B CE3 1 
ATOM   5058 C  CZ2 . TRP B 1 100 ? 100.264 42.146 97.162  1.00 33.60 ? 100  TRP B CZ2 1 
ATOM   5059 C  CZ3 . TRP B 1 100 ? 101.779 43.473 95.805  1.00 34.86 ? 100  TRP B CZ3 1 
ATOM   5060 C  CH2 . TRP B 1 100 ? 100.487 43.198 96.318  1.00 32.98 ? 100  TRP B CH2 1 
ATOM   5061 N  N   . VAL B 1 101 ? 107.930 40.218 99.135  1.00 36.76 ? 101  VAL B N   1 
ATOM   5062 C  CA  . VAL B 1 101 ? 109.326 39.829 99.202  1.00 36.65 ? 101  VAL B CA  1 
ATOM   5063 C  C   . VAL B 1 101 ? 109.416 38.329 99.516  1.00 38.34 ? 101  VAL B C   1 
ATOM   5064 O  O   . VAL B 1 101 ? 108.825 37.868 100.499 1.00 40.05 ? 101  VAL B O   1 
ATOM   5065 C  CB  . VAL B 1 101 ? 110.064 40.619 100.322 1.00 38.23 ? 101  VAL B CB  1 
ATOM   5066 C  CG1 . VAL B 1 101 ? 111.558 40.194 100.430 1.00 37.73 ? 101  VAL B CG1 1 
ATOM   5067 C  CG2 . VAL B 1 101 ? 109.918 42.134 100.135 1.00 35.00 ? 101  VAL B CG2 1 
ATOM   5068 N  N   . PRO B 1 102 ? 110.151 37.558 98.695  1.00 38.04 ? 102  PRO B N   1 
ATOM   5069 C  CA  . PRO B 1 102 ? 110.380 36.145 99.001  1.00 40.32 ? 102  PRO B CA  1 
ATOM   5070 C  C   . PRO B 1 102 ? 110.872 35.876 100.429 1.00 42.71 ? 102  PRO B C   1 
ATOM   5071 O  O   . PRO B 1 102 ? 111.534 36.708 101.044 1.00 42.27 ? 102  PRO B O   1 
ATOM   5072 C  CB  . PRO B 1 102 ? 111.447 35.741 97.970  1.00 40.00 ? 102  PRO B CB  1 
ATOM   5073 C  CG  . PRO B 1 102 ? 111.028 36.562 96.772  1.00 37.70 ? 102  PRO B CG  1 
ATOM   5074 C  CD  . PRO B 1 102 ? 110.687 37.909 97.368  1.00 36.57 ? 102  PRO B CD  1 
ATOM   5075 N  N   . SER B 1 103 ? 110.484 34.726 100.958 1.00 45.63 ? 103  SER B N   1 
ATOM   5076 C  CA  . SER B 1 103 ? 110.983 34.261 102.235 1.00 48.75 ? 103  SER B CA  1 
ATOM   5077 C  C   . SER B 1 103 ? 111.739 32.987 101.975 1.00 51.20 ? 103  SER B C   1 
ATOM   5078 O  O   . SER B 1 103 ? 111.176 32.055 101.396 1.00 52.50 ? 103  SER B O   1 
ATOM   5079 C  CB  . SER B 1 103 ? 109.843 33.992 103.193 1.00 49.54 ? 103  SER B CB  1 
ATOM   5080 O  OG  . SER B 1 103 ? 110.348 33.496 104.408 1.00 52.93 ? 103  SER B OG  1 
ATOM   5081 N  N   . PRO B 1 104 ? 113.009 32.924 102.411 1.00 53.12 ? 104  PRO B N   1 
ATOM   5082 C  CA  . PRO B 1 104 ? 113.696 33.981 103.156 1.00 53.67 ? 104  PRO B CA  1 
ATOM   5083 C  C   . PRO B 1 104 ? 114.028 35.184 102.284 1.00 51.86 ? 104  PRO B C   1 
ATOM   5084 O  O   . PRO B 1 104 ? 114.091 35.054 101.067 1.00 51.23 ? 104  PRO B O   1 
ATOM   5085 C  CB  . PRO B 1 104 ? 114.988 33.302 103.618 1.00 55.70 ? 104  PRO B CB  1 
ATOM   5086 C  CG  . PRO B 1 104 ? 114.702 31.811 103.491 1.00 57.06 ? 104  PRO B CG  1 
ATOM   5087 C  CD  . PRO B 1 104 ? 113.848 31.726 102.281 1.00 54.65 ? 104  PRO B CD  1 
ATOM   5088 N  N   . ARG B 1 105 ? 114.223 36.342 102.907 1.00 51.97 ? 105  ARG B N   1 
ATOM   5089 C  CA  . ARG B 1 105 ? 114.669 37.529 102.196 1.00 50.85 ? 105  ARG B CA  1 
ATOM   5090 C  C   . ARG B 1 105 ? 115.933 37.270 101.360 1.00 51.61 ? 105  ARG B C   1 
ATOM   5091 O  O   . ARG B 1 105 ? 116.973 36.817 101.880 1.00 53.13 ? 105  ARG B O   1 
ATOM   5092 C  CB  . ARG B 1 105 ? 114.903 38.696 103.148 1.00 51.04 ? 105  ARG B CB  1 
ATOM   5093 C  CG  . ARG B 1 105 ? 115.116 40.045 102.432 1.00 48.90 ? 105  ARG B CG  1 
ATOM   5094 C  CD  . ARG B 1 105 ? 115.463 41.132 103.427 1.00 48.86 ? 105  ARG B CD  1 
ATOM   5095 N  NE  . ARG B 1 105 ? 114.374 41.354 104.367 1.00 47.27 ? 105  ARG B NE  1 
ATOM   5096 C  CZ  . ARG B 1 105 ? 114.504 41.961 105.537 1.00 48.14 ? 105  ARG B CZ  1 
ATOM   5097 N  NH1 . ARG B 1 105 ? 115.693 42.386 105.943 1.00 48.35 ? 105  ARG B NH1 1 
ATOM   5098 N  NH2 . ARG B 1 105 ? 113.442 42.112 106.311 1.00 46.91 ? 105  ARG B NH2 1 
ATOM   5099 N  N   . PRO B 1 106 ? 115.830 37.554 100.053 1.00 50.41 ? 106  PRO B N   1 
ATOM   5100 C  CA  . PRO B 1 106 ? 116.926 37.476 99.092  1.00 50.88 ? 106  PRO B CA  1 
ATOM   5101 C  C   . PRO B 1 106 ? 117.914 38.600 99.350  1.00 51.48 ? 106  PRO B C   1 
ATOM   5102 O  O   . PRO B 1 106 ? 117.562 39.555 100.048 1.00 51.25 ? 106  PRO B O   1 
ATOM   5103 C  CB  . PRO B 1 106 ? 116.219 37.676 97.757  1.00 48.91 ? 106  PRO B CB  1 
ATOM   5104 C  CG  . PRO B 1 106 ? 114.999 38.451 98.097  1.00 47.86 ? 106  PRO B CG  1 
ATOM   5105 C  CD  . PRO B 1 106 ? 114.567 37.978 99.425  1.00 48.28 ? 106  PRO B CD  1 
ATOM   5106 N  N   . LYS B 1 107 ? 119.127 38.500 98.801  1.00 52.61 ? 107  LYS B N   1 
ATOM   5107 C  CA  . LYS B 1 107 ? 120.151 39.530 99.062  1.00 53.91 ? 107  LYS B CA  1 
ATOM   5108 C  C   . LYS B 1 107 ? 119.960 40.800 98.252  1.00 52.62 ? 107  LYS B C   1 
ATOM   5109 O  O   . LYS B 1 107 ? 119.820 41.904 98.832  1.00 53.08 ? 107  LYS B O   1 
ATOM   5110 C  CB  . LYS B 1 107 ? 121.587 39.010 98.910  1.00 55.24 ? 107  LYS B CB  1 
ATOM   5111 C  CG  . LYS B 1 107 ? 122.156 38.496 100.221 1.00 58.45 ? 107  LYS B CG  1 
ATOM   5112 C  CD  . LYS B 1 107 ? 123.617 38.893 100.436 1.00 59.68 ? 107  LYS B CD  1 
ATOM   5113 C  CE  . LYS B 1 107 ? 124.035 38.562 101.860 1.00 61.86 ? 107  LYS B CE  1 
ATOM   5114 N  NZ  . LYS B 1 107 ? 125.439 38.977 102.193 1.00 65.03 ? 107  LYS B NZ  1 
ATOM   5115 N  N   . SER B 1 108 ? 119.942 40.660 96.928  1.00 51.06 ? 108  SER B N   1 
ATOM   5116 C  CA  . SER B 1 108 ? 119.939 41.838 96.087  1.00 49.89 ? 108  SER B CA  1 
ATOM   5117 C  C   . SER B 1 108 ? 119.237 41.464 94.783  1.00 48.10 ? 108  SER B C   1 
ATOM   5118 O  O   . SER B 1 108 ? 119.865 41.359 93.722  1.00 48.06 ? 108  SER B O   1 
ATOM   5119 C  CB  . SER B 1 108 ? 121.388 42.297 95.858  1.00 51.07 ? 108  SER B CB  1 
ATOM   5120 O  OG  . SER B 1 108 ? 121.441 43.602 95.324  1.00 52.45 ? 108  SER B OG  1 
ATOM   5121 N  N   . THR B 1 109 ? 117.932 41.230 94.857  1.00 46.01 ? 109  THR B N   1 
ATOM   5122 C  CA  . THR B 1 109 ? 117.300 40.577 93.732  1.00 45.19 ? 109  THR B CA  1 
ATOM   5123 C  C   . THR B 1 109 ? 116.519 41.527 92.828  1.00 41.97 ? 109  THR B C   1 
ATOM   5124 O  O   . THR B 1 109 ? 116.278 42.689 93.164  1.00 41.42 ? 109  THR B O   1 
ATOM   5125 C  CB  . THR B 1 109 ? 116.450 39.344 94.136  1.00 46.26 ? 109  THR B CB  1 
ATOM   5126 O  OG1 . THR B 1 109 ? 116.162 38.582 92.950  1.00 50.00 ? 109  THR B OG1 1 
ATOM   5127 C  CG2 . THR B 1 109 ? 115.135 39.767 94.764  1.00 45.81 ? 109  THR B CG2 1 
ATOM   5128 N  N   . THR B 1 110 ? 116.149 41.004 91.666  1.00 39.13 ? 110  THR B N   1 
ATOM   5129 C  CA  . THR B 1 110 ? 115.373 41.730 90.672  1.00 35.12 ? 110  THR B CA  1 
ATOM   5130 C  C   . THR B 1 110 ? 114.071 42.269 91.250  1.00 32.34 ? 110  THR B C   1 
ATOM   5131 O  O   . THR B 1 110 ? 113.385 41.586 92.016  1.00 30.24 ? 110  THR B O   1 
ATOM   5132 C  CB  . THR B 1 110 ? 115.185 40.821 89.434  1.00 35.04 ? 110  THR B CB  1 
ATOM   5133 O  OG1 . THR B 1 110 ? 116.478 40.661 88.834  1.00 38.64 ? 110  THR B OG1 1 
ATOM   5134 C  CG2 . THR B 1 110 ? 114.246 41.406 88.408  1.00 33.23 ? 110  THR B CG2 1 
ATOM   5135 N  N   . VAL B 1 111 ? 113.751 43.509 90.857  1.00 30.47 ? 111  VAL B N   1 
ATOM   5136 C  CA  . VAL B 1 111 ? 112.539 44.191 91.294  1.00 28.38 ? 111  VAL B CA  1 
ATOM   5137 C  C   . VAL B 1 111 ? 111.616 44.423 90.108  1.00 28.17 ? 111  VAL B C   1 
ATOM   5138 O  O   . VAL B 1 111 ? 112.067 44.823 89.037  1.00 27.79 ? 111  VAL B O   1 
ATOM   5139 C  CB  . VAL B 1 111 ? 112.886 45.527 91.985  1.00 28.41 ? 111  VAL B CB  1 
ATOM   5140 C  CG1 . VAL B 1 111 ? 111.640 46.264 92.491  1.00 26.41 ? 111  VAL B CG1 1 
ATOM   5141 C  CG2 . VAL B 1 111 ? 113.833 45.271 93.148  1.00 28.58 ? 111  VAL B CG2 1 
ATOM   5142 N  N   . MET B 1 112 ? 110.315 44.168 90.296  1.00 28.33 ? 112  MET B N   1 
ATOM   5143 C  CA  . MET B 1 112 ? 109.302 44.598 89.328  1.00 26.94 ? 112  MET B CA  1 
ATOM   5144 C  C   . MET B 1 112 ? 108.287 45.459 90.032  1.00 26.97 ? 112  MET B C   1 
ATOM   5145 O  O   . MET B 1 112 ? 107.863 45.163 91.152  1.00 28.09 ? 112  MET B O   1 
ATOM   5146 C  CB  . MET B 1 112 ? 108.617 43.396 88.662  1.00 27.54 ? 112  MET B CB  1 
ATOM   5147 C  CG  . MET B 1 112 ? 109.625 42.389 88.032  1.00 27.80 ? 112  MET B CG  1 
ATOM   5148 S  SD  . MET B 1 112 ? 108.860 40.917 87.358  1.00 30.94 ? 112  MET B SD  1 
ATOM   5149 C  CE  . MET B 1 112 ? 108.016 41.586 85.912  1.00 31.55 ? 112  MET B CE  1 
ATOM   5150 N  N   . VAL B 1 113 ? 107.892 46.531 89.363  1.00 26.14 ? 113  VAL B N   1 
ATOM   5151 C  CA  . VAL B 1 113 ? 107.000 47.515 89.912  1.00 26.18 ? 113  VAL B CA  1 
ATOM   5152 C  C   . VAL B 1 113 ? 105.820 47.686 88.969  1.00 25.89 ? 113  VAL B C   1 
ATOM   5153 O  O   . VAL B 1 113 ? 106.002 48.055 87.808  1.00 25.84 ? 113  VAL B O   1 
ATOM   5154 C  CB  . VAL B 1 113 ? 107.711 48.874 90.074  1.00 26.21 ? 113  VAL B CB  1 
ATOM   5155 C  CG1 . VAL B 1 113 ? 106.741 49.978 90.526  1.00 26.69 ? 113  VAL B CG1 1 
ATOM   5156 C  CG2 . VAL B 1 113 ? 108.865 48.755 91.054  1.00 27.03 ? 113  VAL B CG2 1 
ATOM   5157 N  N   . TRP B 1 114 ? 104.628 47.433 89.499  1.00 25.37 ? 114  TRP B N   1 
ATOM   5158 C  CA  . TRP B 1 114 ? 103.384 47.407 88.729  1.00 24.87 ? 114  TRP B CA  1 
ATOM   5159 C  C   . TRP B 1 114 ? 102.701 48.771 88.783  1.00 23.74 ? 114  TRP B C   1 
ATOM   5160 O  O   . TRP B 1 114 ? 102.562 49.349 89.853  1.00 23.09 ? 114  TRP B O   1 
ATOM   5161 C  CB  . TRP B 1 114 ? 102.428 46.354 89.307  1.00 24.09 ? 114  TRP B CB  1 
ATOM   5162 C  CG  . TRP B 1 114 ? 101.088 46.262 88.578  1.00 25.06 ? 114  TRP B CG  1 
ATOM   5163 C  CD1 . TRP B 1 114 ? 99.854  46.576 89.091  1.00 24.92 ? 114  TRP B CD1 1 
ATOM   5164 C  CD2 . TRP B 1 114 ? 100.854 45.833 87.219  1.00 22.92 ? 114  TRP B CD2 1 
ATOM   5165 N  NE1 . TRP B 1 114 ? 98.882  46.386 88.132  1.00 25.55 ? 114  TRP B NE1 1 
ATOM   5166 C  CE2 . TRP B 1 114 ? 99.472  45.912 86.985  1.00 23.74 ? 114  TRP B CE2 1 
ATOM   5167 C  CE3 . TRP B 1 114 ? 101.683 45.396 86.185  1.00 26.97 ? 114  TRP B CE3 1 
ATOM   5168 C  CZ2 . TRP B 1 114 ? 98.889  45.544 85.761  1.00 24.37 ? 114  TRP B CZ2 1 
ATOM   5169 C  CZ3 . TRP B 1 114 ? 101.107 45.032 84.970  1.00 27.78 ? 114  TRP B CZ3 1 
ATOM   5170 C  CH2 . TRP B 1 114 ? 99.712  45.124 84.767  1.00 24.67 ? 114  TRP B CH2 1 
ATOM   5171 N  N   . ILE B 1 115 ? 102.274 49.251 87.624  1.00 22.88 ? 115  ILE B N   1 
ATOM   5172 C  CA  . ILE B 1 115 ? 101.523 50.483 87.533  1.00 22.72 ? 115  ILE B CA  1 
ATOM   5173 C  C   . ILE B 1 115 ? 100.161 50.105 86.941  1.00 22.59 ? 115  ILE B C   1 
ATOM   5174 O  O   . ILE B 1 115 ? 100.093 49.733 85.774  1.00 21.82 ? 115  ILE B O   1 
ATOM   5175 C  CB  . ILE B 1 115 ? 102.248 51.510 86.647  1.00 22.17 ? 115  ILE B CB  1 
ATOM   5176 C  CG1 . ILE B 1 115 ? 103.647 51.834 87.217  1.00 22.01 ? 115  ILE B CG1 1 
ATOM   5177 C  CG2 . ILE B 1 115 ? 101.438 52.812 86.580  1.00 24.70 ? 115  ILE B CG2 1 
ATOM   5178 C  CD1 . ILE B 1 115 ? 104.578 52.663 86.261  1.00 16.57 ? 115  ILE B CD1 1 
ATOM   5179 N  N   . TYR B 1 116 ? 99.087  50.172 87.739  1.00 22.47 ? 116  TYR B N   1 
ATOM   5180 C  CA  . TYR B 1 116 ? 97.761  49.821 87.234  1.00 22.98 ? 116  TYR B CA  1 
ATOM   5181 C  C   . TYR B 1 116 ? 97.244  50.701 86.105  1.00 23.24 ? 116  TYR B C   1 
ATOM   5182 O  O   . TYR B 1 116 ? 97.596  51.880 86.021  1.00 22.88 ? 116  TYR B O   1 
ATOM   5183 C  CB  . TYR B 1 116 ? 96.718  49.791 88.365  1.00 23.56 ? 116  TYR B CB  1 
ATOM   5184 C  CG  . TYR B 1 116 ? 96.581  51.077 89.205  1.00 24.22 ? 116  TYR B CG  1 
ATOM   5185 C  CD1 . TYR B 1 116 ? 95.991  52.243 88.686  1.00 24.06 ? 116  TYR B CD1 1 
ATOM   5186 C  CD2 . TYR B 1 116 ? 97.013  51.098 90.528  1.00 24.10 ? 116  TYR B CD2 1 
ATOM   5187 C  CE1 . TYR B 1 116 ? 95.852  53.429 89.478  1.00 22.62 ? 116  TYR B CE1 1 
ATOM   5188 C  CE2 . TYR B 1 116 ? 96.866  52.234 91.320  1.00 24.17 ? 116  TYR B CE2 1 
ATOM   5189 C  CZ  . TYR B 1 116 ? 96.294  53.393 90.795  1.00 24.83 ? 116  TYR B CZ  1 
ATOM   5190 O  OH  . TYR B 1 116 ? 96.184  54.483 91.615  1.00 25.61 ? 116  TYR B OH  1 
ATOM   5191 N  N   . GLY B 1 117 ? 96.359  50.146 85.261  1.00 23.96 ? 117  GLY B N   1 
ATOM   5192 C  CA  . GLY B 1 117 ? 95.648  50.963 84.271  1.00 22.59 ? 117  GLY B CA  1 
ATOM   5193 C  C   . GLY B 1 117 ? 94.284  51.420 84.750  1.00 23.57 ? 117  GLY B C   1 
ATOM   5194 O  O   . GLY B 1 117 ? 94.058  51.545 85.957  1.00 24.80 ? 117  GLY B O   1 
ATOM   5195 N  N   . GLY B 1 118 ? 93.362  51.690 83.820  1.00 23.70 ? 118  GLY B N   1 
ATOM   5196 C  CA  . GLY B 1 118 ? 92.084  52.330 84.177  1.00 23.88 ? 118  GLY B CA  1 
ATOM   5197 C  C   . GLY B 1 118 ? 91.938  53.718 83.567  1.00 23.92 ? 118  GLY B C   1 
ATOM   5198 O  O   . GLY B 1 118 ? 91.279  54.572 84.140  1.00 25.16 ? 118  GLY B O   1 
ATOM   5199 N  N   . GLY B 1 119 ? 92.562  53.947 82.417  1.00 23.08 ? 119  GLY B N   1 
ATOM   5200 C  CA  . GLY B 1 119 ? 92.266  55.117 81.587  1.00 22.96 ? 119  GLY B CA  1 
ATOM   5201 C  C   . GLY B 1 119 ? 92.677  56.440 82.211  1.00 23.90 ? 119  GLY B C   1 
ATOM   5202 O  O   . GLY B 1 119 ? 92.264  57.479 81.740  1.00 25.66 ? 119  GLY B O   1 
ATOM   5203 N  N   . PHE B 1 120 ? 93.522  56.401 83.248  1.00 23.49 ? 120  PHE B N   1 
ATOM   5204 C  CA  . PHE B 1 120 ? 93.897  57.549 84.046  1.00 23.81 ? 120  PHE B CA  1 
ATOM   5205 C  C   . PHE B 1 120 ? 92.715  58.166 84.825  1.00 24.30 ? 120  PHE B C   1 
ATOM   5206 O  O   . PHE B 1 120 ? 92.877  59.257 85.420  1.00 26.21 ? 120  PHE B O   1 
ATOM   5207 C  CB  . PHE B 1 120 ? 94.541  58.638 83.156  1.00 24.02 ? 120  PHE B CB  1 
ATOM   5208 C  CG  . PHE B 1 120 ? 95.852  58.232 82.530  1.00 23.53 ? 120  PHE B CG  1 
ATOM   5209 C  CD1 . PHE B 1 120 ? 97.013  58.126 83.305  1.00 22.42 ? 120  PHE B CD1 1 
ATOM   5210 C  CD2 . PHE B 1 120 ? 95.929  57.988 81.152  1.00 22.36 ? 120  PHE B CD2 1 
ATOM   5211 C  CE1 . PHE B 1 120 ? 98.262  57.757 82.696  1.00 25.97 ? 120  PHE B CE1 1 
ATOM   5212 C  CE2 . PHE B 1 120 ? 97.167  57.625 80.525  1.00 24.62 ? 120  PHE B CE2 1 
ATOM   5213 C  CZ  . PHE B 1 120 ? 98.337  57.509 81.309  1.00 23.27 ? 120  PHE B CZ  1 
ATOM   5214 N  N   . TYR B 1 121 ? 91.542  57.524 84.800  1.00 23.32 ? 121  TYR B N   1 
ATOM   5215 C  CA  . TYR B 1 121 ? 90.370  57.995 85.574  1.00 23.72 ? 121  TYR B CA  1 
ATOM   5216 C  C   . TYR B 1 121 ? 89.962  57.031 86.723  1.00 24.57 ? 121  TYR B C   1 
ATOM   5217 O  O   . TYR B 1 121 ? 89.025  57.312 87.505  1.00 24.95 ? 121  TYR B O   1 
ATOM   5218 C  CB  . TYR B 1 121 ? 89.184  58.232 84.629  1.00 24.66 ? 121  TYR B CB  1 
ATOM   5219 C  CG  . TYR B 1 121 ? 88.486  56.949 84.154  1.00 26.59 ? 121  TYR B CG  1 
ATOM   5220 C  CD1 . TYR B 1 121 ? 87.420  56.397 84.877  1.00 29.29 ? 121  TYR B CD1 1 
ATOM   5221 C  CD2 . TYR B 1 121 ? 88.897  56.295 83.009  1.00 26.57 ? 121  TYR B CD2 1 
ATOM   5222 C  CE1 . TYR B 1 121 ? 86.799  55.219 84.484  1.00 30.35 ? 121  TYR B CE1 1 
ATOM   5223 C  CE2 . TYR B 1 121 ? 88.280  55.084 82.600  1.00 29.78 ? 121  TYR B CE2 1 
ATOM   5224 C  CZ  . TYR B 1 121 ? 87.238  54.578 83.340  1.00 31.73 ? 121  TYR B CZ  1 
ATOM   5225 O  OH  . TYR B 1 121 ? 86.615  53.445 82.920  1.00 35.84 ? 121  TYR B OH  1 
ATOM   5226 N  N   . SER B 1 122 ? 90.644  55.890 86.808  1.00 23.68 ? 122  SER B N   1 
ATOM   5227 C  CA  . SER B 1 122 ? 90.273  54.819 87.737  1.00 25.46 ? 122  SER B CA  1 
ATOM   5228 C  C   . SER B 1 122 ? 91.438  53.847 87.912  1.00 25.00 ? 122  SER B C   1 
ATOM   5229 O  O   . SER B 1 122 ? 92.460  53.960 87.230  1.00 25.29 ? 122  SER B O   1 
ATOM   5230 C  CB  . SER B 1 122 ? 89.075  54.031 87.201  1.00 25.45 ? 122  SER B CB  1 
ATOM   5231 O  OG  . SER B 1 122 ? 89.509  53.231 86.115  1.00 26.13 ? 122  SER B OG  1 
ATOM   5232 N  N   . GLY B 1 123 ? 91.266  52.886 88.804  1.00 26.07 ? 123  GLY B N   1 
ATOM   5233 C  CA  . GLY B 1 123 ? 92.308  51.888 89.074  1.00 27.18 ? 123  GLY B CA  1 
ATOM   5234 C  C   . GLY B 1 123 ? 92.708  51.863 90.546  1.00 28.51 ? 123  GLY B C   1 
ATOM   5235 O  O   . GLY B 1 123 ? 92.528  52.848 91.258  1.00 29.36 ? 123  GLY B O   1 
ATOM   5236 N  N   . SER B 1 124 ? 93.286  50.746 90.983  1.00 29.18 ? 124  SER B N   1 
ATOM   5237 C  CA  . SER B 1 124 ? 93.629  50.487 92.386  1.00 30.27 ? 124  SER B CA  1 
ATOM   5238 C  C   . SER B 1 124 ? 94.749  49.486 92.414  1.00 29.78 ? 124  SER B C   1 
ATOM   5239 O  O   . SER B 1 124 ? 94.789  48.614 91.548  1.00 28.97 ? 124  SER B O   1 
ATOM   5240 C  CB  . SER B 1 124 ? 92.452  49.834 93.103  1.00 31.09 ? 124  SER B CB  1 
ATOM   5241 O  OG  . SER B 1 124 ? 91.374  50.721 93.215  1.00 31.91 ? 124  SER B OG  1 
ATOM   5242 N  N   . SER B 1 125 ? 95.635  49.581 93.408  1.00 30.24 ? 125  SER B N   1 
ATOM   5243 C  CA  . SER B 1 125 ? 96.763  48.643 93.479  1.00 31.03 ? 125  SER B CA  1 
ATOM   5244 C  C   . SER B 1 125 ? 96.337  47.357 94.178  1.00 32.32 ? 125  SER B C   1 
ATOM   5245 O  O   . SER B 1 125 ? 97.099  46.395 94.238  1.00 33.02 ? 125  SER B O   1 
ATOM   5246 C  CB  . SER B 1 125 ? 97.955  49.265 94.190  1.00 30.11 ? 125  SER B CB  1 
ATOM   5247 O  OG  . SER B 1 125 ? 97.549  49.694 95.482  1.00 31.85 ? 125  SER B OG  1 
ATOM   5248 N  N   . THR B 1 126 ? 95.097  47.355 94.671  1.00 33.69 ? 126  THR B N   1 
ATOM   5249 C  CA  . THR B 1 126 ? 94.610  46.379 95.645  1.00 34.51 ? 126  THR B CA  1 
ATOM   5250 C  C   . THR B 1 126 ? 93.678  45.289 95.050  1.00 34.75 ? 126  THR B C   1 
ATOM   5251 O  O   . THR B 1 126 ? 93.275  44.360 95.751  1.00 35.56 ? 126  THR B O   1 
ATOM   5252 C  CB  . THR B 1 126 ? 93.917  47.117 96.821  1.00 35.73 ? 126  THR B CB  1 
ATOM   5253 O  OG1 . THR B 1 126 ? 92.881  47.958 96.305  1.00 35.53 ? 126  THR B OG1 1 
ATOM   5254 C  CG2 . THR B 1 126 ? 94.910  48.033 97.542  1.00 34.85 ? 126  THR B CG2 1 
ATOM   5255 N  N   . LEU B 1 127 ? 93.402  45.359 93.749  1.00 33.15 ? 127  LEU B N   1 
ATOM   5256 C  CA  . LEU B 1 127 ? 92.521  44.375 93.107  1.00 32.84 ? 127  LEU B CA  1 
ATOM   5257 C  C   . LEU B 1 127 ? 93.059  42.981 93.274  1.00 33.13 ? 127  LEU B C   1 
ATOM   5258 O  O   . LEU B 1 127 ? 94.265  42.818 93.368  1.00 32.20 ? 127  LEU B O   1 
ATOM   5259 C  CB  . LEU B 1 127 ? 92.388  44.674 91.610  1.00 31.13 ? 127  LEU B CB  1 
ATOM   5260 C  CG  . LEU B 1 127 ? 92.040  46.083 91.155  1.00 30.95 ? 127  LEU B CG  1 
ATOM   5261 C  CD1 . LEU B 1 127 ? 91.782  46.040 89.641  1.00 29.47 ? 127  LEU B CD1 1 
ATOM   5262 C  CD2 . LEU B 1 127 ? 90.813  46.623 91.896  1.00 29.33 ? 127  LEU B CD2 1 
ATOM   5263 N  N   . ASP B 1 128 ? 92.161  41.986 93.283  1.00 35.32 ? 128  ASP B N   1 
ATOM   5264 C  CA  . ASP B 1 128 ? 92.521  40.549 93.375  1.00 37.18 ? 128  ASP B CA  1 
ATOM   5265 C  C   . ASP B 1 128 ? 93.495  40.162 92.289  1.00 36.80 ? 128  ASP B C   1 
ATOM   5266 O  O   . ASP B 1 128 ? 94.457  39.441 92.549  1.00 37.39 ? 128  ASP B O   1 
ATOM   5267 C  CB  . ASP B 1 128 ? 91.296  39.643 93.201  1.00 38.46 ? 128  ASP B CB  1 
ATOM   5268 C  CG  . ASP B 1 128 ? 90.430  39.570 94.430  1.00 42.74 ? 128  ASP B CG  1 
ATOM   5269 O  OD1 . ASP B 1 128 ? 90.752  40.186 95.472  1.00 45.40 ? 128  ASP B OD1 1 
ATOM   5270 O  OD2 . ASP B 1 128 ? 89.402  38.867 94.357  1.00 48.60 ? 128  ASP B OD2 1 
ATOM   5271 N  N   . VAL B 1 129 ? 93.222  40.634 91.069  1.00 35.36 ? 129  VAL B N   1 
ATOM   5272 C  CA  . VAL B 1 129 ? 94.014  40.298 89.899  1.00 34.72 ? 129  VAL B CA  1 
ATOM   5273 C  C   . VAL B 1 129 ? 95.466  40.836 89.943  1.00 34.91 ? 129  VAL B C   1 
ATOM   5274 O  O   . VAL B 1 129 ? 96.355  40.273 89.280  1.00 35.52 ? 129  VAL B O   1 
ATOM   5275 C  CB  . VAL B 1 129 ? 93.248  40.689 88.570  1.00 35.02 ? 129  VAL B CB  1 
ATOM   5276 C  CG1 . VAL B 1 129 ? 93.155  42.236 88.350  1.00 31.07 ? 129  VAL B CG1 1 
ATOM   5277 C  CG2 . VAL B 1 129 ? 93.837  39.993 87.382  1.00 34.74 ? 129  VAL B CG2 1 
ATOM   5278 N  N   . TYR B 1 130 ? 95.716  41.897 90.731  1.00 34.10 ? 130  TYR B N   1 
ATOM   5279 C  CA  . TYR B 1 130 ? 97.079  42.399 90.953  1.00 32.57 ? 130  TYR B CA  1 
ATOM   5280 C  C   . TYR B 1 130 ? 97.747  41.837 92.204  1.00 33.36 ? 130  TYR B C   1 
ATOM   5281 O  O   . TYR B 1 130 ? 98.757  42.366 92.675  1.00 33.66 ? 130  TYR B O   1 
ATOM   5282 C  CB  . TYR B 1 130 ? 97.092  43.934 91.087  1.00 31.44 ? 130  TYR B CB  1 
ATOM   5283 C  CG  . TYR B 1 130 ? 96.409  44.688 89.973  1.00 30.54 ? 130  TYR B CG  1 
ATOM   5284 C  CD1 . TYR B 1 130 ? 96.314  44.150 88.688  1.00 27.61 ? 130  TYR B CD1 1 
ATOM   5285 C  CD2 . TYR B 1 130 ? 95.892  45.980 90.200  1.00 28.14 ? 130  TYR B CD2 1 
ATOM   5286 C  CE1 . TYR B 1 130 ? 95.688  44.855 87.674  1.00 28.34 ? 130  TYR B CE1 1 
ATOM   5287 C  CE2 . TYR B 1 130 ? 95.279  46.691 89.199  1.00 26.39 ? 130  TYR B CE2 1 
ATOM   5288 C  CZ  . TYR B 1 130 ? 95.181  46.139 87.940  1.00 26.11 ? 130  TYR B CZ  1 
ATOM   5289 O  OH  . TYR B 1 130 ? 94.568  46.850 86.949  1.00 22.96 ? 130  TYR B OH  1 
ATOM   5290 N  N   . ASN B 1 131 ? 97.191  40.796 92.787  1.00 34.66 ? 131  ASN B N   1 
ATOM   5291 C  CA  . ASN B 1 131 ? 97.827  40.224 93.976  1.00 35.57 ? 131  ASN B CA  1 
ATOM   5292 C  C   . ASN B 1 131 ? 99.276  39.797 93.645  1.00 35.27 ? 131  ASN B C   1 
ATOM   5293 O  O   . ASN B 1 131 ? 99.487  38.912 92.794  1.00 36.24 ? 131  ASN B O   1 
ATOM   5294 C  CB  . ASN B 1 131 ? 97.015  39.026 94.458  1.00 36.67 ? 131  ASN B CB  1 
ATOM   5295 C  CG  . ASN B 1 131 ? 97.391  38.611 95.826  1.00 38.95 ? 131  ASN B CG  1 
ATOM   5296 O  OD1 . ASN B 1 131 ? 98.521  38.850 96.277  1.00 38.66 ? 131  ASN B OD1 1 
ATOM   5297 N  ND2 . ASN B 1 131 ? 96.447  37.988 96.529  1.00 40.77 ? 131  ASN B ND2 1 
ATOM   5298 N  N   . GLY B 1 132 ? 100.271 40.395 94.290  1.00 34.03 ? 132  GLY B N   1 
ATOM   5299 C  CA  . GLY B 1 132 ? 101.662 40.175 93.848  1.00 33.86 ? 132  GLY B CA  1 
ATOM   5300 C  C   . GLY B 1 132 ? 102.301 38.852 94.293  1.00 35.41 ? 132  GLY B C   1 
ATOM   5301 O  O   . GLY B 1 132 ? 103.399 38.492 93.852  1.00 35.61 ? 132  GLY B O   1 
ATOM   5302 N  N   . LYS B 1 133 ? 101.622 38.126 95.170  1.00 35.64 ? 133  LYS B N   1 
ATOM   5303 C  CA  . LYS B 1 133 ? 102.259 37.021 95.873  1.00 37.28 ? 133  LYS B CA  1 
ATOM   5304 C  C   . LYS B 1 133 ? 102.627 35.837 94.976  1.00 37.38 ? 133  LYS B C   1 
ATOM   5305 O  O   . LYS B 1 133 ? 103.616 35.155 95.253  1.00 37.81 ? 133  LYS B O   1 
ATOM   5306 C  CB  . LYS B 1 133 ? 101.398 36.524 97.054  1.00 38.26 ? 133  LYS B CB  1 
ATOM   5307 C  CG  . LYS B 1 133 ? 100.196 35.665 96.687  1.00 37.76 ? 133  LYS B CG  1 
ATOM   5308 C  CD  . LYS B 1 133 ? 99.401  35.389 97.965  1.00 39.96 ? 133  LYS B CD  1 
ATOM   5309 C  CE  . LYS B 1 133 ? 98.198  34.443 97.737  1.00 39.03 ? 133  LYS B CE  1 
ATOM   5310 N  NZ  . LYS B 1 133 ? 97.444  34.136 99.001  1.00 35.01 ? 133  LYS B NZ  1 
ATOM   5311 N  N   . TYR B 1 134 ? 101.841 35.597 93.925  1.00 35.94 ? 134  TYR B N   1 
ATOM   5312 C  CA  . TYR B 1 134 ? 102.116 34.475 93.039  1.00 36.64 ? 134  TYR B CA  1 
ATOM   5313 C  C   . TYR B 1 134 ? 103.391 34.664 92.214  1.00 36.10 ? 134  TYR B C   1 
ATOM   5314 O  O   . TYR B 1 134 ? 104.206 33.746 92.102  1.00 37.13 ? 134  TYR B O   1 
ATOM   5315 C  CB  . TYR B 1 134 ? 100.897 34.174 92.174  1.00 35.89 ? 134  TYR B CB  1 
ATOM   5316 C  CG  . TYR B 1 134 ? 99.670  33.941 93.035  1.00 37.44 ? 134  TYR B CG  1 
ATOM   5317 C  CD1 . TYR B 1 134 ? 99.537  32.758 93.796  1.00 38.43 ? 134  TYR B CD1 1 
ATOM   5318 C  CD2 . TYR B 1 134 ? 98.661  34.906 93.119  1.00 35.33 ? 134  TYR B CD2 1 
ATOM   5319 C  CE1 . TYR B 1 134 ? 98.418  32.550 94.612  1.00 39.76 ? 134  TYR B CE1 1 
ATOM   5320 C  CE2 . TYR B 1 134 ? 97.537  34.709 93.914  1.00 38.61 ? 134  TYR B CE2 1 
ATOM   5321 C  CZ  . TYR B 1 134 ? 97.420  33.522 94.647  1.00 41.36 ? 134  TYR B CZ  1 
ATOM   5322 O  OH  . TYR B 1 134 ? 96.330  33.349 95.441  1.00 42.22 ? 134  TYR B OH  1 
ATOM   5323 N  N   . LEU B 1 135 ? 103.587 35.879 91.716  1.00 35.19 ? 135  LEU B N   1 
ATOM   5324 C  CA  . LEU B 1 135 ? 104.705 36.200 90.845  1.00 35.00 ? 135  LEU B CA  1 
ATOM   5325 C  C   . LEU B 1 135 ? 105.960 36.319 91.680  1.00 35.74 ? 135  LEU B C   1 
ATOM   5326 O  O   . LEU B 1 135 ? 106.983 35.697 91.358  1.00 37.58 ? 135  LEU B O   1 
ATOM   5327 C  CB  . LEU B 1 135 ? 104.407 37.492 90.062  1.00 32.84 ? 135  LEU B CB  1 
ATOM   5328 C  CG  . LEU B 1 135 ? 105.474 38.074 89.128  1.00 32.37 ? 135  LEU B CG  1 
ATOM   5329 C  CD1 . LEU B 1 135 ? 106.020 37.048 88.087  1.00 28.36 ? 135  LEU B CD1 1 
ATOM   5330 C  CD2 . LEU B 1 135 ? 104.926 39.325 88.431  1.00 25.34 ? 135  LEU B CD2 1 
ATOM   5331 N  N   . ALA B 1 136 ? 105.888 37.071 92.775  1.00 35.27 ? 136  ALA B N   1 
ATOM   5332 C  CA  . ALA B 1 136 ? 107.045 37.179 93.671  1.00 35.97 ? 136  ALA B CA  1 
ATOM   5333 C  C   . ALA B 1 136 ? 107.556 35.805 94.174  1.00 37.13 ? 136  ALA B C   1 
ATOM   5334 O  O   . ALA B 1 136 ? 108.764 35.544 94.129  1.00 36.97 ? 136  ALA B O   1 
ATOM   5335 C  CB  . ALA B 1 136 ? 106.748 38.122 94.828  1.00 36.29 ? 136  ALA B CB  1 
ATOM   5336 N  N   . TYR B 1 137 ? 106.634 34.929 94.590  1.00 37.44 ? 137  TYR B N   1 
ATOM   5337 C  CA  . TYR B 1 137 ? 106.976 33.578 95.093  1.00 38.81 ? 137  TYR B CA  1 
ATOM   5338 C  C   . TYR B 1 137 ? 107.588 32.714 94.014  1.00 38.92 ? 137  TYR B C   1 
ATOM   5339 O  O   . TYR B 1 137 ? 108.714 32.248 94.165  1.00 38.96 ? 137  TYR B O   1 
ATOM   5340 C  CB  . TYR B 1 137 ? 105.766 32.854 95.697  1.00 39.50 ? 137  TYR B CB  1 
ATOM   5341 C  CG  . TYR B 1 137 ? 106.019 31.382 95.969  1.00 43.84 ? 137  TYR B CG  1 
ATOM   5342 C  CD1 . TYR B 1 137 ? 106.849 30.979 97.017  1.00 45.81 ? 137  TYR B CD1 1 
ATOM   5343 C  CD2 . TYR B 1 137 ? 105.440 30.382 95.171  1.00 45.16 ? 137  TYR B CD2 1 
ATOM   5344 C  CE1 . TYR B 1 137 ? 107.107 29.618 97.258  1.00 48.26 ? 137  TYR B CE1 1 
ATOM   5345 C  CE2 . TYR B 1 137 ? 105.687 29.006 95.421  1.00 46.83 ? 137  TYR B CE2 1 
ATOM   5346 C  CZ  . TYR B 1 137 ? 106.520 28.650 96.461  1.00 49.16 ? 137  TYR B CZ  1 
ATOM   5347 O  OH  . TYR B 1 137 ? 106.775 27.326 96.719  1.00 51.81 ? 137  TYR B OH  1 
ATOM   5348 N  N   . THR B 1 138 ? 106.832 32.526 92.926  1.00 38.49 ? 138  THR B N   1 
ATOM   5349 C  CA  . THR B 1 138 ? 107.183 31.635 91.823  1.00 38.19 ? 138  THR B CA  1 
ATOM   5350 C  C   . THR B 1 138 ? 108.454 32.070 91.099  1.00 37.68 ? 138  THR B C   1 
ATOM   5351 O  O   . THR B 1 138 ? 109.255 31.227 90.697  1.00 38.42 ? 138  THR B O   1 
ATOM   5352 C  CB  . THR B 1 138 ? 106.056 31.607 90.753  1.00 37.59 ? 138  THR B CB  1 
ATOM   5353 O  OG1 . THR B 1 138 ? 104.808 31.259 91.355  1.00 37.02 ? 138  THR B OG1 1 
ATOM   5354 C  CG2 . THR B 1 138 ? 106.390 30.592 89.624  1.00 38.19 ? 138  THR B CG2 1 
ATOM   5355 N  N   . GLU B 1 139 ? 108.616 33.372 90.879  1.00 35.48 ? 139  GLU B N   1 
ATOM   5356 C  CA  . GLU B 1 139 ? 109.777 33.841 90.123  1.00 35.32 ? 139  GLU B CA  1 
ATOM   5357 C  C   . GLU B 1 139 ? 110.903 34.398 90.989  1.00 35.49 ? 139  GLU B C   1 
ATOM   5358 O  O   . GLU B 1 139 ? 111.925 34.828 90.458  1.00 35.72 ? 139  GLU B O   1 
ATOM   5359 C  CB  . GLU B 1 139 ? 109.372 34.835 89.020  1.00 33.13 ? 139  GLU B CB  1 
ATOM   5360 C  CG  . GLU B 1 139 ? 108.622 34.216 87.845  1.00 34.10 ? 139  GLU B CG  1 
ATOM   5361 C  CD  . GLU B 1 139 ? 109.376 33.088 87.120  1.00 39.23 ? 139  GLU B CD  1 
ATOM   5362 O  OE1 . GLU B 1 139 ? 110.547 33.284 86.727  1.00 40.81 ? 139  GLU B OE1 1 
ATOM   5363 O  OE2 . GLU B 1 139 ? 108.785 31.995 86.922  1.00 39.23 ? 139  GLU B OE2 1 
ATOM   5364 N  N   . GLU B 1 140 ? 110.712 34.369 92.311  1.00 36.61 ? 140  GLU B N   1 
ATOM   5365 C  CA  A GLU B 1 140 ? 111.707 34.863 93.271  0.50 37.46 ? 140  GLU B CA  1 
ATOM   5366 C  CA  B GLU B 1 140 ? 111.714 34.854 93.280  0.50 37.54 ? 140  GLU B CA  1 
ATOM   5367 C  C   . GLU B 1 140 ? 112.071 36.319 92.972  1.00 36.25 ? 140  GLU B C   1 
ATOM   5368 O  O   . GLU B 1 140 ? 113.244 36.689 92.899  1.00 37.28 ? 140  GLU B O   1 
ATOM   5369 C  CB  A GLU B 1 140 ? 112.944 33.959 93.294  0.50 38.37 ? 140  GLU B CB  1 
ATOM   5370 C  CB  B GLU B 1 140 ? 112.951 33.927 93.316  0.50 38.59 ? 140  GLU B CB  1 
ATOM   5371 C  CG  A GLU B 1 140 ? 112.603 32.504 93.571  0.50 40.99 ? 140  GLU B CG  1 
ATOM   5372 C  CG  B GLU B 1 140 ? 114.158 34.394 94.162  0.50 40.60 ? 140  GLU B CG  1 
ATOM   5373 C  CD  A GLU B 1 140 ? 113.824 31.615 93.711  0.50 42.54 ? 140  GLU B CD  1 
ATOM   5374 C  CD  B GLU B 1 140 ? 114.169 33.876 95.610  0.50 43.24 ? 140  GLU B CD  1 
ATOM   5375 O  OE1 A GLU B 1 140 ? 114.788 31.742 92.920  0.50 42.21 ? 140  GLU B OE1 1 
ATOM   5376 O  OE1 B GLU B 1 140 ? 113.301 33.060 95.984  0.50 44.21 ? 140  GLU B OE1 1 
ATOM   5377 O  OE2 A GLU B 1 140 ? 113.803 30.771 94.619  0.50 44.53 ? 140  GLU B OE2 1 
ATOM   5378 O  OE2 B GLU B 1 140 ? 115.070 34.288 96.378  0.50 44.66 ? 140  GLU B OE2 1 
ATOM   5379 N  N   . VAL B 1 141 ? 111.058 37.146 92.766  1.00 34.56 ? 141  VAL B N   1 
ATOM   5380 C  CA  . VAL B 1 141 ? 111.325 38.560 92.501  1.00 33.39 ? 141  VAL B CA  1 
ATOM   5381 C  C   . VAL B 1 141 ? 110.756 39.397 93.615  1.00 31.97 ? 141  VAL B C   1 
ATOM   5382 O  O   . VAL B 1 141 ? 109.831 38.982 94.292  1.00 31.87 ? 141  VAL B O   1 
ATOM   5383 C  CB  . VAL B 1 141 ? 110.764 39.053 91.131  1.00 32.12 ? 141  VAL B CB  1 
ATOM   5384 C  CG1 . VAL B 1 141 ? 111.563 38.435 89.997  1.00 33.69 ? 141  VAL B CG1 1 
ATOM   5385 C  CG2 . VAL B 1 141 ? 109.294 38.732 91.003  1.00 33.51 ? 141  VAL B CG2 1 
ATOM   5386 N  N   . VAL B 1 142 ? 111.310 40.579 93.818  1.00 31.61 ? 142  VAL B N   1 
ATOM   5387 C  CA  . VAL B 1 142 ? 110.668 41.513 94.748  1.00 30.99 ? 142  VAL B CA  1 
ATOM   5388 C  C   . VAL B 1 142 ? 109.637 42.278 93.936  1.00 29.50 ? 142  VAL B C   1 
ATOM   5389 O  O   . VAL B 1 142 ? 109.992 42.932 92.964  1.00 28.73 ? 142  VAL B O   1 
ATOM   5390 C  CB  . VAL B 1 142 ? 111.698 42.435 95.448  1.00 31.61 ? 142  VAL B CB  1 
ATOM   5391 C  CG1 . VAL B 1 142 ? 110.999 43.639 96.158  1.00 29.15 ? 142  VAL B CG1 1 
ATOM   5392 C  CG2 . VAL B 1 142 ? 112.526 41.606 96.429  1.00 32.99 ? 142  VAL B CG2 1 
ATOM   5393 N  N   . LEU B 1 143 ? 108.360 42.138 94.288  1.00 29.83 ? 143  LEU B N   1 
ATOM   5394 C  CA  . LEU B 1 143 ? 107.305 42.722 93.465  1.00 29.18 ? 143  LEU B CA  1 
ATOM   5395 C  C   . LEU B 1 143 ? 106.633 43.849 94.209  1.00 28.61 ? 143  LEU B C   1 
ATOM   5396 O  O   . LEU B 1 143 ? 106.120 43.644 95.314  1.00 30.37 ? 143  LEU B O   1 
ATOM   5397 C  CB  . LEU B 1 143 ? 106.266 41.694 93.026  1.00 29.21 ? 143  LEU B CB  1 
ATOM   5398 C  CG  . LEU B 1 143 ? 105.345 42.410 92.053  1.00 32.62 ? 143  LEU B CG  1 
ATOM   5399 C  CD1 . LEU B 1 143 ? 105.678 42.003 90.604  1.00 34.01 ? 143  LEU B CD1 1 
ATOM   5400 C  CD2 . LEU B 1 143 ? 103.893 42.206 92.396  1.00 32.29 ? 143  LEU B CD2 1 
ATOM   5401 N  N   . VAL B 1 144 ? 106.673 45.031 93.612  1.00 27.16 ? 144  VAL B N   1 
ATOM   5402 C  CA  . VAL B 1 144 ? 106.049 46.221 94.178  1.00 27.18 ? 144  VAL B CA  1 
ATOM   5403 C  C   . VAL B 1 144 ? 104.814 46.623 93.338  1.00 26.92 ? 144  VAL B C   1 
ATOM   5404 O  O   . VAL B 1 144 ? 104.856 46.556 92.113  1.00 25.90 ? 144  VAL B O   1 
ATOM   5405 C  CB  . VAL B 1 144 ? 107.032 47.394 94.188  1.00 26.90 ? 144  VAL B CB  1 
ATOM   5406 C  CG1 . VAL B 1 144 ? 106.389 48.632 94.739  1.00 26.22 ? 144  VAL B CG1 1 
ATOM   5407 C  CG2 . VAL B 1 144 ? 108.306 47.062 95.005  1.00 27.90 ? 144  VAL B CG2 1 
ATOM   5408 N  N   . SER B 1 145 ? 103.712 47.025 93.979  1.00 27.40 ? 145  SER B N   1 
ATOM   5409 C  CA  . SER B 1 145 ? 102.672 47.761 93.235  1.00 27.20 ? 145  SER B CA  1 
ATOM   5410 C  C   . SER B 1 145 ? 102.484 49.149 93.812  1.00 27.52 ? 145  SER B C   1 
ATOM   5411 O  O   . SER B 1 145 ? 102.323 49.292 95.017  1.00 28.93 ? 145  SER B O   1 
ATOM   5412 C  CB  . SER B 1 145 ? 101.346 47.004 93.165  1.00 26.30 ? 145  SER B CB  1 
ATOM   5413 O  OG  . SER B 1 145 ? 100.864 46.712 94.463  1.00 30.07 ? 145  SER B OG  1 
ATOM   5414 N  N   . LEU B 1 146 ? 102.503 50.175 92.950  1.00 27.20 ? 146  LEU B N   1 
ATOM   5415 C  CA  . LEU B 1 146 ? 102.407 51.595 93.389  1.00 26.35 ? 146  LEU B CA  1 
ATOM   5416 C  C   . LEU B 1 146 ? 100.978 52.123 93.216  1.00 26.79 ? 146  LEU B C   1 
ATOM   5417 O  O   . LEU B 1 146 ? 100.100 51.404 92.771  1.00 26.85 ? 146  LEU B O   1 
ATOM   5418 C  CB  . LEU B 1 146 ? 103.422 52.492 92.643  1.00 24.80 ? 146  LEU B CB  1 
ATOM   5419 C  CG  . LEU B 1 146 ? 103.503 52.633 91.107  1.00 22.96 ? 146  LEU B CG  1 
ATOM   5420 C  CD1 . LEU B 1 146 ? 102.268 53.355 90.457  1.00 24.39 ? 146  LEU B CD1 1 
ATOM   5421 C  CD2 . LEU B 1 146 ? 104.796 53.330 90.655  1.00 18.48 ? 146  LEU B CD2 1 
ATOM   5422 N  N   . SER B 1 147 ? 100.728 53.371 93.598  1.00 27.23 ? 147  SER B N   1 
ATOM   5423 C  CA  . SER B 1 147 ? 99.456  53.997 93.263  1.00 26.83 ? 147  SER B CA  1 
ATOM   5424 C  C   . SER B 1 147 ? 99.681  55.429 92.802  1.00 26.95 ? 147  SER B C   1 
ATOM   5425 O  O   . SER B 1 147 ? 100.804 55.971 92.883  1.00 25.92 ? 147  SER B O   1 
ATOM   5426 C  CB  . SER B 1 147 ? 98.500  53.948 94.439  1.00 27.97 ? 147  SER B CB  1 
ATOM   5427 O  OG  . SER B 1 147 ? 99.131  54.417 95.602  1.00 31.48 ? 147  SER B OG  1 
ATOM   5428 N  N   . TYR B 1 148 ? 98.640  56.007 92.226  1.00 26.02 ? 148  TYR B N   1 
ATOM   5429 C  CA  . TYR B 1 148 ? 98.745  57.345 91.748  1.00 26.40 ? 148  TYR B CA  1 
ATOM   5430 C  C   . TYR B 1 148 ? 97.344  57.916 91.600  1.00 26.44 ? 148  TYR B C   1 
ATOM   5431 O  O   . TYR B 1 148 ? 96.384  57.167 91.319  1.00 26.10 ? 148  TYR B O   1 
ATOM   5432 C  CB  . TYR B 1 148 ? 99.572  57.377 90.444  1.00 25.41 ? 148  TYR B CB  1 
ATOM   5433 C  CG  . TYR B 1 148 ? 98.958  56.629 89.287  1.00 27.06 ? 148  TYR B CG  1 
ATOM   5434 C  CD1 . TYR B 1 148 ? 99.133  55.245 89.152  1.00 25.70 ? 148  TYR B CD1 1 
ATOM   5435 C  CD2 . TYR B 1 148 ? 98.199  57.296 88.326  1.00 27.09 ? 148  TYR B CD2 1 
ATOM   5436 C  CE1 . TYR B 1 148 ? 98.569  54.552 88.111  1.00 24.93 ? 148  TYR B CE1 1 
ATOM   5437 C  CE2 . TYR B 1 148 ? 97.611  56.579 87.272  1.00 27.78 ? 148  TYR B CE2 1 
ATOM   5438 C  CZ  . TYR B 1 148 ? 97.816  55.208 87.178  1.00 25.43 ? 148  TYR B CZ  1 
ATOM   5439 O  OH  . TYR B 1 148 ? 97.285  54.499 86.112  1.00 26.94 ? 148  TYR B OH  1 
ATOM   5440 N  N   . ARG B 1 149 ? 97.233  59.234 91.775  1.00 26.06 ? 149  ARG B N   1 
ATOM   5441 C  CA  . ARG B 1 149 ? 95.954  59.923 91.661  1.00 25.85 ? 149  ARG B CA  1 
ATOM   5442 C  C   . ARG B 1 149 ? 95.443  59.871 90.234  1.00 25.24 ? 149  ARG B C   1 
ATOM   5443 O  O   . ARG B 1 149 ? 96.217  60.017 89.297  1.00 24.37 ? 149  ARG B O   1 
ATOM   5444 C  CB  . ARG B 1 149 ? 96.104  61.370 92.073  1.00 26.64 ? 149  ARG B CB  1 
ATOM   5445 C  CG  . ARG B 1 149 ? 96.419  61.566 93.540  1.00 27.12 ? 149  ARG B CG  1 
ATOM   5446 C  CD  . ARG B 1 149 ? 96.715  63.027 93.809  1.00 27.09 ? 149  ARG B CD  1 
ATOM   5447 N  NE  . ARG B 1 149 ? 98.123  63.323 93.585  1.00 27.85 ? 149  ARG B NE  1 
ATOM   5448 C  CZ  . ARG B 1 149 ? 98.690  64.527 93.717  1.00 30.43 ? 149  ARG B CZ  1 
ATOM   5449 N  NH1 . ARG B 1 149 ? 97.949  65.633 94.027  1.00 26.62 ? 149  ARG B NH1 1 
ATOM   5450 N  NH2 . ARG B 1 149 ? 100.011 64.627 93.500  1.00 26.39 ? 149  ARG B NH2 1 
ATOM   5451 N  N   . VAL B 1 150 ? 94.137  59.656 90.069  1.00 24.58 ? 150  VAL B N   1 
ATOM   5452 C  CA  . VAL B 1 150 ? 93.555  59.514 88.742  1.00 23.39 ? 150  VAL B CA  1 
ATOM   5453 C  C   . VAL B 1 150 ? 92.437  60.529 88.628  1.00 24.55 ? 150  VAL B C   1 
ATOM   5454 O  O   . VAL B 1 150 ? 92.110  61.173 89.613  1.00 25.52 ? 150  VAL B O   1 
ATOM   5455 C  CB  . VAL B 1 150 ? 93.035  58.095 88.535  1.00 22.85 ? 150  VAL B CB  1 
ATOM   5456 C  CG1 . VAL B 1 150 ? 94.199  57.136 88.533  1.00 21.18 ? 150  VAL B CG1 1 
ATOM   5457 C  CG2 . VAL B 1 150 ? 92.008  57.707 89.650  1.00 22.83 ? 150  VAL B CG2 1 
ATOM   5458 N  N   . GLY B 1 151 ? 91.863  60.687 87.437  1.00 24.44 ? 151  GLY B N   1 
ATOM   5459 C  CA  . GLY B 1 151 ? 90.828  61.712 87.227  1.00 24.99 ? 151  GLY B CA  1 
ATOM   5460 C  C   . GLY B 1 151 ? 91.378  63.113 87.461  1.00 26.09 ? 151  GLY B C   1 
ATOM   5461 O  O   . GLY B 1 151 ? 92.623  63.328 87.491  1.00 25.25 ? 151  GLY B O   1 
ATOM   5462 N  N   . ALA B 1 152 ? 90.462  64.063 87.660  1.00 27.21 ? 152  ALA B N   1 
ATOM   5463 C  CA  . ALA B 1 152 ? 90.834  65.449 87.984  1.00 28.42 ? 152  ALA B CA  1 
ATOM   5464 C  C   . ALA B 1 152 ? 91.941  65.501 89.040  1.00 29.35 ? 152  ALA B C   1 
ATOM   5465 O  O   . ALA B 1 152 ? 92.917  66.217 88.859  1.00 30.91 ? 152  ALA B O   1 
ATOM   5466 C  CB  . ALA B 1 152 ? 89.589  66.274 88.442  1.00 28.56 ? 152  ALA B CB  1 
ATOM   5467 N  N   . PHE B 1 153 ? 91.807  64.737 90.122  1.00 29.73 ? 153  PHE B N   1 
ATOM   5468 C  CA  . PHE B 1 153 ? 92.781  64.752 91.242  1.00 31.04 ? 153  PHE B CA  1 
ATOM   5469 C  C   . PHE B 1 153 ? 94.210  64.539 90.756  1.00 30.57 ? 153  PHE B C   1 
ATOM   5470 O  O   . PHE B 1 153 ? 95.146  65.174 91.260  1.00 31.55 ? 153  PHE B O   1 
ATOM   5471 C  CB  . PHE B 1 153 ? 92.418  63.677 92.262  1.00 30.46 ? 153  PHE B CB  1 
ATOM   5472 C  CG  . PHE B 1 153 ? 90.985  63.744 92.684  1.00 31.87 ? 153  PHE B CG  1 
ATOM   5473 C  CD1 . PHE B 1 153 ? 90.590  64.573 93.726  1.00 31.92 ? 153  PHE B CD1 1 
ATOM   5474 C  CD2 . PHE B 1 153 ? 90.024  63.037 92.010  1.00 30.16 ? 153  PHE B CD2 1 
ATOM   5475 C  CE1 . PHE B 1 153 ? 89.268  64.650 94.099  1.00 33.18 ? 153  PHE B CE1 1 
ATOM   5476 C  CE2 . PHE B 1 153 ? 88.688  63.127 92.387  1.00 32.57 ? 153  PHE B CE2 1 
ATOM   5477 C  CZ  . PHE B 1 153 ? 88.313  63.929 93.416  1.00 31.87 ? 153  PHE B CZ  1 
ATOM   5478 N  N   . GLY B 1 154 ? 94.367  63.680 89.750  1.00 29.24 ? 154  GLY B N   1 
ATOM   5479 C  CA  . GLY B 1 154 ? 95.710  63.340 89.254  1.00 28.03 ? 154  GLY B CA  1 
ATOM   5480 C  C   . GLY B 1 154 ? 96.105  64.121 88.015  1.00 28.04 ? 154  GLY B C   1 
ATOM   5481 O  O   . GLY B 1 154 ? 97.304  64.187 87.676  1.00 28.25 ? 154  GLY B O   1 
ATOM   5482 N  N   . PHE B 1 155 ? 95.121  64.676 87.302  1.00 27.28 ? 155  PHE B N   1 
ATOM   5483 C  CA  . PHE B 1 155 ? 95.405  65.211 85.972  1.00 27.49 ? 155  PHE B CA  1 
ATOM   5484 C  C   . PHE B 1 155 ? 94.760  66.560 85.570  1.00 29.09 ? 155  PHE B C   1 
ATOM   5485 O  O   . PHE B 1 155 ? 94.969  67.022 84.444  1.00 29.60 ? 155  PHE B O   1 
ATOM   5486 C  CB  . PHE B 1 155 ? 95.233  64.127 84.906  1.00 26.00 ? 155  PHE B CB  1 
ATOM   5487 C  CG  . PHE B 1 155 ? 96.159  62.956 85.126  1.00 25.64 ? 155  PHE B CG  1 
ATOM   5488 C  CD1 . PHE B 1 155 ? 97.506  63.057 84.791  1.00 25.56 ? 155  PHE B CD1 1 
ATOM   5489 C  CD2 . PHE B 1 155 ? 95.714  61.813 85.770  1.00 23.87 ? 155  PHE B CD2 1 
ATOM   5490 C  CE1 . PHE B 1 155 ? 98.393  62.012 85.059  1.00 28.56 ? 155  PHE B CE1 1 
ATOM   5491 C  CE2 . PHE B 1 155 ? 96.590  60.743 86.039  1.00 27.00 ? 155  PHE B CE2 1 
ATOM   5492 C  CZ  . PHE B 1 155 ? 97.928  60.837 85.687  1.00 27.60 ? 155  PHE B CZ  1 
ATOM   5493 N  N   . LEU B 1 156 ? 94.018  67.192 86.469  1.00 28.64 ? 156  LEU B N   1 
ATOM   5494 C  CA  . LEU B 1 156 ? 93.585  68.562 86.191  1.00 31.14 ? 156  LEU B CA  1 
ATOM   5495 C  C   . LEU B 1 156 ? 94.789  69.391 85.740  1.00 32.12 ? 156  LEU B C   1 
ATOM   5496 O  O   . LEU B 1 156 ? 95.832  69.423 86.415  1.00 31.81 ? 156  LEU B O   1 
ATOM   5497 C  CB  . LEU B 1 156 ? 92.967  69.213 87.417  1.00 31.31 ? 156  LEU B CB  1 
ATOM   5498 C  CG  . LEU B 1 156 ? 92.287  70.518 87.003  1.00 32.67 ? 156  LEU B CG  1 
ATOM   5499 C  CD1 . LEU B 1 156 ? 90.838  70.234 86.604  1.00 29.16 ? 156  LEU B CD1 1 
ATOM   5500 C  CD2 . LEU B 1 156 ? 92.334  71.494 88.147  1.00 31.87 ? 156  LEU B CD2 1 
ATOM   5501 N  N   . ALA B 1 157 ? 94.670  70.027 84.585  1.00 32.98 ? 157  ALA B N   1 
ATOM   5502 C  CA  . ALA B 1 157 ? 95.822  70.724 84.037  1.00 34.65 ? 157  ALA B CA  1 
ATOM   5503 C  C   . ALA B 1 157 ? 95.559  72.185 83.629  1.00 37.05 ? 157  ALA B C   1 
ATOM   5504 O  O   . ALA B 1 157 ? 94.863  72.462 82.642  1.00 37.09 ? 157  ALA B O   1 
ATOM   5505 C  CB  . ALA B 1 157 ? 96.437  69.922 82.895  1.00 33.58 ? 157  ALA B CB  1 
ATOM   5506 N  N   . LEU B 1 158 ? 96.127  73.100 84.408  1.00 38.68 ? 158  LEU B N   1 
ATOM   5507 C  CA  . LEU B 1 158 ? 96.047  74.534 84.133  1.00 41.93 ? 158  LEU B CA  1 
ATOM   5508 C  C   . LEU B 1 158 ? 97.458  75.034 83.953  1.00 43.58 ? 158  LEU B C   1 
ATOM   5509 O  O   . LEU B 1 158 ? 98.088  75.509 84.896  1.00 44.98 ? 158  LEU B O   1 
ATOM   5510 C  CB  . LEU B 1 158 ? 95.362  75.250 85.288  1.00 42.96 ? 158  LEU B CB  1 
ATOM   5511 C  CG  . LEU B 1 158 ? 93.859  74.974 85.316  1.00 42.98 ? 158  LEU B CG  1 
ATOM   5512 C  CD1 . LEU B 1 158 ? 93.291  75.215 86.688  1.00 44.80 ? 158  LEU B CD1 1 
ATOM   5513 C  CD2 . LEU B 1 158 ? 93.128  75.799 84.269  1.00 42.74 ? 158  LEU B CD2 1 
ATOM   5514 N  N   . HIS B 1 159 ? 97.967  74.888 82.736  1.00 44.70 ? 159  HIS B N   1 
ATOM   5515 C  CA  . HIS B 1 159 ? 99.363  75.186 82.436  1.00 46.41 ? 159  HIS B CA  1 
ATOM   5516 C  C   . HIS B 1 159 ? 99.662  76.646 82.753  1.00 48.97 ? 159  HIS B C   1 
ATOM   5517 O  O   . HIS B 1 159 ? 98.915  77.553 82.348  1.00 50.00 ? 159  HIS B O   1 
ATOM   5518 C  CB  . HIS B 1 159 ? 99.698  74.822 80.978  1.00 46.37 ? 159  HIS B CB  1 
ATOM   5519 C  CG  . HIS B 1 159 ? 101.143 75.001 80.623  1.00 49.34 ? 159  HIS B CG  1 
ATOM   5520 N  ND1 . HIS B 1 159 ? 102.132 74.154 81.074  1.00 49.01 ? 159  HIS B ND1 1 
ATOM   5521 C  CD2 . HIS B 1 159 ? 101.767 75.943 79.871  1.00 53.51 ? 159  HIS B CD2 1 
ATOM   5522 C  CE1 . HIS B 1 159 ? 103.302 74.564 80.615  1.00 52.16 ? 159  HIS B CE1 1 
ATOM   5523 N  NE2 . HIS B 1 159 ? 103.107 75.643 79.877  1.00 53.45 ? 159  HIS B NE2 1 
ATOM   5524 N  N   . GLY B 1 160 ? 100.733 76.852 83.521  1.00 50.07 ? 160  GLY B N   1 
ATOM   5525 C  CA  . GLY B 1 160 ? 101.091 78.189 84.045  1.00 52.04 ? 160  GLY B CA  1 
ATOM   5526 C  C   . GLY B 1 160 ? 100.932 78.276 85.560  1.00 52.19 ? 160  GLY B C   1 
ATOM   5527 O  O   . GLY B 1 160 ? 101.621 79.051 86.219  1.00 53.55 ? 160  GLY B O   1 
ATOM   5528 N  N   . SER B 1 161 ? 100.009 77.497 86.119  1.00 50.85 ? 161  SER B N   1 
ATOM   5529 C  CA  A SER B 1 161 ? 99.834  77.455 87.563  0.50 51.17 ? 161  SER B CA  1 
ATOM   5530 C  CA  B SER B 1 161 ? 99.830  77.448 87.563  0.50 50.90 ? 161  SER B CA  1 
ATOM   5531 C  C   . SER B 1 161 ? 100.758 76.405 88.178  1.00 49.97 ? 161  SER B C   1 
ATOM   5532 O  O   . SER B 1 161 ? 101.014 75.353 87.576  1.00 47.92 ? 161  SER B O   1 
ATOM   5533 C  CB  A SER B 1 161 ? 98.379  77.155 87.915  0.50 50.46 ? 161  SER B CB  1 
ATOM   5534 C  CB  B SER B 1 161 ? 98.374  77.139 87.910  0.50 50.15 ? 161  SER B CB  1 
ATOM   5535 O  OG  A SER B 1 161 ? 98.020  75.854 87.487  0.50 49.11 ? 161  SER B OG  1 
ATOM   5536 O  OG  B SER B 1 161 ? 98.253  76.702 89.253  0.50 49.10 ? 161  SER B OG  1 
ATOM   5537 N  N   . GLN B 1 162 ? 101.276 76.694 89.370  1.00 51.29 ? 162  GLN B N   1 
ATOM   5538 C  CA  . GLN B 1 162 ? 102.043 75.670 90.088  1.00 50.98 ? 162  GLN B CA  1 
ATOM   5539 C  C   . GLN B 1 162 ? 101.140 75.011 91.130  1.00 49.98 ? 162  GLN B C   1 
ATOM   5540 O  O   . GLN B 1 162 ? 101.594 74.197 91.937  1.00 49.65 ? 162  GLN B O   1 
ATOM   5541 C  CB  . GLN B 1 162 ? 103.314 76.227 90.753  1.00 53.01 ? 162  GLN B CB  1 
ATOM   5542 C  CG  . GLN B 1 162 ? 104.368 76.840 89.814  1.00 56.33 ? 162  GLN B CG  1 
ATOM   5543 C  CD  . GLN B 1 162 ? 104.867 75.920 88.699  1.00 60.20 ? 162  GLN B CD  1 
ATOM   5544 O  OE1 . GLN B 1 162 ? 104.843 74.674 88.790  1.00 60.85 ? 162  GLN B OE1 1 
ATOM   5545 N  NE2 . GLN B 1 162 ? 105.331 76.545 87.623  1.00 62.85 ? 162  GLN B NE2 1 
ATOM   5546 N  N   . GLU B 1 163 ? 99.861  75.379 91.104  1.00 49.81 ? 163  GLU B N   1 
ATOM   5547 C  CA  . GLU B 1 163 ? 98.859  74.811 91.993  1.00 48.71 ? 163  GLU B CA  1 
ATOM   5548 C  C   . GLU B 1 163 ? 98.139  73.597 91.360  1.00 45.78 ? 163  GLU B C   1 
ATOM   5549 O  O   . GLU B 1 163 ? 97.784  72.644 92.053  1.00 44.48 ? 163  GLU B O   1 
ATOM   5550 C  CB  . GLU B 1 163 ? 97.855  75.893 92.390  1.00 50.70 ? 163  GLU B CB  1 
ATOM   5551 C  CG  . GLU B 1 163 ? 98.434  76.971 93.338  1.00 54.99 ? 163  GLU B CG  1 
ATOM   5552 C  CD  . GLU B 1 163 ? 99.023  76.396 94.647  1.00 58.02 ? 163  GLU B CD  1 
ATOM   5553 O  OE1 . GLU B 1 163 ? 98.505  75.387 95.183  1.00 56.89 ? 163  GLU B OE1 1 
ATOM   5554 O  OE2 . GLU B 1 163 ? 100.013 76.972 95.152  1.00 62.33 ? 163  GLU B OE2 1 
ATOM   5555 N  N   . ALA B 1 164 ? 97.914  73.662 90.048  1.00 43.89 ? 164  ALA B N   1 
ATOM   5556 C  CA  . ALA B 1 164 ? 97.346  72.563 89.297  1.00 41.42 ? 164  ALA B CA  1 
ATOM   5557 C  C   . ALA B 1 164 ? 98.074  72.449 87.941  1.00 40.33 ? 164  ALA B C   1 
ATOM   5558 O  O   . ALA B 1 164 ? 97.466  72.614 86.891  1.00 40.03 ? 164  ALA B O   1 
ATOM   5559 C  CB  . ALA B 1 164 ? 95.862  72.773 89.124  1.00 41.17 ? 164  ALA B CB  1 
ATOM   5560 N  N   . PRO B 1 165 ? 99.386  72.153 87.971  1.00 39.52 ? 165  PRO B N   1 
ATOM   5561 C  CA  . PRO B 1 165 ? 100.211 72.149 86.766  1.00 39.20 ? 165  PRO B CA  1 
ATOM   5562 C  C   . PRO B 1 165 ? 99.874  71.050 85.755  1.00 37.92 ? 165  PRO B C   1 
ATOM   5563 O  O   . PRO B 1 165 ? 100.227 71.177 84.581  1.00 38.44 ? 165  PRO B O   1 
ATOM   5564 C  CB  . PRO B 1 165 ? 101.618 71.920 87.316  1.00 39.03 ? 165  PRO B CB  1 
ATOM   5565 C  CG  . PRO B 1 165 ? 101.403 71.145 88.571  1.00 39.25 ? 165  PRO B CG  1 
ATOM   5566 C  CD  . PRO B 1 165 ? 100.133 71.682 89.155  1.00 39.31 ? 165  PRO B CD  1 
ATOM   5567 N  N   . GLY B 1 166 ? 99.210  69.986 86.199  1.00 36.39 ? 166  GLY B N   1 
ATOM   5568 C  CA  . GLY B 1 166 ? 98.992  68.801 85.355  1.00 34.56 ? 166  GLY B CA  1 
ATOM   5569 C  C   . GLY B 1 166 ? 100.024 67.736 85.636  1.00 33.49 ? 166  GLY B C   1 
ATOM   5570 O  O   . GLY B 1 166 ? 101.028 68.029 86.271  1.00 34.36 ? 166  GLY B O   1 
ATOM   5571 N  N   . ASN B 1 167 ? 99.770  66.494 85.191  1.00 32.10 ? 167  ASN B N   1 
ATOM   5572 C  CA  . ASN B 1 167 ? 100.714 65.370 85.319  1.00 29.66 ? 167  ASN B CA  1 
ATOM   5573 C  C   . ASN B 1 167 ? 101.103 64.971 86.736  1.00 29.60 ? 167  ASN B C   1 
ATOM   5574 O  O   . ASN B 1 167 ? 102.034 64.181 86.916  1.00 29.40 ? 167  ASN B O   1 
ATOM   5575 C  CB  . ASN B 1 167 ? 101.993 65.588 84.481  1.00 30.26 ? 167  ASN B CB  1 
ATOM   5576 C  CG  . ASN B 1 167 ? 101.704 65.737 82.988  1.00 30.11 ? 167  ASN B CG  1 
ATOM   5577 O  OD1 . ASN B 1 167 ? 100.732 65.187 82.474  1.00 30.81 ? 167  ASN B OD1 1 
ATOM   5578 N  ND2 . ASN B 1 167 ? 102.539 66.496 82.294  1.00 29.84 ? 167  ASN B ND2 1 
ATOM   5579 N  N   . VAL B 1 168 ? 100.414 65.487 87.752  1.00 29.86 ? 168  VAL B N   1 
ATOM   5580 C  CA  . VAL B 1 168 ? 100.785 65.103 89.124  1.00 29.36 ? 168  VAL B CA  1 
ATOM   5581 C  C   . VAL B 1 168 ? 100.627 63.578 89.410  1.00 28.71 ? 168  VAL B C   1 
ATOM   5582 O  O   . VAL B 1 168 ? 101.408 63.005 90.186  1.00 28.93 ? 168  VAL B O   1 
ATOM   5583 C  CB  . VAL B 1 168 ? 100.139 66.008 90.227  1.00 30.89 ? 168  VAL B CB  1 
ATOM   5584 C  CG1 . VAL B 1 168 ? 100.468 67.507 89.977  1.00 29.96 ? 168  VAL B CG1 1 
ATOM   5585 C  CG2 . VAL B 1 168 ? 98.613  65.784 90.327  1.00 29.45 ? 168  VAL B CG2 1 
ATOM   5586 N  N   . GLY B 1 169 ? 99.662  62.926 88.767  1.00 27.89 ? 169  GLY B N   1 
ATOM   5587 C  CA  . GLY B 1 169 ? 99.522  61.471 88.850  1.00 27.06 ? 169  GLY B CA  1 
ATOM   5588 C  C   . GLY B 1 169 ? 100.793 60.784 88.333  1.00 27.36 ? 169  GLY B C   1 
ATOM   5589 O  O   . GLY B 1 169 ? 101.198 59.761 88.859  1.00 26.70 ? 169  GLY B O   1 
ATOM   5590 N  N   . LEU B 1 170 ? 101.425 61.358 87.308  1.00 27.59 ? 170  LEU B N   1 
ATOM   5591 C  CA  . LEU B 1 170 ? 102.689 60.832 86.792  1.00 27.75 ? 170  LEU B CA  1 
ATOM   5592 C  C   . LEU B 1 170 ? 103.812 61.102 87.773  1.00 28.19 ? 170  LEU B C   1 
ATOM   5593 O  O   . LEU B 1 170 ? 104.682 60.261 87.960  1.00 28.93 ? 170  LEU B O   1 
ATOM   5594 C  CB  . LEU B 1 170 ? 103.024 61.393 85.410  1.00 27.42 ? 170  LEU B CB  1 
ATOM   5595 C  CG  . LEU B 1 170 ? 102.177 60.837 84.252  1.00 28.63 ? 170  LEU B CG  1 
ATOM   5596 C  CD1 . LEU B 1 170 ? 102.364 61.661 82.990  1.00 30.49 ? 170  LEU B CD1 1 
ATOM   5597 C  CD2 . LEU B 1 170 ? 102.477 59.367 83.941  1.00 27.03 ? 170  LEU B CD2 1 
ATOM   5598 N  N   . LEU B 1 171 ? 103.771 62.250 88.436  1.00 28.54 ? 171  LEU B N   1 
ATOM   5599 C  CA  . LEU B 1 171 ? 104.727 62.532 89.486  1.00 28.51 ? 171  LEU B CA  1 
ATOM   5600 C  C   . LEU B 1 171 ? 104.516 61.668 90.734  1.00 28.16 ? 171  LEU B C   1 
ATOM   5601 O  O   . LEU B 1 171 ? 105.471 61.302 91.377  1.00 28.23 ? 171  LEU B O   1 
ATOM   5602 C  CB  . LEU B 1 171 ? 104.725 64.022 89.826  1.00 29.23 ? 171  LEU B CB  1 
ATOM   5603 C  CG  . LEU B 1 171 ? 105.254 64.968 88.731  1.00 30.00 ? 171  LEU B CG  1 
ATOM   5604 C  CD1 . LEU B 1 171 ? 104.858 66.460 89.043  1.00 29.52 ? 171  LEU B CD1 1 
ATOM   5605 C  CD2 . LEU B 1 171 ? 106.791 64.875 88.500  1.00 25.71 ? 171  LEU B CD2 1 
ATOM   5606 N  N   . ASP B 1 172 ? 103.274 61.335 91.082  1.00 28.57 ? 172  ASP B N   1 
ATOM   5607 C  CA  . ASP B 1 172 ? 103.011 60.320 92.117  1.00 27.97 ? 172  ASP B CA  1 
ATOM   5608 C  C   . ASP B 1 172 ? 103.764 59.039 91.773  1.00 27.25 ? 172  ASP B C   1 
ATOM   5609 O  O   . ASP B 1 172 ? 104.404 58.424 92.643  1.00 27.19 ? 172  ASP B O   1 
ATOM   5610 C  CB  . ASP B 1 172 ? 101.517 59.987 92.261  1.00 27.24 ? 172  ASP B CB  1 
ATOM   5611 C  CG  . ASP B 1 172 ? 100.696 61.176 92.732  1.00 28.19 ? 172  ASP B CG  1 
ATOM   5612 O  OD1 . ASP B 1 172 ? 101.298 62.109 93.253  1.00 30.61 ? 172  ASP B OD1 1 
ATOM   5613 O  OD2 . ASP B 1 172 ? 99.455  61.203 92.567  1.00 29.46 ? 172  ASP B OD2 1 
ATOM   5614 N  N   . GLN B 1 173 ? 103.716 58.653 90.507  1.00 25.81 ? 173  GLN B N   1 
ATOM   5615 C  CA  . GLN B 1 173 ? 104.348 57.393 90.118  1.00 25.70 ? 173  GLN B CA  1 
ATOM   5616 C  C   . GLN B 1 173 ? 105.862 57.527 90.263  1.00 27.16 ? 173  GLN B C   1 
ATOM   5617 O  O   . GLN B 1 173 ? 106.506 56.587 90.766  1.00 28.25 ? 173  GLN B O   1 
ATOM   5618 C  CB  . GLN B 1 173 ? 103.977 56.971 88.693  1.00 24.78 ? 173  GLN B CB  1 
ATOM   5619 C  CG  . GLN B 1 173 ? 102.518 56.729 88.443  1.00 21.86 ? 173  GLN B CG  1 
ATOM   5620 C  CD  . GLN B 1 173 ? 102.206 56.519 86.957  1.00 25.45 ? 173  GLN B CD  1 
ATOM   5621 O  OE1 . GLN B 1 173 ? 103.120 56.391 86.116  1.00 24.34 ? 173  GLN B OE1 1 
ATOM   5622 N  NE2 . GLN B 1 173 ? 100.913 56.466 86.625  1.00 21.07 ? 173  GLN B NE2 1 
ATOM   5623 N  N   . ARG B 1 174 ? 106.400 58.694 89.865  1.00 27.55 ? 174  ARG B N   1 
ATOM   5624 C  CA  A ARG B 1 174 ? 107.830 58.978 89.904  0.50 28.17 ? 174  ARG B CA  1 
ATOM   5625 C  CA  B ARG B 1 174 ? 107.830 58.974 89.899  0.50 28.95 ? 174  ARG B CA  1 
ATOM   5626 C  C   . ARG B 1 174 ? 108.333 58.908 91.335  1.00 30.09 ? 174  ARG B C   1 
ATOM   5627 O  O   . ARG B 1 174 ? 109.395 58.325 91.612  1.00 30.93 ? 174  ARG B O   1 
ATOM   5628 C  CB  A ARG B 1 174 ? 108.128 60.375 89.332  0.50 28.77 ? 174  ARG B CB  1 
ATOM   5629 C  CB  B ARG B 1 174 ? 108.128 60.369 89.317  0.50 30.00 ? 174  ARG B CB  1 
ATOM   5630 C  CG  A ARG B 1 174 ? 109.608 60.777 89.352  0.50 26.15 ? 174  ARG B CG  1 
ATOM   5631 C  CG  B ARG B 1 174 ? 109.522 60.521 88.691  0.50 30.77 ? 174  ARG B CG  1 
ATOM   5632 C  CD  A ARG B 1 174 ? 109.849 62.105 88.598  0.50 23.11 ? 174  ARG B CD  1 
ATOM   5633 C  CD  B ARG B 1 174 ? 109.716 61.908 88.037  0.50 32.52 ? 174  ARG B CD  1 
ATOM   5634 N  NE  A ARG B 1 174 ? 109.694 61.985 87.148  0.50 16.44 ? 174  ARG B NE  1 
ATOM   5635 N  NE  B ARG B 1 174 ? 109.942 62.942 89.045  0.50 32.97 ? 174  ARG B NE  1 
ATOM   5636 C  CZ  A ARG B 1 174 ? 109.698 63.016 86.321  0.50 13.56 ? 174  ARG B CZ  1 
ATOM   5637 C  CZ  B ARG B 1 174 ? 110.084 64.240 88.786  0.50 34.26 ? 174  ARG B CZ  1 
ATOM   5638 N  NH1 A ARG B 1 174 ? 109.852 64.239 86.798  0.50 15.75 ? 174  ARG B NH1 1 
ATOM   5639 N  NH1 B ARG B 1 174 ? 110.026 64.669 87.529  0.50 34.32 ? 174  ARG B NH1 1 
ATOM   5640 N  NH2 A ARG B 1 174 ? 109.572 62.837 85.024  0.50 11.53 ? 174  ARG B NH2 1 
ATOM   5641 N  NH2 B ARG B 1 174 ? 110.290 65.105 89.780  0.50 31.55 ? 174  ARG B NH2 1 
ATOM   5642 N  N   . MET B 1 175 ? 107.569 59.508 92.234  1.00 30.39 ? 175  MET B N   1 
ATOM   5643 C  CA  . MET B 1 175 ? 107.900 59.498 93.634  1.00 31.19 ? 175  MET B CA  1 
ATOM   5644 C  C   . MET B 1 175 ? 107.931 58.097 94.267  1.00 30.23 ? 175  MET B C   1 
ATOM   5645 O  O   . MET B 1 175 ? 108.774 57.811 95.129  1.00 30.87 ? 175  MET B O   1 
ATOM   5646 C  CB  . MET B 1 175 ? 106.978 60.433 94.416  1.00 31.13 ? 175  MET B CB  1 
ATOM   5647 C  CG  . MET B 1 175 ? 107.533 60.677 95.837  1.00 34.29 ? 175  MET B CG  1 
ATOM   5648 S  SD  . MET B 1 175 ? 106.790 62.080 96.647  1.00 40.94 ? 175  MET B SD  1 
ATOM   5649 C  CE  . MET B 1 175 ? 107.623 63.399 95.714  1.00 33.48 ? 175  MET B CE  1 
ATOM   5650 N  N   . ALA B 1 176 ? 107.016 57.227 93.855  1.00 29.35 ? 176  ALA B N   1 
ATOM   5651 C  CA  . ALA B 1 176 ? 107.047 55.847 94.329  1.00 27.98 ? 176  ALA B CA  1 
ATOM   5652 C  C   . ALA B 1 176 ? 108.286 55.140 93.773  1.00 28.23 ? 176  ALA B C   1 
ATOM   5653 O  O   . ALA B 1 176 ? 108.956 54.336 94.504  1.00 29.42 ? 176  ALA B O   1 
ATOM   5654 C  CB  . ALA B 1 176 ? 105.767 55.117 93.946  1.00 27.10 ? 176  ALA B CB  1 
ATOM   5655 N  N   . LEU B 1 177 ? 108.601 55.429 92.496  1.00 26.33 ? 177  LEU B N   1 
ATOM   5656 C  CA  . LEU B 1 177 ? 109.848 54.934 91.880  1.00 26.37 ? 177  LEU B CA  1 
ATOM   5657 C  C   . LEU B 1 177 ? 111.104 55.407 92.627  1.00 26.95 ? 177  LEU B C   1 
ATOM   5658 O  O   . LEU B 1 177 ? 111.982 54.606 92.904  1.00 27.81 ? 177  LEU B O   1 
ATOM   5659 C  CB  . LEU B 1 177 ? 109.952 55.277 90.371  1.00 25.73 ? 177  LEU B CB  1 
ATOM   5660 C  CG  . LEU B 1 177 ? 108.939 54.511 89.475  1.00 26.09 ? 177  LEU B CG  1 
ATOM   5661 C  CD1 . LEU B 1 177 ? 109.175 54.716 87.992  1.00 25.04 ? 177  LEU B CD1 1 
ATOM   5662 C  CD2 . LEU B 1 177 ? 108.949 53.019 89.784  1.00 24.94 ? 177  LEU B CD2 1 
ATOM   5663 N  N   . GLN B 1 178 ? 111.151 56.691 92.963  1.00 26.27 ? 178  GLN B N   1 
ATOM   5664 C  CA  . GLN B 1 178 ? 112.201 57.246 93.759  1.00 28.36 ? 178  GLN B CA  1 
ATOM   5665 C  C   . GLN B 1 178 ? 112.303 56.551 95.105  1.00 29.44 ? 178  GLN B C   1 
ATOM   5666 O  O   . GLN B 1 178 ? 113.407 56.385 95.617  1.00 30.98 ? 178  GLN B O   1 
ATOM   5667 C  CB  . GLN B 1 178 ? 111.988 58.767 94.000  1.00 28.46 ? 178  GLN B CB  1 
ATOM   5668 C  CG  . GLN B 1 178 ? 113.125 59.412 94.831  1.00 27.82 ? 178  GLN B CG  1 
ATOM   5669 C  CD  . GLN B 1 178 ? 114.414 59.615 94.038  1.00 28.66 ? 178  GLN B CD  1 
ATOM   5670 O  OE1 . GLN B 1 178 ? 114.380 60.084 92.915  1.00 30.51 ? 178  GLN B OE1 1 
ATOM   5671 N  NE2 . GLN B 1 178 ? 115.549 59.301 94.638  1.00 29.75 ? 178  GLN B NE2 1 
ATOM   5672 N  N   . TRP B 1 179 ? 111.151 56.196 95.680  1.00 29.16 ? 179  TRP B N   1 
ATOM   5673 C  CA  . TRP B 1 179 ? 111.095 55.554 97.002  1.00 30.33 ? 179  TRP B CA  1 
ATOM   5674 C  C   . TRP B 1 179 ? 111.722 54.151 96.914  1.00 30.51 ? 179  TRP B C   1 
ATOM   5675 O  O   . TRP B 1 179 ? 112.450 53.741 97.812  1.00 31.50 ? 179  TRP B O   1 
ATOM   5676 C  CB  . TRP B 1 179 ? 109.641 55.471 97.533  1.00 28.68 ? 179  TRP B CB  1 
ATOM   5677 C  CG  . TRP B 1 179 ? 109.548 54.969 98.952  1.00 30.71 ? 179  TRP B CG  1 
ATOM   5678 C  CD1 . TRP B 1 179 ? 109.455 55.738 100.096 1.00 31.77 ? 179  TRP B CD1 1 
ATOM   5679 C  CD2 . TRP B 1 179 ? 109.571 53.593 99.391  1.00 29.67 ? 179  TRP B CD2 1 
ATOM   5680 N  NE1 . TRP B 1 179 ? 109.421 54.919 101.204 1.00 35.01 ? 179  TRP B NE1 1 
ATOM   5681 C  CE2 . TRP B 1 179 ? 109.489 53.605 100.807 1.00 32.37 ? 179  TRP B CE2 1 
ATOM   5682 C  CE3 . TRP B 1 179 ? 109.643 52.358 98.722  1.00 29.39 ? 179  TRP B CE3 1 
ATOM   5683 C  CZ2 . TRP B 1 179 ? 109.482 52.421 101.586 1.00 32.80 ? 179  TRP B CZ2 1 
ATOM   5684 C  CZ3 . TRP B 1 179 ? 109.613 51.169 99.491  1.00 30.71 ? 179  TRP B CZ3 1 
ATOM   5685 C  CH2 . TRP B 1 179 ? 109.549 51.220 100.919 1.00 33.08 ? 179  TRP B CH2 1 
ATOM   5686 N  N   . VAL B 1 180 ? 111.419 53.440 95.829  1.00 30.01 ? 180  VAL B N   1 
ATOM   5687 C  CA  . VAL B 1 180 ? 111.941 52.101 95.568  1.00 29.86 ? 180  VAL B CA  1 
ATOM   5688 C  C   . VAL B 1 180 ? 113.466 52.223 95.394  1.00 31.34 ? 180  VAL B C   1 
ATOM   5689 O  O   . VAL B 1 180 ? 114.247 51.532 96.061  1.00 32.18 ? 180  VAL B O   1 
ATOM   5690 C  CB  . VAL B 1 180 ? 111.219 51.498 94.345  1.00 28.99 ? 180  VAL B CB  1 
ATOM   5691 C  CG1 . VAL B 1 180 ? 111.937 50.272 93.759  1.00 29.46 ? 180  VAL B CG1 1 
ATOM   5692 C  CG2 . VAL B 1 180 ? 109.796 51.120 94.717  1.00 27.39 ? 180  VAL B CG2 1 
ATOM   5693 N  N   . HIS B 1 181 ? 113.877 53.171 94.556  1.00 31.45 ? 181  HIS B N   1 
ATOM   5694 C  CA  . HIS B 1 181 ? 115.269 53.487 94.377  1.00 32.51 ? 181  HIS B CA  1 
ATOM   5695 C  C   . HIS B 1 181 ? 115.980 53.680 95.713  1.00 34.43 ? 181  HIS B C   1 
ATOM   5696 O  O   . HIS B 1 181 ? 117.098 53.167 95.902  1.00 35.56 ? 181  HIS B O   1 
ATOM   5697 C  CB  . HIS B 1 181 ? 115.413 54.764 93.550  1.00 32.14 ? 181  HIS B CB  1 
ATOM   5698 C  CG  . HIS B 1 181 ? 116.837 55.160 93.322  1.00 32.70 ? 181  HIS B CG  1 
ATOM   5699 N  ND1 . HIS B 1 181 ? 117.605 54.619 92.313  1.00 31.80 ? 181  HIS B ND1 1 
ATOM   5700 C  CD2 . HIS B 1 181 ? 117.632 56.043 93.966  1.00 31.38 ? 181  HIS B CD2 1 
ATOM   5701 C  CE1 . HIS B 1 181 ? 118.812 55.150 92.350  1.00 30.22 ? 181  HIS B CE1 1 
ATOM   5702 N  NE2 . HIS B 1 181 ? 118.851 56.022 93.337  1.00 31.73 ? 181  HIS B NE2 1 
ATOM   5703 N  N   . ASP B 1 182 ? 115.344 54.416 96.635  1.00 34.51 ? 182  ASP B N   1 
ATOM   5704 C  CA  . ASP B 1 182 ? 115.969 54.708 97.922  1.00 36.19 ? 182  ASP B CA  1 
ATOM   5705 C  C   . ASP B 1 182 ? 115.852 53.626 98.998  1.00 36.72 ? 182  ASP B C   1 
ATOM   5706 O  O   . ASP B 1 182 ? 116.648 53.621 99.951  1.00 38.49 ? 182  ASP B O   1 
ATOM   5707 C  CB  . ASP B 1 182 ? 115.476 56.046 98.504  1.00 36.44 ? 182  ASP B CB  1 
ATOM   5708 C  CG  . ASP B 1 182 ? 115.819 57.243 97.631  1.00 37.13 ? 182  ASP B CG  1 
ATOM   5709 O  OD1 . ASP B 1 182 ? 116.812 57.215 96.870  1.00 37.82 ? 182  ASP B OD1 1 
ATOM   5710 O  OD2 . ASP B 1 182 ? 115.087 58.239 97.724  1.00 38.59 ? 182  ASP B OD2 1 
ATOM   5711 N  N   . ASN B 1 183 ? 114.900 52.706 98.871  1.00 34.95 ? 183  ASN B N   1 
ATOM   5712 C  CA  . ASN B 1 183 ? 114.546 51.905 100.034 1.00 35.51 ? 183  ASN B CA  1 
ATOM   5713 C  C   . ASN B 1 183 ? 114.474 50.401 99.758  1.00 35.47 ? 183  ASN B C   1 
ATOM   5714 O  O   . ASN B 1 183 ? 114.401 49.606 100.708 1.00 36.00 ? 183  ASN B O   1 
ATOM   5715 C  CB  . ASN B 1 183 ? 113.200 52.384 100.641 1.00 34.67 ? 183  ASN B CB  1 
ATOM   5716 C  CG  . ASN B 1 183 ? 113.287 53.777 101.317 1.00 34.94 ? 183  ASN B CG  1 
ATOM   5717 O  OD1 . ASN B 1 183 ? 113.690 53.893 102.465 1.00 34.36 ? 183  ASN B OD1 1 
ATOM   5718 N  ND2 . ASN B 1 183 ? 112.854 54.813 100.613 1.00 29.68 ? 183  ASN B ND2 1 
ATOM   5719 N  N   . ILE B 1 184 ? 114.446 50.008 98.477  1.00 34.15 ? 184  ILE B N   1 
ATOM   5720 C  CA  . ILE B 1 184 ? 114.164 48.609 98.136  1.00 32.48 ? 184  ILE B CA  1 
ATOM   5721 C  C   . ILE B 1 184 ? 115.309 47.712 98.575  1.00 34.17 ? 184  ILE B C   1 
ATOM   5722 O  O   . ILE B 1 184 ? 115.102 46.535 98.879  1.00 34.66 ? 184  ILE B O   1 
ATOM   5723 C  CB  . ILE B 1 184 ? 113.683 48.408 96.648  1.00 31.22 ? 184  ILE B CB  1 
ATOM   5724 C  CG1 . ILE B 1 184 ? 112.828 47.130 96.491  1.00 31.40 ? 184  ILE B CG1 1 
ATOM   5725 C  CG2 . ILE B 1 184 ? 114.828 48.497 95.612  1.00 28.96 ? 184  ILE B CG2 1 
ATOM   5726 C  CD1 . ILE B 1 184 ? 111.408 47.215 97.104  1.00 31.50 ? 184  ILE B CD1 1 
ATOM   5727 N  N   . GLN B 1 185 ? 116.503 48.284 98.690  1.00 35.05 ? 185  GLN B N   1 
ATOM   5728 C  CA  . GLN B 1 185 ? 117.641 47.525 99.197  1.00 37.19 ? 185  GLN B CA  1 
ATOM   5729 C  C   . GLN B 1 185 ? 117.358 46.940 100.589 1.00 38.87 ? 185  GLN B C   1 
ATOM   5730 O  O   . GLN B 1 185 ? 117.928 45.914 100.959 1.00 40.28 ? 185  GLN B O   1 
ATOM   5731 C  CB  . GLN B 1 185 ? 118.926 48.371 99.192  1.00 37.87 ? 185  GLN B CB  1 
ATOM   5732 C  CG  . GLN B 1 185 ? 118.979 49.497 100.234 1.00 39.24 ? 185  GLN B CG  1 
ATOM   5733 C  CD  . GLN B 1 185 ? 120.038 50.552 99.906  1.00 43.97 ? 185  GLN B CD  1 
ATOM   5734 O  OE1 . GLN B 1 185 ? 119.894 51.333 98.954  1.00 41.09 ? 185  GLN B OE1 1 
ATOM   5735 N  NE2 . GLN B 1 185 ? 121.113 50.575 100.696 1.00 46.11 ? 185  GLN B NE2 1 
ATOM   5736 N  N   . PHE B 1 186 ? 116.469 47.585 101.343 1.00 38.77 ? 186  PHE B N   1 
ATOM   5737 C  CA  . PHE B 1 186 ? 116.133 47.136 102.703 1.00 40.82 ? 186  PHE B CA  1 
ATOM   5738 C  C   . PHE B 1 186 ? 115.217 45.936 102.706 1.00 41.19 ? 186  PHE B C   1 
ATOM   5739 O  O   . PHE B 1 186 ? 115.036 45.292 103.744 1.00 43.23 ? 186  PHE B O   1 
ATOM   5740 C  CB  . PHE B 1 186 ? 115.549 48.290 103.520 1.00 40.09 ? 186  PHE B CB  1 
ATOM   5741 C  CG  . PHE B 1 186 ? 116.476 49.452 103.600 1.00 41.62 ? 186  PHE B CG  1 
ATOM   5742 C  CD1 . PHE B 1 186 ? 117.724 49.305 104.186 1.00 43.68 ? 186  PHE B CD1 1 
ATOM   5743 C  CD2 . PHE B 1 186 ? 116.141 50.679 103.038 1.00 40.45 ? 186  PHE B CD2 1 
ATOM   5744 C  CE1 . PHE B 1 186 ? 118.613 50.385 104.240 1.00 46.81 ? 186  PHE B CE1 1 
ATOM   5745 C  CE2 . PHE B 1 186 ? 117.019 51.756 103.085 1.00 41.07 ? 186  PHE B CE2 1 
ATOM   5746 C  CZ  . PHE B 1 186 ? 118.250 51.612 103.675 1.00 43.59 ? 186  PHE B CZ  1 
ATOM   5747 N  N   . PHE B 1 187 ? 114.660 45.649 101.530 1.00 40.01 ? 187  PHE B N   1 
ATOM   5748 C  CA  . PHE B 1 187 ? 113.801 44.508 101.301 1.00 39.95 ? 187  PHE B CA  1 
ATOM   5749 C  C   . PHE B 1 187 ? 114.555 43.490 100.425 1.00 40.95 ? 187  PHE B C   1 
ATOM   5750 O  O   . PHE B 1 187 ? 113.972 42.581 99.869  1.00 41.44 ? 187  PHE B O   1 
ATOM   5751 C  CB  . PHE B 1 187 ? 112.477 44.976 100.641 1.00 37.45 ? 187  PHE B CB  1 
ATOM   5752 C  CG  . PHE B 1 187 ? 111.733 46.021 101.455 1.00 36.73 ? 187  PHE B CG  1 
ATOM   5753 C  CD1 . PHE B 1 187 ? 112.054 47.378 101.346 1.00 35.76 ? 187  PHE B CD1 1 
ATOM   5754 C  CD2 . PHE B 1 187 ? 110.735 45.645 102.350 1.00 35.39 ? 187  PHE B CD2 1 
ATOM   5755 C  CE1 . PHE B 1 187 ? 111.385 48.342 102.106 1.00 34.67 ? 187  PHE B CE1 1 
ATOM   5756 C  CE2 . PHE B 1 187 ? 110.061 46.599 103.135 1.00 36.14 ? 187  PHE B CE2 1 
ATOM   5757 C  CZ  . PHE B 1 187 ? 110.383 47.950 103.006 1.00 36.95 ? 187  PHE B CZ  1 
ATOM   5758 N  N   . GLY B 1 188 ? 115.863 43.640 100.295 1.00 42.46 ? 188  GLY B N   1 
ATOM   5759 C  CA  . GLY B 1 188 ? 116.616 42.667 99.512  1.00 43.35 ? 188  GLY B CA  1 
ATOM   5760 C  C   . GLY B 1 188 ? 116.319 42.766 98.026  1.00 42.00 ? 188  GLY B C   1 
ATOM   5761 O  O   . GLY B 1 188 ? 116.455 41.777 97.272  1.00 42.58 ? 188  GLY B O   1 
ATOM   5762 N  N   . GLY B 1 189 ? 115.930 43.961 97.594  1.00 40.29 ? 189  GLY B N   1 
ATOM   5763 C  CA  . GLY B 1 189 ? 115.747 44.231 96.171  1.00 39.05 ? 189  GLY B CA  1 
ATOM   5764 C  C   . GLY B 1 189 ? 116.987 44.922 95.662  1.00 39.17 ? 189  GLY B C   1 
ATOM   5765 O  O   . GLY B 1 189 ? 117.671 45.586 96.437  1.00 41.72 ? 189  GLY B O   1 
ATOM   5766 N  N   . ASP B 1 190 ? 117.292 44.792 94.378  1.00 37.68 ? 190  ASP B N   1 
ATOM   5767 C  CA  . ASP B 1 190 ? 118.380 45.556 93.791  1.00 38.00 ? 190  ASP B CA  1 
ATOM   5768 C  C   . ASP B 1 190 ? 117.803 46.805 93.121  1.00 36.63 ? 190  ASP B C   1 
ATOM   5769 O  O   . ASP B 1 190 ? 117.059 46.691 92.170  1.00 35.66 ? 190  ASP B O   1 
ATOM   5770 C  CB  . ASP B 1 190 ? 119.126 44.701 92.770  1.00 38.62 ? 190  ASP B CB  1 
ATOM   5771 C  CG  . ASP B 1 190 ? 120.250 45.450 92.077  1.00 41.44 ? 190  ASP B CG  1 
ATOM   5772 O  OD1 . ASP B 1 190 ? 120.516 46.635 92.386  1.00 43.60 ? 190  ASP B OD1 1 
ATOM   5773 O  OD2 . ASP B 1 190 ? 120.882 44.838 91.199  1.00 44.87 ? 190  ASP B OD2 1 
ATOM   5774 N  N   . PRO B 1 191 ? 118.143 48.007 93.612  1.00 36.81 ? 191  PRO B N   1 
ATOM   5775 C  CA  . PRO B 1 191 ? 117.610 49.212 92.946  1.00 35.33 ? 191  PRO B CA  1 
ATOM   5776 C  C   . PRO B 1 191 ? 118.237 49.513 91.554  1.00 34.95 ? 191  PRO B C   1 
ATOM   5777 O  O   . PRO B 1 191 ? 117.774 50.387 90.841  1.00 34.46 ? 191  PRO B O   1 
ATOM   5778 C  CB  . PRO B 1 191 ? 117.890 50.307 93.959  1.00 36.10 ? 191  PRO B CB  1 
ATOM   5779 C  CG  . PRO B 1 191 ? 119.138 49.808 94.735  1.00 37.11 ? 191  PRO B CG  1 
ATOM   5780 C  CD  . PRO B 1 191 ? 118.896 48.329 94.842  1.00 38.08 ? 191  PRO B CD  1 
ATOM   5781 N  N   . LYS B 1 192 ? 119.252 48.763 91.159  1.00 35.98 ? 192  LYS B N   1 
ATOM   5782 C  CA  . LYS B 1 192 ? 119.854 48.899 89.837  1.00 35.50 ? 192  LYS B CA  1 
ATOM   5783 C  C   . LYS B 1 192 ? 119.221 47.937 88.833  1.00 34.55 ? 192  LYS B C   1 
ATOM   5784 O  O   . LYS B 1 192 ? 119.542 47.962 87.648  1.00 34.68 ? 192  LYS B O   1 
ATOM   5785 C  CB  . LYS B 1 192 ? 121.372 48.667 89.916  1.00 37.78 ? 192  LYS B CB  1 
ATOM   5786 C  CG  . LYS B 1 192 ? 122.154 49.850 90.547  1.00 39.41 ? 192  LYS B CG  1 
ATOM   5787 C  CD  . LYS B 1 192 ? 123.515 49.443 91.156  1.00 43.61 ? 192  LYS B CD  1 
ATOM   5788 C  CE  . LYS B 1 192 ? 124.669 49.471 90.160  1.00 46.57 ? 192  LYS B CE  1 
ATOM   5789 N  NZ  . LYS B 1 192 ? 124.504 50.398 88.969  1.00 49.06 ? 192  LYS B NZ  1 
ATOM   5790 N  N   . THR B 1 193 ? 118.292 47.118 89.299  1.00 33.52 ? 193  THR B N   1 
ATOM   5791 C  CA  . THR B 1 193 ? 117.603 46.176 88.437  1.00 32.85 ? 193  THR B CA  1 
ATOM   5792 C  C   . THR B 1 193 ? 116.071 46.272 88.695  1.00 32.11 ? 193  THR B C   1 
ATOM   5793 O  O   . THR B 1 193 ? 115.404 45.306 89.076  1.00 31.75 ? 193  THR B O   1 
ATOM   5794 C  CB  . THR B 1 193 ? 118.210 44.740 88.610  1.00 34.03 ? 193  THR B CB  1 
ATOM   5795 O  OG1 . THR B 1 193 ? 119.656 44.825 88.647  1.00 36.27 ? 193  THR B OG1 1 
ATOM   5796 C  CG2 . THR B 1 193 ? 117.821 43.826 87.467  1.00 32.57 ? 193  THR B CG2 1 
ATOM   5797 N  N   . VAL B 1 194 ? 115.526 47.472 88.517  1.00 31.13 ? 194  VAL B N   1 
ATOM   5798 C  CA  . VAL B 1 194 ? 114.082 47.657 88.589  1.00 29.96 ? 194  VAL B CA  1 
ATOM   5799 C  C   . VAL B 1 194 ? 113.403 47.593 87.185  1.00 29.41 ? 194  VAL B C   1 
ATOM   5800 O  O   . VAL B 1 194 ? 113.771 48.354 86.293  1.00 29.34 ? 194  VAL B O   1 
ATOM   5801 C  CB  . VAL B 1 194 ? 113.736 48.991 89.308  1.00 29.75 ? 194  VAL B CB  1 
ATOM   5802 C  CG1 . VAL B 1 194 ? 112.230 49.153 89.442  1.00 27.48 ? 194  VAL B CG1 1 
ATOM   5803 C  CG2 . VAL B 1 194 ? 114.417 49.061 90.687  1.00 30.04 ? 194  VAL B CG2 1 
ATOM   5804 N  N   . THR B 1 195 ? 112.438 46.685 86.990  1.00 27.69 ? 195  THR B N   1 
ATOM   5805 C  CA  . THR B 1 195 ? 111.574 46.737 85.811  1.00 26.07 ? 195  THR B CA  1 
ATOM   5806 C  C   . THR B 1 195 ? 110.247 47.381 86.189  1.00 25.89 ? 195  THR B C   1 
ATOM   5807 O  O   . THR B 1 195 ? 109.600 46.958 87.163  1.00 25.24 ? 195  THR B O   1 
ATOM   5808 C  CB  . THR B 1 195 ? 111.265 45.342 85.234  1.00 27.50 ? 195  THR B CB  1 
ATOM   5809 O  OG1 . THR B 1 195 ? 112.463 44.784 84.695  1.00 26.63 ? 195  THR B OG1 1 
ATOM   5810 C  CG2 . THR B 1 195 ? 110.142 45.399 84.120  1.00 23.58 ? 195  THR B CG2 1 
ATOM   5811 N  N   . ILE B 1 196 ? 109.848 48.421 85.449  1.00 24.85 ? 196  ILE B N   1 
ATOM   5812 C  CA  . ILE B 1 196 ? 108.500 48.947 85.625  1.00 24.06 ? 196  ILE B CA  1 
ATOM   5813 C  C   . ILE B 1 196 ? 107.566 48.310 84.636  1.00 23.63 ? 196  ILE B C   1 
ATOM   5814 O  O   . ILE B 1 196 ? 107.929 48.114 83.460  1.00 24.21 ? 196  ILE B O   1 
ATOM   5815 C  CB  . ILE B 1 196 ? 108.449 50.486 85.537  1.00 23.95 ? 196  ILE B CB  1 
ATOM   5816 C  CG1 . ILE B 1 196 ? 109.000 50.995 84.188  1.00 23.90 ? 196  ILE B CG1 1 
ATOM   5817 C  CG2 . ILE B 1 196 ? 109.182 51.077 86.768  1.00 24.29 ? 196  ILE B CG2 1 
ATOM   5818 C  CD1 . ILE B 1 196 ? 108.799 52.526 83.958  1.00 20.78 ? 196  ILE B CD1 1 
ATOM   5819 N  N   . PHE B 1 197 ? 106.374 47.947 85.087  1.00 23.66 ? 197  PHE B N   1 
ATOM   5820 C  CA  . PHE B 1 197 ? 105.432 47.340 84.160  1.00 23.46 ? 197  PHE B CA  1 
ATOM   5821 C  C   . PHE B 1 197 ? 103.994 47.694 84.447  1.00 24.37 ? 197  PHE B C   1 
ATOM   5822 O  O   . PHE B 1 197 ? 103.603 47.914 85.599  1.00 23.89 ? 197  PHE B O   1 
ATOM   5823 C  CB  . PHE B 1 197 ? 105.679 45.829 83.994  1.00 24.05 ? 197  PHE B CB  1 
ATOM   5824 C  CG  . PHE B 1 197 ? 105.219 44.943 85.163  1.00 23.31 ? 197  PHE B CG  1 
ATOM   5825 C  CD1 . PHE B 1 197 ? 105.662 45.160 86.465  1.00 24.00 ? 197  PHE B CD1 1 
ATOM   5826 C  CD2 . PHE B 1 197 ? 104.452 43.802 84.906  1.00 23.54 ? 197  PHE B CD2 1 
ATOM   5827 C  CE1 . PHE B 1 197 ? 105.276 44.302 87.521  1.00 23.41 ? 197  PHE B CE1 1 
ATOM   5828 C  CE2 . PHE B 1 197 ? 104.028 42.939 85.949  1.00 24.75 ? 197  PHE B CE2 1 
ATOM   5829 C  CZ  . PHE B 1 197 ? 104.439 43.184 87.260  1.00 25.36 ? 197  PHE B CZ  1 
ATOM   5830 N  N   . GLY B 1 198 ? 103.191 47.774 83.382  1.00 24.88 ? 198  GLY B N   1 
ATOM   5831 C  CA  . GLY B 1 198 ? 101.777 48.106 83.586  1.00 24.66 ? 198  GLY B CA  1 
ATOM   5832 C  C   . GLY B 1 198 ? 100.954 47.912 82.341  1.00 24.93 ? 198  GLY B C   1 
ATOM   5833 O  O   . GLY B 1 198 ? 101.490 47.774 81.248  1.00 25.66 ? 198  GLY B O   1 
ATOM   5834 N  N   . GLU B 1 199 ? 99.644  47.970 82.511  1.00 25.03 ? 199  GLU B N   1 
ATOM   5835 C  CA  . GLU B 1 199 ? 98.729  47.660 81.461  1.00 24.50 ? 199  GLU B CA  1 
ATOM   5836 C  C   . GLU B 1 199 ? 97.867  48.847 81.134  1.00 24.57 ? 199  GLU B C   1 
ATOM   5837 O  O   . GLU B 1 199 ? 97.417  49.584 82.033  1.00 25.06 ? 199  GLU B O   1 
ATOM   5838 C  CB  . GLU B 1 199 ? 97.888  46.448 81.863  1.00 24.56 ? 199  GLU B CB  1 
ATOM   5839 C  CG  . GLU B 1 199 ? 97.012  45.879 80.759  1.00 25.13 ? 199  GLU B CG  1 
ATOM   5840 C  CD  . GLU B 1 199 ? 95.594  46.433 80.862  1.00 27.22 ? 199  GLU B CD  1 
ATOM   5841 O  OE1 . GLU B 1 199 ? 95.309  47.123 81.871  1.00 26.24 ? 199  GLU B OE1 1 
ATOM   5842 O  OE2 . GLU B 1 199 ? 94.769  46.209 79.959  1.00 26.46 ? 199  GLU B OE2 1 
ATOM   5843 N  N   . SER B 1 200 ? 97.629  49.013 79.839  1.00 24.15 ? 200  SER B N   1 
ATOM   5844 C  CA  . SER B 1 200 ? 96.745  50.045 79.324  1.00 25.50 ? 200  SER B CA  1 
ATOM   5845 C  C   . SER B 1 200 ? 97.275  51.426 79.791  1.00 25.15 ? 200  SER B C   1 
ATOM   5846 O  O   . SER B 1 200 ? 98.407  51.737 79.497  1.00 24.88 ? 200  SER B O   1 
ATOM   5847 C  CB  . SER B 1 200 ? 95.329  49.766 79.794  1.00 25.45 ? 200  SER B CB  1 
ATOM   5848 O  OG  . SER B 1 200 ? 94.422  50.490 79.004  1.00 31.42 ? 200  SER B OG  1 
ATOM   5849 N  N   . ALA B 1 201 ? 96.514  52.193 80.586  1.00 25.13 ? 201  ALA B N   1 
ATOM   5850 C  CA  . ALA B 1 201 ? 97.032  53.464 81.141  1.00 24.64 ? 201  ALA B CA  1 
ATOM   5851 C  C   . ALA B 1 201 ? 98.340  53.241 81.899  1.00 24.36 ? 201  ALA B C   1 
ATOM   5852 O  O   . ALA B 1 201 ? 99.242  54.071 81.835  1.00 24.04 ? 201  ALA B O   1 
ATOM   5853 C  CB  . ALA B 1 201 ? 96.000  54.154 82.006  1.00 24.04 ? 201  ALA B CB  1 
ATOM   5854 N  N   . GLY B 1 202 ? 98.451  52.090 82.561  1.00 24.46 ? 202  GLY B N   1 
ATOM   5855 C  CA  . GLY B 1 202 ? 99.719  51.645 83.187  1.00 24.86 ? 202  GLY B CA  1 
ATOM   5856 C  C   . GLY B 1 202 ? 100.860 51.469 82.180  1.00 24.40 ? 202  GLY B C   1 
ATOM   5857 O  O   . GLY B 1 202 ? 102.011 51.884 82.427  1.00 24.36 ? 202  GLY B O   1 
ATOM   5858 N  N   . GLY B 1 203 ? 100.541 50.877 81.032  1.00 24.62 ? 203  GLY B N   1 
ATOM   5859 C  CA  . GLY B 1 203 ? 101.522 50.720 79.938  1.00 24.54 ? 203  GLY B CA  1 
ATOM   5860 C  C   . GLY B 1 203 ? 101.847 52.079 79.302  1.00 24.87 ? 203  GLY B C   1 
ATOM   5861 O  O   . GLY B 1 203 ? 103.004 52.377 78.984  1.00 25.81 ? 203  GLY B O   1 
ATOM   5862 N  N   . ALA B 1 204 ? 100.845 52.907 79.085  1.00 23.36 ? 204  ALA B N   1 
ATOM   5863 C  CA  . ALA B 1 204 ? 101.136 54.224 78.562  1.00 24.26 ? 204  ALA B CA  1 
ATOM   5864 C  C   . ALA B 1 204 ? 102.078 54.963 79.528  1.00 24.04 ? 204  ALA B C   1 
ATOM   5865 O  O   . ALA B 1 204 ? 103.056 55.570 79.082  1.00 24.78 ? 204  ALA B O   1 
ATOM   5866 C  CB  . ALA B 1 204 ? 99.849  55.008 78.340  1.00 23.87 ? 204  ALA B CB  1 
ATOM   5867 N  N   . SER B 1 205 ? 101.800 54.855 80.843  1.00 22.71 ? 205  SER B N   1 
ATOM   5868 C  CA  . SER B 1 205 ? 102.637 55.433 81.893  1.00 23.38 ? 205  SER B CA  1 
ATOM   5869 C  C   . SER B 1 205 ? 104.098 54.972 81.810  1.00 23.58 ? 205  SER B C   1 
ATOM   5870 O  O   . SER B 1 205 ? 104.990 55.805 81.815  1.00 23.94 ? 205  SER B O   1 
ATOM   5871 C  CB  . SER B 1 205 ? 102.110 55.102 83.289  1.00 23.43 ? 205  SER B CB  1 
ATOM   5872 O  OG  . SER B 1 205 ? 100.888 55.747 83.556  1.00 25.20 ? 205  SER B OG  1 
ATOM   5873 N  N   . VAL B 1 206 ? 104.329 53.646 81.734  1.00 23.34 ? 206  VAL B N   1 
ATOM   5874 C  CA  . VAL B 1 206 ? 105.666 53.116 81.537  1.00 22.21 ? 206  VAL B CA  1 
ATOM   5875 C  C   . VAL B 1 206 ? 106.364 53.834 80.383  1.00 23.55 ? 206  VAL B C   1 
ATOM   5876 O  O   . VAL B 1 206 ? 107.484 54.314 80.550  1.00 24.08 ? 206  VAL B O   1 
ATOM   5877 C  CB  . VAL B 1 206 ? 105.668 51.599 81.307  1.00 22.25 ? 206  VAL B CB  1 
ATOM   5878 C  CG1 . VAL B 1 206 ? 107.049 51.143 80.893  1.00 21.30 ? 206  VAL B CG1 1 
ATOM   5879 C  CG2 . VAL B 1 206 ? 105.205 50.839 82.585  1.00 19.86 ? 206  VAL B CG2 1 
ATOM   5880 N  N   . GLY B 1 207 ? 105.691 53.944 79.231  1.00 23.96 ? 207  GLY B N   1 
ATOM   5881 C  CA  . GLY B 1 207 ? 106.244 54.654 78.065  1.00 24.13 ? 207  GLY B CA  1 
ATOM   5882 C  C   . GLY B 1 207 ? 106.511 56.127 78.374  1.00 24.60 ? 207  GLY B C   1 
ATOM   5883 O  O   . GLY B 1 207 ? 107.447 56.725 77.865  1.00 24.97 ? 207  GLY B O   1 
ATOM   5884 N  N   . MET B 1 208 ? 105.667 56.739 79.189  1.00 24.07 ? 208  MET B N   1 
ATOM   5885 C  CA  . MET B 1 208 ? 105.878 58.158 79.509  1.00 24.70 ? 208  MET B CA  1 
ATOM   5886 C  C   . MET B 1 208 ? 107.114 58.288 80.393  1.00 24.78 ? 208  MET B C   1 
ATOM   5887 O  O   . MET B 1 208 ? 107.814 59.286 80.303  1.00 23.69 ? 208  MET B O   1 
ATOM   5888 C  CB  . MET B 1 208 ? 104.626 58.775 80.172  1.00 23.66 ? 208  MET B CB  1 
ATOM   5889 C  CG  . MET B 1 208 ? 103.478 58.832 79.199  1.00 24.90 ? 208  MET B CG  1 
ATOM   5890 S  SD  . MET B 1 208 ? 101.876 59.199 79.908  1.00 30.10 ? 208  MET B SD  1 
ATOM   5891 C  CE  . MET B 1 208 ? 101.004 59.564 78.373  1.00 24.92 ? 208  MET B CE  1 
ATOM   5892 N  N   . HIS B 1 209 ? 107.403 57.275 81.219  1.00 23.90 ? 209  HIS B N   1 
ATOM   5893 C  CA  . HIS B 1 209 ? 108.614 57.359 82.070  1.00 26.24 ? 209  HIS B CA  1 
ATOM   5894 C  C   . HIS B 1 209 ? 109.878 57.129 81.259  1.00 28.45 ? 209  HIS B C   1 
ATOM   5895 O  O   . HIS B 1 209 ? 110.928 57.745 81.524  1.00 30.89 ? 209  HIS B O   1 
ATOM   5896 C  CB  . HIS B 1 209 ? 108.575 56.383 83.242  1.00 25.28 ? 209  HIS B CB  1 
ATOM   5897 C  CG  . HIS B 1 209 ? 107.526 56.718 84.242  1.00 26.28 ? 209  HIS B CG  1 
ATOM   5898 N  ND1 . HIS B 1 209 ? 107.584 57.861 85.019  1.00 27.69 ? 209  HIS B ND1 1 
ATOM   5899 C  CD2 . HIS B 1 209 ? 106.377 56.083 84.579  1.00 23.80 ? 209  HIS B CD2 1 
ATOM   5900 C  CE1 . HIS B 1 209 ? 106.515 57.909 85.798  1.00 27.31 ? 209  HIS B CE1 1 
ATOM   5901 N  NE2 . HIS B 1 209 ? 105.772 56.838 85.558  1.00 26.11 ? 209  HIS B NE2 1 
ATOM   5902 N  N   . ILE B 1 210 ? 109.776 56.240 80.277  1.00 28.56 ? 210  ILE B N   1 
ATOM   5903 C  CA  . ILE B 1 210 ? 110.817 56.044 79.301  1.00 29.01 ? 210  ILE B CA  1 
ATOM   5904 C  C   . ILE B 1 210 ? 111.194 57.378 78.645  1.00 30.77 ? 210  ILE B C   1 
ATOM   5905 O  O   . ILE B 1 210 ? 112.386 57.659 78.444  1.00 31.56 ? 210  ILE B O   1 
ATOM   5906 C  CB  . ILE B 1 210 ? 110.343 55.020 78.245  1.00 28.73 ? 210  ILE B CB  1 
ATOM   5907 C  CG1 . ILE B 1 210 ? 110.493 53.601 78.823  1.00 27.57 ? 210  ILE B CG1 1 
ATOM   5908 C  CG2 . ILE B 1 210 ? 111.088 55.190 76.896  1.00 26.59 ? 210  ILE B CG2 1 
ATOM   5909 C  CD1 . ILE B 1 210 ? 109.922 52.472 77.912  1.00 29.20 ? 210  ILE B CD1 1 
ATOM   5910 N  N   . LEU B 1 211 ? 110.184 58.184 78.316  1.00 30.77 ? 211  LEU B N   1 
ATOM   5911 C  CA  . LEU B 1 211 ? 110.399 59.435 77.573  1.00 32.15 ? 211  LEU B CA  1 
ATOM   5912 C  C   . LEU B 1 211 ? 110.941 60.544 78.476  1.00 33.46 ? 211  LEU B C   1 
ATOM   5913 O  O   . LEU B 1 211 ? 111.979 61.153 78.171  1.00 35.73 ? 211  LEU B O   1 
ATOM   5914 C  CB  . LEU B 1 211 ? 109.108 59.869 76.869  1.00 31.63 ? 211  LEU B CB  1 
ATOM   5915 C  CG  . LEU B 1 211 ? 108.699 58.927 75.722  1.00 32.44 ? 211  LEU B CG  1 
ATOM   5916 C  CD1 . LEU B 1 211 ? 107.258 59.135 75.350  1.00 33.32 ? 211  LEU B CD1 1 
ATOM   5917 C  CD2 . LEU B 1 211 ? 109.555 59.091 74.490  1.00 33.81 ? 211  LEU B CD2 1 
ATOM   5918 N  N   . SER B 1 212 ? 110.289 60.728 79.623  1.00 32.73 ? 212  SER B N   1 
ATOM   5919 C  CA  . SER B 1 212 ? 110.542 61.816 80.559  1.00 33.88 ? 212  SER B CA  1 
ATOM   5920 C  C   . SER B 1 212 ? 111.940 61.810 81.177  1.00 34.95 ? 212  SER B C   1 
ATOM   5921 O  O   . SER B 1 212 ? 112.268 60.881 81.922  1.00 34.82 ? 212  SER B O   1 
ATOM   5922 C  CB  . SER B 1 212 ? 109.514 61.774 81.688  1.00 32.18 ? 212  SER B CB  1 
ATOM   5923 O  OG  . SER B 1 212 ? 109.655 62.907 82.538  1.00 34.40 ? 212  SER B OG  1 
ATOM   5924 N  N   . PRO B 1 213 ? 112.757 62.851 80.895  1.00 35.81 ? 213  PRO B N   1 
ATOM   5925 C  CA  . PRO B 1 213 ? 114.125 62.855 81.456  1.00 37.26 ? 213  PRO B CA  1 
ATOM   5926 C  C   . PRO B 1 213 ? 114.140 62.660 82.989  1.00 37.51 ? 213  PRO B C   1 
ATOM   5927 O  O   . PRO B 1 213 ? 115.007 61.952 83.496  1.00 37.96 ? 213  PRO B O   1 
ATOM   5928 C  CB  . PRO B 1 213 ? 114.686 64.251 81.056  1.00 38.99 ? 213  PRO B CB  1 
ATOM   5929 C  CG  . PRO B 1 213 ? 113.968 64.575 79.747  1.00 37.40 ? 213  PRO B CG  1 
ATOM   5930 C  CD  . PRO B 1 213 ? 112.540 63.962 79.944  1.00 37.07 ? 213  PRO B CD  1 
ATOM   5931 N  N   . GLY B 1 214 ? 113.182 63.258 83.708  1.00 36.98 ? 214  GLY B N   1 
ATOM   5932 C  CA  . GLY B 1 214 ? 113.119 63.150 85.180  1.00 36.51 ? 214  GLY B CA  1 
ATOM   5933 C  C   . GLY B 1 214 ? 112.822 61.765 85.776  1.00 35.22 ? 214  GLY B C   1 
ATOM   5934 O  O   . GLY B 1 214 ? 113.000 61.576 86.968  1.00 35.26 ? 214  GLY B O   1 
ATOM   5935 N  N   . SER B 1 215 ? 112.399 60.801 84.950  1.00 33.70 ? 215  SER B N   1 
ATOM   5936 C  CA  . SER B 1 215 ? 112.074 59.441 85.414  1.00 32.68 ? 215  SER B CA  1 
ATOM   5937 C  C   . SER B 1 215 ? 113.126 58.403 85.025  1.00 33.19 ? 215  SER B C   1 
ATOM   5938 O  O   . SER B 1 215 ? 113.199 57.314 85.612  1.00 32.68 ? 215  SER B O   1 
ATOM   5939 C  CB  . SER B 1 215 ? 110.722 58.980 84.827  1.00 31.06 ? 215  SER B CB  1 
ATOM   5940 O  OG  . SER B 1 215 ? 109.616 59.720 85.338  1.00 28.88 ? 215  SER B OG  1 
ATOM   5941 N  N   . ARG B 1 216 ? 113.919 58.724 84.009  1.00 34.51 ? 216  ARG B N   1 
ATOM   5942 C  CA  . ARG B 1 216 ? 114.775 57.728 83.337  1.00 35.73 ? 216  ARG B CA  1 
ATOM   5943 C  C   . ARG B 1 216 ? 115.723 56.934 84.230  1.00 34.77 ? 216  ARG B C   1 
ATOM   5944 O  O   . ARG B 1 216 ? 115.894 55.723 84.056  1.00 34.50 ? 216  ARG B O   1 
ATOM   5945 C  CB  . ARG B 1 216 ? 115.565 58.399 82.226  1.00 37.54 ? 216  ARG B CB  1 
ATOM   5946 C  CG  . ARG B 1 216 ? 114.686 58.777 81.045  1.00 40.30 ? 216  ARG B CG  1 
ATOM   5947 C  CD  . ARG B 1 216 ? 115.550 59.425 79.996  1.00 42.87 ? 216  ARG B CD  1 
ATOM   5948 N  NE  . ARG B 1 216 ? 114.745 60.238 79.099  1.00 44.05 ? 216  ARG B NE  1 
ATOM   5949 C  CZ  . ARG B 1 216 ? 115.254 61.000 78.148  1.00 44.28 ? 216  ARG B CZ  1 
ATOM   5950 N  NH1 . ARG B 1 216 ? 116.568 61.025 77.965  1.00 43.21 ? 216  ARG B NH1 1 
ATOM   5951 N  NH2 . ARG B 1 216 ? 114.442 61.716 77.382  1.00 45.38 ? 216  ARG B NH2 1 
ATOM   5952 N  N   . ASP B 1 217 ? 116.321 57.610 85.193  1.00 34.46 ? 217  ASP B N   1 
ATOM   5953 C  CA  . ASP B 1 217 ? 117.328 56.960 86.023  1.00 34.55 ? 217  ASP B CA  1 
ATOM   5954 C  C   . ASP B 1 217 ? 116.702 56.188 87.175  1.00 32.69 ? 217  ASP B C   1 
ATOM   5955 O  O   . ASP B 1 217 ? 117.418 55.616 88.010  1.00 33.81 ? 217  ASP B O   1 
ATOM   5956 C  CB  . ASP B 1 217 ? 118.334 57.985 86.530  1.00 35.70 ? 217  ASP B CB  1 
ATOM   5957 C  CG  . ASP B 1 217 ? 119.089 58.686 85.381  1.00 39.44 ? 217  ASP B CG  1 
ATOM   5958 O  OD1 . ASP B 1 217 ? 119.535 58.013 84.440  1.00 41.39 ? 217  ASP B OD1 1 
ATOM   5959 O  OD2 . ASP B 1 217 ? 119.245 59.915 85.419  1.00 42.77 ? 217  ASP B OD2 1 
ATOM   5960 N  N   . LEU B 1 218 ? 115.373 56.131 87.204  1.00 30.07 ? 218  LEU B N   1 
ATOM   5961 C  CA  . LEU B 1 218 ? 114.686 55.473 88.315  1.00 29.26 ? 218  LEU B CA  1 
ATOM   5962 C  C   . LEU B 1 218 ? 114.238 54.040 88.034  1.00 28.93 ? 218  LEU B C   1 
ATOM   5963 O  O   . LEU B 1 218 ? 113.549 53.429 88.877  1.00 28.45 ? 218  LEU B O   1 
ATOM   5964 C  CB  . LEU B 1 218 ? 113.506 56.297 88.815  1.00 27.65 ? 218  LEU B CB  1 
ATOM   5965 C  CG  . LEU B 1 218 ? 113.792 57.720 89.278  1.00 28.94 ? 218  LEU B CG  1 
ATOM   5966 C  CD1 . LEU B 1 218 ? 112.470 58.319 89.646  1.00 26.78 ? 218  LEU B CD1 1 
ATOM   5967 C  CD2 . LEU B 1 218 ? 114.740 57.768 90.456  1.00 29.84 ? 218  LEU B CD2 1 
ATOM   5968 N  N   . PHE B 1 219 ? 114.599 53.506 86.862  1.00 27.64 ? 219  PHE B N   1 
ATOM   5969 C  CA  . PHE B 1 219 ? 114.307 52.096 86.575  1.00 27.46 ? 219  PHE B CA  1 
ATOM   5970 C  C   . PHE B 1 219 ? 115.291 51.645 85.506  1.00 27.98 ? 219  PHE B C   1 
ATOM   5971 O  O   . PHE B 1 219 ? 115.895 52.472 84.829  1.00 27.96 ? 219  PHE B O   1 
ATOM   5972 C  CB  . PHE B 1 219 ? 112.853 51.905 86.128  1.00 25.20 ? 219  PHE B CB  1 
ATOM   5973 C  CG  . PHE B 1 219 ? 112.524 52.640 84.866  1.00 24.97 ? 219  PHE B CG  1 
ATOM   5974 C  CD1 . PHE B 1 219 ? 112.285 54.021 84.897  1.00 22.96 ? 219  PHE B CD1 1 
ATOM   5975 C  CD2 . PHE B 1 219 ? 112.537 51.977 83.631  1.00 22.20 ? 219  PHE B CD2 1 
ATOM   5976 C  CE1 . PHE B 1 219 ? 112.009 54.728 83.719  1.00 25.28 ? 219  PHE B CE1 1 
ATOM   5977 C  CE2 . PHE B 1 219 ? 112.251 52.674 82.445  1.00 25.73 ? 219  PHE B CE2 1 
ATOM   5978 C  CZ  . PHE B 1 219 ? 111.995 54.048 82.484  1.00 23.48 ? 219  PHE B CZ  1 
ATOM   5979 N  N   . ARG B 1 220 ? 115.489 50.339 85.432  1.00 28.84 ? 220  ARG B N   1 
ATOM   5980 C  CA  . ARG B 1 220 ? 116.451 49.706 84.535  1.00 29.47 ? 220  ARG B CA  1 
ATOM   5981 C  C   . ARG B 1 220 ? 115.821 49.415 83.157  1.00 29.09 ? 220  ARG B C   1 
ATOM   5982 O  O   . ARG B 1 220 ? 116.470 49.620 82.113  1.00 29.76 ? 220  ARG B O   1 
ATOM   5983 C  CB  . ARG B 1 220 ? 116.957 48.413 85.159  1.00 30.02 ? 220  ARG B CB  1 
ATOM   5984 C  CG  . ARG B 1 220 ? 117.875 47.605 84.240  1.00 33.07 ? 220  ARG B CG  1 
ATOM   5985 C  CD  . ARG B 1 220 ? 119.163 48.363 84.065  1.00 35.73 ? 220  ARG B CD  1 
ATOM   5986 N  NE  . ARG B 1 220 ? 120.205 47.543 83.468  1.00 39.48 ? 220  ARG B NE  1 
ATOM   5987 C  CZ  . ARG B 1 220 ? 120.951 46.669 84.149  1.00 41.59 ? 220  ARG B CZ  1 
ATOM   5988 N  NH1 . ARG B 1 220 ? 120.776 46.497 85.469  1.00 38.48 ? 220  ARG B NH1 1 
ATOM   5989 N  NH2 . ARG B 1 220 ? 121.893 45.984 83.509  1.00 40.39 ? 220  ARG B NH2 1 
ATOM   5990 N  N   . ARG B 1 221 ? 114.585 48.920 83.158  1.00 27.68 ? 221  ARG B N   1 
ATOM   5991 C  CA  . ARG B 1 221 ? 113.890 48.599 81.914  1.00 27.84 ? 221  ARG B CA  1 
ATOM   5992 C  C   . ARG B 1 221 ? 112.401 48.407 82.134  1.00 27.51 ? 221  ARG B C   1 
ATOM   5993 O  O   . ARG B 1 221 ? 111.943 48.560 83.269  1.00 26.26 ? 221  ARG B O   1 
ATOM   5994 C  CB  . ARG B 1 221 ? 114.477 47.361 81.269  1.00 28.71 ? 221  ARG B CB  1 
ATOM   5995 C  CG  . ARG B 1 221 ? 114.663 46.195 82.164  1.00 29.45 ? 221  ARG B CG  1 
ATOM   5996 C  CD  . ARG B 1 221 ? 115.717 45.276 81.495  1.00 34.70 ? 221  ARG B CD  1 
ATOM   5997 N  NE  . ARG B 1 221 ? 116.277 44.486 82.545  1.00 35.18 ? 221  ARG B NE  1 
ATOM   5998 C  CZ  . ARG B 1 221 ? 117.536 44.133 82.680  1.00 31.75 ? 221  ARG B CZ  1 
ATOM   5999 N  NH1 . ARG B 1 221 ? 118.476 44.450 81.804  1.00 30.74 ? 221  ARG B NH1 1 
ATOM   6000 N  NH2 . ARG B 1 221 ? 117.825 43.442 83.745  1.00 33.53 ? 221  ARG B NH2 1 
ATOM   6001 N  N   . ALA B 1 222 ? 111.663 48.041 81.067  1.00 26.85 ? 222  ALA B N   1 
ATOM   6002 C  CA  . ALA B 1 222 ? 110.231 48.359 81.001  1.00 25.68 ? 222  ALA B CA  1 
ATOM   6003 C  C   . ALA B 1 222 ? 109.386 47.374 80.231  1.00 25.90 ? 222  ALA B C   1 
ATOM   6004 O  O   . ALA B 1 222 ? 109.775 46.927 79.129  1.00 25.44 ? 222  ALA B O   1 
ATOM   6005 C  CB  . ALA B 1 222 ? 110.032 49.759 80.376  1.00 25.61 ? 222  ALA B CB  1 
ATOM   6006 N  N   . ILE B 1 223 ? 108.213 47.073 80.795  1.00 24.72 ? 223  ILE B N   1 
ATOM   6007 C  CA  . ILE B 1 223 ? 107.242 46.246 80.097  1.00 25.08 ? 223  ILE B CA  1 
ATOM   6008 C  C   . ILE B 1 223 ? 105.943 46.987 79.887  1.00 25.22 ? 223  ILE B C   1 
ATOM   6009 O  O   . ILE B 1 223 ? 105.418 47.565 80.831  1.00 24.66 ? 223  ILE B O   1 
ATOM   6010 C  CB  . ILE B 1 223 ? 106.933 44.950 80.856  1.00 25.45 ? 223  ILE B CB  1 
ATOM   6011 C  CG1 . ILE B 1 223 ? 108.195 44.124 81.037  1.00 22.53 ? 223  ILE B CG1 1 
ATOM   6012 C  CG2 . ILE B 1 223 ? 105.878 44.134 80.114  1.00 25.94 ? 223  ILE B CG2 1 
ATOM   6013 C  CD1 . ILE B 1 223 ? 107.942 42.843 81.799  1.00 22.88 ? 223  ILE B CD1 1 
ATOM   6014 N  N   . LEU B 1 224 ? 105.425 46.968 78.651  1.00 25.46 ? 224  LEU B N   1 
ATOM   6015 C  CA  . LEU B 1 224 ? 104.191 47.659 78.376  1.00 24.87 ? 224  LEU B CA  1 
ATOM   6016 C  C   . LEU B 1 224 ? 103.142 46.715 77.816  1.00 25.50 ? 224  LEU B C   1 
ATOM   6017 O  O   . LEU B 1 224 ? 103.311 46.137 76.747  1.00 25.73 ? 224  LEU B O   1 
ATOM   6018 C  CB  . LEU B 1 224 ? 104.403 48.862 77.427  1.00 24.34 ? 224  LEU B CB  1 
ATOM   6019 C  CG  . LEU B 1 224 ? 105.442 49.966 77.685  1.00 25.97 ? 224  LEU B CG  1 
ATOM   6020 C  CD1 . LEU B 1 224 ? 106.935 49.548 77.464  1.00 24.67 ? 224  LEU B CD1 1 
ATOM   6021 C  CD2 . LEU B 1 224 ? 105.133 51.162 76.772  1.00 24.56 ? 224  LEU B CD2 1 
ATOM   6022 N  N   . GLN B 1 225 ? 102.021 46.604 78.525  1.00 25.46 ? 225  GLN B N   1 
ATOM   6023 C  CA  . GLN B 1 225 ? 100.942 45.720 78.129  1.00 25.37 ? 225  GLN B CA  1 
ATOM   6024 C  C   . GLN B 1 225 ? 99.729  46.542 77.625  1.00 25.41 ? 225  GLN B C   1 
ATOM   6025 O  O   . GLN B 1 225 ? 99.146  47.341 78.396  1.00 24.14 ? 225  GLN B O   1 
ATOM   6026 C  CB  . GLN B 1 225 ? 100.550 44.826 79.340  1.00 26.07 ? 225  GLN B CB  1 
ATOM   6027 C  CG  . GLN B 1 225 ? 101.682 43.879 79.800  1.00 26.26 ? 225  GLN B CG  1 
ATOM   6028 C  CD  . GLN B 1 225 ? 101.465 43.290 81.193  1.00 26.43 ? 225  GLN B CD  1 
ATOM   6029 O  OE1 . GLN B 1 225 ? 102.428 43.071 81.950  1.00 23.96 ? 225  GLN B OE1 1 
ATOM   6030 N  NE2 . GLN B 1 225 ? 100.203 43.030 81.537  1.00 24.42 ? 225  GLN B NE2 1 
ATOM   6031 N  N   . SER B 1 226 ? 99.361  46.369 76.348  1.00 24.22 ? 226  SER B N   1 
ATOM   6032 C  CA  . SER B 1 226 ? 98.153  47.030 75.801  1.00 24.38 ? 226  SER B CA  1 
ATOM   6033 C  C   . SER B 1 226 ? 98.124  48.534 76.089  1.00 24.23 ? 226  SER B C   1 
ATOM   6034 O  O   . SER B 1 226 ? 97.088  49.083 76.474  1.00 24.23 ? 226  SER B O   1 
ATOM   6035 C  CB  . SER B 1 226 ? 96.872  46.377 76.350  1.00 23.86 ? 226  SER B CB  1 
ATOM   6036 O  OG  . SER B 1 226 ? 96.941  44.933 76.227  1.00 24.60 ? 226  SER B OG  1 
ATOM   6037 N  N   . GLY B 1 227 ? 99.244  49.211 75.888  1.00 23.28 ? 227  GLY B N   1 
ATOM   6038 C  CA  . GLY B 1 227 ? 99.264  50.671 76.061  1.00 22.79 ? 227  GLY B CA  1 
ATOM   6039 C  C   . GLY B 1 227 ? 100.617 51.234 75.658  1.00 23.43 ? 227  GLY B C   1 
ATOM   6040 O  O   . GLY B 1 227 ? 101.633 50.546 75.781  1.00 22.12 ? 227  GLY B O   1 
ATOM   6041 N  N   . SER B 1 228 ? 100.641 52.472 75.142  1.00 24.20 ? 228  SER B N   1 
ATOM   6042 C  CA  . SER B 1 228 ? 101.891 53.146 74.907  1.00 24.38 ? 228  SER B CA  1 
ATOM   6043 C  C   . SER B 1 228 ? 101.674 54.655 74.993  1.00 25.32 ? 228  SER B C   1 
ATOM   6044 O  O   . SER B 1 228 ? 100.526 55.118 74.943  1.00 25.37 ? 228  SER B O   1 
ATOM   6045 C  CB  . SER B 1 228 ? 102.487 52.729 73.566  1.00 26.48 ? 228  SER B CB  1 
ATOM   6046 O  OG  . SER B 1 228 ? 101.586 52.960 72.510  1.00 28.19 ? 228  SER B OG  1 
ATOM   6047 N  N   . PRO B 1 229 ? 102.770 55.427 75.140  1.00 24.29 ? 229  PRO B N   1 
ATOM   6048 C  CA  . PRO B 1 229 ? 102.608 56.809 75.526  1.00 24.85 ? 229  PRO B CA  1 
ATOM   6049 C  C   . PRO B 1 229 ? 101.892 57.669 74.484  1.00 25.50 ? 229  PRO B C   1 
ATOM   6050 O  O   . PRO B 1 229 ? 101.257 58.642 74.854  1.00 26.14 ? 229  PRO B O   1 
ATOM   6051 C  CB  . PRO B 1 229 ? 104.065 57.286 75.739  1.00 24.48 ? 229  PRO B CB  1 
ATOM   6052 C  CG  . PRO B 1 229 ? 104.879 56.371 74.852  1.00 25.97 ? 229  PRO B CG  1 
ATOM   6053 C  CD  . PRO B 1 229 ? 104.188 55.045 75.078  1.00 24.23 ? 229  PRO B CD  1 
ATOM   6054 N  N   . ASN B 1 230 ? 102.039 57.311 73.203  1.00 26.46 ? 230  ASN B N   1 
ATOM   6055 C  CA  . ASN B 1 230 ? 101.489 58.012 72.052  1.00 26.24 ? 230  ASN B CA  1 
ATOM   6056 C  C   . ASN B 1 230 ? 99.998  57.650 71.749  1.00 27.10 ? 230  ASN B C   1 
ATOM   6057 O  O   . ASN B 1 230 ? 99.426  58.134 70.751  1.00 28.09 ? 230  ASN B O   1 
ATOM   6058 C  CB  . ASN B 1 230 ? 102.374 57.718 70.805  1.00 26.08 ? 230  ASN B CB  1 
ATOM   6059 C  CG  . ASN B 1 230 ? 102.504 56.179 70.518  1.00 26.58 ? 230  ASN B CG  1 
ATOM   6060 O  OD1 . ASN B 1 230 ? 102.765 55.397 71.434  1.00 24.91 ? 230  ASN B OD1 1 
ATOM   6061 N  ND2 . ASN B 1 230 ? 102.251 55.764 69.275  1.00 20.38 ? 230  ASN B ND2 1 
ATOM   6062 N  N   . CYS B 1 231 ? 99.363  56.822 72.581  1.00 26.56 ? 231  CYS B N   1 
ATOM   6063 C  CA  . CYS B 1 231 ? 97.926  56.509 72.386  1.00 26.84 ? 231  CYS B CA  1 
ATOM   6064 C  C   . CYS B 1 231 ? 97.060  57.782 72.323  1.00 28.30 ? 231  CYS B C   1 
ATOM   6065 O  O   . CYS B 1 231 ? 97.237  58.698 73.121  1.00 28.16 ? 231  CYS B O   1 
ATOM   6066 C  CB  . CYS B 1 231 ? 97.392  55.591 73.477  1.00 25.72 ? 231  CYS B CB  1 
ATOM   6067 S  SG  . CYS B 1 231 ? 97.953  53.868 73.388  1.00 26.05 ? 231  CYS B SG  1 
ATOM   6068 N  N   . PRO B 1 232 ? 96.119  57.837 71.364  1.00 28.89 ? 232  PRO B N   1 
ATOM   6069 C  CA  . PRO B 1 232 ? 95.303  59.023 71.177  1.00 30.00 ? 232  PRO B CA  1 
ATOM   6070 C  C   . PRO B 1 232 ? 94.534  59.483 72.432  1.00 30.29 ? 232  PRO B C   1 
ATOM   6071 O  O   . PRO B 1 232 ? 94.270  60.703 72.582  1.00 32.47 ? 232  PRO B O   1 
ATOM   6072 C  CB  . PRO B 1 232 ? 94.344  58.604 70.046  1.00 30.55 ? 232  PRO B CB  1 
ATOM   6073 C  CG  . PRO B 1 232 ? 94.255  57.167 70.159  1.00 29.49 ? 232  PRO B CG  1 
ATOM   6074 C  CD  . PRO B 1 232 ? 95.599  56.692 70.598  1.00 28.59 ? 232  PRO B CD  1 
ATOM   6075 N  N   . TRP B 1 233 ? 94.205  58.556 73.324  1.00 28.80 ? 233  TRP B N   1 
ATOM   6076 C  CA  . TRP B 1 233 ? 93.483  58.854 74.564  1.00 28.48 ? 233  TRP B CA  1 
ATOM   6077 C  C   . TRP B 1 233 ? 94.383  59.140 75.756  1.00 28.82 ? 233  TRP B C   1 
ATOM   6078 O  O   . TRP B 1 233 ? 93.885  59.539 76.817  1.00 29.26 ? 233  TRP B O   1 
ATOM   6079 C  CB  . TRP B 1 233 ? 92.632  57.647 74.960  1.00 28.17 ? 233  TRP B CB  1 
ATOM   6080 C  CG  . TRP B 1 233 ? 93.384  56.360 74.913  1.00 26.58 ? 233  TRP B CG  1 
ATOM   6081 C  CD1 . TRP B 1 233 ? 93.423  55.457 73.861  1.00 28.46 ? 233  TRP B CD1 1 
ATOM   6082 C  CD2 . TRP B 1 233 ? 94.210  55.796 75.948  1.00 25.54 ? 233  TRP B CD2 1 
ATOM   6083 N  NE1 . TRP B 1 233 ? 94.217  54.364 74.194  1.00 25.21 ? 233  TRP B NE1 1 
ATOM   6084 C  CE2 . TRP B 1 233 ? 94.705  54.548 75.466  1.00 24.15 ? 233  TRP B CE2 1 
ATOM   6085 C  CE3 . TRP B 1 233 ? 94.554  56.202 77.243  1.00 24.54 ? 233  TRP B CE3 1 
ATOM   6086 C  CZ2 . TRP B 1 233 ? 95.556  53.742 76.217  1.00 23.52 ? 233  TRP B CZ2 1 
ATOM   6087 C  CZ3 . TRP B 1 233 ? 95.405  55.394 77.989  1.00 25.06 ? 233  TRP B CZ3 1 
ATOM   6088 C  CH2 . TRP B 1 233 ? 95.888  54.171 77.478  1.00 25.98 ? 233  TRP B CH2 1 
ATOM   6089 N  N   . ALA B 1 234 ? 95.686  58.897 75.610  1.00 27.82 ? 234  ALA B N   1 
ATOM   6090 C  CA  . ALA B 1 234 ? 96.597  58.902 76.739  1.00 26.85 ? 234  ALA B CA  1 
ATOM   6091 C  C   . ALA B 1 234 ? 97.174  60.281 77.055  1.00 27.82 ? 234  ALA B C   1 
ATOM   6092 O  O   . ALA B 1 234 ? 97.821  60.462 78.103  1.00 27.94 ? 234  ALA B O   1 
ATOM   6093 C  CB  . ALA B 1 234 ? 97.738  57.882 76.512  1.00 26.86 ? 234  ALA B CB  1 
ATOM   6094 N  N   . SER B 1 235 ? 96.946  61.263 76.186  1.00 27.92 ? 235  SER B N   1 
ATOM   6095 C  CA  . SER B 1 235 ? 97.421  62.619 76.490  1.00 28.21 ? 235  SER B CA  1 
ATOM   6096 C  C   . SER B 1 235 ? 96.604  63.722 75.781  1.00 29.04 ? 235  SER B C   1 
ATOM   6097 O  O   . SER B 1 235 ? 95.851  63.455 74.836  1.00 30.06 ? 235  SER B O   1 
ATOM   6098 C  CB  . SER B 1 235 ? 98.930  62.744 76.182  1.00 28.39 ? 235  SER B CB  1 
ATOM   6099 O  OG  . SER B 1 235 ? 99.157  62.849 74.787  1.00 28.15 ? 235  SER B OG  1 
ATOM   6100 N  N   . VAL B 1 236 ? 96.732  64.960 76.255  1.00 28.94 ? 236  VAL B N   1 
ATOM   6101 C  CA  . VAL B 1 236 ? 96.088  66.103 75.614  1.00 28.58 ? 236  VAL B CA  1 
ATOM   6102 C  C   . VAL B 1 236 ? 97.058  67.260 75.622  1.00 30.08 ? 236  VAL B C   1 
ATOM   6103 O  O   . VAL B 1 236 ? 98.057  67.257 76.368  1.00 29.85 ? 236  VAL B O   1 
ATOM   6104 C  CB  . VAL B 1 236 ? 94.766  66.543 76.331  1.00 28.86 ? 236  VAL B CB  1 
ATOM   6105 C  CG1 . VAL B 1 236 ? 93.640  65.503 76.124  1.00 26.70 ? 236  VAL B CG1 1 
ATOM   6106 C  CG2 . VAL B 1 236 ? 95.002  66.839 77.814  1.00 26.02 ? 236  VAL B CG2 1 
ATOM   6107 N  N   . SER B 1 237 ? 96.765  68.255 74.805  1.00 31.05 ? 237  SER B N   1 
ATOM   6108 C  CA  . SER B 1 237 ? 97.588  69.469 74.773  1.00 33.33 ? 237  SER B CA  1 
ATOM   6109 C  C   . SER B 1 237 ? 97.283  70.328 75.991  1.00 34.15 ? 237  SER B C   1 
ATOM   6110 O  O   . SER B 1 237 ? 96.232  70.144 76.629  1.00 34.04 ? 237  SER B O   1 
ATOM   6111 C  CB  . SER B 1 237 ? 97.283  70.279 73.509  1.00 33.92 ? 237  SER B CB  1 
ATOM   6112 O  OG  . SER B 1 237 ? 95.940  70.740 73.545  1.00 35.55 ? 237  SER B OG  1 
ATOM   6113 N  N   . VAL B 1 238 ? 98.174  71.290 76.277  1.00 35.22 ? 238  VAL B N   1 
ATOM   6114 C  CA  . VAL B 1 238 ? 97.969  72.243 77.361  1.00 34.73 ? 238  VAL B CA  1 
ATOM   6115 C  C   . VAL B 1 238 ? 96.680  72.980 77.140  1.00 35.76 ? 238  VAL B C   1 
ATOM   6116 O  O   . VAL B 1 238 ? 95.894  73.117 78.069  1.00 35.11 ? 238  VAL B O   1 
ATOM   6117 C  CB  . VAL B 1 238 ? 99.181  73.218 77.630  1.00 36.51 ? 238  VAL B CB  1 
ATOM   6118 C  CG1 . VAL B 1 238 ? 100.383 72.443 78.100  1.00 32.87 ? 238  VAL B CG1 1 
ATOM   6119 C  CG2 . VAL B 1 238 ? 99.524  74.089 76.441  1.00 37.15 ? 238  VAL B CG2 1 
ATOM   6120 N  N   . ALA B 1 239 ? 96.445  73.381 75.894  1.00 36.71 ? 239  ALA B N   1 
ATOM   6121 C  CA  . ALA B 1 239 ? 95.238  74.095 75.509  1.00 38.50 ? 239  ALA B CA  1 
ATOM   6122 C  C   . ALA B 1 239 ? 93.953  73.326 75.827  1.00 37.81 ? 239  ALA B C   1 
ATOM   6123 O  O   . ALA B 1 239 ? 92.975  73.916 76.312  1.00 38.80 ? 239  ALA B O   1 
ATOM   6124 C  CB  . ALA B 1 239 ? 95.286  74.446 74.005  1.00 40.24 ? 239  ALA B CB  1 
ATOM   6125 N  N   . GLU B 1 240 ? 93.950  72.027 75.504  1.00 36.28 ? 240  GLU B N   1 
ATOM   6126 C  CA  . GLU B 1 240 ? 92.797  71.150 75.722  1.00 34.40 ? 240  GLU B CA  1 
ATOM   6127 C  C   . GLU B 1 240 ? 92.660  70.817 77.215  1.00 33.84 ? 240  GLU B C   1 
ATOM   6128 O  O   . GLU B 1 240 ? 91.556  70.846 77.743  1.00 33.63 ? 240  GLU B O   1 
ATOM   6129 C  CB  . GLU B 1 240 ? 92.891  69.885 74.819  1.00 33.63 ? 240  GLU B CB  1 
ATOM   6130 C  CG  . GLU B 1 240 ? 91.767  68.825 74.935  1.00 30.05 ? 240  GLU B CG  1 
ATOM   6131 C  CD  . GLU B 1 240 ? 90.347  69.340 74.755  1.00 32.35 ? 240  GLU B CD  1 
ATOM   6132 O  OE1 . GLU B 1 240 ? 90.140  70.471 74.218  1.00 32.64 ? 240  GLU B OE1 1 
ATOM   6133 O  OE2 . GLU B 1 240 ? 89.410  68.608 75.175  1.00 28.77 ? 240  GLU B OE2 1 
ATOM   6134 N  N   . GLY B 1 241 ? 93.771  70.491 77.892  1.00 33.20 ? 241  GLY B N   1 
ATOM   6135 C  CA  . GLY B 1 241 ? 93.764  70.333 79.370  1.00 32.40 ? 241  GLY B CA  1 
ATOM   6136 C  C   . GLY B 1 241 ? 93.151  71.539 80.093  1.00 34.44 ? 241  GLY B C   1 
ATOM   6137 O  O   . GLY B 1 241 ? 92.275  71.387 80.954  1.00 34.62 ? 241  GLY B O   1 
ATOM   6138 N  N   . ARG B 1 242 ? 93.606  72.742 79.731  1.00 35.34 ? 242  ARG B N   1 
ATOM   6139 C  CA  . ARG B 1 242 ? 93.013  73.992 80.221  1.00 37.18 ? 242  ARG B CA  1 
ATOM   6140 C  C   . ARG B 1 242 ? 91.512  74.072 79.949  1.00 38.29 ? 242  ARG B C   1 
ATOM   6141 O  O   . ARG B 1 242 ? 90.723  74.399 80.844  1.00 39.18 ? 242  ARG B O   1 
ATOM   6142 C  CB  . ARG B 1 242 ? 93.722  75.216 79.605  1.00 38.57 ? 242  ARG B CB  1 
ATOM   6143 C  CG  . ARG B 1 242 ? 93.016  76.598 79.859  1.00 41.99 ? 242  ARG B CG  1 
ATOM   6144 C  CD  . ARG B 1 242 ? 93.987  77.792 79.634  1.00 42.95 ? 242  ARG B CD  1 
ATOM   6145 N  NE  . ARG B 1 242 ? 95.116  77.710 80.574  1.00 43.17 ? 242  ARG B NE  1 
ATOM   6146 C  CZ  . ARG B 1 242 ? 95.105  78.220 81.808  1.00 42.43 ? 242  ARG B CZ  1 
ATOM   6147 N  NH1 . ARG B 1 242 ? 94.033  78.881 82.244  1.00 41.89 ? 242  ARG B NH1 1 
ATOM   6148 N  NH2 . ARG B 1 242 ? 96.165  78.068 82.597  1.00 40.64 ? 242  ARG B NH2 1 
ATOM   6149 N  N   . ARG B 1 243 ? 91.114  73.801 78.709  1.00 38.40 ? 243  ARG B N   1 
ATOM   6150 C  CA  . ARG B 1 243 ? 89.706  73.841 78.359  1.00 38.96 ? 243  ARG B CA  1 
ATOM   6151 C  C   . ARG B 1 243 ? 88.900  72.905 79.244  1.00 36.93 ? 243  ARG B C   1 
ATOM   6152 O  O   . ARG B 1 243 ? 87.851  73.265 79.768  1.00 36.88 ? 243  ARG B O   1 
ATOM   6153 C  CB  . ARG B 1 243 ? 89.520  73.444 76.904  1.00 39.65 ? 243  ARG B CB  1 
ATOM   6154 C  CG  . ARG B 1 243 ? 88.547  74.348 76.189  1.00 44.19 ? 243  ARG B CG  1 
ATOM   6155 C  CD  . ARG B 1 243 ? 87.786  73.606 75.118  1.00 49.72 ? 243  ARG B CD  1 
ATOM   6156 N  NE  . ARG B 1 243 ? 86.745  72.780 75.717  1.00 53.86 ? 243  ARG B NE  1 
ATOM   6157 C  CZ  . ARG B 1 243 ? 86.745  71.458 75.695  1.00 53.67 ? 243  ARG B CZ  1 
ATOM   6158 N  NH1 . ARG B 1 243 ? 87.732  70.830 75.089  1.00 54.25 ? 243  ARG B NH1 1 
ATOM   6159 N  NH2 . ARG B 1 243 ? 85.763  70.773 76.273  1.00 55.51 ? 243  ARG B NH2 1 
ATOM   6160 N  N   . ARG B 1 244 ? 89.404  71.691 79.407  1.00 35.13 ? 244  ARG B N   1 
ATOM   6161 C  CA  . ARG B 1 244 ? 88.740  70.732 80.253  1.00 34.09 ? 244  ARG B CA  1 
ATOM   6162 C  C   . ARG B 1 244 ? 88.703  71.174 81.724  1.00 34.54 ? 244  ARG B C   1 
ATOM   6163 O  O   . ARG B 1 244 ? 87.659  71.050 82.374  1.00 34.48 ? 244  ARG B O   1 
ATOM   6164 C  CB  . ARG B 1 244 ? 89.347  69.339 80.071  1.00 32.52 ? 244  ARG B CB  1 
ATOM   6165 C  CG  . ARG B 1 244 ? 88.813  68.617 78.814  1.00 31.71 ? 244  ARG B CG  1 
ATOM   6166 C  CD  . ARG B 1 244 ? 89.694  67.460 78.504  1.00 29.55 ? 244  ARG B CD  1 
ATOM   6167 N  NE  . ARG B 1 244 ? 89.652  67.054 77.103  1.00 30.33 ? 244  ARG B NE  1 
ATOM   6168 C  CZ  . ARG B 1 244 ? 89.936  65.822 76.690  1.00 30.51 ? 244  ARG B CZ  1 
ATOM   6169 N  NH1 . ARG B 1 244 ? 90.245  64.892 77.588  1.00 29.56 ? 244  ARG B NH1 1 
ATOM   6170 N  NH2 . ARG B 1 244 ? 89.895  65.506 75.394  1.00 30.57 ? 244  ARG B NH2 1 
ATOM   6171 N  N   . ALA B 1 245 ? 89.809  71.706 82.249  1.00 34.33 ? 245  ALA B N   1 
ATOM   6172 C  CA  . ALA B 1 245 ? 89.772  72.199 83.625  1.00 36.48 ? 245  ALA B CA  1 
ATOM   6173 C  C   . ALA B 1 245 ? 88.721  73.301 83.803  1.00 38.58 ? 245  ALA B C   1 
ATOM   6174 O  O   . ALA B 1 245 ? 88.031  73.339 84.816  1.00 39.90 ? 245  ALA B O   1 
ATOM   6175 C  CB  . ALA B 1 245 ? 91.100  72.704 84.057  1.00 37.07 ? 245  ALA B CB  1 
ATOM   6176 N  N   . VAL B 1 246 ? 88.584  74.174 82.807  1.00 39.26 ? 246  VAL B N   1 
ATOM   6177 C  CA  . VAL B 1 246 ? 87.639  75.273 82.885  1.00 40.94 ? 246  VAL B CA  1 
ATOM   6178 C  C   . VAL B 1 246 ? 86.222  74.734 82.658  1.00 41.50 ? 246  VAL B C   1 
ATOM   6179 O  O   . VAL B 1 246 ? 85.269  75.198 83.270  1.00 42.58 ? 246  VAL B O   1 
ATOM   6180 C  CB  . VAL B 1 246 ? 88.000  76.440 81.885  1.00 42.48 ? 246  VAL B CB  1 
ATOM   6181 C  CG1 . VAL B 1 246 ? 86.853  77.436 81.750  1.00 43.49 ? 246  VAL B CG1 1 
ATOM   6182 C  CG2 . VAL B 1 246 ? 89.311  77.153 82.297  1.00 39.66 ? 246  VAL B CG2 1 
ATOM   6183 N  N   . GLU B 1 247 ? 86.072  73.734 81.803  1.00 40.87 ? 247  GLU B N   1 
ATOM   6184 C  CA  . GLU B 1 247 ? 84.743  73.156 81.647  1.00 41.78 ? 247  GLU B CA  1 
ATOM   6185 C  C   . GLU B 1 247 ? 84.286  72.530 82.972  1.00 40.69 ? 247  GLU B C   1 
ATOM   6186 O  O   . GLU B 1 247 ? 83.086  72.530 83.294  1.00 40.76 ? 247  GLU B O   1 
ATOM   6187 C  CB  . GLU B 1 247 ? 84.694  72.139 80.493  1.00 41.25 ? 247  GLU B CB  1 
ATOM   6188 C  CG  . GLU B 1 247 ? 83.284  71.923 79.893  1.00 45.38 ? 247  GLU B CG  1 
ATOM   6189 C  CD  . GLU B 1 247 ? 82.588  73.223 79.466  1.00 52.08 ? 247  GLU B CD  1 
ATOM   6190 O  OE1 . GLU B 1 247 ? 83.260  74.131 78.912  1.00 55.44 ? 247  GLU B OE1 1 
ATOM   6191 O  OE2 . GLU B 1 247 ? 81.356  73.339 79.669  1.00 55.46 ? 247  GLU B OE2 1 
ATOM   6192 N  N   . LEU B 1 248 ? 85.248  72.013 83.735  1.00 39.24 ? 248  LEU B N   1 
ATOM   6193 C  CA  . LEU B 1 248 ? 84.948  71.394 85.032  1.00 39.37 ? 248  LEU B CA  1 
ATOM   6194 C  C   . LEU B 1 248 ? 84.413  72.466 85.994  1.00 41.30 ? 248  LEU B C   1 
ATOM   6195 O  O   . LEU B 1 248 ? 83.410  72.255 86.703  1.00 41.79 ? 248  LEU B O   1 
ATOM   6196 C  CB  . LEU B 1 248 ? 86.176  70.708 85.622  1.00 37.02 ? 248  LEU B CB  1 
ATOM   6197 C  CG  . LEU B 1 248 ? 85.950  69.868 86.880  1.00 38.73 ? 248  LEU B CG  1 
ATOM   6198 C  CD1 . LEU B 1 248 ? 85.062  68.671 86.561  1.00 39.53 ? 248  LEU B CD1 1 
ATOM   6199 C  CD2 . LEU B 1 248 ? 87.249  69.358 87.516  1.00 37.40 ? 248  LEU B CD2 1 
ATOM   6200 N  N   . GLY B 1 249 ? 85.057  73.636 85.974  1.00 42.65 ? 249  GLY B N   1 
ATOM   6201 C  CA  . GLY B 1 249 ? 84.644  74.751 86.813  1.00 43.89 ? 249  GLY B CA  1 
ATOM   6202 C  C   . GLY B 1 249 ? 83.245  75.179 86.497  1.00 45.98 ? 249  GLY B C   1 
ATOM   6203 O  O   . GLY B 1 249 ? 82.435  75.441 87.396  1.00 47.15 ? 249  GLY B O   1 
ATOM   6204 N  N   . ARG B 1 250 ? 82.965  75.267 85.205  1.00 46.71 ? 250  ARG B N   1 
ATOM   6205 C  CA  . ARG B 1 250 ? 81.684  75.744 84.725  1.00 49.07 ? 250  ARG B CA  1 
ATOM   6206 C  C   . ARG B 1 250 ? 80.575  74.791 85.171  1.00 48.92 ? 250  ARG B C   1 
ATOM   6207 O  O   . ARG B 1 250 ? 79.495  75.231 85.566  1.00 51.28 ? 250  ARG B O   1 
ATOM   6208 C  CB  . ARG B 1 250 ? 81.709  75.891 83.198  1.00 49.44 ? 250  ARG B CB  1 
ATOM   6209 C  CG  . ARG B 1 250 ? 80.612  76.796 82.641  1.00 53.29 ? 250  ARG B CG  1 
ATOM   6210 C  CD  . ARG B 1 250 ? 80.682  76.908 81.109  1.00 57.51 ? 250  ARG B CD  1 
ATOM   6211 N  NE  . ARG B 1 250 ? 81.604  77.967 80.674  1.00 61.96 ? 250  ARG B NE  1 
ATOM   6212 C  CZ  . ARG B 1 250 ? 82.823  77.771 80.157  1.00 62.16 ? 250  ARG B CZ  1 
ATOM   6213 N  NH1 . ARG B 1 250 ? 83.311  76.534 79.974  1.00 59.88 ? 250  ARG B NH1 1 
ATOM   6214 N  NH2 . ARG B 1 250 ? 83.555  78.824 79.803  1.00 61.34 ? 250  ARG B NH2 1 
ATOM   6215 N  N   . ASN B 1 251 ? 80.850  73.490 85.124  1.00 47.54 ? 251  ASN B N   1 
ATOM   6216 C  CA  . ASN B 1 251 ? 79.897  72.468 85.590  1.00 47.55 ? 251  ASN B CA  1 
ATOM   6217 C  C   . ASN B 1 251 ? 79.514  72.559 87.062  1.00 48.53 ? 251  ASN B C   1 
ATOM   6218 O  O   . ASN B 1 251 ? 78.381  72.236 87.433  1.00 49.07 ? 251  ASN B O   1 
ATOM   6219 C  CB  . ASN B 1 251 ? 80.397  71.061 85.260  1.00 44.95 ? 251  ASN B CB  1 
ATOM   6220 C  CG  . ASN B 1 251 ? 79.993  70.629 83.878  1.00 44.49 ? 251  ASN B CG  1 
ATOM   6221 O  OD1 . ASN B 1 251 ? 78.936  70.039 83.699  1.00 45.83 ? 251  ASN B OD1 1 
ATOM   6222 N  ND2 . ASN B 1 251 ? 80.804  70.958 82.883  1.00 43.75 ? 251  ASN B ND2 1 
ATOM   6223 N  N   . LEU B 1 252 ? 80.459  73.043 87.870  1.00 49.02 ? 252  LEU B N   1 
ATOM   6224 C  CA  . LEU B 1 252 ? 80.297  73.173 89.311  1.00 50.21 ? 252  LEU B CA  1 
ATOM   6225 C  C   . LEU B 1 252 ? 80.009  74.605 89.797  1.00 53.46 ? 252  LEU B C   1 
ATOM   6226 O  O   . LEU B 1 252 ? 80.124  74.892 91.000  1.00 54.93 ? 252  LEU B O   1 
ATOM   6227 C  CB  . LEU B 1 252 ? 81.513  72.569 90.018  1.00 48.33 ? 252  LEU B CB  1 
ATOM   6228 C  CG  . LEU B 1 252 ? 81.734  71.084 89.670  1.00 45.94 ? 252  LEU B CG  1 
ATOM   6229 C  CD1 . LEU B 1 252 ? 83.114  70.610 90.102  1.00 42.40 ? 252  LEU B CD1 1 
ATOM   6230 C  CD2 . LEU B 1 252 ? 80.633  70.175 90.246  1.00 44.96 ? 252  LEU B CD2 1 
ATOM   6231 N  N   . ASN B 1 253 ? 79.583  75.475 88.871  1.00 55.18 ? 253  ASN B N   1 
ATOM   6232 C  CA  . ASN B 1 253 ? 79.332  76.907 89.137  1.00 57.63 ? 253  ASN B CA  1 
ATOM   6233 C  C   . ASN B 1 253 ? 80.515  77.563 89.842  1.00 57.79 ? 253  ASN B C   1 
ATOM   6234 O  O   . ASN B 1 253 ? 80.360  78.237 90.835  1.00 59.73 ? 253  ASN B O   1 
ATOM   6235 C  CB  . ASN B 1 253 ? 78.022  77.133 89.919  1.00 59.72 ? 253  ASN B CB  1 
ATOM   6236 C  CG  . ASN B 1 253 ? 76.768  76.917 89.070  1.00 60.90 ? 253  ASN B CG  1 
ATOM   6237 O  OD1 . ASN B 1 253 ? 76.798  76.265 88.026  1.00 60.26 ? 253  ASN B OD1 1 
ATOM   6238 N  ND2 . ASN B 1 253 ? 75.654  77.471 89.528  1.00 65.89 ? 253  ASN B ND2 1 
ATOM   6239 N  N   . CYS B 1 254 ? 81.712  77.317 89.331  1.00 56.59 ? 254  CYS B N   1 
ATOM   6240 C  CA  . CYS B 1 254 ? 82.906  77.957 89.845  1.00 56.67 ? 254  CYS B CA  1 
ATOM   6241 C  C   . CYS B 1 254 ? 83.119  79.321 89.210  1.00 58.81 ? 254  CYS B C   1 
ATOM   6242 O  O   . CYS B 1 254 ? 82.624  79.616 88.106  1.00 58.96 ? 254  CYS B O   1 
ATOM   6243 C  CB  . CYS B 1 254 ? 84.134  77.080 89.596  1.00 54.51 ? 254  CYS B CB  1 
ATOM   6244 S  SG  . CYS B 1 254 ? 84.304  75.724 90.784  1.00 51.86 ? 254  CYS B SG  1 
ATOM   6245 N  N   . ASN B 1 255 ? 83.861  80.147 89.939  1.00 59.95 ? 255  ASN B N   1 
ATOM   6246 C  CA  . ASN B 1 255 ? 84.376  81.389 89.435  1.00 61.34 ? 255  ASN B CA  1 
ATOM   6247 C  C   . ASN B 1 255 ? 85.501  81.093 88.440  1.00 59.60 ? 255  ASN B C   1 
ATOM   6248 O  O   . ASN B 1 255 ? 86.481  80.449 88.783  1.00 57.43 ? 255  ASN B O   1 
ATOM   6249 C  CB  . ASN B 1 255 ? 84.907  82.214 90.604  1.00 62.80 ? 255  ASN B CB  1 
ATOM   6250 C  CG  . ASN B 1 255 ? 85.332  83.601 90.187  1.00 65.33 ? 255  ASN B CG  1 
ATOM   6251 O  OD1 . ASN B 1 255 ? 86.247  83.774 89.372  1.00 64.45 ? 255  ASN B OD1 1 
ATOM   6252 N  ND2 . ASN B 1 255 ? 84.667  84.606 90.741  1.00 66.95 ? 255  ASN B ND2 1 
ATOM   6253 N  N   . LEU B 1 256 ? 85.363  81.599 87.220  1.00 60.58 ? 256  LEU B N   1 
ATOM   6254 C  CA  . LEU B 1 256 ? 86.327  81.334 86.166  1.00 59.86 ? 256  LEU B CA  1 
ATOM   6255 C  C   . LEU B 1 256 ? 87.248  82.511 85.805  1.00 62.10 ? 256  LEU B C   1 
ATOM   6256 O  O   . LEU B 1 256 ? 88.073  82.404 84.897  1.00 61.88 ? 256  LEU B O   1 
ATOM   6257 C  CB  . LEU B 1 256 ? 85.586  80.818 84.932  1.00 58.89 ? 256  LEU B CB  1 
ATOM   6258 C  CG  . LEU B 1 256 ? 84.613  79.684 85.252  1.00 56.90 ? 256  LEU B CG  1 
ATOM   6259 C  CD1 . LEU B 1 256 ? 83.728  79.403 84.074  1.00 57.06 ? 256  LEU B CD1 1 
ATOM   6260 C  CD2 . LEU B 1 256 ? 85.356  78.412 85.664  1.00 54.82 ? 256  LEU B CD2 1 
ATOM   6261 N  N   . ASN B 1 257 ? 87.152  83.612 86.535  1.00 65.06 ? 257  ASN B N   1 
ATOM   6262 C  CA  . ASN B 1 257 ? 87.940  84.810 86.196  1.00 67.81 ? 257  ASN B CA  1 
ATOM   6263 C  C   . ASN B 1 257 ? 89.465  84.644 86.211  1.00 67.02 ? 257  ASN B C   1 
ATOM   6264 O  O   . ASN B 1 257 ? 90.158  85.402 85.526  1.00 68.39 ? 257  ASN B O   1 
ATOM   6265 C  CB  . ASN B 1 257 ? 87.521  86.020 87.042  1.00 70.60 ? 257  ASN B CB  1 
ATOM   6266 C  CG  . ASN B 1 257 ? 86.032  86.302 86.944  1.00 73.22 ? 257  ASN B CG  1 
ATOM   6267 O  OD1 . ASN B 1 257 ? 85.367  85.891 85.984  1.00 72.99 ? 257  ASN B OD1 1 
ATOM   6268 N  ND2 . ASN B 1 257 ? 85.495  86.993 87.944  1.00 76.57 ? 257  ASN B ND2 1 
ATOM   6269 N  N   . SER B 1 258 ? 89.978  83.661 86.959  1.00 64.58 ? 258  SER B N   1 
ATOM   6270 C  CA  . SER B 1 258 ? 91.427  83.437 87.051  1.00 63.41 ? 258  SER B CA  1 
ATOM   6271 C  C   . SER B 1 258 ? 91.687  82.019 87.480  1.00 61.02 ? 258  SER B C   1 
ATOM   6272 O  O   . SER B 1 258 ? 90.827  81.414 88.112  1.00 60.76 ? 258  SER B O   1 
ATOM   6273 C  CB  . SER B 1 258 ? 92.069  84.380 88.070  1.00 64.89 ? 258  SER B CB  1 
ATOM   6274 O  OG  . SER B 1 258 ? 91.688  84.028 89.383  1.00 63.24 ? 258  SER B OG  1 
ATOM   6275 N  N   . ASP B 1 259 ? 92.873  81.496 87.172  1.00 59.80 ? 259  ASP B N   1 
ATOM   6276 C  CA  . ASP B 1 259 ? 93.207  80.106 87.534  1.00 57.65 ? 259  ASP B CA  1 
ATOM   6277 C  C   . ASP B 1 259 ? 93.100  79.899 89.029  1.00 58.12 ? 259  ASP B C   1 
ATOM   6278 O  O   . ASP B 1 259 ? 92.654  78.856 89.495  1.00 56.38 ? 259  ASP B O   1 
ATOM   6279 C  CB  . ASP B 1 259 ? 94.620  79.738 87.080  1.00 56.27 ? 259  ASP B CB  1 
ATOM   6280 C  CG  . ASP B 1 259 ? 94.721  79.561 85.589  1.00 56.46 ? 259  ASP B CG  1 
ATOM   6281 O  OD1 . ASP B 1 259 ? 93.675  79.631 84.897  1.00 58.09 ? 259  ASP B OD1 1 
ATOM   6282 O  OD2 . ASP B 1 259 ? 95.853  79.347 85.105  1.00 56.10 ? 259  ASP B OD2 1 
ATOM   6283 N  N   . GLU B 1 260 ? 93.494  80.926 89.771  1.00 60.87 ? 260  GLU B N   1 
ATOM   6284 C  CA  . GLU B 1 260 ? 93.571  80.856 91.223  1.00 61.92 ? 260  GLU B CA  1 
ATOM   6285 C  C   . GLU B 1 260 ? 92.182  80.683 91.837  1.00 61.49 ? 260  GLU B C   1 
ATOM   6286 O  O   . GLU B 1 260 ? 92.000  79.906 92.783  1.00 60.46 ? 260  GLU B O   1 
ATOM   6287 C  CB  . GLU B 1 260 ? 94.250  82.118 91.783  1.00 64.67 ? 260  GLU B CB  1 
ATOM   6288 C  CG  . GLU B 1 260 ? 95.252  81.781 92.883  1.00 67.02 ? 260  GLU B CG  1 
ATOM   6289 C  CD  . GLU B 1 260 ? 95.528  82.923 93.859  1.00 72.63 ? 260  GLU B CD  1 
ATOM   6290 O  OE1 . GLU B 1 260 ? 95.089  84.079 93.626  1.00 75.38 ? 260  GLU B OE1 1 
ATOM   6291 O  OE2 . GLU B 1 260 ? 96.201  82.650 94.877  1.00 73.87 ? 260  GLU B OE2 1 
ATOM   6292 N  N   . GLU B 1 261 ? 91.216  81.422 91.297  1.00 61.93 ? 261  GLU B N   1 
ATOM   6293 C  CA  . GLU B 1 261 ? 89.830  81.321 91.749  1.00 61.78 ? 261  GLU B CA  1 
ATOM   6294 C  C   . GLU B 1 261 ? 89.192  79.993 91.354  1.00 58.57 ? 261  GLU B C   1 
ATOM   6295 O  O   . GLU B 1 261 ? 88.498  79.373 92.156  1.00 57.87 ? 261  GLU B O   1 
ATOM   6296 C  CB  . GLU B 1 261 ? 89.022  82.514 91.256  1.00 64.05 ? 261  GLU B CB  1 
ATOM   6297 C  CG  . GLU B 1 261 ? 89.246  83.724 92.146  1.00 68.63 ? 261  GLU B CG  1 
ATOM   6298 C  CD  . GLU B 1 261 ? 89.107  85.073 91.446  1.00 71.54 ? 261  GLU B CD  1 
ATOM   6299 O  OE1 . GLU B 1 261 ? 89.463  85.213 90.250  1.00 71.75 ? 261  GLU B OE1 1 
ATOM   6300 O  OE2 . GLU B 1 261 ? 88.657  86.008 92.128  1.00 73.78 ? 261  GLU B OE2 1 
ATOM   6301 N  N   . LEU B 1 262 ? 89.465  79.543 90.132  1.00 56.22 ? 262  LEU B N   1 
ATOM   6302 C  CA  . LEU B 1 262 ? 88.968  78.262 89.673  1.00 53.08 ? 262  LEU B CA  1 
ATOM   6303 C  C   . LEU B 1 262 ? 89.497  77.126 90.552  1.00 51.36 ? 262  LEU B C   1 
ATOM   6304 O  O   . LEU B 1 262 ? 88.731  76.299 91.034  1.00 50.03 ? 262  LEU B O   1 
ATOM   6305 C  CB  . LEU B 1 262 ? 89.331  78.041 88.208  1.00 51.87 ? 262  LEU B CB  1 
ATOM   6306 C  CG  . LEU B 1 262 ? 89.090  76.639 87.648  1.00 47.29 ? 262  LEU B CG  1 
ATOM   6307 C  CD1 . LEU B 1 262 ? 87.626  76.240 87.756  1.00 45.38 ? 262  LEU B CD1 1 
ATOM   6308 C  CD2 . LEU B 1 262 ? 89.529  76.612 86.221  1.00 47.28 ? 262  LEU B CD2 1 
ATOM   6309 N  N   . ILE B 1 263 ? 90.806  77.116 90.777  1.00 51.35 ? 263  ILE B N   1 
ATOM   6310 C  CA  . ILE B 1 263 ? 91.445  76.072 91.572  1.00 50.22 ? 263  ILE B CA  1 
ATOM   6311 C  C   . ILE B 1 263 ? 90.943  76.103 93.016  1.00 51.44 ? 263  ILE B C   1 
ATOM   6312 O  O   . ILE B 1 263 ? 90.623  75.057 93.580  1.00 50.79 ? 263  ILE B O   1 
ATOM   6313 C  CB  . ILE B 1 263 ? 92.979  76.160 91.516  1.00 49.55 ? 263  ILE B CB  1 
ATOM   6314 C  CG1 . ILE B 1 263 ? 93.455  75.963 90.082  1.00 49.06 ? 263  ILE B CG1 1 
ATOM   6315 C  CG2 . ILE B 1 263 ? 93.602  75.057 92.340  1.00 48.68 ? 263  ILE B CG2 1 
ATOM   6316 C  CD1 . ILE B 1 263 ? 94.921  76.343 89.841  1.00 49.73 ? 263  ILE B CD1 1 
ATOM   6317 N  N   . HIS B 1 264 ? 90.851  77.294 93.605  1.00 53.67 ? 264  HIS B N   1 
ATOM   6318 C  CA  . HIS B 1 264 ? 90.336  77.431 94.976  1.00 55.17 ? 264  HIS B CA  1 
ATOM   6319 C  C   . HIS B 1 264 ? 88.932  76.850 95.087  1.00 54.27 ? 264  HIS B C   1 
ATOM   6320 O  O   . HIS B 1 264 ? 88.624  76.127 96.045  1.00 53.38 ? 264  HIS B O   1 
ATOM   6321 C  CB  . HIS B 1 264 ? 90.356  78.887 95.450  1.00 58.01 ? 264  HIS B CB  1 
ATOM   6322 C  CG  . HIS B 1 264 ? 89.568  79.124 96.709  1.00 63.14 ? 264  HIS B CG  1 
ATOM   6323 N  ND1 . HIS B 1 264 ? 90.034  78.770 97.961  1.00 66.36 ? 264  HIS B ND1 1 
ATOM   6324 C  CD2 . HIS B 1 264 ? 88.344  79.679 96.909  1.00 66.25 ? 264  HIS B CD2 1 
ATOM   6325 C  CE1 . HIS B 1 264 ? 89.135  79.104 98.875  1.00 68.62 ? 264  HIS B CE1 1 
ATOM   6326 N  NE2 . HIS B 1 264 ? 88.100  79.655 98.264  1.00 68.02 ? 264  HIS B NE2 1 
ATOM   6327 N  N   . CYS B 1 265 ? 88.101  77.170 94.094  1.00 54.17 ? 265  CYS B N   1 
ATOM   6328 C  CA  . CYS B 1 265 ? 86.729  76.703 94.034  1.00 54.37 ? 265  CYS B CA  1 
ATOM   6329 C  C   . CYS B 1 265 ? 86.706  75.172 94.016  1.00 52.01 ? 265  CYS B C   1 
ATOM   6330 O  O   . CYS B 1 265 ? 86.007  74.555 94.820  1.00 52.02 ? 265  CYS B O   1 
ATOM   6331 C  CB  . CYS B 1 265 ? 86.032  77.276 92.794  1.00 55.04 ? 265  CYS B CB  1 
ATOM   6332 S  SG  . CYS B 1 265 ? 84.270  76.782 92.544  1.00 57.35 ? 265  CYS B SG  1 
ATOM   6333 N  N   . LEU B 1 266 ? 87.508  74.583 93.123  1.00 50.28 ? 266  LEU B N   1 
ATOM   6334 C  CA  . LEU B 1 266 ? 87.599  73.131 92.937  1.00 47.90 ? 266  LEU B CA  1 
ATOM   6335 C  C   . LEU B 1 266 ? 88.190  72.397 94.140  1.00 47.16 ? 266  LEU B C   1 
ATOM   6336 O  O   . LEU B 1 266 ? 87.879  71.235 94.363  1.00 46.43 ? 266  LEU B O   1 
ATOM   6337 C  CB  . LEU B 1 266 ? 88.390  72.790 91.664  1.00 46.36 ? 266  LEU B CB  1 
ATOM   6338 C  CG  . LEU B 1 266 ? 87.799  73.285 90.338  1.00 47.14 ? 266  LEU B CG  1 
ATOM   6339 C  CD1 . LEU B 1 266 ? 88.801  73.047 89.194  1.00 46.28 ? 266  LEU B CD1 1 
ATOM   6340 C  CD2 . LEU B 1 266 ? 86.425  72.632 90.022  1.00 45.61 ? 266  LEU B CD2 1 
ATOM   6341 N  N   . ARG B 1 267 ? 89.035  73.071 94.913  1.00 47.71 ? 267  ARG B N   1 
ATOM   6342 C  CA  . ARG B 1 267 ? 89.593  72.494 96.140  1.00 46.95 ? 267  ARG B CA  1 
ATOM   6343 C  C   . ARG B 1 267 ? 88.593  72.430 97.281  1.00 48.59 ? 267  ARG B C   1 
ATOM   6344 O  O   . ARG B 1 267 ? 88.801  71.711 98.245  1.00 48.31 ? 267  ARG B O   1 
ATOM   6345 C  CB  . ARG B 1 267 ? 90.824  73.264 96.575  1.00 46.96 ? 267  ARG B CB  1 
ATOM   6346 C  CG  . ARG B 1 267 ? 92.027  72.945 95.745  1.00 44.92 ? 267  ARG B CG  1 
ATOM   6347 C  CD  . ARG B 1 267 ? 93.243  73.697 96.230  1.00 48.40 ? 267  ARG B CD  1 
ATOM   6348 N  NE  . ARG B 1 267 ? 94.430  73.222 95.522  1.00 49.44 ? 267  ARG B NE  1 
ATOM   6349 C  CZ  . ARG B 1 267 ? 95.502  73.963 95.268  1.00 50.38 ? 267  ARG B CZ  1 
ATOM   6350 N  NH1 . ARG B 1 267 ? 95.531  75.239 95.652  1.00 50.76 ? 267  ARG B NH1 1 
ATOM   6351 N  NH2 . ARG B 1 267 ? 96.536  73.429 94.613  1.00 48.30 ? 267  ARG B NH2 1 
ATOM   6352 N  N   . GLU B 1 268 ? 87.499  73.177 97.176  1.00 50.67 ? 268  GLU B N   1 
ATOM   6353 C  CA  . GLU B 1 268 ? 86.503  73.182 98.241  1.00 53.23 ? 268  GLU B CA  1 
ATOM   6354 C  C   . GLU B 1 268 ? 85.344  72.226 97.996  1.00 52.64 ? 268  GLU B C   1 
ATOM   6355 O  O   . GLU B 1 268 ? 84.516  71.997 98.900  1.00 53.78 ? 268  GLU B O   1 
ATOM   6356 C  CB  . GLU B 1 268 ? 85.989  74.600 98.500  1.00 55.77 ? 268  GLU B CB  1 
ATOM   6357 C  CG  . GLU B 1 268 ? 87.023  75.484 99.203  1.00 59.68 ? 268  GLU B CG  1 
ATOM   6358 C  CD  . GLU B 1 268 ? 86.423  76.783 99.750  1.00 66.74 ? 268  GLU B CD  1 
ATOM   6359 O  OE1 . GLU B 1 268 ? 85.328  77.187 99.279  1.00 68.18 ? 268  GLU B OE1 1 
ATOM   6360 O  OE2 . GLU B 1 268 ? 87.050  77.399 100.652 1.00 68.65 ? 268  GLU B OE2 1 
ATOM   6361 N  N   . LYS B 1 269 ? 85.280  71.669 96.789  1.00 50.59 ? 269  LYS B N   1 
ATOM   6362 C  CA  . LYS B 1 269 ? 84.284  70.658 96.498  1.00 50.59 ? 269  LYS B CA  1 
ATOM   6363 C  C   . LYS B 1 269 ? 84.666  69.337 97.148  1.00 49.65 ? 269  LYS B C   1 
ATOM   6364 O  O   . LYS B 1 269 ? 85.853  69.010 97.261  1.00 48.83 ? 269  LYS B O   1 
ATOM   6365 C  CB  . LYS B 1 269 ? 84.152  70.440 94.992  1.00 49.40 ? 269  LYS B CB  1 
ATOM   6366 C  CG  . LYS B 1 269 ? 83.822  71.693 94.205  1.00 51.00 ? 269  LYS B CG  1 
ATOM   6367 C  CD  . LYS B 1 269 ? 82.411  72.172 94.463  1.00 53.46 ? 269  LYS B CD  1 
ATOM   6368 C  CE  . LYS B 1 269 ? 82.239  73.580 93.909  1.00 56.89 ? 269  LYS B CE  1 
ATOM   6369 N  NZ  . LYS B 1 269 ? 80.937  74.199 94.311  1.00 59.37 ? 269  LYS B NZ  1 
ATOM   6370 N  N   . LYS B 1 270 ? 83.652  68.585 97.565  1.00 49.92 ? 270  LYS B N   1 
ATOM   6371 C  CA  . LYS B 1 270 ? 83.820  67.189 97.923  1.00 48.92 ? 270  LYS B CA  1 
ATOM   6372 C  C   . LYS B 1 270 ? 84.273  66.364 96.703  1.00 46.55 ? 270  LYS B C   1 
ATOM   6373 O  O   . LYS B 1 270 ? 83.839  66.638 95.578  1.00 46.02 ? 270  LYS B O   1 
ATOM   6374 C  CB  . LYS B 1 270 ? 82.504  66.649 98.457  1.00 50.85 ? 270  LYS B CB  1 
ATOM   6375 C  CG  . LYS B 1 270 ? 82.187  67.059 99.889  1.00 54.50 ? 270  LYS B CG  1 
ATOM   6376 C  CD  . LYS B 1 270 ? 80.709  66.812 100.212 1.00 61.88 ? 270  LYS B CD  1 
ATOM   6377 C  CE  . LYS B 1 270 ? 80.382  65.318 100.458 1.00 63.68 ? 270  LYS B CE  1 
ATOM   6378 N  NZ  . LYS B 1 270 ? 80.272  64.968 101.918 1.00 65.48 ? 270  LYS B NZ  1 
ATOM   6379 N  N   . PRO B 1 271 ? 85.153  65.356 96.912  1.00 44.71 ? 271  PRO B N   1 
ATOM   6380 C  CA  . PRO B 1 271 ? 85.642  64.570 95.775  1.00 42.22 ? 271  PRO B CA  1 
ATOM   6381 C  C   . PRO B 1 271 ? 84.522  64.105 94.843  1.00 41.51 ? 271  PRO B C   1 
ATOM   6382 O  O   . PRO B 1 271 ? 84.654  64.169 93.614  1.00 39.89 ? 271  PRO B O   1 
ATOM   6383 C  CB  . PRO B 1 271 ? 86.288  63.341 96.437  1.00 41.96 ? 271  PRO B CB  1 
ATOM   6384 C  CG  . PRO B 1 271 ? 86.632  63.767 97.823  1.00 43.11 ? 271  PRO B CG  1 
ATOM   6385 C  CD  . PRO B 1 271 ? 85.659  64.855 98.205  1.00 44.73 ? 271  PRO B CD  1 
ATOM   6386 N  N   . GLN B 1 272 ? 83.429  63.636 95.427  1.00 42.11 ? 272  GLN B N   1 
ATOM   6387 C  CA  . GLN B 1 272 ? 82.336  63.058 94.631  1.00 42.69 ? 272  GLN B CA  1 
ATOM   6388 C  C   . GLN B 1 272 ? 81.710  64.080 93.688  1.00 42.29 ? 272  GLN B C   1 
ATOM   6389 O  O   . GLN B 1 272 ? 81.241  63.691 92.609  1.00 41.08 ? 272  GLN B O   1 
ATOM   6390 C  CB  . GLN B 1 272 ? 81.266  62.391 95.519  1.00 43.77 ? 272  GLN B CB  1 
ATOM   6391 C  CG  . GLN B 1 272 ? 80.503  61.220 94.851  1.00 46.50 ? 272  GLN B CG  1 
ATOM   6392 C  CD  . GLN B 1 272 ? 81.387  60.268 94.018  1.00 47.64 ? 272  GLN B CD  1 
ATOM   6393 O  OE1 . GLN B 1 272 ? 82.302  59.600 94.530  1.00 48.58 ? 272  GLN B OE1 1 
ATOM   6394 N  NE2 . GLN B 1 272 ? 81.089  60.191 92.730  1.00 47.48 ? 272  GLN B NE2 1 
ATOM   6395 N  N   . GLU B 1 273 ? 81.732  65.367 94.078  1.00 42.62 ? 273  GLU B N   1 
ATOM   6396 C  CA  . GLU B 1 273 ? 81.207  66.449 93.227  1.00 43.04 ? 273  GLU B CA  1 
ATOM   6397 C  C   . GLU B 1 273 ? 82.026  66.573 91.960  1.00 41.24 ? 273  GLU B C   1 
ATOM   6398 O  O   . GLU B 1 273 ? 81.470  66.862 90.916  1.00 41.88 ? 273  GLU B O   1 
ATOM   6399 C  CB  . GLU B 1 273 ? 81.148  67.806 93.941  1.00 45.17 ? 273  GLU B CB  1 
ATOM   6400 C  CG  . GLU B 1 273 ? 80.119  67.913 95.082  1.00 50.37 ? 273  GLU B CG  1 
ATOM   6401 C  CD  . GLU B 1 273 ? 80.128  69.276 95.753  1.00 55.68 ? 273  GLU B CD  1 
ATOM   6402 O  OE1 . GLU B 1 273 ? 79.509  70.215 95.209  1.00 58.82 ? 273  GLU B OE1 1 
ATOM   6403 O  OE2 . GLU B 1 273 ? 80.750  69.414 96.829  1.00 58.83 ? 273  GLU B OE2 1 
ATOM   6404 N  N   . LEU B 1 274 ? 83.342  66.374 92.053  1.00 39.38 ? 274  LEU B N   1 
ATOM   6405 C  CA  . LEU B 1 274 ? 84.206  66.383 90.854  1.00 37.88 ? 274  LEU B CA  1 
ATOM   6406 C  C   . LEU B 1 274 ? 83.908  65.171 89.991  1.00 35.72 ? 274  LEU B C   1 
ATOM   6407 O  O   . LEU B 1 274 ? 83.683  65.300 88.791  1.00 34.92 ? 274  LEU B O   1 
ATOM   6408 C  CB  . LEU B 1 274 ? 85.718  66.458 91.192  1.00 36.00 ? 274  LEU B CB  1 
ATOM   6409 C  CG  . LEU B 1 274 ? 86.140  67.550 92.221  1.00 38.71 ? 274  LEU B CG  1 
ATOM   6410 C  CD1 . LEU B 1 274 ? 87.674  67.596 92.420  1.00 37.68 ? 274  LEU B CD1 1 
ATOM   6411 C  CD2 . LEU B 1 274 ? 85.587  68.937 91.902  1.00 34.20 ? 274  LEU B CD2 1 
ATOM   6412 N  N   . ILE B 1 275 ? 83.885  64.001 90.614  1.00 35.14 ? 275  ILE B N   1 
ATOM   6413 C  CA  . ILE B 1 275 ? 83.603  62.755 89.896  1.00 34.31 ? 275  ILE B CA  1 
ATOM   6414 C  C   . ILE B 1 275 ? 82.249  62.781 89.176  1.00 35.26 ? 275  ILE B C   1 
ATOM   6415 O  O   . ILE B 1 275 ? 82.170  62.396 88.030  1.00 34.88 ? 275  ILE B O   1 
ATOM   6416 C  CB  . ILE B 1 275 ? 83.768  61.558 90.828  1.00 33.85 ? 275  ILE B CB  1 
ATOM   6417 C  CG1 . ILE B 1 275 ? 85.220  61.454 91.226  1.00 31.80 ? 275  ILE B CG1 1 
ATOM   6418 C  CG2 . ILE B 1 275 ? 83.372  60.238 90.158  1.00 34.55 ? 275  ILE B CG2 1 
ATOM   6419 C  CD1 . ILE B 1 275 ? 85.417  60.896 92.560  1.00 32.21 ? 275  ILE B CD1 1 
ATOM   6420 N  N   . ASP B 1 276 ? 81.210  63.320 89.812  1.00 37.81 ? 276  ASP B N   1 
ATOM   6421 C  CA  . ASP B 1 276 ? 79.866  63.335 89.219  1.00 38.73 ? 276  ASP B CA  1 
ATOM   6422 C  C   . ASP B 1 276 ? 79.770  64.011 87.854  1.00 38.86 ? 276  ASP B C   1 
ATOM   6423 O  O   . ASP B 1 276 ? 78.878  63.687 87.062  1.00 38.93 ? 276  ASP B O   1 
ATOM   6424 C  CB  . ASP B 1 276 ? 78.842  63.941 90.184  1.00 41.16 ? 276  ASP B CB  1 
ATOM   6425 C  CG  . ASP B 1 276 ? 78.411  62.958 91.270  1.00 42.11 ? 276  ASP B CG  1 
ATOM   6426 O  OD1 . ASP B 1 276 ? 78.537  61.732 91.066  1.00 41.48 ? 276  ASP B OD1 1 
ATOM   6427 O  OD2 . ASP B 1 276 ? 77.969  63.410 92.340  1.00 44.13 ? 276  ASP B OD2 1 
ATOM   6428 N  N   . VAL B 1 277 ? 80.671  64.954 87.574  1.00 37.49 ? 277  VAL B N   1 
ATOM   6429 C  CA  . VAL B 1 277 ? 80.559  65.721 86.337  1.00 36.56 ? 277  VAL B CA  1 
ATOM   6430 C  C   . VAL B 1 277 ? 81.773  65.493 85.447  1.00 35.89 ? 277  VAL B C   1 
ATOM   6431 O  O   . VAL B 1 277 ? 81.887  66.100 84.393  1.00 35.64 ? 277  VAL B O   1 
ATOM   6432 C  CB  . VAL B 1 277 ? 80.355  67.225 86.602  1.00 38.19 ? 277  VAL B CB  1 
ATOM   6433 C  CG1 . VAL B 1 277 ? 79.046  67.461 87.350  1.00 38.22 ? 277  VAL B CG1 1 
ATOM   6434 C  CG2 . VAL B 1 277 ? 81.558  67.837 87.357  1.00 34.31 ? 277  VAL B CG2 1 
ATOM   6435 N  N   . GLU B 1 278 ? 82.664  64.606 85.888  1.00 35.22 ? 278  GLU B N   1 
ATOM   6436 C  CA  . GLU B 1 278 ? 83.916  64.310 85.209  1.00 34.95 ? 278  GLU B CA  1 
ATOM   6437 C  C   . GLU B 1 278 ? 83.760  64.089 83.694  1.00 35.31 ? 278  GLU B C   1 
ATOM   6438 O  O   . GLU B 1 278 ? 84.559  64.613 82.889  1.00 35.64 ? 278  GLU B O   1 
ATOM   6439 C  CB  . GLU B 1 278 ? 84.587  63.092 85.859  1.00 34.84 ? 278  GLU B CB  1 
ATOM   6440 C  CG  . GLU B 1 278 ? 85.950  62.736 85.255  1.00 34.06 ? 278  GLU B CG  1 
ATOM   6441 C  CD  . GLU B 1 278 ? 86.510  61.471 85.821  1.00 34.07 ? 278  GLU B CD  1 
ATOM   6442 O  OE1 . GLU B 1 278 ? 86.340  61.254 87.028  1.00 34.50 ? 278  GLU B OE1 1 
ATOM   6443 O  OE2 . GLU B 1 278 ? 87.166  60.709 85.074  1.00 35.03 ? 278  GLU B OE2 1 
ATOM   6444 N  N   . TRP B 1 279 ? 82.736  63.343 83.297  1.00 35.17 ? 279  TRP B N   1 
ATOM   6445 C  CA  . TRP B 1 279 ? 82.597  62.935 81.903  1.00 35.17 ? 279  TRP B CA  1 
ATOM   6446 C  C   . TRP B 1 279 ? 82.047  64.044 81.035  1.00 36.70 ? 279  TRP B C   1 
ATOM   6447 O  O   . TRP B 1 279 ? 82.144  63.972 79.808  1.00 36.60 ? 279  TRP B O   1 
ATOM   6448 C  CB  . TRP B 1 279 ? 81.724  61.678 81.784  1.00 35.69 ? 279  TRP B CB  1 
ATOM   6449 C  CG  . TRP B 1 279 ? 82.364  60.531 82.491  1.00 35.73 ? 279  TRP B CG  1 
ATOM   6450 C  CD1 . TRP B 1 279 ? 82.144  60.137 83.784  1.00 35.07 ? 279  TRP B CD1 1 
ATOM   6451 C  CD2 . TRP B 1 279 ? 83.377  59.667 81.966  1.00 34.63 ? 279  TRP B CD2 1 
ATOM   6452 N  NE1 . TRP B 1 279 ? 82.948  59.064 84.087  1.00 36.42 ? 279  TRP B NE1 1 
ATOM   6453 C  CE2 . TRP B 1 279 ? 83.711  58.749 82.989  1.00 35.99 ? 279  TRP B CE2 1 
ATOM   6454 C  CE3 . TRP B 1 279 ? 84.027  59.566 80.725  1.00 34.78 ? 279  TRP B CE3 1 
ATOM   6455 C  CZ2 . TRP B 1 279 ? 84.666  57.732 82.809  1.00 33.26 ? 279  TRP B CZ2 1 
ATOM   6456 C  CZ3 . TRP B 1 279 ? 85.010  58.557 80.555  1.00 32.84 ? 279  TRP B CZ3 1 
ATOM   6457 C  CH2 . TRP B 1 279 ? 85.301  57.655 81.593  1.00 32.18 ? 279  TRP B CH2 1 
ATOM   6458 N  N   . ASN B 1 280 ? 81.495  65.079 81.666  1.00 37.50 ? 280  ASN B N   1 
ATOM   6459 C  CA  . ASN B 1 280 ? 80.880  66.194 80.941  1.00 38.81 ? 280  ASN B CA  1 
ATOM   6460 C  C   . ASN B 1 280 ? 81.850  67.109 80.198  1.00 38.36 ? 280  ASN B C   1 
ATOM   6461 O  O   . ASN B 1 280 ? 81.426  67.879 79.339  1.00 39.90 ? 280  ASN B O   1 
ATOM   6462 C  CB  . ASN B 1 280 ? 79.998  67.041 81.876  1.00 40.42 ? 280  ASN B CB  1 
ATOM   6463 C  CG  . ASN B 1 280 ? 78.841  66.246 82.497  1.00 41.45 ? 280  ASN B CG  1 
ATOM   6464 O  OD1 . ASN B 1 280 ? 78.613  65.078 82.172  1.00 42.27 ? 280  ASN B OD1 1 
ATOM   6465 N  ND2 . ASN B 1 280 ? 78.116  66.885 83.406  1.00 40.93 ? 280  ASN B ND2 1 
ATOM   6466 N  N   . VAL B 1 281 ? 83.137  67.034 80.520  1.00 36.93 ? 281  VAL B N   1 
ATOM   6467 C  CA  . VAL B 1 281 ? 84.150  67.959 79.943  1.00 36.12 ? 281  VAL B CA  1 
ATOM   6468 C  C   . VAL B 1 281 ? 84.763  67.487 78.613  1.00 36.39 ? 281  VAL B C   1 
ATOM   6469 O  O   . VAL B 1 281 ? 85.545  68.225 77.985  1.00 37.21 ? 281  VAL B O   1 
ATOM   6470 C  CB  . VAL B 1 281 ? 85.283  68.251 80.954  1.00 34.77 ? 281  VAL B CB  1 
ATOM   6471 C  CG1 . VAL B 1 281 ? 84.678  68.610 82.315  1.00 33.91 ? 281  VAL B CG1 1 
ATOM   6472 C  CG2 . VAL B 1 281 ? 86.264  67.046 81.082  1.00 32.60 ? 281  VAL B CG2 1 
ATOM   6473 N  N   . LEU B 1 282 ? 84.415  66.270 78.190  1.00 35.79 ? 282  LEU B N   1 
ATOM   6474 C  CA  . LEU B 1 282 ? 84.922  65.697 76.931  1.00 36.27 ? 282  LEU B CA  1 
ATOM   6475 C  C   . LEU B 1 282 ? 84.385  66.476 75.749  1.00 38.41 ? 282  LEU B C   1 
ATOM   6476 O  O   . LEU B 1 282 ? 83.209  66.806 75.719  1.00 40.67 ? 282  LEU B O   1 
ATOM   6477 C  CB  . LEU B 1 282 ? 84.612  64.181 76.788  1.00 33.92 ? 282  LEU B CB  1 
ATOM   6478 C  CG  . LEU B 1 282 ? 85.496  63.253 77.634  1.00 30.49 ? 282  LEU B CG  1 
ATOM   6479 C  CD1 . LEU B 1 282 ? 84.936  61.847 77.689  1.00 30.78 ? 282  LEU B CD1 1 
ATOM   6480 C  CD2 . LEU B 1 282 ? 86.973  63.251 77.122  1.00 25.30 ? 282  LEU B CD2 1 
ATOM   6481 N  N   . PRO B 1 283 ? 85.248  66.767 74.761  1.00 39.68 ? 283  PRO B N   1 
ATOM   6482 C  CA  . PRO B 1 283 ? 84.814  67.622 73.642  1.00 42.12 ? 283  PRO B CA  1 
ATOM   6483 C  C   . PRO B 1 283 ? 83.716  66.971 72.774  1.00 43.55 ? 283  PRO B C   1 
ATOM   6484 O  O   . PRO B 1 283 ? 82.906  67.686 72.209  1.00 44.78 ? 283  PRO B O   1 
ATOM   6485 C  CB  . PRO B 1 283 ? 86.114  67.816 72.822  1.00 42.59 ? 283  PRO B CB  1 
ATOM   6486 C  CG  . PRO B 1 283 ? 86.975  66.615 73.196  1.00 38.79 ? 283  PRO B CG  1 
ATOM   6487 C  CD  . PRO B 1 283 ? 86.667  66.377 74.652  1.00 37.98 ? 283  PRO B CD  1 
ATOM   6488 N  N   . PHE B 1 284 ? 83.705  65.636 72.668  1.00 42.98 ? 284  PHE B N   1 
ATOM   6489 C  CA  . PHE B 1 284 ? 82.776  64.946 71.758  1.00 44.04 ? 284  PHE B CA  1 
ATOM   6490 C  C   . PHE B 1 284 ? 82.087  63.739 72.415  1.00 42.49 ? 284  PHE B C   1 
ATOM   6491 O  O   . PHE B 1 284 ? 82.570  63.220 73.419  1.00 41.03 ? 284  PHE B O   1 
ATOM   6492 C  CB  . PHE B 1 284 ? 83.520  64.415 70.507  1.00 44.73 ? 284  PHE B CB  1 
ATOM   6493 C  CG  . PHE B 1 284 ? 84.568  65.347 69.942  1.00 47.85 ? 284  PHE B CG  1 
ATOM   6494 C  CD1 . PHE B 1 284 ? 84.199  66.469 69.176  1.00 54.21 ? 284  PHE B CD1 1 
ATOM   6495 C  CD2 . PHE B 1 284 ? 85.931  65.080 70.137  1.00 50.88 ? 284  PHE B CD2 1 
ATOM   6496 C  CE1 . PHE B 1 284 ? 85.176  67.337 68.636  1.00 55.55 ? 284  PHE B CE1 1 
ATOM   6497 C  CE2 . PHE B 1 284 ? 86.932  65.940 69.600  1.00 51.83 ? 284  PHE B CE2 1 
ATOM   6498 C  CZ  . PHE B 1 284 ? 86.550  67.062 68.848  1.00 55.34 ? 284  PHE B CZ  1 
ATOM   6499 N  N   . ASP B 1 285 ? 80.943  63.340 71.849  1.00 43.00 ? 285  ASP B N   1 
ATOM   6500 C  CA  A ASP B 1 285 ? 80.359  62.021 72.085  0.50 41.94 ? 285  ASP B CA  1 
ATOM   6501 C  CA  B ASP B 1 285 ? 80.365  62.018 72.088  0.50 42.31 ? 285  ASP B CA  1 
ATOM   6502 C  C   . ASP B 1 285 ? 81.443  61.046 71.637  1.00 40.70 ? 285  ASP B C   1 
ATOM   6503 O  O   . ASP B 1 285 ? 81.857  61.071 70.470  1.00 41.02 ? 285  ASP B O   1 
ATOM   6504 C  CB  A ASP B 1 285 ? 79.108  61.791 71.208  0.50 43.47 ? 285  ASP B CB  1 
ATOM   6505 C  CB  B ASP B 1 285 ? 79.113  61.827 71.217  0.50 44.25 ? 285  ASP B CB  1 
ATOM   6506 C  CG  A ASP B 1 285 ? 77.948  62.763 71.512  0.50 44.43 ? 285  ASP B CG  1 
ATOM   6507 C  CG  B ASP B 1 285 ? 78.129  60.813 71.792  0.50 45.23 ? 285  ASP B CG  1 
ATOM   6508 O  OD1 A ASP B 1 285 ? 77.964  63.457 72.550  0.50 43.33 ? 285  ASP B OD1 1 
ATOM   6509 O  OD1 B ASP B 1 285 ? 78.504  60.055 72.708  0.50 44.86 ? 285  ASP B OD1 1 
ATOM   6510 O  OD2 A ASP B 1 285 ? 76.998  62.810 70.701  0.50 44.77 ? 285  ASP B OD2 1 
ATOM   6511 O  OD2 B ASP B 1 285 ? 76.967  60.779 71.315  0.50 48.58 ? 285  ASP B OD2 1 
ATOM   6512 N  N   . SER B 1 286 ? 81.930  60.204 72.539  1.00 38.52 ? 286  SER B N   1 
ATOM   6513 C  CA  . SER B 1 286 ? 83.015  59.328 72.124  1.00 37.19 ? 286  SER B CA  1 
ATOM   6514 C  C   . SER B 1 286 ? 83.072  57.986 72.836  1.00 35.24 ? 286  SER B C   1 
ATOM   6515 O  O   . SER B 1 286 ? 82.337  57.748 73.791  1.00 34.88 ? 286  SER B O   1 
ATOM   6516 C  CB  . SER B 1 286 ? 84.332  60.045 72.322  1.00 36.10 ? 286  SER B CB  1 
ATOM   6517 O  OG  . SER B 1 286 ? 84.510  60.259 73.705  1.00 37.86 ? 286  SER B OG  1 
ATOM   6518 N  N   . ILE B 1 287 ? 83.992  57.155 72.344  1.00 34.16 ? 287  ILE B N   1 
ATOM   6519 C  CA  . ILE B 1 287 ? 84.341  55.811 72.809  1.00 32.30 ? 287  ILE B CA  1 
ATOM   6520 C  C   . ILE B 1 287 ? 85.850  55.849 73.109  1.00 30.56 ? 287  ILE B C   1 
ATOM   6521 O  O   . ILE B 1 287 ? 86.612  56.438 72.342  1.00 30.67 ? 287  ILE B O   1 
ATOM   6522 C  CB  . ILE B 1 287 ? 83.998  54.797 71.645  1.00 33.69 ? 287  ILE B CB  1 
ATOM   6523 C  CG1 . ILE B 1 287 ? 82.526  54.469 71.686  1.00 36.27 ? 287  ILE B CG1 1 
ATOM   6524 C  CG2 . ILE B 1 287 ? 84.742  53.472 71.704  1.00 32.67 ? 287  ILE B CG2 1 
ATOM   6525 C  CD1 . ILE B 1 287 ? 81.953  54.621 73.082  1.00 36.77 ? 287  ILE B CD1 1 
ATOM   6526 N  N   . PHE B 1 288 ? 86.289  55.245 74.208  1.00 29.02 ? 288  PHE B N   1 
ATOM   6527 C  CA  . PHE B 1 288 ? 87.727  55.145 74.543  1.00 28.47 ? 288  PHE B CA  1 
ATOM   6528 C  C   . PHE B 1 288 ? 88.385  56.523 74.694  1.00 28.99 ? 288  PHE B C   1 
ATOM   6529 O  O   . PHE B 1 288 ? 89.514  56.745 74.199  1.00 29.33 ? 288  PHE B O   1 
ATOM   6530 C  CB  . PHE B 1 288 ? 88.495  54.360 73.448  1.00 27.75 ? 288  PHE B CB  1 
ATOM   6531 C  CG  . PHE B 1 288 ? 89.571  53.458 73.970  1.00 25.13 ? 288  PHE B CG  1 
ATOM   6532 C  CD1 . PHE B 1 288 ? 90.498  53.908 74.896  1.00 23.77 ? 288  PHE B CD1 1 
ATOM   6533 C  CD2 . PHE B 1 288 ? 89.633  52.116 73.533  1.00 24.86 ? 288  PHE B CD2 1 
ATOM   6534 C  CE1 . PHE B 1 288 ? 91.499  53.072 75.386  1.00 22.94 ? 288  PHE B CE1 1 
ATOM   6535 C  CE2 . PHE B 1 288 ? 90.612  51.270 73.999  1.00 24.17 ? 288  PHE B CE2 1 
ATOM   6536 C  CZ  . PHE B 1 288 ? 91.563  51.736 74.944  1.00 25.01 ? 288  PHE B CZ  1 
ATOM   6537 N  N   . ARG B 1 289 ? 87.673  57.461 75.309  1.00 29.31 ? 289  ARG B N   1 
ATOM   6538 C  CA  . ARG B 1 289 ? 88.239  58.772 75.623  1.00 28.86 ? 289  ARG B CA  1 
ATOM   6539 C  C   . ARG B 1 289 ? 87.981  59.128 77.096  1.00 28.84 ? 289  ARG B C   1 
ATOM   6540 O  O   . ARG B 1 289 ? 86.892  58.911 77.625  1.00 29.39 ? 289  ARG B O   1 
ATOM   6541 C  CB  . ARG B 1 289 ? 87.688  59.870 74.696  1.00 30.36 ? 289  ARG B CB  1 
ATOM   6542 C  CG  . ARG B 1 289 ? 88.103  59.772 73.218  1.00 29.04 ? 289  ARG B CG  1 
ATOM   6543 C  CD  . ARG B 1 289 ? 89.621  59.827 73.051  1.00 30.12 ? 289  ARG B CD  1 
ATOM   6544 N  NE  . ARG B 1 289 ? 89.968  59.885 71.636  1.00 28.78 ? 289  ARG B NE  1 
ATOM   6545 C  CZ  . ARG B 1 289 ? 90.337  58.843 70.903  1.00 28.72 ? 289  ARG B CZ  1 
ATOM   6546 N  NH1 . ARG B 1 289 ? 90.423  57.623 71.454  1.00 25.99 ? 289  ARG B NH1 1 
ATOM   6547 N  NH2 . ARG B 1 289 ? 90.613  59.030 69.610  1.00 29.24 ? 289  ARG B NH2 1 
ATOM   6548 N  N   . PHE B 1 290 ? 89.005  59.649 77.751  1.00 28.33 ? 290  PHE B N   1 
ATOM   6549 C  CA  . PHE B 1 290 ? 88.960  59.894 79.194  1.00 28.55 ? 290  PHE B CA  1 
ATOM   6550 C  C   . PHE B 1 290 ? 89.293  61.369 79.486  1.00 29.15 ? 290  PHE B C   1 
ATOM   6551 O  O   . PHE B 1 290 ? 90.096  62.002 78.795  1.00 29.80 ? 290  PHE B O   1 
ATOM   6552 C  CB  . PHE B 1 290 ? 89.889  58.926 79.883  1.00 27.20 ? 290  PHE B CB  1 
ATOM   6553 C  CG  . PHE B 1 290 ? 89.779  57.523 79.344  1.00 27.78 ? 290  PHE B CG  1 
ATOM   6554 C  CD1 . PHE B 1 290 ? 88.615  56.781 79.546  1.00 28.14 ? 290  PHE B CD1 1 
ATOM   6555 C  CD2 . PHE B 1 290 ? 90.806  56.962 78.586  1.00 27.12 ? 290  PHE B CD2 1 
ATOM   6556 C  CE1 . PHE B 1 290 ? 88.474  55.496 79.034  1.00 27.79 ? 290  PHE B CE1 1 
ATOM   6557 C  CE2 . PHE B 1 290 ? 90.679  55.641 78.075  1.00 28.30 ? 290  PHE B CE2 1 
ATOM   6558 C  CZ  . PHE B 1 290 ? 89.520  54.917 78.302  1.00 27.42 ? 290  PHE B CZ  1 
ATOM   6559 N  N   . SER B 1 291 ? 88.613  61.927 80.469  1.00 29.40 ? 291  SER B N   1 
ATOM   6560 C  CA  . SER B 1 291 ? 88.616  63.365 80.671  1.00 29.30 ? 291  SER B CA  1 
ATOM   6561 C  C   . SER B 1 291 ? 89.963  63.954 81.136  1.00 29.21 ? 291  SER B C   1 
ATOM   6562 O  O   . SER B 1 291 ? 90.465  64.889 80.515  1.00 30.59 ? 291  SER B O   1 
ATOM   6563 C  CB  . SER B 1 291 ? 87.500  63.709 81.629  1.00 29.89 ? 291  SER B CB  1 
ATOM   6564 O  OG  . SER B 1 291 ? 86.268  63.553 80.962  1.00 29.92 ? 291  SER B OG  1 
ATOM   6565 N  N   . PHE B 1 292 ? 90.561  63.393 82.182  1.00 28.30 ? 292  PHE B N   1 
ATOM   6566 C  CA  . PHE B 1 292 ? 91.784  63.948 82.757  1.00 28.32 ? 292  PHE B CA  1 
ATOM   6567 C  C   . PHE B 1 292 ? 92.985  63.024 82.655  1.00 27.86 ? 292  PHE B C   1 
ATOM   6568 O  O   . PHE B 1 292 ? 93.098  62.015 83.370  1.00 26.84 ? 292  PHE B O   1 
ATOM   6569 C  CB  . PHE B 1 292 ? 91.529  64.420 84.204  1.00 29.16 ? 292  PHE B CB  1 
ATOM   6570 C  CG  . PHE B 1 292 ? 90.459  65.475 84.291  1.00 31.08 ? 292  PHE B CG  1 
ATOM   6571 C  CD1 . PHE B 1 292 ? 90.724  66.784 83.888  1.00 29.16 ? 292  PHE B CD1 1 
ATOM   6572 C  CD2 . PHE B 1 292 ? 89.175  65.147 84.709  1.00 30.60 ? 292  PHE B CD2 1 
ATOM   6573 C  CE1 . PHE B 1 292 ? 89.751  67.751 83.924  1.00 30.31 ? 292  PHE B CE1 1 
ATOM   6574 C  CE2 . PHE B 1 292 ? 88.176  66.117 84.729  1.00 29.24 ? 292  PHE B CE2 1 
ATOM   6575 C  CZ  . PHE B 1 292 ? 88.469  67.422 84.336  1.00 32.26 ? 292  PHE B CZ  1 
ATOM   6576 N  N   . VAL B 1 293 ? 93.907  63.415 81.768  1.00 27.39 ? 293  VAL B N   1 
ATOM   6577 C  CA  . VAL B 1 293 ? 94.985  62.565 81.328  1.00 25.41 ? 293  VAL B CA  1 
ATOM   6578 C  C   . VAL B 1 293 ? 96.255  63.427 81.228  1.00 26.43 ? 293  VAL B C   1 
ATOM   6579 O  O   . VAL B 1 293 ? 96.172  64.680 81.303  1.00 28.04 ? 293  VAL B O   1 
ATOM   6580 C  CB  . VAL B 1 293 ? 94.622  61.901 79.941  1.00 25.45 ? 293  VAL B CB  1 
ATOM   6581 C  CG1 . VAL B 1 293 ? 93.316  61.079 80.042  1.00 24.60 ? 293  VAL B CG1 1 
ATOM   6582 C  CG2 . VAL B 1 293 ? 94.500  62.942 78.857  1.00 26.31 ? 293  VAL B CG2 1 
ATOM   6583 N  N   . PRO B 1 294 ? 97.430  62.781 81.101  1.00 25.36 ? 294  PRO B N   1 
ATOM   6584 C  CA  . PRO B 1 294 ? 98.698  63.486 81.001  1.00 26.21 ? 294  PRO B CA  1 
ATOM   6585 C  C   . PRO B 1 294 ? 98.626  64.580 79.969  1.00 27.27 ? 294  PRO B C   1 
ATOM   6586 O  O   . PRO B 1 294 ? 97.949  64.417 78.956  1.00 26.77 ? 294  PRO B O   1 
ATOM   6587 C  CB  . PRO B 1 294 ? 99.667  62.386 80.581  1.00 25.13 ? 294  PRO B CB  1 
ATOM   6588 C  CG  . PRO B 1 294 ? 99.127  61.147 81.342  1.00 24.30 ? 294  PRO B CG  1 
ATOM   6589 C  CD  . PRO B 1 294 ? 97.628  61.343 81.406  1.00 25.25 ? 294  PRO B CD  1 
ATOM   6590 N  N   . VAL B 1 295 ? 99.265  65.711 80.263  1.00 29.01 ? 295  VAL B N   1 
ATOM   6591 C  CA  . VAL B 1 295 ? 99.354  66.844 79.314  1.00 30.59 ? 295  VAL B CA  1 
ATOM   6592 C  C   . VAL B 1 295 ? 100.766 67.030 78.774  1.00 30.50 ? 295  VAL B C   1 
ATOM   6593 O  O   . VAL B 1 295 ? 101.729 66.955 79.553  1.00 30.19 ? 295  VAL B O   1 
ATOM   6594 C  CB  . VAL B 1 295 ? 98.949  68.193 79.972  1.00 32.44 ? 295  VAL B CB  1 
ATOM   6595 C  CG1 . VAL B 1 295 ? 97.449  68.284 80.085  1.00 34.92 ? 295  VAL B CG1 1 
ATOM   6596 C  CG2 . VAL B 1 295 ? 99.636  68.398 81.365  1.00 32.64 ? 295  VAL B CG2 1 
ATOM   6597 N  N   . ILE B 1 296 ? 100.897 67.312 77.470  1.00 30.97 ? 296  ILE B N   1 
ATOM   6598 C  CA  . ILE B 1 296 ? 102.215 67.616 76.883  1.00 32.16 ? 296  ILE B CA  1 
ATOM   6599 C  C   . ILE B 1 296 ? 102.649 69.076 77.255  1.00 35.28 ? 296  ILE B C   1 
ATOM   6600 O  O   . ILE B 1 296 ? 102.320 70.054 76.561  1.00 34.48 ? 296  ILE B O   1 
ATOM   6601 C  CB  . ILE B 1 296 ? 102.230 67.380 75.357  1.00 32.66 ? 296  ILE B CB  1 
ATOM   6602 C  CG1 . ILE B 1 296 ? 101.666 65.985 74.991  1.00 33.01 ? 296  ILE B CG1 1 
ATOM   6603 C  CG2 . ILE B 1 296 ? 103.647 67.534 74.798  1.00 33.18 ? 296  ILE B CG2 1 
ATOM   6604 C  CD1 . ILE B 1 296 ? 102.177 64.770 75.841  1.00 28.61 ? 296  ILE B CD1 1 
ATOM   6605 N  N   . ASP B 1 297 ? 103.398 69.176 78.353  1.00 36.20 ? 297  ASP B N   1 
ATOM   6606 C  CA  . ASP B 1 297 ? 103.576 70.415 79.099  1.00 39.14 ? 297  ASP B CA  1 
ATOM   6607 C  C   . ASP B 1 297 ? 104.865 71.171 78.812  1.00 41.48 ? 297  ASP B C   1 
ATOM   6608 O  O   . ASP B 1 297 ? 104.914 72.383 79.010  1.00 43.54 ? 297  ASP B O   1 
ATOM   6609 C  CB  . ASP B 1 297 ? 103.505 70.123 80.596  1.00 38.45 ? 297  ASP B CB  1 
ATOM   6610 C  CG  . ASP B 1 297 ? 104.489 69.069 81.022  1.00 38.97 ? 297  ASP B CG  1 
ATOM   6611 O  OD1 . ASP B 1 297 ? 105.116 68.430 80.124  1.00 40.35 ? 297  ASP B OD1 1 
ATOM   6612 O  OD2 . ASP B 1 297 ? 104.637 68.866 82.253  1.00 39.39 ? 297  ASP B OD2 1 
ATOM   6613 N  N   . GLY B 1 298 ? 105.897 70.467 78.348  1.00 41.84 ? 298  GLY B N   1 
ATOM   6614 C  CA  . GLY B 1 298 ? 107.194 71.090 78.137  1.00 44.57 ? 298  GLY B CA  1 
ATOM   6615 C  C   . GLY B 1 298 ? 108.084 70.921 79.361  1.00 45.35 ? 298  GLY B C   1 
ATOM   6616 O  O   . GLY B 1 298 ? 109.184 71.468 79.398  1.00 46.17 ? 298  GLY B O   1 
ATOM   6617 N  N   . GLU B 1 299 ? 107.615 70.136 80.340  1.00 44.72 ? 299  GLU B N   1 
ATOM   6618 C  CA  . GLU B 1 299 ? 108.345 69.871 81.594  1.00 45.33 ? 299  GLU B CA  1 
ATOM   6619 C  C   . GLU B 1 299 ? 108.579 68.355 81.834  1.00 43.47 ? 299  GLU B C   1 
ATOM   6620 O  O   . GLU B 1 299 ? 109.725 67.851 81.737  1.00 44.10 ? 299  GLU B O   1 
ATOM   6621 C  CB  . GLU B 1 299 ? 107.597 70.499 82.772  1.00 46.19 ? 299  GLU B CB  1 
ATOM   6622 C  CG  . GLU B 1 299 ? 108.480 70.773 83.996  1.00 50.25 ? 299  GLU B CG  1 
ATOM   6623 C  CD  . GLU B 1 299 ? 107.715 71.322 85.213  0.50 51.98 ? 299  GLU B CD  1 
ATOM   6624 O  OE1 . GLU B 1 299 ? 106.469 71.444 85.160  0.50 51.39 ? 299  GLU B OE1 1 
ATOM   6625 O  OE2 . GLU B 1 299 ? 108.380 71.624 86.235  0.50 53.52 ? 299  GLU B OE2 1 
ATOM   6626 N  N   . PHE B 1 300 ? 107.511 67.629 82.151  1.00 40.77 ? 300  PHE B N   1 
ATOM   6627 C  CA  . PHE B 1 300 ? 107.582 66.170 82.217  1.00 38.01 ? 300  PHE B CA  1 
ATOM   6628 C  C   . PHE B 1 300 ? 107.899 65.650 80.806  1.00 37.52 ? 300  PHE B C   1 
ATOM   6629 O  O   . PHE B 1 300 ? 108.696 64.721 80.640  1.00 36.58 ? 300  PHE B O   1 
ATOM   6630 C  CB  . PHE B 1 300 ? 106.253 65.596 82.722  1.00 36.69 ? 300  PHE B CB  1 
ATOM   6631 C  CG  . PHE B 1 300 ? 106.313 64.126 83.083  1.00 34.31 ? 300  PHE B CG  1 
ATOM   6632 C  CD1 . PHE B 1 300 ? 106.170 63.150 82.104  1.00 31.27 ? 300  PHE B CD1 1 
ATOM   6633 C  CD2 . PHE B 1 300 ? 106.470 63.722 84.402  1.00 31.82 ? 300  PHE B CD2 1 
ATOM   6634 C  CE1 . PHE B 1 300 ? 106.208 61.788 82.423  1.00 29.04 ? 300  PHE B CE1 1 
ATOM   6635 C  CE2 . PHE B 1 300 ? 106.521 62.358 84.720  1.00 30.23 ? 300  PHE B CE2 1 
ATOM   6636 C  CZ  . PHE B 1 300 ? 106.400 61.402 83.721  1.00 27.67 ? 300  PHE B CZ  1 
ATOM   6637 N  N   . PHE B 1 301 ? 107.289 66.286 79.801  1.00 37.23 ? 301  PHE B N   1 
ATOM   6638 C  CA  . PHE B 1 301 ? 107.562 66.024 78.400  1.00 36.75 ? 301  PHE B CA  1 
ATOM   6639 C  C   . PHE B 1 301 ? 108.182 67.281 77.815  1.00 39.19 ? 301  PHE B C   1 
ATOM   6640 O  O   . PHE B 1 301 ? 107.487 68.262 77.639  1.00 40.97 ? 301  PHE B O   1 
ATOM   6641 C  CB  . PHE B 1 301 ? 106.275 65.668 77.634  1.00 35.59 ? 301  PHE B CB  1 
ATOM   6642 C  CG  . PHE B 1 301 ? 105.537 64.480 78.211  1.00 31.48 ? 301  PHE B CG  1 
ATOM   6643 C  CD1 . PHE B 1 301 ? 106.015 63.175 78.017  1.00 31.43 ? 301  PHE B CD1 1 
ATOM   6644 C  CD2 . PHE B 1 301 ? 104.408 64.665 78.980  1.00 29.08 ? 301  PHE B CD2 1 
ATOM   6645 C  CE1 . PHE B 1 301 ? 105.356 62.057 78.565  1.00 28.04 ? 301  PHE B CE1 1 
ATOM   6646 C  CE2 . PHE B 1 301 ? 103.726 63.555 79.561  1.00 29.67 ? 301  PHE B CE2 1 
ATOM   6647 C  CZ  . PHE B 1 301 ? 104.203 62.250 79.341  1.00 27.96 ? 301  PHE B CZ  1 
ATOM   6648 N  N   . PRO B 1 302 ? 109.494 67.257 77.513  1.00 39.81 ? 302  PRO B N   1 
ATOM   6649 C  CA  . PRO B 1 302 ? 110.157 68.476 77.002  1.00 41.37 ? 302  PRO B CA  1 
ATOM   6650 C  C   . PRO B 1 302 ? 109.625 68.971 75.646  1.00 41.99 ? 302  PRO B C   1 
ATOM   6651 O  O   . PRO B 1 302 ? 109.568 70.179 75.423  1.00 43.66 ? 302  PRO B O   1 
ATOM   6652 C  CB  . PRO B 1 302 ? 111.638 68.084 76.894  1.00 41.78 ? 302  PRO B CB  1 
ATOM   6653 C  CG  . PRO B 1 302 ? 111.694 66.596 77.171  1.00 41.52 ? 302  PRO B CG  1 
ATOM   6654 C  CD  . PRO B 1 302 ? 110.441 66.184 77.865  1.00 38.26 ? 302  PRO B CD  1 
ATOM   6655 N  N   . THR B 1 303 ? 109.272 68.042 74.754  1.00 40.51 ? 303  THR B N   1 
ATOM   6656 C  CA  . THR B 1 303 ? 108.678 68.366 73.457  1.00 40.08 ? 303  THR B CA  1 
ATOM   6657 C  C   . THR B 1 303 ? 107.601 67.313 73.135  1.00 38.02 ? 303  THR B C   1 
ATOM   6658 O  O   . THR B 1 303 ? 107.333 66.431 73.951  1.00 35.72 ? 303  THR B O   1 
ATOM   6659 C  CB  . THR B 1 303 ? 109.721 68.384 72.333  1.00 41.61 ? 303  THR B CB  1 
ATOM   6660 O  OG1 . THR B 1 303 ? 110.393 67.123 72.286  1.00 42.03 ? 303  THR B OG1 1 
ATOM   6661 C  CG2 . THR B 1 303 ? 110.767 69.469 72.548  1.00 43.55 ? 303  THR B CG2 1 
ATOM   6662 N  N   . SER B 1 304 ? 106.971 67.426 71.964  1.00 37.42 ? 304  SER B N   1 
ATOM   6663 C  CA  . SER B 1 304 ? 105.943 66.479 71.518  1.00 35.62 ? 304  SER B CA  1 
ATOM   6664 C  C   . SER B 1 304 ? 106.439 65.032 71.599  1.00 33.21 ? 304  SER B C   1 
ATOM   6665 O  O   . SER B 1 304 ? 107.615 64.767 71.405  1.00 32.86 ? 304  SER B O   1 
ATOM   6666 C  CB  . SER B 1 304 ? 105.569 66.778 70.069  1.00 36.92 ? 304  SER B CB  1 
ATOM   6667 O  OG  . SER B 1 304 ? 106.605 66.323 69.219  1.00 39.22 ? 304  SER B OG  1 
ATOM   6668 N  N   . LEU B 1 305 ? 105.536 64.116 71.911  1.00 32.16 ? 305  LEU B N   1 
ATOM   6669 C  CA  . LEU B 1 305 ? 105.874 62.678 71.971  1.00 31.30 ? 305  LEU B CA  1 
ATOM   6670 C  C   . LEU B 1 305 ? 106.507 62.257 70.682  1.00 31.68 ? 305  LEU B C   1 
ATOM   6671 O  O   . LEU B 1 305 ? 107.515 61.583 70.693  1.00 31.74 ? 305  LEU B O   1 
ATOM   6672 C  CB  . LEU B 1 305 ? 104.648 61.833 72.250  1.00 29.87 ? 305  LEU B CB  1 
ATOM   6673 C  CG  . LEU B 1 305 ? 103.914 62.212 73.522  1.00 29.29 ? 305  LEU B CG  1 
ATOM   6674 C  CD1 . LEU B 1 305 ? 102.832 61.175 73.739  1.00 26.47 ? 305  LEU B CD1 1 
ATOM   6675 C  CD2 . LEU B 1 305 ? 104.930 62.268 74.695  1.00 28.18 ? 305  LEU B CD2 1 
ATOM   6676 N  N   . GLU B 1 306 ? 105.942 62.710 69.571  1.00 33.41 ? 306  GLU B N   1 
ATOM   6677 C  CA  . GLU B 1 306 ? 106.447 62.328 68.263  1.00 35.49 ? 306  GLU B CA  1 
ATOM   6678 C  C   . GLU B 1 306 ? 107.841 62.873 67.981  1.00 37.12 ? 306  GLU B C   1 
ATOM   6679 O  O   . GLU B 1 306 ? 108.677 62.149 67.430  1.00 37.80 ? 306  GLU B O   1 
ATOM   6680 C  CB  . GLU B 1 306 ? 105.446 62.688 67.150  1.00 36.66 ? 306  GLU B CB  1 
ATOM   6681 C  CG  . GLU B 1 306 ? 105.868 62.251 65.729  1.00 39.72 ? 306  GLU B CG  1 
ATOM   6682 C  CD  . GLU B 1 306 ? 105.836 60.711 65.506  1.00 41.58 ? 306  GLU B CD  1 
ATOM   6683 O  OE1 . GLU B 1 306 ? 105.413 59.939 66.398  1.00 39.28 ? 306  GLU B OE1 1 
ATOM   6684 O  OE2 . GLU B 1 306 ? 106.226 60.267 64.406  1.00 45.75 ? 306  GLU B OE2 1 
ATOM   6685 N  N   . SER B 1 307 ? 108.112 64.136 68.342  1.00 37.80 ? 307  SER B N   1 
ATOM   6686 C  CA  . SER B 1 307 ? 109.476 64.667 68.121  1.00 39.41 ? 307  SER B CA  1 
ATOM   6687 C  C   . SER B 1 307 ? 110.538 63.974 69.001  1.00 38.31 ? 307  SER B C   1 
ATOM   6688 O  O   . SER B 1 307 ? 111.667 63.793 68.566  1.00 39.32 ? 307  SER B O   1 
ATOM   6689 C  CB  . SER B 1 307 ? 109.562 66.194 68.265  1.00 40.51 ? 307  SER B CB  1 
ATOM   6690 O  OG  . SER B 1 307 ? 109.211 66.594 69.582  1.00 41.85 ? 307  SER B OG  1 
ATOM   6691 N  N   . MET B 1 308 ? 110.165 63.584 70.217  1.00 36.88 ? 308  MET B N   1 
ATOM   6692 C  CA  . MET B 1 308 ? 111.069 62.845 71.114  1.00 36.44 ? 308  MET B CA  1 
ATOM   6693 C  C   . MET B 1 308 ? 111.365 61.457 70.558  1.00 37.08 ? 308  MET B C   1 
ATOM   6694 O  O   . MET B 1 308 ? 112.507 61.012 70.577  1.00 37.94 ? 308  MET B O   1 
ATOM   6695 C  CB  . MET B 1 308 ? 110.492 62.713 72.538  1.00 34.06 ? 308  MET B CB  1 
ATOM   6696 C  CG  . MET B 1 308 ? 110.380 64.021 73.374  1.00 33.78 ? 308  MET B CG  1 
ATOM   6697 S  SD  . MET B 1 308 ? 109.667 63.746 75.035  1.00 33.35 ? 308  MET B SD  1 
ATOM   6698 C  CE  . MET B 1 308 ? 111.177 63.359 75.920  1.00 33.57 ? 308  MET B CE  1 
ATOM   6699 N  N   . LEU B 1 309 ? 110.329 60.769 70.069  1.00 37.80 ? 309  LEU B N   1 
ATOM   6700 C  CA  . LEU B 1 309 ? 110.483 59.446 69.501  1.00 38.21 ? 309  LEU B CA  1 
ATOM   6701 C  C   . LEU B 1 309 ? 111.370 59.458 68.248  1.00 41.00 ? 309  LEU B C   1 
ATOM   6702 O  O   . LEU B 1 309 ? 112.111 58.496 68.000  1.00 42.11 ? 309  LEU B O   1 
ATOM   6703 C  CB  . LEU B 1 309 ? 109.113 58.840 69.207  1.00 37.84 ? 309  LEU B CB  1 
ATOM   6704 C  CG  . LEU B 1 309 ? 108.295 58.317 70.393  1.00 36.69 ? 309  LEU B CG  1 
ATOM   6705 C  CD1 . LEU B 1 309 ? 106.903 57.852 69.930  1.00 36.32 ? 309  LEU B CD1 1 
ATOM   6706 C  CD2 . LEU B 1 309 ? 109.018 57.201 71.148  1.00 34.96 ? 309  LEU B CD2 1 
ATOM   6707 N  N   . ASN B 1 310 ? 111.338 60.548 67.478  1.00 42.74 ? 310  ASN B N   1 
ATOM   6708 C  CA  . ASN B 1 310 ? 112.130 60.634 66.248  1.00 44.58 ? 310  ASN B CA  1 
ATOM   6709 C  C   . ASN B 1 310 ? 113.573 60.955 66.491  1.00 45.41 ? 310  ASN B C   1 
ATOM   6710 O  O   . ASN B 1 310 ? 114.429 60.530 65.736  1.00 46.83 ? 310  ASN B O   1 
ATOM   6711 C  CB  . ASN B 1 310 ? 111.565 61.697 65.294  1.00 46.44 ? 310  ASN B CB  1 
ATOM   6712 C  CG  . ASN B 1 310 ? 110.316 61.241 64.599  1.00 47.29 ? 310  ASN B CG  1 
ATOM   6713 O  OD1 . ASN B 1 310 ? 110.068 60.034 64.476  1.00 48.55 ? 310  ASN B OD1 1 
ATOM   6714 N  ND2 . ASN B 1 310 ? 109.513 62.195 64.133  1.00 47.72 ? 310  ASN B ND2 1 
ATOM   6715 N  N   . SER B 1 311 ? 113.843 61.763 67.508  1.00 45.28 ? 311  SER B N   1 
ATOM   6716 C  CA  . SER B 1 311 ? 115.216 62.168 67.800  1.00 46.08 ? 311  SER B CA  1 
ATOM   6717 C  C   . SER B 1 311 ? 115.931 61.159 68.690  1.00 44.60 ? 311  SER B C   1 
ATOM   6718 O  O   . SER B 1 311 ? 117.127 61.260 68.899  1.00 45.98 ? 311  SER B O   1 
ATOM   6719 C  CB  . SER B 1 311 ? 115.243 63.566 68.442  1.00 46.88 ? 311  SER B CB  1 
ATOM   6720 O  OG  . SER B 1 311 ? 114.490 63.590 69.647  1.00 46.87 ? 311  SER B OG  1 
ATOM   6721 N  N   . GLY B 1 312 ? 115.195 60.181 69.205  1.00 42.62 ? 312  GLY B N   1 
ATOM   6722 C  CA  . GLY B 1 312 ? 115.748 59.228 70.145  1.00 41.12 ? 312  GLY B CA  1 
ATOM   6723 C  C   . GLY B 1 312 ? 115.990 59.847 71.516  1.00 40.59 ? 312  GLY B C   1 
ATOM   6724 O  O   . GLY B 1 312 ? 116.843 59.382 72.258  1.00 40.09 ? 312  GLY B O   1 
ATOM   6725 N  N   . ASN B 1 313 ? 115.249 60.905 71.839  1.00 40.20 ? 313  ASN B N   1 
ATOM   6726 C  CA  . ASN B 1 313 ? 115.299 61.527 73.156  1.00 40.07 ? 313  ASN B CA  1 
ATOM   6727 C  C   . ASN B 1 313 ? 114.461 60.762 74.170  1.00 37.61 ? 313  ASN B C   1 
ATOM   6728 O  O   . ASN B 1 313 ? 113.330 61.156 74.471  1.00 36.99 ? 313  ASN B O   1 
ATOM   6729 C  CB  . ASN B 1 313 ? 114.807 62.977 73.087  1.00 41.72 ? 313  ASN B CB  1 
ATOM   6730 C  CG  . ASN B 1 313 ? 114.944 63.710 74.431  1.00 44.41 ? 313  ASN B CG  1 
ATOM   6731 O  OD1 . ASN B 1 313 ? 115.623 63.230 75.351  1.00 45.33 ? 313  ASN B OD1 1 
ATOM   6732 N  ND2 . ASN B 1 313 ? 114.312 64.883 74.538  1.00 46.93 ? 313  ASN B ND2 1 
ATOM   6733 N  N   . PHE B 1 314 ? 115.019 59.678 74.705  1.00 35.83 ? 314  PHE B N   1 
ATOM   6734 C  CA  . PHE B 1 314 ? 114.282 58.808 75.612  1.00 33.62 ? 314  PHE B CA  1 
ATOM   6735 C  C   . PHE B 1 314 ? 115.219 57.729 76.115  1.00 33.33 ? 314  PHE B C   1 
ATOM   6736 O  O   . PHE B 1 314 ? 116.279 57.540 75.536  1.00 34.11 ? 314  PHE B O   1 
ATOM   6737 C  CB  . PHE B 1 314 ? 113.041 58.202 74.919  1.00 31.86 ? 314  PHE B CB  1 
ATOM   6738 C  CG  . PHE B 1 314 ? 113.337 57.423 73.646  1.00 33.06 ? 314  PHE B CG  1 
ATOM   6739 C  CD1 . PHE B 1 314 ? 113.909 56.146 73.689  1.00 30.60 ? 314  PHE B CD1 1 
ATOM   6740 C  CD2 . PHE B 1 314 ? 112.984 57.942 72.408  1.00 32.70 ? 314  PHE B CD2 1 
ATOM   6741 C  CE1 . PHE B 1 314 ? 114.150 55.428 72.510  1.00 29.22 ? 314  PHE B CE1 1 
ATOM   6742 C  CE2 . PHE B 1 314 ? 113.206 57.223 71.243  1.00 31.67 ? 314  PHE B CE2 1 
ATOM   6743 C  CZ  . PHE B 1 314 ? 113.790 55.970 71.297  1.00 31.77 ? 314  PHE B CZ  1 
ATOM   6744 N  N   . LYS B 1 315 ? 114.840 57.039 77.186  1.00 32.21 ? 315  LYS B N   1 
ATOM   6745 C  CA  . LYS B 1 315 ? 115.709 56.017 77.771  1.00 32.63 ? 315  LYS B CA  1 
ATOM   6746 C  C   . LYS B 1 315 ? 116.027 54.906 76.789  1.00 32.90 ? 315  LYS B C   1 
ATOM   6747 O  O   . LYS B 1 315 ? 115.122 54.305 76.202  1.00 32.42 ? 315  LYS B O   1 
ATOM   6748 C  CB  . LYS B 1 315 ? 115.082 55.412 79.041  1.00 31.98 ? 315  LYS B CB  1 
ATOM   6749 C  CG  . LYS B 1 315 ? 116.072 54.631 79.935  1.00 31.18 ? 315  LYS B CG  1 
ATOM   6750 C  CD  . LYS B 1 315 ? 115.333 53.978 81.128  1.00 29.12 ? 315  LYS B CD  1 
ATOM   6751 C  CE  . LYS B 1 315 ? 116.196 52.930 81.818  1.00 26.45 ? 315  LYS B CE  1 
ATOM   6752 N  NZ  . LYS B 1 315 ? 117.270 53.611 82.643  1.00 29.59 ? 315  LYS B NZ  1 
ATOM   6753 N  N   . LYS B 1 316 ? 117.316 54.617 76.625  1.00 33.80 ? 316  LYS B N   1 
ATOM   6754 C  CA  . LYS B 1 316 ? 117.745 53.536 75.762  1.00 34.38 ? 316  LYS B CA  1 
ATOM   6755 C  C   . LYS B 1 316 ? 117.978 52.281 76.573  1.00 33.73 ? 316  LYS B C   1 
ATOM   6756 O  O   . LYS B 1 316 ? 118.938 52.192 77.330  1.00 34.75 ? 316  LYS B O   1 
ATOM   6757 C  CB  . LYS B 1 316 ? 119.009 53.925 74.988  1.00 36.35 ? 316  LYS B CB  1 
ATOM   6758 C  CG  . LYS B 1 316 ? 118.693 54.736 73.763  1.00 39.78 ? 316  LYS B CG  1 
ATOM   6759 C  CD  . LYS B 1 316 ? 119.051 56.168 73.930  1.00 45.61 ? 316  LYS B CD  1 
ATOM   6760 C  CE  . LYS B 1 316 ? 118.864 56.893 72.626  1.00 47.96 ? 316  LYS B CE  1 
ATOM   6761 N  NZ  . LYS B 1 316 ? 119.599 58.204 72.588  1.00 52.50 ? 316  LYS B NZ  1 
ATOM   6762 N  N   . THR B 1 317 ? 117.099 51.303 76.427  1.00 32.05 ? 317  THR B N   1 
ATOM   6763 C  CA  . THR B 1 317 ? 117.206 50.093 77.228  1.00 31.07 ? 317  THR B CA  1 
ATOM   6764 C  C   . THR B 1 317 ? 116.454 48.954 76.524  1.00 30.84 ? 317  THR B C   1 
ATOM   6765 O  O   . THR B 1 317 ? 116.233 49.017 75.298  1.00 30.71 ? 317  THR B O   1 
ATOM   6766 C  CB  . THR B 1 317 ? 116.711 50.315 78.687  1.00 29.73 ? 317  THR B CB  1 
ATOM   6767 O  OG1 . THR B 1 317 ? 116.981 49.152 79.486  1.00 31.22 ? 317  THR B OG1 1 
ATOM   6768 C  CG2 . THR B 1 317 ? 115.230 50.637 78.747  1.00 27.21 ? 317  THR B CG2 1 
ATOM   6769 N  N   . GLN B 1 318 ? 116.089 47.919 77.281  1.00 29.98 ? 318  GLN B N   1 
ATOM   6770 C  CA  . GLN B 1 318 ? 115.350 46.806 76.699  1.00 30.11 ? 318  GLN B CA  1 
ATOM   6771 C  C   . GLN B 1 318 ? 113.890 46.984 77.037  1.00 28.37 ? 318  GLN B C   1 
ATOM   6772 O  O   . GLN B 1 318 ? 113.562 47.424 78.127  1.00 26.80 ? 318  GLN B O   1 
ATOM   6773 C  CB  . GLN B 1 318 ? 115.894 45.425 77.134  1.00 29.94 ? 318  GLN B CB  1 
ATOM   6774 C  CG  . GLN B 1 318 ? 117.378 45.244 76.873  1.00 32.24 ? 318  GLN B CG  1 
ATOM   6775 C  CD  . GLN B 1 318 ? 118.216 45.778 78.030  1.00 35.00 ? 318  GLN B CD  1 
ATOM   6776 O  OE1 . GLN B 1 318 ? 117.717 45.904 79.153  1.00 36.54 ? 318  GLN B OE1 1 
ATOM   6777 N  NE2 . GLN B 1 318 ? 119.482 46.104 77.764  1.00 35.08 ? 318  GLN B NE2 1 
ATOM   6778 N  N   . ILE B 1 319 ? 113.014 46.661 76.084  1.00 28.19 ? 319  ILE B N   1 
ATOM   6779 C  CA  . ILE B 1 319 ? 111.581 46.690 76.370  1.00 26.72 ? 319  ILE B CA  1 
ATOM   6780 C  C   . ILE B 1 319 ? 110.898 45.404 75.924  1.00 27.29 ? 319  ILE B C   1 
ATOM   6781 O  O   . ILE B 1 319 ? 111.316 44.744 74.980  1.00 26.87 ? 319  ILE B O   1 
ATOM   6782 C  CB  . ILE B 1 319 ? 110.868 47.888 75.752  1.00 26.24 ? 319  ILE B CB  1 
ATOM   6783 C  CG1 . ILE B 1 319 ? 110.943 47.852 74.212  1.00 26.24 ? 319  ILE B CG1 1 
ATOM   6784 C  CG2 . ILE B 1 319 ? 111.414 49.196 76.324  1.00 25.95 ? 319  ILE B CG2 1 
ATOM   6785 C  CD1 . ILE B 1 319 ? 109.972 48.888 73.573  1.00 28.36 ? 319  ILE B CD1 1 
ATOM   6786 N  N   . LEU B 1 320 ? 109.835 45.057 76.634  1.00 26.78 ? 320  LEU B N   1 
ATOM   6787 C  CA  . LEU B 1 320 ? 109.023 43.947 76.244  1.00 26.98 ? 320  LEU B CA  1 
ATOM   6788 C  C   . LEU B 1 320 ? 107.625 44.535 76.252  1.00 26.28 ? 320  LEU B C   1 
ATOM   6789 O  O   . LEU B 1 320 ? 107.255 45.256 77.186  1.00 25.87 ? 320  LEU B O   1 
ATOM   6790 C  CB  . LEU B 1 320 ? 109.181 42.802 77.236  1.00 26.33 ? 320  LEU B CB  1 
ATOM   6791 C  CG  . LEU B 1 320 ? 108.447 41.505 76.899  1.00 26.64 ? 320  LEU B CG  1 
ATOM   6792 C  CD1 . LEU B 1 320 ? 109.241 40.263 77.450  1.00 21.88 ? 320  LEU B CD1 1 
ATOM   6793 C  CD2 . LEU B 1 320 ? 107.016 41.564 77.470  1.00 25.12 ? 320  LEU B CD2 1 
ATOM   6794 N  N   . LEU B 1 321 ? 106.850 44.218 75.213  1.00 25.95 ? 321  LEU B N   1 
ATOM   6795 C  CA  . LEU B 1 321 ? 105.528 44.784 75.072  1.00 24.42 ? 321  LEU B CA  1 
ATOM   6796 C  C   . LEU B 1 321 ? 104.673 44.036 74.082  1.00 25.09 ? 321  LEU B C   1 
ATOM   6797 O  O   . LEU B 1 321 ? 105.168 43.253 73.278  1.00 24.64 ? 321  LEU B O   1 
ATOM   6798 C  CB  . LEU B 1 321 ? 105.636 46.213 74.610  1.00 23.54 ? 321  LEU B CB  1 
ATOM   6799 C  CG  . LEU B 1 321 ? 106.105 46.516 73.191  1.00 25.84 ? 321  LEU B CG  1 
ATOM   6800 C  CD1 . LEU B 1 321 ? 106.046 48.086 72.969  1.00 25.50 ? 321  LEU B CD1 1 
ATOM   6801 C  CD2 . LEU B 1 321 ? 107.548 45.976 72.949  1.00 22.10 ? 321  LEU B CD2 1 
ATOM   6802 N  N   . GLY B 1 322 ? 103.387 44.363 74.083  1.00 25.08 ? 322  GLY B N   1 
ATOM   6803 C  CA  . GLY B 1 322 ? 102.441 43.675 73.224  1.00 25.29 ? 322  GLY B CA  1 
ATOM   6804 C  C   . GLY B 1 322 ? 101.013 44.065 73.505  1.00 24.56 ? 322  GLY B C   1 
ATOM   6805 O  O   . GLY B 1 322 ? 100.741 44.995 74.276  1.00 24.68 ? 322  GLY B O   1 
ATOM   6806 N  N   . VAL B 1 323 ? 100.110 43.370 72.837  1.00 24.46 ? 323  VAL B N   1 
ATOM   6807 C  CA  . VAL B 1 323 ? 98.695  43.695 72.807  1.00 23.69 ? 323  VAL B CA  1 
ATOM   6808 C  C   . VAL B 1 323 ? 97.902  42.381 72.856  1.00 24.77 ? 323  VAL B C   1 
ATOM   6809 O  O   . VAL B 1 323 ? 98.472  41.301 72.743  1.00 24.78 ? 323  VAL B O   1 
ATOM   6810 C  CB  . VAL B 1 323 ? 98.314  44.529 71.530  1.00 25.10 ? 323  VAL B CB  1 
ATOM   6811 C  CG1 . VAL B 1 323 ? 99.037  45.912 71.518  1.00 22.98 ? 323  VAL B CG1 1 
ATOM   6812 C  CG2 . VAL B 1 323 ? 98.599  43.761 70.236  1.00 21.82 ? 323  VAL B CG2 1 
ATOM   6813 N  N   . ASN B 1 324 ? 96.598  42.514 73.095  1.00 24.92 ? 324  ASN B N   1 
ATOM   6814 C  CA  . ASN B 1 324 ? 95.635  41.436 73.069  1.00 25.36 ? 324  ASN B CA  1 
ATOM   6815 C  C   . ASN B 1 324 ? 94.831  41.503 71.793  1.00 26.32 ? 324  ASN B C   1 
ATOM   6816 O  O   . ASN B 1 324 ? 94.658  42.575 71.183  1.00 25.60 ? 324  ASN B O   1 
ATOM   6817 C  CB  . ASN B 1 324 ? 94.676  41.584 74.242  1.00 25.07 ? 324  ASN B CB  1 
ATOM   6818 C  CG  . ASN B 1 324 ? 95.368  41.408 75.569  1.00 25.48 ? 324  ASN B CG  1 
ATOM   6819 O  OD1 . ASN B 1 324 ? 96.583  41.293 75.617  1.00 24.90 ? 324  ASN B OD1 1 
ATOM   6820 N  ND2 . ASN B 1 324 ? 94.597  41.374 76.655  1.00 27.42 ? 324  ASN B ND2 1 
ATOM   6821 N  N   . LYS B 1 325 ? 94.297  40.372 71.408  1.00 26.88 ? 325  LYS B N   1 
ATOM   6822 C  CA  . LYS B 1 325 ? 93.588  40.290 70.163  1.00 29.00 ? 325  LYS B CA  1 
ATOM   6823 C  C   . LYS B 1 325 ? 92.373  41.213 70.047  1.00 29.76 ? 325  LYS B C   1 
ATOM   6824 O  O   . LYS B 1 325 ? 92.064  41.694 68.941  1.00 30.59 ? 325  LYS B O   1 
ATOM   6825 C  CB  . LYS B 1 325 ? 93.189  38.839 69.867  1.00 29.79 ? 325  LYS B CB  1 
ATOM   6826 C  CG  . LYS B 1 325 ? 92.400  38.693 68.573  1.00 32.19 ? 325  LYS B CG  1 
ATOM   6827 C  CD  . LYS B 1 325 ? 92.259  37.220 68.192  1.00 38.14 ? 325  LYS B CD  1 
ATOM   6828 C  CE  . LYS B 1 325 ? 91.336  37.049 67.001  1.00 44.29 ? 325  LYS B CE  1 
ATOM   6829 N  NZ  . LYS B 1 325 ? 89.904  37.143 67.472  1.00 50.78 ? 325  LYS B NZ  1 
ATOM   6830 N  N   . ASP B 1 326 ? 91.640  41.430 71.133  1.00 29.67 ? 326  ASP B N   1 
ATOM   6831 C  CA  . ASP B 1 326 ? 90.431  42.247 70.983  1.00 31.03 ? 326  ASP B CA  1 
ATOM   6832 C  C   . ASP B 1 326 ? 90.385  43.367 72.006  1.00 30.75 ? 326  ASP B C   1 
ATOM   6833 O  O   . ASP B 1 326 ? 89.555  43.376 72.936  1.00 32.41 ? 326  ASP B O   1 
ATOM   6834 C  CB  . ASP B 1 326 ? 89.163  41.405 71.038  1.00 31.66 ? 326  ASP B CB  1 
ATOM   6835 C  CG  . ASP B 1 326 ? 89.183  40.244 70.054  1.00 34.24 ? 326  ASP B CG  1 
ATOM   6836 O  OD1 . ASP B 1 326 ? 88.785  40.431 68.870  1.00 37.07 ? 326  ASP B OD1 1 
ATOM   6837 O  OD2 . ASP B 1 326 ? 89.604  39.123 70.478  1.00 35.80 ? 326  ASP B OD2 1 
ATOM   6838 N  N   . GLU B 1 327 ? 91.291  44.311 71.837  1.00 30.07 ? 327  GLU B N   1 
ATOM   6839 C  CA  . GLU B 1 327 ? 91.377  45.478 72.715  1.00 29.05 ? 327  GLU B CA  1 
ATOM   6840 C  C   . GLU B 1 327 ? 90.111  46.352 72.745  1.00 29.01 ? 327  GLU B C   1 
ATOM   6841 O  O   . GLU B 1 327 ? 89.813  46.960 73.759  1.00 30.40 ? 327  GLU B O   1 
ATOM   6842 C  CB  . GLU B 1 327 ? 92.577  46.307 72.309  1.00 28.17 ? 327  GLU B CB  1 
ATOM   6843 C  CG  . GLU B 1 327 ? 93.925  45.551 72.398  1.00 29.09 ? 327  GLU B CG  1 
ATOM   6844 C  CD  . GLU B 1 327 ? 94.468  45.416 73.843  1.00 31.64 ? 327  GLU B CD  1 
ATOM   6845 O  OE1 . GLU B 1 327 ? 93.798  45.880 74.770  1.00 33.53 ? 327  GLU B OE1 1 
ATOM   6846 O  OE2 . GLU B 1 327 ? 95.561  44.830 74.060  1.00 30.90 ? 327  GLU B OE2 1 
ATOM   6847 N  N   . GLY B 1 328 ? 89.371  46.421 71.653  1.00 26.06 ? 328  GLY B N   1 
ATOM   6848 C  CA  . GLY B 1 328 ? 88.263  47.331 71.577  1.00 25.80 ? 328  GLY B CA  1 
ATOM   6849 C  C   . GLY B 1 328 ? 86.941  46.920 72.198  1.00 27.09 ? 328  GLY B C   1 
ATOM   6850 O  O   . GLY B 1 328 ? 86.081  47.780 72.424  1.00 27.23 ? 328  GLY B O   1 
ATOM   6851 N  N   . SER B 1 329 ? 86.761  45.629 72.503  1.00 26.41 ? 329  SER B N   1 
ATOM   6852 C  CA  . SER B 1 329 ? 85.412  45.130 72.719  1.00 27.41 ? 329  SER B CA  1 
ATOM   6853 C  C   . SER B 1 329 ? 84.783  45.699 73.980  1.00 28.58 ? 329  SER B C   1 
ATOM   6854 O  O   . SER B 1 329 ? 83.573  46.006 74.019  1.00 28.70 ? 329  SER B O   1 
ATOM   6855 C  CB  . SER B 1 329 ? 85.357  43.586 72.695  1.00 27.37 ? 329  SER B CB  1 
ATOM   6856 O  OG  . SER B 1 329 ? 86.096  43.033 73.761  1.00 27.65 ? 329  SER B OG  1 
ATOM   6857 N  N   . PHE B 1 330 ? 85.601  45.825 75.019  1.00 28.45 ? 330  PHE B N   1 
ATOM   6858 C  CA  . PHE B 1 330 ? 85.107  46.340 76.269  1.00 29.82 ? 330  PHE B CA  1 
ATOM   6859 C  C   . PHE B 1 330 ? 84.478  47.706 76.085  1.00 29.72 ? 330  PHE B C   1 
ATOM   6860 O  O   . PHE B 1 330 ? 83.442  48.008 76.704  1.00 30.74 ? 330  PHE B O   1 
ATOM   6861 C  CB  . PHE B 1 330 ? 86.218  46.396 77.320  1.00 30.06 ? 330  PHE B CB  1 
ATOM   6862 C  CG  . PHE B 1 330 ? 85.736  46.808 78.654  1.00 34.93 ? 330  PHE B CG  1 
ATOM   6863 C  CD1 . PHE B 1 330 ? 85.094  45.893 79.491  1.00 37.99 ? 330  PHE B CD1 1 
ATOM   6864 C  CD2 . PHE B 1 330 ? 85.894  48.133 79.086  1.00 40.58 ? 330  PHE B CD2 1 
ATOM   6865 C  CE1 . PHE B 1 330 ? 84.635  46.276 80.753  1.00 40.71 ? 330  PHE B CE1 1 
ATOM   6866 C  CE2 . PHE B 1 330 ? 85.427  48.544 80.362  1.00 42.94 ? 330  PHE B CE2 1 
ATOM   6867 C  CZ  . PHE B 1 330 ? 84.801  47.607 81.194  1.00 44.23 ? 330  PHE B CZ  1 
ATOM   6868 N  N   . PHE B 1 331 ? 85.075  48.508 75.216  1.00 28.67 ? 331  PHE B N   1 
ATOM   6869 C  CA  . PHE B 1 331 ? 84.668  49.930 75.041  1.00 30.47 ? 331  PHE B CA  1 
ATOM   6870 C  C   . PHE B 1 331 ? 83.445  50.103 74.180  1.00 31.54 ? 331  PHE B C   1 
ATOM   6871 O  O   . PHE B 1 331 ? 82.699  51.043 74.374  1.00 32.96 ? 331  PHE B O   1 
ATOM   6872 C  CB  . PHE B 1 331 ? 85.843  50.786 74.512  1.00 29.70 ? 331  PHE B CB  1 
ATOM   6873 C  CG  . PHE B 1 331 ? 86.988  50.786 75.448  1.00 30.27 ? 331  PHE B CG  1 
ATOM   6874 C  CD1 . PHE B 1 331 ? 87.949  49.776 75.385  1.00 29.50 ? 331  PHE B CD1 1 
ATOM   6875 C  CD2 . PHE B 1 331 ? 87.013  51.691 76.510  1.00 32.61 ? 331  PHE B CD2 1 
ATOM   6876 C  CE1 . PHE B 1 331 ? 88.984  49.707 76.341  1.00 32.50 ? 331  PHE B CE1 1 
ATOM   6877 C  CE2 . PHE B 1 331 ? 88.039  51.622 77.484  1.00 34.95 ? 331  PHE B CE2 1 
ATOM   6878 C  CZ  . PHE B 1 331 ? 89.026  50.638 77.385  1.00 31.79 ? 331  PHE B CZ  1 
ATOM   6879 N  N   . LEU B 1 332 ? 83.238  49.186 73.241  1.00 32.32 ? 332  LEU B N   1 
ATOM   6880 C  CA  . LEU B 1 332 ? 82.030  49.183 72.426  1.00 34.34 ? 332  LEU B CA  1 
ATOM   6881 C  C   . LEU B 1 332 ? 80.849  48.826 73.309  1.00 36.89 ? 332  LEU B C   1 
ATOM   6882 O  O   . LEU B 1 332 ? 79.779  49.442 73.238  1.00 37.48 ? 332  LEU B O   1 
ATOM   6883 C  CB  . LEU B 1 332 ? 82.155  48.164 71.300  1.00 33.70 ? 332  LEU B CB  1 
ATOM   6884 C  CG  . LEU B 1 332 ? 83.186  48.549 70.233  1.00 33.01 ? 332  LEU B CG  1 
ATOM   6885 C  CD1 . LEU B 1 332 ? 83.438  47.352 69.336  1.00 33.89 ? 332  LEU B CD1 1 
ATOM   6886 C  CD2 . LEU B 1 332 ? 82.681  49.736 69.422  1.00 32.27 ? 332  LEU B CD2 1 
ATOM   6887 N  N   . LEU B 1 333 ? 81.055  47.828 74.163  1.00 38.75 ? 333  LEU B N   1 
ATOM   6888 C  CA  . LEU B 1 333 ? 79.987  47.359 75.041  1.00 41.21 ? 333  LEU B CA  1 
ATOM   6889 C  C   . LEU B 1 333 ? 79.407  48.531 75.811  1.00 42.32 ? 333  LEU B C   1 
ATOM   6890 O  O   . LEU B 1 333 ? 78.198  48.624 76.010  1.00 43.59 ? 333  LEU B O   1 
ATOM   6891 C  CB  . LEU B 1 333 ? 80.513  46.290 76.011  1.00 41.13 ? 333  LEU B CB  1 
ATOM   6892 C  CG  . LEU B 1 333 ? 79.520  45.736 77.003  1.00 41.86 ? 333  LEU B CG  1 
ATOM   6893 C  CD1 . LEU B 1 333 ? 78.341  45.206 76.247  1.00 43.14 ? 333  LEU B CD1 1 
ATOM   6894 C  CD2 . LEU B 1 333 ? 80.173  44.633 77.765  1.00 41.93 ? 333  LEU B CD2 1 
ATOM   6895 N  N   . TYR B 1 334 ? 80.275  49.447 76.219  1.00 42.08 ? 334  TYR B N   1 
ATOM   6896 C  CA  . TYR B 1 334 ? 79.843  50.469 77.165  1.00 42.82 ? 334  TYR B CA  1 
ATOM   6897 C  C   . TYR B 1 334 ? 79.179  51.639 76.519  1.00 43.14 ? 334  TYR B C   1 
ATOM   6898 O  O   . TYR B 1 334 ? 78.267  52.219 77.106  1.00 45.05 ? 334  TYR B O   1 
ATOM   6899 C  CB  . TYR B 1 334 ? 81.005  50.914 78.048  1.00 42.51 ? 334  TYR B CB  1 
ATOM   6900 C  CG  . TYR B 1 334 ? 81.110  50.036 79.268  1.00 44.23 ? 334  TYR B CG  1 
ATOM   6901 C  CD1 . TYR B 1 334 ? 81.604  48.734 79.163  1.00 45.21 ? 334  TYR B CD1 1 
ATOM   6902 C  CD2 . TYR B 1 334 ? 80.682  50.486 80.525  1.00 45.05 ? 334  TYR B CD2 1 
ATOM   6903 C  CE1 . TYR B 1 334 ? 81.695  47.906 80.271  1.00 46.80 ? 334  TYR B CE1 1 
ATOM   6904 C  CE2 . TYR B 1 334 ? 80.767  49.659 81.646  1.00 45.45 ? 334  TYR B CE2 1 
ATOM   6905 C  CZ  . TYR B 1 334 ? 81.278  48.370 81.508  1.00 47.43 ? 334  TYR B CZ  1 
ATOM   6906 O  OH  . TYR B 1 334 ? 81.381  47.516 82.589  1.00 48.97 ? 334  TYR B OH  1 
ATOM   6907 N  N   . GLY B 1 335 ? 79.604  51.969 75.299  1.00 42.11 ? 335  GLY B N   1 
ATOM   6908 C  CA  . GLY B 1 335 ? 79.130  53.185 74.637  1.00 42.06 ? 335  GLY B CA  1 
ATOM   6909 C  C   . GLY B 1 335 ? 78.604  53.142 73.199  1.00 41.17 ? 335  GLY B C   1 
ATOM   6910 O  O   . GLY B 1 335 ? 78.085  54.144 72.702  1.00 42.35 ? 335  GLY B O   1 
ATOM   6911 N  N   . ALA B 1 336 ? 78.730  52.019 72.507  1.00 38.86 ? 336  ALA B N   1 
ATOM   6912 C  CA  . ALA B 1 336 ? 78.305  52.015 71.119  1.00 36.98 ? 336  ALA B CA  1 
ATOM   6913 C  C   . ALA B 1 336 ? 76.949  51.323 70.917  1.00 37.19 ? 336  ALA B C   1 
ATOM   6914 O  O   . ALA B 1 336 ? 76.634  50.347 71.602  1.00 37.87 ? 336  ALA B O   1 
ATOM   6915 C  CB  . ALA B 1 336 ? 79.370  51.424 70.248  1.00 35.48 ? 336  ALA B CB  1 
ATOM   6916 N  N   . PRO B 1 337 ? 76.140  51.821 69.981  1.00 36.61 ? 337  PRO B N   1 
ATOM   6917 C  CA  . PRO B 1 337 ? 74.801  51.247 69.843  1.00 37.80 ? 337  PRO B CA  1 
ATOM   6918 C  C   . PRO B 1 337 ? 74.800  49.862 69.207  1.00 37.52 ? 337  PRO B C   1 
ATOM   6919 O  O   . PRO B 1 337 ? 75.581  49.605 68.269  1.00 36.36 ? 337  PRO B O   1 
ATOM   6920 C  CB  . PRO B 1 337 ? 74.068  52.272 68.954  1.00 38.54 ? 337  PRO B CB  1 
ATOM   6921 C  CG  . PRO B 1 337 ? 75.174  52.986 68.205  1.00 36.62 ? 337  PRO B CG  1 
ATOM   6922 C  CD  . PRO B 1 337 ? 76.322  53.030 69.155  1.00 36.41 ? 337  PRO B CD  1 
ATOM   6923 N  N   . GLY B 1 338 ? 73.935  48.987 69.737  1.00 38.16 ? 338  GLY B N   1 
ATOM   6924 C  CA  . GLY B 1 338 ? 73.719  47.635 69.224  1.00 37.89 ? 338  GLY B CA  1 
ATOM   6925 C  C   . GLY B 1 338 ? 74.564  46.585 69.919  1.00 38.01 ? 338  GLY B C   1 
ATOM   6926 O  O   . GLY B 1 338 ? 74.451  45.390 69.617  1.00 38.05 ? 338  GLY B O   1 
ATOM   6927 N  N   . PHE B 1 339 ? 75.445  47.024 70.822  1.00 37.46 ? 339  PHE B N   1 
ATOM   6928 C  CA  . PHE B 1 339 ? 76.243  46.097 71.637  1.00 37.33 ? 339  PHE B CA  1 
ATOM   6929 C  C   . PHE B 1 339 ? 75.544  45.816 72.957  1.00 39.43 ? 339  PHE B C   1 
ATOM   6930 O  O   . PHE B 1 339 ? 74.890  46.689 73.534  1.00 40.54 ? 339  PHE B O   1 
ATOM   6931 C  CB  . PHE B 1 339 ? 77.665  46.612 71.863  1.00 34.63 ? 339  PHE B CB  1 
ATOM   6932 C  CG  . PHE B 1 339 ? 78.462  46.746 70.579  1.00 33.53 ? 339  PHE B CG  1 
ATOM   6933 C  CD1 . PHE B 1 339 ? 78.319  47.877 69.766  1.00 31.46 ? 339  PHE B CD1 1 
ATOM   6934 C  CD2 . PHE B 1 339 ? 79.313  45.727 70.159  1.00 29.53 ? 339  PHE B CD2 1 
ATOM   6935 C  CE1 . PHE B 1 339 ? 79.029  47.989 68.566  1.00 31.83 ? 339  PHE B CE1 1 
ATOM   6936 C  CE2 . PHE B 1 339 ? 80.028  45.834 68.958  1.00 29.08 ? 339  PHE B CE2 1 
ATOM   6937 C  CZ  . PHE B 1 339 ? 79.894  46.963 68.163  1.00 28.95 ? 339  PHE B CZ  1 
ATOM   6938 N  N   . SER B 1 340 ? 75.674  44.568 73.394  1.00 40.14 ? 340  SER B N   1 
ATOM   6939 C  CA  A SER B 1 340 ? 75.070  44.079 74.626  0.50 41.41 ? 340  SER B CA  1 
ATOM   6940 C  CA  B SER B 1 340 ? 75.069  44.079 74.625  0.50 41.41 ? 340  SER B CA  1 
ATOM   6941 C  C   . SER B 1 340 ? 75.892  42.888 75.078  1.00 41.23 ? 340  SER B C   1 
ATOM   6942 O  O   . SER B 1 340 ? 76.398  42.127 74.235  1.00 40.38 ? 340  SER B O   1 
ATOM   6943 C  CB  A SER B 1 340 ? 73.623  43.645 74.368  0.50 43.02 ? 340  SER B CB  1 
ATOM   6944 C  CB  B SER B 1 340 ? 73.623  43.643 74.364  0.50 43.01 ? 340  SER B CB  1 
ATOM   6945 O  OG  A SER B 1 340 ? 73.161  42.769 75.381  0.50 45.10 ? 340  SER B OG  1 
ATOM   6946 O  OG  B SER B 1 340 ? 73.175  42.730 75.350  0.50 45.04 ? 340  SER B OG  1 
ATOM   6947 N  N   . LYS B 1 341 ? 76.021  42.710 76.395  1.00 42.14 ? 341  LYS B N   1 
ATOM   6948 C  CA  . LYS B 1 341 ? 76.839  41.604 76.908  1.00 42.51 ? 341  LYS B CA  1 
ATOM   6949 C  C   . LYS B 1 341 ? 76.039  40.311 76.954  1.00 44.55 ? 341  LYS B C   1 
ATOM   6950 O  O   . LYS B 1 341 ? 76.597  39.219 77.142  1.00 45.13 ? 341  LYS B O   1 
ATOM   6951 C  CB  . LYS B 1 341 ? 77.478  41.925 78.268  1.00 41.49 ? 341  LYS B CB  1 
ATOM   6952 C  CG  . LYS B 1 341 ? 76.657  41.594 79.471  1.00 43.01 ? 341  LYS B CG  1 
ATOM   6953 C  CD  . LYS B 1 341 ? 77.535  41.643 80.726  1.00 40.54 ? 341  LYS B CD  1 
ATOM   6954 C  CE  . LYS B 1 341 ? 76.696  41.458 81.942  1.00 40.44 ? 341  LYS B CE  1 
ATOM   6955 N  NZ  . LYS B 1 341 ? 75.971  40.176 81.893  1.00 42.37 ? 341  LYS B NZ  1 
ATOM   6956 N  N   . ASP B 1 342 ? 74.734  40.453 76.767  1.00 46.30 ? 342  ASP B N   1 
ATOM   6957 C  CA  . ASP B 1 342 ? 73.806  39.327 76.849  1.00 49.12 ? 342  ASP B CA  1 
ATOM   6958 C  C   . ASP B 1 342 ? 73.243  38.941 75.466  1.00 49.29 ? 342  ASP B C   1 
ATOM   6959 O  O   . ASP B 1 342 ? 72.212  38.281 75.365  1.00 50.84 ? 342  ASP B O   1 
ATOM   6960 C  CB  . ASP B 1 342 ? 72.686  39.631 77.858  1.00 50.83 ? 342  ASP B CB  1 
ATOM   6961 C  CG  . ASP B 1 342 ? 73.228  40.057 79.220  1.00 53.04 ? 342  ASP B CG  1 
ATOM   6962 O  OD1 . ASP B 1 342 ? 74.083  39.335 79.795  1.00 53.26 ? 342  ASP B OD1 1 
ATOM   6963 O  OD2 . ASP B 1 342 ? 72.806  41.131 79.714  1.00 56.53 ? 342  ASP B OD2 1 
ATOM   6964 N  N   . SER B 1 343 ? 73.936  39.354 74.407  1.00 47.34 ? 343  SER B N   1 
ATOM   6965 C  CA  . SER B 1 343 ? 73.559  38.963 73.057  1.00 47.16 ? 343  SER B CA  1 
ATOM   6966 C  C   . SER B 1 343 ? 74.795  38.920 72.169  1.00 45.15 ? 343  SER B C   1 
ATOM   6967 O  O   . SER B 1 343 ? 75.822  39.508 72.497  1.00 43.92 ? 343  SER B O   1 
ATOM   6968 C  CB  . SER B 1 343 ? 72.512  39.931 72.488  1.00 47.82 ? 343  SER B CB  1 
ATOM   6969 O  OG  . SER B 1 343 ? 73.083  40.811 71.531  1.00 46.58 ? 343  SER B OG  1 
ATOM   6970 N  N   . GLU B 1 344 ? 74.688  38.208 71.052  1.00 45.06 ? 344  GLU B N   1 
ATOM   6971 C  CA  A GLU B 1 344 ? 75.858  38.140 70.171  0.50 43.46 ? 344  GLU B CA  1 
ATOM   6972 C  CA  B GLU B 1 344 ? 75.666  38.124 69.976  0.50 43.50 ? 344  GLU B CA  1 
ATOM   6973 C  C   . GLU B 1 344 ? 76.196  39.491 69.488  1.00 41.56 ? 344  GLU B C   1 
ATOM   6974 O  O   . GLU B 1 344 ? 77.239  39.592 68.854  1.00 40.61 ? 344  GLU B O   1 
ATOM   6975 C  CB  A GLU B 1 344 ? 75.825  36.956 69.176  0.50 44.46 ? 344  GLU B CB  1 
ATOM   6976 C  CB  B GLU B 1 344 ? 74.948  37.414 68.822  0.50 44.30 ? 344  GLU B CB  1 
ATOM   6977 C  CG  A GLU B 1 344 ? 77.228  36.288 69.004  0.50 44.21 ? 344  GLU B CG  1 
ATOM   6978 C  CG  B GLU B 1 344 ? 75.831  36.724 67.838  0.50 44.25 ? 344  GLU B CG  1 
ATOM   6979 C  CD  A GLU B 1 344 ? 77.439  35.542 67.667  0.50 45.56 ? 344  GLU B CD  1 
ATOM   6980 C  CD  B GLU B 1 344 ? 75.373  35.310 67.564  0.50 45.34 ? 344  GLU B CD  1 
ATOM   6981 O  OE1 A GLU B 1 344 ? 76.480  34.911 67.161  0.50 46.56 ? 344  GLU B OE1 1 
ATOM   6982 O  OE1 B GLU B 1 344 ? 75.450  34.478 68.500  0.50 45.27 ? 344  GLU B OE1 1 
ATOM   6983 O  OE2 A GLU B 1 344 ? 78.578  35.578 67.133  0.50 42.35 ? 344  GLU B OE2 1 
ATOM   6984 O  OE2 B GLU B 1 344 ? 74.957  35.035 66.417  0.50 45.48 ? 344  GLU B OE2 1 
ATOM   6985 N  N   . SER B 1 345 ? 75.388  40.530 69.688  1.00 40.97 ? 345  SER B N   1 
ATOM   6986 C  CA  . SER B 1 345 ? 75.732  41.894 69.262  1.00 39.58 ? 345  SER B CA  1 
ATOM   6987 C  C   . SER B 1 345 ? 76.031  42.028 67.773  1.00 39.36 ? 345  SER B C   1 
ATOM   6988 O  O   . SER B 1 345 ? 77.013  42.669 67.387  1.00 37.90 ? 345  SER B O   1 
ATOM   6989 C  CB  . SER B 1 345 ? 76.944  42.431 70.044  1.00 37.67 ? 345  SER B CB  1 
ATOM   6990 O  OG  . SER B 1 345 ? 76.650  42.607 71.413  1.00 39.28 ? 345  SER B OG  1 
ATOM   6991 N  N   . LYS B 1 346 ? 75.188  41.415 66.953  1.00 40.49 ? 346  LYS B N   1 
ATOM   6992 C  CA  . LYS B 1 346 ? 75.214  41.589 65.514  1.00 40.58 ? 346  LYS B CA  1 
ATOM   6993 C  C   . LYS B 1 346 ? 74.858  43.047 65.237  1.00 39.81 ? 346  LYS B C   1 
ATOM   6994 O  O   . LYS B 1 346 ? 73.846  43.558 65.739  1.00 40.34 ? 346  LYS B O   1 
ATOM   6995 C  CB  . LYS B 1 346 ? 74.222  40.627 64.831  1.00 42.59 ? 346  LYS B CB  1 
ATOM   6996 C  CG  . LYS B 1 346 ? 74.503  39.097 65.046  1.00 45.29 ? 346  LYS B CG  1 
ATOM   6997 C  CD  . LYS B 1 346 ? 73.485  38.223 64.294  1.00 50.31 ? 346  LYS B CD  1 
ATOM   6998 C  CE  . LYS B 1 346 ? 74.123  36.903 63.838  1.00 53.23 ? 346  LYS B CE  1 
ATOM   6999 N  NZ  . LYS B 1 346 ? 73.141  35.962 63.172  1.00 56.39 ? 346  LYS B NZ  1 
ATOM   7000 N  N   . ILE B 1 347 ? 75.715  43.716 64.470  1.00 38.03 ? 347  ILE B N   1 
ATOM   7001 C  CA  . ILE B 1 347 ? 75.590  45.143 64.252  1.00 37.85 ? 347  ILE B CA  1 
ATOM   7002 C  C   . ILE B 1 347 ? 75.044  45.471 62.856  1.00 38.67 ? 347  ILE B C   1 
ATOM   7003 O  O   . ILE B 1 347 ? 75.601  45.013 61.855  1.00 38.39 ? 347  ILE B O   1 
ATOM   7004 C  CB  . ILE B 1 347 ? 76.961  45.856 64.482  1.00 36.24 ? 347  ILE B CB  1 
ATOM   7005 C  CG1 . ILE B 1 347 ? 77.430  45.712 65.946  1.00 36.25 ? 347  ILE B CG1 1 
ATOM   7006 C  CG2 . ILE B 1 347 ? 76.892  47.328 64.146  1.00 36.36 ? 347  ILE B CG2 1 
ATOM   7007 C  CD1 . ILE B 1 347 ? 76.350  46.050 67.036  1.00 34.13 ? 347  ILE B CD1 1 
ATOM   7008 N  N   . SER B 1 348 ? 73.966  46.271 62.806  1.00 39.34 ? 348  SER B N   1 
ATOM   7009 C  CA  . SER B 1 348 ? 73.427  46.805 61.550  1.00 39.95 ? 348  SER B CA  1 
ATOM   7010 C  C   . SER B 1 348 ? 74.364  47.835 60.928  1.00 39.06 ? 348  SER B C   1 
ATOM   7011 O  O   . SER B 1 348 ? 75.236  48.361 61.597  1.00 38.09 ? 348  SER B O   1 
ATOM   7012 C  CB  . SER B 1 348 ? 72.067  47.471 61.784  1.00 41.27 ? 348  SER B CB  1 
ATOM   7013 O  OG  . SER B 1 348 ? 72.248  48.800 62.287  1.00 40.06 ? 348  SER B OG  1 
ATOM   7014 N  N   . ARG B 1 349 ? 74.130  48.154 59.656  1.00 39.90 ? 349  ARG B N   1 
ATOM   7015 C  CA  . ARG B 1 349 ? 74.927  49.133 58.894  1.00 39.28 ? 349  ARG B CA  1 
ATOM   7016 C  C   . ARG B 1 349 ? 74.857  50.525 59.542  1.00 38.60 ? 349  ARG B C   1 
ATOM   7017 O  O   . ARG B 1 349 ? 75.862  51.215 59.691  1.00 36.77 ? 349  ARG B O   1 
ATOM   7018 C  CB  . ARG B 1 349 ? 74.402  49.229 57.450  1.00 40.18 ? 349  ARG B CB  1 
ATOM   7019 C  CG  . ARG B 1 349 ? 75.339  49.998 56.513  1.00 42.86 ? 349  ARG B CG  1 
ATOM   7020 C  CD  . ARG B 1 349 ? 76.566  49.153 56.256  1.00 43.39 ? 349  ARG B CD  1 
ATOM   7021 N  NE  . ARG B 1 349 ? 77.753  49.955 56.121  1.00 45.93 ? 349  ARG B NE  1 
ATOM   7022 C  CZ  . ARG B 1 349 ? 78.988  49.518 56.331  1.00 43.63 ? 349  ARG B CZ  1 
ATOM   7023 N  NH1 . ARG B 1 349 ? 79.211  48.269 56.717  1.00 43.93 ? 349  ARG B NH1 1 
ATOM   7024 N  NH2 . ARG B 1 349 ? 79.998  50.355 56.163  1.00 42.18 ? 349  ARG B NH2 1 
ATOM   7025 N  N   . GLU B 1 350 ? 73.641  50.911 59.891  1.00 39.43 ? 350  GLU B N   1 
ATOM   7026 C  CA  . GLU B 1 350 ? 73.353  52.155 60.556  1.00 40.48 ? 350  GLU B CA  1 
ATOM   7027 C  C   . GLU B 1 350 ? 74.153  52.267 61.882  1.00 38.91 ? 350  GLU B C   1 
ATOM   7028 O  O   . GLU B 1 350 ? 74.765  53.304 62.136  1.00 38.50 ? 350  GLU B O   1 
ATOM   7029 C  CB  . GLU B 1 350 ? 71.811  52.298 60.710  1.00 42.19 ? 350  GLU B CB  1 
ATOM   7030 C  CG  . GLU B 1 350 ? 71.318  52.968 62.000  1.00 46.24 ? 350  GLU B CG  1 
ATOM   7031 C  CD  . GLU B 1 350 ? 69.833  53.432 61.964  1.00 52.94 ? 350  GLU B CD  1 
ATOM   7032 O  OE1 . GLU B 1 350 ? 69.078  53.171 60.992  1.00 56.40 ? 350  GLU B OE1 1 
ATOM   7033 O  OE2 . GLU B 1 350 ? 69.418  54.083 62.936  1.00 55.31 ? 350  GLU B OE2 1 
ATOM   7034 N  N   . ASP B 1 351 ? 74.195  51.198 62.684  1.00 37.84 ? 351  ASP B N   1 
ATOM   7035 C  CA  . ASP B 1 351 ? 74.905  51.245 63.975  1.00 36.53 ? 351  ASP B CA  1 
ATOM   7036 C  C   . ASP B 1 351 ? 76.431  51.171 63.803  1.00 35.43 ? 351  ASP B C   1 
ATOM   7037 O  O   . ASP B 1 351 ? 77.197  51.650 64.663  1.00 34.64 ? 351  ASP B O   1 
ATOM   7038 C  CB  . ASP B 1 351 ? 74.419  50.148 64.941  1.00 36.02 ? 351  ASP B CB  1 
ATOM   7039 C  CG  . ASP B 1 351 ? 73.061  50.483 65.595  1.00 37.49 ? 351  ASP B CG  1 
ATOM   7040 O  OD1 . ASP B 1 351 ? 72.534  51.619 65.434  1.00 34.51 ? 351  ASP B OD1 1 
ATOM   7041 O  OD2 . ASP B 1 351 ? 72.519  49.581 66.270  1.00 35.93 ? 351  ASP B OD2 1 
ATOM   7042 N  N   . PHE B 1 352 ? 76.860  50.562 62.695  1.00 34.45 ? 352  PHE B N   1 
ATOM   7043 C  CA  . PHE B 1 352 ? 78.260  50.571 62.321  1.00 33.12 ? 352  PHE B CA  1 
ATOM   7044 C  C   . PHE B 1 352 ? 78.707  51.990 61.978  1.00 32.92 ? 352  PHE B C   1 
ATOM   7045 O  O   . PHE B 1 352 ? 79.740  52.421 62.465  1.00 31.86 ? 352  PHE B O   1 
ATOM   7046 C  CB  . PHE B 1 352 ? 78.543  49.613 61.159  1.00 32.72 ? 352  PHE B CB  1 
ATOM   7047 C  CG  . PHE B 1 352 ? 79.968  49.635 60.696  1.00 30.45 ? 352  PHE B CG  1 
ATOM   7048 C  CD1 . PHE B 1 352 ? 80.374  50.529 59.691  1.00 28.27 ? 352  PHE B CD1 1 
ATOM   7049 C  CD2 . PHE B 1 352 ? 80.899  48.747 61.229  1.00 28.04 ? 352  PHE B CD2 1 
ATOM   7050 C  CE1 . PHE B 1 352 ? 81.686  50.554 59.245  1.00 26.71 ? 352  PHE B CE1 1 
ATOM   7051 C  CE2 . PHE B 1 352 ? 82.214  48.762 60.792  1.00 27.45 ? 352  PHE B CE2 1 
ATOM   7052 C  CZ  . PHE B 1 352 ? 82.618  49.684 59.792  1.00 25.02 ? 352  PHE B CZ  1 
ATOM   7053 N  N   . MET B 1 353 ? 77.928  52.702 61.163  1.00 33.56 ? 353  MET B N   1 
ATOM   7054 C  CA  . MET B 1 353 ? 78.226  54.111 60.868  1.00 34.37 ? 353  MET B CA  1 
ATOM   7055 C  C   . MET B 1 353 ? 78.322  54.938 62.159  1.00 34.00 ? 353  MET B C   1 
ATOM   7056 O  O   . MET B 1 353 ? 79.292  55.682 62.335  1.00 32.13 ? 353  MET B O   1 
ATOM   7057 C  CB  . MET B 1 353 ? 77.241  54.705 59.851  1.00 35.54 ? 353  MET B CB  1 
ATOM   7058 C  CG  . MET B 1 353 ? 77.406  54.064 58.439  1.00 39.44 ? 353  MET B CG  1 
ATOM   7059 S  SD  . MET B 1 353 ? 76.387  54.736 57.077  1.00 49.93 ? 353  MET B SD  1 
ATOM   7060 C  CE  . MET B 1 353 ? 74.710  54.580 57.704  1.00 49.76 ? 353  MET B CE  1 
ATOM   7061 N  N   . SER B 1 354 ? 77.349  54.764 63.072  1.00 34.29 ? 354  SER B N   1 
ATOM   7062 C  CA  . SER B 1 354 ? 77.359  55.453 64.375  1.00 34.37 ? 354  SER B CA  1 
ATOM   7063 C  C   . SER B 1 354 ? 78.585  55.108 65.219  1.00 33.52 ? 354  SER B C   1 
ATOM   7064 O  O   . SER B 1 354 ? 79.190  55.985 65.828  1.00 33.80 ? 354  SER B O   1 
ATOM   7065 C  CB  . SER B 1 354 ? 76.098  55.141 65.187  1.00 34.85 ? 354  SER B CB  1 
ATOM   7066 O  OG  . SER B 1 354 ? 74.939  55.607 64.541  1.00 34.87 ? 354  SER B OG  1 
ATOM   7067 N  N   . GLY B 1 355 ? 78.949  53.825 65.234  1.00 33.35 ? 355  GLY B N   1 
ATOM   7068 C  CA  . GLY B 1 355 ? 80.087  53.325 65.997  1.00 31.97 ? 355  GLY B CA  1 
ATOM   7069 C  C   . GLY B 1 355 ? 81.387  53.928 65.509  1.00 32.68 ? 355  GLY B C   1 
ATOM   7070 O  O   . GLY B 1 355 ? 82.271  54.269 66.322  1.00 32.42 ? 355  GLY B O   1 
ATOM   7071 N  N   . VAL B 1 356 ? 81.507  54.059 64.185  1.00 32.75 ? 356  VAL B N   1 
ATOM   7072 C  CA  . VAL B 1 356 ? 82.711  54.613 63.578  1.00 32.96 ? 356  VAL B CA  1 
ATOM   7073 C  C   . VAL B 1 356 ? 82.918  56.055 64.023  1.00 33.65 ? 356  VAL B C   1 
ATOM   7074 O  O   . VAL B 1 356 ? 83.988  56.410 64.497  1.00 32.37 ? 356  VAL B O   1 
ATOM   7075 C  CB  . VAL B 1 356 ? 82.676  54.510 62.017  1.00 33.69 ? 356  VAL B CB  1 
ATOM   7076 C  CG1 . VAL B 1 356 ? 83.859  55.216 61.435  1.00 33.60 ? 356  VAL B CG1 1 
ATOM   7077 C  CG2 . VAL B 1 356 ? 82.683  53.034 61.582  1.00 31.71 ? 356  VAL B CG2 1 
ATOM   7078 N  N   . LYS B 1 357 ? 81.877  56.869 63.889  1.00 35.88 ? 357  LYS B N   1 
ATOM   7079 C  CA  . LYS B 1 357 ? 81.896  58.238 64.395  1.00 37.93 ? 357  LYS B CA  1 
ATOM   7080 C  C   . LYS B 1 357 ? 82.257  58.328 65.894  1.00 37.71 ? 357  LYS B C   1 
ATOM   7081 O  O   . LYS B 1 357 ? 83.067  59.160 66.287  1.00 38.02 ? 357  LYS B O   1 
ATOM   7082 C  CB  . LYS B 1 357 ? 80.566  58.950 64.102  1.00 39.87 ? 357  LYS B CB  1 
ATOM   7083 C  CG  . LYS B 1 357 ? 80.614  60.434 64.404  1.00 43.25 ? 357  LYS B CG  1 
ATOM   7084 C  CD  . LYS B 1 357 ? 79.442  61.196 63.799  1.00 48.25 ? 357  LYS B CD  1 
ATOM   7085 C  CE  . LYS B 1 357 ? 79.638  62.717 63.907  1.00 50.09 ? 357  LYS B CE  1 
ATOM   7086 N  NZ  . LYS B 1 357 ? 80.975  63.211 63.405  1.00 50.93 ? 357  LYS B NZ  1 
ATOM   7087 N  N   . LEU B 1 358 ? 81.692  57.462 66.727  1.00 37.08 ? 358  LEU B N   1 
ATOM   7088 C  CA  . LEU B 1 358 ? 82.020  57.501 68.144  1.00 36.80 ? 358  LEU B CA  1 
ATOM   7089 C  C   . LEU B 1 358 ? 83.484  57.106 68.389  1.00 35.96 ? 358  LEU B C   1 
ATOM   7090 O  O   . LEU B 1 358 ? 84.080  57.509 69.392  1.00 35.58 ? 358  LEU B O   1 
ATOM   7091 C  CB  . LEU B 1 358 ? 81.105  56.562 68.938  1.00 37.18 ? 358  LEU B CB  1 
ATOM   7092 C  CG  . LEU B 1 358 ? 79.612  56.908 69.027  1.00 39.47 ? 358  LEU B CG  1 
ATOM   7093 C  CD1 . LEU B 1 358 ? 78.879  55.727 69.552  1.00 39.16 ? 358  LEU B CD1 1 
ATOM   7094 C  CD2 . LEU B 1 358 ? 79.366  58.091 69.951  1.00 39.49 ? 358  LEU B CD2 1 
ATOM   7095 N  N   . SER B 1 359 ? 84.036  56.300 67.488  1.00 34.64 ? 359  SER B N   1 
ATOM   7096 C  CA  . SER B 1 359 ? 85.333  55.704 67.690  1.00 34.47 ? 359  SER B CA  1 
ATOM   7097 C  C   . SER B 1 359 ? 86.458  56.636 67.306  1.00 34.36 ? 359  SER B C   1 
ATOM   7098 O  O   . SER B 1 359 ? 87.545  56.528 67.840  1.00 33.89 ? 359  SER B O   1 
ATOM   7099 C  CB  . SER B 1 359 ? 85.480  54.409 66.884  1.00 34.59 ? 359  SER B CB  1 
ATOM   7100 O  OG  . SER B 1 359 ? 84.554  53.416 67.332  1.00 35.80 ? 359  SER B OG  1 
ATOM   7101 N  N   . VAL B 1 360 ? 86.204  57.496 66.335  1.00 34.50 ? 360  VAL B N   1 
ATOM   7102 C  CA  . VAL B 1 360 ? 87.211  58.374 65.794  1.00 35.01 ? 360  VAL B CA  1 
ATOM   7103 C  C   . VAL B 1 360 ? 86.620  59.792 65.874  1.00 36.33 ? 360  VAL B C   1 
ATOM   7104 O  O   . VAL B 1 360 ? 86.371  60.425 64.855  1.00 37.19 ? 360  VAL B O   1 
ATOM   7105 C  CB  . VAL B 1 360 ? 87.601  57.969 64.317  1.00 34.16 ? 360  VAL B CB  1 
ATOM   7106 C  CG1 . VAL B 1 360 ? 88.930  58.534 63.942  1.00 35.45 ? 360  VAL B CG1 1 
ATOM   7107 C  CG2 . VAL B 1 360 ? 87.684  56.473 64.148  1.00 34.19 ? 360  VAL B CG2 1 
ATOM   7108 N  N   . PRO B 1 361 ? 86.412  60.299 67.096  1.00 37.59 ? 361  PRO B N   1 
ATOM   7109 C  CA  . PRO B 1 361 ? 85.587  61.495 67.303  1.00 40.14 ? 361  PRO B CA  1 
ATOM   7110 C  C   . PRO B 1 361 ? 86.212  62.786 66.743  1.00 42.26 ? 361  PRO B C   1 
ATOM   7111 O  O   . PRO B 1 361 ? 85.502  63.765 66.461  1.00 43.49 ? 361  PRO B O   1 
ATOM   7112 C  CB  . PRO B 1 361 ? 85.435  61.541 68.823  1.00 40.09 ? 361  PRO B CB  1 
ATOM   7113 C  CG  . PRO B 1 361 ? 86.693  60.916 69.352  1.00 37.54 ? 361  PRO B CG  1 
ATOM   7114 C  CD  . PRO B 1 361 ? 87.105  59.885 68.336  1.00 37.74 ? 361  PRO B CD  1 
ATOM   7115 N  N   . HIS B 1 362 ? 87.525  62.758 66.550  1.00 43.41 ? 362  HIS B N   1 
ATOM   7116 C  CA  . HIS B 1 362 ? 88.262  63.876 65.987  1.00 46.57 ? 362  HIS B CA  1 
ATOM   7117 C  C   . HIS B 1 362 ? 88.155  63.965 64.443  1.00 47.20 ? 362  HIS B C   1 
ATOM   7118 O  O   . HIS B 1 362 ? 88.501  65.001 63.852  1.00 49.27 ? 362  HIS B O   1 
ATOM   7119 C  CB  . HIS B 1 362 ? 89.730  63.846 66.471  1.00 47.11 ? 362  HIS B CB  1 
ATOM   7120 C  CG  . HIS B 1 362 ? 90.438  62.554 66.185  1.00 49.22 ? 362  HIS B CG  1 
ATOM   7121 N  ND1 . HIS B 1 362 ? 90.209  61.398 66.907  1.00 50.09 ? 362  HIS B ND1 1 
ATOM   7122 C  CD2 . HIS B 1 362 ? 91.364  62.233 65.246  1.00 52.01 ? 362  HIS B CD2 1 
ATOM   7123 C  CE1 . HIS B 1 362 ? 90.963  60.422 66.425  1.00 51.36 ? 362  HIS B CE1 1 
ATOM   7124 N  NE2 . HIS B 1 362 ? 91.674  60.900 65.417  1.00 51.95 ? 362  HIS B NE2 1 
ATOM   7125 N  N   . ALA B 1 363 ? 87.603  62.937 63.791  1.00 45.56 ? 363  ALA B N   1 
ATOM   7126 C  CA  . ALA B 1 363 ? 87.617  62.902 62.310  1.00 44.59 ? 363  ALA B CA  1 
ATOM   7127 C  C   . ALA B 1 363 ? 86.575  63.784 61.588  1.00 44.79 ? 363  ALA B C   1 
ATOM   7128 O  O   . ALA B 1 363 ? 85.412  63.808 61.962  1.00 45.26 ? 363  ALA B O   1 
ATOM   7129 C  CB  . ALA B 1 363 ? 87.545  61.439 61.797  1.00 43.04 ? 363  ALA B CB  1 
ATOM   7130 N  N   . ASN B 1 364 ? 87.007  64.473 60.528  1.00 44.49 ? 364  ASN B N   1 
ATOM   7131 C  CA  . ASN B 1 364 ? 86.093  65.111 59.571  1.00 44.69 ? 364  ASN B CA  1 
ATOM   7132 C  C   . ASN B 1 364 ? 85.372  64.065 58.731  1.00 43.36 ? 364  ASN B C   1 
ATOM   7133 O  O   . ASN B 1 364 ? 85.732  62.871 58.733  1.00 41.46 ? 364  ASN B O   1 
ATOM   7134 C  CB  . ASN B 1 364 ? 86.843  66.095 58.644  1.00 45.97 ? 364  ASN B CB  1 
ATOM   7135 C  CG  . ASN B 1 364 ? 88.005  65.435 57.889  1.00 46.53 ? 364  ASN B CG  1 
ATOM   7136 O  OD1 . ASN B 1 364 ? 88.012  64.211 57.672  1.00 47.08 ? 364  ASN B OD1 1 
ATOM   7137 N  ND2 . ASN B 1 364 ? 88.998  66.234 57.501  1.00 44.08 ? 364  ASN B ND2 1 
ATOM   7138 N  N   . ASP B 1 365 ? 84.342  64.507 58.026  1.00 44.18 ? 365  ASP B N   1 
ATOM   7139 C  CA  . ASP B 1 365 ? 83.546  63.612 57.162  1.00 44.02 ? 365  ASP B CA  1 
ATOM   7140 C  C   . ASP B 1 365 ? 84.387  62.700 56.248  1.00 41.72 ? 365  ASP B C   1 
ATOM   7141 O  O   . ASP B 1 365 ? 84.075  61.518 56.103  1.00 40.28 ? 365  ASP B O   1 
ATOM   7142 C  CB  . ASP B 1 365 ? 82.512  64.409 56.353  1.00 46.01 ? 365  ASP B CB  1 
ATOM   7143 C  CG  . ASP B 1 365 ? 81.447  65.044 57.240  1.00 51.60 ? 365  ASP B CG  1 
ATOM   7144 O  OD1 . ASP B 1 365 ? 81.584  64.991 58.494  1.00 55.04 ? 365  ASP B OD1 1 
ATOM   7145 O  OD2 . ASP B 1 365 ? 80.452  65.589 56.695  1.00 58.83 ? 365  ASP B OD2 1 
ATOM   7146 N  N   . LEU B 1 366 ? 85.452  63.252 55.665  1.00 40.86 ? 366  LEU B N   1 
ATOM   7147 C  CA  . LEU B 1 366 ? 86.300  62.505 54.758  1.00 39.60 ? 366  LEU B CA  1 
ATOM   7148 C  C   . LEU B 1 366 ? 87.036  61.385 55.520  1.00 37.48 ? 366  LEU B C   1 
ATOM   7149 O  O   . LEU B 1 366 ? 87.137  60.247 55.040  1.00 36.94 ? 366  LEU B O   1 
ATOM   7150 C  CB  . LEU B 1 366 ? 87.263  63.443 54.022  1.00 40.13 ? 366  LEU B CB  1 
ATOM   7151 C  CG  . LEU B 1 366 ? 88.174  62.767 52.998  1.00 40.31 ? 366  LEU B CG  1 
ATOM   7152 C  CD1 . LEU B 1 366 ? 87.430  62.414 51.727  1.00 41.86 ? 366  LEU B CD1 1 
ATOM   7153 C  CD2 . LEU B 1 366 ? 89.400  63.579 52.671  1.00 40.00 ? 366  LEU B CD2 1 
ATOM   7154 N  N   . GLY B 1 367 ? 87.516  61.713 56.716  1.00 36.19 ? 367  GLY B N   1 
ATOM   7155 C  CA  . GLY B 1 367 ? 88.243  60.794 57.564  1.00 34.14 ? 367  GLY B CA  1 
ATOM   7156 C  C   . GLY B 1 367 ? 87.349  59.631 57.956  1.00 33.28 ? 367  GLY B C   1 
ATOM   7157 O  O   . GLY B 1 367 ? 87.779  58.499 57.906  1.00 32.65 ? 367  GLY B O   1 
ATOM   7158 N  N   . LEU B 1 368 ? 86.090  59.923 58.281  1.00 33.61 ? 368  LEU B N   1 
ATOM   7159 C  CA  . LEU B 1 368 ? 85.098  58.916 58.609  1.00 33.04 ? 368  LEU B CA  1 
ATOM   7160 C  C   . LEU B 1 368 ? 84.852  57.997 57.436  1.00 32.91 ? 368  LEU B C   1 
ATOM   7161 O  O   . LEU B 1 368 ? 84.793  56.770 57.611  1.00 32.24 ? 368  LEU B O   1 
ATOM   7162 C  CB  . LEU B 1 368 ? 83.781  59.527 59.130  1.00 32.88 ? 368  LEU B CB  1 
ATOM   7163 C  CG  . LEU B 1 368 ? 83.846  60.288 60.472  1.00 34.86 ? 368  LEU B CG  1 
ATOM   7164 C  CD1 . LEU B 1 368 ? 82.549  61.109 60.750  1.00 36.08 ? 368  LEU B CD1 1 
ATOM   7165 C  CD2 . LEU B 1 368 ? 84.168  59.388 61.617  1.00 31.01 ? 368  LEU B CD2 1 
ATOM   7166 N  N   . ASP B 1 369 ? 84.697  58.581 56.254  1.00 33.71 ? 369  ASP B N   1 
ATOM   7167 C  CA  . ASP B 1 369 ? 84.634  57.789 55.014  1.00 34.11 ? 369  ASP B CA  1 
ATOM   7168 C  C   . ASP B 1 369 ? 85.828  56.834 54.790  1.00 32.80 ? 369  ASP B C   1 
ATOM   7169 O  O   . ASP B 1 369 ? 85.632  55.733 54.292  1.00 33.14 ? 369  ASP B O   1 
ATOM   7170 C  CB  . ASP B 1 369 ? 84.460  58.687 53.779  1.00 35.58 ? 369  ASP B CB  1 
ATOM   7171 C  CG  . ASP B 1 369 ? 83.060  59.254 53.659  1.00 39.72 ? 369  ASP B CG  1 
ATOM   7172 O  OD1 . ASP B 1 369 ? 82.228  59.056 54.577  1.00 42.87 ? 369  ASP B OD1 1 
ATOM   7173 O  OD2 . ASP B 1 369 ? 82.786  59.916 52.645  1.00 44.48 ? 369  ASP B OD2 1 
ATOM   7174 N  N   . ALA B 1 370 ? 87.045  57.258 55.133  1.00 31.90 ? 370  ALA B N   1 
ATOM   7175 C  CA  . ALA B 1 370 ? 88.231  56.438 54.890  1.00 30.99 ? 370  ALA B CA  1 
ATOM   7176 C  C   . ALA B 1 370 ? 88.252  55.256 55.854  1.00 30.24 ? 370  ALA B C   1 
ATOM   7177 O  O   . ALA B 1 370 ? 88.602  54.129 55.475  1.00 29.00 ? 370  ALA B O   1 
ATOM   7178 C  CB  . ALA B 1 370 ? 89.505  57.252 55.026  1.00 30.19 ? 370  ALA B CB  1 
ATOM   7179 N  N   . VAL B 1 371 ? 87.877  55.536 57.101  1.00 30.39 ? 371  VAL B N   1 
ATOM   7180 C  CA  . VAL B 1 371 ? 87.789  54.504 58.116  1.00 30.09 ? 371  VAL B CA  1 
ATOM   7181 C  C   . VAL B 1 371 ? 86.765  53.448 57.680  1.00 30.69 ? 371  VAL B C   1 
ATOM   7182 O  O   . VAL B 1 371 ? 87.057  52.230 57.679  1.00 30.42 ? 371  VAL B O   1 
ATOM   7183 C  CB  . VAL B 1 371 ? 87.439  55.096 59.513  1.00 29.57 ? 371  VAL B CB  1 
ATOM   7184 C  CG1 . VAL B 1 371 ? 87.203  53.972 60.521  1.00 28.40 ? 371  VAL B CG1 1 
ATOM   7185 C  CG2 . VAL B 1 371 ? 88.547  55.989 59.982  1.00 28.46 ? 371  VAL B CG2 1 
ATOM   7186 N  N   . THR B 1 372 ? 85.596  53.937 57.256  1.00 31.23 ? 372  THR B N   1 
ATOM   7187 C  CA  . THR B 1 372 ? 84.490  53.088 56.863  1.00 31.51 ? 372  THR B CA  1 
ATOM   7188 C  C   . THR B 1 372 ? 84.925  52.195 55.700  1.00 31.97 ? 372  THR B C   1 
ATOM   7189 O  O   . THR B 1 372 ? 84.759  50.968 55.755  1.00 31.66 ? 372  THR B O   1 
ATOM   7190 C  CB  . THR B 1 372 ? 83.276  53.944 56.486  1.00 32.57 ? 372  THR B CB  1 
ATOM   7191 O  OG1 . THR B 1 372 ? 82.807  54.601 57.670  1.00 34.60 ? 372  THR B OG1 1 
ATOM   7192 C  CG2 . THR B 1 372 ? 82.170  53.093 55.923  1.00 31.15 ? 372  THR B CG2 1 
ATOM   7193 N  N   . LEU B 1 373 ? 85.498  52.820 54.668  1.00 31.41 ? 373  LEU B N   1 
ATOM   7194 C  CA  . LEU B 1 373 ? 85.955  52.094 53.524  1.00 31.42 ? 373  LEU B CA  1 
ATOM   7195 C  C   . LEU B 1 373 ? 86.990  51.034 53.920  1.00 31.08 ? 373  LEU B C   1 
ATOM   7196 O  O   . LEU B 1 373 ? 86.933  49.904 53.408  1.00 31.72 ? 373  LEU B O   1 
ATOM   7197 C  CB  . LEU B 1 373 ? 86.529  53.029 52.457  1.00 31.49 ? 373  LEU B CB  1 
ATOM   7198 C  CG  . LEU B 1 373 ? 87.160  52.387 51.216  1.00 32.32 ? 373  LEU B CG  1 
ATOM   7199 C  CD1 . LEU B 1 373 ? 86.139  51.504 50.493  1.00 33.07 ? 373  LEU B CD1 1 
ATOM   7200 C  CD2 . LEU B 1 373 ? 87.727  53.402 50.243  1.00 32.02 ? 373  LEU B CD2 1 
ATOM   7201 N  N   . GLN B 1 374 ? 87.937  51.404 54.780  1.00 29.17 ? 374  GLN B N   1 
ATOM   7202 C  CA  . GLN B 1 374 ? 89.040  50.514 55.147  1.00 30.10 ? 374  GLN B CA  1 
ATOM   7203 C  C   . GLN B 1 374 ? 88.564  49.231 55.884  1.00 29.39 ? 374  GLN B C   1 
ATOM   7204 O  O   . GLN B 1 374 ? 89.194  48.186 55.826  1.00 29.68 ? 374  GLN B O   1 
ATOM   7205 C  CB  . GLN B 1 374 ? 90.042  51.297 56.018  1.00 29.41 ? 374  GLN B CB  1 
ATOM   7206 C  CG  . GLN B 1 374 ? 91.382  50.613 56.269  1.00 32.60 ? 374  GLN B CG  1 
ATOM   7207 C  CD  . GLN B 1 374 ? 92.274  50.507 55.017  1.00 37.34 ? 374  GLN B CD  1 
ATOM   7208 O  OE1 . GLN B 1 374 ? 93.302  49.825 55.051  1.00 38.84 ? 374  GLN B OE1 1 
ATOM   7209 N  NE2 . GLN B 1 374 ? 91.881  51.170 53.920  1.00 34.86 ? 374  GLN B NE2 1 
ATOM   7210 N  N   . TYR B 1 375 ? 87.447  49.343 56.584  1.00 28.69 ? 375  TYR B N   1 
ATOM   7211 C  CA  . TYR B 1 375 ? 86.928  48.278 57.378  1.00 28.42 ? 375  TYR B CA  1 
ATOM   7212 C  C   . TYR B 1 375 ? 85.583  47.688 56.898  1.00 29.24 ? 375  TYR B C   1 
ATOM   7213 O  O   . TYR B 1 375 ? 84.960  46.958 57.641  1.00 30.08 ? 375  TYR B O   1 
ATOM   7214 C  CB  . TYR B 1 375 ? 86.828  48.767 58.811  1.00 27.83 ? 375  TYR B CB  1 
ATOM   7215 C  CG  . TYR B 1 375 ? 88.161  48.820 59.528  1.00 27.65 ? 375  TYR B CG  1 
ATOM   7216 C  CD1 . TYR B 1 375 ? 88.643  47.698 60.239  1.00 26.58 ? 375  TYR B CD1 1 
ATOM   7217 C  CD2 . TYR B 1 375 ? 88.944  49.979 59.501  1.00 25.82 ? 375  TYR B CD2 1 
ATOM   7218 C  CE1 . TYR B 1 375 ? 89.888  47.752 60.937  1.00 26.98 ? 375  TYR B CE1 1 
ATOM   7219 C  CE2 . TYR B 1 375 ? 90.167  50.053 60.193  1.00 28.72 ? 375  TYR B CE2 1 
ATOM   7220 C  CZ  . TYR B 1 375 ? 90.624  48.927 60.907  1.00 28.30 ? 375  TYR B CZ  1 
ATOM   7221 O  OH  . TYR B 1 375 ? 91.806  49.003 61.564  1.00 30.64 ? 375  TYR B OH  1 
ATOM   7222 N  N   . THR B 1 376 ? 85.145  47.973 55.672  1.00 29.23 ? 376  THR B N   1 
ATOM   7223 C  CA  . THR B 1 376 ? 83.871  47.424 55.192  1.00 30.68 ? 376  THR B CA  1 
ATOM   7224 C  C   . THR B 1 376 ? 84.086  46.479 54.039  1.00 32.07 ? 376  THR B C   1 
ATOM   7225 O  O   . THR B 1 376 ? 84.786  46.810 53.096  1.00 33.16 ? 376  THR B O   1 
ATOM   7226 C  CB  . THR B 1 376 ? 82.874  48.537 54.749  1.00 30.64 ? 376  THR B CB  1 
ATOM   7227 O  OG1 . THR B 1 376 ? 82.626  49.420 55.852  1.00 29.13 ? 376  THR B OG1 1 
ATOM   7228 C  CG2 . THR B 1 376 ? 81.563  47.945 54.276  1.00 30.74 ? 376  THR B CG2 1 
ATOM   7229 N  N   . ASP B 1 377 ? 83.470  45.315 54.110  1.00 33.23 ? 377  ASP B N   1 
ATOM   7230 C  CA  . ASP B 1 377 ? 83.458  44.343 53.005  1.00 35.27 ? 377  ASP B CA  1 
ATOM   7231 C  C   . ASP B 1 377 ? 82.244  44.680 52.134  1.00 37.00 ? 377  ASP B C   1 
ATOM   7232 O  O   . ASP B 1 377 ? 81.104  44.357 52.496  1.00 36.76 ? 377  ASP B O   1 
ATOM   7233 C  CB  . ASP B 1 377 ? 83.348  42.932 53.610  1.00 35.30 ? 377  ASP B CB  1 
ATOM   7234 C  CG  . ASP B 1 377 ? 83.262  41.805 52.564  1.00 39.73 ? 377  ASP B CG  1 
ATOM   7235 O  OD1 . ASP B 1 377 ? 83.181  42.065 51.349  1.00 41.64 ? 377  ASP B OD1 1 
ATOM   7236 O  OD2 . ASP B 1 377 ? 83.237  40.622 52.996  1.00 42.66 ? 377  ASP B OD2 1 
ATOM   7237 N  N   . TRP B 1 378 ? 82.468  45.352 51.001  1.00 38.30 ? 378  TRP B N   1 
ATOM   7238 C  CA  . TRP B 1 378 ? 81.328  45.823 50.190  1.00 40.40 ? 378  TRP B CA  1 
ATOM   7239 C  C   . TRP B 1 378 ? 80.610  44.724 49.387  1.00 42.29 ? 378  TRP B C   1 
ATOM   7240 O  O   . TRP B 1 378 ? 79.617  44.998 48.700  1.00 42.69 ? 378  TRP B O   1 
ATOM   7241 C  CB  . TRP B 1 378 ? 81.676  47.068 49.342  1.00 40.49 ? 378  TRP B CB  1 
ATOM   7242 C  CG  . TRP B 1 378 ? 81.667  48.322 50.171  1.00 41.32 ? 378  TRP B CG  1 
ATOM   7243 C  CD1 . TRP B 1 378 ? 82.748  49.034 50.599  1.00 39.31 ? 378  TRP B CD1 1 
ATOM   7244 C  CD2 . TRP B 1 378 ? 80.508  48.979 50.716  1.00 44.03 ? 378  TRP B CD2 1 
ATOM   7245 N  NE1 . TRP B 1 378 ? 82.339  50.092 51.377  1.00 40.71 ? 378  TRP B NE1 1 
ATOM   7246 C  CE2 . TRP B 1 378 ? 80.971  50.087 51.460  1.00 43.17 ? 378  TRP B CE2 1 
ATOM   7247 C  CE3 . TRP B 1 378 ? 79.124  48.731 50.649  1.00 47.08 ? 378  TRP B CE3 1 
ATOM   7248 C  CZ2 . TRP B 1 378 ? 80.104  50.956 52.138  1.00 46.11 ? 378  TRP B CZ2 1 
ATOM   7249 C  CZ3 . TRP B 1 378 ? 78.245  49.607 51.319  1.00 48.46 ? 378  TRP B CZ3 1 
ATOM   7250 C  CH2 . TRP B 1 378 ? 78.747  50.702 52.061  1.00 48.29 ? 378  TRP B CH2 1 
ATOM   7251 N  N   . MET B 1 379 ? 81.106  43.491 49.491  1.00 43.35 ? 379  MET B N   1 
ATOM   7252 C  CA  A MET B 1 379 ? 80.403  42.330 48.949  0.50 45.55 ? 379  MET B CA  1 
ATOM   7253 C  CA  B MET B 1 379 ? 80.385  42.343 48.948  0.50 45.66 ? 379  MET B CA  1 
ATOM   7254 C  C   . MET B 1 379 ? 79.315  41.916 49.934  1.00 46.03 ? 379  MET B C   1 
ATOM   7255 O  O   . MET B 1 379 ? 78.335  41.260 49.562  1.00 47.80 ? 379  MET B O   1 
ATOM   7256 C  CB  A MET B 1 379 ? 81.369  41.158 48.688  0.50 45.87 ? 379  MET B CB  1 
ATOM   7257 C  CB  B MET B 1 379 ? 81.321  41.166 48.657  0.50 46.09 ? 379  MET B CB  1 
ATOM   7258 C  CG  A MET B 1 379 ? 82.434  41.436 47.624  0.50 46.41 ? 379  MET B CG  1 
ATOM   7259 C  CG  B MET B 1 379 ? 82.214  41.366 47.453  0.50 47.30 ? 379  MET B CG  1 
ATOM   7260 S  SD  A MET B 1 379 ? 83.591  40.081 47.318  0.50 48.27 ? 379  MET B SD  1 
ATOM   7261 S  SD  B MET B 1 379 ? 82.511  39.818 46.599  0.50 51.35 ? 379  MET B SD  1 
ATOM   7262 C  CE  A MET B 1 379 ? 84.616  40.128 48.786  0.50 43.78 ? 379  MET B CE  1 
ATOM   7263 C  CE  B MET B 1 379 ? 80.886  39.544 45.864  0.50 50.78 ? 379  MET B CE  1 
ATOM   7264 N  N   . ASP B 1 380 ? 79.489  42.331 51.187  1.00 45.35 ? 380  ASP B N   1 
ATOM   7265 C  CA  . ASP B 1 380 ? 78.694  41.807 52.287  1.00 46.11 ? 380  ASP B CA  1 
ATOM   7266 C  C   . ASP B 1 380 ? 78.466  42.857 53.384  1.00 45.28 ? 380  ASP B C   1 
ATOM   7267 O  O   . ASP B 1 380 ? 78.631  42.566 54.564  1.00 44.90 ? 380  ASP B O   1 
ATOM   7268 C  CB  . ASP B 1 380 ? 79.453  40.604 52.859  1.00 46.01 ? 380  ASP B CB  1 
ATOM   7269 C  CG  . ASP B 1 380 ? 78.553  39.610 53.560  1.00 46.79 ? 380  ASP B CG  1 
ATOM   7270 O  OD1 . ASP B 1 380 ? 77.318  39.734 53.467  1.00 47.52 ? 380  ASP B OD1 1 
ATOM   7271 O  OD2 . ASP B 1 380 ? 79.100  38.708 54.217  1.00 45.04 ? 380  ASP B OD2 1 
ATOM   7272 N  N   . ASP B 1 381 ? 78.070  44.067 52.995  1.00 45.50 ? 381  ASP B N   1 
ATOM   7273 C  CA  . ASP B 1 381 ? 78.068  45.218 53.915  1.00 44.69 ? 381  ASP B CA  1 
ATOM   7274 C  C   . ASP B 1 381 ? 76.982  45.165 55.010  1.00 45.41 ? 381  ASP B C   1 
ATOM   7275 O  O   . ASP B 1 381 ? 77.021  45.952 55.973  1.00 45.31 ? 381  ASP B O   1 
ATOM   7276 C  CB  . ASP B 1 381 ? 77.950  46.529 53.122  1.00 45.20 ? 381  ASP B CB  1 
ATOM   7277 C  CG  . ASP B 1 381 ? 76.735  46.548 52.191  1.00 46.61 ? 381  ASP B CG  1 
ATOM   7278 O  OD1 . ASP B 1 381 ? 76.663  45.731 51.249  1.00 46.26 ? 381  ASP B OD1 1 
ATOM   7279 O  OD2 . ASP B 1 381 ? 75.851  47.388 52.414  1.00 49.26 ? 381  ASP B OD2 1 
ATOM   7280 N  N   . ASN B 1 382 ? 76.027  44.251 54.855  1.00 46.19 ? 382  ASN B N   1 
ATOM   7281 C  CA  . ASN B 1 382 ? 74.967  44.058 55.832  1.00 47.05 ? 382  ASN B CA  1 
ATOM   7282 C  C   . ASN B 1 382 ? 75.198  42.878 56.766  1.00 46.10 ? 382  ASN B C   1 
ATOM   7283 O  O   . ASN B 1 382 ? 74.283  42.488 57.485  1.00 46.73 ? 382  ASN B O   1 
ATOM   7284 C  CB  . ASN B 1 382 ? 73.613  43.890 55.125  1.00 48.66 ? 382  ASN B CB  1 
ATOM   7285 C  CG  . ASN B 1 382 ? 73.043  45.205 54.676  1.00 50.12 ? 382  ASN B CG  1 
ATOM   7286 O  OD1 . ASN B 1 382 ? 73.105  46.192 55.406  1.00 48.57 ? 382  ASN B OD1 1 
ATOM   7287 N  ND2 . ASN B 1 382 ? 72.478  45.232 53.466  1.00 52.24 ? 382  ASN B ND2 1 
ATOM   7288 N  N   . ASN B 1 383 ? 76.400  42.296 56.727  1.00 44.69 ? 383  ASN B N   1 
ATOM   7289 C  CA  . ASN B 1 383 ? 76.761  41.233 57.666  1.00 43.11 ? 383  ASN B CA  1 
ATOM   7290 C  C   . ASN B 1 383 ? 76.906  41.801 59.087  1.00 41.31 ? 383  ASN B C   1 
ATOM   7291 O  O   . ASN B 1 383 ? 77.766  42.652 59.355  1.00 39.50 ? 383  ASN B O   1 
ATOM   7292 C  CB  . ASN B 1 383 ? 78.021  40.498 57.229  1.00 42.31 ? 383  ASN B CB  1 
ATOM   7293 C  CG  . ASN B 1 383 ? 78.145  39.109 57.872  1.00 43.12 ? 383  ASN B CG  1 
ATOM   7294 O  OD1 . ASN B 1 383 ? 78.037  38.967 59.079  1.00 44.54 ? 383  ASN B OD1 1 
ATOM   7295 N  ND2 . ASN B 1 383 ? 78.397  38.094 57.062  1.00 41.00 ? 383  ASN B ND2 1 
ATOM   7296 N  N   . GLY B 1 384 ? 76.019  41.348 59.972  1.00 41.07 ? 384  GLY B N   1 
ATOM   7297 C  CA  . GLY B 1 384 ? 75.990  41.803 61.360  1.00 39.47 ? 384  GLY B CA  1 
ATOM   7298 C  C   . GLY B 1 384 ? 77.239  41.422 62.119  1.00 38.02 ? 384  GLY B C   1 
ATOM   7299 O  O   . GLY B 1 384 ? 77.708  42.189 62.951  1.00 36.96 ? 384  GLY B O   1 
ATOM   7300 N  N   . ILE B 1 385 ? 77.753  40.222 61.840  1.00 38.15 ? 385  ILE B N   1 
ATOM   7301 C  CA  . ILE B 1 385 ? 78.972  39.711 62.441  1.00 38.07 ? 385  ILE B CA  1 
ATOM   7302 C  C   . ILE B 1 385 ? 80.208  40.435 61.910  1.00 36.21 ? 385  ILE B C   1 
ATOM   7303 O  O   . ILE B 1 385 ? 81.028  40.882 62.684  1.00 36.24 ? 385  ILE B O   1 
ATOM   7304 C  CB  . ILE B 1 385 ? 79.142  38.189 62.196  1.00 39.48 ? 385  ILE B CB  1 
ATOM   7305 C  CG1 . ILE B 1 385 ? 77.912  37.397 62.711  1.00 43.40 ? 385  ILE B CG1 1 
ATOM   7306 C  CG2 . ILE B 1 385 ? 80.508  37.687 62.777  1.00 38.86 ? 385  ILE B CG2 1 
ATOM   7307 C  CD1 . ILE B 1 385 ? 77.877  37.104 64.219  1.00 43.06 ? 385  ILE B CD1 1 
ATOM   7308 N  N   . LYS B 1 386 ? 80.363  40.526 60.596  1.00 35.88 ? 386  LYS B N   1 
ATOM   7309 C  CA  . LYS B 1 386 ? 81.450  41.328 60.035  1.00 35.03 ? 386  LYS B CA  1 
ATOM   7310 C  C   . LYS B 1 386 ? 81.391  42.806 60.492  1.00 33.46 ? 386  LYS B C   1 
ATOM   7311 O  O   . LYS B 1 386 ? 82.434  43.420 60.710  1.00 32.47 ? 386  LYS B O   1 
ATOM   7312 C  CB  . LYS B 1 386 ? 81.474  41.236 58.504  1.00 35.50 ? 386  LYS B CB  1 
ATOM   7313 C  CG  . LYS B 1 386 ? 82.170  40.010 57.973  1.00 36.69 ? 386  LYS B CG  1 
ATOM   7314 C  CD  . LYS B 1 386 ? 81.841  39.801 56.494  1.00 37.90 ? 386  LYS B CD  1 
ATOM   7315 C  CE  . LYS B 1 386 ? 82.248  38.410 55.999  1.00 36.66 ? 386  LYS B CE  1 
ATOM   7316 N  NZ  . LYS B 1 386 ? 81.701  38.119 54.595  1.00 38.87 ? 386  LYS B NZ  1 
ATOM   7317 N  N   . ASN B 1 387 ? 80.193  43.374 60.657  1.00 32.88 ? 387  ASN B N   1 
ATOM   7318 C  CA  . ASN B 1 387 ? 80.121  44.772 61.130  1.00 31.99 ? 387  ASN B CA  1 
ATOM   7319 C  C   . ASN B 1 387 ? 80.512  44.892 62.592  1.00 31.49 ? 387  ASN B C   1 
ATOM   7320 O  O   . ASN B 1 387 ? 81.107  45.885 62.988  1.00 30.20 ? 387  ASN B O   1 
ATOM   7321 C  CB  . ASN B 1 387 ? 78.716  45.354 60.946  1.00 32.41 ? 387  ASN B CB  1 
ATOM   7322 C  CG  . ASN B 1 387 ? 78.355  45.534 59.490  1.00 33.72 ? 387  ASN B CG  1 
ATOM   7323 O  OD1 . ASN B 1 387 ? 79.230  45.518 58.634  1.00 34.26 ? 387  ASN B OD1 1 
ATOM   7324 N  ND2 . ASN B 1 387 ? 77.063  45.698 59.200  1.00 32.19 ? 387  ASN B ND2 1 
ATOM   7325 N  N   . ARG B 1 388 ? 80.134  43.886 63.399  1.00 31.94 ? 388  ARG B N   1 
ATOM   7326 C  CA  . ARG B 1 388 ? 80.516  43.852 64.796  1.00 31.85 ? 388  ARG B CA  1 
ATOM   7327 C  C   . ARG B 1 388 ? 82.029  43.733 64.956  1.00 30.87 ? 388  ARG B C   1 
ATOM   7328 O  O   . ARG B 1 388 ? 82.642  44.509 65.696  1.00 28.27 ? 388  ARG B O   1 
ATOM   7329 C  CB  . ARG B 1 388 ? 79.825  42.705 65.529  1.00 33.11 ? 388  ARG B CB  1 
ATOM   7330 C  CG  . ARG B 1 388 ? 80.156  42.647 67.027  1.00 33.40 ? 388  ARG B CG  1 
ATOM   7331 C  CD  . ARG B 1 388 ? 79.872  41.262 67.561  1.00 35.38 ? 388  ARG B CD  1 
ATOM   7332 N  NE  . ARG B 1 388 ? 80.726  40.242 66.958  1.00 34.46 ? 388  ARG B NE  1 
ATOM   7333 C  CZ  . ARG B 1 388 ? 80.377  38.964 66.840  1.00 36.25 ? 388  ARG B CZ  1 
ATOM   7334 N  NH1 . ARG B 1 388 ? 79.175  38.555 67.255  1.00 37.22 ? 388  ARG B NH1 1 
ATOM   7335 N  NH2 . ARG B 1 388 ? 81.215  38.099 66.292  1.00 31.49 ? 388  ARG B NH2 1 
ATOM   7336 N  N   . ASP B 1 389 ? 82.618  42.763 64.248  1.00 31.46 ? 389  ASP B N   1 
ATOM   7337 C  CA  . ASP B 1 389 ? 84.082  42.534 64.317  1.00 31.59 ? 389  ASP B CA  1 
ATOM   7338 C  C   . ASP B 1 389 ? 84.875  43.693 63.744  1.00 30.59 ? 389  ASP B C   1 
ATOM   7339 O  O   . ASP B 1 389 ? 85.923  44.027 64.281  1.00 29.73 ? 389  ASP B O   1 
ATOM   7340 C  CB  . ASP B 1 389 ? 84.469  41.196 63.648  1.00 32.11 ? 389  ASP B CB  1 
ATOM   7341 C  CG  . ASP B 1 389 ? 83.961  40.001 64.436  1.00 35.13 ? 389  ASP B CG  1 
ATOM   7342 O  OD1 . ASP B 1 389 ? 83.499  40.182 65.593  1.00 38.27 ? 389  ASP B OD1 1 
ATOM   7343 O  OD2 . ASP B 1 389 ? 84.017  38.887 63.917  1.00 40.07 ? 389  ASP B OD2 1 
ATOM   7344 N  N   . GLY B 1 390 ? 84.349  44.306 62.674  1.00 30.94 ? 390  GLY B N   1 
ATOM   7345 C  CA  . GLY B 1 390 ? 84.970  45.478 62.059  1.00 31.60 ? 390  GLY B CA  1 
ATOM   7346 C  C   . GLY B 1 390 ? 85.137  46.634 63.022  1.00 31.55 ? 390  GLY B C   1 
ATOM   7347 O  O   . GLY B 1 390 ? 86.200  47.227 63.123  1.00 31.14 ? 390  GLY B O   1 
ATOM   7348 N  N   . LEU B 1 391 ? 84.063  46.934 63.739  1.00 32.35 ? 391  LEU B N   1 
ATOM   7349 C  CA  . LEU B 1 391 ? 84.053  47.933 64.782  1.00 32.69 ? 391  LEU B CA  1 
ATOM   7350 C  C   . LEU B 1 391 ? 85.050  47.623 65.914  1.00 32.33 ? 391  LEU B C   1 
ATOM   7351 O  O   . LEU B 1 391 ? 85.830  48.492 66.349  1.00 32.21 ? 391  LEU B O   1 
ATOM   7352 C  CB  . LEU B 1 391 ? 82.629  48.024 65.322  1.00 33.21 ? 391  LEU B CB  1 
ATOM   7353 C  CG  . LEU B 1 391 ? 82.130  49.426 65.655  1.00 36.75 ? 391  LEU B CG  1 
ATOM   7354 C  CD1 . LEU B 1 391 ? 82.782  50.466 64.737  1.00 38.81 ? 391  LEU B CD1 1 
ATOM   7355 C  CD2 . LEU B 1 391 ? 80.604  49.495 65.569  1.00 38.50 ? 391  LEU B CD2 1 
ATOM   7356 N  N   . ASP B 1 392 ? 85.021  46.377 66.378  1.00 32.67 ? 392  ASP B N   1 
ATOM   7357 C  CA  . ASP B 1 392 ? 85.973  45.865 67.353  1.00 32.06 ? 392  ASP B CA  1 
ATOM   7358 C  C   . ASP B 1 392 ? 87.400  46.102 66.852  1.00 30.82 ? 392  ASP B C   1 
ATOM   7359 O  O   . ASP B 1 392 ? 88.206  46.692 67.563  1.00 29.61 ? 392  ASP B O   1 
ATOM   7360 C  CB  . ASP B 1 392 ? 85.703  44.371 67.592  1.00 33.67 ? 392  ASP B CB  1 
ATOM   7361 C  CG  . ASP B 1 392 ? 86.230  43.868 68.948  1.00 37.83 ? 392  ASP B CG  1 
ATOM   7362 O  OD1 . ASP B 1 392 ? 86.869  44.636 69.699  1.00 36.04 ? 392  ASP B OD1 1 
ATOM   7363 O  OD2 . ASP B 1 392 ? 86.012  42.668 69.260  1.00 44.00 ? 392  ASP B OD2 1 
ATOM   7364 N  N   . ASP B 1 393 ? 87.713  45.661 65.625  1.00 30.01 ? 393  ASP B N   1 
ATOM   7365 C  CA  . ASP B 1 393 ? 89.031  45.953 65.043  1.00 28.99 ? 393  ASP B CA  1 
ATOM   7366 C  C   . ASP B 1 393 ? 89.349  47.461 64.998  1.00 28.06 ? 393  ASP B C   1 
ATOM   7367 O  O   . ASP B 1 393 ? 90.448  47.877 65.370  1.00 27.95 ? 393  ASP B O   1 
ATOM   7368 C  CB  . ASP B 1 393 ? 89.199  45.293 63.665  1.00 29.49 ? 393  ASP B CB  1 
ATOM   7369 C  CG  . ASP B 1 393 ? 89.156  43.754 63.745  1.00 31.43 ? 393  ASP B CG  1 
ATOM   7370 O  OD1 . ASP B 1 393 ? 89.445  43.191 64.814  1.00 34.38 ? 393  ASP B OD1 1 
ATOM   7371 O  OD2 . ASP B 1 393 ? 88.827  43.089 62.743  1.00 35.56 ? 393  ASP B OD2 1 
ATOM   7372 N  N   . ILE B 1 394 ? 88.388  48.289 64.606  1.00 26.61 ? 394  ILE B N   1 
ATOM   7373 C  CA  . ILE B 1 394 ? 88.652  49.742 64.565  1.00 25.08 ? 394  ILE B CA  1 
ATOM   7374 C  C   . ILE B 1 394 ? 89.033  50.301 65.916  1.00 24.68 ? 394  ILE B C   1 
ATOM   7375 O  O   . ILE B 1 394 ? 89.987  51.068 66.048  1.00 23.91 ? 394  ILE B O   1 
ATOM   7376 C  CB  . ILE B 1 394 ? 87.414  50.537 64.053  1.00 25.41 ? 394  ILE B CB  1 
ATOM   7377 C  CG1 . ILE B 1 394 ? 87.249  50.354 62.536  1.00 23.25 ? 394  ILE B CG1 1 
ATOM   7378 C  CG2 . ILE B 1 394 ? 87.497  52.031 64.462  1.00 22.74 ? 394  ILE B CG2 1 
ATOM   7379 C  CD1 . ILE B 1 394 ? 85.835  50.534 62.106  1.00 24.30 ? 394  ILE B CD1 1 
ATOM   7380 N  N   . VAL B 1 395 ? 88.252  49.931 66.929  1.00 25.08 ? 395  VAL B N   1 
ATOM   7381 C  CA  . VAL B 1 395 ? 88.480  50.468 68.229  1.00 24.82 ? 395  VAL B CA  1 
ATOM   7382 C  C   . VAL B 1 395 ? 89.849  50.021 68.784  1.00 24.89 ? 395  VAL B C   1 
ATOM   7383 O  O   . VAL B 1 395 ? 90.610  50.849 69.309  1.00 24.95 ? 395  VAL B O   1 
ATOM   7384 C  CB  . VAL B 1 395 ? 87.319  50.180 69.154  1.00 25.01 ? 395  VAL B CB  1 
ATOM   7385 C  CG1 . VAL B 1 395 ? 87.706  50.553 70.589  1.00 25.74 ? 395  VAL B CG1 1 
ATOM   7386 C  CG2 . VAL B 1 395 ? 86.078  51.034 68.711  1.00 26.16 ? 395  VAL B CG2 1 
ATOM   7387 N  N   . GLY B 1 396 ? 90.169  48.733 68.608  1.00 24.86 ? 396  GLY B N   1 
ATOM   7388 C  CA  . GLY B 1 396 ? 91.436  48.172 69.028  1.00 24.46 ? 396  GLY B CA  1 
ATOM   7389 C  C   . GLY B 1 396 ? 92.619  48.665 68.200  1.00 24.80 ? 396  GLY B C   1 
ATOM   7390 O  O   . GLY B 1 396 ? 93.661  48.987 68.761  1.00 25.06 ? 396  GLY B O   1 
ATOM   7391 N  N   . ASP B 1 397 ? 92.465  48.727 66.874  1.00 25.17 ? 397  ASP B N   1 
ATOM   7392 C  CA  . ASP B 1 397 ? 93.547  49.165 65.986  1.00 25.08 ? 397  ASP B CA  1 
ATOM   7393 C  C   . ASP B 1 397 ? 93.895  50.619 66.264  1.00 25.48 ? 397  ASP B C   1 
ATOM   7394 O  O   . ASP B 1 397 ? 95.078  50.932 66.465  1.00 26.03 ? 397  ASP B O   1 
ATOM   7395 C  CB  . ASP B 1 397 ? 93.192  48.990 64.506  1.00 25.23 ? 397  ASP B CB  1 
ATOM   7396 C  CG  . ASP B 1 397 ? 93.117  47.535 64.082  1.00 26.76 ? 397  ASP B CG  1 
ATOM   7397 O  OD1 . ASP B 1 397 ? 93.611  46.650 64.810  1.00 23.59 ? 397  ASP B OD1 1 
ATOM   7398 O  OD2 . ASP B 1 397 ? 92.562  47.274 63.002  1.00 25.82 ? 397  ASP B OD2 1 
ATOM   7399 N  N   . HIS B 1 398 ? 92.878  51.484 66.326  1.00 25.57 ? 398  HIS B N   1 
ATOM   7400 C  CA  . HIS B 1 398 ? 93.092  52.928 66.536  1.00 26.06 ? 398  HIS B CA  1 
ATOM   7401 C  C   . HIS B 1 398 ? 93.639  53.266 67.925  1.00 26.07 ? 398  HIS B C   1 
ATOM   7402 O  O   . HIS B 1 398 ? 94.526  54.120 68.064  1.00 27.17 ? 398  HIS B O   1 
ATOM   7403 C  CB  . HIS B 1 398 ? 91.787  53.708 66.241  1.00 26.00 ? 398  HIS B CB  1 
ATOM   7404 C  CG  . HIS B 1 398 ? 91.783  55.147 66.686  1.00 27.52 ? 398  HIS B CG  1 
ATOM   7405 N  ND1 . HIS B 1 398 ? 92.575  56.125 66.103  1.00 28.44 ? 398  HIS B ND1 1 
ATOM   7406 C  CD2 . HIS B 1 398 ? 91.038  55.782 67.627  1.00 27.50 ? 398  HIS B CD2 1 
ATOM   7407 C  CE1 . HIS B 1 398 ? 92.341  57.290 66.691  1.00 28.88 ? 398  HIS B CE1 1 
ATOM   7408 N  NE2 . HIS B 1 398 ? 91.421  57.105 67.628  1.00 29.04 ? 398  HIS B NE2 1 
ATOM   7409 N  N   . ASN B 1 399 ? 93.105  52.628 68.952  1.00 24.74 ? 399  ASN B N   1 
ATOM   7410 C  CA  . ASN B 1 399 ? 93.355  53.089 70.315  1.00 24.61 ? 399  ASN B CA  1 
ATOM   7411 C  C   . ASN B 1 399 ? 94.554  52.446 71.000  1.00 24.85 ? 399  ASN B C   1 
ATOM   7412 O  O   . ASN B 1 399 ? 95.158  53.042 71.862  1.00 25.13 ? 399  ASN B O   1 
ATOM   7413 C  CB  . ASN B 1 399 ? 92.085  52.894 71.144  1.00 24.24 ? 399  ASN B CB  1 
ATOM   7414 C  CG  . ASN B 1 399 ? 91.045  54.003 70.870  1.00 26.60 ? 399  ASN B CG  1 
ATOM   7415 O  OD1 . ASN B 1 399 ? 91.293  55.172 71.162  1.00 24.57 ? 399  ASN B OD1 1 
ATOM   7416 N  ND2 . ASN B 1 399 ? 89.908  53.639 70.288  1.00 27.43 ? 399  ASN B ND2 1 
ATOM   7417 N  N   . VAL B 1 400 ? 94.885  51.214 70.612  1.00 24.76 ? 400  VAL B N   1 
ATOM   7418 C  CA  . VAL B 1 400 ? 95.917  50.467 71.270  1.00 25.32 ? 400  VAL B CA  1 
ATOM   7419 C  C   . VAL B 1 400 ? 96.927  49.879 70.280  1.00 25.78 ? 400  VAL B C   1 
ATOM   7420 O  O   . VAL B 1 400 ? 98.111  50.178 70.372  1.00 26.67 ? 400  VAL B O   1 
ATOM   7421 C  CB  . VAL B 1 400 ? 95.323  49.304 72.116  1.00 25.89 ? 400  VAL B CB  1 
ATOM   7422 C  CG1 . VAL B 1 400 ? 96.418  48.513 72.744  1.00 24.88 ? 400  VAL B CG1 1 
ATOM   7423 C  CG2 . VAL B 1 400 ? 94.370  49.844 73.181  1.00 25.28 ? 400  VAL B CG2 1 
ATOM   7424 N  N   . ILE B 1 401 ? 96.470  49.075 69.324  1.00 25.24 ? 401  ILE B N   1 
ATOM   7425 C  CA  . ILE B 1 401 ? 97.424  48.315 68.526  1.00 25.37 ? 401  ILE B CA  1 
ATOM   7426 C  C   . ILE B 1 401 ? 98.346  49.174 67.666  1.00 26.12 ? 401  ILE B C   1 
ATOM   7427 O  O   . ILE B 1 401 ? 99.543  49.026 67.749  1.00 25.80 ? 401  ILE B O   1 
ATOM   7428 C  CB  . ILE B 1 401 ? 96.770  47.190 67.686  1.00 25.53 ? 401  ILE B CB  1 
ATOM   7429 C  CG1 . ILE B 1 401 ? 95.971  46.275 68.592  1.00 22.86 ? 401  ILE B CG1 1 
ATOM   7430 C  CG2 . ILE B 1 401 ? 97.849  46.427 66.833  1.00 24.32 ? 401  ILE B CG2 1 
ATOM   7431 C  CD1 . ILE B 1 401 ? 95.501  45.033 67.944  1.00 25.46 ? 401  ILE B CD1 1 
ATOM   7432 N  N   . CYS B 1 402 ? 97.781  50.073 66.859  1.00 27.21 ? 402  CYS B N   1 
ATOM   7433 C  CA  . CYS B 1 402 ? 98.597  50.852 65.914  1.00 27.26 ? 402  CYS B CA  1 
ATOM   7434 C  C   . CYS B 1 402 ? 99.465  51.883 66.607  1.00 26.68 ? 402  CYS B C   1 
ATOM   7435 O  O   . CYS B 1 402 ? 100.594 52.123 66.168  1.00 26.53 ? 402  CYS B O   1 
ATOM   7436 C  CB  . CYS B 1 402 ? 97.740  51.452 64.796  1.00 27.57 ? 402  CYS B CB  1 
ATOM   7437 S  SG  . CYS B 1 402 ? 96.978  50.131 63.797  1.00 30.46 ? 402  CYS B SG  1 
ATOM   7438 N  N   . PRO B 1 403 ? 98.951  52.501 67.687  1.00 26.50 ? 403  PRO B N   1 
ATOM   7439 C  CA  . PRO B 1 403 ? 99.848  53.372 68.478  1.00 26.47 ? 403  PRO B CA  1 
ATOM   7440 C  C   . PRO B 1 403 ? 101.007 52.580 69.065  1.00 26.03 ? 403  PRO B C   1 
ATOM   7441 O  O   . PRO B 1 403 ? 102.133 53.061 69.031  1.00 27.17 ? 403  PRO B O   1 
ATOM   7442 C  CB  . PRO B 1 403 ? 98.950  53.876 69.619  1.00 26.97 ? 403  PRO B CB  1 
ATOM   7443 C  CG  . PRO B 1 403 ? 97.559  53.804 69.044  1.00 27.26 ? 403  PRO B CG  1 
ATOM   7444 C  CD  . PRO B 1 403 ? 97.546  52.616 68.120  1.00 25.78 ? 403  PRO B CD  1 
ATOM   7445 N  N   . LEU B 1 404 ? 100.743 51.384 69.584  1.00 24.62 ? 404  LEU B N   1 
ATOM   7446 C  CA  . LEU B 1 404 ? 101.820 50.577 70.144  1.00 24.77 ? 404  LEU B CA  1 
ATOM   7447 C  C   . LEU B 1 404 ? 102.830 50.223 69.067  1.00 25.99 ? 404  LEU B C   1 
ATOM   7448 O  O   . LEU B 1 404 ? 104.058 50.334 69.278  1.00 27.31 ? 404  LEU B O   1 
ATOM   7449 C  CB  . LEU B 1 404 ? 101.307 49.314 70.869  1.00 23.43 ? 404  LEU B CB  1 
ATOM   7450 C  CG  . LEU B 1 404 ? 102.422 48.456 71.509  1.00 22.71 ? 404  LEU B CG  1 
ATOM   7451 C  CD1 . LEU B 1 404 ? 102.030 48.026 72.909  1.00 19.05 ? 404  LEU B CD1 1 
ATOM   7452 C  CD2 . LEU B 1 404 ? 102.848 47.228 70.617  1.00 21.67 ? 404  LEU B CD2 1 
ATOM   7453 N  N   . MET B 1 405 ? 102.326 49.836 67.897  1.00 26.52 ? 405  MET B N   1 
ATOM   7454 C  CA  . MET B 1 405 ? 103.203 49.435 66.796  1.00 27.15 ? 405  MET B CA  1 
ATOM   7455 C  C   . MET B 1 405 ? 104.032 50.609 66.314  1.00 27.41 ? 405  MET B C   1 
ATOM   7456 O  O   . MET B 1 405 ? 105.197 50.458 66.006  1.00 29.47 ? 405  MET B O   1 
ATOM   7457 C  CB  . MET B 1 405 ? 102.409 48.840 65.652  1.00 26.53 ? 405  MET B CB  1 
ATOM   7458 C  CG  . MET B 1 405 ? 101.799 47.525 66.003  1.00 26.93 ? 405  MET B CG  1 
ATOM   7459 S  SD  . MET B 1 405 ? 102.960 46.343 66.683  1.00 28.52 ? 405  MET B SD  1 
ATOM   7460 C  CE  . MET B 1 405 ? 104.208 46.143 65.358  1.00 26.24 ? 405  MET B CE  1 
ATOM   7461 N  N   . HIS B 1 406 ? 103.455 51.794 66.300  1.00 27.61 ? 406  HIS B N   1 
ATOM   7462 C  CA  . HIS B 1 406 ? 104.223 52.982 65.937  1.00 28.15 ? 406  HIS B CA  1 
ATOM   7463 C  C   . HIS B 1 406 ? 105.334 53.200 66.961  1.00 28.03 ? 406  HIS B C   1 
ATOM   7464 O  O   . HIS B 1 406 ? 106.450 53.501 66.605  1.00 28.51 ? 406  HIS B O   1 
ATOM   7465 C  CB  . HIS B 1 406 ? 103.307 54.196 65.878  1.00 27.85 ? 406  HIS B CB  1 
ATOM   7466 C  CG  . HIS B 1 406 ? 104.018 55.475 65.571  1.00 30.22 ? 406  HIS B CG  1 
ATOM   7467 N  ND1 . HIS B 1 406 ? 104.456 55.805 64.298  1.00 32.73 ? 406  HIS B ND1 1 
ATOM   7468 C  CD2 . HIS B 1 406 ? 104.370 56.507 66.369  1.00 30.18 ? 406  HIS B CD2 1 
ATOM   7469 C  CE1 . HIS B 1 406 ? 105.043 56.988 64.331  1.00 30.78 ? 406  HIS B CE1 1 
ATOM   7470 N  NE2 . HIS B 1 406 ? 105.004 57.434 65.576  1.00 31.71 ? 406  HIS B NE2 1 
ATOM   7471 N  N   . PHE B 1 407 ? 105.001 53.013 68.238  1.00 27.32 ? 407  PHE B N   1 
ATOM   7472 C  CA  . PHE B 1 407 ? 105.953 53.165 69.319  1.00 27.52 ? 407  PHE B CA  1 
ATOM   7473 C  C   . PHE B 1 407 ? 107.078 52.166 69.210  1.00 28.64 ? 407  PHE B C   1 
ATOM   7474 O  O   . PHE B 1 407 ? 108.228 52.518 69.400  1.00 29.73 ? 407  PHE B O   1 
ATOM   7475 C  CB  . PHE B 1 407 ? 105.269 53.015 70.680  1.00 25.20 ? 407  PHE B CB  1 
ATOM   7476 C  CG  . PHE B 1 407 ? 106.220 53.070 71.847  1.00 25.96 ? 407  PHE B CG  1 
ATOM   7477 C  CD1 . PHE B 1 407 ? 106.717 54.284 72.297  1.00 22.97 ? 407  PHE B CD1 1 
ATOM   7478 C  CD2 . PHE B 1 407 ? 106.614 51.889 72.512  1.00 25.95 ? 407  PHE B CD2 1 
ATOM   7479 C  CE1 . PHE B 1 407 ? 107.591 54.323 73.370  1.00 24.98 ? 407  PHE B CE1 1 
ATOM   7480 C  CE2 . PHE B 1 407 ? 107.495 51.926 73.592  1.00 24.15 ? 407  PHE B CE2 1 
ATOM   7481 C  CZ  . PHE B 1 407 ? 107.978 53.149 74.029  1.00 24.10 ? 407  PHE B CZ  1 
ATOM   7482 N  N   . VAL B 1 408 ? 106.746 50.910 68.929  1.00 29.28 ? 408  VAL B N   1 
ATOM   7483 C  CA  . VAL B 1 408 ? 107.757 49.886 68.980  1.00 30.85 ? 408  VAL B CA  1 
ATOM   7484 C  C   . VAL B 1 408 ? 108.729 50.108 67.803  1.00 32.17 ? 408  VAL B C   1 
ATOM   7485 O  O   . VAL B 1 408 ? 109.956 49.973 67.972  1.00 32.88 ? 408  VAL B O   1 
ATOM   7486 C  CB  . VAL B 1 408 ? 107.119 48.434 69.056  1.00 30.99 ? 408  VAL B CB  1 
ATOM   7487 C  CG1 . VAL B 1 408 ? 106.568 47.990 67.753  1.00 30.67 ? 408  VAL B CG1 1 
ATOM   7488 C  CG2 . VAL B 1 408 ? 108.149 47.422 69.501  1.00 34.05 ? 408  VAL B CG2 1 
ATOM   7489 N  N   . ASN B 1 409 ? 108.198 50.499 66.635  1.00 31.68 ? 409  ASN B N   1 
ATOM   7490 C  CA  . ASN B 1 409 ? 109.058 50.778 65.484  1.00 32.91 ? 409  ASN B CA  1 
ATOM   7491 C  C   . ASN B 1 409 ? 110.022 51.934 65.728  1.00 33.14 ? 409  ASN B C   1 
ATOM   7492 O  O   . ASN B 1 409 ? 111.227 51.832 65.437  1.00 32.93 ? 409  ASN B O   1 
ATOM   7493 C  CB  . ASN B 1 409 ? 108.249 50.934 64.182  1.00 33.71 ? 409  ASN B CB  1 
ATOM   7494 C  CG  . ASN B 1 409 ? 107.958 49.551 63.500  1.00 36.60 ? 409  ASN B CG  1 
ATOM   7495 O  OD1 . ASN B 1 409 ? 108.853 48.969 62.884  1.00 40.64 ? 409  ASN B OD1 1 
ATOM   7496 N  ND2 . ASN B 1 409 ? 106.733 49.035 63.635  1.00 33.13 ? 409  ASN B ND2 1 
ATOM   7497 N  N   . LYS B 1 410 ? 109.480 53.023 66.276  1.00 32.21 ? 410  LYS B N   1 
ATOM   7498 C  CA  . LYS B 1 410 ? 110.257 54.201 66.602  1.00 32.01 ? 410  LYS B CA  1 
ATOM   7499 C  C   . LYS B 1 410 ? 111.255 53.847 67.690  1.00 31.93 ? 410  LYS B C   1 
ATOM   7500 O  O   . LYS B 1 410 ? 112.426 54.207 67.623  1.00 32.39 ? 410  LYS B O   1 
ATOM   7501 C  CB  . LYS B 1 410 ? 109.339 55.324 67.085  1.00 32.20 ? 410  LYS B CB  1 
ATOM   7502 C  CG  . LYS B 1 410 ? 108.478 55.950 65.995  1.00 33.60 ? 410  LYS B CG  1 
ATOM   7503 C  CD  . LYS B 1 410 ? 109.382 56.581 64.919  1.00 34.78 ? 410  LYS B CD  1 
ATOM   7504 C  CE  . LYS B 1 410 ? 108.614 57.110 63.728  1.00 36.62 ? 410  LYS B CE  1 
ATOM   7505 N  NZ  . LYS B 1 410 ? 109.581 57.865 62.824  1.00 39.31 ? 410  LYS B NZ  1 
ATOM   7506 N  N   . TYR B 1 411 ? 110.809 53.106 68.691  1.00 30.46 ? 411  TYR B N   1 
ATOM   7507 C  CA  . TYR B 1 411 ? 111.718 52.805 69.789  1.00 30.37 ? 411  TYR B CA  1 
ATOM   7508 C  C   . TYR B 1 411 ? 112.913 51.959 69.332  1.00 30.50 ? 411  TYR B C   1 
ATOM   7509 O  O   . TYR B 1 411 ? 114.065 52.192 69.727  1.00 32.39 ? 411  TYR B O   1 
ATOM   7510 C  CB  . TYR B 1 411 ? 110.991 52.117 70.928  1.00 28.74 ? 411  TYR B CB  1 
ATOM   7511 C  CG  . TYR B 1 411 ? 111.867 52.045 72.165  1.00 30.26 ? 411  TYR B CG  1 
ATOM   7512 C  CD1 . TYR B 1 411 ? 111.925 53.118 73.048  1.00 26.70 ? 411  TYR B CD1 1 
ATOM   7513 C  CD2 . TYR B 1 411 ? 112.627 50.902 72.451  1.00 28.09 ? 411  TYR B CD2 1 
ATOM   7514 C  CE1 . TYR B 1 411 ? 112.725 53.078 74.168  1.00 27.86 ? 411  TYR B CE1 1 
ATOM   7515 C  CE2 . TYR B 1 411 ? 113.425 50.846 73.587  1.00 28.97 ? 411  TYR B CE2 1 
ATOM   7516 C  CZ  . TYR B 1 411 ? 113.470 51.963 74.436  1.00 27.76 ? 411  TYR B CZ  1 
ATOM   7517 O  OH  . TYR B 1 411 ? 114.251 51.966 75.559  1.00 29.36 ? 411  TYR B OH  1 
ATOM   7518 N  N   . THR B 1 412 ? 112.638 50.994 68.481  1.00 30.05 ? 412  THR B N   1 
ATOM   7519 C  CA  . THR B 1 412 ? 113.607 49.975 68.135  1.00 30.31 ? 412  THR B CA  1 
ATOM   7520 C  C   . THR B 1 412 ? 114.782 50.588 67.390  1.00 33.24 ? 412  THR B C   1 
ATOM   7521 O  O   . THR B 1 412 ? 115.864 50.003 67.370  1.00 33.99 ? 412  THR B O   1 
ATOM   7522 C  CB  . THR B 1 412 ? 112.884 48.851 67.386  1.00 30.43 ? 412  THR B CB  1 
ATOM   7523 O  OG1 . THR B 1 412 ? 111.917 48.292 68.283  1.00 26.71 ? 412  THR B OG1 1 
ATOM   7524 C  CG2 . THR B 1 412 ? 113.801 47.718 66.856  1.00 29.32 ? 412  THR B CG2 1 
ATOM   7525 N  N   . LYS B 1 413 ? 114.610 51.798 66.850  1.00 34.46 ? 413  LYS B N   1 
ATOM   7526 C  CA  . LYS B 1 413 ? 115.703 52.447 66.109  1.00 37.21 ? 413  LYS B CA  1 
ATOM   7527 C  C   . LYS B 1 413 ? 116.853 52.803 67.037  1.00 37.79 ? 413  LYS B C   1 
ATOM   7528 O  O   . LYS B 1 413 ? 118.023 52.832 66.623  1.00 38.75 ? 413  LYS B O   1 
ATOM   7529 C  CB  . LYS B 1 413 ? 115.232 53.723 65.401  1.00 37.27 ? 413  LYS B CB  1 
ATOM   7530 C  CG  . LYS B 1 413 ? 114.355 53.463 64.164  1.00 41.41 ? 413  LYS B CG  1 
ATOM   7531 N  N   . PHE B 1 414 ? 116.503 53.092 68.284  1.00 36.65 ? 414  PHE B N   1 
ATOM   7532 C  CA  . PHE B 1 414 ? 117.465 53.621 69.235  1.00 37.10 ? 414  PHE B CA  1 
ATOM   7533 C  C   . PHE B 1 414 ? 117.688 52.720 70.429  1.00 35.95 ? 414  PHE B C   1 
ATOM   7534 O  O   . PHE B 1 414 ? 118.708 52.831 71.074  1.00 37.66 ? 414  PHE B O   1 
ATOM   7535 C  CB  . PHE B 1 414 ? 117.030 55.006 69.716  1.00 37.08 ? 414  PHE B CB  1 
ATOM   7536 C  CG  . PHE B 1 414 ? 117.186 56.083 68.686  1.00 39.41 ? 414  PHE B CG  1 
ATOM   7537 C  CD1 . PHE B 1 414 ? 118.421 56.699 68.487  1.00 40.89 ? 414  PHE B CD1 1 
ATOM   7538 C  CD2 . PHE B 1 414 ? 116.095 56.488 67.925  1.00 39.01 ? 414  PHE B CD2 1 
ATOM   7539 C  CE1 . PHE B 1 414 ? 118.567 57.696 67.546  1.00 43.31 ? 414  PHE B CE1 1 
ATOM   7540 C  CE2 . PHE B 1 414 ? 116.217 57.491 66.988  1.00 40.43 ? 414  PHE B CE2 1 
ATOM   7541 C  CZ  . PHE B 1 414 ? 117.464 58.094 66.779  1.00 43.45 ? 414  PHE B CZ  1 
ATOM   7542 N  N   . GLY B 1 415 ? 116.756 51.820 70.719  1.00 34.56 ? 415  GLY B N   1 
ATOM   7543 C  CA  . GLY B 1 415 ? 116.822 51.029 71.963  1.00 33.76 ? 415  GLY B CA  1 
ATOM   7544 C  C   . GLY B 1 415 ? 117.847 49.903 71.943  1.00 34.22 ? 415  GLY B C   1 
ATOM   7545 O  O   . GLY B 1 415 ? 118.574 49.725 70.962  1.00 35.08 ? 415  GLY B O   1 
ATOM   7546 N  N   . ASN B 1 416 ? 117.899 49.144 73.028  1.00 33.52 ? 416  ASN B N   1 
ATOM   7547 C  CA  . ASN B 1 416 ? 118.881 48.092 73.170  1.00 35.39 ? 416  ASN B CA  1 
ATOM   7548 C  C   . ASN B 1 416 ? 118.285 46.677 73.179  1.00 34.75 ? 416  ASN B C   1 
ATOM   7549 O  O   . ASN B 1 416 ? 118.967 45.700 73.510  1.00 35.55 ? 416  ASN B O   1 
ATOM   7550 C  CB  . ASN B 1 416 ? 119.733 48.329 74.425  1.00 36.52 ? 416  ASN B CB  1 
ATOM   7551 C  CG  . ASN B 1 416 ? 120.902 47.371 74.520  1.00 41.08 ? 416  ASN B CG  1 
ATOM   7552 O  OD1 . ASN B 1 416 ? 121.003 46.606 75.480  1.00 40.11 ? 416  ASN B OD1 1 
ATOM   7553 N  ND2 . ASN B 1 416 ? 121.782 47.393 73.508  1.00 46.59 ? 416  ASN B ND2 1 
ATOM   7554 N  N   . GLY B 1 417 ? 117.015 46.566 72.808  1.00 33.38 ? 417  GLY B N   1 
ATOM   7555 C  CA  . GLY B 1 417 ? 116.358 45.256 72.684  1.00 33.22 ? 417  GLY B CA  1 
ATOM   7556 C  C   . GLY B 1 417 ? 114.849 45.331 72.856  1.00 32.33 ? 417  GLY B C   1 
ATOM   7557 O  O   . GLY B 1 417 ? 114.362 45.825 73.886  1.00 32.64 ? 417  GLY B O   1 
ATOM   7558 N  N   . THR B 1 418 ? 114.113 44.856 71.855  1.00 31.24 ? 418  THR B N   1 
ATOM   7559 C  CA  . THR B 1 418 ? 112.666 44.924 71.854  1.00 29.96 ? 418  THR B CA  1 
ATOM   7560 C  C   . THR B 1 418 ? 112.092 43.529 71.686  1.00 30.08 ? 418  THR B C   1 
ATOM   7561 O  O   . THR B 1 418 ? 112.473 42.809 70.752  1.00 30.19 ? 418  THR B O   1 
ATOM   7562 C  CB  . THR B 1 418 ? 112.167 45.780 70.655  1.00 30.22 ? 418  THR B CB  1 
ATOM   7563 O  OG1 . THR B 1 418 ? 112.539 47.153 70.839  1.00 32.33 ? 418  THR B OG1 1 
ATOM   7564 C  CG2 . THR B 1 418 ? 110.644 45.677 70.504  1.00 28.64 ? 418  THR B CG2 1 
ATOM   7565 N  N   . TYR B 1 419 ? 111.156 43.154 72.557  1.00 29.22 ? 419  TYR B N   1 
ATOM   7566 C  CA  . TYR B 1 419 ? 110.458 41.883 72.422  1.00 29.50 ? 419  TYR B CA  1 
ATOM   7567 C  C   . TYR B 1 419 ? 108.966 42.179 72.389  1.00 28.92 ? 419  TYR B C   1 
ATOM   7568 O  O   . TYR B 1 419 ? 108.451 42.884 73.288  1.00 28.61 ? 419  TYR B O   1 
ATOM   7569 C  CB  . TYR B 1 419 ? 110.819 40.913 73.559  1.00 29.20 ? 419  TYR B CB  1 
ATOM   7570 C  CG  . TYR B 1 419 ? 112.287 40.533 73.567  1.00 31.39 ? 419  TYR B CG  1 
ATOM   7571 C  CD1 . TYR B 1 419 ? 113.236 41.319 74.240  1.00 30.15 ? 419  TYR B CD1 1 
ATOM   7572 C  CD2 . TYR B 1 419 ? 112.738 39.393 72.879  1.00 30.44 ? 419  TYR B CD2 1 
ATOM   7573 C  CE1 . TYR B 1 419 ? 114.595 40.946 74.251  1.00 31.25 ? 419  TYR B CE1 1 
ATOM   7574 C  CE2 . TYR B 1 419 ? 114.093 39.022 72.869  1.00 31.62 ? 419  TYR B CE2 1 
ATOM   7575 C  CZ  . TYR B 1 419 ? 114.998 39.795 73.560  1.00 32.38 ? 419  TYR B CZ  1 
ATOM   7576 O  OH  . TYR B 1 419 ? 116.306 39.450 73.521  1.00 34.78 ? 419  TYR B OH  1 
ATOM   7577 N  N   . LEU B 1 420 ? 108.295 41.653 71.358  1.00 28.34 ? 420  LEU B N   1 
ATOM   7578 C  CA  . LEU B 1 420 ? 106.901 42.008 71.043  1.00 27.19 ? 420  LEU B CA  1 
ATOM   7579 C  C   . LEU B 1 420 ? 105.982 40.782 71.079  1.00 26.66 ? 420  LEU B C   1 
ATOM   7580 O  O   . LEU B 1 420 ? 106.339 39.737 70.531  1.00 28.50 ? 420  LEU B O   1 
ATOM   7581 C  CB  . LEU B 1 420 ? 106.839 42.677 69.654  1.00 26.45 ? 420  LEU B CB  1 
ATOM   7582 C  CG  . LEU B 1 420 ? 105.434 43.050 69.131  1.00 26.82 ? 420  LEU B CG  1 
ATOM   7583 C  CD1 . LEU B 1 420 ? 104.775 44.133 70.010  1.00 23.60 ? 420  LEU B CD1 1 
ATOM   7584 C  CD2 . LEU B 1 420 ? 105.451 43.494 67.674  1.00 25.07 ? 420  LEU B CD2 1 
ATOM   7585 N  N   . TYR B 1 421 ? 104.827 40.888 71.730  1.00 25.41 ? 421  TYR B N   1 
ATOM   7586 C  CA  . TYR B 1 421 ? 103.903 39.759 71.800  1.00 26.71 ? 421  TYR B CA  1 
ATOM   7587 C  C   . TYR B 1 421 ? 102.498 40.125 71.328  1.00 26.52 ? 421  TYR B C   1 
ATOM   7588 O  O   . TYR B 1 421 ? 102.103 41.300 71.362  1.00 24.78 ? 421  TYR B O   1 
ATOM   7589 C  CB  . TYR B 1 421 ? 103.847 39.150 73.216  1.00 25.80 ? 421  TYR B CB  1 
ATOM   7590 C  CG  . TYR B 1 421 ? 103.177 40.028 74.232  1.00 25.71 ? 421  TYR B CG  1 
ATOM   7591 C  CD1 . TYR B 1 421 ? 101.788 40.094 74.296  1.00 25.14 ? 421  TYR B CD1 1 
ATOM   7592 C  CD2 . TYR B 1 421 ? 103.919 40.800 75.134  1.00 25.20 ? 421  TYR B CD2 1 
ATOM   7593 C  CE1 . TYR B 1 421 ? 101.143 40.913 75.211  1.00 22.61 ? 421  TYR B CE1 1 
ATOM   7594 C  CE2 . TYR B 1 421 ? 103.279 41.638 76.068  1.00 23.10 ? 421  TYR B CE2 1 
ATOM   7595 C  CZ  . TYR B 1 421 ? 101.880 41.667 76.094  1.00 24.84 ? 421  TYR B CZ  1 
ATOM   7596 O  OH  . TYR B 1 421 ? 101.180 42.467 76.958  1.00 24.90 ? 421  TYR B OH  1 
ATOM   7597 N  N   . PHE B 1 422 ? 101.748 39.094 70.933  1.00 26.99 ? 422  PHE B N   1 
ATOM   7598 C  CA  . PHE B 1 422 ? 100.329 39.214 70.628  1.00 27.89 ? 422  PHE B CA  1 
ATOM   7599 C  C   . PHE B 1 422 ? 99.618  38.152 71.459  1.00 28.42 ? 422  PHE B C   1 
ATOM   7600 O  O   . PHE B 1 422 ? 99.707  36.953 71.162  1.00 29.83 ? 422  PHE B O   1 
ATOM   7601 C  CB  . PHE B 1 422 ? 100.121 38.975 69.128  1.00 29.00 ? 422  PHE B CB  1 
ATOM   7602 C  CG  . PHE B 1 422 ? 98.708  39.195 68.629  1.00 28.98 ? 422  PHE B CG  1 
ATOM   7603 C  CD1 . PHE B 1 422 ? 98.179  40.490 68.503  1.00 29.08 ? 422  PHE B CD1 1 
ATOM   7604 C  CD2 . PHE B 1 422 ? 97.941  38.108 68.181  1.00 32.70 ? 422  PHE B CD2 1 
ATOM   7605 C  CE1 . PHE B 1 422 ? 96.867  40.704 67.989  1.00 29.67 ? 422  PHE B CE1 1 
ATOM   7606 C  CE2 . PHE B 1 422 ? 96.613  38.295 67.653  1.00 33.23 ? 422  PHE B CE2 1 
ATOM   7607 C  CZ  . PHE B 1 422 ? 96.086  39.607 67.560  1.00 32.51 ? 422  PHE B CZ  1 
ATOM   7608 N  N   . PHE B 1 423 ? 98.928  38.585 72.509  1.00 27.80 ? 423  PHE B N   1 
ATOM   7609 C  CA  . PHE B 1 423 ? 98.235  37.663 73.411  1.00 28.24 ? 423  PHE B CA  1 
ATOM   7610 C  C   . PHE B 1 423 ? 96.861  37.327 72.835  1.00 28.52 ? 423  PHE B C   1 
ATOM   7611 O  O   . PHE B 1 423 ? 95.992  38.192 72.745  1.00 28.34 ? 423  PHE B O   1 
ATOM   7612 C  CB  . PHE B 1 423 ? 98.107  38.286 74.800  1.00 26.71 ? 423  PHE B CB  1 
ATOM   7613 C  CG  . PHE B 1 423 ? 97.428  37.399 75.811  1.00 28.24 ? 423  PHE B CG  1 
ATOM   7614 C  CD1 . PHE B 1 423 ? 98.159  36.512 76.580  1.00 28.41 ? 423  PHE B CD1 1 
ATOM   7615 C  CD2 . PHE B 1 423 ? 96.060  37.501 76.037  1.00 26.81 ? 423  PHE B CD2 1 
ATOM   7616 C  CE1 . PHE B 1 423 ? 97.526  35.710 77.515  1.00 31.00 ? 423  PHE B CE1 1 
ATOM   7617 C  CE2 . PHE B 1 423 ? 95.423  36.714 76.985  1.00 28.26 ? 423  PHE B CE2 1 
ATOM   7618 C  CZ  . PHE B 1 423 ? 96.151  35.810 77.720  1.00 30.30 ? 423  PHE B CZ  1 
ATOM   7619 N  N   . ASN B 1 424 ? 96.653  36.079 72.450  1.00 29.86 ? 424  ASN B N   1 
ATOM   7620 C  CA  . ASN B 1 424 ? 95.374  35.718 71.820  1.00 31.61 ? 424  ASN B CA  1 
ATOM   7621 C  C   . ASN B 1 424 ? 94.687  34.488 72.376  1.00 33.16 ? 424  ASN B C   1 
ATOM   7622 O  O   . ASN B 1 424 ? 94.005  33.770 71.656  1.00 34.53 ? 424  ASN B O   1 
ATOM   7623 C  CB  . ASN B 1 424 ? 95.472  35.655 70.288  1.00 30.83 ? 424  ASN B CB  1 
ATOM   7624 C  CG  . ASN B 1 424 ? 96.428  34.576 69.789  1.00 32.15 ? 424  ASN B CG  1 
ATOM   7625 O  OD1 . ASN B 1 424 ? 97.166  33.958 70.557  1.00 27.84 ? 424  ASN B OD1 1 
ATOM   7626 N  ND2 . ASN B 1 424 ? 96.413  34.353 68.472  1.00 31.37 ? 424  ASN B ND2 1 
ATOM   7627 N  N   . HIS B 1 425 ? 94.852  34.272 73.667  1.00 34.31 ? 425  HIS B N   1 
ATOM   7628 C  CA  . HIS B 1 425 ? 94.127  33.222 74.352  1.00 37.01 ? 425  HIS B CA  1 
ATOM   7629 C  C   . HIS B 1 425 ? 92.896  33.753 75.067  1.00 38.05 ? 425  HIS B C   1 
ATOM   7630 O  O   . HIS B 1 425 ? 92.979  34.681 75.889  1.00 37.29 ? 425  HIS B O   1 
ATOM   7631 C  CB  . HIS B 1 425 ? 95.027  32.547 75.373  1.00 37.49 ? 425  HIS B CB  1 
ATOM   7632 C  CG  . HIS B 1 425 ? 94.315  31.555 76.225  1.00 37.96 ? 425  HIS B CG  1 
ATOM   7633 N  ND1 . HIS B 1 425 ? 93.919  30.326 75.752  1.00 38.43 ? 425  HIS B ND1 1 
ATOM   7634 C  CD2 . HIS B 1 425 ? 93.922  31.609 77.519  1.00 38.34 ? 425  HIS B CD2 1 
ATOM   7635 C  CE1 . HIS B 1 425 ? 93.317  29.658 76.720  1.00 40.67 ? 425  HIS B CE1 1 
ATOM   7636 N  NE2 . HIS B 1 425 ? 93.328  30.403 77.811  1.00 39.25 ? 425  HIS B NE2 1 
ATOM   7637 N  N   . ARG B 1 426 ? 91.758  33.157 74.760  1.00 40.67 ? 426  ARG B N   1 
ATOM   7638 C  CA  . ARG B 1 426 ? 90.531  33.461 75.493  1.00 43.40 ? 426  ARG B CA  1 
ATOM   7639 C  C   . ARG B 1 426 ? 90.289  32.464 76.657  1.00 44.62 ? 426  ARG B C   1 
ATOM   7640 O  O   . ARG B 1 426 ? 90.097  31.259 76.424  1.00 45.29 ? 426  ARG B O   1 
ATOM   7641 C  CB  . ARG B 1 426 ? 89.334  33.474 74.544  1.00 44.34 ? 426  ARG B CB  1 
ATOM   7642 C  CG  . ARG B 1 426 ? 88.086  33.922 75.273  1.00 48.73 ? 426  ARG B CG  1 
ATOM   7643 C  CD  . ARG B 1 426 ? 86.832  33.555 74.526  1.00 53.66 ? 426  ARG B CD  1 
ATOM   7644 N  NE  . ARG B 1 426 ? 85.656  33.608 75.397  1.00 57.82 ? 426  ARG B NE  1 
ATOM   7645 C  CZ  . ARG B 1 426 ? 84.957  34.710 75.699  1.00 59.10 ? 426  ARG B CZ  1 
ATOM   7646 N  NH1 . ARG B 1 426 ? 85.294  35.929 75.228  1.00 53.36 ? 426  ARG B NH1 1 
ATOM   7647 N  NH2 . ARG B 1 426 ? 83.892  34.580 76.490  1.00 60.12 ? 426  ARG B NH2 1 
ATOM   7648 N  N   . ALA B 1 427 ? 90.267  32.982 77.886  1.00 44.43 ? 427  ALA B N   1 
ATOM   7649 C  CA  . ALA B 1 427 ? 90.226  32.151 79.093  1.00 45.88 ? 427  ALA B CA  1 
ATOM   7650 C  C   . ALA B 1 427 ? 88.953  31.348 79.199  1.00 48.02 ? 427  ALA B C   1 
ATOM   7651 O  O   . ALA B 1 427 ? 87.874  31.851 78.917  1.00 48.33 ? 427  ALA B O   1 
ATOM   7652 C  CB  . ALA B 1 427 ? 90.479  32.971 80.375  1.00 44.74 ? 427  ALA B CB  1 
ATOM   7653 N  N   . SER B 1 428 ? 89.100  30.084 79.608  1.00 50.37 ? 428  SER B N   1 
ATOM   7654 C  CA  . SER B 1 428 ? 88.011  29.124 79.624  1.00 52.75 ? 428  SER B CA  1 
ATOM   7655 C  C   . SER B 1 428 ? 86.906  29.488 80.625  1.00 53.43 ? 428  SER B C   1 
ATOM   7656 O  O   . SER B 1 428 ? 85.748  29.051 80.465  1.00 55.30 ? 428  SER B O   1 
ATOM   7657 C  CB  . SER B 1 428 ? 88.543  27.719 79.920  1.00 54.51 ? 428  SER B CB  1 
ATOM   7658 O  OG  . SER B 1 428 ? 89.130  27.682 81.211  1.00 56.04 ? 428  SER B OG  1 
ATOM   7659 N  N   . ASN B 1 429 ? 87.262  30.271 81.648  1.00 52.22 ? 429  ASN B N   1 
ATOM   7660 C  CA  . ASN B 1 429 ? 86.313  30.686 82.703  1.00 52.58 ? 429  ASN B CA  1 
ATOM   7661 C  C   . ASN B 1 429 ? 85.866  32.162 82.621  1.00 50.73 ? 429  ASN B C   1 
ATOM   7662 O  O   . ASN B 1 429 ? 85.457  32.756 83.628  1.00 50.68 ? 429  ASN B O   1 
ATOM   7663 C  CB  . ASN B 1 429 ? 86.891  30.387 84.097  1.00 53.34 ? 429  ASN B CB  1 
ATOM   7664 C  CG  . ASN B 1 429 ? 88.193  31.140 84.373  1.00 51.24 ? 429  ASN B CG  1 
ATOM   7665 O  OD1 . ASN B 1 429 ? 88.692  31.908 83.533  1.00 48.25 ? 429  ASN B OD1 1 
ATOM   7666 N  ND2 . ASN B 1 429 ? 88.766  30.892 85.544  1.00 52.30 ? 429  ASN B ND2 1 
ATOM   7667 N  N   . LEU B 1 430 ? 85.949  32.736 81.427  1.00 48.92 ? 430  LEU B N   1 
ATOM   7668 C  CA  . LEU B 1 430 ? 85.535  34.125 81.199  1.00 47.76 ? 430  LEU B CA  1 
ATOM   7669 C  C   . LEU B 1 430 ? 84.016  34.304 81.382  1.00 48.09 ? 430  LEU B C   1 
ATOM   7670 O  O   . LEU B 1 430 ? 83.225  33.475 80.924  1.00 49.30 ? 430  LEU B O   1 
ATOM   7671 C  CB  . LEU B 1 430 ? 85.936  34.571 79.793  1.00 46.48 ? 430  LEU B CB  1 
ATOM   7672 C  CG  . LEU B 1 430 ? 86.442  36.004 79.641  1.00 46.02 ? 430  LEU B CG  1 
ATOM   7673 C  CD1 . LEU B 1 430 ? 87.898  36.144 80.081  1.00 44.15 ? 430  LEU B CD1 1 
ATOM   7674 C  CD2 . LEU B 1 430 ? 86.299  36.408 78.207  1.00 45.55 ? 430  LEU B CD2 1 
ATOM   7675 N  N   . VAL B 1 431 ? 83.618  35.381 82.051  1.00 46.55 ? 431  VAL B N   1 
ATOM   7676 C  CA  . VAL B 1 431 ? 82.205  35.628 82.290  1.00 46.69 ? 431  VAL B CA  1 
ATOM   7677 C  C   . VAL B 1 431 ? 81.614  36.531 81.213  1.00 44.63 ? 431  VAL B C   1 
ATOM   7678 O  O   . VAL B 1 431 ? 80.407  36.731 81.165  1.00 45.55 ? 431  VAL B O   1 
ATOM   7679 C  CB  . VAL B 1 431 ? 81.972  36.218 83.695  1.00 47.93 ? 431  VAL B CB  1 
ATOM   7680 C  CG1 . VAL B 1 431 ? 82.166  35.129 84.772  1.00 50.06 ? 431  VAL B CG1 1 
ATOM   7681 C  CG2 . VAL B 1 431 ? 82.907  37.429 83.931  1.00 46.34 ? 431  VAL B CG2 1 
ATOM   7682 N  N   . TRP B 1 432 ? 82.468  37.061 80.346  1.00 42.18 ? 432  TRP B N   1 
ATOM   7683 C  CA  . TRP B 1 432 ? 82.030  37.923 79.240  1.00 41.15 ? 432  TRP B CA  1 
ATOM   7684 C  C   . TRP B 1 432 ? 81.619  37.076 78.032  1.00 41.45 ? 432  TRP B C   1 
ATOM   7685 O  O   . TRP B 1 432 ? 82.174  35.997 77.840  1.00 42.26 ? 432  TRP B O   1 
ATOM   7686 C  CB  . TRP B 1 432 ? 83.149  38.879 78.840  1.00 39.19 ? 432  TRP B CB  1 
ATOM   7687 C  CG  . TRP B 1 432 ? 83.540  39.909 79.895  1.00 38.62 ? 432  TRP B CG  1 
ATOM   7688 C  CD1 . TRP B 1 432 ? 84.631  39.867 80.717  1.00 38.50 ? 432  TRP B CD1 1 
ATOM   7689 C  CD2 . TRP B 1 432 ? 82.853  41.128 80.211  1.00 37.20 ? 432  TRP B CD2 1 
ATOM   7690 N  NE1 . TRP B 1 432 ? 84.651  40.967 81.547  1.00 38.14 ? 432  TRP B NE1 1 
ATOM   7691 C  CE2 . TRP B 1 432 ? 83.581  41.763 81.251  1.00 38.15 ? 432  TRP B CE2 1 
ATOM   7692 C  CE3 . TRP B 1 432 ? 81.690  41.734 79.734  1.00 35.62 ? 432  TRP B CE3 1 
ATOM   7693 C  CZ2 . TRP B 1 432 ? 83.180  42.983 81.820  1.00 39.48 ? 432  TRP B CZ2 1 
ATOM   7694 C  CZ3 . TRP B 1 432 ? 81.283  42.934 80.307  1.00 39.93 ? 432  TRP B CZ3 1 
ATOM   7695 C  CH2 . TRP B 1 432 ? 82.036  43.557 81.331  1.00 39.65 ? 432  TRP B CH2 1 
ATOM   7696 N  N   . PRO B 1 433 ? 80.666  37.557 77.200  1.00 41.31 ? 433  PRO B N   1 
ATOM   7697 C  CA  . PRO B 1 433 ? 80.279  36.761 76.031  1.00 41.77 ? 433  PRO B CA  1 
ATOM   7698 C  C   . PRO B 1 433 ? 81.422  36.535 75.013  1.00 40.50 ? 433  PRO B C   1 
ATOM   7699 O  O   . PRO B 1 433 ? 82.397  37.270 74.995  1.00 38.89 ? 433  PRO B O   1 
ATOM   7700 C  CB  . PRO B 1 433 ? 79.146  37.589 75.410  1.00 42.20 ? 433  PRO B CB  1 
ATOM   7701 C  CG  . PRO B 1 433 ? 79.505  38.985 75.760  1.00 40.74 ? 433  PRO B CG  1 
ATOM   7702 C  CD  . PRO B 1 433 ? 80.003  38.878 77.193  1.00 40.61 ? 433  PRO B CD  1 
ATOM   7703 N  N   . GLU B 1 434 ? 81.262  35.500 74.193  1.00 41.67 ? 434  GLU B N   1 
ATOM   7704 C  CA  A GLU B 1 434 ? 82.272  35.079 73.224  0.50 41.06 ? 434  GLU B CA  1 
ATOM   7705 C  CA  B GLU B 1 434 ? 82.256  35.072 73.204  0.50 40.76 ? 434  GLU B CA  1 
ATOM   7706 C  C   . GLU B 1 434 ? 82.606  36.187 72.232  1.00 39.25 ? 434  GLU B C   1 
ATOM   7707 O  O   . GLU B 1 434 ? 83.759  36.346 71.837  1.00 37.97 ? 434  GLU B O   1 
ATOM   7708 C  CB  A GLU B 1 434 ? 81.785  33.824 72.468  0.50 42.75 ? 434  GLU B CB  1 
ATOM   7709 C  CB  B GLU B 1 434 ? 81.734  33.858 72.397  0.50 42.26 ? 434  GLU B CB  1 
ATOM   7710 C  CG  A GLU B 1 434 ? 82.850  33.115 71.629  0.50 44.26 ? 434  GLU B CG  1 
ATOM   7711 C  CG  B GLU B 1 434 ? 81.723  32.521 73.134  0.50 43.76 ? 434  GLU B CG  1 
ATOM   7712 C  CD  A GLU B 1 434 ? 83.711  32.168 72.451  0.50 47.90 ? 434  GLU B CD  1 
ATOM   7713 C  CD  B GLU B 1 434 ? 81.467  31.322 72.205  0.50 47.50 ? 434  GLU B CD  1 
ATOM   7714 O  OE1 A GLU B 1 434 ? 83.191  31.638 73.466  0.50 51.34 ? 434  GLU B OE1 1 
ATOM   7715 O  OE1 B GLU B 1 434 ? 81.263  31.524 70.984  0.50 47.62 ? 434  GLU B OE1 1 
ATOM   7716 O  OE2 A GLU B 1 434 ? 84.894  31.942 72.084  0.50 46.06 ? 434  GLU B OE2 1 
ATOM   7717 O  OE2 B GLU B 1 434 ? 81.473  30.171 72.699  0.50 48.29 ? 434  GLU B OE2 1 
ATOM   7718 N  N   . TRP B 1 435 ? 81.601  36.952 71.816  1.00 39.06 ? 435  TRP B N   1 
ATOM   7719 C  CA  . TRP B 1 435 ? 81.865  37.977 70.797  1.00 37.26 ? 435  TRP B CA  1 
ATOM   7720 C  C   . TRP B 1 435 ? 83.000  38.893 71.213  1.00 34.95 ? 435  TRP B C   1 
ATOM   7721 O  O   . TRP B 1 435 ? 83.757  39.374 70.366  1.00 34.01 ? 435  TRP B O   1 
ATOM   7722 C  CB  . TRP B 1 435 ? 80.605  38.761 70.385  1.00 37.52 ? 435  TRP B CB  1 
ATOM   7723 C  CG  . TRP B 1 435 ? 80.065  39.785 71.376  1.00 36.46 ? 435  TRP B CG  1 
ATOM   7724 C  CD1 . TRP B 1 435 ? 78.983  39.630 72.232  1.00 37.31 ? 435  TRP B CD1 1 
ATOM   7725 C  CD2 . TRP B 1 435 ? 80.531  41.131 71.565  1.00 33.89 ? 435  TRP B CD2 1 
ATOM   7726 N  NE1 . TRP B 1 435 ? 78.781  40.788 72.952  1.00 34.85 ? 435  TRP B NE1 1 
ATOM   7727 C  CE2 . TRP B 1 435 ? 79.711  41.723 72.567  1.00 34.33 ? 435  TRP B CE2 1 
ATOM   7728 C  CE3 . TRP B 1 435 ? 81.580  41.878 71.016  1.00 31.06 ? 435  TRP B CE3 1 
ATOM   7729 C  CZ2 . TRP B 1 435 ? 79.905  43.036 73.015  1.00 34.16 ? 435  TRP B CZ2 1 
ATOM   7730 C  CZ3 . TRP B 1 435 ? 81.769  43.179 71.453  1.00 31.87 ? 435  TRP B CZ3 1 
ATOM   7731 C  CH2 . TRP B 1 435 ? 80.940  43.744 72.453  1.00 33.98 ? 435  TRP B CH2 1 
ATOM   7732 N  N   . MET B 1 436 ? 83.131  39.118 72.518  1.00 33.67 ? 436  MET B N   1 
ATOM   7733 C  CA  . MET B 1 436 ? 84.131  40.050 73.028  1.00 31.27 ? 436  MET B CA  1 
ATOM   7734 C  C   . MET B 1 436 ? 85.576  39.536 72.888  1.00 30.34 ? 436  MET B C   1 
ATOM   7735 O  O   . MET B 1 436 ? 86.515  40.311 73.015  1.00 27.60 ? 436  MET B O   1 
ATOM   7736 C  CB  . MET B 1 436 ? 83.811  40.471 74.465  1.00 31.57 ? 436  MET B CB  1 
ATOM   7737 C  CG  . MET B 1 436 ? 82.543  41.322 74.576  1.00 33.23 ? 436  MET B CG  1 
ATOM   7738 S  SD  . MET B 1 436 ? 82.147  41.847 76.272  1.00 34.21 ? 436  MET B SD  1 
ATOM   7739 C  CE  . MET B 1 436 ? 83.379  43.110 76.513  1.00 27.10 ? 436  MET B CE  1 
ATOM   7740 N  N   . GLY B 1 437 ? 85.737  38.237 72.617  1.00 30.56 ? 437  GLY B N   1 
ATOM   7741 C  CA  . GLY B 1 437 ? 87.047  37.659 72.369  1.00 31.25 ? 437  GLY B CA  1 
ATOM   7742 C  C   . GLY B 1 437 ? 88.031  37.811 73.537  1.00 31.52 ? 437  GLY B C   1 
ATOM   7743 O  O   . GLY B 1 437 ? 87.667  37.617 74.714  1.00 31.78 ? 437  GLY B O   1 
ATOM   7744 N  N   . VAL B 1 438 ? 89.271  38.144 73.196  1.00 30.93 ? 438  VAL B N   1 
ATOM   7745 C  CA  . VAL B 1 438 ? 90.355  38.258 74.154  1.00 32.40 ? 438  VAL B CA  1 
ATOM   7746 C  C   . VAL B 1 438 ? 90.396  39.712 74.637  1.00 32.56 ? 438  VAL B C   1 
ATOM   7747 O  O   . VAL B 1 438 ? 90.992  40.561 73.996  1.00 33.20 ? 438  VAL B O   1 
ATOM   7748 C  CB  . VAL B 1 438 ? 91.711  37.945 73.500  1.00 32.40 ? 438  VAL B CB  1 
ATOM   7749 C  CG1 . VAL B 1 438 ? 92.804  37.901 74.567  1.00 32.81 ? 438  VAL B CG1 1 
ATOM   7750 C  CG2 . VAL B 1 438 ? 91.652  36.607 72.724  1.00 33.60 ? 438  VAL B CG2 1 
ATOM   7751 N  N   . ILE B 1 439 ? 89.781  39.952 75.783  1.00 33.22 ? 439  ILE B N   1 
ATOM   7752 C  CA  . ILE B 1 439 ? 89.430  41.258 76.242  1.00 33.82 ? 439  ILE B CA  1 
ATOM   7753 C  C   . ILE B 1 439 ? 90.629  42.018 76.842  1.00 33.82 ? 439  ILE B C   1 
ATOM   7754 O  O   . ILE B 1 439 ? 91.617  41.445 77.323  1.00 33.75 ? 439  ILE B O   1 
ATOM   7755 C  CB  . ILE B 1 439 ? 88.238  41.141 77.218  1.00 34.40 ? 439  ILE B CB  1 
ATOM   7756 C  CG1 . ILE B 1 439 ? 87.079  40.437 76.513  1.00 35.50 ? 439  ILE B CG1 1 
ATOM   7757 C  CG2 . ILE B 1 439 ? 87.741  42.530 77.735  1.00 35.46 ? 439  ILE B CG2 1 
ATOM   7758 C  CD1 . ILE B 1 439 ? 86.208  39.573 77.470  1.00 35.05 ? 439  ILE B CD1 1 
ATOM   7759 N  N   . HIS B 1 440 ? 90.528  43.334 76.732  1.00 33.73 ? 440  HIS B N   1 
ATOM   7760 C  CA  . HIS B 1 440 ? 91.394  44.311 77.357  1.00 32.60 ? 440  HIS B CA  1 
ATOM   7761 C  C   . HIS B 1 440 ? 91.566  43.949 78.848  1.00 32.55 ? 440  HIS B C   1 
ATOM   7762 O  O   . HIS B 1 440 ? 90.577  43.887 79.577  1.00 33.12 ? 440  HIS B O   1 
ATOM   7763 C  CB  . HIS B 1 440 ? 90.654  45.637 77.200  1.00 32.86 ? 440  HIS B CB  1 
ATOM   7764 C  CG  . HIS B 1 440 ? 91.456  46.825 77.605  1.00 34.21 ? 440  HIS B CG  1 
ATOM   7765 N  ND1 . HIS B 1 440 ? 92.461  47.344 76.809  1.00 34.95 ? 440  HIS B ND1 1 
ATOM   7766 C  CD2 . HIS B 1 440 ? 91.440  47.560 78.742  1.00 32.55 ? 440  HIS B CD2 1 
ATOM   7767 C  CE1 . HIS B 1 440 ? 93.024  48.363 77.441  1.00 38.63 ? 440  HIS B CE1 1 
ATOM   7768 N  NE2 . HIS B 1 440 ? 92.408  48.525 78.606  1.00 38.88 ? 440  HIS B NE2 1 
ATOM   7769 N  N   . GLY B 1 441 ? 92.796  43.669 79.289  1.00 31.66 ? 441  GLY B N   1 
ATOM   7770 C  CA  . GLY B 1 441 ? 93.070  43.363 80.717  1.00 31.04 ? 441  GLY B CA  1 
ATOM   7771 C  C   . GLY B 1 441 ? 93.140  41.882 81.071  1.00 31.58 ? 441  GLY B C   1 
ATOM   7772 O  O   . GLY B 1 441 ? 93.532  41.487 82.175  1.00 31.48 ? 441  GLY B O   1 
ATOM   7773 N  N   . TYR B 1 442 ? 92.778  41.031 80.130  1.00 31.34 ? 442  TYR B N   1 
ATOM   7774 C  CA  . TYR B 1 442 ? 92.667  39.667 80.493  1.00 32.10 ? 442  TYR B CA  1 
ATOM   7775 C  C   . TYR B 1 442 ? 93.931  38.859 80.378  1.00 31.71 ? 442  TYR B C   1 
ATOM   7776 O  O   . TYR B 1 442 ? 93.930  37.705 80.794  1.00 32.00 ? 442  TYR B O   1 
ATOM   7777 C  CB  . TYR B 1 442 ? 91.394  39.024 79.945  1.00 33.57 ? 442  TYR B CB  1 
ATOM   7778 C  CG  . TYR B 1 442 ? 90.214  39.545 80.767  1.00 37.26 ? 442  TYR B CG  1 
ATOM   7779 C  CD1 . TYR B 1 442 ? 89.784  40.866 80.634  1.00 38.45 ? 442  TYR B CD1 1 
ATOM   7780 C  CD2 . TYR B 1 442 ? 89.590  38.756 81.740  1.00 41.79 ? 442  TYR B CD2 1 
ATOM   7781 C  CE1 . TYR B 1 442 ? 88.755  41.370 81.398  1.00 39.80 ? 442  TYR B CE1 1 
ATOM   7782 C  CE2 . TYR B 1 442 ? 88.530  39.273 82.517  1.00 42.77 ? 442  TYR B CE2 1 
ATOM   7783 C  CZ  . TYR B 1 442 ? 88.135  40.587 82.329  1.00 40.94 ? 442  TYR B CZ  1 
ATOM   7784 O  OH  . TYR B 1 442 ? 87.105  41.143 83.060  1.00 44.84 ? 442  TYR B OH  1 
ATOM   7785 N  N   . GLU B 1 443 ? 95.020  39.481 79.905  1.00 29.71 ? 443  GLU B N   1 
ATOM   7786 C  CA  . GLU B 1 443 ? 96.347  38.867 80.062  1.00 28.85 ? 443  GLU B CA  1 
ATOM   7787 C  C   . GLU B 1 443 ? 96.910  39.051 81.476  1.00 28.85 ? 443  GLU B C   1 
ATOM   7788 O  O   . GLU B 1 443 ? 97.720  38.247 81.914  1.00 30.21 ? 443  GLU B O   1 
ATOM   7789 C  CB  . GLU B 1 443 ? 97.331  39.333 78.996  1.00 27.49 ? 443  GLU B CB  1 
ATOM   7790 C  CG  . GLU B 1 443 ? 98.125  40.604 79.347  1.00 29.54 ? 443  GLU B CG  1 
ATOM   7791 C  CD  . GLU B 1 443 ? 97.252  41.827 79.547  1.00 27.34 ? 443  GLU B CD  1 
ATOM   7792 O  OE1 . GLU B 1 443 ? 96.035  41.819 79.231  1.00 28.34 ? 443  GLU B OE1 1 
ATOM   7793 O  OE2 . GLU B 1 443 ? 97.790  42.805 80.056  1.00 31.34 ? 443  GLU B OE2 1 
ATOM   7794 N  N   . ILE B 1 444 ? 96.435  40.074 82.200  1.00 28.80 ? 444  ILE B N   1 
ATOM   7795 C  CA  . ILE B 1 444 ? 96.882  40.349 83.563  1.00 28.48 ? 444  ILE B CA  1 
ATOM   7796 C  C   . ILE B 1 444 ? 96.866  39.127 84.499  1.00 29.89 ? 444  ILE B C   1 
ATOM   7797 O  O   . ILE B 1 444 ? 97.853  38.834 85.166  1.00 30.10 ? 444  ILE B O   1 
ATOM   7798 C  CB  . ILE B 1 444 ? 96.147  41.563 84.212  1.00 28.32 ? 444  ILE B CB  1 
ATOM   7799 C  CG1 . ILE B 1 444 ? 96.383  42.826 83.365  1.00 27.02 ? 444  ILE B CG1 1 
ATOM   7800 C  CG2 . ILE B 1 444 ? 96.750  41.862 85.600  1.00 27.24 ? 444  ILE B CG2 1 
ATOM   7801 C  CD1 . ILE B 1 444 ? 95.502  44.015 83.700  1.00 26.55 ? 444  ILE B CD1 1 
ATOM   7802 N  N   . GLU B 1 445 ? 95.759  38.401 84.535  1.00 30.53 ? 445  GLU B N   1 
ATOM   7803 C  CA  . GLU B 1 445 ? 95.643  37.273 85.445  1.00 31.70 ? 445  GLU B CA  1 
ATOM   7804 C  C   . GLU B 1 445 ? 96.683  36.189 85.139  1.00 31.59 ? 445  GLU B C   1 
ATOM   7805 O  O   . GLU B 1 445 ? 97.146  35.508 86.047  1.00 32.57 ? 445  GLU B O   1 
ATOM   7806 C  CB  . GLU B 1 445 ? 94.205  36.714 85.471  1.00 33.28 ? 445  GLU B CB  1 
ATOM   7807 C  CG  . GLU B 1 445 ? 93.609  36.390 84.120  1.00 35.67 ? 445  GLU B CG  1 
ATOM   7808 C  CD  . GLU B 1 445 ? 92.077  36.502 84.116  1.00 39.69 ? 445  GLU B CD  1 
ATOM   7809 O  OE1 . GLU B 1 445 ? 91.542  37.613 84.327  1.00 37.12 ? 445  GLU B OE1 1 
ATOM   7810 O  OE2 . GLU B 1 445 ? 91.414  35.466 83.890  1.00 40.59 ? 445  GLU B OE2 1 
ATOM   7811 N  N   . PHE B 1 446 ? 97.092  36.062 83.880  1.00 30.00 ? 446  PHE B N   1 
ATOM   7812 C  CA  . PHE B 1 446 ? 98.190  35.154 83.550  1.00 29.55 ? 446  PHE B CA  1 
ATOM   7813 C  C   . PHE B 1 446 ? 99.552  35.673 84.025  1.00 29.28 ? 446  PHE B C   1 
ATOM   7814 O  O   . PHE B 1 446 ? 100.368 34.913 84.581  1.00 29.49 ? 446  PHE B O   1 
ATOM   7815 C  CB  . PHE B 1 446 ? 98.188  34.851 82.043  1.00 29.82 ? 446  PHE B CB  1 
ATOM   7816 C  CG  . PHE B 1 446 ? 97.006  34.079 81.623  1.00 28.89 ? 446  PHE B CG  1 
ATOM   7817 C  CD1 . PHE B 1 446 ? 95.783  34.721 81.435  1.00 30.86 ? 446  PHE B CD1 1 
ATOM   7818 C  CD2 . PHE B 1 446 ? 97.081  32.702 81.492  1.00 32.05 ? 446  PHE B CD2 1 
ATOM   7819 C  CE1 . PHE B 1 446 ? 94.653  34.015 81.069  1.00 32.07 ? 446  PHE B CE1 1 
ATOM   7820 C  CE2 . PHE B 1 446 ? 95.952  31.962 81.128  1.00 35.00 ? 446  PHE B CE2 1 
ATOM   7821 C  CZ  . PHE B 1 446 ? 94.733  32.618 80.918  1.00 33.95 ? 446  PHE B CZ  1 
ATOM   7822 N  N   . VAL B 1 447 ? 99.767  36.968 83.816  1.00 27.09 ? 447  VAL B N   1 
ATOM   7823 C  CA  . VAL B 1 447 ? 100.961 37.658 84.251  1.00 26.14 ? 447  VAL B CA  1 
ATOM   7824 C  C   . VAL B 1 447 ? 101.148 37.540 85.755  1.00 27.43 ? 447  VAL B C   1 
ATOM   7825 O  O   . VAL B 1 447 ? 102.291 37.379 86.224  1.00 27.98 ? 447  VAL B O   1 
ATOM   7826 C  CB  . VAL B 1 447 ? 100.890 39.168 83.833  1.00 25.79 ? 447  VAL B CB  1 
ATOM   7827 C  CG1 . VAL B 1 447 ? 101.960 40.024 84.553  1.00 24.71 ? 447  VAL B CG1 1 
ATOM   7828 C  CG2 . VAL B 1 447 ? 100.956 39.305 82.294  1.00 22.86 ? 447  VAL B CG2 1 
ATOM   7829 N  N   . PHE B 1 448 ? 100.045 37.637 86.515  1.00 27.93 ? 448  PHE B N   1 
ATOM   7830 C  CA  . PHE B 1 448 ? 100.096 37.591 87.982  1.00 28.90 ? 448  PHE B CA  1 
ATOM   7831 C  C   . PHE B 1 448 ? 99.861  36.186 88.549  1.00 30.66 ? 448  PHE B C   1 
ATOM   7832 O  O   . PHE B 1 448 ? 99.839  36.000 89.770  1.00 31.92 ? 448  PHE B O   1 
ATOM   7833 C  CB  . PHE B 1 448 ? 99.110  38.588 88.603  1.00 29.10 ? 448  PHE B CB  1 
ATOM   7834 C  CG  . PHE B 1 448 ? 99.602  39.990 88.625  1.00 28.41 ? 448  PHE B CG  1 
ATOM   7835 C  CD1 . PHE B 1 448 ? 99.550  40.768 87.500  1.00 28.78 ? 448  PHE B CD1 1 
ATOM   7836 C  CD2 . PHE B 1 448 ? 100.138 40.527 89.783  1.00 31.02 ? 448  PHE B CD2 1 
ATOM   7837 C  CE1 . PHE B 1 448 ? 100.035 42.106 87.525  1.00 30.30 ? 448  PHE B CE1 1 
ATOM   7838 C  CE2 . PHE B 1 448 ? 100.620 41.838 89.823  1.00 30.75 ? 448  PHE B CE2 1 
ATOM   7839 C  CZ  . PHE B 1 448 ? 100.566 42.631 88.694  1.00 29.70 ? 448  PHE B CZ  1 
ATOM   7840 N  N   . GLY B 1 449 ? 99.697  35.197 87.671  1.00 30.58 ? 449  GLY B N   1 
ATOM   7841 C  CA  . GLY B 1 449 ? 99.808  33.807 88.095  1.00 32.05 ? 449  GLY B CA  1 
ATOM   7842 C  C   . GLY B 1 449 ? 98.551  33.253 88.741  1.00 33.61 ? 449  GLY B C   1 
ATOM   7843 O  O   . GLY B 1 449 ? 98.596  32.261 89.483  1.00 34.93 ? 449  GLY B O   1 
ATOM   7844 N  N   . LEU B 1 450 ? 97.421  33.881 88.449  1.00 33.25 ? 450  LEU B N   1 
ATOM   7845 C  CA  . LEU B 1 450 ? 96.157  33.448 89.003  1.00 34.58 ? 450  LEU B CA  1 
ATOM   7846 C  C   . LEU B 1 450 ? 95.782  32.038 88.531  1.00 35.68 ? 450  LEU B C   1 
ATOM   7847 O  O   . LEU B 1 450 ? 95.189  31.292 89.282  1.00 37.17 ? 450  LEU B O   1 
ATOM   7848 C  CB  . LEU B 1 450 ? 95.064  34.479 88.702  1.00 33.90 ? 450  LEU B CB  1 
ATOM   7849 C  CG  . LEU B 1 450 ? 94.836  35.451 89.863  1.00 35.44 ? 450  LEU B CG  1 
ATOM   7850 C  CD1 . LEU B 1 450 ? 95.954  36.502 89.890  1.00 35.37 ? 450  LEU B CD1 1 
ATOM   7851 C  CD2 . LEU B 1 450 ? 93.453  36.113 89.731  1.00 35.25 ? 450  LEU B CD2 1 
ATOM   7852 N  N   . PRO B 1 451 ? 96.164  31.648 87.299  1.00 35.43 ? 451  PRO B N   1 
ATOM   7853 C  CA  . PRO B 1 451 ? 95.862  30.269 86.941  1.00 37.22 ? 451  PRO B CA  1 
ATOM   7854 C  C   . PRO B 1 451 ? 96.591  29.219 87.782  1.00 39.68 ? 451  PRO B C   1 
ATOM   7855 O  O   . PRO B 1 451 ? 96.277  28.031 87.667  1.00 41.77 ? 451  PRO B O   1 
ATOM   7856 C  CB  . PRO B 1 451 ? 96.291  30.195 85.482  1.00 36.34 ? 451  PRO B CB  1 
ATOM   7857 C  CG  . PRO B 1 451 ? 96.038  31.600 84.990  1.00 34.95 ? 451  PRO B CG  1 
ATOM   7858 C  CD  . PRO B 1 451 ? 96.600  32.419 86.125  1.00 33.24 ? 451  PRO B CD  1 
ATOM   7859 N  N   . LEU B 1 452 ? 97.511  29.642 88.654  1.00 40.04 ? 452  LEU B N   1 
ATOM   7860 C  CA  . LEU B 1 452 ? 98.179  28.710 89.566  1.00 42.47 ? 452  LEU B CA  1 
ATOM   7861 C  C   . LEU B 1 452 ? 97.335  28.341 90.768  1.00 44.87 ? 452  LEU B C   1 
ATOM   7862 O  O   . LEU B 1 452 ? 97.698  27.441 91.520  1.00 47.03 ? 452  LEU B O   1 
ATOM   7863 C  CB  . LEU B 1 452 ? 99.523  29.250 90.039  1.00 41.70 ? 452  LEU B CB  1 
ATOM   7864 C  CG  . LEU B 1 452 ? 100.703 29.118 89.069  1.00 41.14 ? 452  LEU B CG  1 
ATOM   7865 C  CD1 . LEU B 1 452 ? 100.568 30.011 87.818  1.00 36.97 ? 452  LEU B CD1 1 
ATOM   7866 C  CD2 . LEU B 1 452 ? 101.964 29.459 89.827  1.00 41.19 ? 452  LEU B CD2 1 
ATOM   7867 N  N   . VAL B 1 453 ? 96.217  29.027 90.957  1.00 45.51 ? 453  VAL B N   1 
ATOM   7868 C  CA  . VAL B 1 453 ? 95.319  28.718 92.065  1.00 48.48 ? 453  VAL B CA  1 
ATOM   7869 C  C   . VAL B 1 453 ? 94.237  27.733 91.598  1.00 50.79 ? 453  VAL B C   1 
ATOM   7870 O  O   . VAL B 1 453 ? 93.430  28.052 90.726  1.00 50.36 ? 453  VAL B O   1 
ATOM   7871 C  CB  . VAL B 1 453 ? 94.646  29.989 92.603  1.00 47.97 ? 453  VAL B CB  1 
ATOM   7872 C  CG1 . VAL B 1 453 ? 93.925  29.708 93.910  1.00 48.58 ? 453  VAL B CG1 1 
ATOM   7873 C  CG2 . VAL B 1 453 ? 95.668  31.133 92.752  1.00 46.45 ? 453  VAL B CG2 1 
ATOM   7874 N  N   . LYS B 1 454 ? 94.219  26.539 92.176  1.00 54.10 ? 454  LYS B N   1 
ATOM   7875 C  CA  . LYS B 1 454 ? 93.254  25.524 91.754  1.00 56.46 ? 454  LYS B CA  1 
ATOM   7876 C  C   . LYS B 1 454 ? 91.779  25.961 91.883  1.00 56.76 ? 454  LYS B C   1 
ATOM   7877 O  O   . LYS B 1 454 ? 90.976  25.681 90.990  1.00 56.71 ? 454  LYS B O   1 
ATOM   7878 C  CB  . LYS B 1 454 ? 93.514  24.188 92.466  1.00 59.43 ? 454  LYS B CB  1 
ATOM   7879 C  CG  . LYS B 1 454 ? 94.964  23.665 92.350  1.00 61.09 ? 454  LYS B CG  1 
ATOM   7880 C  CD  . LYS B 1 454 ? 95.470  23.573 90.898  1.00 61.75 ? 454  LYS B CD  1 
ATOM   7881 N  N   . GLU B 1 455 ? 91.429  26.658 92.964  1.00 57.18 ? 455  GLU B N   1 
ATOM   7882 C  CA  . GLU B 1 455 ? 90.026  27.080 93.175  1.00 58.49 ? 455  GLU B CA  1 
ATOM   7883 C  C   . GLU B 1 455 ? 89.457  28.077 92.147  1.00 56.27 ? 455  GLU B C   1 
ATOM   7884 O  O   . GLU B 1 455 ? 88.244  28.273 92.092  1.00 57.24 ? 455  GLU B O   1 
ATOM   7885 C  CB  . GLU B 1 455 ? 89.739  27.548 94.627  1.00 59.90 ? 455  GLU B CB  1 
ATOM   7886 C  CG  . GLU B 1 455 ? 90.892  28.219 95.380  1.00 61.22 ? 455  GLU B CG  1 
ATOM   7887 C  CD  . GLU B 1 455 ? 91.854  27.219 96.032  1.00 65.95 ? 455  GLU B CD  1 
ATOM   7888 O  OE1 . GLU B 1 455 ? 91.388  26.216 96.630  1.00 69.66 ? 455  GLU B OE1 1 
ATOM   7889 O  OE2 . GLU B 1 455 ? 93.082  27.447 95.965  1.00 65.49 ? 455  GLU B OE2 1 
ATOM   7890 N  N   . LEU B 1 456 ? 90.309  28.676 91.313  1.00 53.58 ? 456  LEU B N   1 
ATOM   7891 C  CA  . LEU B 1 456 ? 89.819  29.625 90.318  1.00 51.37 ? 456  LEU B CA  1 
ATOM   7892 C  C   . LEU B 1 456 ? 89.411  28.939 89.027  1.00 51.60 ? 456  LEU B C   1 
ATOM   7893 O  O   . LEU B 1 456 ? 88.856  29.574 88.123  1.00 51.16 ? 456  LEU B O   1 
ATOM   7894 C  CB  . LEU B 1 456 ? 90.823  30.734 90.063  1.00 48.56 ? 456  LEU B CB  1 
ATOM   7895 C  CG  . LEU B 1 456 ? 91.261  31.529 91.296  1.00 48.45 ? 456  LEU B CG  1 
ATOM   7896 C  CD1 . LEU B 1 456 ? 92.139  32.761 90.886  1.00 43.47 ? 456  LEU B CD1 1 
ATOM   7897 C  CD2 . LEU B 1 456 ? 90.052  31.966 92.128  1.00 48.58 ? 456  LEU B CD2 1 
ATOM   7898 N  N   . ASN B 1 457 ? 89.700  27.645 88.949  1.00 52.50 ? 457  ASN B N   1 
ATOM   7899 C  CA  . ASN B 1 457 ? 89.196  26.767 87.880  1.00 53.29 ? 457  ASN B CA  1 
ATOM   7900 C  C   . ASN B 1 457 ? 89.681  27.032 86.456  1.00 51.31 ? 457  ASN B C   1 
ATOM   7901 O  O   . ASN B 1 457 ? 88.927  26.812 85.502  1.00 52.53 ? 457  ASN B O   1 
ATOM   7902 C  CB  . ASN B 1 457 ? 87.650  26.666 87.905  1.00 54.41 ? 457  ASN B CB  1 
ATOM   7903 C  CG  . ASN B 1 457 ? 87.133  25.709 88.976  1.00 57.56 ? 457  ASN B CG  1 
ATOM   7904 O  OD1 . ASN B 1 457 ? 85.924  25.606 89.188  1.00 61.17 ? 457  ASN B OD1 1 
ATOM   7905 N  ND2 . ASN B 1 457 ? 88.042  25.009 89.656  1.00 56.69 ? 457  ASN B ND2 1 
ATOM   7906 N  N   . TYR B 1 458 ? 90.915  27.503 86.306  1.00 48.62 ? 458  TYR B N   1 
ATOM   7907 C  CA  . TYR B 1 458 ? 91.534  27.584 84.993  1.00 46.50 ? 458  TYR B CA  1 
ATOM   7908 C  C   . TYR B 1 458 ? 91.966  26.179 84.572  1.00 47.59 ? 458  TYR B C   1 
ATOM   7909 O  O   . TYR B 1 458 ? 92.008  25.271 85.411  1.00 49.41 ? 458  TYR B O   1 
ATOM   7910 C  CB  . TYR B 1 458 ? 92.761  28.480 85.052  1.00 44.72 ? 458  TYR B CB  1 
ATOM   7911 C  CG  . TYR B 1 458 ? 92.503  29.951 85.313  1.00 43.42 ? 458  TYR B CG  1 
ATOM   7912 C  CD1 . TYR B 1 458 ? 92.418  30.453 86.613  1.00 43.39 ? 458  TYR B CD1 1 
ATOM   7913 C  CD2 . TYR B 1 458 ? 92.403  30.848 84.255  1.00 41.75 ? 458  TYR B CD2 1 
ATOM   7914 C  CE1 . TYR B 1 458 ? 92.209  31.826 86.837  1.00 43.98 ? 458  TYR B CE1 1 
ATOM   7915 C  CE2 . TYR B 1 458 ? 92.203  32.208 84.464  1.00 41.09 ? 458  TYR B CE2 1 
ATOM   7916 C  CZ  . TYR B 1 458 ? 92.107  32.691 85.751  1.00 42.49 ? 458  TYR B CZ  1 
ATOM   7917 O  OH  . TYR B 1 458 ? 91.912  34.048 85.938  1.00 43.79 ? 458  TYR B OH  1 
ATOM   7918 N  N   . THR B 1 459 ? 92.287  25.983 83.294  1.00 46.15 ? 459  THR B N   1 
ATOM   7919 C  CA  . THR B 1 459 ? 92.785  24.668 82.863  1.00 47.23 ? 459  THR B CA  1 
ATOM   7920 C  C   . THR B 1 459 ? 94.268  24.482 83.165  1.00 46.87 ? 459  THR B C   1 
ATOM   7921 O  O   . THR B 1 459 ? 94.991  25.458 83.467  1.00 45.07 ? 459  THR B O   1 
ATOM   7922 C  CB  . THR B 1 459 ? 92.585  24.396 81.353  1.00 47.54 ? 459  THR B CB  1 
ATOM   7923 O  OG1 . THR B 1 459 ? 93.167  25.463 80.574  1.00 44.14 ? 459  THR B OG1 1 
ATOM   7924 C  CG2 . THR B 1 459 ? 91.101  24.195 81.004  1.00 47.20 ? 459  THR B CG2 1 
ATOM   7925 N  N   . ALA B 1 460 ? 94.719  23.233 83.042  1.00 47.49 ? 460  ALA B N   1 
ATOM   7926 C  CA  . ALA B 1 460 ? 96.131  22.906 83.129  1.00 47.30 ? 460  ALA B CA  1 
ATOM   7927 C  C   . ALA B 1 460 ? 96.909  23.580 82.019  1.00 45.45 ? 460  ALA B C   1 
ATOM   7928 O  O   . ALA B 1 460 ? 98.060  23.929 82.222  1.00 44.89 ? 460  ALA B O   1 
ATOM   7929 C  CB  . ALA B 1 460 ? 96.363  21.376 83.099  1.00 50.35 ? 460  ALA B CB  1 
ATOM   7930 N  N   . GLU B 1 461 ? 96.299  23.761 80.850  1.00 44.84 ? 461  GLU B N   1 
ATOM   7931 C  CA  . GLU B 1 461 ? 96.947  24.509 79.771  1.00 44.20 ? 461  GLU B CA  1 
ATOM   7932 C  C   . GLU B 1 461 ? 97.086  25.998 80.147  1.00 42.02 ? 461  GLU B C   1 
ATOM   7933 O  O   . GLU B 1 461 ? 98.052  26.686 79.750  1.00 40.77 ? 461  GLU B O   1 
ATOM   7934 C  CB  . GLU B 1 461 ? 96.155  24.393 78.464  1.00 44.93 ? 461  GLU B CB  1 
ATOM   7935 C  CG  . GLU B 1 461 ? 96.078  22.983 77.879  1.00 50.93 ? 461  GLU B CG  1 
ATOM   7936 C  CD  . GLU B 1 461 ? 95.000  22.127 78.548  1.00 57.76 ? 461  GLU B CD  1 
ATOM   7937 O  OE1 . GLU B 1 461 ? 94.999  21.970 79.793  1.00 58.41 ? 461  GLU B OE1 1 
ATOM   7938 O  OE2 . GLU B 1 461 ? 94.143  21.590 77.816  1.00 62.65 ? 461  GLU B OE2 1 
ATOM   7939 N  N   . GLU B 1 462 ? 96.119  26.492 80.914  1.00 40.91 ? 462  GLU B N   1 
ATOM   7940 C  CA  . GLU B 1 462 ? 96.118  27.888 81.302  1.00 39.04 ? 462  GLU B CA  1 
ATOM   7941 C  C   . GLU B 1 462 ? 97.161  28.120 82.400  1.00 38.55 ? 462  GLU B C   1 
ATOM   7942 O  O   . GLU B 1 462 ? 97.805  29.171 82.449  1.00 36.07 ? 462  GLU B O   1 
ATOM   7943 C  CB  . GLU B 1 462 ? 94.702  28.333 81.688  1.00 38.53 ? 462  GLU B CB  1 
ATOM   7944 C  CG  . GLU B 1 462 ? 93.865  28.651 80.466  1.00 36.02 ? 462  GLU B CG  1 
ATOM   7945 C  CD  . GLU B 1 462 ? 92.382  28.792 80.761  1.00 38.29 ? 462  GLU B CD  1 
ATOM   7946 O  OE1 . GLU B 1 462 ? 91.890  28.081 81.659  1.00 39.66 ? 462  GLU B OE1 1 
ATOM   7947 O  OE2 . GLU B 1 462 ? 91.692  29.579 80.057  1.00 37.70 ? 462  GLU B OE2 1 
ATOM   7948 N  N   . GLU B 1 463 ? 97.354  27.096 83.234  1.00 40.24 ? 463  GLU B N   1 
ATOM   7949 C  CA  . GLU B 1 463 ? 98.411  27.138 84.239  1.00 40.58 ? 463  GLU B CA  1 
ATOM   7950 C  C   . GLU B 1 463 ? 99.770  27.135 83.572  1.00 39.32 ? 463  GLU B C   1 
ATOM   7951 O  O   . GLU B 1 463 ? 100.623 27.975 83.891  1.00 38.96 ? 463  GLU B O   1 
ATOM   7952 C  CB  . GLU B 1 463 ? 98.303  26.009 85.260  1.00 43.22 ? 463  GLU B CB  1 
ATOM   7953 C  CG  . GLU B 1 463 ? 99.393  26.107 86.291  1.00 46.24 ? 463  GLU B CG  1 
ATOM   7954 C  CD  . GLU B 1 463 ? 99.372  25.028 87.337  1.00 51.38 ? 463  GLU B CD  1 
ATOM   7955 O  OE1 . GLU B 1 463 ? 98.351  24.309 87.494  1.00 56.71 ? 463  GLU B OE1 1 
ATOM   7956 O  OE2 . GLU B 1 463 ? 100.404 24.915 88.027  1.00 53.85 ? 463  GLU B OE2 1 
ATOM   7957 N  N   . ALA B 1 464 ? 99.967  26.231 82.626  1.00 39.08 ? 464  ALA B N   1 
ATOM   7958 C  CA  . ALA B 1 464 ? 101.233 26.172 81.910  1.00 38.75 ? 464  ALA B CA  1 
ATOM   7959 C  C   . ALA B 1 464 ? 101.499 27.532 81.235  1.00 36.54 ? 464  ALA B C   1 
ATOM   7960 O  O   . ALA B 1 464 ? 102.570 28.110 81.422  1.00 36.47 ? 464  ALA B O   1 
ATOM   7961 C  CB  . ALA B 1 464 ? 101.264 24.990 80.892  1.00 39.57 ? 464  ALA B CB  1 
ATOM   7962 N  N   . LEU B 1 465 ? 100.513 28.066 80.510  1.00 34.65 ? 465  LEU B N   1 
ATOM   7963 C  CA  . LEU B 1 465 ? 100.665 29.370 79.895  1.00 32.42 ? 465  LEU B CA  1 
ATOM   7964 C  C   . LEU B 1 465 ? 101.049 30.460 80.913  1.00 31.47 ? 465  LEU B C   1 
ATOM   7965 O  O   . LEU B 1 465 ? 101.946 31.266 80.670  1.00 29.52 ? 465  LEU B O   1 
ATOM   7966 C  CB  . LEU B 1 465 ? 99.407  29.765 79.073  1.00 31.41 ? 465  LEU B CB  1 
ATOM   7967 C  CG  . LEU B 1 465 ? 99.435  31.169 78.480  1.00 26.65 ? 465  LEU B CG  1 
ATOM   7968 C  CD1 . LEU B 1 465 ? 100.633 31.300 77.528  1.00 25.16 ? 465  LEU B CD1 1 
ATOM   7969 C  CD2 . LEU B 1 465 ? 98.135  31.552 77.786  1.00 22.57 ? 465  LEU B CD2 1 
ATOM   7970 N  N   . SER B 1 466 ? 100.387 30.485 82.056  1.00 32.46 ? 466  SER B N   1 
ATOM   7971 C  CA  . SER B 1 466 ? 100.689 31.552 83.018  1.00 32.10 ? 466  SER B CA  1 
ATOM   7972 C  C   . SER B 1 466 ? 102.127 31.430 83.539  1.00 32.73 ? 466  SER B C   1 
ATOM   7973 O  O   . SER B 1 466 ? 102.826 32.447 83.712  1.00 30.92 ? 466  SER B O   1 
ATOM   7974 C  CB  . SER B 1 466 ? 99.683  31.553 84.167  1.00 33.17 ? 466  SER B CB  1 
ATOM   7975 O  OG  . SER B 1 466 ? 100.099 32.425 85.198  1.00 31.76 ? 466  SER B OG  1 
ATOM   7976 N  N   . ARG B 1 467 ? 102.571 30.183 83.751  1.00 34.52 ? 467  ARG B N   1 
ATOM   7977 C  CA  . ARG B 1 467 ? 103.934 29.908 84.234  1.00 35.49 ? 467  ARG B CA  1 
ATOM   7978 C  C   . ARG B 1 467 ? 104.967 30.398 83.248  1.00 35.19 ? 467  ARG B C   1 
ATOM   7979 O  O   . ARG B 1 467 ? 105.979 30.942 83.662  1.00 34.34 ? 467  ARG B O   1 
ATOM   7980 C  CB  . ARG B 1 467 ? 104.167 28.424 84.491  1.00 36.89 ? 467  ARG B CB  1 
ATOM   7981 C  CG  . ARG B 1 467 ? 103.471 27.952 85.727  1.00 39.18 ? 467  ARG B CG  1 
ATOM   7982 C  CD  . ARG B 1 467 ? 103.796 26.493 86.098  1.00 39.29 ? 467  ARG B CD  1 
ATOM   7983 N  NE  . ARG B 1 467 ? 103.120 26.132 87.343  1.00 37.75 ? 467  ARG B NE  1 
ATOM   7984 C  CZ  . ARG B 1 467 ? 103.584 26.402 88.561  1.00 40.17 ? 467  ARG B CZ  1 
ATOM   7985 N  NH1 . ARG B 1 467 ? 104.756 27.020 88.725  1.00 38.99 ? 467  ARG B NH1 1 
ATOM   7986 N  NH2 . ARG B 1 467 ? 102.882 26.033 89.631  1.00 42.26 ? 467  ARG B NH2 1 
ATOM   7987 N  N   . ARG B 1 468 ? 104.732 30.197 81.945  1.00 35.91 ? 468  ARG B N   1 
ATOM   7988 C  CA  . ARG B 1 468 ? 105.710 30.692 80.971  1.00 36.26 ? 468  ARG B CA  1 
ATOM   7989 C  C   . ARG B 1 468 ? 105.663 32.201 80.763  1.00 33.33 ? 468  ARG B C   1 
ATOM   7990 O  O   . ARG B 1 468 ? 106.691 32.804 80.520  1.00 32.50 ? 468  ARG B O   1 
ATOM   7991 C  CB  . ARG B 1 468 ? 105.736 29.924 79.645  1.00 37.81 ? 468  ARG B CB  1 
ATOM   7992 C  CG  . ARG B 1 468 ? 104.471 29.704 78.901  1.00 42.26 ? 468  ARG B CG  1 
ATOM   7993 C  CD  . ARG B 1 468 ? 104.799 28.852 77.601  1.00 47.65 ? 468  ARG B CD  1 
ATOM   7994 N  NE  . ARG B 1 468 ? 105.045 29.740 76.460  1.00 48.93 ? 468  ARG B NE  1 
ATOM   7995 C  CZ  . ARG B 1 468 ? 104.126 30.067 75.551  1.00 48.98 ? 468  ARG B CZ  1 
ATOM   7996 N  NH1 . ARG B 1 468 ? 102.909 29.527 75.626  1.00 50.16 ? 468  ARG B NH1 1 
ATOM   7997 N  NH2 . ARG B 1 468 ? 104.429 30.898 74.549  1.00 44.61 ? 468  ARG B NH2 1 
ATOM   7998 N  N   . ILE B 1 469 ? 104.486 32.797 80.901  1.00 32.24 ? 469  ILE B N   1 
ATOM   7999 C  CA  . ILE B 1 469 ? 104.360 34.270 80.867  1.00 30.78 ? 469  ILE B CA  1 
ATOM   8000 C  C   . ILE B 1 469 ? 105.128 34.893 82.045  1.00 30.82 ? 469  ILE B C   1 
ATOM   8001 O  O   . ILE B 1 469 ? 105.968 35.784 81.836  1.00 30.42 ? 469  ILE B O   1 
ATOM   8002 C  CB  . ILE B 1 469 ? 102.896 34.726 80.798  1.00 29.54 ? 469  ILE B CB  1 
ATOM   8003 C  CG1 . ILE B 1 469 ? 102.338 34.401 79.399  1.00 29.75 ? 469  ILE B CG1 1 
ATOM   8004 C  CG2 . ILE B 1 469 ? 102.779 36.224 81.112  1.00 27.61 ? 469  ILE B CG2 1 
ATOM   8005 C  CD1 . ILE B 1 469 ? 100.858 34.693 79.206  1.00 29.21 ? 469  ILE B CD1 1 
ATOM   8006 N  N   . MET B 1 470 ? 104.911 34.359 83.248  1.00 31.40 ? 470  MET B N   1 
ATOM   8007 C  CA  . MET B 1 470 ? 105.562 34.890 84.427  1.00 32.13 ? 470  MET B CA  1 
ATOM   8008 C  C   . MET B 1 470 ? 107.070 34.722 84.283  1.00 32.95 ? 470  MET B C   1 
ATOM   8009 O  O   . MET B 1 470 ? 107.824 35.624 84.640  1.00 33.14 ? 470  MET B O   1 
ATOM   8010 C  CB  . MET B 1 470 ? 105.076 34.191 85.702  1.00 32.99 ? 470  MET B CB  1 
ATOM   8011 C  CG  . MET B 1 470 ? 103.688 34.594 86.174  1.00 31.79 ? 470  MET B CG  1 
ATOM   8012 S  SD  . MET B 1 470 ? 103.387 34.009 87.861  1.00 37.23 ? 470  MET B SD  1 
ATOM   8013 C  CE  . MET B 1 470 ? 103.283 32.257 87.562  1.00 31.02 ? 470  MET B CE  1 
ATOM   8014 N  N   . HIS B 1 471 ? 107.493 33.577 83.739  1.00 33.02 ? 471  HIS B N   1 
ATOM   8015 C  CA  . HIS B 1 471 ? 108.920 33.306 83.560  1.00 33.28 ? 471  HIS B CA  1 
ATOM   8016 C  C   . HIS B 1 471 ? 109.537 34.160 82.461  1.00 31.96 ? 471  HIS B C   1 
ATOM   8017 O  O   . HIS B 1 471 ? 110.648 34.620 82.634  1.00 31.83 ? 471  HIS B O   1 
ATOM   8018 C  CB  . HIS B 1 471 ? 109.212 31.813 83.313  1.00 34.29 ? 471  HIS B CB  1 
ATOM   8019 C  CG  . HIS B 1 471 ? 110.647 31.434 83.536  1.00 37.31 ? 471  HIS B CG  1 
ATOM   8020 N  ND1 . HIS B 1 471 ? 111.309 31.673 84.725  1.00 38.68 ? 471  HIS B ND1 1 
ATOM   8021 C  CD2 . HIS B 1 471 ? 111.541 30.812 82.733  1.00 37.29 ? 471  HIS B CD2 1 
ATOM   8022 C  CE1 . HIS B 1 471 ? 112.543 31.212 84.644  1.00 37.82 ? 471  HIS B CE1 1 
ATOM   8023 N  NE2 . HIS B 1 471 ? 112.712 30.700 83.440  1.00 39.90 ? 471  HIS B NE2 1 
ATOM   8024 N  N   . TYR B 1 472 ? 108.850 34.339 81.329  1.00 30.15 ? 472  TYR B N   1 
ATOM   8025 C  CA  . TYR B 1 472 ? 109.254 35.383 80.385  1.00 29.77 ? 472  TYR B CA  1 
ATOM   8026 C  C   . TYR B 1 472 ? 109.405 36.778 81.034  1.00 28.72 ? 472  TYR B C   1 
ATOM   8027 O  O   . TYR B 1 472 ? 110.399 37.448 80.818  1.00 28.67 ? 472  TYR B O   1 
ATOM   8028 C  CB  . TYR B 1 472 ? 108.260 35.535 79.245  1.00 28.68 ? 472  TYR B CB  1 
ATOM   8029 C  CG  . TYR B 1 472 ? 108.205 34.419 78.221  1.00 31.90 ? 472  TYR B CG  1 
ATOM   8030 C  CD1 . TYR B 1 472 ? 109.351 33.695 77.856  1.00 32.87 ? 472  TYR B CD1 1 
ATOM   8031 C  CD2 . TYR B 1 472 ? 107.003 34.138 77.562  1.00 29.89 ? 472  TYR B CD2 1 
ATOM   8032 C  CE1 . TYR B 1 472 ? 109.272 32.686 76.885  1.00 36.32 ? 472  TYR B CE1 1 
ATOM   8033 C  CE2 . TYR B 1 472 ? 106.925 33.166 76.593  1.00 32.18 ? 472  TYR B CE2 1 
ATOM   8034 C  CZ  . TYR B 1 472 ? 108.045 32.446 76.255  1.00 36.03 ? 472  TYR B CZ  1 
ATOM   8035 O  OH  . TYR B 1 472 ? 107.923 31.469 75.291  1.00 41.68 ? 472  TYR B OH  1 
ATOM   8036 N  N   . TRP B 1 473 ? 108.398 37.221 81.783  1.00 27.92 ? 473  TRP B N   1 
ATOM   8037 C  CA  . TRP B 1 473 ? 108.396 38.582 82.296  1.00 27.20 ? 473  TRP B CA  1 
ATOM   8038 C  C   . TRP B 1 473 ? 109.562 38.760 83.287  1.00 28.61 ? 473  TRP B C   1 
ATOM   8039 O  O   . TRP B 1 473 ? 110.289 39.744 83.220  1.00 27.21 ? 473  TRP B O   1 
ATOM   8040 C  CB  . TRP B 1 473 ? 107.084 38.835 83.017  1.00 26.36 ? 473  TRP B CB  1 
ATOM   8041 C  CG  . TRP B 1 473 ? 106.013 39.556 82.242  1.00 24.39 ? 473  TRP B CG  1 
ATOM   8042 C  CD1 . TRP B 1 473 ? 105.281 40.607 82.700  1.00 22.72 ? 473  TRP B CD1 1 
ATOM   8043 C  CD2 . TRP B 1 473 ? 105.518 39.262 80.920  1.00 21.03 ? 473  TRP B CD2 1 
ATOM   8044 N  NE1 . TRP B 1 473 ? 104.389 41.025 81.733  1.00 24.71 ? 473  TRP B NE1 1 
ATOM   8045 C  CE2 . TRP B 1 473 ? 104.502 40.210 80.637  1.00 22.15 ? 473  TRP B CE2 1 
ATOM   8046 C  CE3 . TRP B 1 473 ? 105.860 38.326 79.937  1.00 20.40 ? 473  TRP B CE3 1 
ATOM   8047 C  CZ2 . TRP B 1 473 ? 103.794 40.231 79.415  1.00 20.73 ? 473  TRP B CZ2 1 
ATOM   8048 C  CZ3 . TRP B 1 473 ? 105.151 38.339 78.719  1.00 20.07 ? 473  TRP B CZ3 1 
ATOM   8049 C  CH2 . TRP B 1 473 ? 104.138 39.293 78.467  1.00 22.15 ? 473  TRP B CH2 1 
ATOM   8050 N  N   . ALA B 1 474 ? 109.728 37.787 84.186  1.00 29.77 ? 474  ALA B N   1 
ATOM   8051 C  CA  . ALA B 1 474 ? 110.739 37.875 85.242  1.00 31.38 ? 474  ALA B CA  1 
ATOM   8052 C  C   . ALA B 1 474 ? 112.136 37.685 84.691  1.00 32.13 ? 474  ALA B C   1 
ATOM   8053 O  O   . ALA B 1 474 ? 113.065 38.377 85.124  1.00 33.50 ? 474  ALA B O   1 
ATOM   8054 C  CB  . ALA B 1 474 ? 110.485 36.846 86.346  1.00 31.42 ? 474  ALA B CB  1 
ATOM   8055 N  N   . THR B 1 475 ? 112.285 36.746 83.755  1.00 31.70 ? 475  THR B N   1 
ATOM   8056 C  CA  . THR B 1 475 ? 113.570 36.492 83.130  1.00 31.99 ? 475  THR B CA  1 
ATOM   8057 C  C   . THR B 1 475 ? 113.986 37.719 82.360  1.00 31.22 ? 475  THR B C   1 
ATOM   8058 O  O   . THR B 1 475 ? 115.150 38.088 82.375  1.00 33.65 ? 475  THR B O   1 
ATOM   8059 C  CB  . THR B 1 475 ? 113.563 35.214 82.243  1.00 32.84 ? 475  THR B CB  1 
ATOM   8060 O  OG1 . THR B 1 475 ? 113.200 34.084 83.063  1.00 35.29 ? 475  THR B OG1 1 
ATOM   8061 C  CG2 . THR B 1 475 ? 114.952 34.971 81.568  1.00 32.42 ? 475  THR B CG2 1 
ATOM   8062 N  N   . PHE B 1 476 ? 113.036 38.367 81.715  1.00 29.67 ? 476  PHE B N   1 
ATOM   8063 C  CA  . PHE B 1 476 ? 113.287 39.646 81.047  1.00 29.20 ? 476  PHE B CA  1 
ATOM   8064 C  C   . PHE B 1 476 ? 113.662 40.717 82.076  1.00 28.98 ? 476  PHE B C   1 
ATOM   8065 O  O   . PHE B 1 476 ? 114.583 41.498 81.872  1.00 29.36 ? 476  PHE B O   1 
ATOM   8066 C  CB  . PHE B 1 476 ? 112.052 40.131 80.260  1.00 27.07 ? 476  PHE B CB  1 
ATOM   8067 C  CG  . PHE B 1 476 ? 112.195 41.539 79.764  1.00 25.74 ? 476  PHE B CG  1 
ATOM   8068 C  CD1 . PHE B 1 476 ? 112.842 41.800 78.568  1.00 24.81 ? 476  PHE B CD1 1 
ATOM   8069 C  CD2 . PHE B 1 476 ? 111.737 42.604 80.517  1.00 22.02 ? 476  PHE B CD2 1 
ATOM   8070 C  CE1 . PHE B 1 476 ? 113.015 43.117 78.131  1.00 25.76 ? 476  PHE B CE1 1 
ATOM   8071 C  CE2 . PHE B 1 476 ? 111.901 43.908 80.089  1.00 21.19 ? 476  PHE B CE2 1 
ATOM   8072 C  CZ  . PHE B 1 476 ? 112.534 44.171 78.889  1.00 19.70 ? 476  PHE B CZ  1 
ATOM   8073 N  N   . ALA B 1 477 ? 112.921 40.767 83.179  1.00 29.01 ? 477  ALA B N   1 
ATOM   8074 C  CA  . ALA B 1 477 ? 113.218 41.723 84.238  1.00 29.05 ? 477  ALA B CA  1 
ATOM   8075 C  C   . ALA B 1 477 ? 114.643 41.486 84.759  1.00 30.95 ? 477  ALA B C   1 
ATOM   8076 O  O   . ALA B 1 477 ? 115.396 42.430 84.939  1.00 30.49 ? 477  ALA B O   1 
ATOM   8077 C  CB  . ALA B 1 477 ? 112.189 41.609 85.358  1.00 28.25 ? 477  ALA B CB  1 
ATOM   8078 N  N   . LYS B 1 478 ? 115.033 40.214 84.942  1.00 33.20 ? 478  LYS B N   1 
ATOM   8079 C  CA  . LYS B 1 478 ? 116.363 39.898 85.498  1.00 35.01 ? 478  LYS B CA  1 
ATOM   8080 C  C   . LYS B 1 478 ? 117.512 40.251 84.534  1.00 34.76 ? 478  LYS B C   1 
ATOM   8081 O  O   . LYS B 1 478 ? 118.558 40.740 84.962  1.00 34.96 ? 478  LYS B O   1 
ATOM   8082 C  CB  . LYS B 1 478 ? 116.442 38.425 85.940  1.00 36.87 ? 478  LYS B CB  1 
ATOM   8083 C  CG  . LYS B 1 478 ? 115.639 38.085 87.245  1.00 41.67 ? 478  LYS B CG  1 
ATOM   8084 C  CD  . LYS B 1 478 ? 115.058 36.627 87.324  1.00 44.04 ? 478  LYS B CD  1 
ATOM   8085 C  CE  . LYS B 1 478 ? 114.621 36.268 88.776  1.00 46.97 ? 478  LYS B CE  1 
ATOM   8086 N  NZ  . LYS B 1 478 ? 115.642 35.460 89.612  1.00 51.99 ? 478  LYS B NZ  1 
ATOM   8087 N  N   . THR B 1 479 ? 117.300 40.028 83.239  1.00 33.91 ? 479  THR B N   1 
ATOM   8088 C  CA  . THR B 1 479 ? 118.414 39.977 82.282  1.00 34.37 ? 479  THR B CA  1 
ATOM   8089 C  C   . THR B 1 479 ? 118.284 40.856 81.038  1.00 33.91 ? 479  THR B C   1 
ATOM   8090 O  O   . THR B 1 479 ? 119.254 40.972 80.305  1.00 34.26 ? 479  THR B O   1 
ATOM   8091 C  CB  . THR B 1 479 ? 118.653 38.526 81.730  1.00 35.18 ? 479  THR B CB  1 
ATOM   8092 O  OG1 . THR B 1 479 ? 117.537 38.124 80.895  1.00 32.49 ? 479  THR B OG1 1 
ATOM   8093 C  CG2 . THR B 1 479 ? 118.884 37.526 82.866  1.00 35.18 ? 479  THR B CG2 1 
ATOM   8094 N  N   . GLY B 1 480 ? 117.087 41.387 80.763  1.00 32.45 ? 480  GLY B N   1 
ATOM   8095 C  CA  . GLY B 1 480 ? 116.800 42.118 79.509  1.00 31.86 ? 480  GLY B CA  1 
ATOM   8096 C  C   . GLY B 1 480 ? 116.419 41.230 78.319  1.00 32.94 ? 480  GLY B C   1 
ATOM   8097 O  O   . GLY B 1 480 ? 116.384 41.675 77.172  1.00 32.56 ? 480  GLY B O   1 
ATOM   8098 N  N   . ASN B 1 481 ? 116.105 39.971 78.594  1.00 33.78 ? 481  ASN B N   1 
ATOM   8099 C  CA  . ASN B 1 481 ? 115.829 38.979 77.569  1.00 33.72 ? 481  ASN B CA  1 
ATOM   8100 C  C   . ASN B 1 481 ? 114.911 37.945 78.213  1.00 34.21 ? 481  ASN B C   1 
ATOM   8101 O  O   . ASN B 1 481 ? 115.237 37.391 79.272  1.00 34.60 ? 481  ASN B O   1 
ATOM   8102 C  CB  . ASN B 1 481 ? 117.155 38.355 77.125  1.00 35.60 ? 481  ASN B CB  1 
ATOM   8103 C  CG  . ASN B 1 481 ? 117.015 37.359 75.973  1.00 35.81 ? 481  ASN B CG  1 
ATOM   8104 O  OD1 . ASN B 1 481 ? 115.929 36.837 75.684  1.00 36.45 ? 481  ASN B OD1 1 
ATOM   8105 N  ND2 . ASN B 1 481 ? 118.140 37.070 75.326  1.00 33.94 ? 481  ASN B ND2 1 
ATOM   8106 N  N   . PRO B 1 482 ? 113.725 37.730 77.618  1.00 34.21 ? 482  PRO B N   1 
ATOM   8107 C  CA  . PRO B 1 482 ? 112.738 36.836 78.240  1.00 34.72 ? 482  PRO B CA  1 
ATOM   8108 C  C   . PRO B 1 482 ? 113.149 35.375 78.155  1.00 37.37 ? 482  PRO B C   1 
ATOM   8109 O  O   . PRO B 1 482 ? 112.586 34.530 78.874  1.00 37.89 ? 482  PRO B O   1 
ATOM   8110 C  CB  . PRO B 1 482 ? 111.472 37.075 77.404  1.00 33.57 ? 482  PRO B CB  1 
ATOM   8111 C  CG  . PRO B 1 482 ? 111.980 37.545 76.058  1.00 34.33 ? 482  PRO B CG  1 
ATOM   8112 C  CD  . PRO B 1 482 ? 113.188 38.401 76.414  1.00 33.06 ? 482  PRO B CD  1 
ATOM   8113 N  N   . ASN B 1 483 ? 114.125 35.092 77.292  1.00 39.52 ? 483  ASN B N   1 
ATOM   8114 C  CA  . ASN B 1 483 ? 114.640 33.732 77.066  1.00 43.32 ? 483  ASN B CA  1 
ATOM   8115 C  C   . ASN B 1 483 ? 115.752 33.389 78.052  1.00 46.56 ? 483  ASN B C   1 
ATOM   8116 O  O   . ASN B 1 483 ? 116.625 34.219 78.314  1.00 46.62 ? 483  ASN B O   1 
ATOM   8117 C  CB  . ASN B 1 483 ? 115.187 33.607 75.638  1.00 42.27 ? 483  ASN B CB  1 
ATOM   8118 C  CG  . ASN B 1 483 ? 114.119 33.884 74.572  1.00 41.70 ? 483  ASN B CG  1 
ATOM   8119 O  OD1 . ASN B 1 483 ? 113.182 33.101 74.406  1.00 42.54 ? 483  ASN B OD1 1 
ATOM   8120 N  ND2 . ASN B 1 483 ? 114.272 34.979 73.838  1.00 32.75 ? 483  ASN B ND2 1 
ATOM   8121 N  N   . GLU B 1 484 ? 115.709 32.193 78.624  1.00 50.57 ? 484  GLU B N   1 
ATOM   8122 C  CA  . GLU B 1 484 ? 116.871 31.686 79.355  1.00 55.58 ? 484  GLU B CA  1 
ATOM   8123 C  C   . GLU B 1 484 ? 117.855 31.113 78.340  1.00 58.81 ? 484  GLU B C   1 
ATOM   8124 O  O   . GLU B 1 484 ? 117.538 30.136 77.676  1.00 59.19 ? 484  GLU B O   1 
ATOM   8125 C  CB  . GLU B 1 484 ? 116.468 30.608 80.357  1.00 56.83 ? 484  GLU B CB  1 
ATOM   8126 C  CG  . GLU B 1 484 ? 115.928 31.148 81.669  1.00 58.10 ? 484  GLU B CG  1 
ATOM   8127 C  CD  . GLU B 1 484 ? 115.714 30.048 82.696  1.00 63.45 ? 484  GLU B CD  1 
ATOM   8128 O  OE1 . GLU B 1 484 ? 114.922 29.112 82.437  1.00 64.29 ? 484  GLU B OE1 1 
ATOM   8129 O  OE2 . GLU B 1 484 ? 116.340 30.120 83.775  1.00 68.56 ? 484  GLU B OE2 1 
ATOM   8130 N  N   . PRO B 1 485 ? 119.044 31.733 78.199  1.00 61.72 ? 485  PRO B N   1 
ATOM   8131 C  CA  . PRO B 1 485 ? 120.005 31.191 77.226  1.00 64.94 ? 485  PRO B CA  1 
ATOM   8132 C  C   . PRO B 1 485 ? 120.356 29.758 77.623  1.00 68.12 ? 485  PRO B C   1 
ATOM   8133 O  O   . PRO B 1 485 ? 120.135 29.366 78.782  1.00 68.34 ? 485  PRO B O   1 
ATOM   8134 C  CB  . PRO B 1 485 ? 121.237 32.096 77.396  1.00 65.30 ? 485  PRO B CB  1 
ATOM   8135 C  CG  . PRO B 1 485 ? 121.148 32.573 78.861  1.00 64.29 ? 485  PRO B CG  1 
ATOM   8136 C  CD  . PRO B 1 485 ? 119.651 32.762 79.074  1.00 61.45 ? 485  PRO B CD  1 
ATOM   8137 N  N   . HIS B 1 486 ? 120.882 28.990 76.674  1.00 71.03 ? 486  HIS B N   1 
ATOM   8138 C  CA  . HIS B 1 486 ? 121.303 27.604 76.927  1.00 74.71 ? 486  HIS B CA  1 
ATOM   8139 C  C   . HIS B 1 486 ? 120.124 26.637 77.145  1.00 74.72 ? 486  HIS B C   1 
ATOM   8140 O  O   . HIS B 1 486 ? 120.329 25.422 77.169  1.00 77.03 ? 486  HIS B O   1 
ATOM   8141 C  CB  . HIS B 1 486 ? 122.309 27.504 78.102  1.00 76.25 ? 486  HIS B CB  1 
ATOM   8142 C  CG  . HIS B 1 486 ? 123.659 28.101 77.814  1.00 79.87 ? 486  HIS B CG  1 
ATOM   8143 N  ND1 . HIS B 1 486 ? 124.245 29.048 78.632  1.00 81.18 ? 486  HIS B ND1 1 
ATOM   8144 C  CD2 . HIS B 1 486 ? 124.545 27.873 76.812  1.00 83.87 ? 486  HIS B CD2 1 
ATOM   8145 C  CE1 . HIS B 1 486 ? 125.427 29.382 78.142  1.00 83.20 ? 486  HIS B CE1 1 
ATOM   8146 N  NE2 . HIS B 1 486 ? 125.633 28.685 77.037  1.00 84.50 ? 486  HIS B NE2 1 
ATOM   8147 N  N   . SER B 1 487 ? 118.904 27.162 77.297  1.00 72.61 ? 487  SER B N   1 
ATOM   8148 C  CA  . SER B 1 487 ? 117.721 26.306 77.437  1.00 72.62 ? 487  SER B CA  1 
ATOM   8149 C  C   . SER B 1 487 ? 117.258 25.798 76.081  1.00 72.88 ? 487  SER B C   1 
ATOM   8150 O  O   . SER B 1 487 ? 117.384 26.501 75.074  1.00 72.35 ? 487  SER B O   1 
ATOM   8151 C  CB  . SER B 1 487 ? 116.571 27.060 78.075  1.00 70.81 ? 487  SER B CB  1 
ATOM   8152 O  OG  . SER B 1 487 ? 115.809 27.722 77.074  1.00 69.88 ? 487  SER B OG  1 
ATOM   8153 N  N   . GLN B 1 488 ? 116.684 24.599 76.066  1.00 73.45 ? 488  GLN B N   1 
ATOM   8154 C  CA  . GLN B 1 488 ? 116.229 23.984 74.814  1.00 73.52 ? 488  GLN B CA  1 
ATOM   8155 C  C   . GLN B 1 488 ? 114.859 24.496 74.291  1.00 70.82 ? 488  GLN B C   1 
ATOM   8156 O  O   . GLN B 1 488 ? 114.401 24.067 73.236  1.00 71.16 ? 488  GLN B O   1 
ATOM   8157 C  CB  . GLN B 1 488 ? 116.269 22.439 74.922  1.00 76.44 ? 488  GLN B CB  1 
ATOM   8158 C  CG  . GLN B 1 488 ? 117.681 21.851 75.157  1.00 78.94 ? 488  GLN B CG  1 
ATOM   8159 C  CD  . GLN B 1 488 ? 117.784 20.341 74.885  1.00 83.57 ? 488  GLN B CD  1 
ATOM   8160 O  OE1 . GLN B 1 488 ? 117.392 19.857 73.821  1.00 84.89 ? 488  GLN B OE1 1 
ATOM   8161 N  NE2 . GLN B 1 488 ? 118.340 19.599 75.844  1.00 85.18 ? 488  GLN B NE2 1 
ATOM   8162 N  N   . GLU B 1 489 ? 114.228 25.424 75.010  1.00 67.65 ? 489  GLU B N   1 
ATOM   8163 C  CA  . GLU B 1 489 ? 112.857 25.874 74.691  1.00 65.28 ? 489  GLU B CA  1 
ATOM   8164 C  C   . GLU B 1 489 ? 112.743 26.664 73.388  1.00 62.86 ? 489  GLU B C   1 
ATOM   8165 O  O   . GLU B 1 489 ? 113.747 27.189 72.897  1.00 63.07 ? 489  GLU B O   1 
ATOM   8166 C  CB  . GLU B 1 489 ? 112.280 26.729 75.835  1.00 63.82 ? 489  GLU B CB  1 
ATOM   8167 C  CG  . GLU B 1 489 ? 112.541 26.185 77.252  1.00 67.49 ? 489  GLU B CG  1 
ATOM   8168 C  CD  . GLU B 1 489 ? 112.171 24.711 77.400  1.00 72.77 ? 489  GLU B CD  1 
ATOM   8169 O  OE1 . GLU B 1 489 ? 111.055 24.339 76.950  1.00 74.94 ? 489  GLU B OE1 1 
ATOM   8170 O  OE2 . GLU B 1 489 ? 112.994 23.932 77.952  1.00 74.78 ? 489  GLU B OE2 1 
ATOM   8171 N  N   . SER B 1 490 ? 111.522 26.746 72.842  1.00 60.04 ? 490  SER B N   1 
ATOM   8172 C  CA  . SER B 1 490 ? 111.215 27.654 71.723  1.00 57.07 ? 490  SER B CA  1 
ATOM   8173 C  C   . SER B 1 490 ? 111.682 29.072 72.077  1.00 53.42 ? 490  SER B C   1 
ATOM   8174 O  O   . SER B 1 490 ? 111.439 29.516 73.189  1.00 52.20 ? 490  SER B O   1 
ATOM   8175 C  CB  . SER B 1 490 ? 109.708 27.689 71.462  1.00 56.28 ? 490  SER B CB  1 
ATOM   8176 O  OG  . SER B 1 490 ? 109.226 26.408 71.114  1.00 58.64 ? 490  SER B OG  1 
ATOM   8177 N  N   . LYS B 1 491 ? 112.335 29.764 71.141  1.00 51.02 ? 491  LYS B N   1 
ATOM   8178 C  CA  . LYS B 1 491 ? 112.922 31.092 71.411  1.00 48.27 ? 491  LYS B CA  1 
ATOM   8179 C  C   . LYS B 1 491 ? 112.094 32.275 70.883  1.00 45.29 ? 491  LYS B C   1 
ATOM   8180 O  O   . LYS B 1 491 ? 111.751 32.337 69.699  1.00 46.08 ? 491  LYS B O   1 
ATOM   8181 C  CB  . LYS B 1 491 ? 114.375 31.210 70.910  1.00 49.18 ? 491  LYS B CB  1 
ATOM   8182 C  CG  . LYS B 1 491 ? 115.403 30.226 71.518  1.00 51.70 ? 491  LYS B CG  1 
ATOM   8183 C  CD  . LYS B 1 491 ? 115.534 30.326 73.040  1.00 53.30 ? 491  LYS B CD  1 
ATOM   8184 C  CE  . LYS B 1 491 ? 116.950 29.963 73.544  1.00 55.53 ? 491  LYS B CE  1 
ATOM   8185 N  NZ  . LYS B 1 491 ? 117.275 28.506 73.484  1.00 60.28 ? 491  LYS B NZ  1 
ATOM   8186 N  N   . TRP B 1 492 ? 111.763 33.181 71.792  1.00 41.58 ? 492  TRP B N   1 
ATOM   8187 C  CA  . TRP B 1 492 ? 111.131 34.470 71.497  1.00 38.33 ? 492  TRP B CA  1 
ATOM   8188 C  C   . TRP B 1 492 ? 112.210 35.378 70.898  1.00 38.15 ? 492  TRP B C   1 
ATOM   8189 O  O   . TRP B 1 492 ? 113.105 35.817 71.630  1.00 37.64 ? 492  TRP B O   1 
ATOM   8190 C  CB  . TRP B 1 492 ? 110.607 35.074 72.801  1.00 35.69 ? 492  TRP B CB  1 
ATOM   8191 C  CG  . TRP B 1 492 ? 109.757 36.341 72.659  1.00 33.36 ? 492  TRP B CG  1 
ATOM   8192 C  CD1 . TRP B 1 492 ? 109.716 37.203 71.589  1.00 29.85 ? 492  TRP B CD1 1 
ATOM   8193 C  CD2 . TRP B 1 492 ? 108.886 36.901 73.651  1.00 30.03 ? 492  TRP B CD2 1 
ATOM   8194 N  NE1 . TRP B 1 492 ? 108.865 38.230 71.844  1.00 27.55 ? 492  TRP B NE1 1 
ATOM   8195 C  CE2 . TRP B 1 492 ? 108.340 38.080 73.104  1.00 27.65 ? 492  TRP B CE2 1 
ATOM   8196 C  CE3 . TRP B 1 492 ? 108.490 36.502 74.943  1.00 30.30 ? 492  TRP B CE3 1 
ATOM   8197 C  CZ2 . TRP B 1 492 ? 107.383 38.853 73.784  1.00 21.77 ? 492  TRP B CZ2 1 
ATOM   8198 C  CZ3 . TRP B 1 492 ? 107.575 37.290 75.637  1.00 26.45 ? 492  TRP B CZ3 1 
ATOM   8199 C  CH2 . TRP B 1 492 ? 107.031 38.460 75.044  1.00 24.82 ? 492  TRP B CH2 1 
ATOM   8200 N  N   . PRO B 1 493 ? 112.153 35.639 69.564  1.00 38.00 ? 493  PRO B N   1 
ATOM   8201 C  CA  . PRO B 1 493 ? 113.238 36.407 68.923  1.00 38.06 ? 493  PRO B CA  1 
ATOM   8202 C  C   . PRO B 1 493 ? 113.069 37.899 69.158  1.00 36.37 ? 493  PRO B C   1 
ATOM   8203 O  O   . PRO B 1 493 ? 111.945 38.370 69.324  1.00 34.91 ? 493  PRO B O   1 
ATOM   8204 C  CB  . PRO B 1 493 ? 113.070 36.093 67.432  1.00 38.09 ? 493  PRO B CB  1 
ATOM   8205 C  CG  . PRO B 1 493 ? 111.587 35.831 67.270  1.00 38.29 ? 493  PRO B CG  1 
ATOM   8206 C  CD  . PRO B 1 493 ? 111.101 35.248 68.595  1.00 38.12 ? 493  PRO B CD  1 
ATOM   8207 N  N   . LEU B 1 494 ? 114.187 38.618 69.191  1.00 36.32 ? 494  LEU B N   1 
ATOM   8208 C  CA  . LEU B 1 494 ? 114.195 40.086 69.150  1.00 35.18 ? 494  LEU B CA  1 
ATOM   8209 C  C   . LEU B 1 494 ? 113.322 40.652 68.040  1.00 34.09 ? 494  LEU B C   1 
ATOM   8210 O  O   . LEU B 1 494 ? 113.364 40.186 66.909  1.00 34.49 ? 494  LEU B O   1 
ATOM   8211 C  CB  . LEU B 1 494 ? 115.628 40.585 68.893  1.00 35.59 ? 494  LEU B CB  1 
ATOM   8212 C  CG  . LEU B 1 494 ? 116.496 40.722 70.135  1.00 37.60 ? 494  LEU B CG  1 
ATOM   8213 C  CD1 . LEU B 1 494 ? 118.027 40.612 69.869  1.00 36.32 ? 494  LEU B CD1 1 
ATOM   8214 C  CD2 . LEU B 1 494 ? 116.142 42.006 70.885  1.00 36.32 ? 494  LEU B CD2 1 
ATOM   8215 N  N   . PHE B 1 495 ? 112.573 41.698 68.343  1.00 33.48 ? 495  PHE B N   1 
ATOM   8216 C  CA  . PHE B 1 495 ? 111.939 42.475 67.286  1.00 33.19 ? 495  PHE B CA  1 
ATOM   8217 C  C   . PHE B 1 495 ? 112.996 43.424 66.662  1.00 34.79 ? 495  PHE B C   1 
ATOM   8218 O  O   . PHE B 1 495 ? 113.691 44.139 67.385  1.00 34.68 ? 495  PHE B O   1 
ATOM   8219 C  CB  . PHE B 1 495 ? 110.748 43.230 67.880  1.00 31.35 ? 495  PHE B CB  1 
ATOM   8220 C  CG  . PHE B 1 495 ? 110.126 44.217 66.943  1.00 29.33 ? 495  PHE B CG  1 
ATOM   8221 C  CD1 . PHE B 1 495 ? 110.748 45.453 66.696  1.00 27.36 ? 495  PHE B CD1 1 
ATOM   8222 C  CD2 . PHE B 1 495 ? 108.930 43.910 66.303  1.00 26.68 ? 495  PHE B CD2 1 
ATOM   8223 C  CE1 . PHE B 1 495 ? 110.187 46.370 65.827  1.00 28.52 ? 495  PHE B CE1 1 
ATOM   8224 C  CE2 . PHE B 1 495 ? 108.343 44.819 65.429  1.00 29.66 ? 495  PHE B CE2 1 
ATOM   8225 C  CZ  . PHE B 1 495 ? 108.968 46.056 65.192  1.00 30.69 ? 495  PHE B CZ  1 
ATOM   8226 N  N   . THR B 1 496 ? 113.150 43.405 65.336  1.00 36.72 ? 496  THR B N   1 
ATOM   8227 C  CA  . THR B 1 496 ? 114.152 44.248 64.668  1.00 38.67 ? 496  THR B CA  1 
ATOM   8228 C  C   . THR B 1 496 ? 113.494 45.199 63.672  1.00 39.79 ? 496  THR B C   1 
ATOM   8229 O  O   . THR B 1 496 ? 112.458 44.914 63.110  1.00 39.65 ? 496  THR B O   1 
ATOM   8230 C  CB  . THR B 1 496 ? 115.208 43.398 63.906  1.00 40.84 ? 496  THR B CB  1 
ATOM   8231 O  OG1 . THR B 1 496 ? 114.556 42.609 62.899  1.00 42.06 ? 496  THR B OG1 1 
ATOM   8232 C  CG2 . THR B 1 496 ? 116.012 42.456 64.863  1.00 40.32 ? 496  THR B CG2 1 
ATOM   8233 N  N   . THR B 1 497 ? 114.096 46.342 63.424  1.00 42.04 ? 497  THR B N   1 
ATOM   8234 C  CA  . THR B 1 497 ? 113.565 47.225 62.394  1.00 42.95 ? 497  THR B CA  1 
ATOM   8235 C  C   . THR B 1 497 ? 113.245 46.486 61.082  1.00 44.31 ? 497  THR B C   1 
ATOM   8236 O  O   . THR B 1 497 ? 112.178 46.708 60.473  1.00 44.08 ? 497  THR B O   1 
ATOM   8237 C  CB  . THR B 1 497 ? 114.542 48.394 62.161  1.00 44.82 ? 497  THR B CB  1 
ATOM   8238 O  OG1 . THR B 1 497 ? 114.442 49.280 63.284  1.00 44.24 ? 497  THR B OG1 1 
ATOM   8239 C  CG2 . THR B 1 497 ? 114.227 49.175 60.858  1.00 44.40 ? 497  THR B CG2 1 
ATOM   8240 N  N   . LYS B 1 498 ? 114.152 45.603 60.653  1.00 45.19 ? 498  LYS B N   1 
ATOM   8241 C  CA  . LYS B 1 498 ? 113.985 44.905 59.382  1.00 45.87 ? 498  LYS B CA  1 
ATOM   8242 C  C   . LYS B 1 498 ? 112.976 43.768 59.402  1.00 44.97 ? 498  LYS B C   1 
ATOM   8243 O  O   . LYS B 1 498 ? 112.165 43.650 58.490  1.00 45.96 ? 498  LYS B O   1 
ATOM   8244 C  CB  . LYS B 1 498 ? 115.317 44.381 58.856  1.00 47.95 ? 498  LYS B CB  1 
ATOM   8245 C  CG  . LYS B 1 498 ? 115.247 43.911 57.395  1.00 50.43 ? 498  LYS B CG  1 
ATOM   8246 C  CD  . LYS B 1 498 ? 116.578 43.282 56.963  1.00 54.24 ? 498  LYS B CD  1 
ATOM   8247 C  CE  . LYS B 1 498 ? 116.709 43.190 55.450  1.00 57.50 ? 498  LYS B CE  1 
ATOM   8248 N  NZ  . LYS B 1 498 ? 118.160 43.026 55.082  1.00 60.40 ? 498  LYS B NZ  1 
ATOM   8249 N  N   . GLU B 1 499 ? 113.033 42.897 60.399  1.00 43.89 ? 499  GLU B N   1 
ATOM   8250 C  CA  . GLU B 1 499 ? 112.208 41.696 60.328  1.00 43.01 ? 499  GLU B CA  1 
ATOM   8251 C  C   . GLU B 1 499 ? 110.916 41.825 61.058  1.00 39.84 ? 499  GLU B C   1 
ATOM   8252 O  O   . GLU B 1 499 ? 109.951 41.163 60.696  1.00 39.53 ? 499  GLU B O   1 
ATOM   8253 C  CB  . GLU B 1 499 ? 112.952 40.443 60.787  1.00 44.35 ? 499  GLU B CB  1 
ATOM   8254 C  CG  . GLU B 1 499 ? 113.500 39.659 59.642  1.00 50.15 ? 499  GLU B CG  1 
ATOM   8255 C  CD  . GLU B 1 499 ? 114.895 40.032 59.378  1.00 57.19 ? 499  GLU B CD  1 
ATOM   8256 O  OE1 . GLU B 1 499 ? 115.387 40.931 60.101  1.00 61.85 ? 499  GLU B OE1 1 
ATOM   8257 O  OE2 . GLU B 1 499 ? 115.514 39.429 58.475  1.00 63.24 ? 499  GLU B OE2 1 
ATOM   8258 N  N   . GLN B 1 500 ? 110.905 42.656 62.096  1.00 37.11 ? 500  GLN B N   1 
ATOM   8259 C  CA  . GLN B 1 500 ? 109.658 43.024 62.783  1.00 35.18 ? 500  GLN B CA  1 
ATOM   8260 C  C   . GLN B 1 500 ? 108.881 41.823 63.359  1.00 34.05 ? 500  GLN B C   1 
ATOM   8261 O  O   . GLN B 1 500 ? 107.657 41.782 63.296  1.00 33.04 ? 500  GLN B O   1 
ATOM   8262 C  CB  . GLN B 1 500 ? 108.799 43.862 61.828  1.00 35.00 ? 500  GLN B CB  1 
ATOM   8263 C  CG  . GLN B 1 500 ? 109.432 45.229 61.472  1.00 38.11 ? 500  GLN B CG  1 
ATOM   8264 C  CD  . GLN B 1 500 ? 108.701 45.944 60.354  1.00 41.21 ? 500  GLN B CD  1 
ATOM   8265 O  OE1 . GLN B 1 500 ? 107.488 46.180 60.432  1.00 41.27 ? 500  GLN B OE1 1 
ATOM   8266 N  NE2 . GLN B 1 500 ? 109.433 46.268 59.280  1.00 43.16 ? 500  GLN B NE2 1 
ATOM   8267 N  N   . LYS B 1 501 ? 109.619 40.857 63.920  1.00 33.86 ? 501  LYS B N   1 
ATOM   8268 C  CA  . LYS B 1 501 ? 109.080 39.594 64.412  1.00 33.26 ? 501  LYS B CA  1 
ATOM   8269 C  C   . LYS B 1 501 ? 108.376 39.746 65.739  1.00 31.81 ? 501  LYS B C   1 
ATOM   8270 O  O   . LYS B 1 501 ? 108.758 40.601 66.566  1.00 31.73 ? 501  LYS B O   1 
ATOM   8271 C  CB  . LYS B 1 501 ? 110.209 38.549 64.561  1.00 35.43 ? 501  LYS B CB  1 
ATOM   8272 C  CG  . LYS B 1 501 ? 110.710 37.909 63.238  1.00 36.25 ? 501  LYS B CG  1 
ATOM   8273 C  CD  . LYS B 1 501 ? 112.082 37.248 63.389  1.00 38.62 ? 501  LYS B CD  1 
ATOM   8274 C  CE  . LYS B 1 501 ? 112.504 36.552 62.074  1.00 42.52 ? 501  LYS B CE  1 
ATOM   8275 N  NZ  . LYS B 1 501 ? 113.793 35.778 62.200  1.00 43.49 ? 501  LYS B NZ  1 
ATOM   8276 N  N   . PHE B 1 502 ? 107.348 38.926 65.948  1.00 30.41 ? 502  PHE B N   1 
ATOM   8277 C  CA  . PHE B 1 502 ? 106.715 38.805 67.250  1.00 28.94 ? 502  PHE B CA  1 
ATOM   8278 C  C   . PHE B 1 502 ? 106.211 37.405 67.502  1.00 30.22 ? 502  PHE B C   1 
ATOM   8279 O  O   . PHE B 1 502 ? 106.172 36.565 66.592  1.00 30.10 ? 502  PHE B O   1 
ATOM   8280 C  CB  . PHE B 1 502 ? 105.561 39.790 67.384  1.00 27.54 ? 502  PHE B CB  1 
ATOM   8281 C  CG  . PHE B 1 502 ? 104.406 39.539 66.436  1.00 27.58 ? 502  PHE B CG  1 
ATOM   8282 C  CD1 . PHE B 1 502 ? 104.490 39.916 65.094  1.00 27.17 ? 502  PHE B CD1 1 
ATOM   8283 C  CD2 . PHE B 1 502 ? 103.225 38.938 66.897  1.00 28.55 ? 502  PHE B CD2 1 
ATOM   8284 C  CE1 . PHE B 1 502 ? 103.432 39.706 64.219  1.00 28.81 ? 502  PHE B CE1 1 
ATOM   8285 C  CE2 . PHE B 1 502 ? 102.132 38.713 66.021  1.00 30.04 ? 502  PHE B CE2 1 
ATOM   8286 C  CZ  . PHE B 1 502 ? 102.237 39.095 64.684  1.00 30.76 ? 502  PHE B CZ  1 
ATOM   8287 N  N   . ILE B 1 503 ? 105.772 37.154 68.733  1.00 31.04 ? 503  ILE B N   1 
ATOM   8288 C  CA  . ILE B 1 503 ? 105.158 35.842 69.033  1.00 32.74 ? 503  ILE B CA  1 
ATOM   8289 C  C   . ILE B 1 503 ? 103.698 35.981 69.455  1.00 32.95 ? 503  ILE B C   1 
ATOM   8290 O  O   . ILE B 1 503 ? 103.290 37.042 69.961  1.00 31.31 ? 503  ILE B O   1 
ATOM   8291 C  CB  . ILE B 1 503 ? 105.925 35.064 70.106  1.00 33.04 ? 503  ILE B CB  1 
ATOM   8292 C  CG1 . ILE B 1 503 ? 106.032 35.891 71.380  1.00 31.17 ? 503  ILE B CG1 1 
ATOM   8293 C  CG2 . ILE B 1 503 ? 107.313 34.655 69.563  1.00 34.17 ? 503  ILE B CG2 1 
ATOM   8294 C  CD1 . ILE B 1 503 ? 106.191 35.071 72.615  1.00 36.70 ? 503  ILE B CD1 1 
ATOM   8295 N  N   . ASP B 1 504 ? 102.930 34.912 69.206  1.00 34.18 ? 504  ASP B N   1 
ATOM   8296 C  CA  . ASP B 1 504 ? 101.616 34.719 69.830  1.00 34.65 ? 504  ASP B CA  1 
ATOM   8297 C  C   . ASP B 1 504 ? 101.863 34.235 71.255  1.00 34.11 ? 504  ASP B C   1 
ATOM   8298 O  O   . ASP B 1 504 ? 102.832 33.510 71.492  1.00 34.62 ? 504  ASP B O   1 
ATOM   8299 C  CB  . ASP B 1 504 ? 100.774 33.676 69.067  1.00 36.23 ? 504  ASP B CB  1 
ATOM   8300 C  CG  . ASP B 1 504 ? 100.355 34.148 67.639  1.00 39.77 ? 504  ASP B CG  1 
ATOM   8301 O  OD1 . ASP B 1 504 ? 100.268 35.382 67.353  1.00 42.49 ? 504  ASP B OD1 1 
ATOM   8302 O  OD2 . ASP B 1 504 ? 100.107 33.256 66.791  1.00 43.71 ? 504  ASP B OD2 1 
ATOM   8303 N  N   . LEU B 1 505 ? 101.013 34.636 72.205  1.00 32.73 ? 505  LEU B N   1 
ATOM   8304 C  CA  . LEU B 1 505 ? 101.061 34.037 73.544  1.00 32.40 ? 505  LEU B CA  1 
ATOM   8305 C  C   . LEU B 1 505 ? 99.729  33.401 73.766  1.00 32.80 ? 505  LEU B C   1 
ATOM   8306 O  O   . LEU B 1 505 ? 98.692  34.081 73.916  1.00 32.07 ? 505  LEU B O   1 
ATOM   8307 C  CB  . LEU B 1 505 ? 101.333 35.057 74.664  1.00 31.53 ? 505  LEU B CB  1 
ATOM   8308 C  CG  . LEU B 1 505 ? 102.770 35.531 74.847  1.00 32.27 ? 505  LEU B CG  1 
ATOM   8309 C  CD1 . LEU B 1 505 ? 102.802 36.711 75.797  1.00 30.68 ? 505  LEU B CD1 1 
ATOM   8310 C  CD2 . LEU B 1 505 ? 103.654 34.367 75.368  1.00 30.48 ? 505  LEU B CD2 1 
ATOM   8311 N  N   . ASN B 1 506 ? 99.754  32.084 73.784  1.00 33.52 ? 506  ASN B N   1 
ATOM   8312 C  CA  . ASN B 1 506 ? 98.572  31.298 73.910  1.00 34.36 ? 506  ASN B CA  1 
ATOM   8313 C  C   . ASN B 1 506 ? 98.975  29.893 74.336  1.00 36.10 ? 506  ASN B C   1 
ATOM   8314 O  O   . ASN B 1 506 ? 100.174 29.617 74.583  1.00 35.57 ? 506  ASN B O   1 
ATOM   8315 C  CB  . ASN B 1 506 ? 97.733  31.338 72.613  1.00 34.76 ? 506  ASN B CB  1 
ATOM   8316 C  CG  . ASN B 1 506 ? 98.448  30.740 71.401  1.00 38.04 ? 506  ASN B CG  1 
ATOM   8317 O  OD1 . ASN B 1 506 ? 99.139  29.716 71.491  1.00 40.89 ? 506  ASN B OD1 1 
ATOM   8318 N  ND2 . ASN B 1 506 ? 98.245  31.358 70.245  1.00 40.04 ? 506  ASN B ND2 1 
ATOM   8319 N  N   . THR B 1 507 ? 97.981  29.023 74.458  1.00 37.44 ? 507  THR B N   1 
ATOM   8320 C  CA  . THR B 1 507 ? 98.181  27.674 75.030  1.00 40.17 ? 507  THR B CA  1 
ATOM   8321 C  C   . THR B 1 507 ? 98.799  26.677 74.053  1.00 42.33 ? 507  THR B C   1 
ATOM   8322 O  O   . THR B 1 507 ? 98.972  25.490 74.378  1.00 45.36 ? 507  THR B O   1 
ATOM   8323 C  CB  . THR B 1 507 ? 96.852  27.100 75.568  1.00 41.01 ? 507  THR B CB  1 
ATOM   8324 O  OG1 . THR B 1 507 ? 95.817  27.283 74.586  1.00 40.95 ? 507  THR B OG1 1 
ATOM   8325 C  CG2 . THR B 1 507 ? 96.442  27.804 76.887  1.00 39.72 ? 507  THR B CG2 1 
ATOM   8326 N  N   . GLU B 1 508 ? 99.121  27.159 72.862  1.00 41.79 ? 508  GLU B N   1 
ATOM   8327 C  CA  . GLU B 1 508 ? 99.709  26.353 71.816  1.00 44.10 ? 508  GLU B CA  1 
ATOM   8328 C  C   . GLU B 1 508 ? 101.216 26.573 71.743  1.00 44.34 ? 508  GLU B C   1 
ATOM   8329 O  O   . GLU B 1 508 ? 101.716 27.562 72.274  1.00 42.96 ? 508  GLU B O   1 
ATOM   8330 C  CB  . GLU B 1 508 ? 99.131  26.769 70.476  1.00 43.33 ? 508  GLU B CB  1 
ATOM   8331 C  CG  . GLU B 1 508 ? 97.796  26.243 70.181  1.00 44.58 ? 508  GLU B CG  1 
ATOM   8332 C  CD  . GLU B 1 508 ? 97.336  26.706 68.817  1.00 44.73 ? 508  GLU B CD  1 
ATOM   8333 O  OE1 . GLU B 1 508 ? 98.177  27.012 67.953  0.80 44.69 ? 508  GLU B OE1 1 
ATOM   8334 O  OE2 . GLU B 1 508 ? 96.125  26.765 68.583  0.80 45.05 ? 508  GLU B OE2 1 
ATOM   8335 N  N   . PRO B 1 509 ? 101.932 25.674 71.042  1.00 46.58 ? 509  PRO B N   1 
ATOM   8336 C  CA  . PRO B 1 509 ? 103.336 25.916 70.762  1.00 47.51 ? 509  PRO B CA  1 
ATOM   8337 C  C   . PRO B 1 509 ? 103.503 27.257 70.041  1.00 46.84 ? 509  PRO B C   1 
ATOM   8338 O  O   . PRO B 1 509 ? 102.652 27.652 69.240  1.00 46.36 ? 509  PRO B O   1 
ATOM   8339 C  CB  . PRO B 1 509 ? 103.721 24.745 69.858  1.00 49.41 ? 509  PRO B CB  1 
ATOM   8340 C  CG  . PRO B 1 509 ? 102.782 23.651 70.262  1.00 50.45 ? 509  PRO B CG  1 
ATOM   8341 C  CD  . PRO B 1 509 ? 101.494 24.351 70.559  1.00 48.78 ? 509  PRO B CD  1 
ATOM   8342 N  N   . MET B 1 510 ? 104.599 27.933 70.355  1.00 47.20 ? 510  MET B N   1 
ATOM   8343 C  CA  . MET B 1 510 ? 104.885 29.279 69.910  1.00 47.20 ? 510  MET B CA  1 
ATOM   8344 C  C   . MET B 1 510 ? 105.003 29.389 68.397  1.00 48.13 ? 510  MET B C   1 
ATOM   8345 O  O   . MET B 1 510 ? 105.565 28.530 67.730  1.00 50.50 ? 510  MET B O   1 
ATOM   8346 C  CB  . MET B 1 510 ? 106.172 29.758 70.585  1.00 47.77 ? 510  MET B CB  1 
ATOM   8347 C  CG  . MET B 1 510 ? 106.684 31.104 70.137  1.00 47.45 ? 510  MET B CG  1 
ATOM   8348 S  SD  . MET B 1 510 ? 108.434 31.193 70.501  1.00 53.56 ? 510  MET B SD  1 
ATOM   8349 C  CE  . MET B 1 510 ? 108.320 31.493 72.251  1.00 47.52 ? 510  MET B CE  1 
ATOM   8350 N  N   . LYS B 1 511 ? 104.426 30.447 67.856  1.00 47.21 ? 511  LYS B N   1 
ATOM   8351 C  CA  . LYS B 1 511 ? 104.551 30.742 66.442  1.00 48.25 ? 511  LYS B CA  1 
ATOM   8352 C  C   . LYS B 1 511 ? 105.160 32.129 66.344  1.00 45.59 ? 511  LYS B C   1 
ATOM   8353 O  O   . LYS B 1 511 ? 104.730 33.038 67.014  1.00 44.28 ? 511  LYS B O   1 
ATOM   8354 C  CB  . LYS B 1 511 ? 103.179 30.699 65.724  1.00 48.63 ? 511  LYS B CB  1 
ATOM   8355 C  CG  . LYS B 1 511 ? 102.227 29.602 66.236  1.00 52.58 ? 511  LYS B CG  1 
ATOM   8356 C  CD  . LYS B 1 511 ? 100.819 29.670 65.588  1.00 56.31 ? 511  LYS B CD  1 
ATOM   8357 C  CE  . LYS B 1 511 ? 100.721 28.753 64.367  1.00 58.25 ? 511  LYS B CE  1 
ATOM   8358 N  NZ  . LYS B 1 511 ? 99.533  29.033 63.496  1.00 60.12 ? 511  LYS B NZ  1 
ATOM   8359 N  N   . VAL B 1 512 ? 106.183 32.270 65.527  1.00 45.86 ? 512  VAL B N   1 
ATOM   8360 C  CA  . VAL B 1 512 ? 106.752 33.567 65.237  1.00 44.43 ? 512  VAL B CA  1 
ATOM   8361 C  C   . VAL B 1 512 ? 106.016 34.151 64.034  1.00 44.12 ? 512  VAL B C   1 
ATOM   8362 O  O   . VAL B 1 512 ? 105.834 33.477 63.038  1.00 45.99 ? 512  VAL B O   1 
ATOM   8363 C  CB  . VAL B 1 512 ? 108.255 33.403 64.937  1.00 45.83 ? 512  VAL B CB  1 
ATOM   8364 C  CG1 . VAL B 1 512 ? 108.863 34.708 64.465  1.00 43.53 ? 512  VAL B CG1 1 
ATOM   8365 C  CG2 . VAL B 1 512 ? 108.976 32.841 66.177  1.00 45.27 ? 512  VAL B CG2 1 
ATOM   8366 N  N   . HIS B 1 513 ? 105.561 35.387 64.127  1.00 42.60 ? 513  HIS B N   1 
ATOM   8367 C  CA  . HIS B 1 513 ? 105.022 36.058 62.950  1.00 42.19 ? 513  HIS B CA  1 
ATOM   8368 C  C   . HIS B 1 513 ? 105.816 37.325 62.758  1.00 40.62 ? 513  HIS B C   1 
ATOM   8369 O  O   . HIS B 1 513 ? 106.709 37.602 63.544  1.00 40.35 ? 513  HIS B O   1 
ATOM   8370 C  CB  . HIS B 1 513 ? 103.554 36.445 63.129  1.00 41.39 ? 513  HIS B CB  1 
ATOM   8371 C  CG  . HIS B 1 513 ? 102.679 35.326 63.576  1.00 41.93 ? 513  HIS B CG  1 
ATOM   8372 N  ND1 . HIS B 1 513 ? 101.987 34.524 62.690  1.00 44.68 ? 513  HIS B ND1 1 
ATOM   8373 C  CD2 . HIS B 1 513 ? 102.375 34.877 64.817  1.00 40.92 ? 513  HIS B CD2 1 
ATOM   8374 C  CE1 . HIS B 1 513 ? 101.277 33.642 63.374  1.00 43.90 ? 513  HIS B CE1 1 
ATOM   8375 N  NE2 . HIS B 1 513 ? 101.486 33.843 64.665  1.00 40.07 ? 513  HIS B NE2 1 
ATOM   8376 N  N   . GLN B 1 514 ? 105.451 38.088 61.730  1.00 39.31 ? 514  GLN B N   1 
ATOM   8377 C  CA  . GLN B 1 514 ? 106.091 39.365 61.374  1.00 38.24 ? 514  GLN B CA  1 
ATOM   8378 C  C   . GLN B 1 514 ? 105.047 40.413 60.998  1.00 36.49 ? 514  GLN B C   1 
ATOM   8379 O  O   . GLN B 1 514 ? 103.997 40.076 60.453  1.00 35.57 ? 514  GLN B O   1 
ATOM   8380 C  CB  . GLN B 1 514 ? 107.017 39.193 60.168  1.00 39.44 ? 514  GLN B CB  1 
ATOM   8381 C  CG  . GLN B 1 514 ? 108.324 38.496 60.493  1.00 42.64 ? 514  GLN B CG  1 
ATOM   8382 C  CD  . GLN B 1 514 ? 108.953 37.868 59.267  1.00 48.55 ? 514  GLN B CD  1 
ATOM   8383 O  OE1 . GLN B 1 514 ? 108.386 36.944 58.643  1.00 50.67 ? 514  GLN B OE1 1 
ATOM   8384 N  NE2 . GLN B 1 514 ? 110.118 38.371 58.896  1.00 48.59 ? 514  GLN B NE2 1 
ATOM   8385 N  N   . ARG B 1 515 ? 105.372 41.682 61.271  1.00 34.71 ? 515  ARG B N   1 
ATOM   8386 C  CA  . ARG B 1 515 ? 104.581 42.835 60.872  1.00 33.59 ? 515  ARG B CA  1 
ATOM   8387 C  C   . ARG B 1 515 ? 103.167 42.829 61.427  1.00 32.56 ? 515  ARG B C   1 
ATOM   8388 O  O   . ARG B 1 515 ? 102.194 42.748 60.671  1.00 33.89 ? 515  ARG B O   1 
ATOM   8389 C  CB  . ARG B 1 515 ? 104.570 42.989 59.362  1.00 33.52 ? 515  ARG B CB  1 
ATOM   8390 C  CG  . ARG B 1 515 ? 105.945 43.076 58.795  1.00 36.73 ? 515  ARG B CG  1 
ATOM   8391 C  CD  . ARG B 1 515 ? 105.912 43.495 57.343  1.00 42.66 ? 515  ARG B CD  1 
ATOM   8392 N  NE  . ARG B 1 515 ? 107.151 44.170 56.966  1.00 47.47 ? 515  ARG B NE  1 
ATOM   8393 C  CZ  . ARG B 1 515 ? 107.381 44.682 55.757  1.00 51.86 ? 515  ARG B CZ  1 
ATOM   8394 N  NH1 . ARG B 1 515 ? 106.457 44.581 54.795  1.00 52.76 ? 515  ARG B NH1 1 
ATOM   8395 N  NH2 . ARG B 1 515 ? 108.535 45.287 55.498  1.00 51.24 ? 515  ARG B NH2 1 
ATOM   8396 N  N   . LEU B 1 516 ? 103.065 42.931 62.742  1.00 30.90 ? 516  LEU B N   1 
ATOM   8397 C  CA  . LEU B 1 516 ? 101.788 42.832 63.419  1.00 29.94 ? 516  LEU B CA  1 
ATOM   8398 C  C   . LEU B 1 516 ? 100.801 43.880 62.852  1.00 29.36 ? 516  LEU B C   1 
ATOM   8399 O  O   . LEU B 1 516 ? 101.046 45.093 62.933  1.00 27.07 ? 516  LEU B O   1 
ATOM   8400 C  CB  . LEU B 1 516 ? 102.012 43.032 64.918  1.00 29.83 ? 516  LEU B CB  1 
ATOM   8401 C  CG  . LEU B 1 516 ? 100.861 42.945 65.940  1.00 29.98 ? 516  LEU B CG  1 
ATOM   8402 C  CD1 . LEU B 1 516 ? 99.992  41.804 65.621  1.00 34.41 ? 516  LEU B CD1 1 
ATOM   8403 C  CD2 . LEU B 1 516 ? 101.478 42.717 67.309  1.00 31.68 ? 516  LEU B CD2 1 
ATOM   8404 N  N   . ARG B 1 517 ? 99.736  43.384 62.200  1.00 29.47 ? 517  ARG B N   1 
ATOM   8405 C  CA  . ARG B 1 517 ? 98.649  44.223 61.691  1.00 28.88 ? 517  ARG B CA  1 
ATOM   8406 C  C   . ARG B 1 517 ? 99.189  45.410 60.866  1.00 27.94 ? 517  ARG B C   1 
ATOM   8407 O  O   . ARG B 1 517 ? 98.753  46.519 61.016  1.00 26.07 ? 517  ARG B O   1 
ATOM   8408 C  CB  . ARG B 1 517 ? 97.711  44.648 62.852  1.00 28.45 ? 517  ARG B CB  1 
ATOM   8409 C  CG  . ARG B 1 517 ? 96.783  43.432 63.198  1.00 33.75 ? 517  ARG B CG  1 
ATOM   8410 C  CD  . ARG B 1 517 ? 95.674  43.649 64.220  1.00 35.78 ? 517  ARG B CD  1 
ATOM   8411 N  NE  . ARG B 1 517 ? 94.569  44.420 63.651  1.00 40.73 ? 517  ARG B NE  1 
ATOM   8412 C  CZ  . ARG B 1 517 ? 93.640  43.956 62.814  1.00 40.54 ? 517  ARG B CZ  1 
ATOM   8413 N  NH1 . ARG B 1 517 ? 93.676  42.697 62.396  1.00 41.85 ? 517  ARG B NH1 1 
ATOM   8414 N  NH2 . ARG B 1 517 ? 92.686  44.776 62.365  1.00 37.50 ? 517  ARG B NH2 1 
ATOM   8415 N  N   . VAL B 1 518 ? 100.157 45.132 59.992  1.00 28.41 ? 518  VAL B N   1 
ATOM   8416 C  CA  . VAL B 1 518 ? 100.857 46.177 59.267  1.00 27.70 ? 518  VAL B CA  1 
ATOM   8417 C  C   . VAL B 1 518 ? 99.895  46.936 58.351  1.00 28.31 ? 518  VAL B C   1 
ATOM   8418 O  O   . VAL B 1 518 ? 99.976  48.158 58.277  1.00 28.42 ? 518  VAL B O   1 
ATOM   8419 C  CB  . VAL B 1 518 ? 102.085 45.623 58.514  1.00 28.39 ? 518  VAL B CB  1 
ATOM   8420 C  CG1 . VAL B 1 518 ? 101.689 44.602 57.447  1.00 29.14 ? 518  VAL B CG1 1 
ATOM   8421 C  CG2 . VAL B 1 518 ? 102.952 46.757 57.910  1.00 29.09 ? 518  VAL B CG2 1 
ATOM   8422 N  N   . GLN B 1 519 ? 98.954  46.227 57.718  1.00 28.89 ? 519  GLN B N   1 
ATOM   8423 C  CA  . GLN B 1 519 ? 98.081  46.848 56.735  1.00 30.13 ? 519  GLN B CA  1 
ATOM   8424 C  C   . GLN B 1 519 ? 97.240  47.928 57.373  1.00 29.66 ? 519  GLN B C   1 
ATOM   8425 O  O   . GLN B 1 519 ? 97.210  49.045 56.876  1.00 31.24 ? 519  GLN B O   1 
ATOM   8426 C  CB  . GLN B 1 519 ? 97.130  45.855 56.043  1.00 30.39 ? 519  GLN B CB  1 
ATOM   8427 C  CG  . GLN B 1 519 ? 96.553  46.469 54.723  1.00 32.21 ? 519  GLN B CG  1 
ATOM   8428 C  CD  . GLN B 1 519 ? 97.611  46.592 53.575  1.00 35.46 ? 519  GLN B CD  1 
ATOM   8429 O  OE1 . GLN B 1 519 ? 98.657  45.927 53.584  1.00 34.77 ? 519  GLN B OE1 1 
ATOM   8430 N  NE2 . GLN B 1 519 ? 97.331  47.449 52.605  1.00 34.01 ? 519  GLN B NE2 1 
ATOM   8431 N  N   . MET B 1 520 ? 96.555  47.571 58.452  1.00 28.24 ? 520  MET B N   1 
ATOM   8432 C  CA  A MET B 1 520 ? 95.707  48.496 59.153  0.50 27.52 ? 520  MET B CA  1 
ATOM   8433 C  CA  B MET B 1 520 ? 95.713  48.485 59.191  0.50 28.50 ? 520  MET B CA  1 
ATOM   8434 C  C   . MET B 1 520 ? 96.538  49.580 59.848  1.00 28.15 ? 520  MET B C   1 
ATOM   8435 O  O   . MET B 1 520 ? 96.104  50.731 59.942  1.00 28.75 ? 520  MET B O   1 
ATOM   8436 C  CB  A MET B 1 520 ? 94.823  47.754 60.155  0.50 26.35 ? 520  MET B CB  1 
ATOM   8437 C  CB  B MET B 1 520 ? 94.943  47.748 60.284  0.50 28.04 ? 520  MET B CB  1 
ATOM   8438 C  CG  A MET B 1 520 ? 93.712  46.924 59.510  0.50 25.65 ? 520  MET B CG  1 
ATOM   8439 C  CG  B MET B 1 520 ? 94.017  46.686 59.784  0.50 31.54 ? 520  MET B CG  1 
ATOM   8440 S  SD  A MET B 1 520 ? 92.685  47.791 58.295  0.50 22.35 ? 520  MET B SD  1 
ATOM   8441 S  SD  B MET B 1 520 ? 94.668  45.037 60.091  0.50 39.72 ? 520  MET B SD  1 
ATOM   8442 C  CE  A MET B 1 520 ? 93.611  47.591 56.801  0.50 23.18 ? 520  MET B CE  1 
ATOM   8443 C  CE  B MET B 1 520 ? 96.268  45.124 59.350  0.50 37.90 ? 520  MET B CE  1 
ATOM   8444 N  N   . CYS B 1 521 ? 97.733  49.239 60.327  1.00 27.51 ? 521  CYS B N   1 
ATOM   8445 C  CA  . CYS B 1 521 ? 98.500  50.291 60.996  1.00 28.73 ? 521  CYS B CA  1 
ATOM   8446 C  C   . CYS B 1 521 ? 99.184  51.295 60.064  1.00 28.76 ? 521  CYS B C   1 
ATOM   8447 O  O   . CYS B 1 521 ? 99.434  52.407 60.483  1.00 30.57 ? 521  CYS B O   1 
ATOM   8448 C  CB  . CYS B 1 521 ? 99.435  49.731 62.077  1.00 27.93 ? 521  CYS B CB  1 
ATOM   8449 S  SG  . CYS B 1 521 ? 98.477  48.877 63.322  1.00 29.37 ? 521  CYS B SG  1 
ATOM   8450 N  N   . VAL B 1 522 ? 99.451  50.936 58.815  1.00 28.59 ? 522  VAL B N   1 
ATOM   8451 C  CA  . VAL B 1 522 ? 99.833  51.961 57.841  1.00 29.68 ? 522  VAL B CA  1 
ATOM   8452 C  C   . VAL B 1 522 ? 98.669  52.964 57.658  1.00 29.76 ? 522  VAL B C   1 
ATOM   8453 O  O   . VAL B 1 522 ? 98.885  54.175 57.628  1.00 30.83 ? 522  VAL B O   1 
ATOM   8454 C  CB  . VAL B 1 522 ? 100.257 51.339 56.484  1.00 31.14 ? 522  VAL B CB  1 
ATOM   8455 C  CG1 . VAL B 1 522 ? 100.316 52.417 55.346  1.00 30.73 ? 522  VAL B CG1 1 
ATOM   8456 C  CG2 . VAL B 1 522 ? 101.606 50.596 56.638  1.00 31.01 ? 522  VAL B CG2 1 
ATOM   8457 N  N   . PHE B 1 523 ? 97.439  52.460 57.559  1.00 28.98 ? 523  PHE B N   1 
ATOM   8458 C  CA  . PHE B 1 523 ? 96.266  53.324 57.513  1.00 28.71 ? 523  PHE B CA  1 
ATOM   8459 C  C   . PHE B 1 523 ? 96.188  54.277 58.726  1.00 28.33 ? 523  PHE B C   1 
ATOM   8460 O  O   . PHE B 1 523 ? 96.124  55.500 58.553  1.00 28.51 ? 523  PHE B O   1 
ATOM   8461 C  CB  . PHE B 1 523 ? 94.976  52.508 57.394  1.00 28.46 ? 523  PHE B CB  1 
ATOM   8462 C  CG  . PHE B 1 523 ? 93.724  53.342 57.538  1.00 27.97 ? 523  PHE B CG  1 
ATOM   8463 C  CD1 . PHE B 1 523 ? 93.223  54.061 56.453  1.00 28.90 ? 523  PHE B CD1 1 
ATOM   8464 C  CD2 . PHE B 1 523 ? 93.064  53.418 58.747  1.00 23.50 ? 523  PHE B CD2 1 
ATOM   8465 C  CE1 . PHE B 1 523 ? 92.070  54.841 56.579  1.00 31.17 ? 523  PHE B CE1 1 
ATOM   8466 C  CE2 . PHE B 1 523 ? 91.919  54.202 58.879  1.00 27.59 ? 523  PHE B CE2 1 
ATOM   8467 C  CZ  . PHE B 1 523 ? 91.411  54.904 57.797  1.00 28.18 ? 523  PHE B CZ  1 
ATOM   8468 N  N   . TRP B 1 524 ? 96.218  53.726 59.931  1.00 26.87 ? 524  TRP B N   1 
ATOM   8469 C  CA  . TRP B 1 524 ? 96.139  54.575 61.130  1.00 28.33 ? 524  TRP B CA  1 
ATOM   8470 C  C   . TRP B 1 524 ? 97.352  55.487 61.392  1.00 29.78 ? 524  TRP B C   1 
ATOM   8471 O  O   . TRP B 1 524 ? 97.175  56.668 61.813  1.00 31.08 ? 524  TRP B O   1 
ATOM   8472 C  CB  . TRP B 1 524 ? 95.844  53.728 62.372  1.00 26.27 ? 524  TRP B CB  1 
ATOM   8473 C  CG  . TRP B 1 524 ? 94.504  53.070 62.312  1.00 25.53 ? 524  TRP B CG  1 
ATOM   8474 C  CD1 . TRP B 1 524 ? 94.239  51.758 62.059  1.00 24.79 ? 524  TRP B CD1 1 
ATOM   8475 C  CD2 . TRP B 1 524 ? 93.240  53.700 62.517  1.00 25.72 ? 524  TRP B CD2 1 
ATOM   8476 N  NE1 . TRP B 1 524 ? 92.880  51.527 62.094  1.00 25.24 ? 524  TRP B NE1 1 
ATOM   8477 C  CE2 . TRP B 1 524 ? 92.246  52.704 62.382  1.00 25.08 ? 524  TRP B CE2 1 
ATOM   8478 C  CE3 . TRP B 1 524 ? 92.847  55.011 62.813  1.00 25.51 ? 524  TRP B CE3 1 
ATOM   8479 C  CZ2 . TRP B 1 524 ? 90.889  52.978 62.520  1.00 25.02 ? 524  TRP B CZ2 1 
ATOM   8480 C  CZ3 . TRP B 1 524 ? 91.468  55.276 62.960  1.00 23.12 ? 524  TRP B CZ3 1 
ATOM   8481 C  CH2 . TRP B 1 524 ? 90.528  54.270 62.812  1.00 23.56 ? 524  TRP B CH2 1 
ATOM   8482 N  N   . ASN B 1 525 ? 98.559  54.990 61.097  1.00 29.86 ? 525  ASN B N   1 
ATOM   8483 C  CA  . ASN B 1 525 ? 99.777  55.724 61.475  1.00 31.31 ? 525  ASN B CA  1 
ATOM   8484 C  C   . ASN B 1 525 ? 100.346 56.618 60.396  1.00 33.58 ? 525  ASN B C   1 
ATOM   8485 O  O   . ASN B 1 525 ? 101.086 57.542 60.733  1.00 34.60 ? 525  ASN B O   1 
ATOM   8486 C  CB  . ASN B 1 525 ? 100.847 54.771 62.007  1.00 30.70 ? 525  ASN B CB  1 
ATOM   8487 C  CG  . ASN B 1 525 ? 100.390 54.053 63.229  1.00 30.40 ? 525  ASN B CG  1 
ATOM   8488 O  OD1 . ASN B 1 525 ? 99.522  54.551 63.944  1.00 32.15 ? 525  ASN B OD1 1 
ATOM   8489 N  ND2 . ASN B 1 525 ? 100.947 52.885 63.490  1.00 29.35 ? 525  ASN B ND2 1 
ATOM   8490 N  N   . GLN B 1 526 ? 100.006 56.363 59.121  1.00 34.01 ? 526  GLN B N   1 
ATOM   8491 C  CA  . GLN B 1 526 ? 100.499 57.193 58.037  1.00 35.80 ? 526  GLN B CA  1 
ATOM   8492 C  C   . GLN B 1 526 ? 99.406  57.898 57.253  1.00 35.52 ? 526  GLN B C   1 
ATOM   8493 O  O   . GLN B 1 526 ? 99.441  59.127 57.085  1.00 36.22 ? 526  GLN B O   1 
ATOM   8494 C  CB  . GLN B 1 526 ? 101.359 56.407 57.067  1.00 36.57 ? 526  GLN B CB  1 
ATOM   8495 C  CG  . GLN B 1 526 ? 102.548 55.744 57.658  1.00 43.44 ? 526  GLN B CG  1 
ATOM   8496 C  CD  . GLN B 1 526 ? 103.475 55.186 56.580  1.00 54.41 ? 526  GLN B CD  1 
ATOM   8497 O  OE1 . GLN B 1 526 ? 103.473 55.654 55.408  1.00 57.89 ? 526  GLN B OE1 1 
ATOM   8498 N  NE2 . GLN B 1 526 ? 104.279 54.175 56.962  1.00 56.31 ? 526  GLN B NE2 1 
ATOM   8499 N  N   . PHE B 1 527 ? 98.458  57.130 56.731  1.00 34.19 ? 527  PHE B N   1 
ATOM   8500 C  CA  . PHE B 1 527 ? 97.471  57.707 55.825  1.00 33.90 ? 527  PHE B CA  1 
ATOM   8501 C  C   . PHE B 1 527 ? 96.408  58.528 56.544  1.00 34.14 ? 527  PHE B C   1 
ATOM   8502 O  O   . PHE B 1 527 ? 96.148  59.673 56.168  1.00 34.69 ? 527  PHE B O   1 
ATOM   8503 C  CB  . PHE B 1 527 ? 96.821  56.645 54.932  1.00 33.32 ? 527  PHE B CB  1 
ATOM   8504 C  CG  . PHE B 1 527 ? 95.819  57.205 53.993  1.00 33.38 ? 527  PHE B CG  1 
ATOM   8505 C  CD1 . PHE B 1 527 ? 96.223  57.949 52.896  1.00 31.60 ? 527  PHE B CD1 1 
ATOM   8506 C  CD2 . PHE B 1 527 ? 94.457  57.034 54.234  1.00 32.39 ? 527  PHE B CD2 1 
ATOM   8507 C  CE1 . PHE B 1 527 ? 95.295  58.487 52.033  1.00 34.29 ? 527  PHE B CE1 1 
ATOM   8508 C  CE2 . PHE B 1 527 ? 93.513  57.582 53.368  1.00 31.49 ? 527  PHE B CE2 1 
ATOM   8509 C  CZ  . PHE B 1 527 ? 93.923  58.299 52.278  1.00 32.38 ? 527  PHE B CZ  1 
ATOM   8510 N  N   . LEU B 1 528 ? 95.794  57.987 57.590  1.00 33.47 ? 528  LEU B N   1 
ATOM   8511 C  CA  . LEU B 1 528 ? 94.732  58.787 58.210  1.00 34.71 ? 528  LEU B CA  1 
ATOM   8512 C  C   . LEU B 1 528 ? 95.166  60.204 58.667  1.00 35.80 ? 528  LEU B C   1 
ATOM   8513 O  O   . LEU B 1 528 ? 94.514  61.175 58.289  1.00 36.47 ? 528  LEU B O   1 
ATOM   8514 C  CB  . LEU B 1 528 ? 93.929  58.029 59.279  1.00 33.35 ? 528  LEU B CB  1 
ATOM   8515 C  CG  . LEU B 1 528 ? 92.650  58.756 59.768  1.00 34.95 ? 528  LEU B CG  1 
ATOM   8516 C  CD1 . LEU B 1 528 ? 91.606  58.997 58.682  1.00 34.59 ? 528  LEU B CD1 1 
ATOM   8517 C  CD2 . LEU B 1 528 ? 92.044  57.995 60.935  1.00 33.82 ? 528  LEU B CD2 1 
ATOM   8518 N  N   . PRO B 1 529 ? 96.280  60.328 59.434  1.00 36.20 ? 529  PRO B N   1 
ATOM   8519 C  CA  . PRO B 1 529 ? 96.666  61.648 59.956  1.00 37.38 ? 529  PRO B CA  1 
ATOM   8520 C  C   . PRO B 1 529 ? 96.983  62.626 58.829  1.00 39.33 ? 529  PRO B C   1 
ATOM   8521 O  O   . PRO B 1 529 ? 96.511  63.758 58.866  1.00 39.93 ? 529  PRO B O   1 
ATOM   8522 C  CB  . PRO B 1 529 ? 97.927  61.353 60.786  1.00 37.14 ? 529  PRO B CB  1 
ATOM   8523 C  CG  . PRO B 1 529 ? 97.823  59.903 61.137  1.00 34.83 ? 529  PRO B CG  1 
ATOM   8524 C  CD  . PRO B 1 529 ? 97.239  59.297 59.868  1.00 35.57 ? 529  PRO B CD  1 
ATOM   8525 N  N   . LYS B 1 530 ? 97.717  62.159 57.812  1.00 40.08 ? 530  LYS B N   1 
ATOM   8526 C  CA  . LYS B 1 530 ? 97.929  62.919 56.575  1.00 42.60 ? 530  LYS B CA  1 
ATOM   8527 C  C   . LYS B 1 530 ? 96.620  63.437 55.975  1.00 43.18 ? 530  LYS B C   1 
ATOM   8528 O  O   . LYS B 1 530 ? 96.528  64.581 55.573  1.00 46.35 ? 530  LYS B O   1 
ATOM   8529 C  CB  . LYS B 1 530 ? 98.760  62.120 55.560  1.00 42.93 ? 530  LYS B CB  1 
ATOM   8530 C  CG  . LYS B 1 530 ? 99.077  62.892 54.293  1.00 47.93 ? 530  LYS B CG  1 
ATOM   8531 C  CD  . LYS B 1 530 ? 100.241 62.320 53.431  1.00 53.32 ? 530  LYS B CD  1 
ATOM   8532 C  CE  . LYS B 1 530 ? 100.466 63.247 52.186  1.00 58.02 ? 530  LYS B CE  1 
ATOM   8533 N  NZ  . LYS B 1 530 ? 101.549 62.862 51.210  1.00 60.24 ? 530  LYS B NZ  1 
ATOM   8534 N  N   . LEU B 1 531 ? 95.592  62.611 55.957  1.00 42.92 ? 531  LEU B N   1 
ATOM   8535 C  CA  . LEU B 1 531 ? 94.283  63.018 55.456  1.00 44.18 ? 531  LEU B CA  1 
ATOM   8536 C  C   . LEU B 1 531 ? 93.559  64.034 56.365  1.00 45.13 ? 531  LEU B C   1 
ATOM   8537 O  O   . LEU B 1 531 ? 92.952  64.981 55.870  1.00 46.31 ? 531  LEU B O   1 
ATOM   8538 C  CB  . LEU B 1 531 ? 93.418  61.766 55.218  1.00 42.78 ? 531  LEU B CB  1 
ATOM   8539 C  CG  . LEU B 1 531 ? 91.967  61.882 54.787  1.00 43.41 ? 531  LEU B CG  1 
ATOM   8540 C  CD1 . LEU B 1 531 ? 91.445  60.560 54.280  1.00 42.67 ? 531  LEU B CD1 1 
ATOM   8541 C  CD2 . LEU B 1 531 ? 91.157  62.288 55.976  1.00 44.53 ? 531  LEU B CD2 1 
ATOM   8542 N  N   . LEU B 1 532 ? 93.596  63.828 57.681  1.00 44.96 ? 532  LEU B N   1 
ATOM   8543 C  CA  . LEU B 1 532 ? 92.908  64.750 58.597  1.00 46.85 ? 532  LEU B CA  1 
ATOM   8544 C  C   . LEU B 1 532 ? 93.628  66.103 58.624  1.00 50.27 ? 532  LEU B C   1 
ATOM   8545 O  O   . LEU B 1 532 ? 93.029  67.149 58.893  1.00 50.88 ? 532  LEU B O   1 
ATOM   8546 C  CB  . LEU B 1 532 ? 92.824  64.167 60.009  1.00 44.74 ? 532  LEU B CB  1 
ATOM   8547 C  CG  . LEU B 1 532 ? 92.062  62.839 60.152  1.00 41.45 ? 532  LEU B CG  1 
ATOM   8548 C  CD1 . LEU B 1 532 ? 92.255  62.242 61.539  1.00 36.11 ? 532  LEU B CD1 1 
ATOM   8549 C  CD2 . LEU B 1 532 ? 90.581  63.017 59.841  1.00 40.29 ? 532  LEU B CD2 1 
ATOM   8550 N  N   . ASN B 1 533 ? 94.921  66.058 58.309  1.00 52.74 ? 533  ASN B N   1 
ATOM   8551 C  CA  . ASN B 1 533 ? 95.783  67.228 58.319  1.00 56.74 ? 533  ASN B CA  1 
ATOM   8552 C  C   . ASN B 1 533 ? 95.739  68.053 57.029  1.00 59.32 ? 533  ASN B C   1 
ATOM   8553 O  O   . ASN B 1 533 ? 96.654  68.825 56.768  1.00 61.13 ? 533  ASN B O   1 
ATOM   8554 C  CB  . ASN B 1 533 ? 97.212  66.765 58.582  1.00 56.40 ? 533  ASN B CB  1 
ATOM   8555 C  CG  . ASN B 1 533 ? 98.154  67.902 58.782  1.00 60.96 ? 533  ASN B CG  1 
ATOM   8556 O  OD1 . ASN B 1 533 ? 97.947  68.743 59.660  1.00 65.08 ? 533  ASN B OD1 1 
ATOM   8557 N  ND2 . ASN B 1 533 ? 99.211  67.950 57.963  1.00 64.58 ? 533  ASN B ND2 1 
ATOM   8558 N  N   . ALA B 1 534 ? 94.671  67.917 56.243  1.00 60.64 ? 534  ALA B N   1 
ATOM   8559 C  CA  . ALA B 1 534 ? 94.680  68.370 54.845  1.00 62.97 ? 534  ALA B CA  1 
ATOM   8560 C  C   . ALA B 1 534 ? 93.935  69.675 54.480  1.00 65.80 ? 534  ALA B C   1 
ATOM   8561 O  O   . ALA B 1 534 ? 94.481  70.495 53.731  1.00 67.87 ? 534  ALA B O   1 
ATOM   8562 C  CB  . ALA B 1 534 ? 94.241  67.240 53.926  1.00 61.78 ? 534  ALA B CB  1 
ATOM   8563 N  N   . THR B 1 535 ? 92.703  69.852 54.965  1.00 66.41 ? 535  THR B N   1 
ATOM   8564 C  CA  . THR B 1 535 ? 91.826  71.012 54.584  1.00 69.46 ? 535  THR B CA  1 
ATOM   8565 C  C   . THR B 1 535 ? 91.504  71.184 53.076  1.00 70.70 ? 535  THR B C   1 
ATOM   8566 O  O   . THR B 1 535 ? 92.330  71.628 52.272  1.00 71.78 ? 535  THR B O   1 
ATOM   8567 C  CB  . THR B 1 535 ? 92.234  72.410 55.271  1.00 71.55 ? 535  THR B CB  1 
ATOM   8568 O  OG1 . THR B 1 535 ? 91.061  73.219 55.454  1.00 73.92 ? 535  THR B OG1 1 
ATOM   8569 C  CG2 . THR B 1 535 ? 93.309  73.217 54.468  1.00 73.37 ? 535  THR B CG2 1 
HETATM 8570 C  C8A . AFT C 2 .   ? 99.589  52.355 22.428  0.75 50.83 ? 1000 AFT A C8A 1 
HETATM 8571 C  C9B . AFT C 2 .   ? 100.026 55.697 22.969  0.75 50.18 ? 1000 AFT A C9B 1 
HETATM 8572 O  O7  . AFT C 2 .   ? 99.806  52.806 21.133  0.75 50.44 ? 1000 AFT A O7  1 
HETATM 8573 C  C6A . AFT C 2 .   ? 99.641  54.239 21.132  0.75 51.06 ? 1000 AFT A C6A 1 
HETATM 8574 O  O6A . AFT C 2 .   ? 100.896 54.928 20.991  0.75 51.26 ? 1000 AFT A O6A 1 
HETATM 8575 C  C5A . AFT C 2 .   ? 101.019 55.859 22.003  0.75 50.24 ? 1000 AFT A C5A 1 
HETATM 8576 C  C5B . AFT C 2 .   ? 101.962 56.864 22.185  0.75 49.58 ? 1000 AFT A C5B 1 
HETATM 8577 C  C4B . AFT C 2 .   ? 101.914 57.708 23.298  0.75 49.97 ? 1000 AFT A C4B 1 
HETATM 8578 O  O4  . AFT C 2 .   ? 102.868 58.673 23.422  0.75 49.87 ? 1000 AFT A O4  1 
HETATM 8579 C  CM  . AFT C 2 .   ? 103.539 58.997 22.175  0.75 47.67 ? 1000 AFT A CM  1 
HETATM 8580 C  C4A . AFT C 2 .   ? 100.904 57.535 24.270  0.75 51.12 ? 1000 AFT A C4A 1 
HETATM 8581 C  C10 . AFT C 2 .   ? 99.952  56.523 24.070  0.75 50.31 ? 1000 AFT A C10 1 
HETATM 8582 O  O10 . AFT C 2 .   ? 98.925  56.268 24.926  0.75 51.06 ? 1000 AFT A O10 1 
HETATM 8583 C  C11 . AFT C 2 .   ? 98.789  57.059 26.022  0.75 51.59 ? 1000 AFT A C11 1 
HETATM 8584 O  O11 . AFT C 2 .   ? 97.850  56.827 26.778  0.75 52.21 ? 1000 AFT A O11 1 
HETATM 8585 C  C12 . AFT C 2 .   ? 99.670  58.112 26.287  0.75 51.39 ? 1000 AFT A C12 1 
HETATM 8586 C  C3A . AFT C 2 .   ? 100.758 58.339 25.418  0.75 51.30 ? 1000 AFT A C3A 1 
HETATM 8587 C  C3  . AFT C 2 .   ? 101.569 59.573 25.875  0.75 50.83 ? 1000 AFT A C3  1 
HETATM 8588 C  C2A . AFT C 2 .   ? 100.861 60.036 27.152  0.75 50.49 ? 1000 AFT A C2A 1 
HETATM 8589 C  C9A . AFT C 2 .   ? 99.104  54.578 22.535  0.75 51.15 ? 1000 AFT A C9A 1 
HETATM 8590 C  C1  . AFT C 2 .   ? 99.683  59.051 27.322  0.75 51.31 ? 1000 AFT A C1  1 
HETATM 8591 C  C9  . AFT C 2 .   ? 99.244  53.289 23.323  0.75 49.62 ? 1000 AFT A C9  1 
HETATM 8592 O  O1  . AFT C 2 .   ? 98.842  59.100 28.229  0.75 47.47 ? 1000 AFT A O1  1 
HETATM 8593 CL CL  . CL  D 3 .   ? 86.650  32.289 5.031   1.00 66.16 ? 1001 CL  A CL  1 
HETATM 8594 CL CL  . CL  E 3 .   ? 65.949  47.124 38.573  1.00 63.34 ? 1002 CL  A CL  1 
HETATM 8595 C  C1  . PEG F 4 .   ? 81.080  60.180 -9.145  1.00 68.34 ? 1003 PEG A C1  1 
HETATM 8596 O  O1  . PEG F 4 .   ? 82.449  60.551 -9.361  1.00 68.74 ? 1003 PEG A O1  1 
HETATM 8597 C  C2  . PEG F 4 .   ? 81.035  58.762 -8.570  1.00 68.22 ? 1003 PEG A C2  1 
HETATM 8598 O  O2  . PEG F 4 .   ? 80.299  57.892 -9.431  1.00 67.79 ? 1003 PEG A O2  1 
HETATM 8599 C  C3  . PEG F 4 .   ? 81.085  56.714 -9.623  1.00 66.91 ? 1003 PEG A C3  1 
HETATM 8600 C  C4  . PEG F 4 .   ? 80.462  55.921 -10.771 1.00 65.61 ? 1003 PEG A C4  1 
HETATM 8601 O  O4  . PEG F 4 .   ? 81.475  55.433 -11.657 1.00 64.91 ? 1003 PEG A O4  1 
HETATM 8602 C  C1  . PEG G 4 .   ? 94.976  41.176 22.204  1.00 60.00 ? 1004 PEG A C1  1 
HETATM 8603 O  O1  . PEG G 4 .   ? 93.994  42.209 22.134  1.00 59.63 ? 1004 PEG A O1  1 
HETATM 8604 C  C2  . PEG G 4 .   ? 94.676  40.104 21.160  1.00 61.51 ? 1004 PEG A C2  1 
HETATM 8605 O  O2  . PEG G 4 .   ? 95.604  40.224 20.083  1.00 62.70 ? 1004 PEG A O2  1 
HETATM 8606 C  C3  . PEG G 4 .   ? 96.436  41.363 20.306  1.00 61.37 ? 1004 PEG A C3  1 
HETATM 8607 C  C4  . PEG G 4 .   ? 95.554  42.594 20.489  1.00 59.58 ? 1004 PEG A C4  1 
HETATM 8608 O  O4  . PEG G 4 .   ? 96.310  43.628 21.105  1.00 54.99 ? 1004 PEG A O4  1 
HETATM 8609 C  C1  . PEG H 4 .   ? 78.397  52.871 41.667  1.00 59.41 ? 1005 PEG A C1  1 
HETATM 8610 O  O1  . PEG H 4 .   ? 78.596  54.258 41.309  1.00 55.03 ? 1005 PEG A O1  1 
HETATM 8611 C  C2  . PEG H 4 .   ? 79.575  52.006 41.195  1.00 59.83 ? 1005 PEG A C2  1 
HETATM 8612 O  O2  . PEG H 4 .   ? 79.296  50.640 41.546  1.00 63.01 ? 1005 PEG A O2  1 
HETATM 8613 C  C3  . PEG H 4 .   ? 80.454  49.952 42.006  1.00 64.95 ? 1005 PEG A C3  1 
HETATM 8614 C  C4  . PEG H 4 .   ? 80.856  50.412 43.422  1.00 67.00 ? 1005 PEG A C4  1 
HETATM 8615 O  O4  . PEG H 4 .   ? 80.851  51.858 43.501  1.00 68.62 ? 1005 PEG A O4  1 
HETATM 8616 C  C1  . PGE I 5 .   ? 91.083  47.914 20.878  1.00 64.63 ? 1006 PGE A C1  1 
HETATM 8617 O  O1  . PGE I 5 .   ? 92.479  47.781 21.248  1.00 63.74 ? 1006 PGE A O1  1 
HETATM 8618 C  C2  . PGE I 5 .   ? 90.867  48.992 19.807  1.00 60.82 ? 1006 PGE A C2  1 
HETATM 8619 O  O2  . PGE I 5 .   ? 91.755  50.049 20.085  1.00 60.74 ? 1006 PGE A O2  1 
HETATM 8620 C  C3  . PGE I 5 .   ? 93.075  49.872 19.497  1.00 60.43 ? 1006 PGE A C3  1 
HETATM 8621 C  C4  . PGE I 5 .   ? 94.222  50.730 20.091  1.00 59.80 ? 1006 PGE A C4  1 
HETATM 8622 O  O4  . PGE I 5 .   ? 92.912  52.753 23.292  1.00 58.00 ? 1006 PGE A O4  1 
HETATM 8623 C  C6  . PGE I 5 .   ? 93.957  53.209 22.409  1.00 57.81 ? 1006 PGE A C6  1 
HETATM 8624 C  C5  . PGE I 5 .   ? 94.902  52.086 21.965  1.00 56.83 ? 1006 PGE A C5  1 
HETATM 8625 O  O3  . PGE I 5 .   ? 94.205  50.908 21.521  1.00 59.35 ? 1006 PGE A O3  1 
HETATM 8626 C  C1  . NAG J 6 .   ? 85.715  47.933 -8.897  1.00 54.25 ? 1007 NAG A C1  1 
HETATM 8627 C  C2  . NAG J 6 .   ? 85.575  47.444 -10.338 1.00 61.35 ? 1007 NAG A C2  1 
HETATM 8628 C  C3  . NAG J 6 .   ? 86.031  45.996 -10.367 1.00 62.68 ? 1007 NAG A C3  1 
HETATM 8629 C  C4  . NAG J 6 .   ? 87.546  46.034 -10.141 1.00 62.37 ? 1007 NAG A C4  1 
HETATM 8630 C  C5  . NAG J 6 .   ? 87.824  46.654 -8.749  1.00 60.71 ? 1007 NAG A C5  1 
HETATM 8631 C  C6  . NAG J 6 .   ? 89.347  46.797 -8.555  1.00 62.05 ? 1007 NAG A C6  1 
HETATM 8632 C  C7  . NAG J 6 .   ? 84.008  48.353 -11.991 1.00 65.95 ? 1007 NAG A C7  1 
HETATM 8633 C  C8  . NAG J 6 .   ? 85.153  49.035 -12.700 1.00 66.35 ? 1007 NAG A C8  1 
HETATM 8634 N  N2  . NAG J 6 .   ? 84.242  47.615 -10.890 1.00 63.75 ? 1007 NAG A N2  1 
HETATM 8635 O  O3  . NAG J 6 .   ? 85.652  45.390 -11.583 1.00 63.75 ? 1007 NAG A O3  1 
HETATM 8636 O  O4  . NAG J 6 .   ? 88.123  44.742 -10.300 1.00 63.16 ? 1007 NAG A O4  1 
HETATM 8637 O  O5  . NAG J 6 .   ? 87.104  47.892 -8.530  1.00 58.59 ? 1007 NAG A O5  1 
HETATM 8638 O  O6  . NAG J 6 .   ? 89.739  47.893 -7.739  1.00 62.25 ? 1007 NAG A O6  1 
HETATM 8639 O  O7  . NAG J 6 .   ? 82.876  48.489 -12.451 1.00 66.63 ? 1007 NAG A O7  1 
HETATM 8640 C  C1  . NAG K 6 .   ? 60.521  47.294 30.088  1.00 47.62 ? 1008 NAG A C1  1 
HETATM 8641 C  C2  . NAG K 6 .   ? 60.490  46.774 31.528  1.00 52.95 ? 1008 NAG A C2  1 
HETATM 8642 C  C3  . NAG K 6 .   ? 59.116  46.317 32.103  1.00 55.38 ? 1008 NAG A C3  1 
HETATM 8643 C  C4  . NAG K 6 .   ? 57.894  46.686 31.273  1.00 56.22 ? 1008 NAG A C4  1 
HETATM 8644 C  C5  . NAG K 6 .   ? 58.240  46.979 29.811  1.00 56.19 ? 1008 NAG A C5  1 
HETATM 8645 C  C6  . NAG K 6 .   ? 57.027  47.515 29.055  1.00 56.53 ? 1008 NAG A C6  1 
HETATM 8646 C  C7  . NAG K 6 .   ? 62.496  45.848 32.422  1.00 51.48 ? 1008 NAG A C7  1 
HETATM 8647 C  C8  . NAG K 6 .   ? 63.452  44.687 32.494  1.00 49.17 ? 1008 NAG A C8  1 
HETATM 8648 N  N2  . NAG K 6 .   ? 61.456  45.691 31.618  1.00 51.48 ? 1008 NAG A N2  1 
HETATM 8649 O  O3  . NAG K 6 .   ? 58.872  46.869 33.395  1.00 57.78 ? 1008 NAG A O3  1 
HETATM 8650 O  O4  . NAG K 6 .   ? 56.930  45.662 31.409  1.00 59.54 ? 1008 NAG A O4  1 
HETATM 8651 O  O5  . NAG K 6 .   ? 59.299  47.932 29.785  1.00 52.25 ? 1008 NAG A O5  1 
HETATM 8652 O  O6  . NAG K 6 .   ? 56.532  48.642 29.748  1.00 58.70 ? 1008 NAG A O6  1 
HETATM 8653 O  O7  . NAG K 6 .   ? 62.660  46.899 33.065  1.00 51.95 ? 1008 NAG A O7  1 
HETATM 8654 C  C1  . NAG L 6 .   ? 98.160  27.340 11.761  1.00 60.13 ? 1009 NAG A C1  1 
HETATM 8655 C  C2  . NAG L 6 .   ? 99.467  28.023 11.312  1.00 67.69 ? 1009 NAG A C2  1 
HETATM 8656 C  C3  . NAG L 6 .   ? 100.232 27.305 10.181  1.00 69.14 ? 1009 NAG A C3  1 
HETATM 8657 C  C4  . NAG L 6 .   ? 100.023 25.782 10.092  1.00 69.14 ? 1009 NAG A C4  1 
HETATM 8658 C  C5  . NAG L 6 .   ? 98.551  25.441 10.379  1.00 68.01 ? 1009 NAG A C5  1 
HETATM 8659 C  C6  . NAG L 6 .   ? 98.243  23.942 10.228  1.00 69.59 ? 1009 NAG A C6  1 
HETATM 8660 C  C7  . NAG L 6 .   ? 99.487  30.538 11.413  1.00 75.05 ? 1009 NAG A C7  1 
HETATM 8661 C  C8  . NAG L 6 .   ? 99.068  31.779 10.651  1.00 74.29 ? 1009 NAG A C8  1 
HETATM 8662 N  N2  . NAG L 6 .   ? 99.181  29.363 10.814  1.00 71.62 ? 1009 NAG A N2  1 
HETATM 8663 O  O3  . NAG L 6 .   ? 101.611 27.586 10.344  1.00 70.98 ? 1009 NAG A O3  1 
HETATM 8664 O  O4  . NAG L 6 .   ? 100.491 25.248 8.849   1.00 69.49 ? 1009 NAG A O4  1 
HETATM 8665 O  O5  . NAG L 6 .   ? 98.182  25.920 11.673  1.00 63.45 ? 1009 NAG A O5  1 
HETATM 8666 O  O6  . NAG L 6 .   ? 98.860  23.184 11.250  1.00 71.83 ? 1009 NAG A O6  1 
HETATM 8667 O  O7  . NAG L 6 .   ? 100.065 30.649 12.514  1.00 74.83 ? 1009 NAG A O7  1 
HETATM 8668 K  K   . K   M 7 .   ? 86.948  81.162 8.825   1.00 36.39 ? 1010 K   A K   1 
HETATM 8669 C  C8A . AFT N 2 .   ? 83.632  51.111 81.311  0.80 55.94 ? 1000 AFT B C8A 1 
HETATM 8670 C  C9B . AFT N 2 .   ? 83.301  54.500 80.819  0.80 54.30 ? 1000 AFT B C9B 1 
HETATM 8671 O  O7  . AFT N 2 .   ? 83.479  51.544 82.620  0.80 55.11 ? 1000 AFT B O7  1 
HETATM 8672 C  C6A . AFT N 2 .   ? 83.632  52.995 82.640  0.80 56.21 ? 1000 AFT B C6A 1 
HETATM 8673 O  O6A . AFT N 2 .   ? 82.415  53.788 82.814  0.80 56.71 ? 1000 AFT B O6A 1 
HETATM 8674 C  C5A . AFT N 2 .   ? 82.316  54.714 81.789  0.80 55.34 ? 1000 AFT B C5A 1 
HETATM 8675 C  C5B . AFT N 2 .   ? 81.394  55.748 81.603  0.80 53.02 ? 1000 AFT B C5B 1 
HETATM 8676 C  C4B . AFT N 2 .   ? 81.453  56.583 80.485  0.80 52.67 ? 1000 AFT B C4B 1 
HETATM 8677 O  O4  . AFT N 2 .   ? 80.534  57.599 80.328  0.80 52.18 ? 1000 AFT B O4  1 
HETATM 8678 C  CM  . AFT N 2 .   ? 79.905  58.113 81.523  0.80 50.01 ? 1000 AFT B CM  1 
HETATM 8679 C  C4A . AFT N 2 .   ? 82.458  56.357 79.516  0.80 53.24 ? 1000 AFT B C4A 1 
HETATM 8680 C  C10 . AFT N 2 .   ? 83.393  55.320 79.712  0.80 54.11 ? 1000 AFT B C10 1 
HETATM 8681 O  O10 . AFT N 2 .   ? 84.405  55.034 78.829  0.80 54.16 ? 1000 AFT B O10 1 
HETATM 8682 C  C11 . AFT N 2 .   ? 84.566  55.854 77.741  0.80 52.60 ? 1000 AFT B C11 1 
HETATM 8683 O  O11 . AFT N 2 .   ? 85.496  55.590 76.976  0.80 51.23 ? 1000 AFT B O11 1 
HETATM 8684 C  C12 . AFT N 2 .   ? 83.702  56.943 77.505  0.80 51.41 ? 1000 AFT B C12 1 
HETATM 8685 C  C3A . AFT N 2 .   ? 82.611  57.159 78.374  0.80 51.70 ? 1000 AFT B C3A 1 
HETATM 8686 C  C3  . AFT N 2 .   ? 81.810  58.409 77.959  0.80 49.73 ? 1000 AFT B C3  1 
HETATM 8687 C  C2A . AFT N 2 .   ? 82.508  58.913 76.702  0.80 48.52 ? 1000 AFT B C2A 1 
HETATM 8688 C  C9A . AFT N 2 .   ? 84.178  53.347 81.246  0.80 55.59 ? 1000 AFT B C9A 1 
HETATM 8689 C  C1  . AFT N 2 .   ? 83.683  57.932 76.504  0.80 50.09 ? 1000 AFT B C1  1 
HETATM 8690 C  C9  . AFT N 2 .   ? 83.969  52.071 80.439  0.80 55.55 ? 1000 AFT B C9  1 
HETATM 8691 O  O1  . AFT N 2 .   ? 84.501  58.015 75.579  0.80 46.20 ? 1000 AFT B O1  1 
HETATM 8692 CL CL  . CL  O 3 .   ? 117.352 46.600 64.744  1.00 61.06 ? 1001 CL  B CL  1 
HETATM 8693 CL CL  . CL  P 3 .   ? 96.838  30.669 97.839  1.00 67.80 ? 1002 CL  B CL  1 
HETATM 8694 C  C1  . PEG Q 4 .   ? 96.749  38.269 103.866 1.00 74.73 ? 1003 PEG B C1  1 
HETATM 8695 O  O1  . PEG Q 4 .   ? 96.293  36.958 103.475 1.00 74.67 ? 1003 PEG B O1  1 
HETATM 8696 C  C2  . PEG Q 4 .   ? 96.460  39.311 102.760 1.00 73.95 ? 1003 PEG B C2  1 
HETATM 8697 O  O2  . PEG Q 4 .   ? 97.026  38.910 101.464 1.00 72.28 ? 1003 PEG B O2  1 
HETATM 8698 C  C3  . PEG Q 4 .   ? 96.558  39.760 100.395 1.00 68.82 ? 1003 PEG B C3  1 
HETATM 8699 C  C4  . PEG Q 4 .   ? 97.787  40.127 99.551  1.00 67.90 ? 1003 PEG B C4  1 
HETATM 8700 O  O4  . PEG Q 4 .   ? 98.760  39.063 99.505  1.00 64.80 ? 1003 PEG B O4  1 
HETATM 8701 C  C1  . PGE R 5 .   ? 88.648  51.174 81.576  1.00 63.67 ? 1004 PGE B C1  1 
HETATM 8702 O  O1  . PGE R 5 .   ? 89.832  51.618 80.895  1.00 63.77 ? 1004 PGE B O1  1 
HETATM 8703 C  C2  . PGE R 5 .   ? 88.462  49.669 81.325  1.00 65.16 ? 1004 PGE B C2  1 
HETATM 8704 O  O2  . PGE R 5 .   ? 88.246  48.867 82.556  1.00 64.95 ? 1004 PGE B O2  1 
HETATM 8705 C  C3  . PGE R 5 .   ? 88.259  47.400 82.329  1.00 64.90 ? 1004 PGE B C3  1 
HETATM 8706 C  C4  . PGE R 5 .   ? 89.543  46.833 81.634  1.00 63.23 ? 1004 PGE B C4  1 
HETATM 8707 O  O4  . PGE R 5 .   ? 93.090  48.258 82.841  1.00 57.85 ? 1004 PGE B O4  1 
HETATM 8708 C  C6  . PGE R 5 .   ? 92.084  48.543 83.809  1.00 58.83 ? 1004 PGE B C6  1 
HETATM 8709 C  C5  . PGE R 5 .   ? 90.733  48.212 83.201  1.00 59.96 ? 1004 PGE B C5  1 
HETATM 8710 O  O3  . PGE R 5 .   ? 90.767  47.011 82.383  1.00 61.34 ? 1004 PGE B O3  1 
HETATM 8711 C  C1  . PEG S 4 .   ? 103.871 47.967 61.670  1.00 49.79 ? 1005 PEG B C1  1 
HETATM 8712 O  O1  . PEG S 4 .   ? 103.274 46.651 61.898  1.00 47.30 ? 1005 PEG B O1  1 
HETATM 8713 C  C2  . PEG S 4 .   ? 102.877 49.142 61.784  1.00 49.04 ? 1005 PEG B C2  1 
HETATM 8714 O  O2  . PEG S 4 .   ? 103.615 50.291 62.236  1.00 46.41 ? 1005 PEG B O2  1 
HETATM 8715 C  C3  . PEG S 4 .   ? 103.331 51.557 61.654  1.00 47.45 ? 1005 PEG B C3  1 
HETATM 8716 C  C4  . PEG S 4 .   ? 104.298 52.372 62.563  1.00 48.87 ? 1005 PEG B C4  1 
HETATM 8717 O  O4  . PEG S 4 .   ? 104.580 53.723 62.132  1.00 47.08 ? 1005 PEG B O4  1 
HETATM 8718 C  C1  . PEG T 4 .   ? 118.521 33.318 73.069  1.00 61.53 ? 1006 PEG B C1  1 
HETATM 8719 O  O1  . PEG T 4 .   ? 117.676 34.365 72.694  1.00 55.61 ? 1006 PEG B O1  1 
HETATM 8720 C  C2  . PEG T 4 .   ? 119.959 33.816 72.877  1.00 64.33 ? 1006 PEG B C2  1 
HETATM 8721 O  O2  . PEG T 4 .   ? 119.931 35.032 72.103  1.00 66.59 ? 1006 PEG B O2  1 
HETATM 8722 C  C3  . PEG T 4 .   ? 120.683 34.871 70.860  1.00 68.13 ? 1006 PEG B C3  1 
HETATM 8723 C  C4  . PEG T 4 .   ? 119.773 34.502 69.674  1.00 67.94 ? 1006 PEG B C4  1 
HETATM 8724 O  O4  . PEG T 4 .   ? 120.491 34.679 68.452  1.00 68.46 ? 1006 PEG B O4  1 
HETATM 8725 C  C1  . NAG U 6 .   ? 98.208  45.638 112.422 1.00 54.80 ? 1008 NAG B C1  1 
HETATM 8726 C  C2  . NAG U 6 .   ? 98.270  44.988 113.811 1.00 62.37 ? 1008 NAG B C2  1 
HETATM 8727 C  C3  . NAG U 6 .   ? 97.538  43.640 113.824 1.00 63.05 ? 1008 NAG B C3  1 
HETATM 8728 C  C4  . NAG U 6 .   ? 96.146  43.728 113.210 1.00 63.12 ? 1008 NAG B C4  1 
HETATM 8729 C  C5  . NAG U 6 .   ? 96.288  44.297 111.805 1.00 61.25 ? 1008 NAG B C5  1 
HETATM 8730 C  C6  . NAG U 6 .   ? 94.945  44.281 111.054 1.00 62.04 ? 1008 NAG B C6  1 
HETATM 8731 C  C7  . NAG U 6 .   ? 100.223 45.514 115.238 1.00 65.91 ? 1008 NAG B C7  1 
HETATM 8732 C  C8  . NAG U 6 .   ? 101.670 45.197 115.546 1.00 65.92 ? 1008 NAG B C8  1 
HETATM 8733 N  N2  . NAG U 6 .   ? 99.657  44.814 114.235 1.00 63.90 ? 1008 NAG B N2  1 
HETATM 8734 O  O3  . NAG U 6 .   ? 97.396  43.176 115.144 1.00 65.09 ? 1008 NAG B O3  1 
HETATM 8735 O  O4  . NAG U 6 .   ? 95.584  42.427 113.159 1.00 65.91 ? 1008 NAG B O4  1 
HETATM 8736 O  O5  . NAG U 6 .   ? 96.891  45.589 111.873 1.00 58.30 ? 1008 NAG B O5  1 
HETATM 8737 O  O6  . NAG U 6 .   ? 94.042  45.298 111.433 1.00 61.06 ? 1008 NAG B O6  1 
HETATM 8738 O  O7  . NAG U 6 .   ? 99.630  46.379 115.893 1.00 65.42 ? 1008 NAG B O7  1 
HETATM 8739 C  C1  . NAG V 6 .   ? 122.922 46.531 73.474  1.00 38.88 ? 1009 NAG B C1  1 
HETATM 8740 C  C2  . NAG V 6 .   ? 123.119 45.940 72.071  1.00 43.38 ? 1009 NAG B C2  1 
HETATM 8741 C  C3  . NAG V 6 .   ? 124.442 45.171 71.975  1.00 44.48 ? 1009 NAG B C3  1 
HETATM 8742 C  C4  . NAG V 6 .   ? 125.622 45.955 72.525  1.00 46.92 ? 1009 NAG B C4  1 
HETATM 8743 C  C5  . NAG V 6 .   ? 125.285 46.445 73.937  1.00 46.80 ? 1009 NAG B C5  1 
HETATM 8744 C  C6  . NAG V 6 .   ? 126.374 47.362 74.473  1.00 48.13 ? 1009 NAG B C6  1 
HETATM 8745 C  C7  . NAG V 6 .   ? 121.066 45.289 70.937  1.00 40.28 ? 1009 NAG B C7  1 
HETATM 8746 C  C8  . NAG V 6 .   ? 120.124 44.162 70.630  1.00 38.49 ? 1009 NAG B C8  1 
HETATM 8747 N  N2  . NAG V 6 .   ? 122.084 44.971 71.711  1.00 41.92 ? 1009 NAG B N2  1 
HETATM 8748 O  O3  . NAG V 6 .   ? 124.721 44.848 70.633  1.00 47.27 ? 1009 NAG B O3  1 
HETATM 8749 O  O4  . NAG V 6 .   ? 126.796 45.144 72.461  1.00 49.27 ? 1009 NAG B O4  1 
HETATM 8750 O  O5  . NAG V 6 .   ? 124.090 47.215 73.891  1.00 43.91 ? 1009 NAG B O5  1 
HETATM 8751 O  O6  . NAG V 6 .   ? 126.694 48.257 73.431  1.00 47.70 ? 1009 NAG B O6  1 
HETATM 8752 O  O7  . NAG V 6 .   ? 120.904 46.436 70.506  1.00 39.23 ? 1009 NAG B O7  1 
HETATM 8753 O  O   . HOH W 8 .   ? 98.081  53.075 19.218  1.00 35.55 ? 2001 HOH A O   1 
HETATM 8754 O  O   . HOH W 8 .   ? 103.643 54.013 19.902  1.00 33.55 ? 2002 HOH A O   1 
HETATM 8755 O  O   . HOH W 8 .   ? 100.104 54.267 27.372  1.00 42.85 ? 2003 HOH A O   1 
HETATM 8756 O  O   . HOH W 8 .   ? 102.181 62.675 28.327  1.00 31.98 ? 2004 HOH A O   1 
HETATM 8757 O  O   . HOH W 8 .   ? 103.421 60.644 29.212  1.00 53.66 ? 2005 HOH A O   1 
HETATM 8758 O  O   . HOH W 8 .   ? 73.881  60.657 1.359   1.00 32.70 ? 2006 HOH A O   1 
HETATM 8759 O  O   . HOH W 8 .   ? 85.758  67.086 -2.220  1.00 30.86 ? 2007 HOH A O   1 
HETATM 8760 O  O   . HOH W 8 .   ? 104.606 56.613 25.645  1.00 33.44 ? 2008 HOH A O   1 
HETATM 8761 O  O   . HOH W 8 .   ? 55.376  45.685 35.474  1.00 43.60 ? 2009 HOH A O   1 
HETATM 8762 O  O   . HOH W 8 .   ? 77.216  70.055 1.711   1.00 44.76 ? 2010 HOH A O   1 
HETATM 8763 O  O   . HOH W 8 .   ? 77.906  25.417 4.689   1.00 16.70 ? 2011 HOH A O   1 
HETATM 8764 O  O   . HOH W 8 .   ? 72.580  39.298 -0.373  1.00 11.42 ? 2012 HOH A O   1 
HETATM 8765 O  O   . HOH W 8 .   ? 102.082 57.675 9.227   1.00 26.76 ? 2013 HOH A O   1 
HETATM 8766 O  O   . HOH W 8 .   ? 107.226 39.548 15.556  1.00 32.18 ? 2014 HOH A O   1 
HETATM 8767 O  O   . HOH W 8 .   ? 64.609  60.617 23.318  1.00 43.91 ? 2015 HOH A O   1 
HETATM 8768 O  O   . HOH W 8 .   ? 82.706  60.091 1.913   1.00 16.23 ? 2016 HOH A O   1 
HETATM 8769 O  O   . HOH W 8 .   ? 100.081 53.746 7.881   1.00 34.70 ? 2017 HOH A O   1 
HETATM 8770 O  O   . HOH W 8 .   ? 99.020  50.647 3.545   1.00 32.95 ? 2018 HOH A O   1 
HETATM 8771 O  O   . HOH W 8 .   ? 80.331  75.903 28.371  1.00 32.86 ? 2019 HOH A O   1 
HETATM 8772 O  O   . HOH W 8 .   ? 78.537  73.716 29.011  1.00 25.25 ? 2020 HOH A O   1 
HETATM 8773 O  O   . HOH W 8 .   ? 80.558  64.600 -3.038  1.00 34.56 ? 2021 HOH A O   1 
HETATM 8774 O  O   . HOH W 8 .   ? 81.455  66.429 5.351   1.00 26.44 ? 2022 HOH A O   1 
HETATM 8775 O  O   . HOH W 8 .   ? 81.913  68.990 -0.575  1.00 21.05 ? 2023 HOH A O   1 
HETATM 8776 O  O   . HOH W 8 .   ? 84.357  68.133 0.218   1.00 30.53 ? 2024 HOH A O   1 
HETATM 8777 O  O   . HOH W 8 .   ? 85.812  70.710 0.902   1.00 31.96 ? 2025 HOH A O   1 
HETATM 8778 O  O   . HOH W 8 .   ? 92.309  69.440 4.163   1.00 26.58 ? 2026 HOH A O   1 
HETATM 8779 O  O   . HOH W 8 .   ? 92.369  71.837 5.570   1.00 26.53 ? 2027 HOH A O   1 
HETATM 8780 O  O   . HOH W 8 .   ? 87.975  73.382 0.448   1.00 12.21 ? 2028 HOH A O   1 
HETATM 8781 O  O   . HOH W 8 .   ? 86.877  41.527 2.623   1.00 36.95 ? 2029 HOH A O   1 
HETATM 8782 O  O   . HOH W 8 .   ? 83.046  68.580 6.897   0.50 16.15 ? 2030 HOH A O   1 
HETATM 8783 O  O   . HOH W 8 .   ? 79.306  69.810 17.715  1.00 32.70 ? 2031 HOH A O   1 
HETATM 8784 O  O   . HOH W 8 .   ? 74.435  69.592 3.084   1.00 38.79 ? 2032 HOH A O   1 
HETATM 8785 O  O   . HOH W 8 .   ? 75.393  68.183 1.281   1.00 34.36 ? 2033 HOH A O   1 
HETATM 8786 O  O   . HOH W 8 .   ? 83.001  60.658 -0.817  1.00 22.91 ? 2034 HOH A O   1 
HETATM 8787 O  O   . HOH W 8 .   ? 78.291  63.214 -5.058  1.00 38.16 ? 2035 HOH A O   1 
HETATM 8788 O  O   . HOH W 8 .   ? 80.747  67.917 -4.131  1.00 35.77 ? 2036 HOH A O   1 
HETATM 8789 O  O   . HOH W 8 .   ? 71.286  59.799 -7.528  1.00 19.48 ? 2037 HOH A O   1 
HETATM 8790 O  O   . HOH W 8 .   ? 73.469  56.420 -8.969  1.00 26.10 ? 2038 HOH A O   1 
HETATM 8791 O  O   . HOH W 8 .   ? 82.659  54.396 -7.794  1.00 21.07 ? 2039 HOH A O   1 
HETATM 8792 O  O   . HOH W 8 .   ? 88.261  56.016 0.145   1.00 22.98 ? 2040 HOH A O   1 
HETATM 8793 O  O   . HOH W 8 .   ? 91.073  58.342 -2.452  1.00 37.71 ? 2041 HOH A O   1 
HETATM 8794 O  O   . HOH W 8 .   ? 87.114  54.829 6.310   1.00 20.03 ? 2042 HOH A O   1 
HETATM 8795 O  O   . HOH W 8 .   ? 73.314  63.449 11.000  1.00 22.59 ? 2043 HOH A O   1 
HETATM 8796 O  O   . HOH W 8 .   ? 96.125  56.906 -1.014  1.00 33.26 ? 2044 HOH A O   1 
HETATM 8797 O  O   . HOH W 8 .   ? 88.497  53.625 8.380   1.00 21.10 ? 2045 HOH A O   1 
HETATM 8798 O  O   . HOH W 8 .   ? 74.698  68.716 13.877  1.00 32.68 ? 2046 HOH A O   1 
HETATM 8799 O  O   . HOH W 8 .   ? 99.634  60.808 7.065   1.00 34.30 ? 2047 HOH A O   1 
HETATM 8800 O  O   . HOH W 8 .   ? 94.749  63.384 3.531   1.00 23.01 ? 2048 HOH A O   1 
HETATM 8801 O  O   . HOH W 8 .   ? 91.180  61.733 11.555  1.00 15.48 ? 2049 HOH A O   1 
HETATM 8802 O  O   . HOH W 8 .   ? 91.217  62.158 9.026   1.00 23.75 ? 2050 HOH A O   1 
HETATM 8803 O  O   . HOH W 8 .   ? 94.739  62.207 13.758  1.00 20.88 ? 2051 HOH A O   1 
HETATM 8804 O  O   . HOH W 8 .   ? 73.943  34.268 42.088  1.00 27.35 ? 2052 HOH A O   1 
HETATM 8805 O  O   . HOH W 8 .   ? 100.619 58.742 11.019  1.00 20.66 ? 2053 HOH A O   1 
HETATM 8806 O  O   . HOH W 8 .   ? 68.309  45.757 -5.407  1.00 35.82 ? 2054 HOH A O   1 
HETATM 8807 O  O   . HOH W 8 .   ? 87.524  40.398 46.048  1.00 38.68 ? 2055 HOH A O   1 
HETATM 8808 O  O   . HOH W 8 .   ? 98.742  49.689 18.289  1.00 38.10 ? 2056 HOH A O   1 
HETATM 8809 O  O   . HOH W 8 .   ? 105.227 54.866 17.172  1.00 28.16 ? 2057 HOH A O   1 
HETATM 8810 O  O   . HOH W 8 .   ? 108.248 56.914 11.152  1.00 38.44 ? 2058 HOH A O   1 
HETATM 8811 O  O   . HOH W 8 .   ? 102.126 49.667 10.388  1.00 35.49 ? 2059 HOH A O   1 
HETATM 8812 O  O   . HOH W 8 .   ? 109.700 52.668 23.752  1.00 35.64 ? 2060 HOH A O   1 
HETATM 8813 O  O   . HOH W 8 .   ? 104.112 48.600 16.457  1.00 27.93 ? 2061 HOH A O   1 
HETATM 8814 O  O   . HOH W 8 .   ? 110.884 44.841 12.376  1.00 30.44 ? 2062 HOH A O   1 
HETATM 8815 O  O   . HOH W 8 .   ? 104.191 39.182 14.773  1.00 27.79 ? 2063 HOH A O   1 
HETATM 8816 O  O   . HOH W 8 .   ? 64.486  57.999 23.576  1.00 28.61 ? 2064 HOH A O   1 
HETATM 8817 O  O   . HOH W 8 .   ? 104.627 44.712 9.372   1.00 36.01 ? 2065 HOH A O   1 
HETATM 8818 O  O   . HOH W 8 .   ? 93.225  43.433 12.768  1.00 24.44 ? 2066 HOH A O   1 
HETATM 8819 O  O   . HOH W 8 .   ? 92.697  50.844 16.047  1.00 23.45 ? 2067 HOH A O   1 
HETATM 8820 O  O   . HOH W 8 .   ? 81.223  62.058 34.339  1.00 27.01 ? 2068 HOH A O   1 
HETATM 8821 O  O   . HOH W 8 .   ? 96.092  46.480 10.810  1.00 22.49 ? 2069 HOH A O   1 
HETATM 8822 O  O   . HOH W 8 .   ? 99.542  51.266 9.264   1.00 33.63 ? 2070 HOH A O   1 
HETATM 8823 O  O   . HOH W 8 .   ? 90.314  66.535 31.848  1.00 28.93 ? 2071 HOH A O   1 
HETATM 8824 O  O   . HOH W 8 .   ? 96.972  49.308 1.492   1.00 36.79 ? 2072 HOH A O   1 
HETATM 8825 O  O   . HOH W 8 .   ? 90.270  69.675 32.968  1.00 41.06 ? 2073 HOH A O   1 
HETATM 8826 O  O   . HOH W 8 .   ? 81.600  74.205 30.672  1.00 21.89 ? 2074 HOH A O   1 
HETATM 8827 O  O   . HOH W 8 .   ? 84.733  77.528 29.754  1.00 17.98 ? 2075 HOH A O   1 
HETATM 8828 O  O   . HOH W 8 .   ? 95.992  46.152 1.033   1.00 39.83 ? 2076 HOH A O   1 
HETATM 8829 O  O   . HOH W 8 .   ? 98.470  54.135 6.058   1.00 25.00 ? 2077 HOH A O   1 
HETATM 8830 O  O   . HOH W 8 .   ? 91.928  43.792 3.876   1.00 31.82 ? 2078 HOH A O   1 
HETATM 8831 O  O   . HOH W 8 .   ? 91.937  52.484 -0.148  1.00 39.09 ? 2079 HOH A O   1 
HETATM 8832 O  O   . HOH W 8 .   ? 92.137  45.746 -1.485  1.00 29.15 ? 2080 HOH A O   1 
HETATM 8833 O  O   . HOH W 8 .   ? 98.770  56.099 4.108   1.00 25.11 ? 2081 HOH A O   1 
HETATM 8834 O  O   . HOH W 8 .   ? 103.366 83.688 13.660  1.00 23.23 ? 2082 HOH A O   1 
HETATM 8835 O  O   . HOH W 8 .   ? 100.910 83.983 21.370  1.00 22.17 ? 2083 HOH A O   1 
HETATM 8836 O  O   . HOH W 8 .   ? 89.126  63.586 7.713   1.00 15.74 ? 2084 HOH A O   1 
HETATM 8837 O  O   . HOH W 8 .   ? 89.539  66.375 7.886   1.00 13.98 ? 2085 HOH A O   1 
HETATM 8838 O  O   . HOH W 8 .   ? 94.651  65.969 3.019   1.00 31.66 ? 2086 HOH A O   1 
HETATM 8839 O  O   . HOH W 8 .   ? 85.480  61.070 -2.589  1.00 17.48 ? 2087 HOH A O   1 
HETATM 8840 O  O   . HOH W 8 .   ? 90.020  60.800 -2.345  1.00 35.57 ? 2088 HOH A O   1 
HETATM 8841 O  O   . HOH W 8 .   ? 85.180  61.348 3.040   1.00 21.34 ? 2089 HOH A O   1 
HETATM 8842 O  O   . HOH W 8 .   ? 87.026  56.854 -2.050  1.00 36.03 ? 2090 HOH A O   1 
HETATM 8843 O  O   . HOH W 8 .   ? 84.561  40.761 4.005   1.00 22.08 ? 2091 HOH A O   1 
HETATM 8844 O  O   . HOH W 8 .   ? 68.678  38.258 -2.560  1.00 31.57 ? 2092 HOH A O   1 
HETATM 8845 O  O   . HOH W 8 .   ? 83.239  69.866 31.809  1.00 24.38 ? 2093 HOH A O   1 
HETATM 8846 O  O   . HOH W 8 .   ? 64.412  42.585 1.497   1.00 27.58 ? 2094 HOH A O   1 
HETATM 8847 O  O   . HOH W 8 .   ? 94.357  51.931 17.643  1.00 18.74 ? 2095 HOH A O   1 
HETATM 8848 O  O   . HOH W 8 .   ? 89.536  55.469 10.116  1.00 24.39 ? 2096 HOH A O   1 
HETATM 8849 O  O   . HOH W 8 .   ? 93.649  52.172 12.730  1.00 16.57 ? 2097 HOH A O   1 
HETATM 8850 O  O   . HOH W 8 .   ? 85.105  53.056 6.621   1.00 25.92 ? 2098 HOH A O   1 
HETATM 8851 O  O   . HOH W 8 .   ? 114.256 47.984 38.435  1.00 31.06 ? 2099 HOH A O   1 
HETATM 8852 O  O   . HOH W 8 .   ? 89.294  39.044 9.046   1.00 29.52 ? 2100 HOH A O   1 
HETATM 8853 O  O   . HOH W 8 .   ? 90.650  43.512 6.543   1.00 24.39 ? 2101 HOH A O   1 
HETATM 8854 O  O   . HOH W 8 .   ? 94.014  44.399 10.000  1.00 29.42 ? 2102 HOH A O   1 
HETATM 8855 O  O   . HOH W 8 .   ? 94.871  43.523 7.061   1.00 34.90 ? 2103 HOH A O   1 
HETATM 8856 O  O   . HOH W 8 .   ? 106.971 58.375 45.799  1.00 32.13 ? 2104 HOH A O   1 
HETATM 8857 O  O   . HOH W 8 .   ? 84.264  46.267 9.507   1.00 21.53 ? 2105 HOH A O   1 
HETATM 8858 O  O   . HOH W 8 .   ? 90.003  50.334 15.960  1.00 23.75 ? 2106 HOH A O   1 
HETATM 8859 O  O   . HOH W 8 .   ? 87.555  48.757 18.716  1.00 20.82 ? 2107 HOH A O   1 
HETATM 8860 O  O   . HOH W 8 .   ? 82.277  38.876 11.621  1.00 20.67 ? 2108 HOH A O   1 
HETATM 8861 O  O   . HOH W 8 .   ? 86.904  38.687 3.433   1.00 31.18 ? 2109 HOH A O   1 
HETATM 8862 O  O   . HOH W 8 .   ? 100.222 56.402 53.425  1.00 26.23 ? 2110 HOH A O   1 
HETATM 8863 O  O   . HOH W 8 .   ? 97.076  42.272 55.651  1.00 22.34 ? 2111 HOH A O   1 
HETATM 8864 O  O   . HOH W 8 .   ? 78.619  29.711 11.265  1.00 35.61 ? 2112 HOH A O   1 
HETATM 8865 O  O   . HOH W 8 .   ? 108.653 49.115 54.126  1.00 24.74 ? 2113 HOH A O   1 
HETATM 8866 O  O   . HOH W 8 .   ? 73.447  30.657 16.047  1.00 27.14 ? 2114 HOH A O   1 
HETATM 8867 O  O   . HOH W 8 .   ? 66.748  34.123 10.656  1.00 30.69 ? 2115 HOH A O   1 
HETATM 8868 O  O   . HOH W 8 .   ? 83.640  51.126 13.083  1.00 14.54 ? 2116 HOH A O   1 
HETATM 8869 O  O   . HOH W 8 .   ? 88.896  55.915 18.458  1.00 19.55 ? 2117 HOH A O   1 
HETATM 8870 O  O   . HOH W 8 .   ? 95.537  64.594 15.187  1.00 18.36 ? 2118 HOH A O   1 
HETATM 8871 O  O   . HOH W 8 .   ? 88.231  67.320 10.088  1.00 13.55 ? 2119 HOH A O   1 
HETATM 8872 O  O   . HOH W 8 .   ? 85.831  67.521 20.602  1.00 13.93 ? 2120 HOH A O   1 
HETATM 8873 O  O   . HOH W 8 .   ? 95.937  37.685 23.258  1.00 27.56 ? 2121 HOH A O   1 
HETATM 8874 O  O   . HOH W 8 .   ? 107.123 36.352 29.350  1.00 25.27 ? 2122 HOH A O   1 
HETATM 8875 O  O   . HOH W 8 .   ? 80.776  73.006 11.705  1.00 22.76 ? 2123 HOH A O   1 
HETATM 8876 O  O   . HOH W 8 .   ? 77.037  80.490 16.381  1.00 37.86 ? 2124 HOH A O   1 
HETATM 8877 O  O   . HOH W 8 .   ? 82.632  79.983 8.273   1.00 24.31 ? 2125 HOH A O   1 
HETATM 8878 O  O   . HOH W 8 .   ? 85.464  70.664 15.683  1.00 14.19 ? 2126 HOH A O   1 
HETATM 8879 O  O   . HOH W 8 .   ? 79.246  25.282 19.904  1.00 16.55 ? 2127 HOH A O   1 
HETATM 8880 O  O   . HOH W 8 .   ? 75.641  64.282 12.082  1.00 17.56 ? 2128 HOH A O   1 
HETATM 8881 O  O   . HOH W 8 .   ? 74.068  67.779 18.689  1.00 32.12 ? 2129 HOH A O   1 
HETATM 8882 O  O   . HOH W 8 .   ? 73.231  66.091 14.113  1.00 32.82 ? 2130 HOH A O   1 
HETATM 8883 O  O   . HOH W 8 .   ? 66.879  62.088 12.705  1.00 35.25 ? 2131 HOH A O   1 
HETATM 8884 O  O   . HOH W 8 .   ? 71.000  63.441 12.207  1.00 23.28 ? 2132 HOH A O   1 
HETATM 8885 O  O   . HOH W 8 .   ? 72.898  60.247 6.474   1.00 32.59 ? 2133 HOH A O   1 
HETATM 8886 O  O   . HOH W 8 .   ? 63.598  54.851 8.380   1.00 25.30 ? 2134 HOH A O   1 
HETATM 8887 O  O   . HOH W 8 .   ? 72.084  33.390 40.848  1.00 22.38 ? 2135 HOH A O   1 
HETATM 8888 O  O   . HOH W 8 .   ? 70.855  59.783 5.289   1.00 15.91 ? 2136 HOH A O   1 
HETATM 8889 O  O   . HOH W 8 .   ? 85.219  39.821 38.705  1.00 35.56 ? 2137 HOH A O   1 
HETATM 8890 O  O   . HOH W 8 .   ? 70.622  58.886 2.579   1.00 27.14 ? 2138 HOH A O   1 
HETATM 8891 O  O   . HOH W 8 .   ? 66.125  52.138 5.901   1.00 18.58 ? 2139 HOH A O   1 
HETATM 8892 O  O   . HOH W 8 .   ? 62.377  49.370 0.582   1.00 36.74 ? 2140 HOH A O   1 
HETATM 8893 O  O   . HOH W 8 .   ? 67.002  46.999 -2.740  1.00 24.44 ? 2141 HOH A O   1 
HETATM 8894 O  O   . HOH W 8 .   ? 89.649  44.027 45.110  0.50 27.15 ? 2142 HOH A O   1 
HETATM 8895 O  O   . HOH W 8 .   ? 86.544  42.545 47.462  1.00 37.24 ? 2143 HOH A O   1 
HETATM 8896 O  O   . HOH W 8 .   ? 66.707  51.242 15.275  1.00 7.37  ? 2144 HOH A O   1 
HETATM 8897 O  O   . HOH W 8 .   ? 67.424  53.750 12.156  1.00 29.95 ? 2145 HOH A O   1 
HETATM 8898 O  O   . HOH W 8 .   ? 69.040  45.976 17.337  1.00 22.37 ? 2146 HOH A O   1 
HETATM 8899 O  O   . HOH W 8 .   ? 88.212  45.367 24.848  1.00 22.95 ? 2147 HOH A O   1 
HETATM 8900 O  O   . HOH W 8 .   ? 90.023  53.175 22.784  1.00 38.51 ? 2148 HOH A O   1 
HETATM 8901 O  O   . HOH W 8 .   ? 89.510  50.243 26.773  1.00 48.20 ? 2149 HOH A O   1 
HETATM 8902 O  O   . HOH W 8 .   ? 72.055  66.410 21.134  1.00 38.37 ? 2150 HOH A O   1 
HETATM 8903 O  O   . HOH W 8 .   ? 64.791  61.581 27.945  1.00 34.85 ? 2151 HOH A O   1 
HETATM 8904 O  O   . HOH W 8 .   ? 67.569  61.279 17.677  1.00 29.80 ? 2152 HOH A O   1 
HETATM 8905 O  O   . HOH W 8 .   ? 63.849  57.121 21.145  1.00 41.01 ? 2153 HOH A O   1 
HETATM 8906 O  O   . HOH W 8 .   ? 70.619  53.750 12.443  1.00 29.69 ? 2154 HOH A O   1 
HETATM 8907 O  O   . HOH W 8 .   ? 64.755  52.554 16.726  1.00 24.59 ? 2155 HOH A O   1 
HETATM 8908 O  O   . HOH W 8 .   ? 63.241  44.186 19.375  1.00 20.78 ? 2156 HOH A O   1 
HETATM 8909 O  O   . HOH W 8 .   ? 82.247  58.247 36.427  1.00 20.84 ? 2157 HOH A O   1 
HETATM 8910 O  O   . HOH W 8 .   ? 83.247  61.940 32.530  1.00 34.30 ? 2158 HOH A O   1 
HETATM 8911 O  O   . HOH W 8 .   ? 84.099  61.064 30.033  1.00 23.19 ? 2159 HOH A O   1 
HETATM 8912 O  O   . HOH W 8 .   ? 91.847  61.709 27.097  1.00 18.65 ? 2160 HOH A O   1 
HETATM 8913 O  O   . HOH W 8 .   ? 89.808  63.983 30.158  1.00 20.75 ? 2161 HOH A O   1 
HETATM 8914 O  O   . HOH W 8 .   ? 82.912  64.725 31.518  1.00 23.75 ? 2162 HOH A O   1 
HETATM 8915 O  O   . HOH W 8 .   ? 88.536  68.566 31.265  1.00 18.94 ? 2163 HOH A O   1 
HETATM 8916 O  O   . HOH W 8 .   ? 86.394  74.168 23.547  1.00 13.44 ? 2164 HOH A O   1 
HETATM 8917 O  O   . HOH W 8 .   ? 84.820  74.774 30.429  1.00 20.39 ? 2165 HOH A O   1 
HETATM 8918 O  O   . HOH W 8 .   ? 90.872  77.448 28.047  1.00 17.71 ? 2166 HOH A O   1 
HETATM 8919 O  O   . HOH W 8 .   ? 91.830  73.752 31.002  1.00 37.55 ? 2167 HOH A O   1 
HETATM 8920 O  O   . HOH W 8 .   ? 90.779  70.694 21.316  1.00 14.13 ? 2168 HOH A O   1 
HETATM 8921 O  O   . HOH W 8 .   ? 91.536  80.956 23.612  1.00 20.37 ? 2169 HOH A O   1 
HETATM 8922 O  O   . HOH W 8 .   ? 92.429  63.788 29.006  1.00 17.78 ? 2170 HOH A O   1 
HETATM 8923 O  O   . HOH W 8 .   ? 103.272 71.399 24.164  1.00 37.44 ? 2171 HOH A O   1 
HETATM 8924 O  O   . HOH W 8 .   ? 104.129 75.381 23.559  1.00 31.69 ? 2172 HOH A O   1 
HETATM 8925 O  O   . HOH W 8 .   ? 103.622 79.692 18.302  1.00 23.36 ? 2173 HOH A O   1 
HETATM 8926 O  O   . HOH W 8 .   ? 106.512 83.108 12.983  1.00 21.39 ? 2174 HOH A O   1 
HETATM 8927 O  O   . HOH W 8 .   ? 93.057  81.756 20.676  1.00 29.28 ? 2175 HOH A O   1 
HETATM 8928 O  O   . HOH W 8 .   ? 98.637  85.952 20.576  1.00 19.46 ? 2176 HOH A O   1 
HETATM 8929 O  O   . HOH W 8 .   ? 88.655  84.161 18.739  1.00 18.17 ? 2177 HOH A O   1 
HETATM 8930 O  O   . HOH W 8 .   ? 87.425  84.425 16.090  1.00 15.45 ? 2178 HOH A O   1 
HETATM 8931 O  O   . HOH W 8 .   ? 96.144  81.838 9.757   1.00 23.30 ? 2179 HOH A O   1 
HETATM 8932 O  O   . HOH W 8 .   ? 106.925 70.894 5.507   1.00 50.66 ? 2180 HOH A O   1 
HETATM 8933 O  O   . HOH W 8 .   ? 103.182 60.671 14.381  1.00 22.15 ? 2181 HOH A O   1 
HETATM 8934 O  O   . HOH W 8 .   ? 100.594 64.619 5.728   1.00 31.36 ? 2182 HOH A O   1 
HETATM 8935 O  O   . HOH W 8 .   ? 105.097 69.082 12.491  1.00 16.02 ? 2183 HOH A O   1 
HETATM 8936 O  O   . HOH W 8 .   ? 105.290 71.556 11.326  1.00 24.17 ? 2184 HOH A O   1 
HETATM 8937 O  O   . HOH W 8 .   ? 102.878 61.934 17.106  1.00 36.64 ? 2185 HOH A O   1 
HETATM 8938 O  O   . HOH W 8 .   ? 103.166 64.359 19.381  1.00 22.95 ? 2186 HOH A O   1 
HETATM 8939 O  O   . HOH W 8 .   ? 96.064  60.614 15.637  1.00 11.98 ? 2187 HOH A O   1 
HETATM 8940 O  O   . HOH W 8 .   ? 96.311  61.724 21.612  1.00 22.79 ? 2188 HOH A O   1 
HETATM 8941 O  O   . HOH W 8 .   ? 93.939  62.672 19.696  1.00 19.91 ? 2189 HOH A O   1 
HETATM 8942 O  O   . HOH W 8 .   ? 67.156  49.430 -4.098  1.00 20.73 ? 2190 HOH A O   1 
HETATM 8943 O  O   . HOH W 8 .   ? 97.683  63.988 30.343  1.00 37.57 ? 2191 HOH A O   1 
HETATM 8944 O  O   . HOH W 8 .   ? 101.752 62.413 35.873  1.00 28.13 ? 2192 HOH A O   1 
HETATM 8945 O  O   . HOH W 8 .   ? 69.001  58.920 -6.264  1.00 31.69 ? 2193 HOH A O   1 
HETATM 8946 O  O   . HOH W 8 .   ? 91.199  68.623 23.085  1.00 32.92 ? 2194 HOH A O   1 
HETATM 8947 O  O   . HOH W 8 .   ? 92.065  61.252 21.066  1.00 21.13 ? 2195 HOH A O   1 
HETATM 8948 O  O   . HOH W 8 .   ? 88.743  67.886 22.248  1.00 17.23 ? 2196 HOH A O   1 
HETATM 8949 O  O   . HOH W 8 .   ? 82.412  71.676 29.688  1.00 22.57 ? 2197 HOH A O   1 
HETATM 8950 O  O   . HOH W 8 .   ? 70.378  67.073 31.512  1.00 26.35 ? 2198 HOH A O   1 
HETATM 8951 O  O   . HOH W 8 .   ? 77.501  67.904 37.126  1.00 23.33 ? 2199 HOH A O   1 
HETATM 8952 O  O   . HOH W 8 .   ? 75.810  70.294 34.080  1.00 21.22 ? 2200 HOH A O   1 
HETATM 8953 O  O   . HOH W 8 .   ? 80.793  65.791 32.225  1.00 14.07 ? 2201 HOH A O   1 
HETATM 8954 O  O   . HOH W 8 .   ? 79.785  64.315 34.525  1.00 22.03 ? 2202 HOH A O   1 
HETATM 8955 O  O   . HOH W 8 .   ? 64.922  62.704 37.343  1.00 28.28 ? 2203 HOH A O   1 
HETATM 8956 O  O   . HOH W 8 .   ? 67.628  66.900 26.795  1.00 25.20 ? 2204 HOH A O   1 
HETATM 8957 O  O   . HOH W 8 .   ? 63.216  60.525 32.857  1.00 32.99 ? 2205 HOH A O   1 
HETATM 8958 O  O   . HOH W 8 .   ? 94.785  35.369 32.025  1.00 31.94 ? 2206 HOH A O   1 
HETATM 8959 O  O   . HOH W 8 .   ? 90.791  45.455 34.164  1.00 45.50 ? 2207 HOH A O   1 
HETATM 8960 O  O   . HOH W 8 .   ? 90.141  42.885 36.505  1.00 30.87 ? 2208 HOH A O   1 
HETATM 8961 O  O   . HOH W 8 .   ? 93.729  40.412 36.764  1.00 37.03 ? 2209 HOH A O   1 
HETATM 8962 O  O   . HOH W 8 .   ? 95.223  45.925 28.287  1.00 23.89 ? 2210 HOH A O   1 
HETATM 8963 O  O   . HOH W 8 .   ? 65.400  51.589 -7.676  1.00 11.89 ? 2211 HOH A O   1 
HETATM 8964 O  O   . HOH W 8 .   ? 106.874 51.284 29.057  1.00 25.50 ? 2212 HOH A O   1 
HETATM 8965 O  O   . HOH W 8 .   ? 107.667 53.694 28.190  1.00 31.27 ? 2213 HOH A O   1 
HETATM 8966 O  O   . HOH W 8 .   ? 81.227  32.909 -5.609  1.00 32.54 ? 2214 HOH A O   1 
HETATM 8967 O  O   . HOH W 8 .   ? 111.141 50.524 31.567  1.00 20.32 ? 2215 HOH A O   1 
HETATM 8968 O  O   . HOH W 8 .   ? 108.545 46.544 25.430  1.00 31.25 ? 2216 HOH A O   1 
HETATM 8969 O  O   . HOH W 8 .   ? 108.566 41.128 18.244  1.00 26.53 ? 2217 HOH A O   1 
HETATM 8970 O  O   . HOH W 8 .   ? 113.145 43.063 25.322  1.00 25.85 ? 2218 HOH A O   1 
HETATM 8971 O  O   . HOH W 8 .   ? 110.921 45.951 35.880  1.00 22.34 ? 2219 HOH A O   1 
HETATM 8972 O  O   . HOH W 8 .   ? 107.466 51.943 49.710  1.00 35.56 ? 2220 HOH A O   1 
HETATM 8973 O  O   . HOH W 8 .   ? 112.408 50.571 44.514  1.00 30.51 ? 2221 HOH A O   1 
HETATM 8974 O  O   . HOH W 8 .   ? 110.864 47.671 37.909  1.00 18.54 ? 2222 HOH A O   1 
HETATM 8975 O  O   . HOH W 8 .   ? 105.463 51.882 36.390  1.00 16.19 ? 2223 HOH A O   1 
HETATM 8976 O  O   . HOH W 8 .   ? 112.773 51.314 35.605  1.00 19.30 ? 2224 HOH A O   1 
HETATM 8977 O  O   . HOH W 8 .   ? 110.467 54.917 38.381  1.00 10.92 ? 2225 HOH A O   1 
HETATM 8978 O  O   . HOH W 8 .   ? 103.054 58.148 43.117  1.00 22.16 ? 2226 HOH A O   1 
HETATM 8979 O  O   . HOH W 8 .   ? 105.771 59.219 37.289  1.00 23.46 ? 2227 HOH A O   1 
HETATM 8980 O  O   . HOH W 8 .   ? 100.672 64.352 37.382  1.00 23.31 ? 2228 HOH A O   1 
HETATM 8981 O  O   . HOH W 8 .   ? 89.788  60.288 39.913  1.00 26.58 ? 2229 HOH A O   1 
HETATM 8982 O  O   . HOH W 8 .   ? 99.293  63.041 39.995  1.00 39.05 ? 2230 HOH A O   1 
HETATM 8983 O  O   . HOH W 8 .   ? 100.489 67.285 45.845  1.00 32.98 ? 2231 HOH A O   1 
HETATM 8984 O  O   . HOH W 8 .   ? 99.977  55.304 50.896  1.00 33.30 ? 2232 HOH A O   1 
HETATM 8985 O  O   . HOH W 8 .   ? 102.097 56.216 49.360  1.00 22.55 ? 2233 HOH A O   1 
HETATM 8986 O  O   . HOH W 8 .   ? 102.787 59.942 47.070  1.00 30.66 ? 2234 HOH A O   1 
HETATM 8987 O  O   . HOH W 8 .   ? 93.134  54.237 50.561  1.00 29.80 ? 2235 HOH A O   1 
HETATM 8988 O  O   . HOH W 8 .   ? 103.373 55.789 45.618  1.00 47.80 ? 2236 HOH A O   1 
HETATM 8989 O  O   . HOH W 8 .   ? 92.183  46.914 45.707  0.50 8.42  ? 2237 HOH A O   1 
HETATM 8990 O  O   . HOH W 8 .   ? 100.605 38.784 52.019  1.00 27.97 ? 2238 HOH A O   1 
HETATM 8991 O  O   . HOH W 8 .   ? 98.322  42.935 53.627  1.00 16.61 ? 2239 HOH A O   1 
HETATM 8992 O  O   . HOH W 8 .   ? 101.407 44.983 46.629  1.00 26.06 ? 2240 HOH A O   1 
HETATM 8993 O  O   . HOH W 8 .   ? 100.852 52.688 51.343  1.00 33.04 ? 2241 HOH A O   1 
HETATM 8994 O  O   . HOH W 8 .   ? 105.138 40.399 56.441  1.00 28.72 ? 2242 HOH A O   1 
HETATM 8995 O  O   . HOH W 8 .   ? 108.878 50.188 50.954  1.00 30.63 ? 2243 HOH A O   1 
HETATM 8996 O  O   . HOH W 8 .   ? 111.203 47.377 45.391  1.00 20.87 ? 2244 HOH A O   1 
HETATM 8997 O  O   . HOH W 8 .   ? 111.150 49.307 49.180  1.00 29.13 ? 2245 HOH A O   1 
HETATM 8998 O  O   . HOH W 8 .   ? 108.220 41.987 49.768  1.00 18.65 ? 2246 HOH A O   1 
HETATM 8999 O  O   . HOH W 8 .   ? 98.631  43.172 43.694  1.00 19.71 ? 2247 HOH A O   1 
HETATM 9000 O  O   . HOH W 8 .   ? 99.638  36.545 48.871  1.00 34.01 ? 2248 HOH A O   1 
HETATM 9001 O  O   . HOH W 8 .   ? 102.599 47.889 45.591  1.00 33.95 ? 2249 HOH A O   1 
HETATM 9002 O  O   . HOH W 8 .   ? 102.537 36.071 37.447  1.00 22.48 ? 2250 HOH A O   1 
HETATM 9003 O  O   . HOH W 8 .   ? 93.769  45.875 34.396  1.00 39.30 ? 2251 HOH A O   1 
HETATM 9004 O  O   . HOH W 8 .   ? 93.449  44.667 42.826  1.00 36.40 ? 2252 HOH A O   1 
HETATM 9005 O  O   . HOH W 8 .   ? 95.227  41.051 40.376  1.00 50.88 ? 2253 HOH A O   1 
HETATM 9006 O  O   . HOH W 8 .   ? 91.158  45.401 36.869  1.00 28.97 ? 2254 HOH A O   1 
HETATM 9007 O  O   . HOH W 8 .   ? 87.761  56.007 37.811  1.00 17.42 ? 2255 HOH A O   1 
HETATM 9008 O  O   . HOH W 8 .   ? 95.628  55.935 33.644  1.00 20.77 ? 2256 HOH A O   1 
HETATM 9009 O  O   . HOH W 8 .   ? 84.346  51.933 30.875  1.00 33.06 ? 2257 HOH A O   1 
HETATM 9010 O  O   . HOH W 8 .   ? 73.987  53.954 40.903  1.00 45.80 ? 2258 HOH A O   1 
HETATM 9011 O  O   . HOH W 8 .   ? 70.606  56.961 37.343  1.00 25.62 ? 2259 HOH A O   1 
HETATM 9012 O  O   . HOH W 8 .   ? 67.043  48.532 34.538  1.00 17.67 ? 2260 HOH A O   1 
HETATM 9013 O  O   . HOH W 8 .   ? 62.748  52.271 30.959  1.00 19.48 ? 2261 HOH A O   1 
HETATM 9014 O  O   . HOH W 8 .   ? 63.864  44.189 29.206  1.00 36.01 ? 2262 HOH A O   1 
HETATM 9015 O  O   . HOH W 8 .   ? 61.780  49.980 32.188  1.00 21.75 ? 2263 HOH A O   1 
HETATM 9016 O  O   . HOH W 8 .   ? 68.156  49.166 32.276  1.00 24.32 ? 2264 HOH A O   1 
HETATM 9017 O  O   . HOH W 8 .   ? 67.965  45.694 34.168  1.00 17.73 ? 2265 HOH A O   1 
HETATM 9018 O  O   . HOH W 8 .   ? 65.365  42.192 28.546  1.00 19.77 ? 2266 HOH A O   1 
HETATM 9019 O  O   . HOH W 8 .   ? 66.316  37.924 31.381  1.00 17.34 ? 2267 HOH A O   1 
HETATM 9020 O  O   . HOH W 8 .   ? 84.925  43.505 26.777  1.00 11.29 ? 2268 HOH A O   1 
HETATM 9021 O  O   . HOH W 8 .   ? 89.097  36.061 36.371  1.00 31.08 ? 2269 HOH A O   1 
HETATM 9022 O  O   . HOH W 8 .   ? 93.729  35.635 27.717  1.00 39.59 ? 2270 HOH A O   1 
HETATM 9023 O  O   . HOH W 8 .   ? 89.221  30.246 29.913  1.00 23.01 ? 2271 HOH A O   1 
HETATM 9024 O  O   . HOH W 8 .   ? 101.883 30.155 28.366  1.00 36.38 ? 2272 HOH A O   1 
HETATM 9025 O  O   . HOH W 8 .   ? 105.177 39.355 22.663  1.00 18.19 ? 2273 HOH A O   1 
HETATM 9026 O  O   . HOH W 8 .   ? 98.030  37.466 24.380  1.00 38.06 ? 2274 HOH A O   1 
HETATM 9027 O  O   . HOH W 8 .   ? 104.660 35.171 28.581  1.00 35.73 ? 2275 HOH A O   1 
HETATM 9028 O  O   . HOH W 8 .   ? 103.904 35.823 33.581  1.00 31.76 ? 2276 HOH A O   1 
HETATM 9029 O  O   . HOH W 8 .   ? 105.092 37.167 31.266  1.00 25.41 ? 2277 HOH A O   1 
HETATM 9030 O  O   . HOH W 8 .   ? 98.295  37.466 27.778  1.00 39.10 ? 2278 HOH A O   1 
HETATM 9031 O  O   . HOH W 8 .   ? 91.198  48.372 27.451  1.00 45.90 ? 2279 HOH A O   1 
HETATM 9032 O  O   . HOH W 8 .   ? 91.909  41.488 19.738  1.00 36.24 ? 2280 HOH A O   1 
HETATM 9033 O  O   . HOH W 8 .   ? 93.320  33.321 21.407  1.00 25.83 ? 2281 HOH A O   1 
HETATM 9034 O  O   . HOH W 8 .   ? 94.116  38.597 16.728  1.00 44.83 ? 2282 HOH A O   1 
HETATM 9035 O  O   . HOH W 8 .   ? 83.795  27.194 11.431  1.00 20.66 ? 2283 HOH A O   1 
HETATM 9036 O  O   . HOH W 8 .   ? 96.376  28.672 19.489  1.00 34.81 ? 2284 HOH A O   1 
HETATM 9037 O  O   . HOH W 8 .   ? 91.303  25.738 14.423  1.00 23.18 ? 2285 HOH A O   1 
HETATM 9038 O  O   . HOH W 8 .   ? 90.646  28.551 14.683  1.00 28.21 ? 2286 HOH A O   1 
HETATM 9039 O  O   . HOH W 8 .   ? 91.142  27.596 25.017  1.00 30.11 ? 2287 HOH A O   1 
HETATM 9040 O  O   . HOH W 8 .   ? 83.988  24.239 18.915  1.00 28.64 ? 2288 HOH A O   1 
HETATM 9041 O  O   . HOH W 8 .   ? 83.903  27.105 25.134  1.00 10.73 ? 2289 HOH A O   1 
HETATM 9042 O  O   . HOH W 8 .   ? 82.127  23.500 14.661  1.00 27.00 ? 2290 HOH A O   1 
HETATM 9043 O  O   . HOH W 8 .   ? 81.369  25.252 18.429  1.00 16.14 ? 2291 HOH A O   1 
HETATM 9044 O  O   . HOH W 8 .   ? 78.844  27.480 21.256  1.00 16.34 ? 2292 HOH A O   1 
HETATM 9045 O  O   . HOH W 8 .   ? 77.021  31.977 16.951  1.00 13.88 ? 2293 HOH A O   1 
HETATM 9046 O  O   . HOH W 8 .   ? 76.860  29.204 15.344  1.00 22.05 ? 2294 HOH A O   1 
HETATM 9047 O  O   . HOH W 8 .   ? 74.672  32.211 22.939  1.00 15.49 ? 2295 HOH A O   1 
HETATM 9048 O  O   . HOH W 8 .   ? 81.569  28.357 25.756  1.00 21.24 ? 2296 HOH A O   1 
HETATM 9049 O  O   . HOH W 8 .   ? 76.425  29.024 20.752  1.00 25.93 ? 2297 HOH A O   1 
HETATM 9050 O  O   . HOH W 8 .   ? 67.563  34.970 12.906  1.00 34.19 ? 2298 HOH A O   1 
HETATM 9051 O  O   . HOH W 8 .   ? 70.681  35.542 15.714  1.00 22.53 ? 2299 HOH A O   1 
HETATM 9052 O  O   . HOH W 8 .   ? 63.049  42.603 16.138  1.00 29.43 ? 2300 HOH A O   1 
HETATM 9053 O  O   . HOH W 8 .   ? 65.763  35.370 29.999  1.00 25.69 ? 2301 HOH A O   1 
HETATM 9054 O  O   . HOH W 8 .   ? 71.771  32.706 23.267  1.00 29.89 ? 2302 HOH A O   1 
HETATM 9055 O  O   . HOH W 8 .   ? 71.090  31.732 27.562  1.00 13.62 ? 2303 HOH A O   1 
HETATM 9056 O  O   . HOH W 8 .   ? 65.484  36.611 23.322  1.00 17.05 ? 2304 HOH A O   1 
HETATM 9057 O  O   . HOH W 8 .   ? 69.961  32.954 35.254  1.00 31.67 ? 2305 HOH A O   1 
HETATM 9058 O  O   . HOH W 8 .   ? 67.908  39.109 37.484  1.00 16.85 ? 2306 HOH A O   1 
HETATM 9059 O  O   . HOH W 8 .   ? 70.722  41.287 39.272  1.00 18.96 ? 2307 HOH A O   1 
HETATM 9060 O  O   . HOH W 8 .   ? 71.923  46.152 47.049  1.00 30.26 ? 2308 HOH A O   1 
HETATM 9061 O  O   . HOH W 8 .   ? 66.310  45.434 41.835  1.00 41.73 ? 2309 HOH A O   1 
HETATM 9062 O  O   . HOH W 8 .   ? 67.339  36.052 42.640  1.00 36.24 ? 2310 HOH A O   1 
HETATM 9063 O  O   . HOH W 8 .   ? 77.583  46.413 40.780  1.00 21.05 ? 2311 HOH A O   1 
HETATM 9064 O  O   . HOH W 8 .   ? 77.770  43.759 39.479  1.00 17.30 ? 2312 HOH A O   1 
HETATM 9065 O  O   . HOH W 8 .   ? 68.098  36.340 38.597  1.00 24.29 ? 2313 HOH A O   1 
HETATM 9066 O  O   . HOH W 8 .   ? 70.558  34.543 39.134  1.00 25.19 ? 2314 HOH A O   1 
HETATM 9067 O  O   . HOH W 8 .   ? 69.560  34.974 43.702  1.00 32.34 ? 2315 HOH A O   1 
HETATM 9068 O  O   . HOH W 8 .   ? 74.000  40.651 34.066  1.00 22.18 ? 2316 HOH A O   1 
HETATM 9069 O  O   . HOH W 8 .   ? 84.681  37.010 38.233  1.00 32.77 ? 2317 HOH A O   1 
HETATM 9070 O  O   . HOH W 8 .   ? 90.013  25.543 26.865  1.00 36.89 ? 2318 HOH A O   1 
HETATM 9071 O  O   . HOH W 8 .   ? 82.087  30.631 33.632  1.00 27.34 ? 2319 HOH A O   1 
HETATM 9072 O  O   . HOH W 8 .   ? 75.725  30.427 38.506  1.00 33.35 ? 2320 HOH A O   1 
HETATM 9073 O  O   . HOH W 8 .   ? 82.314  39.438 41.879  1.00 27.58 ? 2321 HOH A O   1 
HETATM 9074 O  O   . HOH W 8 .   ? 79.313  36.910 43.681  1.00 27.26 ? 2322 HOH A O   1 
HETATM 9075 O  O   . HOH W 8 .   ? 73.878  42.889 45.424  1.00 17.69 ? 2323 HOH A O   1 
HETATM 9076 O  O   . HOH W 8 .   ? 79.925  46.418 41.791  1.00 26.33 ? 2324 HOH A O   1 
HETATM 9077 O  O   . HOH W 8 .   ? 92.072  42.678 43.203  1.00 46.03 ? 2325 HOH A O   1 
HETATM 9078 O  O   . HOH W 8 .   ? 84.405  41.012 41.297  1.00 18.35 ? 2326 HOH A O   1 
HETATM 9079 O  O   . HOH W 8 .   ? 85.139  43.116 49.508  1.00 27.18 ? 2327 HOH A O   1 
HETATM 9080 O  O   . HOH W 8 .   ? 88.826  48.822 51.149  1.00 21.63 ? 2328 HOH A O   1 
HETATM 9081 O  O   . HOH W 8 .   ? 85.310  43.714 45.303  1.00 23.14 ? 2329 HOH A O   1 
HETATM 9082 O  O   . HOH W 8 .   ? 87.138  44.851 44.105  0.50 4.58  ? 2330 HOH A O   1 
HETATM 9083 O  O   . HOH W 8 .   ? 88.278  57.826 39.751  1.00 28.17 ? 2331 HOH A O   1 
HETATM 9084 O  O   . HOH W 8 .   ? 85.119  55.815 37.740  1.00 14.95 ? 2332 HOH A O   1 
HETATM 9085 O  O   . HOH W 8 .   ? 82.105  61.339 45.750  1.00 30.83 ? 2333 HOH A O   1 
HETATM 9086 O  O   . HOH W 8 .   ? 86.307  65.156 42.230  1.00 20.66 ? 2334 HOH A O   1 
HETATM 9087 O  O   . HOH W 8 .   ? 79.755  61.365 54.508  1.00 45.46 ? 2335 HOH A O   1 
HETATM 9088 O  O   . HOH W 8 .   ? 88.977  67.712 42.278  1.00 33.26 ? 2336 HOH A O   1 
HETATM 9089 O  O   . HOH W 8 .   ? 82.029  69.420 45.163  1.00 40.83 ? 2337 HOH A O   1 
HETATM 9090 O  O   . HOH W 8 .   ? 92.977  67.908 44.755  1.00 39.71 ? 2338 HOH A O   1 
HETATM 9091 O  O   . HOH W 8 .   ? 91.979  70.345 44.822  1.00 28.67 ? 2339 HOH A O   1 
HETATM 9092 O  O   . HOH W 8 .   ? 80.471  58.531 -12.176 1.00 47.01 ? 2340 HOH A O   1 
HETATM 9093 O  O   . HOH W 8 .   ? 96.040  45.483 22.753  1.00 46.37 ? 2341 HOH A O   1 
HETATM 9094 O  O   . HOH W 8 .   ? 76.156  55.057 41.689  1.00 42.15 ? 2342 HOH A O   1 
HETATM 9095 O  O   . HOH W 8 .   ? 91.079  51.221 21.958  1.00 58.32 ? 2343 HOH A O   1 
HETATM 9096 O  O   . HOH W 8 .   ? 72.203  42.163 -0.698  1.00 24.70 ? 2344 HOH A O   1 
HETATM 9097 O  O   . HOH W 8 .   ? 91.235  49.008 -9.195  1.00 52.64 ? 2345 HOH A O   1 
HETATM 9098 O  O   . HOH W 8 .   ? 89.255  42.681 -8.786  1.00 47.76 ? 2346 HOH A O   1 
HETATM 9099 O  O   . HOH W 8 .   ? 54.414  46.211 30.679  1.00 58.17 ? 2347 HOH A O   1 
HETATM 9100 O  O   . HOH W 8 .   ? 55.148  46.089 33.096  1.00 57.91 ? 2348 HOH A O   1 
HETATM 9101 O  O   . HOH W 8 .   ? 54.850  44.406 28.915  1.00 49.42 ? 2349 HOH A O   1 
HETATM 9102 O  O   . HOH W 8 .   ? 57.529  50.650 28.412  1.00 35.10 ? 2350 HOH A O   1 
HETATM 9103 O  O   . HOH W 8 .   ? 61.586  48.501 35.404  1.00 38.93 ? 2351 HOH A O   1 
HETATM 9104 O  O   . HOH X 8 .   ? 79.993  52.922 83.795  1.00 30.99 ? 2001 HOH B O   1 
HETATM 9105 O  O   . HOH X 8 .   ? 85.277  51.679 84.649  1.00 37.92 ? 2002 HOH B O   1 
HETATM 9106 O  O   . HOH X 8 .   ? 79.518  59.962 78.929  1.00 35.16 ? 2003 HOH B O   1 
HETATM 9107 O  O   . HOH X 8 .   ? 78.349  55.885 79.218  1.00 39.36 ? 2004 HOH B O   1 
HETATM 9108 O  O   . HOH X 8 .   ? 81.146  61.470 75.712  1.00 45.71 ? 2005 HOH B O   1 
HETATM 9109 O  O   . HOH X 8 .   ? 79.849  59.333 74.749  1.00 44.71 ? 2006 HOH B O   1 
HETATM 9110 O  O   . HOH X 8 .   ? 83.187  53.104 76.120  1.00 26.99 ? 2007 HOH B O   1 
HETATM 9111 O  O   . HOH X 8 .   ? 84.285  34.188 94.361  1.00 36.41 ? 2008 HOH B O   1 
HETATM 9112 O  O   . HOH X 8 .   ? 102.738 37.712 110.290 1.00 17.09 ? 2009 HOH B O   1 
HETATM 9113 O  O   . HOH X 8 .   ? 129.979 46.986 74.634  1.00 46.90 ? 2010 HOH B O   1 
HETATM 9114 O  O   . HOH X 8 .   ? 80.360  75.822 73.360  1.00 25.89 ? 2011 HOH B O   1 
HETATM 9115 O  O   . HOH X 8 .   ? 104.220 25.704 96.282  1.00 23.61 ? 2012 HOH B O   1 
HETATM 9116 O  O   . HOH X 8 .   ? 102.644 56.110 112.765 1.00 24.04 ? 2013 HOH B O   1 
HETATM 9117 O  O   . HOH X 8 .   ? 106.822 50.615 118.697 1.00 23.05 ? 2014 HOH B O   1 
HETATM 9118 O  O   . HOH X 8 .   ? 80.431  36.485 91.066  1.00 45.43 ? 2015 HOH B O   1 
HETATM 9119 O  O   . HOH X 8 .   ? 83.051  36.475 92.022  1.00 32.12 ? 2016 HOH B O   1 
HETATM 9120 O  O   . HOH X 8 .   ? 108.830 59.502 99.944  1.00 22.78 ? 2017 HOH B O   1 
HETATM 9121 O  O   . HOH X 8 .   ? 100.517 58.691 101.814 1.00 19.30 ? 2018 HOH B O   1 
HETATM 9122 O  O   . HOH X 8 .   ? 83.669  52.100 95.671  1.00 31.64 ? 2019 HOH B O   1 
HETATM 9123 O  O   . HOH X 8 .   ? 101.759 64.825 98.644  1.00 26.41 ? 2020 HOH B O   1 
HETATM 9124 O  O   . HOH X 8 .   ? 83.578  52.433 101.786 1.00 30.40 ? 2021 HOH B O   1 
HETATM 9125 O  O   . HOH X 8 .   ? 105.978 68.015 103.084 1.00 29.48 ? 2022 HOH B O   1 
HETATM 9126 O  O   . HOH X 8 .   ? 90.118  73.062 101.814 1.00 20.30 ? 2023 HOH B O   1 
HETATM 9127 O  O   . HOH X 8 .   ? 97.366  68.877 103.025 1.00 26.22 ? 2024 HOH B O   1 
HETATM 9128 O  O   . HOH X 8 .   ? 90.993  67.735 99.912  1.00 18.65 ? 2025 HOH B O   1 
HETATM 9129 O  O   . HOH X 8 .   ? 94.745  72.543 103.483 1.00 28.89 ? 2026 HOH B O   1 
HETATM 9130 O  O   . HOH X 8 .   ? 83.712  75.307 72.771  1.00 21.85 ? 2027 HOH B O   1 
HETATM 9131 O  O   . HOH X 8 .   ? 81.879  74.184 74.499  1.00 32.65 ? 2028 HOH B O   1 
HETATM 9132 O  O   . HOH X 8 .   ? 86.220  74.841 71.568  1.00 25.20 ? 2029 HOH B O   1 
HETATM 9133 O  O   . HOH X 8 .   ? 87.026  67.636 100.453 1.00 34.04 ? 2030 HOH B O   1 
HETATM 9134 O  O   . HOH X 8 .   ? 103.845 71.014 71.379  1.00 34.15 ? 2031 HOH B O   1 
HETATM 9135 O  O   . HOH X 8 .   ? 103.618 70.384 95.870  1.00 44.67 ? 2032 HOH B O   1 
HETATM 9136 O  O   . HOH X 8 .   ? 100.265 58.988 104.652 1.00 29.42 ? 2033 HOH B O   1 
HETATM 9137 O  O   . HOH X 8 .   ? 102.457 67.650 107.640 1.00 35.04 ? 2034 HOH B O   1 
HETATM 9138 O  O   . HOH X 8 .   ? 106.524 23.817 99.199  1.00 22.97 ? 2035 HOH B O   1 
HETATM 9139 O  O   . HOH X 8 .   ? 104.840 60.805 112.744 1.00 30.48 ? 2036 HOH B O   1 
HETATM 9140 O  O   . HOH X 8 .   ? 109.948 54.915 112.589 1.00 15.15 ? 2037 HOH B O   1 
HETATM 9141 O  O   . HOH X 8 .   ? 102.242 53.510 114.910 1.00 30.20 ? 2038 HOH B O   1 
HETATM 9142 O  O   . HOH X 8 .   ? 105.083 51.108 117.028 1.00 25.66 ? 2039 HOH B O   1 
HETATM 9143 O  O   . HOH X 8 .   ? 100.425 52.149 111.828 1.00 25.34 ? 2040 HOH B O   1 
HETATM 9144 O  O   . HOH X 8 .   ? 94.218  43.486 103.182 1.00 30.24 ? 2041 HOH B O   1 
HETATM 9145 O  O   . HOH X 8 .   ? 96.391  53.208 97.269  1.00 21.06 ? 2042 HOH B O   1 
HETATM 9146 O  O   . HOH X 8 .   ? 93.361  52.620 105.400 1.00 33.56 ? 2043 HOH B O   1 
HETATM 9147 O  O   . HOH X 8 .   ? 106.770 24.082 84.759  1.00 20.51 ? 2044 HOH B O   1 
HETATM 9148 O  O   . HOH X 8 .   ? 108.394 26.675 77.939  1.00 28.87 ? 2045 HOH B O   1 
HETATM 9149 O  O   . HOH X 8 .   ? 108.722 24.421 81.631  1.00 25.17 ? 2046 HOH B O   1 
HETATM 9150 O  O   . HOH X 8 .   ? 116.614 60.740 88.844  1.00 34.65 ? 2047 HOH B O   1 
HETATM 9151 O  O   . HOH X 8 .   ? 88.703  61.682 100.380 1.00 21.86 ? 2048 HOH B O   1 
HETATM 9152 O  O   . HOH X 8 .   ? 92.077  60.708 94.927  1.00 28.53 ? 2049 HOH B O   1 
HETATM 9153 O  O   . HOH X 8 .   ? 92.146  60.120 92.219  1.00 17.97 ? 2050 HOH B O   1 
HETATM 9154 O  O   . HOH X 8 .   ? 88.681  60.877 90.122  1.00 21.90 ? 2051 HOH B O   1 
HETATM 9155 O  O   . HOH X 8 .   ? 121.065 52.459 92.851  1.00 18.99 ? 2052 HOH B O   1 
HETATM 9156 O  O   . HOH X 8 .   ? 114.822 63.055 95.284  1.00 41.07 ? 2053 HOH B O   1 
HETATM 9157 O  O   . HOH X 8 .   ? 119.398 42.735 66.534  1.00 28.74 ? 2054 HOH B O   1 
HETATM 9158 O  O   . HOH X 8 .   ? 119.829 43.988 64.324  1.00 39.12 ? 2055 HOH B O   1 
HETATM 9159 O  O   . HOH X 8 .   ? 82.881  57.236 92.649  1.00 27.31 ? 2056 HOH B O   1 
HETATM 9160 O  O   . HOH X 8 .   ? 89.947  50.643 90.792  1.00 15.16 ? 2057 HOH B O   1 
HETATM 9161 O  O   . HOH X 8 .   ? 76.951  56.099 83.601  1.00 28.96 ? 2058 HOH B O   1 
HETATM 9162 O  O   . HOH X 8 .   ? 109.433 38.178 111.532 1.00 31.32 ? 2059 HOH B O   1 
HETATM 9163 O  O   . HOH X 8 .   ? 81.089  56.894 90.713  1.00 20.46 ? 2060 HOH B O   1 
HETATM 9164 O  O   . HOH X 8 .   ? 84.356  48.019 85.465  1.00 28.70 ? 2061 HOH B O   1 
HETATM 9165 O  O   . HOH X 8 .   ? 74.173  53.228 88.605  1.00 23.17 ? 2062 HOH B O   1 
HETATM 9166 O  O   . HOH X 8 .   ? 75.573  53.018 86.136  1.00 20.51 ? 2063 HOH B O   1 
HETATM 9167 O  O   . HOH X 8 .   ? 79.195  49.701 91.559  1.00 37.69 ? 2064 HOH B O   1 
HETATM 9168 O  O   . HOH X 8 .   ? 75.401  55.489 92.573  1.00 26.00 ? 2065 HOH B O   1 
HETATM 9169 O  O   . HOH X 8 .   ? 78.193  53.216 86.186  1.00 29.24 ? 2066 HOH B O   1 
HETATM 9170 O  O   . HOH X 8 .   ? 75.741  38.793 87.565  1.00 35.91 ? 2067 HOH B O   1 
HETATM 9171 O  O   . HOH X 8 .   ? 81.903  35.273 88.862  1.00 34.58 ? 2068 HOH B O   1 
HETATM 9172 O  O   . HOH X 8 .   ? 79.115  37.623 88.620  1.00 40.17 ? 2069 HOH B O   1 
HETATM 9173 O  O   . HOH X 8 .   ? 84.979  37.453 87.073  1.00 47.24 ? 2070 HOH B O   1 
HETATM 9174 O  O   . HOH X 8 .   ? 118.981 56.664 80.330  1.00 25.64 ? 2071 HOH B O   1 
HETATM 9175 O  O   . HOH X 8 .   ? 79.440  46.922 87.010  1.00 33.00 ? 2072 HOH B O   1 
HETATM 9176 O  O   . HOH X 8 .   ? 90.341  41.867 90.752  1.00 34.14 ? 2073 HOH B O   1 
HETATM 9177 O  O   . HOH X 8 .   ? 90.709  49.195 87.453  1.00 24.41 ? 2074 HOH B O   1 
HETATM 9178 O  O   . HOH X 8 .   ? 102.129 61.323 69.666  1.00 32.86 ? 2075 HOH B O   1 
HETATM 9179 O  O   . HOH X 8 .   ? 96.548  63.304 71.121  1.00 37.00 ? 2076 HOH B O   1 
HETATM 9180 O  O   . HOH X 8 .   ? 87.342  45.065 92.740  1.00 26.05 ? 2077 HOH B O   1 
HETATM 9181 O  O   . HOH X 8 .   ? 86.025  50.613 86.744  1.00 37.94 ? 2078 HOH B O   1 
HETATM 9182 O  O   . HOH X 8 .   ? 81.845  47.465 92.882  1.00 31.07 ? 2079 HOH B O   1 
HETATM 9183 O  O   . HOH X 8 .   ? 92.709  65.686 72.223  1.00 40.59 ? 2080 HOH B O   1 
HETATM 9184 O  O   . HOH X 8 .   ? 83.656  49.891 94.260  1.00 31.79 ? 2081 HOH B O   1 
HETATM 9185 O  O   . HOH X 8 .   ? 98.806  66.530 72.303  1.00 29.79 ? 2082 HOH B O   1 
HETATM 9186 O  O   . HOH X 8 .   ? 85.443  44.893 98.915  1.00 48.23 ? 2083 HOH B O   1 
HETATM 9187 O  O   . HOH X 8 .   ? 96.719  65.789 71.358  1.00 34.84 ? 2084 HOH B O   1 
HETATM 9188 O  O   . HOH X 8 .   ? 101.204 72.955 73.429  1.00 16.95 ? 2085 HOH B O   1 
HETATM 9189 O  O   . HOH X 8 .   ? 89.032  72.896 69.964  1.00 35.90 ? 2086 HOH B O   1 
HETATM 9190 O  O   . HOH X 8 .   ? 88.375  76.126 73.046  1.00 20.07 ? 2087 HOH B O   1 
HETATM 9191 O  O   . HOH X 8 .   ? 89.203  44.419 100.211 1.00 43.00 ? 2088 HOH B O   1 
HETATM 9192 O  O   . HOH X 8 .   ? 85.137  52.232 97.827  1.00 24.69 ? 2089 HOH B O   1 
HETATM 9193 O  O   . HOH X 8 .   ? 89.146  55.760 105.046 1.00 40.83 ? 2090 HOH B O   1 
HETATM 9194 O  O   . HOH X 8 .   ? 84.575  54.556 99.419  1.00 24.44 ? 2091 HOH B O   1 
HETATM 9195 O  O   . HOH X 8 .   ? 91.129  58.801 105.000 1.00 30.96 ? 2092 HOH B O   1 
HETATM 9196 O  O   . HOH X 8 .   ? 88.889  64.359 100.698 1.00 22.55 ? 2093 HOH B O   1 
HETATM 9197 O  O   . HOH X 8 .   ? 93.824  64.685 95.957  1.00 16.11 ? 2094 HOH B O   1 
HETATM 9198 O  O   . HOH X 8 .   ? 94.135  61.980 96.000  1.00 22.18 ? 2095 HOH B O   1 
HETATM 9199 O  O   . HOH X 8 .   ? 98.252  59.622 100.680 1.00 16.27 ? 2096 HOH B O   1 
HETATM 9200 O  O   . HOH X 8 .   ? 93.372  60.720 105.925 1.00 31.17 ? 2097 HOH B O   1 
HETATM 9201 O  O   . HOH X 8 .   ? 93.354  57.728 106.143 1.00 31.15 ? 2098 HOH B O   1 
HETATM 9202 O  O   . HOH X 8 .   ? 97.949  59.043 106.631 1.00 21.18 ? 2099 HOH B O   1 
HETATM 9203 O  O   . HOH X 8 .   ? 91.907  74.453 100.290 1.00 37.43 ? 2100 HOH B O   1 
HETATM 9204 O  O   . HOH X 8 .   ? 84.347  73.124 72.124  1.00 30.22 ? 2101 HOH B O   1 
HETATM 9205 O  O   . HOH X 8 .   ? 78.722  61.113 67.193  1.00 34.26 ? 2102 HOH B O   1 
HETATM 9206 O  O   . HOH X 8 .   ? 109.501 32.831 98.971  1.00 28.00 ? 2103 HOH B O   1 
HETATM 9207 O  O   . HOH X 8 .   ? 111.702 40.612 104.036 1.00 26.19 ? 2104 HOH B O   1 
HETATM 9208 O  O   . HOH X 8 .   ? 119.024 41.160 101.877 1.00 37.32 ? 2105 HOH B O   1 
HETATM 9209 O  O   . HOH X 8 .   ? 125.873 40.183 104.467 1.00 28.92 ? 2106 HOH B O   1 
HETATM 9210 O  O   . HOH X 8 .   ? 105.366 69.714 67.993  1.00 30.03 ? 2107 HOH B O   1 
HETATM 9211 O  O   . HOH X 8 .   ? 102.562 67.772 71.327  1.00 19.42 ? 2108 HOH B O   1 
HETATM 9212 O  O   . HOH X 8 .   ? 117.487 38.533 90.118  1.00 36.08 ? 2109 HOH B O   1 
HETATM 9213 O  O   . HOH X 8 .   ? 99.924  49.608 90.519  1.00 18.49 ? 2110 HOH B O   1 
HETATM 9214 O  O   . HOH X 8 .   ? 94.462  54.558 85.208  1.00 17.34 ? 2111 HOH B O   1 
HETATM 9215 O  O   . HOH X 8 .   ? 89.223  50.456 85.785  1.00 36.92 ? 2112 HOH B O   1 
HETATM 9216 O  O   . HOH X 8 .   ? 93.991  53.855 93.422  1.00 20.47 ? 2113 HOH B O   1 
HETATM 9217 O  O   . HOH X 8 .   ? 74.243  42.291 84.871  1.00 19.18 ? 2114 HOH B O   1 
HETATM 9218 O  O   . HOH X 8 .   ? 98.452  51.715 96.926  1.00 37.31 ? 2115 HOH B O   1 
HETATM 9219 O  O   . HOH X 8 .   ? 99.124  44.977 93.645  1.00 24.55 ? 2116 HOH B O   1 
HETATM 9220 O  O   . HOH X 8 .   ? 95.136  51.930 95.267  1.00 24.24 ? 2117 HOH B O   1 
HETATM 9221 O  O   . HOH X 8 .   ? 69.210  46.671 64.938  1.00 27.23 ? 2118 HOH B O   1 
HETATM 9222 O  O   . HOH X 8 .   ? 89.488  42.851 92.956  1.00 30.70 ? 2119 HOH B O   1 
HETATM 9223 O  O   . HOH X 8 .   ? 95.939  47.470 84.685  1.00 25.72 ? 2120 HOH B O   1 
HETATM 9224 O  O   . HOH X 8 .   ? 93.499  48.967 87.539  1.00 16.56 ? 2121 HOH B O   1 
HETATM 9225 O  O   . HOH X 8 .   ? 101.385 37.426 91.645  1.00 19.25 ? 2122 HOH B O   1 
HETATM 9226 O  O   . HOH X 8 .   ? 94.319  34.389 94.473  1.00 36.94 ? 2123 HOH B O   1 
HETATM 9227 O  O   . HOH X 8 .   ? 87.919  44.433 55.813  1.00 30.56 ? 2124 HOH B O   1 
HETATM 9228 O  O   . HOH X 8 .   ? 108.054 26.355 98.536  1.00 33.80 ? 2125 HOH B O   1 
HETATM 9229 O  O   . HOH X 8 .   ? 110.483 32.234 96.199  1.00 29.76 ? 2126 HOH B O   1 
HETATM 9230 O  O   . HOH X 8 .   ? 104.818 28.291 91.595  1.00 35.46 ? 2127 HOH B O   1 
HETATM 9231 O  O   . HOH X 8 .   ? 112.988 34.149 87.328  1.00 27.18 ? 2128 HOH B O   1 
HETATM 9232 O  O   . HOH X 8 .   ? 106.590 30.737 86.280  1.00 20.86 ? 2129 HOH B O   1 
HETATM 9233 O  O   . HOH X 8 .   ? 115.437 29.151 93.212  1.00 33.00 ? 2130 HOH B O   1 
HETATM 9234 O  O   . HOH X 8 .   ? 120.857 48.169 66.612  1.00 42.37 ? 2131 HOH B O   1 
HETATM 9235 O  O   . HOH X 8 .   ? 121.631 49.786 68.596  1.00 33.32 ? 2132 HOH B O   1 
HETATM 9236 O  O   . HOH X 8 .   ? 94.995  65.819 93.862  1.00 18.46 ? 2133 HOH B O   1 
HETATM 9237 O  O   . HOH X 8 .   ? 97.680  69.177 88.373  1.00 16.16 ? 2134 HOH B O   1 
HETATM 9238 O  O   . HOH X 8 .   ? 96.681  73.029 80.701  1.00 15.07 ? 2135 HOH B O   1 
HETATM 9239 O  O   . HOH X 8 .   ? 76.760  35.268 73.379  1.00 32.41 ? 2136 HOH B O   1 
HETATM 9240 O  O   . HOH X 8 .   ? 102.211 72.955 83.366  1.00 29.27 ? 2137 HOH B O   1 
HETATM 9241 O  O   . HOH X 8 .   ? 101.790 75.021 84.921  1.00 25.12 ? 2138 HOH B O   1 
HETATM 9242 O  O   . HOH X 8 .   ? 102.556 81.599 84.522  1.00 26.55 ? 2139 HOH B O   1 
HETATM 9243 O  O   . HOH X 8 .   ? 102.353 71.763 92.414  1.00 29.56 ? 2140 HOH B O   1 
HETATM 9244 O  O   . HOH X 8 .   ? 98.818  74.780 97.717  1.00 23.95 ? 2141 HOH B O   1 
HETATM 9245 O  O   . HOH X 8 .   ? 103.605 68.940 86.001  1.00 31.68 ? 2142 HOH B O   1 
HETATM 9246 O  O   . HOH X 8 .   ? 85.158  27.082 83.499  1.00 18.08 ? 2143 HOH B O   1 
HETATM 9247 O  O   . HOH X 8 .   ? 83.884  21.606 88.953  1.00 24.29 ? 2144 HOH B O   1 
HETATM 9248 O  O   . HOH X 8 .   ? 97.606  66.354 83.486  1.00 13.58 ? 2145 HOH B O   1 
HETATM 9249 O  O   . HOH X 8 .   ? 107.454 22.856 80.307  1.00 31.25 ? 2146 HOH B O   1 
HETATM 9250 O  O   . HOH X 8 .   ? 107.604 26.680 84.995  1.00 20.67 ? 2147 HOH B O   1 
HETATM 9251 O  O   . HOH X 8 .   ? 109.621 28.857 77.945  1.00 27.17 ? 2148 HOH B O   1 
HETATM 9252 O  O   . HOH X 8 .   ? 107.724 62.962 91.937  1.00 21.29 ? 2149 HOH B O   1 
HETATM 9253 O  O   . HOH X 8 .   ? 120.725 36.533 78.732  1.00 26.61 ? 2150 HOH B O   1 
HETATM 9254 O  O   . HOH X 8 .   ? 110.261 59.200 97.396  1.00 41.26 ? 2151 HOH B O   1 
HETATM 9255 O  O   . HOH X 8 .   ? 110.186 61.791 93.072  1.00 25.84 ? 2152 HOH B O   1 
HETATM 9256 O  O   . HOH X 8 .   ? 115.835 29.089 88.705  1.00 25.14 ? 2153 HOH B O   1 
HETATM 9257 O  O   . HOH X 8 .   ? 116.518 60.483 91.345  1.00 30.53 ? 2154 HOH B O   1 
HETATM 9258 O  O   . HOH X 8 .   ? 112.385 61.765 91.894  1.00 23.12 ? 2155 HOH B O   1 
HETATM 9259 O  O   . HOH X 8 .   ? 117.971 44.339 67.389  1.00 32.47 ? 2156 HOH B O   1 
HETATM 9260 O  O   . HOH X 8 .   ? 116.039 52.522 91.354  1.00 20.91 ? 2157 HOH B O   1 
HETATM 9261 O  O   . HOH X 8 .   ? 119.816 53.576 95.134  1.00 23.78 ? 2158 HOH B O   1 
HETATM 9262 O  O   . HOH X 8 .   ? 108.182 49.774 58.039  1.00 39.62 ? 2159 HOH B O   1 
HETATM 9263 O  O   . HOH X 8 .   ? 112.195 34.067 58.862  1.00 37.78 ? 2160 HOH B O   1 
HETATM 9264 O  O   . HOH X 8 .   ? 112.433 58.334 98.762  1.00 14.50 ? 2161 HOH B O   1 
HETATM 9265 O  O   . HOH X 8 .   ? 115.500 60.642 97.943  1.00 26.41 ? 2162 HOH B O   1 
HETATM 9266 O  O   . HOH X 8 .   ? 97.805  39.753 64.487  1.00 52.31 ? 2163 HOH B O   1 
HETATM 9267 O  O   . HOH X 8 .   ? 112.697 57.467 101.214 1.00 23.80 ? 2164 HOH B O   1 
HETATM 9268 O  O   . HOH X 8 .   ? 117.395 50.728 97.551  1.00 17.52 ? 2165 HOH B O   1 
HETATM 9269 O  O   . HOH X 8 .   ? 121.123 48.398 102.562 1.00 42.42 ? 2166 HOH B O   1 
HETATM 9270 O  O   . HOH X 8 .   ? 116.733 45.658 106.099 1.00 23.26 ? 2167 HOH B O   1 
HETATM 9271 O  O   . HOH X 8 .   ? 93.947  43.595 58.427  1.00 36.25 ? 2168 HOH B O   1 
HETATM 9272 O  O   . HOH X 8 .   ? 119.966 45.334 98.033  1.00 38.19 ? 2169 HOH B O   1 
HETATM 9273 O  O   . HOH X 8 .   ? 123.025 44.882 89.761  1.00 31.47 ? 2170 HOH B O   1 
HETATM 9274 O  O   . HOH X 8 .   ? 119.523 52.285 90.673  1.00 23.69 ? 2171 HOH B O   1 
HETATM 9275 O  O   . HOH X 8 .   ? 116.780 50.134 88.229  1.00 13.21 ? 2172 HOH B O   1 
HETATM 9276 O  O   . HOH X 8 .   ? 126.916 48.602 88.493  1.00 19.43 ? 2173 HOH B O   1 
HETATM 9277 O  O   . HOH X 8 .   ? 123.666 48.006 86.808  1.00 24.08 ? 2174 HOH B O   1 
HETATM 9278 O  O   . HOH X 8 .   ? 114.629 44.870 86.223  1.00 33.70 ? 2175 HOH B O   1 
HETATM 9279 O  O   . HOH X 8 .   ? 95.331  44.421 78.362  1.00 23.62 ? 2176 HOH B O   1 
HETATM 9280 O  O   . HOH X 8 .   ? 93.605  52.191 80.642  1.00 48.15 ? 2177 HOH B O   1 
HETATM 9281 O  O   . HOH X 8 .   ? 115.668 60.397 86.440  1.00 39.90 ? 2178 HOH B O   1 
HETATM 9282 O  O   . HOH X 8 .   ? 111.619 65.423 83.218  1.00 35.09 ? 2179 HOH B O   1 
HETATM 9283 O  O   . HOH X 8 .   ? 118.657 59.567 79.339  1.00 37.93 ? 2180 HOH B O   1 
HETATM 9284 O  O   . HOH X 8 .   ? 119.249 59.543 81.736  1.00 42.27 ? 2181 HOH B O   1 
HETATM 9285 O  O   . HOH X 8 .   ? 113.312 52.736 91.085  1.00 30.49 ? 2182 HOH B O   1 
HETATM 9286 O  O   . HOH X 8 .   ? 118.665 51.468 86.725  1.00 18.15 ? 2183 HOH B O   1 
HETATM 9287 O  O   . HOH X 8 .   ? 119.530 48.266 80.726  1.00 26.23 ? 2184 HOH B O   1 
HETATM 9288 O  O   . HOH X 8 .   ? 99.539  61.458 70.912  1.00 30.92 ? 2185 HOH B O   1 
HETATM 9289 O  O   . HOH X 8 .   ? 101.477 57.559 67.396  1.00 33.97 ? 2186 HOH B O   1 
HETATM 9290 O  O   . HOH X 8 .   ? 99.253  60.301 73.853  1.00 22.18 ? 2187 HOH B O   1 
HETATM 9291 O  O   . HOH X 8 .   ? 93.476  62.813 73.821  1.00 28.02 ? 2188 HOH B O   1 
HETATM 9292 O  O   . HOH X 8 .   ? 91.535  60.686 76.618  1.00 24.40 ? 2189 HOH B O   1 
HETATM 9293 O  O   . HOH X 8 .   ? 100.292 64.053 72.538  1.00 22.62 ? 2190 HOH B O   1 
HETATM 9294 O  O   . HOH X 8 .   ? 94.622  67.586 72.875  1.00 18.13 ? 2191 HOH B O   1 
HETATM 9295 O  O   . HOH X 8 .   ? 98.374  73.684 73.656  1.00 29.34 ? 2192 HOH B O   1 
HETATM 9296 O  O   . HOH X 8 .   ? 91.864  76.510 76.052  1.00 21.84 ? 2193 HOH B O   1 
HETATM 9297 O  O   . HOH X 8 .   ? 91.050  72.944 72.847  1.00 28.75 ? 2194 HOH B O   1 
HETATM 9298 O  O   . HOH X 8 .   ? 92.435  69.430 82.716  1.00 21.92 ? 2195 HOH B O   1 
HETATM 9299 O  O   . HOH X 8 .   ? 91.538  79.685 81.055  1.00 25.67 ? 2196 HOH B O   1 
HETATM 9300 O  O   . HOH X 8 .   ? 85.345  74.480 77.011  1.00 32.58 ? 2197 HOH B O   1 
HETATM 9301 O  O   . HOH X 8 .   ? 91.013  62.888 74.944  1.00 19.98 ? 2198 HOH B O   1 
HETATM 9302 O  O   . HOH X 8 .   ? 88.591  63.434 72.999  1.00 39.49 ? 2199 HOH B O   1 
HETATM 9303 O  O   . HOH X 8 .   ? 90.290  65.964 72.675  1.00 28.61 ? 2200 HOH B O   1 
HETATM 9304 O  O   . HOH X 8 .   ? 78.963  74.122 80.322  1.00 25.89 ? 2201 HOH B O   1 
HETATM 9305 O  O   . HOH X 8 .   ? 84.408  79.787 92.730  1.00 31.92 ? 2202 HOH B O   1 
HETATM 9306 O  O   . HOH X 8 .   ? 90.233  80.346 84.312  1.00 25.10 ? 2203 HOH B O   1 
HETATM 9307 O  O   . HOH X 8 .   ? 96.223  79.450 95.889  1.00 27.55 ? 2204 HOH B O   1 
HETATM 9308 O  O   . HOH X 8 .   ? 93.341  76.730 97.835  1.00 23.95 ? 2205 HOH B O   1 
HETATM 9309 O  O   . HOH X 8 .   ? 90.882  70.035 98.457  1.00 19.96 ? 2206 HOH B O   1 
HETATM 9310 O  O   . HOH X 8 .   ? 87.603  70.108 100.562 1.00 30.68 ? 2207 HOH B O   1 
HETATM 9311 O  O   . HOH X 8 .   ? 80.664  76.530 93.426  1.00 17.66 ? 2208 HOH B O   1 
HETATM 9312 O  O   . HOH X 8 .   ? 82.980  63.027 98.208  1.00 31.72 ? 2209 HOH B O   1 
HETATM 9313 O  O   . HOH X 8 .   ? 80.992  72.031 98.198  1.00 22.75 ? 2210 HOH B O   1 
HETATM 9314 O  O   . HOH X 8 .   ? 78.509  67.587 91.142  1.00 18.63 ? 2211 HOH B O   1 
HETATM 9315 O  O   . HOH X 8 .   ? 79.392  72.550 96.371  1.00 23.51 ? 2212 HOH B O   1 
HETATM 9316 O  O   . HOH X 8 .   ? 77.529  65.895 92.661  1.00 29.28 ? 2213 HOH B O   1 
HETATM 9317 O  O   . HOH X 8 .   ? 80.078  59.220 89.515  1.00 25.37 ? 2214 HOH B O   1 
HETATM 9318 O  O   . HOH X 8 .   ? 87.062  60.389 82.417  1.00 29.40 ? 2215 HOH B O   1 
HETATM 9319 O  O   . HOH X 8 .   ? 87.285  59.201 88.186  1.00 23.25 ? 2216 HOH B O   1 
HETATM 9320 O  O   . HOH X 8 .   ? 89.503  61.621 84.010  1.00 18.93 ? 2217 HOH B O   1 
HETATM 9321 O  O   . HOH X 8 .   ? 87.704  63.086 88.730  1.00 20.93 ? 2218 HOH B O   1 
HETATM 9322 O  O   . HOH X 8 .   ? 79.804  62.987 84.149  1.00 35.02 ? 2219 HOH B O   1 
HETATM 9323 O  O   . HOH X 8 .   ? 83.938  70.456 71.657  1.00 27.19 ? 2220 HOH B O   1 
HETATM 9324 O  O   . HOH X 8 .   ? 86.679  33.309 93.052  1.00 36.43 ? 2221 HOH B O   1 
HETATM 9325 O  O   . HOH X 8 .   ? 116.715 54.801 108.439 1.00 34.03 ? 2222 HOH B O   1 
HETATM 9326 O  O   . HOH X 8 .   ? 81.473  61.502 67.863  1.00 34.08 ? 2223 HOH B O   1 
HETATM 9327 O  O   . HOH X 8 .   ? 85.827  63.161 73.533  1.00 39.42 ? 2224 HOH B O   1 
HETATM 9328 O  O   . HOH X 8 .   ? 80.092  56.645 74.975  1.00 40.52 ? 2225 HOH B O   1 
HETATM 9329 O  O   . HOH X 8 .   ? 89.800  62.383 70.459  1.00 33.13 ? 2226 HOH B O   1 
HETATM 9330 O  O   . HOH X 8 .   ? 92.259  67.365 80.860  1.00 28.88 ? 2227 HOH B O   1 
HETATM 9331 O  O   . HOH X 8 .   ? 91.274  59.999 82.748  1.00 34.69 ? 2228 HOH B O   1 
HETATM 9332 O  O   . HOH X 8 .   ? 94.601  66.601 81.710  1.00 20.45 ? 2229 HOH B O   1 
HETATM 9333 O  O   . HOH X 8 .   ? 100.621 70.810 74.636  1.00 18.31 ? 2230 HOH B O   1 
HETATM 9334 O  O   . HOH X 8 .   ? 104.816 71.257 73.733  1.00 20.69 ? 2231 HOH B O   1 
HETATM 9335 O  O   . HOH X 8 .   ? 107.409 69.679 69.791  1.00 26.19 ? 2232 HOH B O   1 
HETATM 9336 O  O   . HOH X 8 .   ? 102.588 65.094 71.587  1.00 23.92 ? 2233 HOH B O   1 
HETATM 9337 O  O   . HOH X 8 .   ? 103.220 63.716 69.431  1.00 25.84 ? 2234 HOH B O   1 
HETATM 9338 O  O   . HOH X 8 .   ? 103.354 59.955 67.846  1.00 39.49 ? 2235 HOH B O   1 
HETATM 9339 O  O   . HOH X 8 .   ? 112.848 56.573 66.336  1.00 21.04 ? 2236 HOH B O   1 
HETATM 9340 O  O   . HOH X 8 .   ? 113.249 66.206 72.410  1.00 28.07 ? 2237 HOH B O   1 
HETATM 9341 O  O   . HOH X 8 .   ? 118.555 61.961 75.554  1.00 30.11 ? 2238 HOH B O   1 
HETATM 9342 O  O   . HOH X 8 .   ? 119.016 59.499 75.674  1.00 42.65 ? 2239 HOH B O   1 
HETATM 9343 O  O   . HOH X 8 .   ? 119.119 52.101 83.975  1.00 18.63 ? 2240 HOH B O   1 
HETATM 9344 O  O   . HOH X 8 .   ? 119.235 56.000 77.832  1.00 15.33 ? 2241 HOH B O   1 
HETATM 9345 O  O   . HOH X 8 .   ? 121.764 44.578 79.673  1.00 33.66 ? 2242 HOH B O   1 
HETATM 9346 O  O   . HOH X 8 .   ? 98.520  42.787 76.665  1.00 14.72 ? 2243 HOH B O   1 
HETATM 9347 O  O   . HOH X 8 .   ? 93.369  41.962 66.775  1.00 19.89 ? 2244 HOH B O   1 
HETATM 9348 O  O   . HOH X 8 .   ? 88.285  44.866 75.151  1.00 27.42 ? 2245 HOH B O   1 
HETATM 9349 O  O   . HOH X 8 .   ? 100.848 59.314 113.824 1.00 38.33 ? 2246 HOH B O   1 
HETATM 9350 O  O   . HOH X 8 .   ? 76.542  50.199 74.423  1.00 28.72 ? 2247 HOH B O   1 
HETATM 9351 O  O   . HOH X 8 .   ? 76.028  53.593 75.431  1.00 35.03 ? 2248 HOH B O   1 
HETATM 9352 O  O   . HOH X 8 .   ? 73.774  51.885 73.181  1.00 34.00 ? 2249 HOH B O   1 
HETATM 9353 O  O   . HOH X 8 .   ? 72.172  49.146 71.815  1.00 14.79 ? 2250 HOH B O   1 
HETATM 9354 O  O   . HOH X 8 .   ? 73.142  46.491 76.105  1.00 37.36 ? 2251 HOH B O   1 
HETATM 9355 O  O   . HOH X 8 .   ? 74.880  45.283 77.954  1.00 29.56 ? 2252 HOH B O   1 
HETATM 9356 O  O   . HOH X 8 .   ? 74.853  39.738 84.434  1.00 20.47 ? 2253 HOH B O   1 
HETATM 9357 O  O   . HOH X 8 .   ? 69.791  38.753 74.199  1.00 26.56 ? 2254 HOH B O   1 
HETATM 9358 O  O   . HOH X 8 .   ? 71.612  41.714 69.767  1.00 35.67 ? 2255 HOH B O   1 
HETATM 9359 O  O   . HOH X 8 .   ? 76.598  33.115 64.764  1.00 31.43 ? 2256 HOH B O   1 
HETATM 9360 O  O   . HOH X 8 .   ? 80.929  35.083 65.871  1.00 30.73 ? 2257 HOH B O   1 
HETATM 9361 O  O   . HOH X 8 .   ? 69.925  49.421 63.268  1.00 27.60 ? 2258 HOH B O   1 
HETATM 9362 O  O   . HOH X 8 .   ? 79.435  53.655 53.898  1.00 36.71 ? 2259 HOH B O   1 
HETATM 9363 O  O   . HOH X 8 .   ? 71.198  49.638 58.645  1.00 30.31 ? 2260 HOH B O   1 
HETATM 9364 O  O   . HOH X 8 .   ? 71.021  55.574 64.060  1.00 32.71 ? 2261 HOH B O   1 
HETATM 9365 O  O   . HOH X 8 .   ? 72.664  46.948 65.533  1.00 14.34 ? 2262 HOH B O   1 
HETATM 9366 O  O   . HOH X 8 .   ? 77.967  51.088 67.196  1.00 21.11 ? 2263 HOH B O   1 
HETATM 9367 O  O   . HOH X 8 .   ? 72.615  54.139 65.540  1.00 26.34 ? 2264 HOH B O   1 
HETATM 9368 O  O   . HOH X 8 .   ? 70.668  49.754 67.912  1.00 14.99 ? 2265 HOH B O   1 
HETATM 9369 O  O   . HOH X 8 .   ? 77.820  58.379 66.306  1.00 29.84 ? 2266 HOH B O   1 
HETATM 9370 O  O   . HOH X 8 .   ? 87.723  55.416 70.059  1.00 18.99 ? 2267 HOH B O   1 
HETATM 9371 O  O   . HOH X 8 .   ? 85.620  65.688 64.547  1.00 37.49 ? 2268 HOH B O   1 
HETATM 9372 O  O   . HOH X 8 .   ? 90.590  66.469 55.292  1.00 45.21 ? 2269 HOH B O   1 
HETATM 9373 O  O   . HOH X 8 .   ? 80.299  62.251 57.484  1.00 53.91 ? 2270 HOH B O   1 
HETATM 9374 O  O   . HOH X 8 .   ? 82.294  64.563 60.943  1.00 39.64 ? 2271 HOH B O   1 
HETATM 9375 O  O   . HOH X 8 .   ? 77.885  65.860 56.395  1.00 42.89 ? 2272 HOH B O   1 
HETATM 9376 O  O   . HOH X 8 .   ? 83.212  58.757 50.238  1.00 24.87 ? 2273 HOH B O   1 
HETATM 9377 O  O   . HOH X 8 .   ? 91.294  46.261 57.801  0.50 6.96  ? 2274 HOH B O   1 
HETATM 9378 O  O   . HOH X 8 .   ? 87.031  44.870 58.638  1.00 49.31 ? 2275 HOH B O   1 
HETATM 9379 O  O   . HOH X 8 .   ? 87.781  45.005 53.477  1.00 26.34 ? 2276 HOH B O   1 
HETATM 9380 O  O   . HOH X 8 .   ? 82.998  38.779 51.078  1.00 23.38 ? 2277 HOH B O   1 
HETATM 9381 O  O   . HOH X 8 .   ? 82.221  44.470 56.613  1.00 23.64 ? 2278 HOH B O   1 
HETATM 9382 O  O   . HOH X 8 .   ? 82.888  53.077 52.358  1.00 24.39 ? 2279 HOH B O   1 
HETATM 9383 O  O   . HOH X 8 .   ? 72.234  46.480 57.981  1.00 27.40 ? 2280 HOH B O   1 
HETATM 9384 O  O   . HOH X 8 .   ? 75.290  41.940 53.438  1.00 14.17 ? 2281 HOH B O   1 
HETATM 9385 O  O   . HOH X 8 .   ? 72.597  48.864 54.202  1.00 30.23 ? 2282 HOH B O   1 
HETATM 9386 O  O   . HOH X 8 .   ? 75.962  36.789 60.078  1.00 35.78 ? 2283 HOH B O   1 
HETATM 9387 O  O   . HOH X 8 .   ? 80.164  35.825 58.880  1.00 20.45 ? 2284 HOH B O   1 
HETATM 9388 O  O   . HOH X 8 .   ? 73.877  39.661 59.561  1.00 28.86 ? 2285 HOH B O   1 
HETATM 9389 O  O   . HOH X 8 .   ? 84.838  42.859 59.773  1.00 23.34 ? 2286 HOH B O   1 
HETATM 9390 O  O   . HOH X 8 .   ? 83.905  36.180 64.535  1.00 31.72 ? 2287 HOH B O   1 
HETATM 9391 O  O   . HOH X 8 .   ? 89.661  45.047 69.042  1.00 38.60 ? 2288 HOH B O   1 
HETATM 9392 O  O   . HOH X 8 .   ? 83.894  41.450 68.247  1.00 22.34 ? 2289 HOH B O   1 
HETATM 9393 O  O   . HOH X 8 .   ? 90.624  41.085 62.530  1.00 43.66 ? 2290 HOH B O   1 
HETATM 9394 O  O   . HOH X 8 .   ? 89.586  44.154 60.160  1.00 44.64 ? 2291 HOH B O   1 
HETATM 9395 O  O   . HOH X 8 .   ? 92.164  44.671 66.425  1.00 27.91 ? 2292 HOH B O   1 
HETATM 9396 O  O   . HOH X 8 .   ? 95.789  55.445 66.023  1.00 25.80 ? 2293 HOH B O   1 
HETATM 9397 O  O   . HOH X 8 .   ? 99.116  51.244 72.715  1.00 42.15 ? 2294 HOH B O   1 
HETATM 9398 O  O   . HOH X 8 .   ? 116.313 47.838 68.912  1.00 18.31 ? 2295 HOH B O   1 
HETATM 9399 O  O   . HOH X 8 .   ? 120.582 51.492 72.664  1.00 24.85 ? 2296 HOH B O   1 
HETATM 9400 O  O   . HOH X 8 .   ? 120.963 55.049 70.191  1.00 38.63 ? 2297 HOH B O   1 
HETATM 9401 O  O   . HOH X 8 .   ? 119.305 50.231 68.055  1.00 33.24 ? 2298 HOH B O   1 
HETATM 9402 O  O   . HOH X 8 .   ? 121.770 49.504 71.311  1.00 14.59 ? 2299 HOH B O   1 
HETATM 9403 O  O   . HOH X 8 .   ? 119.650 43.324 74.326  1.00 25.35 ? 2300 HOH B O   1 
HETATM 9404 O  O   . HOH X 8 .   ? 115.143 48.324 71.259  1.00 16.87 ? 2301 HOH B O   1 
HETATM 9405 O  O   . HOH X 8 .   ? 93.654  31.123 69.578  1.00 30.96 ? 2302 HOH B O   1 
HETATM 9406 O  O   . HOH X 8 .   ? 94.869  35.497 66.326  1.00 25.41 ? 2303 HOH B O   1 
HETATM 9407 O  O   . HOH X 8 .   ? 92.246  33.549 69.331  1.00 29.56 ? 2304 HOH B O   1 
HETATM 9408 O  O   . HOH X 8 .   ? 92.066  31.124 72.663  1.00 37.32 ? 2305 HOH B O   1 
HETATM 9409 O  O   . HOH X 8 .   ? 91.314  35.584 77.985  1.00 29.50 ? 2306 HOH B O   1 
HETATM 9410 O  O   . HOH X 8 .   ? 83.705  30.506 79.937  1.00 29.00 ? 2307 HOH B O   1 
HETATM 9411 O  O   . HOH X 8 .   ? 78.108  38.176 80.587  1.00 26.95 ? 2308 HOH B O   1 
HETATM 9412 O  O   . HOH X 8 .   ? 78.295  35.396 82.963  1.00 22.29 ? 2309 HOH B O   1 
HETATM 9413 O  O   . HOH X 8 .   ? 85.979  36.645 83.987  1.00 30.38 ? 2310 HOH B O   1 
HETATM 9414 O  O   . HOH X 8 .   ? 79.861  33.778 79.016  1.00 33.60 ? 2311 HOH B O   1 
HETATM 9415 O  O   . HOH X 8 .   ? 78.739  36.188 71.941  1.00 29.43 ? 2312 HOH B O   1 
HETATM 9416 O  O   . HOH X 8 .   ? 92.937  39.826 83.972  1.00 30.95 ? 2313 HOH B O   1 
HETATM 9417 O  O   . HOH X 8 .   ? 91.822  35.611 80.598  1.00 40.99 ? 2314 HOH B O   1 
HETATM 9418 O  O   . HOH X 8 .   ? 89.690  37.296 86.788  1.00 31.24 ? 2315 HOH B O   1 
HETATM 9419 O  O   . HOH X 8 .   ? 99.871  25.470 91.177  1.00 19.01 ? 2316 HOH B O   1 
HETATM 9420 O  O   . HOH X 8 .   ? 93.192  27.351 88.286  1.00 20.21 ? 2317 HOH B O   1 
HETATM 9421 O  O   . HOH X 8 .   ? 84.064  26.482 90.780  1.00 29.53 ? 2318 HOH B O   1 
HETATM 9422 O  O   . HOH X 8 .   ? 84.333  24.009 89.921  1.00 22.59 ? 2319 HOH B O   1 
HETATM 9423 O  O   . HOH X 8 .   ? 87.795  26.423 83.348  1.00 28.50 ? 2320 HOH B O   1 
HETATM 9424 O  O   . HOH X 8 .   ? 89.840  22.728 85.125  1.00 22.83 ? 2321 HOH B O   1 
HETATM 9425 O  O   . HOH X 8 .   ? 92.755  25.708 77.762  1.00 19.94 ? 2322 HOH B O   1 
HETATM 9426 O  O   . HOH X 8 .   ? 92.717  21.107 82.920  1.00 17.19 ? 2323 HOH B O   1 
HETATM 9427 O  O   . HOH X 8 .   ? 92.329  21.318 80.265  1.00 43.54 ? 2324 HOH B O   1 
HETATM 9428 O  O   . HOH X 8 .   ? 99.765  26.431 77.667  1.00 20.31 ? 2325 HOH B O   1 
HETATM 9429 O  O   . HOH X 8 .   ? 104.603 26.296 81.221  1.00 12.55 ? 2326 HOH B O   1 
HETATM 9430 O  O   . HOH X 8 .   ? 102.415 24.146 84.278  1.00 25.03 ? 2327 HOH B O   1 
HETATM 9431 O  O   . HOH X 8 .   ? 106.686 28.170 87.092  1.00 13.49 ? 2328 HOH B O   1 
HETATM 9432 O  O   . HOH X 8 .   ? 103.154 26.208 92.909  1.00 24.69 ? 2329 HOH B O   1 
HETATM 9433 O  O   . HOH X 8 .   ? 106.356 23.628 87.674  1.00 23.37 ? 2330 HOH B O   1 
HETATM 9434 O  O   . HOH X 8 .   ? 102.099 27.213 77.301  1.00 24.85 ? 2331 HOH B O   1 
HETATM 9435 O  O   . HOH X 8 .   ? 108.833 31.138 79.956  1.00 24.11 ? 2332 HOH B O   1 
HETATM 9436 O  O   . HOH X 8 .   ? 102.383 30.826 72.681  1.00 28.43 ? 2333 HOH B O   1 
HETATM 9437 O  O   . HOH X 8 .   ? 115.183 33.769 85.189  1.00 45.54 ? 2334 HOH B O   1 
HETATM 9438 O  O   . HOH X 8 .   ? 117.502 33.519 88.898  1.00 35.50 ? 2335 HOH B O   1 
HETATM 9439 O  O   . HOH X 8 .   ? 118.025 41.236 74.943  1.00 18.20 ? 2336 HOH B O   1 
HETATM 9440 O  O   . HOH X 8 .   ? 118.123 35.739 79.734  1.00 20.75 ? 2337 HOH B O   1 
HETATM 9441 O  O   . HOH X 8 .   ? 115.282 30.312 86.409  1.00 27.57 ? 2338 HOH B O   1 
HETATM 9442 O  O   . HOH X 8 .   ? 111.437 30.579 67.520  1.00 35.33 ? 2339 HOH B O   1 
HETATM 9443 O  O   . HOH X 8 .   ? 109.634 40.082 69.279  1.00 16.15 ? 2340 HOH B O   1 
HETATM 9444 O  O   . HOH X 8 .   ? 115.624 38.799 65.671  1.00 31.15 ? 2341 HOH B O   1 
HETATM 9445 O  O   . HOH X 8 .   ? 116.601 37.299 69.000  1.00 19.94 ? 2342 HOH B O   1 
HETATM 9446 O  O   . HOH X 8 .   ? 115.599 45.212 68.969  1.00 17.33 ? 2343 HOH B O   1 
HETATM 9447 O  O   . HOH X 8 .   ? 112.643 40.919 64.083  1.00 17.24 ? 2344 HOH B O   1 
HETATM 9448 O  O   . HOH X 8 .   ? 112.101 49.796 63.836  1.00 25.98 ? 2345 HOH B O   1 
HETATM 9449 O  O   . HOH X 8 .   ? 109.641 43.025 57.860  1.00 25.44 ? 2346 HOH B O   1 
HETATM 9450 O  O   . HOH X 8 .   ? 116.981 45.279 61.408  1.00 40.66 ? 2347 HOH B O   1 
HETATM 9451 O  O   . HOH X 8 .   ? 118.585 40.025 59.601  1.00 37.24 ? 2348 HOH B O   1 
HETATM 9452 O  O   . HOH X 8 .   ? 106.075 46.073 62.618  1.00 26.49 ? 2349 HOH B O   1 
HETATM 9453 O  O   . HOH X 8 .   ? 105.997 48.749 58.846  1.00 43.64 ? 2350 HOH B O   1 
HETATM 9454 O  O   . HOH X 8 .   ? 105.658 43.591 63.923  1.00 20.61 ? 2351 HOH B O   1 
HETATM 9455 O  O   . HOH X 8 .   ? 114.840 35.182 59.566  1.00 36.09 ? 2352 HOH B O   1 
HETATM 9456 O  O   . HOH X 8 .   ? 115.607 37.558 61.154  1.00 46.09 ? 2353 HOH B O   1 
HETATM 9457 O  O   . HOH X 8 .   ? 115.335 32.792 61.888  1.00 34.82 ? 2354 HOH B O   1 
HETATM 9458 O  O   . HOH X 8 .   ? 98.738  37.191 64.952  1.00 26.45 ? 2355 HOH B O   1 
HETATM 9459 O  O   . HOH X 8 .   ? 95.216  29.488 73.480  1.00 37.47 ? 2356 HOH B O   1 
HETATM 9460 O  O   . HOH X 8 .   ? 101.495 38.988 61.541  1.00 21.89 ? 2357 HOH B O   1 
HETATM 9461 O  O   . HOH X 8 .   ? 103.887 36.557 59.599  1.00 20.77 ? 2358 HOH B O   1 
HETATM 9462 O  O   . HOH X 8 .   ? 99.628  41.531 58.976  1.00 23.27 ? 2359 HOH B O   1 
HETATM 9463 O  O   . HOH X 8 .   ? 95.501  40.402 63.238  1.00 31.16 ? 2360 HOH B O   1 
HETATM 9464 O  O   . HOH X 8 .   ? 91.728  42.086 60.405  1.00 44.70 ? 2361 HOH B O   1 
HETATM 9465 O  O   . HOH X 8 .   ? 99.196  40.578 61.825  1.00 25.17 ? 2362 HOH B O   1 
HETATM 9466 O  O   . HOH X 8 .   ? 98.174  43.217 57.875  1.00 7.72  ? 2363 HOH B O   1 
HETATM 9467 O  O   . HOH X 8 .   ? 94.602  48.727 52.271  1.00 25.49 ? 2364 HOH B O   1 
HETATM 9468 O  O   . HOH X 8 .   ? 96.183  44.535 59.443  0.50 4.05  ? 2365 HOH B O   1 
HETATM 9469 O  O   . HOH X 8 .   ? 98.343  55.377 65.912  1.00 22.57 ? 2366 HOH B O   1 
HETATM 9470 O  O   . HOH X 8 .   ? 101.570 60.667 57.847  1.00 30.81 ? 2367 HOH B O   1 
HETATM 9471 O  O   . HOH X 8 .   ? 102.795 54.430 53.167  1.00 28.57 ? 2368 HOH B O   1 
HETATM 9472 O  O   . HOH X 8 .   ? 104.823 52.118 55.084  1.00 36.43 ? 2369 HOH B O   1 
HETATM 9473 O  O   . HOH X 8 .   ? 96.421  64.632 61.408  1.00 29.86 ? 2370 HOH B O   1 
HETATM 9474 O  O   . HOH X 8 .   ? 101.754 68.227 59.215  1.00 32.73 ? 2371 HOH B O   1 
HETATM 9475 O  O   . HOH X 8 .   ? 100.520 70.007 58.094  1.00 35.74 ? 2372 HOH B O   1 
HETATM 9476 O  O   . HOH X 8 .   ? 91.099  73.262 50.844  1.00 22.90 ? 2373 HOH B O   1 
HETATM 9477 O  O   . HOH X 8 .   ? 96.778  36.777 99.674  1.00 28.34 ? 2374 HOH B O   1 
HETATM 9478 O  O   . HOH X 8 .   ? 93.917  36.484 105.430 1.00 55.04 ? 2375 HOH B O   1 
HETATM 9479 O  O   . HOH X 8 .   ? 92.063  50.625 81.581  1.00 56.82 ? 2376 HOH B O   1 
HETATM 9480 O  O   . HOH X 8 .   ? 105.306 50.716 59.928  1.00 47.20 ? 2377 HOH B O   1 
HETATM 9481 O  O   . HOH X 8 .   ? 123.332 35.662 69.438  1.00 67.77 ? 2378 HOH B O   1 
HETATM 9482 O  O   . HOH X 8 .   ? 108.963 36.702 109.610 1.00 33.14 ? 2379 HOH B O   1 
HETATM 9483 O  O   . HOH X 8 .   ? 110.887 37.602 103.408 1.00 15.96 ? 2380 HOH B O   1 
HETATM 9484 O  O   . HOH X 8 .   ? 116.056 47.068 108.245 1.00 28.95 ? 2381 HOH B O   1 
HETATM 9485 O  O   . HOH X 8 .   ? 94.712  40.884 114.818 1.00 34.10 ? 2382 HOH B O   1 
HETATM 9486 O  O   . HOH X 8 .   ? 94.623  40.144 112.437 1.00 34.85 ? 2383 HOH B O   1 
HETATM 9487 O  O   . HOH X 8 .   ? 92.060  44.737 112.680 1.00 33.73 ? 2384 HOH B O   1 
HETATM 9488 O  O   . HOH X 8 .   ? 92.138  47.064 111.991 1.00 34.33 ? 2385 HOH B O   1 
HETATM 9489 O  O   . HOH X 8 .   ? 96.061  40.209 110.392 1.00 29.45 ? 2386 HOH B O   1 
HETATM 9490 O  O   . HOH X 8 .   ? 119.230 47.011 68.626  1.00 31.34 ? 2387 HOH B O   1 
HETATM 9491 O  O   . HOH X 8 .   ? 128.742 44.428 74.780  1.00 43.36 ? 2388 HOH B O   1 
HETATM 9492 O  O   . HOH X 8 .   ? 128.143 45.449 70.381  1.00 53.80 ? 2389 HOH B O   1 
HETATM 9493 O  O   . HOH X 8 .   ? 128.166 50.345 72.621  1.00 47.58 ? 2390 HOH B O   1 
HETATM 9494 O  O   . HOH X 8 .   ? 127.002 50.382 74.770  1.00 69.63 ? 2391 HOH B O   1 
HETATM 9495 O  O   . HOH X 8 .   ? 129.426 44.949 72.615  1.00 58.07 ? 2392 HOH B O   1 
HETATM 9496 O  O   . HOH X 8 .   ? 122.763 47.504 68.333  1.00 51.99 ? 2393 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 4   ? 0.9690 0.8868 0.6258 -0.1220 -0.1950 -0.0883 4   SER A N   
2    C CA  . SER A 4   ? 0.9586 0.8843 0.6397 -0.1346 -0.2131 -0.0812 4   SER A CA  
3    C C   . SER A 4   ? 0.9061 0.8317 0.6281 -0.1305 -0.2050 -0.0725 4   SER A C   
4    O O   . SER A 4   ? 0.8698 0.8154 0.6171 -0.1245 -0.2003 -0.0546 4   SER A O   
5    C CB  . SER A 4   ? 1.0064 0.9119 0.6678 -0.1478 -0.2272 -0.1006 4   SER A CB  
6    O OG  . SER A 4   ? 1.0249 0.9393 0.7113 -0.1617 -0.2444 -0.0938 4   SER A OG  
7    N N   . GLU A 5   ? 0.8950 0.7966 0.6219 -0.1338 -0.2035 -0.0853 5   GLU A N   
8    C CA  . GLU A 5   ? 0.8419 0.7376 0.5994 -0.1280 -0.1923 -0.0801 5   GLU A CA  
9    C C   . GLU A 5   ? 0.8005 0.7028 0.5616 -0.1116 -0.1731 -0.0729 5   GLU A C   
10   O O   . GLU A 5   ? 0.7596 0.6713 0.5498 -0.1064 -0.1654 -0.0605 5   GLU A O   
11   C CB  . GLU A 5   ? 0.8706 0.7328 0.6202 -0.1310 -0.1918 -0.0981 5   GLU A CB  
12   C CG  . GLU A 5   ? 0.8460 0.6968 0.6219 -0.1255 -0.1811 -0.0944 5   GLU A CG  
13   C CD  . GLU A 5   ? 0.8982 0.7135 0.6671 -0.1307 -0.1850 -0.1107 5   GLU A CD  
14   O OE1 . GLU A 5   ? 0.9309 0.7256 0.6692 -0.1307 -0.1882 -0.1295 5   GLU A OE1 
15   O OE2 . GLU A 5   ? 0.8860 0.6934 0.6794 -0.1347 -0.1849 -0.1046 5   GLU A OE2 
16   N N   . LEU A 6   ? 0.8027 0.7010 0.5336 -0.1045 -0.1656 -0.0812 6   LEU A N   
17   C CA  . LEU A 6   ? 0.7663 0.6697 0.4966 -0.0905 -0.1475 -0.0767 6   LEU A CA  
18   C C   . LEU A 6   ? 0.7437 0.6716 0.4720 -0.0880 -0.1471 -0.0602 6   LEU A C   
19   O O   . LEU A 6   ? 0.7156 0.6499 0.4476 -0.0782 -0.1333 -0.0531 6   LEU A O   
20   C CB  . LEU A 6   ? 0.7972 0.6834 0.4970 -0.0838 -0.1374 -0.0957 6   LEU A CB  
21   C CG  . LEU A 6   ? 0.8184 0.6767 0.5203 -0.0801 -0.1325 -0.1125 6   LEU A CG  
22   C CD1 . LEU A 6   ? 0.8664 0.7132 0.5361 -0.0718 -0.1226 -0.1315 6   LEU A CD1 
23   C CD2 . LEU A 6   ? 0.7868 0.6438 0.5211 -0.0718 -0.1214 -0.1037 6   LEU A CD2 
24   N N   . LEU A 7   ? 0.7501 0.6911 0.4729 -0.0972 -0.1632 -0.0536 7   LEU A N   
25   C CA  . LEU A 7   ? 0.7394 0.7019 0.4601 -0.0952 -0.1658 -0.0366 7   LEU A CA  
26   C C   . LEU A 7   ? 0.7112 0.6910 0.4682 -0.0972 -0.1747 -0.0198 7   LEU A C   
27   O O   . LEU A 7   ? 0.7219 0.7079 0.4875 -0.1069 -0.1902 -0.0194 7   LEU A O   
28   C CB  . LEU A 7   ? 0.7741 0.7404 0.4576 -0.1023 -0.1772 -0.0407 7   LEU A CB  
29   C CG  . LEU A 7   ? 0.7734 0.7597 0.4471 -0.1020 -0.1833 -0.0229 7   LEU A CG  
30   C CD1 . LEU A 7   ? 0.7445 0.7340 0.4171 -0.0914 -0.1660 -0.0135 7   LEU A CD1 
31   C CD2 . LEU A 7   ? 0.8144 0.8024 0.4478 -0.1108 -0.1956 -0.0295 7   LEU A CD2 
32   N N   . VAL A 8   ? 0.6830 0.6709 0.4627 -0.0878 -0.1643 -0.0070 8   VAL A N   
33   C CA  . VAL A 8   ? 0.6603 0.6642 0.4764 -0.0874 -0.1697 0.0067  8   VAL A CA  
34   C C   . VAL A 8   ? 0.6543 0.6739 0.4744 -0.0808 -0.1709 0.0240  8   VAL A C   
35   O O   . VAL A 8   ? 0.6562 0.6715 0.4676 -0.0730 -0.1588 0.0278  8   VAL A O   
36   C CB  . VAL A 8   ? 0.6308 0.6281 0.4742 -0.0821 -0.1568 0.0053  8   VAL A CB  
37   C CG1 . VAL A 8   ? 0.5964 0.6124 0.4760 -0.0800 -0.1596 0.0190  8   VAL A CG1 
38   C CG2 . VAL A 8   ? 0.6512 0.6315 0.4923 -0.0896 -0.1584 -0.0095 8   VAL A CG2 
39   N N   . ASN A 9   ? 0.6542 0.6918 0.4884 -0.0842 -0.1861 0.0348  9   ASN A N   
40   C CA  . ASN A 9   ? 0.6543 0.7059 0.4969 -0.0771 -0.1897 0.0524  9   ASN A CA  
41   C C   . ASN A 9   ? 0.6187 0.6784 0.5003 -0.0682 -0.1826 0.0609  9   ASN A C   
42   O O   . ASN A 9   ? 0.6120 0.6848 0.5213 -0.0707 -0.1888 0.0622  9   ASN A O   
43   C CB  . ASN A 9   ? 0.6739 0.7423 0.5127 -0.0837 -0.2110 0.0603  9   ASN A CB  
44   C CG  . ASN A 9   ? 0.7019 0.7804 0.5417 -0.0763 -0.2162 0.0787  9   ASN A CG  
45   O OD1 . ASN A 9   ? 0.7266 0.7971 0.5657 -0.0674 -0.2036 0.0850  9   ASN A OD1 
46   N ND2 . ASN A 9   ? 0.6720 0.7676 0.5141 -0.0801 -0.2357 0.0882  9   ASN A ND2 
47   N N   . THR A 10  ? 0.5992 0.6520 0.4827 -0.0586 -0.1694 0.0663  10  THR A N   
48   C CA  . THR A 10  ? 0.5692 0.6274 0.4860 -0.0498 -0.1617 0.0723  10  THR A CA  
49   C C   . THR A 10  ? 0.5792 0.6474 0.5058 -0.0422 -0.1688 0.0885  10  THR A C   
50   O O   . THR A 10  ? 0.5986 0.6684 0.5051 -0.0446 -0.1789 0.0954  10  THR A O   
51   C CB  . THR A 10  ? 0.5456 0.5881 0.4602 -0.0440 -0.1429 0.0670  10  THR A CB  
52   O OG1 . THR A 10  ? 0.5427 0.5794 0.4432 -0.0388 -0.1385 0.0754  10  THR A OG1 
53   C CG2 . THR A 10  ? 0.5360 0.5641 0.4306 -0.0500 -0.1362 0.0515  10  THR A CG2 
54   N N   . LYS A 11  ? 0.5690 0.6425 0.5250 -0.0328 -0.1633 0.0943  11  LYS A N   
55   C CA  . LYS A 11  ? 0.5888 0.6701 0.5592 -0.0235 -0.1704 0.1091  11  LYS A CA  
56   C C   . LYS A 11  ? 0.5962 0.6620 0.5452 -0.0198 -0.1667 0.1176  11  LYS A C   
57   O O   . LYS A 11  ? 0.6187 0.6879 0.5695 -0.0151 -0.1768 0.1311  11  LYS A O   
58   C CB  . LYS A 11  ? 0.5696 0.6602 0.5774 -0.0137 -0.1646 0.1105  11  LYS A CB  
59   C CG  . LYS A 11  ? 0.5973 0.7113 0.6302 -0.0172 -0.1731 0.1083  11  LYS A CG  
60   C CD  . LYS A 11  ? 0.6226 0.7520 0.6927 -0.0057 -0.1703 0.1125  11  LYS A CD  
61   C CE  . LYS A 11  ? 0.6404 0.7985 0.7361 -0.0103 -0.1803 0.1124  11  LYS A CE  
62   N NZ  . LYS A 11  ? 0.6649 0.8266 0.7716 -0.0167 -0.1691 0.1019  11  LYS A NZ  
63   N N   . SER A 12  ? 0.5875 0.6374 0.5174 -0.0221 -0.1527 0.1106  12  SER A N   
64   C CA  . SER A 12  ? 0.6094 0.6463 0.5190 -0.0207 -0.1480 0.1189  12  SER A CA  
65   C C   . SER A 12  ? 0.6256 0.6588 0.4969 -0.0301 -0.1497 0.1165  12  SER A C   
66   O O   . SER A 12  ? 0.6516 0.6766 0.5023 -0.0312 -0.1454 0.1237  12  SER A O   
67   C CB  . SER A 12  ? 0.5990 0.6233 0.5151 -0.0164 -0.1307 0.1146  12  SER A CB  
68   O OG  . SER A 12  ? 0.6228 0.6513 0.5676 -0.0114 -0.1253 0.1073  12  SER A OG  
69   N N   . GLY A 13  ? 0.6184 0.6579 0.4799 -0.0375 -0.1561 0.1062  13  GLY A N   
70   C CA  . GLY A 13  ? 0.6291 0.6656 0.4528 -0.0462 -0.1581 0.1009  13  GLY A CA  
71   C C   . GLY A 13  ? 0.6130 0.6461 0.4276 -0.0523 -0.1543 0.0818  13  GLY A C   
72   O O   . GLY A 13  ? 0.5942 0.6267 0.4317 -0.0508 -0.1502 0.0736  13  GLY A O   
73   N N   . LYS A 14  ? 0.6310 0.6607 0.4106 -0.0593 -0.1558 0.0746  14  LYS A N   
74   C CA  . LYS A 14  ? 0.6282 0.6511 0.3943 -0.0651 -0.1537 0.0551  14  LYS A CA  
75   C C   . LYS A 14  ? 0.6165 0.6269 0.3773 -0.0612 -0.1343 0.0429  14  LYS A C   
76   O O   . LYS A 14  ? 0.6034 0.6120 0.3531 -0.0578 -0.1231 0.0478  14  LYS A O   
77   C CB  . LYS A 14  ? 0.6637 0.6883 0.3921 -0.0737 -0.1639 0.0506  14  LYS A CB  
78   C CG  . LYS A 14  ? 0.6856 0.7235 0.4155 -0.0793 -0.1856 0.0600  14  LYS A CG  
79   C CD  . LYS A 14  ? 0.7196 0.7597 0.4059 -0.0868 -0.1940 0.0603  14  LYS A CD  
80   C CE  . LYS A 14  ? 0.7274 0.7774 0.4083 -0.0958 -0.2159 0.0596  14  LYS A CE  
81   N NZ  . LYS A 14  ? 0.7809 0.8332 0.4159 -0.1030 -0.2237 0.0603  14  LYS A NZ  
82   N N   . VAL A 15  ? 0.6069 0.6091 0.3760 -0.0624 -0.1315 0.0278  15  VAL A N   
83   C CA  A VAL A 15  ? 0.6023 0.5922 0.3697 -0.0580 -0.1153 0.0148  15  VAL A CA  
84   C CA  B VAL A 15  ? 0.5996 0.5896 0.3655 -0.0581 -0.1152 0.0148  15  VAL A CA  
85   C C   . VAL A 15  ? 0.6282 0.6066 0.3739 -0.0630 -0.1173 -0.0048 15  VAL A C   
86   O O   . VAL A 15  ? 0.6301 0.6067 0.3788 -0.0699 -0.1301 -0.0098 15  VAL A O   
87   C CB  A VAL A 15  ? 0.5687 0.5564 0.3720 -0.0530 -0.1095 0.0163  15  VAL A CB  
88   C CB  B VAL A 15  ? 0.5652 0.5524 0.3657 -0.0520 -0.1070 0.0165  15  VAL A CB  
89   C CG1 A VAL A 15  ? 0.5684 0.5427 0.3710 -0.0494 -0.0968 0.0021  15  VAL A CG1 
90   C CG1 B VAL A 15  ? 0.5327 0.5284 0.3516 -0.0463 -0.1038 0.0333  15  VAL A CG1 
91   C CG2 A VAL A 15  ? 0.5372 0.5325 0.3596 -0.0465 -0.1045 0.0320  15  VAL A CG2 
92   C CG2 B VAL A 15  ? 0.5406 0.5277 0.3616 -0.0565 -0.1167 0.0129  15  VAL A CG2 
93   N N   . MET A 16  ? 0.6519 0.6226 0.3768 -0.0595 -0.1047 -0.0163 16  MET A N   
94   C CA  . MET A 16  ? 0.6884 0.6452 0.3933 -0.0619 -0.1053 -0.0366 16  MET A CA  
95   C C   . MET A 16  ? 0.6771 0.6215 0.3982 -0.0543 -0.0925 -0.0464 16  MET A C   
96   O O   . MET A 16  ? 0.6711 0.6179 0.3914 -0.0466 -0.0776 -0.0466 16  MET A O   
97   C CB  . MET A 16  ? 0.7321 0.6909 0.3978 -0.0628 -0.1010 -0.0444 16  MET A CB  
98   C CG  . MET A 16  ? 0.7990 0.7416 0.4413 -0.0634 -0.1000 -0.0687 16  MET A CG  
99   S SD  . MET A 16  ? 0.9330 0.8674 0.5601 -0.0763 -0.1226 -0.0779 16  MET A SD  
100  C CE  . MET A 16  ? 0.9531 0.9025 0.5376 -0.0822 -0.1279 -0.0739 16  MET A CE  
101  N N   . GLY A 17  ? 0.6752 0.6068 0.4110 -0.0570 -0.0988 -0.0539 17  GLY A N   
102  C CA  . GLY A 17  ? 0.6797 0.5974 0.4297 -0.0502 -0.0888 -0.0626 17  GLY A CA  
103  C C   . GLY A 17  ? 0.7210 0.6219 0.4471 -0.0468 -0.0840 -0.0836 17  GLY A C   
104  O O   . GLY A 17  ? 0.7565 0.6588 0.4523 -0.0491 -0.0856 -0.0919 17  GLY A O   
105  N N   . THR A 18  ? 0.7163 0.6009 0.4555 -0.0409 -0.0785 -0.0925 18  THR A N   
106  C CA  . THR A 18  ? 0.7373 0.6026 0.4579 -0.0354 -0.0740 -0.1138 18  THR A CA  
107  C C   . THR A 18  ? 0.7397 0.5794 0.4739 -0.0371 -0.0810 -0.1221 18  THR A C   
108  O O   . THR A 18  ? 0.7165 0.5560 0.4786 -0.0377 -0.0819 -0.1108 18  THR A O   
109  C CB  . THR A 18  ? 0.7339 0.6071 0.4523 -0.0219 -0.0551 -0.1175 18  THR A CB  
110  O OG1 . THR A 18  ? 0.7704 0.6263 0.4715 -0.0146 -0.0504 -0.1394 18  THR A OG1 
111  C CG2 . THR A 18  ? 0.6780 0.5558 0.4292 -0.0150 -0.0470 -0.1057 18  THR A CG2 
112  N N   . ARG A 19  ? 0.7675 0.5850 0.4813 -0.0386 -0.0867 -0.1414 19  ARG A N   
113  C CA  A ARG A 19  ? 0.7781 0.5670 0.5024 -0.0405 -0.0938 -0.1499 19  ARG A CA  
114  C CA  B ARG A 19  ? 0.7781 0.5668 0.5020 -0.0405 -0.0938 -0.1502 19  ARG A CA  
115  C C   . ARG A 19  ? 0.7756 0.5529 0.5095 -0.0250 -0.0806 -0.1569 19  ARG A C   
116  O O   . ARG A 19  ? 0.7977 0.5740 0.5146 -0.0140 -0.0703 -0.1709 19  ARG A O   
117  C CB  A ARG A 19  ? 0.8237 0.5899 0.5220 -0.0488 -0.1064 -0.1687 19  ARG A CB  
118  C CB  B ARG A 19  ? 0.8240 0.5898 0.5207 -0.0478 -0.1055 -0.1699 19  ARG A CB  
119  C CG  A ARG A 19  ? 0.8275 0.5653 0.5386 -0.0574 -0.1192 -0.1721 19  ARG A CG  
120  C CG  B ARG A 19  ? 0.8251 0.5630 0.5340 -0.0570 -0.1188 -0.1733 19  ARG A CG  
121  C CD  A ARG A 19  ? 0.8601 0.5828 0.5495 -0.0721 -0.1363 -0.1844 19  ARG A CD  
122  C CD  B ARG A 19  ? 0.8660 0.5723 0.5480 -0.0598 -0.1274 -0.1977 19  ARG A CD  
123  N NE  A ARG A 19  ? 0.8535 0.5446 0.5529 -0.0808 -0.1482 -0.1896 19  ARG A NE  
124  N NE  B ARG A 19  ? 0.8507 0.5321 0.5439 -0.0734 -0.1432 -0.1979 19  ARG A NE  
125  C CZ  A ARG A 19  ? 0.8343 0.5288 0.5567 -0.0955 -0.1595 -0.1746 19  ARG A CZ  
126  C CZ  B ARG A 19  ? 0.8978 0.5435 0.5748 -0.0770 -0.1525 -0.2177 19  ARG A CZ  
127  N NH1 A ARG A 19  ? 0.7808 0.5090 0.5195 -0.1012 -0.1603 -0.1547 19  ARG A NH1 
128  N NH1 B ARG A 19  ? 0.9264 0.5577 0.5747 -0.0663 -0.1467 -0.2407 19  ARG A NH1 
129  N NH2 A ARG A 19  ? 0.8536 0.5173 0.5829 -0.1043 -0.1700 -0.1796 19  ARG A NH2 
130  N NH2 B ARG A 19  ? 0.8880 0.5124 0.5777 -0.0917 -0.1673 -0.2148 19  ARG A NH2 
131  N N   . VAL A 20  ? 0.7559 0.5270 0.5177 -0.0240 -0.0808 -0.1466 20  VAL A N   
132  C CA  . VAL A 20  ? 0.7606 0.5229 0.5352 -0.0093 -0.0698 -0.1502 20  VAL A CA  
133  C C   . VAL A 20  ? 0.7877 0.5145 0.5683 -0.0091 -0.0779 -0.1590 20  VAL A C   
134  O O   . VAL A 20  ? 0.7915 0.5063 0.5793 -0.0227 -0.0908 -0.1531 20  VAL A O   
135  C CB  . VAL A 20  ? 0.7123 0.4966 0.5134 -0.0054 -0.0616 -0.1307 20  VAL A CB  
136  C CG1 . VAL A 20  ? 0.7156 0.5305 0.5104 -0.0038 -0.0526 -0.1231 20  VAL A CG1 
137  C CG2 . VAL A 20  ? 0.7001 0.4855 0.5210 -0.0176 -0.0713 -0.1146 20  VAL A CG2 
138  N N   . PRO A 21  ? 0.8091 0.5195 0.5882 0.0062  -0.0704 -0.1726 21  PRO A N   
139  C CA  . PRO A 21  ? 0.8377 0.5117 0.6242 0.0059  -0.0795 -0.1784 21  PRO A CA  
140  C C   . PRO A 21  ? 0.8026 0.4787 0.6187 0.0063  -0.0791 -0.1594 21  PRO A C   
141  O O   . PRO A 21  ? 0.7742 0.4752 0.6039 0.0142  -0.0682 -0.1487 21  PRO A O   
142  C CB  . PRO A 21  ? 0.8722 0.5280 0.6465 0.0240  -0.0719 -0.2006 21  PRO A CB  
143  C CG  . PRO A 21  ? 0.8730 0.5621 0.6349 0.0331  -0.0567 -0.2046 21  PRO A CG  
144  C CD  . PRO A 21  ? 0.8041 0.5268 0.5769 0.0235  -0.0546 -0.1825 21  PRO A CD  
145  N N   . VAL A 22  ? 0.8138 0.4640 0.6383 -0.0035 -0.0914 -0.1551 22  VAL A N   
146  C CA  . VAL A 22  ? 0.7840 0.4331 0.6335 -0.0051 -0.0925 -0.1372 22  VAL A CA  
147  C C   . VAL A 22  ? 0.8190 0.4258 0.6700 -0.0101 -0.1051 -0.1413 22  VAL A C   
148  O O   . VAL A 22  ? 0.8403 0.4301 0.6817 -0.0250 -0.1172 -0.1459 22  VAL A O   
149  C CB  . VAL A 22  ? 0.7446 0.4238 0.6070 -0.0196 -0.0940 -0.1165 22  VAL A CB  
150  C CG1 . VAL A 22  ? 0.7458 0.4210 0.6005 -0.0386 -0.1070 -0.1165 22  VAL A CG1 
151  C CG2 . VAL A 22  ? 0.7243 0.4062 0.6101 -0.0209 -0.0934 -0.0983 22  VAL A CG2 
152  N N   . LEU A 23  ? 0.8295 0.4185 0.6922 0.0022  -0.1030 -0.1401 23  LEU A N   
153  C CA  . LEU A 23  ? 0.8661 0.4119 0.7320 -0.0014 -0.1152 -0.1413 23  LEU A CA  
154  C C   . LEU A 23  ? 0.9215 0.4320 0.7688 -0.0124 -0.1286 -0.1575 23  LEU A C   
155  O O   . LEU A 23  ? 0.9385 0.4313 0.7894 -0.0313 -0.1416 -0.1490 23  LEU A O   
156  C CB  . LEU A 23  ? 0.8389 0.3886 0.7247 -0.0141 -0.1203 -0.1170 23  LEU A CB  
157  C CG  . LEU A 23  ? 0.8001 0.3854 0.7029 -0.0082 -0.1094 -0.0996 23  LEU A CG  
158  C CD1 . LEU A 23  ? 0.7776 0.3693 0.6947 -0.0251 -0.1151 -0.0774 23  LEU A CD1 
159  C CD2 . LEU A 23  ? 0.7899 0.3708 0.7007 0.0138  -0.1018 -0.1026 23  LEU A CD2 
160  N N   . SER A 24  ? 0.9521 0.4520 0.7795 -0.0010 -0.1253 -0.1811 24  SER A N   
161  C CA  . SER A 24  ? 1.0100 0.4772 0.8156 -0.0101 -0.1374 -0.2003 24  SER A CA  
162  C C   . SER A 24  ? 1.0014 0.4836 0.8007 -0.0344 -0.1469 -0.1933 24  SER A C   
163  O O   . SER A 24  ? 1.0462 0.4997 0.8398 -0.0508 -0.1621 -0.1969 24  SER A O   
164  C CB  . SER A 24  ? 1.0612 0.4748 0.8693 -0.0109 -0.1502 -0.2056 24  SER A CB  
165  O OG  . SER A 24  ? 1.0623 0.4695 0.8919 -0.0001 -0.1470 -0.1918 24  SER A OG  
166  N N   . SER A 25  ? 0.9544 0.4814 0.7560 -0.0366 -0.1385 -0.1831 25  SER A N   
167  C CA  . SER A 25  ? 0.9354 0.4845 0.7321 -0.0561 -0.1460 -0.1764 25  SER A CA  
168  C C   . SER A 25  ? 0.8976 0.4905 0.6903 -0.0486 -0.1331 -0.1727 25  SER A C   
169  O O   . SER A 25  ? 0.8937 0.4953 0.6837 -0.0301 -0.1194 -0.1787 25  SER A O   
170  C CB  . SER A 25  ? 0.9138 0.4692 0.7336 -0.0743 -0.1542 -0.1536 25  SER A CB  
171  O OG  . SER A 25  ? 0.8931 0.4623 0.7092 -0.0943 -0.1650 -0.1500 25  SER A OG  
172  N N   . HIS A 26  ? 0.8735 0.4942 0.6668 -0.0626 -0.1374 -0.1623 26  HIS A N   
173  C CA  . HIS A 26  ? 0.8437 0.5025 0.6321 -0.0563 -0.1268 -0.1577 26  HIS A CA  
174  C C   . HIS A 26  ? 0.7969 0.4880 0.6050 -0.0674 -0.1285 -0.1353 26  HIS A C   
175  O O   . HIS A 26  ? 0.8021 0.4892 0.6235 -0.0824 -0.1392 -0.1259 26  HIS A O   
176  C CB  . HIS A 26  ? 0.8736 0.5335 0.6311 -0.0579 -0.1298 -0.1749 26  HIS A CB  
177  C CG  . HIS A 26  ? 0.9382 0.5694 0.6741 -0.0452 -0.1262 -0.1995 26  HIS A CG  
178  N ND1 . HIS A 26  ? 1.0082 0.5983 0.7359 -0.0497 -0.1376 -0.2145 26  HIS A ND1 
179  C CD2 . HIS A 26  ? 0.9533 0.5912 0.6744 -0.0280 -0.1122 -0.2123 26  HIS A CD2 
180  C CE1 . HIS A 26  ? 1.0431 0.6148 0.7519 -0.0341 -0.1306 -0.2366 26  HIS A CE1 
181  N NE2 . HIS A 26  ? 1.0023 0.6045 0.7073 -0.0207 -0.1146 -0.2355 26  HIS A NE2 
182  N N   . ILE A 27  ? 0.7544 0.4775 0.5655 -0.0598 -0.1175 -0.1267 27  ILE A N   
183  C CA  . ILE A 27  ? 0.7145 0.4693 0.5374 -0.0695 -0.1205 -0.1097 27  ILE A CA  
184  C C   . ILE A 27  ? 0.6782 0.4615 0.4921 -0.0624 -0.1120 -0.1063 27  ILE A C   
185  O O   . ILE A 27  ? 0.6915 0.4732 0.4884 -0.0511 -0.1029 -0.1171 27  ILE A O   
186  C CB  . ILE A 27  ? 0.6883 0.4538 0.5413 -0.0740 -0.1196 -0.0907 27  ILE A CB  
187  C CG1 . ILE A 27  ? 0.6476 0.4194 0.5122 -0.0592 -0.1053 -0.0848 27  ILE A CG1 
188  C CG2 . ILE A 27  ? 0.7211 0.4625 0.5828 -0.0881 -0.1321 -0.0899 27  ILE A CG2 
189  C CD1 . ILE A 27  ? 0.6434 0.4318 0.5334 -0.0639 -0.1038 -0.0663 27  ILE A CD1 
190  N N   . SER A 28  ? 0.6341 0.4436 0.4601 -0.0695 -0.1152 -0.0911 28  SER A N   
191  C CA  . SER A 28  ? 0.6142 0.4491 0.4326 -0.0652 -0.1101 -0.0853 28  SER A CA  
192  C C   . SER A 28  ? 0.5716 0.4226 0.4064 -0.0545 -0.0964 -0.0735 28  SER A C   
193  O O   . SER A 28  ? 0.5435 0.4006 0.4024 -0.0557 -0.0953 -0.0619 28  SER A O   
194  C CB  . SER A 28  ? 0.6066 0.4601 0.4290 -0.0775 -0.1225 -0.0755 28  SER A CB  
195  O OG  . SER A 28  ? 0.6223 0.4620 0.4273 -0.0883 -0.1360 -0.0872 28  SER A OG  
196  N N   . ALA A 29  ? 0.5561 0.4143 0.3772 -0.0447 -0.0860 -0.0770 29  ALA A N   
197  C CA  . ALA A 29  ? 0.5248 0.3991 0.3598 -0.0361 -0.0740 -0.0660 29  ALA A CA  
198  C C   . ALA A 29  ? 0.5251 0.4202 0.3499 -0.0361 -0.0720 -0.0584 29  ALA A C   
199  O O   . ALA A 29  ? 0.5462 0.4416 0.3459 -0.0364 -0.0723 -0.0664 29  ALA A O   
200  C CB  . ALA A 29  ? 0.5215 0.3867 0.3558 -0.0241 -0.0618 -0.0744 29  ALA A CB  
201  N N   . PHE A 30  ? 0.4862 0.3977 0.3297 -0.0359 -0.0704 -0.0429 30  PHE A N   
202  C CA  . PHE A 30  ? 0.4867 0.4159 0.3244 -0.0354 -0.0690 -0.0328 30  PHE A CA  
203  C C   . PHE A 30  ? 0.4615 0.3978 0.3127 -0.0272 -0.0562 -0.0256 30  PHE A C   
204  O O   . PHE A 30  ? 0.4345 0.3749 0.3085 -0.0263 -0.0554 -0.0170 30  PHE A O   
205  C CB  . PHE A 30  ? 0.4765 0.4175 0.3269 -0.0425 -0.0806 -0.0208 30  PHE A CB  
206  C CG  . PHE A 30  ? 0.4791 0.4157 0.3198 -0.0523 -0.0948 -0.0267 30  PHE A CG  
207  C CD1 . PHE A 30  ? 0.4584 0.3997 0.2756 -0.0565 -0.1022 -0.0283 30  PHE A CD1 
208  C CD2 . PHE A 30  ? 0.4810 0.4090 0.3354 -0.0585 -0.1015 -0.0300 30  PHE A CD2 
209  C CE1 . PHE A 30  ? 0.5018 0.4395 0.3097 -0.0665 -0.1165 -0.0342 30  PHE A CE1 
210  C CE2 . PHE A 30  ? 0.4759 0.4000 0.3221 -0.0693 -0.1157 -0.0354 30  PHE A CE2 
211  C CZ  . PHE A 30  ? 0.4844 0.4134 0.3076 -0.0731 -0.1233 -0.0380 30  PHE A CZ  
212  N N   . LEU A 31  ? 0.4665 0.4044 0.3037 -0.0217 -0.0460 -0.0303 31  LEU A N   
213  C CA  . LEU A 31  ? 0.4482 0.3919 0.2977 -0.0146 -0.0338 -0.0261 31  LEU A CA  
214  C C   . LEU A 31  ? 0.4433 0.4014 0.2884 -0.0151 -0.0297 -0.0145 31  LEU A C   
215  O O   . LEU A 31  ? 0.4648 0.4278 0.2883 -0.0181 -0.0308 -0.0145 31  LEU A O   
216  C CB  . LEU A 31  ? 0.4533 0.3902 0.2950 -0.0073 -0.0242 -0.0397 31  LEU A CB  
217  C CG  . LEU A 31  ? 0.4640 0.3816 0.3072 -0.0056 -0.0283 -0.0526 31  LEU A CG  
218  C CD1 . LEU A 31  ? 0.4651 0.3777 0.2975 0.0035  -0.0187 -0.0670 31  LEU A CD1 
219  C CD2 . LEU A 31  ? 0.4058 0.3174 0.2742 -0.0053 -0.0307 -0.0467 31  LEU A CD2 
220  N N   . GLY A 32  ? 0.4322 0.3959 0.2965 -0.0127 -0.0252 -0.0047 32  GLY A N   
221  C CA  . GLY A 32  ? 0.4202 0.3945 0.2823 -0.0136 -0.0212 0.0072  32  GLY A CA  
222  C C   . GLY A 32  ? 0.4245 0.4023 0.2818 -0.0187 -0.0318 0.0178  32  GLY A C   
223  O O   . GLY A 32  ? 0.4611 0.4440 0.3006 -0.0216 -0.0319 0.0229  32  GLY A O   
224  N N   . ILE A 33  ? 0.4077 0.3839 0.2804 -0.0198 -0.0410 0.0212  33  ILE A N   
225  C CA  . ILE A 33  ? 0.4130 0.3945 0.2862 -0.0231 -0.0520 0.0316  33  ILE A CA  
226  C C   . ILE A 33  ? 0.3928 0.3773 0.2817 -0.0198 -0.0494 0.0439  33  ILE A C   
227  O O   . ILE A 33  ? 0.3752 0.3584 0.2840 -0.0163 -0.0453 0.0434  33  ILE A O   
228  C CB  . ILE A 33  ? 0.4140 0.3960 0.2998 -0.0258 -0.0630 0.0296  33  ILE A CB  
229  C CG1 . ILE A 33  ? 0.4546 0.4315 0.3216 -0.0311 -0.0690 0.0184  33  ILE A CG1 
230  C CG2 . ILE A 33  ? 0.4129 0.4041 0.3072 -0.0267 -0.0739 0.0421  33  ILE A CG2 
231  C CD1 . ILE A 33  ? 0.4592 0.4338 0.3395 -0.0351 -0.0769 0.0137  33  ILE A CD1 
232  N N   . PRO A 34  ? 0.4013 0.3887 0.2803 -0.0213 -0.0522 0.0548  34  PRO A N   
233  C CA  . PRO A 34  ? 0.3899 0.3763 0.2834 -0.0183 -0.0508 0.0665  34  PRO A CA  
234  C C   . PRO A 34  ? 0.3768 0.3650 0.2931 -0.0145 -0.0591 0.0713  34  PRO A C   
235  O O   . PRO A 34  ? 0.3885 0.3816 0.3041 -0.0156 -0.0702 0.0751  34  PRO A O   
236  C CB  . PRO A 34  ? 0.4052 0.3925 0.2793 -0.0221 -0.0538 0.0778  34  PRO A CB  
237  C CG  . PRO A 34  ? 0.4337 0.4253 0.2872 -0.0264 -0.0619 0.0741  34  PRO A CG  
238  C CD  . PRO A 34  ? 0.4323 0.4228 0.2861 -0.0263 -0.0587 0.0576  34  PRO A CD  
239  N N   . PHE A 35  ? 0.3667 0.3526 0.3033 -0.0100 -0.0539 0.0706  35  PHE A N   
240  C CA  . PHE A 35  ? 0.3694 0.3589 0.3277 -0.0051 -0.0602 0.0751  35  PHE A CA  
241  C C   . PHE A 35  ? 0.3771 0.3604 0.3434 -0.0006 -0.0607 0.0852  35  PHE A C   
242  O O   . PHE A 35  ? 0.3881 0.3739 0.3719 0.0052  -0.0662 0.0893  35  PHE A O   
243  C CB  . PHE A 35  ? 0.3454 0.3383 0.3212 -0.0031 -0.0561 0.0664  35  PHE A CB  
244  C CG  . PHE A 35  ? 0.3480 0.3349 0.3296 -0.0010 -0.0452 0.0622  35  PHE A CG  
245  C CD1 . PHE A 35  ? 0.3326 0.3168 0.3286 0.0041  -0.0428 0.0655  35  PHE A CD1 
246  C CD2 . PHE A 35  ? 0.3225 0.3063 0.2951 -0.0036 -0.0380 0.0544  35  PHE A CD2 
247  C CE1 . PHE A 35  ? 0.3407 0.3199 0.3407 0.0050  -0.0340 0.0614  35  PHE A CE1 
248  C CE2 . PHE A 35  ? 0.3180 0.2983 0.2967 -0.0018 -0.0293 0.0514  35  PHE A CE2 
249  C CZ  . PHE A 35  ? 0.3083 0.2867 0.2999 0.0017  -0.0276 0.0548  35  PHE A CZ  
250  N N   . ALA A 36  ? 0.3910 0.3665 0.3452 -0.0032 -0.0553 0.0896  36  ALA A N   
251  C CA  . ALA A 36  ? 0.3947 0.3605 0.3559 -0.0003 -0.0565 0.0995  36  ALA A CA  
252  C C   . ALA A 36  ? 0.4235 0.3835 0.3647 -0.0065 -0.0557 0.1092  36  ALA A C   
253  O O   . ALA A 36  ? 0.4320 0.3971 0.3557 -0.0124 -0.0503 0.1055  36  ALA A O   
254  C CB  . ALA A 36  ? 0.3633 0.3236 0.3394 0.0027  -0.0478 0.0934  36  ALA A CB  
255  N N   . GLU A 37  ? 0.4448 0.3942 0.3885 -0.0053 -0.0608 0.1215  37  GLU A N   
256  C CA  . GLU A 37  ? 0.4714 0.4140 0.3980 -0.0129 -0.0583 0.1320  37  GLU A CA  
257  C C   . GLU A 37  ? 0.4645 0.4072 0.3918 -0.0174 -0.0449 0.1249  37  GLU A C   
258  O O   . GLU A 37  ? 0.4510 0.3915 0.3957 -0.0131 -0.0406 0.1161  37  GLU A O   
259  C CB  . GLU A 37  ? 0.5033 0.4302 0.4356 -0.0107 -0.0666 0.1468  37  GLU A CB  
260  C CG  . GLU A 37  ? 0.5144 0.4419 0.4420 -0.0075 -0.0810 0.1581  37  GLU A CG  
261  C CD  . GLU A 37  ? 0.5647 0.5010 0.4642 -0.0164 -0.0826 0.1639  37  GLU A CD  
262  O OE1 . GLU A 37  ? 0.6027 0.5333 0.4850 -0.0247 -0.0797 0.1746  37  GLU A OE1 
263  O OE2 . GLU A 37  ? 0.5933 0.5427 0.4869 -0.0160 -0.0863 0.1575  37  GLU A OE2 
264  N N   . PRO A 38  ? 0.4699 0.4177 0.3787 -0.0260 -0.0382 0.1282  38  PRO A N   
265  C CA  . PRO A 38  ? 0.4568 0.4069 0.3696 -0.0302 -0.0264 0.1232  38  PRO A CA  
266  C C   . PRO A 38  ? 0.4681 0.4032 0.3953 -0.0309 -0.0274 0.1297  38  PRO A C   
267  O O   . PRO A 38  ? 0.4868 0.4101 0.4093 -0.0344 -0.0334 0.1436  38  PRO A O   
268  C CB  . PRO A 38  ? 0.4725 0.4319 0.3629 -0.0394 -0.0204 0.1292  38  PRO A CB  
269  C CG  . PRO A 38  ? 0.4968 0.4613 0.3689 -0.0389 -0.0275 0.1312  38  PRO A CG  
270  C CD  . PRO A 38  ? 0.4890 0.4428 0.3727 -0.0322 -0.0409 0.1364  38  PRO A CD  
271  N N   . PRO A 39  ? 0.4557 0.3899 0.3994 -0.0281 -0.0222 0.1195  39  PRO A N   
272  C CA  . PRO A 39  ? 0.4573 0.3762 0.4144 -0.0284 -0.0236 0.1223  39  PRO A CA  
273  C C   . PRO A 39  ? 0.4790 0.3982 0.4324 -0.0395 -0.0168 0.1279  39  PRO A C   
274  O O   . PRO A 39  ? 0.4616 0.3822 0.4260 -0.0414 -0.0114 0.1207  39  PRO A O   
275  C CB  . PRO A 39  ? 0.4344 0.3562 0.4076 -0.0209 -0.0210 0.1077  39  PRO A CB  
276  C CG  . PRO A 39  ? 0.4240 0.3635 0.3917 -0.0210 -0.0144 0.0986  39  PRO A CG  
277  C CD  . PRO A 39  ? 0.4282 0.3746 0.3777 -0.0239 -0.0162 0.1045  39  PRO A CD  
278  N N   . VAL A 40  ? 0.5001 0.4188 0.4380 -0.0476 -0.0178 0.1415  40  VAL A N   
279  C CA  . VAL A 40  ? 0.5082 0.4328 0.4403 -0.0600 -0.0103 0.1485  40  VAL A CA  
280  C C   . VAL A 40  ? 0.5411 0.4443 0.4722 -0.0676 -0.0171 0.1650  40  VAL A C   
281  O O   . VAL A 40  ? 0.5511 0.4364 0.4829 -0.0618 -0.0278 0.1715  40  VAL A O   
282  C CB  . VAL A 40  ? 0.5233 0.4680 0.4353 -0.0647 -0.0039 0.1508  40  VAL A CB  
283  C CG1 . VAL A 40  ? 0.5021 0.4646 0.4154 -0.0568 0.0025  0.1334  40  VAL A CG1 
284  C CG2 . VAL A 40  ? 0.5428 0.4808 0.4367 -0.0651 -0.0130 0.1636  40  VAL A CG2 
285  N N   . GLY A 41  ? 0.5458 0.4510 0.4762 -0.0806 -0.0114 0.1723  41  GLY A N   
286  C CA  . GLY A 41  ? 0.5906 0.4740 0.5181 -0.0906 -0.0180 0.1901  41  GLY A CA  
287  C C   . GLY A 41  ? 0.5964 0.4515 0.5404 -0.0843 -0.0272 0.1872  41  GLY A C   
288  O O   . GLY A 41  ? 0.5756 0.4300 0.5347 -0.0821 -0.0243 0.1742  41  GLY A O   
289  N N   . ASN A 42  ? 0.6252 0.4571 0.5660 -0.0804 -0.0388 0.1983  42  ASN A N   
290  C CA  . ASN A 42  ? 0.6413 0.4444 0.5977 -0.0727 -0.0477 0.1947  42  ASN A CA  
291  C C   . ASN A 42  ? 0.6041 0.4119 0.5731 -0.0553 -0.0485 0.1766  42  ASN A C   
292  O O   . ASN A 42  ? 0.6057 0.3951 0.5885 -0.0470 -0.0532 0.1689  42  ASN A O   
293  C CB  . ASN A 42  ? 0.6868 0.4592 0.6383 -0.0746 -0.0603 0.2139  42  ASN A CB  
294  C CG  . ASN A 42  ? 0.7311 0.5019 0.6768 -0.0622 -0.0699 0.2202  42  ASN A CG  
295  O OD1 . ASN A 42  ? 0.7834 0.5638 0.7378 -0.0478 -0.0707 0.2071  42  ASN A OD1 
296  N ND2 . ASN A 42  ? 0.8021 0.5601 0.7340 -0.0685 -0.0782 0.2415  42  ASN A ND2 
297  N N   . MET A 43  ? 0.5762 0.4098 0.5401 -0.0507 -0.0430 0.1691  43  MET A N   
298  C CA  A MET A 43  ? 0.5416 0.3837 0.5158 -0.0364 -0.0433 0.1540  43  MET A CA  
299  C CA  B MET A 43  ? 0.5552 0.3958 0.5302 -0.0363 -0.0436 0.1540  43  MET A CA  
300  C C   . MET A 43  ? 0.5206 0.3750 0.5043 -0.0363 -0.0341 0.1376  43  MET A C   
301  O O   . MET A 43  ? 0.5075 0.3680 0.5006 -0.0261 -0.0334 0.1248  43  MET A O   
302  C CB  A MET A 43  ? 0.5340 0.3950 0.4970 -0.0326 -0.0439 0.1550  43  MET A CB  
303  C CB  B MET A 43  ? 0.5575 0.4143 0.5229 -0.0309 -0.0458 0.1556  43  MET A CB  
304  C CG  A MET A 43  ? 0.5269 0.3785 0.4818 -0.0298 -0.0552 0.1697  43  MET A CG  
305  C CG  B MET A 43  ? 0.5859 0.4375 0.5623 -0.0164 -0.0546 0.1522  43  MET A CG  
306  S SD  A MET A 43  ? 0.5030 0.3763 0.4515 -0.0218 -0.0584 0.1649  43  MET A SD  
307  S SD  B MET A 43  ? 0.6959 0.5310 0.6654 -0.0143 -0.0688 0.1721  43  MET A SD  
308  C CE  A MET A 43  ? 0.4358 0.3101 0.4089 -0.0073 -0.0590 0.1482  43  MET A CE  
309  C CE  B MET A 43  ? 0.6953 0.4961 0.6782 -0.0121 -0.0744 0.1761  43  MET A CE  
310  N N   . ARG A 44  ? 0.5109 0.3713 0.4927 -0.0482 -0.0272 0.1386  44  ARG A N   
311  C CA  . ARG A 44  ? 0.4728 0.3455 0.4641 -0.0480 -0.0198 0.1241  44  ARG A CA  
312  C C   . ARG A 44  ? 0.4587 0.3137 0.4635 -0.0407 -0.0244 0.1147  44  ARG A C   
313  O O   . ARG A 44  ? 0.4691 0.3006 0.4764 -0.0419 -0.0309 0.1203  44  ARG A O   
314  C CB  . ARG A 44  ? 0.4707 0.3535 0.4609 -0.0622 -0.0128 0.1278  44  ARG A CB  
315  C CG  . ARG A 44  ? 0.4357 0.3328 0.4370 -0.0620 -0.0066 0.1139  44  ARG A CG  
316  C CD  . ARG A 44  ? 0.4032 0.3103 0.4076 -0.0763 -0.0013 0.1183  44  ARG A CD  
317  N NE  . ARG A 44  ? 0.4251 0.3550 0.4202 -0.0819 0.0066  0.1247  44  ARG A NE  
318  C CZ  . ARG A 44  ? 0.4598 0.4032 0.4562 -0.0951 0.0125  0.1318  44  ARG A CZ  
319  N NH1 . ARG A 44  ? 0.4602 0.3955 0.4669 -0.1054 0.0103  0.1341  44  ARG A NH1 
320  N NH2 . ARG A 44  ? 0.4655 0.4315 0.4527 -0.0985 0.0208  0.1362  44  ARG A NH2 
321  N N   . PHE A 45  ? 0.4362 0.3018 0.4482 -0.0326 -0.0212 0.1004  45  PHE A N   
322  C CA  . PHE A 45  ? 0.4375 0.2904 0.4604 -0.0248 -0.0239 0.0892  45  PHE A CA  
323  C C   . PHE A 45  ? 0.4468 0.2895 0.4746 -0.0114 -0.0299 0.0876  45  PHE A C   
324  O O   . PHE A 45  ? 0.4390 0.2773 0.4753 -0.0033 -0.0301 0.0764  45  PHE A O   
325  C CB  . PHE A 45  ? 0.4456 0.2785 0.4723 -0.0328 -0.0265 0.0893  45  PHE A CB  
326  C CG  . PHE A 45  ? 0.4381 0.2826 0.4636 -0.0466 -0.0213 0.0908  45  PHE A CG  
327  C CD1 . PHE A 45  ? 0.3875 0.2559 0.4153 -0.0465 -0.0146 0.0821  45  PHE A CD1 
328  C CD2 . PHE A 45  ? 0.4143 0.2467 0.4378 -0.0598 -0.0234 0.1018  45  PHE A CD2 
329  C CE1 . PHE A 45  ? 0.3902 0.2722 0.4199 -0.0582 -0.0101 0.0837  45  PHE A CE1 
330  C CE2 . PHE A 45  ? 0.4072 0.2540 0.4326 -0.0731 -0.0185 0.1035  45  PHE A CE2 
331  C CZ  . PHE A 45  ? 0.3646 0.2378 0.3939 -0.0717 -0.0117 0.0940  45  PHE A CZ  
332  N N   . ARG A 46  ? 0.4680 0.3087 0.4908 -0.0090 -0.0349 0.0988  46  ARG A N   
333  C CA  . ARG A 46  ? 0.4939 0.3276 0.5235 0.0038  -0.0416 0.0991  46  ARG A CA  
334  C C   . ARG A 46  ? 0.4788 0.3352 0.5116 0.0118  -0.0394 0.0924  46  ARG A C   
335  O O   . ARG A 46  ? 0.4563 0.3312 0.4820 0.0069  -0.0343 0.0908  46  ARG A O   
336  C CB  . ARG A 46  ? 0.5310 0.3515 0.5540 0.0022  -0.0500 0.1159  46  ARG A CB  
337  C CG  . ARG A 46  ? 0.6166 0.4087 0.6384 -0.0052 -0.0543 0.1243  46  ARG A CG  
338  C CD  . ARG A 46  ? 0.7002 0.4764 0.7160 -0.0055 -0.0642 0.1424  46  ARG A CD  
339  N NE  . ARG A 46  ? 0.7923 0.5642 0.8186 0.0109  -0.0720 0.1412  46  ARG A NE  
340  C CZ  . ARG A 46  ? 0.8654 0.6103 0.9003 0.0193  -0.0811 0.1453  46  ARG A CZ  
341  N NH1 . ARG A 46  ? 0.8723 0.5884 0.9049 0.0114  -0.0844 0.1515  46  ARG A NH1 
342  N NH2 . ARG A 46  ? 0.8705 0.6173 0.9176 0.0356  -0.0873 0.1434  46  ARG A NH2 
343  N N   . ARG A 47  ? 0.4894 0.3441 0.5338 0.0243  -0.0434 0.0882  47  ARG A N   
344  C CA  . ARG A 47  ? 0.4838 0.3594 0.5332 0.0312  -0.0432 0.0843  47  ARG A CA  
345  C C   . ARG A 47  ? 0.4742 0.3600 0.5118 0.0258  -0.0465 0.0947  47  ARG A C   
346  O O   . ARG A 47  ? 0.4761 0.3507 0.5058 0.0223  -0.0522 0.1071  47  ARG A O   
347  C CB  . ARG A 47  ? 0.5124 0.3847 0.5774 0.0454  -0.0487 0.0822  47  ARG A CB  
348  C CG  . ARG A 47  ? 0.5651 0.4253 0.6401 0.0521  -0.0453 0.0703  47  ARG A CG  
349  C CD  . ARG A 47  ? 0.6763 0.5323 0.7675 0.0677  -0.0504 0.0682  47  ARG A CD  
350  N NE  . ARG A 47  ? 0.7590 0.5940 0.8561 0.0738  -0.0493 0.0587  47  ARG A NE  
351  C CZ  . ARG A 47  ? 0.7693 0.6110 0.8717 0.0785  -0.0418 0.0431  47  ARG A CZ  
352  N NH1 . ARG A 47  ? 0.7454 0.6142 0.8488 0.0773  -0.0346 0.0367  47  ARG A NH1 
353  N NH2 . ARG A 47  ? 0.8096 0.6297 0.9151 0.0840  -0.0417 0.0339  47  ARG A NH2 
354  N N   . PRO A 48  ? 0.4555 0.3617 0.4906 0.0246  -0.0432 0.0896  48  PRO A N   
355  C CA  . PRO A 48  ? 0.4529 0.3690 0.4761 0.0202  -0.0468 0.0969  48  PRO A CA  
356  C C   . PRO A 48  ? 0.4707 0.3857 0.4987 0.0271  -0.0578 0.1059  48  PRO A C   
357  O O   . PRO A 48  ? 0.4533 0.3682 0.4983 0.0374  -0.0609 0.1029  48  PRO A O   
358  C CB  . PRO A 48  ? 0.4336 0.3682 0.4580 0.0197  -0.0420 0.0869  48  PRO A CB  
359  C CG  . PRO A 48  ? 0.4298 0.3668 0.4707 0.0271  -0.0392 0.0777  48  PRO A CG  
360  C CD  . PRO A 48  ? 0.4373 0.3570 0.4808 0.0276  -0.0369 0.0770  48  PRO A CD  
361  N N   . GLU A 49  ? 0.4981 0.4129 0.5112 0.0217  -0.0635 0.1172  49  GLU A N   
362  C CA  . GLU A 49  ? 0.5211 0.4388 0.5359 0.0269  -0.0754 0.1269  49  GLU A CA  
363  C C   . GLU A 49  ? 0.5023 0.4400 0.5083 0.0228  -0.0767 0.1238  49  GLU A C   
364  O O   . GLU A 49  ? 0.4884 0.4306 0.4785 0.0140  -0.0701 0.1200  49  GLU A O   
365  C CB  . GLU A 49  ? 0.5517 0.4540 0.5525 0.0224  -0.0824 0.1433  49  GLU A CB  
366  C CG  . GLU A 49  ? 0.6397 0.5172 0.6483 0.0257  -0.0843 0.1491  49  GLU A CG  
367  C CD  . GLU A 49  ? 0.7120 0.5839 0.7445 0.0409  -0.0900 0.1454  49  GLU A CD  
368  O OE1 . GLU A 49  ? 0.7488 0.6339 0.7905 0.0489  -0.0977 0.1473  49  GLU A OE1 
369  O OE2 . GLU A 49  ? 0.7507 0.6058 0.7933 0.0450  -0.0868 0.1402  49  GLU A OE2 
370  N N   . PRO A 50  ? 0.5022 0.4519 0.5191 0.0290  -0.0855 0.1250  50  PRO A N   
371  C CA  . PRO A 50  ? 0.4986 0.4649 0.5055 0.0233  -0.0885 0.1225  50  PRO A CA  
372  C C   . PRO A 50  ? 0.5209 0.4841 0.5001 0.0140  -0.0918 0.1310  50  PRO A C   
373  O O   . PRO A 50  ? 0.5285 0.4800 0.4989 0.0132  -0.0971 0.1442  50  PRO A O   
374  C CB  . PRO A 50  ? 0.5086 0.4879 0.5335 0.0313  -0.0999 0.1258  50  PRO A CB  
375  C CG  . PRO A 50  ? 0.5113 0.4840 0.5599 0.0431  -0.0984 0.1247  50  PRO A CG  
376  C CD  . PRO A 50  ? 0.5056 0.4548 0.5439 0.0412  -0.0939 0.1291  50  PRO A CD  
377  N N   . LYS A 51  ? 0.5122 0.4853 0.4773 0.0068  -0.0885 0.1232  51  LYS A N   
378  C CA  . LYS A 51  ? 0.5394 0.5129 0.4765 -0.0019 -0.0898 0.1276  51  LYS A CA  
379  C C   . LYS A 51  ? 0.5713 0.5491 0.5022 -0.0015 -0.1051 0.1397  51  LYS A C   
380  O O   . LYS A 51  ? 0.5680 0.5576 0.5103 0.0016  -0.1138 0.1374  51  LYS A O   
381  C CB  . LYS A 51  ? 0.5279 0.5102 0.4539 -0.0075 -0.0840 0.1140  51  LYS A CB  
382  C CG  . LYS A 51  ? 0.5421 0.5263 0.4372 -0.0157 -0.0842 0.1155  51  LYS A CG  
383  C CD  . LYS A 51  ? 0.5073 0.4840 0.3880 -0.0200 -0.0750 0.1216  51  LYS A CD  
384  C CE  . LYS A 51  ? 0.5129 0.4952 0.3624 -0.0279 -0.0732 0.1209  51  LYS A CE  
385  N NZ  . LYS A 51  ? 0.5027 0.4824 0.3382 -0.0333 -0.0629 0.1267  51  LYS A NZ  
386  N N   . LYS A 52  ? 0.6056 0.5745 0.5193 -0.0051 -0.1087 0.1535  52  LYS A N   
387  C CA  . LYS A 52  ? 0.6402 0.6126 0.5424 -0.0060 -0.1240 0.1671  52  LYS A CA  
388  C C   . LYS A 52  ? 0.6445 0.6304 0.5242 -0.0139 -0.1276 0.1610  52  LYS A C   
389  O O   . LYS A 52  ? 0.6402 0.6273 0.5018 -0.0206 -0.1168 0.1512  52  LYS A O   
390  C CB  . LYS A 52  ? 0.6714 0.6296 0.5576 -0.0098 -0.1258 0.1841  52  LYS A CB  
391  C CG  . LYS A 52  ? 0.7187 0.6642 0.6254 -0.0002 -0.1360 0.1974  52  LYS A CG  
392  C CD  . LYS A 52  ? 0.7696 0.6939 0.6762 -0.0018 -0.1293 0.2055  52  LYS A CD  
393  C CE  . LYS A 52  ? 0.7931 0.7143 0.6676 -0.0154 -0.1245 0.2150  52  LYS A CE  
394  N NZ  . LYS A 52  ? 0.8206 0.7207 0.6956 -0.0187 -0.1210 0.2264  52  LYS A NZ  
395  N N   . PRO A 53  ? 0.6538 0.6503 0.5359 -0.0125 -0.1429 0.1655  53  PRO A N   
396  C CA  . PRO A 53  ? 0.6667 0.6748 0.5259 -0.0207 -0.1489 0.1597  53  PRO A CA  
397  C C   . PRO A 53  ? 0.6900 0.6947 0.5102 -0.0306 -0.1449 0.1628  53  PRO A C   
398  O O   . PRO A 53  ? 0.7089 0.7059 0.5164 -0.0323 -0.1467 0.1785  53  PRO A O   
399  C CB  . PRO A 53  ? 0.6812 0.6996 0.5499 -0.0173 -0.1687 0.1706  53  PRO A CB  
400  C CG  . PRO A 53  ? 0.6624 0.6816 0.5703 -0.0054 -0.1688 0.1709  53  PRO A CG  
401  C CD  . PRO A 53  ? 0.6469 0.6484 0.5596 -0.0020 -0.1540 0.1711  53  PRO A CD  
402  N N   . TRP A 54  ? 0.6860 0.6962 0.4872 -0.0372 -0.1393 0.1478  54  TRP A N   
403  C CA  . TRP A 54  ? 0.7117 0.7224 0.4741 -0.0461 -0.1353 0.1481  54  TRP A CA  
404  C C   . TRP A 54  ? 0.7370 0.7578 0.4784 -0.0520 -0.1495 0.1448  54  TRP A C   
405  O O   . TRP A 54  ? 0.7268 0.7538 0.4840 -0.0507 -0.1579 0.1362  54  TRP A O   
406  C CB  . TRP A 54  ? 0.6949 0.7033 0.4495 -0.0481 -0.1161 0.1315  54  TRP A CB  
407  C CG  . TRP A 54  ? 0.6671 0.6781 0.4316 -0.0468 -0.1148 0.1118  54  TRP A CG  
408  C CD1 . TRP A 54  ? 0.6646 0.6796 0.4080 -0.0522 -0.1185 0.0987  54  TRP A CD1 
409  C CD2 . TRP A 54  ? 0.6072 0.6158 0.4045 -0.0405 -0.1108 0.1038  54  TRP A CD2 
410  N NE1 . TRP A 54  ? 0.6425 0.6559 0.4047 -0.0500 -0.1172 0.0839  54  TRP A NE1 
411  C CE2 . TRP A 54  ? 0.5944 0.6051 0.3893 -0.0430 -0.1123 0.0874  54  TRP A CE2 
412  C CE3 . TRP A 54  ? 0.5757 0.5799 0.4027 -0.0334 -0.1063 0.1088  54  TRP A CE3 
413  C CZ2 . TRP A 54  ? 0.5737 0.5829 0.3949 -0.0394 -0.1092 0.0778  54  TRP A CZ2 
414  C CZ3 . TRP A 54  ? 0.5347 0.5391 0.3863 -0.0293 -0.1026 0.0982  54  TRP A CZ3 
415  C CH2 . TRP A 54  ? 0.5450 0.5524 0.3938 -0.0326 -0.1040 0.0837  54  TRP A CH2 
416  N N   . SER A 55  ? 0.7725 0.7957 0.4778 -0.0596 -0.1523 0.1517  55  SER A N   
417  C CA  . SER A 55  ? 0.8001 0.8319 0.4788 -0.0667 -0.1636 0.1449  55  SER A CA  
418  C C   . SER A 55  ? 0.8065 0.8378 0.4582 -0.0718 -0.1492 0.1249  55  SER A C   
419  O O   . SER A 55  ? 0.7993 0.8259 0.4512 -0.0700 -0.1311 0.1197  55  SER A O   
420  C CB  . SER A 55  ? 0.8400 0.8763 0.4934 -0.0719 -0.1784 0.1647  55  SER A CB  
421  O OG  . SER A 55  ? 0.8523 0.8830 0.4877 -0.0746 -0.1677 0.1770  55  SER A OG  
422  N N   . GLY A 56  ? 0.8262 0.8624 0.4554 -0.0778 -0.1580 0.1130  56  GLY A N   
423  C CA  . GLY A 56  ? 0.8275 0.8612 0.4340 -0.0809 -0.1461 0.0906  56  GLY A CA  
424  C C   . GLY A 56  ? 0.7842 0.8106 0.4210 -0.0750 -0.1377 0.0741  56  GLY A C   
425  O O   . GLY A 56  ? 0.7539 0.7792 0.4266 -0.0697 -0.1411 0.0799  56  GLY A O   
426  N N   . VAL A 57  ? 0.7788 0.8001 0.4002 -0.0756 -0.1264 0.0536  57  VAL A N   
427  C CA  . VAL A 57  ? 0.7435 0.7560 0.3884 -0.0712 -0.1208 0.0374  57  VAL A CA  
428  C C   . VAL A 57  ? 0.7180 0.7264 0.3761 -0.0641 -0.1006 0.0343  57  VAL A C   
429  O O   . VAL A 57  ? 0.7305 0.7405 0.3662 -0.0638 -0.0876 0.0280  57  VAL A O   
430  C CB  . VAL A 57  ? 0.7753 0.7814 0.3960 -0.0758 -0.1237 0.0150  57  VAL A CB  
431  C CG1 . VAL A 57  ? 0.7476 0.7420 0.3934 -0.0723 -0.1206 -0.0001 57  VAL A CG1 
432  C CG2 . VAL A 57  ? 0.7879 0.7999 0.3903 -0.0848 -0.1447 0.0180  57  VAL A CG2 
433  N N   . TRP A 58  ? 0.6799 0.6850 0.3744 -0.0584 -0.0981 0.0384  58  TRP A N   
434  C CA  . TRP A 58  ? 0.6638 0.6645 0.3748 -0.0517 -0.0809 0.0335  58  TRP A CA  
435  C C   . TRP A 58  ? 0.6683 0.6610 0.3728 -0.0495 -0.0727 0.0115  58  TRP A C   
436  O O   . TRP A 58  ? 0.6600 0.6450 0.3724 -0.0506 -0.0804 0.0012  58  TRP A O   
437  C CB  . TRP A 58  ? 0.6293 0.6280 0.3787 -0.0466 -0.0819 0.0417  58  TRP A CB  
438  C CG  . TRP A 58  ? 0.6066 0.6032 0.3702 -0.0410 -0.0658 0.0414  58  TRP A CG  
439  C CD1 . TRP A 58  ? 0.5965 0.5876 0.3693 -0.0367 -0.0555 0.0276  58  TRP A CD1 
440  C CD2 . TRP A 58  ? 0.5841 0.5836 0.3540 -0.0397 -0.0594 0.0558  58  TRP A CD2 
441  N NE1 . TRP A 58  ? 0.5612 0.5541 0.3461 -0.0327 -0.0432 0.0324  58  TRP A NE1 
442  C CE2 . TRP A 58  ? 0.5690 0.5665 0.3522 -0.0351 -0.0451 0.0492  58  TRP A CE2 
443  C CE3 . TRP A 58  ? 0.5768 0.5791 0.3431 -0.0422 -0.0653 0.0741  58  TRP A CE3 
444  C CZ2 . TRP A 58  ? 0.5245 0.5238 0.3173 -0.0342 -0.0365 0.0596  58  TRP A CZ2 
445  C CZ3 . TRP A 58  ? 0.5756 0.5768 0.3508 -0.0411 -0.0565 0.0847  58  TRP A CZ3 
446  C CH2 . TRP A 58  ? 0.5479 0.5482 0.3362 -0.0377 -0.0422 0.0769  58  TRP A CH2 
447  N N   . ASN A 59  ? 0.6808 0.6755 0.3719 -0.0464 -0.0572 0.0047  59  ASN A N   
448  C CA  . ASN A 59  ? 0.7005 0.6872 0.3882 -0.0415 -0.0478 -0.0159 59  ASN A CA  
449  C C   . ASN A 59  ? 0.6465 0.6267 0.3691 -0.0350 -0.0427 -0.0167 59  ASN A C   
450  O O   . ASN A 59  ? 0.6085 0.5944 0.3457 -0.0311 -0.0323 -0.0090 59  ASN A O   
451  C CB  . ASN A 59  ? 0.7322 0.7275 0.3969 -0.0391 -0.0319 -0.0224 59  ASN A CB  
452  C CG  . ASN A 59  ? 0.8340 0.8209 0.4877 -0.0334 -0.0245 -0.0465 59  ASN A CG  
453  O OD1 . ASN A 59  ? 0.8707 0.8422 0.5348 -0.0317 -0.0315 -0.0577 59  ASN A OD1 
454  N ND2 . ASN A 59  ? 0.9601 0.9570 0.5929 -0.0304 -0.0101 -0.0545 59  ASN A ND2 
455  N N   . ALA A 60  ? 0.6271 0.5956 0.3620 -0.0353 -0.0511 -0.0249 60  ALA A N   
456  C CA  . ALA A 60  ? 0.6063 0.5681 0.3717 -0.0303 -0.0478 -0.0254 60  ALA A CA  
457  C C   . ALA A 60  ? 0.6161 0.5639 0.3794 -0.0257 -0.0430 -0.0441 60  ALA A C   
458  O O   . ALA A 60  ? 0.6077 0.5438 0.3868 -0.0262 -0.0490 -0.0482 60  ALA A O   
459  C CB  . ALA A 60  ? 0.5860 0.5470 0.3721 -0.0347 -0.0610 -0.0166 60  ALA A CB  
460  N N   . SER A 61  ? 0.6311 0.5803 0.3752 -0.0210 -0.0323 -0.0551 61  SER A N   
461  C CA  . SER A 61  ? 0.6524 0.5871 0.3922 -0.0148 -0.0280 -0.0744 61  SER A CA  
462  C C   . SER A 61  ? 0.6363 0.5736 0.3948 -0.0045 -0.0140 -0.0761 61  SER A C   
463  O O   . SER A 61  ? 0.6560 0.5814 0.4157 0.0031  -0.0097 -0.0908 61  SER A O   
464  C CB  . SER A 61  ? 0.6964 0.6308 0.4011 -0.0151 -0.0256 -0.0892 61  SER A CB  
465  O OG  . SER A 61  ? 0.7189 0.6713 0.4134 -0.0111 -0.0110 -0.0866 61  SER A OG  
466  N N   . THR A 62  ? 0.6048 0.5566 0.3793 -0.0041 -0.0082 -0.0607 62  THR A N   
467  C CA  . THR A 62  ? 0.5876 0.5488 0.3753 0.0040  0.0059  -0.0606 62  THR A CA  
468  C C   . THR A 62  ? 0.5423 0.5078 0.3576 0.0032  0.0053  -0.0453 62  THR A C   
469  O O   . THR A 62  ? 0.5369 0.5074 0.3545 -0.0034 -0.0006 -0.0316 62  THR A O   
470  C CB  . THR A 62  ? 0.6045 0.5847 0.3734 0.0032  0.0167  -0.0584 62  THR A CB  
471  O OG1 . THR A 62  ? 0.6678 0.6454 0.4102 0.0057  0.0199  -0.0753 62  THR A OG1 
472  C CG2 . THR A 62  ? 0.6088 0.6037 0.3938 0.0089  0.0304  -0.0547 62  THR A CG2 
473  N N   . TYR A 63  ? 0.5161 0.4798 0.3515 0.0103  0.0110  -0.0478 63  TYR A N   
474  C CA  . TYR A 63  ? 0.4868 0.4564 0.3463 0.0099  0.0121  -0.0349 63  TYR A CA  
475  C C   . TYR A 63  ? 0.4751 0.4616 0.3333 0.0058  0.0179  -0.0221 63  TYR A C   
476  O O   . TYR A 63  ? 0.4885 0.4866 0.3329 0.0060  0.0264  -0.0242 63  TYR A O   
477  C CB  . TYR A 63  ? 0.4827 0.4510 0.3596 0.0187  0.0186  -0.0407 63  TYR A CB  
478  C CG  . TYR A 63  ? 0.4862 0.4366 0.3744 0.0209  0.0108  -0.0451 63  TYR A CG  
479  C CD1 . TYR A 63  ? 0.4752 0.4185 0.3707 0.0141  0.0008  -0.0370 63  TYR A CD1 
480  C CD2 . TYR A 63  ? 0.4958 0.4371 0.3889 0.0300  0.0137  -0.0565 63  TYR A CD2 
481  C CE1 . TYR A 63  ? 0.4520 0.3805 0.3579 0.0143  -0.0058 -0.0391 63  TYR A CE1 
482  C CE2 . TYR A 63  ? 0.4965 0.4194 0.3998 0.0309  0.0057  -0.0581 63  TYR A CE2 
483  C CZ  . TYR A 63  ? 0.4736 0.3910 0.3826 0.0219  -0.0037 -0.0488 63  TYR A CZ  
484  O OH  . TYR A 63  ? 0.5293 0.4309 0.4476 0.0203  -0.0112 -0.0483 63  TYR A OH  
485  N N   . PRO A 64  ? 0.4559 0.4432 0.3280 0.0016  0.0133  -0.0089 64  PRO A N   
486  C CA  . PRO A 64  ? 0.4446 0.4435 0.3175 -0.0028 0.0175  0.0041  64  PRO A CA  
487  C C   . PRO A 64  ? 0.4381 0.4467 0.3270 0.0003  0.0275  0.0055  64  PRO A C   
488  O O   . PRO A 64  ? 0.4251 0.4317 0.3263 0.0067  0.0302  -0.0027 64  PRO A O   
489  C CB  . PRO A 64  ? 0.4190 0.4112 0.3040 -0.0062 0.0078  0.0149  64  PRO A CB  
490  C CG  . PRO A 64  ? 0.4054 0.3892 0.3068 -0.0019 0.0049  0.0083  64  PRO A CG  
491  C CD  . PRO A 64  ? 0.4209 0.3981 0.3088 0.0006  0.0040  -0.0053 64  PRO A CD  
492  N N   . ASN A 65  ? 0.4433 0.4613 0.3328 -0.0051 0.0315  0.0168  65  ASN A N   
493  C CA  . ASN A 65  ? 0.4277 0.4553 0.3342 -0.0052 0.0386  0.0211  65  ASN A CA  
494  C C   . ASN A 65  ? 0.4098 0.4286 0.3374 -0.0027 0.0333  0.0222  65  ASN A C   
495  O O   . ASN A 65  ? 0.3927 0.3997 0.3221 -0.0035 0.0243  0.0249  65  ASN A O   
496  C CB  . ASN A 65  ? 0.4492 0.4833 0.3519 -0.0140 0.0405  0.0353  65  ASN A CB  
497  C CG  . ASN A 65  ? 0.5102 0.5574 0.3914 -0.0181 0.0481  0.0365  65  ASN A CG  
498  O OD1 . ASN A 65  ? 0.5704 0.6306 0.4481 -0.0140 0.0577  0.0269  65  ASN A OD1 
499  N ND2 . ASN A 65  ? 0.5561 0.6004 0.4224 -0.0259 0.0436  0.0486  65  ASN A ND2 
500  N N   . ASN A 66  ? 0.3891 0.4158 0.3327 -0.0001 0.0388  0.0204  66  ASN A N   
501  C CA  . ASN A 66  ? 0.3728 0.3930 0.3342 0.0010  0.0343  0.0223  66  ASN A CA  
502  C C   . ASN A 66  ? 0.3684 0.3906 0.3363 -0.0060 0.0341  0.0332  66  ASN A C   
503  O O   . ASN A 66  ? 0.3774 0.4086 0.3395 -0.0115 0.0392  0.0390  66  ASN A O   
504  C CB  . ASN A 66  ? 0.3649 0.3916 0.3398 0.0076  0.0383  0.0149  66  ASN A CB  
505  C CG  . ASN A 66  ? 0.3865 0.4077 0.3550 0.0153  0.0380  0.0037  66  ASN A CG  
506  O OD1 . ASN A 66  ? 0.3728 0.4023 0.3460 0.0218  0.0438  -0.0034 66  ASN A OD1 
507  N ND2 . ASN A 66  ? 0.4060 0.4130 0.3647 0.0146  0.0309  0.0019  66  ASN A ND2 
508  N N   . CYS A 67  ? 0.3540 0.3672 0.3331 -0.0063 0.0284  0.0359  67  CYS A N   
509  C CA  . CYS A 67  ? 0.3616 0.3728 0.3468 -0.0125 0.0273  0.0445  67  CYS A CA  
510  C C   . CYS A 67  ? 0.3603 0.3843 0.3569 -0.0153 0.0333  0.0446  67  CYS A C   
511  O O   . CYS A 67  ? 0.3501 0.3834 0.3543 -0.0102 0.0366  0.0376  67  CYS A O   
512  C CB  . CYS A 67  ? 0.3603 0.3586 0.3533 -0.0111 0.0201  0.0453  67  CYS A CB  
513  S SG  . CYS A 67  ? 0.3933 0.3807 0.3772 -0.0088 0.0124  0.0471  67  CYS A SG  
514  N N   . GLN A 68  ? 0.3612 0.3855 0.3595 -0.0235 0.0339  0.0532  68  GLN A N   
515  C CA  . GLN A 68  ? 0.3491 0.3856 0.3597 -0.0289 0.0381  0.0551  68  GLN A CA  
516  C C   . GLN A 68  ? 0.3397 0.3741 0.3645 -0.0256 0.0343  0.0495  68  GLN A C   
517  O O   . GLN A 68  ? 0.3286 0.3478 0.3542 -0.0245 0.0279  0.0491  68  GLN A O   
518  C CB  . GLN A 68  ? 0.3584 0.3900 0.3671 -0.0402 0.0373  0.0665  68  GLN A CB  
519  C CG  . GLN A 68  ? 0.3498 0.3882 0.3434 -0.0451 0.0423  0.0737  68  GLN A CG  
520  C CD  . GLN A 68  ? 0.3787 0.4429 0.3754 -0.0491 0.0530  0.0739  68  GLN A CD  
521  O OE1 . GLN A 68  ? 0.3689 0.4471 0.3806 -0.0464 0.0563  0.0677  68  GLN A OE1 
522  N NE2 . GLN A 68  ? 0.3752 0.4475 0.3579 -0.0556 0.0584  0.0815  68  GLN A NE2 
523  N N   . GLN A 69  ? 0.3245 0.3756 0.3601 -0.0233 0.0383  0.0451  69  GLN A N   
524  C CA  . GLN A 69  ? 0.3065 0.3574 0.3538 -0.0199 0.0341  0.0404  69  GLN A CA  
525  C C   . GLN A 69  ? 0.3027 0.3753 0.3650 -0.0202 0.0377  0.0389  69  GLN A C   
526  O O   . GLN A 69  ? 0.2997 0.3896 0.3642 -0.0193 0.0449  0.0387  69  GLN A O   
527  C CB  . GLN A 69  ? 0.3060 0.3487 0.3489 -0.0099 0.0313  0.0338  69  GLN A CB  
528  C CG  . GLN A 69  ? 0.2980 0.3501 0.3382 -0.0022 0.0364  0.0283  69  GLN A CG  
529  C CD  . GLN A 69  ? 0.3139 0.3521 0.3470 0.0048  0.0322  0.0233  69  GLN A CD  
530  O OE1 . GLN A 69  ? 0.3158 0.3526 0.3554 0.0102  0.0293  0.0197  69  GLN A OE1 
531  N NE2 . GLN A 69  ? 0.2923 0.3198 0.3122 0.0037  0.0307  0.0243  69  GLN A NE2 
532  N N   . TYR A 70  ? 0.3027 0.3755 0.3753 -0.0210 0.0324  0.0374  70  TYR A N   
533  C CA  . TYR A 70  ? 0.3001 0.3937 0.3884 -0.0193 0.0334  0.0355  70  TYR A CA  
534  C C   . TYR A 70  ? 0.2956 0.3953 0.3847 -0.0066 0.0362  0.0295  70  TYR A C   
535  O O   . TYR A 70  ? 0.2833 0.3673 0.3631 -0.0002 0.0333  0.0263  70  TYR A O   
536  C CB  . TYR A 70  ? 0.2979 0.3873 0.3931 -0.0217 0.0252  0.0345  70  TYR A CB  
537  C CG  . TYR A 70  ? 0.3013 0.4120 0.4133 -0.0185 0.0237  0.0328  70  TYR A CG  
538  C CD1 . TYR A 70  ? 0.3310 0.4615 0.4576 -0.0270 0.0242  0.0361  70  TYR A CD1 
539  C CD2 . TYR A 70  ? 0.3489 0.4594 0.4628 -0.0074 0.0207  0.0289  70  TYR A CD2 
540  C CE1 . TYR A 70  ? 0.3479 0.5001 0.4918 -0.0236 0.0216  0.0350  70  TYR A CE1 
541  C CE2 . TYR A 70  ? 0.3553 0.4849 0.4854 -0.0032 0.0179  0.0284  70  TYR A CE2 
542  C CZ  . TYR A 70  ? 0.3672 0.5185 0.5126 -0.0107 0.0183  0.0312  70  TYR A CZ  
543  O OH  . TYR A 70  ? 0.3820 0.5542 0.5452 -0.0059 0.0145  0.0310  70  TYR A OH  
544  N N   . VAL A 71  ? 0.2949 0.4179 0.3965 -0.0032 0.0417  0.0281  71  VAL A N   
545  C CA  . VAL A 71  ? 0.3032 0.4317 0.4072 0.0099  0.0446  0.0216  71  VAL A CA  
546  C C   . VAL A 71  ? 0.3045 0.4491 0.4282 0.0152  0.0408  0.0205  71  VAL A C   
547  O O   . VAL A 71  ? 0.2998 0.4675 0.4393 0.0102  0.0428  0.0234  71  VAL A O   
548  C CB  . VAL A 71  ? 0.3190 0.4642 0.4210 0.0117  0.0558  0.0196  71  VAL A CB  
549  C CG1 . VAL A 71  ? 0.3248 0.4795 0.4337 0.0269  0.0595  0.0109  71  VAL A CG1 
550  C CG2 . VAL A 71  ? 0.3330 0.4615 0.4130 0.0077  0.0581  0.0207  71  VAL A CG2 
551  N N   . ASP A 72  ? 0.2963 0.4295 0.4197 0.0251  0.0350  0.0169  72  ASP A N   
552  C CA  . ASP A 72  ? 0.2921 0.4374 0.4326 0.0313  0.0292  0.0170  72  ASP A CA  
553  C C   . ASP A 72  ? 0.2845 0.4528 0.4407 0.0424  0.0357  0.0127  72  ASP A C   
554  O O   . ASP A 72  ? 0.3124 0.4726 0.4628 0.0532  0.0393  0.0064  72  ASP A O   
555  C CB  . ASP A 72  ? 0.2802 0.4027 0.4127 0.0374  0.0204  0.0163  72  ASP A CB  
556  C CG  . ASP A 72  ? 0.3308 0.4629 0.4788 0.0460  0.0135  0.0172  72  ASP A CG  
557  O OD1 . ASP A 72  ? 0.3376 0.4939 0.5034 0.0443  0.0124  0.0196  72  ASP A OD1 
558  O OD2 . ASP A 72  ? 0.3858 0.5010 0.5287 0.0541  0.0083  0.0163  72  ASP A OD2 
559  N N   . GLU A 73  ? 0.2685 0.4655 0.4452 0.0401  0.0368  0.0153  73  GLU A N   
560  C CA  A GLU A 73  ? 0.2731 0.4981 0.4690 0.0508  0.0438  0.0113  73  GLU A CA  
561  C CA  B GLU A 73  ? 0.2774 0.5004 0.4725 0.0521  0.0435  0.0108  73  GLU A CA  
562  C C   . GLU A 73  ? 0.2707 0.5111 0.4892 0.0586  0.0350  0.0130  73  GLU A C   
563  O O   . GLU A 73  ? 0.2634 0.5341 0.5045 0.0663  0.0393  0.0113  73  GLU A O   
564  C CB  A GLU A 73  ? 0.2755 0.5290 0.4798 0.0403  0.0542  0.0141  73  GLU A CB  
565  C CB  B GLU A 73  ? 0.2880 0.5381 0.4890 0.0447  0.0561  0.0115  73  GLU A CB  
566  C CG  A GLU A 73  ? 0.2799 0.5258 0.4641 0.0350  0.0647  0.0128  73  GLU A CG  
567  C CG  B GLU A 73  ? 0.3093 0.5492 0.4896 0.0456  0.0667  0.0068  73  GLU A CG  
568  C CD  A GLU A 73  ? 0.2803 0.5591 0.4751 0.0265  0.0761  0.0161  73  GLU A CD  
569  C CD  B GLU A 73  ? 0.3571 0.5916 0.5348 0.0641  0.0706  -0.0039 73  GLU A CD  
570  O OE1 A GLU A 73  ? 0.3069 0.6119 0.5145 0.0368  0.0856  0.0106  73  GLU A OE1 
571  O OE1 B GLU A 73  ? 0.3448 0.6060 0.5413 0.0755  0.0772  -0.0091 73  GLU A OE1 
572  O OE2 A GLU A 73  ? 0.2443 0.5230 0.4352 0.0096  0.0757  0.0242  73  GLU A OE2 
573  O OE2 B GLU A 73  ? 0.3460 0.5495 0.5034 0.0673  0.0670  -0.0076 73  GLU A OE2 
574  N N   . GLN A 74  ? 0.2666 0.4892 0.4799 0.0562  0.0227  0.0170  74  GLN A N   
575  C CA  . GLN A 74  ? 0.2706 0.5069 0.5028 0.0623  0.0125  0.0202  74  GLN A CA  
576  C C   . GLN A 74  ? 0.2720 0.5136 0.5177 0.0824  0.0128  0.0156  74  GLN A C   
577  O O   . GLN A 74  ? 0.2719 0.5407 0.5428 0.0895  0.0094  0.0173  74  GLN A O   
578  C CB  . GLN A 74  ? 0.2829 0.4968 0.5025 0.0568  -0.0003 0.0251  74  GLN A CB  
579  C CG  . GLN A 74  ? 0.3338 0.5617 0.5707 0.0627  -0.0121 0.0296  74  GLN A CG  
580  C CD  . GLN A 74  ? 0.4394 0.6693 0.6725 0.0479  -0.0210 0.0348  74  GLN A CD  
581  O OE1 . GLN A 74  ? 0.4766 0.7296 0.7220 0.0375  -0.0199 0.0362  74  GLN A OE1 
582  N NE2 . GLN A 74  ? 0.4606 0.6660 0.6754 0.0456  -0.0298 0.0375  74  GLN A NE2 
583  N N   . PHE A 75  ? 0.2720 0.4882 0.5025 0.0918  0.0160  0.0097  75  PHE A N   
584  C CA  . PHE A 75  ? 0.2934 0.5097 0.5356 0.1121  0.0162  0.0037  75  PHE A CA  
585  C C   . PHE A 75  ? 0.3187 0.5322 0.5528 0.1193  0.0295  -0.0069 75  PHE A C   
586  O O   . PHE A 75  ? 0.3253 0.5082 0.5402 0.1235  0.0293  -0.0119 75  PHE A O   
587  C CB  . PHE A 75  ? 0.2979 0.4823 0.5307 0.1192  0.0038  0.0063  75  PHE A CB  
588  C CG  . PHE A 75  ? 0.2931 0.4778 0.5286 0.1118  -0.0096 0.0167  75  PHE A CG  
589  C CD1 . PHE A 75  ? 0.3120 0.5223 0.5723 0.1183  -0.0170 0.0213  75  PHE A CD1 
590  C CD2 . PHE A 75  ? 0.2601 0.4211 0.4732 0.0987  -0.0149 0.0216  75  PHE A CD2 
591  C CE1 . PHE A 75  ? 0.3159 0.5265 0.5759 0.1106  -0.0304 0.0308  75  PHE A CE1 
592  C CE2 . PHE A 75  ? 0.2948 0.4564 0.5075 0.0917  -0.0266 0.0301  75  PHE A CE2 
593  C CZ  . PHE A 75  ? 0.2883 0.4738 0.5228 0.0970  -0.0347 0.0348  75  PHE A CZ  
594  N N   . PRO A 76  ? 0.3355 0.5826 0.5842 0.1204  0.0412  -0.0105 76  PRO A N   
595  C CA  . PRO A 76  ? 0.3559 0.6022 0.5929 0.1250  0.0550  -0.0205 76  PRO A CA  
596  C C   . PRO A 76  ? 0.3748 0.6071 0.6138 0.1465  0.0551  -0.0314 76  PRO A C   
597  O O   . PRO A 76  ? 0.3824 0.6288 0.6452 0.1614  0.0514  -0.0327 76  PRO A O   
598  C CB  . PRO A 76  ? 0.3648 0.6557 0.6206 0.1212  0.0670  -0.0203 76  PRO A CB  
599  C CG  . PRO A 76  ? 0.3548 0.6664 0.6311 0.1110  0.0577  -0.0088 76  PRO A CG  
600  C CD  . PRO A 76  ? 0.3241 0.6126 0.6017 0.1190  0.0421  -0.0060 76  PRO A CD  
601  N N   . GLY A 77  ? 0.3903 0.5930 0.6045 0.1479  0.0579  -0.0389 77  GLY A N   
602  C CA  . GLY A 77  ? 0.4298 0.6160 0.6434 0.1677  0.0587  -0.0514 77  GLY A CA  
603  C C   . GLY A 77  ? 0.4368 0.5825 0.6413 0.1710  0.0437  -0.0484 77  GLY A C   
604  O O   . GLY A 77  ? 0.4563 0.5766 0.6533 0.1835  0.0422  -0.0581 77  GLY A O   
605  N N   . PHE A 78  ? 0.4110 0.5507 0.6152 0.1588  0.0328  -0.0351 78  PHE A N   
606  C CA  . PHE A 78  ? 0.4077 0.5157 0.6066 0.1604  0.0182  -0.0289 78  PHE A CA  
607  C C   . PHE A 78  ? 0.4113 0.4863 0.5816 0.1484  0.0161  -0.0287 78  PHE A C   
608  O O   . PHE A 78  ? 0.3828 0.4613 0.5414 0.1324  0.0186  -0.0237 78  PHE A O   
609  C CB  . PHE A 78  ? 0.3835 0.5053 0.5953 0.1531  0.0081  -0.0153 78  PHE A CB  
610  C CG  . PHE A 78  ? 0.3817 0.4740 0.5852 0.1515  -0.0063 -0.0067 78  PHE A CG  
611  C CD1 . PHE A 78  ? 0.4057 0.4771 0.6147 0.1673  -0.0143 -0.0082 78  PHE A CD1 
612  C CD2 . PHE A 78  ? 0.3531 0.4382 0.5434 0.1346  -0.0121 0.0031  78  PHE A CD2 
613  C CE1 . PHE A 78  ? 0.3893 0.4336 0.5897 0.1645  -0.0277 0.0015  78  PHE A CE1 
614  C CE2 . PHE A 78  ? 0.3624 0.4225 0.5437 0.1324  -0.0244 0.0116  78  PHE A CE2 
615  C CZ  . PHE A 78  ? 0.3514 0.3913 0.5378 0.1469  -0.0324 0.0116  78  PHE A CZ  
616  N N   . SER A 79  ? 0.4467 0.4893 0.6066 0.1560  0.0113  -0.0342 79  SER A N   
617  C CA  . SER A 79  ? 0.4596 0.4739 0.5936 0.1445  0.0101  -0.0353 79  SER A CA  
618  C C   . SER A 79  ? 0.4374 0.4429 0.5629 0.1286  0.0021  -0.0221 79  SER A C   
619  O O   . SER A 79  ? 0.4298 0.4257 0.5380 0.1161  0.0037  -0.0213 79  SER A O   
620  C CB  . SER A 79  ? 0.4945 0.4742 0.6200 0.1545  0.0049  -0.0434 79  SER A CB  
621  O OG  . SER A 79  ? 0.5446 0.5076 0.6793 0.1601  -0.0079 -0.0351 79  SER A OG  
622  N N   . GLY A 80  ? 0.4338 0.4438 0.5715 0.1293  -0.0068 -0.0120 80  GLY A N   
623  C CA  . GLY A 80  ? 0.4228 0.4233 0.5511 0.1156  -0.0146 -0.0003 80  GLY A CA  
624  C C   . GLY A 80  ? 0.4169 0.4369 0.5412 0.1013  -0.0092 0.0033  80  GLY A C   
625  O O   . GLY A 80  ? 0.4082 0.4178 0.5191 0.0891  -0.0118 0.0087  80  GLY A O   
626  N N   . SER A 81  ? 0.4029 0.4513 0.5398 0.1027  -0.0019 0.0007  81  SER A N   
627  C CA  . SER A 81  ? 0.3896 0.4521 0.5215 0.0889  0.0032  0.0035  81  SER A CA  
628  C C   . SER A 81  ? 0.3915 0.4515 0.5108 0.0860  0.0133  -0.0038 81  SER A C   
629  O O   . SER A 81  ? 0.3727 0.4276 0.4791 0.0742  0.0149  -0.0012 81  SER A O   
630  C CB  . SER A 81  ? 0.3731 0.4671 0.5243 0.0883  0.0046  0.0065  81  SER A CB  
631  O OG  . SER A 81  ? 0.4205 0.5314 0.5877 0.1017  0.0102  0.0000  81  SER A OG  
632  N N   . GLU A 82  ? 0.4065 0.4696 0.5288 0.0972  0.0196  -0.0131 82  GLU A N   
633  C CA  . GLU A 82  ? 0.4236 0.4904 0.5339 0.0945  0.0301  -0.0201 82  GLU A CA  
634  C C   . GLU A 82  ? 0.4331 0.4728 0.5208 0.0889  0.0280  -0.0226 82  GLU A C   
635  O O   . GLU A 82  ? 0.4343 0.4766 0.5092 0.0812  0.0339  -0.0238 82  GLU A O   
636  C CB  . GLU A 82  ? 0.4372 0.5221 0.5573 0.1075  0.0395  -0.0301 82  GLU A CB  
637  C CG  . GLU A 82  ? 0.4607 0.5785 0.6047 0.1094  0.0419  -0.0257 82  GLU A CG  
638  C CD  . GLU A 82  ? 0.5484 0.6961 0.7020 0.1151  0.0551  -0.0325 82  GLU A CD  
639  O OE1 . GLU A 82  ? 0.6162 0.7615 0.7695 0.1294  0.0603  -0.0440 82  GLU A OE1 
640  O OE2 . GLU A 82  ? 0.5598 0.7344 0.7225 0.1054  0.0602  -0.0265 82  GLU A OE2 
641  N N   . MET A 83  ? 0.4344 0.4492 0.5178 0.0914  0.0189  -0.0218 83  MET A N   
642  C CA  . MET A 83  ? 0.4416 0.4316 0.5063 0.0850  0.0154  -0.0232 83  MET A CA  
643  C C   . MET A 83  ? 0.4145 0.4067 0.4706 0.0706  0.0150  -0.0156 83  MET A C   
644  O O   . MET A 83  ? 0.4138 0.3932 0.4558 0.0648  0.0142  -0.0171 83  MET A O   
645  C CB  . MET A 83  ? 0.4573 0.4218 0.5214 0.0881  0.0050  -0.0210 83  MET A CB  
646  C CG  . MET A 83  ? 0.4896 0.4546 0.5595 0.0815  -0.0025 -0.0087 83  MET A CG  
647  S SD  . MET A 83  ? 0.6342 0.5686 0.7000 0.0817  -0.0147 -0.0033 83  MET A SD  
648  C CE  . MET A 83  ? 0.5940 0.5177 0.6690 0.1000  -0.0161 -0.0124 83  MET A CE  
649  N N   . TRP A 84  ? 0.3923 0.4004 0.4575 0.0652  0.0151  -0.0080 84  TRP A N   
650  C CA  . TRP A 84  ? 0.3727 0.3810 0.4314 0.0531  0.0141  -0.0013 84  TRP A CA  
651  C C   . TRP A 84  ? 0.3662 0.3894 0.4223 0.0477  0.0217  -0.0014 84  TRP A C   
652  O O   . TRP A 84  ? 0.3768 0.3967 0.4255 0.0390  0.0212  0.0027  84  TRP A O   
653  C CB  . TRP A 84  ? 0.3631 0.3764 0.4304 0.0493  0.0086  0.0064  84  TRP A CB  
654  C CG  . TRP A 84  ? 0.4080 0.4071 0.4761 0.0527  0.0005  0.0092  84  TRP A CG  
655  C CD1 . TRP A 84  ? 0.4527 0.4558 0.5324 0.0597  -0.0043 0.0116  84  TRP A CD1 
656  C CD2 . TRP A 84  ? 0.4247 0.4035 0.4821 0.0490  -0.0044 0.0110  84  TRP A CD2 
657  N NE1 . TRP A 84  ? 0.4768 0.4610 0.5518 0.0604  -0.0120 0.0155  84  TRP A NE1 
658  C CE2 . TRP A 84  ? 0.4563 0.4260 0.5181 0.0532  -0.0118 0.0152  84  TRP A CE2 
659  C CE3 . TRP A 84  ? 0.4101 0.3787 0.4558 0.0423  -0.0038 0.0102  84  TRP A CE3 
660  C CZ2 . TRP A 84  ? 0.4363 0.3869 0.4902 0.0494  -0.0178 0.0192  84  TRP A CZ2 
661  C CZ3 . TRP A 84  ? 0.4351 0.3868 0.4749 0.0389  -0.0098 0.0133  84  TRP A CZ3 
662  C CH2 . TRP A 84  ? 0.4176 0.3602 0.4611 0.0418  -0.0163 0.0179  84  TRP A CH2 
663  N N   . ASN A 85  ? 0.3659 0.4062 0.4289 0.0529  0.0288  -0.0055 85  ASN A N   
664  C CA  . ASN A 85  ? 0.3494 0.4063 0.4107 0.0467  0.0367  -0.0039 85  ASN A CA  
665  C C   . ASN A 85  ? 0.3452 0.3944 0.3881 0.0450  0.0408  -0.0080 85  ASN A C   
666  O O   . ASN A 85  ? 0.3436 0.3798 0.3783 0.0514  0.0395  -0.0153 85  ASN A O   
667  C CB  . ASN A 85  ? 0.3490 0.4310 0.4252 0.0528  0.0439  -0.0067 85  ASN A CB  
668  C CG  . ASN A 85  ? 0.3726 0.4681 0.4681 0.0525  0.0398  -0.0015 85  ASN A CG  
669  O OD1 . ASN A 85  ? 0.4008 0.4908 0.4965 0.0442  0.0336  0.0051  85  ASN A OD1 
670  N ND2 . ASN A 85  ? 0.3492 0.4639 0.4612 0.0618  0.0432  -0.0050 85  ASN A ND2 
671  N N   . PRO A 86  ? 0.3334 0.3907 0.3698 0.0362  0.0451  -0.0032 86  PRO A N   
672  C CA  . PRO A 86  ? 0.3525 0.4043 0.3702 0.0341  0.0481  -0.0059 86  PRO A CA  
673  C C   . PRO A 86  ? 0.3618 0.4175 0.3736 0.0437  0.0542  -0.0172 86  PRO A C   
674  O O   . PRO A 86  ? 0.3682 0.4429 0.3905 0.0493  0.0616  -0.0205 86  PRO A O   
675  C CB  . PRO A 86  ? 0.3465 0.4121 0.3621 0.0242  0.0532  0.0022  86  PRO A CB  
676  C CG  . PRO A 86  ? 0.3376 0.4040 0.3669 0.0187  0.0486  0.0097  86  PRO A CG  
677  C CD  . PRO A 86  ? 0.3110 0.3803 0.3555 0.0269  0.0461  0.0055  86  PRO A CD  
678  N N   . ASN A 87  ? 0.3710 0.4097 0.3665 0.0455  0.0511  -0.0236 87  ASN A N   
679  C CA  . ASN A 87  ? 0.4007 0.4425 0.3861 0.0537  0.0578  -0.0358 87  ASN A CA  
680  C C   . ASN A 87  ? 0.4185 0.4655 0.3827 0.0473  0.0627  -0.0360 87  ASN A C   
681  O O   . ASN A 87  ? 0.4461 0.4908 0.3959 0.0525  0.0664  -0.0471 87  ASN A O   
682  C CB  . ASN A 87  ? 0.4000 0.4183 0.3801 0.0613  0.0511  -0.0458 87  ASN A CB  
683  C CG  . ASN A 87  ? 0.4137 0.4110 0.3833 0.0528  0.0407  -0.0413 87  ASN A CG  
684  O OD1 . ASN A 87  ? 0.3608 0.3612 0.3292 0.0431  0.0382  -0.0308 87  ASN A OD1 
685  N ND2 . ASN A 87  ? 0.3819 0.3578 0.3456 0.0566  0.0341  -0.0491 87  ASN A ND2 
686  N N   . ARG A 88  ? 0.4178 0.4706 0.3791 0.0361  0.0622  -0.0240 88  ARG A N   
687  C CA  A ARG A 88  ? 0.4272 0.4852 0.3676 0.0290  0.0658  -0.0213 88  ARG A CA  
688  C CA  B ARG A 88  ? 0.4350 0.4929 0.3755 0.0288  0.0657  -0.0211 88  ARG A CA  
689  C C   . ARG A 88  ? 0.4223 0.4988 0.3693 0.0203  0.0715  -0.0090 88  ARG A C   
690  O O   . ARG A 88  ? 0.4108 0.4921 0.3774 0.0189  0.0704  -0.0031 88  ARG A O   
691  C CB  A ARG A 88  ? 0.4251 0.4629 0.3518 0.0230  0.0549  -0.0177 88  ARG A CB  
692  C CB  B ARG A 88  ? 0.4334 0.4717 0.3611 0.0224  0.0547  -0.0165 88  ARG A CB  
693  C CG  A ARG A 88  ? 0.4189 0.4381 0.3362 0.0290  0.0488  -0.0300 88  ARG A CG  
694  C CG  B ARG A 88  ? 0.4863 0.5187 0.3888 0.0217  0.0538  -0.0235 88  ARG A CG  
695  C CD  A ARG A 88  ? 0.4451 0.4708 0.3466 0.0350  0.0570  -0.0430 88  ARG A CD  
696  C CD  B ARG A 88  ? 0.4862 0.5106 0.3842 0.0318  0.0551  -0.0400 88  ARG A CD  
697  N NE  A ARG A 88  ? 0.4696 0.4758 0.3567 0.0385  0.0507  -0.0554 88  ARG A NE  
698  N NE  B ARG A 88  ? 0.5106 0.5213 0.3856 0.0296  0.0490  -0.0471 88  ARG A NE  
699  C CZ  A ARG A 88  ? 0.4531 0.4472 0.3461 0.0485  0.0497  -0.0677 88  ARG A CZ  
700  C CZ  B ARG A 88  ? 0.5491 0.5669 0.4005 0.0279  0.0539  -0.0523 88  ARG A CZ  
701  N NH1 A ARG A 88  ? 0.3921 0.3929 0.3059 0.0572  0.0544  -0.0690 88  ARG A NH1 
702  N NH1 B ARG A 88  ? 0.5710 0.6111 0.4182 0.0277  0.0662  -0.0506 88  ARG A NH1 
703  N NH2 A ARG A 88  ? 0.4853 0.4593 0.3632 0.0495  0.0429  -0.0785 88  ARG A NH2 
704  N NH2 B ARG A 88  ? 0.5476 0.5513 0.3786 0.0252  0.0461  -0.0590 88  ARG A NH2 
705  N N   . GLU A 89  ? 0.4435 0.5302 0.3738 0.0137  0.0772  -0.0048 89  GLU A N   
706  C CA  . GLU A 89  ? 0.4496 0.5495 0.3853 0.0030  0.0807  0.0093  89  GLU A CA  
707  C C   . GLU A 89  ? 0.4097 0.4931 0.3544 -0.0035 0.0698  0.0203  89  GLU A C   
708  O O   . GLU A 89  ? 0.4099 0.4742 0.3467 -0.0034 0.0604  0.0208  89  GLU A O   
709  C CB  . GLU A 89  ? 0.4759 0.5855 0.3891 -0.0051 0.0864  0.0151  89  GLU A CB  
710  C CG  . GLU A 89  ? 0.5719 0.6995 0.4728 0.0013  0.0986  0.0030  89  GLU A CG  
711  C CD  . GLU A 89  ? 0.6575 0.8158 0.5738 0.0015  0.1124  0.0034  89  GLU A CD  
712  O OE1 . GLU A 89  ? 0.6677 0.8320 0.6104 0.0040  0.1119  0.0045  89  GLU A OE1 
713  O OE2 . GLU A 89  ? 0.7176 0.8963 0.6192 -0.0010 0.1240  0.0022  89  GLU A OE2 
714  N N   . MET A 90  ? 0.3776 0.4693 0.3391 -0.0089 0.0712  0.0283  90  MET A N   
715  C CA  . MET A 90  ? 0.3686 0.4447 0.3361 -0.0153 0.0621  0.0379  90  MET A CA  
716  C C   . MET A 90  ? 0.3785 0.4509 0.3322 -0.0260 0.0608  0.0508  90  MET A C   
717  O O   . MET A 90  ? 0.3747 0.4625 0.3211 -0.0321 0.0688  0.0557  90  MET A O   
718  C CB  . MET A 90  ? 0.3587 0.4418 0.3486 -0.0172 0.0622  0.0402  90  MET A CB  
719  C CG  . MET A 90  ? 0.3193 0.4000 0.3224 -0.0071 0.0594  0.0304  90  MET A CG  
720  S SD  . MET A 90  ? 0.3471 0.4375 0.3745 -0.0102 0.0580  0.0335  90  MET A SD  
721  C CE  . MET A 90  ? 0.2538 0.3763 0.2907 -0.0135 0.0699  0.0349  90  MET A CE  
722  N N   . SER A 91  ? 0.3724 0.4249 0.3225 -0.0279 0.0508  0.0564  91  SER A N   
723  C CA  . SER A 91  ? 0.3804 0.4258 0.3197 -0.0370 0.0473  0.0700  91  SER A CA  
724  C C   . SER A 91  ? 0.3628 0.3873 0.3095 -0.0362 0.0363  0.0740  91  SER A C   
725  O O   . SER A 91  ? 0.3437 0.3606 0.2962 -0.0288 0.0316  0.0663  91  SER A O   
726  C CB  . SER A 91  ? 0.3999 0.4475 0.3151 -0.0378 0.0481  0.0710  91  SER A CB  
727  O OG  . SER A 91  ? 0.4405 0.4758 0.3455 -0.0439 0.0405  0.0838  91  SER A OG  
728  N N   . GLU A 92  ? 0.3739 0.3895 0.3213 -0.0440 0.0327  0.0862  92  GLU A N   
729  C CA  . GLU A 92  ? 0.3602 0.3556 0.3134 -0.0424 0.0227  0.0903  92  GLU A CA  
730  C C   . GLU A 92  ? 0.3715 0.3596 0.3122 -0.0376 0.0157  0.0910  92  GLU A C   
731  O O   . GLU A 92  ? 0.3637 0.3401 0.3111 -0.0321 0.0080  0.0894  92  GLU A O   
732  C CB  . GLU A 92  ? 0.3726 0.3582 0.3269 -0.0520 0.0203  0.1038  92  GLU A CB  
733  C CG  . GLU A 92  ? 0.3705 0.3584 0.3409 -0.0570 0.0234  0.1025  92  GLU A CG  
734  C CD  . GLU A 92  ? 0.4484 0.4197 0.4206 -0.0661 0.0184  0.1147  92  GLU A CD  
735  O OE1 . GLU A 92  ? 0.4427 0.4200 0.4083 -0.0772 0.0222  0.1258  92  GLU A OE1 
736  O OE2 . GLU A 92  ? 0.4653 0.4170 0.4454 -0.0623 0.0106  0.1133  92  GLU A OE2 
737  N N   . ASP A 93  ? 0.3867 0.3838 0.3091 -0.0400 0.0185  0.0929  93  ASP A N   
738  C CA  . ASP A 93  ? 0.4082 0.4011 0.3178 -0.0361 0.0114  0.0919  93  ASP A CA  
739  C C   . ASP A 93  ? 0.3895 0.3867 0.3031 -0.0281 0.0127  0.0764  93  ASP A C   
740  O O   . ASP A 93  ? 0.3980 0.4047 0.3005 -0.0271 0.0181  0.0689  93  ASP A O   
741  C CB  . ASP A 93  ? 0.4199 0.4203 0.3055 -0.0425 0.0135  0.0994  93  ASP A CB  
742  C CG  . ASP A 93  ? 0.4526 0.4505 0.3226 -0.0394 0.0052  0.0977  93  ASP A CG  
743  O OD1 . ASP A 93  ? 0.4222 0.4134 0.3016 -0.0328 -0.0019 0.0911  93  ASP A OD1 
744  O OD2 . ASP A 93  ? 0.4982 0.5021 0.3459 -0.0445 0.0057  0.1031  93  ASP A OD2 
745  N N   . CYS A 94  ? 0.3941 0.3834 0.3232 -0.0225 0.0078  0.0716  94  CYS A N   
746  C CA  . CYS A 94  ? 0.3881 0.3800 0.3228 -0.0165 0.0093  0.0587  94  CYS A CA  
747  C C   . CYS A 94  ? 0.3796 0.3637 0.3210 -0.0123 0.0006  0.0561  94  CYS A C   
748  O O   . CYS A 94  ? 0.3620 0.3462 0.3101 -0.0084 0.0008  0.0473  94  CYS A O   
749  C CB  . CYS A 94  ? 0.3820 0.3779 0.3325 -0.0150 0.0156  0.0540  94  CYS A CB  
750  S SG  . CYS A 94  ? 0.3724 0.3584 0.3408 -0.0157 0.0114  0.0594  94  CYS A SG  
751  N N   . LEU A 95  ? 0.3848 0.3630 0.3258 -0.0129 -0.0073 0.0645  95  LEU A N   
752  C CA  . LEU A 95  ? 0.3682 0.3431 0.3197 -0.0087 -0.0147 0.0621  95  LEU A CA  
753  C C   . LEU A 95  ? 0.3753 0.3533 0.3159 -0.0091 -0.0202 0.0583  95  LEU A C   
754  O O   . LEU A 95  ? 0.3926 0.3707 0.3262 -0.0104 -0.0281 0.0648  95  LEU A O   
755  C CB  . LEU A 95  ? 0.3653 0.3337 0.3270 -0.0068 -0.0208 0.0709  95  LEU A CB  
756  C CG  . LEU A 95  ? 0.3678 0.3301 0.3409 -0.0065 -0.0165 0.0725  95  LEU A CG  
757  C CD1 . LEU A 95  ? 0.2905 0.2439 0.2733 -0.0028 -0.0234 0.0792  95  LEU A CD1 
758  C CD2 . LEU A 95  ? 0.2977 0.2632 0.2820 -0.0040 -0.0113 0.0624  95  LEU A CD2 
759  N N   . TYR A 96  ? 0.3671 0.3467 0.3063 -0.0082 -0.0170 0.0478  96  TYR A N   
760  C CA  . TYR A 96  ? 0.3764 0.3564 0.3043 -0.0096 -0.0222 0.0419  96  TYR A CA  
761  C C   . TYR A 96  ? 0.3634 0.3409 0.3033 -0.0079 -0.0241 0.0345  96  TYR A C   
762  O O   . TYR A 96  ? 0.3569 0.3334 0.3100 -0.0052 -0.0193 0.0327  96  TYR A O   
763  C CB  . TYR A 96  ? 0.3933 0.3751 0.3019 -0.0109 -0.0163 0.0357  96  TYR A CB  
764  C CG  . TYR A 96  ? 0.3951 0.3813 0.2898 -0.0144 -0.0139 0.0443  96  TYR A CG  
765  C CD1 . TYR A 96  ? 0.4083 0.3975 0.3080 -0.0150 -0.0057 0.0493  96  TYR A CD1 
766  C CD2 . TYR A 96  ? 0.4055 0.3931 0.2816 -0.0182 -0.0206 0.0486  96  TYR A CD2 
767  C CE1 . TYR A 96  ? 0.4065 0.3997 0.2930 -0.0201 -0.0034 0.0592  96  TYR A CE1 
768  C CE2 . TYR A 96  ? 0.4216 0.4132 0.2830 -0.0225 -0.0187 0.0587  96  TYR A CE2 
769  C CZ  . TYR A 96  ? 0.4356 0.4295 0.3025 -0.0237 -0.0099 0.0644  96  TYR A CZ  
770  O OH  . TYR A 96  ? 0.4424 0.4398 0.2949 -0.0296 -0.0082 0.0759  96  TYR A OH  
771  N N   . LEU A 97  ? 0.3705 0.3473 0.3057 -0.0104 -0.0318 0.0311  97  LEU A N   
772  C CA  . LEU A 97  ? 0.3608 0.3339 0.3049 -0.0109 -0.0338 0.0244  97  LEU A CA  
773  C C   . LEU A 97  ? 0.3757 0.3423 0.3045 -0.0137 -0.0368 0.0148  97  LEU A C   
774  O O   . LEU A 97  ? 0.3808 0.3479 0.2915 -0.0158 -0.0390 0.0134  97  LEU A O   
775  C CB  . LEU A 97  ? 0.3500 0.3290 0.3105 -0.0122 -0.0408 0.0299  97  LEU A CB  
776  C CG  . LEU A 97  ? 0.3800 0.3658 0.3382 -0.0151 -0.0511 0.0355  97  LEU A CG  
777  C CD1 . LEU A 97  ? 0.3775 0.3621 0.3294 -0.0213 -0.0590 0.0296  97  LEU A CD1 
778  C CD2 . LEU A 97  ? 0.3623 0.3575 0.3417 -0.0122 -0.0537 0.0430  97  LEU A CD2 
779  N N   . ASN A 98  ? 0.3771 0.3362 0.3118 -0.0141 -0.0371 0.0083  98  ASN A N   
780  C CA  . ASN A 98  ? 0.3995 0.3478 0.3207 -0.0165 -0.0407 -0.0023 98  ASN A CA  
781  C C   . ASN A 98  ? 0.4048 0.3487 0.3348 -0.0227 -0.0495 -0.0029 98  ASN A C   
782  O O   . ASN A 98  ? 0.3899 0.3370 0.3377 -0.0233 -0.0491 0.0024  98  ASN A O   
783  C CB  . ASN A 98  ? 0.4064 0.3455 0.3249 -0.0107 -0.0326 -0.0109 98  ASN A CB  
784  C CG  . ASN A 98  ? 0.4002 0.3476 0.3176 -0.0050 -0.0224 -0.0086 98  ASN A CG  
785  O OD1 . ASN A 98  ? 0.4290 0.3811 0.3311 -0.0048 -0.0195 -0.0101 98  ASN A OD1 
786  N ND2 . ASN A 98  ? 0.3688 0.3186 0.3017 -0.0014 -0.0171 -0.0049 98  ASN A ND2 
787  N N   . ILE A 99  ? 0.4257 0.3629 0.3424 -0.0282 -0.0575 -0.0095 99  ILE A N   
788  C CA  . ILE A 99  ? 0.4320 0.3659 0.3569 -0.0366 -0.0673 -0.0096 99  ILE A CA  
789  C C   . ILE A 99  ? 0.4603 0.3741 0.3718 -0.0397 -0.0713 -0.0221 99  ILE A C   
790  O O   . ILE A 99  ? 0.4846 0.3913 0.3753 -0.0383 -0.0716 -0.0315 99  ILE A O   
791  C CB  . ILE A 99  ? 0.4297 0.3775 0.3563 -0.0433 -0.0777 -0.0032 99  ILE A CB  
792  C CG1 . ILE A 99  ? 0.3938 0.3582 0.3294 -0.0380 -0.0742 0.0079  99  ILE A CG1 
793  C CG2 . ILE A 99  ? 0.4087 0.3596 0.3522 -0.0519 -0.0855 -0.0001 99  ILE A CG2 
794  C CD1 . ILE A 99  ? 0.4325 0.4122 0.3736 -0.0424 -0.0849 0.0157  99  ILE A CD1 
795  N N   . TRP A 100 ? 0.4696 0.3734 0.3924 -0.0440 -0.0742 -0.0223 100 TRP A N   
796  C CA  . TRP A 100 ? 0.4847 0.3659 0.3968 -0.0487 -0.0807 -0.0335 100 TRP A CA  
797  C C   . TRP A 100 ? 0.4867 0.3712 0.4072 -0.0622 -0.0928 -0.0292 100 TRP A C   
798  O O   . TRP A 100 ? 0.4659 0.3615 0.4067 -0.0664 -0.0929 -0.0185 100 TRP A O   
799  C CB  . TRP A 100 ? 0.4730 0.3372 0.3912 -0.0431 -0.0751 -0.0362 100 TRP A CB  
800  C CG  . TRP A 100 ? 0.4689 0.3297 0.3778 -0.0302 -0.0648 -0.0433 100 TRP A CG  
801  C CD1 . TRP A 100 ? 0.5276 0.3724 0.4185 -0.0247 -0.0636 -0.0580 100 TRP A CD1 
802  C CD2 . TRP A 100 ? 0.4364 0.3113 0.3537 -0.0214 -0.0541 -0.0370 100 TRP A CD2 
803  N NE1 . TRP A 100 ? 0.5341 0.3851 0.4239 -0.0128 -0.0520 -0.0603 100 TRP A NE1 
804  C CE2 . TRP A 100 ? 0.4747 0.3439 0.3804 -0.0114 -0.0466 -0.0472 100 TRP A CE2 
805  C CE3 . TRP A 100 ? 0.4433 0.3358 0.3768 -0.0212 -0.0501 -0.0245 100 TRP A CE3 
806  C CZ2 . TRP A 100 ? 0.4785 0.3603 0.3900 -0.0025 -0.0358 -0.0439 100 TRP A CZ2 
807  C CZ3 . TRP A 100 ? 0.4327 0.3339 0.3699 -0.0124 -0.0401 -0.0222 100 TRP A CZ3 
808  C CH2 . TRP A 100 ? 0.4269 0.3235 0.3537 -0.0038 -0.0333 -0.0312 100 TRP A CH2 
809  N N   . VAL A 101 ? 0.5213 0.3989 0.4261 -0.0694 -0.1027 -0.0373 101 VAL A N   
810  C CA  . VAL A 101 ? 0.5328 0.4145 0.4451 -0.0840 -0.1160 -0.0341 101 VAL A CA  
811  C C   . VAL A 101 ? 0.5715 0.4245 0.4735 -0.0926 -0.1248 -0.0457 101 VAL A C   
812  O O   . VAL A 101 ? 0.6044 0.4392 0.4833 -0.0895 -0.1262 -0.0600 101 VAL A O   
813  C CB  . VAL A 101 ? 0.5362 0.4368 0.4410 -0.0880 -0.1240 -0.0320 101 VAL A CB  
814  C CG1 . VAL A 101 ? 0.5292 0.4386 0.4454 -0.1036 -0.1385 -0.0279 101 VAL A CG1 
815  C CG2 . VAL A 101 ? 0.5017 0.4262 0.4168 -0.0794 -0.1165 -0.0204 101 VAL A CG2 
816  N N   . PRO A 102 ? 0.5787 0.4269 0.4971 -0.1038 -0.1308 -0.0398 102 PRO A N   
817  C CA  . PRO A 102 ? 0.6174 0.4359 0.5269 -0.1142 -0.1411 -0.0496 102 PRO A CA  
818  C C   . PRO A 102 ? 0.6630 0.4768 0.5532 -0.1226 -0.1536 -0.0608 102 PRO A C   
819  O O   . PRO A 102 ? 0.6618 0.5013 0.5543 -0.1272 -0.1588 -0.0552 102 PRO A O   
820  C CB  . PRO A 102 ? 0.6087 0.4348 0.5422 -0.1281 -0.1462 -0.0365 102 PRO A CB  
821  C CG  . PRO A 102 ? 0.5666 0.4132 0.5176 -0.1188 -0.1334 -0.0238 102 PRO A CG  
822  C CD  . PRO A 102 ? 0.5431 0.4113 0.4882 -0.1073 -0.1273 -0.0240 102 PRO A CD  
823  N N   . SER A 103 ? 0.7094 0.4899 0.5801 -0.1242 -0.1590 -0.0768 103 SER A N   
824  C CA  . SER A 103 ? 0.7549 0.5269 0.6027 -0.1320 -0.1709 -0.0903 103 SER A CA  
825  C C   . SER A 103 ? 0.8019 0.5465 0.6499 -0.1487 -0.1854 -0.0963 103 SER A C   
826  O O   . SER A 103 ? 0.8252 0.5371 0.6701 -0.1457 -0.1839 -0.1036 103 SER A O   
827  C CB  . SER A 103 ? 0.7722 0.5291 0.5912 -0.1174 -0.1634 -0.1077 103 SER A CB  
828  O OG  . SER A 103 ? 0.7988 0.5486 0.5920 -0.1249 -0.1746 -0.1216 103 SER A OG  
829  N N   . PRO A 104 ? 0.8218 0.5788 0.6734 -0.1666 -0.2004 -0.0932 104 PRO A N   
830  C CA  . PRO A 104 ? 0.8100 0.6031 0.6621 -0.1695 -0.2050 -0.0867 104 PRO A CA  
831  C C   . PRO A 104 ? 0.7607 0.5907 0.6428 -0.1664 -0.1973 -0.0659 104 PRO A C   
832  O O   . PRO A 104 ? 0.7393 0.5692 0.6434 -0.1685 -0.1923 -0.0559 104 PRO A O   
833  C CB  . PRO A 104 ? 0.8422 0.6323 0.6928 -0.1914 -0.2252 -0.0903 104 PRO A CB  
834  C CG  . PRO A 104 ? 0.8627 0.6291 0.7287 -0.2027 -0.2288 -0.0878 104 PRO A CG  
835  C CD  . PRO A 104 ? 0.8516 0.5877 0.7095 -0.1864 -0.2151 -0.0947 104 PRO A CD  
836  N N   . ARG A 105 ? 0.7503 0.6104 0.6318 -0.1612 -0.1967 -0.0597 105 ARG A N   
837  C CA  . ARG A 105 ? 0.7140 0.6085 0.6222 -0.1553 -0.1890 -0.0417 105 ARG A CA  
838  C C   . ARG A 105 ? 0.7109 0.6226 0.6501 -0.1696 -0.1953 -0.0293 105 ARG A C   
839  O O   . ARG A 105 ? 0.7344 0.6548 0.6782 -0.1855 -0.2105 -0.0290 105 ARG A O   
840  C CB  . ARG A 105 ? 0.6988 0.6198 0.6010 -0.1499 -0.1916 -0.0370 105 ARG A CB  
841  C CG  . ARG A 105 ? 0.6674 0.6176 0.5937 -0.1395 -0.1816 -0.0210 105 ARG A CG  
842  C CD  . ARG A 105 ? 0.6693 0.6447 0.5928 -0.1360 -0.1876 -0.0143 105 ARG A CD  
843  N NE  . ARG A 105 ? 0.6645 0.6278 0.5561 -0.1273 -0.1840 -0.0225 105 ARG A NE  
844  C CZ  . ARG A 105 ? 0.7006 0.6750 0.5759 -0.1283 -0.1933 -0.0216 105 ARG A CZ  
845  N NH1 . ARG A 105 ? 0.6893 0.6871 0.5784 -0.1371 -0.2080 -0.0132 105 ARG A NH1 
846  N NH2 . ARG A 105 ? 0.7268 0.6904 0.5718 -0.1208 -0.1879 -0.0288 105 ARG A NH2 
847  N N   . PRO A 106 ? 0.6916 0.6098 0.6519 -0.1648 -0.1835 -0.0191 106 PRO A N   
848  C CA  . PRO A 106 ? 0.6883 0.6277 0.6786 -0.1771 -0.1864 -0.0062 106 PRO A CA  
849  C C   . PRO A 106 ? 0.6769 0.6584 0.6863 -0.1776 -0.1908 0.0042  106 PRO A C   
850  O O   . PRO A 106 ? 0.6605 0.6527 0.6610 -0.1653 -0.1887 0.0039  106 PRO A O   
851  C CB  . PRO A 106 ? 0.6564 0.5943 0.6585 -0.1670 -0.1701 0.0011  106 PRO A CB  
852  C CG  . PRO A 106 ? 0.6489 0.5836 0.6358 -0.1475 -0.1594 -0.0034 106 PRO A CG  
853  C CD  . PRO A 106 ? 0.6714 0.5823 0.6289 -0.1473 -0.1666 -0.0184 106 PRO A CD  
854  N N   . LYS A 107 ? 0.6857 0.6910 0.7217 -0.1916 -0.1971 0.0140  107 LYS A N   
855  C CA  . LYS A 107 ? 0.6756 0.7226 0.7332 -0.1923 -0.2030 0.0235  107 LYS A CA  
856  C C   . LYS A 107 ? 0.6331 0.7043 0.7076 -0.1749 -0.1885 0.0330  107 LYS A C   
857  O O   . LYS A 107 ? 0.6412 0.7250 0.7118 -0.1625 -0.1886 0.0343  107 LYS A O   
858  C CB  . LYS A 107 ? 0.6812 0.7506 0.7644 -0.2127 -0.2142 0.0307  107 LYS A CB  
859  C CG  . LYS A 107 ? 0.7290 0.7989 0.8023 -0.2264 -0.2344 0.0247  107 LYS A CG  
860  C CD  . LYS A 107 ? 0.7419 0.8562 0.8487 -0.2387 -0.2448 0.0360  107 LYS A CD  
861  C CE  . LYS A 107 ? 0.8014 0.9135 0.8984 -0.2567 -0.2671 0.0295  107 LYS A CE  
862  N NZ  . LYS A 107 ? 0.8379 0.9409 0.9056 -0.2457 -0.2735 0.0212  107 LYS A NZ  
863  N N   . SER A 108 ? 0.5953 0.6719 0.6872 -0.1743 -0.1766 0.0396  108 SER A N   
864  C CA  . SER A 108 ? 0.5557 0.6550 0.6636 -0.1586 -0.1632 0.0472  108 SER A CA  
865  C C   . SER A 108 ? 0.5357 0.6237 0.6466 -0.1559 -0.1486 0.0495  108 SER A C   
866  O O   . SER A 108 ? 0.5233 0.6340 0.6578 -0.1612 -0.1431 0.0582  108 SER A O   
867  C CB  . SER A 108 ? 0.5422 0.6858 0.6825 -0.1619 -0.1675 0.0573  108 SER A CB  
868  O OG  . SER A 108 ? 0.5416 0.7034 0.6932 -0.1438 -0.1565 0.0620  108 SER A OG  
869  N N   . THR A 109 ? 0.5187 0.5736 0.6059 -0.1477 -0.1422 0.0421  109 THR A N   
870  C CA  . THR A 109 ? 0.5127 0.5510 0.5992 -0.1490 -0.1326 0.0437  109 THR A CA  
871  C C   . THR A 109 ? 0.4683 0.5140 0.5591 -0.1330 -0.1168 0.0473  109 THR A C   
872  O O   . THR A 109 ? 0.4541 0.5101 0.5439 -0.1193 -0.1130 0.0465  109 THR A O   
873  C CB  . THR A 109 ? 0.5418 0.5369 0.6029 -0.1530 -0.1369 0.0336  109 THR A CB  
874  O OG1 . THR A 109 ? 0.5526 0.5338 0.6176 -0.1591 -0.1318 0.0382  109 THR A OG1 
875  C CG2 . THR A 109 ? 0.5358 0.5120 0.5747 -0.1361 -0.1307 0.0246  109 THR A CG2 
876  N N   . THR A 110 ? 0.4403 0.4803 0.5353 -0.1357 -0.1087 0.0518  110 THR A N   
877  C CA  . THR A 110 ? 0.4004 0.4419 0.4954 -0.1221 -0.0945 0.0538  110 THR A CA  
878  C C   . THR A 110 ? 0.3830 0.4044 0.4583 -0.1072 -0.0911 0.0456  110 THR A C   
879  O O   . THR A 110 ? 0.3920 0.3862 0.4489 -0.1083 -0.0963 0.0379  110 THR A O   
880  C CB  . THR A 110 ? 0.4101 0.4377 0.5038 -0.1291 -0.0899 0.0583  110 THR A CB  
881  O OG1 . THR A 110 ? 0.4324 0.4823 0.5453 -0.1442 -0.0917 0.0675  110 THR A OG1 
882  C CG2 . THR A 110 ? 0.3962 0.4249 0.4881 -0.1163 -0.0765 0.0601  110 THR A CG2 
883  N N   . VAL A 111 ? 0.3529 0.3880 0.4326 -0.0937 -0.0822 0.0469  111 VAL A N   
884  C CA  . VAL A 111 ? 0.3408 0.3615 0.4045 -0.0800 -0.0778 0.0409  111 VAL A CA  
885  C C   . VAL A 111 ? 0.3373 0.3525 0.4003 -0.0727 -0.0663 0.0423  111 VAL A C   
886  O O   . VAL A 111 ? 0.3156 0.3485 0.3928 -0.0729 -0.0602 0.0482  111 VAL A O   
887  C CB  . VAL A 111 ? 0.3298 0.3695 0.3995 -0.0709 -0.0778 0.0425  111 VAL A CB  
888  C CG1 . VAL A 111 ? 0.2982 0.3243 0.3523 -0.0587 -0.0725 0.0381  111 VAL A CG1 
889  C CG2 . VAL A 111 ? 0.3414 0.3907 0.4130 -0.0778 -0.0904 0.0426  111 VAL A CG2 
890  N N   . MET A 112 ? 0.3427 0.3348 0.3894 -0.0664 -0.0634 0.0366  112 MET A N   
891  C CA  . MET A 112 ? 0.3372 0.3254 0.3828 -0.0587 -0.0538 0.0376  112 MET A CA  
892  C C   . MET A 112 ? 0.3410 0.3241 0.3767 -0.0470 -0.0498 0.0327  112 MET A C   
893  O O   . MET A 112 ? 0.3636 0.3328 0.3856 -0.0455 -0.0534 0.0264  112 MET A O   
894  C CB  . MET A 112 ? 0.3547 0.3209 0.3929 -0.0627 -0.0544 0.0370  112 MET A CB  
895  C CG  . MET A 112 ? 0.3597 0.3275 0.4062 -0.0765 -0.0588 0.0436  112 MET A CG  
896  S SD  . MET A 112 ? 0.3807 0.3182 0.4179 -0.0807 -0.0612 0.0446  112 MET A SD  
897  C CE  . MET A 112 ? 0.3146 0.2610 0.3554 -0.0750 -0.0511 0.0519  112 MET A CE  
898  N N   . VAL A 113 ? 0.3195 0.3140 0.3614 -0.0393 -0.0424 0.0352  113 VAL A N   
899  C CA  . VAL A 113 ? 0.3122 0.3036 0.3469 -0.0298 -0.0385 0.0323  113 VAL A CA  
900  C C   . VAL A 113 ? 0.3136 0.2984 0.3459 -0.0246 -0.0311 0.0315  113 VAL A C   
901  O O   . VAL A 113 ? 0.3015 0.2949 0.3420 -0.0241 -0.0265 0.0349  113 VAL A O   
902  C CB  . VAL A 113 ? 0.3066 0.3149 0.3511 -0.0252 -0.0374 0.0358  113 VAL A CB  
903  C CG1 . VAL A 113 ? 0.3160 0.3191 0.3530 -0.0172 -0.0340 0.0343  113 VAL A CG1 
904  C CG2 . VAL A 113 ? 0.3156 0.3335 0.3647 -0.0298 -0.0458 0.0376  113 VAL A CG2 
905  N N   . TRP A 114 ? 0.3243 0.2949 0.3452 -0.0210 -0.0302 0.0268  114 TRP A N   
906  C CA  . TRP A 114 ? 0.3234 0.2879 0.3425 -0.0162 -0.0248 0.0258  114 TRP A CA  
907  C C   . TRP A 114 ? 0.3163 0.2874 0.3360 -0.0099 -0.0194 0.0259  114 TRP A C   
908  O O   . TRP A 114 ? 0.3141 0.2854 0.3283 -0.0075 -0.0196 0.0244  114 TRP A O   
909  C CB  . TRP A 114 ? 0.3367 0.2845 0.3456 -0.0144 -0.0264 0.0200  114 TRP A CB  
910  C CG  . TRP A 114 ? 0.3260 0.2702 0.3349 -0.0081 -0.0214 0.0191  114 TRP A CG  
911  C CD1 . TRP A 114 ? 0.3018 0.2461 0.3065 -0.0015 -0.0171 0.0151  114 TRP A CD1 
912  C CD2 . TRP A 114 ? 0.3217 0.2641 0.3357 -0.0084 -0.0207 0.0230  114 TRP A CD2 
913  N NE1 . TRP A 114 ? 0.3329 0.2767 0.3418 0.0026  -0.0142 0.0160  114 TRP A NE1 
914  C CE2 . TRP A 114 ? 0.3172 0.2589 0.3307 -0.0013 -0.0169 0.0209  114 TRP A CE2 
915  C CE3 . TRP A 114 ? 0.3111 0.2544 0.3297 -0.0147 -0.0229 0.0290  114 TRP A CE3 
916  C CZ2 . TRP A 114 ? 0.2934 0.2341 0.3106 0.0003  -0.0166 0.0244  114 TRP A CZ2 
917  C CZ3 . TRP A 114 ? 0.3024 0.2437 0.3225 -0.0135 -0.0219 0.0330  114 TRP A CZ3 
918  C CH2 . TRP A 114 ? 0.3100 0.2495 0.3292 -0.0058 -0.0194 0.0306  114 TRP A CH2 
919  N N   . ILE A 115 ? 0.3020 0.2777 0.3273 -0.0079 -0.0150 0.0280  115 ILE A N   
920  C CA  . ILE A 115 ? 0.2979 0.2772 0.3237 -0.0029 -0.0105 0.0276  115 ILE A CA  
921  C C   . ILE A 115 ? 0.3002 0.2750 0.3239 -0.0002 -0.0075 0.0260  115 ILE A C   
922  O O   . ILE A 115 ? 0.2905 0.2669 0.3171 -0.0011 -0.0067 0.0277  115 ILE A O   
923  C CB  . ILE A 115 ? 0.2977 0.2874 0.3320 -0.0022 -0.0081 0.0299  115 ILE A CB  
924  C CG1 . ILE A 115 ? 0.2639 0.2618 0.3043 -0.0037 -0.0113 0.0320  115 ILE A CG1 
925  C CG2 . ILE A 115 ? 0.2619 0.2510 0.2958 0.0020  -0.0048 0.0288  115 ILE A CG2 
926  C CD1 . ILE A 115 ? 0.2252 0.2346 0.2756 -0.0010 -0.0080 0.0328  115 ILE A CD1 
927  N N   . TYR A 116 ? 0.2959 0.2673 0.3148 0.0028  -0.0059 0.0232  116 TYR A N   
928  C CA  . TYR A 116 ? 0.2960 0.2661 0.3156 0.0060  -0.0036 0.0217  116 TYR A CA  
929  C C   . TYR A 116 ? 0.2926 0.2692 0.3176 0.0063  -0.0012 0.0236  116 TYR A C   
930  O O   . TYR A 116 ? 0.2829 0.2637 0.3098 0.0054  0.0002  0.0246  116 TYR A O   
931  C CB  . TYR A 116 ? 0.2943 0.2634 0.3092 0.0094  -0.0012 0.0179  116 TYR A CB  
932  C CG  . TYR A 116 ? 0.3194 0.2943 0.3323 0.0086  0.0018  0.0192  116 TYR A CG  
933  C CD1 . TYR A 116 ? 0.2851 0.2656 0.3033 0.0080  0.0043  0.0217  116 TYR A CD1 
934  C CD2 . TYR A 116 ? 0.2966 0.2702 0.3008 0.0078  0.0013  0.0182  116 TYR A CD2 
935  C CE1 . TYR A 116 ? 0.2805 0.2635 0.2968 0.0062  0.0062  0.0242  116 TYR A CE1 
936  C CE2 . TYR A 116 ? 0.2683 0.2462 0.2694 0.0064  0.0035  0.0214  116 TYR A CE2 
937  C CZ  . TYR A 116 ? 0.2786 0.2603 0.2864 0.0055  0.0058  0.0248  116 TYR A CZ  
938  O OH  . TYR A 116 ? 0.2716 0.2547 0.2764 0.0031  0.0072  0.0291  116 TYR A OH  
939  N N   . GLY A 117 ? 0.3032 0.2797 0.3303 0.0079  -0.0017 0.0238  117 GLY A N   
940  C CA  . GLY A 117 ? 0.2924 0.2753 0.3230 0.0077  -0.0005 0.0247  117 GLY A CA  
941  C C   . GLY A 117 ? 0.3071 0.2949 0.3408 0.0099  0.0018  0.0230  117 GLY A C   
942  O O   . GLY A 117 ? 0.3214 0.3093 0.3535 0.0111  0.0042  0.0214  117 GLY A O   
943  N N   . GLY A 118 ? 0.2998 0.2936 0.3379 0.0098  0.0011  0.0237  118 GLY A N   
944  C CA  . GLY A 118 ? 0.3064 0.3084 0.3500 0.0101  0.0032  0.0228  118 GLY A CA  
945  C C   . GLY A 118 ? 0.3080 0.3136 0.3531 0.0052  0.0033  0.0229  118 GLY A C   
946  O O   . GLY A 118 ? 0.3304 0.3410 0.3793 0.0029  0.0054  0.0230  118 GLY A O   
947  N N   . GLY A 119 ? 0.2928 0.2956 0.3346 0.0032  0.0012  0.0227  119 GLY A N   
948  C CA  . GLY A 119 ? 0.2809 0.2855 0.3229 -0.0009 0.0002  0.0209  119 GLY A CA  
949  C C   . GLY A 119 ? 0.2901 0.2888 0.3314 -0.0036 0.0021  0.0194  119 GLY A C   
950  O O   . GLY A 119 ? 0.2766 0.2744 0.3187 -0.0075 0.0009  0.0172  119 GLY A O   
951  N N   . PHE A 120 ? 0.2839 0.2773 0.3234 -0.0016 0.0042  0.0207  120 PHE A N   
952  C CA  . PHE A 120 ? 0.2929 0.2796 0.3321 -0.0031 0.0052  0.0215  120 PHE A CA  
953  C C   . PHE A 120 ? 0.2978 0.2868 0.3400 -0.0073 0.0063  0.0241  120 PHE A C   
954  O O   . PHE A 120 ? 0.3245 0.3060 0.3659 -0.0099 0.0063  0.0262  120 PHE A O   
955  C CB  . PHE A 120 ? 0.2778 0.2576 0.3159 -0.0034 0.0041  0.0180  120 PHE A CB  
956  C CG  . PHE A 120 ? 0.2748 0.2556 0.3108 0.0005  0.0046  0.0161  120 PHE A CG  
957  C CD1 . PHE A 120 ? 0.2488 0.2286 0.2855 0.0036  0.0051  0.0183  120 PHE A CD1 
958  C CD2 . PHE A 120 ? 0.2325 0.2175 0.2659 0.0003  0.0044  0.0126  120 PHE A CD2 
959  C CE1 . PHE A 120 ? 0.2793 0.2635 0.3164 0.0061  0.0058  0.0171  120 PHE A CE1 
960  C CE2 . PHE A 120 ? 0.2340 0.2228 0.2656 0.0027  0.0060  0.0116  120 PHE A CE2 
961  C CZ  . PHE A 120 ? 0.2628 0.2519 0.2975 0.0055  0.0069  0.0139  120 PHE A CZ  
962  N N   . TYR A 121 ? 0.2872 0.2867 0.3335 -0.0077 0.0072  0.0246  121 TYR A N   
963  C CA  . TYR A 121 ? 0.2845 0.2916 0.3357 -0.0124 0.0095  0.0273  121 TYR A CA  
964  C C   . TYR A 121 ? 0.2911 0.3068 0.3421 -0.0087 0.0137  0.0285  121 TYR A C   
965  O O   . TYR A 121 ? 0.3076 0.3324 0.3618 -0.0121 0.0173  0.0310  121 TYR A O   
966  C CB  . TYR A 121 ? 0.2693 0.2861 0.3287 -0.0164 0.0072  0.0262  121 TYR A CB  
967  C CG  . TYR A 121 ? 0.2889 0.3179 0.3535 -0.0112 0.0065  0.0250  121 TYR A CG  
968  C CD1 . TYR A 121 ? 0.2882 0.3306 0.3598 -0.0085 0.0101  0.0261  121 TYR A CD1 
969  C CD2 . TYR A 121 ? 0.2728 0.2995 0.3350 -0.0084 0.0022  0.0230  121 TYR A CD2 
970  C CE1 . TYR A 121 ? 0.2984 0.3497 0.3760 -0.0021 0.0086  0.0250  121 TYR A CE1 
971  C CE2 . TYR A 121 ? 0.2884 0.3233 0.3550 -0.0034 0.0002  0.0234  121 TYR A CE2 
972  C CZ  . TYR A 121 ? 0.3446 0.3909 0.4197 0.0004  0.0030  0.0242  121 TYR A CZ  
973  O OH  . TYR A 121 ? 0.3885 0.4413 0.4695 0.0071  0.0002  0.0245  121 TYR A OH  
974  N N   . SER A 122 ? 0.2825 0.2959 0.3299 -0.0024 0.0133  0.0262  122 SER A N   
975  C CA  . SER A 122 ? 0.2906 0.3089 0.3359 0.0022  0.0167  0.0249  122 SER A CA  
976  C C   . SER A 122 ? 0.2926 0.3007 0.3303 0.0065  0.0146  0.0229  122 SER A C   
977  O O   . SER A 122 ? 0.3001 0.3004 0.3357 0.0056  0.0113  0.0235  122 SER A O   
978  C CB  . SER A 122 ? 0.2922 0.3226 0.3469 0.0064  0.0174  0.0228  122 SER A CB  
979  O OG  . SER A 122 ? 0.2901 0.3157 0.3464 0.0092  0.0123  0.0219  122 SER A OG  
980  N N   . GLY A 123 ? 0.2958 0.3047 0.3298 0.0108  0.0167  0.0200  123 GLY A N   
981  C CA  . GLY A 123 ? 0.3018 0.3002 0.3282 0.0133  0.0140  0.0177  123 GLY A CA  
982  C C   . GLY A 123 ? 0.3075 0.3046 0.3235 0.0130  0.0163  0.0163  123 GLY A C   
983  O O   . GLY A 123 ? 0.3076 0.3099 0.3208 0.0095  0.0194  0.0195  123 GLY A O   
984  N N   . SER A 124 ? 0.3215 0.3112 0.3308 0.0161  0.0144  0.0118  124 SER A N   
985  C CA  . SER A 124 ? 0.3180 0.3055 0.3143 0.0153  0.0153  0.0094  124 SER A CA  
986  C C   . SER A 124 ? 0.3343 0.3094 0.3255 0.0159  0.0094  0.0058  124 SER A C   
987  O O   . SER A 124 ? 0.3336 0.3024 0.3304 0.0186  0.0068  0.0037  124 SER A O   
988  C CB  . SER A 124 ? 0.3237 0.3189 0.3162 0.0196  0.0218  0.0038  124 SER A CB  
989  O OG  . SER A 124 ? 0.3115 0.3200 0.3143 0.0201  0.0270  0.0060  124 SER A OG  
990  N N   . SER A 125 ? 0.3354 0.3071 0.3158 0.0126  0.0066  0.0057  125 SER A N   
991  C CA  . SER A 125 ? 0.3434 0.3046 0.3193 0.0109  0.0000  0.0030  125 SER A CA  
992  C C   . SER A 125 ? 0.3652 0.3186 0.3322 0.0150  0.0007  -0.0069 125 SER A C   
993  O O   . SER A 125 ? 0.3707 0.3121 0.3346 0.0137  -0.0051 -0.0107 125 SER A O   
994  C CB  . SER A 125 ? 0.3302 0.2929 0.2989 0.0057  -0.0043 0.0069  125 SER A CB  
995  O OG  . SER A 125 ? 0.3815 0.3479 0.3367 0.0058  -0.0011 0.0048  125 SER A OG  
996  N N   . THR A 126 ? 0.3697 0.3302 0.3337 0.0200  0.0080  -0.0112 126 THR A N   
997  C CA  . THR A 126 ? 0.3879 0.3437 0.3405 0.0250  0.0105  -0.0222 126 THR A CA  
998  C C   . THR A 126 ? 0.3999 0.3509 0.3610 0.0341  0.0128  -0.0290 126 THR A C   
999  O O   . THR A 126 ? 0.4054 0.3534 0.3589 0.0407  0.0163  -0.0398 126 THR A O   
1000 C CB  . THR A 126 ? 0.4001 0.3701 0.3429 0.0254  0.0186  -0.0233 126 THR A CB  
1001 O OG1 . THR A 126 ? 0.3904 0.3747 0.3468 0.0277  0.0253  -0.0186 126 THR A OG1 
1002 C CG2 . THR A 126 ? 0.3948 0.3682 0.3265 0.0171  0.0154  -0.0159 126 THR A CG2 
1003 N N   . LEU A 127 ? 0.3808 0.3315 0.3574 0.0350  0.0106  -0.0231 127 LEU A N   
1004 C CA  . LEU A 127 ? 0.3929 0.3396 0.3797 0.0437  0.0110  -0.0269 127 LEU A CA  
1005 C C   . LEU A 127 ? 0.4125 0.3365 0.3931 0.0466  0.0047  -0.0346 127 LEU A C   
1006 O O   . LEU A 127 ? 0.4111 0.3224 0.3855 0.0390  -0.0024 -0.0326 127 LEU A O   
1007 C CB  . LEU A 127 ? 0.3669 0.3176 0.3685 0.0423  0.0084  -0.0175 127 LEU A CB  
1008 C CG  . LEU A 127 ? 0.3699 0.3399 0.3786 0.0386  0.0132  -0.0104 127 LEU A CG  
1009 C CD1 . LEU A 127 ? 0.3524 0.3239 0.3732 0.0372  0.0093  -0.0031 127 LEU A CD1 
1010 C CD2 . LEU A 127 ? 0.2896 0.2767 0.3019 0.0436  0.0217  -0.0140 127 LEU A CD2 
1011 N N   . ASP A 128 ? 0.4298 0.3492 0.4135 0.0575  0.0071  -0.0431 128 ASP A N   
1012 C CA  . ASP A 128 ? 0.4661 0.3603 0.4455 0.0618  0.0006  -0.0510 128 ASP A CA  
1013 C C   . ASP A 128 ? 0.4646 0.3432 0.4485 0.0541  -0.0093 -0.0418 128 ASP A C   
1014 O O   . ASP A 128 ? 0.4863 0.3457 0.4610 0.0485  -0.0162 -0.0449 128 ASP A O   
1015 C CB  . ASP A 128 ? 0.4834 0.3760 0.4719 0.0769  0.0040  -0.0591 128 ASP A CB  
1016 C CG  . ASP A 128 ? 0.5307 0.4371 0.5121 0.0849  0.0144  -0.0712 128 ASP A CG  
1017 O OD1 . ASP A 128 ? 0.5544 0.4687 0.5209 0.0779  0.0182  -0.0733 128 ASP A OD1 
1018 O OD2 . ASP A 128 ? 0.5881 0.4987 0.5790 0.0985  0.0190  -0.0785 128 ASP A OD2 
1019 N N   . VAL A 129 ? 0.4337 0.3213 0.4307 0.0527  -0.0101 -0.0307 129 VAL A N   
1020 C CA  . VAL A 129 ? 0.4336 0.3090 0.4339 0.0451  -0.0184 -0.0212 129 VAL A CA  
1021 C C   . VAL A 129 ? 0.4234 0.3007 0.4177 0.0321  -0.0211 -0.0159 129 VAL A C   
1022 O O   . VAL A 129 ? 0.4337 0.3032 0.4304 0.0247  -0.0271 -0.0084 129 VAL A O   
1023 C CB  . VAL A 129 ? 0.4207 0.3060 0.4343 0.0462  -0.0191 -0.0104 129 VAL A CB  
1024 C CG1 . VAL A 129 ? 0.4526 0.3262 0.4737 0.0565  -0.0227 -0.0116 129 VAL A CG1 
1025 C CG2 . VAL A 129 ? 0.3754 0.2869 0.3948 0.0463  -0.0117 -0.0074 129 VAL A CG2 
1026 N N   . TYR A 130 ? 0.4247 0.3139 0.4120 0.0292  -0.0169 -0.0187 130 TYR A N   
1027 C CA  . TYR A 130 ? 0.4014 0.2943 0.3851 0.0182  -0.0202 -0.0134 130 TYR A CA  
1028 C C   . TYR A 130 ? 0.4119 0.2946 0.3824 0.0151  -0.0238 -0.0217 130 TYR A C   
1029 O O   . TYR A 130 ? 0.4135 0.3023 0.3797 0.0076  -0.0263 -0.0192 130 TYR A O   
1030 C CB  . TYR A 130 ? 0.3870 0.3010 0.3734 0.0163  -0.0147 -0.0080 130 TYR A CB  
1031 C CG  . TYR A 130 ? 0.3681 0.2939 0.3658 0.0185  -0.0109 -0.0013 130 TYR A CG  
1032 C CD1 . TYR A 130 ? 0.3560 0.2767 0.3613 0.0185  -0.0141 0.0037  130 TYR A CD1 
1033 C CD2 . TYR A 130 ? 0.3269 0.2684 0.3266 0.0194  -0.0050 0.0007  130 TYR A CD2 
1034 C CE1 . TYR A 130 ? 0.3328 0.2649 0.3464 0.0198  -0.0115 0.0093  130 TYR A CE1 
1035 C CE2 . TYR A 130 ? 0.3378 0.2890 0.3470 0.0203  -0.0026 0.0058  130 TYR A CE2 
1036 C CZ  . TYR A 130 ? 0.3414 0.2884 0.3571 0.0206  -0.0060 0.0096  130 TYR A CZ  
1037 O OH  . TYR A 130 ? 0.3349 0.2918 0.3580 0.0210  -0.0045 0.0139  130 TYR A OH  
1038 N N   . ASN A 131 ? 0.4353 0.3027 0.3988 0.0215  -0.0245 -0.0323 131 ASN A N   
1039 C CA  . ASN A 131 ? 0.4488 0.3044 0.3973 0.0178  -0.0289 -0.0417 131 ASN A CA  
1040 C C   . ASN A 131 ? 0.4534 0.2975 0.4029 0.0056  -0.0392 -0.0367 131 ASN A C   
1041 O O   . ASN A 131 ? 0.4575 0.2845 0.4127 0.0041  -0.0446 -0.0345 131 ASN A O   
1042 C CB  . ASN A 131 ? 0.4730 0.3114 0.4147 0.0276  -0.0281 -0.0552 131 ASN A CB  
1043 C CG  . ASN A 131 ? 0.5202 0.3506 0.4425 0.0258  -0.0301 -0.0677 131 ASN A CG  
1044 O OD1 . ASN A 131 ? 0.4968 0.3262 0.4116 0.0145  -0.0368 -0.0658 131 ASN A OD1 
1045 N ND2 . ASN A 131 ? 0.5278 0.3540 0.4420 0.0371  -0.0242 -0.0813 131 ASN A ND2 
1046 N N   . GLY A 132 ? 0.4417 0.2961 0.3867 -0.0032 -0.0421 -0.0338 132 GLY A N   
1047 C CA  . GLY A 132 ? 0.4419 0.2936 0.3919 -0.0157 -0.0508 -0.0271 132 GLY A CA  
1048 C C   . GLY A 132 ? 0.4781 0.3070 0.4192 -0.0228 -0.0608 -0.0348 132 GLY A C   
1049 O O   . GLY A 132 ? 0.4865 0.3129 0.4338 -0.0345 -0.0684 -0.0285 132 GLY A O   
1050 N N   . LYS A 133 ? 0.4841 0.2966 0.4110 -0.0163 -0.0607 -0.0487 133 LYS A N   
1051 C CA  . LYS A 133 ? 0.5274 0.3184 0.4418 -0.0235 -0.0706 -0.0586 133 LYS A CA  
1052 C C   . LYS A 133 ? 0.5377 0.3040 0.4598 -0.0299 -0.0789 -0.0557 133 LYS A C   
1053 O O   . LYS A 133 ? 0.5427 0.2964 0.4612 -0.0424 -0.0894 -0.0571 133 LYS A O   
1054 C CB  . LYS A 133 ? 0.5467 0.3258 0.4421 -0.0136 -0.0675 -0.0764 133 LYS A CB  
1055 C CG  . LYS A 133 ? 0.5677 0.3314 0.4657 0.0008  -0.0618 -0.0837 133 LYS A CG  
1056 C CD  . LYS A 133 ? 0.6095 0.3691 0.4892 0.0113  -0.0562 -0.1016 133 LYS A CD  
1057 C CE  . LYS A 133 ? 0.6614 0.4010 0.5439 0.0262  -0.0529 -0.1120 133 LYS A CE  
1058 N NZ  . LYS A 133 ? 0.6898 0.4302 0.5557 0.0385  -0.0448 -0.1305 133 LYS A NZ  
1059 N N   . TYR A 134 ? 0.5310 0.2918 0.4639 -0.0224 -0.0749 -0.0501 134 TYR A N   
1060 C CA  . TYR A 134 ? 0.5553 0.2913 0.4945 -0.0279 -0.0827 -0.0454 134 TYR A CA  
1061 C C   . TYR A 134 ? 0.5463 0.2933 0.4969 -0.0442 -0.0877 -0.0300 134 TYR A C   
1062 O O   . TYR A 134 ? 0.5800 0.3088 0.5300 -0.0569 -0.0978 -0.0287 134 TYR A O   
1063 C CB  . TYR A 134 ? 0.5386 0.2664 0.4854 -0.0146 -0.0780 -0.0431 134 TYR A CB  
1064 C CG  . TYR A 134 ? 0.5584 0.2807 0.4972 0.0025  -0.0717 -0.0583 134 TYR A CG  
1065 C CD1 . TYR A 134 ? 0.5773 0.2707 0.5038 0.0069  -0.0767 -0.0743 134 TYR A CD1 
1066 C CD2 . TYR A 134 ? 0.5203 0.2676 0.4640 0.0139  -0.0604 -0.0573 134 TYR A CD2 
1067 C CE1 . TYR A 134 ? 0.5929 0.2846 0.5126 0.0239  -0.0692 -0.0895 134 TYR A CE1 
1068 C CE2 . TYR A 134 ? 0.5006 0.2475 0.4389 0.0290  -0.0535 -0.0706 134 TYR A CE2 
1069 C CZ  . TYR A 134 ? 0.5521 0.2724 0.4785 0.0346  -0.0573 -0.0868 134 TYR A CZ  
1070 O OH  . TYR A 134 ? 0.5353 0.2593 0.4570 0.0506  -0.0486 -0.1009 134 TYR A OH  
1071 N N   . LEU A 135 ? 0.5145 0.2911 0.4755 -0.0439 -0.0805 -0.0190 135 LEU A N   
1072 C CA  . LEU A 135 ? 0.5045 0.2978 0.4777 -0.0573 -0.0825 -0.0047 135 LEU A CA  
1073 C C   . LEU A 135 ? 0.5119 0.3145 0.4829 -0.0691 -0.0889 -0.0069 135 LEU A C   
1074 O O   . LEU A 135 ? 0.5308 0.3327 0.5084 -0.0839 -0.0962 -0.0003 135 LEU A O   
1075 C CB  . LEU A 135 ? 0.4756 0.2973 0.4586 -0.0512 -0.0724 0.0041  135 LEU A CB  
1076 C CG  . LEU A 135 ? 0.4545 0.3025 0.4504 -0.0604 -0.0704 0.0167  135 LEU A CG  
1077 C CD1 . LEU A 135 ? 0.4552 0.2946 0.4576 -0.0731 -0.0758 0.0266  135 LEU A CD1 
1078 C CD2 . LEU A 135 ? 0.4087 0.2750 0.4100 -0.0506 -0.0604 0.0212  135 LEU A CD2 
1079 N N   . ALA A 136 ? 0.5084 0.3195 0.4697 -0.0635 -0.0871 -0.0160 136 ALA A N   
1080 C CA  . ALA A 136 ? 0.5154 0.3361 0.4736 -0.0742 -0.0946 -0.0179 136 ALA A CA  
1081 C C   . ALA A 136 ? 0.5529 0.3471 0.5036 -0.0859 -0.1070 -0.0247 136 ALA A C   
1082 O O   . ALA A 136 ? 0.5561 0.3571 0.5146 -0.1013 -0.1154 -0.0188 136 ALA A O   
1083 C CB  . ALA A 136 ? 0.5050 0.3387 0.4515 -0.0661 -0.0910 -0.0253 136 ALA A CB  
1084 N N   . TYR A 137 ? 0.5795 0.3436 0.5162 -0.0788 -0.1084 -0.0374 137 TYR A N   
1085 C CA  . TYR A 137 ? 0.6140 0.3469 0.5415 -0.0888 -0.1206 -0.0462 137 TYR A CA  
1086 C C   . TYR A 137 ? 0.6136 0.3331 0.5544 -0.1009 -0.1265 -0.0344 137 TYR A C   
1087 O O   . TYR A 137 ? 0.6155 0.3312 0.5597 -0.1183 -0.1370 -0.0311 137 TYR A O   
1088 C CB  . TYR A 137 ? 0.6467 0.3503 0.5564 -0.0757 -0.1195 -0.0640 137 TYR A CB  
1089 C CG  . TYR A 137 ? 0.7179 0.3810 0.6183 -0.0835 -0.1319 -0.0742 137 TYR A CG  
1090 C CD1 . TYR A 137 ? 0.7548 0.4084 0.6415 -0.0953 -0.1429 -0.0850 137 TYR A CD1 
1091 C CD2 . TYR A 137 ? 0.7452 0.3777 0.6496 -0.0786 -0.1334 -0.0736 137 TYR A CD2 
1092 C CE1 . TYR A 137 ? 0.7946 0.4077 0.6719 -0.1030 -0.1551 -0.0957 137 TYR A CE1 
1093 C CE2 . TYR A 137 ? 0.8042 0.3951 0.6999 -0.0854 -0.1456 -0.0833 137 TYR A CE2 
1094 C CZ  . TYR A 137 ? 0.8230 0.4037 0.7050 -0.0978 -0.1562 -0.0949 137 TYR A CZ  
1095 O OH  . TYR A 137 ? 0.8653 0.4021 0.7381 -0.1049 -0.1688 -0.1055 137 TYR A OH  
1096 N N   . THR A 138 ? 0.6105 0.3250 0.5590 -0.0926 -0.1200 -0.0268 138 THR A N   
1097 C CA  . THR A 138 ? 0.6302 0.3274 0.5878 -0.1034 -0.1259 -0.0154 138 THR A CA  
1098 C C   . THR A 138 ? 0.6119 0.3367 0.5847 -0.1206 -0.1274 0.0002  138 THR A C   
1099 O O   . THR A 138 ? 0.6346 0.3478 0.6115 -0.1378 -0.1369 0.0057  138 THR A O   
1100 C CB  . THR A 138 ? 0.6310 0.3204 0.5932 -0.0906 -0.1190 -0.0091 138 THR A CB  
1101 O OG1 . THR A 138 ? 0.6544 0.3224 0.6052 -0.0732 -0.1169 -0.0245 138 THR A OG1 
1102 C CG2 . THR A 138 ? 0.6287 0.2964 0.5975 -0.1023 -0.1264 0.0037  138 THR A CG2 
1103 N N   . GLU A 139 ? 0.5781 0.3400 0.5598 -0.1161 -0.1179 0.0068  139 GLU A N   
1104 C CA  . GLU A 139 ? 0.5611 0.3520 0.5594 -0.1298 -0.1173 0.0216  139 GLU A CA  
1105 C C   . GLU A 139 ? 0.5492 0.3640 0.5520 -0.1389 -0.1221 0.0196  139 GLU A C   
1106 O O   . GLU A 139 ? 0.5354 0.3772 0.5541 -0.1501 -0.1220 0.0307  139 GLU A O   
1107 C CB  . GLU A 139 ? 0.5280 0.3432 0.5358 -0.1209 -0.1050 0.0319  139 GLU A CB  
1108 C CG  . GLU A 139 ? 0.5654 0.3588 0.5721 -0.1188 -0.1039 0.0391  139 GLU A CG  
1109 C CD  . GLU A 139 ? 0.6191 0.3986 0.6308 -0.1381 -0.1126 0.0497  139 GLU A CD  
1110 O OE1 . GLU A 139 ? 0.6207 0.4263 0.6446 -0.1520 -0.1122 0.0596  139 GLU A OE1 
1111 O OE2 . GLU A 139 ? 0.6668 0.4096 0.6711 -0.1396 -0.1200 0.0483  139 GLU A OE2 
1112 N N   . GLU A 140 ? 0.5577 0.3614 0.5459 -0.1346 -0.1271 0.0053  140 GLU A N   
1113 C CA  A GLU A 140 ? 0.5609 0.3853 0.5502 -0.1422 -0.1335 0.0025  140 GLU A CA  
1114 C CA  B GLU A 140 ? 0.5557 0.3800 0.5446 -0.1413 -0.1331 0.0021  140 GLU A CA  
1115 C C   . GLU A 140 ? 0.5183 0.3844 0.5228 -0.1373 -0.1253 0.0119  140 GLU A C   
1116 O O   . GLU A 140 ? 0.5089 0.4003 0.5286 -0.1487 -0.1297 0.0195  140 GLU A O   
1117 C CB  A GLU A 140 ? 0.5814 0.3993 0.5768 -0.1641 -0.1472 0.0053  140 GLU A CB  
1118 C CB  B GLU A 140 ? 0.5757 0.3900 0.5673 -0.1622 -0.1475 0.0025  140 GLU A CB  
1119 C CG  A GLU A 140 ? 0.6033 0.4453 0.6024 -0.1739 -0.1562 0.0035  140 GLU A CG  
1120 C CG  B GLU A 140 ? 0.6143 0.3893 0.5840 -0.1634 -0.1574 -0.0142 140 GLU A CG  
1121 C CD  A GLU A 140 ? 0.6616 0.4778 0.6398 -0.1791 -0.1690 -0.0124 140 GLU A CD  
1122 C CD  B GLU A 140 ? 0.6249 0.3761 0.5973 -0.1839 -0.1708 -0.0125 140 GLU A CD  
1123 O OE1 A GLU A 140 ? 0.6971 0.4804 0.6686 -0.1900 -0.1782 -0.0173 140 GLU A OE1 
1124 O OE1 B GLU A 140 ? 0.6754 0.3987 0.6315 -0.1894 -0.1820 -0.0265 140 GLU A OE1 
1125 O OE2 A GLU A 140 ? 0.6688 0.4973 0.6367 -0.1730 -0.1706 -0.0198 140 GLU A OE2 
1126 O OE2 B GLU A 140 ? 0.5823 0.3430 0.5723 -0.1951 -0.1701 0.0028  140 GLU A OE2 
1127 N N   . VAL A 141 ? 0.4964 0.3693 0.4980 -0.1205 -0.1138 0.0112  141 VAL A N   
1128 C CA  . VAL A 141 ? 0.4586 0.3658 0.4721 -0.1135 -0.1060 0.0181  141 VAL A CA  
1129 C C   . VAL A 141 ? 0.4643 0.3728 0.4638 -0.1014 -0.1041 0.0093  141 VAL A C   
1130 O O   . VAL A 141 ? 0.4785 0.3636 0.4598 -0.0960 -0.1049 -0.0015 141 VAL A O   
1131 C CB  . VAL A 141 ? 0.4367 0.3520 0.4591 -0.1050 -0.0936 0.0261  141 VAL A CB  
1132 C CG1 . VAL A 141 ? 0.4338 0.3507 0.4684 -0.1171 -0.0943 0.0365  141 VAL A CG1 
1133 C CG2 . VAL A 141 ? 0.4311 0.3246 0.4396 -0.0913 -0.0875 0.0193  141 VAL A CG2 
1134 N N   . VAL A 142 ? 0.4537 0.3896 0.4615 -0.0966 -0.1010 0.0142  142 VAL A N   
1135 C CA  . VAL A 142 ? 0.4450 0.3832 0.4401 -0.0847 -0.0974 0.0091  142 VAL A CA  
1136 C C   . VAL A 142 ? 0.4235 0.3653 0.4223 -0.0719 -0.0844 0.0123  142 VAL A C   
1137 O O   . VAL A 142 ? 0.4077 0.3688 0.4226 -0.0701 -0.0792 0.0208  142 VAL A O   
1138 C CB  . VAL A 142 ? 0.4394 0.4020 0.4404 -0.0864 -0.1032 0.0132  142 VAL A CB  
1139 C CG1 . VAL A 142 ? 0.4121 0.3786 0.4021 -0.0740 -0.0978 0.0117  142 VAL A CG1 
1140 C CG2 . VAL A 142 ? 0.4617 0.4199 0.4555 -0.0989 -0.1173 0.0084  142 VAL A CG2 
1141 N N   . LEU A 143 ? 0.4256 0.3495 0.4096 -0.0633 -0.0793 0.0049  143 LEU A N   
1142 C CA  . LEU A 143 ? 0.4007 0.3266 0.3876 -0.0524 -0.0682 0.0071  143 LEU A CA  
1143 C C   . LEU A 143 ? 0.3820 0.3169 0.3615 -0.0431 -0.0630 0.0058  143 LEU A C   
1144 O O   . LEU A 143 ? 0.3948 0.3209 0.3579 -0.0402 -0.0636 -0.0018 143 LEU A O   
1145 C CB  . LEU A 143 ? 0.4290 0.3316 0.4082 -0.0486 -0.0657 0.0011  143 LEU A CB  
1146 C CG  . LEU A 143 ? 0.4458 0.3499 0.4309 -0.0397 -0.0563 0.0047  143 LEU A CG  
1147 C CD1 . LEU A 143 ? 0.4669 0.3763 0.4659 -0.0461 -0.0564 0.0141  143 LEU A CD1 
1148 C CD2 . LEU A 143 ? 0.5089 0.3916 0.4844 -0.0337 -0.0553 -0.0034 143 LEU A CD2 
1149 N N   . VAL A 144 ? 0.3573 0.3090 0.3484 -0.0388 -0.0576 0.0133  144 VAL A N   
1150 C CA  . VAL A 144 ? 0.3523 0.3102 0.3380 -0.0308 -0.0524 0.0139  144 VAL A CA  
1151 C C   . VAL A 144 ? 0.3438 0.2992 0.3325 -0.0234 -0.0427 0.0143  144 VAL A C   
1152 O O   . VAL A 144 ? 0.3262 0.2844 0.3264 -0.0238 -0.0399 0.0181  144 VAL A O   
1153 C CB  . VAL A 144 ? 0.3377 0.3145 0.3352 -0.0305 -0.0542 0.0219  144 VAL A CB  
1154 C CG1 . VAL A 144 ? 0.3269 0.3068 0.3183 -0.0234 -0.0501 0.0239  144 VAL A CG1 
1155 C CG2 . VAL A 144 ? 0.3595 0.3435 0.3587 -0.0387 -0.0654 0.0230  144 VAL A CG2 
1156 N N   . SER A 145 ? 0.3557 0.3074 0.3337 -0.0174 -0.0377 0.0107  145 SER A N   
1157 C CA  . SER A 145 ? 0.3516 0.3065 0.3348 -0.0111 -0.0293 0.0129  145 SER A CA  
1158 C C   . SER A 145 ? 0.3489 0.3130 0.3306 -0.0086 -0.0272 0.0173  145 SER A C   
1159 O O   . SER A 145 ? 0.3717 0.3353 0.3408 -0.0088 -0.0283 0.0158  145 SER A O   
1160 C CB  . SER A 145 ? 0.3418 0.2867 0.3182 -0.0062 -0.0245 0.0063  145 SER A CB  
1161 O OG  . SER A 145 ? 0.3942 0.3351 0.3553 -0.0050 -0.0245 -0.0003 145 SER A OG  
1162 N N   . LEU A 146 ? 0.3316 0.3030 0.3249 -0.0065 -0.0242 0.0229  146 LEU A N   
1163 C CA  . LEU A 146 ? 0.3299 0.3064 0.3230 -0.0040 -0.0226 0.0278  146 LEU A CA  
1164 C C   . LEU A 146 ? 0.3330 0.3074 0.3237 -0.0009 -0.0151 0.0269  146 LEU A C   
1165 O O   . LEU A 146 ? 0.3397 0.3108 0.3305 0.0005  -0.0114 0.0224  146 LEU A O   
1166 C CB  . LEU A 146 ? 0.2893 0.2737 0.2966 -0.0029 -0.0244 0.0333  146 LEU A CB  
1167 C CG  . LEU A 146 ? 0.2769 0.2648 0.2970 -0.0017 -0.0207 0.0330  146 LEU A CG  
1168 C CD1 . LEU A 146 ? 0.2851 0.2694 0.3050 0.0014  -0.0141 0.0320  146 LEU A CD1 
1169 C CD2 . LEU A 146 ? 0.2373 0.2356 0.2710 0.0000  -0.0225 0.0366  146 LEU A CD2 
1170 N N   . SER A 147 ? 0.3448 0.3213 0.3341 -0.0001 -0.0135 0.0317  147 SER A N   
1171 C CA  . SER A 147 ? 0.3421 0.3188 0.3333 0.0013  -0.0070 0.0322  147 SER A CA  
1172 C C   . SER A 147 ? 0.3367 0.3133 0.3361 0.0020  -0.0075 0.0380  147 SER A C   
1173 O O   . SER A 147 ? 0.3300 0.3069 0.3331 0.0028  -0.0125 0.0417  147 SER A O   
1174 C CB  . SER A 147 ? 0.3551 0.3330 0.3336 0.0002  -0.0033 0.0317  147 SER A CB  
1175 O OG  . SER A 147 ? 0.4322 0.4103 0.4023 -0.0022 -0.0067 0.0379  147 SER A OG  
1176 N N   . TYR A 148 ? 0.3263 0.3023 0.3297 0.0019  -0.0029 0.0382  148 TYR A N   
1177 C CA  . TYR A 148 ? 0.3073 0.2797 0.3175 0.0024  -0.0035 0.0422  148 TYR A CA  
1178 C C   . TYR A 148 ? 0.3053 0.2772 0.3155 -0.0005 0.0011  0.0429  148 TYR A C   
1179 O O   . TYR A 148 ? 0.2962 0.2733 0.3066 -0.0010 0.0051  0.0390  148 TYR A O   
1180 C CB  . TYR A 148 ? 0.2889 0.2619 0.3098 0.0055  -0.0044 0.0390  148 TYR A CB  
1181 C CG  . TYR A 148 ? 0.2999 0.2761 0.3238 0.0053  -0.0010 0.0339  148 TYR A CG  
1182 C CD1 . TYR A 148 ? 0.2898 0.2689 0.3121 0.0051  -0.0015 0.0311  148 TYR A CD1 
1183 C CD2 . TYR A 148 ? 0.2843 0.2593 0.3122 0.0048  0.0015  0.0322  148 TYR A CD2 
1184 C CE1 . TYR A 148 ? 0.2826 0.2632 0.3074 0.0052  0.0005  0.0281  148 TYR A CE1 
1185 C CE2 . TYR A 148 ? 0.2643 0.2430 0.2943 0.0046  0.0034  0.0286  148 TYR A CE2 
1186 C CZ  . TYR A 148 ? 0.2744 0.2558 0.3028 0.0051  0.0028  0.0272  148 TYR A CZ  
1187 O OH  . TYR A 148 ? 0.2867 0.2705 0.3169 0.0051  0.0035  0.0252  148 TYR A OH  
1188 N N   . ARG A 149 ? 0.3049 0.2703 0.3161 -0.0025 0.0000  0.0483  149 ARG A N   
1189 C CA  . ARG A 149 ? 0.2970 0.2618 0.3100 -0.0071 0.0034  0.0499  149 ARG A CA  
1190 C C   . ARG A 149 ? 0.2849 0.2511 0.3066 -0.0066 0.0050  0.0438  149 ARG A C   
1191 O O   . ARG A 149 ? 0.2631 0.2261 0.2897 -0.0029 0.0030  0.0401  149 ARG A O   
1192 C CB  . ARG A 149 ? 0.3185 0.2721 0.3307 -0.0101 0.0004  0.0575  149 ARG A CB  
1193 C CG  . ARG A 149 ? 0.3188 0.2719 0.3201 -0.0126 -0.0014 0.0659  149 ARG A CG  
1194 C CD  . ARG A 149 ? 0.3281 0.2664 0.3304 -0.0140 -0.0065 0.0742  149 ARG A CD  
1195 N NE  . ARG A 149 ? 0.3296 0.2609 0.3373 -0.0063 -0.0129 0.0740  149 ARG A NE  
1196 C CZ  . ARG A 149 ? 0.3419 0.2586 0.3526 -0.0045 -0.0186 0.0803  149 ARG A CZ  
1197 N NH1 . ARG A 149 ? 0.3047 0.2100 0.3123 -0.0114 -0.0192 0.0879  149 ARG A NH1 
1198 N NH2 . ARG A 149 ? 0.3241 0.2376 0.3420 0.0039  -0.0240 0.0794  149 ARG A NH2 
1199 N N   . VAL A 150 ? 0.2747 0.2481 0.2984 -0.0105 0.0088  0.0430  150 VAL A N   
1200 C CA  . VAL A 150 ? 0.2702 0.2475 0.3012 -0.0107 0.0094  0.0379  150 VAL A CA  
1201 C C   . VAL A 150 ? 0.2949 0.2718 0.3300 -0.0179 0.0099  0.0405  150 VAL A C   
1202 O O   . VAL A 150 ? 0.3110 0.2855 0.3432 -0.0230 0.0108  0.0469  150 VAL A O   
1203 C CB  . VAL A 150 ? 0.2475 0.2361 0.2794 -0.0077 0.0118  0.0340  150 VAL A CB  
1204 C CG1 . VAL A 150 ? 0.2177 0.2035 0.2457 -0.0023 0.0100  0.0316  150 VAL A CG1 
1205 C CG2 . VAL A 150 ? 0.2570 0.2556 0.2868 -0.0094 0.0164  0.0360  150 VAL A CG2 
1206 N N   . GLY A 151 ? 0.2951 0.2740 0.3362 -0.0196 0.0087  0.0362  151 GLY A N   
1207 C CA  . GLY A 151 ? 0.3090 0.2872 0.3549 -0.0279 0.0080  0.0382  151 GLY A CA  
1208 C C   . GLY A 151 ? 0.3237 0.2830 0.3672 -0.0310 0.0045  0.0410  151 GLY A C   
1209 O O   . GLY A 151 ? 0.3234 0.2711 0.3636 -0.0248 0.0023  0.0395  151 GLY A O   
1210 N N   . ALA A 152 ? 0.3330 0.2893 0.3794 -0.0407 0.0038  0.0455  152 ALA A N   
1211 C CA  . ALA A 152 ? 0.3499 0.2856 0.3944 -0.0450 -0.0002 0.0497  152 ALA A CA  
1212 C C   . ALA A 152 ? 0.3611 0.2876 0.3988 -0.0394 -0.0009 0.0555  152 ALA A C   
1213 O O   . ALA A 152 ? 0.3787 0.2869 0.4156 -0.0354 -0.0053 0.0548  152 ALA A O   
1214 C CB  . ALA A 152 ? 0.3610 0.2983 0.4091 -0.0584 0.0000  0.0571  152 ALA A CB  
1215 N N   . PHE A 153 ? 0.3518 0.2915 0.3848 -0.0387 0.0032  0.0605  153 PHE A N   
1216 C CA  . PHE A 153 ? 0.3614 0.2952 0.3863 -0.0355 0.0018  0.0675  153 PHE A CA  
1217 C C   . PHE A 153 ? 0.3565 0.2832 0.3818 -0.0247 -0.0018 0.0623  153 PHE A C   
1218 O O   . PHE A 153 ? 0.3785 0.2941 0.4009 -0.0214 -0.0061 0.0675  153 PHE A O   
1219 C CB  . PHE A 153 ? 0.3442 0.2961 0.3623 -0.0359 0.0073  0.0701  153 PHE A CB  
1220 C CG  . PHE A 153 ? 0.3570 0.3225 0.3767 -0.0454 0.0129  0.0742  153 PHE A CG  
1221 C CD1 . PHE A 153 ? 0.3411 0.3038 0.3551 -0.0547 0.0136  0.0856  153 PHE A CD1 
1222 C CD2 . PHE A 153 ? 0.3678 0.3504 0.3954 -0.0452 0.0173  0.0676  153 PHE A CD2 
1223 C CE1 . PHE A 153 ? 0.3651 0.3438 0.3822 -0.0644 0.0196  0.0898  153 PHE A CE1 
1224 C CE2 . PHE A 153 ? 0.3573 0.3562 0.3894 -0.0536 0.0227  0.0714  153 PHE A CE2 
1225 C CZ  . PHE A 153 ? 0.3235 0.3213 0.3507 -0.0636 0.0243  0.0823  153 PHE A CZ  
1226 N N   . GLY A 154 ? 0.3328 0.2672 0.3624 -0.0196 -0.0003 0.0529  154 GLY A N   
1227 C CA  . GLY A 154 ? 0.3259 0.2585 0.3569 -0.0104 -0.0023 0.0482  154 GLY A CA  
1228 C C   . GLY A 154 ? 0.3236 0.2464 0.3603 -0.0069 -0.0043 0.0411  154 GLY A C   
1229 O O   . GLY A 154 ? 0.3262 0.2455 0.3658 0.0008  -0.0061 0.0383  154 GLY A O   
1230 N N   . PHE A 155 ? 0.3140 0.2341 0.3527 -0.0125 -0.0039 0.0374  155 PHE A N   
1231 C CA  . PHE A 155 ? 0.3203 0.2326 0.3616 -0.0093 -0.0052 0.0283  155 PHE A CA  
1232 C C   . PHE A 155 ? 0.3331 0.2288 0.3754 -0.0153 -0.0085 0.0263  155 PHE A C   
1233 O O   . PHE A 155 ? 0.3261 0.2158 0.3687 -0.0131 -0.0094 0.0168  155 PHE A O   
1234 C CB  . PHE A 155 ? 0.2960 0.2234 0.3371 -0.0079 -0.0024 0.0213  155 PHE A CB  
1235 C CG  . PHE A 155 ? 0.3041 0.2430 0.3448 -0.0017 -0.0003 0.0221  155 PHE A CG  
1236 C CD1 . PHE A 155 ? 0.2809 0.2186 0.3236 0.0060  -0.0004 0.0186  155 PHE A CD1 
1237 C CD2 . PHE A 155 ? 0.2814 0.2318 0.3202 -0.0035 0.0016  0.0263  155 PHE A CD2 
1238 C CE1 . PHE A 155 ? 0.2946 0.2431 0.3382 0.0099  0.0008  0.0202  155 PHE A CE1 
1239 C CE2 . PHE A 155 ? 0.3164 0.2745 0.3543 0.0012  0.0024  0.0268  155 PHE A CE2 
1240 C CZ  . PHE A 155 ? 0.2931 0.2504 0.3336 0.0069  0.0016  0.0243  155 PHE A CZ  
1241 N N   . LEU A 156 ? 0.3470 0.2357 0.3890 -0.0237 -0.0102 0.0349  156 LEU A N   
1242 C CA  . LEU A 156 ? 0.3901 0.2581 0.4332 -0.0304 -0.0147 0.0342  156 LEU A CA  
1243 C C   . LEU A 156 ? 0.4089 0.2571 0.4528 -0.0206 -0.0181 0.0283  156 LEU A C   
1244 O O   . LEU A 156 ? 0.4217 0.2662 0.4663 -0.0127 -0.0191 0.0333  156 LEU A O   
1245 C CB  . LEU A 156 ? 0.4002 0.2609 0.4423 -0.0399 -0.0164 0.0474  156 LEU A CB  
1246 C CG  . LEU A 156 ? 0.4477 0.2866 0.4915 -0.0496 -0.0216 0.0476  156 LEU A CG  
1247 C CD1 . LEU A 156 ? 0.4283 0.2824 0.4756 -0.0619 -0.0201 0.0458  156 LEU A CD1 
1248 C CD2 . LEU A 156 ? 0.4578 0.2798 0.4993 -0.0548 -0.0252 0.0618  156 LEU A CD2 
1249 N N   . ALA A 157 ? 0.4257 0.2622 0.4697 -0.0201 -0.0201 0.0171  157 ALA A N   
1250 C CA  . ALA A 157 ? 0.4455 0.2668 0.4910 -0.0079 -0.0218 0.0088  157 ALA A CA  
1251 C C   . ALA A 157 ? 0.4806 0.2718 0.5258 -0.0105 -0.0276 0.0037  157 ALA A C   
1252 O O   . ALA A 157 ? 0.4898 0.2770 0.5318 -0.0172 -0.0288 -0.0057 157 ALA A O   
1253 C CB  . ALA A 157 ? 0.4286 0.2657 0.4727 -0.0002 -0.0171 -0.0033 157 ALA A CB  
1254 N N   . LEU A 158 ? 0.5043 0.2734 0.5526 -0.0058 -0.0324 0.0099  158 LEU A N   
1255 C CA  . LEU A 158 ? 0.5449 0.2798 0.5935 -0.0055 -0.0388 0.0034  158 LEU A CA  
1256 C C   . LEU A 158 ? 0.5624 0.2852 0.6163 0.0127  -0.0399 -0.0027 158 LEU A C   
1257 O O   . LEU A 158 ? 0.5758 0.2840 0.6342 0.0178  -0.0446 0.0076  158 LEU A O   
1258 C CB  . LEU A 158 ? 0.5673 0.2811 0.6155 -0.0181 -0.0453 0.0177  158 LEU A CB  
1259 C CG  . LEU A 158 ? 0.5569 0.2840 0.6023 -0.0364 -0.0439 0.0213  158 LEU A CG  
1260 C CD1 . LEU A 158 ? 0.5723 0.3042 0.6176 -0.0469 -0.0444 0.0409  158 LEU A CD1 
1261 C CD2 . LEU A 158 ? 0.5138 0.2185 0.5575 -0.0463 -0.0495 0.0111  158 LEU A CD2 
1262 N N   . HIS A 159 ? 0.5646 0.2966 0.6184 0.0226  -0.0351 -0.0190 159 HIS A N   
1263 C CA  . HIS A 159 ? 0.5873 0.3171 0.6482 0.0412  -0.0336 -0.0268 159 HIS A CA  
1264 C C   . HIS A 159 ? 0.6346 0.3263 0.7002 0.0479  -0.0417 -0.0273 159 HIS A C   
1265 O O   . HIS A 159 ? 0.6503 0.3136 0.7108 0.0400  -0.0470 -0.0323 159 HIS A O   
1266 C CB  . HIS A 159 ? 0.5916 0.3357 0.6485 0.0473  -0.0266 -0.0456 159 HIS A CB  
1267 C CG  . HIS A 159 ? 0.6295 0.3803 0.6950 0.0666  -0.0224 -0.0547 159 HIS A CG  
1268 N ND1 . HIS A 159 ? 0.6785 0.4066 0.7465 0.0787  -0.0236 -0.0695 159 HIS A ND1 
1269 C CD2 . HIS A 159 ? 0.6095 0.3882 0.6830 0.0758  -0.0170 -0.0512 159 HIS A CD2 
1270 C CE1 . HIS A 159 ? 0.6830 0.4276 0.7613 0.0955  -0.0183 -0.0747 159 HIS A CE1 
1271 N NE2 . HIS A 159 ? 0.6568 0.4328 0.7388 0.0931  -0.0144 -0.0633 159 HIS A NE2 
1272 N N   . GLY A 160 ? 0.6474 0.3380 0.7232 0.0618  -0.0437 -0.0209 160 GLY A N   
1273 C CA  . GLY A 160 ? 0.7077 0.3623 0.7899 0.0709  -0.0522 -0.0198 160 GLY A CA  
1274 C C   . GLY A 160 ? 0.7283 0.3729 0.8114 0.0640  -0.0600 0.0031  160 GLY A C   
1275 O O   . GLY A 160 ? 0.7494 0.3779 0.8411 0.0757  -0.0667 0.0103  160 GLY A O   
1276 N N   . SER A 161 ? 0.7207 0.3765 0.7949 0.0454  -0.0589 0.0146  161 SER A N   
1277 C CA  . SER A 161 ? 0.7364 0.3902 0.8080 0.0364  -0.0640 0.0368  161 SER A CA  
1278 C C   . SER A 161 ? 0.7104 0.3943 0.7857 0.0443  -0.0613 0.0453  161 SER A C   
1279 O O   . SER A 161 ? 0.6830 0.3980 0.7585 0.0463  -0.0533 0.0380  161 SER A O   
1280 C CB  . SER A 161 ? 0.7293 0.3908 0.7910 0.0145  -0.0616 0.0439  161 SER A CB  
1281 O OG  . SER A 161 ? 0.7687 0.4304 0.8261 0.0053  -0.0652 0.0650  161 SER A OG  
1282 N N   . GLN A 162 ? 0.7235 0.3980 0.8010 0.0479  -0.0689 0.0613  162 GLN A N   
1283 C CA  . GLN A 162 ? 0.6953 0.3982 0.7741 0.0522  -0.0679 0.0707  162 GLN A CA  
1284 C C   . GLN A 162 ? 0.6807 0.3990 0.7463 0.0346  -0.0653 0.0839  162 GLN A C   
1285 O O   . GLN A 162 ? 0.6689 0.4123 0.7317 0.0348  -0.0633 0.0900  162 GLN A O   
1286 C CB  . GLN A 162 ? 0.7140 0.4043 0.8017 0.0660  -0.0777 0.0808  162 GLN A CB  
1287 C CG  . GLN A 162 ? 0.7304 0.4088 0.8339 0.0860  -0.0793 0.0663  162 GLN A CG  
1288 C CD  . GLN A 162 ? 0.7105 0.4165 0.8200 0.0936  -0.0682 0.0467  162 GLN A CD  
1289 O OE1 . GLN A 162 ? 0.6786 0.4178 0.7861 0.0900  -0.0619 0.0470  162 GLN A OE1 
1290 N NE2 . GLN A 162 ? 0.7276 0.4189 0.8435 0.1039  -0.0661 0.0295  162 GLN A NE2 
1291 N N   . GLU A 163 ? 0.6824 0.3865 0.7401 0.0192  -0.0650 0.0869  163 GLU A N   
1292 C CA  . GLU A 163 ? 0.6641 0.3813 0.7105 0.0021  -0.0619 0.0991  163 GLU A CA  
1293 C C   . GLU A 163 ? 0.6184 0.3651 0.6621 -0.0041 -0.0515 0.0890  163 GLU A C   
1294 O O   . GLU A 163 ? 0.6022 0.3716 0.6390 -0.0105 -0.0472 0.0959  163 GLU A O   
1295 C CB  . GLU A 163 ? 0.7003 0.3904 0.7424 -0.0123 -0.0662 0.1071  163 GLU A CB  
1296 C CG  . GLU A 163 ? 0.7605 0.4494 0.7926 -0.0242 -0.0693 0.1282  163 GLU A CG  
1297 C CD  . GLU A 163 ? 0.8072 0.4737 0.8399 -0.0157 -0.0800 0.1414  163 GLU A CD  
1298 O OE1 . GLU A 163 ? 0.8589 0.4900 0.8947 -0.0166 -0.0880 0.1447  163 GLU A OE1 
1299 O OE2 . GLU A 163 ? 0.8063 0.4896 0.8361 -0.0087 -0.0813 0.1487  163 GLU A OE2 
1300 N N   . ALA A 164 ? 0.5879 0.3335 0.6360 -0.0026 -0.0481 0.0730  164 ALA A N   
1301 C CA  . ALA A 164 ? 0.5337 0.3072 0.5805 -0.0058 -0.0395 0.0632  164 ALA A CA  
1302 C C   . ALA A 164 ? 0.5079 0.2843 0.5608 0.0066  -0.0370 0.0462  164 ALA A C   
1303 O O   . ALA A 164 ? 0.5062 0.2772 0.5587 0.0032  -0.0356 0.0349  164 ALA A O   
1304 C CB  . ALA A 164 ? 0.5309 0.3042 0.5741 -0.0221 -0.0374 0.0633  164 ALA A CB  
1305 N N   . PRO A 165 ? 0.4948 0.2808 0.5533 0.0204  -0.0368 0.0445  165 PRO A N   
1306 C CA  . PRO A 165 ? 0.4884 0.2793 0.5538 0.0333  -0.0337 0.0293  165 PRO A CA  
1307 C C   . PRO A 165 ? 0.4690 0.2836 0.5314 0.0305  -0.0258 0.0190  165 PRO A C   
1308 O O   . PRO A 165 ? 0.4772 0.2941 0.5420 0.0377  -0.0225 0.0053  165 PRO A O   
1309 C CB  . PRO A 165 ? 0.4820 0.2837 0.5554 0.0459  -0.0356 0.0344  165 PRO A CB  
1310 C CG  . PRO A 165 ? 0.4640 0.2771 0.5307 0.0372  -0.0369 0.0492  165 PRO A CG  
1311 C CD  . PRO A 165 ? 0.4893 0.2839 0.5478 0.0239  -0.0397 0.0574  165 PRO A CD  
1312 N N   . GLY A 166 ? 0.4440 0.2762 0.5007 0.0208  -0.0229 0.0255  166 GLY A N   
1313 C CA  . GLY A 166 ? 0.4279 0.2823 0.4823 0.0190  -0.0165 0.0179  166 GLY A CA  
1314 C C   . GLY A 166 ? 0.4048 0.2800 0.4626 0.0262  -0.0138 0.0194  166 GLY A C   
1315 O O   . GLY A 166 ? 0.4161 0.2895 0.4799 0.0344  -0.0168 0.0234  166 GLY A O   
1316 N N   . ASN A 167 ? 0.3797 0.2741 0.4343 0.0228  -0.0091 0.0167  167 ASN A N   
1317 C CA  . ASN A 167 ? 0.3504 0.2642 0.4079 0.0273  -0.0067 0.0177  167 ASN A CA  
1318 C C   . ASN A 167 ? 0.3455 0.2640 0.4023 0.0262  -0.0096 0.0284  167 ASN A C   
1319 O O   . ASN A 167 ? 0.3543 0.2871 0.4139 0.0292  -0.0090 0.0292  167 ASN A O   
1320 C CB  . ASN A 167 ? 0.3494 0.2676 0.4150 0.0380  -0.0051 0.0102  167 ASN A CB  
1321 C CG  . ASN A 167 ? 0.3608 0.2823 0.4234 0.0382  -0.0003 -0.0014 167 ASN A CG  
1322 O OD1 . ASN A 167 ? 0.3516 0.2786 0.4070 0.0304  0.0016  -0.0025 167 ASN A OD1 
1323 N ND2 . ASN A 167 ? 0.3488 0.2675 0.4167 0.0474  0.0015  -0.0104 167 ASN A ND2 
1324 N N   . VAL A 168 ? 0.3414 0.2492 0.3933 0.0207  -0.0128 0.0368  168 VAL A N   
1325 C CA  . VAL A 168 ? 0.3214 0.2334 0.3703 0.0203  -0.0161 0.0467  168 VAL A CA  
1326 C C   . VAL A 168 ? 0.3038 0.2333 0.3476 0.0167  -0.0132 0.0468  168 VAL A C   
1327 O O   . VAL A 168 ? 0.2974 0.2343 0.3404 0.0186  -0.0159 0.0509  168 VAL A O   
1328 C CB  . VAL A 168 ? 0.3255 0.2227 0.3685 0.0148  -0.0202 0.0572  168 VAL A CB  
1329 C CG1 . VAL A 168 ? 0.3478 0.2233 0.3969 0.0196  -0.0249 0.0571  168 VAL A CG1 
1330 C CG2 . VAL A 168 ? 0.3174 0.2168 0.3528 0.0038  -0.0162 0.0589  168 VAL A CG2 
1331 N N   . GLY A 169 ? 0.3013 0.2366 0.3418 0.0116  -0.0084 0.0423  169 GLY A N   
1332 C CA  . GLY A 169 ? 0.2723 0.2214 0.3092 0.0098  -0.0058 0.0408  169 GLY A CA  
1333 C C   . GLY A 169 ? 0.2808 0.2389 0.3235 0.0151  -0.0063 0.0372  169 GLY A C   
1334 O O   . GLY A 169 ? 0.2885 0.2544 0.3287 0.0142  -0.0073 0.0388  169 GLY A O   
1335 N N   . LEU A 170 ? 0.2771 0.2349 0.3274 0.0200  -0.0054 0.0321  170 LEU A N   
1336 C CA  . LEU A 170 ? 0.2892 0.2592 0.3466 0.0244  -0.0047 0.0292  170 LEU A CA  
1337 C C   . LEU A 170 ? 0.2959 0.2688 0.3592 0.0288  -0.0098 0.0345  170 LEU A C   
1338 O O   . LEU A 170 ? 0.2971 0.2825 0.3642 0.0287  -0.0111 0.0356  170 LEU A O   
1339 C CB  . LEU A 170 ? 0.2828 0.2546 0.3458 0.0288  -0.0009 0.0214  170 LEU A CB  
1340 C CG  . LEU A 170 ? 0.2930 0.2687 0.3505 0.0246  0.0035  0.0161  170 LEU A CG  
1341 C CD1 . LEU A 170 ? 0.2551 0.2300 0.3144 0.0289  0.0069  0.0074  170 LEU A CD1 
1342 C CD2 . LEU A 170 ? 0.2202 0.2093 0.2769 0.0215  0.0049  0.0176  170 LEU A CD2 
1343 N N   . LEU A 171 ? 0.3031 0.2640 0.3666 0.0313  -0.0137 0.0388  171 LEU A N   
1344 C CA  . LEU A 171 ? 0.3188 0.2818 0.3873 0.0356  -0.0200 0.0452  171 LEU A CA  
1345 C C   . LEU A 171 ? 0.3113 0.2781 0.3697 0.0293  -0.0234 0.0515  171 LEU A C   
1346 O O   . LEU A 171 ? 0.3144 0.2901 0.3766 0.0310  -0.0286 0.0551  171 LEU A O   
1347 C CB  . LEU A 171 ? 0.3321 0.2784 0.4038 0.0409  -0.0244 0.0493  171 LEU A CB  
1348 C CG  . LEU A 171 ? 0.3587 0.2993 0.4414 0.0497  -0.0222 0.0415  171 LEU A CG  
1349 C CD1 . LEU A 171 ? 0.3362 0.2526 0.4191 0.0532  -0.0272 0.0454  171 LEU A CD1 
1350 C CD2 . LEU A 171 ? 0.3031 0.2611 0.4012 0.0592  -0.0222 0.0380  171 LEU A CD2 
1351 N N   . ASP A 172 ? 0.3174 0.2787 0.3633 0.0222  -0.0206 0.0523  172 ASP A N   
1352 C CA  . ASP A 172 ? 0.3251 0.2910 0.3596 0.0166  -0.0223 0.0556  172 ASP A CA  
1353 C C   . ASP A 172 ? 0.3180 0.2963 0.3557 0.0161  -0.0222 0.0510  172 ASP A C   
1354 O O   . ASP A 172 ? 0.3400 0.3239 0.3748 0.0146  -0.0274 0.0536  172 ASP A O   
1355 C CB  . ASP A 172 ? 0.3145 0.2766 0.3373 0.0103  -0.0172 0.0549  172 ASP A CB  
1356 C CG  . ASP A 172 ? 0.3540 0.3049 0.3732 0.0079  -0.0169 0.0606  172 ASP A CG  
1357 O OD1 . ASP A 172 ? 0.3782 0.3205 0.4002 0.0107  -0.0221 0.0669  172 ASP A OD1 
1358 O OD2 . ASP A 172 ? 0.3617 0.3122 0.3764 0.0030  -0.0118 0.0592  172 ASP A OD2 
1359 N N   . GLN A 173 ? 0.2991 0.2812 0.3420 0.0161  -0.0172 0.0447  173 GLN A N   
1360 C CA  . GLN A 173 ? 0.2953 0.2877 0.3412 0.0140  -0.0173 0.0417  173 GLN A CA  
1361 C C   . GLN A 173 ? 0.3057 0.3089 0.3630 0.0170  -0.0223 0.0442  173 GLN A C   
1362 O O   . GLN A 173 ? 0.3084 0.3186 0.3652 0.0133  -0.0267 0.0454  173 GLN A O   
1363 C CB  . GLN A 173 ? 0.2742 0.2693 0.3241 0.0137  -0.0114 0.0365  173 GLN A CB  
1364 C CG  . GLN A 173 ? 0.2455 0.2330 0.2874 0.0113  -0.0073 0.0341  173 GLN A CG  
1365 C CD  . GLN A 173 ? 0.2890 0.2798 0.3340 0.0111  -0.0031 0.0300  173 GLN A CD  
1366 O OE1 . GLN A 173 ? 0.2714 0.2706 0.3231 0.0121  -0.0022 0.0289  173 GLN A OE1 
1367 N NE2 . GLN A 173 ? 0.2502 0.2363 0.2904 0.0094  -0.0005 0.0282  173 GLN A NE2 
1368 N N   . ARG A 174 ? 0.3069 0.3115 0.3752 0.0239  -0.0220 0.0446  174 ARG A N   
1369 C CA  . ARG A 174 ? 0.3089 0.3269 0.3920 0.0288  -0.0261 0.0465  174 ARG A CA  
1370 C C   . ARG A 174 ? 0.3199 0.3380 0.4003 0.0285  -0.0354 0.0537  174 ARG A C   
1371 O O   . ARG A 174 ? 0.3268 0.3589 0.4152 0.0276  -0.0407 0.0559  174 ARG A O   
1372 C CB  . ARG A 174 ? 0.3133 0.3308 0.4085 0.0383  -0.0235 0.0440  174 ARG A CB  
1373 C CG  . ARG A 174 ? 0.3316 0.3645 0.4446 0.0455  -0.0282 0.0466  174 ARG A CG  
1374 C CD  . ARG A 174 ? 0.3334 0.3607 0.4574 0.0573  -0.0268 0.0439  174 ARG A CD  
1375 N NE  . ARG A 174 ? 0.2974 0.3279 0.4241 0.0594  -0.0173 0.0345  174 ARG A NE  
1376 C CZ  . ARG A 174 ? 0.3287 0.3521 0.4613 0.0688  -0.0138 0.0284  174 ARG A CZ  
1377 N NH1 . ARG A 174 ? 0.3136 0.3239 0.4520 0.0777  -0.0196 0.0312  174 ARG A NH1 
1378 N NH2 . ARG A 174 ? 0.3217 0.3505 0.4538 0.0692  -0.0050 0.0193  174 ARG A NH2 
1379 N N   . MET A 175 ? 0.3239 0.3276 0.3923 0.0279  -0.0376 0.0580  175 MET A N   
1380 C CA  . MET A 175 ? 0.3371 0.3411 0.3988 0.0262  -0.0465 0.0654  175 MET A CA  
1381 C C   . MET A 175 ? 0.3210 0.3306 0.3714 0.0177  -0.0488 0.0637  175 MET A C   
1382 O O   . MET A 175 ? 0.3295 0.3465 0.3790 0.0159  -0.0574 0.0677  175 MET A O   
1383 C CB  . MET A 175 ? 0.3445 0.3325 0.3935 0.0258  -0.0481 0.0717  175 MET A CB  
1384 C CG  . MET A 175 ? 0.4240 0.4143 0.4690 0.0262  -0.0589 0.0811  175 MET A CG  
1385 S SD  . MET A 175 ? 0.5433 0.5159 0.5851 0.0304  -0.0631 0.0917  175 MET A SD  
1386 C CE  . MET A 175 ? 0.4484 0.4130 0.4652 0.0195  -0.0578 0.0926  175 MET A CE  
1387 N N   . ALA A 176 ? 0.3101 0.3152 0.3516 0.0127  -0.0422 0.0577  176 ALA A N   
1388 C CA  . ALA A 176 ? 0.3147 0.3222 0.3461 0.0054  -0.0445 0.0543  176 ALA A CA  
1389 C C   . ALA A 176 ? 0.3060 0.3272 0.3515 0.0035  -0.0478 0.0528  176 ALA A C   
1390 O O   . ALA A 176 ? 0.3168 0.3433 0.3591 -0.0016 -0.0551 0.0532  176 ALA A O   
1391 C CB  . ALA A 176 ? 0.3026 0.3010 0.3229 0.0023  -0.0370 0.0482  176 ALA A CB  
1392 N N   . LEU A 177 ? 0.3004 0.3286 0.3612 0.0071  -0.0426 0.0511  177 LEU A N   
1393 C CA  . LEU A 177 ? 0.3068 0.3526 0.3840 0.0054  -0.0446 0.0512  177 LEU A CA  
1394 C C   . LEU A 177 ? 0.3063 0.3659 0.3950 0.0079  -0.0540 0.0567  177 LEU A C   
1395 O O   . LEU A 177 ? 0.3156 0.3887 0.4115 0.0020  -0.0598 0.0577  177 LEU A O   
1396 C CB  . LEU A 177 ? 0.2946 0.3474 0.3847 0.0096  -0.0360 0.0484  177 LEU A CB  
1397 C CG  . LEU A 177 ? 0.3109 0.3544 0.3921 0.0059  -0.0283 0.0438  177 LEU A CG  
1398 C CD1 . LEU A 177 ? 0.2851 0.3388 0.3775 0.0089  -0.0206 0.0413  177 LEU A CD1 
1399 C CD2 . LEU A 177 ? 0.3188 0.3576 0.3907 -0.0038 -0.0309 0.0427  177 LEU A CD2 
1400 N N   . GLN A 178 ? 0.3029 0.3591 0.3941 0.0162  -0.0562 0.0609  178 GLN A N   
1401 C CA  . GLN A 178 ? 0.2995 0.3681 0.4026 0.0205  -0.0660 0.0673  178 GLN A CA  
1402 C C   . GLN A 178 ? 0.3013 0.3689 0.3900 0.0124  -0.0760 0.0704  178 GLN A C   
1403 O O   . GLN A 178 ? 0.3017 0.3858 0.4003 0.0097  -0.0849 0.0733  178 GLN A O   
1404 C CB  . GLN A 178 ? 0.3151 0.3737 0.4202 0.0309  -0.0671 0.0719  178 GLN A CB  
1405 C CG  . GLN A 178 ? 0.3261 0.3954 0.4435 0.0373  -0.0790 0.0804  178 GLN A CG  
1406 C CD  . GLN A 178 ? 0.3261 0.4195 0.4719 0.0442  -0.0789 0.0789  178 GLN A CD  
1407 O OE1 . GLN A 178 ? 0.3165 0.4110 0.4743 0.0520  -0.0702 0.0740  178 GLN A OE1 
1408 N NE2 . GLN A 178 ? 0.3231 0.4377 0.4800 0.0408  -0.0883 0.0828  178 GLN A NE2 
1409 N N   . TRP A 179 ? 0.3035 0.3533 0.3687 0.0081  -0.0743 0.0691  179 TRP A N   
1410 C CA  . TRP A 179 ? 0.3192 0.3658 0.3654 0.0003  -0.0823 0.0698  179 TRP A CA  
1411 C C   . TRP A 179 ? 0.3216 0.3759 0.3691 -0.0091 -0.0854 0.0642  179 TRP A C   
1412 O O   . TRP A 179 ? 0.3244 0.3843 0.3660 -0.0153 -0.0959 0.0653  179 TRP A O   
1413 C CB  . TRP A 179 ? 0.3256 0.3536 0.3476 -0.0016 -0.0764 0.0677  179 TRP A CB  
1414 C CG  . TRP A 179 ? 0.3498 0.3747 0.3500 -0.0080 -0.0837 0.0683  179 TRP A CG  
1415 C CD1 . TRP A 179 ? 0.3638 0.3856 0.3503 -0.0074 -0.0896 0.0761  179 TRP A CD1 
1416 C CD2 . TRP A 179 ? 0.3494 0.3732 0.3372 -0.0164 -0.0866 0.0606  179 TRP A CD2 
1417 N NE1 . TRP A 179 ? 0.4044 0.4253 0.3693 -0.0148 -0.0952 0.0731  179 TRP A NE1 
1418 C CE2 . TRP A 179 ? 0.4010 0.4222 0.3667 -0.0201 -0.0937 0.0628  179 TRP A CE2 
1419 C CE3 . TRP A 179 ? 0.3530 0.3758 0.3449 -0.0213 -0.0840 0.0522  179 TRP A CE3 
1420 C CZ2 . TRP A 179 ? 0.4354 0.4531 0.3827 -0.0280 -0.0982 0.0549  179 TRP A CZ2 
1421 C CZ3 . TRP A 179 ? 0.3959 0.4131 0.3710 -0.0294 -0.0893 0.0452  179 TRP A CZ3 
1422 C CH2 . TRP A 179 ? 0.4142 0.4290 0.3672 -0.0323 -0.0961 0.0457  179 TRP A CH2 
1423 N N   . VAL A 180 ? 0.3121 0.3656 0.3664 -0.0110 -0.0771 0.0586  180 VAL A N   
1424 C CA  . VAL A 180 ? 0.3189 0.3767 0.3756 -0.0207 -0.0795 0.0543  180 VAL A CA  
1425 C C   . VAL A 180 ? 0.3214 0.4035 0.4015 -0.0221 -0.0867 0.0591  180 VAL A C   
1426 O O   . VAL A 180 ? 0.3406 0.4304 0.4213 -0.0311 -0.0964 0.0591  180 VAL A O   
1427 C CB  . VAL A 180 ? 0.3067 0.3559 0.3639 -0.0219 -0.0685 0.0490  180 VAL A CB  
1428 C CG1 . VAL A 180 ? 0.3199 0.3763 0.3864 -0.0315 -0.0705 0.0475  180 VAL A CG1 
1429 C CG2 . VAL A 180 ? 0.3213 0.3490 0.3560 -0.0219 -0.0638 0.0435  180 VAL A CG2 
1430 N N   . HIS A 181 ? 0.3021 0.3970 0.4018 -0.0130 -0.0822 0.0626  181 HIS A N   
1431 C CA  . HIS A 181 ? 0.2996 0.4211 0.4245 -0.0116 -0.0879 0.0672  181 HIS A CA  
1432 C C   . HIS A 181 ? 0.3213 0.4502 0.4450 -0.0122 -0.1023 0.0728  181 HIS A C   
1433 O O   . HIS A 181 ? 0.3295 0.4790 0.4679 -0.0180 -0.1110 0.0754  181 HIS A O   
1434 C CB  . HIS A 181 ? 0.2827 0.4130 0.4257 0.0015  -0.0802 0.0685  181 HIS A CB  
1435 C CG  . HIS A 181 ? 0.2872 0.4472 0.4589 0.0060  -0.0846 0.0726  181 HIS A CG  
1436 N ND1 . HIS A 181 ? 0.3115 0.4940 0.5029 0.0023  -0.0790 0.0712  181 HIS A ND1 
1437 C CD2 . HIS A 181 ? 0.2880 0.4606 0.4731 0.0144  -0.0938 0.0787  181 HIS A CD2 
1438 C CE1 . HIS A 181 ? 0.2902 0.5001 0.5076 0.0087  -0.0837 0.0753  181 HIS A CE1 
1439 N NE2 . HIS A 181 ? 0.2875 0.4913 0.5021 0.0167  -0.0933 0.0799  181 HIS A NE2 
1440 N N   . ASP A 182 ? 0.3400 0.4534 0.4465 -0.0071 -0.1054 0.0756  182 ASP A N   
1441 C CA  . ASP A 182 ? 0.3576 0.4772 0.4601 -0.0073 -0.1198 0.0825  182 ASP A CA  
1442 C C   . ASP A 182 ? 0.3755 0.4885 0.4552 -0.0201 -0.1289 0.0795  182 ASP A C   
1443 O O   . ASP A 182 ? 0.3964 0.5214 0.4767 -0.0239 -0.1428 0.0842  182 ASP A O   
1444 C CB  . ASP A 182 ? 0.3761 0.4819 0.4690 0.0030  -0.1199 0.0887  182 ASP A CB  
1445 C CG  . ASP A 182 ? 0.3660 0.4798 0.4838 0.0168  -0.1161 0.0924  182 ASP A CG  
1446 O OD1 . ASP A 182 ? 0.3827 0.5185 0.5266 0.0194  -0.1153 0.0914  182 ASP A OD1 
1447 O OD2 . ASP A 182 ? 0.3993 0.4974 0.5107 0.0248  -0.1136 0.0961  182 ASP A OD2 
1448 N N   . ASN A 183 ? 0.3800 0.4739 0.4395 -0.0264 -0.1216 0.0712  183 ASN A N   
1449 C CA  . ASN A 183 ? 0.3959 0.4783 0.4290 -0.0364 -0.1285 0.0661  183 ASN A CA  
1450 C C   . ASN A 183 ? 0.3891 0.4644 0.4176 -0.0475 -0.1272 0.0565  183 ASN A C   
1451 O O   . ASN A 183 ? 0.4111 0.4798 0.4219 -0.0567 -0.1357 0.0514  183 ASN A O   
1452 C CB  . ASN A 183 ? 0.4013 0.4636 0.4071 -0.0328 -0.1229 0.0649  183 ASN A CB  
1453 C CG  . ASN A 183 ? 0.4250 0.4906 0.4299 -0.0249 -0.1274 0.0757  183 ASN A CG  
1454 O OD1 . ASN A 183 ? 0.5018 0.5729 0.4967 -0.0278 -0.1398 0.0809  183 ASN A OD1 
1455 N ND2 . ASN A 183 ? 0.3896 0.4506 0.4041 -0.0154 -0.1184 0.0795  183 ASN A ND2 
1456 N N   . ILE A 184 ? 0.3669 0.4422 0.4099 -0.0471 -0.1173 0.0541  184 ILE A N   
1457 C CA  . ILE A 184 ? 0.3684 0.4314 0.4043 -0.0573 -0.1161 0.0460  184 ILE A CA  
1458 C C   . ILE A 184 ? 0.3871 0.4606 0.4285 -0.0704 -0.1297 0.0455  184 ILE A C   
1459 O O   . ILE A 184 ? 0.4102 0.4677 0.4371 -0.0801 -0.1333 0.0376  184 ILE A O   
1460 C CB  . ILE A 184 ? 0.3403 0.3986 0.3870 -0.0552 -0.1031 0.0444  184 ILE A CB  
1461 C CG1 . ILE A 184 ? 0.3468 0.3803 0.3749 -0.0602 -0.0996 0.0355  184 ILE A CG1 
1462 C CG2 . ILE A 184 ? 0.3123 0.3933 0.3869 -0.0596 -0.1034 0.0495  184 ILE A CG2 
1463 C CD1 . ILE A 184 ? 0.3495 0.3639 0.3531 -0.0536 -0.0948 0.0299  184 ILE A CD1 
1464 N N   . GLN A 185 ? 0.3815 0.4811 0.4437 -0.0706 -0.1381 0.0533  185 GLN A N   
1465 C CA  . GLN A 185 ? 0.4084 0.5213 0.4774 -0.0840 -0.1526 0.0536  185 GLN A CA  
1466 C C   . GLN A 185 ? 0.4415 0.5389 0.4808 -0.0907 -0.1639 0.0474  185 GLN A C   
1467 O O   . GLN A 185 ? 0.4688 0.5668 0.5054 -0.1043 -0.1753 0.0436  185 GLN A O   
1468 C CB  . GLN A 185 ? 0.3990 0.5463 0.4969 -0.0815 -0.1604 0.0636  185 GLN A CB  
1469 C CG  . GLN A 185 ? 0.4173 0.5694 0.5075 -0.0725 -0.1687 0.0693  185 GLN A CG  
1470 C CD  . GLN A 185 ? 0.4473 0.6305 0.5697 -0.0635 -0.1720 0.0795  185 GLN A CD  
1471 O OE1 . GLN A 185 ? 0.4242 0.6148 0.5658 -0.0532 -0.1601 0.0817  185 GLN A OE1 
1472 N NE2 . GLN A 185 ? 0.4461 0.6484 0.5751 -0.0667 -0.1886 0.0853  185 GLN A NE2 
1473 N N   . PHE A 186 ? 0.4551 0.5389 0.4715 -0.0820 -0.1608 0.0463  186 PHE A N   
1474 C CA  . PHE A 186 ? 0.4942 0.5645 0.4792 -0.0878 -0.1702 0.0398  186 PHE A CA  
1475 C C   . PHE A 186 ? 0.5137 0.5563 0.4759 -0.0937 -0.1655 0.0259  186 PHE A C   
1476 O O   . PHE A 186 ? 0.5325 0.5641 0.4706 -0.1012 -0.1744 0.0175  186 PHE A O   
1477 C CB  . PHE A 186 ? 0.4916 0.5612 0.4609 -0.0777 -0.1692 0.0454  186 PHE A CB  
1478 C CG  . PHE A 186 ? 0.4965 0.5912 0.4878 -0.0721 -0.1771 0.0590  186 PHE A CG  
1479 C CD1 . PHE A 186 ? 0.4863 0.6016 0.4899 -0.0802 -0.1935 0.0629  186 PHE A CD1 
1480 C CD2 . PHE A 186 ? 0.4756 0.5732 0.4777 -0.0584 -0.1686 0.0676  186 PHE A CD2 
1481 C CE1 . PHE A 186 ? 0.4985 0.6390 0.5258 -0.0734 -0.2016 0.0756  186 PHE A CE1 
1482 C CE2 . PHE A 186 ? 0.4805 0.5995 0.5047 -0.0515 -0.1764 0.0795  186 PHE A CE2 
1483 C CZ  . PHE A 186 ? 0.4759 0.6174 0.5136 -0.0583 -0.1928 0.0837  186 PHE A CZ  
1484 N N   . PHE A 187 ? 0.4992 0.5309 0.4696 -0.0896 -0.1520 0.0234  187 PHE A N   
1485 C CA  . PHE A 187 ? 0.5143 0.5193 0.4683 -0.0928 -0.1468 0.0113  187 PHE A CA  
1486 C C   . PHE A 187 ? 0.5204 0.5227 0.4907 -0.1042 -0.1503 0.0098  187 PHE A C   
1487 O O   . PHE A 187 ? 0.5287 0.5102 0.4943 -0.1048 -0.1438 0.0034  187 PHE A O   
1488 C CB  . PHE A 187 ? 0.4881 0.4820 0.4389 -0.0804 -0.1303 0.0105  187 PHE A CB  
1489 C CG  . PHE A 187 ? 0.4842 0.4797 0.4193 -0.0710 -0.1261 0.0128  187 PHE A CG  
1490 C CD1 . PHE A 187 ? 0.4610 0.4747 0.4101 -0.0642 -0.1253 0.0249  187 PHE A CD1 
1491 C CD2 . PHE A 187 ? 0.5055 0.4842 0.4116 -0.0690 -0.1228 0.0031  187 PHE A CD2 
1492 C CE1 . PHE A 187 ? 0.4416 0.4548 0.3757 -0.0571 -0.1223 0.0287  187 PHE A CE1 
1493 C CE2 . PHE A 187 ? 0.4736 0.4557 0.3645 -0.0620 -0.1184 0.0068  187 PHE A CE2 
1494 C CZ  . PHE A 187 ? 0.4626 0.4608 0.3672 -0.0569 -0.1187 0.0203  187 PHE A CZ  
1495 N N   . GLY A 188 ? 0.5255 0.5499 0.5161 -0.1134 -0.1607 0.0168  188 GLY A N   
1496 C CA  . GLY A 188 ? 0.5322 0.5583 0.5407 -0.1264 -0.1642 0.0179  188 GLY A CA  
1497 C C   . GLY A 188 ? 0.5128 0.5471 0.5440 -0.1217 -0.1511 0.0253  188 GLY A C   
1498 O O   . GLY A 188 ? 0.5124 0.5418 0.5538 -0.1318 -0.1507 0.0262  188 GLY A O   
1499 N N   . GLY A 189 ? 0.4800 0.5257 0.5180 -0.1072 -0.1407 0.0309  189 GLY A N   
1500 C CA  . GLY A 189 ? 0.4555 0.5098 0.5126 -0.1018 -0.1279 0.0368  189 GLY A CA  
1501 C C   . GLY A 189 ? 0.4371 0.5266 0.5247 -0.1022 -0.1286 0.0468  189 GLY A C   
1502 O O   . GLY A 189 ? 0.4431 0.5517 0.5381 -0.0992 -0.1360 0.0507  189 GLY A O   
1503 N N   . ASP A 190 ? 0.4229 0.5221 0.5281 -0.1052 -0.1206 0.0512  190 ASP A N   
1504 C CA  . ASP A 190 ? 0.4081 0.5430 0.5432 -0.1036 -0.1179 0.0596  190 ASP A CA  
1505 C C   . ASP A 190 ? 0.3910 0.5317 0.5315 -0.0864 -0.1046 0.0613  190 ASP A C   
1506 O O   . ASP A 190 ? 0.3712 0.5029 0.5092 -0.0835 -0.0930 0.0606  190 ASP A O   
1507 C CB  . ASP A 190 ? 0.4048 0.5505 0.5559 -0.1181 -0.1164 0.0639  190 ASP A CB  
1508 C CG  . ASP A 190 ? 0.4167 0.6033 0.5999 -0.1165 -0.1118 0.0719  190 ASP A CG  
1509 O OD1 . ASP A 190 ? 0.4319 0.6390 0.6274 -0.1040 -0.1120 0.0738  190 ASP A OD1 
1510 O OD2 . ASP A 190 ? 0.4488 0.6473 0.6453 -0.1280 -0.1079 0.0765  190 ASP A OD2 
1511 N N   . PRO A 191 ? 0.3894 0.5448 0.5375 -0.0751 -0.1070 0.0639  191 PRO A N   
1512 C CA  . PRO A 191 ? 0.3696 0.5258 0.5210 -0.0588 -0.0956 0.0645  191 PRO A CA  
1513 C C   . PRO A 191 ? 0.3561 0.5356 0.5312 -0.0560 -0.0847 0.0674  191 PRO A C   
1514 O O   . PRO A 191 ? 0.3459 0.5220 0.5208 -0.0445 -0.0738 0.0659  191 PRO A O   
1515 C CB  . PRO A 191 ? 0.3705 0.5371 0.5265 -0.0493 -0.1037 0.0679  191 PRO A CB  
1516 C CG  . PRO A 191 ? 0.3817 0.5714 0.5527 -0.0603 -0.1172 0.0717  191 PRO A CG  
1517 C CD  . PRO A 191 ? 0.3932 0.5637 0.5469 -0.0765 -0.1212 0.0669  191 PRO A CD  
1518 N N   . LYS A 192 ? 0.3576 0.5614 0.5522 -0.0671 -0.0875 0.0714  192 LYS A N   
1519 C CA  . LYS A 192 ? 0.3437 0.5713 0.5585 -0.0665 -0.0758 0.0740  192 LYS A CA  
1520 C C   . LYS A 192 ? 0.3368 0.5490 0.5400 -0.0768 -0.0679 0.0735  192 LYS A C   
1521 O O   . LYS A 192 ? 0.3414 0.5724 0.5575 -0.0782 -0.0578 0.0762  192 LYS A O   
1522 C CB  . LYS A 192 ? 0.3481 0.6145 0.5924 -0.0739 -0.0812 0.0798  192 LYS A CB  
1523 C CG  . LYS A 192 ? 0.3741 0.6536 0.6282 -0.0688 -0.0945 0.0818  192 LYS A CG  
1524 C CD  . LYS A 192 ? 0.3958 0.7130 0.6783 -0.0808 -0.1028 0.0878  192 LYS A CD  
1525 C CE  . LYS A 192 ? 0.4106 0.7691 0.7272 -0.0673 -0.0972 0.0912  192 LYS A CE  
1526 N NZ  . LYS A 192 ? 0.4008 0.7650 0.7227 -0.0564 -0.0787 0.0884  192 LYS A NZ  
1527 N N   . THR A 193 ? 0.3331 0.5121 0.5121 -0.0832 -0.0724 0.0701  193 THR A N   
1528 C CA  . THR A 193 ? 0.3191 0.4794 0.4861 -0.0919 -0.0668 0.0703  193 THR A CA  
1529 C C   . THR A 193 ? 0.3127 0.4385 0.4542 -0.0832 -0.0636 0.0641  193 THR A C   
1530 O O   . THR A 193 ? 0.3171 0.4160 0.4416 -0.0899 -0.0677 0.0613  193 THR A O   
1531 C CB  . THR A 193 ? 0.3398 0.4962 0.5078 -0.1121 -0.0766 0.0734  193 THR A CB  
1532 O OG1 . THR A 193 ? 0.3323 0.5248 0.5262 -0.1196 -0.0808 0.0792  193 THR A OG1 
1533 C CG2 . THR A 193 ? 0.3298 0.4728 0.4914 -0.1223 -0.0709 0.0771  193 THR A CG2 
1534 N N   . VAL A 194 ? 0.2894 0.4166 0.4297 -0.0681 -0.0563 0.0617  194 VAL A N   
1535 C CA  . VAL A 194 ? 0.2823 0.3823 0.4021 -0.0596 -0.0524 0.0565  194 VAL A CA  
1536 C C   . VAL A 194 ? 0.2866 0.3830 0.4037 -0.0575 -0.0414 0.0570  194 VAL A C   
1537 O O   . VAL A 194 ? 0.2976 0.4136 0.4268 -0.0524 -0.0334 0.0586  194 VAL A O   
1538 C CB  . VAL A 194 ? 0.2679 0.3687 0.3863 -0.0456 -0.0518 0.0542  194 VAL A CB  
1539 C CG1 . VAL A 194 ? 0.2453 0.3214 0.3445 -0.0387 -0.0471 0.0497  194 VAL A CG1 
1540 C CG2 . VAL A 194 ? 0.2627 0.3661 0.3805 -0.0474 -0.0636 0.0547  194 VAL A CG2 
1541 N N   . THR A 195 ? 0.2906 0.3621 0.3913 -0.0607 -0.0414 0.0552  195 THR A N   
1542 C CA  . THR A 195 ? 0.2731 0.3375 0.3675 -0.0572 -0.0327 0.0554  195 THR A CA  
1543 C C   . THR A 195 ? 0.2739 0.3209 0.3549 -0.0460 -0.0301 0.0498  195 THR A C   
1544 O O   . THR A 195 ? 0.2820 0.3111 0.3516 -0.0453 -0.0352 0.0460  195 THR A O   
1545 C CB  . THR A 195 ? 0.2788 0.3280 0.3660 -0.0682 -0.0349 0.0589  195 THR A CB  
1546 O OG1 . THR A 195 ? 0.2793 0.3481 0.3799 -0.0796 -0.0348 0.0659  195 THR A OG1 
1547 C CG2 . THR A 195 ? 0.2668 0.3051 0.3444 -0.0637 -0.0281 0.0594  195 THR A CG2 
1548 N N   . ILE A 196 ? 0.2601 0.3127 0.3423 -0.0379 -0.0221 0.0489  196 ILE A N   
1549 C CA  . ILE A 196 ? 0.2682 0.3047 0.3386 -0.0296 -0.0197 0.0444  196 ILE A CA  
1550 C C   . ILE A 196 ? 0.2826 0.3082 0.3448 -0.0316 -0.0166 0.0454  196 ILE A C   
1551 O O   . ILE A 196 ? 0.2938 0.3292 0.3599 -0.0360 -0.0129 0.0493  196 ILE A O   
1552 C CB  . ILE A 196 ? 0.2587 0.3039 0.3341 -0.0194 -0.0148 0.0421  196 ILE A CB  
1553 C CG1 . ILE A 196 ? 0.2388 0.3033 0.3253 -0.0181 -0.0080 0.0431  196 ILE A CG1 
1554 C CG2 . ILE A 196 ? 0.2579 0.3082 0.3386 -0.0162 -0.0199 0.0421  196 ILE A CG2 
1555 C CD1 . ILE A 196 ? 0.2019 0.2689 0.2909 -0.0071 -0.0030 0.0388  196 ILE A CD1 
1556 N N   . PHE A 197 ? 0.2867 0.2937 0.3378 -0.0286 -0.0182 0.0422  197 PHE A N   
1557 C CA  . PHE A 197 ? 0.2834 0.2809 0.3282 -0.0288 -0.0163 0.0434  197 PHE A CA  
1558 C C   . PHE A 197 ? 0.2799 0.2665 0.3173 -0.0208 -0.0148 0.0389  197 PHE A C   
1559 O O   . PHE A 197 ? 0.2761 0.2576 0.3102 -0.0173 -0.0163 0.0348  197 PHE A O   
1560 C CB  . PHE A 197 ? 0.3104 0.2959 0.3522 -0.0373 -0.0217 0.0472  197 PHE A CB  
1561 C CG  . PHE A 197 ? 0.3196 0.2864 0.3545 -0.0372 -0.0279 0.0426  197 PHE A CG  
1562 C CD1 . PHE A 197 ? 0.3191 0.2878 0.3536 -0.0367 -0.0311 0.0383  197 PHE A CD1 
1563 C CD2 . PHE A 197 ? 0.3446 0.2914 0.3727 -0.0379 -0.0315 0.0426  197 PHE A CD2 
1564 C CE1 . PHE A 197 ? 0.3251 0.2768 0.3506 -0.0372 -0.0367 0.0327  197 PHE A CE1 
1565 C CE2 . PHE A 197 ? 0.3372 0.2657 0.3582 -0.0371 -0.0369 0.0364  197 PHE A CE2 
1566 C CZ  . PHE A 197 ? 0.3073 0.2386 0.3261 -0.0372 -0.0392 0.0309  197 PHE A CZ  
1567 N N   . GLY A 198 ? 0.2770 0.2621 0.3118 -0.0188 -0.0119 0.0400  198 GLY A N   
1568 C CA  . GLY A 198 ? 0.2765 0.2546 0.3068 -0.0121 -0.0106 0.0363  198 GLY A CA  
1569 C C   . GLY A 198 ? 0.2804 0.2579 0.3086 -0.0114 -0.0095 0.0389  198 GLY A C   
1570 O O   . GLY A 198 ? 0.2834 0.2669 0.3117 -0.0160 -0.0087 0.0435  198 GLY A O   
1571 N N   . GLU A 199 ? 0.2834 0.2558 0.3096 -0.0061 -0.0094 0.0363  199 GLU A N   
1572 C CA  . GLU A 199 ? 0.2858 0.2573 0.3103 -0.0053 -0.0105 0.0392  199 GLU A CA  
1573 C C   . GLU A 199 ? 0.2890 0.2684 0.3145 -0.0017 -0.0074 0.0363  199 GLU A C   
1574 O O   . GLU A 199 ? 0.2939 0.2745 0.3214 0.0015  -0.0053 0.0319  199 GLU A O   
1575 C CB  . GLU A 199 ? 0.2949 0.2526 0.3184 -0.0024 -0.0151 0.0398  199 GLU A CB  
1576 C CG  . GLU A 199 ? 0.2734 0.2298 0.2964 -0.0005 -0.0180 0.0441  199 GLU A CG  
1577 C CD  . GLU A 199 ? 0.2979 0.2602 0.3247 0.0062  -0.0165 0.0401  199 GLU A CD  
1578 O OE1 . GLU A 199 ? 0.2832 0.2481 0.3121 0.0090  -0.0130 0.0343  199 GLU A OE1 
1579 O OE2 . GLU A 199 ? 0.3245 0.2903 0.3520 0.0077  -0.0190 0.0434  199 GLU A OE2 
1580 N N   . SER A 200 ? 0.2782 0.2631 0.3013 -0.0035 -0.0076 0.0391  200 SER A N   
1581 C CA  . SER A 200 ? 0.2917 0.2828 0.3148 -0.0016 -0.0064 0.0362  200 SER A CA  
1582 C C   . SER A 200 ? 0.2924 0.2881 0.3173 -0.0013 -0.0019 0.0311  200 SER A C   
1583 O O   . SER A 200 ? 0.3027 0.3032 0.3267 -0.0033 0.0007  0.0308  200 SER A O   
1584 C CB  . SER A 200 ? 0.2920 0.2804 0.3191 0.0030  -0.0089 0.0353  200 SER A CB  
1585 O OG  . SER A 200 ? 0.3274 0.3235 0.3552 0.0029  -0.0091 0.0338  200 SER A OG  
1586 N N   . ALA A 201 ? 0.2833 0.2779 0.3114 0.0012  -0.0010 0.0276  201 ALA A N   
1587 C CA  . ALA A 201 ? 0.2925 0.2879 0.3221 0.0016  0.0020  0.0242  201 ALA A CA  
1588 C C   . ALA A 201 ? 0.2847 0.2792 0.3160 0.0018  0.0027  0.0252  201 ALA A C   
1589 O O   . ALA A 201 ? 0.2947 0.2920 0.3281 0.0026  0.0046  0.0236  201 ALA A O   
1590 C CB  . ALA A 201 ? 0.2813 0.2747 0.3136 0.0026  0.0025  0.0223  201 ALA A CB  
1591 N N   . GLY A 202 ? 0.2927 0.2832 0.3235 0.0015  0.0006  0.0274  202 GLY A N   
1592 C CA  . GLY A 202 ? 0.2744 0.2649 0.3066 0.0002  -0.0003 0.0286  202 GLY A CA  
1593 C C   . GLY A 202 ? 0.2731 0.2709 0.3072 -0.0031 0.0005  0.0309  202 GLY A C   
1594 O O   . GLY A 202 ? 0.2753 0.2793 0.3142 -0.0037 0.0010  0.0313  202 GLY A O   
1595 N N   . GLY A 203 ? 0.2707 0.2697 0.3015 -0.0055 0.0004  0.0333  203 GLY A N   
1596 C CA  . GLY A 203 ? 0.2650 0.2737 0.2958 -0.0096 0.0026  0.0362  203 GLY A CA  
1597 C C   . GLY A 203 ? 0.2617 0.2803 0.2936 -0.0069 0.0076  0.0316  203 GLY A C   
1598 O O   . GLY A 203 ? 0.2690 0.2989 0.3055 -0.0075 0.0110  0.0313  203 GLY A O   
1599 N N   . ALA A 204 ? 0.2540 0.2692 0.2824 -0.0039 0.0081  0.0275  204 ALA A N   
1600 C CA  . ALA A 204 ? 0.2658 0.2855 0.2950 -0.0006 0.0119  0.0212  204 ALA A CA  
1601 C C   . ALA A 204 ? 0.2636 0.2842 0.3018 0.0035  0.0129  0.0194  204 ALA A C   
1602 O O   . ALA A 204 ? 0.2571 0.2868 0.2997 0.0062  0.0167  0.0164  204 ALA A O   
1603 C CB  . ALA A 204 ? 0.2605 0.2728 0.2857 0.0008  0.0104  0.0170  204 ALA A CB  
1604 N N   . SER A 205 ? 0.2570 0.2693 0.2975 0.0044  0.0094  0.0214  205 SER A N   
1605 C CA  . SER A 205 ? 0.2663 0.2787 0.3137 0.0076  0.0084  0.0216  205 SER A CA  
1606 C C   . SER A 205 ? 0.2752 0.3002 0.3300 0.0067  0.0091  0.0238  205 SER A C   
1607 O O   . SER A 205 ? 0.2938 0.3263 0.3569 0.0114  0.0107  0.0219  205 SER A O   
1608 C CB  . SER A 205 ? 0.2695 0.2730 0.3146 0.0067  0.0045  0.0244  205 SER A CB  
1609 O OG  . SER A 205 ? 0.2737 0.2690 0.3152 0.0077  0.0046  0.0228  205 SER A OG  
1610 N N   . VAL A 206 ? 0.2696 0.2972 0.3227 0.0007  0.0075  0.0281  206 VAL A N   
1611 C CA  . VAL A 206 ? 0.2715 0.3127 0.3322 -0.0028 0.0080  0.0313  206 VAL A CA  
1612 C C   . VAL A 206 ? 0.2809 0.3381 0.3466 -0.0005 0.0146  0.0286  206 VAL A C   
1613 O O   . VAL A 206 ? 0.2916 0.3629 0.3689 0.0019  0.0162  0.0283  206 VAL A O   
1614 C CB  . VAL A 206 ? 0.2830 0.3214 0.3393 -0.0114 0.0053  0.0368  206 VAL A CB  
1615 C CG1 . VAL A 206 ? 0.2611 0.3164 0.3253 -0.0174 0.0070  0.0410  206 VAL A CG1 
1616 C CG2 . VAL A 206 ? 0.2645 0.2891 0.3175 -0.0131 -0.0012 0.0379  206 VAL A CG2 
1617 N N   . GLY A 207 ? 0.2744 0.3313 0.3316 -0.0010 0.0184  0.0263  207 GLY A N   
1618 C CA  . GLY A 207 ? 0.2719 0.3437 0.3308 0.0015  0.0255  0.0221  207 GLY A CA  
1619 C C   . GLY A 207 ? 0.2856 0.3559 0.3508 0.0116  0.0274  0.0141  207 GLY A C   
1620 O O   . GLY A 207 ? 0.2856 0.3703 0.3577 0.0164  0.0331  0.0095  207 GLY A O   
1621 N N   . MET A 208 ? 0.2800 0.3331 0.3430 0.0150  0.0229  0.0125  208 MET A N   
1622 C CA  . MET A 208 ? 0.2991 0.3475 0.3684 0.0241  0.0235  0.0063  208 MET A CA  
1623 C C   . MET A 208 ? 0.2989 0.3569 0.3833 0.0291  0.0221  0.0086  208 MET A C   
1624 O O   . MET A 208 ? 0.3050 0.3679 0.3985 0.0381  0.0247  0.0032  208 MET A O   
1625 C CB  . MET A 208 ? 0.2947 0.3224 0.3577 0.0248  0.0191  0.0054  208 MET A CB  
1626 C CG  . MET A 208 ? 0.2950 0.3166 0.3461 0.0215  0.0207  0.0010  208 MET A CG  
1627 S SD  . MET A 208 ? 0.3316 0.3347 0.3767 0.0183  0.0154  0.0027  208 MET A SD  
1628 C CE  . MET A 208 ? 0.3231 0.3247 0.3572 0.0153  0.0169  -0.0042 208 MET A CE  
1629 N N   . HIS A 209 ? 0.2965 0.3571 0.3838 0.0238  0.0173  0.0160  209 HIS A N   
1630 C CA  . HIS A 209 ? 0.3016 0.3735 0.4031 0.0269  0.0142  0.0193  209 HIS A CA  
1631 C C   . HIS A 209 ? 0.3153 0.4126 0.4285 0.0266  0.0197  0.0189  209 HIS A C   
1632 O O   . HIS A 209 ? 0.3210 0.4326 0.4501 0.0321  0.0188  0.0195  209 HIS A O   
1633 C CB  . HIS A 209 ? 0.2974 0.3643 0.3965 0.0202  0.0069  0.0262  209 HIS A CB  
1634 C CG  . HIS A 209 ? 0.3047 0.3514 0.3944 0.0212  0.0020  0.0271  209 HIS A CG  
1635 N ND1 . HIS A 209 ? 0.3281 0.3681 0.4218 0.0283  -0.0012 0.0274  209 HIS A ND1 
1636 C CD2 . HIS A 209 ? 0.2935 0.3263 0.3704 0.0162  0.0004  0.0282  209 HIS A CD2 
1637 C CE1 . HIS A 209 ? 0.3242 0.3479 0.4069 0.0261  -0.0044 0.0295  209 HIS A CE1 
1638 N NE2 . HIS A 209 ? 0.3081 0.3285 0.3812 0.0192  -0.0029 0.0293  209 HIS A NE2 
1639 N N   . ILE A 210 ? 0.3162 0.4206 0.4222 0.0200  0.0252  0.0188  210 ILE A N   
1640 C CA  . ILE A 210 ? 0.3167 0.4477 0.4325 0.0186  0.0323  0.0188  210 ILE A CA  
1641 C C   . ILE A 210 ? 0.3426 0.4814 0.4634 0.0304  0.0396  0.0090  210 ILE A C   
1642 O O   . ILE A 210 ? 0.3497 0.5118 0.4870 0.0361  0.0444  0.0068  210 ILE A O   
1643 C CB  . ILE A 210 ? 0.3156 0.4504 0.4192 0.0070  0.0357  0.0230  210 ILE A CB  
1644 C CG1 . ILE A 210 ? 0.2987 0.4284 0.4015 -0.0041 0.0284  0.0325  210 ILE A CG1 
1645 C CG2 . ILE A 210 ? 0.2559 0.4184 0.3649 0.0064  0.0460  0.0212  210 ILE A CG2 
1646 C CD1 . ILE A 210 ? 0.3139 0.4423 0.4048 -0.0157 0.0297  0.0387  210 ILE A CD1 
1647 N N   . LEU A 211 ? 0.3577 0.4774 0.4653 0.0341  0.0403  0.0024  211 LEU A N   
1648 C CA  . LEU A 211 ? 0.3784 0.4994 0.4879 0.0452  0.0463  -0.0087 211 LEU A CA  
1649 C C   . LEU A 211 ? 0.3822 0.4968 0.5064 0.0576  0.0422  -0.0115 211 LEU A C   
1650 O O   . LEU A 211 ? 0.4128 0.5394 0.5489 0.0685  0.0474  -0.0189 211 LEU A O   
1651 C CB  . LEU A 211 ? 0.3861 0.4882 0.4761 0.0434  0.0471  -0.0149 211 LEU A CB  
1652 C CG  . LEU A 211 ? 0.3824 0.4938 0.4577 0.0337  0.0519  -0.0135 211 LEU A CG  
1653 C CD1 . LEU A 211 ? 0.4077 0.4977 0.4656 0.0306  0.0484  -0.0165 211 LEU A CD1 
1654 C CD2 . LEU A 211 ? 0.3827 0.5167 0.4581 0.0374  0.0629  -0.0212 211 LEU A CD2 
1655 N N   . SER A 212 ? 0.3749 0.4724 0.4993 0.0563  0.0330  -0.0051 212 SER A N   
1656 C CA  . SER A 212 ? 0.3635 0.4494 0.4980 0.0675  0.0278  -0.0065 212 SER A CA  
1657 C C   . SER A 212 ? 0.3542 0.4608 0.5105 0.0739  0.0254  -0.0023 212 SER A C   
1658 O O   . SER A 212 ? 0.3398 0.4543 0.4998 0.0665  0.0199  0.0069  212 SER A O   
1659 C CB  . SER A 212 ? 0.3528 0.4135 0.4768 0.0626  0.0191  -0.0003 212 SER A CB  
1660 O OG  . SER A 212 ? 0.3797 0.4267 0.5109 0.0719  0.0135  0.0001  212 SER A OG  
1661 N N   . PRO A 213 ? 0.3589 0.4740 0.5305 0.0881  0.0288  -0.0095 213 PRO A N   
1662 C CA  . PRO A 213 ? 0.3533 0.4924 0.5492 0.0