data_2XJC
# 
_entry.id   2XJC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XJC         
PDBE  EBI-44483    
WWPDB D_1290044483 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JC9 unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH ADENOSINE
;
PDB 2XCV unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND 2,3- BISPHOSPHOGLYCERATE
;
PDB 2XJE unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH URIDINE 5'-MONOPHOSPHATE AND ADENOSINE TRIPHOSPHATE
;
PDB 2XJD unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INORGANIC PHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2J2C unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II (NT5C2, CN-II)
;
PDB 2XJB unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH DEOXYGUANOSINE MONOPHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2JCM unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH BERYLLIUM TRIFLUORIDE
;
PDB 2XJF unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II WITH A COVALENTLY MODIFIED ASN52
;
PDB 2XCX unspecified 
;CRYSTAL STRUCTURE OF THE APOFORM OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II
;
PDB 2XCW unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND ATP
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XJC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wallden, K.'  1 
'Nordlund, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                684 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21396942 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2011.02.059 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wallden, K.'  1 
primary 'Nordlund, P.' 2 
# 
_cell.entry_id           2XJC 
_cell.length_a           91.540 
_cell.length_b           127.360 
_cell.length_c           130.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XJC 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE
;
63956.750 1   3.1.3.5 YES 'RESIDUES 1-536' ? 
2 non-polymer syn "GUANOSINE-5'-MONOPHOSPHATE"       363.221   1   ?       ?   ?                ? 
3 non-polymer syn "BIS(ADENOSINE)-5'-TETRAPHOSPHATE" 836.387   1   ?       ?   ?                ? 
4 non-polymer syn GLYCEROL                           92.094    8   ?       ?   ?                ? 
5 non-polymer syn 'MAGNESIUM ION'                    24.305    1   ?       ?   ?                ? 
6 water       nat water                              18.015    394 ?       ?   ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CYTOSOLIC 5'-NUCLEOTIDASE II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  MET n 
1 20  SER n 
1 21  THR n 
1 22  SER n 
1 23  TRP n 
1 24  SER n 
1 25  ASP n 
1 26  ARG n 
1 27  LEU n 
1 28  GLN n 
1 29  ASN n 
1 30  ALA n 
1 31  ALA n 
1 32  ASP n 
1 33  MET n 
1 34  PRO n 
1 35  ALA n 
1 36  ASN n 
1 37  MET n 
1 38  ASP n 
1 39  LYS n 
1 40  HIS n 
1 41  ALA n 
1 42  LEU n 
1 43  LYS n 
1 44  LYS n 
1 45  TYR n 
1 46  ARG n 
1 47  ARG n 
1 48  GLU n 
1 49  ALA n 
1 50  TYR n 
1 51  HIS n 
1 52  ARG n 
1 53  VAL n 
1 54  PHE n 
1 55  VAL n 
1 56  ASN n 
1 57  ARG n 
1 58  SER n 
1 59  LEU n 
1 60  ALA n 
1 61  MET n 
1 62  GLU n 
1 63  LYS n 
1 64  ILE n 
1 65  LYS n 
1 66  CYS n 
1 67  PHE n 
1 68  GLY n 
1 69  PHE n 
1 70  ASN n 
1 71  MET n 
1 72  ASP n 
1 73  TYR n 
1 74  THR n 
1 75  LEU n 
1 76  ALA n 
1 77  VAL n 
1 78  TYR n 
1 79  LYS n 
1 80  SER n 
1 81  PRO n 
1 82  GLU n 
1 83  TYR n 
1 84  GLU n 
1 85  SER n 
1 86  LEU n 
1 87  GLY n 
1 88  PHE n 
1 89  GLU n 
1 90  LEU n 
1 91  THR n 
1 92  VAL n 
1 93  GLU n 
1 94  ARG n 
1 95  LEU n 
1 96  VAL n 
1 97  SER n 
1 98  ILE n 
1 99  GLY n 
1 100 TYR n 
1 101 PRO n 
1 102 GLN n 
1 103 GLU n 
1 104 LEU n 
1 105 LEU n 
1 106 SER n 
1 107 PHE n 
1 108 ALA n 
1 109 TYR n 
1 110 ASP n 
1 111 SER n 
1 112 THR n 
1 113 PHE n 
1 114 PRO n 
1 115 THR n 
1 116 ARG n 
1 117 GLY n 
1 118 LEU n 
1 119 VAL n 
1 120 PHE n 
1 121 ASP n 
1 122 THR n 
1 123 LEU n 
1 124 TYR n 
1 125 GLY n 
1 126 ASN n 
1 127 LEU n 
1 128 LEU n 
1 129 LYS n 
1 130 VAL n 
1 131 ASP n 
1 132 ALA n 
1 133 TYR n 
1 134 GLY n 
1 135 ASN n 
1 136 LEU n 
1 137 LEU n 
1 138 VAL n 
1 139 CYS n 
1 140 ALA n 
1 141 HIS n 
1 142 GLY n 
1 143 PHE n 
1 144 ASN n 
1 145 PHE n 
1 146 ILE n 
1 147 ARG n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 THR n 
1 152 ARG n 
1 153 GLU n 
1 154 GLN n 
1 155 TYR n 
1 156 PRO n 
1 157 ASN n 
1 158 LYS n 
1 159 PHE n 
1 160 ILE n 
1 161 GLN n 
1 162 ARG n 
1 163 ASP n 
1 164 ASP n 
1 165 THR n 
1 166 GLU n 
1 167 ARG n 
1 168 PHE n 
1 169 TYR n 
1 170 ILE n 
1 171 LEU n 
1 172 ASN n 
1 173 THR n 
1 174 LEU n 
1 175 PHE n 
1 176 ASN n 
1 177 LEU n 
1 178 PRO n 
1 179 GLU n 
1 180 THR n 
1 181 TYR n 
1 182 LEU n 
1 183 LEU n 
1 184 ALA n 
1 185 CYS n 
1 186 LEU n 
1 187 VAL n 
1 188 ASP n 
1 189 PHE n 
1 190 PHE n 
1 191 THR n 
1 192 ASN n 
1 193 CYS n 
1 194 PRO n 
1 195 ARG n 
1 196 TYR n 
1 197 THR n 
1 198 SER n 
1 199 CYS n 
1 200 GLU n 
1 201 THR n 
1 202 GLY n 
1 203 PHE n 
1 204 LYS n 
1 205 ASP n 
1 206 GLY n 
1 207 ASP n 
1 208 LEU n 
1 209 PHE n 
1 210 MET n 
1 211 SER n 
1 212 TYR n 
1 213 ARG n 
1 214 SER n 
1 215 MET n 
1 216 PHE n 
1 217 GLN n 
1 218 ASP n 
1 219 VAL n 
1 220 ARG n 
1 221 ASP n 
1 222 ALA n 
1 223 VAL n 
1 224 ASP n 
1 225 TRP n 
1 226 VAL n 
1 227 HIS n 
1 228 TYR n 
1 229 LYS n 
1 230 GLY n 
1 231 SER n 
1 232 LEU n 
1 233 LYS n 
1 234 GLU n 
1 235 LYS n 
1 236 THR n 
1 237 VAL n 
1 238 GLU n 
1 239 ASN n 
1 240 LEU n 
1 241 GLU n 
1 242 LYS n 
1 243 TYR n 
1 244 VAL n 
1 245 VAL n 
1 246 LYS n 
1 247 ASP n 
1 248 GLY n 
1 249 LYS n 
1 250 LEU n 
1 251 PRO n 
1 252 LEU n 
1 253 LEU n 
1 254 LEU n 
1 255 SER n 
1 256 ARG n 
1 257 MET n 
1 258 LYS n 
1 259 GLU n 
1 260 VAL n 
1 261 GLY n 
1 262 LYS n 
1 263 VAL n 
1 264 PHE n 
1 265 LEU n 
1 266 ALA n 
1 267 THR n 
1 268 ASN n 
1 269 SER n 
1 270 ASP n 
1 271 TYR n 
1 272 LYS n 
1 273 TYR n 
1 274 THR n 
1 275 ASP n 
1 276 LYS n 
1 277 ILE n 
1 278 MET n 
1 279 THR n 
1 280 TYR n 
1 281 LEU n 
1 282 PHE n 
1 283 ASP n 
1 284 PHE n 
1 285 PRO n 
1 286 HIS n 
1 287 GLY n 
1 288 PRO n 
1 289 LYS n 
1 290 PRO n 
1 291 GLY n 
1 292 SER n 
1 293 SER n 
1 294 HIS n 
1 295 ARG n 
1 296 PRO n 
1 297 TRP n 
1 298 GLN n 
1 299 SER n 
1 300 TYR n 
1 301 PHE n 
1 302 ASP n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 VAL n 
1 307 ASP n 
1 308 ALA n 
1 309 ARG n 
1 310 LYS n 
1 311 PRO n 
1 312 LEU n 
1 313 PHE n 
1 314 PHE n 
1 315 GLY n 
1 316 GLU n 
1 317 GLY n 
1 318 THR n 
1 319 VAL n 
1 320 LEU n 
1 321 ARG n 
1 322 GLN n 
1 323 VAL n 
1 324 ASP n 
1 325 THR n 
1 326 LYS n 
1 327 THR n 
1 328 GLY n 
1 329 LYS n 
1 330 LEU n 
1 331 LYS n 
1 332 ILE n 
1 333 GLY n 
1 334 THR n 
1 335 TYR n 
1 336 THR n 
1 337 GLY n 
1 338 PRO n 
1 339 LEU n 
1 340 GLN n 
1 341 HIS n 
1 342 GLY n 
1 343 ILE n 
1 344 VAL n 
1 345 TYR n 
1 346 SER n 
1 347 GLY n 
1 348 GLY n 
1 349 SER n 
1 350 SER n 
1 351 ASP n 
1 352 THR n 
1 353 ILE n 
1 354 CYS n 
1 355 ASP n 
1 356 LEU n 
1 357 LEU n 
1 358 GLY n 
1 359 ALA n 
1 360 LYS n 
1 361 GLY n 
1 362 LYS n 
1 363 ASP n 
1 364 ILE n 
1 365 LEU n 
1 366 TYR n 
1 367 ILE n 
1 368 GLY n 
1 369 ASP n 
1 370 HIS n 
1 371 ILE n 
1 372 PHE n 
1 373 GLY n 
1 374 ASP n 
1 375 ILE n 
1 376 LEU n 
1 377 LYS n 
1 378 SER n 
1 379 LYS n 
1 380 LYS n 
1 381 ARG n 
1 382 GLN n 
1 383 GLY n 
1 384 TRP n 
1 385 ARG n 
1 386 THR n 
1 387 PHE n 
1 388 LEU n 
1 389 VAL n 
1 390 ILE n 
1 391 PRO n 
1 392 GLU n 
1 393 LEU n 
1 394 ALA n 
1 395 GLN n 
1 396 GLU n 
1 397 LEU n 
1 398 HIS n 
1 399 VAL n 
1 400 TRP n 
1 401 THR n 
1 402 ASP n 
1 403 LYS n 
1 404 SER n 
1 405 SER n 
1 406 LEU n 
1 407 PHE n 
1 408 GLU n 
1 409 GLU n 
1 410 LEU n 
1 411 GLN n 
1 412 SER n 
1 413 LEU n 
1 414 ASP n 
1 415 ILE n 
1 416 PHE n 
1 417 LEU n 
1 418 ALA n 
1 419 GLU n 
1 420 LEU n 
1 421 TYR n 
1 422 LYS n 
1 423 HIS n 
1 424 LEU n 
1 425 ASP n 
1 426 SER n 
1 427 SER n 
1 428 SER n 
1 429 ASN n 
1 430 GLU n 
1 431 ARG n 
1 432 PRO n 
1 433 ASP n 
1 434 ILE n 
1 435 SER n 
1 436 SER n 
1 437 ILE n 
1 438 GLN n 
1 439 ARG n 
1 440 ARG n 
1 441 ILE n 
1 442 LYS n 
1 443 LYS n 
1 444 VAL n 
1 445 THR n 
1 446 HIS n 
1 447 ASP n 
1 448 MET n 
1 449 ASP n 
1 450 MET n 
1 451 CYS n 
1 452 TYR n 
1 453 GLY n 
1 454 MET n 
1 455 MET n 
1 456 GLY n 
1 457 SER n 
1 458 LEU n 
1 459 PHE n 
1 460 ARG n 
1 461 SER n 
1 462 GLY n 
1 463 SER n 
1 464 ARG n 
1 465 GLN n 
1 466 THR n 
1 467 LEU n 
1 468 PHE n 
1 469 ALA n 
1 470 SER n 
1 471 GLN n 
1 472 VAL n 
1 473 MET n 
1 474 ARG n 
1 475 TYR n 
1 476 ALA n 
1 477 ASP n 
1 478 LEU n 
1 479 TYR n 
1 480 ALA n 
1 481 ALA n 
1 482 SER n 
1 483 PHE n 
1 484 ILE n 
1 485 ASN n 
1 486 LEU n 
1 487 LEU n 
1 488 TYR n 
1 489 TYR n 
1 490 PRO n 
1 491 PHE n 
1 492 SER n 
1 493 TYR n 
1 494 LEU n 
1 495 PHE n 
1 496 ARG n 
1 497 ALA n 
1 498 ALA n 
1 499 HIS n 
1 500 VAL n 
1 501 LEU n 
1 502 MET n 
1 503 PRO n 
1 504 HIS n 
1 505 GLU n 
1 506 SER n 
1 507 THR n 
1 508 VAL n 
1 509 GLU n 
1 510 HIS n 
1 511 THR n 
1 512 HIS n 
1 513 VAL n 
1 514 ASP n 
1 515 ILE n 
1 516 ASN n 
1 517 GLU n 
1 518 MET n 
1 519 GLU n 
1 520 SER n 
1 521 PRO n 
1 522 LEU n 
1 523 ALA n 
1 524 THR n 
1 525 ARG n 
1 526 ASN n 
1 527 ARG n 
1 528 THR n 
1 529 SER n 
1 530 VAL n 
1 531 ASP n 
1 532 PHE n 
1 533 LYS n 
1 534 ASP n 
1 535 THR n 
1 536 ASP n 
1 537 TYR n 
1 538 LYS n 
1 539 ARG n 
1 540 HIS n 
1 541 GLN n 
1 542 LEU n 
1 543 THR n 
1 544 ARG n 
1 545 SER n 
1 546 ILE n 
1 547 SER n 
1 548 GLU n 
1 549 ILE n 
1 550 LYS n 
1 551 PRO n 
1 552 PRO n 
1 553 ASN n 
1 554 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'R3 PRARE2' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               P28A-LIC 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    5NTC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P49902 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XJC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 554 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49902 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  536 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       536 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XJC GLY A 1  ? UNP P49902 ?   ?  'expression tag'      -17 1  
1 2XJC SER A 2  ? UNP P49902 ?   ?  'expression tag'      -16 2  
1 2XJC SER A 3  ? UNP P49902 ?   ?  'expression tag'      -15 3  
1 2XJC HIS A 4  ? UNP P49902 ?   ?  'expression tag'      -14 4  
1 2XJC HIS A 5  ? UNP P49902 ?   ?  'expression tag'      -13 5  
1 2XJC HIS A 6  ? UNP P49902 ?   ?  'expression tag'      -12 6  
1 2XJC HIS A 7  ? UNP P49902 ?   ?  'expression tag'      -11 7  
1 2XJC HIS A 8  ? UNP P49902 ?   ?  'expression tag'      -10 8  
1 2XJC HIS A 9  ? UNP P49902 ?   ?  'expression tag'      -9  9  
1 2XJC SER A 10 ? UNP P49902 ?   ?  'expression tag'      -8  10 
1 2XJC SER A 11 ? UNP P49902 ?   ?  'expression tag'      -7  11 
1 2XJC GLY A 12 ? UNP P49902 ?   ?  'expression tag'      -6  12 
1 2XJC LEU A 13 ? UNP P49902 ?   ?  'expression tag'      -5  13 
1 2XJC VAL A 14 ? UNP P49902 ?   ?  'expression tag'      -4  14 
1 2XJC PRO A 15 ? UNP P49902 ?   ?  'expression tag'      -3  15 
1 2XJC ARG A 16 ? UNP P49902 ?   ?  'expression tag'      -2  16 
1 2XJC GLY A 17 ? UNP P49902 ?   ?  'expression tag'      -1  17 
1 2XJC SER A 18 ? UNP P49902 ?   ?  'expression tag'      0   18 
1 2XJC ASN A 70 ? UNP P49902 ASP 52 'engineered mutation' 52  19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5GP non-polymer         . "GUANOSINE-5'-MONOPHOSPHATE"       ?                               'C10 H14 N5 O8 P'    363.221 
ALA 'L-peptide linking' y ALANINE                            ?                               'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                           ?                               'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ?                               'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ?                               'C4 H7 N O4'         133.103 
B4P non-polymer         . "BIS(ADENOSINE)-5'-TETRAPHOSPHATE" ?                               'C20 H28 N10 O19 P4' 836.387 
CYS 'L-peptide linking' y CYSTEINE                           ?                               'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ?                               'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ?                               'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                            ?                               'C2 H5 N O2'         75.067  
GOL non-polymer         . GLYCEROL                           'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'           92.094  
HIS 'L-peptide linking' y HISTIDINE                          ?                               'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                              ?                               'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ?                               'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                            ?                               'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                             ?                               'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                         ?                               'C5 H11 N O2 S'      149.211 
MG  non-polymer         . 'MAGNESIUM ION'                    ?                               'Mg 2'               24.305  
PHE 'L-peptide linking' y PHENYLALANINE                      ?                               'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                            ?                               'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                             ?                               'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE                          ?                               'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                         ?                               'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                           ?                               'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                             ?                               'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          2XJC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BICINE PH 9.0, 10% PEG6000' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2008-01-30 
_diffrn_detector.details                'DYNAMICALLY BENDABLE' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0081 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.0081 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XJC 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   51649 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.37 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.20 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.44 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.10 
_reflns_shell.pdbx_redundancy        5.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XJC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     49042 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.79 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.94 
_refine.ls_R_factor_obs                          0.17801 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17580 
_refine.ls_R_factor_R_free                       0.21893 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2605 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.B_iso_mean                               33.892 
_refine.aniso_B[1][1]                            0.80 
_refine.aniso_B[2][2]                            -0.62 
_refine.aniso_B[3][3]                            -0.18 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2JCM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.134 
_refine.pdbx_overall_ESU_R_Free                  0.134 
_refine.overall_SU_ML                            0.107 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.316 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3776 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         126 
_refine_hist.number_atoms_solvent             394 
_refine_hist.number_atoms_total               4296 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        45.79 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 4121 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.588  1.995  ? 5579 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.045  5.000  ? 485  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.482 22.865 ? 192  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.132 15.000 ? 702  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.367 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.104  0.200  ? 583  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 3107 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.203  0.200  ? 1838 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.305  0.200  ? 2795 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.167  0.200  ? 327  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.073  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.227  0.200  ? 78   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.218  0.200  ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.861  1.500  ? 2438 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.341  2.000  ? 3839 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.275  3.000  ? 1952 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.317  4.500  ? 1740 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             3599 
_refine_ls_shell.R_factor_R_work                  0.283 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.353 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             166 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XJC 
_struct.title                     
;Crystal structure of the D52N variant of cytosolic 5'-nucleotidase II in complex with guanosine monophosphate and diadenosine tetraphosphate
;
_struct.pdbx_descriptor           
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE (E.C.3.1.3.5)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XJC 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;ALLOSTERIC ENZYME, CN-II, GMP-IMP SPECIFIC NUCLEOTIDASE, HIGH KM 5-PRIME NUCLEOTIDASE, HYDROLASE, METAL-BINDING, NT5C2, NUCLEOTIDE METABOLISM, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 22  ? ASP A 32  ? SER A 4   ASP A 14  1 ? 11 
HELX_P HELX_P2  2  ASP A 38  ? ARG A 46  ? ASP A 20  ARG A 28  1 ? 9  
HELX_P HELX_P3  3  ARG A 47  ? ARG A 52  ? ARG A 29  ARG A 34  5 ? 6  
HELX_P HELX_P4  4  GLU A 62  ? ILE A 64  ? GLU A 44  ILE A 46  5 ? 3  
HELX_P HELX_P5  5  PRO A 81  ? ILE A 98  ? PRO A 63  ILE A 80  1 ? 18 
HELX_P HELX_P6  6  PRO A 101 ? PHE A 107 ? PRO A 83  PHE A 89  5 ? 7  
HELX_P HELX_P7  7  ARG A 147 ? ARG A 152 ? ARG A 129 ARG A 134 1 ? 6  
HELX_P HELX_P8  8  THR A 173 ? PHE A 175 ? THR A 155 PHE A 157 5 ? 3  
HELX_P HELX_P9  9  ASN A 176 ? CYS A 193 ? ASN A 158 CYS A 175 1 ? 18 
HELX_P HELX_P10 10 TYR A 212 ? LYS A 229 ? TYR A 194 LYS A 211 1 ? 18 
HELX_P HELX_P11 11 SER A 231 ? GLU A 238 ? SER A 213 GLU A 220 1 ? 8  
HELX_P HELX_P12 12 ASN A 239 ? VAL A 244 ? ASN A 221 VAL A 226 1 ? 6  
HELX_P HELX_P13 13 GLY A 248 ? GLY A 261 ? GLY A 230 GLY A 243 1 ? 14 
HELX_P HELX_P14 14 ASP A 270 ? PHE A 282 ? ASP A 252 PHE A 264 1 ? 13 
HELX_P HELX_P15 15 PRO A 296 ? PHE A 301 ? PRO A 278 PHE A 283 5 ? 6  
HELX_P HELX_P16 16 PRO A 311 ? GLY A 315 ? PRO A 293 GLY A 297 5 ? 5  
HELX_P HELX_P17 17 SER A 349 ? GLY A 358 ? SER A 331 GLY A 340 1 ? 10 
HELX_P HELX_P18 18 LYS A 360 ? LYS A 362 ? LYS A 342 LYS A 344 5 ? 3  
HELX_P HELX_P19 19 ASP A 374 ? GLY A 383 ? ASP A 356 GLY A 365 1 ? 10 
HELX_P HELX_P20 20 GLU A 392 ? LYS A 403 ? GLU A 374 LYS A 385 1 ? 12 
HELX_P HELX_P21 21 LYS A 403 ? ASP A 414 ? LYS A 385 ASP A 396 1 ? 12 
HELX_P HELX_P22 22 GLN A 438 ? CYS A 451 ? GLN A 420 CYS A 433 1 ? 14 
HELX_P HELX_P23 23 THR A 466 ? ALA A 476 ? THR A 448 ALA A 458 1 ? 11 
HELX_P HELX_P24 24 SER A 482 ? TYR A 489 ? SER A 464 TYR A 471 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B 5GP . O2P ? ? ? 1_555 L MG  .   MG  ? ? A 5GP 1489 A MG  1499 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc2 metalc ? ? L MG  . MG  ? ? ? 1_555 M HOH .   O   ? ? A MG  1499 A HOH 2307 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc3 metalc ? ? L MG  . MG  ? ? ? 1_555 A ASP 72  O   ? ? A MG  1499 A ASP 54   1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc4 metalc ? ? L MG  . MG  ? ? ? 1_555 A ASN 70  OD1 ? ? A MG  1499 A ASN 52   1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc5 metalc ? ? L MG  . MG  ? ? ? 1_555 A ASP 369 OD1 ? ? A MG  1499 A ASP 351  1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc6 metalc ? ? L MG  . MG  ? ? ? 1_555 M HOH .   O   ? ? A MG  1499 A HOH 2305 1_555 ? ? ? ? ? ? ? 2.068 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 80  A . ? SER 62  A PRO 81  A ? PRO 63  A 1 2.92 
2 LYS 310 A . ? LYS 292 A PRO 311 A ? PRO 293 A 1 0.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 9 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 3 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
AA 8 9 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 54  ? VAL A 55  ? PHE A 36  VAL A 37  
AA 2 LEU A 478 ? ALA A 480 ? LEU A 460 ALA A 462 
AA 3 ARG A 385 ? VAL A 389 ? ARG A 367 VAL A 371 
AA 4 ILE A 364 ? GLY A 368 ? ILE A 346 GLY A 350 
AA 5 CYS A 66  ? PHE A 69  ? CYS A 48  PHE A 51  
AA 6 LYS A 262 ? ALA A 266 ? LYS A 244 ALA A 248 
AA 7 LEU A 303 ? VAL A 306 ? LEU A 285 VAL A 288 
AA 8 TYR A 345 ? GLY A 347 ? TYR A 327 GLY A 329 
AA 9 LEU A 320 ? GLN A 322 ? LEU A 302 GLN A 304 
AB 1 LEU A 59  ? ALA A 60  ? LEU A 41  ALA A 42  
AB 2 LEU A 494 ? PHE A 495 ? LEU A 476 PHE A 477 
AC 1 ASN A 144 ? PHE A 145 ? ASN A 126 PHE A 127 
AC 2 LEU A 136 ? HIS A 141 ? LEU A 118 HIS A 123 
AC 3 ASN A 126 ? VAL A 130 ? ASN A 108 VAL A 112 
AC 4 VAL A 119 ? ASP A 121 ? VAL A 101 ASP A 103 
AC 5 PHE A 168 ? ILE A 170 ? PHE A 150 ILE A 152 
AD 1 THR A 197 ? SER A 198 ? THR A 179 SER A 180 
AD 2 GLY A 202 ? ASP A 205 ? GLY A 184 ASP A 187 
AD 3 LEU A 208 ? SER A 211 ? LEU A 190 SER A 193 
AE 1 ARG A 460 ? SER A 461 ? ARG A 442 SER A 443 
AE 2 ARG A 464 ? GLN A 465 ? ARG A 446 GLN A 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N PHE A 54  ? N PHE A 36  O TYR A 479 ? O TYR A 461 
AA 2 3 N LEU A 478 ? N LEU A 460 O THR A 386 ? O THR A 368 
AA 3 4 N ARG A 385 ? N ARG A 367 O ILE A 364 ? O ILE A 346 
AA 4 5 N LEU A 365 ? N LEU A 347 O CYS A 66  ? O CYS A 48  
AA 5 6 N PHE A 67  ? N PHE A 49  O LYS A 262 ? O LYS A 244 
AA 6 7 N LEU A 265 ? N LEU A 247 O LEU A 303 ? O LEU A 285 
AA 7 8 N VAL A 306 ? N VAL A 288 O TYR A 345 ? O TYR A 327 
AA 8 9 N SER A 346 ? N SER A 328 O ARG A 321 ? O ARG A 303 
AB 1 2 N LEU A 59  ? N LEU A 41  O PHE A 495 ? O PHE A 477 
AC 1 2 N ASN A 144 ? N ASN A 126 O HIS A 141 ? O HIS A 123 
AC 2 3 N ALA A 140 ? N ALA A 122 O LEU A 127 ? O LEU A 109 
AC 3 4 N LEU A 128 ? N LEU A 110 O VAL A 119 ? O VAL A 101 
AC 4 5 N PHE A 120 ? N PHE A 102 O TYR A 169 ? O TYR A 151 
AD 1 2 N THR A 197 ? N THR A 179 O LYS A 204 ? O LYS A 186 
AD 2 3 N ASP A 205 ? N ASP A 187 O LEU A 208 ? O LEU A 190 
AE 1 2 N SER A 461 ? N SER A 443 O ARG A 464 ? O ARG A 446 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE 5GP A 1489' 
AC2 Software ? ? ? ? 36 'BINDING SITE FOR RESIDUE B4P A 1490' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 1491' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 1492' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 1493' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 1494' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 1495' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 1496' 
AC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 1497' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 1498' 
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 1499'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 20 ASN A 70  ? ASN A 52   . ? 1_555 ? 
2   AC1 20 MET A 71  ? MET A 53   . ? 1_555 ? 
3   AC1 20 ASP A 72  ? ASP A 54   . ? 1_555 ? 
4   AC1 20 PHE A 175 ? PHE A 157  . ? 1_555 ? 
5   AC1 20 ARG A 220 ? ARG A 202  . ? 1_555 ? 
6   AC1 20 ASP A 224 ? ASP A 206  . ? 1_555 ? 
7   AC1 20 HIS A 227 ? HIS A 209  . ? 1_555 ? 
8   AC1 20 LYS A 233 ? LYS A 215  . ? 1_555 ? 
9   AC1 20 THR A 267 ? THR A 249  . ? 1_555 ? 
10  AC1 20 ASN A 268 ? ASN A 250  . ? 1_555 ? 
11  AC1 20 SER A 269 ? SER A 251  . ? 1_555 ? 
12  AC1 20 LYS A 310 ? LYS A 292  . ? 1_555 ? 
13  AC1 20 GOL K .   ? GOL A 1498 . ? 1_555 ? 
14  AC1 20 MG  L .   ? MG  A 1499 . ? 1_555 ? 
15  AC1 20 HOH M .   ? HOH A 2162 . ? 1_555 ? 
16  AC1 20 HOH M .   ? HOH A 2305 . ? 1_555 ? 
17  AC1 20 HOH M .   ? HOH A 2307 . ? 1_555 ? 
18  AC1 20 HOH M .   ? HOH A 2366 . ? 1_555 ? 
19  AC1 20 HOH M .   ? HOH A 2367 . ? 1_555 ? 
20  AC1 20 HOH M .   ? HOH A 2368 . ? 1_555 ? 
21  AC2 36 ARG A 162 ? ARG A 144  . ? 3_556 ? 
22  AC2 36 ARG A 162 ? ARG A 144  . ? 1_555 ? 
23  AC2 36 ASP A 163 ? ASP A 145  . ? 3_556 ? 
24  AC2 36 ASP A 163 ? ASP A 145  . ? 1_555 ? 
25  AC2 36 THR A 165 ? THR A 147  . ? 3_556 ? 
26  AC2 36 ILE A 170 ? ILE A 152  . ? 1_555 ? 
27  AC2 36 ASN A 172 ? ASN A 154  . ? 3_556 ? 
28  AC2 36 ASN A 172 ? ASN A 154  . ? 1_555 ? 
29  AC2 36 PHE A 372 ? PHE A 354  . ? 1_555 ? 
30  AC2 36 PHE A 372 ? PHE A 354  . ? 3_556 ? 
31  AC2 36 LEU A 376 ? LEU A 358  . ? 1_555 ? 
32  AC2 36 LYS A 380 ? LYS A 362  . ? 1_555 ? 
33  AC2 36 LYS A 380 ? LYS A 362  . ? 3_556 ? 
34  AC2 36 GLN A 471 ? GLN A 453  . ? 1_555 ? 
35  AC2 36 GLN A 471 ? GLN A 453  . ? 3_556 ? 
36  AC2 36 ARG A 474 ? ARG A 456  . ? 3_556 ? 
37  AC2 36 ARG A 474 ? ARG A 456  . ? 1_555 ? 
38  AC2 36 TYR A 475 ? TYR A 457  . ? 1_555 ? 
39  AC2 36 TYR A 475 ? TYR A 457  . ? 3_556 ? 
40  AC2 36 GOL G .   ? GOL A 1494 . ? 1_555 ? 
41  AC2 36 GOL G .   ? GOL A 1494 . ? 3_556 ? 
42  AC2 36 HOH M .   ? HOH A 2370 . ? 1_555 ? 
43  AC2 36 HOH M .   ? HOH A 2371 . ? 1_555 ? 
44  AC2 36 HOH M .   ? HOH A 2371 . ? 3_556 ? 
45  AC2 36 HOH M .   ? HOH A 2372 . ? 1_555 ? 
46  AC2 36 HOH M .   ? HOH A 2372 . ? 3_556 ? 
47  AC2 36 HOH M .   ? HOH A 2373 . ? 3_556 ? 
48  AC2 36 HOH M .   ? HOH A 2373 . ? 1_555 ? 
49  AC2 36 HOH M .   ? HOH A 2374 . ? 1_555 ? 
50  AC2 36 HOH M .   ? HOH A 2374 . ? 3_556 ? 
51  AC2 36 HOH M .   ? HOH A 2375 . ? 1_555 ? 
52  AC2 36 HOH M .   ? HOH A 2376 . ? 3_556 ? 
53  AC2 36 HOH M .   ? HOH A 2376 . ? 1_555 ? 
54  AC2 36 HOH M .   ? HOH A 2377 . ? 1_555 ? 
55  AC2 36 HOH M .   ? HOH A 2378 . ? 1_555 ? 
56  AC2 36 HOH M .   ? HOH A 2378 . ? 3_556 ? 
57  AC3 8  PRO A 114 ? PRO A 96   . ? 1_555 ? 
58  AC3 8  THR A 115 ? THR A 97   . ? 1_555 ? 
59  AC3 8  GLU A 392 ? GLU A 374  . ? 1_555 ? 
60  AC3 8  GLU A 396 ? GLU A 378  . ? 1_555 ? 
61  AC3 8  TYR A 452 ? TYR A 434  . ? 1_555 ? 
62  AC3 8  HOH M .   ? HOH A 2316 . ? 1_555 ? 
63  AC3 8  HOH M .   ? HOH A 2379 . ? 1_555 ? 
64  AC3 8  HOH M .   ? HOH A 2381 . ? 1_555 ? 
65  AC4 9  ARG A 57  ? ARG A 39   . ? 1_555 ? 
66  AC4 9  TYR A 133 ? TYR A 115  . ? 3_556 ? 
67  AC4 9  ASN A 135 ? ASN A 117  . ? 3_556 ? 
68  AC4 9  LYS A 379 ? LYS A 361  . ? 1_555 ? 
69  AC4 9  ARG A 385 ? ARG A 367  . ? 1_555 ? 
70  AC4 9  ASP A 477 ? ASP A 459  . ? 1_555 ? 
71  AC4 9  HOH M .   ? HOH A 2382 . ? 1_555 ? 
72  AC4 9  HOH M .   ? HOH A 2383 . ? 1_555 ? 
73  AC4 9  HOH M .   ? HOH A 2384 . ? 1_555 ? 
74  AC5 7  LEU A 75  ? LEU A 57   . ? 1_555 ? 
75  AC5 7  VAL A 245 ? VAL A 227  . ? 1_555 ? 
76  AC5 7  ASP A 247 ? ASP A 229  . ? 1_555 ? 
77  AC5 7  SER A 482 ? SER A 464  . ? 1_555 ? 
78  AC5 7  PHE A 483 ? PHE A 465  . ? 1_555 ? 
79  AC5 7  ILE A 484 ? ILE A 466  . ? 1_555 ? 
80  AC5 7  HOH M .   ? HOH A 2346 . ? 1_555 ? 
81  AC6 8  ILE A 170 ? ILE A 152  . ? 1_555 ? 
82  AC6 8  ASN A 172 ? ASN A 154  . ? 1_555 ? 
83  AC6 8  HIS A 370 ? HIS A 352  . ? 1_555 ? 
84  AC6 8  B4P C .   ? B4P A 1490 . ? 1_555 ? 
85  AC6 8  B4P C .   ? B4P A 1490 . ? 3_556 ? 
86  AC6 8  HOH M .   ? HOH A 2386 . ? 1_555 ? 
87  AC6 8  HOH M .   ? HOH A 2387 . ? 1_555 ? 
88  AC6 8  HOH M .   ? HOH A 2389 . ? 1_555 ? 
89  AC7 5  ASP A 275 ? ASP A 257  . ? 1_555 ? 
90  AC7 5  THR A 279 ? THR A 261  . ? 1_555 ? 
91  AC7 5  PRO A 296 ? PRO A 278  . ? 1_555 ? 
92  AC7 5  GLN A 298 ? GLN A 280  . ? 1_555 ? 
93  AC7 5  HOH M .   ? HOH A 2390 . ? 1_555 ? 
94  AC8 5  ASP A 270 ? ASP A 252  . ? 1_555 ? 
95  AC8 5  TYR A 271 ? TYR A 253  . ? 1_555 ? 
96  AC8 5  VAL A 306 ? VAL A 288  . ? 1_555 ? 
97  AC8 5  ASP A 307 ? ASP A 289  . ? 1_555 ? 
98  AC8 5  GLY A 328 ? GLY A 310  . ? 1_555 ? 
99  AC9 9  PHE A 301 ? PHE A 283  . ? 1_555 ? 
100 AC9 9  ASP A 302 ? ASP A 284  . ? 1_555 ? 
101 AC9 9  GLN A 340 ? GLN A 322  . ? 1_555 ? 
102 AC9 9  HIS A 341 ? HIS A 323  . ? 1_555 ? 
103 AC9 9  GLY A 342 ? GLY A 324  . ? 1_555 ? 
104 AC9 9  ILE A 343 ? ILE A 325  . ? 1_555 ? 
105 AC9 9  HOH M .   ? HOH A 2291 . ? 1_555 ? 
106 AC9 9  HOH M .   ? HOH A 2391 . ? 1_555 ? 
107 AC9 9  HOH M .   ? HOH A 2392 . ? 1_555 ? 
108 BC1 5  TYR A 228 ? TYR A 210  . ? 1_555 ? 
109 BC1 5  LYS A 233 ? LYS A 215  . ? 1_555 ? 
110 BC1 5  ASN A 268 ? ASN A 250  . ? 1_555 ? 
111 BC1 5  5GP B .   ? 5GP A 1489 . ? 1_555 ? 
112 BC1 5  HOH M .   ? HOH A 2393 . ? 1_555 ? 
113 BC2 6  ASN A 70  ? ASN A 52   . ? 1_555 ? 
114 BC2 6  ASP A 72  ? ASP A 54   . ? 1_555 ? 
115 BC2 6  ASP A 369 ? ASP A 351  . ? 1_555 ? 
116 BC2 6  5GP B .   ? 5GP A 1489 . ? 1_555 ? 
117 BC2 6  HOH M .   ? HOH A 2305 . ? 1_555 ? 
118 BC2 6  HOH M .   ? HOH A 2307 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XJC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XJC 
_atom_sites.fract_transf_matrix[1][1]   0.010924 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007852 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007678 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 21  ? -8.688  37.159 32.530 1.00 61.50  ? 3    THR A N     1 
ATOM   2    C  CA    . THR A 1 21  ? -7.332  37.381 33.142 1.00 58.23  ? 3    THR A CA    1 
ATOM   3    C  C     . THR A 1 21  ? -7.098  36.469 34.344 1.00 54.06  ? 3    THR A C     1 
ATOM   4    O  O     . THR A 1 21  ? -7.416  36.827 35.492 1.00 55.55  ? 3    THR A O     1 
ATOM   5    C  CB    . THR A 1 21  ? -7.107  38.842 33.614 1.00 61.66  ? 3    THR A CB    1 
ATOM   6    O  OG1   . THR A 1 21  ? -7.493  39.762 32.580 1.00 67.24  ? 3    THR A OG1   1 
ATOM   7    C  CG2   . THR A 1 21  ? -5.630  39.067 33.972 1.00 57.91  ? 3    THR A CG2   1 
ATOM   8    N  N     . SER A 1 22  ? -6.513  35.304 34.087 1.00 49.43  ? 4    SER A N     1 
ATOM   9    C  CA    . SER A 1 22  ? -6.205  34.359 35.147 1.00 45.33  ? 4    SER A CA    1 
ATOM   10   C  C     . SER A 1 22  ? -4.925  34.764 35.912 1.00 43.86  ? 4    SER A C     1 
ATOM   11   O  O     . SER A 1 22  ? -4.171  35.647 35.478 1.00 45.09  ? 4    SER A O     1 
ATOM   12   C  CB    . SER A 1 22  ? -6.020  32.984 34.537 1.00 42.87  ? 4    SER A CB    1 
ATOM   13   O  OG    . SER A 1 22  ? -4.713  32.873 34.017 1.00 39.40  ? 4    SER A OG    1 
ATOM   14   N  N     . TRP A 1 23  ? -4.660  34.103 37.032 1.00 41.78  ? 5    TRP A N     1 
ATOM   15   C  CA    . TRP A 1 23  ? -3.417  34.365 37.758 1.00 40.06  ? 5    TRP A CA    1 
ATOM   16   C  C     . TRP A 1 23  ? -2.191  33.991 36.923 1.00 38.71  ? 5    TRP A C     1 
ATOM   17   O  O     . TRP A 1 23  ? -1.137  34.607 37.059 1.00 38.24  ? 5    TRP A O     1 
ATOM   18   C  CB    . TRP A 1 23  ? -3.395  33.663 39.115 1.00 39.82  ? 5    TRP A CB    1 
ATOM   19   C  CG    . TRP A 1 23  ? -3.779  32.206 39.092 1.00 37.87  ? 5    TRP A CG    1 
ATOM   20   C  CD1   . TRP A 1 23  ? -5.001  31.674 39.386 1.00 37.54  ? 5    TRP A CD1   1 
ATOM   21   C  CD2   . TRP A 1 23  ? -2.920  31.100 38.781 1.00 36.86  ? 5    TRP A CD2   1 
ATOM   22   N  NE1   . TRP A 1 23  ? -4.959  30.303 39.282 1.00 36.22  ? 5    TRP A NE1   1 
ATOM   23   C  CE2   . TRP A 1 23  ? -3.694  29.921 38.913 1.00 36.72  ? 5    TRP A CE2   1 
ATOM   24   C  CE3   . TRP A 1 23  ? -1.562  30.987 38.407 1.00 37.11  ? 5    TRP A CE3   1 
ATOM   25   C  CZ2   . TRP A 1 23  ? -3.160  28.639 38.675 1.00 36.17  ? 5    TRP A CZ2   1 
ATOM   26   C  CZ3   . TRP A 1 23  ? -1.031  29.712 38.166 1.00 35.29  ? 5    TRP A CZ3   1 
ATOM   27   C  CH2   . TRP A 1 23  ? -1.823  28.560 38.318 1.00 34.95  ? 5    TRP A CH2   1 
ATOM   28   N  N     . SER A 1 24  ? -2.336  33.014 36.022 1.00 37.87  ? 6    SER A N     1 
ATOM   29   C  CA    . SER A 1 24  ? -1.181  32.591 35.223 1.00 37.63  ? 6    SER A CA    1 
ATOM   30   C  C     . SER A 1 24  ? -0.883  33.603 34.099 1.00 40.03  ? 6    SER A C     1 
ATOM   31   O  O     . SER A 1 24  ? 0.254   33.649 33.598 1.00 40.31  ? 6    SER A O     1 
ATOM   32   C  CB    . SER A 1 24  ? -1.353  31.165 34.665 1.00 36.53  ? 6    SER A CB    1 
ATOM   33   O  OG    . SER A 1 24  ? -2.311  31.149 33.621 1.00 36.07  ? 6    SER A OG    1 
ATOM   34   N  N     . ASP A 1 25  ? -1.911  34.374 33.709 1.00 42.64  ? 7    ASP A N     1 
ATOM   35   C  CA    . ASP A 1 25  ? -1.823  35.440 32.690 1.00 46.03  ? 7    ASP A CA    1 
ATOM   36   C  C     . ASP A 1 25  ? -0.940  36.557 33.263 1.00 46.69  ? 7    ASP A C     1 
ATOM   37   O  O     . ASP A 1 25  ? 0.037   36.972 32.629 1.00 47.98  ? 7    ASP A O     1 
ATOM   38   C  CB    . ASP A 1 25  ? -3.218  36.003 32.345 1.00 48.88  ? 7    ASP A CB    1 
ATOM   39   C  CG    . ASP A 1 25  ? -4.035  35.079 31.435 1.00 50.96  ? 7    ASP A CG    1 
ATOM   40   O  OD1   . ASP A 1 25  ? -3.467  34.120 30.878 1.00 52.34  ? 7    ASP A OD1   1 
ATOM   41   O  OD2   . ASP A 1 25  ? -5.257  35.308 31.259 1.00 55.15  ? 7    ASP A OD2   1 
ATOM   42   N  N     . ARG A 1 26  ? -1.287  37.003 34.473 1.00 46.36  ? 8    ARG A N     1 
ATOM   43   C  CA    . ARG A 1 26  ? -0.474  37.927 35.272 1.00 46.73  ? 8    ARG A CA    1 
ATOM   44   C  C     . ARG A 1 26  ? 0.991   37.455 35.361 1.00 44.30  ? 8    ARG A C     1 
ATOM   45   O  O     . ARG A 1 26  ? 1.908   38.228 35.066 1.00 45.16  ? 8    ARG A O     1 
ATOM   46   C  CB    . ARG A 1 26  ? -1.072  38.113 36.680 1.00 46.29  ? 8    ARG A CB    1 
ATOM   47   C  CG    . ARG A 1 26  ? -2.563  38.506 36.738 1.00 49.83  ? 8    ARG A CG    1 
ATOM   48   C  CD    . ARG A 1 26  ? -2.789  40.021 36.600 1.00 57.70  ? 8    ARG A CD    1 
ATOM   49   N  NE    . ARG A 1 26  ? -4.201  40.407 36.765 1.00 62.10  ? 8    ARG A NE    1 
ATOM   50   C  CZ    . ARG A 1 26  ? -4.718  41.587 36.418 1.00 67.65  ? 8    ARG A CZ    1 
ATOM   51   N  NH1   . ARG A 1 26  ? -3.952  42.528 35.880 1.00 69.79  ? 8    ARG A NH1   1 
ATOM   52   N  NH2   . ARG A 1 26  ? -6.014  41.831 36.599 1.00 71.54  ? 8    ARG A NH2   1 
ATOM   53   N  N     . LEU A 1 27  ? 1.197   36.185 35.709 1.00 41.63  ? 9    LEU A N     1 
ATOM   54   C  CA    . LEU A 1 27  ? 2.548   35.625 35.813 1.00 40.48  ? 9    LEU A CA    1 
ATOM   55   C  C     . LEU A 1 27  ? 3.303   35.569 34.480 1.00 41.87  ? 9    LEU A C     1 
ATOM   56   O  O     . LEU A 1 27  ? 4.477   35.935 34.423 1.00 42.07  ? 9    LEU A O     1 
ATOM   57   C  CB    . LEU A 1 27  ? 2.539   34.248 36.482 1.00 39.24  ? 9    LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 27  ? 2.156   34.105 37.969 1.00 38.25  ? 9    LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 27  ? 2.156   32.625 38.322 1.00 37.40  ? 9    LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 27  ? 3.081   34.882 38.927 1.00 37.67  ? 9    LEU A CD2   1 
ATOM   61   N  N     . GLN A 1 28  ? 2.655   35.094 33.418 1.00 42.86  ? 10   GLN A N     1 
ATOM   62   C  CA    . GLN A 1 28  ? 3.284   35.107 32.099 1.00 45.71  ? 10   GLN A CA    1 
ATOM   63   C  C     . GLN A 1 28  ? 3.591   36.549 31.612 1.00 48.05  ? 10   GLN A C     1 
ATOM   64   O  O     . GLN A 1 28  ? 4.564   36.759 30.875 1.00 49.76  ? 10   GLN A O     1 
ATOM   65   C  CB    . GLN A 1 28  ? 2.470   34.309 31.054 1.00 46.71  ? 10   GLN A CB    1 
ATOM   66   C  CG    . GLN A 1 28  ? 3.167   34.159 29.669 1.00 50.96  ? 10   GLN A CG    1 
ATOM   67   C  CD    . GLN A 1 28  ? 4.515   33.413 29.742 1.00 51.04  ? 10   GLN A CD    1 
ATOM   68   O  OE1   . GLN A 1 28  ? 4.560   32.203 29.936 1.00 52.84  ? 10   GLN A OE1   1 
ATOM   69   N  NE2   . GLN A 1 28  ? 5.607   34.140 29.557 1.00 50.51  ? 10   GLN A NE2   1 
ATOM   70   N  N     . ASN A 1 29  ? 2.782   37.531 32.016 1.00 48.80  ? 11   ASN A N     1 
ATOM   71   C  CA    . ASN A 1 29  ? 3.032   38.926 31.605 1.00 51.99  ? 11   ASN A CA    1 
ATOM   72   C  C     . ASN A 1 29  ? 4.352   39.440 32.171 1.00 51.15  ? 11   ASN A C     1 
ATOM   73   O  O     . ASN A 1 29  ? 5.176   40.012 31.450 1.00 53.01  ? 11   ASN A O     1 
ATOM   74   C  CB    . ASN A 1 29  ? 1.870   39.840 31.988 1.00 53.72  ? 11   ASN A CB    1 
ATOM   75   C  CG    . ASN A 1 29  ? 0.662   39.681 31.055 1.00 58.17  ? 11   ASN A CG    1 
ATOM   76   O  OD1   . ASN A 1 29  ? 0.735   39.043 29.992 1.00 59.76  ? 11   ASN A OD1   1 
ATOM   77   N  ND2   . ASN A 1 29  ? -0.462  40.258 31.462 1.00 61.11  ? 11   ASN A ND2   1 
ATOM   78   N  N     . ALA A 1 30  ? 4.551   39.180 33.458 1.00 48.38  ? 12   ALA A N     1 
ATOM   79   C  CA    . ALA A 1 30  ? 5.788   39.504 34.153 1.00 48.36  ? 12   ALA A CA    1 
ATOM   80   C  C     . ALA A 1 30  ? 6.963   38.655 33.628 1.00 48.31  ? 12   ALA A C     1 
ATOM   81   O  O     . ALA A 1 30  ? 8.086   39.169 33.525 1.00 49.06  ? 12   ALA A O     1 
ATOM   82   C  CB    . ALA A 1 30  ? 5.614   39.343 35.671 1.00 45.75  ? 12   ALA A CB    1 
ATOM   83   N  N     . ALA A 1 31  ? 6.691   37.386 33.281 1.00 47.62  ? 13   ALA A N     1 
ATOM   84   C  CA    . ALA A 1 31  ? 7.693   36.483 32.680 1.00 49.03  ? 13   ALA A CA    1 
ATOM   85   C  C     . ALA A 1 31  ? 8.264   37.031 31.353 1.00 52.68  ? 13   ALA A C     1 
ATOM   86   O  O     . ALA A 1 31  ? 9.440   36.855 31.053 1.00 53.79  ? 13   ALA A O     1 
ATOM   87   C  CB    . ALA A 1 31  ? 7.116   35.076 32.486 1.00 47.74  ? 13   ALA A CB    1 
ATOM   88   N  N     . ASP A 1 32  ? 7.426   37.707 30.573 1.00 56.04  ? 14   ASP A N     1 
ATOM   89   C  CA    . ASP A 1 32  ? 7.832   38.244 29.269 1.00 61.65  ? 14   ASP A CA    1 
ATOM   90   C  C     . ASP A 1 32  ? 8.729   39.483 29.386 1.00 63.75  ? 14   ASP A C     1 
ATOM   91   O  O     . ASP A 1 32  ? 9.391   39.886 28.416 1.00 67.17  ? 14   ASP A O     1 
ATOM   92   C  CB    . ASP A 1 32  ? 6.601   38.536 28.394 1.00 64.61  ? 14   ASP A CB    1 
ATOM   93   C  CG    . ASP A 1 32  ? 5.783   37.296 28.101 1.00 64.66  ? 14   ASP A CG    1 
ATOM   94   O  OD1   . ASP A 1 32  ? 6.352   36.184 28.079 1.00 64.37  ? 14   ASP A OD1   1 
ATOM   95   O  OD2   . ASP A 1 32  ? 4.560   37.431 27.905 1.00 67.66  ? 14   ASP A OD2   1 
ATOM   96   N  N     . MET A 1 33  ? 8.748   40.085 30.572 1.00 62.34  ? 15   MET A N     1 
ATOM   97   C  CA    . MET A 1 33  ? 9.629   41.226 30.843 1.00 65.46  ? 15   MET A CA    1 
ATOM   98   C  C     . MET A 1 33  ? 11.091  40.779 31.045 1.00 63.45  ? 15   MET A C     1 
ATOM   99   O  O     . MET A 1 33  ? 11.359  39.802 31.767 1.00 61.53  ? 15   MET A O     1 
ATOM   100  C  CB    . MET A 1 33  ? 9.136   42.015 32.061 1.00 63.23  ? 15   MET A CB    1 
ATOM   101  C  CG    . MET A 1 33  ? 7.922   42.903 31.792 1.00 68.66  ? 15   MET A CG    1 
ATOM   102  S  SD    . MET A 1 33  ? 7.822   44.229 33.044 1.00 72.28  ? 15   MET A SD    1 
ATOM   103  C  CE    . MET A 1 33  ? 9.052   45.440 32.470 1.00 75.11  ? 15   MET A CE    1 
ATOM   104  N  N     . PRO A 1 34  ? 12.037  41.460 30.370 1.00 65.41  ? 16   PRO A N     1 
ATOM   105  C  CA    . PRO A 1 34  ? 13.454  41.233 30.658 1.00 64.36  ? 16   PRO A CA    1 
ATOM   106  C  C     . PRO A 1 34  ? 13.842  41.873 31.983 1.00 61.15  ? 16   PRO A C     1 
ATOM   107  O  O     . PRO A 1 34  ? 13.203  42.832 32.415 1.00 60.35  ? 16   PRO A O     1 
ATOM   108  C  CB    . PRO A 1 34  ? 14.161  41.946 29.502 1.00 68.69  ? 16   PRO A CB    1 
ATOM   109  C  CG    . PRO A 1 34  ? 13.210  43.017 29.086 1.00 70.92  ? 16   PRO A CG    1 
ATOM   110  C  CD    . PRO A 1 34  ? 11.839  42.454 29.295 1.00 69.50  ? 16   PRO A CD    1 
ATOM   111  N  N     . ALA A 1 35  ? 14.875  41.337 32.621 1.00 59.87  ? 17   ALA A N     1 
ATOM   112  C  CA    . ALA A 1 35  ? 15.373  41.891 33.881 1.00 57.70  ? 17   ALA A CA    1 
ATOM   113  C  C     . ALA A 1 35  ? 16.247  43.112 33.656 1.00 59.07  ? 17   ALA A C     1 
ATOM   114  O  O     . ALA A 1 35  ? 17.311  43.027 33.042 1.00 60.93  ? 17   ALA A O     1 
ATOM   115  C  CB    . ALA A 1 35  ? 16.138  40.840 34.678 1.00 56.85  ? 17   ALA A CB    1 
ATOM   116  N  N     . ASN A 1 36  ? 15.781  44.252 34.158 1.00 58.24  ? 18   ASN A N     1 
ATOM   117  C  CA    . ASN A 1 36  ? 16.617  45.427 34.276 1.00 59.44  ? 18   ASN A CA    1 
ATOM   118  C  C     . ASN A 1 36  ? 17.258  45.384 35.671 1.00 57.70  ? 18   ASN A C     1 
ATOM   119  O  O     . ASN A 1 36  ? 16.577  45.576 36.674 1.00 56.28  ? 18   ASN A O     1 
ATOM   120  C  CB    . ASN A 1 36  ? 15.799  46.709 34.044 1.00 60.82  ? 18   ASN A CB    1 
ATOM   121  C  CG    . ASN A 1 36  ? 16.600  47.976 34.298 1.00 62.20  ? 18   ASN A CG    1 
ATOM   122  O  OD1   . ASN A 1 36  ? 17.721  47.928 34.797 1.00 60.32  ? 18   ASN A OD1   1 
ATOM   123  N  ND2   . ASN A 1 36  ? 16.023  49.121 33.949 1.00 63.47  ? 18   ASN A ND2   1 
ATOM   124  N  N     . MET A 1 37  ? 18.570  45.146 35.711 1.00 58.53  ? 19   MET A N     1 
ATOM   125  C  CA    . MET A 1 37  ? 19.292  44.864 36.957 1.00 58.23  ? 19   MET A CA    1 
ATOM   126  C  C     . MET A 1 37  ? 19.942  46.091 37.617 1.00 59.23  ? 19   MET A C     1 
ATOM   127  O  O     . MET A 1 37  ? 20.683  45.964 38.594 1.00 59.70  ? 19   MET A O     1 
ATOM   128  C  CB    . MET A 1 37  ? 20.318  43.732 36.746 1.00 58.84  ? 19   MET A CB    1 
ATOM   129  C  CG    . MET A 1 37  ? 19.691  42.364 36.449 1.00 57.79  ? 19   MET A CG    1 
ATOM   130  S  SD    . MET A 1 37  ? 18.633  41.720 37.792 1.00 53.56  ? 19   MET A SD    1 
ATOM   131  C  CE    . MET A 1 37  ? 19.875  41.176 38.968 1.00 54.72  ? 19   MET A CE    1 
ATOM   132  N  N     . ASP A 1 38  ? 19.644  47.269 37.077 1.00 60.92  ? 20   ASP A N     1 
ATOM   133  C  CA    . ASP A 1 38  ? 20.064  48.540 37.648 1.00 62.44  ? 20   ASP A CA    1 
ATOM   134  C  C     . ASP A 1 38  ? 19.536  48.572 39.085 1.00 61.96  ? 20   ASP A C     1 
ATOM   135  O  O     . ASP A 1 38  ? 18.375  48.257 39.330 1.00 60.81  ? 20   ASP A O     1 
ATOM   136  C  CB    . ASP A 1 38  ? 19.529  49.684 36.772 1.00 64.63  ? 20   ASP A CB    1 
ATOM   137  C  CG    . ASP A 1 38  ? 19.808  51.055 37.343 1.00 67.05  ? 20   ASP A CG    1 
ATOM   138  O  OD1   . ASP A 1 38  ? 20.772  51.720 36.892 1.00 71.66  ? 20   ASP A OD1   1 
ATOM   139  O  OD2   . ASP A 1 38  ? 19.047  51.485 38.233 1.00 68.27  ? 20   ASP A OD2   1 
ATOM   140  N  N     . LYS A 1 39  ? 20.408  48.902 40.035 1.00 63.63  ? 21   LYS A N     1 
ATOM   141  C  CA    . LYS A 1 39  ? 20.093  48.786 41.471 1.00 64.78  ? 21   LYS A CA    1 
ATOM   142  C  C     . LYS A 1 39  ? 18.878  49.622 41.948 1.00 65.19  ? 21   LYS A C     1 
ATOM   143  O  O     . LYS A 1 39  ? 18.191  49.237 42.907 1.00 65.63  ? 21   LYS A O     1 
ATOM   144  C  CB    . LYS A 1 39  ? 21.348  49.057 42.331 1.00 67.45  ? 21   LYS A CB    1 
ATOM   145  C  CG    . LYS A 1 39  ? 22.508  48.022 42.132 1.00 69.29  ? 21   LYS A CG    1 
ATOM   146  C  CD    . LYS A 1 39  ? 22.377  46.753 43.003 1.00 72.89  ? 21   LYS A CD    1 
ATOM   147  C  CE    . LYS A 1 39  ? 22.775  46.970 44.492 1.00 76.93  ? 21   LYS A CE    1 
ATOM   148  N  NZ    . LYS A 1 39  ? 24.215  47.371 44.703 1.00 78.57  ? 21   LYS A NZ    1 
ATOM   149  N  N     . HIS A 1 40  ? 18.625  50.744 41.263 1.00 65.60  ? 22   HIS A N     1 
ATOM   150  C  CA    . HIS A 1 40  ? 17.455  51.610 41.494 1.00 66.51  ? 22   HIS A CA    1 
ATOM   151  C  C     . HIS A 1 40  ? 16.154  51.114 40.839 1.00 64.34  ? 22   HIS A C     1 
ATOM   152  O  O     . HIS A 1 40  ? 15.072  51.248 41.421 1.00 65.32  ? 22   HIS A O     1 
ATOM   153  C  CB    . HIS A 1 40  ? 17.765  53.044 41.050 1.00 69.56  ? 22   HIS A CB    1 
ATOM   154  C  CG    . HIS A 1 40  ? 18.763  53.726 41.927 1.00 72.96  ? 22   HIS A CG    1 
ATOM   155  N  ND1   . HIS A 1 40  ? 20.078  53.317 42.013 1.00 73.19  ? 22   HIS A ND1   1 
ATOM   156  C  CD2   . HIS A 1 40  ? 18.635  54.768 42.783 1.00 77.56  ? 22   HIS A CD2   1 
ATOM   157  C  CE1   . HIS A 1 40  ? 20.718  54.081 42.880 1.00 75.72  ? 22   HIS A CE1   1 
ATOM   158  N  NE2   . HIS A 1 40  ? 19.867  54.973 43.356 1.00 78.95  ? 22   HIS A NE2   1 
ATOM   159  N  N     . ALA A 1 41  ? 16.257  50.564 39.628 1.00 61.34  ? 23   ALA A N     1 
ATOM   160  C  CA    . ALA A 1 41  ? 15.117  49.937 38.976 1.00 59.11  ? 23   ALA A CA    1 
ATOM   161  C  C     . ALA A 1 41  ? 14.645  48.712 39.791 1.00 56.20  ? 23   ALA A C     1 
ATOM   162  O  O     . ALA A 1 41  ? 13.440  48.481 39.931 1.00 55.62  ? 23   ALA A O     1 
ATOM   163  C  CB    . ALA A 1 41  ? 15.464  49.557 37.538 1.00 58.70  ? 23   ALA A CB    1 
ATOM   164  N  N     . LEU A 1 42  ? 15.592  47.951 40.345 1.00 54.28  ? 24   LEU A N     1 
ATOM   165  C  CA    . LEU A 1 42  ? 15.257  46.810 41.216 1.00 52.80  ? 24   LEU A CA    1 
ATOM   166  C  C     . LEU A 1 42  ? 14.464  47.253 42.445 1.00 54.61  ? 24   LEU A C     1 
ATOM   167  O  O     . LEU A 1 42  ? 13.421  46.680 42.754 1.00 53.83  ? 24   LEU A O     1 
ATOM   168  C  CB    . LEU A 1 42  ? 16.508  46.022 41.635 1.00 51.94  ? 24   LEU A CB    1 
ATOM   169  C  CG    . LEU A 1 42  ? 17.227  45.199 40.552 1.00 50.48  ? 24   LEU A CG    1 
ATOM   170  C  CD1   . LEU A 1 42  ? 18.501  44.590 41.105 1.00 50.70  ? 24   LEU A CD1   1 
ATOM   171  C  CD2   . LEU A 1 42  ? 16.339  44.120 39.917 1.00 46.61  ? 24   LEU A CD2   1 
ATOM   172  N  N     . LYS A 1 43  ? 14.948  48.292 43.123 1.00 57.39  ? 25   LYS A N     1 
ATOM   173  C  CA    . LYS A 1 43  ? 14.272  48.802 44.313 1.00 60.34  ? 25   LYS A CA    1 
ATOM   174  C  C     . LYS A 1 43  ? 12.847  49.299 44.018 1.00 61.57  ? 25   LYS A C     1 
ATOM   175  O  O     . LYS A 1 43  ? 11.932  49.063 44.821 1.00 62.67  ? 25   LYS A O     1 
ATOM   176  C  CB    . LYS A 1 43  ? 15.104  49.882 45.004 1.00 63.24  ? 25   LYS A CB    1 
ATOM   177  C  CG    . LYS A 1 43  ? 14.725  50.082 46.466 1.00 67.74  ? 25   LYS A CG    1 
ATOM   178  C  CD    . LYS A 1 43  ? 15.712  50.995 47.168 1.00 71.93  ? 25   LYS A CD    1 
ATOM   179  C  CE    . LYS A 1 43  ? 15.407  51.092 48.656 1.00 77.47  ? 25   LYS A CE    1 
ATOM   180  N  NZ    . LYS A 1 43  ? 16.328  52.062 49.318 1.00 82.02  ? 25   LYS A NZ    1 
ATOM   181  N  N     . LYS A 1 44  ? 12.667  49.954 42.866 1.00 61.45  ? 26   LYS A N     1 
ATOM   182  C  CA    . LYS A 1 44  ? 11.359  50.481 42.451 1.00 63.81  ? 26   LYS A CA    1 
ATOM   183  C  C     . LYS A 1 44  ? 10.365  49.383 42.004 1.00 61.40  ? 26   LYS A C     1 
ATOM   184  O  O     . LYS A 1 44  ? 9.160   49.500 42.221 1.00 62.83  ? 26   LYS A O     1 
ATOM   185  C  CB    . LYS A 1 44  ? 11.540  51.545 41.361 1.00 65.81  ? 26   LYS A CB    1 
ATOM   186  C  CG    . LYS A 1 44  ? 10.267  52.294 40.971 1.00 70.16  ? 26   LYS A CG    1 
ATOM   187  C  CD    . LYS A 1 44  ? 10.490  53.159 39.720 1.00 72.90  ? 26   LYS A CD    1 
ATOM   188  C  CE    . LYS A 1 44  ? 9.194   53.389 38.924 1.00 76.48  ? 26   LYS A CE    1 
ATOM   189  N  NZ    . LYS A 1 44  ? 9.353   54.471 37.888 1.00 80.12  ? 26   LYS A NZ    1 
ATOM   190  N  N     . TYR A 1 45  ? 10.872  48.324 41.377 1.00 57.93  ? 27   TYR A N     1 
ATOM   191  C  CA    . TYR A 1 45  ? 10.039  47.183 40.985 1.00 56.27  ? 27   TYR A CA    1 
ATOM   192  C  C     . TYR A 1 45  ? 9.389   46.465 42.190 1.00 56.00  ? 27   TYR A C     1 
ATOM   193  O  O     . TYR A 1 45  ? 8.189   46.172 42.184 1.00 56.67  ? 27   TYR A O     1 
ATOM   194  C  CB    . TYR A 1 45  ? 10.869  46.178 40.180 1.00 53.91  ? 27   TYR A CB    1 
ATOM   195  C  CG    . TYR A 1 45  ? 10.094  45.447 39.116 1.00 53.44  ? 27   TYR A CG    1 
ATOM   196  C  CD1   . TYR A 1 45  ? 9.468   46.144 38.077 1.00 57.40  ? 27   TYR A CD1   1 
ATOM   197  C  CD2   . TYR A 1 45  ? 10.006  44.064 39.123 1.00 51.86  ? 27   TYR A CD2   1 
ATOM   198  C  CE1   . TYR A 1 45  ? 8.763   45.479 37.073 1.00 57.15  ? 27   TYR A CE1   1 
ATOM   199  C  CE2   . TYR A 1 45  ? 9.295   43.373 38.126 1.00 52.08  ? 27   TYR A CE2   1 
ATOM   200  C  CZ    . TYR A 1 45  ? 8.678   44.086 37.098 1.00 54.88  ? 27   TYR A CZ    1 
ATOM   201  O  OH    . TYR A 1 45  ? 7.964   43.404 36.095 1.00 54.38  ? 27   TYR A OH    1 
ATOM   202  N  N     . ARG A 1 46  ? 10.192  46.177 43.213 1.00 55.60  ? 28   ARG A N     1 
ATOM   203  C  CA    . ARG A 1 46  ? 9.711   45.527 44.431 1.00 56.20  ? 28   ARG A CA    1 
ATOM   204  C  C     . ARG A 1 46  ? 8.921   46.494 45.323 1.00 60.90  ? 28   ARG A C     1 
ATOM   205  O  O     . ARG A 1 46  ? 8.765   46.252 46.525 1.00 64.15  ? 28   ARG A O     1 
ATOM   206  C  CB    . ARG A 1 46  ? 10.875  44.870 45.191 1.00 55.21  ? 28   ARG A CB    1 
ATOM   207  C  CG    . ARG A 1 46  ? 11.858  45.834 45.838 1.00 55.12  ? 28   ARG A CG    1 
ATOM   208  C  CD    . ARG A 1 46  ? 12.996  45.102 46.482 1.00 51.92  ? 28   ARG A CD    1 
ATOM   209  N  NE    . ARG A 1 46  ? 13.799  45.942 47.367 1.00 56.51  ? 28   ARG A NE    1 
ATOM   210  C  CZ    . ARG A 1 46  ? 15.053  46.333 47.115 1.00 57.84  ? 28   ARG A CZ    1 
ATOM   211  N  NH1   . ARG A 1 46  ? 15.686  45.966 45.999 1.00 55.30  ? 28   ARG A NH1   1 
ATOM   212  N  NH2   . ARG A 1 46  ? 15.684  47.111 47.978 1.00 61.51  ? 28   ARG A NH2   1 
ATOM   213  N  N     . ARG A 1 47  ? 8.441   47.599 44.746 1.00 63.01  ? 29   ARG A N     1 
ATOM   214  C  CA    . ARG A 1 47  ? 7.465   48.457 45.433 1.00 67.98  ? 29   ARG A CA    1 
ATOM   215  C  C     . ARG A 1 47  ? 6.088   47.810 45.248 1.00 66.94  ? 29   ARG A C     1 
ATOM   216  O  O     . ARG A 1 47  ? 5.287   47.735 46.193 1.00 69.87  ? 29   ARG A O     1 
ATOM   217  C  CB    . ARG A 1 47  ? 7.441   49.895 44.876 1.00 71.58  ? 29   ARG A CB    1 
ATOM   218  C  CG    . ARG A 1 47  ? 8.606   50.834 45.245 1.00 76.60  ? 29   ARG A CG    1 
ATOM   219  C  CD    . ARG A 1 47  ? 8.695   51.103 46.747 1.00 86.83  ? 29   ARG A CD    1 
ATOM   220  N  NE    . ARG A 1 47  ? 9.712   50.247 47.362 1.00 89.56  ? 29   ARG A NE    1 
ATOM   221  C  CZ    . ARG A 1 47  ? 10.797  50.685 48.007 1.00 94.05  ? 29   ARG A CZ    1 
ATOM   222  N  NH1   . ARG A 1 47  ? 11.016  51.994 48.171 1.00 98.00  ? 29   ARG A NH1   1 
ATOM   223  N  NH2   . ARG A 1 47  ? 11.661  49.803 48.510 1.00 93.79  ? 29   ARG A NH2   1 
ATOM   224  N  N     . GLU A 1 48  ? 5.837   47.337 44.024 1.00 62.49  ? 30   GLU A N     1 
ATOM   225  C  CA    . GLU A 1 48  ? 4.545   46.771 43.651 1.00 61.22  ? 30   GLU A CA    1 
ATOM   226  C  C     . GLU A 1 48  ? 4.364   45.418 44.291 1.00 57.03  ? 30   GLU A C     1 
ATOM   227  O  O     . GLU A 1 48  ? 5.267   44.584 44.245 1.00 53.10  ? 30   GLU A O     1 
ATOM   228  C  CB    . GLU A 1 48  ? 4.419   46.644 42.140 1.00 59.35  ? 30   GLU A CB    1 
ATOM   229  C  CG    . GLU A 1 48  ? 4.273   47.972 41.428 1.00 66.08  ? 30   GLU A CG    1 
ATOM   230  C  CD    . GLU A 1 48  ? 4.689   47.860 39.982 1.00 68.46  ? 30   GLU A CD    1 
ATOM   231  O  OE1   . GLU A 1 48  ? 4.054   47.059 39.247 1.00 68.15  ? 30   GLU A OE1   1 
ATOM   232  O  OE2   . GLU A 1 48  ? 5.660   48.559 39.588 1.00 71.35  ? 30   GLU A OE2   1 
ATOM   233  N  N     . ALA A 1 49  ? 3.197   45.222 44.893 1.00 57.69  ? 31   ALA A N     1 
ATOM   234  C  CA    . ALA A 1 49  ? 2.897   44.001 45.618 1.00 55.36  ? 31   ALA A CA    1 
ATOM   235  C  C     . ALA A 1 49  ? 3.163   42.753 44.780 1.00 49.68  ? 31   ALA A C     1 
ATOM   236  O  O     . ALA A 1 49  ? 3.669   41.776 45.308 1.00 48.08  ? 31   ALA A O     1 
ATOM   237  C  CB    . ALA A 1 49  ? 1.473   44.029 46.126 1.00 58.76  ? 31   ALA A CB    1 
ATOM   238  N  N     . TYR A 1 50  ? 2.877   42.804 43.474 1.00 47.39  ? 32   TYR A N     1 
ATOM   239  C  CA    . TYR A 1 50  ? 3.078   41.658 42.546 1.00 43.96  ? 32   TYR A CA    1 
ATOM   240  C  C     . TYR A 1 50  ? 4.518   41.137 42.550 1.00 40.74  ? 32   TYR A C     1 
ATOM   241  O  O     . TYR A 1 50  ? 4.752   39.960 42.342 1.00 39.14  ? 32   TYR A O     1 
ATOM   242  C  CB    . TYR A 1 50  ? 2.558   41.977 41.094 1.00 44.54  ? 32   TYR A CB    1 
ATOM   243  C  CG    . TYR A 1 50  ? 1.384   42.922 41.179 1.00 50.68  ? 32   TYR A CG    1 
ATOM   244  C  CD1   . TYR A 1 50  ? 0.115   42.457 41.597 1.00 53.42  ? 32   TYR A CD1   1 
ATOM   245  C  CD2   . TYR A 1 50  ? 1.551   44.314 40.976 1.00 55.78  ? 32   TYR A CD2   1 
ATOM   246  C  CE1   . TYR A 1 50  ? -0.981  43.354 41.770 1.00 58.61  ? 32   TYR A CE1   1 
ATOM   247  C  CE2   . TYR A 1 50  ? 0.455   45.222 41.137 1.00 61.05  ? 32   TYR A CE2   1 
ATOM   248  C  CZ    . TYR A 1 50  ? -0.807  44.727 41.533 1.00 61.89  ? 32   TYR A CZ    1 
ATOM   249  O  OH    . TYR A 1 50  ? -1.886  45.588 41.701 1.00 66.53  ? 32   TYR A OH    1 
ATOM   250  N  N     . HIS A 1 51  ? 5.467   42.014 42.844 1.00 32.35  ? 33   HIS A N     1 
ATOM   251  C  CA    . HIS A 1 51  ? 6.873   41.704 42.725 1.00 31.11  ? 33   HIS A CA    1 
ATOM   252  C  C     . HIS A 1 51  ? 7.579   41.656 44.058 1.00 30.31  ? 33   HIS A C     1 
ATOM   253  O  O     . HIS A 1 51  ? 8.803   41.585 44.110 1.00 30.63  ? 33   HIS A O     1 
ATOM   254  C  CB    . HIS A 1 51  ? 7.523   42.747 41.825 1.00 32.73  ? 33   HIS A CB    1 
ATOM   255  C  CG    . HIS A 1 51  ? 6.853   42.875 40.489 1.00 33.81  ? 33   HIS A CG    1 
ATOM   256  N  ND1   . HIS A 1 51  ? 6.488   44.090 39.949 1.00 35.41  ? 33   HIS A ND1   1 
ATOM   257  C  CD2   . HIS A 1 51  ? 6.425   41.930 39.615 1.00 33.17  ? 33   HIS A CD2   1 
ATOM   258  C  CE1   . HIS A 1 51  ? 5.901   43.889 38.783 1.00 33.23  ? 33   HIS A CE1   1 
ATOM   259  N  NE2   . HIS A 1 51  ? 5.849   42.589 38.559 1.00 35.56  ? 33   HIS A NE2   1 
ATOM   260  N  N     . ARG A 1 52  ? 6.812   41.715 45.140 1.00 29.02  ? 34   ARG A N     1 
ATOM   261  C  CA    . ARG A 1 52  ? 7.379   41.714 46.465 1.00 28.40  ? 34   ARG A CA    1 
ATOM   262  C  C     . ARG A 1 52  ? 7.512   40.315 46.998 1.00 25.87  ? 34   ARG A C     1 
ATOM   263  O  O     . ARG A 1 52  ? 6.795   39.426 46.574 1.00 24.08  ? 34   ARG A O     1 
ATOM   264  C  CB    . ARG A 1 52  ? 6.516   42.506 47.441 1.00 29.21  ? 34   ARG A CB    1 
ATOM   265  C  CG    . ARG A 1 52  ? 6.878   43.977 47.475 1.00 35.74  ? 34   ARG A CG    1 
ATOM   266  C  CD    . ARG A 1 52  ? 6.050   44.728 48.472 1.00 41.05  ? 34   ARG A CD    1 
ATOM   267  N  NE    . ARG A 1 52  ? 6.359   44.308 49.843 1.00 45.93  ? 34   ARG A NE    1 
ATOM   268  C  CZ    . ARG A 1 52  ? 5.684   44.734 50.917 1.00 47.97  ? 34   ARG A CZ    1 
ATOM   269  N  NH1   . ARG A 1 52  ? 4.654   45.562 50.769 1.00 48.46  ? 34   ARG A NH1   1 
ATOM   270  N  NH2   . ARG A 1 52  ? 6.015   44.322 52.136 1.00 48.07  ? 34   ARG A NH2   1 
ATOM   271  N  N     . VAL A 1 53  ? 8.446   40.161 47.939 1.00 24.84  ? 35   VAL A N     1 
ATOM   272  C  CA    . VAL A 1 53  ? 8.560   38.980 48.784 1.00 23.68  ? 35   VAL A CA    1 
ATOM   273  C  C     . VAL A 1 53  ? 7.973   39.374 50.145 1.00 23.78  ? 35   VAL A C     1 
ATOM   274  O  O     . VAL A 1 53  ? 8.427   40.330 50.744 1.00 23.91  ? 35   VAL A O     1 
ATOM   275  C  CB    . VAL A 1 53  ? 10.043  38.518 48.927 1.00 23.21  ? 35   VAL A CB    1 
ATOM   276  C  CG1   . VAL A 1 53  ? 10.138  37.430 49.991 1.00 22.44  ? 35   VAL A CG1   1 
ATOM   277  C  CG2   . VAL A 1 53  ? 10.582  37.978 47.568 1.00 21.29  ? 35   VAL A CG2   1 
ATOM   278  N  N     . PHE A 1 54  ? 6.924   38.675 50.593 1.00 23.64  ? 36   PHE A N     1 
ATOM   279  C  CA    . PHE A 1 54  ? 6.308   38.993 51.881 1.00 23.04  ? 36   PHE A CA    1 
ATOM   280  C  C     . PHE A 1 54  ? 6.972   38.226 53.015 1.00 22.64  ? 36   PHE A C     1 
ATOM   281  O  O     . PHE A 1 54  ? 7.456   37.117 52.813 1.00 20.40  ? 36   PHE A O     1 
ATOM   282  C  CB    . PHE A 1 54  ? 4.804   38.758 51.805 1.00 22.55  ? 36   PHE A CB    1 
ATOM   283  C  CG    . PHE A 1 54  ? 4.143   39.675 50.817 1.00 24.53  ? 36   PHE A CG    1 
ATOM   284  C  CD1   . PHE A 1 54  ? 3.907   41.014 51.157 1.00 24.13  ? 36   PHE A CD1   1 
ATOM   285  C  CD2   . PHE A 1 54  ? 3.873   39.240 49.517 1.00 23.15  ? 36   PHE A CD2   1 
ATOM   286  C  CE1   . PHE A 1 54  ? 3.360   41.880 50.240 1.00 26.80  ? 36   PHE A CE1   1 
ATOM   287  C  CE2   . PHE A 1 54  ? 3.310   40.118 48.579 1.00 25.67  ? 36   PHE A CE2   1 
ATOM   288  C  CZ    . PHE A 1 54  ? 3.053   41.434 48.946 1.00 26.30  ? 36   PHE A CZ    1 
ATOM   289  N  N     . VAL A 1 55  ? 6.970   38.797 54.210 1.00 22.11  ? 37   VAL A N     1 
ATOM   290  C  CA    . VAL A 1 55  ? 7.800   38.252 55.302 1.00 22.95  ? 37   VAL A CA    1 
ATOM   291  C  C     . VAL A 1 55  ? 6.951   37.928 56.511 1.00 22.60  ? 37   VAL A C     1 
ATOM   292  O  O     . VAL A 1 55  ? 6.323   38.836 57.053 1.00 23.00  ? 37   VAL A O     1 
ATOM   293  C  CB    . VAL A 1 55  ? 8.854   39.277 55.741 1.00 23.35  ? 37   VAL A CB    1 
ATOM   294  C  CG1   . VAL A 1 55  ? 9.815   38.676 56.763 1.00 25.45  ? 37   VAL A CG1   1 
ATOM   295  C  CG2   . VAL A 1 55  ? 9.621   39.780 54.551 1.00 25.39  ? 37   VAL A CG2   1 
ATOM   296  N  N     . ASN A 1 56  ? 6.928   36.653 56.924 1.00 21.90  ? 38   ASN A N     1 
ATOM   297  C  CA    . ASN A 1 56  ? 6.262   36.242 58.167 1.00 22.48  ? 38   ASN A CA    1 
ATOM   298  C  C     . ASN A 1 56  ? 7.218   36.218 59.365 1.00 23.75  ? 38   ASN A C     1 
ATOM   299  O  O     . ASN A 1 56  ? 6.821   36.564 60.486 1.00 24.32  ? 38   ASN A O     1 
ATOM   300  C  CB    . ASN A 1 56  ? 5.575   34.871 58.012 1.00 20.90  ? 38   ASN A CB    1 
ATOM   301  C  CG    . ASN A 1 56  ? 4.378   34.913 57.063 1.00 21.47  ? 38   ASN A CG    1 
ATOM   302  O  OD1   . ASN A 1 56  ? 4.248   34.095 56.101 1.00 20.86  ? 38   ASN A OD1   1 
ATOM   303  N  ND2   . ASN A 1 56  ? 3.476   35.847 57.331 1.00 18.14  ? 38   ASN A ND2   1 
ATOM   304  N  N     . ARG A 1 57  ? 8.457   35.769 59.138 1.00 24.44  ? 39   ARG A N     1 
ATOM   305  C  CA    . ARG A 1 57  ? 9.485   35.734 60.200 1.00 25.54  ? 39   ARG A CA    1 
ATOM   306  C  C     . ARG A 1 57  ? 10.770  36.253 59.551 1.00 25.71  ? 39   ARG A C     1 
ATOM   307  O  O     . ARG A 1 57  ? 11.007  35.980 58.386 1.00 24.82  ? 39   ARG A O     1 
ATOM   308  C  CB    . ARG A 1 57  ? 9.690   34.313 60.765 1.00 24.78  ? 39   ARG A CB    1 
ATOM   309  C  CG    . ARG A 1 57  ? 8.765   33.948 61.935 1.00 24.45  ? 39   ARG A CG    1 
ATOM   310  C  CD    . ARG A 1 57  ? 8.693   32.441 62.161 1.00 26.51  ? 39   ARG A CD    1 
ATOM   311  N  NE    . ARG A 1 57  ? 8.381   31.750 60.917 1.00 28.67  ? 39   ARG A NE    1 
ATOM   312  C  CZ    . ARG A 1 57  ? 7.178   31.721 60.332 1.00 28.72  ? 39   ARG A CZ    1 
ATOM   313  N  NH1   . ARG A 1 57  ? 6.121   32.305 60.896 1.00 27.46  ? 39   ARG A NH1   1 
ATOM   314  N  NH2   . ARG A 1 57  ? 7.036   31.105 59.168 1.00 25.12  ? 39   ARG A NH2   1 
ATOM   315  N  N     . SER A 1 58  ? 11.565  37.011 60.297 1.00 26.03  ? 40   SER A N     1 
ATOM   316  C  CA    . SER A 1 58  ? 12.766  37.643 59.752 1.00 26.73  ? 40   SER A CA    1 
ATOM   317  C  C     . SER A 1 58  ? 13.733  36.610 59.196 1.00 26.56  ? 40   SER A C     1 
ATOM   318  O  O     . SER A 1 58  ? 13.849  35.515 59.746 1.00 25.85  ? 40   SER A O     1 
ATOM   319  C  CB    . SER A 1 58  ? 13.472  38.445 60.839 1.00 27.57  ? 40   SER A CB    1 
ATOM   320  O  OG    . SER A 1 58  ? 12.714  39.583 61.147 1.00 27.63  ? 40   SER A OG    1 
ATOM   321  N  N     . LEU A 1 59  ? 14.434  36.974 58.120 1.00 27.15  ? 41   LEU A N     1 
ATOM   322  C  CA    . LEU A 1 59  ? 15.370  36.081 57.456 1.00 26.93  ? 41   LEU A CA    1 
ATOM   323  C  C     . LEU A 1 59  ? 16.521  36.905 56.870 1.00 28.29  ? 41   LEU A C     1 
ATOM   324  O  O     . LEU A 1 59  ? 16.303  37.757 55.992 1.00 27.66  ? 41   LEU A O     1 
ATOM   325  C  CB    . LEU A 1 59  ? 14.637  35.289 56.350 1.00 25.23  ? 41   LEU A CB    1 
ATOM   326  C  CG    . LEU A 1 59  ? 15.338  34.075 55.734 1.00 24.74  ? 41   LEU A CG    1 
ATOM   327  C  CD1   . LEU A 1 59  ? 14.361  32.972 55.359 1.00 23.29  ? 41   LEU A CD1   1 
ATOM   328  C  CD2   . LEU A 1 59  ? 16.171  34.509 54.496 1.00 24.22  ? 41   LEU A CD2   1 
ATOM   329  N  N     . ALA A 1 60  ? 17.739  36.661 57.377 1.00 29.19  ? 42   ALA A N     1 
ATOM   330  C  CA    . ALA A 1 60  ? 18.940  37.278 56.836 1.00 29.96  ? 42   ALA A CA    1 
ATOM   331  C  C     . ALA A 1 60  ? 19.420  36.432 55.652 1.00 30.56  ? 42   ALA A C     1 
ATOM   332  O  O     . ALA A 1 60  ? 19.919  35.308 55.841 1.00 29.31  ? 42   ALA A O     1 
ATOM   333  C  CB    . ALA A 1 60  ? 20.040  37.375 57.921 1.00 29.92  ? 42   ALA A CB    1 
ATOM   334  N  N     . MET A 1 61  ? 19.289  36.972 54.435 1.00 31.77  ? 43   MET A N     1 
ATOM   335  C  CA    . MET A 1 61  ? 19.672  36.226 53.223 1.00 33.10  ? 43   MET A CA    1 
ATOM   336  C  C     . MET A 1 61  ? 21.133  35.865 53.188 1.00 34.44  ? 43   MET A C     1 
ATOM   337  O  O     . MET A 1 61  ? 21.487  34.852 52.596 1.00 34.03  ? 43   MET A O     1 
ATOM   338  C  CB    . MET A 1 61  ? 19.277  36.953 51.932 1.00 33.63  ? 43   MET A CB    1 
ATOM   339  C  CG    . MET A 1 61  ? 17.813  36.847 51.674 1.00 35.91  ? 43   MET A CG    1 
ATOM   340  S  SD    . MET A 1 61  ? 17.322  35.208 51.056 1.00 38.84  ? 43   MET A SD    1 
ATOM   341  C  CE    . MET A 1 61  ? 17.926  35.232 49.383 1.00 38.03  ? 43   MET A CE    1 
ATOM   342  N  N     . GLU A 1 62  ? 21.965  36.691 53.824 1.00 35.79  ? 44   GLU A N     1 
ATOM   343  C  CA    . GLU A 1 62  ? 23.389  36.439 53.996 1.00 38.81  ? 44   GLU A CA    1 
ATOM   344  C  C     . GLU A 1 62  ? 23.678  35.090 54.693 1.00 37.61  ? 44   GLU A C     1 
ATOM   345  O  O     . GLU A 1 62  ? 24.724  34.483 54.464 1.00 38.60  ? 44   GLU A O     1 
ATOM   346  C  CB    . GLU A 1 62  ? 24.031  37.617 54.761 1.00 39.55  ? 44   GLU A CB    1 
ATOM   347  C  CG    . GLU A 1 62  ? 24.882  37.209 55.977 1.00 44.33  ? 44   GLU A CG    1 
ATOM   348  C  CD    . GLU A 1 62  ? 25.069  38.340 56.997 1.00 46.51  ? 44   GLU A CD    1 
ATOM   349  O  OE1   . GLU A 1 62  ? 25.410  39.474 56.556 1.00 53.48  ? 44   GLU A OE1   1 
ATOM   350  O  OE2   . GLU A 1 62  ? 24.882  38.089 58.231 1.00 53.15  ? 44   GLU A OE2   1 
ATOM   351  N  N     . LYS A 1 63  ? 22.753  34.629 55.528 1.00 36.59  ? 45   LYS A N     1 
ATOM   352  C  CA    . LYS A 1 63  ? 22.923  33.381 56.271 1.00 36.16  ? 45   LYS A CA    1 
ATOM   353  C  C     . LYS A 1 63  ? 22.506  32.138 55.465 1.00 33.88  ? 45   LYS A C     1 
ATOM   354  O  O     . LYS A 1 63  ? 22.781  30.990 55.868 1.00 32.86  ? 45   LYS A O     1 
ATOM   355  C  CB    . LYS A 1 63  ? 22.143  33.434 57.596 1.00 37.48  ? 45   LYS A CB    1 
ATOM   356  C  CG    . LYS A 1 63  ? 22.676  34.455 58.639 1.00 40.49  ? 45   LYS A CG    1 
ATOM   357  C  CD    . LYS A 1 63  ? 22.246  34.052 60.033 1.00 43.89  ? 45   LYS A CD    1 
ATOM   358  C  CE    . LYS A 1 63  ? 22.818  34.988 61.120 1.00 49.03  ? 45   LYS A CE    1 
ATOM   359  N  NZ    . LYS A 1 63  ? 21.772  35.851 61.774 1.00 52.46  ? 45   LYS A NZ    1 
ATOM   360  N  N     . ILE A 1 64  ? 21.846  32.363 54.330 1.00 31.55  ? 46   ILE A N     1 
ATOM   361  C  CA    . ILE A 1 64  ? 21.414  31.254 53.474 1.00 29.65  ? 46   ILE A CA    1 
ATOM   362  C  C     . ILE A 1 64  ? 22.610  30.745 52.627 1.00 30.00  ? 46   ILE A C     1 
ATOM   363  O  O     . ILE A 1 64  ? 23.195  31.497 51.812 1.00 30.14  ? 46   ILE A O     1 
ATOM   364  C  CB    . ILE A 1 64  ? 20.197  31.664 52.585 1.00 29.13  ? 46   ILE A CB    1 
ATOM   365  C  CG1   . ILE A 1 64  ? 18.943  31.959 53.427 1.00 25.55  ? 46   ILE A CG1   1 
ATOM   366  C  CG2   . ILE A 1 64  ? 19.935  30.641 51.511 1.00 26.79  ? 46   ILE A CG2   1 
ATOM   367  C  CD1   . ILE A 1 64  ? 18.610  30.936 54.583 1.00 22.83  ? 46   ILE A CD1   1 
ATOM   368  N  N     . LYS A 1 65  ? 22.981  29.481 52.826 1.00 29.10  ? 47   LYS A N     1 
ATOM   369  C  CA    . LYS A 1 65  ? 24.070  28.893 52.055 1.00 30.00  ? 47   LYS A CA    1 
ATOM   370  C  C     . LYS A 1 65  ? 23.637  27.983 50.890 1.00 28.48  ? 47   LYS A C     1 
ATOM   371  O  O     . LYS A 1 65  ? 24.479  27.683 50.019 1.00 28.24  ? 47   LYS A O     1 
ATOM   372  C  CB    . LYS A 1 65  ? 25.048  28.147 52.984 1.00 31.29  ? 47   LYS A CB    1 
ATOM   373  C  CG    . LYS A 1 65  ? 25.413  28.887 54.279 1.00 36.47  ? 47   LYS A CG    1 
ATOM   374  C  CD    . LYS A 1 65  ? 26.754  29.631 54.180 1.00 44.82  ? 47   LYS A CD    1 
ATOM   375  C  CE    . LYS A 1 65  ? 26.656  31.017 53.512 1.00 48.47  ? 47   LYS A CE    1 
ATOM   376  N  NZ    . LYS A 1 65  ? 26.527  32.110 54.548 1.00 50.83  ? 47   LYS A NZ    1 
ATOM   377  N  N     . CYS A 1 66  ? 22.373  27.521 50.896 1.00 27.31  ? 48   CYS A N     1 
ATOM   378  C  CA    . CYS A 1 66  ? 21.808  26.593 49.871 1.00 27.68  ? 48   CYS A CA    1 
ATOM   379  C  C     . CYS A 1 66  ? 20.403  26.996 49.536 1.00 25.84  ? 48   CYS A C     1 
ATOM   380  O  O     . CYS A 1 66  ? 19.583  27.162 50.425 1.00 26.11  ? 48   CYS A O     1 
ATOM   381  C  CB    . CYS A 1 66  ? 21.668  25.129 50.332 1.00 27.76  ? 48   CYS A CB    1 
ATOM   382  S  SG    . CYS A 1 66  ? 23.152  24.408 50.892 1.00 36.55  ? 48   CYS A SG    1 
ATOM   383  N  N     . PHE A 1 67  ? 20.119  27.140 48.250 1.00 24.69  ? 49   PHE A N     1 
ATOM   384  C  CA    . PHE A 1 67  ? 18.782  27.418 47.812 1.00 23.47  ? 49   PHE A CA    1 
ATOM   385  C  C     . PHE A 1 67  ? 18.219  26.145 47.183 1.00 23.46  ? 49   PHE A C     1 
ATOM   386  O  O     . PHE A 1 67  ? 18.830  25.588 46.253 1.00 23.01  ? 49   PHE A O     1 
ATOM   387  C  CB    . PHE A 1 67  ? 18.784  28.573 46.809 1.00 24.09  ? 49   PHE A CB    1 
ATOM   388  C  CG    . PHE A 1 67  ? 19.466  29.833 47.326 1.00 25.51  ? 49   PHE A CG    1 
ATOM   389  C  CD1   . PHE A 1 67  ? 18.731  30.818 47.991 1.00 26.88  ? 49   PHE A CD1   1 
ATOM   390  C  CD2   . PHE A 1 67  ? 20.841  30.037 47.123 1.00 23.76  ? 49   PHE A CD2   1 
ATOM   391  C  CE1   . PHE A 1 67  ? 19.359  32.003 48.435 1.00 26.94  ? 49   PHE A CE1   1 
ATOM   392  C  CE2   . PHE A 1 67  ? 21.480  31.208 47.584 1.00 27.57  ? 49   PHE A CE2   1 
ATOM   393  C  CZ    . PHE A 1 67  ? 20.734  32.190 48.245 1.00 27.24  ? 49   PHE A CZ    1 
ATOM   394  N  N     . GLY A 1 68  ? 17.074  25.678 47.692 1.00 21.25  ? 50   GLY A N     1 
ATOM   395  C  CA    . GLY A 1 68  ? 16.507  24.443 47.192 1.00 21.02  ? 50   GLY A CA    1 
ATOM   396  C  C     . GLY A 1 68  ? 15.191  24.738 46.528 1.00 20.95  ? 50   GLY A C     1 
ATOM   397  O  O     . GLY A 1 68  ? 14.469  25.643 46.963 1.00 20.45  ? 50   GLY A O     1 
ATOM   398  N  N     . PHE A 1 69  ? 14.896  24.000 45.458 1.00 21.11  ? 51   PHE A N     1 
ATOM   399  C  CA    . PHE A 1 69  ? 13.702  24.227 44.654 1.00 21.87  ? 51   PHE A CA    1 
ATOM   400  C  C     . PHE A 1 69  ? 12.898  22.973 44.462 1.00 22.60  ? 51   PHE A C     1 
ATOM   401  O  O     . PHE A 1 69  ? 13.403  21.873 44.399 1.00 23.81  ? 51   PHE A O     1 
ATOM   402  C  CB    . PHE A 1 69  ? 14.019  24.771 43.248 1.00 23.11  ? 51   PHE A CB    1 
ATOM   403  C  CG    . PHE A 1 69  ? 14.529  26.184 43.230 1.00 23.56  ? 51   PHE A CG    1 
ATOM   404  C  CD1   . PHE A 1 69  ? 13.656  27.240 43.002 1.00 23.87  ? 51   PHE A CD1   1 
ATOM   405  C  CD2   . PHE A 1 69  ? 15.882  26.457 43.469 1.00 24.88  ? 51   PHE A CD2   1 
ATOM   406  C  CE1   . PHE A 1 69  ? 14.118  28.546 42.987 1.00 24.14  ? 51   PHE A CE1   1 
ATOM   407  C  CE2   . PHE A 1 69  ? 16.355  27.766 43.475 1.00 24.48  ? 51   PHE A CE2   1 
ATOM   408  C  CZ    . PHE A 1 69  ? 15.456  28.823 43.208 1.00 22.73  ? 51   PHE A CZ    1 
ATOM   409  N  N     . ASN A 1 70  ? 11.612  23.171 44.389 1.00 22.04  ? 52   ASN A N     1 
ATOM   410  C  CA    . ASN A 1 70  ? 10.691  22.184 43.941 1.00 22.56  ? 52   ASN A CA    1 
ATOM   411  C  C     . ASN A 1 70  ? 10.502  22.473 42.457 1.00 22.22  ? 52   ASN A C     1 
ATOM   412  O  O     . ASN A 1 70  ? 10.758  23.599 42.050 1.00 20.75  ? 52   ASN A O     1 
ATOM   413  C  CB    . ASN A 1 70  ? 9.406   22.536 44.666 1.00 24.11  ? 52   ASN A CB    1 
ATOM   414  C  CG    . ASN A 1 70  ? 8.356   21.616 44.364 1.00 27.10  ? 52   ASN A CG    1 
ATOM   415  O  OD1   . ASN A 1 70  ? 7.299   21.998 43.854 1.00 27.01  ? 52   ASN A OD1   1 
ATOM   416  N  ND2   . ASN A 1 70  ? 8.635   20.347 44.609 1.00 31.58  ? 52   ASN A ND2   1 
ATOM   417  N  N     . MET A 1 71  ? 10.031  21.506 41.658 1.00 22.02  ? 53   MET A N     1 
ATOM   418  C  CA    . MET A 1 71  ? 9.781   21.769 40.237 1.00 22.53  ? 53   MET A CA    1 
ATOM   419  C  C     . MET A 1 71  ? 8.341   22.189 39.971 1.00 22.34  ? 53   MET A C     1 
ATOM   420  O  O     . MET A 1 71  ? 8.071   23.310 39.570 1.00 22.14  ? 53   MET A O     1 
ATOM   421  C  CB    . MET A 1 71  ? 10.113  20.555 39.370 1.00 22.01  ? 53   MET A CB    1 
ATOM   422  C  CG    . MET A 1 71  ? 10.041  20.899 37.877 1.00 24.49  ? 53   MET A CG    1 
ATOM   423  S  SD    . MET A 1 71  ? 10.246  19.540 36.706 1.00 26.92  ? 53   MET A SD    1 
ATOM   424  C  CE    . MET A 1 71  ? 8.844   18.484 37.172 1.00 23.89  ? 53   MET A CE    1 
ATOM   425  N  N     . ASP A 1 72  ? 7.406   21.282 40.188 1.00 22.91  ? 54   ASP A N     1 
ATOM   426  C  CA    . ASP A 1 72  ? 6.022   21.548 39.742 1.00 22.94  ? 54   ASP A CA    1 
ATOM   427  C  C     . ASP A 1 72  ? 5.271   22.599 40.554 1.00 22.42  ? 54   ASP A C     1 
ATOM   428  O  O     . ASP A 1 72  ? 5.251   22.551 41.781 1.00 22.74  ? 54   ASP A O     1 
ATOM   429  C  CB    . ASP A 1 72  ? 5.252   20.273 39.615 1.00 23.90  ? 54   ASP A CB    1 
ATOM   430  C  CG    . ASP A 1 72  ? 5.473   19.603 38.279 1.00 25.79  ? 54   ASP A CG    1 
ATOM   431  O  OD1   . ASP A 1 72  ? 6.103   20.215 37.379 1.00 30.65  ? 54   ASP A OD1   1 
ATOM   432  O  OD2   . ASP A 1 72  ? 4.943   18.513 38.078 1.00 28.36  ? 54   ASP A OD2   1 
ATOM   433  N  N     . TYR A 1 73  ? 4.727   23.577 39.840 1.00 22.06  ? 55   TYR A N     1 
ATOM   434  C  CA    . TYR A 1 73  ? 4.117   24.786 40.408 1.00 21.63  ? 55   TYR A CA    1 
ATOM   435  C  C     . TYR A 1 73  ? 5.061   25.637 41.235 1.00 21.46  ? 55   TYR A C     1 
ATOM   436  O  O     . TYR A 1 73  ? 4.633   26.468 42.040 1.00 21.35  ? 55   TYR A O     1 
ATOM   437  C  CB    . TYR A 1 73  ? 2.840   24.461 41.180 1.00 20.82  ? 55   TYR A CB    1 
ATOM   438  C  CG    . TYR A 1 73  ? 1.643   24.219 40.293 1.00 21.47  ? 55   TYR A CG    1 
ATOM   439  C  CD1   . TYR A 1 73  ? 1.132   25.241 39.483 1.00 21.42  ? 55   TYR A CD1   1 
ATOM   440  C  CD2   . TYR A 1 73  ? 1.011   22.975 40.268 1.00 22.33  ? 55   TYR A CD2   1 
ATOM   441  C  CE1   . TYR A 1 73  ? 0.001   25.022 38.673 1.00 20.24  ? 55   TYR A CE1   1 
ATOM   442  C  CE2   . TYR A 1 73  ? -0.103  22.751 39.453 1.00 21.54  ? 55   TYR A CE2   1 
ATOM   443  C  CZ    . TYR A 1 73  ? -0.597  23.789 38.672 1.00 19.58  ? 55   TYR A CZ    1 
ATOM   444  O  OH    . TYR A 1 73  ? -1.740  23.587 37.903 1.00 22.52  ? 55   TYR A OH    1 
ATOM   445  N  N     . THR A 1 74  ? 6.359   25.492 40.990 1.00 21.48  ? 56   THR A N     1 
ATOM   446  C  CA    . THR A 1 74  ? 7.324   26.376 41.627 1.00 20.99  ? 56   THR A CA    1 
ATOM   447  C  C     . THR A 1 74  ? 8.186   26.905 40.512 1.00 21.52  ? 56   THR A C     1 
ATOM   448  O  O     . THR A 1 74  ? 8.044   28.072 40.115 1.00 22.61  ? 56   THR A O     1 
ATOM   449  C  CB    . THR A 1 74  ? 8.144   25.637 42.745 1.00 21.21  ? 56   THR A CB    1 
ATOM   450  O  OG1   . THR A 1 74  ? 7.259   25.278 43.797 1.00 22.20  ? 56   THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 74  ? 9.227   26.544 43.348 1.00 19.54  ? 56   THR A CG2   1 
ATOM   452  N  N     . LEU A 1 75  ? 9.051   26.047 39.975 1.00 21.05  ? 57   LEU A N     1 
ATOM   453  C  CA    . LEU A 1 75  ? 9.821   26.369 38.781 1.00 22.58  ? 57   LEU A CA    1 
ATOM   454  C  C     . LEU A 1 75  ? 8.928   26.264 37.537 1.00 22.52  ? 57   LEU A C     1 
ATOM   455  O  O     . LEU A 1 75  ? 8.968   27.128 36.649 1.00 22.80  ? 57   LEU A O     1 
ATOM   456  C  CB    . LEU A 1 75  ? 11.029  25.425 38.649 1.00 22.38  ? 57   LEU A CB    1 
ATOM   457  C  CG    . LEU A 1 75  ? 12.230  25.572 39.610 1.00 25.64  ? 57   LEU A CG    1 
ATOM   458  C  CD1   . LEU A 1 75  ? 13.270  24.489 39.358 1.00 24.44  ? 57   LEU A CD1   1 
ATOM   459  C  CD2   . LEU A 1 75  ? 12.896  26.922 39.521 1.00 21.89  ? 57   LEU A CD2   1 
ATOM   460  N  N     . ALA A 1 76  ? 8.099   25.213 37.479 1.00 21.91  ? 58   ALA A N     1 
ATOM   461  C  CA    . ALA A 1 76  ? 7.244   24.972 36.333 1.00 21.28  ? 58   ALA A CA    1 
ATOM   462  C  C     . ALA A 1 76  ? 5.839   25.316 36.752 1.00 21.86  ? 58   ALA A C     1 
ATOM   463  O  O     . ALA A 1 76  ? 5.172   24.532 37.389 1.00 21.78  ? 58   ALA A O     1 
ATOM   464  C  CB    . ALA A 1 76  ? 7.319   23.476 35.897 1.00 21.57  ? 58   ALA A CB    1 
ATOM   465  N  N     . VAL A 1 77  ? 5.371   26.500 36.387 1.00 23.11  ? 59   VAL A N     1 
ATOM   466  C  CA    . VAL A 1 77  ? 4.040   26.925 36.794 1.00 22.62  ? 59   VAL A CA    1 
ATOM   467  C  C     . VAL A 1 77  ? 3.115   26.677 35.587 1.00 22.66  ? 59   VAL A C     1 
ATOM   468  O  O     . VAL A 1 77  ? 3.328   27.197 34.501 1.00 21.21  ? 59   VAL A O     1 
ATOM   469  C  CB    . VAL A 1 77  ? 4.013   28.415 37.254 1.00 23.27  ? 59   VAL A CB    1 
ATOM   470  C  CG1   . VAL A 1 77  ? 2.562   28.895 37.406 1.00 24.22  ? 59   VAL A CG1   1 
ATOM   471  C  CG2   . VAL A 1 77  ? 4.752   28.597 38.575 1.00 23.62  ? 59   VAL A CG2   1 
ATOM   472  N  N     . TYR A 1 78  ? 2.095   25.853 35.777 1.00 22.37  ? 60   TYR A N     1 
ATOM   473  C  CA    . TYR A 1 78  ? 1.224   25.466 34.676 1.00 21.71  ? 60   TYR A CA    1 
ATOM   474  C  C     . TYR A 1 78  ? 0.127   26.492 34.471 1.00 22.73  ? 60   TYR A C     1 
ATOM   475  O  O     . TYR A 1 78  ? -0.502  26.962 35.442 1.00 22.88  ? 60   TYR A O     1 
ATOM   476  C  CB    . TYR A 1 78  ? 0.615   24.099 34.967 1.00 20.86  ? 60   TYR A CB    1 
ATOM   477  C  CG    . TYR A 1 78  ? 1.671   23.024 35.066 1.00 20.34  ? 60   TYR A CG    1 
ATOM   478  C  CD1   . TYR A 1 78  ? 2.242   22.487 33.910 1.00 20.99  ? 60   TYR A CD1   1 
ATOM   479  C  CD2   . TYR A 1 78  ? 2.089   22.536 36.315 1.00 20.51  ? 60   TYR A CD2   1 
ATOM   480  C  CE1   . TYR A 1 78  ? 3.199   21.520 33.973 1.00 22.22  ? 60   TYR A CE1   1 
ATOM   481  C  CE2   . TYR A 1 78  ? 3.061   21.549 36.398 1.00 23.67  ? 60   TYR A CE2   1 
ATOM   482  C  CZ    . TYR A 1 78  ? 3.615   21.044 35.200 1.00 24.21  ? 60   TYR A CZ    1 
ATOM   483  O  OH    . TYR A 1 78  ? 4.595   20.049 35.235 1.00 24.99  ? 60   TYR A OH    1 
ATOM   484  N  N     . LYS A 1 79  ? -0.139  26.781 33.200 1.00 23.57  ? 61   LYS A N     1 
ATOM   485  C  CA    . LYS A 1 79  ? -1.082  27.826 32.803 1.00 23.90  ? 61   LYS A CA    1 
ATOM   486  C  C     . LYS A 1 79  ? -2.525  27.418 33.135 1.00 24.25  ? 61   LYS A C     1 
ATOM   487  O  O     . LYS A 1 79  ? -2.939  26.251 32.954 1.00 23.71  ? 61   LYS A O     1 
ATOM   488  C  CB    . LYS A 1 79  ? -0.922  28.157 31.334 1.00 25.02  ? 61   LYS A CB    1 
ATOM   489  C  CG    . LYS A 1 79  ? 0.458   28.746 30.990 1.00 25.45  ? 61   LYS A CG    1 
ATOM   490  C  CD    . LYS A 1 79  ? 0.585   29.115 29.548 1.00 25.16  ? 61   LYS A CD    1 
ATOM   491  C  CE    . LYS A 1 79  ? 1.870   29.878 29.326 1.00 25.24  ? 61   LYS A CE    1 
ATOM   492  N  NZ    . LYS A 1 79  ? 2.080   30.284 27.890 1.00 33.03  ? 61   LYS A NZ    1 
ATOM   493  N  N     . SER A 1 80  ? -3.267  28.425 33.589 1.00 24.16  ? 62   SER A N     1 
ATOM   494  C  CA    . SER A 1 80  ? -4.638  28.327 34.075 1.00 24.22  ? 62   SER A CA    1 
ATOM   495  C  C     . SER A 1 80  ? -5.595  29.126 33.198 1.00 24.73  ? 62   SER A C     1 
ATOM   496  O  O     . SER A 1 80  ? -5.284  30.261 32.856 1.00 25.43  ? 62   SER A O     1 
ATOM   497  C  CB    . SER A 1 80  ? -4.655  28.873 35.500 1.00 22.73  ? 62   SER A CB    1 
ATOM   498  O  OG    . SER A 1 80  ? -5.944  28.815 36.095 1.00 24.83  ? 62   SER A OG    1 
ATOM   499  N  N     . PRO A 1 81  ? -6.785  28.570 32.868 1.00 25.39  ? 63   PRO A N     1 
ATOM   500  C  CA    . PRO A 1 81  ? -7.328  27.269 33.304 1.00 25.56  ? 63   PRO A CA    1 
ATOM   501  C  C     . PRO A 1 81  ? -6.979  26.054 32.433 1.00 26.49  ? 63   PRO A C     1 
ATOM   502  O  O     . PRO A 1 81  ? -7.518  24.989 32.689 1.00 26.03  ? 63   PRO A O     1 
ATOM   503  C  CB    . PRO A 1 81  ? -8.843  27.505 33.243 1.00 25.44  ? 63   PRO A CB    1 
ATOM   504  C  CG    . PRO A 1 81  ? -9.007  28.459 32.058 1.00 27.26  ? 63   PRO A CG    1 
ATOM   505  C  CD    . PRO A 1 81  ? -7.757  29.329 32.054 1.00 25.85  ? 63   PRO A CD    1 
ATOM   506  N  N     . GLU A 1 82  ? -6.095  26.211 31.443 1.00 26.28  ? 64   GLU A N     1 
ATOM   507  C  CA    . GLU A 1 82  ? -5.833  25.159 30.452 1.00 27.63  ? 64   GLU A CA    1 
ATOM   508  C  C     . GLU A 1 82  ? -5.336  23.880 31.089 1.00 26.48  ? 64   GLU A C     1 
ATOM   509  O  O     . GLU A 1 82  ? -5.808  22.803 30.724 1.00 25.85  ? 64   GLU A O     1 
ATOM   510  C  CB    . GLU A 1 82  ? -4.808  25.602 29.400 1.00 28.54  ? 64   GLU A CB    1 
ATOM   511  C  CG    . GLU A 1 82  ? -5.357  26.543 28.308 1.00 31.97  ? 64   GLU A CG    1 
ATOM   512  C  CD    . GLU A 1 82  ? -5.478  28.006 28.778 1.00 36.15  ? 64   GLU A CD    1 
ATOM   513  O  OE1   . GLU A 1 82  ? -4.940  28.354 29.853 1.00 33.65  ? 64   GLU A OE1   1 
ATOM   514  O  OE2   . GLU A 1 82  ? -6.122  28.809 28.055 1.00 40.88  ? 64   GLU A OE2   1 
ATOM   515  N  N     . TYR A 1 83  ? -4.371  23.988 32.014 1.00 24.41  ? 65   TYR A N     1 
ATOM   516  C  CA    . TYR A 1 83  ? -3.837  22.768 32.620 1.00 23.46  ? 65   TYR A CA    1 
ATOM   517  C  C     . TYR A 1 83  ? -4.843  22.077 33.574 1.00 23.62  ? 65   TYR A C     1 
ATOM   518  O  O     . TYR A 1 83  ? -4.997  20.845 33.538 1.00 23.53  ? 65   TYR A O     1 
ATOM   519  C  CB    . TYR A 1 83  ? -2.526  23.081 33.293 1.00 23.11  ? 65   TYR A CB    1 
ATOM   520  C  CG    . TYR A 1 83  ? -1.817  21.885 33.799 1.00 21.45  ? 65   TYR A CG    1 
ATOM   521  C  CD1   . TYR A 1 83  ? -1.167  21.031 32.926 1.00 23.58  ? 65   TYR A CD1   1 
ATOM   522  C  CD2   . TYR A 1 83  ? -1.764  21.613 35.175 1.00 22.08  ? 65   TYR A CD2   1 
ATOM   523  C  CE1   . TYR A 1 83  ? -0.500  19.928 33.390 1.00 20.74  ? 65   TYR A CE1   1 
ATOM   524  C  CE2   . TYR A 1 83  ? -1.094  20.487 35.652 1.00 20.33  ? 65   TYR A CE2   1 
ATOM   525  C  CZ    . TYR A 1 83  ? -0.460  19.657 34.732 1.00 21.72  ? 65   TYR A CZ    1 
ATOM   526  O  OH    . TYR A 1 83  ? 0.225   18.542 35.173 1.00 20.64  ? 65   TYR A OH    1 
ATOM   527  N  N     . GLU A 1 84  ? -5.541  22.863 34.407 1.00 23.31  ? 66   GLU A N     1 
ATOM   528  C  CA    . GLU A 1 84  ? -6.623  22.318 35.237 1.00 22.70  ? 66   GLU A CA    1 
ATOM   529  C  C     . GLU A 1 84  ? -7.692  21.616 34.387 1.00 23.46  ? 66   GLU A C     1 
ATOM   530  O  O     . GLU A 1 84  ? -8.134  20.533 34.763 1.00 23.15  ? 66   GLU A O     1 
ATOM   531  C  CB    . GLU A 1 84  ? -7.295  23.376 36.114 1.00 23.71  ? 66   GLU A CB    1 
ATOM   532  C  CG    . GLU A 1 84  ? -6.415  24.071 37.148 1.00 23.91  ? 66   GLU A CG    1 
ATOM   533  C  CD    . GLU A 1 84  ? -5.916  25.418 36.612 1.00 27.31  ? 66   GLU A CD    1 
ATOM   534  O  OE1   . GLU A 1 84  ? -5.220  25.386 35.585 1.00 31.09  ? 66   GLU A OE1   1 
ATOM   535  O  OE2   . GLU A 1 84  ? -6.228  26.501 37.194 1.00 26.75  ? 66   GLU A OE2   1 
ATOM   536  N  N     A SER A 1 85  ? -8.107  22.249 33.275 0.50 23.12  ? 67   SER A N     1 
ATOM   537  N  N     B SER A 1 85  ? -8.103  22.253 33.283 0.50 23.37  ? 67   SER A N     1 
ATOM   538  C  CA    A SER A 1 85  ? -9.058  21.657 32.311 0.50 23.50  ? 67   SER A CA    1 
ATOM   539  C  CA    B SER A 1 85  ? -9.032  21.664 32.311 0.50 24.05  ? 67   SER A CA    1 
ATOM   540  C  C     A SER A 1 85  ? -8.575  20.330 31.704 0.50 23.47  ? 67   SER A C     1 
ATOM   541  C  C     B SER A 1 85  ? -8.566  20.328 31.725 0.50 23.75  ? 67   SER A C     1 
ATOM   542  O  O     A SER A 1 85  ? -9.355  19.382 31.572 0.50 23.69  ? 67   SER A O     1 
ATOM   543  O  O     B SER A 1 85  ? -9.347  19.377 31.626 0.50 23.98  ? 67   SER A O     1 
ATOM   544  C  CB    A SER A 1 85  ? -9.391  22.649 31.184 0.50 24.36  ? 67   SER A CB    1 
ATOM   545  C  CB    B SER A 1 85  ? -9.289  22.654 31.180 0.50 24.92  ? 67   SER A CB    1 
ATOM   546  O  OG    A SER A 1 85  ? -10.690 22.412 30.640 0.50 23.21  ? 67   SER A OG    1 
ATOM   547  O  OG    B SER A 1 85  ? -10.010 23.762 31.682 0.50 25.70  ? 67   SER A OG    1 
ATOM   548  N  N     . LEU A 1 86  ? -7.295  20.267 31.335 1.00 22.90  ? 68   LEU A N     1 
ATOM   549  C  CA    . LEU A 1 86  ? -6.680  19.037 30.839 1.00 22.92  ? 68   LEU A CA    1 
ATOM   550  C  C     . LEU A 1 86  ? -6.736  17.931 31.907 1.00 23.05  ? 68   LEU A C     1 
ATOM   551  O  O     . LEU A 1 86  ? -7.077  16.801 31.604 1.00 24.12  ? 68   LEU A O     1 
ATOM   552  C  CB    . LEU A 1 86  ? -5.208  19.284 30.426 1.00 23.24  ? 68   LEU A CB    1 
ATOM   553  C  CG    . LEU A 1 86  ? -4.453  18.038 29.921 1.00 23.41  ? 68   LEU A CG    1 
ATOM   554  C  CD1   . LEU A 1 86  ? -5.091  17.476 28.701 1.00 22.48  ? 68   LEU A CD1   1 
ATOM   555  C  CD2   . LEU A 1 86  ? -2.986  18.365 29.671 1.00 21.21  ? 68   LEU A CD2   1 
ATOM   556  N  N     . GLY A 1 87  ? -6.387  18.255 33.152 1.00 22.63  ? 69   GLY A N     1 
ATOM   557  C  CA    . GLY A 1 87  ? -6.416  17.262 34.223 1.00 21.92  ? 69   GLY A CA    1 
ATOM   558  C  C     . GLY A 1 87  ? -7.843  16.820 34.479 1.00 22.65  ? 69   GLY A C     1 
ATOM   559  O  O     . GLY A 1 87  ? -8.115  15.611 34.660 1.00 23.12  ? 69   GLY A O     1 
ATOM   560  N  N     . PHE A 1 88  ? -8.754  17.798 34.528 1.00 21.90  ? 70   PHE A N     1 
ATOM   561  C  CA    . PHE A 1 88  ? -10.174 17.500 34.697 1.00 22.94  ? 70   PHE A CA    1 
ATOM   562  C  C     . PHE A 1 88  ? -10.725 16.555 33.598 1.00 23.63  ? 70   PHE A C     1 
ATOM   563  O  O     . PHE A 1 88  ? -11.349 15.550 33.907 1.00 24.46  ? 70   PHE A O     1 
ATOM   564  C  CB    . PHE A 1 88  ? -10.966 18.807 34.777 1.00 22.55  ? 70   PHE A CB    1 
ATOM   565  C  CG    . PHE A 1 88  ? -12.465 18.624 34.958 1.00 21.62  ? 70   PHE A CG    1 
ATOM   566  C  CD1   . PHE A 1 88  ? -13.015 18.535 36.250 1.00 20.07  ? 70   PHE A CD1   1 
ATOM   567  C  CD2   . PHE A 1 88  ? -13.316 18.560 33.846 1.00 23.53  ? 70   PHE A CD2   1 
ATOM   568  C  CE1   . PHE A 1 88  ? -14.376 18.414 36.439 1.00 18.81  ? 70   PHE A CE1   1 
ATOM   569  C  CE2   . PHE A 1 88  ? -14.692 18.413 34.025 1.00 25.02  ? 70   PHE A CE2   1 
ATOM   570  C  CZ    . PHE A 1 88  ? -15.219 18.356 35.342 1.00 20.55  ? 70   PHE A CZ    1 
ATOM   571  N  N     . GLU A 1 89  ? -10.470 16.856 32.324 1.00 25.68  ? 71   GLU A N     1 
ATOM   572  C  CA    . GLU A 1 89  ? -10.905 15.981 31.202 1.00 26.70  ? 71   GLU A CA    1 
ATOM   573  C  C     . GLU A 1 89  ? -10.364 14.567 31.312 1.00 25.17  ? 71   GLU A C     1 
ATOM   574  O  O     . GLU A 1 89  ? -11.097 13.609 31.140 1.00 23.85  ? 71   GLU A O     1 
ATOM   575  C  CB    . GLU A 1 89  ? -10.417 16.509 29.875 1.00 28.70  ? 71   GLU A CB    1 
ATOM   576  C  CG    . GLU A 1 89  ? -11.028 17.820 29.439 1.00 37.91  ? 71   GLU A CG    1 
ATOM   577  C  CD    . GLU A 1 89  ? -10.530 18.200 28.036 1.00 47.94  ? 71   GLU A CD    1 
ATOM   578  O  OE1   . GLU A 1 89  ? -9.566  19.037 27.921 1.00 50.62  ? 71   GLU A OE1   1 
ATOM   579  O  OE2   . GLU A 1 89  ? -11.074 17.610 27.065 1.00 51.02  ? 71   GLU A OE2   1 
ATOM   580  N  N     . LEU A 1 90  ? -9.064  14.440 31.566 1.00 24.05  ? 72   LEU A N     1 
ATOM   581  C  CA    . LEU A 1 90  ? -8.452  13.102 31.697 1.00 23.83  ? 72   LEU A CA    1 
ATOM   582  C  C     . LEU A 1 90  ? -8.934  12.320 32.922 1.00 23.25  ? 72   LEU A C     1 
ATOM   583  O  O     . LEU A 1 90  ? -9.014  11.098 32.870 1.00 23.99  ? 72   LEU A O     1 
ATOM   584  C  CB    . LEU A 1 90  ? -6.921  13.204 31.707 1.00 23.70  ? 72   LEU A CB    1 
ATOM   585  C  CG    . LEU A 1 90  ? -6.302  13.849 30.461 1.00 23.01  ? 72   LEU A CG    1 
ATOM   586  C  CD1   . LEU A 1 90  ? -4.764  14.107 30.621 1.00 23.44  ? 72   LEU A CD1   1 
ATOM   587  C  CD2   . LEU A 1 90  ? -6.596  13.059 29.203 1.00 25.01  ? 72   LEU A CD2   1 
ATOM   588  N  N     . THR A 1 91  ? -9.227  13.008 34.030 1.00 23.12  ? 73   THR A N     1 
ATOM   589  C  CA    . THR A 1 91  ? -9.778  12.346 35.233 1.00 22.90  ? 73   THR A CA    1 
ATOM   590  C  C     . THR A 1 91  ? -11.191 11.871 34.938 1.00 24.06  ? 73   THR A C     1 
ATOM   591  O  O     . THR A 1 91  ? -11.556 10.740 35.244 1.00 24.66  ? 73   THR A O     1 
ATOM   592  C  CB    . THR A 1 91  ? -9.730  13.280 36.453 1.00 23.00  ? 73   THR A CB    1 
ATOM   593  O  OG1   . THR A 1 91  ? -8.359  13.651 36.663 1.00 20.71  ? 73   THR A OG1   1 
ATOM   594  C  CG2   . THR A 1 91  ? -10.250 12.587 37.737 1.00 21.87  ? 73   THR A CG2   1 
ATOM   595  N  N     . VAL A 1 92  ? -11.988 12.738 34.323 1.00 24.11  ? 74   VAL A N     1 
ATOM   596  C  CA    . VAL A 1 92  ? -13.331 12.359 33.945 1.00 24.90  ? 74   VAL A CA    1 
ATOM   597  C  C     . VAL A 1 92  ? -13.279 11.131 32.996 1.00 26.08  ? 74   VAL A C     1 
ATOM   598  O  O     . VAL A 1 92  ? -14.016 10.166 33.204 1.00 26.72  ? 74   VAL A O     1 
ATOM   599  C  CB    . VAL A 1 92  ? -14.066 13.549 33.296 1.00 25.85  ? 74   VAL A CB    1 
ATOM   600  C  CG1   . VAL A 1 92  ? -15.247 13.073 32.509 1.00 26.71  ? 74   VAL A CG1   1 
ATOM   601  C  CG2   . VAL A 1 92  ? -14.469 14.576 34.385 1.00 22.03  ? 74   VAL A CG2   1 
ATOM   602  N  N     A GLU A 1 93  ? -12.408 11.158 31.991 0.50 26.19  ? 75   GLU A N     1 
ATOM   603  N  N     B GLU A 1 93  ? -12.396 11.190 31.988 0.50 25.96  ? 75   GLU A N     1 
ATOM   604  C  CA    A GLU A 1 93  ? -12.353 10.050 31.036 0.50 27.22  ? 75   GLU A CA    1 
ATOM   605  C  CA    B GLU A 1 93  ? -12.221 10.108 31.001 0.50 26.73  ? 75   GLU A CA    1 
ATOM   606  C  C     A GLU A 1 93  ? -11.939 8.745  31.714 0.50 26.65  ? 75   GLU A C     1 
ATOM   607  C  C     B GLU A 1 93  ? -11.952 8.789  31.725 0.50 26.37  ? 75   GLU A C     1 
ATOM   608  O  O     A GLU A 1 93  ? -12.449 7.688  31.367 0.50 27.09  ? 75   GLU A O     1 
ATOM   609  O  O     B GLU A 1 93  ? -12.577 7.779  31.430 0.50 26.65  ? 75   GLU A O     1 
ATOM   610  C  CB    A GLU A 1 93  ? -11.469 10.384 29.835 0.50 27.46  ? 75   GLU A CB    1 
ATOM   611  C  CB    B GLU A 1 93  ? -11.105 10.437 29.980 0.50 26.78  ? 75   GLU A CB    1 
ATOM   612  C  CG    A GLU A 1 93  ? -12.128 11.325 28.840 0.50 29.73  ? 75   GLU A CG    1 
ATOM   613  C  CG    B GLU A 1 93  ? -10.760 9.289  29.003 0.50 27.81  ? 75   GLU A CG    1 
ATOM   614  C  CD    A GLU A 1 93  ? -11.147 11.941 27.869 0.50 32.11  ? 75   GLU A CD    1 
ATOM   615  C  CD    B GLU A 1 93  ? -9.579  9.578  28.060 0.50 28.24  ? 75   GLU A CD    1 
ATOM   616  O  OE1   A GLU A 1 93  ? -9.960  11.538 27.862 0.50 33.75  ? 75   GLU A OE1   1 
ATOM   617  O  OE1   B GLU A 1 93  ? -8.505  10.047 28.488 0.50 25.71  ? 75   GLU A OE1   1 
ATOM   618  O  OE2   A GLU A 1 93  ? -11.554 12.847 27.113 0.50 32.81  ? 75   GLU A OE2   1 
ATOM   619  O  OE2   B GLU A 1 93  ? -9.729  9.292  26.862 0.50 32.39  ? 75   GLU A OE2   1 
ATOM   620  N  N     . ARG A 1 94  ? -11.051 8.829  32.705 1.00 25.99  ? 76   ARG A N     1 
ATOM   621  C  CA    . ARG A 1 94  ? -10.680 7.649  33.505 1.00 25.05  ? 76   ARG A CA    1 
ATOM   622  C  C     . ARG A 1 94  ? -11.861 7.046  34.297 1.00 25.82  ? 76   ARG A C     1 
ATOM   623  O  O     . ARG A 1 94  ? -12.045 5.836  34.283 1.00 25.18  ? 76   ARG A O     1 
ATOM   624  C  CB    . ARG A 1 94  ? -9.526  7.976  34.443 1.00 24.10  ? 76   ARG A CB    1 
ATOM   625  C  CG    . ARG A 1 94  ? -9.123  6.832  35.379 1.00 21.96  ? 76   ARG A CG    1 
ATOM   626  C  CD    . ARG A 1 94  ? -8.743  5.532  34.628 1.00 25.60  ? 76   ARG A CD    1 
ATOM   627  N  NE    . ARG A 1 94  ? -8.328  4.560  35.633 1.00 27.59  ? 76   ARG A NE    1 
ATOM   628  C  CZ    . ARG A 1 94  ? -7.976  3.303  35.383 1.00 30.31  ? 76   ARG A CZ    1 
ATOM   629  N  NH1   . ARG A 1 94  ? -7.977  2.818  34.133 1.00 29.44  ? 76   ARG A NH1   1 
ATOM   630  N  NH2   . ARG A 1 94  ? -7.652  2.527  36.403 1.00 29.57  ? 76   ARG A NH2   1 
ATOM   631  N  N     . LEU A 1 95  ? -12.648 7.901  34.967 1.00 25.47  ? 77   LEU A N     1 
ATOM   632  C  CA    . LEU A 1 95  ? -13.868 7.478  35.651 1.00 26.52  ? 77   LEU A CA    1 
ATOM   633  C  C     . LEU A 1 95  ? -14.930 6.851  34.744 1.00 27.54  ? 77   LEU A C     1 
ATOM   634  O  O     . LEU A 1 95  ? -15.557 5.844  35.107 1.00 28.33  ? 77   LEU A O     1 
ATOM   635  C  CB    . LEU A 1 95  ? -14.490 8.630  36.458 1.00 24.54  ? 77   LEU A CB    1 
ATOM   636  C  CG    . LEU A 1 95  ? -13.730 9.217  37.651 1.00 25.46  ? 77   LEU A CG    1 
ATOM   637  C  CD1   . LEU A 1 95  ? -14.400 10.529 38.052 1.00 21.19  ? 77   LEU A CD1   1 
ATOM   638  C  CD2   . LEU A 1 95  ? -13.676 8.247  38.832 1.00 21.40  ? 77   LEU A CD2   1 
ATOM   639  N  N     . VAL A 1 96  ? -15.159 7.451  33.578 1.00 28.75  ? 78   VAL A N     1 
ATOM   640  C  CA    . VAL A 1 96  ? -16.075 6.865  32.613 1.00 29.85  ? 78   VAL A CA    1 
ATOM   641  C  C     . VAL A 1 96  ? -15.550 5.509  32.158 1.00 31.17  ? 78   VAL A C     1 
ATOM   642  O  O     . VAL A 1 96  ? -16.317 4.570  32.062 1.00 31.90  ? 78   VAL A O     1 
ATOM   643  C  CB    . VAL A 1 96  ? -16.347 7.794  31.392 1.00 30.05  ? 78   VAL A CB    1 
ATOM   644  C  CG1   . VAL A 1 96  ? -17.191 7.079  30.375 1.00 31.52  ? 78   VAL A CG1   1 
ATOM   645  C  CG2   . VAL A 1 96  ? -17.101 9.045  31.846 1.00 29.00  ? 78   VAL A CG2   1 
ATOM   646  N  N     . SER A 1 97  ? -14.252 5.396  31.895 1.00 31.84  ? 79   SER A N     1 
ATOM   647  C  CA    . SER A 1 97  ? -13.693 4.119  31.439 1.00 33.36  ? 79   SER A CA    1 
ATOM   648  C  C     . SER A 1 97  ? -13.741 2.983  32.493 1.00 33.47  ? 79   SER A C     1 
ATOM   649  O  O     . SER A 1 97  ? -13.807 1.805  32.125 1.00 34.52  ? 79   SER A O     1 
ATOM   650  C  CB    . SER A 1 97  ? -12.292 4.298  30.835 1.00 33.69  ? 79   SER A CB    1 
ATOM   651  O  OG    . SER A 1 97  ? -11.287 4.265  31.809 1.00 37.02  ? 79   SER A OG    1 
ATOM   652  N  N     . ILE A 1 98  ? -13.735 3.327  33.783 1.00 32.72  ? 80   ILE A N     1 
ATOM   653  C  CA    . ILE A 1 98  ? -13.915 2.327  34.843 1.00 32.87  ? 80   ILE A CA    1 
ATOM   654  C  C     . ILE A 1 98  ? -15.401 2.079  35.226 1.00 32.86  ? 80   ILE A C     1 
ATOM   655  O  O     . ILE A 1 98  ? -15.714 1.238  36.073 1.00 33.16  ? 80   ILE A O     1 
ATOM   656  C  CB    . ILE A 1 98  ? -13.045 2.623  36.110 1.00 32.71  ? 80   ILE A CB    1 
ATOM   657  C  CG1   . ILE A 1 98  ? -13.498 3.903  36.815 1.00 32.03  ? 80   ILE A CG1   1 
ATOM   658  C  CG2   . ILE A 1 98  ? -11.563 2.685  35.753 1.00 33.78  ? 80   ILE A CG2   1 
ATOM   659  C  CD1   . ILE A 1 98  ? -13.487 3.792  38.298 1.00 31.75  ? 80   ILE A CD1   1 
ATOM   660  N  N     . GLY A 1 99  ? -16.322 2.804  34.609 1.00 32.47  ? 81   GLY A N     1 
ATOM   661  C  CA    . GLY A 1 99  ? -17.741 2.475  34.771 1.00 32.25  ? 81   GLY A CA    1 
ATOM   662  C  C     . GLY A 1 99  ? -18.694 3.579  35.168 1.00 31.68  ? 81   GLY A C     1 
ATOM   663  O  O     . GLY A 1 99  ? -19.908 3.339  35.237 1.00 31.99  ? 81   GLY A O     1 
ATOM   664  N  N     . TYR A 1 100 ? -18.161 4.769  35.445 1.00 29.94  ? 82   TYR A N     1 
ATOM   665  C  CA    . TYR A 1 100 ? -18.993 5.930  35.788 1.00 30.50  ? 82   TYR A CA    1 
ATOM   666  C  C     . TYR A 1 100 ? -19.884 6.307  34.610 1.00 31.55  ? 82   TYR A C     1 
ATOM   667  O  O     . TYR A 1 100 ? -19.533 6.030  33.457 1.00 32.03  ? 82   TYR A O     1 
ATOM   668  C  CB    . TYR A 1 100 ? -18.135 7.112  36.277 1.00 27.86  ? 82   TYR A CB    1 
ATOM   669  C  CG    . TYR A 1 100 ? -17.882 7.053  37.767 1.00 28.09  ? 82   TYR A CG    1 
ATOM   670  C  CD1   . TYR A 1 100 ? -16.991 6.114  38.304 1.00 27.07  ? 82   TYR A CD1   1 
ATOM   671  C  CD2   . TYR A 1 100 ? -18.561 7.908  38.652 1.00 26.57  ? 82   TYR A CD2   1 
ATOM   672  C  CE1   . TYR A 1 100 ? -16.788 6.035  39.694 1.00 27.19  ? 82   TYR A CE1   1 
ATOM   673  C  CE2   . TYR A 1 100 ? -18.356 7.830  40.032 1.00 27.57  ? 82   TYR A CE2   1 
ATOM   674  C  CZ    . TYR A 1 100 ? -17.471 6.891  40.542 1.00 26.77  ? 82   TYR A CZ    1 
ATOM   675  O  OH    . TYR A 1 100 ? -17.259 6.806  41.904 1.00 25.95  ? 82   TYR A OH    1 
ATOM   676  N  N     . PRO A 1 101 ? -21.068 6.866  34.890 1.00 33.03  ? 83   PRO A N     1 
ATOM   677  C  CA    . PRO A 1 101 ? -21.983 7.138  33.770 1.00 34.81  ? 83   PRO A CA    1 
ATOM   678  C  C     . PRO A 1 101 ? -21.484 8.135  32.713 1.00 35.89  ? 83   PRO A C     1 
ATOM   679  O  O     . PRO A 1 101 ? -20.691 9.035  33.008 1.00 35.18  ? 83   PRO A O     1 
ATOM   680  C  CB    . PRO A 1 101 ? -23.257 7.640  34.450 1.00 35.10  ? 83   PRO A CB    1 
ATOM   681  C  CG    . PRO A 1 101 ? -22.875 7.944  35.865 1.00 33.34  ? 83   PRO A CG    1 
ATOM   682  C  CD    . PRO A 1 101 ? -21.667 7.158  36.204 1.00 32.27  ? 83   PRO A CD    1 
ATOM   683  N  N     . GLN A 1 102 ? -21.974 7.947  31.491 1.00 37.85  ? 84   GLN A N     1 
ATOM   684  C  CA    . GLN A 1 102 ? -21.642 8.744  30.318 1.00 38.95  ? 84   GLN A CA    1 
ATOM   685  C  C     . GLN A 1 102 ? -21.849 10.226 30.513 1.00 38.19  ? 84   GLN A C     1 
ATOM   686  O  O     . GLN A 1 102 ? -21.159 11.013 29.910 1.00 38.16  ? 84   GLN A O     1 
ATOM   687  C  CB    . GLN A 1 102 ? -22.530 8.304  29.149 1.00 40.87  ? 84   GLN A CB    1 
ATOM   688  C  CG    . GLN A 1 102 ? -22.210 6.929  28.623 1.00 45.59  ? 84   GLN A CG    1 
ATOM   689  C  CD    . GLN A 1 102 ? -20.809 6.849  28.034 1.00 50.43  ? 84   GLN A CD    1 
ATOM   690  O  OE1   . GLN A 1 102 ? -20.461 7.598  27.110 1.00 53.99  ? 84   GLN A OE1   1 
ATOM   691  N  NE2   . GLN A 1 102 ? -20.010 5.916  28.541 1.00 51.91  ? 84   GLN A NE2   1 
ATOM   692  N  N     . GLU A 1 103 ? -22.815 10.607 31.338 1.00 38.48  ? 85   GLU A N     1 
ATOM   693  C  CA    . GLU A 1 103 ? -23.105 12.024 31.583 1.00 38.74  ? 85   GLU A CA    1 
ATOM   694  C  C     . GLU A 1 103 ? -21.908 12.818 32.069 1.00 37.08  ? 85   GLU A C     1 
ATOM   695  O  O     . GLU A 1 103 ? -21.834 14.018 31.801 1.00 37.67  ? 85   GLU A O     1 
ATOM   696  C  CB    . GLU A 1 103 ? -24.227 12.221 32.591 1.00 38.90  ? 85   GLU A CB    1 
ATOM   697  C  CG    . GLU A 1 103 ? -25.600 11.904 32.063 1.00 43.19  ? 85   GLU A CG    1 
ATOM   698  C  CD    . GLU A 1 103 ? -26.015 10.470 32.368 1.00 47.38  ? 85   GLU A CD    1 
ATOM   699  O  OE1   . GLU A 1 103 ? -25.137 9.585  32.470 1.00 47.11  ? 85   GLU A OE1   1 
ATOM   700  O  OE2   . GLU A 1 103 ? -27.233 10.231 32.508 1.00 51.60  ? 85   GLU A OE2   1 
ATOM   701  N  N     . LEU A 1 104 ? -20.999 12.168 32.798 1.00 35.32  ? 86   LEU A N     1 
ATOM   702  C  CA    . LEU A 1 104 ? -19.745 12.801 33.210 1.00 33.03  ? 86   LEU A CA    1 
ATOM   703  C  C     . LEU A 1 104 ? -19.079 13.478 32.018 1.00 33.55  ? 86   LEU A C     1 
ATOM   704  O  O     . LEU A 1 104 ? -18.437 14.505 32.179 1.00 33.06  ? 86   LEU A O     1 
ATOM   705  C  CB    . LEU A 1 104 ? -18.793 11.767 33.790 1.00 32.59  ? 86   LEU A CB    1 
ATOM   706  C  CG    . LEU A 1 104 ? -18.818 11.567 35.301 1.00 32.43  ? 86   LEU A CG    1 
ATOM   707  C  CD1   . LEU A 1 104 ? -20.160 11.011 35.829 1.00 32.08  ? 86   LEU A CD1   1 
ATOM   708  C  CD2   . LEU A 1 104 ? -17.648 10.669 35.687 1.00 31.75  ? 86   LEU A CD2   1 
ATOM   709  N  N     . LEU A 1 105 ? -19.265 12.910 30.820 1.00 33.65  ? 87   LEU A N     1 
ATOM   710  C  CA    . LEU A 1 105 ? -18.607 13.409 29.600 1.00 34.18  ? 87   LEU A CA    1 
ATOM   711  C  C     . LEU A 1 105 ? -19.052 14.815 29.203 1.00 34.51  ? 87   LEU A C     1 
ATOM   712  O  O     . LEU A 1 105 ? -18.356 15.509 28.466 1.00 35.45  ? 87   LEU A O     1 
ATOM   713  C  CB    . LEU A 1 105 ? -18.777 12.424 28.430 1.00 35.40  ? 87   LEU A CB    1 
ATOM   714  C  CG    . LEU A 1 105 ? -18.004 11.111 28.591 1.00 34.57  ? 87   LEU A CG    1 
ATOM   715  C  CD1   . LEU A 1 105 ? -18.260 10.189 27.367 1.00 36.94  ? 87   LEU A CD1   1 
ATOM   716  C  CD2   . LEU A 1 105 ? -16.489 11.377 28.835 1.00 29.52  ? 87   LEU A CD2   1 
ATOM   717  N  N     . SER A 1 106 ? -20.174 15.254 29.752 1.00 34.06  ? 88   SER A N     1 
ATOM   718  C  CA    . SER A 1 106 ? -20.686 16.579 29.482 1.00 34.66  ? 88   SER A CA    1 
ATOM   719  C  C     . SER A 1 106 ? -20.320 17.639 30.531 1.00 33.45  ? 88   SER A C     1 
ATOM   720  O  O     . SER A 1 106 ? -20.729 18.791 30.401 1.00 33.80  ? 88   SER A O     1 
ATOM   721  C  CB    . SER A 1 106 ? -22.203 16.500 29.288 1.00 35.67  ? 88   SER A CB    1 
ATOM   722  O  OG    . SER A 1 106 ? -22.801 16.282 30.547 1.00 38.07  ? 88   SER A OG    1 
ATOM   723  N  N     . PHE A 1 107 ? -19.588 17.258 31.583 1.00 31.95  ? 89   PHE A N     1 
ATOM   724  C  CA    . PHE A 1 107 ? -19.017 18.212 32.537 1.00 29.80  ? 89   PHE A CA    1 
ATOM   725  C  C     . PHE A 1 107 ? -17.935 19.006 31.805 1.00 29.57  ? 89   PHE A C     1 
ATOM   726  O  O     . PHE A 1 107 ? -17.278 18.478 30.934 1.00 29.42  ? 89   PHE A O     1 
ATOM   727  C  CB    . PHE A 1 107 ? -18.297 17.503 33.685 1.00 28.54  ? 89   PHE A CB    1 
ATOM   728  C  CG    . PHE A 1 107 ? -19.170 16.657 34.586 1.00 28.22  ? 89   PHE A CG    1 
ATOM   729  C  CD1   . PHE A 1 107 ? -20.562 16.626 34.482 1.00 29.68  ? 89   PHE A CD1   1 
ATOM   730  C  CD2   . PHE A 1 107 ? -18.566 15.894 35.587 1.00 29.53  ? 89   PHE A CD2   1 
ATOM   731  C  CE1   . PHE A 1 107 ? -21.348 15.835 35.349 1.00 28.01  ? 89   PHE A CE1   1 
ATOM   732  C  CE2   . PHE A 1 107 ? -19.344 15.105 36.472 1.00 27.80  ? 89   PHE A CE2   1 
ATOM   733  C  CZ    . PHE A 1 107 ? -20.735 15.088 36.353 1.00 28.11  ? 89   PHE A CZ    1 
ATOM   734  N  N     . ALA A 1 108 ? -17.733 20.265 32.171 1.00 29.28  ? 90   ALA A N     1 
ATOM   735  C  CA    . ALA A 1 108 ? -16.622 21.032 31.616 1.00 28.89  ? 90   ALA A CA    1 
ATOM   736  C  C     . ALA A 1 108 ? -16.036 21.816 32.756 1.00 27.96  ? 90   ALA A C     1 
ATOM   737  O  O     . ALA A 1 108 ? -16.787 22.407 33.548 1.00 26.70  ? 90   ALA A O     1 
ATOM   738  C  CB    . ALA A 1 108 ? -17.101 21.956 30.516 1.00 30.15  ? 90   ALA A CB    1 
ATOM   739  N  N     . TYR A 1 109 ? -14.703 21.813 32.853 1.00 26.30  ? 91   TYR A N     1 
ATOM   740  C  CA    . TYR A 1 109 ? -14.032 22.495 33.944 1.00 26.15  ? 91   TYR A CA    1 
ATOM   741  C  C     . TYR A 1 109 ? -14.510 23.946 34.035 1.00 26.59  ? 91   TYR A C     1 
ATOM   742  O  O     . TYR A 1 109 ? -14.644 24.612 33.028 1.00 26.91  ? 91   TYR A O     1 
ATOM   743  C  CB    . TYR A 1 109 ? -12.501 22.440 33.783 1.00 25.96  ? 91   TYR A CB    1 
ATOM   744  C  CG    . TYR A 1 109 ? -11.800 23.029 34.981 1.00 25.07  ? 91   TYR A CG    1 
ATOM   745  C  CD1   . TYR A 1 109 ? -11.844 22.379 36.231 1.00 24.04  ? 91   TYR A CD1   1 
ATOM   746  C  CD2   . TYR A 1 109 ? -11.139 24.253 34.885 1.00 24.15  ? 91   TYR A CD2   1 
ATOM   747  C  CE1   . TYR A 1 109 ? -11.233 22.917 37.322 1.00 24.73  ? 91   TYR A CE1   1 
ATOM   748  C  CE2   . TYR A 1 109 ? -10.504 24.807 35.971 1.00 21.81  ? 91   TYR A CE2   1 
ATOM   749  C  CZ    . TYR A 1 109 ? -10.549 24.130 37.187 1.00 24.40  ? 91   TYR A CZ    1 
ATOM   750  O  OH    . TYR A 1 109 ? -9.954  24.673 38.287 1.00 24.05  ? 91   TYR A OH    1 
ATOM   751  N  N     . ASP A 1 110 ? -14.750 24.427 35.244 1.00 26.41  ? 92   ASP A N     1 
ATOM   752  C  CA    . ASP A 1 110 ? -15.117 25.820 35.464 1.00 27.48  ? 92   ASP A CA    1 
ATOM   753  C  C     . ASP A 1 110 ? -14.175 26.381 36.500 1.00 26.37  ? 92   ASP A C     1 
ATOM   754  O  O     . ASP A 1 110 ? -14.297 26.077 37.680 1.00 25.19  ? 92   ASP A O     1 
ATOM   755  C  CB    . ASP A 1 110 ? -16.543 25.953 36.015 1.00 28.46  ? 92   ASP A CB    1 
ATOM   756  C  CG    . ASP A 1 110 ? -17.018 27.423 36.051 1.00 32.34  ? 92   ASP A CG    1 
ATOM   757  O  OD1   . ASP A 1 110 ? -16.184 28.348 36.210 1.00 32.46  ? 92   ASP A OD1   1 
ATOM   758  O  OD2   . ASP A 1 110 ? -18.217 27.643 35.838 1.00 36.63  ? 92   ASP A OD2   1 
ATOM   759  N  N     . SER A 1 111 ? -13.274 27.247 36.073 1.00 26.76  ? 93   SER A N     1 
ATOM   760  C  CA    . SER A 1 111 ? -12.277 27.803 36.985 1.00 26.39  ? 93   SER A CA    1 
ATOM   761  C  C     . SER A 1 111 ? -12.842 28.751 38.058 1.00 26.66  ? 93   SER A C     1 
ATOM   762  O  O     . SER A 1 111 ? -12.122 29.079 39.011 1.00 26.87  ? 93   SER A O     1 
ATOM   763  C  CB    . SER A 1 111 ? -11.175 28.492 36.196 1.00 27.38  ? 93   SER A CB    1 
ATOM   764  O  OG    . SER A 1 111 ? -11.625 29.741 35.695 1.00 28.84  ? 93   SER A OG    1 
ATOM   765  N  N     . THR A 1 112 ? -14.106 29.171 37.920 1.00 25.85  ? 94   THR A N     1 
ATOM   766  C  CA    . THR A 1 112 ? -14.722 30.114 38.862 1.00 25.97  ? 94   THR A CA    1 
ATOM   767  C  C     . THR A 1 112 ? -15.320 29.451 40.103 1.00 25.81  ? 94   THR A C     1 
ATOM   768  O  O     . THR A 1 112 ? -15.665 30.138 41.057 1.00 25.24  ? 94   THR A O     1 
ATOM   769  C  CB    . THR A 1 112 ? -15.769 31.023 38.231 1.00 26.54  ? 94   THR A CB    1 
ATOM   770  O  OG1   . THR A 1 112 ? -16.948 30.283 37.875 1.00 28.33  ? 94   THR A OG1   1 
ATOM   771  C  CG2   . THR A 1 112 ? -15.200 31.744 37.027 1.00 27.30  ? 94   THR A CG2   1 
ATOM   772  N  N     . PHE A 1 113 ? -15.419 28.122 40.086 1.00 25.14  ? 95   PHE A N     1 
ATOM   773  C  CA    . PHE A 1 113 ? -15.916 27.410 41.228 1.00 25.10  ? 95   PHE A CA    1 
ATOM   774  C  C     . PHE A 1 113 ? -14.850 27.170 42.295 1.00 24.54  ? 95   PHE A C     1 
ATOM   775  O  O     . PHE A 1 113 ? -15.068 27.617 43.411 1.00 25.49  ? 95   PHE A O     1 
ATOM   776  C  CB    . PHE A 1 113 ? -16.700 26.128 40.893 1.00 24.19  ? 95   PHE A CB    1 
ATOM   777  C  CG    . PHE A 1 113 ? -17.105 25.333 42.131 1.00 24.32  ? 95   PHE A CG    1 
ATOM   778  C  CD1   . PHE A 1 113 ? -18.268 25.629 42.798 1.00 20.25  ? 95   PHE A CD1   1 
ATOM   779  C  CD2   . PHE A 1 113 ? -16.274 24.330 42.652 1.00 22.38  ? 95   PHE A CD2   1 
ATOM   780  C  CE1   . PHE A 1 113 ? -18.652 24.914 43.963 1.00 23.13  ? 95   PHE A CE1   1 
ATOM   781  C  CE2   . PHE A 1 113 ? -16.616 23.639 43.816 1.00 21.36  ? 95   PHE A CE2   1 
ATOM   782  C  CZ    . PHE A 1 113 ? -17.822 23.909 44.473 1.00 22.16  ? 95   PHE A CZ    1 
ATOM   783  N  N     . PRO A 1 114 ? -13.743 26.445 41.974 1.00 24.10  ? 96   PRO A N     1 
ATOM   784  C  CA    . PRO A 1 114 ? -12.845 26.007 43.057 1.00 23.54  ? 96   PRO A CA    1 
ATOM   785  C  C     . PRO A 1 114 ? -11.872 27.069 43.537 1.00 23.23  ? 96   PRO A C     1 
ATOM   786  O  O     . PRO A 1 114 ? -11.319 27.843 42.746 1.00 24.27  ? 96   PRO A O     1 
ATOM   787  C  CB    . PRO A 1 114 ? -12.052 24.841 42.437 1.00 22.62  ? 96   PRO A CB    1 
ATOM   788  C  CG    . PRO A 1 114 ? -12.059 25.108 40.978 1.00 22.29  ? 96   PRO A CG    1 
ATOM   789  C  CD    . PRO A 1 114 ? -13.275 25.947 40.656 1.00 23.07  ? 96   PRO A CD    1 
ATOM   790  N  N     . THR A 1 115 ? -11.723 27.121 44.855 1.00 22.96  ? 97   THR A N     1 
ATOM   791  C  CA    . THR A 1 115 ? -10.621 27.813 45.503 1.00 21.72  ? 97   THR A CA    1 
ATOM   792  C  C     . THR A 1 115 ? -9.739  26.729 46.095 1.00 21.07  ? 97   THR A C     1 
ATOM   793  O  O     . THR A 1 115 ? -10.236 25.703 46.481 1.00 20.81  ? 97   THR A O     1 
ATOM   794  C  CB    . THR A 1 115 ? -11.166 28.728 46.576 1.00 22.55  ? 97   THR A CB    1 
ATOM   795  O  OG1   . THR A 1 115 ? -11.897 29.748 45.898 1.00 24.27  ? 97   THR A OG1   1 
ATOM   796  C  CG2   . THR A 1 115 ? -10.049 29.393 47.412 1.00 17.92  ? 97   THR A CG2   1 
ATOM   797  N  N     . ARG A 1 116 ? -8.437  26.957 46.152 1.00 21.26  ? 98   ARG A N     1 
ATOM   798  C  CA    . ARG A 1 116 ? -7.532  25.983 46.740 1.00 21.67  ? 98   ARG A CA    1 
ATOM   799  C  C     . ARG A 1 116 ? -7.599  25.905 48.287 1.00 21.35  ? 98   ARG A C     1 
ATOM   800  O  O     . ARG A 1 116 ? -7.873  26.917 48.960 1.00 22.46  ? 98   ARG A O     1 
ATOM   801  C  CB    . ARG A 1 116 ? -6.122  26.305 46.282 1.00 22.44  ? 98   ARG A CB    1 
ATOM   802  C  CG    . ARG A 1 116 ? -5.126  25.297 46.709 1.00 21.83  ? 98   ARG A CG    1 
ATOM   803  C  CD    . ARG A 1 116 ? -3.908  25.425 45.821 1.00 24.91  ? 98   ARG A CD    1 
ATOM   804  N  NE    . ARG A 1 116 ? -3.251  26.735 45.813 1.00 24.33  ? 98   ARG A NE    1 
ATOM   805  C  CZ    . ARG A 1 116 ? -2.042  27.000 46.337 1.00 27.03  ? 98   ARG A CZ    1 
ATOM   806  N  NH1   . ARG A 1 116 ? -1.358  26.070 46.994 1.00 25.79  ? 98   ARG A NH1   1 
ATOM   807  N  NH2   . ARG A 1 116 ? -1.519  28.218 46.224 1.00 22.03  ? 98   ARG A NH2   1 
ATOM   808  N  N     . GLY A 1 117 ? -7.347  24.714 48.834 1.00 20.65  ? 99   GLY A N     1 
ATOM   809  C  CA    . GLY A 1 117 ? -7.264  24.500 50.272 1.00 19.56  ? 99   GLY A CA    1 
ATOM   810  C  C     . GLY A 1 117 ? -8.617  24.106 50.877 1.00 19.70  ? 99   GLY A C     1 
ATOM   811  O  O     . GLY A 1 117 ? -8.756  24.066 52.098 1.00 19.77  ? 99   GLY A O     1 
ATOM   812  N  N     . LEU A 1 118 ? -9.618  23.821 50.042 1.00 18.32  ? 100  LEU A N     1 
ATOM   813  C  CA    . LEU A 1 118 ? -10.882 23.280 50.578 1.00 19.02  ? 100  LEU A CA    1 
ATOM   814  C  C     . LEU A 1 118 ? -10.713 21.899 51.193 1.00 18.25  ? 100  LEU A C     1 
ATOM   815  O  O     . LEU A 1 118 ? -9.719  21.206 50.956 1.00 18.56  ? 100  LEU A O     1 
ATOM   816  C  CB    . LEU A 1 118 ? -12.027 23.345 49.550 1.00 17.83  ? 100  LEU A CB    1 
ATOM   817  C  CG    . LEU A 1 118 ? -12.242 24.742 48.948 1.00 19.41  ? 100  LEU A CG    1 
ATOM   818  C  CD1   . LEU A 1 118 ? -13.212 24.682 47.765 1.00 17.69  ? 100  LEU A CD1   1 
ATOM   819  C  CD2   . LEU A 1 118 ? -12.806 25.735 50.006 1.00 19.53  ? 100  LEU A CD2   1 
ATOM   820  N  N     . VAL A 1 119 ? -11.666 21.535 52.052 1.00 18.51  ? 101  VAL A N     1 
ATOM   821  C  CA    . VAL A 1 119 ? -11.676 20.258 52.751 1.00 18.40  ? 101  VAL A CA    1 
ATOM   822  C  C     . VAL A 1 119 ? -12.884 19.488 52.259 1.00 18.88  ? 101  VAL A C     1 
ATOM   823  O  O     . VAL A 1 119 ? -14.026 20.017 52.299 1.00 18.38  ? 101  VAL A O     1 
ATOM   824  C  CB    . VAL A 1 119 ? -11.731 20.444 54.286 1.00 18.73  ? 101  VAL A CB    1 
ATOM   825  C  CG1   . VAL A 1 119 ? -11.736 19.083 55.009 1.00 19.45  ? 101  VAL A CG1   1 
ATOM   826  C  CG2   . VAL A 1 119 ? -10.531 21.317 54.800 1.00 16.62  ? 101  VAL A CG2   1 
ATOM   827  N  N     . PHE A 1 120 ? -12.651 18.279 51.738 1.00 17.46  ? 102  PHE A N     1 
ATOM   828  C  CA    . PHE A 1 120 ? -13.780 17.428 51.387 1.00 17.74  ? 102  PHE A CA    1 
ATOM   829  C  C     . PHE A 1 120 ? -14.103 16.544 52.562 1.00 19.12  ? 102  PHE A C     1 
ATOM   830  O  O     . PHE A 1 120 ? -13.233 15.844 53.097 1.00 20.67  ? 102  PHE A O     1 
ATOM   831  C  CB    . PHE A 1 120 ? -13.524 16.581 50.124 1.00 17.80  ? 102  PHE A CB    1 
ATOM   832  C  CG    . PHE A 1 120 ? -14.766 15.923 49.580 1.00 17.37  ? 102  PHE A CG    1 
ATOM   833  C  CD1   . PHE A 1 120 ? -15.749 16.687 48.947 1.00 18.33  ? 102  PHE A CD1   1 
ATOM   834  C  CD2   . PHE A 1 120 ? -14.966 14.552 49.735 1.00 18.49  ? 102  PHE A CD2   1 
ATOM   835  C  CE1   . PHE A 1 120 ? -16.931 16.097 48.457 1.00 19.07  ? 102  PHE A CE1   1 
ATOM   836  C  CE2   . PHE A 1 120 ? -16.168 13.942 49.236 1.00 20.90  ? 102  PHE A CE2   1 
ATOM   837  C  CZ    . PHE A 1 120 ? -17.121 14.721 48.583 1.00 19.55  ? 102  PHE A CZ    1 
ATOM   838  N  N     . ASP A 1 121 ? -15.367 16.586 52.970 1.00 19.55  ? 103  ASP A N     1 
ATOM   839  C  CA    . ASP A 1 121 ? -15.853 15.749 54.023 1.00 19.80  ? 103  ASP A CA    1 
ATOM   840  C  C     . ASP A 1 121 ? -16.413 14.508 53.346 1.00 19.75  ? 103  ASP A C     1 
ATOM   841  O  O     . ASP A 1 121 ? -17.488 14.584 52.726 1.00 19.22  ? 103  ASP A O     1 
ATOM   842  C  CB    . ASP A 1 121 ? -16.960 16.487 54.786 1.00 19.85  ? 103  ASP A CB    1 
ATOM   843  C  CG    . ASP A 1 121 ? -17.601 15.629 55.896 1.00 21.86  ? 103  ASP A CG    1 
ATOM   844  O  OD1   . ASP A 1 121 ? -17.305 14.406 56.044 1.00 23.85  ? 103  ASP A OD1   1 
ATOM   845  O  OD2   . ASP A 1 121 ? -18.463 16.203 56.604 1.00 19.99  ? 103  ASP A OD2   1 
ATOM   846  N  N     . THR A 1 122 ? -15.711 13.368 53.498 1.00 19.88  ? 104  THR A N     1 
ATOM   847  C  CA    . THR A 1 122 ? -16.134 12.113 52.844 1.00 20.62  ? 104  THR A CA    1 
ATOM   848  C  C     . THR A 1 122 ? -17.358 11.460 53.508 1.00 21.81  ? 104  THR A C     1 
ATOM   849  O  O     . THR A 1 122 ? -17.927 10.513 52.969 1.00 23.48  ? 104  THR A O     1 
ATOM   850  C  CB    . THR A 1 122 ? -15.018 11.094 52.855 1.00 20.97  ? 104  THR A CB    1 
ATOM   851  O  OG1   . THR A 1 122 ? -14.694 10.765 54.219 1.00 20.76  ? 104  THR A OG1   1 
ATOM   852  C  CG2   . THR A 1 122 ? -13.812 11.643 52.149 1.00 17.91  ? 104  THR A CG2   1 
ATOM   853  N  N     . LEU A 1 123 ? -17.770 11.959 54.677 1.00 21.69  ? 105  LEU A N     1 
ATOM   854  C  CA    . LEU A 1 123 ? -18.954 11.382 55.333 1.00 21.19  ? 105  LEU A CA    1 
ATOM   855  C  C     . LEU A 1 123 ? -20.180 11.924 54.634 1.00 21.97  ? 105  LEU A C     1 
ATOM   856  O  O     . LEU A 1 123 ? -21.001 11.139 54.188 1.00 21.88  ? 105  LEU A O     1 
ATOM   857  C  CB    . LEU A 1 123 ? -19.004 11.651 56.849 1.00 21.36  ? 105  LEU A CB    1 
ATOM   858  C  CG    . LEU A 1 123 ? -20.163 10.980 57.632 1.00 22.63  ? 105  LEU A CG    1 
ATOM   859  C  CD1   . LEU A 1 123 ? -20.167 9.413  57.466 1.00 22.11  ? 105  LEU A CD1   1 
ATOM   860  C  CD2   . LEU A 1 123 ? -20.152 11.344 59.093 1.00 20.29  ? 105  LEU A CD2   1 
ATOM   861  N  N     . TYR A 1 124 ? -20.284 13.255 54.510 1.00 22.13  ? 106  TYR A N     1 
ATOM   862  C  CA    . TYR A 1 124 ? -21.508 13.904 53.998 1.00 22.10  ? 106  TYR A CA    1 
ATOM   863  C  C     . TYR A 1 124 ? -21.427 14.497 52.602 1.00 22.08  ? 106  TYR A C     1 
ATOM   864  O  O     . TYR A 1 124 ? -22.437 14.999 52.083 1.00 22.86  ? 106  TYR A O     1 
ATOM   865  C  CB    . TYR A 1 124 ? -21.992 14.982 54.971 1.00 22.38  ? 106  TYR A CB    1 
ATOM   866  C  CG    . TYR A 1 124 ? -22.328 14.453 56.326 1.00 24.30  ? 106  TYR A CG    1 
ATOM   867  C  CD1   . TYR A 1 124 ? -23.306 13.435 56.499 1.00 25.65  ? 106  TYR A CD1   1 
ATOM   868  C  CD2   . TYR A 1 124 ? -21.707 14.981 57.452 1.00 26.81  ? 106  TYR A CD2   1 
ATOM   869  C  CE1   . TYR A 1 124 ? -23.620 12.966 57.774 1.00 24.98  ? 106  TYR A CE1   1 
ATOM   870  C  CE2   . TYR A 1 124 ? -22.028 14.529 58.723 1.00 25.94  ? 106  TYR A CE2   1 
ATOM   871  C  CZ    . TYR A 1 124 ? -22.972 13.529 58.866 1.00 25.95  ? 106  TYR A CZ    1 
ATOM   872  O  OH    . TYR A 1 124 ? -23.247 13.083 60.136 1.00 25.67  ? 106  TYR A OH    1 
ATOM   873  N  N     . GLY A 1 125 ? -20.265 14.402 51.964 1.00 21.30  ? 107  GLY A N     1 
ATOM   874  C  CA    . GLY A 1 125 ? -20.160 14.812 50.569 1.00 20.25  ? 107  GLY A CA    1 
ATOM   875  C  C     . GLY A 1 125 ? -20.077 16.319 50.378 1.00 20.18  ? 107  GLY A C     1 
ATOM   876  O  O     . GLY A 1 125 ? -20.460 16.828 49.350 1.00 20.15  ? 107  GLY A O     1 
ATOM   877  N  N     . ASN A 1 126 ? -19.557 17.041 51.368 1.00 19.54  ? 108  ASN A N     1 
ATOM   878  C  CA    . ASN A 1 126 ? -19.526 18.488 51.303 1.00 20.00  ? 108  ASN A CA    1 
ATOM   879  C  C     . ASN A 1 126 ? -18.110 18.953 51.028 1.00 19.01  ? 108  ASN A C     1 
ATOM   880  O  O     . ASN A 1 126 ? -17.199 18.332 51.507 1.00 19.62  ? 108  ASN A O     1 
ATOM   881  C  CB    . ASN A 1 126 ? -20.008 19.081 52.644 1.00 20.18  ? 108  ASN A CB    1 
ATOM   882  C  CG    . ASN A 1 126 ? -21.461 18.745 52.932 1.00 21.66  ? 108  ASN A CG    1 
ATOM   883  O  OD1   . ASN A 1 126 ? -22.290 18.783 52.032 1.00 23.58  ? 108  ASN A OD1   1 
ATOM   884  N  ND2   . ASN A 1 126 ? -21.759 18.370 54.155 1.00 20.75  ? 108  ASN A ND2   1 
ATOM   885  N  N     . LEU A 1 127 ? -17.953 20.045 50.275 1.00 18.39  ? 109  LEU A N     1 
ATOM   886  C  CA    . LEU A 1 127 ? -16.707 20.814 50.276 1.00 19.10  ? 109  LEU A CA    1 
ATOM   887  C  C     . LEU A 1 127 ? -16.828 21.886 51.324 1.00 19.38  ? 109  LEU A C     1 
ATOM   888  O  O     . LEU A 1 127 ? -17.831 22.598 51.369 1.00 20.05  ? 109  LEU A O     1 
ATOM   889  C  CB    . LEU A 1 127 ? -16.429 21.470 48.911 1.00 18.52  ? 109  LEU A CB    1 
ATOM   890  C  CG    . LEU A 1 127 ? -15.865 20.534 47.861 1.00 19.78  ? 109  LEU A CG    1 
ATOM   891  C  CD1   . LEU A 1 127 ? -15.930 21.236 46.506 1.00 21.20  ? 109  LEU A CD1   1 
ATOM   892  C  CD2   . LEU A 1 127 ? -14.426 20.135 48.197 1.00 20.44  ? 109  LEU A CD2   1 
ATOM   893  N  N     . LEU A 1 128 ? -15.811 21.993 52.164 1.00 18.95  ? 110  LEU A N     1 
ATOM   894  C  CA    . LEU A 1 128 ? -15.817 22.968 53.264 1.00 19.34  ? 110  LEU A CA    1 
ATOM   895  C  C     . LEU A 1 128 ? -14.658 23.932 53.165 1.00 19.04  ? 110  LEU A C     1 
ATOM   896  O  O     . LEU A 1 128 ? -13.551 23.509 52.883 1.00 18.28  ? 110  LEU A O     1 
ATOM   897  C  CB    . LEU A 1 128 ? -15.715 22.231 54.615 1.00 19.46  ? 110  LEU A CB    1 
ATOM   898  C  CG    . LEU A 1 128 ? -16.717 21.106 54.878 1.00 18.92  ? 110  LEU A CG    1 
ATOM   899  C  CD1   . LEU A 1 128 ? -16.355 20.455 56.217 1.00 19.18  ? 110  LEU A CD1   1 
ATOM   900  C  CD2   . LEU A 1 128 ? -18.131 21.634 54.892 1.00 17.17  ? 110  LEU A CD2   1 
ATOM   901  N  N     . LYS A 1 129 ? -14.906 25.218 53.396 1.00 18.56  ? 111  LYS A N     1 
ATOM   902  C  CA    . LYS A 1 129 ? -13.800 26.156 53.620 1.00 20.13  ? 111  LYS A CA    1 
ATOM   903  C  C     . LYS A 1 129 ? -13.811 26.401 55.110 1.00 19.69  ? 111  LYS A C     1 
ATOM   904  O  O     . LYS A 1 129 ? -14.825 26.772 55.678 1.00 20.45  ? 111  LYS A O     1 
ATOM   905  C  CB    . LYS A 1 129 ? -14.031 27.470 52.912 1.00 19.56  ? 111  LYS A CB    1 
ATOM   906  C  CG    . LYS A 1 129 ? -12.833 28.349 52.756 1.00 20.81  ? 111  LYS A CG    1 
ATOM   907  C  CD    . LYS A 1 129 ? -13.397 29.620 52.095 1.00 22.72  ? 111  LYS A CD    1 
ATOM   908  C  CE    . LYS A 1 129 ? -12.360 30.584 51.671 1.00 25.33  ? 111  LYS A CE    1 
ATOM   909  N  NZ    . LYS A 1 129 ? -12.966 31.782 50.960 1.00 22.36  ? 111  LYS A NZ    1 
ATOM   910  N  N     . VAL A 1 130 ? -12.676 26.181 55.738 1.00 19.04  ? 112  VAL A N     1 
ATOM   911  C  CA    . VAL A 1 130 ? -12.617 26.256 57.190 1.00 20.59  ? 112  VAL A CA    1 
ATOM   912  C  C     . VAL A 1 130 ? -11.490 27.185 57.643 1.00 20.19  ? 112  VAL A C     1 
ATOM   913  O  O     . VAL A 1 130 ? -10.581 27.480 56.859 1.00 19.92  ? 112  VAL A O     1 
ATOM   914  C  CB    . VAL A 1 130 ? -12.492 24.837 57.899 1.00 20.01  ? 112  VAL A CB    1 
ATOM   915  C  CG1   . VAL A 1 130 ? -13.681 23.903 57.549 1.00 20.87  ? 112  VAL A CG1   1 
ATOM   916  C  CG2   . VAL A 1 130 ? -11.164 24.187 57.628 1.00 18.40  ? 112  VAL A CG2   1 
ATOM   917  N  N     . ASP A 1 131 ? -11.590 27.670 58.881 1.00 19.51  ? 113  ASP A N     1 
ATOM   918  C  CA    . ASP A 1 131 ? -10.452 28.369 59.484 1.00 20.56  ? 113  ASP A CA    1 
ATOM   919  C  C     . ASP A 1 131 ? -9.460  27.394 60.164 1.00 20.82  ? 113  ASP A C     1 
ATOM   920  O  O     . ASP A 1 131 ? -9.608  26.137 60.049 1.00 19.99  ? 113  ASP A O     1 
ATOM   921  C  CB    . ASP A 1 131 ? -10.900 29.500 60.445 1.00 20.15  ? 113  ASP A CB    1 
ATOM   922  C  CG    . ASP A 1 131 ? -11.508 28.985 61.708 1.00 23.74  ? 113  ASP A CG    1 
ATOM   923  O  OD1   . ASP A 1 131 ? -11.327 27.776 62.004 1.00 21.76  ? 113  ASP A OD1   1 
ATOM   924  O  OD2   . ASP A 1 131 ? -12.173 29.783 62.433 1.00 28.35  ? 113  ASP A OD2   1 
ATOM   925  N  N     . ALA A 1 132 ? -8.449  27.953 60.848 1.00 21.35  ? 114  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 132 ? -7.349  27.132 61.428 1.00 22.51  ? 114  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 132 ? -7.808  26.192 62.526 1.00 23.16  ? 114  ALA A C     1 
ATOM   928  O  O     . ALA A 1 132 ? -7.069  25.269 62.889 1.00 24.75  ? 114  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 132 ? -6.247  28.007 61.962 1.00 22.35  ? 114  ALA A CB    1 
ATOM   930  N  N     . TYR A 1 133 ? -9.013  26.432 63.041 1.00 22.58  ? 115  TYR A N     1 
ATOM   931  C  CA    . TYR A 1 133 ? -9.581  25.728 64.189 1.00 22.88  ? 115  TYR A CA    1 
ATOM   932  C  C     . TYR A 1 133 ? -10.648 24.728 63.741 1.00 23.66  ? 115  TYR A C     1 
ATOM   933  O  O     . TYR A 1 133 ? -11.279 24.088 64.565 1.00 25.56  ? 115  TYR A O     1 
ATOM   934  C  CB    . TYR A 1 133 ? -10.185 26.756 65.190 1.00 22.75  ? 115  TYR A CB    1 
ATOM   935  C  CG    . TYR A 1 133 ? -9.105  27.667 65.720 1.00 21.57  ? 115  TYR A CG    1 
ATOM   936  C  CD1   . TYR A 1 133 ? -8.205  27.196 66.703 1.00 23.62  ? 115  TYR A CD1   1 
ATOM   937  C  CD2   . TYR A 1 133 ? -8.911  28.944 65.184 1.00 20.81  ? 115  TYR A CD2   1 
ATOM   938  C  CE1   . TYR A 1 133 ? -7.150  27.995 67.169 1.00 22.94  ? 115  TYR A CE1   1 
ATOM   939  C  CE2   . TYR A 1 133 ? -7.846  29.769 65.621 1.00 24.63  ? 115  TYR A CE2   1 
ATOM   940  C  CZ    . TYR A 1 133 ? -6.980  29.292 66.633 1.00 23.14  ? 115  TYR A CZ    1 
ATOM   941  O  OH    . TYR A 1 133 ? -5.922  30.076 67.090 1.00 23.89  ? 115  TYR A OH    1 
ATOM   942  N  N     . GLY A 1 134 ? -10.862 24.612 62.435 1.00 22.00  ? 116  GLY A N     1 
ATOM   943  C  CA    . GLY A 1 134 ? -11.903 23.747 61.952 1.00 21.47  ? 116  GLY A CA    1 
ATOM   944  C  C     . GLY A 1 134 ? -13.285 24.381 61.951 1.00 21.64  ? 116  GLY A C     1 
ATOM   945  O  O     . GLY A 1 134 ? -14.268 23.672 61.735 1.00 21.19  ? 116  GLY A O     1 
ATOM   946  N  N     . ASN A 1 135 ? -13.388 25.697 62.165 1.00 21.55  ? 117  ASN A N     1 
ATOM   947  C  CA    . ASN A 1 135 ? -14.687 26.356 62.048 1.00 23.12  ? 117  ASN A CA    1 
ATOM   948  C  C     . ASN A 1 135 ? -15.107 26.530 60.594 1.00 22.61  ? 117  ASN A C     1 
ATOM   949  O  O     . ASN A 1 135 ? -14.306 26.887 59.748 1.00 21.42  ? 117  ASN A O     1 
ATOM   950  C  CB    . ASN A 1 135 ? -14.683 27.707 62.740 1.00 23.61  ? 117  ASN A CB    1 
ATOM   951  C  CG    . ASN A 1 135 ? -14.262 27.610 64.196 1.00 26.02  ? 117  ASN A CG    1 
ATOM   952  O  OD1   . ASN A 1 135 ? -14.729 26.738 64.947 1.00 26.36  ? 117  ASN A OD1   1 
ATOM   953  N  ND2   . ASN A 1 135 ? -13.409 28.524 64.610 1.00 26.27  ? 117  ASN A ND2   1 
ATOM   954  N  N     . LEU A 1 136 ? -16.388 26.284 60.330 1.00 23.32  ? 118  LEU A N     1 
ATOM   955  C  CA    . LEU A 1 136 ? -16.921 26.326 58.989 1.00 23.05  ? 118  LEU A CA    1 
ATOM   956  C  C     . LEU A 1 136 ? -17.106 27.748 58.566 1.00 23.56  ? 118  LEU A C     1 
ATOM   957  O  O     . LEU A 1 136 ? -17.793 28.513 59.255 1.00 23.85  ? 118  LEU A O     1 
ATOM   958  C  CB    . LEU A 1 136 ? -18.268 25.594 58.942 1.00 24.05  ? 118  LEU A CB    1 
ATOM   959  C  CG    . LEU A 1 136 ? -18.293 24.173 58.404 1.00 25.77  ? 118  LEU A CG    1 
ATOM   960  C  CD1   . LEU A 1 136 ? -17.334 23.267 59.136 1.00 26.99  ? 118  LEU A CD1   1 
ATOM   961  C  CD2   . LEU A 1 136 ? -19.715 23.644 58.501 1.00 25.91  ? 118  LEU A CD2   1 
ATOM   962  N  N     . LEU A 1 137 ? -16.491 28.100 57.432 1.00 23.30  ? 119  LEU A N     1 
ATOM   963  C  CA    . LEU A 1 137 ? -16.674 29.393 56.785 1.00 23.43  ? 119  LEU A CA    1 
ATOM   964  C  C     . LEU A 1 137 ? -17.610 29.231 55.600 1.00 24.39  ? 119  LEU A C     1 
ATOM   965  O  O     . LEU A 1 137 ? -18.513 30.047 55.392 1.00 24.38  ? 119  LEU A O     1 
ATOM   966  C  CB    . LEU A 1 137 ? -15.320 29.955 56.331 1.00 22.68  ? 119  LEU A CB    1 
ATOM   967  C  CG    . LEU A 1 137 ? -14.235 30.084 57.431 1.00 19.55  ? 119  LEU A CG    1 
ATOM   968  C  CD1   . LEU A 1 137 ? -12.965 30.700 56.831 1.00 18.73  ? 119  LEU A CD1   1 
ATOM   969  C  CD2   . LEU A 1 137 ? -14.718 30.877 58.681 1.00 20.64  ? 119  LEU A CD2   1 
ATOM   970  N  N     . VAL A 1 138 ? -17.429 28.157 54.833 1.00 24.16  ? 120  VAL A N     1 
ATOM   971  C  CA    . VAL A 1 138 ? -18.335 27.890 53.693 1.00 24.50  ? 120  VAL A CA    1 
ATOM   972  C  C     . VAL A 1 138 ? -18.619 26.403 53.649 1.00 23.97  ? 120  VAL A C     1 
ATOM   973  O  O     . VAL A 1 138 ? -17.752 25.603 53.960 1.00 24.36  ? 120  VAL A O     1 
ATOM   974  C  CB    . VAL A 1 138 ? -17.727 28.387 52.311 1.00 23.94  ? 120  VAL A CB    1 
ATOM   975  C  CG1   . VAL A 1 138 ? -18.664 28.084 51.116 1.00 25.01  ? 120  VAL A CG1   1 
ATOM   976  C  CG2   . VAL A 1 138 ? -17.396 29.872 52.368 1.00 25.08  ? 120  VAL A CG2   1 
ATOM   977  N  N     . CYS A 1 139 ? -19.814 26.045 53.213 1.00 25.15  ? 121  CYS A N     1 
ATOM   978  C  CA    . CYS A 1 139 ? -20.225 24.655 53.048 1.00 25.10  ? 121  CYS A CA    1 
ATOM   979  C  C     . CYS A 1 139 ? -21.035 24.506 51.774 1.00 24.59  ? 121  CYS A C     1 
ATOM   980  O  O     . CYS A 1 139 ? -22.097 25.102 51.662 1.00 25.16  ? 121  CYS A O     1 
ATOM   981  C  CB    . CYS A 1 139 ? -21.086 24.205 54.242 1.00 26.22  ? 121  CYS A CB    1 
ATOM   982  S  SG    . CYS A 1 139 ? -21.615 22.429 54.124 1.00 29.13  ? 121  CYS A SG    1 
ATOM   983  N  N     . ALA A 1 140 ? -20.535 23.719 50.819 1.00 23.41  ? 122  ALA A N     1 
ATOM   984  C  CA    . ALA A 1 140 ? -21.243 23.492 49.567 1.00 23.22  ? 122  ALA A CA    1 
ATOM   985  C  C     . ALA A 1 140 ? -21.480 21.997 49.394 1.00 22.19  ? 122  ALA A C     1 
ATOM   986  O  O     . ALA A 1 140 ? -20.540 21.217 49.426 1.00 23.01  ? 122  ALA A O     1 
ATOM   987  C  CB    . ALA A 1 140 ? -20.427 24.039 48.385 1.00 22.18  ? 122  ALA A CB    1 
ATOM   988  N  N     . HIS A 1 141 ? -22.727 21.608 49.184 1.00 22.85  ? 123  HIS A N     1 
ATOM   989  C  CA    . HIS A 1 141 ? -23.074 20.248 48.812 1.00 22.77  ? 123  HIS A CA    1 
ATOM   990  C  C     . HIS A 1 141 ? -23.432 20.286 47.318 1.00 24.21  ? 123  HIS A C     1 
ATOM   991  O  O     . HIS A 1 141 ? -24.425 20.924 46.928 1.00 24.12  ? 123  HIS A O     1 
ATOM   992  C  CB    . HIS A 1 141 ? -24.255 19.765 49.651 1.00 24.30  ? 123  HIS A CB    1 
ATOM   993  C  CG    . HIS A 1 141 ? -24.578 18.324 49.448 1.00 25.00  ? 123  HIS A CG    1 
ATOM   994  N  ND1   . HIS A 1 141 ? -23.861 17.313 50.047 1.00 25.40  ? 123  HIS A ND1   1 
ATOM   995  C  CD2   . HIS A 1 141 ? -25.530 17.719 48.699 1.00 26.92  ? 123  HIS A CD2   1 
ATOM   996  C  CE1   . HIS A 1 141 ? -24.354 16.149 49.674 1.00 24.57  ? 123  HIS A CE1   1 
ATOM   997  N  NE2   . HIS A 1 141 ? -25.359 16.367 48.848 1.00 27.91  ? 123  HIS A NE2   1 
ATOM   998  N  N     . GLY A 1 142 ? -22.608 19.657 46.474 1.00 24.28  ? 124  GLY A N     1 
ATOM   999  C  CA    . GLY A 1 142 ? -22.738 19.895 45.030 1.00 25.52  ? 124  GLY A CA    1 
ATOM   1000 C  C     . GLY A 1 142 ? -22.463 21.374 44.758 1.00 25.82  ? 124  GLY A C     1 
ATOM   1001 O  O     . GLY A 1 142 ? -21.435 21.925 45.192 1.00 25.79  ? 124  GLY A O     1 
ATOM   1002 N  N     . PHE A 1 143 ? -23.385 22.017 44.044 1.00 25.79  ? 125  PHE A N     1 
ATOM   1003 C  CA    . PHE A 1 143 ? -23.315 23.463 43.804 1.00 26.77  ? 125  PHE A CA    1 
ATOM   1004 C  C     . PHE A 1 143 ? -24.279 24.234 44.717 1.00 26.98  ? 125  PHE A C     1 
ATOM   1005 O  O     . PHE A 1 143 ? -24.595 25.404 44.470 1.00 29.27  ? 125  PHE A O     1 
ATOM   1006 C  CB    . PHE A 1 143 ? -23.586 23.743 42.315 1.00 26.84  ? 125  PHE A CB    1 
ATOM   1007 C  CG    . PHE A 1 143 ? -22.586 23.076 41.408 1.00 26.59  ? 125  PHE A CG    1 
ATOM   1008 C  CD1   . PHE A 1 143 ? -21.222 23.234 41.647 1.00 24.95  ? 125  PHE A CD1   1 
ATOM   1009 C  CD2   . PHE A 1 143 ? -22.995 22.297 40.351 1.00 24.62  ? 125  PHE A CD2   1 
ATOM   1010 C  CE1   . PHE A 1 143 ? -20.290 22.614 40.860 1.00 23.82  ? 125  PHE A CE1   1 
ATOM   1011 C  CE2   . PHE A 1 143 ? -22.065 21.658 39.545 1.00 25.99  ? 125  PHE A CE2   1 
ATOM   1012 C  CZ    . PHE A 1 143 ? -20.712 21.820 39.803 1.00 23.45  ? 125  PHE A CZ    1 
ATOM   1013 N  N     . ASN A 1 144 ? -24.738 23.567 45.765 1.00 31.32  ? 126  ASN A N     1 
ATOM   1014 C  CA    . ASN A 1 144 ? -25.704 24.121 46.682 1.00 33.41  ? 126  ASN A CA    1 
ATOM   1015 C  C     . ASN A 1 144 ? -24.978 24.632 47.930 1.00 32.09  ? 126  ASN A C     1 
ATOM   1016 O  O     . ASN A 1 144 ? -24.440 23.844 48.695 1.00 28.29  ? 126  ASN A O     1 
ATOM   1017 C  CB    . ASN A 1 144 ? -26.732 23.045 47.054 1.00 35.05  ? 126  ASN A CB    1 
ATOM   1018 C  CG    . ASN A 1 144 ? -27.855 23.582 47.954 1.00 43.23  ? 126  ASN A CG    1 
ATOM   1019 O  OD1   . ASN A 1 144 ? -28.386 24.678 47.719 1.00 50.78  ? 126  ASN A OD1   1 
ATOM   1020 N  ND2   . ASN A 1 144 ? -28.225 22.809 48.986 1.00 44.59  ? 126  ASN A ND2   1 
ATOM   1021 N  N     . PHE A 1 145 ? -24.943 25.953 48.110 1.00 34.98  ? 127  PHE A N     1 
ATOM   1022 C  CA    . PHE A 1 145 ? -24.243 26.558 49.237 1.00 36.73  ? 127  PHE A CA    1 
ATOM   1023 C  C     . PHE A 1 145 ? -25.137 26.583 50.461 1.00 39.12  ? 127  PHE A C     1 
ATOM   1024 O  O     . PHE A 1 145 ? -26.206 27.180 50.459 1.00 42.60  ? 127  PHE A O     1 
ATOM   1025 C  CB    . PHE A 1 145 ? -23.655 27.931 48.880 1.00 41.30  ? 127  PHE A CB    1 
ATOM   1026 C  CG    . PHE A 1 145 ? -22.449 27.837 47.983 1.00 38.99  ? 127  PHE A CG    1 
ATOM   1027 C  CD1   . PHE A 1 145 ? -22.584 27.481 46.626 1.00 38.80  ? 127  PHE A CD1   1 
ATOM   1028 C  CD2   . PHE A 1 145 ? -21.178 28.076 48.488 1.00 40.43  ? 127  PHE A CD2   1 
ATOM   1029 C  CE1   . PHE A 1 145 ? -21.478 27.372 45.778 1.00 35.77  ? 127  PHE A CE1   1 
ATOM   1030 C  CE2   . PHE A 1 145 ? -20.056 27.975 47.657 1.00 40.04  ? 127  PHE A CE2   1 
ATOM   1031 C  CZ    . PHE A 1 145 ? -20.208 27.620 46.299 1.00 39.58  ? 127  PHE A CZ    1 
ATOM   1032 N  N     . ILE A 1 146 ? -24.698 25.848 51.484 1.00 37.35  ? 128  ILE A N     1 
ATOM   1033 C  CA    . ILE A 1 146 ? -25.503 25.648 52.686 1.00 40.18  ? 128  ILE A CA    1 
ATOM   1034 C  C     . ILE A 1 146 ? -25.277 26.839 53.614 1.00 45.97  ? 128  ILE A C     1 
ATOM   1035 O  O     . ILE A 1 146 ? -24.144 27.114 54.016 1.00 45.30  ? 128  ILE A O     1 
ATOM   1036 C  CB    . ILE A 1 146 ? -25.194 24.274 53.377 1.00 35.66  ? 128  ILE A CB    1 
ATOM   1037 C  CG1   . ILE A 1 146 ? -25.132 23.118 52.350 1.00 31.04  ? 128  ILE A CG1   1 
ATOM   1038 C  CG2   . ILE A 1 146 ? -26.188 23.985 54.523 1.00 37.78  ? 128  ILE A CG2   1 
ATOM   1039 C  CD1   . ILE A 1 146 ? -26.331 22.914 51.487 1.00 28.90  ? 128  ILE A CD1   1 
ATOM   1040 N  N     . ARG A 1 147 ? -26.352 27.563 53.914 1.00 53.63  ? 129  ARG A N     1 
ATOM   1041 C  CA    . ARG A 1 147 ? -26.267 28.743 54.779 1.00 62.36  ? 129  ARG A CA    1 
ATOM   1042 C  C     . ARG A 1 147 ? -26.281 28.367 56.248 1.00 62.08  ? 129  ARG A C     1 
ATOM   1043 O  O     . ARG A 1 147 ? -26.704 27.262 56.602 1.00 58.17  ? 129  ARG A O     1 
ATOM   1044 C  CB    . ARG A 1 147 ? -27.362 29.754 54.452 1.00 72.59  ? 129  ARG A CB    1 
ATOM   1045 C  CG    . ARG A 1 147 ? -27.159 30.424 53.091 1.00 78.61  ? 129  ARG A CG    1 
ATOM   1046 C  CD    . ARG A 1 147 ? -25.664 30.738 52.823 1.00 81.31  ? 129  ARG A CD    1 
ATOM   1047 N  NE    . ARG A 1 147 ? -25.331 30.780 51.389 1.00 82.54  ? 129  ARG A NE    1 
ATOM   1048 C  CZ    . ARG A 1 147 ? -24.318 31.479 50.870 1.00 86.21  ? 129  ARG A CZ    1 
ATOM   1049 N  NH1   . ARG A 1 147 ? -24.098 31.462 49.557 1.00 83.66  ? 129  ARG A NH1   1 
ATOM   1050 N  NH2   . ARG A 1 147 ? -23.531 32.210 51.661 1.00 92.75  ? 129  ARG A NH2   1 
ATOM   1051 N  N     . GLY A 1 148 ? -25.770 29.270 57.083 1.00 67.42  ? 130  GLY A N     1 
ATOM   1052 C  CA    . GLY A 1 148 ? -25.662 29.065 58.529 1.00 68.41  ? 130  GLY A CA    1 
ATOM   1053 C  C     . GLY A 1 148 ? -26.523 27.993 59.190 1.00 65.57  ? 130  GLY A C     1 
ATOM   1054 O  O     . GLY A 1 148 ? -26.012 26.922 59.514 1.00 58.80  ? 130  GLY A O     1 
ATOM   1055 N  N     . PRO A 1 149 ? -27.831 28.281 59.421 1.00 72.84  ? 131  PRO A N     1 
ATOM   1056 C  CA    . PRO A 1 149 ? -28.732 27.376 60.175 1.00 72.88  ? 131  PRO A CA    1 
ATOM   1057 C  C     . PRO A 1 149 ? -28.786 25.926 59.668 1.00 65.10  ? 131  PRO A C     1 
ATOM   1058 O  O     . PRO A 1 149 ? -28.716 24.992 60.468 1.00 61.20  ? 131  PRO A O     1 
ATOM   1059 C  CB    . PRO A 1 149 ? -30.100 28.050 60.043 1.00 83.57  ? 131  PRO A CB    1 
ATOM   1060 C  CG    . PRO A 1 149 ? -29.786 29.488 59.827 1.00 91.19  ? 131  PRO A CG    1 
ATOM   1061 C  CD    . PRO A 1 149 ? -28.536 29.503 58.989 1.00 82.72  ? 131  PRO A CD    1 
ATOM   1062 N  N     . GLU A 1 150 ? -28.890 25.744 58.354 1.00 63.44  ? 132  GLU A N     1 
ATOM   1063 C  CA    . GLU A 1 150 ? -28.962 24.395 57.769 1.00 59.25  ? 132  GLU A CA    1 
ATOM   1064 C  C     . GLU A 1 150 ? -27.675 23.543 57.920 1.00 50.38  ? 132  GLU A C     1 
ATOM   1065 O  O     . GLU A 1 150 ? -27.750 22.310 57.891 1.00 48.02  ? 132  GLU A O     1 
ATOM   1066 C  CB    . GLU A 1 150 ? -29.413 24.447 56.295 1.00 60.05  ? 132  GLU A CB    1 
ATOM   1067 C  CG    . GLU A 1 150 ? -29.954 23.084 55.743 1.00 61.54  ? 132  GLU A CG    1 
ATOM   1068 C  CD    . GLU A 1 150 ? -29.758 22.880 54.212 1.00 59.37  ? 132  GLU A CD    1 
ATOM   1069 O  OE1   . GLU A 1 150 ? -30.219 23.731 53.400 1.00 65.25  ? 132  GLU A OE1   1 
ATOM   1070 O  OE2   . GLU A 1 150 ? -29.150 21.846 53.820 1.00 58.98  ? 132  GLU A OE2   1 
ATOM   1071 N  N     . THR A 1 151 ? -26.507 24.175 58.077 1.00 47.33  ? 133  THR A N     1 
ATOM   1072 C  CA    . THR A 1 151 ? -25.266 23.399 58.273 1.00 42.05  ? 133  THR A CA    1 
ATOM   1073 C  C     . THR A 1 151 ? -25.204 22.759 59.672 1.00 41.37  ? 133  THR A C     1 
ATOM   1074 O  O     . THR A 1 151 ? -24.398 21.861 59.900 1.00 38.37  ? 133  THR A O     1 
ATOM   1075 C  CB    . THR A 1 151 ? -23.945 24.213 58.048 1.00 41.46  ? 133  THR A CB    1 
ATOM   1076 O  OG1   . THR A 1 151 ? -23.706 25.039 59.176 1.00 46.51  ? 133  THR A OG1   1 
ATOM   1077 C  CG2   . THR A 1 151 ? -24.018 25.092 56.817 1.00 44.00  ? 133  THR A CG2   1 
ATOM   1078 N  N     . ARG A 1 152 ? -26.056 23.215 60.590 1.00 44.38  ? 134  ARG A N     1 
ATOM   1079 C  CA    . ARG A 1 152 ? -26.083 22.696 61.956 1.00 44.98  ? 134  ARG A CA    1 
ATOM   1080 C  C     . ARG A 1 152 ? -26.685 21.302 62.089 1.00 44.19  ? 134  ARG A C     1 
ATOM   1081 O  O     . ARG A 1 152 ? -26.401 20.597 63.049 1.00 43.81  ? 134  ARG A O     1 
ATOM   1082 C  CB    . ARG A 1 152 ? -26.764 23.697 62.921 1.00 51.00  ? 134  ARG A CB    1 
ATOM   1083 C  CG    . ARG A 1 152 ? -25.866 24.885 63.238 1.00 53.34  ? 134  ARG A CG    1 
ATOM   1084 C  CD    . ARG A 1 152 ? -26.472 25.775 64.248 1.00 61.48  ? 134  ARG A CD    1 
ATOM   1085 N  NE    . ARG A 1 152 ? -25.709 27.002 64.516 1.00 67.80  ? 134  ARG A NE    1 
ATOM   1086 C  CZ    . ARG A 1 152 ? -24.667 27.095 65.353 1.00 67.58  ? 134  ARG A CZ    1 
ATOM   1087 N  NH1   . ARG A 1 152 ? -24.196 26.009 65.972 1.00 61.54  ? 134  ARG A NH1   1 
ATOM   1088 N  NH2   . ARG A 1 152 ? -24.077 28.273 65.558 1.00 71.75  ? 134  ARG A NH2   1 
ATOM   1089 N  N     . GLU A 1 153 ? -27.513 20.895 61.132 1.00 44.83  ? 135  GLU A N     1 
ATOM   1090 C  CA    . GLU A 1 153 ? -27.976 19.512 61.091 1.00 45.61  ? 135  GLU A CA    1 
ATOM   1091 C  C     . GLU A 1 153 ? -26.767 18.542 61.049 1.00 40.19  ? 135  GLU A C     1 
ATOM   1092 O  O     . GLU A 1 153 ? -26.687 17.649 61.891 1.00 42.06  ? 135  GLU A O     1 
ATOM   1093 C  CB    . GLU A 1 153 ? -28.941 19.303 59.913 1.00 49.02  ? 135  GLU A CB    1 
ATOM   1094 C  CG    . GLU A 1 153 ? -30.150 20.275 59.928 1.00 56.89  ? 135  GLU A CG    1 
ATOM   1095 C  CD    . GLU A 1 153 ? -31.092 20.120 58.709 1.00 62.01  ? 135  GLU A CD    1 
ATOM   1096 O  OE1   . GLU A 1 153 ? -30.607 20.147 57.540 1.00 61.43  ? 135  GLU A OE1   1 
ATOM   1097 O  OE2   . GLU A 1 153 ? -32.325 19.996 58.933 1.00 72.63  ? 135  GLU A OE2   1 
ATOM   1098 N  N     . GLN A 1 154 ? -25.801 18.787 60.151 1.00 34.65  ? 136  GLN A N     1 
ATOM   1099 C  CA    . GLN A 1 154 ? -24.595 17.948 59.983 1.00 31.09  ? 136  GLN A CA    1 
ATOM   1100 C  C     . GLN A 1 154 ? -23.357 18.343 60.806 1.00 30.24  ? 136  GLN A C     1 
ATOM   1101 O  O     . GLN A 1 154 ? -22.491 17.495 61.101 1.00 30.20  ? 136  GLN A O     1 
ATOM   1102 C  CB    . GLN A 1 154 ? -24.225 17.841 58.502 1.00 29.31  ? 136  GLN A CB    1 
ATOM   1103 C  CG    . GLN A 1 154 ? -25.262 17.105 57.694 1.00 31.03  ? 136  GLN A CG    1 
ATOM   1104 C  CD    . GLN A 1 154 ? -24.922 16.998 56.202 1.00 29.99  ? 136  GLN A CD    1 
ATOM   1105 O  OE1   . GLN A 1 154 ? -24.167 17.797 55.660 1.00 25.70  ? 136  GLN A OE1   1 
ATOM   1106 N  NE2   . GLN A 1 154 ? -25.488 16.007 55.544 1.00 30.59  ? 136  GLN A NE2   1 
ATOM   1107 N  N     . TYR A 1 155 ? -23.274 19.629 61.156 1.00 25.30  ? 137  TYR A N     1 
ATOM   1108 C  CA    . TYR A 1 155 ? -22.155 20.217 61.921 1.00 25.26  ? 137  TYR A CA    1 
ATOM   1109 C  C     . TYR A 1 155 ? -22.779 21.015 63.068 1.00 26.25  ? 137  TYR A C     1 
ATOM   1110 O  O     . TYR A 1 155 ? -22.962 22.243 62.978 1.00 26.27  ? 137  TYR A O     1 
ATOM   1111 C  CB    . TYR A 1 155 ? -21.252 21.096 61.010 1.00 23.46  ? 137  TYR A CB    1 
ATOM   1112 C  CG    . TYR A 1 155 ? -20.809 20.396 59.729 1.00 21.81  ? 137  TYR A CG    1 
ATOM   1113 C  CD1   . TYR A 1 155 ? -19.648 19.604 59.697 1.00 21.62  ? 137  TYR A CD1   1 
ATOM   1114 C  CD2   . TYR A 1 155 ? -21.557 20.531 58.543 1.00 22.41  ? 137  TYR A CD2   1 
ATOM   1115 C  CE1   . TYR A 1 155 ? -19.263 18.937 58.545 1.00 21.95  ? 137  TYR A CE1   1 
ATOM   1116 C  CE2   . TYR A 1 155 ? -21.174 19.875 57.368 1.00 20.74  ? 137  TYR A CE2   1 
ATOM   1117 C  CZ    . TYR A 1 155 ? -20.028 19.084 57.375 1.00 22.21  ? 137  TYR A CZ    1 
ATOM   1118 O  OH    . TYR A 1 155 ? -19.671 18.431 56.232 1.00 20.97  ? 137  TYR A OH    1 
ATOM   1119 N  N     . PRO A 1 156 ? -23.173 20.314 64.147 1.00 28.33  ? 138  PRO A N     1 
ATOM   1120 C  CA    . PRO A 1 156 ? -23.904 20.936 65.266 1.00 29.65  ? 138  PRO A CA    1 
ATOM   1121 C  C     . PRO A 1 156 ? -23.129 22.091 65.907 1.00 29.39  ? 138  PRO A C     1 
ATOM   1122 O  O     . PRO A 1 156 ? -23.735 23.032 66.457 1.00 30.64  ? 138  PRO A O     1 
ATOM   1123 C  CB    . PRO A 1 156 ? -24.055 19.776 66.265 1.00 30.89  ? 138  PRO A CB    1 
ATOM   1124 C  CG    . PRO A 1 156 ? -23.974 18.576 65.420 1.00 30.51  ? 138  PRO A CG    1 
ATOM   1125 C  CD    . PRO A 1 156 ? -22.947 18.885 64.389 1.00 27.99  ? 138  PRO A CD    1 
ATOM   1126 N  N     . ASN A 1 157 ? -21.800 22.035 65.815 1.00 27.79  ? 139  ASN A N     1 
ATOM   1127 C  CA    . ASN A 1 157 ? -20.973 23.051 66.423 1.00 27.59  ? 139  ASN A CA    1 
ATOM   1128 C  C     . ASN A 1 157 ? -20.291 23.904 65.365 1.00 26.99  ? 139  ASN A C     1 
ATOM   1129 O  O     . ASN A 1 157 ? -19.345 24.631 65.671 1.00 26.19  ? 139  ASN A O     1 
ATOM   1130 C  CB    . ASN A 1 157 ? -19.943 22.422 67.381 1.00 27.09  ? 139  ASN A CB    1 
ATOM   1131 C  CG    . ASN A 1 157 ? -19.293 23.454 68.290 1.00 26.80  ? 139  ASN A CG    1 
ATOM   1132 O  OD1   . ASN A 1 157 ? -19.949 24.385 68.775 1.00 26.59  ? 139  ASN A OD1   1 
ATOM   1133 N  ND2   . ASN A 1 157 ? -17.998 23.293 68.534 1.00 26.72  ? 139  ASN A ND2   1 
ATOM   1134 N  N     . LYS A 1 158 ? -20.784 23.802 64.126 1.00 26.83  ? 140  LYS A N     1 
ATOM   1135 C  CA    . LYS A 1 158 ? -20.195 24.458 62.933 1.00 26.60  ? 140  LYS A CA    1 
ATOM   1136 C  C     . LYS A 1 158 ? -18.678 24.304 62.898 1.00 23.70  ? 140  LYS A C     1 
ATOM   1137 O  O     . LYS A 1 158 ? -17.949 25.246 62.719 1.00 23.19  ? 140  LYS A O     1 
ATOM   1138 C  CB    . LYS A 1 158 ? -20.590 25.950 62.874 1.00 28.02  ? 140  LYS A CB    1 
ATOM   1139 C  CG    . LYS A 1 158 ? -21.993 26.231 62.298 1.00 33.35  ? 140  LYS A CG    1 
ATOM   1140 C  CD    . LYS A 1 158 ? -22.185 27.763 61.969 1.00 31.87  ? 140  LYS A CD    1 
ATOM   1141 C  CE    . LYS A 1 158 ? -23.652 28.069 61.581 1.00 37.82  ? 140  LYS A CE    1 
ATOM   1142 N  NZ    . LYS A 1 158 ? -24.021 29.527 61.664 1.00 39.93  ? 140  LYS A NZ    1 
ATOM   1143 N  N     . PHE A 1 159 ? -18.222 23.083 63.068 1.00 22.63  ? 141  PHE A N     1 
ATOM   1144 C  CA    . PHE A 1 159 ? -16.860 22.792 63.372 1.00 22.30  ? 141  PHE A CA    1 
ATOM   1145 C  C     . PHE A 1 159 ? -16.566 21.368 62.886 1.00 20.98  ? 141  PHE A C     1 
ATOM   1146 O  O     . PHE A 1 159 ? -17.404 20.483 63.025 1.00 20.72  ? 141  PHE A O     1 
ATOM   1147 C  CB    . PHE A 1 159 ? -16.708 22.908 64.928 1.00 23.89  ? 141  PHE A CB    1 
ATOM   1148 C  CG    . PHE A 1 159 ? -15.612 22.087 65.515 1.00 23.63  ? 141  PHE A CG    1 
ATOM   1149 C  CD1   . PHE A 1 159 ? -14.320 22.592 65.576 1.00 25.68  ? 141  PHE A CD1   1 
ATOM   1150 C  CD2   . PHE A 1 159 ? -15.872 20.841 66.046 1.00 25.78  ? 141  PHE A CD2   1 
ATOM   1151 C  CE1   . PHE A 1 159 ? -13.285 21.839 66.140 1.00 24.28  ? 141  PHE A CE1   1 
ATOM   1152 C  CE2   . PHE A 1 159 ? -14.850 20.056 66.582 1.00 23.57  ? 141  PHE A CE2   1 
ATOM   1153 C  CZ    . PHE A 1 159 ? -13.552 20.564 66.634 1.00 24.31  ? 141  PHE A CZ    1 
ATOM   1154 N  N     . ILE A 1 160 ? -15.365 21.157 62.363 1.00 20.36  ? 142  ILE A N     1 
ATOM   1155 C  CA    . ILE A 1 160 ? -14.838 19.823 62.071 1.00 21.17  ? 142  ILE A CA    1 
ATOM   1156 C  C     . ILE A 1 160 ? -13.560 19.531 62.871 1.00 22.62  ? 142  ILE A C     1 
ATOM   1157 O  O     . ILE A 1 160 ? -12.802 20.462 63.188 1.00 23.44  ? 142  ILE A O     1 
ATOM   1158 C  CB    . ILE A 1 160 ? -14.588 19.591 60.563 1.00 20.01  ? 142  ILE A CB    1 
ATOM   1159 C  CG1   . ILE A 1 160 ? -13.473 20.506 60.019 1.00 20.02  ? 142  ILE A CG1   1 
ATOM   1160 C  CG2   . ILE A 1 160 ? -15.892 19.793 59.774 1.00 18.56  ? 142  ILE A CG2   1 
ATOM   1161 C  CD1   . ILE A 1 160 ? -12.906 20.099 58.633 1.00 18.95  ? 142  ILE A CD1   1 
ATOM   1162 N  N     . GLN A 1 161 ? -13.346 18.249 63.194 1.00 24.08  ? 143  GLN A N     1 
ATOM   1163 C  CA    . GLN A 1 161 ? -12.104 17.768 63.829 1.00 26.04  ? 143  GLN A CA    1 
ATOM   1164 C  C     . GLN A 1 161 ? -11.048 17.558 62.756 1.00 26.40  ? 143  GLN A C     1 
ATOM   1165 O  O     . GLN A 1 161 ? -11.047 16.540 62.052 1.00 26.10  ? 143  GLN A O     1 
ATOM   1166 C  CB    . GLN A 1 161 ? -12.321 16.446 64.600 1.00 26.01  ? 143  GLN A CB    1 
ATOM   1167 C  CG    . GLN A 1 161 ? -13.275 16.530 65.751 1.00 28.24  ? 143  GLN A CG    1 
ATOM   1168 C  CD    . GLN A 1 161 ? -13.526 15.201 66.448 1.00 29.88  ? 143  GLN A CD    1 
ATOM   1169 O  OE1   . GLN A 1 161 ? -13.483 15.125 67.672 1.00 31.71  ? 143  GLN A OE1   1 
ATOM   1170 N  NE2   . GLN A 1 161 ? -13.800 14.159 65.681 1.00 28.36  ? 143  GLN A NE2   1 
ATOM   1171 N  N     . ARG A 1 162 ? -10.183 18.547 62.595 1.00 28.06  ? 144  ARG A N     1 
ATOM   1172 C  CA    . ARG A 1 162 ? -9.038  18.472 61.691 1.00 29.26  ? 144  ARG A CA    1 
ATOM   1173 C  C     . ARG A 1 162 ? -8.119  17.233 61.882 1.00 29.46  ? 144  ARG A C     1 
ATOM   1174 O  O     . ARG A 1 162 ? -7.574  16.741 60.924 1.00 28.84  ? 144  ARG A O     1 
ATOM   1175 C  CB    . ARG A 1 162 ? -8.212  19.739 61.845 1.00 30.39  ? 144  ARG A CB    1 
ATOM   1176 C  CG    . ARG A 1 162 ? -8.883  20.971 61.201 1.00 32.46  ? 144  ARG A CG    1 
ATOM   1177 C  CD    . ARG A 1 162 ? -7.844  21.663 60.302 1.00 33.78  ? 144  ARG A CD    1 
ATOM   1178 N  NE    . ARG A 1 162 ? -6.968  22.418 61.151 1.00 32.95  ? 144  ARG A NE    1 
ATOM   1179 C  CZ    . ARG A 1 162 ? -5.651  22.347 61.186 1.00 33.19  ? 144  ARG A CZ    1 
ATOM   1180 N  NH1   . ARG A 1 162 ? -4.958  21.540 60.390 1.00 27.92  ? 144  ARG A NH1   1 
ATOM   1181 N  NH2   . ARG A 1 162 ? -5.032  23.139 62.048 1.00 34.22  ? 144  ARG A NH2   1 
ATOM   1182 N  N     A ASP A 1 163 ? -7.984  16.749 63.120 0.50 30.43  ? 145  ASP A N     1 
ATOM   1183 N  N     B ASP A 1 163 ? -7.952  16.771 63.124 0.50 30.82  ? 145  ASP A N     1 
ATOM   1184 C  CA    A ASP A 1 163 ? -7.231  15.516 63.393 0.50 30.70  ? 145  ASP A CA    1 
ATOM   1185 C  CA    B ASP A 1 163 ? -7.271  15.500 63.401 0.50 31.47  ? 145  ASP A CA    1 
ATOM   1186 C  C     A ASP A 1 163 ? -7.911  14.243 62.819 0.50 30.16  ? 145  ASP A C     1 
ATOM   1187 C  C     B ASP A 1 163 ? -7.801  14.357 62.522 0.50 30.60  ? 145  ASP A C     1 
ATOM   1188 O  O     A ASP A 1 163 ? -7.366  13.139 62.929 0.50 30.11  ? 145  ASP A O     1 
ATOM   1189 O  O     B ASP A 1 163 ? -7.060  13.456 62.143 0.50 31.18  ? 145  ASP A O     1 
ATOM   1190 C  CB    A ASP A 1 163 ? -6.984  15.361 64.897 0.50 32.03  ? 145  ASP A CB    1 
ATOM   1191 C  CB    B ASP A 1 163 ? -7.505  15.101 64.852 0.50 32.91  ? 145  ASP A CB    1 
ATOM   1192 C  CG    A ASP A 1 163 ? -6.331  16.595 65.520 0.50 33.86  ? 145  ASP A CG    1 
ATOM   1193 C  CG    B ASP A 1 163 ? -8.988  14.996 65.187 0.50 35.47  ? 145  ASP A CG    1 
ATOM   1194 O  OD1   A ASP A 1 163 ? -5.077  16.691 65.476 0.50 33.24  ? 145  ASP A OD1   1 
ATOM   1195 O  OD1   B ASP A 1 163 ? -9.620  16.057 65.413 0.50 37.58  ? 145  ASP A OD1   1 
ATOM   1196 O  OD2   A ASP A 1 163 ? -7.079  17.454 66.062 0.50 33.13  ? 145  ASP A OD2   1 
ATOM   1197 O  OD2   B ASP A 1 163 ? -9.524  13.858 65.220 0.50 38.52  ? 145  ASP A OD2   1 
ATOM   1198 N  N     . ASP A 1 164 ? -9.096  14.391 62.222 1.00 29.33  ? 146  ASP A N     1 
ATOM   1199 C  CA    . ASP A 1 164 ? -9.798  13.246 61.594 1.00 28.57  ? 146  ASP A CA    1 
ATOM   1200 C  C     . ASP A 1 164 ? -9.481  13.197 60.097 1.00 28.10  ? 146  ASP A C     1 
ATOM   1201 O  O     . ASP A 1 164 ? -10.316 13.447 59.226 1.00 26.44  ? 146  ASP A O     1 
ATOM   1202 C  CB    . ASP A 1 164 ? -11.290 13.294 61.884 1.00 27.69  ? 146  ASP A CB    1 
ATOM   1203 C  CG    . ASP A 1 164 ? -12.018 12.015 61.522 1.00 27.52  ? 146  ASP A CG    1 
ATOM   1204 O  OD1   . ASP A 1 164 ? -11.401 11.065 61.003 1.00 26.15  ? 146  ASP A OD1   1 
ATOM   1205 O  OD2   . ASP A 1 164 ? -13.251 11.970 61.746 1.00 29.09  ? 146  ASP A OD2   1 
ATOM   1206 N  N     . THR A 1 165 ? -8.234  12.854 59.838 1.00 29.35  ? 147  THR A N     1 
ATOM   1207 C  CA    . THR A 1 165 ? -7.675  12.908 58.517 1.00 31.12  ? 147  THR A CA    1 
ATOM   1208 C  C     . THR A 1 165 ? -8.187  11.732 57.672 1.00 31.47  ? 147  THR A C     1 
ATOM   1209 O  O     . THR A 1 165 ? -8.092  11.791 56.457 1.00 32.80  ? 147  THR A O     1 
ATOM   1210 C  CB    . THR A 1 165 ? -6.145  12.920 58.567 1.00 30.99  ? 147  THR A CB    1 
ATOM   1211 O  OG1   . THR A 1 165 ? -5.721  11.790 59.324 1.00 35.21  ? 147  THR A OG1   1 
ATOM   1212 C  CG2   . THR A 1 165 ? -5.596  14.211 59.250 1.00 32.07  ? 147  THR A CG2   1 
ATOM   1213 N  N     . GLU A 1 166 ? -8.762  10.700 58.290 1.00 32.04  ? 148  GLU A N     1 
ATOM   1214 C  CA    . GLU A 1 166 ? -9.494  9.674  57.512 1.00 32.03  ? 148  GLU A CA    1 
ATOM   1215 C  C     . GLU A 1 166 ? -10.800 10.193 56.903 1.00 30.00  ? 148  GLU A C     1 
ATOM   1216 O  O     . GLU A 1 166 ? -11.105 9.894  55.748 1.00 30.48  ? 148  GLU A O     1 
ATOM   1217 C  CB    . GLU A 1 166 ? -9.717  8.386  58.315 1.00 34.11  ? 148  GLU A CB    1 
ATOM   1218 C  CG    . GLU A 1 166 ? -8.679  7.299  57.976 1.00 41.39  ? 148  GLU A CG    1 
ATOM   1219 C  CD    . GLU A 1 166 ? -8.503  6.245  59.071 1.00 52.55  ? 148  GLU A CD    1 
ATOM   1220 O  OE1   . GLU A 1 166 ? -9.513  5.830  59.710 1.00 55.59  ? 148  GLU A OE1   1 
ATOM   1221 O  OE2   . GLU A 1 166 ? -7.336  5.820  59.292 1.00 56.70  ? 148  GLU A OE2   1 
ATOM   1222 N  N     . ARG A 1 167 ? -11.554 10.997 57.650 1.00 27.22  ? 149  ARG A N     1 
ATOM   1223 C  CA    . ARG A 1 167 ? -12.798 11.589 57.134 1.00 24.35  ? 149  ARG A CA    1 
ATOM   1224 C  C     . ARG A 1 167 ? -12.598 12.822 56.221 1.00 22.71  ? 149  ARG A C     1 
ATOM   1225 O  O     . ARG A 1 167 ? -13.339 13.001 55.271 1.00 20.72  ? 149  ARG A O     1 
ATOM   1226 C  CB    . ARG A 1 167 ? -13.705 11.962 58.306 1.00 23.47  ? 149  ARG A CB    1 
ATOM   1227 C  CG    . ARG A 1 167 ? -14.954 12.709 57.935 1.00 23.99  ? 149  ARG A CG    1 
ATOM   1228 C  CD    . ARG A 1 167 ? -15.877 12.864 59.155 1.00 23.89  ? 149  ARG A CD    1 
ATOM   1229 N  NE    . ARG A 1 167 ? -16.944 13.800 58.828 1.00 22.52  ? 149  ARG A NE    1 
ATOM   1230 C  CZ    . ARG A 1 167 ? -17.781 14.322 59.710 1.00 24.34  ? 149  ARG A CZ    1 
ATOM   1231 N  NH1   . ARG A 1 167 ? -17.675 14.012 60.994 1.00 21.40  ? 149  ARG A NH1   1 
ATOM   1232 N  NH2   . ARG A 1 167 ? -18.716 15.174 59.305 1.00 22.78  ? 149  ARG A NH2   1 
ATOM   1233 N  N     . PHE A 1 168 ? -11.613 13.665 56.525 1.00 21.76  ? 150  PHE A N     1 
ATOM   1234 C  CA    . PHE A 1 168 ? -11.479 14.965 55.873 1.00 21.16  ? 150  PHE A CA    1 
ATOM   1235 C  C     . PHE A 1 168 ? -10.250 14.998 55.011 1.00 22.23  ? 150  PHE A C     1 
ATOM   1236 O  O     . PHE A 1 168 ? -9.175  14.619 55.446 1.00 24.12  ? 150  PHE A O     1 
ATOM   1237 C  CB    . PHE A 1 168 ? -11.470 16.147 56.884 1.00 20.29  ? 150  PHE A CB    1 
ATOM   1238 C  CG    . PHE A 1 168 ? -12.675 16.193 57.791 1.00 19.28  ? 150  PHE A CG    1 
ATOM   1239 C  CD1   . PHE A 1 168 ? -13.909 16.648 57.311 1.00 15.18  ? 150  PHE A CD1   1 
ATOM   1240 C  CD2   . PHE A 1 168 ? -12.568 15.797 59.123 1.00 17.66  ? 150  PHE A CD2   1 
ATOM   1241 C  CE1   . PHE A 1 168 ? -15.029 16.693 58.151 1.00 17.12  ? 150  PHE A CE1   1 
ATOM   1242 C  CE2   . PHE A 1 168 ? -13.664 15.841 59.965 1.00 20.09  ? 150  PHE A CE2   1 
ATOM   1243 C  CZ    . PHE A 1 168 ? -14.909 16.322 59.459 1.00 19.05  ? 150  PHE A CZ    1 
ATOM   1244 N  N     . TYR A 1 169 ? -10.409 15.416 53.764 1.00 20.67  ? 151  TYR A N     1 
ATOM   1245 C  CA    . TYR A 1 169 ? -9.242  15.520 52.904 1.00 20.30  ? 151  TYR A CA    1 
ATOM   1246 C  C     . TYR A 1 169 ? -8.998  16.991 52.485 1.00 18.22  ? 151  TYR A C     1 
ATOM   1247 O  O     . TYR A 1 169 ? -9.856  17.632 51.911 1.00 18.53  ? 151  TYR A O     1 
ATOM   1248 C  CB    . TYR A 1 169 ? -9.413  14.603 51.695 1.00 20.47  ? 151  TYR A CB    1 
ATOM   1249 C  CG    . TYR A 1 169 ? -8.183  14.520 50.803 1.00 20.21  ? 151  TYR A CG    1 
ATOM   1250 C  CD1   . TYR A 1 169 ? -7.183  13.583 51.055 1.00 20.43  ? 151  TYR A CD1   1 
ATOM   1251 C  CD2   . TYR A 1 169 ? -8.045  15.372 49.692 1.00 19.92  ? 151  TYR A CD2   1 
ATOM   1252 C  CE1   . TYR A 1 169 ? -6.038  13.501 50.223 1.00 21.94  ? 151  TYR A CE1   1 
ATOM   1253 C  CE2   . TYR A 1 169 ? -6.925  15.292 48.854 1.00 22.24  ? 151  TYR A CE2   1 
ATOM   1254 C  CZ    . TYR A 1 169 ? -5.924  14.359 49.138 1.00 21.84  ? 151  TYR A CZ    1 
ATOM   1255 O  OH    . TYR A 1 169 ? -4.796  14.258 48.326 1.00 25.19  ? 151  TYR A OH    1 
ATOM   1256 N  N     . ILE A 1 170 ? -7.820  17.510 52.790 1.00 18.99  ? 152  ILE A N     1 
ATOM   1257 C  CA    . ILE A 1 170 ? -7.500  18.895 52.470 1.00 18.12  ? 152  ILE A CA    1 
ATOM   1258 C  C     . ILE A 1 170 ? -6.843  18.965 51.089 1.00 18.30  ? 152  ILE A C     1 
ATOM   1259 O  O     . ILE A 1 170 ? -5.766  18.341 50.829 1.00 18.23  ? 152  ILE A O     1 
ATOM   1260 C  CB    . ILE A 1 170 ? -6.568  19.545 53.516 1.00 18.60  ? 152  ILE A CB    1 
ATOM   1261 C  CG1   . ILE A 1 170 ? -7.162  19.431 54.944 1.00 18.33  ? 152  ILE A CG1   1 
ATOM   1262 C  CG2   . ILE A 1 170 ? -6.289  21.030 53.139 1.00 18.78  ? 152  ILE A CG2   1 
ATOM   1263 C  CD1   . ILE A 1 170 ? -6.139  19.663 56.027 1.00 17.24  ? 152  ILE A CD1   1 
ATOM   1264 N  N     . LEU A 1 171 ? -7.448  19.783 50.240 1.00 17.25  ? 153  LEU A N     1 
ATOM   1265 C  CA    . LEU A 1 171 ? -7.052  19.891 48.845 1.00 18.94  ? 153  LEU A CA    1 
ATOM   1266 C  C     . LEU A 1 171 ? -6.009  21.003 48.762 1.00 19.13  ? 153  LEU A C     1 
ATOM   1267 O  O     . LEU A 1 171 ? -6.314  22.118 48.351 1.00 21.26  ? 153  LEU A O     1 
ATOM   1268 C  CB    . LEU A 1 171 ? -8.297  20.146 47.974 1.00 17.70  ? 153  LEU A CB    1 
ATOM   1269 C  CG    . LEU A 1 171 ? -9.281  18.959 48.061 1.00 18.50  ? 153  LEU A CG    1 
ATOM   1270 C  CD1   . LEU A 1 171 ? -10.772 19.397 48.010 1.00 18.48  ? 153  LEU A CD1   1 
ATOM   1271 C  CD2   . LEU A 1 171 ? -8.992  17.875 46.992 1.00 14.98  ? 153  LEU A CD2   1 
ATOM   1272 N  N     . ASN A 1 172 ? -4.772  20.675 49.144 1.00 19.79  ? 154  ASN A N     1 
ATOM   1273 C  CA    . ASN A 1 172 ? -3.718  21.665 49.301 1.00 19.90  ? 154  ASN A CA    1 
ATOM   1274 C  C     . ASN A 1 172 ? -3.150  22.322 48.050 1.00 20.96  ? 154  ASN A C     1 
ATOM   1275 O  O     . ASN A 1 172 ? -2.618  23.433 48.138 1.00 22.12  ? 154  ASN A O     1 
ATOM   1276 C  CB    . ASN A 1 172 ? -2.526  21.047 50.045 1.00 20.48  ? 154  ASN A CB    1 
ATOM   1277 C  CG    . ASN A 1 172 ? -2.824  20.785 51.553 1.00 18.11  ? 154  ASN A CG    1 
ATOM   1278 O  OD1   . ASN A 1 172 ? -3.083  21.703 52.328 1.00 21.21  ? 154  ASN A OD1   1 
ATOM   1279 N  ND2   . ASN A 1 172 ? -2.712  19.537 51.956 1.00 17.34  ? 154  ASN A ND2   1 
ATOM   1280 N  N     . THR A 1 173 ? -3.150  21.616 46.914 1.00 20.47  ? 155  THR A N     1 
ATOM   1281 C  CA    . THR A 1 173 ? -2.358  22.113 45.782 1.00 20.90  ? 155  THR A CA    1 
ATOM   1282 C  C     . THR A 1 173 ? -3.166  22.489 44.567 1.00 20.34  ? 155  THR A C     1 
ATOM   1283 O  O     . THR A 1 173 ? -4.379  22.177 44.460 1.00 19.27  ? 155  THR A O     1 
ATOM   1284 C  CB    . THR A 1 173 ? -1.196  21.162 45.395 1.00 21.89  ? 155  THR A CB    1 
ATOM   1285 O  OG1   . THR A 1 173 ? -1.713  20.095 44.621 1.00 19.96  ? 155  THR A OG1   1 
ATOM   1286 C  CG2   . THR A 1 173 ? -0.561  20.577 46.667 1.00 21.98  ? 155  THR A CG2   1 
ATOM   1287 N  N     . LEU A 1 174 ? -2.493  23.184 43.665 1.00 20.72  ? 156  LEU A N     1 
ATOM   1288 C  CA    . LEU A 1 174 ? -3.101  23.531 42.385 1.00 21.32  ? 156  LEU A CA    1 
ATOM   1289 C  C     . LEU A 1 174 ? -3.421  22.275 41.562 1.00 20.86  ? 156  LEU A C     1 
ATOM   1290 O  O     . LEU A 1 174 ? -4.359  22.298 40.787 1.00 20.71  ? 156  LEU A O     1 
ATOM   1291 C  CB    . LEU A 1 174 ? -2.241  24.575 41.607 1.00 21.79  ? 156  LEU A CB    1 
ATOM   1292 C  CG    . LEU A 1 174 ? -2.137  25.912 42.378 1.00 23.98  ? 156  LEU A CG    1 
ATOM   1293 C  CD1   . LEU A 1 174 ? -1.007  26.748 41.887 1.00 25.04  ? 156  LEU A CD1   1 
ATOM   1294 C  CD2   . LEU A 1 174 ? -3.457  26.672 42.236 1.00 23.55  ? 156  LEU A CD2   1 
ATOM   1295 N  N     . PHE A 1 175 ? -2.695  21.169 41.797 1.00 19.95  ? 157  PHE A N     1 
ATOM   1296 C  CA    . PHE A 1 175 ? -3.046  19.882 41.192 1.00 19.55  ? 157  PHE A CA    1 
ATOM   1297 C  C     . PHE A 1 175 ? -4.408  19.384 41.669 1.00 19.09  ? 157  PHE A C     1 
ATOM   1298 O  O     . PHE A 1 175 ? -5.025  18.565 41.011 1.00 21.49  ? 157  PHE A O     1 
ATOM   1299 C  CB    . PHE A 1 175 ? -1.985  18.826 41.525 1.00 18.49  ? 157  PHE A CB    1 
ATOM   1300 C  CG    . PHE A 1 175 ? -0.688  18.995 40.780 1.00 19.04  ? 157  PHE A CG    1 
ATOM   1301 C  CD1   . PHE A 1 175 ? -0.627  18.823 39.397 1.00 16.79  ? 157  PHE A CD1   1 
ATOM   1302 C  CD2   . PHE A 1 175 ? 0.472   19.276 41.469 1.00 19.54  ? 157  PHE A CD2   1 
ATOM   1303 C  CE1   . PHE A 1 175 ? 0.545   18.942 38.733 1.00 18.31  ? 157  PHE A CE1   1 
ATOM   1304 C  CE2   . PHE A 1 175 ? 1.673   19.387 40.804 1.00 18.07  ? 157  PHE A CE2   1 
ATOM   1305 C  CZ    . PHE A 1 175 ? 1.698   19.216 39.418 1.00 18.95  ? 157  PHE A CZ    1 
ATOM   1306 N  N     . ASN A 1 176 ? -4.882  19.881 42.802 1.00 19.33  ? 158  ASN A N     1 
ATOM   1307 C  CA    . ASN A 1 176 ? -6.194  19.474 43.366 1.00 18.97  ? 158  ASN A CA    1 
ATOM   1308 C  C     . ASN A 1 176 ? -7.386  20.303 42.904 1.00 19.42  ? 158  ASN A C     1 
ATOM   1309 O  O     . ASN A 1 176 ? -8.545  20.009 43.266 1.00 19.83  ? 158  ASN A O     1 
ATOM   1310 C  CB    . ASN A 1 176 ? -6.171  19.495 44.903 1.00 18.55  ? 158  ASN A CB    1 
ATOM   1311 C  CG    . ASN A 1 176 ? -5.157  18.547 45.495 1.00 21.05  ? 158  ASN A CG    1 
ATOM   1312 O  OD1   . ASN A 1 176 ? -4.363  18.939 46.359 1.00 22.88  ? 158  ASN A OD1   1 
ATOM   1313 N  ND2   . ASN A 1 176 ? -5.167  17.292 45.030 1.00 20.84  ? 158  ASN A ND2   1 
ATOM   1314 N  N     . LEU A 1 177 ? -7.142  21.336 42.109 1.00 20.79  ? 159  LEU A N     1 
ATOM   1315 C  CA    . LEU A 1 177 ? -8.251  22.150 41.583 1.00 20.86  ? 159  LEU A CA    1 
ATOM   1316 C  C     . LEU A 1 177 ? -9.226  21.361 40.700 1.00 21.31  ? 159  LEU A C     1 
ATOM   1317 O  O     . LEU A 1 177 ? -10.443 21.454 40.905 1.00 20.73  ? 159  LEU A O     1 
ATOM   1318 C  CB    . LEU A 1 177 ? -7.725  23.406 40.888 1.00 21.37  ? 159  LEU A CB    1 
ATOM   1319 C  CG    . LEU A 1 177 ? -7.171  24.500 41.843 1.00 23.03  ? 159  LEU A CG    1 
ATOM   1320 C  CD1   . LEU A 1 177 ? -6.829  25.699 41.034 1.00 20.14  ? 159  LEU A CD1   1 
ATOM   1321 C  CD2   . LEU A 1 177 ? -8.193  24.913 42.924 1.00 21.67  ? 159  LEU A CD2   1 
ATOM   1322 N  N     . PRO A 1 178 ? -8.719  20.548 39.738 1.00 21.80  ? 160  PRO A N     1 
ATOM   1323 C  CA    . PRO A 1 178 ? -9.667  19.723 38.978 1.00 22.10  ? 160  PRO A CA    1 
ATOM   1324 C  C     . PRO A 1 178 ? -10.555 18.775 39.829 1.00 21.70  ? 160  PRO A C     1 
ATOM   1325 O  O     . PRO A 1 178 ? -11.801 18.676 39.589 1.00 20.13  ? 160  PRO A O     1 
ATOM   1326 C  CB    . PRO A 1 178 ? -8.764  18.944 37.988 1.00 23.30  ? 160  PRO A CB    1 
ATOM   1327 C  CG    . PRO A 1 178 ? -7.520  19.715 37.911 1.00 22.66  ? 160  PRO A CG    1 
ATOM   1328 C  CD    . PRO A 1 178 ? -7.336  20.359 39.272 1.00 22.41  ? 160  PRO A CD    1 
ATOM   1329 N  N     . GLU A 1 179 ? -9.966  18.079 40.802 1.00 21.73  ? 161  GLU A N     1 
ATOM   1330 C  CA    . GLU A 1 179 ? -10.792 17.202 41.619 1.00 21.46  ? 161  GLU A CA    1 
ATOM   1331 C  C     . GLU A 1 179 ? -11.712 17.983 42.542 1.00 20.49  ? 161  GLU A C     1 
ATOM   1332 O  O     . GLU A 1 179 ? -12.819 17.514 42.803 1.00 20.03  ? 161  GLU A O     1 
ATOM   1333 C  CB    . GLU A 1 179 ? -10.008 16.127 42.390 1.00 22.60  ? 161  GLU A CB    1 
ATOM   1334 C  CG    . GLU A 1 179 ? -9.196  16.652 43.530 1.00 24.27  ? 161  GLU A CG    1 
ATOM   1335 C  CD    . GLU A 1 179 ? -8.147  15.662 43.983 1.00 27.27  ? 161  GLU A CD    1 
ATOM   1336 O  OE1   . GLU A 1 179 ? -8.478  14.829 44.849 1.00 26.91  ? 161  GLU A OE1   1 
ATOM   1337 O  OE2   . GLU A 1 179 ? -6.999  15.724 43.472 1.00 26.95  ? 161  GLU A OE2   1 
ATOM   1338 N  N     . THR A 1 180 ? -11.283 19.157 43.020 1.00 19.68  ? 162  THR A N     1 
ATOM   1339 C  CA    . THR A 1 180 ? -12.172 20.012 43.812 1.00 19.06  ? 162  THR A CA    1 
ATOM   1340 C  C     . THR A 1 180 ? -13.449 20.274 43.025 1.00 20.36  ? 162  THR A C     1 
ATOM   1341 O  O     . THR A 1 180 ? -14.567 20.090 43.546 1.00 20.78  ? 162  THR A O     1 
ATOM   1342 C  CB    . THR A 1 180 ? -11.530 21.370 44.138 1.00 19.63  ? 162  THR A CB    1 
ATOM   1343 O  OG1   . THR A 1 180 ? -10.325 21.162 44.885 1.00 19.52  ? 162  THR A OG1   1 
ATOM   1344 C  CG2   . THR A 1 180 ? -12.419 22.201 44.935 1.00 16.65  ? 162  THR A CG2   1 
ATOM   1345 N  N     . TYR A 1 181 ? -13.305 20.705 41.768 1.00 19.90  ? 163  TYR A N     1 
ATOM   1346 C  CA    . TYR A 1 181 ? -14.488 20.993 40.970 1.00 20.70  ? 163  TYR A CA    1 
ATOM   1347 C  C     . TYR A 1 181 ? -15.252 19.689 40.625 1.00 20.46  ? 163  TYR A C     1 
ATOM   1348 O  O     . TYR A 1 181 ? -16.508 19.650 40.655 1.00 19.69  ? 163  TYR A O     1 
ATOM   1349 C  CB    . TYR A 1 181 ? -14.113 21.782 39.679 1.00 21.32  ? 163  TYR A CB    1 
ATOM   1350 C  CG    . TYR A 1 181 ? -15.307 22.126 38.807 1.00 21.70  ? 163  TYR A CG    1 
ATOM   1351 C  CD1   . TYR A 1 181 ? -16.336 22.948 39.289 1.00 22.36  ? 163  TYR A CD1   1 
ATOM   1352 C  CD2   . TYR A 1 181 ? -15.425 21.608 37.515 1.00 23.27  ? 163  TYR A CD2   1 
ATOM   1353 C  CE1   . TYR A 1 181 ? -17.439 23.254 38.489 1.00 20.68  ? 163  TYR A CE1   1 
ATOM   1354 C  CE2   . TYR A 1 181 ? -16.507 21.914 36.711 1.00 22.44  ? 163  TYR A CE2   1 
ATOM   1355 C  CZ    . TYR A 1 181 ? -17.515 22.730 37.204 1.00 22.24  ? 163  TYR A CZ    1 
ATOM   1356 O  OH    . TYR A 1 181 ? -18.619 23.006 36.396 1.00 22.07  ? 163  TYR A OH    1 
ATOM   1357 N  N     . LEU A 1 182 ? -14.501 18.624 40.319 1.00 18.59  ? 164  LEU A N     1 
ATOM   1358 C  CA    . LEU A 1 182 ? -15.114 17.360 39.920 1.00 20.00  ? 164  LEU A CA    1 
ATOM   1359 C  C     . LEU A 1 182 ? -15.964 16.718 41.052 1.00 20.28  ? 164  LEU A C     1 
ATOM   1360 O  O     . LEU A 1 182 ? -17.076 16.229 40.840 1.00 21.07  ? 164  LEU A O     1 
ATOM   1361 C  CB    . LEU A 1 182 ? -14.042 16.407 39.359 1.00 18.87  ? 164  LEU A CB    1 
ATOM   1362 C  CG    . LEU A 1 182 ? -14.502 15.004 38.979 1.00 20.78  ? 164  LEU A CG    1 
ATOM   1363 C  CD1   . LEU A 1 182 ? -15.576 15.094 37.878 1.00 19.16  ? 164  LEU A CD1   1 
ATOM   1364 C  CD2   . LEU A 1 182 ? -13.283 14.195 38.494 1.00 20.18  ? 164  LEU A CD2   1 
ATOM   1365 N  N     . LEU A 1 183 ? -15.449 16.762 42.269 1.00 20.03  ? 165  LEU A N     1 
ATOM   1366 C  CA    . LEU A 1 183 ? -16.207 16.319 43.424 1.00 20.82  ? 165  LEU A CA    1 
ATOM   1367 C  C     . LEU A 1 183 ? -17.578 17.023 43.504 1.00 20.55  ? 165  LEU A C     1 
ATOM   1368 O  O     . LEU A 1 183 ? -18.601 16.344 43.622 1.00 21.46  ? 165  LEU A O     1 
ATOM   1369 C  CB    . LEU A 1 183 ? -15.362 16.509 44.713 1.00 19.68  ? 165  LEU A CB    1 
ATOM   1370 C  CG    . LEU A 1 183 ? -14.210 15.513 44.913 1.00 20.65  ? 165  LEU A CG    1 
ATOM   1371 C  CD1   . LEU A 1 183 ? -13.268 16.009 46.030 1.00 14.43  ? 165  LEU A CD1   1 
ATOM   1372 C  CD2   . LEU A 1 183 ? -14.767 14.054 45.199 1.00 19.26  ? 165  LEU A CD2   1 
ATOM   1373 N  N     . ALA A 1 184 ? -17.610 18.361 43.422 1.00 20.40  ? 166  ALA A N     1 
ATOM   1374 C  CA    . ALA A 1 184 ? -18.872 19.116 43.388 1.00 20.78  ? 166  ALA A CA    1 
ATOM   1375 C  C     . ALA A 1 184 ? -19.803 18.742 42.198 1.00 21.75  ? 166  ALA A C     1 
ATOM   1376 O  O     . ALA A 1 184 ? -21.018 18.534 42.382 1.00 22.39  ? 166  ALA A O     1 
ATOM   1377 C  CB    . ALA A 1 184 ? -18.604 20.626 43.408 1.00 19.38  ? 166  ALA A CB    1 
ATOM   1378 N  N     . CYS A 1 185 ? -19.232 18.666 40.997 1.00 21.98  ? 167  CYS A N     1 
ATOM   1379 C  CA    . CYS A 1 185 ? -19.903 18.121 39.815 1.00 23.11  ? 167  CYS A CA    1 
ATOM   1380 C  C     . CYS A 1 185 ? -20.577 16.773 40.053 1.00 23.12  ? 167  CYS A C     1 
ATOM   1381 O  O     . CYS A 1 185 ? -21.744 16.609 39.728 1.00 23.82  ? 167  CYS A O     1 
ATOM   1382 C  CB    . CYS A 1 185 ? -18.909 17.942 38.659 1.00 22.78  ? 167  CYS A CB    1 
ATOM   1383 S  SG    . CYS A 1 185 ? -18.495 19.461 37.775 1.00 25.66  ? 167  CYS A SG    1 
ATOM   1384 N  N     . LEU A 1 186 ? -19.820 15.799 40.585 1.00 22.66  ? 168  LEU A N     1 
ATOM   1385 C  CA    . LEU A 1 186 ? -20.326 14.457 40.836 1.00 21.48  ? 168  LEU A CA    1 
ATOM   1386 C  C     . LEU A 1 186 ? -21.461 14.513 41.863 1.00 21.86  ? 168  LEU A C     1 
ATOM   1387 O  O     . LEU A 1 186 ? -22.518 13.979 41.599 1.00 22.36  ? 168  LEU A O     1 
ATOM   1388 C  CB    . LEU A 1 186 ? -19.224 13.516 41.308 1.00 21.02  ? 168  LEU A CB    1 
ATOM   1389 C  CG    . LEU A 1 186 ? -18.221 13.115 40.228 1.00 21.35  ? 168  LEU A CG    1 
ATOM   1390 C  CD1   . LEU A 1 186 ? -17.067 12.354 40.878 1.00 22.59  ? 168  LEU A CD1   1 
ATOM   1391 C  CD2   . LEU A 1 186 ? -18.935 12.319 39.129 1.00 21.12  ? 168  LEU A CD2   1 
ATOM   1392 N  N     . VAL A 1 187 ? -21.272 15.205 42.988 1.00 20.18  ? 169  VAL A N     1 
ATOM   1393 C  CA    . VAL A 1 187 ? -22.337 15.287 43.991 1.00 20.91  ? 169  VAL A CA    1 
ATOM   1394 C  C     . VAL A 1 187 ? -23.590 15.947 43.378 1.00 22.20  ? 169  VAL A C     1 
ATOM   1395 O  O     . VAL A 1 187 ? -24.708 15.445 43.546 1.00 22.97  ? 169  VAL A O     1 
ATOM   1396 C  CB    . VAL A 1 187 ? -21.878 15.997 45.264 1.00 19.71  ? 169  VAL A CB    1 
ATOM   1397 C  CG1   . VAL A 1 187 ? -23.098 16.230 46.228 1.00 19.81  ? 169  VAL A CG1   1 
ATOM   1398 C  CG2   . VAL A 1 187 ? -20.818 15.178 45.946 1.00 19.58  ? 169  VAL A CG2   1 
ATOM   1399 N  N     . ASP A 1 188 ? -23.394 17.038 42.630 1.00 22.15  ? 170  ASP A N     1 
ATOM   1400 C  CA    . ASP A 1 188 ? -24.497 17.700 41.920 1.00 24.39  ? 170  ASP A CA    1 
ATOM   1401 C  C     . ASP A 1 188 ? -25.206 16.743 40.957 1.00 24.85  ? 170  ASP A C     1 
ATOM   1402 O  O     . ASP A 1 188 ? -26.418 16.702 40.943 1.00 26.27  ? 170  ASP A O     1 
ATOM   1403 C  CB    . ASP A 1 188 ? -24.006 18.934 41.158 1.00 24.30  ? 170  ASP A CB    1 
ATOM   1404 C  CG    . ASP A 1 188 ? -25.092 19.563 40.292 1.00 27.99  ? 170  ASP A CG    1 
ATOM   1405 O  OD1   . ASP A 1 188 ? -25.966 20.237 40.869 1.00 28.79  ? 170  ASP A OD1   1 
ATOM   1406 O  OD2   . ASP A 1 188 ? -25.079 19.388 39.035 1.00 28.20  ? 170  ASP A OD2   1 
ATOM   1407 N  N     . PHE A 1 189 ? -24.442 15.985 40.161 1.00 24.38  ? 171  PHE A N     1 
ATOM   1408 C  CA    . PHE A 1 189 ? -25.003 15.024 39.202 1.00 25.02  ? 171  PHE A CA    1 
ATOM   1409 C  C     . PHE A 1 189 ? -25.872 13.930 39.845 1.00 25.46  ? 171  PHE A C     1 
ATOM   1410 O  O     . PHE A 1 189 ? -27.047 13.747 39.464 1.00 25.61  ? 171  PHE A O     1 
ATOM   1411 C  CB    . PHE A 1 189 ? -23.914 14.384 38.315 1.00 24.78  ? 171  PHE A CB    1 
ATOM   1412 C  CG    . PHE A 1 189 ? -24.446 13.282 37.449 1.00 28.23  ? 171  PHE A CG    1 
ATOM   1413 C  CD1   . PHE A 1 189 ? -25.244 13.578 36.331 1.00 28.03  ? 171  PHE A CD1   1 
ATOM   1414 C  CD2   . PHE A 1 189 ? -24.211 11.947 37.779 1.00 29.00  ? 171  PHE A CD2   1 
ATOM   1415 C  CE1   . PHE A 1 189 ? -25.800 12.560 35.568 1.00 30.61  ? 171  PHE A CE1   1 
ATOM   1416 C  CE2   . PHE A 1 189 ? -24.760 10.910 37.004 1.00 30.59  ? 171  PHE A CE2   1 
ATOM   1417 C  CZ    . PHE A 1 189 ? -25.545 11.217 35.896 1.00 29.19  ? 171  PHE A CZ    1 
ATOM   1418 N  N     . PHE A 1 190 ? -25.318 13.180 40.802 1.00 23.92  ? 172  PHE A N     1 
ATOM   1419 C  CA    . PHE A 1 190 ? -26.096 12.082 41.393 1.00 25.58  ? 172  PHE A CA    1 
ATOM   1420 C  C     . PHE A 1 190 ? -27.299 12.588 42.184 1.00 26.88  ? 172  PHE A C     1 
ATOM   1421 O  O     . PHE A 1 190 ? -28.337 11.951 42.163 1.00 28.71  ? 172  PHE A O     1 
ATOM   1422 C  CB    . PHE A 1 190 ? -25.217 11.187 42.266 1.00 25.19  ? 172  PHE A CB    1 
ATOM   1423 C  CG    . PHE A 1 190 ? -24.124 10.499 41.510 1.00 23.68  ? 172  PHE A CG    1 
ATOM   1424 C  CD1   . PHE A 1 190 ? -24.424 9.527  40.558 1.00 27.39  ? 172  PHE A CD1   1 
ATOM   1425 C  CD2   . PHE A 1 190 ? -22.809 10.817 41.742 1.00 23.82  ? 172  PHE A CD2   1 
ATOM   1426 C  CE1   . PHE A 1 190 ? -23.404 8.863  39.836 1.00 30.32  ? 172  PHE A CE1   1 
ATOM   1427 C  CE2   . PHE A 1 190 ? -21.757 10.164 41.023 1.00 25.03  ? 172  PHE A CE2   1 
ATOM   1428 C  CZ    . PHE A 1 190 ? -22.056 9.202  40.079 1.00 26.53  ? 172  PHE A CZ    1 
ATOM   1429 N  N     . THR A 1 191 ? -27.178 13.734 42.857 1.00 27.23  ? 173  THR A N     1 
ATOM   1430 C  CA    . THR A 1 191 ? -28.319 14.347 43.566 1.00 29.13  ? 173  THR A CA    1 
ATOM   1431 C  C     . THR A 1 191 ? -29.484 14.642 42.633 1.00 31.30  ? 173  THR A C     1 
ATOM   1432 O  O     . THR A 1 191 ? -30.654 14.355 42.958 1.00 32.27  ? 173  THR A O     1 
ATOM   1433 C  CB    . THR A 1 191 ? -27.911 15.669 44.213 1.00 28.53  ? 173  THR A CB    1 
ATOM   1434 O  OG1   . THR A 1 191 ? -26.774 15.426 45.040 1.00 28.22  ? 173  THR A OG1   1 
ATOM   1435 C  CG2   . THR A 1 191 ? -29.063 16.280 45.032 1.00 30.91  ? 173  THR A CG2   1 
ATOM   1436 N  N     . ASN A 1 192 ? -29.173 15.226 41.483 1.00 31.57  ? 174  ASN A N     1 
ATOM   1437 C  CA    . ASN A 1 192 ? -30.229 15.651 40.552 1.00 34.58  ? 174  ASN A CA    1 
ATOM   1438 C  C     . ASN A 1 192 ? -30.700 14.660 39.494 1.00 35.80  ? 174  ASN A C     1 
ATOM   1439 O  O     . ASN A 1 192 ? -31.681 14.918 38.779 1.00 36.90  ? 174  ASN A O     1 
ATOM   1440 C  CB    . ASN A 1 192 ? -29.892 17.017 39.957 1.00 34.94  ? 174  ASN A CB    1 
ATOM   1441 C  CG    . ASN A 1 192 ? -29.948 18.104 41.011 1.00 37.16  ? 174  ASN A CG    1 
ATOM   1442 O  OD1   . ASN A 1 192 ? -28.923 18.685 41.374 1.00 41.86  ? 174  ASN A OD1   1 
ATOM   1443 N  ND2   . ASN A 1 192 ? -31.132 18.321 41.578 1.00 39.34  ? 174  ASN A ND2   1 
ATOM   1444 N  N     . CYS A 1 193 ? -30.039 13.514 39.415 1.00 35.44  ? 175  CYS A N     1 
ATOM   1445 C  CA    . CYS A 1 193 ? -30.401 12.502 38.446 1.00 36.27  ? 175  CYS A CA    1 
ATOM   1446 C  C     . CYS A 1 193 ? -31.400 11.539 39.082 1.00 37.01  ? 175  CYS A C     1 
ATOM   1447 O  O     . CYS A 1 193 ? -31.136 10.990 40.160 1.00 36.06  ? 175  CYS A O     1 
ATOM   1448 C  CB    . CYS A 1 193 ? -29.159 11.747 38.016 1.00 35.54  ? 175  CYS A CB    1 
ATOM   1449 S  SG    . CYS A 1 193 ? -29.538 10.474 36.857 1.00 37.26  ? 175  CYS A SG    1 
ATOM   1450 N  N     . PRO A 1 194 ? -32.541 11.301 38.409 1.00 38.53  ? 176  PRO A N     1 
ATOM   1451 C  CA    . PRO A 1 194 ? -33.582 10.551 39.101 1.00 39.09  ? 176  PRO A CA    1 
ATOM   1452 C  C     . PRO A 1 194 ? -33.391 9.035  39.152 1.00 38.67  ? 176  PRO A C     1 
ATOM   1453 O  O     . PRO A 1 194 ? -34.171 8.368  39.817 1.00 39.57  ? 176  PRO A O     1 
ATOM   1454 C  CB    . PRO A 1 194 ? -34.883 10.961 38.381 1.00 40.70  ? 176  PRO A CB    1 
ATOM   1455 C  CG    . PRO A 1 194 ? -34.455 11.760 37.147 1.00 42.51  ? 176  PRO A CG    1 
ATOM   1456 C  CD    . PRO A 1 194 ? -32.941 11.661 37.038 1.00 40.36  ? 176  PRO A CD    1 
ATOM   1457 N  N     A ARG A 1 195 ? -32.353 8.528  38.484 0.50 38.02  ? 177  ARG A N     1 
ATOM   1458 N  N     B ARG A 1 195 ? -32.375 8.497  38.471 0.50 38.40  ? 177  ARG A N     1 
ATOM   1459 C  CA    A ARG A 1 195 ? -31.924 7.119  38.593 0.50 37.45  ? 177  ARG A CA    1 
ATOM   1460 C  CA    B ARG A 1 195 ? -31.970 7.084  38.661 0.50 38.26  ? 177  ARG A CA    1 
ATOM   1461 C  C     A ARG A 1 195 ? -31.270 6.778  39.956 0.50 36.65  ? 177  ARG A C     1 
ATOM   1462 C  C     B ARG A 1 195 ? -31.531 6.811  40.106 0.50 37.17  ? 177  ARG A C     1 
ATOM   1463 O  O     A ARG A 1 195 ? -31.120 5.603  40.288 0.50 36.64  ? 177  ARG A O     1 
ATOM   1464 O  O     B ARG A 1 195 ? -31.778 5.728  40.644 0.50 37.07  ? 177  ARG A O     1 
ATOM   1465 C  CB    A ARG A 1 195 ? -30.969 6.743  37.438 0.50 37.22  ? 177  ARG A CB    1 
ATOM   1466 C  CB    B ARG A 1 195 ? -30.824 6.675  37.717 0.50 38.01  ? 177  ARG A CB    1 
ATOM   1467 C  CG    A ARG A 1 195 ? -31.340 7.332  36.057 0.50 37.70  ? 177  ARG A CG    1 
ATOM   1468 C  CG    B ARG A 1 195 ? -31.091 6.859  36.228 0.50 40.12  ? 177  ARG A CG    1 
ATOM   1469 C  CD    A ARG A 1 195 ? -30.495 6.749  34.899 0.50 37.29  ? 177  ARG A CD    1 
ATOM   1470 C  CD    B ARG A 1 195 ? -30.384 5.787  35.372 0.50 42.18  ? 177  ARG A CD    1 
ATOM   1471 N  NE    A ARG A 1 195 ? -29.045 6.874  35.108 0.50 32.96  ? 177  ARG A NE    1 
ATOM   1472 N  NE    B ARG A 1 195 ? -28.919 5.876  35.391 0.50 42.13  ? 177  ARG A NE    1 
ATOM   1473 C  CZ    A ARG A 1 195 ? -28.273 7.783  34.523 0.50 30.21  ? 177  ARG A CZ    1 
ATOM   1474 C  CZ    B ARG A 1 195 ? -28.115 5.111  36.132 0.50 41.19  ? 177  ARG A CZ    1 
ATOM   1475 N  NH1   A ARG A 1 195 ? -28.808 8.660  33.693 0.50 28.99  ? 177  ARG A NH1   1 
ATOM   1476 N  NH1   B ARG A 1 195 ? -28.615 4.186  36.944 0.50 40.53  ? 177  ARG A NH1   1 
ATOM   1477 N  NH2   A ARG A 1 195 ? -26.972 7.815  34.776 0.50 27.08  ? 177  ARG A NH2   1 
ATOM   1478 N  NH2   B ARG A 1 195 ? -26.799 5.279  36.055 0.50 39.75  ? 177  ARG A NH2   1 
ATOM   1479 N  N     . TYR A 1 196 ? -30.888 7.805  40.725 1.00 35.79  ? 178  TYR A N     1 
ATOM   1480 C  CA    . TYR A 1 196 ? -30.304 7.657  42.081 1.00 35.46  ? 178  TYR A CA    1 
ATOM   1481 C  C     . TYR A 1 196 ? -31.151 8.255  43.202 1.00 35.74  ? 178  TYR A C     1 
ATOM   1482 O  O     . TYR A 1 196 ? -31.766 9.305  43.032 1.00 37.31  ? 178  TYR A O     1 
ATOM   1483 C  CB    . TYR A 1 196 ? -28.914 8.315  42.144 1.00 34.34  ? 178  TYR A CB    1 
ATOM   1484 C  CG    . TYR A 1 196 ? -28.053 7.891  41.005 1.00 35.03  ? 178  TYR A CG    1 
ATOM   1485 C  CD1   . TYR A 1 196 ? -27.207 6.786  41.116 1.00 33.92  ? 178  TYR A CD1   1 
ATOM   1486 C  CD2   . TYR A 1 196 ? -28.112 8.572  39.790 1.00 35.80  ? 178  TYR A CD2   1 
ATOM   1487 C  CE1   . TYR A 1 196 ? -26.428 6.373  40.029 1.00 36.53  ? 178  TYR A CE1   1 
ATOM   1488 C  CE2   . TYR A 1 196 ? -27.335 8.182  38.702 1.00 36.71  ? 178  TYR A CE2   1 
ATOM   1489 C  CZ    . TYR A 1 196 ? -26.502 7.090  38.826 1.00 36.40  ? 178  TYR A CZ    1 
ATOM   1490 O  OH    . TYR A 1 196 ? -25.765 6.717  37.736 1.00 37.33  ? 178  TYR A OH    1 
ATOM   1491 N  N     . THR A 1 197 ? -31.149 7.611  44.362 1.00 35.42  ? 179  THR A N     1 
ATOM   1492 C  CA    . THR A 1 197 ? -31.786 8.162  45.564 1.00 35.33  ? 179  THR A CA    1 
ATOM   1493 C  C     . THR A 1 197 ? -30.700 8.710  46.518 1.00 34.40  ? 179  THR A C     1 
ATOM   1494 O  O     . THR A 1 197 ? -29.733 8.038  46.809 1.00 33.34  ? 179  THR A O     1 
ATOM   1495 C  CB    . THR A 1 197 ? -32.672 7.095  46.240 1.00 36.54  ? 179  THR A CB    1 
ATOM   1496 O  OG1   . THR A 1 197 ? -33.542 6.532  45.249 1.00 37.77  ? 179  THR A OG1   1 
ATOM   1497 C  CG2   . THR A 1 197 ? -33.542 7.683  47.328 1.00 36.96  ? 179  THR A CG2   1 
ATOM   1498 N  N     . SER A 1 198 ? -30.866 9.943  46.977 1.00 34.01  ? 180  SER A N     1 
ATOM   1499 C  CA    . SER A 1 198 ? -29.916 10.586 47.874 1.00 34.15  ? 180  SER A CA    1 
ATOM   1500 C  C     . SER A 1 198 ? -30.114 10.149 49.309 1.00 34.15  ? 180  SER A C     1 
ATOM   1501 O  O     . SER A 1 198 ? -31.232 10.231 49.825 1.00 35.77  ? 180  SER A O     1 
ATOM   1502 C  CB    . SER A 1 198 ? -30.116 12.090 47.832 1.00 34.99  ? 180  SER A CB    1 
ATOM   1503 O  OG    . SER A 1 198 ? -29.651 12.593 46.613 1.00 38.49  ? 180  SER A OG    1 
ATOM   1504 N  N     . CYS A 1 199 ? -29.038 9.728  49.967 1.00 32.98  ? 181  CYS A N     1 
ATOM   1505 C  CA    . CYS A 1 199 ? -29.083 9.421  51.402 1.00 33.70  ? 181  CYS A CA    1 
ATOM   1506 C  C     . CYS A 1 199 ? -28.095 10.347 52.118 1.00 32.90  ? 181  CYS A C     1 
ATOM   1507 O  O     . CYS A 1 199 ? -27.362 11.101 51.476 1.00 30.50  ? 181  CYS A O     1 
ATOM   1508 C  CB    . CYS A 1 199 ? -28.734 7.952  51.667 1.00 32.80  ? 181  CYS A CB    1 
ATOM   1509 S  SG    . CYS A 1 199 ? -29.588 6.770  50.522 1.00 42.86  ? 181  CYS A SG    1 
ATOM   1510 N  N     . GLU A 1 200 ? -28.038 10.241 53.442 1.00 33.03  ? 182  GLU A N     1 
ATOM   1511 C  CA    . GLU A 1 200 ? -27.175 11.100 54.248 1.00 35.32  ? 182  GLU A CA    1 
ATOM   1512 C  C     . GLU A 1 200 ? -25.697 10.960 53.800 1.00 31.55  ? 182  GLU A C     1 
ATOM   1513 O  O     . GLU A 1 200 ? -24.981 11.962 53.674 1.00 31.86  ? 182  GLU A O     1 
ATOM   1514 C  CB    . GLU A 1 200 ? -27.382 10.751 55.747 1.00 36.35  ? 182  GLU A CB    1 
ATOM   1515 C  CG    . GLU A 1 200 ? -26.956 11.795 56.769 1.00 42.18  ? 182  GLU A CG    1 
ATOM   1516 C  CD    . GLU A 1 200 ? -26.892 11.212 58.226 1.00 44.92  ? 182  GLU A CD    1 
ATOM   1517 O  OE1   . GLU A 1 200 ? -26.730 9.952  58.413 1.00 49.95  ? 182  GLU A OE1   1 
ATOM   1518 O  OE2   . GLU A 1 200 ? -26.983 12.024 59.191 1.00 53.49  ? 182  GLU A OE2   1 
ATOM   1519 N  N     . THR A 1 201 ? -25.265 9.723  53.528 1.00 28.35  ? 183  THR A N     1 
ATOM   1520 C  CA    . THR A 1 201 ? -23.841 9.428  53.297 1.00 26.04  ? 183  THR A CA    1 
ATOM   1521 C  C     . THR A 1 201 ? -23.489 8.954  51.903 1.00 25.30  ? 183  THR A C     1 
ATOM   1522 O  O     . THR A 1 201 ? -22.338 8.574  51.662 1.00 23.05  ? 183  THR A O     1 
ATOM   1523 C  CB    . THR A 1 201 ? -23.335 8.376  54.276 1.00 27.32  ? 183  THR A CB    1 
ATOM   1524 O  OG1   . THR A 1 201 ? -24.079 7.159  54.074 1.00 27.48  ? 183  THR A OG1   1 
ATOM   1525 C  CG2   . THR A 1 201 ? -23.480 8.887  55.722 1.00 25.07  ? 183  THR A CG2   1 
ATOM   1526 N  N     . GLY A 1 202 ? -24.455 9.035  50.987 1.00 24.77  ? 184  GLY A N     1 
ATOM   1527 C  CA    . GLY A 1 202 ? -24.206 8.778  49.558 1.00 25.36  ? 184  GLY A CA    1 
ATOM   1528 C  C     . GLY A 1 202 ? -25.484 8.564  48.759 1.00 25.92  ? 184  GLY A C     1 
ATOM   1529 O  O     . GLY A 1 202 ? -26.507 9.194  49.037 1.00 26.51  ? 184  GLY A O     1 
ATOM   1530 N  N     . PHE A 1 203 ? -25.415 7.677  47.768 1.00 25.88  ? 185  PHE A N     1 
ATOM   1531 C  CA    . PHE A 1 203 ? -26.446 7.544  46.751 1.00 28.41  ? 185  PHE A CA    1 
ATOM   1532 C  C     . PHE A 1 203 ? -26.765 6.098  46.566 1.00 29.11  ? 185  PHE A C     1 
ATOM   1533 O  O     . PHE A 1 203 ? -25.861 5.273  46.513 1.00 29.15  ? 185  PHE A O     1 
ATOM   1534 C  CB    . PHE A 1 203 ? -25.976 8.136  45.412 1.00 28.16  ? 185  PHE A CB    1 
ATOM   1535 C  CG    . PHE A 1 203 ? -25.714 9.591  45.481 1.00 30.86  ? 185  PHE A CG    1 
ATOM   1536 C  CD1   . PHE A 1 203 ? -26.790 10.502 45.525 1.00 31.45  ? 185  PHE A CD1   1 
ATOM   1537 C  CD2   . PHE A 1 203 ? -24.400 10.080 45.518 1.00 31.22  ? 185  PHE A CD2   1 
ATOM   1538 C  CE1   . PHE A 1 203 ? -26.576 11.881 45.616 1.00 30.34  ? 185  PHE A CE1   1 
ATOM   1539 C  CE2   . PHE A 1 203 ? -24.160 11.474 45.596 1.00 31.22  ? 185  PHE A CE2   1 
ATOM   1540 C  CZ    . PHE A 1 203 ? -25.258 12.386 45.645 1.00 31.83  ? 185  PHE A CZ    1 
ATOM   1541 N  N     A LYS A 1 204 ? -28.058 5.815  46.498 0.50 30.30  ? 186  LYS A N     1 
ATOM   1542 N  N     B LYS A 1 204 ? -28.048 5.778  46.464 0.50 30.27  ? 186  LYS A N     1 
ATOM   1543 C  CA    A LYS A 1 204 ? -28.593 4.506  46.160 0.50 32.48  ? 186  LYS A CA    1 
ATOM   1544 C  CA    B LYS A 1 204 ? -28.507 4.405  46.240 0.50 32.27  ? 186  LYS A CA    1 
ATOM   1545 C  C     A LYS A 1 204 ? -28.870 4.453  44.655 0.50 34.03  ? 186  LYS A C     1 
ATOM   1546 C  C     B LYS A 1 204 ? -29.041 4.275  44.801 0.50 34.12  ? 186  LYS A C     1 
ATOM   1547 O  O     A LYS A 1 204 ? -29.428 5.395  44.075 0.50 34.24  ? 186  LYS A O     1 
ATOM   1548 O  O     B LYS A 1 204 ? -29.942 5.022  44.402 0.50 35.05  ? 186  LYS A O     1 
ATOM   1549 C  CB    A LYS A 1 204 ? -29.880 4.285  46.967 0.50 33.17  ? 186  LYS A CB    1 
ATOM   1550 C  CB    B LYS A 1 204 ? -29.576 4.078  47.297 0.50 32.58  ? 186  LYS A CB    1 
ATOM   1551 C  CG    A LYS A 1 204 ? -30.674 3.029  46.672 0.50 35.18  ? 186  LYS A CG    1 
ATOM   1552 C  CG    B LYS A 1 204 ? -30.044 2.633  47.427 0.50 33.79  ? 186  LYS A CG    1 
ATOM   1553 C  CD    A LYS A 1 204 ? -31.917 2.958  47.594 0.50 35.43  ? 186  LYS A CD    1 
ATOM   1554 C  CD    B LYS A 1 204 ? -31.186 2.591  48.469 0.50 34.05  ? 186  LYS A CD    1 
ATOM   1555 C  CE    A LYS A 1 204 ? -32.821 1.767  47.255 0.50 38.47  ? 186  LYS A CE    1 
ATOM   1556 C  CE    B LYS A 1 204 ? -32.254 1.528  48.172 0.50 35.10  ? 186  LYS A CE    1 
ATOM   1557 N  NZ    A LYS A 1 204 ? -33.239 1.783  45.827 0.50 39.87  ? 186  LYS A NZ    1 
ATOM   1558 N  NZ    B LYS A 1 204 ? -31.794 0.138  48.396 0.50 34.84  ? 186  LYS A NZ    1 
ATOM   1559 N  N     . ASP A 1 205 ? -28.443 3.367  44.019 1.00 35.16  ? 187  ASP A N     1 
ATOM   1560 C  CA    . ASP A 1 205 ? -28.840 3.071  42.624 1.00 37.93  ? 187  ASP A CA    1 
ATOM   1561 C  C     . ASP A 1 205 ? -29.414 1.650  42.564 1.00 39.70  ? 187  ASP A C     1 
ATOM   1562 O  O     . ASP A 1 205 ? -28.713 0.725  42.192 1.00 40.77  ? 187  ASP A O     1 
ATOM   1563 C  CB    . ASP A 1 205 ? -27.620 3.232  41.672 1.00 38.45  ? 187  ASP A CB    1 
ATOM   1564 C  CG    . ASP A 1 205 ? -27.887 2.782  40.201 1.00 41.68  ? 187  ASP A CG    1 
ATOM   1565 O  OD1   . ASP A 1 205 ? -29.056 2.631  39.729 1.00 45.23  ? 187  ASP A OD1   1 
ATOM   1566 O  OD2   . ASP A 1 205 ? -26.873 2.603  39.493 1.00 47.42  ? 187  ASP A OD2   1 
ATOM   1567 N  N     . GLY A 1 206 ? -30.675 1.477  42.956 1.00 40.99  ? 188  GLY A N     1 
ATOM   1568 C  CA    . GLY A 1 206 ? -31.253 0.145  43.124 1.00 42.21  ? 188  GLY A CA    1 
ATOM   1569 C  C     . GLY A 1 206 ? -30.600 -0.647 44.250 1.00 41.40  ? 188  GLY A C     1 
ATOM   1570 O  O     . GLY A 1 206 ? -30.701 -0.268 45.415 1.00 39.83  ? 188  GLY A O     1 
ATOM   1571 N  N     . ASP A 1 207 ? -29.936 -1.752 43.880 1.00 42.57  ? 189  ASP A N     1 
ATOM   1572 C  CA    . ASP A 1 207 ? -29.172 -2.634 44.787 1.00 41.99  ? 189  ASP A CA    1 
ATOM   1573 C  C     . ASP A 1 207 ? -27.676 -2.267 44.926 1.00 40.18  ? 189  ASP A C     1 
ATOM   1574 O  O     . ASP A 1 207 ? -26.881 -3.074 45.425 1.00 40.66  ? 189  ASP A O     1 
ATOM   1575 C  CB    . ASP A 1 207 ? -29.237 -4.083 44.287 1.00 44.50  ? 189  ASP A CB    1 
ATOM   1576 C  CG    . ASP A 1 207 ? -30.542 -4.756 44.591 1.00 47.08  ? 189  ASP A CG    1 
ATOM   1577 O  OD1   . ASP A 1 207 ? -31.176 -4.430 45.625 1.00 47.67  ? 189  ASP A OD1   1 
ATOM   1578 O  OD2   . ASP A 1 207 ? -30.923 -5.647 43.796 1.00 52.14  ? 189  ASP A OD2   1 
ATOM   1579 N  N     . LEU A 1 208 ? -27.285 -1.086 44.455 1.00 37.83  ? 190  LEU A N     1 
ATOM   1580 C  CA    . LEU A 1 208 ? -25.923 -0.624 44.619 1.00 35.17  ? 190  LEU A CA    1 
ATOM   1581 C  C     . LEU A 1 208 ? -25.912 0.632  45.487 1.00 33.15  ? 190  LEU A C     1 
ATOM   1582 O  O     . LEU A 1 208 ? -26.730 1.537  45.282 1.00 33.53  ? 190  LEU A O     1 
ATOM   1583 C  CB    . LEU A 1 208 ? -25.287 -0.364 43.255 1.00 35.61  ? 190  LEU A CB    1 
ATOM   1584 C  CG    . LEU A 1 208 ? -25.047 -1.548 42.313 1.00 38.36  ? 190  LEU A CG    1 
ATOM   1585 C  CD1   . LEU A 1 208 ? -24.759 -1.005 40.932 1.00 39.06  ? 190  LEU A CD1   1 
ATOM   1586 C  CD2   . LEU A 1 208 ? -23.894 -2.405 42.777 1.00 38.50  ? 190  LEU A CD2   1 
ATOM   1587 N  N     . PHE A 1 209 ? -25.024 0.690  46.475 1.00 31.11  ? 191  PHE A N     1 
ATOM   1588 C  CA    . PHE A 1 209 ? -24.887 1.902  47.282 1.00 29.03  ? 191  PHE A CA    1 
ATOM   1589 C  C     . PHE A 1 209 ? -23.492 2.506  47.122 1.00 29.40  ? 191  PHE A C     1 
ATOM   1590 O  O     . PHE A 1 209 ? -22.496 1.860  47.396 1.00 29.09  ? 191  PHE A O     1 
ATOM   1591 C  CB    . PHE A 1 209 ? -25.171 1.648  48.755 1.00 28.26  ? 191  PHE A CB    1 
ATOM   1592 C  CG    . PHE A 1 209 ? -25.009 2.879  49.608 1.00 28.17  ? 191  PHE A CG    1 
ATOM   1593 C  CD1   . PHE A 1 209 ? -26.025 3.830  49.676 1.00 29.61  ? 191  PHE A CD1   1 
ATOM   1594 C  CD2   . PHE A 1 209 ? -23.838 3.090  50.334 1.00 26.57  ? 191  PHE A CD2   1 
ATOM   1595 C  CE1   . PHE A 1 209 ? -25.865 4.995  50.454 1.00 30.78  ? 191  PHE A CE1   1 
ATOM   1596 C  CE2   . PHE A 1 209 ? -23.672 4.228  51.116 1.00 28.11  ? 191  PHE A CE2   1 
ATOM   1597 C  CZ    . PHE A 1 209 ? -24.688 5.178  51.184 1.00 28.73  ? 191  PHE A CZ    1 
ATOM   1598 N  N     . MET A 1 210 ? -23.439 3.749  46.672 1.00 28.48  ? 192  MET A N     1 
ATOM   1599 C  CA    . MET A 1 210 ? -22.190 4.442  46.567 1.00 30.04  ? 192  MET A CA    1 
ATOM   1600 C  C     . MET A 1 210 ? -22.118 5.542  47.628 1.00 26.69  ? 192  MET A C     1 
ATOM   1601 O  O     . MET A 1 210 ? -22.885 6.517  47.606 1.00 25.60  ? 192  MET A O     1 
ATOM   1602 C  CB    . MET A 1 210 ? -22.052 5.028  45.173 1.00 28.99  ? 192  MET A CB    1 
ATOM   1603 C  CG    . MET A 1 210 ? -20.727 5.726  44.931 1.00 33.08  ? 192  MET A CG    1 
ATOM   1604 S  SD    . MET A 1 210 ? -20.831 6.850  43.487 1.00 41.35  ? 192  MET A SD    1 
ATOM   1605 C  CE    . MET A 1 210 ? -22.452 7.670  43.739 1.00 40.19  ? 192  MET A CE    1 
ATOM   1606 N  N     . SER A 1 211 ? -21.202 5.360  48.572 1.00 24.60  ? 193  SER A N     1 
ATOM   1607 C  CA    . SER A 1 211 ? -21.001 6.328  49.627 1.00 23.48  ? 193  SER A CA    1 
ATOM   1608 C  C     . SER A 1 211 ? -20.187 7.482  49.057 1.00 22.65  ? 193  SER A C     1 
ATOM   1609 O  O     . SER A 1 211 ? -19.457 7.327  48.052 1.00 21.08  ? 193  SER A O     1 
ATOM   1610 C  CB    . SER A 1 211 ? -20.285 5.666  50.812 1.00 23.76  ? 193  SER A CB    1 
ATOM   1611 O  OG    . SER A 1 211 ? -18.967 5.318  50.475 1.00 24.21  ? 193  SER A OG    1 
ATOM   1612 N  N     . TYR A 1 212 ? -20.319 8.649  49.675 1.00 22.18  ? 194  TYR A N     1 
ATOM   1613 C  CA    . TYR A 1 212 ? -19.506 9.764  49.256 1.00 22.28  ? 194  TYR A CA    1 
ATOM   1614 C  C     . TYR A 1 212 ? -18.031 9.413  49.442 1.00 21.76  ? 194  TYR A C     1 
ATOM   1615 O  O     . TYR A 1 212 ? -17.201 9.879  48.659 1.00 21.51  ? 194  TYR A O     1 
ATOM   1616 C  CB    . TYR A 1 212 ? -19.863 11.036 50.020 1.00 22.81  ? 194  TYR A CB    1 
ATOM   1617 C  CG    . TYR A 1 212 ? -21.225 11.583 49.724 1.00 24.35  ? 194  TYR A CG    1 
ATOM   1618 C  CD1   . TYR A 1 212 ? -21.557 12.047 48.444 1.00 24.91  ? 194  TYR A CD1   1 
ATOM   1619 C  CD2   . TYR A 1 212 ? -22.170 11.680 50.721 1.00 25.32  ? 194  TYR A CD2   1 
ATOM   1620 C  CE1   . TYR A 1 212 ? -22.811 12.599 48.192 1.00 27.46  ? 194  TYR A CE1   1 
ATOM   1621 C  CE2   . TYR A 1 212 ? -23.416 12.214 50.468 1.00 28.01  ? 194  TYR A CE2   1 
ATOM   1622 C  CZ    . TYR A 1 212 ? -23.720 12.667 49.194 1.00 26.32  ? 194  TYR A CZ    1 
ATOM   1623 O  OH    . TYR A 1 212 ? -24.949 13.201 48.964 1.00 31.30  ? 194  TYR A OH    1 
ATOM   1624 N  N     . ARG A 1 213 ? -17.714 8.592  50.451 1.00 22.21  ? 195  ARG A N     1 
ATOM   1625 C  CA    . ARG A 1 213 ? -16.337 8.167  50.683 1.00 23.22  ? 195  ARG A CA    1 
ATOM   1626 C  C     . ARG A 1 213 ? -15.730 7.331  49.550 1.00 22.79  ? 195  ARG A C     1 
ATOM   1627 O  O     . ARG A 1 213 ? -14.582 7.541  49.175 1.00 22.91  ? 195  ARG A O     1 
ATOM   1628 C  CB    . ARG A 1 213 ? -16.131 7.419  52.003 1.00 24.79  ? 195  ARG A CB    1 
ATOM   1629 C  CG    . ARG A 1 213 ? -14.647 7.535  52.402 1.00 29.00  ? 195  ARG A CG    1 
ATOM   1630 C  CD    . ARG A 1 213 ? -14.184 6.455  53.324 1.00 42.88  ? 195  ARG A CD    1 
ATOM   1631 N  NE    . ARG A 1 213 ? -12.869 6.749  53.951 1.00 53.19  ? 195  ARG A NE    1 
ATOM   1632 C  CZ    . ARG A 1 213 ? -11.697 6.950  53.308 1.00 56.77  ? 195  ARG A CZ    1 
ATOM   1633 N  NH1   . ARG A 1 213 ? -11.590 6.921  51.961 1.00 52.92  ? 195  ARG A NH1   1 
ATOM   1634 N  NH2   . ARG A 1 213 ? -10.603 7.186  54.041 1.00 59.68  ? 195  ARG A NH2   1 
ATOM   1635 N  N     . SER A 1 214 ? -16.471 6.355  49.051 1.00 23.21  ? 196  SER A N     1 
ATOM   1636 C  CA    . SER A 1 214 ? -15.958 5.564  47.964 1.00 24.22  ? 196  SER A CA    1 
ATOM   1637 C  C     . SER A 1 214 ? -15.940 6.385  46.670 1.00 23.74  ? 196  SER A C     1 
ATOM   1638 O  O     . SER A 1 214 ? -15.000 6.241  45.885 1.00 23.13  ? 196  SER A O     1 
ATOM   1639 C  CB    . SER A 1 214 ? -16.711 4.257  47.838 1.00 24.82  ? 196  SER A CB    1 
ATOM   1640 O  OG    . SER A 1 214 ? -17.993 4.488  47.334 1.00 28.17  ? 196  SER A OG    1 
ATOM   1641 N  N     . MET A 1 215 ? -16.910 7.293  46.495 1.00 22.67  ? 197  MET A N     1 
ATOM   1642 C  CA    . MET A 1 215 ? -16.878 8.208  45.356 1.00 24.61  ? 197  MET A CA    1 
ATOM   1643 C  C     . MET A 1 215 ? -15.602 9.058  45.376 1.00 23.09  ? 197  MET A C     1 
ATOM   1644 O  O     . MET A 1 215 ? -14.936 9.215  44.361 1.00 23.29  ? 197  MET A O     1 
ATOM   1645 C  CB    . MET A 1 215 ? -18.115 9.114  45.347 1.00 22.96  ? 197  MET A CB    1 
ATOM   1646 C  CG    . MET A 1 215 ? -18.409 9.775  44.000 1.00 26.57  ? 197  MET A CG    1 
ATOM   1647 S  SD    . MET A 1 215 ? -19.521 11.170 44.187 1.00 31.01  ? 197  MET A SD    1 
ATOM   1648 C  CE    . MET A 1 215 ? -18.438 12.269 45.102 1.00 29.96  ? 197  MET A CE    1 
ATOM   1649 N  N     . PHE A 1 216 ? -15.260 9.610  46.532 1.00 22.13  ? 198  PHE A N     1 
ATOM   1650 C  CA    . PHE A 1 216 ? -14.056 10.419 46.657 1.00 20.94  ? 198  PHE A CA    1 
ATOM   1651 C  C     . PHE A 1 216 ? -12.813 9.580  46.380 1.00 21.94  ? 198  PHE A C     1 
ATOM   1652 O  O     . PHE A 1 216 ? -11.856 10.076 45.757 1.00 21.52  ? 198  PHE A O     1 
ATOM   1653 C  CB    . PHE A 1 216 ? -13.986 11.009 48.075 1.00 21.10  ? 198  PHE A CB    1 
ATOM   1654 C  CG    . PHE A 1 216 ? -12.608 11.457 48.472 1.00 21.30  ? 198  PHE A CG    1 
ATOM   1655 C  CD1   . PHE A 1 216 ? -12.129 12.716 48.072 1.00 21.02  ? 198  PHE A CD1   1 
ATOM   1656 C  CD2   . PHE A 1 216 ? -11.771 10.606 49.208 1.00 22.18  ? 198  PHE A CD2   1 
ATOM   1657 C  CE1   . PHE A 1 216 ? -10.866 13.114 48.401 1.00 19.91  ? 198  PHE A CE1   1 
ATOM   1658 C  CE2   . PHE A 1 216 ? -10.491 11.002 49.535 1.00 19.82  ? 198  PHE A CE2   1 
ATOM   1659 C  CZ    . PHE A 1 216 ? -10.041 12.251 49.114 1.00 19.94  ? 198  PHE A CZ    1 
ATOM   1660 N  N     . GLN A 1 217 ? -12.794 8.339  46.885 1.00 22.19  ? 199  GLN A N     1 
ATOM   1661 C  CA    . GLN A 1 217 ? -11.660 7.452  46.651 1.00 24.70  ? 199  GLN A CA    1 
ATOM   1662 C  C     . GLN A 1 217 ? -11.514 7.143  45.163 1.00 23.95  ? 199  GLN A C     1 
ATOM   1663 O  O     . GLN A 1 217 ? -10.407 7.131  44.673 1.00 24.74  ? 199  GLN A O     1 
ATOM   1664 C  CB    . GLN A 1 217 ? -11.743 6.143  47.448 1.00 26.12  ? 199  GLN A CB    1 
ATOM   1665 C  CG    . GLN A 1 217 ? -10.358 5.456  47.620 1.00 30.93  ? 199  GLN A CG    1 
ATOM   1666 C  CD    . GLN A 1 217 ? -9.352  6.360  48.365 1.00 35.28  ? 199  GLN A CD    1 
ATOM   1667 O  OE1   . GLN A 1 217 ? -9.579  6.734  49.526 1.00 38.39  ? 199  GLN A OE1   1 
ATOM   1668 N  NE2   . GLN A 1 217 ? -8.267  6.743  47.686 1.00 33.37  ? 199  GLN A NE2   1 
ATOM   1669 N  N     . ASP A 1 218 ? -12.616 6.906  44.458 1.00 24.14  ? 200  ASP A N     1 
ATOM   1670 C  CA    . ASP A 1 218 ? -12.563 6.734  42.995 1.00 24.65  ? 200  ASP A CA    1 
ATOM   1671 C  C     . ASP A 1 218 ? -11.950 7.984  42.347 1.00 23.60  ? 200  ASP A C     1 
ATOM   1672 O  O     . ASP A 1 218 ? -11.089 7.848  41.506 1.00 25.09  ? 200  ASP A O     1 
ATOM   1673 C  CB    . ASP A 1 218 ? -13.951 6.465  42.399 1.00 24.98  ? 200  ASP A CB    1 
ATOM   1674 C  CG    . ASP A 1 218 ? -14.473 5.050  42.683 1.00 28.71  ? 200  ASP A CG    1 
ATOM   1675 O  OD1   . ASP A 1 218 ? -13.692 4.142  42.992 1.00 32.27  ? 200  ASP A OD1   1 
ATOM   1676 O  OD2   . ASP A 1 218 ? -15.695 4.837  42.565 1.00 32.58  ? 200  ASP A OD2   1 
ATOM   1677 N  N     . VAL A 1 219 ? -12.344 9.197  42.770 1.00 22.37  ? 201  VAL A N     1 
ATOM   1678 C  CA    . VAL A 1 219 ? -11.816 10.415 42.152 1.00 21.82  ? 201  VAL A CA    1 
ATOM   1679 C  C     . VAL A 1 219 ? -10.300 10.504 42.416 1.00 22.77  ? 201  VAL A C     1 
ATOM   1680 O  O     . VAL A 1 219 ? -9.506  10.692 41.482 1.00 23.10  ? 201  VAL A O     1 
ATOM   1681 C  CB    . VAL A 1 219 ? -12.533 11.684 42.626 1.00 21.82  ? 201  VAL A CB    1 
ATOM   1682 C  CG1   . VAL A 1 219 ? -11.836 12.956 42.110 1.00 21.87  ? 201  VAL A CG1   1 
ATOM   1683 C  CG2   . VAL A 1 219 ? -13.975 11.688 42.180 1.00 20.08  ? 201  VAL A CG2   1 
ATOM   1684 N  N     . ARG A 1 220 ? -9.922  10.372 43.685 1.00 22.32  ? 202  ARG A N     1 
ATOM   1685 C  CA    . ARG A 1 220 ? -8.526  10.384 44.124 1.00 23.69  ? 202  ARG A CA    1 
ATOM   1686 C  C     . ARG A 1 220 ? -7.670  9.356  43.314 1.00 24.20  ? 202  ARG A C     1 
ATOM   1687 O  O     . ARG A 1 220 ? -6.599  9.683  42.807 1.00 26.11  ? 202  ARG A O     1 
ATOM   1688 C  CB    . ARG A 1 220 ? -8.533  10.105 45.640 1.00 23.78  ? 202  ARG A CB    1 
ATOM   1689 C  CG    . ARG A 1 220 ? -7.305  10.503 46.409 1.00 27.68  ? 202  ARG A CG    1 
ATOM   1690 C  CD    . ARG A 1 220 ? -7.176  12.003 46.725 1.00 27.09  ? 202  ARG A CD    1 
ATOM   1691 N  NE    . ARG A 1 220 ? -6.740  12.794 45.570 1.00 24.71  ? 202  ARG A NE    1 
ATOM   1692 C  CZ    . ARG A 1 220 ? -5.534  12.722 44.993 1.00 25.95  ? 202  ARG A CZ    1 
ATOM   1693 N  NH1   . ARG A 1 220 ? -4.596  11.902 45.441 1.00 26.59  ? 202  ARG A NH1   1 
ATOM   1694 N  NH2   . ARG A 1 220 ? -5.257  13.477 43.956 1.00 22.84  ? 202  ARG A NH2   1 
ATOM   1695 N  N     . ASP A 1 221 ? -8.168  8.126  43.183 1.00 24.78  ? 203  ASP A N     1 
ATOM   1696 C  CA    . ASP A 1 221 ? -7.498  7.050  42.466 1.00 24.74  ? 203  ASP A CA    1 
ATOM   1697 C  C     . ASP A 1 221 ? -7.336  7.403  40.985 1.00 24.44  ? 203  ASP A C     1 
ATOM   1698 O  O     . ASP A 1 221 ? -6.276  7.116  40.397 1.00 25.19  ? 203  ASP A O     1 
ATOM   1699 C  CB    . ASP A 1 221 ? -8.282  5.742  42.578 1.00 25.41  ? 203  ASP A CB    1 
ATOM   1700 C  CG    . ASP A 1 221 ? -8.191  5.079  43.964 1.00 28.42  ? 203  ASP A CG    1 
ATOM   1701 O  OD1   . ASP A 1 221 ? -7.354  5.454  44.839 1.00 29.52  ? 203  ASP A OD1   1 
ATOM   1702 O  OD2   . ASP A 1 221 ? -8.984  4.137  44.158 1.00 28.53  ? 203  ASP A OD2   1 
ATOM   1703 N  N     . ALA A 1 222 ? -8.378  8.009  40.413 1.00 22.77  ? 204  ALA A N     1 
ATOM   1704 C  CA    . ALA A 1 222 ? -8.420  8.439  39.010 1.00 24.22  ? 204  ALA A CA    1 
ATOM   1705 C  C     . ALA A 1 222 ? -7.421  9.563  38.741 1.00 23.48  ? 204  ALA A C     1 
ATOM   1706 O  O     . ALA A 1 222 ? -6.763  9.525  37.711 1.00 24.80  ? 204  ALA A O     1 
ATOM   1707 C  CB    . ALA A 1 222 ? -9.849  8.866  38.573 1.00 22.84  ? 204  ALA A CB    1 
ATOM   1708 N  N     . VAL A 1 223 ? -7.306  10.533 39.668 1.00 22.69  ? 205  VAL A N     1 
ATOM   1709 C  CA    . VAL A 1 223 ? -6.286  11.600 39.550 1.00 22.32  ? 205  VAL A CA    1 
ATOM   1710 C  C     . VAL A 1 223 ? -4.891  10.970 39.599 1.00 23.36  ? 205  VAL A C     1 
ATOM   1711 O  O     . VAL A 1 223 ? -4.054  11.235 38.746 1.00 24.06  ? 205  VAL A O     1 
ATOM   1712 C  CB    . VAL A 1 223 ? -6.458  12.707 40.647 1.00 22.35  ? 205  VAL A CB    1 
ATOM   1713 C  CG1   . VAL A 1 223 ? -5.328  13.763 40.565 1.00 21.33  ? 205  VAL A CG1   1 
ATOM   1714 C  CG2   . VAL A 1 223 ? -7.839  13.384 40.490 1.00 18.44  ? 205  VAL A CG2   1 
ATOM   1715 N  N     . ASP A 1 224 ? -4.662  10.110 40.589 1.00 23.85  ? 206  ASP A N     1 
ATOM   1716 C  CA    . ASP A 1 224 ? -3.370  9.427  40.741 1.00 24.53  ? 206  ASP A CA    1 
ATOM   1717 C  C     . ASP A 1 224 ? -2.987  8.682  39.466 1.00 25.39  ? 206  ASP A C     1 
ATOM   1718 O  O     . ASP A 1 224 ? -1.852  8.780  39.004 1.00 25.68  ? 206  ASP A O     1 
ATOM   1719 C  CB    . ASP A 1 224 ? -3.414  8.427  41.883 1.00 25.53  ? 206  ASP A CB    1 
ATOM   1720 C  CG    . ASP A 1 224 ? -3.330  9.076  43.265 1.00 26.49  ? 206  ASP A CG    1 
ATOM   1721 O  OD1   . ASP A 1 224 ? -2.966  10.264 43.424 1.00 27.13  ? 206  ASP A OD1   1 
ATOM   1722 O  OD2   . ASP A 1 224 ? -3.639  8.356  44.215 1.00 27.13  ? 206  ASP A OD2   1 
ATOM   1723 N  N     . TRP A 1 225 ? -3.944  7.924  38.929 1.00 25.30  ? 207  TRP A N     1 
ATOM   1724 C  CA    . TRP A 1 225 ? -3.807  7.175  37.695 1.00 27.19  ? 207  TRP A CA    1 
ATOM   1725 C  C     . TRP A 1 225 ? -3.408  8.100  36.526 1.00 28.07  ? 207  TRP A C     1 
ATOM   1726 O  O     . TRP A 1 225 ? -2.440  7.811  35.809 1.00 29.15  ? 207  TRP A O     1 
ATOM   1727 C  CB    . TRP A 1 225 ? -5.098  6.392  37.412 1.00 26.63  ? 207  TRP A CB    1 
ATOM   1728 C  CG    . TRP A 1 225 ? -5.000  5.511  36.223 1.00 29.70  ? 207  TRP A CG    1 
ATOM   1729 C  CD1   . TRP A 1 225 ? -4.669  4.201  36.213 1.00 32.43  ? 207  TRP A CD1   1 
ATOM   1730 C  CD2   . TRP A 1 225 ? -5.218  5.879  34.854 1.00 30.62  ? 207  TRP A CD2   1 
ATOM   1731 N  NE1   . TRP A 1 225 ? -4.654  3.715  34.922 1.00 35.45  ? 207  TRP A NE1   1 
ATOM   1732 C  CE2   . TRP A 1 225 ? -4.985  4.730  34.069 1.00 32.62  ? 207  TRP A CE2   1 
ATOM   1733 C  CE3   . TRP A 1 225 ? -5.600  7.064  34.216 1.00 28.92  ? 207  TRP A CE3   1 
ATOM   1734 C  CZ2   . TRP A 1 225 ? -5.109  4.730  32.675 1.00 35.11  ? 207  TRP A CZ2   1 
ATOM   1735 C  CZ3   . TRP A 1 225 ? -5.710  7.058  32.806 1.00 30.21  ? 207  TRP A CZ3   1 
ATOM   1736 C  CH2   . TRP A 1 225 ? -5.478  5.900  32.072 1.00 32.26  ? 207  TRP A CH2   1 
ATOM   1737 N  N     . VAL A 1 226 ? -4.120  9.218  36.360 1.00 27.44  ? 208  VAL A N     1 
ATOM   1738 C  CA    . VAL A 1 226 ? -3.829  10.187 35.288 1.00 27.69  ? 208  VAL A CA    1 
ATOM   1739 C  C     . VAL A 1 226 ? -2.377  10.718 35.326 1.00 28.08  ? 208  VAL A C     1 
ATOM   1740 O  O     . VAL A 1 226 ? -1.723  10.822 34.285 1.00 27.97  ? 208  VAL A O     1 
ATOM   1741 C  CB    . VAL A 1 226 ? -4.854  11.359 35.283 1.00 27.56  ? 208  VAL A CB    1 
ATOM   1742 C  CG1   . VAL A 1 226 ? -4.373  12.497 34.385 1.00 27.17  ? 208  VAL A CG1   1 
ATOM   1743 C  CG2   . VAL A 1 226 ? -6.236  10.874 34.782 1.00 27.64  ? 208  VAL A CG2   1 
ATOM   1744 N  N     . HIS A 1 227 ? -1.902  11.035 36.532 1.00 27.07  ? 209  HIS A N     1 
ATOM   1745 C  CA    . HIS A 1 227 ? -0.516  11.421 36.822 1.00 27.21  ? 209  HIS A CA    1 
ATOM   1746 C  C     . HIS A 1 227 ? 0.519   10.314 36.638 1.00 29.06  ? 209  HIS A C     1 
ATOM   1747 O  O     . HIS A 1 227 ? 1.632   10.565 36.157 1.00 29.12  ? 209  HIS A O     1 
ATOM   1748 C  CB    . HIS A 1 227 ? -0.418  11.974 38.253 1.00 26.19  ? 209  HIS A CB    1 
ATOM   1749 C  CG    . HIS A 1 227 ? -0.780  13.420 38.346 1.00 27.76  ? 209  HIS A CG    1 
ATOM   1750 N  ND1   . HIS A 1 227 ? -2.088  13.862 38.431 1.00 28.54  ? 209  HIS A ND1   1 
ATOM   1751 C  CD2   . HIS A 1 227 ? -0.008  14.532 38.302 1.00 26.68  ? 209  HIS A CD2   1 
ATOM   1752 C  CE1   . HIS A 1 227 ? -2.104  15.183 38.464 1.00 24.75  ? 209  HIS A CE1   1 
ATOM   1753 N  NE2   . HIS A 1 227 ? -0.856  15.614 38.375 1.00 28.24  ? 209  HIS A NE2   1 
ATOM   1754 N  N     . TYR A 1 228 ? 0.163   9.095  37.032 1.00 30.03  ? 210  TYR A N     1 
ATOM   1755 C  CA    . TYR A 1 228 ? 1.112   8.005  37.067 1.00 33.74  ? 210  TYR A CA    1 
ATOM   1756 C  C     . TYR A 1 228 ? 1.081   7.114  35.805 1.00 35.28  ? 210  TYR A C     1 
ATOM   1757 O  O     . TYR A 1 228 ? 2.124   6.785  35.254 1.00 36.27  ? 210  TYR A O     1 
ATOM   1758 C  CB    . TYR A 1 228 ? 0.927   7.194  38.361 1.00 35.62  ? 210  TYR A CB    1 
ATOM   1759 C  CG    . TYR A 1 228 ? 1.973   6.138  38.605 1.00 41.54  ? 210  TYR A CG    1 
ATOM   1760 C  CD1   . TYR A 1 228 ? 3.348   6.428  38.445 1.00 45.55  ? 210  TYR A CD1   1 
ATOM   1761 C  CD2   . TYR A 1 228 ? 1.601   4.837  39.019 1.00 46.64  ? 210  TYR A CD2   1 
ATOM   1762 C  CE1   . TYR A 1 228 ? 4.324   5.442  38.661 1.00 47.68  ? 210  TYR A CE1   1 
ATOM   1763 C  CE2   . TYR A 1 228 ? 2.569   3.843  39.252 1.00 49.94  ? 210  TYR A CE2   1 
ATOM   1764 C  CZ    . TYR A 1 228 ? 3.930   4.166  39.064 1.00 50.34  ? 210  TYR A CZ    1 
ATOM   1765 O  OH    . TYR A 1 228 ? 4.899   3.214  39.285 1.00 53.19  ? 210  TYR A OH    1 
ATOM   1766 N  N     . LYS A 1 229 ? -0.110  6.733  35.348 1.00 35.69  ? 211  LYS A N     1 
ATOM   1767 C  CA    . LYS A 1 229 ? -0.234  5.783  34.256 1.00 38.48  ? 211  LYS A CA    1 
ATOM   1768 C  C     . LYS A 1 229 ? -0.965  6.393  33.073 1.00 38.17  ? 211  LYS A C     1 
ATOM   1769 O  O     . LYS A 1 229 ? -0.963  5.822  32.000 1.00 41.06  ? 211  LYS A O     1 
ATOM   1770 C  CB    . LYS A 1 229 ? -0.967  4.526  34.716 1.00 40.58  ? 211  LYS A CB    1 
ATOM   1771 C  CG    . LYS A 1 229 ? -0.198  3.611  35.672 1.00 46.36  ? 211  LYS A CG    1 
ATOM   1772 C  CD    . LYS A 1 229 ? -1.186  3.039  36.693 1.00 48.51  ? 211  LYS A CD    1 
ATOM   1773 C  CE    . LYS A 1 229 ? -0.827  1.636  37.219 1.00 54.33  ? 211  LYS A CE    1 
ATOM   1774 N  NZ    . LYS A 1 229 ? -1.907  1.113  38.200 1.00 52.76  ? 211  LYS A NZ    1 
ATOM   1775 N  N     . GLY A 1 230 ? -1.589  7.553  33.256 1.00 35.66  ? 212  GLY A N     1 
ATOM   1776 C  CA    . GLY A 1 230 ? -2.372  8.175  32.189 1.00 34.93  ? 212  GLY A CA    1 
ATOM   1777 C  C     . GLY A 1 230 ? -1.559  9.047  31.240 1.00 35.08  ? 212  GLY A C     1 
ATOM   1778 O  O     . GLY A 1 230 ? -0.327  8.932  31.149 1.00 35.55  ? 212  GLY A O     1 
ATOM   1779 N  N     . SER A 1 231 ? -2.245  9.948  30.547 1.00 34.58  ? 213  SER A N     1 
ATOM   1780 C  CA    . SER A 1 231 ? -1.584  10.680 29.468 1.00 35.56  ? 213  SER A CA    1 
ATOM   1781 C  C     . SER A 1 231 ? -1.360  12.171 29.743 1.00 32.92  ? 213  SER A C     1 
ATOM   1782 O  O     . SER A 1 231 ? -1.020  12.905 28.813 1.00 32.67  ? 213  SER A O     1 
ATOM   1783 C  CB    . SER A 1 231 ? -2.334  10.469 28.136 1.00 38.05  ? 213  SER A CB    1 
ATOM   1784 O  OG    . SER A 1 231 ? -3.582  11.144 28.144 1.00 40.64  ? 213  SER A OG    1 
ATOM   1785 N  N     . LEU A 1 232 ? -1.567  12.606 31.001 1.00 30.29  ? 214  LEU A N     1 
ATOM   1786 C  CA    . LEU A 1 232 ? -1.333  14.010 31.387 1.00 28.25  ? 214  LEU A CA    1 
ATOM   1787 C  C     . LEU A 1 232 ? 0.074   14.512 31.024 1.00 28.42  ? 214  LEU A C     1 
ATOM   1788 O  O     . LEU A 1 232 ? 0.216   15.563 30.392 1.00 27.74  ? 214  LEU A O     1 
ATOM   1789 C  CB    . LEU A 1 232 ? -1.620  14.236 32.870 1.00 27.08  ? 214  LEU A CB    1 
ATOM   1790 C  CG    . LEU A 1 232 ? -1.450  15.641 33.480 1.00 25.65  ? 214  LEU A CG    1 
ATOM   1791 C  CD1   . LEU A 1 232 ? -2.285  16.678 32.739 1.00 25.47  ? 214  LEU A CD1   1 
ATOM   1792 C  CD2   . LEU A 1 232 ? -1.812  15.638 34.946 1.00 23.56  ? 214  LEU A CD2   1 
ATOM   1793 N  N     . LYS A 1 233 ? 1.103   13.775 31.454 1.00 28.38  ? 215  LYS A N     1 
ATOM   1794 C  CA    . LYS A 1 233 ? 2.489   14.154 31.162 1.00 28.42  ? 215  LYS A CA    1 
ATOM   1795 C  C     . LYS A 1 233 ? 2.793   14.167 29.662 1.00 29.98  ? 215  LYS A C     1 
ATOM   1796 O  O     . LYS A 1 233 ? 3.409   15.104 29.171 1.00 29.29  ? 215  LYS A O     1 
ATOM   1797 C  CB    . LYS A 1 233 ? 3.498   13.302 31.956 1.00 28.87  ? 215  LYS A CB    1 
ATOM   1798 C  CG    . LYS A 1 233 ? 3.474   13.595 33.474 1.00 26.52  ? 215  LYS A CG    1 
ATOM   1799 C  CD    . LYS A 1 233 ? 4.535   12.760 34.232 1.00 28.67  ? 215  LYS A CD    1 
ATOM   1800 C  CE    . LYS A 1 233 ? 4.598   13.122 35.706 1.00 27.61  ? 215  LYS A CE    1 
ATOM   1801 N  NZ    . LYS A 1 233 ? 3.238   13.047 36.311 1.00 28.86  ? 215  LYS A NZ    1 
ATOM   1802 N  N     . GLU A 1 234 ? 2.339   13.142 28.939 1.00 31.70  ? 216  GLU A N     1 
ATOM   1803 C  CA    . GLU A 1 234 ? 2.543   13.078 27.488 1.00 35.46  ? 216  GLU A CA    1 
ATOM   1804 C  C     . GLU A 1 234 ? 1.863   14.269 26.784 1.00 33.83  ? 216  GLU A C     1 
ATOM   1805 O  O     . GLU A 1 234 ? 2.450   14.879 25.887 1.00 33.53  ? 216  GLU A O     1 
ATOM   1806 C  CB    . GLU A 1 234 ? 2.064   11.730 26.906 1.00 36.79  ? 216  GLU A CB    1 
ATOM   1807 C  CG    . GLU A 1 234 ? 1.682   11.836 25.427 1.00 44.28  ? 216  GLU A CG    1 
ATOM   1808 C  CD    . GLU A 1 234 ? 0.912   10.647 24.877 1.00 47.71  ? 216  GLU A CD    1 
ATOM   1809 O  OE1   . GLU A 1 234 ? -0.359  10.692 24.777 1.00 55.31  ? 216  GLU A OE1   1 
ATOM   1810 O  OE2   . GLU A 1 234 ? 1.598   9.678  24.502 1.00 56.65  ? 216  GLU A OE2   1 
ATOM   1811 N  N     A LYS A 1 235 ? 0.643   14.592 27.214 0.50 32.60  ? 217  LYS A N     1 
ATOM   1812 N  N     B LYS A 1 235 ? 0.640   14.605 27.202 0.50 32.59  ? 217  LYS A N     1 
ATOM   1813 C  CA    A LYS A 1 235 ? -0.137  15.673 26.607 0.50 32.35  ? 217  LYS A CA    1 
ATOM   1814 C  CA    B LYS A 1 235 ? -0.120  15.684 26.553 0.50 32.28  ? 217  LYS A CA    1 
ATOM   1815 C  C     A LYS A 1 235 ? 0.477   17.027 26.917 0.50 30.86  ? 217  LYS A C     1 
ATOM   1816 C  C     B LYS A 1 235 ? 0.337   17.081 26.984 0.50 30.79  ? 217  LYS A C     1 
ATOM   1817 O  O     A LYS A 1 235 ? 0.505   17.908 26.056 0.50 32.04  ? 217  LYS A O     1 
ATOM   1818 O  O     B LYS A 1 235 ? 0.115   18.052 26.266 0.50 31.98  ? 217  LYS A O     1 
ATOM   1819 C  CB    A LYS A 1 235 ? -1.606  15.603 27.042 0.50 31.49  ? 217  LYS A CB    1 
ATOM   1820 C  CB    B LYS A 1 235 ? -1.640  15.477 26.696 0.50 32.17  ? 217  LYS A CB    1 
ATOM   1821 C  CG    A LYS A 1 235 ? -2.331  14.405 26.439 0.50 34.12  ? 217  LYS A CG    1 
ATOM   1822 C  CG    B LYS A 1 235 ? -2.196  14.444 25.674 0.50 34.14  ? 217  LYS A CG    1 
ATOM   1823 C  CD    A LYS A 1 235 ? -3.809  14.407 26.741 0.50 34.17  ? 217  LYS A CD    1 
ATOM   1824 C  CD    B LYS A 1 235 ? -3.707  14.234 25.793 0.50 35.04  ? 217  LYS A CD    1 
ATOM   1825 C  CE    A LYS A 1 235 ? -4.540  13.282 25.993 0.50 37.08  ? 217  LYS A CE    1 
ATOM   1826 C  CE    B LYS A 1 235 ? -4.175  12.941 25.103 0.50 37.61  ? 217  LYS A CE    1 
ATOM   1827 N  NZ    A LYS A 1 235 ? -4.162  13.124 24.545 0.50 38.71  ? 217  LYS A NZ    1 
ATOM   1828 N  NZ    B LYS A 1 235 ? -5.534  12.512 25.590 0.50 37.36  ? 217  LYS A NZ    1 
ATOM   1829 N  N     . THR A 1 236 ? 1.002   17.171 28.133 1.00 28.65  ? 218  THR A N     1 
ATOM   1830 C  CA    . THR A 1 236 ? 1.661   18.417 28.576 1.00 27.06  ? 218  THR A CA    1 
ATOM   1831 C  C     . THR A 1 236 ? 2.874   18.726 27.704 1.00 27.64  ? 218  THR A C     1 
ATOM   1832 O  O     . THR A 1 236 ? 2.986   19.818 27.170 1.00 27.56  ? 218  THR A O     1 
ATOM   1833 C  CB    . THR A 1 236 ? 2.065   18.347 30.075 1.00 24.46  ? 218  THR A CB    1 
ATOM   1834 O  OG1   . THR A 1 236 ? 0.903   18.099 30.869 1.00 25.20  ? 218  THR A OG1   1 
ATOM   1835 C  CG2   . THR A 1 236 ? 2.751   19.645 30.567 1.00 24.09  ? 218  THR A CG2   1 
ATOM   1836 N  N     . VAL A 1 237 ? 3.741   17.729 27.562 1.00 29.07  ? 219  VAL A N     1 
ATOM   1837 C  CA    . VAL A 1 237 ? 5.017   17.789 26.846 1.00 30.93  ? 219  VAL A CA    1 
ATOM   1838 C  C     . VAL A 1 237 ? 4.848   18.004 25.327 1.00 34.09  ? 219  VAL A C     1 
ATOM   1839 O  O     . VAL A 1 237 ? 5.671   18.677 24.675 1.00 34.22  ? 219  VAL A O     1 
ATOM   1840 C  CB    . VAL A 1 237 ? 5.875   16.526 27.213 1.00 31.38  ? 219  VAL A CB    1 
ATOM   1841 C  CG1   . VAL A 1 237 ? 6.965   16.267 26.215 1.00 36.16  ? 219  VAL A CG1   1 
ATOM   1842 C  CG2   . VAL A 1 237 ? 6.455   16.656 28.645 1.00 28.57  ? 219  VAL A CG2   1 
ATOM   1843 N  N     . GLU A 1 238 ? 3.780   17.466 24.749 1.00 36.36  ? 220  GLU A N     1 
ATOM   1844 C  CA    . GLU A 1 238 ? 3.548   17.723 23.328 1.00 40.27  ? 220  GLU A CA    1 
ATOM   1845 C  C     . GLU A 1 238 ? 2.949   19.118 23.069 1.00 39.05  ? 220  GLU A C     1 
ATOM   1846 O  O     . GLU A 1 238 ? 2.788   19.496 21.929 1.00 41.22  ? 220  GLU A O     1 
ATOM   1847 C  CB    . GLU A 1 238 ? 2.757   16.602 22.669 1.00 41.91  ? 220  GLU A CB    1 
ATOM   1848 C  CG    . GLU A 1 238 ? 1.391   16.396 23.245 1.00 45.17  ? 220  GLU A CG    1 
ATOM   1849 C  CD    . GLU A 1 238 ? 0.675   15.158 22.696 1.00 47.88  ? 220  GLU A CD    1 
ATOM   1850 O  OE1   . GLU A 1 238 ? 1.337   14.312 22.035 1.00 54.96  ? 220  GLU A OE1   1 
ATOM   1851 O  OE2   . GLU A 1 238 ? -0.558  15.028 22.941 1.00 53.86  ? 220  GLU A OE2   1 
ATOM   1852 N  N     . ASN A 1 239 ? 2.656   19.883 24.127 1.00 36.47  ? 221  ASN A N     1 
ATOM   1853 C  CA    . ASN A 1 239 ? 2.294   21.309 23.985 1.00 36.35  ? 221  ASN A CA    1 
ATOM   1854 C  C     . ASN A 1 239 ? 2.721   22.223 25.122 1.00 33.14  ? 221  ASN A C     1 
ATOM   1855 O  O     . ASN A 1 239 ? 1.902   22.841 25.781 1.00 32.72  ? 221  ASN A O     1 
ATOM   1856 C  CB    . ASN A 1 239 ? 0.810   21.536 23.715 1.00 37.23  ? 221  ASN A CB    1 
ATOM   1857 C  CG    . ASN A 1 239 ? 0.565   22.795 22.864 1.00 41.00  ? 221  ASN A CG    1 
ATOM   1858 O  OD1   . ASN A 1 239 ? 1.398   23.739 22.815 1.00 40.86  ? 221  ASN A OD1   1 
ATOM   1859 N  ND2   . ASN A 1 239 ? -0.573  22.812 22.188 1.00 41.31  ? 221  ASN A ND2   1 
ATOM   1860 N  N     . LEU A 1 240 ? 4.020   22.345 25.302 1.00 32.17  ? 222  LEU A N     1 
ATOM   1861 C  CA    . LEU A 1 240 ? 4.575   23.045 26.444 1.00 30.17  ? 222  LEU A CA    1 
ATOM   1862 C  C     . LEU A 1 240 ? 4.207   24.519 26.493 1.00 30.31  ? 222  LEU A C     1 
ATOM   1863 O  O     . LEU A 1 240 ? 3.914   25.023 27.557 1.00 28.69  ? 222  LEU A O     1 
ATOM   1864 C  CB    . LEU A 1 240 ? 6.067   22.837 26.479 1.00 30.93  ? 222  LEU A CB    1 
ATOM   1865 C  CG    . LEU A 1 240 ? 6.454   21.408 26.860 1.00 30.73  ? 222  LEU A CG    1 
ATOM   1866 C  CD1   . LEU A 1 240 ? 7.856   21.122 26.429 1.00 33.15  ? 222  LEU A CD1   1 
ATOM   1867 C  CD2   . LEU A 1 240 ? 6.290   21.201 28.319 1.00 27.97  ? 222  LEU A CD2   1 
ATOM   1868 N  N     A GLU A 1 241 ? 4.210   25.219 25.353 0.50 31.02  ? 223  GLU A N     1 
ATOM   1869 N  N     B GLU A 1 241 ? 4.184   25.172 25.333 0.50 31.07  ? 223  GLU A N     1 
ATOM   1870 C  CA    A GLU A 1 241 ? 3.842   26.639 25.380 0.50 31.67  ? 223  GLU A CA    1 
ATOM   1871 C  CA    B GLU A 1 241 ? 3.844   26.588 25.222 0.50 31.90  ? 223  GLU A CA    1 
ATOM   1872 C  C     A GLU A 1 241 ? 2.411   26.840 25.889 0.50 31.45  ? 223  GLU A C     1 
ATOM   1873 C  C     B GLU A 1 241 ? 2.413   26.894 25.707 0.50 31.74  ? 223  GLU A C     1 
ATOM   1874 O  O     A GLU A 1 241 ? 2.122   27.804 26.629 0.50 30.77  ? 223  GLU A O     1 
ATOM   1875 O  O     B GLU A 1 241 ? 2.132   27.977 26.261 0.50 31.43  ? 223  GLU A O     1 
ATOM   1876 C  CB    A GLU A 1 241 ? 4.020   27.329 24.016 0.50 33.94  ? 223  GLU A CB    1 
ATOM   1877 C  CB    B GLU A 1 241 ? 4.045   27.045 23.765 0.50 34.15  ? 223  GLU A CB    1 
ATOM   1878 C  CG    A GLU A 1 241 ? 4.417   28.800 24.177 0.50 36.14  ? 223  GLU A CG    1 
ATOM   1879 C  CG    B GLU A 1 241 ? 5.503   26.928 23.261 0.50 35.97  ? 223  GLU A CG    1 
ATOM   1880 C  CD    A GLU A 1 241 ? 3.673   29.748 23.242 0.50 40.43  ? 223  GLU A CD    1 
ATOM   1881 C  CD    B GLU A 1 241 ? 5.989   25.475 23.027 0.50 38.68  ? 223  GLU A CD    1 
ATOM   1882 O  OE1   A GLU A 1 241 ? 2.723   30.423 23.722 0.50 41.79  ? 223  GLU A OE1   1 
ATOM   1883 O  OE1   B GLU A 1 241 ? 5.162   24.539 22.841 0.50 37.66  ? 223  GLU A OE1   1 
ATOM   1884 O  OE2   A GLU A 1 241 ? 4.045   29.820 22.044 0.50 40.96  ? 223  GLU A OE2   1 
ATOM   1885 O  OE2   B GLU A 1 241 ? 7.228   25.278 23.025 0.50 39.81  ? 223  GLU A OE2   1 
ATOM   1886 N  N     . LYS A 1 242 ? 1.521   25.925 25.502 1.00 31.87  ? 224  LYS A N     1 
ATOM   1887 C  CA    . LYS A 1 242 ? 0.129   25.996 25.945 1.00 32.09  ? 224  LYS A CA    1 
ATOM   1888 C  C     . LYS A 1 242 ? -0.048  25.835 27.453 1.00 30.30  ? 224  LYS A C     1 
ATOM   1889 O  O     . LYS A 1 242 ? -0.920  26.465 28.054 1.00 30.61  ? 224  LYS A O     1 
ATOM   1890 C  CB    . LYS A 1 242 ? -0.705  24.919 25.233 1.00 33.12  ? 224  LYS A CB    1 
ATOM   1891 C  CG    . LYS A 1 242 ? -2.144  24.872 25.657 1.00 33.17  ? 224  LYS A CG    1 
ATOM   1892 C  CD    . LYS A 1 242 ? -2.969  24.047 24.733 1.00 35.72  ? 224  LYS A CD    1 
ATOM   1893 C  CE    . LYS A 1 242 ? -4.341  23.894 25.323 1.00 38.58  ? 224  LYS A CE    1 
ATOM   1894 N  NZ    . LYS A 1 242 ? -5.285  23.496 24.280 1.00 43.29  ? 224  LYS A NZ    1 
ATOM   1895 N  N     . TYR A 1 243 ? 0.768   24.962 28.039 1.00 28.58  ? 225  TYR A N     1 
ATOM   1896 C  CA    . TYR A 1 243 ? 0.578   24.479 29.384 1.00 26.82  ? 225  TYR A CA    1 
ATOM   1897 C  C     . TYR A 1 243 ? 1.559   25.017 30.422 1.00 25.73  ? 225  TYR A C     1 
ATOM   1898 O  O     . TYR A 1 243 ? 1.258   24.948 31.600 1.00 24.45  ? 225  TYR A O     1 
ATOM   1899 C  CB    . TYR A 1 243 ? 0.603   22.942 29.385 1.00 26.38  ? 225  TYR A CB    1 
ATOM   1900 C  CG    . TYR A 1 243 ? -0.618  22.372 28.734 1.00 26.26  ? 225  TYR A CG    1 
ATOM   1901 C  CD1   . TYR A 1 243 ? -1.893  22.649 29.245 1.00 27.40  ? 225  TYR A CD1   1 
ATOM   1902 C  CD2   . TYR A 1 243 ? -0.521  21.559 27.607 1.00 26.81  ? 225  TYR A CD2   1 
ATOM   1903 C  CE1   . TYR A 1 243 ? -3.034  22.138 28.643 1.00 26.42  ? 225  TYR A CE1   1 
ATOM   1904 C  CE2   . TYR A 1 243 ? -1.649  21.055 27.002 1.00 28.68  ? 225  TYR A CE2   1 
ATOM   1905 C  CZ    . TYR A 1 243 ? -2.903  21.349 27.521 1.00 28.84  ? 225  TYR A CZ    1 
ATOM   1906 O  OH    . TYR A 1 243 ? -4.025  20.822 26.920 1.00 32.69  ? 225  TYR A OH    1 
ATOM   1907 N  N     . VAL A 1 244 ? 2.717   25.556 30.011 1.00 25.67  ? 226  VAL A N     1 
ATOM   1908 C  CA    . VAL A 1 244 ? 3.783   25.883 31.014 1.00 24.80  ? 226  VAL A CA    1 
ATOM   1909 C  C     . VAL A 1 244 ? 4.275   27.320 30.869 1.00 25.43  ? 226  VAL A C     1 
ATOM   1910 O  O     . VAL A 1 244 ? 4.701   27.690 29.794 1.00 25.87  ? 226  VAL A O     1 
ATOM   1911 C  CB    . VAL A 1 244 ? 5.017   24.889 30.919 1.00 24.97  ? 226  VAL A CB    1 
ATOM   1912 C  CG1   . VAL A 1 244 ? 5.975   25.062 32.079 1.00 22.74  ? 226  VAL A CG1   1 
ATOM   1913 C  CG2   . VAL A 1 244 ? 4.546   23.435 30.857 1.00 24.21  ? 226  VAL A CG2   1 
ATOM   1914 N  N     . VAL A 1 245 ? 4.209   28.116 31.941 1.00 25.61  ? 227  VAL A N     1 
ATOM   1915 C  CA    . VAL A 1 245 ? 4.803   29.482 31.999 1.00 27.78  ? 227  VAL A CA    1 
ATOM   1916 C  C     . VAL A 1 245 ? 6.348   29.396 31.788 1.00 28.50  ? 227  VAL A C     1 
ATOM   1917 O  O     . VAL A 1 245 ? 7.021   28.549 32.381 1.00 28.20  ? 227  VAL A O     1 
ATOM   1918 C  CB    . VAL A 1 245 ? 4.427   30.215 33.345 1.00 28.38  ? 227  VAL A CB    1 
ATOM   1919 C  CG1   . VAL A 1 245 ? 5.194   31.510 33.523 1.00 29.86  ? 227  VAL A CG1   1 
ATOM   1920 C  CG2   . VAL A 1 245 ? 2.914   30.495 33.444 1.00 27.81  ? 227  VAL A CG2   1 
ATOM   1921 N  N     . LYS A 1 246 ? 6.901   30.230 30.909 1.00 29.85  ? 228  LYS A N     1 
ATOM   1922 C  CA    . LYS A 1 246 ? 8.336   30.238 30.660 1.00 30.53  ? 228  LYS A CA    1 
ATOM   1923 C  C     . LYS A 1 246 ? 8.888   31.630 30.907 1.00 31.82  ? 228  LYS A C     1 
ATOM   1924 O  O     . LYS A 1 246 ? 8.267   32.581 30.488 1.00 34.02  ? 228  LYS A O     1 
ATOM   1925 C  CB    . LYS A 1 246 ? 8.573   29.902 29.195 1.00 30.76  ? 228  LYS A CB    1 
ATOM   1926 C  CG    . LYS A 1 246 ? 9.956   29.460 28.920 1.00 31.88  ? 228  LYS A CG    1 
ATOM   1927 C  CD    . LYS A 1 246 ? 10.022  29.058 27.528 1.00 33.02  ? 228  LYS A CD    1 
ATOM   1928 C  CE    . LYS A 1 246 ? 11.380  28.619 27.177 1.00 37.00  ? 228  LYS A CE    1 
ATOM   1929 N  NZ    . LYS A 1 246 ? 11.227  28.081 25.812 1.00 37.94  ? 228  LYS A NZ    1 
ATOM   1930 N  N     . ASP A 1 247 ? 10.070  31.754 31.513 1.00 32.22  ? 229  ASP A N     1 
ATOM   1931 C  CA    . ASP A 1 247 ? 10.621  33.055 31.927 1.00 34.24  ? 229  ASP A CA    1 
ATOM   1932 C  C     . ASP A 1 247 ? 12.136  33.118 31.721 1.00 35.17  ? 229  ASP A C     1 
ATOM   1933 O  O     . ASP A 1 247 ? 12.877  32.321 32.295 1.00 35.87  ? 229  ASP A O     1 
ATOM   1934 C  CB    . ASP A 1 247 ? 10.296  33.275 33.430 1.00 35.08  ? 229  ASP A CB    1 
ATOM   1935 C  CG    . ASP A 1 247 ? 10.612  34.689 33.925 1.00 38.87  ? 229  ASP A CG    1 
ATOM   1936 O  OD1   . ASP A 1 247 ? 11.477  35.402 33.334 1.00 38.43  ? 229  ASP A OD1   1 
ATOM   1937 O  OD2   . ASP A 1 247 ? 9.989   35.087 34.947 1.00 41.71  ? 229  ASP A OD2   1 
ATOM   1938 N  N     . GLY A 1 248 ? 12.603  34.073 30.915 1.00 30.28  ? 230  GLY A N     1 
ATOM   1939 C  CA    . GLY A 1 248 ? 14.028  34.278 30.670 1.00 30.05  ? 230  GLY A CA    1 
ATOM   1940 C  C     . GLY A 1 248 ? 14.805  34.643 31.921 1.00 30.14  ? 230  GLY A C     1 
ATOM   1941 O  O     . GLY A 1 248 ? 15.998  34.391 31.984 1.00 30.51  ? 230  GLY A O     1 
ATOM   1942 N  N     . LYS A 1 249 ? 14.117  35.219 32.912 1.00 29.84  ? 231  LYS A N     1 
ATOM   1943 C  CA    . LYS A 1 249 ? 14.719  35.597 34.190 1.00 30.39  ? 231  LYS A CA    1 
ATOM   1944 C  C     . LYS A 1 249 ? 15.073  34.427 35.115 1.00 30.70  ? 231  LYS A C     1 
ATOM   1945 O  O     . LYS A 1 249 ? 15.855  34.624 36.048 1.00 31.05  ? 231  LYS A O     1 
ATOM   1946 C  CB    . LYS A 1 249 ? 13.828  36.590 34.943 1.00 31.17  ? 231  LYS A CB    1 
ATOM   1947 C  CG    . LYS A 1 249 ? 13.694  37.940 34.206 1.00 33.04  ? 231  LYS A CG    1 
ATOM   1948 C  CD    . LYS A 1 249 ? 12.911  38.971 34.990 1.00 33.44  ? 231  LYS A CD    1 
ATOM   1949 C  CE    . LYS A 1 249 ? 11.426  38.618 35.062 1.00 35.76  ? 231  LYS A CE    1 
ATOM   1950 N  NZ    . LYS A 1 249 ? 10.883  38.061 33.780 1.00 34.51  ? 231  LYS A NZ    1 
ATOM   1951 N  N     . LEU A 1 250 ? 14.515  33.230 34.872 1.00 30.05  ? 232  LEU A N     1 
ATOM   1952 C  CA    . LEU A 1 250 ? 14.816  32.055 35.729 1.00 29.72  ? 232  LEU A CA    1 
ATOM   1953 C  C     . LEU A 1 250 ? 16.317  31.686 35.706 1.00 28.97  ? 232  LEU A C     1 
ATOM   1954 O  O     . LEU A 1 250 ? 16.933  31.623 36.752 1.00 29.11  ? 232  LEU A O     1 
ATOM   1955 C  CB    . LEU A 1 250 ? 13.892  30.859 35.420 1.00 29.28  ? 232  LEU A CB    1 
ATOM   1956 C  CG    . LEU A 1 250 ? 14.310  29.449 35.893 1.00 29.06  ? 232  LEU A CG    1 
ATOM   1957 C  CD1   . LEU A 1 250 ? 14.400  29.420 37.403 1.00 31.11  ? 232  LEU A CD1   1 
ATOM   1958 C  CD2   . LEU A 1 250 ? 13.342  28.373 35.439 1.00 29.79  ? 232  LEU A CD2   1 
ATOM   1959 N  N     . PRO A 1 251 ? 16.923  31.463 34.510 1.00 28.82  ? 233  PRO A N     1 
ATOM   1960 C  CA    . PRO A 1 251 ? 18.376  31.245 34.500 1.00 28.10  ? 233  PRO A CA    1 
ATOM   1961 C  C     . PRO A 1 251 ? 19.226  32.338 35.171 1.00 28.05  ? 233  PRO A C     1 
ATOM   1962 O  O     . PRO A 1 251 ? 20.289  32.046 35.759 1.00 27.96  ? 233  PRO A O     1 
ATOM   1963 C  CB    . PRO A 1 251 ? 18.711  31.130 33.001 1.00 27.84  ? 233  PRO A CB    1 
ATOM   1964 C  CG    . PRO A 1 251 ? 17.461  30.717 32.330 1.00 28.18  ? 233  PRO A CG    1 
ATOM   1965 C  CD    . PRO A 1 251 ? 16.316  31.234 33.180 1.00 29.07  ? 233  PRO A CD    1 
ATOM   1966 N  N     . LEU A 1 252 ? 18.790  33.593 35.064 1.00 27.71  ? 234  LEU A N     1 
ATOM   1967 C  CA    . LEU A 1 252 ? 19.529  34.682 35.698 1.00 27.89  ? 234  LEU A CA    1 
ATOM   1968 C  C     . LEU A 1 252 ? 19.494  34.561 37.226 1.00 26.99  ? 234  LEU A C     1 
ATOM   1969 O  O     . LEU A 1 252 ? 20.532  34.692 37.870 1.00 27.17  ? 234  LEU A O     1 
ATOM   1970 C  CB    . LEU A 1 252 ? 19.039  36.062 35.231 1.00 29.18  ? 234  LEU A CB    1 
ATOM   1971 C  CG    . LEU A 1 252 ? 19.702  37.296 35.831 1.00 30.05  ? 234  LEU A CG    1 
ATOM   1972 C  CD1   . LEU A 1 252 ? 21.189  37.377 35.469 1.00 31.73  ? 234  LEU A CD1   1 
ATOM   1973 C  CD2   . LEU A 1 252 ? 18.933  38.536 35.377 1.00 31.07  ? 234  LEU A CD2   1 
ATOM   1974 N  N     . LEU A 1 253 ? 18.314  34.305 37.786 1.00 25.85  ? 235  LEU A N     1 
ATOM   1975 C  CA    . LEU A 1 253 ? 18.181  34.214 39.260 1.00 26.04  ? 235  LEU A CA    1 
ATOM   1976 C  C     . LEU A 1 253 ? 18.960  33.015 39.823 1.00 25.38  ? 235  LEU A C     1 
ATOM   1977 O  O     . LEU A 1 253 ? 19.756  33.166 40.764 1.00 26.02  ? 235  LEU A O     1 
ATOM   1978 C  CB    . LEU A 1 253 ? 16.715  34.179 39.696 1.00 25.68  ? 235  LEU A CB    1 
ATOM   1979 C  CG    . LEU A 1 253 ? 16.547  33.982 41.215 1.00 26.45  ? 235  LEU A CG    1 
ATOM   1980 C  CD1   . LEU A 1 253 ? 17.078  35.168 41.995 1.00 25.93  ? 235  LEU A CD1   1 
ATOM   1981 C  CD2   . LEU A 1 253 ? 15.080  33.776 41.564 1.00 28.12  ? 235  LEU A CD2   1 
ATOM   1982 N  N     . LEU A 1 254 ? 18.807  31.864 39.169 1.00 25.21  ? 236  LEU A N     1 
ATOM   1983 C  CA    . LEU A 1 254 ? 19.519  30.658 39.547 1.00 26.19  ? 236  LEU A CA    1 
ATOM   1984 C  C     . LEU A 1 254 ? 21.011  30.855 39.489 1.00 26.43  ? 236  LEU A C     1 
ATOM   1985 O  O     . LEU A 1 254 ? 21.733  30.423 40.398 1.00 27.06  ? 236  LEU A O     1 
ATOM   1986 C  CB    . LEU A 1 254 ? 19.086  29.440 38.702 1.00 25.69  ? 236  LEU A CB    1 
ATOM   1987 C  CG    . LEU A 1 254 ? 17.712  28.826 39.044 1.00 27.18  ? 236  LEU A CG    1 
ATOM   1988 C  CD1   . LEU A 1 254 ? 17.604  27.374 38.543 1.00 29.56  ? 236  LEU A CD1   1 
ATOM   1989 C  CD2   . LEU A 1 254 ? 17.464  28.821 40.473 1.00 28.56  ? 236  LEU A CD2   1 
ATOM   1990 N  N     . SER A 1 255 ? 21.481  31.546 38.459 1.00 27.63  ? 237  SER A N     1 
ATOM   1991 C  CA    . SER A 1 255 ? 22.925  31.734 38.284 1.00 28.82  ? 237  SER A CA    1 
ATOM   1992 C  C     . SER A 1 255 ? 23.507  32.717 39.321 1.00 29.88  ? 237  SER A C     1 
ATOM   1993 O  O     . SER A 1 255 ? 24.666  32.577 39.744 1.00 30.91  ? 237  SER A O     1 
ATOM   1994 C  CB    . SER A 1 255 ? 23.248  32.207 36.857 1.00 29.72  ? 237  SER A CB    1 
ATOM   1995 O  OG    . SER A 1 255 ? 22.827  33.551 36.706 1.00 32.66  ? 237  SER A OG    1 
ATOM   1996 N  N     . ARG A 1 256 ? 22.710  33.702 39.730 1.00 30.39  ? 238  ARG A N     1 
ATOM   1997 C  CA    . ARG A 1 256 ? 23.102  34.612 40.807 1.00 32.08  ? 238  ARG A CA    1 
ATOM   1998 C  C     . ARG A 1 256 ? 23.113  33.904 42.172 1.00 32.55  ? 238  ARG A C     1 
ATOM   1999 O  O     . ARG A 1 256 ? 23.982  34.172 43.009 1.00 33.12  ? 238  ARG A O     1 
ATOM   2000 C  CB    . ARG A 1 256 ? 22.191  35.832 40.821 1.00 33.20  ? 238  ARG A CB    1 
ATOM   2001 C  CG    . ARG A 1 256 ? 22.428  36.742 39.591 1.00 36.93  ? 238  ARG A CG    1 
ATOM   2002 C  CD    . ARG A 1 256 ? 21.414  37.846 39.461 1.00 43.06  ? 238  ARG A CD    1 
ATOM   2003 N  NE    . ARG A 1 256 ? 21.330  38.582 40.716 1.00 51.45  ? 238  ARG A NE    1 
ATOM   2004 C  CZ    . ARG A 1 256 ? 22.108  39.614 41.038 1.00 54.86  ? 238  ARG A CZ    1 
ATOM   2005 N  NH1   . ARG A 1 256 ? 23.031  40.055 40.182 1.00 56.18  ? 238  ARG A NH1   1 
ATOM   2006 N  NH2   . ARG A 1 256 ? 21.953  40.202 42.218 1.00 57.71  ? 238  ARG A NH2   1 
ATOM   2007 N  N     . MET A 1 257 ? 22.171  32.981 42.371 1.00 32.03  ? 239  MET A N     1 
ATOM   2008 C  CA    . MET A 1 257 ? 22.118  32.205 43.608 1.00 32.70  ? 239  MET A CA    1 
ATOM   2009 C  C     . MET A 1 257 ? 23.358  31.339 43.719 1.00 33.95  ? 239  MET A C     1 
ATOM   2010 O  O     . MET A 1 257 ? 23.964  31.242 44.799 1.00 34.83  ? 239  MET A O     1 
ATOM   2011 C  CB    . MET A 1 257 ? 20.859  31.348 43.683 1.00 30.82  ? 239  MET A CB    1 
ATOM   2012 C  CG    . MET A 1 257 ? 19.593  32.112 43.998 1.00 30.22  ? 239  MET A CG    1 
ATOM   2013 S  SD    . MET A 1 257 ? 18.137  31.069 43.792 1.00 30.65  ? 239  MET A SD    1 
ATOM   2014 C  CE    . MET A 1 257 ? 16.908  31.987 44.735 1.00 29.07  ? 239  MET A CE    1 
ATOM   2015 N  N     . LYS A 1 258 ? 23.758  30.748 42.592 1.00 34.68  ? 240  LYS A N     1 
ATOM   2016 C  CA    . LYS A 1 258 ? 24.936  29.897 42.553 1.00 36.39  ? 240  LYS A CA    1 
ATOM   2017 C  C     . LYS A 1 258 ? 26.225  30.652 42.795 1.00 37.78  ? 240  LYS A C     1 
ATOM   2018 O  O     . LYS A 1 258 ? 27.197  30.055 43.210 1.00 38.79  ? 240  LYS A O     1 
ATOM   2019 C  CB    . LYS A 1 258 ? 24.985  29.031 41.285 1.00 36.05  ? 240  LYS A CB    1 
ATOM   2020 C  CG    . LYS A 1 258 ? 25.777  27.729 41.455 1.00 39.23  ? 240  LYS A CG    1 
ATOM   2021 C  CD    . LYS A 1 258 ? 25.057  26.548 40.801 1.00 42.29  ? 240  LYS A CD    1 
ATOM   2022 C  CE    . LYS A 1 258 ? 25.968  25.859 39.789 1.00 43.42  ? 240  LYS A CE    1 
ATOM   2023 N  NZ    . LYS A 1 258 ? 26.933  25.026 40.516 1.00 45.45  ? 240  LYS A NZ    1 
ATOM   2024 N  N     . GLU A 1 259 ? 26.222  31.967 42.602 1.00 39.80  ? 241  GLU A N     1 
ATOM   2025 C  CA    . GLU A 1 259 ? 27.397  32.790 42.887 1.00 42.23  ? 241  GLU A CA    1 
ATOM   2026 C  C     . GLU A 1 259 ? 27.681  32.912 44.378 1.00 41.90  ? 241  GLU A C     1 
ATOM   2027 O  O     . GLU A 1 259 ? 28.828  33.092 44.780 1.00 43.97  ? 241  GLU A O     1 
ATOM   2028 C  CB    . GLU A 1 259 ? 27.265  34.190 42.254 1.00 43.07  ? 241  GLU A CB    1 
ATOM   2029 C  CG    . GLU A 1 259 ? 27.406  34.181 40.735 1.00 45.56  ? 241  GLU A CG    1 
ATOM   2030 C  CD    . GLU A 1 259 ? 26.960  35.488 40.062 1.00 47.12  ? 241  GLU A CD    1 
ATOM   2031 O  OE1   . GLU A 1 259 ? 26.857  36.544 40.779 1.00 51.97  ? 241  GLU A OE1   1 
ATOM   2032 O  OE2   . GLU A 1 259 ? 26.719  35.442 38.810 1.00 50.54  ? 241  GLU A OE2   1 
ATOM   2033 N  N     . VAL A 1 260 ? 26.646  32.828 45.208 1.00 40.63  ? 242  VAL A N     1 
ATOM   2034 C  CA    . VAL A 1 260 ? 26.804  33.011 46.664 1.00 39.68  ? 242  VAL A CA    1 
ATOM   2035 C  C     . VAL A 1 260 ? 26.462  31.773 47.499 1.00 38.42  ? 242  VAL A C     1 
ATOM   2036 O  O     . VAL A 1 260 ? 26.566  31.795 48.726 1.00 38.23  ? 242  VAL A O     1 
ATOM   2037 C  CB    . VAL A 1 260 ? 25.988  34.231 47.194 1.00 41.07  ? 242  VAL A CB    1 
ATOM   2038 C  CG1   . VAL A 1 260 ? 26.440  35.517 46.494 1.00 41.52  ? 242  VAL A CG1   1 
ATOM   2039 C  CG2   . VAL A 1 260 ? 24.465  34.015 47.047 1.00 38.09  ? 242  VAL A CG2   1 
ATOM   2040 N  N     . GLY A 1 261 ? 26.028  30.696 46.841 1.00 35.59  ? 243  GLY A N     1 
ATOM   2041 C  CA    . GLY A 1 261 ? 25.640  29.504 47.574 1.00 34.36  ? 243  GLY A CA    1 
ATOM   2042 C  C     . GLY A 1 261 ? 25.496  28.322 46.661 1.00 32.36  ? 243  GLY A C     1 
ATOM   2043 O  O     . GLY A 1 261 ? 25.881  28.366 45.476 1.00 33.07  ? 243  GLY A O     1 
ATOM   2044 N  N     . LYS A 1 262 ? 24.942  27.259 47.219 1.00 31.13  ? 244  LYS A N     1 
ATOM   2045 C  CA    . LYS A 1 262 ? 24.640  26.045 46.483 1.00 29.18  ? 244  LYS A CA    1 
ATOM   2046 C  C     . LYS A 1 262 ? 23.191  26.044 46.093 1.00 27.42  ? 244  LYS A C     1 
ATOM   2047 O  O     . LYS A 1 262 ? 22.367  26.670 46.762 1.00 27.55  ? 244  LYS A O     1 
ATOM   2048 C  CB    . LYS A 1 262 ? 24.987  24.833 47.360 1.00 30.21  ? 244  LYS A CB    1 
ATOM   2049 C  CG    . LYS A 1 262 ? 26.471  24.546 47.276 1.00 33.02  ? 244  LYS A CG    1 
ATOM   2050 C  CD    . LYS A 1 262 ? 26.964  23.832 48.444 1.00 37.60  ? 244  LYS A CD    1 
ATOM   2051 C  CE    . LYS A 1 262 ? 28.411  23.474 48.232 1.00 40.92  ? 244  LYS A CE    1 
ATOM   2052 N  NZ    . LYS A 1 262 ? 28.837  22.619 49.394 1.00 43.96  ? 244  LYS A NZ    1 
ATOM   2053 N  N     . VAL A 1 263 ? 22.873  25.374 44.986 1.00 25.20  ? 245  VAL A N     1 
ATOM   2054 C  CA    . VAL A 1 263 ? 21.504  25.318 44.487 1.00 23.44  ? 245  VAL A CA    1 
ATOM   2055 C  C     . VAL A 1 263 ? 21.135  23.857 44.269 1.00 22.14  ? 245  VAL A C     1 
ATOM   2056 O  O     . VAL A 1 263 ? 21.935  23.094 43.736 1.00 22.26  ? 245  VAL A O     1 
ATOM   2057 C  CB    . VAL A 1 263 ? 21.324  26.187 43.183 1.00 23.06  ? 245  VAL A CB    1 
ATOM   2058 C  CG1   . VAL A 1 263 ? 19.913  26.056 42.615 1.00 21.99  ? 245  VAL A CG1   1 
ATOM   2059 C  CG2   . VAL A 1 263 ? 21.680  27.673 43.456 1.00 24.63  ? 245  VAL A CG2   1 
ATOM   2060 N  N     . PHE A 1 264 ? 19.955  23.446 44.717 1.00 21.53  ? 246  PHE A N     1 
ATOM   2061 C  CA    . PHE A 1 264 ? 19.521  22.059 44.524 1.00 20.48  ? 246  PHE A CA    1 
ATOM   2062 C  C     . PHE A 1 264 ? 18.049  21.969 44.082 1.00 20.34  ? 246  PHE A C     1 
ATOM   2063 O  O     . PHE A 1 264 ? 17.239  22.889 44.294 1.00 20.36  ? 246  PHE A O     1 
ATOM   2064 C  CB    . PHE A 1 264 ? 19.839  21.154 45.771 1.00 20.47  ? 246  PHE A CB    1 
ATOM   2065 C  CG    . PHE A 1 264 ? 18.974  21.428 46.987 1.00 19.97  ? 246  PHE A CG    1 
ATOM   2066 C  CD1   . PHE A 1 264 ? 17.750  20.767 47.154 1.00 20.03  ? 246  PHE A CD1   1 
ATOM   2067 C  CD2   . PHE A 1 264 ? 19.404  22.315 48.000 1.00 17.73  ? 246  PHE A CD2   1 
ATOM   2068 C  CE1   . PHE A 1 264 ? 16.953  21.002 48.287 1.00 17.82  ? 246  PHE A CE1   1 
ATOM   2069 C  CE2   . PHE A 1 264 ? 18.607  22.559 49.133 1.00 20.06  ? 246  PHE A CE2   1 
ATOM   2070 C  CZ    . PHE A 1 264 ? 17.378  21.898 49.266 1.00 19.15  ? 246  PHE A CZ    1 
ATOM   2071 N  N     . LEU A 1 265 ? 17.727  20.855 43.461 1.00 20.75  ? 247  LEU A N     1 
ATOM   2072 C  CA    . LEU A 1 265 ? 16.356  20.549 43.028 1.00 21.21  ? 247  LEU A CA    1 
ATOM   2073 C  C     . LEU A 1 265 ? 15.889  19.298 43.774 1.00 20.84  ? 247  LEU A C     1 
ATOM   2074 O  O     . LEU A 1 265 ? 16.604  18.308 43.815 1.00 21.84  ? 247  LEU A O     1 
ATOM   2075 C  CB    . LEU A 1 265 ? 16.367  20.275 41.513 1.00 21.28  ? 247  LEU A CB    1 
ATOM   2076 C  CG    . LEU A 1 265 ? 15.001  20.001 40.859 1.00 21.04  ? 247  LEU A CG    1 
ATOM   2077 C  CD1   . LEU A 1 265 ? 14.308  21.354 40.770 1.00 21.75  ? 247  LEU A CD1   1 
ATOM   2078 C  CD2   . LEU A 1 265 ? 15.176  19.468 39.413 1.00 22.46  ? 247  LEU A CD2   1 
ATOM   2079 N  N     . ALA A 1 266 ? 14.680  19.317 44.329 1.00 20.37  ? 248  ALA A N     1 
ATOM   2080 C  CA    . ALA A 1 266 ? 14.131  18.130 44.989 1.00 21.26  ? 248  ALA A CA    1 
ATOM   2081 C  C     . ALA A 1 266 ? 12.688  18.043 44.544 1.00 21.17  ? 248  ALA A C     1 
ATOM   2082 O  O     . ALA A 1 266 ? 11.880  18.870 44.949 1.00 23.24  ? 248  ALA A O     1 
ATOM   2083 C  CB    . ALA A 1 266 ? 14.210  18.250 46.540 1.00 19.95  ? 248  ALA A CB    1 
ATOM   2084 N  N     . THR A 1 267 ? 12.381  17.098 43.662 1.00 20.49  ? 249  THR A N     1 
ATOM   2085 C  CA    . THR A 1 267 ? 11.037  17.027 43.051 1.00 19.83  ? 249  THR A CA    1 
ATOM   2086 C  C     . THR A 1 267 ? 10.400  15.683 43.344 1.00 19.26  ? 249  THR A C     1 
ATOM   2087 O  O     . THR A 1 267 ? 11.074  14.688 43.440 1.00 19.05  ? 249  THR A O     1 
ATOM   2088 C  CB    . THR A 1 267 ? 11.056  17.323 41.515 1.00 20.10  ? 249  THR A CB    1 
ATOM   2089 O  OG1   . THR A 1 267 ? 9.799   16.993 40.937 1.00 18.01  ? 249  THR A OG1   1 
ATOM   2090 C  CG2   . THR A 1 267 ? 12.159  16.550 40.743 1.00 19.72  ? 249  THR A CG2   1 
ATOM   2091 N  N     . ASN A 1 268 ? 9.083   15.641 43.489 1.00 19.70  ? 250  ASN A N     1 
ATOM   2092 C  CA    . ASN A 1 268 ? 8.450   14.354 43.605 1.00 19.80  ? 250  ASN A CA    1 
ATOM   2093 C  C     . ASN A 1 268 ? 8.321   13.664 42.256 1.00 20.00  ? 250  ASN A C     1 
ATOM   2094 O  O     . ASN A 1 268 ? 7.937   12.503 42.216 1.00 19.94  ? 250  ASN A O     1 
ATOM   2095 C  CB    . ASN A 1 268 ? 7.046   14.473 44.231 1.00 19.97  ? 250  ASN A CB    1 
ATOM   2096 C  CG    . ASN A 1 268 ? 7.071   14.445 45.740 1.00 18.60  ? 250  ASN A CG    1 
ATOM   2097 O  OD1   . ASN A 1 268 ? 8.119   14.551 46.351 1.00 19.22  ? 250  ASN A OD1   1 
ATOM   2098 N  ND2   . ASN A 1 268 ? 5.891   14.269 46.357 1.00 16.08  ? 250  ASN A ND2   1 
ATOM   2099 N  N     A SER A 1 269 ? 8.573   14.370 41.150 0.50 20.29  ? 251  SER A N     1 
ATOM   2100 N  N     B SER A 1 269 ? 8.636   14.383 41.172 0.50 19.41  ? 251  SER A N     1 
ATOM   2101 C  CA    A SER A 1 269 ? 8.401   13.737 39.843 0.50 21.20  ? 251  SER A CA    1 
ATOM   2102 C  CA    B SER A 1 269 ? 8.489   13.865 39.813 0.50 19.39  ? 251  SER A CA    1 
ATOM   2103 C  C     A SER A 1 269 ? 9.596   12.830 39.499 0.50 21.47  ? 251  SER A C     1 
ATOM   2104 C  C     B SER A 1 269 ? 9.695   13.009 39.369 0.50 20.42  ? 251  SER A C     1 
ATOM   2105 O  O     A SER A 1 269 ? 10.560  12.716 40.278 0.50 21.46  ? 251  SER A O     1 
ATOM   2106 O  O     B SER A 1 269 ? 10.773  13.105 39.962 0.50 20.53  ? 251  SER A O     1 
ATOM   2107 C  CB    A SER A 1 269 ? 8.106   14.766 38.732 0.50 21.28  ? 251  SER A CB    1 
ATOM   2108 C  CB    B SER A 1 269 ? 8.235   15.024 38.837 0.50 18.94  ? 251  SER A CB    1 
ATOM   2109 O  OG    A SER A 1 269 ? 9.241   15.546 38.456 0.50 23.73  ? 251  SER A OG    1 
ATOM   2110 O  OG    B SER A 1 269 ? 7.719   14.535 37.624 0.50 15.75  ? 251  SER A OG    1 
ATOM   2111 N  N     . ASP A 1 270 ? 9.488   12.165 38.354 1.00 21.47  ? 252  ASP A N     1 
ATOM   2112 C  CA    . ASP A 1 270 ? 10.509  11.244 37.855 1.00 22.73  ? 252  ASP A CA    1 
ATOM   2113 C  C     . ASP A 1 270 ? 11.525  11.991 36.972 1.00 21.07  ? 252  ASP A C     1 
ATOM   2114 O  O     . ASP A 1 270 ? 11.294  13.122 36.531 1.00 19.22  ? 252  ASP A O     1 
ATOM   2115 C  CB    . ASP A 1 270 ? 9.832   10.117 37.059 1.00 25.04  ? 252  ASP A CB    1 
ATOM   2116 C  CG    . ASP A 1 270 ? 9.029   10.646 35.849 1.00 30.42  ? 252  ASP A CG    1 
ATOM   2117 O  OD1   . ASP A 1 270 ? 9.609   10.687 34.749 1.00 33.94  ? 252  ASP A OD1   1 
ATOM   2118 O  OD2   . ASP A 1 270 ? 7.836   11.048 35.985 1.00 36.84  ? 252  ASP A OD2   1 
ATOM   2119 N  N     . TYR A 1 271 ? 12.659  11.373 36.713 1.00 22.02  ? 253  TYR A N     1 
ATOM   2120 C  CA    . TYR A 1 271 ? 13.695  12.057 35.912 1.00 22.68  ? 253  TYR A CA    1 
ATOM   2121 C  C     . TYR A 1 271 ? 13.271  12.456 34.485 1.00 23.36  ? 253  TYR A C     1 
ATOM   2122 O  O     . TYR A 1 271 ? 13.541  13.590 34.032 1.00 23.66  ? 253  TYR A O     1 
ATOM   2123 C  CB    . TYR A 1 271 ? 15.030  11.275 35.897 1.00 23.27  ? 253  TYR A CB    1 
ATOM   2124 C  CG    . TYR A 1 271 ? 16.122  12.069 35.172 1.00 25.66  ? 253  TYR A CG    1 
ATOM   2125 C  CD1   . TYR A 1 271 ? 16.680  13.214 35.753 1.00 25.91  ? 253  TYR A CD1   1 
ATOM   2126 C  CD2   . TYR A 1 271 ? 16.563  11.688 33.904 1.00 25.54  ? 253  TYR A CD2   1 
ATOM   2127 C  CE1   . TYR A 1 271 ? 17.672  13.961 35.085 1.00 26.21  ? 253  TYR A CE1   1 
ATOM   2128 C  CE2   . TYR A 1 271 ? 17.549  12.430 33.225 1.00 26.42  ? 253  TYR A CE2   1 
ATOM   2129 C  CZ    . TYR A 1 271 ? 18.087  13.564 33.822 1.00 24.77  ? 253  TYR A CZ    1 
ATOM   2130 O  OH    . TYR A 1 271 ? 19.058  14.298 33.148 1.00 27.34  ? 253  TYR A OH    1 
ATOM   2131 N  N     . LYS A 1 272 ? 12.631  11.531 33.764 1.00 23.97  ? 254  LYS A N     1 
ATOM   2132 C  CA    . LYS A 1 272 ? 12.271  11.772 32.355 1.00 25.16  ? 254  LYS A CA    1 
ATOM   2133 C  C     . LYS A 1 272 ? 11.370  12.977 32.192 1.00 22.99  ? 254  LYS A C     1 
ATOM   2134 O  O     . LYS A 1 272 ? 11.629  13.841 31.389 1.00 23.62  ? 254  LYS A O     1 
ATOM   2135 C  CB    . LYS A 1 272 ? 11.606  10.533 31.733 1.00 27.04  ? 254  LYS A CB    1 
ATOM   2136 C  CG    . LYS A 1 272 ? 12.583  9.526  31.140 1.00 34.31  ? 254  LYS A CG    1 
ATOM   2137 C  CD    . LYS A 1 272 ? 11.977  8.107  31.219 1.00 41.58  ? 254  LYS A CD    1 
ATOM   2138 C  CE    . LYS A 1 272 ? 12.811  7.079  30.454 1.00 47.43  ? 254  LYS A CE    1 
ATOM   2139 N  NZ    . LYS A 1 272 ? 12.624  5.686  31.034 1.00 50.68  ? 254  LYS A NZ    1 
ATOM   2140 N  N     . TYR A 1 273 ? 10.320  13.057 32.977 1.00 22.60  ? 255  TYR A N     1 
ATOM   2141 C  CA    . TYR A 1 273 ? 9.487   14.238 32.972 1.00 22.82  ? 255  TYR A CA    1 
ATOM   2142 C  C     . TYR A 1 273 ? 10.225  15.551 33.415 1.00 22.45  ? 255  TYR A C     1 
ATOM   2143 O  O     . TYR A 1 273 ? 10.092  16.602 32.773 1.00 21.39  ? 255  TYR A O     1 
ATOM   2144 C  CB    . TYR A 1 273 ? 8.257   13.995 33.834 1.00 22.98  ? 255  TYR A CB    1 
ATOM   2145 C  CG    . TYR A 1 273 ? 7.246   15.124 33.764 1.00 23.41  ? 255  TYR A CG    1 
ATOM   2146 C  CD1   . TYR A 1 273 ? 6.519   15.348 32.586 1.00 23.84  ? 255  TYR A CD1   1 
ATOM   2147 C  CD2   . TYR A 1 273 ? 6.990   15.940 34.880 1.00 21.68  ? 255  TYR A CD2   1 
ATOM   2148 C  CE1   . TYR A 1 273 ? 5.590   16.366 32.496 1.00 23.49  ? 255  TYR A CE1   1 
ATOM   2149 C  CE2   . TYR A 1 273 ? 6.045   16.959 34.810 1.00 21.91  ? 255  TYR A CE2   1 
ATOM   2150 C  CZ    . TYR A 1 273 ? 5.338   17.157 33.621 1.00 24.24  ? 255  TYR A CZ    1 
ATOM   2151 O  OH    . TYR A 1 273 ? 4.382   18.156 33.527 1.00 23.24  ? 255  TYR A OH    1 
ATOM   2152 N  N     . THR A 1 274 ? 10.961  15.473 34.525 1.00 22.40  ? 256  THR A N     1 
ATOM   2153 C  CA    . THR A 1 274 ? 11.774  16.595 35.019 1.00 22.21  ? 256  THR A CA    1 
ATOM   2154 C  C     . THR A 1 274 ? 12.703  17.112 33.907 1.00 22.51  ? 256  THR A C     1 
ATOM   2155 O  O     . THR A 1 274 ? 12.836  18.319 33.676 1.00 23.26  ? 256  THR A O     1 
ATOM   2156 C  CB    . THR A 1 274 ? 12.621  16.164 36.254 1.00 22.14  ? 256  THR A CB    1 
ATOM   2157 O  OG1   . THR A 1 274 ? 11.763  15.617 37.286 1.00 24.51  ? 256  THR A OG1   1 
ATOM   2158 C  CG2   . THR A 1 274 ? 13.427  17.373 36.822 1.00 21.26  ? 256  THR A CG2   1 
ATOM   2159 N  N     . ASP A 1 275 ? 13.361  16.184 33.234 1.00 22.18  ? 257  ASP A N     1 
ATOM   2160 C  CA    . ASP A 1 275 ? 14.245  16.543 32.147 1.00 22.99  ? 257  ASP A CA    1 
ATOM   2161 C  C     . ASP A 1 275 ? 13.494  17.237 30.995 1.00 23.19  ? 257  ASP A C     1 
ATOM   2162 O  O     . ASP A 1 275 ? 13.972  18.236 30.508 1.00 22.66  ? 257  ASP A O     1 
ATOM   2163 C  CB    . ASP A 1 275 ? 15.012  15.322 31.682 1.00 22.50  ? 257  ASP A CB    1 
ATOM   2164 C  CG    . ASP A 1 275 ? 16.098  15.654 30.697 1.00 25.70  ? 257  ASP A CG    1 
ATOM   2165 O  OD1   . ASP A 1 275 ? 16.588  16.806 30.667 1.00 27.50  ? 257  ASP A OD1   1 
ATOM   2166 O  OD2   . ASP A 1 275 ? 16.448  14.738 29.902 1.00 29.26  ? 257  ASP A OD2   1 
ATOM   2167 N  N     . LYS A 1 276 ? 12.303  16.758 30.612 1.00 23.44  ? 258  LYS A N     1 
ATOM   2168 C  CA    . LYS A 1 276 ? 11.540  17.424 29.549 1.00 24.81  ? 258  LYS A CA    1 
ATOM   2169 C  C     . LYS A 1 276 ? 11.129  18.840 29.963 1.00 24.01  ? 258  LYS A C     1 
ATOM   2170 O  O     . LYS A 1 276 ? 11.258  19.793 29.211 1.00 23.72  ? 258  LYS A O     1 
ATOM   2171 C  CB    . LYS A 1 276 ? 10.238  16.669 29.217 1.00 26.00  ? 258  LYS A CB    1 
ATOM   2172 C  CG    . LYS A 1 276 ? 10.344  15.305 28.525 1.00 31.61  ? 258  LYS A CG    1 
ATOM   2173 C  CD    . LYS A 1 276 ? 11.344  15.239 27.395 1.00 40.70  ? 258  LYS A CD    1 
ATOM   2174 C  CE    . LYS A 1 276 ? 10.806  14.387 26.219 1.00 44.90  ? 258  LYS A CE    1 
ATOM   2175 N  NZ    . LYS A 1 276 ? 9.900   13.279 26.691 1.00 49.25  ? 258  LYS A NZ    1 
ATOM   2176 N  N     . ILE A 1 277 ? 10.550  18.952 31.155 1.00 23.10  ? 259  ILE A N     1 
ATOM   2177 C  CA    . ILE A 1 277 ? 10.032  20.249 31.663 1.00 23.14  ? 259  ILE A CA    1 
ATOM   2178 C  C     . ILE A 1 277 ? 11.139  21.290 31.880 1.00 22.92  ? 259  ILE A C     1 
ATOM   2179 O  O     . ILE A 1 277 ? 11.025  22.430 31.420 1.00 23.59  ? 259  ILE A O     1 
ATOM   2180 C  CB    . ILE A 1 277 ? 9.232   20.038 32.979 1.00 21.72  ? 259  ILE A CB    1 
ATOM   2181 C  CG1   . ILE A 1 277 ? 7.948   19.223 32.709 1.00 21.43  ? 259  ILE A CG1   1 
ATOM   2182 C  CG2   . ILE A 1 277 ? 8.932   21.379 33.694 1.00 22.66  ? 259  ILE A CG2   1 
ATOM   2183 C  CD1   . ILE A 1 277 ? 7.014   19.894 31.695 1.00 21.67  ? 259  ILE A CD1   1 
ATOM   2184 N  N     . MET A 1 278 ? 12.199  20.881 32.574 1.00 22.42  ? 260  MET A N     1 
ATOM   2185 C  CA    . MET A 1 278 ? 13.366  21.742 32.833 1.00 22.15  ? 260  MET A CA    1 
ATOM   2186 C  C     . MET A 1 278 ? 14.099  22.185 31.564 1.00 23.83  ? 260  MET A C     1 
ATOM   2187 O  O     . MET A 1 278 ? 14.523  23.330 31.484 1.00 24.25  ? 260  MET A O     1 
ATOM   2188 C  CB    . MET A 1 278 ? 14.324  21.046 33.782 1.00 21.93  ? 260  MET A CB    1 
ATOM   2189 C  CG    . MET A 1 278 ? 13.749  20.775 35.221 1.00 22.39  ? 260  MET A CG    1 
ATOM   2190 S  SD    . MET A 1 278 ? 13.412  22.279 36.146 1.00 26.21  ? 260  MET A SD    1 
ATOM   2191 C  CE    . MET A 1 278 ? 15.100  22.869 36.425 1.00 23.78  ? 260  MET A CE    1 
ATOM   2192 N  N     . THR A 1 279 ? 14.269  21.288 30.578 1.00 24.66  ? 261  THR A N     1 
ATOM   2193 C  CA    . THR A 1 279 ? 14.853  21.675 29.291 1.00 24.88  ? 261  THR A CA    1 
ATOM   2194 C  C     . THR A 1 279 ? 14.040  22.811 28.659 1.00 25.12  ? 261  THR A C     1 
ATOM   2195 O  O     . THR A 1 279 ? 14.586  23.814 28.182 1.00 25.80  ? 261  THR A O     1 
ATOM   2196 C  CB    . THR A 1 279 ? 14.874  20.491 28.324 1.00 25.25  ? 261  THR A CB    1 
ATOM   2197 O  OG1   . THR A 1 279 ? 15.625  19.419 28.920 1.00 24.74  ? 261  THR A OG1   1 
ATOM   2198 C  CG2   . THR A 1 279 ? 15.443  20.908 26.933 1.00 24.85  ? 261  THR A CG2   1 
ATOM   2199 N  N     . TYR A 1 280 ? 12.729  22.627 28.639 1.00 25.44  ? 262  TYR A N     1 
ATOM   2200 C  CA    . TYR A 1 280 ? 11.820  23.652 28.171 1.00 26.39  ? 262  TYR A CA    1 
ATOM   2201 C  C     . TYR A 1 280 ? 11.993  24.964 28.955 1.00 26.20  ? 262  TYR A C     1 
ATOM   2202 O  O     . TYR A 1 280 ? 12.076  25.998 28.336 1.00 26.85  ? 262  TYR A O     1 
ATOM   2203 C  CB    . TYR A 1 280 ? 10.382  23.175 28.230 1.00 27.25  ? 262  TYR A CB    1 
ATOM   2204 C  CG    . TYR A 1 280 ? 9.350   24.275 28.009 1.00 29.92  ? 262  TYR A CG    1 
ATOM   2205 C  CD1   . TYR A 1 280 ? 9.070   24.777 26.735 1.00 30.05  ? 262  TYR A CD1   1 
ATOM   2206 C  CD2   . TYR A 1 280 ? 8.658   24.807 29.094 1.00 29.08  ? 262  TYR A CD2   1 
ATOM   2207 C  CE1   . TYR A 1 280 ? 8.105   25.806 26.566 1.00 33.78  ? 262  TYR A CE1   1 
ATOM   2208 C  CE2   . TYR A 1 280 ? 7.723   25.797 28.935 1.00 30.21  ? 262  TYR A CE2   1 
ATOM   2209 C  CZ    . TYR A 1 280 ? 7.443   26.284 27.703 1.00 30.83  ? 262  TYR A CZ    1 
ATOM   2210 O  OH    . TYR A 1 280 ? 6.484   27.266 27.648 1.00 35.44  ? 262  TYR A OH    1 
ATOM   2211 N  N     . LEU A 1 281 ? 12.069  24.920 30.289 1.00 24.54  ? 263  LEU A N     1 
ATOM   2212 C  CA    . LEU A 1 281 ? 12.184  26.161 31.063 1.00 24.80  ? 263  LEU A CA    1 
ATOM   2213 C  C     . LEU A 1 281 ? 13.476  26.971 30.798 1.00 25.00  ? 263  LEU A C     1 
ATOM   2214 O  O     . LEU A 1 281 ? 13.490  28.185 31.022 1.00 25.84  ? 263  LEU A O     1 
ATOM   2215 C  CB    . LEU A 1 281 ? 12.023  25.913 32.572 1.00 23.40  ? 263  LEU A CB    1 
ATOM   2216 C  CG    . LEU A 1 281 ? 10.710  25.313 33.109 1.00 23.60  ? 263  LEU A CG    1 
ATOM   2217 C  CD1   . LEU A 1 281 ? 10.904  24.951 34.580 1.00 22.90  ? 263  LEU A CD1   1 
ATOM   2218 C  CD2   . LEU A 1 281 ? 9.551   26.228 32.874 1.00 25.57  ? 263  LEU A CD2   1 
ATOM   2219 N  N     . PHE A 1 282 ? 14.539  26.289 30.359 1.00 23.83  ? 264  PHE A N     1 
ATOM   2220 C  CA    . PHE A 1 282 ? 15.804  26.922 30.064 1.00 24.61  ? 264  PHE A CA    1 
ATOM   2221 C  C     . PHE A 1 282 ? 16.018  27.068 28.543 1.00 25.58  ? 264  PHE A C     1 
ATOM   2222 O  O     . PHE A 1 282 ? 17.093  27.496 28.122 1.00 26.88  ? 264  PHE A O     1 
ATOM   2223 C  CB    . PHE A 1 282 ? 16.978  26.141 30.694 1.00 23.67  ? 264  PHE A CB    1 
ATOM   2224 C  CG    . PHE A 1 282 ? 17.060  26.262 32.189 1.00 23.60  ? 264  PHE A CG    1 
ATOM   2225 C  CD1   . PHE A 1 282 ? 17.951  27.150 32.788 1.00 23.14  ? 264  PHE A CD1   1 
ATOM   2226 C  CD2   . PHE A 1 282 ? 16.226  25.505 33.009 1.00 22.25  ? 264  PHE A CD2   1 
ATOM   2227 C  CE1   . PHE A 1 282 ? 18.002  27.277 34.187 1.00 21.27  ? 264  PHE A CE1   1 
ATOM   2228 C  CE2   . PHE A 1 282 ? 16.264  25.630 34.401 1.00 23.87  ? 264  PHE A CE2   1 
ATOM   2229 C  CZ    . PHE A 1 282 ? 17.168  26.505 34.989 1.00 22.90  ? 264  PHE A CZ    1 
ATOM   2230 N  N     . ASP A 1 283 ? 15.012  26.721 27.718 1.00 25.72  ? 265  ASP A N     1 
ATOM   2231 C  CA    . ASP A 1 283 ? 15.184  26.793 26.268 1.00 27.53  ? 265  ASP A CA    1 
ATOM   2232 C  C     . ASP A 1 283 ? 15.039  28.224 25.758 1.00 27.77  ? 265  ASP A C     1 
ATOM   2233 O  O     . ASP A 1 283 ? 13.945  28.660 25.393 1.00 27.91  ? 265  ASP A O     1 
ATOM   2234 C  CB    . ASP A 1 283 ? 14.216  25.860 25.539 1.00 28.02  ? 265  ASP A CB    1 
ATOM   2235 C  CG    . ASP A 1 283 ? 14.373  25.891 24.012 1.00 32.17  ? 265  ASP A CG    1 
ATOM   2236 O  OD1   . ASP A 1 283 ? 15.479  26.180 23.449 1.00 34.49  ? 265  ASP A OD1   1 
ATOM   2237 O  OD2   . ASP A 1 283 ? 13.348  25.599 23.361 1.00 36.72  ? 265  ASP A OD2   1 
ATOM   2238 N  N     . PHE A 1 284 ? 16.166  28.925 25.729 1.00 27.99  ? 266  PHE A N     1 
ATOM   2239 C  CA    . PHE A 1 284 ? 16.277  30.288 25.207 1.00 28.33  ? 266  PHE A CA    1 
ATOM   2240 C  C     . PHE A 1 284 ? 17.543  30.303 24.391 1.00 29.28  ? 266  PHE A C     1 
ATOM   2241 O  O     . PHE A 1 284 ? 18.404  29.480 24.621 1.00 28.90  ? 266  PHE A O     1 
ATOM   2242 C  CB    . PHE A 1 284 ? 16.398  31.317 26.344 1.00 28.24  ? 266  PHE A CB    1 
ATOM   2243 C  CG    . PHE A 1 284 ? 15.176  31.387 27.236 1.00 28.48  ? 266  PHE A CG    1 
ATOM   2244 C  CD1   . PHE A 1 284 ? 14.077  32.185 26.889 1.00 28.88  ? 266  PHE A CD1   1 
ATOM   2245 C  CD2   . PHE A 1 284 ? 15.136  30.679 28.419 1.00 26.64  ? 266  PHE A CD2   1 
ATOM   2246 C  CE1   . PHE A 1 284 ? 12.943  32.239 27.713 1.00 27.63  ? 266  PHE A CE1   1 
ATOM   2247 C  CE2   . PHE A 1 284 ? 13.994  30.719 29.237 1.00 29.22  ? 266  PHE A CE2   1 
ATOM   2248 C  CZ    . PHE A 1 284 ? 12.901  31.484 28.861 1.00 27.98  ? 266  PHE A CZ    1 
ATOM   2249 N  N     . PRO A 1 285 ? 17.664  31.244 23.433 1.00 30.63  ? 267  PRO A N     1 
ATOM   2250 C  CA    . PRO A 1 285 ? 18.850  31.262 22.607 1.00 31.80  ? 267  PRO A CA    1 
ATOM   2251 C  C     . PRO A 1 285 ? 20.051  31.846 23.357 1.00 32.42  ? 267  PRO A C     1 
ATOM   2252 O  O     . PRO A 1 285 ? 20.933  32.406 22.726 1.00 35.09  ? 267  PRO A O     1 
ATOM   2253 C  CB    . PRO A 1 285 ? 18.420  32.138 21.427 1.00 32.65  ? 267  PRO A CB    1 
ATOM   2254 C  CG    . PRO A 1 285 ? 17.406  33.058 21.996 1.00 33.32  ? 267  PRO A CG    1 
ATOM   2255 C  CD    . PRO A 1 285 ? 16.699  32.293 23.059 1.00 30.82  ? 267  PRO A CD    1 
ATOM   2256 N  N     . HIS A 1 286 ? 20.079  31.715 24.685 1.00 31.16  ? 268  HIS A N     1 
ATOM   2257 C  CA    . HIS A 1 286 ? 21.133  32.270 25.544 1.00 31.30  ? 268  HIS A CA    1 
ATOM   2258 C  C     . HIS A 1 286 ? 21.139  31.557 26.894 1.00 30.23  ? 268  HIS A C     1 
ATOM   2259 O  O     . HIS A 1 286 ? 20.211  30.791 27.196 1.00 29.03  ? 268  HIS A O     1 
ATOM   2260 C  CB    . HIS A 1 286 ? 20.963  33.796 25.771 1.00 31.82  ? 268  HIS A CB    1 
ATOM   2261 C  CG    . HIS A 1 286 ? 19.645  34.190 26.368 1.00 32.20  ? 268  HIS A CG    1 
ATOM   2262 N  ND1   . HIS A 1 286 ? 19.322  33.962 27.690 1.00 35.73  ? 268  HIS A ND1   1 
ATOM   2263 C  CD2   . HIS A 1 286 ? 18.568  34.802 25.823 1.00 32.33  ? 268  HIS A CD2   1 
ATOM   2264 C  CE1   . HIS A 1 286 ? 18.102  34.408 27.933 1.00 33.85  ? 268  HIS A CE1   1 
ATOM   2265 N  NE2   . HIS A 1 286 ? 17.622  34.918 26.815 1.00 34.93  ? 268  HIS A NE2   1 
ATOM   2266 N  N     . GLY A 1 287 ? 22.158  31.844 27.710 1.00 30.15  ? 269  GLY A N     1 
ATOM   2267 C  CA    . GLY A 1 287 ? 22.253  31.315 29.076 1.00 30.12  ? 269  GLY A CA    1 
ATOM   2268 C  C     . GLY A 1 287 ? 21.576  32.259 30.090 1.00 31.18  ? 269  GLY A C     1 
ATOM   2269 O  O     . GLY A 1 287 ? 20.479  32.768 29.824 1.00 31.72  ? 269  GLY A O     1 
ATOM   2270 N  N     . PRO A 1 288 ? 22.249  32.562 31.222 1.00 31.17  ? 270  PRO A N     1 
ATOM   2271 C  CA    . PRO A 1 288 ? 21.645  33.430 32.271 1.00 31.89  ? 270  PRO A CA    1 
ATOM   2272 C  C     . PRO A 1 288 ? 21.097  34.754 31.737 1.00 33.20  ? 270  PRO A C     1 
ATOM   2273 O  O     . PRO A 1 288 ? 20.009  35.170 32.126 1.00 35.30  ? 270  PRO A O     1 
ATOM   2274 C  CB    . PRO A 1 288 ? 22.804  33.692 33.237 1.00 32.29  ? 270  PRO A CB    1 
ATOM   2275 C  CG    . PRO A 1 288 ? 23.648  32.524 33.123 1.00 32.30  ? 270  PRO A CG    1 
ATOM   2276 C  CD    . PRO A 1 288 ? 23.606  32.152 31.589 1.00 30.94  ? 270  PRO A CD    1 
ATOM   2277 N  N     . LYS A 1 289 ? 21.847  35.427 30.869 1.00 33.20  ? 271  LYS A N     1 
ATOM   2278 C  CA    . LYS A 1 289 ? 21.377  36.679 30.270 1.00 32.95  ? 271  LYS A CA    1 
ATOM   2279 C  C     . LYS A 1 289 ? 21.624  36.680 28.753 1.00 31.55  ? 271  LYS A C     1 
ATOM   2280 O  O     . LYS A 1 289 ? 22.478  35.920 28.267 1.00 29.76  ? 271  LYS A O     1 
ATOM   2281 C  CB    . LYS A 1 289 ? 22.032  37.879 30.954 1.00 35.04  ? 271  LYS A CB    1 
ATOM   2282 C  CG    . LYS A 1 289 ? 23.528  37.860 30.848 1.00 37.34  ? 271  LYS A CG    1 
ATOM   2283 C  CD    . LYS A 1 289 ? 24.213  38.903 31.747 1.00 41.53  ? 271  LYS A CD    1 
ATOM   2284 C  CE    . LYS A 1 289 ? 25.731  38.981 31.301 1.00 41.64  ? 271  LYS A CE    1 
ATOM   2285 N  NZ    . LYS A 1 289 ? 26.560  40.022 31.994 1.00 37.84  ? 271  LYS A NZ    1 
ATOM   2286 N  N     . PRO A 1 290 ? 20.862  37.511 28.006 1.00 31.11  ? 272  PRO A N     1 
ATOM   2287 C  CA    . PRO A 1 290 ? 21.066  37.669 26.563 1.00 30.50  ? 272  PRO A CA    1 
ATOM   2288 C  C     . PRO A 1 290 ? 22.543  37.878 26.226 1.00 29.36  ? 272  PRO A C     1 
ATOM   2289 O  O     . PRO A 1 290 ? 23.245  38.622 26.923 1.00 29.31  ? 272  PRO A O     1 
ATOM   2290 C  CB    . PRO A 1 290 ? 20.251  38.928 26.236 1.00 31.51  ? 272  PRO A CB    1 
ATOM   2291 C  CG    . PRO A 1 290 ? 19.134  38.898 27.251 1.00 30.73  ? 272  PRO A CG    1 
ATOM   2292 C  CD    . PRO A 1 290 ? 19.762  38.375 28.499 1.00 31.56  ? 272  PRO A CD    1 
ATOM   2293 N  N     . GLY A 1 291 ? 23.004  37.187 25.180 1.00 28.79  ? 273  GLY A N     1 
ATOM   2294 C  CA    . GLY A 1 291 ? 24.393  37.260 24.722 1.00 28.01  ? 273  GLY A CA    1 
ATOM   2295 C  C     . GLY A 1 291 ? 25.290  36.167 25.298 1.00 28.00  ? 273  GLY A C     1 
ATOM   2296 O  O     . GLY A 1 291 ? 26.363  35.878 24.761 1.00 27.54  ? 273  GLY A O     1 
ATOM   2297 N  N     . SER A 1 292 ? 24.857  35.547 26.386 1.00 26.90  ? 274  SER A N     1 
ATOM   2298 C  CA    . SER A 1 292 ? 25.655  34.481 27.007 1.00 27.25  ? 274  SER A CA    1 
ATOM   2299 C  C     . SER A 1 292 ? 25.310  33.120 26.400 1.00 27.77  ? 274  SER A C     1 
ATOM   2300 O  O     . SER A 1 292 ? 24.153  32.895 25.963 1.00 28.16  ? 274  SER A O     1 
ATOM   2301 C  CB    . SER A 1 292 ? 25.474  34.485 28.523 1.00 26.39  ? 274  SER A CB    1 
ATOM   2302 O  OG    . SER A 1 292 ? 24.259  33.880 28.903 1.00 25.85  ? 274  SER A OG    1 
ATOM   2303 N  N     . SER A 1 293 ? 26.279  32.195 26.372 1.00 28.03  ? 275  SER A N     1 
ATOM   2304 C  CA    . SER A 1 293 ? 26.004  30.868 25.808 1.00 27.51  ? 275  SER A CA    1 
ATOM   2305 C  C     . SER A 1 293 ? 24.915  30.140 26.610 1.00 27.03  ? 275  SER A C     1 
ATOM   2306 O  O     . SER A 1 293 ? 24.903  30.172 27.848 1.00 26.76  ? 275  SER A O     1 
ATOM   2307 C  CB    . SER A 1 293 ? 27.251  29.986 25.795 1.00 28.01  ? 275  SER A CB    1 
ATOM   2308 O  OG    . SER A 1 293 ? 28.274  30.527 25.001 1.00 31.34  ? 275  SER A OG    1 
ATOM   2309 N  N     . HIS A 1 294 ? 24.031  29.443 25.901 1.00 26.31  ? 276  HIS A N     1 
ATOM   2310 C  CA    . HIS A 1 294 ? 23.067  28.590 26.547 1.00 25.76  ? 276  HIS A CA    1 
ATOM   2311 C  C     . HIS A 1 294 ? 23.820  27.475 27.283 1.00 25.85  ? 276  HIS A C     1 
ATOM   2312 O  O     . HIS A 1 294 ? 24.846  26.961 26.788 1.00 25.25  ? 276  HIS A O     1 
ATOM   2313 C  CB    . HIS A 1 294 ? 22.137  27.985 25.512 1.00 25.46  ? 276  HIS A CB    1 
ATOM   2314 C  CG    . HIS A 1 294 ? 21.149  27.041 26.103 1.00 25.59  ? 276  HIS A CG    1 
ATOM   2315 N  ND1   . HIS A 1 294 ? 21.400  25.694 26.246 1.00 26.67  ? 276  HIS A ND1   1 
ATOM   2316 C  CD2   . HIS A 1 294 ? 19.917  27.255 26.619 1.00 25.24  ? 276  HIS A CD2   1 
ATOM   2317 C  CE1   . HIS A 1 294 ? 20.356  25.114 26.808 1.00 26.21  ? 276  HIS A CE1   1 
ATOM   2318 N  NE2   . HIS A 1 294 ? 19.445  26.043 27.052 1.00 26.14  ? 276  HIS A NE2   1 
ATOM   2319 N  N     . ARG A 1 295 ? 23.362  27.141 28.480 1.00 24.86  ? 277  ARG A N     1 
ATOM   2320 C  CA    . ARG A 1 295 ? 23.885  25.942 29.157 1.00 26.72  ? 277  ARG A CA    1 
ATOM   2321 C  C     . ARG A 1 295 ? 22.763  25.026 29.625 1.00 25.26  ? 277  ARG A C     1 
ATOM   2322 O  O     . ARG A 1 295 ? 21.643  25.489 29.841 1.00 25.01  ? 277  ARG A O     1 
ATOM   2323 C  CB    . ARG A 1 295 ? 24.857  26.243 30.315 1.00 26.91  ? 277  ARG A CB    1 
ATOM   2324 C  CG    . ARG A 1 295 ? 24.877  27.636 30.855 1.00 31.09  ? 277  ARG A CG    1 
ATOM   2325 C  CD    . ARG A 1 295 ? 25.960  27.703 31.890 1.00 36.11  ? 277  ARG A CD    1 
ATOM   2326 N  NE    . ARG A 1 295 ? 25.781  28.777 32.846 1.00 37.73  ? 277  ARG A NE    1 
ATOM   2327 C  CZ    . ARG A 1 295 ? 25.397  28.621 34.121 1.00 39.62  ? 277  ARG A CZ    1 
ATOM   2328 N  NH1   . ARG A 1 295 ? 25.117  27.406 34.663 1.00 33.58  ? 277  ARG A NH1   1 
ATOM   2329 N  NH2   . ARG A 1 295 ? 25.294  29.721 34.866 1.00 39.24  ? 277  ARG A NH2   1 
ATOM   2330 N  N     . PRO A 1 296 ? 23.052  23.722 29.734 1.00 25.49  ? 278  PRO A N     1 
ATOM   2331 C  CA    . PRO A 1 296 ? 22.046  22.716 30.101 1.00 24.67  ? 278  PRO A CA    1 
ATOM   2332 C  C     . PRO A 1 296 ? 21.439  23.084 31.439 1.00 23.18  ? 278  PRO A C     1 
ATOM   2333 O  O     . PRO A 1 296 ? 22.146  23.599 32.302 1.00 23.23  ? 278  PRO A O     1 
ATOM   2334 C  CB    . PRO A 1 296 ? 22.891  21.456 30.284 1.00 24.68  ? 278  PRO A CB    1 
ATOM   2335 C  CG    . PRO A 1 296 ? 24.014  21.665 29.439 1.00 26.23  ? 278  PRO A CG    1 
ATOM   2336 C  CD    . PRO A 1 296 ? 24.365  23.102 29.528 1.00 25.94  ? 278  PRO A CD    1 
ATOM   2337 N  N     . TRP A 1 297 ? 20.150  22.819 31.627 1.00 22.99  ? 279  TRP A N     1 
ATOM   2338 C  CA    . TRP A 1 297 ? 19.523  23.084 32.909 1.00 21.40  ? 279  TRP A CA    1 
ATOM   2339 C  C     . TRP A 1 297 ? 20.268  22.456 34.114 1.00 20.60  ? 279  TRP A C     1 
ATOM   2340 O  O     . TRP A 1 297 ? 20.353  23.065 35.172 1.00 19.81  ? 279  TRP A O     1 
ATOM   2341 C  CB    . TRP A 1 297 ? 18.042  22.690 32.890 1.00 21.38  ? 279  TRP A CB    1 
ATOM   2342 C  CG    . TRP A 1 297 ? 17.745  21.217 32.888 1.00 22.05  ? 279  TRP A CG    1 
ATOM   2343 C  CD1   . TRP A 1 297 ? 17.494  20.451 31.798 1.00 22.56  ? 279  TRP A CD1   1 
ATOM   2344 C  CD2   . TRP A 1 297 ? 17.619  20.338 34.035 1.00 22.54  ? 279  TRP A CD2   1 
ATOM   2345 N  NE1   . TRP A 1 297 ? 17.247  19.138 32.172 1.00 22.15  ? 279  TRP A NE1   1 
ATOM   2346 C  CE2   . TRP A 1 297 ? 17.302  19.044 33.536 1.00 23.07  ? 279  TRP A CE2   1 
ATOM   2347 C  CE3   . TRP A 1 297 ? 17.750  20.515 35.427 1.00 22.76  ? 279  TRP A CE3   1 
ATOM   2348 C  CZ2   . TRP A 1 297 ? 17.111  17.926 34.383 1.00 22.89  ? 279  TRP A CZ2   1 
ATOM   2349 C  CZ3   . TRP A 1 297 ? 17.555  19.420 36.267 1.00 20.52  ? 279  TRP A CZ3   1 
ATOM   2350 C  CH2   . TRP A 1 297 ? 17.253  18.132 35.740 1.00 21.57  ? 279  TRP A CH2   1 
ATOM   2351 N  N     . GLN A 1 298 ? 20.812  21.256 33.940 1.00 20.23  ? 280  GLN A N     1 
ATOM   2352 C  CA    . GLN A 1 298 ? 21.471  20.540 35.043 1.00 20.19  ? 280  GLN A CA    1 
ATOM   2353 C  C     . GLN A 1 298 ? 22.653  21.312 35.582 1.00 21.80  ? 280  GLN A C     1 
ATOM   2354 O  O     . GLN A 1 298 ? 22.981  21.175 36.756 1.00 23.24  ? 280  GLN A O     1 
ATOM   2355 C  CB    . GLN A 1 298 ? 21.973  19.167 34.599 1.00 20.60  ? 280  GLN A CB    1 
ATOM   2356 C  CG    . GLN A 1 298 ? 20.860  18.169 34.279 1.00 20.07  ? 280  GLN A CG    1 
ATOM   2357 C  CD    . GLN A 1 298 ? 20.555  18.135 32.798 1.00 23.52  ? 280  GLN A CD    1 
ATOM   2358 O  OE1   . GLN A 1 298 ? 20.727  19.133 32.092 1.00 20.35  ? 280  GLN A OE1   1 
ATOM   2359 N  NE2   . GLN A 1 298 ? 20.073  17.001 32.323 1.00 23.96  ? 280  GLN A NE2   1 
ATOM   2360 N  N     . SER A 1 299 ? 23.286  22.133 34.744 1.00 21.69  ? 281  SER A N     1 
ATOM   2361 C  CA    . SER A 1 299 ? 24.484  22.899 35.172 1.00 22.65  ? 281  SER A CA    1 
ATOM   2362 C  C     . SER A 1 299 ? 24.147  23.964 36.234 1.00 22.20  ? 281  SER A C     1 
ATOM   2363 O  O     . SER A 1 299 ? 25.043  24.505 36.890 1.00 22.55  ? 281  SER A O     1 
ATOM   2364 C  CB    . SER A 1 299 ? 25.207  23.553 33.972 1.00 22.61  ? 281  SER A CB    1 
ATOM   2365 O  OG    . SER A 1 299 ? 24.514  24.706 33.509 1.00 23.85  ? 281  SER A OG    1 
ATOM   2366 N  N     . TYR A 1 300 ? 22.866  24.273 36.404 1.00 21.73  ? 282  TYR A N     1 
ATOM   2367 C  CA    . TYR A 1 300 ? 22.478  25.293 37.375 1.00 22.42  ? 282  TYR A CA    1 
ATOM   2368 C  C     . TYR A 1 300 ? 22.334  24.730 38.817 1.00 23.09  ? 282  TYR A C     1 
ATOM   2369 O  O     . TYR A 1 300 ? 22.072  25.485 39.783 1.00 22.79  ? 282  TYR A O     1 
ATOM   2370 C  CB    . TYR A 1 300 ? 21.178  25.966 36.922 1.00 22.06  ? 282  TYR A CB    1 
ATOM   2371 C  CG    . TYR A 1 300 ? 21.348  26.829 35.703 1.00 22.44  ? 282  TYR A CG    1 
ATOM   2372 C  CD1   . TYR A 1 300 ? 21.540  28.211 35.834 1.00 20.85  ? 282  TYR A CD1   1 
ATOM   2373 C  CD2   . TYR A 1 300 ? 21.314  26.263 34.395 1.00 20.40  ? 282  TYR A CD2   1 
ATOM   2374 C  CE1   . TYR A 1 300 ? 21.699  29.019 34.692 1.00 24.99  ? 282  TYR A CE1   1 
ATOM   2375 C  CE2   . TYR A 1 300 ? 21.466  27.079 33.237 1.00 22.74  ? 282  TYR A CE2   1 
ATOM   2376 C  CZ    . TYR A 1 300 ? 21.676  28.423 33.397 1.00 21.97  ? 282  TYR A CZ    1 
ATOM   2377 O  OH    . TYR A 1 300 ? 21.833  29.227 32.291 1.00 26.89  ? 282  TYR A OH    1 
ATOM   2378 N  N     . PHE A 1 301 ? 22.485  23.409 38.962 1.00 23.53  ? 283  PHE A N     1 
ATOM   2379 C  CA    . PHE A 1 301 ? 22.261  22.742 40.253 1.00 23.82  ? 283  PHE A CA    1 
ATOM   2380 C  C     . PHE A 1 301 ? 23.452  21.942 40.736 1.00 25.33  ? 283  PHE A C     1 
ATOM   2381 O  O     . PHE A 1 301 ? 24.072  21.208 39.965 1.00 26.55  ? 283  PHE A O     1 
ATOM   2382 C  CB    . PHE A 1 301 ? 21.071  21.803 40.157 1.00 22.98  ? 283  PHE A CB    1 
ATOM   2383 C  CG    . PHE A 1 301 ? 19.821  22.494 39.787 1.00 22.10  ? 283  PHE A CG    1 
ATOM   2384 C  CD1   . PHE A 1 301 ? 18.957  22.957 40.784 1.00 19.61  ? 283  PHE A CD1   1 
ATOM   2385 C  CD2   . PHE A 1 301 ? 19.504  22.707 38.429 1.00 23.09  ? 283  PHE A CD2   1 
ATOM   2386 C  CE1   . PHE A 1 301 ? 17.802  23.634 40.455 1.00 17.95  ? 283  PHE A CE1   1 
ATOM   2387 C  CE2   . PHE A 1 301 ? 18.327  23.401 38.082 1.00 20.28  ? 283  PHE A CE2   1 
ATOM   2388 C  CZ    . PHE A 1 301 ? 17.484  23.849 39.087 1.00 20.29  ? 283  PHE A CZ    1 
ATOM   2389 N  N     . ASP A 1 302 ? 23.744  22.095 42.022 1.00 25.37  ? 284  ASP A N     1 
ATOM   2390 C  CA    . ASP A 1 302 ? 24.789  21.335 42.680 1.00 26.56  ? 284  ASP A CA    1 
ATOM   2391 C  C     . ASP A 1 302 ? 24.306  19.948 43.046 1.00 25.18  ? 284  ASP A C     1 
ATOM   2392 O  O     . ASP A 1 302 ? 25.118  19.050 43.248 1.00 25.40  ? 284  ASP A O     1 
ATOM   2393 C  CB    . ASP A 1 302 ? 25.259  22.072 43.940 1.00 27.66  ? 284  ASP A CB    1 
ATOM   2394 C  CG    . ASP A 1 302 ? 25.973  23.380 43.598 1.00 31.33  ? 284  ASP A CG    1 
ATOM   2395 O  OD1   . ASP A 1 302 ? 27.153  23.347 43.154 1.00 32.82  ? 284  ASP A OD1   1 
ATOM   2396 O  OD2   . ASP A 1 302 ? 25.348  24.449 43.753 1.00 30.02  ? 284  ASP A OD2   1 
ATOM   2397 N  N     . LEU A 1 303 ? 22.980  19.758 43.105 1.00 23.37  ? 285  LEU A N     1 
ATOM   2398 C  CA    . LEU A 1 303 ? 22.435  18.484 43.439 1.00 22.37  ? 285  LEU A CA    1 
ATOM   2399 C  C     . LEU A 1 303 ? 21.024  18.401 42.862 1.00 21.43  ? 285  LEU A C     1 
ATOM   2400 O  O     . LEU A 1 303 ? 20.230  19.288 43.084 1.00 20.37  ? 285  LEU A O     1 
ATOM   2401 C  CB    . LEU A 1 303 ? 22.417  18.326 44.968 1.00 21.42  ? 285  LEU A CB    1 
ATOM   2402 C  CG    . LEU A 1 303 ? 21.994  17.005 45.602 1.00 23.60  ? 285  LEU A CG    1 
ATOM   2403 C  CD1   . LEU A 1 303 ? 22.521  16.862 47.060 1.00 23.71  ? 285  LEU A CD1   1 
ATOM   2404 C  CD2   . LEU A 1 303 ? 20.488  16.815 45.603 1.00 20.54  ? 285  LEU A CD2   1 
ATOM   2405 N  N     . ILE A 1 304 ? 20.728  17.326 42.135 1.00 20.61  ? 286  ILE A N     1 
ATOM   2406 C  CA    . ILE A 1 304 ? 19.412  17.103 41.543 1.00 20.33  ? 286  ILE A CA    1 
ATOM   2407 C  C     . ILE A 1 304 ? 18.842  15.844 42.113 1.00 20.58  ? 286  ILE A C     1 
ATOM   2408 O  O     . ILE A 1 304 ? 19.517  14.810 42.136 1.00 21.65  ? 286  ILE A O     1 
ATOM   2409 C  CB    . ILE A 1 304 ? 19.510  16.945 39.994 1.00 21.03  ? 286  ILE A CB    1 
ATOM   2410 C  CG1   . ILE A 1 304 ? 20.194  18.204 39.397 1.00 20.89  ? 286  ILE A CG1   1 
ATOM   2411 C  CG2   . ILE A 1 304 ? 18.115  16.668 39.422 1.00 20.27  ? 286  ILE A CG2   1 
ATOM   2412 C  CD1   . ILE A 1 304 ? 20.634  18.107 37.903 1.00 20.55  ? 286  ILE A CD1   1 
ATOM   2413 N  N     . LEU A 1 305 ? 17.612  15.914 42.605 1.00 23.12  ? 287  LEU A N     1 
ATOM   2414 C  CA    . LEU A 1 305 ? 17.014  14.764 43.278 1.00 22.19  ? 287  LEU A CA    1 
ATOM   2415 C  C     . LEU A 1 305 ? 15.560  14.650 42.833 1.00 22.22  ? 287  LEU A C     1 
ATOM   2416 O  O     . LEU A 1 305 ? 14.781  15.590 42.985 1.00 22.73  ? 287  LEU A O     1 
ATOM   2417 C  CB    . LEU A 1 305 ? 17.126  14.863 44.798 1.00 21.83  ? 287  LEU A CB    1 
ATOM   2418 C  CG    . LEU A 1 305 ? 16.728  13.626 45.611 1.00 23.18  ? 287  LEU A CG    1 
ATOM   2419 C  CD1   . LEU A 1 305 ? 17.590  13.470 46.876 1.00 21.93  ? 287  LEU A CD1   1 
ATOM   2420 C  CD2   . LEU A 1 305 ? 15.221  13.689 45.957 1.00 24.10  ? 287  LEU A CD2   1 
ATOM   2421 N  N     . VAL A 1 306 ? 15.234  13.484 42.288 1.00 20.92  ? 288  VAL A N     1 
ATOM   2422 C  CA    . VAL A 1 306 ? 13.921  13.189 41.746 1.00 21.05  ? 288  VAL A CA    1 
ATOM   2423 C  C     . VAL A 1 306 ? 13.261  12.102 42.613 1.00 20.38  ? 288  VAL A C     1 
ATOM   2424 O  O     . VAL A 1 306 ? 13.886  11.572 43.538 1.00 20.36  ? 288  VAL A O     1 
ATOM   2425 C  CB    . VAL A 1 306 ? 14.025  12.825 40.224 1.00 22.13  ? 288  VAL A CB    1 
ATOM   2426 C  CG1   . VAL A 1 306 ? 14.594  14.024 39.421 1.00 21.64  ? 288  VAL A CG1   1 
ATOM   2427 C  CG2   . VAL A 1 306 ? 14.903  11.600 39.991 1.00 19.58  ? 288  VAL A CG2   1 
ATOM   2428 N  N     . ASP A 1 307 ? 12.004  11.767 42.321 1.00 21.73  ? 289  ASP A N     1 
ATOM   2429 C  CA    . ASP A 1 307 ? 11.260  10.775 43.101 1.00 21.45  ? 289  ASP A CA    1 
ATOM   2430 C  C     . ASP A 1 307 ? 11.460  10.999 44.599 1.00 22.10  ? 289  ASP A C     1 
ATOM   2431 O  O     . ASP A 1 307 ? 11.713  10.045 45.334 1.00 22.72  ? 289  ASP A O     1 
ATOM   2432 C  CB    . ASP A 1 307 ? 11.695  9.343  42.749 1.00 20.80  ? 289  ASP A CB    1 
ATOM   2433 C  CG    . ASP A 1 307 ? 11.779  9.106  41.271 1.00 24.21  ? 289  ASP A CG    1 
ATOM   2434 O  OD1   . ASP A 1 307 ? 10.744  9.316  40.543 1.00 23.73  ? 289  ASP A OD1   1 
ATOM   2435 O  OD2   . ASP A 1 307 ? 12.889  8.702  40.820 1.00 23.58  ? 289  ASP A OD2   1 
ATOM   2436 N  N     . ALA A 1 308 ? 11.351  12.256 45.059 1.00 21.93  ? 290  ALA A N     1 
ATOM   2437 C  CA    . ALA A 1 308 ? 11.681  12.611 46.448 1.00 19.92  ? 290  ALA A CA    1 
ATOM   2438 C  C     . ALA A 1 308 ? 10.764  11.997 47.481 1.00 20.48  ? 290  ALA A C     1 
ATOM   2439 O  O     . ALA A 1 308 ? 11.179  11.750 48.628 1.00 19.13  ? 290  ALA A O     1 
ATOM   2440 C  CB    . ALA A 1 308 ? 11.735  14.144 46.615 1.00 20.25  ? 290  ALA A CB    1 
ATOM   2441 N  N     A ARG A 1 309 ? 9.531   11.724 47.058 0.50 21.07  ? 291  ARG A N     1 
ATOM   2442 N  N     B ARG A 1 309 ? 9.525   11.706 47.081 0.50 20.87  ? 291  ARG A N     1 
ATOM   2443 C  CA    A ARG A 1 309 ? 8.449   11.311 47.942 0.50 21.55  ? 291  ARG A CA    1 
ATOM   2444 C  CA    B ARG A 1 309 ? 8.473   11.262 48.002 0.50 21.16  ? 291  ARG A CA    1 
ATOM   2445 C  C     A ARG A 1 309 ? 8.289   12.204 49.190 0.50 21.32  ? 291  ARG A C     1 
ATOM   2446 C  C     B ARG A 1 309 ? 8.279   12.207 49.212 0.50 21.08  ? 291  ARG A C     1 
ATOM   2447 O  O     A ARG A 1 309 ? 8.219   11.723 50.312 0.50 21.19  ? 291  ARG A O     1 
ATOM   2448 O  O     B ARG A 1 309 ? 8.174   11.758 50.345 0.50 20.93  ? 291  ARG A O     1 
ATOM   2449 C  CB    A ARG A 1 309 ? 8.538   9.818  48.282 0.50 22.20  ? 291  ARG A CB    1 
ATOM   2450 C  CB    B ARG A 1 309 ? 8.687   9.809  48.465 0.50 21.59  ? 291  ARG A CB    1 
ATOM   2451 C  CG    A ARG A 1 309 ? 8.170   8.973  47.074 0.50 24.10  ? 291  ARG A CG    1 
ATOM   2452 C  CG    B ARG A 1 309 ? 8.644   8.806  47.329 0.50 22.38  ? 291  ARG A CG    1 
ATOM   2453 C  CD    A ARG A 1 309 ? 8.112   7.520  47.355 0.50 27.93  ? 291  ARG A CD    1 
ATOM   2454 C  CD    B ARG A 1 309 ? 9.232   7.494  47.726 0.50 26.25  ? 291  ARG A CD    1 
ATOM   2455 N  NE    A ARG A 1 309 ? 7.099   7.166  48.342 0.50 29.43  ? 291  ARG A NE    1 
ATOM   2456 N  NE    B ARG A 1 309 ? 9.354   6.570  46.594 0.50 27.36  ? 291  ARG A NE    1 
ATOM   2457 C  CZ    A ARG A 1 309 ? 6.989   5.957  48.874 0.50 29.43  ? 291  ARG A CZ    1 
ATOM   2458 C  CZ    B ARG A 1 309 ? 10.459  6.390  45.877 0.50 27.85  ? 291  ARG A CZ    1 
ATOM   2459 N  NH1   A ARG A 1 309 ? 7.820   4.989  48.494 0.50 28.48  ? 291  ARG A NH1   1 
ATOM   2460 N  NH1   B ARG A 1 309 ? 11.572  7.061  46.155 0.50 25.54  ? 291  ARG A NH1   1 
ATOM   2461 N  NH2   A ARG A 1 309 ? 6.045   5.714  49.773 0.50 27.71  ? 291  ARG A NH2   1 
ATOM   2462 N  NH2   B ARG A 1 309 ? 10.450  5.517  44.883 0.50 28.67  ? 291  ARG A NH2   1 
ATOM   2463 N  N     . LYS A 1 310 ? 8.213   13.512 48.958 1.00 20.88  ? 292  LYS A N     1 
ATOM   2464 C  CA    . LYS A 1 310 ? 7.860   14.471 50.004 1.00 20.98  ? 292  LYS A CA    1 
ATOM   2465 C  C     . LYS A 1 310 ? 6.385   14.217 50.342 1.00 22.39  ? 292  LYS A C     1 
ATOM   2466 O  O     . LYS A 1 310 ? 5.615   13.919 49.438 1.00 22.15  ? 292  LYS A O     1 
ATOM   2467 C  CB    . LYS A 1 310 ? 8.050   15.901 49.499 1.00 19.79  ? 292  LYS A CB    1 
ATOM   2468 C  CG    . LYS A 1 310 ? 9.500   16.273 49.366 1.00 21.34  ? 292  LYS A CG    1 
ATOM   2469 C  CD    . LYS A 1 310 ? 9.741   17.640 48.740 1.00 21.89  ? 292  LYS A CD    1 
ATOM   2470 C  CE    . LYS A 1 310 ? 9.637   17.585 47.236 1.00 24.94  ? 292  LYS A CE    1 
ATOM   2471 N  NZ    . LYS A 1 310 ? 8.393   18.218 46.732 1.00 25.77  ? 292  LYS A NZ    1 
ATOM   2472 N  N     . PRO A 1 311 ? 5.986   14.331 51.646 1.00 23.10  ? 293  PRO A N     1 
ATOM   2473 C  CA    . PRO A 1 311 ? 6.794   14.683 52.826 1.00 22.73  ? 293  PRO A CA    1 
ATOM   2474 C  C     . PRO A 1 311 ? 7.607   13.588 53.534 1.00 22.85  ? 293  PRO A C     1 
ATOM   2475 O  O     . PRO A 1 311 ? 8.461   13.946 54.363 1.00 21.79  ? 293  PRO A O     1 
ATOM   2476 C  CB    . PRO A 1 311 ? 5.750   15.242 53.797 1.00 23.97  ? 293  PRO A CB    1 
ATOM   2477 C  CG    . PRO A 1 311 ? 4.550   14.375 53.520 1.00 22.94  ? 293  PRO A CG    1 
ATOM   2478 C  CD    . PRO A 1 311 ? 4.560   14.180 51.995 1.00 24.06  ? 293  PRO A CD    1 
ATOM   2479 N  N     . LEU A 1 312 ? 7.368   12.306 53.222 1.00 23.73  ? 294  LEU A N     1 
ATOM   2480 C  CA    . LEU A 1 312 ? 8.185   11.179 53.758 1.00 24.77  ? 294  LEU A CA    1 
ATOM   2481 C  C     . LEU A 1 312 ? 9.678   11.520 53.682 1.00 23.46  ? 294  LEU A C     1 
ATOM   2482 O  O     . LEU A 1 312 ? 10.425  11.186 54.585 1.00 23.52  ? 294  LEU A O     1 
ATOM   2483 C  CB    . LEU A 1 312 ? 7.873   9.824  53.040 1.00 25.74  ? 294  LEU A CB    1 
ATOM   2484 C  CG    . LEU A 1 312 ? 8.771   8.578  53.284 1.00 25.69  ? 294  LEU A CG    1 
ATOM   2485 C  CD1   . LEU A 1 312 ? 8.690   8.123  54.768 1.00 27.40  ? 294  LEU A CD1   1 
ATOM   2486 C  CD2   . LEU A 1 312 ? 8.420   7.386  52.360 1.00 27.49  ? 294  LEU A CD2   1 
ATOM   2487 N  N     . PHE A 1 313 ? 10.075  12.232 52.622 1.00 21.68  ? 295  PHE A N     1 
ATOM   2488 C  CA    . PHE A 1 313 ? 11.443  12.736 52.416 1.00 20.20  ? 295  PHE A CA    1 
ATOM   2489 C  C     . PHE A 1 313 ? 12.017  13.449 53.643 1.00 20.48  ? 295  PHE A C     1 
ATOM   2490 O  O     . PHE A 1 313 ? 13.224  13.357 53.936 1.00 19.64  ? 295  PHE A O     1 
ATOM   2491 C  CB    . PHE A 1 313 ? 11.407  13.739 51.243 1.00 19.48  ? 295  PHE A CB    1 
ATOM   2492 C  CG    . PHE A 1 313 ? 12.756  14.258 50.817 1.00 20.63  ? 295  PHE A CG    1 
ATOM   2493 C  CD1   . PHE A 1 313 ? 13.654  13.432 50.139 1.00 20.82  ? 295  PHE A CD1   1 
ATOM   2494 C  CD2   . PHE A 1 313 ? 13.112  15.598 51.046 1.00 19.95  ? 295  PHE A CD2   1 
ATOM   2495 C  CE1   . PHE A 1 313 ? 14.897  13.918 49.713 1.00 18.71  ? 295  PHE A CE1   1 
ATOM   2496 C  CE2   . PHE A 1 313 ? 14.340  16.095 50.638 1.00 21.84  ? 295  PHE A CE2   1 
ATOM   2497 C  CZ    . PHE A 1 313 ? 15.248  15.250 49.980 1.00 21.64  ? 295  PHE A CZ    1 
ATOM   2498 N  N     . PHE A 1 314 ? 11.164  14.216 54.327 1.00 21.02  ? 296  PHE A N     1 
ATOM   2499 C  CA    . PHE A 1 314 ? 11.573  14.940 55.539 1.00 23.10  ? 296  PHE A CA    1 
ATOM   2500 C  C     . PHE A 1 314 ? 11.541  14.125 56.811 1.00 24.99  ? 296  PHE A C     1 
ATOM   2501 O  O     . PHE A 1 314 ? 11.913  14.652 57.875 1.00 27.23  ? 296  PHE A O     1 
ATOM   2502 C  CB    . PHE A 1 314 ? 10.731  16.221 55.715 1.00 22.46  ? 296  PHE A CB    1 
ATOM   2503 C  CG    . PHE A 1 314 ? 10.867  17.154 54.564 1.00 20.28  ? 296  PHE A CG    1 
ATOM   2504 C  CD1   . PHE A 1 314 ? 12.069  17.833 54.364 1.00 16.43  ? 296  PHE A CD1   1 
ATOM   2505 C  CD2   . PHE A 1 314 ? 9.819   17.333 53.665 1.00 18.72  ? 296  PHE A CD2   1 
ATOM   2506 C  CE1   . PHE A 1 314 ? 12.232  18.691 53.256 1.00 17.52  ? 296  PHE A CE1   1 
ATOM   2507 C  CE2   . PHE A 1 314 ? 9.968   18.190 52.566 1.00 19.45  ? 296  PHE A CE2   1 
ATOM   2508 C  CZ    . PHE A 1 314 ? 11.173  18.873 52.372 1.00 17.79  ? 296  PHE A CZ    1 
ATOM   2509 N  N     . GLY A 1 315 ? 11.060  12.883 56.715 1.00 25.19  ? 297  GLY A N     1 
ATOM   2510 C  CA    . GLY A 1 315 ? 11.179  11.893 57.799 1.00 27.53  ? 297  GLY A CA    1 
ATOM   2511 C  C     . GLY A 1 315 ? 12.253  10.872 57.472 1.00 28.15  ? 297  GLY A C     1 
ATOM   2512 O  O     . GLY A 1 315 ? 13.376  11.233 57.108 1.00 28.61  ? 297  GLY A O     1 
ATOM   2513 N  N     . GLU A 1 316 ? 11.915  9.596  57.552 1.00 29.18  ? 298  GLU A N     1 
ATOM   2514 C  CA    . GLU A 1 316 ? 12.889  8.541  57.233 1.00 31.17  ? 298  GLU A CA    1 
ATOM   2515 C  C     . GLU A 1 316 ? 13.293  8.473  55.733 1.00 29.34  ? 298  GLU A C     1 
ATOM   2516 O  O     . GLU A 1 316 ? 14.370  7.960  55.370 1.00 29.32  ? 298  GLU A O     1 
ATOM   2517 C  CB    . GLU A 1 316 ? 12.338  7.190  57.721 1.00 34.18  ? 298  GLU A CB    1 
ATOM   2518 C  CG    . GLU A 1 316 ? 11.003  6.833  57.059 1.00 41.02  ? 298  GLU A CG    1 
ATOM   2519 C  CD    . GLU A 1 316 ? 10.013  6.095  57.987 1.00 52.66  ? 298  GLU A CD    1 
ATOM   2520 O  OE1   . GLU A 1 316 ? 10.492  5.392  58.928 1.00 56.57  ? 298  GLU A OE1   1 
ATOM   2521 O  OE2   . GLU A 1 316 ? 8.760   6.226  57.767 1.00 54.30  ? 298  GLU A OE2   1 
ATOM   2522 N  N     . GLY A 1 317 ? 12.432  9.022  54.877 1.00 26.55  ? 299  GLY A N     1 
ATOM   2523 C  CA    . GLY A 1 317 ? 12.666  9.056  53.450 1.00 24.73  ? 299  GLY A CA    1 
ATOM   2524 C  C     . GLY A 1 317 ? 12.635  7.642  52.900 1.00 24.45  ? 299  GLY A C     1 
ATOM   2525 O  O     . GLY A 1 317 ? 11.992  6.725  53.444 1.00 24.56  ? 299  GLY A O     1 
ATOM   2526 N  N     . THR A 1 318 ? 13.341  7.466  51.808 1.00 23.68  ? 300  THR A N     1 
ATOM   2527 C  CA    . THR A 1 318 ? 13.504  6.139  51.217 1.00 25.21  ? 300  THR A CA    1 
ATOM   2528 C  C     . THR A 1 318 ? 14.975  5.948  50.889 1.00 25.11  ? 300  THR A C     1 
ATOM   2529 O  O     . THR A 1 318 ? 15.798  6.833  51.070 1.00 24.46  ? 300  THR A O     1 
ATOM   2530 C  CB    . THR A 1 318 ? 12.601  5.929  49.937 1.00 24.52  ? 300  THR A CB    1 
ATOM   2531 O  OG1   . THR A 1 318 ? 12.919  6.905  48.952 1.00 26.48  ? 300  THR A OG1   1 
ATOM   2532 C  CG2   . THR A 1 318 ? 11.135  6.074  50.276 1.00 25.86  ? 300  THR A CG2   1 
ATOM   2533 N  N     . VAL A 1 319 ? 15.303  4.774  50.410 1.00 26.51  ? 301  VAL A N     1 
ATOM   2534 C  CA    . VAL A 1 319 ? 16.667  4.458  50.069 1.00 26.75  ? 301  VAL A CA    1 
ATOM   2535 C  C     . VAL A 1 319 ? 17.150  5.375  48.933 1.00 25.31  ? 301  VAL A C     1 
ATOM   2536 O  O     . VAL A 1 319 ? 16.433  5.642  47.972 1.00 24.19  ? 301  VAL A O     1 
ATOM   2537 C  CB    . VAL A 1 319 ? 16.710  2.941  49.798 1.00 28.68  ? 301  VAL A CB    1 
ATOM   2538 C  CG1   . VAL A 1 319 ? 17.402  2.588  48.555 1.00 29.91  ? 301  VAL A CG1   1 
ATOM   2539 C  CG2   . VAL A 1 319 ? 17.213  2.185  51.068 1.00 29.80  ? 301  VAL A CG2   1 
ATOM   2540 N  N     . LEU A 1 320 ? 18.355  5.901  49.086 1.00 24.75  ? 302  LEU A N     1 
ATOM   2541 C  CA    . LEU A 1 320 ? 18.946  6.717  48.071 1.00 24.26  ? 302  LEU A CA    1 
ATOM   2542 C  C     . LEU A 1 320 ? 19.322  5.862  46.828 1.00 24.52  ? 302  LEU A C     1 
ATOM   2543 O  O     . LEU A 1 320 ? 19.983  4.838  46.954 1.00 25.51  ? 302  LEU A O     1 
ATOM   2544 C  CB    . LEU A 1 320 ? 20.180  7.398  48.659 1.00 23.73  ? 302  LEU A CB    1 
ATOM   2545 C  CG    . LEU A 1 320 ? 20.819  8.425  47.722 1.00 22.33  ? 302  LEU A CG    1 
ATOM   2546 C  CD1   . LEU A 1 320 ? 19.901  9.590  47.299 1.00 22.62  ? 302  LEU A CD1   1 
ATOM   2547 C  CD2   . LEU A 1 320 ? 22.162  8.931  48.274 1.00 25.07  ? 302  LEU A CD2   1 
ATOM   2548 N  N     . ARG A 1 321 ? 18.889  6.279  45.634 1.00 24.52  ? 303  ARG A N     1 
ATOM   2549 C  CA    . ARG A 1 321 ? 19.224  5.573  44.393 1.00 24.45  ? 303  ARG A CA    1 
ATOM   2550 C  C     . ARG A 1 321 ? 19.927  6.539  43.467 1.00 25.07  ? 303  ARG A C     1 
ATOM   2551 O  O     . ARG A 1 321 ? 19.838  7.749  43.686 1.00 24.27  ? 303  ARG A O     1 
ATOM   2552 C  CB    . ARG A 1 321 ? 17.948  5.098  43.680 1.00 25.27  ? 303  ARG A CB    1 
ATOM   2553 C  CG    . ARG A 1 321 ? 16.996  4.269  44.548 1.00 26.26  ? 303  ARG A CG    1 
ATOM   2554 C  CD    . ARG A 1 321 ? 17.542  2.866  44.892 1.00 26.47  ? 303  ARG A CD    1 
ATOM   2555 N  NE    . ARG A 1 321 ? 17.702  2.050  43.689 1.00 29.91  ? 303  ARG A NE    1 
ATOM   2556 C  CZ    . ARG A 1 321 ? 16.704  1.468  43.030 1.00 28.47  ? 303  ARG A CZ    1 
ATOM   2557 N  NH1   . ARG A 1 321 ? 15.465  1.616  43.464 1.00 29.31  ? 303  ARG A NH1   1 
ATOM   2558 N  NH2   . ARG A 1 321 ? 16.946  0.738  41.934 1.00 27.85  ? 303  ARG A NH2   1 
ATOM   2559 N  N     . GLN A 1 322 ? 20.609  6.007  42.443 1.00 24.01  ? 304  GLN A N     1 
ATOM   2560 C  CA    . GLN A 1 322 ? 21.206  6.808  41.408 1.00 24.62  ? 304  GLN A CA    1 
ATOM   2561 C  C     . GLN A 1 322 ? 20.440  6.579  40.108 1.00 25.34  ? 304  GLN A C     1 
ATOM   2562 O  O     . GLN A 1 322 ? 20.171  5.430  39.723 1.00 24.89  ? 304  GLN A O     1 
ATOM   2563 C  CB    . GLN A 1 322 ? 22.669  6.418  41.233 1.00 25.03  ? 304  GLN A CB    1 
ATOM   2564 C  CG    . GLN A 1 322 ? 23.354  7.155  40.131 1.00 28.19  ? 304  GLN A CG    1 
ATOM   2565 C  CD    . GLN A 1 322 ? 24.802  6.750  39.952 1.00 28.98  ? 304  GLN A CD    1 
ATOM   2566 O  OE1   . GLN A 1 322 ? 25.314  5.881  40.657 1.00 32.75  ? 304  GLN A OE1   1 
ATOM   2567 N  NE2   . GLN A 1 322 ? 25.473  7.398  39.018 1.00 28.96  ? 304  GLN A NE2   1 
ATOM   2568 N  N     . VAL A 1 323 ? 20.068  7.678  39.440 1.00 25.82  ? 305  VAL A N     1 
ATOM   2569 C  CA    . VAL A 1 323 ? 19.496  7.609  38.110 1.00 26.15  ? 305  VAL A CA    1 
ATOM   2570 C  C     . VAL A 1 323 ? 20.587  7.352  37.039 1.00 28.99  ? 305  VAL A C     1 
ATOM   2571 O  O     . VAL A 1 323 ? 21.645  7.992  37.001 1.00 28.96  ? 305  VAL A O     1 
ATOM   2572 C  CB    . VAL A 1 323 ? 18.711  8.902  37.764 1.00 26.01  ? 305  VAL A CB    1 
ATOM   2573 C  CG1   . VAL A 1 323 ? 18.113  8.835  36.326 1.00 27.32  ? 305  VAL A CG1   1 
ATOM   2574 C  CG2   . VAL A 1 323 ? 17.640  9.208  38.835 1.00 23.11  ? 305  VAL A CG2   1 
ATOM   2575 N  N     . ASP A 1 324 ? 20.307  6.401  36.166 1.00 30.76  ? 306  ASP A N     1 
ATOM   2576 C  CA    . ASP A 1 324 ? 21.023  6.277  34.916 1.00 33.42  ? 306  ASP A CA    1 
ATOM   2577 C  C     . ASP A 1 324 ? 20.411  7.301  33.953 1.00 34.95  ? 306  ASP A C     1 
ATOM   2578 O  O     . ASP A 1 324 ? 19.310  7.098  33.440 1.00 35.24  ? 306  ASP A O     1 
ATOM   2579 C  CB    . ASP A 1 324 ? 20.845  4.884  34.366 1.00 34.01  ? 306  ASP A CB    1 
ATOM   2580 C  CG    . ASP A 1 324 ? 21.692  4.641  33.106 1.00 37.90  ? 306  ASP A CG    1 
ATOM   2581 O  OD1   . ASP A 1 324 ? 21.962  5.593  32.339 1.00 38.13  ? 306  ASP A OD1   1 
ATOM   2582 O  OD2   . ASP A 1 324 ? 22.088  3.486  32.899 1.00 39.74  ? 306  ASP A OD2   1 
ATOM   2583 N  N     . THR A 1 325 ? 21.100  8.421  33.739 1.00 36.46  ? 307  THR A N     1 
ATOM   2584 C  CA    . THR A 1 325 ? 20.539  9.513  32.939 1.00 38.19  ? 307  THR A CA    1 
ATOM   2585 C  C     . THR A 1 325 ? 20.415  9.199  31.428 1.00 40.99  ? 307  THR A C     1 
ATOM   2586 O  O     . THR A 1 325 ? 19.632  9.858  30.715 1.00 42.53  ? 307  THR A O     1 
ATOM   2587 C  CB    . THR A 1 325 ? 21.307  10.820 33.174 1.00 38.09  ? 307  THR A CB    1 
ATOM   2588 O  OG1   . THR A 1 325 ? 22.698  10.593 32.950 1.00 39.41  ? 307  THR A OG1   1 
ATOM   2589 C  CG2   . THR A 1 325 ? 21.118  11.295 34.596 1.00 35.45  ? 307  THR A CG2   1 
ATOM   2590 N  N     . LYS A 1 326 ? 21.161  8.195  30.954 1.00 42.39  ? 308  LYS A N     1 
ATOM   2591 C  CA    . LYS A 1 326 ? 21.030  7.679  29.590 1.00 44.56  ? 308  LYS A CA    1 
ATOM   2592 C  C     . LYS A 1 326 ? 19.666  7.019  29.296 1.00 44.34  ? 308  LYS A C     1 
ATOM   2593 O  O     . LYS A 1 326 ? 19.076  7.256  28.243 1.00 44.75  ? 308  LYS A O     1 
ATOM   2594 C  CB    . LYS A 1 326 ? 22.137  6.652  29.276 1.00 46.07  ? 308  LYS A CB    1 
ATOM   2595 C  CG    . LYS A 1 326 ? 23.467  7.245  28.863 1.00 50.58  ? 308  LYS A CG    1 
ATOM   2596 C  CD    . LYS A 1 326 ? 24.043  6.528  27.626 1.00 56.13  ? 308  LYS A CD    1 
ATOM   2597 C  CE    . LYS A 1 326 ? 24.781  7.531  26.691 1.00 58.93  ? 308  LYS A CE    1 
ATOM   2598 N  NZ    . LYS A 1 326 ? 25.491  6.883  25.538 1.00 59.38  ? 308  LYS A NZ    1 
ATOM   2599 N  N     . THR A 1 327 ? 19.188  6.170  30.219 1.00 43.03  ? 309  THR A N     1 
ATOM   2600 C  CA    . THR A 1 327 ? 17.992  5.364  29.989 1.00 41.81  ? 309  THR A CA    1 
ATOM   2601 C  C     . THR A 1 327 ? 16.790  5.922  30.737 1.00 40.68  ? 309  THR A C     1 
ATOM   2602 O  O     . THR A 1 327 ? 15.635  5.614  30.399 1.00 41.57  ? 309  THR A O     1 
ATOM   2603 C  CB    . THR A 1 327 ? 18.230  3.924  30.427 1.00 41.69  ? 309  THR A CB    1 
ATOM   2604 O  OG1   . THR A 1 327 ? 18.530  3.909  31.830 1.00 40.50  ? 309  THR A OG1   1 
ATOM   2605 C  CG2   . THR A 1 327 ? 19.413  3.335  29.675 1.00 41.87  ? 309  THR A CG2   1 
ATOM   2606 N  N     . GLY A 1 328 ? 17.067  6.717  31.767 1.00 38.32  ? 310  GLY A N     1 
ATOM   2607 C  CA    . GLY A 1 328 ? 16.031  7.253  32.654 1.00 36.44  ? 310  GLY A CA    1 
ATOM   2608 C  C     . GLY A 1 328 ? 15.585  6.249  33.711 1.00 35.16  ? 310  GLY A C     1 
ATOM   2609 O  O     . GLY A 1 328 ? 14.635  6.515  34.486 1.00 34.48  ? 310  GLY A O     1 
ATOM   2610 N  N     . LYS A 1 329 ? 16.286  5.116  33.766 1.00 34.21  ? 311  LYS A N     1 
ATOM   2611 C  CA    . LYS A 1 329 ? 15.981  4.065  34.740 1.00 33.02  ? 311  LYS A CA    1 
ATOM   2612 C  C     . LYS A 1 329 ? 16.866  4.212  35.964 1.00 31.35  ? 311  LYS A C     1 
ATOM   2613 O  O     . LYS A 1 329 ? 17.971  4.750  35.883 1.00 31.70  ? 311  LYS A O     1 
ATOM   2614 C  CB    . LYS A 1 329 ? 16.223  2.695  34.127 1.00 33.47  ? 311  LYS A CB    1 
ATOM   2615 C  CG    . LYS A 1 329 ? 15.240  2.340  33.054 1.00 36.56  ? 311  LYS A CG    1 
ATOM   2616 C  CD    . LYS A 1 329 ? 15.683  1.083  32.315 1.00 39.14  ? 311  LYS A CD    1 
ATOM   2617 C  CE    . LYS A 1 329 ? 14.902  0.934  30.999 1.00 41.27  ? 311  LYS A CE    1 
ATOM   2618 N  NZ    . LYS A 1 329 ? 15.391  -0.268 30.265 1.00 44.13  ? 311  LYS A NZ    1 
ATOM   2619 N  N     . LEU A 1 330 ? 16.402  3.693  37.087 1.00 30.11  ? 312  LEU A N     1 
ATOM   2620 C  CA    . LEU A 1 330 ? 17.261  3.575  38.270 1.00 29.42  ? 312  LEU A CA    1 
ATOM   2621 C  C     . LEU A 1 330 ? 18.355  2.517  38.099 1.00 30.03  ? 312  LEU A C     1 
ATOM   2622 O  O     . LEU A 1 330 ? 18.117  1.436  37.549 1.00 30.61  ? 312  LEU A O     1 
ATOM   2623 C  CB    . LEU A 1 330 ? 16.418  3.305  39.504 1.00 28.44  ? 312  LEU A CB    1 
ATOM   2624 C  CG    . LEU A 1 330 ? 15.345  4.368  39.772 1.00 27.58  ? 312  LEU A CG    1 
ATOM   2625 C  CD1   . LEU A 1 330 ? 14.667  4.100  41.094 1.00 31.33  ? 312  LEU A CD1   1 
ATOM   2626 C  CD2   . LEU A 1 330 ? 15.895  5.773  39.751 1.00 25.45  ? 312  LEU A CD2   1 
ATOM   2627 N  N     . LYS A 1 331 ? 19.561  2.824  38.566 1.00 29.80  ? 313  LYS A N     1 
ATOM   2628 C  CA    . LYS A 1 331 ? 20.577  1.792  38.690 1.00 30.93  ? 313  LYS A CA    1 
ATOM   2629 C  C     . LYS A 1 331 ? 20.152  0.868  39.817 1.00 30.51  ? 313  LYS A C     1 
ATOM   2630 O  O     . LYS A 1 331 ? 19.434  1.301  40.739 1.00 30.56  ? 313  LYS A O     1 
ATOM   2631 C  CB    . LYS A 1 331 ? 21.938  2.377  39.023 1.00 30.96  ? 313  LYS A CB    1 
ATOM   2632 C  CG    . LYS A 1 331 ? 22.389  3.441  38.076 1.00 34.68  ? 313  LYS A CG    1 
ATOM   2633 C  CD    . LYS A 1 331 ? 23.874  3.442  37.957 1.00 37.30  ? 313  LYS A CD    1 
ATOM   2634 C  CE    . LYS A 1 331 ? 24.256  4.623  37.098 1.00 42.44  ? 313  LYS A CE    1 
ATOM   2635 N  NZ    . LYS A 1 331 ? 25.652  4.546  36.631 1.00 46.84  ? 313  LYS A NZ    1 
ATOM   2636 N  N     . ILE A 1 332 ? 20.570  -0.399 39.740 1.00 30.80  ? 314  ILE A N     1 
ATOM   2637 C  CA    . ILE A 1 332 ? 20.175  -1.378 40.754 1.00 31.48  ? 314  ILE A CA    1 
ATOM   2638 C  C     . ILE A 1 332 ? 21.040  -1.179 42.001 1.00 30.70  ? 314  ILE A C     1 
ATOM   2639 O  O     . ILE A 1 332 ? 22.270  -1.113 41.913 1.00 31.50  ? 314  ILE A O     1 
ATOM   2640 C  CB    . ILE A 1 332 ? 20.153  -2.878 40.233 1.00 32.78  ? 314  ILE A CB    1 
ATOM   2641 C  CG1   . ILE A 1 332 ? 19.375  -3.004 38.912 1.00 32.62  ? 314  ILE A CG1   1 
ATOM   2642 C  CG2   . ILE A 1 332 ? 19.486  -3.805 41.280 1.00 33.33  ? 314  ILE A CG2   1 
ATOM   2643 C  CD1   . ILE A 1 332 ? 17.997  -2.333 38.942 1.00 28.99  ? 314  ILE A CD1   1 
ATOM   2644 N  N     . GLY A 1 333 ? 20.386  -0.997 43.137 1.00 29.93  ? 315  GLY A N     1 
ATOM   2645 C  CA    . GLY A 1 333 ? 21.078  -0.914 44.398 1.00 30.25  ? 315  GLY A CA    1 
ATOM   2646 C  C     . GLY A 1 333 ? 20.987  0.445  45.041 1.00 29.53  ? 315  GLY A C     1 
ATOM   2647 O  O     . GLY A 1 333 ? 20.549  1.414  44.416 1.00 28.39  ? 315  GLY A O     1 
ATOM   2648 N  N     . THR A 1 334 ? 21.354  0.496  46.320 1.00 29.36  ? 316  THR A N     1 
ATOM   2649 C  CA    . THR A 1 334 ? 21.407  1.763  47.068 1.00 28.97  ? 316  THR A CA    1 
ATOM   2650 C  C     . THR A 1 334 ? 22.724  2.446  46.747 1.00 29.38  ? 316  THR A C     1 
ATOM   2651 O  O     . THR A 1 334 ? 23.781  1.804  46.760 1.00 29.76  ? 316  THR A O     1 
ATOM   2652 C  CB    . THR A 1 334 ? 21.275  1.550  48.600 1.00 28.48  ? 316  THR A CB    1 
ATOM   2653 O  OG1   . THR A 1 334 ? 20.051  0.850  48.872 1.00 30.43  ? 316  THR A OG1   1 
ATOM   2654 C  CG2   . THR A 1 334 ? 21.232  2.870  49.358 1.00 27.85  ? 316  THR A CG2   1 
ATOM   2655 N  N     . TYR A 1 335 ? 22.650  3.739  46.462 1.00 29.37  ? 317  TYR A N     1 
ATOM   2656 C  CA    . TYR A 1 335 ? 23.848  4.511  46.157 1.00 31.48  ? 317  TYR A CA    1 
ATOM   2657 C  C     . TYR A 1 335 ? 24.580  4.878  47.434 1.00 31.99  ? 317  TYR A C     1 
ATOM   2658 O  O     . TYR A 1 335 ? 24.035  5.545  48.282 1.00 31.24  ? 317  TYR A O     1 
ATOM   2659 C  CB    . TYR A 1 335 ? 23.522  5.777  45.335 1.00 31.71  ? 317  TYR A CB    1 
ATOM   2660 C  CG    . TYR A 1 335 ? 24.771  6.537  44.968 1.00 33.23  ? 317  TYR A CG    1 
ATOM   2661 C  CD1   . TYR A 1 335 ? 25.629  6.049  43.985 1.00 35.25  ? 317  TYR A CD1   1 
ATOM   2662 C  CD2   . TYR A 1 335 ? 25.115  7.719  45.624 1.00 32.86  ? 317  TYR A CD2   1 
ATOM   2663 C  CE1   . TYR A 1 335 ? 26.799  6.714  43.654 1.00 37.84  ? 317  TYR A CE1   1 
ATOM   2664 C  CE2   . TYR A 1 335 ? 26.294  8.409  45.296 1.00 35.46  ? 317  TYR A CE2   1 
ATOM   2665 C  CZ    . TYR A 1 335 ? 27.133  7.899  44.315 1.00 37.57  ? 317  TYR A CZ    1 
ATOM   2666 O  OH    . TYR A 1 335 ? 28.307  8.559  43.959 1.00 39.18  ? 317  TYR A OH    1 
ATOM   2667 N  N     . THR A 1 336 ? 25.830  4.444  47.541 1.00 35.32  ? 318  THR A N     1 
ATOM   2668 C  CA    . THR A 1 336 ? 26.624  4.614  48.757 1.00 38.23  ? 318  THR A CA    1 
ATOM   2669 C  C     . THR A 1 336 ? 27.766  5.627  48.581 1.00 39.66  ? 318  THR A C     1 
ATOM   2670 O  O     . THR A 1 336 ? 28.394  6.036  49.569 1.00 41.04  ? 318  THR A O     1 
ATOM   2671 C  CB    . THR A 1 336 ? 27.249  3.259  49.216 1.00 39.19  ? 318  THR A CB    1 
ATOM   2672 O  OG1   . THR A 1 336 ? 28.088  2.756  48.168 1.00 41.27  ? 318  THR A OG1   1 
ATOM   2673 C  CG2   . THR A 1 336 ? 26.139  2.212  49.569 1.00 38.45  ? 318  THR A CG2   1 
ATOM   2674 N  N     . GLY A 1 337 ? 28.025  6.017  47.330 1.00 40.17  ? 319  GLY A N     1 
ATOM   2675 C  CA    . GLY A 1 337 ? 29.139  6.914  46.972 1.00 41.10  ? 319  GLY A CA    1 
ATOM   2676 C  C     . GLY A 1 337 ? 28.910  8.382  47.335 1.00 40.81  ? 319  GLY A C     1 
ATOM   2677 O  O     . GLY A 1 337 ? 27.902  8.736  47.975 1.00 39.62  ? 319  GLY A O     1 
ATOM   2678 N  N     . PRO A 1 338 ? 29.850  9.252  46.934 1.00 41.66  ? 320  PRO A N     1 
ATOM   2679 C  CA    . PRO A 1 338 ? 29.758  10.688 47.235 1.00 41.21  ? 320  PRO A CA    1 
ATOM   2680 C  C     . PRO A 1 338 ? 29.056  11.498 46.130 1.00 39.98  ? 320  PRO A C     1 
ATOM   2681 O  O     . PRO A 1 338 ? 28.793  10.970 45.043 1.00 39.57  ? 320  PRO A O     1 
ATOM   2682 C  CB    . PRO A 1 338 ? 31.233  11.091 47.300 1.00 42.20  ? 320  PRO A CB    1 
ATOM   2683 C  CG    . PRO A 1 338 ? 31.853  10.268 46.178 1.00 43.47  ? 320  PRO A CG    1 
ATOM   2684 C  CD    . PRO A 1 338 ? 31.105  8.924  46.215 1.00 43.27  ? 320  PRO A CD    1 
ATOM   2685 N  N     . LEU A 1 339 ? 28.781  12.771 46.410 1.00 39.73  ? 321  LEU A N     1 
ATOM   2686 C  CA    . LEU A 1 339 ? 28.329  13.708 45.385 1.00 39.97  ? 321  LEU A CA    1 
ATOM   2687 C  C     . LEU A 1 339 ? 29.365  13.772 44.262 1.00 41.73  ? 321  LEU A C     1 
ATOM   2688 O  O     . LEU A 1 339 ? 30.519  14.082 44.518 1.00 43.41  ? 321  LEU A O     1 
ATOM   2689 C  CB    . LEU A 1 339 ? 28.116  15.100 46.002 1.00 39.23  ? 321  LEU A CB    1 
ATOM   2690 C  CG    . LEU A 1 339 ? 27.375  16.147 45.150 1.00 39.09  ? 321  LEU A CG    1 
ATOM   2691 C  CD1   . LEU A 1 339 ? 25.919  15.766 44.927 1.00 36.18  ? 321  LEU A CD1   1 
ATOM   2692 C  CD2   . LEU A 1 339 ? 27.438  17.533 45.789 1.00 39.32  ? 321  LEU A CD2   1 
ATOM   2693 N  N     . GLN A 1 340 ? 28.976  13.441 43.029 1.00 42.28  ? 322  GLN A N     1 
ATOM   2694 C  CA    . GLN A 1 340 ? 29.892  13.593 41.887 1.00 44.50  ? 322  GLN A CA    1 
ATOM   2695 C  C     . GLN A 1 340 ? 29.246  14.486 40.865 1.00 43.33  ? 322  GLN A C     1 
ATOM   2696 O  O     . GLN A 1 340 ? 28.033  14.538 40.772 1.00 41.59  ? 322  GLN A O     1 
ATOM   2697 C  CB    . GLN A 1 340 ? 30.222  12.258 41.189 1.00 45.20  ? 322  GLN A CB    1 
ATOM   2698 C  CG    . GLN A 1 340 ? 30.382  11.029 42.088 1.00 47.52  ? 322  GLN A CG    1 
ATOM   2699 C  CD    . GLN A 1 340 ? 30.760  9.769  41.298 1.00 48.58  ? 322  GLN A CD    1 
ATOM   2700 O  OE1   . GLN A 1 340 ? 31.568  9.827  40.347 1.00 50.60  ? 322  GLN A OE1   1 
ATOM   2701 N  NE2   . GLN A 1 340 ? 30.183  8.614  41.700 1.00 50.43  ? 322  GLN A NE2   1 
ATOM   2702 N  N     . HIS A 1 341 ? 30.062  15.162 40.069 1.00 43.67  ? 323  HIS A N     1 
ATOM   2703 C  CA    . HIS A 1 341 ? 29.525  16.010 39.014 1.00 43.50  ? 323  HIS A CA    1 
ATOM   2704 C  C     . HIS A 1 341 ? 28.671  15.186 38.059 1.00 41.69  ? 323  HIS A C     1 
ATOM   2705 O  O     . HIS A 1 341 ? 29.064  14.105 37.641 1.00 41.87  ? 323  HIS A O     1 
ATOM   2706 C  CB    . HIS A 1 341 ? 30.635  16.753 38.251 1.00 45.43  ? 323  HIS A CB    1 
ATOM   2707 C  CG    . HIS A 1 341 ? 30.105  17.643 37.168 1.00 48.57  ? 323  HIS A CG    1 
ATOM   2708 N  ND1   . HIS A 1 341 ? 29.452  18.832 37.434 1.00 50.44  ? 323  HIS A ND1   1 
ATOM   2709 C  CD2   . HIS A 1 341 ? 30.085  17.494 35.818 1.00 52.11  ? 323  HIS A CD2   1 
ATOM   2710 C  CE1   . HIS A 1 341 ? 29.087  19.394 36.292 1.00 53.10  ? 323  HIS A CE1   1 
ATOM   2711 N  NE2   . HIS A 1 341 ? 29.453  18.598 35.298 1.00 53.40  ? 323  HIS A NE2   1 
ATOM   2712 N  N     . GLY A 1 342 ? 27.479  15.678 37.751 1.00 39.91  ? 324  GLY A N     1 
ATOM   2713 C  CA    . GLY A 1 342 ? 26.641  15.006 36.763 1.00 38.55  ? 324  GLY A CA    1 
ATOM   2714 C  C     . GLY A 1 342 ? 25.810  13.850 37.271 1.00 37.15  ? 324  GLY A C     1 
ATOM   2715 O  O     . GLY A 1 342 ? 25.006  13.313 36.528 1.00 37.48  ? 324  GLY A O     1 
ATOM   2716 N  N     . ILE A 1 343 ? 25.979  13.460 38.534 1.00 35.99  ? 325  ILE A N     1 
ATOM   2717 C  CA    . ILE A 1 343 ? 25.113  12.444 39.143 1.00 34.22  ? 325  ILE A CA    1 
ATOM   2718 C  C     . ILE A 1 343 ? 23.691  12.994 39.397 1.00 32.02  ? 325  ILE A C     1 
ATOM   2719 O  O     . ILE A 1 343 ? 23.526  14.164 39.760 1.00 30.88  ? 325  ILE A O     1 
ATOM   2720 C  CB    . ILE A 1 343 ? 25.709  11.930 40.478 1.00 34.28  ? 325  ILE A CB    1 
ATOM   2721 C  CG1   . ILE A 1 343 ? 24.944  10.711 40.991 1.00 36.21  ? 325  ILE A CG1   1 
ATOM   2722 C  CG2   . ILE A 1 343 ? 25.640  13.044 41.574 1.00 35.64  ? 325  ILE A CG2   1 
ATOM   2723 C  CD1   . ILE A 1 343 ? 25.727  9.868  41.968 1.00 39.22  ? 325  ILE A CD1   1 
ATOM   2724 N  N     . VAL A 1 344 ? 22.671  12.150 39.209 1.00 30.10  ? 326  VAL A N     1 
ATOM   2725 C  CA    . VAL A 1 344 ? 21.308  12.518 39.572 1.00 27.31  ? 326  VAL A CA    1 
ATOM   2726 C  C     . VAL A 1 344 ? 20.784  11.488 40.557 1.00 26.67  ? 326  VAL A C     1 
ATOM   2727 O  O     . VAL A 1 344 ? 20.844  10.290 40.289 1.00 26.88  ? 326  VAL A O     1 
ATOM   2728 C  CB    . VAL A 1 344 ? 20.376  12.602 38.341 1.00 28.12  ? 326  VAL A CB    1 
ATOM   2729 C  CG1   . VAL A 1 344 ? 18.887  12.791 38.779 1.00 26.05  ? 326  VAL A CG1   1 
ATOM   2730 C  CG2   . VAL A 1 344 ? 20.821  13.706 37.419 1.00 26.16  ? 326  VAL A CG2   1 
ATOM   2731 N  N     . TYR A 1 345 ? 20.279  11.963 41.690 1.00 25.09  ? 327  TYR A N     1 
ATOM   2732 C  CA    . TYR A 1 345 ? 19.735  11.086 42.725 1.00 24.64  ? 327  TYR A CA    1 
ATOM   2733 C  C     . TYR A 1 345 ? 18.235  10.895 42.660 1.00 22.91  ? 327  TYR A C     1 
ATOM   2734 O  O     . TYR A 1 345 ? 17.499  11.745 42.151 1.00 22.86  ? 327  TYR A O     1 
ATOM   2735 C  CB    . TYR A 1 345 ? 20.040  11.660 44.090 1.00 25.32  ? 327  TYR A CB    1 
ATOM   2736 C  CG    . TYR A 1 345 ? 21.483  11.832 44.346 1.00 28.85  ? 327  TYR A CG    1 
ATOM   2737 C  CD1   . TYR A 1 345 ? 22.289  10.738 44.626 1.00 29.75  ? 327  TYR A CD1   1 
ATOM   2738 C  CD2   . TYR A 1 345 ? 22.063  13.097 44.287 1.00 31.26  ? 327  TYR A CD2   1 
ATOM   2739 C  CE1   . TYR A 1 345 ? 23.647  10.895 44.882 1.00 30.43  ? 327  TYR A CE1   1 
ATOM   2740 C  CE2   . TYR A 1 345 ? 23.406  13.268 44.530 1.00 34.37  ? 327  TYR A CE2   1 
ATOM   2741 C  CZ    . TYR A 1 345 ? 24.192  12.156 44.842 1.00 33.97  ? 327  TYR A CZ    1 
ATOM   2742 O  OH    . TYR A 1 345 ? 25.535  12.317 45.080 1.00 36.55  ? 327  TYR A OH    1 
ATOM   2743 N  N     . SER A 1 346 ? 17.806  9.790  43.253 1.00 22.19  ? 328  SER A N     1 
ATOM   2744 C  CA    . SER A 1 346 ? 16.423  9.400  43.351 1.00 22.08  ? 328  SER A CA    1 
ATOM   2745 C  C     . SER A 1 346 ? 16.101  8.948  44.781 1.00 22.12  ? 328  SER A C     1 
ATOM   2746 O  O     . SER A 1 346 ? 16.846  8.171  45.380 1.00 23.05  ? 328  SER A O     1 
ATOM   2747 C  CB    . SER A 1 346 ? 16.151  8.279  42.351 1.00 21.96  ? 328  SER A CB    1 
ATOM   2748 O  OG    . SER A 1 346 ? 14.807  7.846  42.465 1.00 20.03  ? 328  SER A OG    1 
ATOM   2749 N  N     . GLY A 1 347 ? 14.999  9.451  45.344 1.00 22.36  ? 329  GLY A N     1 
ATOM   2750 C  CA    . GLY A 1 347 ? 14.522  8.987  46.643 1.00 21.34  ? 329  GLY A CA    1 
ATOM   2751 C  C     . GLY A 1 347 ? 15.336  9.670  47.725 1.00 22.47  ? 329  GLY A C     1 
ATOM   2752 O  O     . GLY A 1 347 ? 15.537  10.883 47.679 1.00 22.12  ? 329  GLY A O     1 
ATOM   2753 N  N     . GLY A 1 348 ? 15.872  8.891  48.665 1.00 22.03  ? 330  GLY A N     1 
ATOM   2754 C  CA    . GLY A 1 348 ? 16.687  9.452  49.756 1.00 22.53  ? 330  GLY A CA    1 
ATOM   2755 C  C     . GLY A 1 348 ? 15.845  10.185 50.791 1.00 21.74  ? 330  GLY A C     1 
ATOM   2756 O  O     . GLY A 1 348 ? 14.638  9.917  50.926 1.00 21.97  ? 330  GLY A O     1 
ATOM   2757 N  N     . SER A 1 349 ? 16.477  11.114 51.500 1.00 21.21  ? 331  SER A N     1 
ATOM   2758 C  CA    . SER A 1 349 ? 15.843  11.906 52.570 1.00 21.91  ? 331  SER A CA    1 
ATOM   2759 C  C     . SER A 1 349 ? 16.427  13.308 52.603 1.00 21.79  ? 331  SER A C     1 
ATOM   2760 O  O     . SER A 1 349 ? 17.467  13.578 51.976 1.00 20.96  ? 331  SER A O     1 
ATOM   2761 C  CB    . SER A 1 349 ? 16.026  11.249 53.947 1.00 22.29  ? 331  SER A CB    1 
ATOM   2762 O  OG    . SER A 1 349 ? 17.383  11.350 54.377 1.00 26.45  ? 331  SER A OG    1 
ATOM   2763 N  N     . SER A 1 350 ? 15.782  14.218 53.339 1.00 21.92  ? 332  SER A N     1 
ATOM   2764 C  CA    . SER A 1 350 ? 16.351  15.579 53.464 1.00 22.93  ? 332  SER A CA    1 
ATOM   2765 C  C     . SER A 1 350 ? 17.792  15.559 54.008 1.00 23.90  ? 332  SER A C     1 
ATOM   2766 O  O     . SER A 1 350 ? 18.592  16.455 53.663 1.00 24.84  ? 332  SER A O     1 
ATOM   2767 C  CB    . SER A 1 350 ? 15.452  16.468 54.317 1.00 22.70  ? 332  SER A CB    1 
ATOM   2768 O  OG    . SER A 1 350 ? 15.271  15.882 55.581 1.00 24.22  ? 332  SER A OG    1 
ATOM   2769 N  N     . ASP A 1 351 ? 18.140  14.537 54.806 1.00 25.26  ? 333  ASP A N     1 
ATOM   2770 C  CA    . ASP A 1 351 ? 19.522  14.349 55.317 1.00 28.08  ? 333  ASP A CA    1 
ATOM   2771 C  C     . ASP A 1 351 ? 20.566  14.086 54.227 1.00 28.99  ? 333  ASP A C     1 
ATOM   2772 O  O     . ASP A 1 351 ? 21.754  14.342 54.430 1.00 29.71  ? 333  ASP A O     1 
ATOM   2773 C  CB    . ASP A 1 351 ? 19.616  13.233 56.360 1.00 29.73  ? 333  ASP A CB    1 
ATOM   2774 C  CG    . ASP A 1 351 ? 19.049  13.637 57.730 1.00 33.99  ? 333  ASP A CG    1 
ATOM   2775 O  OD1   . ASP A 1 351 ? 18.952  14.854 58.074 1.00 37.30  ? 333  ASP A OD1   1 
ATOM   2776 O  OD2   . ASP A 1 351 ? 18.706  12.709 58.484 1.00 38.85  ? 333  ASP A OD2   1 
ATOM   2777 N  N     . THR A 1 352 ? 20.119  13.535 53.104 1.00 28.58  ? 334  THR A N     1 
ATOM   2778 C  CA    . THR A 1 352 ? 20.916  13.414 51.908 1.00 30.43  ? 334  THR A CA    1 
ATOM   2779 C  C     . THR A 1 352 ? 21.393  14.784 51.470 1.00 30.33  ? 334  THR A C     1 
ATOM   2780 O  O     . THR A 1 352 ? 22.578  14.965 51.223 1.00 30.90  ? 334  THR A O     1 
ATOM   2781 C  CB    . THR A 1 352 ? 20.079  12.823 50.732 1.00 30.43  ? 334  THR A CB    1 
ATOM   2782 O  OG1   . THR A 1 352 ? 19.474  11.586 51.143 1.00 32.33  ? 334  THR A OG1   1 
ATOM   2783 C  CG2   . THR A 1 352 ? 20.928  12.645 49.461 1.00 30.24  ? 334  THR A CG2   1 
ATOM   2784 N  N     . ILE A 1 353 ? 20.464  15.738 51.374 1.00 30.18  ? 335  ILE A N     1 
ATOM   2785 C  CA    . ILE A 1 353 ? 20.828  17.089 50.959 1.00 30.63  ? 335  ILE A CA    1 
ATOM   2786 C  C     . ILE A 1 353 ? 21.806  17.707 51.959 1.00 30.85  ? 335  ILE A C     1 
ATOM   2787 O  O     . ILE A 1 353 ? 22.871  18.192 51.565 1.00 30.89  ? 335  ILE A O     1 
ATOM   2788 C  CB    . ILE A 1 353 ? 19.596  18.029 50.783 1.00 30.76  ? 335  ILE A CB    1 
ATOM   2789 C  CG1   . ILE A 1 353 ? 18.403  17.328 50.093 1.00 30.69  ? 335  ILE A CG1   1 
ATOM   2790 C  CG2   . ILE A 1 353 ? 20.009  19.340 50.124 1.00 31.49  ? 335  ILE A CG2   1 
ATOM   2791 C  CD1   . ILE A 1 353 ? 18.427  17.197 48.604 1.00 32.45  ? 335  ILE A CD1   1 
ATOM   2792 N  N     . CYS A 1 354 ? 21.485  17.664 53.251 1.00 30.53  ? 336  CYS A N     1 
ATOM   2793 C  CA    . CYS A 1 354 ? 22.409  18.206 54.248 1.00 32.10  ? 336  CYS A CA    1 
ATOM   2794 C  C     . CYS A 1 354 ? 23.778  17.590 54.237 1.00 32.49  ? 336  CYS A C     1 
ATOM   2795 O  O     . CYS A 1 354 ? 24.758  18.307 54.265 1.00 33.26  ? 336  CYS A O     1 
ATOM   2796 C  CB    . CYS A 1 354 ? 21.829  18.113 55.645 1.00 32.91  ? 336  CYS A CB    1 
ATOM   2797 S  SG    . CYS A 1 354 ? 20.323  19.070 55.692 1.00 36.34  ? 336  CYS A SG    1 
ATOM   2798 N  N     . ASP A 1 355 ? 23.856  16.266 54.202 1.00 32.95  ? 337  ASP A N     1 
ATOM   2799 C  CA    . ASP A 1 355 ? 25.147  15.600 54.202 1.00 34.59  ? 337  ASP A CA    1 
ATOM   2800 C  C     . ASP A 1 355 ? 25.952  15.950 52.962 1.00 34.05  ? 337  ASP A C     1 
ATOM   2801 O  O     . ASP A 1 355 ? 27.114  16.319 53.077 1.00 34.56  ? 337  ASP A O     1 
ATOM   2802 C  CB    . ASP A 1 355 ? 24.979  14.080 54.293 1.00 36.14  ? 337  ASP A CB    1 
ATOM   2803 C  CG    . ASP A 1 355 ? 24.393  13.611 55.652 1.00 41.13  ? 337  ASP A CG    1 
ATOM   2804 O  OD1   . ASP A 1 355 ? 24.237  14.447 56.606 1.00 43.97  ? 337  ASP A OD1   1 
ATOM   2805 O  OD2   . ASP A 1 355 ? 24.070  12.386 55.741 1.00 45.39  ? 337  ASP A OD2   1 
ATOM   2806 N  N     . LEU A 1 356 ? 25.331  15.841 51.787 1.00 32.52  ? 338  LEU A N     1 
ATOM   2807 C  CA    . LEU A 1 356 ? 26.034  16.065 50.502 1.00 33.14  ? 338  LEU A CA    1 
ATOM   2808 C  C     . LEU A 1 356 ? 26.414  17.523 50.246 1.00 33.08  ? 338  LEU A C     1 
ATOM   2809 O  O     . LEU A 1 356 ? 27.489  17.800 49.698 1.00 34.12  ? 338  LEU A O     1 
ATOM   2810 C  CB    . LEU A 1 356 ? 25.254  15.469 49.320 1.00 32.23  ? 338  LEU A CB    1 
ATOM   2811 C  CG    . LEU A 1 356 ? 25.146  13.921 49.348 1.00 34.22  ? 338  LEU A CG    1 
ATOM   2812 C  CD1   . LEU A 1 356 ? 24.294  13.383 48.206 1.00 32.59  ? 338  LEU A CD1   1 
ATOM   2813 C  CD2   . LEU A 1 356 ? 26.530  13.227 49.340 1.00 33.40  ? 338  LEU A CD2   1 
ATOM   2814 N  N     . LEU A 1 357 ? 25.579  18.460 50.693 1.00 31.47  ? 339  LEU A N     1 
ATOM   2815 C  CA    . LEU A 1 357 ? 25.928  19.858 50.554 1.00 31.49  ? 339  LEU A CA    1 
ATOM   2816 C  C     . LEU A 1 357 ? 26.640  20.471 51.770 1.00 32.33  ? 339  LEU A C     1 
ATOM   2817 O  O     . LEU A 1 357 ? 27.005  21.632 51.724 1.00 32.72  ? 339  LEU A O     1 
ATOM   2818 C  CB    . LEU A 1 357 ? 24.694  20.684 50.167 1.00 30.12  ? 339  LEU A CB    1 
ATOM   2819 C  CG    . LEU A 1 357 ? 24.013  20.251 48.871 1.00 29.36  ? 339  LEU A CG    1 
ATOM   2820 C  CD1   . LEU A 1 357 ? 22.830  21.131 48.558 1.00 27.40  ? 339  LEU A CD1   1 
ATOM   2821 C  CD2   . LEU A 1 357 ? 25.000  20.225 47.667 1.00 28.67  ? 339  LEU A CD2   1 
ATOM   2822 N  N     . GLY A 1 358 ? 26.852  19.700 52.837 1.00 33.02  ? 340  GLY A N     1 
ATOM   2823 C  CA    . GLY A 1 358 ? 27.513  20.224 54.042 1.00 33.74  ? 340  GLY A CA    1 
ATOM   2824 C  C     . GLY A 1 358 ? 26.687  21.343 54.654 1.00 33.56  ? 340  GLY A C     1 
ATOM   2825 O  O     . GLY A 1 358 ? 27.201  22.400 55.005 1.00 35.11  ? 340  GLY A O     1 
ATOM   2826 N  N     . ALA A 1 359 ? 25.387  21.128 54.744 1.00 32.92  ? 341  ALA A N     1 
ATOM   2827 C  CA    . ALA A 1 359 ? 24.454  22.180 55.164 1.00 32.71  ? 341  ALA A CA    1 
ATOM   2828 C  C     . ALA A 1 359 ? 23.667  21.759 56.437 1.00 32.48  ? 341  ALA A C     1 
ATOM   2829 O  O     . ALA A 1 359 ? 23.380  20.572 56.628 1.00 32.93  ? 341  ALA A O     1 
ATOM   2830 C  CB    . ALA A 1 359 ? 23.515  22.485 54.037 1.00 31.27  ? 341  ALA A CB    1 
ATOM   2831 N  N     . LYS A 1 360 ? 23.381  22.723 57.312 1.00 31.47  ? 342  LYS A N     1 
ATOM   2832 C  CA    . LYS A 1 360 ? 22.437  22.531 58.407 1.00 31.38  ? 342  LYS A CA    1 
ATOM   2833 C  C     . LYS A 1 360 ? 21.134  23.110 57.892 1.00 28.98  ? 342  LYS A C     1 
ATOM   2834 O  O     . LYS A 1 360 ? 21.147  23.957 56.979 1.00 29.32  ? 342  LYS A O     1 
ATOM   2835 C  CB    . LYS A 1 360 ? 22.857  23.321 59.643 1.00 31.45  ? 342  LYS A CB    1 
ATOM   2836 C  CG    . LYS A 1 360 ? 24.309  23.147 60.075 1.00 37.99  ? 342  LYS A CG    1 
ATOM   2837 C  CD    . LYS A 1 360 ? 24.697  21.673 60.203 1.00 43.68  ? 342  LYS A CD    1 
ATOM   2838 C  CE    . LYS A 1 360 ? 26.225  21.542 60.369 1.00 49.35  ? 342  LYS A CE    1 
ATOM   2839 N  NZ    . LYS A 1 360 ? 26.809  20.298 59.759 1.00 50.28  ? 342  LYS A NZ    1 
ATOM   2840 N  N     . GLY A 1 361 ? 20.020  22.703 58.471 1.00 27.85  ? 343  GLY A N     1 
ATOM   2841 C  CA    . GLY A 1 361 ? 18.705  23.179 58.012 1.00 25.63  ? 343  GLY A CA    1 
ATOM   2842 C  C     . GLY A 1 361 ? 18.542  24.703 57.877 1.00 25.62  ? 343  GLY A C     1 
ATOM   2843 O  O     . GLY A 1 361 ? 17.907  25.175 56.934 1.00 25.62  ? 343  GLY A O     1 
ATOM   2844 N  N     . LYS A 1 362 ? 19.054  25.481 58.823 1.00 25.48  ? 344  LYS A N     1 
ATOM   2845 C  CA    . LYS A 1 362 ? 18.842  26.939 58.806 1.00 26.44  ? 344  LYS A CA    1 
ATOM   2846 C  C     . LYS A 1 362 ? 19.687  27.677 57.742 1.00 26.49  ? 344  LYS A C     1 
ATOM   2847 O  O     . LYS A 1 362 ? 19.470  28.869 57.479 1.00 27.72  ? 344  LYS A O     1 
ATOM   2848 C  CB    . LYS A 1 362 ? 19.092  27.530 60.192 1.00 26.79  ? 344  LYS A CB    1 
ATOM   2849 C  CG    . LYS A 1 362 ? 17.901  27.345 61.126 1.00 25.61  ? 344  LYS A CG    1 
ATOM   2850 C  CD    . LYS A 1 362 ? 18.253  27.566 62.578 1.00 24.29  ? 344  LYS A CD    1 
ATOM   2851 C  CE    . LYS A 1 362 ? 17.161  27.012 63.431 1.00 26.54  ? 344  LYS A CE    1 
ATOM   2852 N  NZ    . LYS A 1 362 ? 17.614  26.818 64.796 1.00 25.42  ? 344  LYS A NZ    1 
ATOM   2853 N  N     . ASP A 1 363 ? 20.646  26.953 57.157 1.00 27.04  ? 345  ASP A N     1 
ATOM   2854 C  CA    . ASP A 1 363 ? 21.457  27.390 56.025 1.00 26.59  ? 345  ASP A CA    1 
ATOM   2855 C  C     . ASP A 1 363 ? 20.652  27.182 54.739 1.00 25.41  ? 345  ASP A C     1 
ATOM   2856 O  O     . ASP A 1 363 ? 21.092  27.613 53.666 1.00 25.31  ? 345  ASP A O     1 
ATOM   2857 C  CB    . ASP A 1 363 ? 22.624  26.432 55.824 1.00 27.38  ? 345  ASP A CB    1 
ATOM   2858 C  CG    . ASP A 1 363 ? 23.612  26.425 56.943 1.00 33.31  ? 345  ASP A CG    1 
ATOM   2859 O  OD1   . ASP A 1 363 ? 23.765  27.433 57.704 1.00 34.96  ? 345  ASP A OD1   1 
ATOM   2860 O  OD2   . ASP A 1 363 ? 24.293  25.368 57.017 1.00 36.20  ? 345  ASP A OD2   1 
ATOM   2861 N  N     . ILE A 1 364 ? 19.505  26.493 54.813 1.00 23.51  ? 346  ILE A N     1 
ATOM   2862 C  CA    . ILE A 1 364 ? 18.752  26.155 53.590 1.00 22.25  ? 346  ILE A CA    1 
ATOM   2863 C  C     . ILE A 1 364 ? 17.507  26.997 53.452 1.00 22.29  ? 346  ILE A C     1 
ATOM   2864 O  O     . ILE A 1 364 ? 16.720  27.063 54.384 1.00 22.04  ? 346  ILE A O     1 
ATOM   2865 C  CB    . ILE A 1 364 ? 18.317  24.665 53.601 1.00 21.81  ? 346  ILE A CB    1 
ATOM   2866 C  CG1   . ILE A 1 364 ? 19.559  23.768 53.564 1.00 22.79  ? 346  ILE A CG1   1 
ATOM   2867 C  CG2   . ILE A 1 364 ? 17.450  24.321 52.424 1.00 18.16  ? 346  ILE A CG2   1 
ATOM   2868 C  CD1   . ILE A 1 364 ? 19.318  22.298 54.036 1.00 20.91  ? 346  ILE A CD1   1 
ATOM   2869 N  N     . LEU A 1 365 ? 17.315  27.617 52.292 1.00 20.79  ? 347  LEU A N     1 
ATOM   2870 C  CA    . LEU A 1 365 ? 16.034  28.169 51.971 1.00 20.48  ? 347  LEU A CA    1 
ATOM   2871 C  C     . LEU A 1 365 ? 15.401  27.263 50.937 1.00 20.93  ? 347  LEU A C     1 
ATOM   2872 O  O     . LEU A 1 365 ? 15.886  27.162 49.829 1.00 20.70  ? 347  LEU A O     1 
ATOM   2873 C  CB    . LEU A 1 365 ? 16.127  29.623 51.470 1.00 21.11  ? 347  LEU A CB    1 
ATOM   2874 C  CG    . LEU A 1 365 ? 14.805  30.315 51.077 1.00 20.22  ? 347  LEU A CG    1 
ATOM   2875 C  CD1   . LEU A 1 365 ? 13.850  30.408 52.257 1.00 19.59  ? 347  LEU A CD1   1 
ATOM   2876 C  CD2   . LEU A 1 365 ? 15.048  31.671 50.403 1.00 22.01  ? 347  LEU A CD2   1 
ATOM   2877 N  N     . TYR A 1 366 ? 14.294  26.616 51.314 1.00 21.20  ? 348  TYR A N     1 
ATOM   2878 C  CA    . TYR A 1 366 ? 13.601  25.731 50.405 1.00 20.65  ? 348  TYR A CA    1 
ATOM   2879 C  C     . TYR A 1 366 ? 12.338  26.401 49.883 1.00 20.64  ? 348  TYR A C     1 
ATOM   2880 O  O     . TYR A 1 366 ? 11.526  26.881 50.666 1.00 20.70  ? 348  TYR A O     1 
ATOM   2881 C  CB    . TYR A 1 366 ? 13.304  24.383 51.099 1.00 20.03  ? 348  TYR A CB    1 
ATOM   2882 C  CG    . TYR A 1 366 ? 12.628  23.393 50.180 1.00 21.25  ? 348  TYR A CG    1 
ATOM   2883 C  CD1   . TYR A 1 366 ? 13.259  22.962 49.019 1.00 23.90  ? 348  TYR A CD1   1 
ATOM   2884 C  CD2   . TYR A 1 366 ? 11.349  22.916 50.453 1.00 22.52  ? 348  TYR A CD2   1 
ATOM   2885 C  CE1   . TYR A 1 366 ? 12.672  22.086 48.181 1.00 23.61  ? 348  TYR A CE1   1 
ATOM   2886 C  CE2   . TYR A 1 366 ? 10.721  22.024 49.582 1.00 24.18  ? 348  TYR A CE2   1 
ATOM   2887 C  CZ    . TYR A 1 366 ? 11.388  21.633 48.443 1.00 24.40  ? 348  TYR A CZ    1 
ATOM   2888 O  OH    . TYR A 1 366 ? 10.821  20.752 47.538 1.00 24.86  ? 348  TYR A OH    1 
ATOM   2889 N  N     . ILE A 1 367 ? 12.188  26.411 48.548 1.00 20.80  ? 349  ILE A N     1 
ATOM   2890 C  CA    . ILE A 1 367 ? 11.182  27.183 47.814 1.00 20.69  ? 349  ILE A CA    1 
ATOM   2891 C  C     . ILE A 1 367 ? 10.202  26.144 47.250 1.00 20.81  ? 349  ILE A C     1 
ATOM   2892 O  O     . ILE A 1 367 ? 10.587  25.285 46.443 1.00 21.72  ? 349  ILE A O     1 
ATOM   2893 C  CB    . ILE A 1 367 ? 11.876  28.041 46.726 1.00 21.29  ? 349  ILE A CB    1 
ATOM   2894 C  CG1   . ILE A 1 367 ? 12.950  28.916 47.385 1.00 20.81  ? 349  ILE A CG1   1 
ATOM   2895 C  CG2   . ILE A 1 367 ? 10.888  28.906 45.923 1.00 22.65  ? 349  ILE A CG2   1 
ATOM   2896 C  CD1   . ILE A 1 367 ? 13.985  29.464 46.402 1.00 22.91  ? 349  ILE A CD1   1 
ATOM   2897 N  N     . GLY A 1 368 ? 8.956   26.171 47.707 1.00 20.53  ? 350  GLY A N     1 
ATOM   2898 C  CA    . GLY A 1 368 ? 7.986   25.175 47.262 1.00 19.96  ? 350  GLY A CA    1 
ATOM   2899 C  C     . GLY A 1 368 ? 6.605   25.785 47.211 1.00 21.18  ? 350  GLY A C     1 
ATOM   2900 O  O     . GLY A 1 368 ? 6.425   26.943 47.618 1.00 20.20  ? 350  GLY A O     1 
ATOM   2901 N  N     . ASP A 1 369 ? 5.644   25.011 46.702 1.00 20.15  ? 351  ASP A N     1 
ATOM   2902 C  CA    . ASP A 1 369 ? 4.234   25.440 46.513 1.00 20.47  ? 351  ASP A CA    1 
ATOM   2903 C  C     . ASP A 1 369 ? 3.309   24.589 47.370 1.00 20.01  ? 351  ASP A C     1 
ATOM   2904 O  O     . ASP A 1 369 ? 2.150   24.912 47.494 1.00 20.87  ? 351  ASP A O     1 
ATOM   2905 C  CB    . ASP A 1 369 ? 3.759   25.251 45.049 1.00 21.21  ? 351  ASP A CB    1 
ATOM   2906 C  CG    . ASP A 1 369 ? 3.754   23.778 44.621 1.00 22.80  ? 351  ASP A CG    1 
ATOM   2907 O  OD1   . ASP A 1 369 ? 4.855   23.189 44.555 1.00 19.98  ? 351  ASP A OD1   1 
ATOM   2908 O  OD2   . ASP A 1 369 ? 2.670   23.159 44.413 1.00 23.76  ? 351  ASP A OD2   1 
ATOM   2909 N  N     . HIS A 1 370 ? 3.810   23.475 47.909 1.00 18.73  ? 352  HIS A N     1 
ATOM   2910 C  CA    . HIS A 1 370 ? 2.984   22.565 48.716 1.00 19.81  ? 352  HIS A CA    1 
ATOM   2911 C  C     . HIS A 1 370 ? 3.133   22.917 50.201 1.00 19.14  ? 352  HIS A C     1 
ATOM   2912 O  O     . HIS A 1 370 ? 4.162   22.616 50.830 1.00 18.42  ? 352  HIS A O     1 
ATOM   2913 C  CB    . HIS A 1 370 ? 3.359   21.100 48.472 1.00 18.75  ? 352  HIS A CB    1 
ATOM   2914 C  CG    . HIS A 1 370 ? 2.307   20.133 48.891 1.00 20.61  ? 352  HIS A CG    1 
ATOM   2915 N  ND1   . HIS A 1 370 ? 2.029   18.997 48.171 1.00 20.57  ? 352  HIS A ND1   1 
ATOM   2916 C  CD2   . HIS A 1 370 ? 1.413   20.156 49.915 1.00 18.83  ? 352  HIS A CD2   1 
ATOM   2917 C  CE1   . HIS A 1 370 ? 1.045   18.333 48.756 1.00 16.53  ? 352  HIS A CE1   1 
ATOM   2918 N  NE2   . HIS A 1 370 ? 0.642   19.030 49.799 1.00 21.60  ? 352  HIS A NE2   1 
ATOM   2919 N  N     . ILE A 1 371 ? 2.095   23.568 50.721 1.00 19.92  ? 353  ILE A N     1 
ATOM   2920 C  CA    . ILE A 1 371 ? 2.065   24.118 52.063 1.00 20.07  ? 353  ILE A CA    1 
ATOM   2921 C  C     . ILE A 1 371 ? 2.302   23.022 53.111 1.00 20.41  ? 353  ILE A C     1 
ATOM   2922 O  O     . ILE A 1 371 ? 2.905   23.285 54.164 1.00 20.42  ? 353  ILE A O     1 
ATOM   2923 C  CB    . ILE A 1 371 ? 0.734   24.889 52.324 1.00 20.19  ? 353  ILE A CB    1 
ATOM   2924 C  CG1   . ILE A 1 371 ? 0.716   25.633 53.683 1.00 21.21  ? 353  ILE A CG1   1 
ATOM   2925 C  CG2   . ILE A 1 371 ? -0.389  23.968 52.270 1.00 21.31  ? 353  ILE A CG2   1 
ATOM   2926 C  CD1   . ILE A 1 371 ? 1.924   26.524 53.936 1.00 24.47  ? 353  ILE A CD1   1 
ATOM   2927 N  N     . PHE A 1 372 ? 1.881   21.788 52.806 1.00 20.09  ? 354  PHE A N     1 
ATOM   2928 C  CA    . PHE A 1 372 ? 2.020   20.677 53.740 1.00 20.26  ? 354  PHE A CA    1 
ATOM   2929 C  C     . PHE A 1 372 ? 3.345   19.949 53.468 1.00 20.65  ? 354  PHE A C     1 
ATOM   2930 O  O     . PHE A 1 372 ? 4.265   19.955 54.317 1.00 21.87  ? 354  PHE A O     1 
ATOM   2931 C  CB    . PHE A 1 372 ? 0.816   19.743 53.636 1.00 20.10  ? 354  PHE A CB    1 
ATOM   2932 C  CG    . PHE A 1 372 ? 0.894   18.588 54.552 1.00 21.72  ? 354  PHE A CG    1 
ATOM   2933 C  CD1   . PHE A 1 372 ? 0.929   18.782 55.950 1.00 23.35  ? 354  PHE A CD1   1 
ATOM   2934 C  CD2   . PHE A 1 372 ? 0.972   17.298 54.050 1.00 22.56  ? 354  PHE A CD2   1 
ATOM   2935 C  CE1   . PHE A 1 372 ? 1.010   17.695 56.835 1.00 24.45  ? 354  PHE A CE1   1 
ATOM   2936 C  CE2   . PHE A 1 372 ? 1.066   16.205 54.938 1.00 23.29  ? 354  PHE A CE2   1 
ATOM   2937 C  CZ    . PHE A 1 372 ? 1.108   16.424 56.327 1.00 22.29  ? 354  PHE A CZ    1 
ATOM   2938 N  N     . GLY A 1 373 ? 3.493   19.470 52.237 1.00 20.15  ? 355  GLY A N     1 
ATOM   2939 C  CA    . GLY A 1 373 ? 4.555   18.534 51.856 1.00 19.88  ? 355  GLY A CA    1 
ATOM   2940 C  C     . GLY A 1 373 ? 5.900   19.178 51.637 1.00 20.76  ? 355  GLY A C     1 
ATOM   2941 O  O     . GLY A 1 373 ? 6.926   18.517 51.856 1.00 21.96  ? 355  GLY A O     1 
ATOM   2942 N  N     . ASP A 1 374 ? 5.917   20.449 51.236 1.00 20.02  ? 356  ASP A N     1 
ATOM   2943 C  CA    . ASP A 1 374 ? 7.175   21.195 51.094 1.00 19.85  ? 356  ASP A CA    1 
ATOM   2944 C  C     . ASP A 1 374 ? 7.499   22.018 52.339 1.00 19.46  ? 356  ASP A C     1 
ATOM   2945 O  O     . ASP A 1 374 ? 8.621   22.007 52.842 1.00 20.71  ? 356  ASP A O     1 
ATOM   2946 C  CB    . ASP A 1 374 ? 7.131   22.158 49.880 1.00 19.22  ? 356  ASP A CB    1 
ATOM   2947 C  CG    . ASP A 1 374 ? 7.005   21.437 48.534 1.00 21.92  ? 356  ASP A CG    1 
ATOM   2948 O  OD1   . ASP A 1 374 ? 7.585   20.348 48.375 1.00 22.64  ? 356  ASP A OD1   1 
ATOM   2949 O  OD2   . ASP A 1 374 ? 6.356   21.985 47.610 1.00 16.47  ? 356  ASP A OD2   1 
ATOM   2950 N  N     . ILE A 1 375 ? 6.503   22.730 52.853 1.00 18.66  ? 357  ILE A N     1 
ATOM   2951 C  CA    . ILE A 1 375 ? 6.720   23.882 53.739 1.00 17.98  ? 357  ILE A CA    1 
ATOM   2952 C  C     . ILE A 1 375 ? 6.556   23.521 55.213 1.00 17.75  ? 357  ILE A C     1 
ATOM   2953 O  O     . ILE A 1 375 ? 7.520   23.564 55.991 1.00 17.24  ? 357  ILE A O     1 
ATOM   2954 C  CB    . ILE A 1 375 ? 5.816   25.125 53.286 1.00 18.15  ? 357  ILE A CB    1 
ATOM   2955 C  CG1   . ILE A 1 375 ? 6.205   25.565 51.857 1.00 20.81  ? 357  ILE A CG1   1 
ATOM   2956 C  CG2   . ILE A 1 375 ? 5.889   26.293 54.306 1.00 16.78  ? 357  ILE A CG2   1 
ATOM   2957 C  CD1   . ILE A 1 375 ? 7.693   25.953 51.666 1.00 18.92  ? 357  ILE A CD1   1 
ATOM   2958 N  N     . LEU A 1 376 ? 5.340   23.151 55.604 1.00 18.24  ? 358  LEU A N     1 
ATOM   2959 C  CA    . LEU A 1 376 ? 5.074   22.717 56.961 1.00 18.81  ? 358  LEU A CA    1 
ATOM   2960 C  C     . LEU A 1 376 ? 6.028   21.572 57.415 1.00 20.16  ? 358  LEU A C     1 
ATOM   2961 O  O     . LEU A 1 376 ? 6.581   21.620 58.531 1.00 20.86  ? 358  LEU A O     1 
ATOM   2962 C  CB    . LEU A 1 376 ? 3.584   22.287 57.087 1.00 18.71  ? 358  LEU A CB    1 
ATOM   2963 C  CG    . LEU A 1 376 ? 3.098   21.854 58.468 1.00 19.07  ? 358  LEU A CG    1 
ATOM   2964 C  CD1   . LEU A 1 376 ? 1.568   22.039 58.579 1.00 18.73  ? 358  LEU A CD1   1 
ATOM   2965 C  CD2   . LEU A 1 376 ? 3.560   20.423 58.818 1.00 15.80  ? 358  LEU A CD2   1 
ATOM   2966 N  N     . LYS A 1 377 ? 6.216   20.550 56.566 1.00 19.18  ? 359  LYS A N     1 
ATOM   2967 C  CA    . LYS A 1 377 ? 7.038   19.396 56.949 1.00 19.78  ? 359  LYS A CA    1 
ATOM   2968 C  C     . LYS A 1 377 ? 8.534   19.695 56.999 1.00 19.97  ? 359  LYS A C     1 
ATOM   2969 O  O     . LYS A 1 377 ? 9.220   19.208 57.882 1.00 20.99  ? 359  LYS A O     1 
ATOM   2970 C  CB    . LYS A 1 377 ? 6.793   18.180 56.034 1.00 19.37  ? 359  LYS A CB    1 
ATOM   2971 C  CG    . LYS A 1 377 ? 5.477   17.480 56.334 1.00 20.82  ? 359  LYS A CG    1 
ATOM   2972 C  CD    . LYS A 1 377 ? 5.502   16.886 57.716 1.00 23.15  ? 359  LYS A CD    1 
ATOM   2973 C  CE    . LYS A 1 377 ? 4.256   16.086 57.927 1.00 28.02  ? 359  LYS A CE    1 
ATOM   2974 N  NZ    . LYS A 1 377 ? 4.194   15.433 59.263 1.00 32.17  ? 359  LYS A NZ    1 
ATOM   2975 N  N     . SER A 1 378 ? 9.049   20.492 56.076 1.00 19.31  ? 360  SER A N     1 
ATOM   2976 C  CA    . SER A 1 378 ? 10.474  20.862 56.172 1.00 19.28  ? 360  SER A CA    1 
ATOM   2977 C  C     . SER A 1 378 ? 10.735  21.754 57.375 1.00 20.09  ? 360  SER A C     1 
ATOM   2978 O  O     . SER A 1 378 ? 11.745  21.584 58.030 1.00 20.66  ? 360  SER A O     1 
ATOM   2979 C  CB    . SER A 1 378 ? 11.016  21.467 54.884 1.00 18.17  ? 360  SER A CB    1 
ATOM   2980 O  OG    . SER A 1 378 ? 10.491  22.735 54.636 1.00 19.34  ? 360  SER A OG    1 
ATOM   2981 N  N     . LYS A 1 379 ? 9.831   22.699 57.660 1.00 19.96  ? 361  LYS A N     1 
ATOM   2982 C  CA    . LYS A 1 379 ? 9.919   23.499 58.875 1.00 21.03  ? 361  LYS A CA    1 
ATOM   2983 C  C     . LYS A 1 379 ? 9.899   22.644 60.158 1.00 21.46  ? 361  LYS A C     1 
ATOM   2984 O  O     . LYS A 1 379 ? 10.879  22.648 60.948 1.00 20.55  ? 361  LYS A O     1 
ATOM   2985 C  CB    . LYS A 1 379 ? 8.826   24.595 58.898 1.00 21.07  ? 361  LYS A CB    1 
ATOM   2986 C  CG    . LYS A 1 379 ? 8.776   25.437 60.168 1.00 21.07  ? 361  LYS A CG    1 
ATOM   2987 C  CD    . LYS A 1 379 ? 10.052  26.288 60.377 1.00 20.16  ? 361  LYS A CD    1 
ATOM   2988 C  CE    . LYS A 1 379 ? 10.307  27.298 59.248 1.00 20.31  ? 361  LYS A CE    1 
ATOM   2989 N  NZ    . LYS A 1 379 ? 11.561  28.125 59.542 1.00 22.22  ? 361  LYS A NZ    1 
ATOM   2990 N  N     . LYS A 1 380 ? 8.820   21.879 60.364 1.00 21.40  ? 362  LYS A N     1 
ATOM   2991 C  CA    . LYS A 1 380 ? 8.686   21.143 61.616 1.00 22.44  ? 362  LYS A CA    1 
ATOM   2992 C  C     . LYS A 1 380 ? 9.719   20.038 61.775 1.00 22.73  ? 362  LYS A C     1 
ATOM   2993 O  O     . LYS A 1 380 ? 10.191  19.815 62.892 1.00 22.42  ? 362  LYS A O     1 
ATOM   2994 C  CB    . LYS A 1 380 ? 7.309   20.486 61.771 1.00 23.00  ? 362  LYS A CB    1 
ATOM   2995 C  CG    . LYS A 1 380 ? 6.159   21.432 61.959 1.00 24.51  ? 362  LYS A CG    1 
ATOM   2996 C  CD    . LYS A 1 380 ? 4.919   20.555 62.247 1.00 26.04  ? 362  LYS A CD    1 
ATOM   2997 C  CE    . LYS A 1 380 ? 3.703   21.352 62.572 1.00 30.43  ? 362  LYS A CE    1 
ATOM   2998 N  NZ    . LYS A 1 380 ? 3.813   22.078 63.915 1.00 34.11  ? 362  LYS A NZ    1 
ATOM   2999 N  N     . ARG A 1 381 ? 10.028  19.307 60.693 1.00 20.95  ? 363  ARG A N     1 
ATOM   3000 C  CA    . ARG A 1 381 ? 10.799  18.109 60.875 1.00 21.68  ? 363  ARG A CA    1 
ATOM   3001 C  C     . ARG A 1 381 ? 12.257  18.448 60.862 1.00 21.82  ? 363  ARG A C     1 
ATOM   3002 O  O     . ARG A 1 381 ? 13.022  17.720 61.463 1.00 20.67  ? 363  ARG A O     1 
ATOM   3003 C  CB    . ARG A 1 381 ? 10.543  17.036 59.809 1.00 22.15  ? 363  ARG A CB    1 
ATOM   3004 C  CG    . ARG A 1 381 ? 9.085   16.654 59.537 1.00 27.12  ? 363  ARG A CG    1 
ATOM   3005 C  CD    . ARG A 1 381 ? 8.543   15.676 60.476 1.00 35.96  ? 363  ARG A CD    1 
ATOM   3006 N  NE    . ARG A 1 381 ? 9.259   14.413 60.388 1.00 44.02  ? 363  ARG A NE    1 
ATOM   3007 C  CZ    . ARG A 1 381 ? 9.890   13.848 61.415 1.00 46.62  ? 363  ARG A CZ    1 
ATOM   3008 N  NH1   . ARG A 1 381 ? 9.891   14.451 62.608 1.00 48.20  ? 363  ARG A NH1   1 
ATOM   3009 N  NH2   . ARG A 1 381 ? 10.532  12.694 61.252 1.00 46.43  ? 363  ARG A NH2   1 
ATOM   3010 N  N     . GLN A 1 382 ? 12.651  19.528 60.161 1.00 21.49  ? 364  GLN A N     1 
ATOM   3011 C  CA    . GLN A 1 382 ? 14.097  19.777 59.925 1.00 22.11  ? 364  GLN A CA    1 
ATOM   3012 C  C     . GLN A 1 382 ? 14.586  21.181 60.204 1.00 22.17  ? 364  GLN A C     1 
ATOM   3013 O  O     . GLN A 1 382 ? 15.792  21.438 60.174 1.00 21.94  ? 364  GLN A O     1 
ATOM   3014 C  CB    . GLN A 1 382 ? 14.500  19.384 58.488 1.00 21.59  ? 364  GLN A CB    1 
ATOM   3015 C  CG    . GLN A 1 382 ? 14.226  17.902 58.148 1.00 23.00  ? 364  GLN A CG    1 
ATOM   3016 C  CD    . GLN A 1 382 ? 15.071  16.933 59.005 1.00 26.49  ? 364  GLN A CD    1 
ATOM   3017 O  OE1   . GLN A 1 382 ? 16.125  17.299 59.525 1.00 31.27  ? 364  GLN A OE1   1 
ATOM   3018 N  NE2   . GLN A 1 382 ? 14.604  15.714 59.155 1.00 27.90  ? 364  GLN A NE2   1 
ATOM   3019 N  N     . GLY A 1 383 ? 13.677  22.104 60.480 1.00 22.17  ? 365  GLY A N     1 
ATOM   3020 C  CA    . GLY A 1 383 ? 14.114  23.462 60.783 1.00 22.84  ? 365  GLY A CA    1 
ATOM   3021 C  C     . GLY A 1 383 ? 14.728  24.172 59.580 1.00 22.53  ? 365  GLY A C     1 
ATOM   3022 O  O     . GLY A 1 383 ? 15.620  25.028 59.739 1.00 23.78  ? 365  GLY A O     1 
ATOM   3023 N  N     . TRP A 1 384 ? 14.237  23.829 58.380 1.00 20.98  ? 366  TRP A N     1 
ATOM   3024 C  CA    . TRP A 1 384 ? 14.636  24.506 57.144 1.00 19.59  ? 366  TRP A CA    1 
ATOM   3025 C  C     . TRP A 1 384 ? 13.986  25.884 57.111 1.00 20.31  ? 366  TRP A C     1 
ATOM   3026 O  O     . TRP A 1 384 ? 12.910  26.083 57.699 1.00 20.37  ? 366  TRP A O     1 
ATOM   3027 C  CB    . TRP A 1 384 ? 14.236  23.704 55.908 1.00 19.42  ? 366  TRP A CB    1 
ATOM   3028 C  CG    . TRP A 1 384 ? 15.126  22.480 55.614 1.00 18.24  ? 366  TRP A CG    1 
ATOM   3029 C  CD1   . TRP A 1 384 ? 16.003  21.851 56.476 1.00 20.17  ? 366  TRP A CD1   1 
ATOM   3030 C  CD2   . TRP A 1 384 ? 15.163  21.728 54.392 1.00 19.95  ? 366  TRP A CD2   1 
ATOM   3031 N  NE1   . TRP A 1 384 ? 16.624  20.778 55.840 1.00 20.01  ? 366  TRP A NE1   1 
ATOM   3032 C  CE2   . TRP A 1 384 ? 16.137  20.694 54.557 1.00 19.83  ? 366  TRP A CE2   1 
ATOM   3033 C  CE3   . TRP A 1 384 ? 14.531  21.871 53.137 1.00 18.41  ? 366  TRP A CE3   1 
ATOM   3034 C  CZ2   . TRP A 1 384 ? 16.449  19.799 53.546 1.00 19.35  ? 366  TRP A CZ2   1 
ATOM   3035 C  CZ3   . TRP A 1 384 ? 14.836  20.954 52.133 1.00 19.25  ? 366  TRP A CZ3   1 
ATOM   3036 C  CH2   . TRP A 1 384 ? 15.789  19.940 52.337 1.00 19.50  ? 366  TRP A CH2   1 
ATOM   3037 N  N     . ARG A 1 385 ? 14.648  26.847 56.470 1.00 19.82  ? 367  ARG A N     1 
ATOM   3038 C  CA    . ARG A 1 385 ? 13.997  28.117 56.169 1.00 20.30  ? 367  ARG A CA    1 
ATOM   3039 C  C     . ARG A 1 385 ? 13.127  27.871 54.961 1.00 20.40  ? 367  ARG A C     1 
ATOM   3040 O  O     . ARG A 1 385 ? 13.465  27.036 54.112 1.00 20.29  ? 367  ARG A O     1 
ATOM   3041 C  CB    . ARG A 1 385 ? 15.004  29.225 55.907 1.00 21.35  ? 367  ARG A CB    1 
ATOM   3042 C  CG    . ARG A 1 385 ? 16.072  29.366 56.988 1.00 22.14  ? 367  ARG A CG    1 
ATOM   3043 C  CD    . ARG A 1 385 ? 15.483  29.492 58.397 1.00 22.95  ? 367  ARG A CD    1 
ATOM   3044 N  NE    . ARG A 1 385 ? 14.511  30.590 58.589 1.00 25.45  ? 367  ARG A NE    1 
ATOM   3045 C  CZ    . ARG A 1 385 ? 14.826  31.846 58.928 1.00 25.65  ? 367  ARG A CZ    1 
ATOM   3046 N  NH1   . ARG A 1 385 ? 16.108  32.198 59.092 1.00 25.69  ? 367  ARG A NH1   1 
ATOM   3047 N  NH2   . ARG A 1 385 ? 13.860  32.751 59.114 1.00 24.88  ? 367  ARG A NH2   1 
ATOM   3048 N  N     . THR A 1 386 ? 11.999  28.560 54.901 1.00 18.80  ? 368  THR A N     1 
ATOM   3049 C  CA    . THR A 1 386 ? 10.978  28.227 53.936 1.00 19.52  ? 368  THR A CA    1 
ATOM   3050 C  C     . THR A 1 386 ? 10.507  29.446 53.149 1.00 19.18  ? 368  THR A C     1 
ATOM   3051 O  O     . THR A 1 386 ? 10.450  30.550 53.678 1.00 19.25  ? 368  THR A O     1 
ATOM   3052 C  CB    . THR A 1 386 ? 9.757   27.619 54.621 1.00 18.47  ? 368  THR A CB    1 
ATOM   3053 O  OG1   . THR A 1 386 ? 9.365   28.479 55.689 1.00 22.09  ? 368  THR A OG1   1 
ATOM   3054 C  CG2   . THR A 1 386 ? 10.044  26.215 55.167 1.00 18.50  ? 368  THR A CG2   1 
ATOM   3055 N  N     . PHE A 1 387 ? 10.174  29.213 51.873 1.00 19.91  ? 369  PHE A N     1 
ATOM   3056 C  CA    . PHE A 1 387 ? 9.637   30.227 50.963 1.00 19.87  ? 369  PHE A CA    1 
ATOM   3057 C  C     . PHE A 1 387 ? 8.487   29.542 50.227 1.00 20.57  ? 369  PHE A C     1 
ATOM   3058 O  O     . PHE A 1 387 ? 8.686   28.586 49.470 1.00 20.49  ? 369  PHE A O     1 
ATOM   3059 C  CB    . PHE A 1 387 ? 10.748  30.703 49.976 1.00 20.71  ? 369  PHE A CB    1 
ATOM   3060 C  CG    . PHE A 1 387 ? 10.315  31.792 48.998 1.00 20.22  ? 369  PHE A CG    1 
ATOM   3061 C  CD1   . PHE A 1 387 ? 10.940  33.035 49.000 1.00 19.18  ? 369  PHE A CD1   1 
ATOM   3062 C  CD2   . PHE A 1 387 ? 9.324   31.561 48.053 1.00 21.68  ? 369  PHE A CD2   1 
ATOM   3063 C  CE1   . PHE A 1 387 ? 10.554  34.053 48.083 1.00 22.84  ? 369  PHE A CE1   1 
ATOM   3064 C  CE2   . PHE A 1 387 ? 8.946   32.566 47.125 1.00 22.21  ? 369  PHE A CE2   1 
ATOM   3065 C  CZ    . PHE A 1 387 ? 9.547   33.801 47.155 1.00 21.73  ? 369  PHE A CZ    1 
ATOM   3066 N  N     . LEU A 1 388 ? 7.269   30.029 50.454 1.00 20.62  ? 370  LEU A N     1 
ATOM   3067 C  CA    . LEU A 1 388 ? 6.106   29.502 49.778 1.00 19.87  ? 370  LEU A CA    1 
ATOM   3068 C  C     . LEU A 1 388 ? 5.758   30.338 48.560 1.00 20.59  ? 370  LEU A C     1 
ATOM   3069 O  O     . LEU A 1 388 ? 5.488   31.536 48.688 1.00 20.99  ? 370  LEU A O     1 
ATOM   3070 C  CB    . LEU A 1 388 ? 4.887   29.465 50.725 1.00 19.82  ? 370  LEU A CB    1 
ATOM   3071 C  CG    . LEU A 1 388 ? 3.607   28.856 50.131 1.00 20.71  ? 370  LEU A CG    1 
ATOM   3072 C  CD1   . LEU A 1 388 ? 3.704   27.287 49.869 1.00 17.88  ? 370  LEU A CD1   1 
ATOM   3073 C  CD2   . LEU A 1 388 ? 2.481   29.186 51.063 1.00 22.13  ? 370  LEU A CD2   1 
ATOM   3074 N  N     . VAL A 1 389 ? 5.673   29.672 47.396 1.00 20.30  ? 371  VAL A N     1 
ATOM   3075 C  CA    . VAL A 1 389 ? 5.203   30.270 46.145 1.00 20.89  ? 371  VAL A CA    1 
ATOM   3076 C  C     . VAL A 1 389 ? 3.698   30.094 46.126 1.00 20.94  ? 371  VAL A C     1 
ATOM   3077 O  O     . VAL A 1 389 ? 3.194   28.974 46.322 1.00 21.38  ? 371  VAL A O     1 
ATOM   3078 C  CB    . VAL A 1 389 ? 5.878   29.560 44.916 1.00 21.66  ? 371  VAL A CB    1 
ATOM   3079 C  CG1   . VAL A 1 389 ? 5.192   29.970 43.608 1.00 22.67  ? 371  VAL A CG1   1 
ATOM   3080 C  CG2   . VAL A 1 389 ? 7.385   29.909 44.862 1.00 20.12  ? 371  VAL A CG2   1 
ATOM   3081 N  N     . ILE A 1 390 ? 2.968   31.188 45.943 1.00 20.83  ? 372  ILE A N     1 
ATOM   3082 C  CA    . ILE A 1 390 ? 1.506   31.121 45.860 1.00 21.48  ? 372  ILE A CA    1 
ATOM   3083 C  C     . ILE A 1 390 ? 1.085   31.714 44.516 1.00 22.97  ? 372  ILE A C     1 
ATOM   3084 O  O     . ILE A 1 390 ? 0.848   32.921 44.454 1.00 24.64  ? 372  ILE A O     1 
ATOM   3085 C  CB    . ILE A 1 390 ? 0.792   31.923 47.017 1.00 21.30  ? 372  ILE A CB    1 
ATOM   3086 C  CG1   . ILE A 1 390 ? 1.401   31.598 48.398 1.00 21.19  ? 372  ILE A CG1   1 
ATOM   3087 C  CG2   . ILE A 1 390 ? -0.720  31.714 46.974 1.00 21.58  ? 372  ILE A CG2   1 
ATOM   3088 C  CD1   . ILE A 1 390 ? 0.707   32.281 49.626 1.00 18.64  ? 372  ILE A CD1   1 
ATOM   3089 N  N     . PRO A 1 391 ? 0.978   30.882 43.439 1.00 23.85  ? 373  PRO A N     1 
ATOM   3090 C  CA    . PRO A 1 391 ? 0.700   31.430 42.114 1.00 25.20  ? 373  PRO A CA    1 
ATOM   3091 C  C     . PRO A 1 391 ? -0.559  32.310 42.034 1.00 26.48  ? 373  PRO A C     1 
ATOM   3092 O  O     . PRO A 1 391 ? -0.534  33.306 41.353 1.00 26.64  ? 373  PRO A O     1 
ATOM   3093 C  CB    . PRO A 1 391 ? 0.566   30.175 41.233 1.00 25.53  ? 373  PRO A CB    1 
ATOM   3094 C  CG    . PRO A 1 391 ? 1.423   29.178 41.891 1.00 25.24  ? 373  PRO A CG    1 
ATOM   3095 C  CD    . PRO A 1 391 ? 1.149   29.413 43.368 1.00 23.74  ? 373  PRO A CD    1 
ATOM   3096 N  N     . GLU A 1 392 ? -1.628  31.976 42.754 1.00 26.74  ? 374  GLU A N     1 
ATOM   3097 C  CA    . GLU A 1 392 ? -2.864  32.773 42.708 1.00 28.20  ? 374  GLU A CA    1 
ATOM   3098 C  C     . GLU A 1 392 ? -2.748  34.153 43.318 1.00 29.42  ? 374  GLU A C     1 
ATOM   3099 O  O     . GLU A 1 392 ? -3.671  34.967 43.166 1.00 29.54  ? 374  GLU A O     1 
ATOM   3100 C  CB    . GLU A 1 392 ? -4.047  32.074 43.388 1.00 29.00  ? 374  GLU A CB    1 
ATOM   3101 C  CG    . GLU A 1 392 ? -4.292  30.663 42.984 1.00 28.97  ? 374  GLU A CG    1 
ATOM   3102 C  CD    . GLU A 1 392 ? -3.697  29.677 43.948 1.00 27.48  ? 374  GLU A CD    1 
ATOM   3103 O  OE1   . GLU A 1 392 ? -2.496  29.781 44.247 1.00 22.85  ? 374  GLU A OE1   1 
ATOM   3104 O  OE2   . GLU A 1 392 ? -4.460  28.791 44.391 1.00 29.27  ? 374  GLU A OE2   1 
ATOM   3105 N  N     . LEU A 1 393 ? -1.652  34.416 44.036 1.00 29.94  ? 375  LEU A N     1 
ATOM   3106 C  CA    . LEU A 1 393 ? -1.470  35.702 44.704 1.00 31.66  ? 375  LEU A CA    1 
ATOM   3107 C  C     . LEU A 1 393 ? -1.401  36.834 43.670 1.00 34.44  ? 375  LEU A C     1 
ATOM   3108 O  O     . LEU A 1 393 ? -1.810  37.969 43.945 1.00 35.94  ? 375  LEU A O     1 
ATOM   3109 C  CB    . LEU A 1 393 ? -0.206  35.678 45.573 1.00 30.27  ? 375  LEU A CB    1 
ATOM   3110 C  CG    . LEU A 1 393 ? 0.047   36.785 46.611 1.00 30.94  ? 375  LEU A CG    1 
ATOM   3111 C  CD1   . LEU A 1 393 ? -1.121  37.062 47.598 1.00 28.65  ? 375  LEU A CD1   1 
ATOM   3112 C  CD2   . LEU A 1 393 ? 1.310   36.465 47.346 1.00 28.51  ? 375  LEU A CD2   1 
ATOM   3113 N  N     . ALA A 1 394 ? -0.876  36.489 42.486 1.00 36.22  ? 376  ALA A N     1 
ATOM   3114 C  CA    . ALA A 1 394 ? -0.873  37.349 41.307 1.00 38.84  ? 376  ALA A CA    1 
ATOM   3115 C  C     . ALA A 1 394 ? -2.247  38.016 41.133 1.00 40.99  ? 376  ALA A C     1 
ATOM   3116 O  O     . ALA A 1 394 ? -2.355  39.236 41.243 1.00 42.71  ? 376  ALA A O     1 
ATOM   3117 C  CB    . ALA A 1 394 ? -0.468  36.514 40.080 1.00 39.31  ? 376  ALA A CB    1 
ATOM   3118 N  N     . GLN A 1 395 ? -3.298  37.214 40.935 1.00 42.01  ? 377  GLN A N     1 
ATOM   3119 C  CA    . GLN A 1 395 ? -4.676  37.717 40.820 1.00 43.25  ? 377  GLN A CA    1 
ATOM   3120 C  C     . GLN A 1 395 ? -5.281  38.227 42.142 1.00 42.34  ? 377  GLN A C     1 
ATOM   3121 O  O     . GLN A 1 395 ? -5.883  39.292 42.158 1.00 43.18  ? 377  GLN A O     1 
ATOM   3122 C  CB    . GLN A 1 395 ? -5.594  36.671 40.139 1.00 44.94  ? 377  GLN A CB    1 
ATOM   3123 C  CG    . GLN A 1 395 ? -6.987  37.172 39.665 1.00 47.62  ? 377  GLN A CG    1 
ATOM   3124 C  CD    . GLN A 1 395 ? -6.965  38.462 38.803 1.00 53.16  ? 377  GLN A CD    1 
ATOM   3125 O  OE1   . GLN A 1 395 ? -5.908  38.943 38.357 1.00 53.65  ? 377  GLN A OE1   1 
ATOM   3126 N  NE2   . GLN A 1 395 ? -8.154  39.028 38.577 1.00 56.56  ? 377  GLN A NE2   1 
ATOM   3127 N  N     . GLU A 1 396 ? -5.116  37.471 43.230 1.00 40.06  ? 378  GLU A N     1 
ATOM   3128 C  CA    . GLU A 1 396 ? -5.618  37.840 44.572 1.00 39.06  ? 378  GLU A CA    1 
ATOM   3129 C  C     . GLU A 1 396 ? -5.214  39.253 45.052 1.00 39.32  ? 378  GLU A C     1 
ATOM   3130 O  O     . GLU A 1 396 ? -6.017  39.924 45.703 1.00 39.84  ? 378  GLU A O     1 
ATOM   3131 C  CB    . GLU A 1 396 ? -5.186  36.802 45.625 1.00 37.33  ? 378  GLU A CB    1 
ATOM   3132 C  CG    . GLU A 1 396 ? -5.861  35.416 45.502 1.00 36.15  ? 378  GLU A CG    1 
ATOM   3133 C  CD    . GLU A 1 396 ? -6.956  35.139 46.551 1.00 35.12  ? 378  GLU A CD    1 
ATOM   3134 O  OE1   . GLU A 1 396 ? -7.152  35.941 47.482 1.00 34.04  ? 378  GLU A OE1   1 
ATOM   3135 O  OE2   . GLU A 1 396 ? -7.619  34.098 46.454 1.00 31.72  ? 378  GLU A OE2   1 
ATOM   3136 N  N     . LEU A 1 397 ? -3.981  39.689 44.758 1.00 38.15  ? 379  LEU A N     1 
ATOM   3137 C  CA    . LEU A 1 397 ? -3.562  41.072 45.035 1.00 38.92  ? 379  LEU A CA    1 
ATOM   3138 C  C     . LEU A 1 397 ? -4.385  42.070 44.222 1.00 41.32  ? 379  LEU A C     1 
ATOM   3139 O  O     . LEU A 1 397 ? -4.875  43.060 44.768 1.00 41.61  ? 379  LEU A O     1 
ATOM   3140 C  CB    . LEU A 1 397 ? -2.079  41.276 44.752 1.00 37.80  ? 379  LEU A CB    1 
ATOM   3141 C  CG    . LEU A 1 397 ? -1.206  40.657 45.828 1.00 36.22  ? 379  LEU A CG    1 
ATOM   3142 C  CD1   . LEU A 1 397 ? 0.203   40.332 45.308 1.00 31.75  ? 379  LEU A CD1   1 
ATOM   3143 C  CD2   . LEU A 1 397 ? -1.226  41.564 47.069 1.00 36.59  ? 379  LEU A CD2   1 
ATOM   3144 N  N     . HIS A 1 398 ? -4.586  41.790 42.935 1.00 42.79  ? 380  HIS A N     1 
ATOM   3145 C  CA    . HIS A 1 398 ? -5.417  42.691 42.141 1.00 45.93  ? 380  HIS A CA    1 
ATOM   3146 C  C     . HIS A 1 398 ? -6.796  42.867 42.758 1.00 45.62  ? 380  HIS A C     1 
ATOM   3147 O  O     . HIS A 1 398 ? -7.206  43.987 42.950 1.00 45.91  ? 380  HIS A O     1 
ATOM   3148 C  CB    . HIS A 1 398 ? -5.482  42.314 40.653 1.00 48.08  ? 380  HIS A CB    1 
ATOM   3149 C  CG    . HIS A 1 398 ? -4.239  42.690 39.890 1.00 53.71  ? 380  HIS A CG    1 
ATOM   3150 N  ND1   . HIS A 1 398 ? -4.061  43.935 39.312 1.00 58.59  ? 380  HIS A ND1   1 
ATOM   3151 C  CD2   . HIS A 1 398 ? -3.100  41.990 39.632 1.00 55.79  ? 380  HIS A CD2   1 
ATOM   3152 C  CE1   . HIS A 1 398 ? -2.873  43.979 38.724 1.00 59.98  ? 380  HIS A CE1   1 
ATOM   3153 N  NE2   . HIS A 1 398 ? -2.270  42.813 38.903 1.00 57.95  ? 380  HIS A NE2   1 
ATOM   3154 N  N     . VAL A 1 399 ? -7.483  41.772 43.096 1.00 44.31  ? 381  VAL A N     1 
ATOM   3155 C  CA    . VAL A 1 399 ? -8.795  41.847 43.765 1.00 44.11  ? 381  VAL A CA    1 
ATOM   3156 C  C     . VAL A 1 399 ? -8.733  42.532 45.144 1.00 43.96  ? 381  VAL A C     1 
ATOM   3157 O  O     . VAL A 1 399 ? -9.615  43.344 45.479 1.00 45.28  ? 381  VAL A O     1 
ATOM   3158 C  CB    . VAL A 1 399 ? -9.500  40.468 43.865 1.00 43.51  ? 381  VAL A CB    1 
ATOM   3159 C  CG1   . VAL A 1 399 ? -10.946 40.630 44.271 1.00 43.48  ? 381  VAL A CG1   1 
ATOM   3160 C  CG2   . VAL A 1 399 ? -9.447  39.741 42.539 1.00 44.02  ? 381  VAL A CG2   1 
ATOM   3161 N  N     . TRP A 1 400 ? -7.692  42.230 45.925 1.00 42.73  ? 382  TRP A N     1 
ATOM   3162 C  CA    . TRP A 1 400 ? -7.489  42.843 47.250 1.00 42.55  ? 382  TRP A CA    1 
ATOM   3163 C  C     . TRP A 1 400 ? -7.358  44.363 47.120 1.00 44.61  ? 382  TRP A C     1 
ATOM   3164 O  O     . TRP A 1 400 ? -8.005  45.123 47.861 1.00 45.49  ? 382  TRP A O     1 
ATOM   3165 C  CB    . TRP A 1 400 ? -6.255  42.255 47.972 1.00 40.21  ? 382  TRP A CB    1 
ATOM   3166 C  CG    . TRP A 1 400 ? -6.066  42.832 49.367 1.00 39.33  ? 382  TRP A CG    1 
ATOM   3167 C  CD1   . TRP A 1 400 ? -5.156  43.782 49.744 1.00 37.75  ? 382  TRP A CD1   1 
ATOM   3168 C  CD2   . TRP A 1 400 ? -6.833  42.524 50.544 1.00 38.88  ? 382  TRP A CD2   1 
ATOM   3169 N  NE1   . TRP A 1 400 ? -5.302  44.076 51.073 1.00 37.05  ? 382  TRP A NE1   1 
ATOM   3170 C  CE2   . TRP A 1 400 ? -6.321  43.322 51.594 1.00 37.93  ? 382  TRP A CE2   1 
ATOM   3171 C  CE3   . TRP A 1 400 ? -7.899  41.645 50.819 1.00 40.86  ? 382  TRP A CE3   1 
ATOM   3172 C  CZ2   . TRP A 1 400 ? -6.836  43.277 52.893 1.00 36.74  ? 382  TRP A CZ2   1 
ATOM   3173 C  CZ3   . TRP A 1 400 ? -8.417  41.602 52.120 1.00 38.89  ? 382  TRP A CZ3   1 
ATOM   3174 C  CH2   . TRP A 1 400 ? -7.882  42.417 53.135 1.00 39.66  ? 382  TRP A CH2   1 
ATOM   3175 N  N     . THR A 1 401 ? -6.531  44.796 46.168 1.00 45.70  ? 383  THR A N     1 
ATOM   3176 C  CA    . THR A 1 401 ? -6.314  46.224 45.928 1.00 47.42  ? 383  THR A CA    1 
ATOM   3177 C  C     . THR A 1 401 ? -7.585  46.928 45.417 1.00 49.05  ? 383  THR A C     1 
ATOM   3178 O  O     . THR A 1 401 ? -8.100  47.806 46.108 1.00 50.31  ? 383  THR A O     1 
ATOM   3179 C  CB    . THR A 1 401 ? -4.990  46.547 45.094 1.00 47.69  ? 383  THR A CB    1 
ATOM   3180 O  OG1   . THR A 1 401 ? -4.718  47.952 45.126 1.00 50.36  ? 383  THR A OG1   1 
ATOM   3181 C  CG2   . THR A 1 401 ? -5.072  46.134 43.622 1.00 49.88  ? 383  THR A CG2   1 
ATOM   3182 N  N     . ASP A 1 402 ? -8.125  46.523 44.266 1.00 96.96  ? 384  ASP A N     1 
ATOM   3183 C  CA    . ASP A 1 402 ? -9.245  47.265 43.673 1.00 103.00 ? 384  ASP A CA    1 
ATOM   3184 C  C     . ASP A 1 402 ? -10.620 46.995 44.299 1.00 97.42  ? 384  ASP A C     1 
ATOM   3185 O  O     . ASP A 1 402 ? -11.609 47.615 43.912 1.00 103.76 ? 384  ASP A O     1 
ATOM   3186 C  CB    . ASP A 1 402 ? -9.265  47.155 42.134 1.00 111.20 ? 384  ASP A CB    1 
ATOM   3187 C  CG    . ASP A 1 402 ? -9.750  45.802 41.635 1.00 106.58 ? 384  ASP A CG    1 
ATOM   3188 O  OD1   . ASP A 1 402 ? -10.882 45.398 41.983 1.00 103.30 ? 384  ASP A OD1   1 
ATOM   3189 O  OD2   . ASP A 1 402 ? -9.005  45.153 40.864 1.00 108.26 ? 384  ASP A OD2   1 
ATOM   3190 N  N     . LYS A 1 403 ? -10.675 46.090 45.271 1.00 86.94  ? 385  LYS A N     1 
ATOM   3191 C  CA    . LYS A 1 403 ? -11.913 45.849 46.023 1.00 82.54  ? 385  LYS A CA    1 
ATOM   3192 C  C     . LYS A 1 403 ? -11.746 46.118 47.528 1.00 77.78  ? 385  LYS A C     1 
ATOM   3193 O  O     . LYS A 1 403 ? -12.569 45.684 48.329 1.00 73.41  ? 385  LYS A O     1 
ATOM   3194 C  CB    . LYS A 1 403 ? -12.466 44.424 45.774 1.00 77.88  ? 385  LYS A CB    1 
ATOM   3195 C  CG    . LYS A 1 403 ? -12.996 44.134 44.350 1.00 83.21  ? 385  LYS A CG    1 
ATOM   3196 C  CD    . LYS A 1 403 ? -14.311 44.863 44.037 1.00 89.94  ? 385  LYS A CD    1 
ATOM   3197 C  CE    . LYS A 1 403 ? -14.662 44.744 42.551 1.00 98.73  ? 385  LYS A CE    1 
ATOM   3198 N  NZ    . LYS A 1 403 ? -15.780 45.644 42.136 1.00 107.58 ? 385  LYS A NZ    1 
ATOM   3199 N  N     . SER A 1 404 ? -10.693 46.854 47.896 1.00 79.84  ? 386  SER A N     1 
ATOM   3200 C  CA    . SER A 1 404 ? -10.348 47.137 49.307 1.00 77.42  ? 386  SER A CA    1 
ATOM   3201 C  C     . SER A 1 404 ? -11.390 47.966 50.073 1.00 79.74  ? 386  SER A C     1 
ATOM   3202 O  O     . SER A 1 404 ? -11.452 47.909 51.306 1.00 77.11  ? 386  SER A O     1 
ATOM   3203 C  CB    . SER A 1 404 ? -8.962  47.799 49.410 1.00 81.71  ? 386  SER A CB    1 
ATOM   3204 O  OG    . SER A 1 404 ? -8.932  49.030 48.707 1.00 89.81  ? 386  SER A OG    1 
ATOM   3205 N  N     . SER A 1 405 ? -12.198 48.731 49.339 1.00 85.84  ? 387  SER A N     1 
ATOM   3206 C  CA    . SER A 1 405 ? -13.293 49.505 49.935 1.00 89.54  ? 387  SER A CA    1 
ATOM   3207 C  C     . SER A 1 405 ? -14.405 48.620 50.509 1.00 83.27  ? 387  SER A C     1 
ATOM   3208 O  O     . SER A 1 405 ? -15.066 49.005 51.468 1.00 84.31  ? 387  SER A O     1 
ATOM   3209 C  CB    . SER A 1 405 ? -13.854 50.532 48.938 1.00 100.34 ? 387  SER A CB    1 
ATOM   3210 O  OG    . SER A 1 405 ? -13.808 50.032 47.611 1.00 102.49 ? 387  SER A OG    1 
ATOM   3211 N  N     . LEU A 1 406 ? -14.609 47.445 49.916 1.00 78.30  ? 388  LEU A N     1 
ATOM   3212 C  CA    . LEU A 1 406 ? -15.496 46.412 50.482 1.00 73.38  ? 388  LEU A CA    1 
ATOM   3213 C  C     . LEU A 1 406 ? -14.975 45.862 51.823 1.00 67.79  ? 388  LEU A C     1 
ATOM   3214 O  O     . LEU A 1 406 ? -15.731 45.777 52.795 1.00 67.05  ? 388  LEU A O     1 
ATOM   3215 C  CB    . LEU A 1 406 ? -15.704 45.239 49.499 1.00 71.51  ? 388  LEU A CB    1 
ATOM   3216 C  CG    . LEU A 1 406 ? -16.693 45.339 48.328 1.00 77.86  ? 388  LEU A CG    1 
ATOM   3217 C  CD1   . LEU A 1 406 ? -16.364 44.289 47.259 1.00 76.98  ? 388  LEU A CD1   1 
ATOM   3218 C  CD2   . LEU A 1 406 ? -18.149 45.222 48.792 1.00 79.85  ? 388  LEU A CD2   1 
ATOM   3219 N  N     . PHE A 1 407 ? -13.696 45.472 51.856 1.00 64.91  ? 389  PHE A N     1 
ATOM   3220 C  CA    . PHE A 1 407 ? -13.075 44.946 53.076 1.00 62.13  ? 389  PHE A CA    1 
ATOM   3221 C  C     . PHE A 1 407 ? -13.047 46.019 54.161 1.00 65.62  ? 389  PHE A C     1 
ATOM   3222 O  O     . PHE A 1 407 ? -13.354 45.746 55.329 1.00 64.74  ? 389  PHE A O     1 
ATOM   3223 C  CB    . PHE A 1 407 ? -11.658 44.420 52.801 1.00 60.24  ? 389  PHE A CB    1 
ATOM   3224 C  CG    . PHE A 1 407 ? -10.986 43.802 54.015 1.00 60.11  ? 389  PHE A CG    1 
ATOM   3225 C  CD1   . PHE A 1 407 ? -11.263 42.486 54.397 1.00 58.09  ? 389  PHE A CD1   1 
ATOM   3226 C  CD2   . PHE A 1 407 ? -10.064 44.528 54.767 1.00 63.38  ? 389  PHE A CD2   1 
ATOM   3227 C  CE1   . PHE A 1 407 ? -10.643 41.927 55.503 1.00 59.56  ? 389  PHE A CE1   1 
ATOM   3228 C  CE2   . PHE A 1 407 ? -9.439  43.960 55.871 1.00 63.95  ? 389  PHE A CE2   1 
ATOM   3229 C  CZ    . PHE A 1 407 ? -9.739  42.662 56.240 1.00 62.62  ? 389  PHE A CZ    1 
ATOM   3230 N  N     . GLU A 1 408 ? -12.686 47.239 53.759 1.00 70.71  ? 390  GLU A N     1 
ATOM   3231 C  CA    . GLU A 1 408 ? -12.634 48.354 54.682 1.00 76.45  ? 390  GLU A CA    1 
ATOM   3232 C  C     . GLU A 1 408 ? -14.004 48.635 55.292 1.00 77.81  ? 390  GLU A C     1 
ATOM   3233 O  O     . GLU A 1 408 ? -14.080 48.979 56.473 1.00 80.63  ? 390  GLU A O     1 
ATOM   3234 C  CB    . GLU A 1 408 ? -12.055 49.602 54.017 1.00 83.33  ? 390  GLU A CB    1 
ATOM   3235 C  CG    . GLU A 1 408 ? -10.544 49.555 53.838 1.00 84.97  ? 390  GLU A CG    1 
ATOM   3236 C  CD    . GLU A 1 408 ? -10.008 50.731 53.027 1.00 93.95  ? 390  GLU A CD    1 
ATOM   3237 O  OE1   . GLU A 1 408 ? -10.088 51.895 53.499 1.00 103.09 ? 390  GLU A OE1   1 
ATOM   3238 O  OE2   . GLU A 1 408 ? -9.492  50.483 51.912 1.00 96.44  ? 390  GLU A OE2   1 
ATOM   3239 N  N     . GLU A 1 409 ? -15.074 48.473 54.504 1.00 77.22  ? 391  GLU A N     1 
ATOM   3240 C  CA    . GLU A 1 409 ? -16.444 48.645 55.018 1.00 79.16  ? 391  GLU A CA    1 
ATOM   3241 C  C     . GLU A 1 409 ? -16.726 47.590 56.083 1.00 74.66  ? 391  GLU A C     1 
ATOM   3242 O  O     . GLU A 1 409 ? -17.278 47.886 57.146 1.00 77.38  ? 391  GLU A O     1 
ATOM   3243 C  CB    . GLU A 1 409 ? -17.515 48.581 53.907 1.00 81.09  ? 391  GLU A CB    1 
ATOM   3244 C  CG    . GLU A 1 409 ? -18.976 48.617 54.460 1.00 84.29  ? 391  GLU A CG    1 
ATOM   3245 C  CD    . GLU A 1 409 ? -20.083 48.710 53.400 1.00 89.19  ? 391  GLU A CD    1 
ATOM   3246 O  OE1   . GLU A 1 409 ? -19.779 48.729 52.187 1.00 92.12  ? 391  GLU A OE1   1 
ATOM   3247 O  OE2   . GLU A 1 409 ? -21.274 48.771 53.795 1.00 92.82  ? 391  GLU A OE2   1 
ATOM   3248 N  N     . LEU A 1 410 ? -16.331 46.357 55.777 1.00 69.27  ? 392  LEU A N     1 
ATOM   3249 C  CA    . LEU A 1 410 ? -16.465 45.223 56.687 1.00 66.53  ? 392  LEU A CA    1 
ATOM   3250 C  C     . LEU A 1 410 ? -15.705 45.453 58.008 1.00 68.27  ? 392  LEU A C     1 
ATOM   3251 O  O     . LEU A 1 410 ? -16.246 45.233 59.094 1.00 70.48  ? 392  LEU A O     1 
ATOM   3252 C  CB    . LEU A 1 410 ? -15.982 43.949 55.978 1.00 62.83  ? 392  LEU A CB    1 
ATOM   3253 C  CG    . LEU A 1 410 ? -16.280 42.591 56.593 1.00 62.12  ? 392  LEU A CG    1 
ATOM   3254 C  CD1   . LEU A 1 410 ? -17.777 42.332 56.548 1.00 63.98  ? 392  LEU A CD1   1 
ATOM   3255 C  CD2   . LEU A 1 410 ? -15.509 41.538 55.811 1.00 59.39  ? 392  LEU A CD2   1 
ATOM   3256 N  N     . GLN A 1 411 ? -14.458 45.906 57.899 1.00 68.06  ? 393  GLN A N     1 
ATOM   3257 C  CA    . GLN A 1 411 ? -13.655 46.236 59.069 1.00 71.93  ? 393  GLN A CA    1 
ATOM   3258 C  C     . GLN A 1 411 ? -14.294 47.329 59.938 1.00 77.32  ? 393  GLN A C     1 
ATOM   3259 O  O     . GLN A 1 411 ? -14.194 47.277 61.173 1.00 81.27  ? 393  GLN A O     1 
ATOM   3260 C  CB    . GLN A 1 411 ? -12.242 46.631 58.652 1.00 72.51  ? 393  GLN A CB    1 
ATOM   3261 C  CG    . GLN A 1 411 ? -11.323 45.441 58.471 1.00 70.69  ? 393  GLN A CG    1 
ATOM   3262 C  CD    . GLN A 1 411 ? -9.854  45.807 58.645 1.00 74.56  ? 393  GLN A CD    1 
ATOM   3263 O  OE1   . GLN A 1 411 ? -9.453  46.939 58.370 1.00 75.66  ? 393  GLN A OE1   1 
ATOM   3264 N  NE2   . GLN A 1 411 ? -9.043  44.841 59.099 1.00 75.76  ? 393  GLN A NE2   1 
ATOM   3265 N  N     . SER A 1 412 ? -14.950 48.297 59.284 1.00 78.57  ? 394  SER A N     1 
ATOM   3266 C  CA    . SER A 1 412 ? -15.676 49.383 59.961 1.00 84.68  ? 394  SER A CA    1 
ATOM   3267 C  C     . SER A 1 412 ? -16.826 48.857 60.829 1.00 85.22  ? 394  SER A C     1 
ATOM   3268 O  O     . SER A 1 412 ? -16.875 49.126 62.037 1.00 90.15  ? 394  SER A O     1 
ATOM   3269 C  CB    . SER A 1 412 ? -16.205 50.406 58.944 1.00 87.84  ? 394  SER A CB    1 
ATOM   3270 O  OG    . SER A 1 412 ? -15.185 51.286 58.508 1.00 91.62  ? 394  SER A OG    1 
ATOM   3271 N  N     . LEU A 1 413 ? -17.724 48.090 60.205 1.00 81.22  ? 395  LEU A N     1 
ATOM   3272 C  CA    . LEU A 1 413 ? -18.897 47.497 60.865 1.00 82.57  ? 395  LEU A CA    1 
ATOM   3273 C  C     . LEU A 1 413 ? -18.583 46.658 62.119 1.00 84.34  ? 395  LEU A C     1 
ATOM   3274 O  O     . LEU A 1 413 ? -19.423 46.547 63.014 1.00 88.88  ? 395  LEU A O     1 
ATOM   3275 C  CB    . LEU A 1 413 ? -19.706 46.654 59.864 1.00 78.85  ? 395  LEU A CB    1 
ATOM   3276 C  CG    . LEU A 1 413 ? -20.233 47.313 58.580 1.00 79.36  ? 395  LEU A CG    1 
ATOM   3277 C  CD1   . LEU A 1 413 ? -20.426 46.292 57.467 1.00 75.37  ? 395  LEU A CD1   1 
ATOM   3278 C  CD2   . LEU A 1 413 ? -21.522 48.089 58.816 1.00 85.33  ? 395  LEU A CD2   1 
ATOM   3279 N  N     . ASP A 1 414 ? -17.381 46.082 62.186 1.00 82.29  ? 396  ASP A N     1 
ATOM   3280 C  CA    . ASP A 1 414 ? -17.019 45.151 63.264 1.00 85.77  ? 396  ASP A CA    1 
ATOM   3281 C  C     . ASP A 1 414 ? -16.592 45.849 64.558 1.00 92.84  ? 396  ASP A C     1 
ATOM   3282 O  O     . ASP A 1 414 ? -16.938 47.005 64.800 1.00 95.81  ? 396  ASP A O     1 
ATOM   3283 C  CB    . ASP A 1 414 ? -15.932 44.164 62.783 1.00 82.55  ? 396  ASP A CB    1 
ATOM   3284 C  CG    . ASP A 1 414 ? -16.464 43.117 61.774 1.00 78.22  ? 396  ASP A CG    1 
ATOM   3285 O  OD1   . ASP A 1 414 ? -17.570 42.561 61.982 1.00 81.35  ? 396  ASP A OD1   1 
ATOM   3286 O  OD2   . ASP A 1 414 ? -15.762 42.823 60.778 1.00 73.43  ? 396  ASP A OD2   1 
ATOM   3287 N  N     . GLN A 1 438 ? -25.339 43.682 61.208 1.00 103.12 ? 420  GLN A N     1 
ATOM   3288 C  CA    . GLN A 1 438 ? -24.958 42.292 61.437 1.00 102.90 ? 420  GLN A CA    1 
ATOM   3289 C  C     . GLN A 1 438 ? -25.255 41.444 60.209 1.00 101.12 ? 420  GLN A C     1 
ATOM   3290 O  O     . GLN A 1 438 ? -24.453 40.591 59.821 1.00 97.70  ? 420  GLN A O     1 
ATOM   3291 C  CB    . GLN A 1 438 ? -25.686 41.717 62.654 1.00 111.26 ? 420  GLN A CB    1 
ATOM   3292 C  CG    . GLN A 1 438 ? -25.188 40.338 63.102 1.00 113.96 ? 420  GLN A CG    1 
ATOM   3293 C  CD    . GLN A 1 438 ? -26.244 39.527 63.851 1.00 124.95 ? 420  GLN A CD    1 
ATOM   3294 O  OE1   . GLN A 1 438 ? -27.234 40.068 64.355 1.00 130.25 ? 420  GLN A OE1   1 
ATOM   3295 N  NE2   . GLN A 1 438 ? -26.032 38.216 63.925 1.00 129.30 ? 420  GLN A NE2   1 
ATOM   3296 N  N     . ARG A 1 439 ? -26.421 41.666 59.614 1.00 104.90 ? 421  ARG A N     1 
ATOM   3297 C  CA    . ARG A 1 439 ? -26.762 41.018 58.353 1.00 104.76 ? 421  ARG A CA    1 
ATOM   3298 C  C     . ARG A 1 439 ? -26.269 41.881 57.193 1.00 100.05 ? 421  ARG A C     1 
ATOM   3299 O  O     . ARG A 1 439 ? -26.251 41.454 56.033 1.00 99.03  ? 421  ARG A O     1 
ATOM   3300 C  CB    . ARG A 1 439 ? -28.257 40.700 58.287 1.00 113.25 ? 421  ARG A CB    1 
ATOM   3301 C  CG    . ARG A 1 439 ? -28.627 39.509 59.182 1.00 119.44 ? 421  ARG A CG    1 
ATOM   3302 C  CD    . ARG A 1 439 ? -30.050 39.563 59.711 1.00 129.32 ? 421  ARG A CD    1 
ATOM   3303 N  NE    . ARG A 1 439 ? -30.427 40.898 60.173 1.00 130.40 ? 421  ARG A NE    1 
ATOM   3304 C  CZ    . ARG A 1 439 ? -31.368 41.651 59.604 1.00 134.50 ? 421  ARG A CZ    1 
ATOM   3305 N  NH1   . ARG A 1 439 ? -32.041 41.204 58.551 1.00 137.90 ? 421  ARG A NH1   1 
ATOM   3306 N  NH2   . ARG A 1 439 ? -31.640 42.854 60.089 1.00 136.32 ? 421  ARG A NH2   1 
ATOM   3307 N  N     . ARG A 1 440 ? -25.847 43.095 57.538 1.00 98.57  ? 422  ARG A N     1 
ATOM   3308 C  CA    . ARG A 1 440 ? -25.048 43.929 56.652 1.00 95.03  ? 422  ARG A CA    1 
ATOM   3309 C  C     . ARG A 1 440 ? -23.643 43.309 56.487 1.00 88.26  ? 422  ARG A C     1 
ATOM   3310 O  O     . ARG A 1 440 ? -23.101 43.269 55.375 1.00 84.99  ? 422  ARG A O     1 
ATOM   3311 C  CB    . ARG A 1 440 ? -24.974 45.363 57.203 1.00 97.21  ? 422  ARG A CB    1 
ATOM   3312 C  CG    . ARG A 1 440 ? -24.182 46.345 56.342 1.00 95.91  ? 422  ARG A CG    1 
ATOM   3313 C  CD    . ARG A 1 440 ? -24.929 46.722 55.080 1.00 100.84 ? 422  ARG A CD    1 
ATOM   3314 N  NE    . ARG A 1 440 ? -24.017 46.901 53.948 1.00 98.25  ? 422  ARG A NE    1 
ATOM   3315 C  CZ    . ARG A 1 440 ? -24.404 46.908 52.669 1.00 103.47 ? 422  ARG A CZ    1 
ATOM   3316 N  NH1   . ARG A 1 440 ? -25.695 46.749 52.354 1.00 110.04 ? 422  ARG A NH1   1 
ATOM   3317 N  NH2   . ARG A 1 440 ? -23.506 47.074 51.699 1.00 101.59 ? 422  ARG A NH2   1 
ATOM   3318 N  N     . ILE A 1 441 ? -23.080 42.833 57.605 1.00 87.42  ? 423  ILE A N     1 
ATOM   3319 C  CA    . ILE A 1 441 ? -21.823 42.061 57.633 1.00 83.37  ? 423  ILE A CA    1 
ATOM   3320 C  C     . ILE A 1 441 ? -21.927 40.807 56.748 1.00 83.57  ? 423  ILE A C     1 
ATOM   3321 O  O     . ILE A 1 441 ? -21.033 40.544 55.945 1.00 79.47  ? 423  ILE A O     1 
ATOM   3322 C  CB    . ILE A 1 441 ? -21.406 41.668 59.086 1.00 85.35  ? 423  ILE A CB    1 
ATOM   3323 C  CG1   . ILE A 1 441 ? -21.031 42.909 59.906 1.00 86.01  ? 423  ILE A CG1   1 
ATOM   3324 C  CG2   . ILE A 1 441 ? -20.255 40.655 59.084 1.00 82.94  ? 423  ILE A CG2   1 
ATOM   3325 C  CD1   . ILE A 1 441 ? -20.818 42.639 61.395 1.00 90.72  ? 423  ILE A CD1   1 
ATOM   3326 N  N     . LYS A 1 442 ? -23.022 40.055 56.881 1.00 89.67  ? 424  LYS A N     1 
ATOM   3327 C  CA    . LYS A 1 442 ? -23.259 38.878 56.035 1.00 92.28  ? 424  LYS A CA    1 
ATOM   3328 C  C     . LYS A 1 442 ? -23.325 39.213 54.535 1.00 91.39  ? 424  LYS A C     1 
ATOM   3329 O  O     . LYS A 1 442 ? -22.688 38.530 53.724 1.00 89.46  ? 424  LYS A O     1 
ATOM   3330 C  CB    . LYS A 1 442 ? -24.484 38.077 56.500 1.00 99.95  ? 424  LYS A CB    1 
ATOM   3331 C  CG    . LYS A 1 442 ? -24.134 36.862 57.377 1.00 103.84 ? 424  LYS A CG    1 
ATOM   3332 C  CD    . LYS A 1 442 ? -25.359 36.234 58.065 1.00 114.14 ? 424  LYS A CD    1 
ATOM   3333 C  CE    . LYS A 1 442 ? -26.347 35.571 57.081 1.00 120.29 ? 424  LYS A CE    1 
ATOM   3334 N  NZ    . LYS A 1 442 ? -25.920 34.228 56.558 1.00 123.08 ? 424  LYS A NZ    1 
ATOM   3335 N  N     . LYS A 1 443 ? -24.050 40.277 54.176 1.00 56.01  ? 425  LYS A N     1 
ATOM   3336 C  CA    . LYS A 1 443 ? -24.177 40.692 52.764 1.00 57.67  ? 425  LYS A CA    1 
ATOM   3337 C  C     . LYS A 1 443 ? -22.829 41.091 52.112 1.00 56.55  ? 425  LYS A C     1 
ATOM   3338 O  O     . LYS A 1 443 ? -22.540 40.711 50.962 1.00 56.32  ? 425  LYS A O     1 
ATOM   3339 C  CB    . LYS A 1 443 ? -25.210 41.823 52.594 1.00 60.52  ? 425  LYS A CB    1 
ATOM   3340 C  CG    . LYS A 1 443 ? -25.902 41.810 51.245 1.00 62.51  ? 425  LYS A CG    1 
ATOM   3341 C  CD    . LYS A 1 443 ? -25.963 43.194 50.622 1.00 66.45  ? 425  LYS A CD    1 
ATOM   3342 C  CE    . LYS A 1 443 ? -26.494 43.134 49.175 1.00 69.81  ? 425  LYS A CE    1 
ATOM   3343 N  NZ    . LYS A 1 443 ? -25.682 42.242 48.265 1.00 67.39  ? 425  LYS A NZ    1 
ATOM   3344 N  N     . VAL A 1 444 ? -22.026 41.861 52.848 1.00 55.87  ? 426  VAL A N     1 
ATOM   3345 C  CA    . VAL A 1 444 ? -20.771 42.427 52.338 1.00 54.61  ? 426  VAL A CA    1 
ATOM   3346 C  C     . VAL A 1 444 ? -19.651 41.377 52.260 1.00 51.75  ? 426  VAL A C     1 
ATOM   3347 O  O     . VAL A 1 444 ? -18.872 41.361 51.293 1.00 50.70  ? 426  VAL A O     1 
ATOM   3348 C  CB    . VAL A 1 444 ? -20.334 43.641 53.195 1.00 55.63  ? 426  VAL A CB    1 
ATOM   3349 C  CG1   . VAL A 1 444 ? -18.884 44.039 52.914 1.00 53.84  ? 426  VAL A CG1   1 
ATOM   3350 C  CG2   . VAL A 1 444 ? -21.269 44.802 52.950 1.00 58.24  ? 426  VAL A CG2   1 
ATOM   3351 N  N     . THR A 1 445 ? -19.576 40.531 53.296 1.00 50.33  ? 427  THR A N     1 
ATOM   3352 C  CA    . THR A 1 445 ? -18.742 39.330 53.318 1.00 47.98  ? 427  THR A CA    1 
ATOM   3353 C  C     . THR A 1 445 ? -18.989 38.548 52.023 1.00 47.98  ? 427  THR A C     1 
ATOM   3354 O  O     . THR A 1 445 ? -18.041 38.212 51.289 1.00 45.79  ? 427  THR A O     1 
ATOM   3355 C  CB    . THR A 1 445 ? -19.086 38.428 54.559 1.00 48.05  ? 427  THR A CB    1 
ATOM   3356 O  OG1   . THR A 1 445 ? -18.802 39.129 55.776 1.00 47.59  ? 427  THR A OG1   1 
ATOM   3357 C  CG2   . THR A 1 445 ? -18.329 37.095 54.537 1.00 43.55  ? 427  THR A CG2   1 
ATOM   3358 N  N     . HIS A 1 446 ? -20.273 38.293 51.743 1.00 49.23  ? 428  HIS A N     1 
ATOM   3359 C  CA    . HIS A 1 446 ? -20.669 37.593 50.530 1.00 49.99  ? 428  HIS A CA    1 
ATOM   3360 C  C     . HIS A 1 446 ? -20.181 38.275 49.242 1.00 49.95  ? 428  HIS A C     1 
ATOM   3361 O  O     . HIS A 1 446 ? -19.546 37.627 48.397 1.00 48.77  ? 428  HIS A O     1 
ATOM   3362 C  CB    . HIS A 1 446 ? -22.180 37.353 50.485 1.00 52.20  ? 428  HIS A CB    1 
ATOM   3363 C  CG    . HIS A 1 446 ? -22.616 36.562 49.289 1.00 54.54  ? 428  HIS A CG    1 
ATOM   3364 N  ND1   . HIS A 1 446 ? -23.248 37.139 48.206 1.00 57.38  ? 428  HIS A ND1   1 
ATOM   3365 C  CD2   . HIS A 1 446 ? -22.461 35.251 48.984 1.00 54.05  ? 428  HIS A CD2   1 
ATOM   3366 C  CE1   . HIS A 1 446 ? -23.479 36.213 47.292 1.00 57.74  ? 428  HIS A CE1   1 
ATOM   3367 N  NE2   . HIS A 1 446 ? -23.017 35.058 47.742 1.00 55.83  ? 428  HIS A NE2   1 
ATOM   3368 N  N     . ASP A 1 447 ? -20.456 39.573 49.105 1.00 50.96  ? 429  ASP A N     1 
ATOM   3369 C  CA    . ASP A 1 447 ? -20.020 40.336 47.924 1.00 51.29  ? 429  ASP A CA    1 
ATOM   3370 C  C     . ASP A 1 447 ? -18.503 40.434 47.769 1.00 48.63  ? 429  ASP A C     1 
ATOM   3371 O  O     . ASP A 1 447 ? -17.986 40.389 46.638 1.00 47.95  ? 429  ASP A O     1 
ATOM   3372 C  CB    . ASP A 1 447 ? -20.618 41.734 47.932 1.00 54.18  ? 429  ASP A CB    1 
ATOM   3373 C  CG    . ASP A 1 447 ? -22.104 41.731 47.663 1.00 58.42  ? 429  ASP A CG    1 
ATOM   3374 O  OD1   . ASP A 1 447 ? -22.594 40.769 47.012 1.00 60.63  ? 429  ASP A OD1   1 
ATOM   3375 O  OD2   . ASP A 1 447 ? -22.770 42.698 48.105 1.00 61.38  ? 429  ASP A OD2   1 
ATOM   3376 N  N     . MET A 1 448 ? -17.810 40.583 48.900 1.00 46.22  ? 430  MET A N     1 
ATOM   3377 C  CA    . MET A 1 448 ? -16.365 40.573 48.936 1.00 44.66  ? 430  MET A CA    1 
ATOM   3378 C  C     . MET A 1 448 ? -15.904 39.254 48.333 1.00 40.86  ? 430  MET A C     1 
ATOM   3379 O  O     . MET A 1 448 ? -15.138 39.240 47.368 1.00 39.37  ? 430  MET A O     1 
ATOM   3380 C  CB    . MET A 1 448 ? -15.850 40.709 50.385 1.00 43.63  ? 430  MET A CB    1 
ATOM   3381 C  CG    . MET A 1 448 ? -14.410 41.229 50.479 1.00 45.25  ? 430  MET A CG    1 
ATOM   3382 S  SD    . MET A 1 448 ? -13.540 40.920 52.043 1.00 47.14  ? 430  MET A SD    1 
ATOM   3383 C  CE    . MET A 1 448 ? -12.538 39.481 51.619 1.00 44.54  ? 430  MET A CE    1 
ATOM   3384 N  N     . ASP A 1 449 ? -16.405 38.154 48.909 1.00 39.17  ? 431  ASP A N     1 
ATOM   3385 C  CA    . ASP A 1 449 ? -15.997 36.786 48.547 1.00 36.81  ? 431  ASP A CA    1 
ATOM   3386 C  C     . ASP A 1 449 ? -16.248 36.450 47.084 1.00 36.59  ? 431  ASP A C     1 
ATOM   3387 O  O     . ASP A 1 449 ? -15.390 35.820 46.445 1.00 34.93  ? 431  ASP A O     1 
ATOM   3388 C  CB    . ASP A 1 449 ? -16.699 35.747 49.429 1.00 36.63  ? 431  ASP A CB    1 
ATOM   3389 C  CG    . ASP A 1 449 ? -16.198 35.764 50.885 1.00 36.55  ? 431  ASP A CG    1 
ATOM   3390 O  OD1   . ASP A 1 449 ? -15.194 36.464 51.200 1.00 34.50  ? 431  ASP A OD1   1 
ATOM   3391 O  OD2   . ASP A 1 449 ? -16.837 35.079 51.720 1.00 36.67  ? 431  ASP A OD2   1 
ATOM   3392 N  N     . MET A 1 450 ? -17.406 36.888 46.570 1.00 37.33  ? 432  MET A N     1 
ATOM   3393 C  CA    . MET A 1 450 ? -17.825 36.591 45.203 1.00 38.30  ? 432  MET A CA    1 
ATOM   3394 C  C     . MET A 1 450 ? -16.847 37.136 44.164 1.00 38.13  ? 432  MET A C     1 
ATOM   3395 O  O     . MET A 1 450 ? -16.784 36.624 43.047 1.00 38.45  ? 432  MET A O     1 
ATOM   3396 C  CB    . MET A 1 450 ? -19.257 37.095 44.932 1.00 40.25  ? 432  MET A CB    1 
ATOM   3397 C  CG    . MET A 1 450 ? -20.375 36.179 45.487 1.00 41.35  ? 432  MET A CG    1 
ATOM   3398 S  SD    . MET A 1 450 ? -20.103 34.354 45.355 1.00 42.15  ? 432  MET A SD    1 
ATOM   3399 C  CE    . MET A 1 450 ? -18.980 33.933 46.697 1.00 37.32  ? 432  MET A CE    1 
ATOM   3400 N  N     . CYS A 1 451 ? -16.083 38.160 44.543 1.00 38.04  ? 433  CYS A N     1 
ATOM   3401 C  CA    . CYS A 1 451 ? -15.142 38.803 43.621 1.00 39.09  ? 433  CYS A CA    1 
ATOM   3402 C  C     . CYS A 1 451 ? -14.023 37.860 43.249 1.00 36.83  ? 433  CYS A C     1 
ATOM   3403 O  O     . CYS A 1 451 ? -13.403 38.004 42.188 1.00 37.11  ? 433  CYS A O     1 
ATOM   3404 C  CB    . CYS A 1 451 ? -14.523 40.038 44.257 1.00 39.43  ? 433  CYS A CB    1 
ATOM   3405 S  SG    . CYS A 1 451 ? -15.595 41.436 44.423 1.00 46.35  ? 433  CYS A SG    1 
ATOM   3406 N  N     . TYR A 1 452 ? -13.738 36.925 44.158 1.00 34.77  ? 434  TYR A N     1 
ATOM   3407 C  CA    . TYR A 1 452 ? -12.655 35.969 43.979 1.00 32.81  ? 434  TYR A CA    1 
ATOM   3408 C  C     . TYR A 1 452 ? -13.118 34.713 43.262 1.00 32.07  ? 434  TYR A C     1 
ATOM   3409 O  O     . TYR A 1 452 ? -12.287 34.012 42.695 1.00 32.00  ? 434  TYR A O     1 
ATOM   3410 C  CB    . TYR A 1 452 ? -12.050 35.548 45.317 1.00 30.97  ? 434  TYR A CB    1 
ATOM   3411 C  CG    . TYR A 1 452 ? -11.435 36.664 46.082 1.00 30.61  ? 434  TYR A CG    1 
ATOM   3412 C  CD1   . TYR A 1 452 ? -10.069 36.943 45.958 1.00 31.71  ? 434  TYR A CD1   1 
ATOM   3413 C  CD2   . TYR A 1 452 ? -12.202 37.448 46.937 1.00 31.28  ? 434  TYR A CD2   1 
ATOM   3414 C  CE1   . TYR A 1 452 ? -9.483  37.979 46.653 1.00 31.17  ? 434  TYR A CE1   1 
ATOM   3415 C  CE2   . TYR A 1 452 ? -11.640 38.510 47.628 1.00 34.36  ? 434  TYR A CE2   1 
ATOM   3416 C  CZ    . TYR A 1 452 ? -10.266 38.760 47.496 1.00 34.11  ? 434  TYR A CZ    1 
ATOM   3417 O  OH    . TYR A 1 452 ? -9.681  39.796 48.201 1.00 34.85  ? 434  TYR A OH    1 
ATOM   3418 N  N     . GLY A 1 453 ? -14.424 34.437 43.303 1.00 31.46  ? 435  GLY A N     1 
ATOM   3419 C  CA    . GLY A 1 453 ? -14.961 33.174 42.829 1.00 29.59  ? 435  GLY A CA    1 
ATOM   3420 C  C     . GLY A 1 453 ? -16.001 32.648 43.802 1.00 29.07  ? 435  GLY A C     1 
ATOM   3421 O  O     . GLY A 1 453 ? -16.199 33.219 44.888 1.00 28.96  ? 435  GLY A O     1 
ATOM   3422 N  N     . MET A 1 454 ? -16.650 31.548 43.434 1.00 27.78  ? 436  MET A N     1 
ATOM   3423 C  CA    . MET A 1 454 ? -17.745 30.950 44.225 1.00 27.22  ? 436  MET A CA    1 
ATOM   3424 C  C     . MET A 1 454 ? -17.310 30.476 45.611 1.00 26.87  ? 436  MET A C     1 
ATOM   3425 O  O     . MET A 1 454 ? -18.117 30.418 46.543 1.00 26.91  ? 436  MET A O     1 
ATOM   3426 C  CB    . MET A 1 454 ? -18.335 29.780 43.448 1.00 27.17  ? 436  MET A CB    1 
ATOM   3427 C  CG    . MET A 1 454 ? -19.068 30.247 42.200 1.00 27.57  ? 436  MET A CG    1 
ATOM   3428 S  SD    . MET A 1 454 ? -20.552 31.205 42.608 1.00 37.13  ? 436  MET A SD    1 
ATOM   3429 C  CE    . MET A 1 454 ? -21.837 29.953 42.473 1.00 34.89  ? 436  MET A CE    1 
ATOM   3430 N  N     . MET A 1 455 ? -16.030 30.140 45.731 1.00 25.66  ? 437  MET A N     1 
ATOM   3431 C  CA    . MET A 1 455 ? -15.514 29.649 47.016 1.00 25.62  ? 437  MET A CA    1 
ATOM   3432 C  C     . MET A 1 455 ? -14.629 30.704 47.689 1.00 25.27  ? 437  MET A C     1 
ATOM   3433 O  O     . MET A 1 455 ? -13.935 30.413 48.649 1.00 24.93  ? 437  MET A O     1 
ATOM   3434 C  CB    . MET A 1 455 ? -14.786 28.307 46.837 1.00 24.21  ? 437  MET A CB    1 
ATOM   3435 C  CG    . MET A 1 455 ? -15.737 27.127 46.622 1.00 26.34  ? 437  MET A CG    1 
ATOM   3436 S  SD    . MET A 1 455 ? -16.593 26.763 48.162 1.00 36.22  ? 437  MET A SD    1 
ATOM   3437 C  CE    . MET A 1 455 ? -17.811 25.667 47.573 1.00 31.61  ? 437  MET A CE    1 
ATOM   3438 N  N     . GLY A 1 456 ? -14.679 31.935 47.197 1.00 25.31  ? 438  GLY A N     1 
ATOM   3439 C  CA    . GLY A 1 456 ? -14.083 33.054 47.920 1.00 25.12  ? 438  GLY A CA    1 
ATOM   3440 C  C     . GLY A 1 456 ? -12.581 33.057 47.785 1.00 24.08  ? 438  GLY A C     1 
ATOM   3441 O  O     . GLY A 1 456 ? -12.033 32.275 47.029 1.00 22.63  ? 438  GLY A O     1 
ATOM   3442 N  N     . SER A 1 457 ? -11.935 33.981 48.485 1.00 24.43  ? 439  SER A N     1 
ATOM   3443 C  CA    . SER A 1 457 ? -10.482 34.099 48.504 1.00 23.88  ? 439  SER A CA    1 
ATOM   3444 C  C     . SER A 1 457 ? -9.793  32.868 49.108 1.00 23.58  ? 439  SER A C     1 
ATOM   3445 O  O     . SER A 1 457 ? -10.321 32.219 50.024 1.00 23.38  ? 439  SER A O     1 
ATOM   3446 C  CB    . SER A 1 457 ? -10.131 35.299 49.370 1.00 24.79  ? 439  SER A CB    1 
ATOM   3447 O  OG    . SER A 1 457 ? -8.727  35.441 49.510 1.00 22.85  ? 439  SER A OG    1 
ATOM   3448 N  N     . LEU A 1 458 ? -8.611  32.556 48.588 1.00 23.22  ? 440  LEU A N     1 
ATOM   3449 C  CA    . LEU A 1 458 ? -7.729  31.584 49.173 1.00 22.83  ? 440  LEU A CA    1 
ATOM   3450 C  C     . LEU A 1 458 ? -7.508  31.839 50.703 1.00 22.09  ? 440  LEU A C     1 
ATOM   3451 O  O     . LEU A 1 458 ? -7.383  30.879 51.496 1.00 21.44  ? 440  LEU A O     1 
ATOM   3452 C  CB    . LEU A 1 458 ? -6.405  31.676 48.397 1.00 23.05  ? 440  LEU A CB    1 
ATOM   3453 C  CG    . LEU A 1 458 ? -5.258  30.709 48.682 1.00 24.10  ? 440  LEU A CG    1 
ATOM   3454 C  CD1   . LEU A 1 458 ? -5.686  29.206 48.644 1.00 25.88  ? 440  LEU A CD1   1 
ATOM   3455 C  CD2   . LEU A 1 458 ? -4.189  30.982 47.679 1.00 26.13  ? 440  LEU A CD2   1 
ATOM   3456 N  N     . PHE A 1 459 ? -7.530  33.115 51.101 1.00 22.35  ? 441  PHE A N     1 
ATOM   3457 C  CA    . PHE A 1 459 ? -6.949  33.578 52.379 1.00 22.71  ? 441  PHE A CA    1 
ATOM   3458 C  C     . PHE A 1 459 ? -7.971  33.948 53.435 1.00 23.90  ? 441  PHE A C     1 
ATOM   3459 O  O     . PHE A 1 459 ? -7.628  34.167 54.597 1.00 24.55  ? 441  PHE A O     1 
ATOM   3460 C  CB    . PHE A 1 459 ? -6.077  34.806 52.127 1.00 22.54  ? 441  PHE A CB    1 
ATOM   3461 C  CG    . PHE A 1 459 ? -4.882  34.533 51.230 1.00 22.36  ? 441  PHE A CG    1 
ATOM   3462 C  CD1   . PHE A 1 459 ? -3.878  33.650 51.644 1.00 21.39  ? 441  PHE A CD1   1 
ATOM   3463 C  CD2   . PHE A 1 459 ? -4.755  35.176 50.017 1.00 23.43  ? 441  PHE A CD2   1 
ATOM   3464 C  CE1   . PHE A 1 459 ? -2.747  33.406 50.842 1.00 22.07  ? 441  PHE A CE1   1 
ATOM   3465 C  CE2   . PHE A 1 459 ? -3.637  34.927 49.172 1.00 24.22  ? 441  PHE A CE2   1 
ATOM   3466 C  CZ    . PHE A 1 459 ? -2.634  34.055 49.604 1.00 22.03  ? 441  PHE A CZ    1 
ATOM   3467 N  N     . ARG A 1 460 ? -9.217  34.116 53.010 1.00 25.10  ? 442  ARG A N     1 
ATOM   3468 C  CA    . ARG A 1 460 ? -10.264 34.552 53.937 1.00 25.90  ? 442  ARG A CA    1 
ATOM   3469 C  C     . ARG A 1 460 ? -11.647 34.373 53.403 1.00 27.05  ? 442  ARG A C     1 
ATOM   3470 O  O     . ARG A 1 460 ? -11.833 34.119 52.216 1.00 25.91  ? 442  ARG A O     1 
ATOM   3471 C  CB    . ARG A 1 460 ? -10.101 36.016 54.351 1.00 27.34  ? 442  ARG A CB    1 
ATOM   3472 C  CG    . ARG A 1 460 ? -9.661  36.964 53.240 1.00 26.53  ? 442  ARG A CG    1 
ATOM   3473 C  CD    . ARG A 1 460 ? -9.574  38.386 53.804 1.00 28.34  ? 442  ARG A CD    1 
ATOM   3474 N  NE    . ARG A 1 460 ? -8.442  38.581 54.703 1.00 28.79  ? 442  ARG A NE    1 
ATOM   3475 C  CZ    . ARG A 1 460 ? -8.557  38.724 56.020 1.00 30.21  ? 442  ARG A CZ    1 
ATOM   3476 N  NH1   . ARG A 1 460 ? -7.484  38.917 56.770 1.00 30.02  ? 442  ARG A NH1   1 
ATOM   3477 N  NH2   . ARG A 1 460 ? -9.750  38.693 56.585 1.00 28.94  ? 442  ARG A NH2   1 
ATOM   3478 N  N     . SER A 1 461 ? -12.600 34.422 54.331 1.00 28.13  ? 443  SER A N     1 
ATOM   3479 C  CA    . SER A 1 461 ? -13.996 34.670 54.039 1.00 30.43  ? 443  SER A CA    1 
ATOM   3480 C  C     . SER A 1 461 ? -14.369 35.864 54.924 1.00 31.67  ? 443  SER A C     1 
ATOM   3481 O  O     . SER A 1 461 ? -14.417 35.763 56.140 1.00 32.75  ? 443  SER A O     1 
ATOM   3482 C  CB    . SER A 1 461 ? -14.851 33.424 54.325 1.00 30.42  ? 443  SER A CB    1 
ATOM   3483 O  OG    . SER A 1 461 ? -16.247 33.727 54.217 1.00 33.43  ? 443  SER A OG    1 
ATOM   3484 N  N     . GLY A 1 462 ? -14.567 37.017 54.305 1.00 33.07  ? 444  GLY A N     1 
ATOM   3485 C  CA    . GLY A 1 462 ? -14.772 38.246 55.041 1.00 34.45  ? 444  GLY A CA    1 
ATOM   3486 C  C     . GLY A 1 462 ? -13.633 38.541 55.987 1.00 34.16  ? 444  GLY A C     1 
ATOM   3487 O  O     . GLY A 1 462 ? -12.460 38.552 55.582 1.00 34.37  ? 444  GLY A O     1 
ATOM   3488 N  N     . SER A 1 463 ? -13.957 38.747 57.259 1.00 34.61  ? 445  SER A N     1 
ATOM   3489 C  CA    . SER A 1 463 ? -12.911 38.996 58.240 1.00 34.62  ? 445  SER A CA    1 
ATOM   3490 C  C     . SER A 1 463 ? -12.287 37.727 58.842 1.00 32.85  ? 445  SER A C     1 
ATOM   3491 O  O     . SER A 1 463 ? -11.402 37.797 59.705 1.00 32.47  ? 445  SER A O     1 
ATOM   3492 C  CB    . SER A 1 463 ? -13.442 39.890 59.344 1.00 36.61  ? 445  SER A CB    1 
ATOM   3493 O  OG    . SER A 1 463 ? -14.487 39.222 60.022 1.00 41.26  ? 445  SER A OG    1 
ATOM   3494 N  N     . ARG A 1 464 ? -12.716 36.560 58.382 1.00 31.53  ? 446  ARG A N     1 
ATOM   3495 C  CA    . ARG A 1 464 ? -12.212 35.305 58.959 1.00 29.64  ? 446  ARG A CA    1 
ATOM   3496 C  C     . ARG A 1 464 ? -11.113 34.732 58.056 1.00 27.59  ? 446  ARG A C     1 
ATOM   3497 O  O     . ARG A 1 464 ? -11.326 34.538 56.864 1.00 26.54  ? 446  ARG A O     1 
ATOM   3498 C  CB    . ARG A 1 464 ? -13.358 34.322 59.170 1.00 30.20  ? 446  ARG A CB    1 
ATOM   3499 C  CG    . ARG A 1 464 ? -14.546 34.997 59.851 1.00 35.10  ? 446  ARG A CG    1 
ATOM   3500 C  CD    . ARG A 1 464 ? -15.409 34.070 60.622 1.00 43.95  ? 446  ARG A CD    1 
ATOM   3501 N  NE    . ARG A 1 464 ? -14.643 33.124 61.443 1.00 48.55  ? 446  ARG A NE    1 
ATOM   3502 C  CZ    . ARG A 1 464 ? -15.188 32.119 62.132 1.00 50.98  ? 446  ARG A CZ    1 
ATOM   3503 N  NH1   . ARG A 1 464 ? -16.509 31.924 62.127 1.00 53.62  ? 446  ARG A NH1   1 
ATOM   3504 N  NH2   . ARG A 1 464 ? -14.408 31.306 62.821 1.00 52.22  ? 446  ARG A NH2   1 
ATOM   3505 N  N     . GLN A 1 465 ? -9.944  34.463 58.627 1.00 25.51  ? 447  GLN A N     1 
ATOM   3506 C  CA    . GLN A 1 465 ? -8.856  33.893 57.850 1.00 24.37  ? 447  GLN A CA    1 
ATOM   3507 C  C     . GLN A 1 465 ? -9.069  32.386 57.654 1.00 23.44  ? 447  GLN A C     1 
ATOM   3508 O  O     . GLN A 1 465 ? -9.640  31.723 58.527 1.00 23.10  ? 447  GLN A O     1 
ATOM   3509 C  CB    . GLN A 1 465 ? -7.545  34.167 58.545 1.00 23.67  ? 447  GLN A CB    1 
ATOM   3510 C  CG    . GLN A 1 465 ? -7.170  35.656 58.640 1.00 25.90  ? 447  GLN A CG    1 
ATOM   3511 C  CD    . GLN A 1 465 ? -5.748  35.789 59.160 1.00 29.32  ? 447  GLN A CD    1 
ATOM   3512 O  OE1   . GLN A 1 465 ? -5.510  35.563 60.336 1.00 32.78  ? 447  GLN A OE1   1 
ATOM   3513 N  NE2   . GLN A 1 465 ? -4.795  36.111 58.284 1.00 29.15  ? 447  GLN A NE2   1 
ATOM   3514 N  N     . THR A 1 466 ? -8.613  31.857 56.516 1.00 21.97  ? 448  THR A N     1 
ATOM   3515 C  CA    . THR A 1 466 ? -8.750  30.439 56.221 1.00 20.53  ? 448  THR A CA    1 
ATOM   3516 C  C     . THR A 1 466 ? -7.615  29.664 56.904 1.00 20.07  ? 448  THR A C     1 
ATOM   3517 O  O     . THR A 1 466 ? -6.637  30.271 57.379 1.00 17.52  ? 448  THR A O     1 
ATOM   3518 C  CB    . THR A 1 466 ? -8.691  30.146 54.710 1.00 21.32  ? 448  THR A CB    1 
ATOM   3519 O  OG1   . THR A 1 466 ? -7.463  30.657 54.169 1.00 22.31  ? 448  THR A OG1   1 
ATOM   3520 C  CG2   . THR A 1 466 ? -9.882  30.737 53.966 1.00 20.21  ? 448  THR A CG2   1 
ATOM   3521 N  N     . LEU A 1 467 ? -7.770  28.341 56.964 1.00 19.04  ? 449  LEU A N     1 
ATOM   3522 C  CA    . LEU A 1 467 ? -6.715  27.462 57.409 1.00 19.64  ? 449  LEU A CA    1 
ATOM   3523 C  C     . LEU A 1 467 ? -5.461  27.709 56.570 1.00 19.62  ? 449  LEU A C     1 
ATOM   3524 O  O     . LEU A 1 467 ? -4.338  27.736 57.104 1.00 20.64  ? 449  LEU A O     1 
ATOM   3525 C  CB    . LEU A 1 467 ? -7.162  26.002 57.250 1.00 18.17  ? 449  LEU A CB    1 
ATOM   3526 C  CG    . LEU A 1 467 ? -6.082  24.946 57.427 1.00 19.90  ? 449  LEU A CG    1 
ATOM   3527 C  CD1   . LEU A 1 467 ? -5.536  24.942 58.891 1.00 18.39  ? 449  LEU A CD1   1 
ATOM   3528 C  CD2   . LEU A 1 467 ? -6.646  23.582 57.038 1.00 16.49  ? 449  LEU A CD2   1 
ATOM   3529 N  N     . PHE A 1 468 ? -5.639  27.888 55.258 1.00 19.36  ? 450  PHE A N     1 
ATOM   3530 C  CA    . PHE A 1 468 ? -4.472  28.082 54.381 1.00 19.87  ? 450  PHE A CA    1 
ATOM   3531 C  C     . PHE A 1 468 ? -3.707  29.344 54.781 1.00 19.53  ? 450  PHE A C     1 
ATOM   3532 O  O     . PHE A 1 468 ? -2.492  29.301 54.903 1.00 20.05  ? 450  PHE A O     1 
ATOM   3533 C  CB    . PHE A 1 468 ? -4.901  28.190 52.906 1.00 19.45  ? 450  PHE A CB    1 
ATOM   3534 C  CG    . PHE A 1 468 ? -3.750  28.229 51.934 1.00 17.65  ? 450  PHE A CG    1 
ATOM   3535 C  CD1   . PHE A 1 468 ? -3.137  27.050 51.507 1.00 20.08  ? 450  PHE A CD1   1 
ATOM   3536 C  CD2   . PHE A 1 468 ? -3.302  29.429 51.428 1.00 20.60  ? 450  PHE A CD2   1 
ATOM   3537 C  CE1   . PHE A 1 468 ? -2.054  27.093 50.602 1.00 20.48  ? 450  PHE A CE1   1 
ATOM   3538 C  CE2   . PHE A 1 468 ? -2.235  29.490 50.517 1.00 20.25  ? 450  PHE A CE2   1 
ATOM   3539 C  CZ    . PHE A 1 468 ? -1.598  28.316 50.114 1.00 18.44  ? 450  PHE A CZ    1 
ATOM   3540 N  N     . ALA A 1 469 ? -4.416  30.461 54.921 1.00 19.78  ? 451  ALA A N     1 
ATOM   3541 C  CA    . ALA A 1 469 ? -3.835  31.708 55.407 1.00 20.71  ? 451  ALA A CA    1 
ATOM   3542 C  C     . ALA A 1 469 ? -3.055  31.527 56.725 1.00 20.91  ? 451  ALA A C     1 
ATOM   3543 O  O     . ALA A 1 469 ? -1.926  32.051 56.860 1.00 20.77  ? 451  ALA A O     1 
ATOM   3544 C  CB    . ALA A 1 469 ? -4.912  32.794 55.584 1.00 20.74  ? 451  ALA A CB    1 
ATOM   3545 N  N     A SER A 1 470 ? -3.630  30.816 57.700 0.50 21.30  ? 452  SER A N     1 
ATOM   3546 N  N     B SER A 1 470 ? -3.641  30.804 57.682 0.50 20.68  ? 452  SER A N     1 
ATOM   3547 C  CA    A SER A 1 470 ? -2.916  30.641 58.978 0.50 21.52  ? 452  SER A CA    1 
ATOM   3548 C  CA    B SER A 1 470 ? -2.975  30.603 58.978 0.50 20.19  ? 452  SER A CA    1 
ATOM   3549 C  C     A SER A 1 470 ? -1.669  29.773 58.827 0.50 20.76  ? 452  SER A C     1 
ATOM   3550 C  C     B SER A 1 470 ? -1.705  29.760 58.847 0.50 20.09  ? 452  SER A C     1 
ATOM   3551 O  O     A SER A 1 470 ? -0.622  30.061 59.437 0.50 20.82  ? 452  SER A O     1 
ATOM   3552 O  O     B SER A 1 470 ? -0.677  30.058 59.483 0.50 20.22  ? 452  SER A O     1 
ATOM   3553 C  CB    A SER A 1 470 ? -3.822  30.109 60.092 0.50 22.35  ? 452  SER A CB    1 
ATOM   3554 C  CB    B SER A 1 470 ? -3.928  30.011 60.020 0.50 20.83  ? 452  SER A CB    1 
ATOM   3555 O  OG    A SER A 1 470 ? -4.283  28.812 59.793 0.50 24.95  ? 452  SER A OG    1 
ATOM   3556 O  OG    B SER A 1 470 ? -5.132  30.764 60.100 0.50 18.69  ? 452  SER A OG    1 
ATOM   3557 N  N     . GLN A 1 471 ? -1.769  28.729 58.008 1.00 19.70  ? 453  GLN A N     1 
ATOM   3558 C  CA    . GLN A 1 471 ? -0.605  27.864 57.748 1.00 19.01  ? 453  GLN A CA    1 
ATOM   3559 C  C     . GLN A 1 471 ? 0.519   28.597 56.982 1.00 18.56  ? 453  GLN A C     1 
ATOM   3560 O  O     . GLN A 1 471 ? 1.698   28.363 57.264 1.00 18.96  ? 453  GLN A O     1 
ATOM   3561 C  CB    . GLN A 1 471 ? -1.022  26.555 57.035 1.00 19.36  ? 453  GLN A CB    1 
ATOM   3562 C  CG    . GLN A 1 471 ? -1.962  25.681 57.889 1.00 19.47  ? 453  GLN A CG    1 
ATOM   3563 C  CD    . GLN A 1 471 ? -1.945  24.252 57.458 1.00 21.19  ? 453  GLN A CD    1 
ATOM   3564 O  OE1   . GLN A 1 471 ? -2.147  23.946 56.290 1.00 23.35  ? 453  GLN A OE1   1 
ATOM   3565 N  NE2   . GLN A 1 471 ? -1.666  23.357 58.394 1.00 22.70  ? 453  GLN A NE2   1 
ATOM   3566 N  N     . VAL A 1 472 ? 0.171   29.441 56.016 1.00 17.51  ? 454  VAL A N     1 
ATOM   3567 C  CA    . VAL A 1 472 ? 1.163   30.319 55.373 1.00 17.88  ? 454  VAL A CA    1 
ATOM   3568 C  C     . VAL A 1 472 ? 1.872   31.163 56.428 1.00 18.63  ? 454  VAL A C     1 
ATOM   3569 O  O     . VAL A 1 472 ? 3.084   31.197 56.466 1.00 19.56  ? 454  VAL A O     1 
ATOM   3570 C  CB    . VAL A 1 472 ? 0.585   31.222 54.287 1.00 17.89  ? 454  VAL A CB    1 
ATOM   3571 C  CG1   . VAL A 1 472 ? 1.666   32.174 53.747 1.00 18.00  ? 454  VAL A CG1   1 
ATOM   3572 C  CG2   . VAL A 1 472 ? 0.003   30.370 53.116 1.00 17.43  ? 454  VAL A CG2   1 
ATOM   3573 N  N     . MET A 1 473 ? 1.117   31.829 57.285 1.00 18.53  ? 455  MET A N     1 
ATOM   3574 C  CA    . MET A 1 473 ? 1.712   32.663 58.314 1.00 20.69  ? 455  MET A CA    1 
ATOM   3575 C  C     . MET A 1 473 ? 2.570   31.886 59.285 1.00 20.11  ? 455  MET A C     1 
ATOM   3576 O  O     . MET A 1 473 ? 3.672   32.354 59.630 1.00 20.88  ? 455  MET A O     1 
ATOM   3577 C  CB    . MET A 1 473 ? 0.624   33.427 59.075 1.00 20.89  ? 455  MET A CB    1 
ATOM   3578 C  CG    . MET A 1 473 ? -0.056  34.483 58.223 1.00 23.30  ? 455  MET A CG    1 
ATOM   3579 S  SD    . MET A 1 473 ? -1.316  35.337 59.180 1.00 27.87  ? 455  MET A SD    1 
ATOM   3580 C  CE    . MET A 1 473 ? -0.349  36.483 60.130 1.00 33.82  ? 455  MET A CE    1 
ATOM   3581 N  N     A ARG A 1 474 ? 2.100   30.706 59.713 0.50 19.27  ? 456  ARG A N     1 
ATOM   3582 N  N     B ARG A 1 474 ? 2.094   30.705 59.698 0.50 19.15  ? 456  ARG A N     1 
ATOM   3583 C  CA    A ARG A 1 474 ? 2.822   29.914 60.714 0.50 19.69  ? 456  ARG A CA    1 
ATOM   3584 C  CA    B ARG A 1 474 ? 2.786   29.896 60.699 0.50 19.40  ? 456  ARG A CA    1 
ATOM   3585 C  C     A ARG A 1 474 ? 4.082   29.238 60.169 0.50 19.23  ? 456  ARG A C     1 
ATOM   3586 C  C     B ARG A 1 474 ? 4.061   29.229 60.173 0.50 19.10  ? 456  ARG A C     1 
ATOM   3587 O  O     A ARG A 1 474 ? 5.082   29.119 60.878 0.50 19.86  ? 456  ARG A O     1 
ATOM   3588 O  O     B ARG A 1 474 ? 5.048   29.110 60.899 0.50 19.71  ? 456  ARG A O     1 
ATOM   3589 C  CB    A ARG A 1 474 ? 1.890   28.876 61.370 0.50 19.32  ? 456  ARG A CB    1 
ATOM   3590 C  CB    B ARG A 1 474 ? 1.825   28.843 61.276 0.50 19.09  ? 456  ARG A CB    1 
ATOM   3591 C  CG    A ARG A 1 474 ? 2.482   28.139 62.576 0.50 21.02  ? 456  ARG A CG    1 
ATOM   3592 C  CG    B ARG A 1 474 ? 2.337   28.088 62.483 0.50 20.40  ? 456  ARG A CG    1 
ATOM   3593 C  CD    A ARG A 1 474 ? 1.403   27.451 63.436 0.50 20.97  ? 456  ARG A CD    1 
ATOM   3594 C  CD    B ARG A 1 474 ? 1.246   27.188 63.074 0.50 19.79  ? 456  ARG A CD    1 
ATOM   3595 N  NE    A ARG A 1 474 ? 0.296   28.360 63.741 0.50 23.20  ? 456  ARG A NE    1 
ATOM   3596 N  NE    B ARG A 1 474 ? 1.658   26.604 64.341 0.50 21.42  ? 456  ARG A NE    1 
ATOM   3597 C  CZ    A ARG A 1 474 ? 0.272   29.237 64.746 0.50 23.87  ? 456  ARG A CZ    1 
ATOM   3598 C  CZ    B ARG A 1 474 ? 0.984   25.648 64.969 0.50 22.26  ? 456  ARG A CZ    1 
ATOM   3599 N  NH1   A ARG A 1 474 ? 1.299   29.352 65.590 0.50 23.38  ? 456  ARG A NH1   1 
ATOM   3600 N  NH1   B ARG A 1 474 ? -0.131  25.161 64.442 0.50 22.23  ? 456  ARG A NH1   1 
ATOM   3601 N  NH2   A ARG A 1 474 ? -0.801  30.004 64.911 0.50 22.34  ? 456  ARG A NH2   1 
ATOM   3602 N  NH2   B ARG A 1 474 ? 1.417   25.181 66.131 0.50 23.33  ? 456  ARG A NH2   1 
ATOM   3603 N  N     . TYR A 1 475 ? 4.029   28.782 58.920 1.00 19.19  ? 457  TYR A N     1 
ATOM   3604 C  CA    . TYR A 1 475 ? 5.055   27.869 58.398 1.00 19.83  ? 457  TYR A CA    1 
ATOM   3605 C  C     . TYR A 1 475 ? 5.969   28.425 57.277 1.00 19.46  ? 457  TYR A C     1 
ATOM   3606 O  O     . TYR A 1 475 ? 7.106   27.956 57.147 1.00 19.54  ? 457  TYR A O     1 
ATOM   3607 C  CB    . TYR A 1 475 ? 4.409   26.513 57.979 1.00 19.43  ? 457  TYR A CB    1 
ATOM   3608 C  CG    . TYR A 1 475 ? 3.771   25.812 59.142 1.00 21.64  ? 457  TYR A CG    1 
ATOM   3609 C  CD1   . TYR A 1 475 ? 4.543   25.360 60.192 1.00 23.20  ? 457  TYR A CD1   1 
ATOM   3610 C  CD2   . TYR A 1 475 ? 2.383   25.665 59.227 1.00 19.84  ? 457  TYR A CD2   1 
ATOM   3611 C  CE1   . TYR A 1 475 ? 3.959   24.753 61.319 1.00 25.65  ? 457  TYR A CE1   1 
ATOM   3612 C  CE2   . TYR A 1 475 ? 1.790   25.043 60.336 1.00 22.25  ? 457  TYR A CE2   1 
ATOM   3613 C  CZ    . TYR A 1 475 ? 2.576   24.590 61.366 1.00 22.53  ? 457  TYR A CZ    1 
ATOM   3614 O  OH    . TYR A 1 475 ? 2.008   23.972 62.457 1.00 26.53  ? 457  TYR A OH    1 
ATOM   3615 N  N     . ALA A 1 476 ? 5.469   29.390 56.477 1.00 19.08  ? 458  ALA A N     1 
ATOM   3616 C  CA    . ALA A 1 476 ? 6.282   30.004 55.411 1.00 17.60  ? 458  ALA A CA    1 
ATOM   3617 C  C     . ALA A 1 476 ? 6.963   31.255 55.953 1.00 18.42  ? 458  ALA A C     1 
ATOM   3618 O  O     . ALA A 1 476 ? 6.299   32.268 56.299 1.00 18.05  ? 458  ALA A O     1 
ATOM   3619 C  CB    . ALA A 1 476 ? 5.449   30.370 54.248 1.00 17.32  ? 458  ALA A CB    1 
ATOM   3620 N  N     . ASP A 1 477 ? 8.287   31.203 56.071 1.00 18.40  ? 459  ASP A N     1 
ATOM   3621 C  CA    . ASP A 1 477 ? 9.037   32.372 56.565 1.00 19.31  ? 459  ASP A CA    1 
ATOM   3622 C  C     . ASP A 1 477 ? 8.856   33.518 55.606 1.00 19.60  ? 459  ASP A C     1 
ATOM   3623 O  O     . ASP A 1 477 ? 8.647   34.649 56.045 1.00 21.96  ? 459  ASP A O     1 
ATOM   3624 C  CB    . ASP A 1 477 ? 10.528  32.051 56.738 1.00 19.41  ? 459  ASP A CB    1 
ATOM   3625 C  CG    . ASP A 1 477 ? 10.756  30.900 57.716 1.00 21.95  ? 459  ASP A CG    1 
ATOM   3626 O  OD1   . ASP A 1 477 ? 9.897   30.696 58.607 1.00 24.96  ? 459  ASP A OD1   1 
ATOM   3627 O  OD2   . ASP A 1 477 ? 11.788  30.217 57.645 1.00 21.62  ? 459  ASP A OD2   1 
ATOM   3628 N  N     . LEU A 1 478 ? 8.988   33.234 54.312 1.00 20.17  ? 460  LEU A N     1 
ATOM   3629 C  CA    . LEU A 1 478 ? 8.769   34.182 53.199 1.00 20.11  ? 460  LEU A CA    1 
ATOM   3630 C  C     . LEU A 1 478 ? 7.728   33.598 52.242 1.00 19.96  ? 460  LEU A C     1 
ATOM   3631 O  O     . LEU A 1 478 ? 7.565   32.365 52.163 1.00 19.99  ? 460  LEU A O     1 
ATOM   3632 C  CB    . LEU A 1 478 ? 10.073  34.387 52.408 1.00 20.92  ? 460  LEU A CB    1 
ATOM   3633 C  CG    . LEU A 1 478 ? 11.340  34.724 53.190 1.00 21.18  ? 460  LEU A CG    1 
ATOM   3634 C  CD1   . LEU A 1 478 ? 12.554  34.702 52.258 1.00 21.57  ? 460  LEU A CD1   1 
ATOM   3635 C  CD2   . LEU A 1 478 ? 11.223  36.091 53.891 1.00 20.09  ? 460  LEU A CD2   1 
ATOM   3636 N  N     . TYR A 1 479 ? 7.011   34.474 51.527 1.00 20.29  ? 461  TYR A N     1 
ATOM   3637 C  CA    . TYR A 1 479 ? 6.099   34.048 50.458 1.00 20.06  ? 461  TYR A CA    1 
ATOM   3638 C  C     . TYR A 1 479 ? 5.912   35.122 49.394 1.00 21.02  ? 461  TYR A C     1 
ATOM   3639 O  O     . TYR A 1 479 ? 6.182   36.323 49.619 1.00 22.30  ? 461  TYR A O     1 
ATOM   3640 C  CB    . TYR A 1 479 ? 4.751   33.559 51.007 1.00 19.29  ? 461  TYR A CB    1 
ATOM   3641 C  CG    . TYR A 1 479 ? 3.820   34.630 51.540 1.00 19.66  ? 461  TYR A CG    1 
ATOM   3642 C  CD1   . TYR A 1 479 ? 2.832   35.176 50.728 1.00 20.14  ? 461  TYR A CD1   1 
ATOM   3643 C  CD2   . TYR A 1 479 ? 3.936   35.102 52.859 1.00 16.99  ? 461  TYR A CD2   1 
ATOM   3644 C  CE1   . TYR A 1 479 ? 1.967   36.145 51.191 1.00 20.72  ? 461  TYR A CE1   1 
ATOM   3645 C  CE2   . TYR A 1 479 ? 3.049   36.094 53.359 1.00 19.39  ? 461  TYR A CE2   1 
ATOM   3646 C  CZ    . TYR A 1 479 ? 2.063   36.585 52.516 1.00 21.28  ? 461  TYR A CZ    1 
ATOM   3647 O  OH    . TYR A 1 479 ? 1.172   37.534 52.953 1.00 22.54  ? 461  TYR A OH    1 
ATOM   3648 N  N     . ALA A 1 480 ? 5.475   34.683 48.211 1.00 21.38  ? 462  ALA A N     1 
ATOM   3649 C  CA    . ALA A 1 480 ? 5.359   35.590 47.069 1.00 21.66  ? 462  ALA A CA    1 
ATOM   3650 C  C     . ALA A 1 480 ? 4.587   34.872 46.009 1.00 21.94  ? 462  ALA A C     1 
ATOM   3651 O  O     . ALA A 1 480 ? 4.423   33.644 46.077 1.00 22.12  ? 462  ALA A O     1 
ATOM   3652 C  CB    . ALA A 1 480 ? 6.753   35.994 46.551 1.00 21.96  ? 462  ALA A CB    1 
ATOM   3653 N  N     . ALA A 1 481 ? 4.110   35.644 45.033 1.00 22.90  ? 463  ALA A N     1 
ATOM   3654 C  CA    . ALA A 1 481 ? 3.415   35.150 43.849 1.00 23.10  ? 463  ALA A CA    1 
ATOM   3655 C  C     . ALA A 1 481 ? 4.324   34.246 43.007 1.00 23.57  ? 463  ALA A C     1 
ATOM   3656 O  O     . ALA A 1 481 ? 3.856   33.308 42.342 1.00 24.18  ? 463  ALA A O     1 
ATOM   3657 C  CB    . ALA A 1 481 ? 2.933   36.367 43.026 1.00 23.44  ? 463  ALA A CB    1 
ATOM   3658 N  N     . SER A 1 482 ? 5.631   34.507 43.067 1.00 24.04  ? 464  SER A N     1 
ATOM   3659 C  CA    . SER A 1 482 ? 6.635   33.766 42.276 1.00 24.27  ? 464  SER A CA    1 
ATOM   3660 C  C     . SER A 1 482 ? 7.959   33.805 43.030 1.00 25.08  ? 464  SER A C     1 
ATOM   3661 O  O     . SER A 1 482 ? 8.270   34.831 43.639 1.00 25.69  ? 464  SER A O     1 
ATOM   3662 C  CB    . SER A 1 482 ? 6.850   34.468 40.951 1.00 25.77  ? 464  SER A CB    1 
ATOM   3663 O  OG    . SER A 1 482 ? 7.819   33.774 40.165 1.00 26.55  ? 464  SER A OG    1 
ATOM   3664 N  N     . PHE A 1 483 ? 8.770   32.749 42.942 1.00 25.42  ? 465  PHE A N     1 
ATOM   3665 C  CA    . PHE A 1 483 ? 10.131  32.786 43.534 1.00 26.74  ? 465  PHE A CA    1 
ATOM   3666 C  C     . PHE A 1 483 ? 11.005  33.819 42.794 1.00 26.90  ? 465  PHE A C     1 
ATOM   3667 O  O     . PHE A 1 483 ? 11.984  34.333 43.343 1.00 28.06  ? 465  PHE A O     1 
ATOM   3668 C  CB    . PHE A 1 483 ? 10.817  31.415 43.470 1.00 27.54  ? 465  PHE A CB    1 
ATOM   3669 C  CG    . PHE A 1 483 ? 11.189  31.032 42.112 1.00 29.81  ? 465  PHE A CG    1 
ATOM   3670 C  CD1   . PHE A 1 483 ? 12.457  31.342 41.616 1.00 31.73  ? 465  PHE A CD1   1 
ATOM   3671 C  CD2   . PHE A 1 483 ? 10.240  30.459 41.260 1.00 32.58  ? 465  PHE A CD2   1 
ATOM   3672 C  CE1   . PHE A 1 483 ? 12.798  31.043 40.346 1.00 31.67  ? 465  PHE A CE1   1 
ATOM   3673 C  CE2   . PHE A 1 483 ? 10.559  30.156 39.960 1.00 35.21  ? 465  PHE A CE2   1 
ATOM   3674 C  CZ    . PHE A 1 483 ? 11.859  30.458 39.485 1.00 36.42  ? 465  PHE A CZ    1 
ATOM   3675 N  N     . ILE A 1 484 ? 10.654  34.113 41.545 1.00 26.78  ? 466  ILE A N     1 
ATOM   3676 C  CA    . ILE A 1 484 ? 11.390  35.116 40.757 1.00 27.83  ? 466  ILE A CA    1 
ATOM   3677 C  C     . ILE A 1 484 ? 11.536  36.488 41.460 1.00 27.52  ? 466  ILE A C     1 
ATOM   3678 O  O     . ILE A 1 484 ? 12.454  37.276 41.160 1.00 28.39  ? 466  ILE A O     1 
ATOM   3679 C  CB    . ILE A 1 484 ? 10.826  35.260 39.303 1.00 28.80  ? 466  ILE A CB    1 
ATOM   3680 C  CG1   . ILE A 1 484 ? 11.960  35.636 38.344 1.00 32.75  ? 466  ILE A CG1   1 
ATOM   3681 C  CG2   . ILE A 1 484 ? 9.750   36.318 39.217 1.00 29.74  ? 466  ILE A CG2   1 
ATOM   3682 C  CD1   . ILE A 1 484 ? 12.886  34.430 38.033 1.00 36.22  ? 466  ILE A CD1   1 
ATOM   3683 N  N     . ASN A 1 485 ? 10.635  36.778 42.401 1.00 26.56  ? 467  ASN A N     1 
ATOM   3684 C  CA    . ASN A 1 485 ? 10.644  38.061 43.111 1.00 26.47  ? 467  ASN A CA    1 
ATOM   3685 C  C     . ASN A 1 485 ? 11.900  38.229 43.936 1.00 27.37  ? 467  ASN A C     1 
ATOM   3686 O  O     . ASN A 1 485 ? 12.265  39.335 44.241 1.00 28.71  ? 467  ASN A O     1 
ATOM   3687 C  CB    . ASN A 1 485 ? 9.385   38.231 43.957 1.00 25.20  ? 467  ASN A CB    1 
ATOM   3688 C  CG    . ASN A 1 485 ? 8.128   38.353 43.095 1.00 25.52  ? 467  ASN A CG    1 
ATOM   3689 O  OD1   . ASN A 1 485 ? 8.214   38.377 41.878 1.00 27.83  ? 467  ASN A OD1   1 
ATOM   3690 N  ND2   . ASN A 1 485 ? 6.972   38.445 43.722 1.00 23.55  ? 467  ASN A ND2   1 
ATOM   3691 N  N     . LEU A 1 486 ? 12.576  37.122 44.260 1.00 27.99  ? 468  LEU A N     1 
ATOM   3692 C  CA    . LEU A 1 486 ? 13.908  37.154 44.901 1.00 28.45  ? 468  LEU A CA    1 
ATOM   3693 C  C     . LEU A 1 486 ? 14.949  37.869 44.066 1.00 30.28  ? 468  LEU A C     1 
ATOM   3694 O  O     . LEU A 1 486 ? 15.929  38.402 44.602 1.00 31.27  ? 468  LEU A O     1 
ATOM   3695 C  CB    . LEU A 1 486 ? 14.384  35.729 45.251 1.00 28.52  ? 468  LEU A CB    1 
ATOM   3696 C  CG    . LEU A 1 486 ? 13.556  35.055 46.371 1.00 27.05  ? 468  LEU A CG    1 
ATOM   3697 C  CD1   . LEU A 1 486 ? 13.820  33.541 46.469 1.00 27.94  ? 468  LEU A CD1   1 
ATOM   3698 C  CD2   . LEU A 1 486 ? 13.790  35.725 47.724 1.00 27.77  ? 468  LEU A CD2   1 
ATOM   3699 N  N     . LEU A 1 487 ? 14.747  37.890 42.750 1.00 30.50  ? 469  LEU A N     1 
ATOM   3700 C  CA    . LEU A 1 487 ? 15.677  38.610 41.852 1.00 32.42  ? 469  LEU A CA    1 
ATOM   3701 C  C     . LEU A 1 487 ? 15.760  40.101 42.168 1.00 33.42  ? 469  LEU A C     1 
ATOM   3702 O  O     . LEU A 1 487 ? 16.776  40.751 41.869 1.00 35.53  ? 469  LEU A O     1 
ATOM   3703 C  CB    . LEU A 1 487 ? 15.260  38.416 40.402 1.00 32.03  ? 469  LEU A CB    1 
ATOM   3704 C  CG    . LEU A 1 487 ? 16.127  38.916 39.246 1.00 33.08  ? 469  LEU A CG    1 
ATOM   3705 C  CD1   . LEU A 1 487 ? 17.446  38.170 39.166 1.00 29.22  ? 469  LEU A CD1   1 
ATOM   3706 C  CD2   . LEU A 1 487 ? 15.291  38.695 38.003 1.00 31.68  ? 469  LEU A CD2   1 
ATOM   3707 N  N     . TYR A 1 488 ? 14.701  40.632 42.775 1.00 33.38  ? 470  TYR A N     1 
ATOM   3708 C  CA    . TYR A 1 488 ? 14.569  42.068 42.965 1.00 35.21  ? 470  TYR A CA    1 
ATOM   3709 C  C     . TYR A 1 488 ? 15.123  42.541 44.312 1.00 35.97  ? 470  TYR A C     1 
ATOM   3710 O  O     . TYR A 1 488 ? 14.986  43.720 44.660 1.00 38.21  ? 470  TYR A O     1 
ATOM   3711 C  CB    . TYR A 1 488 ? 13.117  42.548 42.710 1.00 34.99  ? 470  TYR A CB    1 
ATOM   3712 C  CG    . TYR A 1 488 ? 12.539  41.955 41.444 1.00 35.75  ? 470  TYR A CG    1 
ATOM   3713 C  CD1   . TYR A 1 488 ? 13.282  41.953 40.261 1.00 38.24  ? 470  TYR A CD1   1 
ATOM   3714 C  CD2   . TYR A 1 488 ? 11.288  41.340 41.440 1.00 33.87  ? 470  TYR A CD2   1 
ATOM   3715 C  CE1   . TYR A 1 488 ? 12.783  41.363 39.085 1.00 37.07  ? 470  TYR A CE1   1 
ATOM   3716 C  CE2   . TYR A 1 488 ? 10.786  40.744 40.279 1.00 33.78  ? 470  TYR A CE2   1 
ATOM   3717 C  CZ    . TYR A 1 488 ? 11.542  40.774 39.108 1.00 35.22  ? 470  TYR A CZ    1 
ATOM   3718 O  OH    . TYR A 1 488 ? 11.067  40.188 37.955 1.00 37.86  ? 470  TYR A OH    1 
ATOM   3719 N  N     . TYR A 1 489 ? 15.790  41.637 45.027 1.00 35.38  ? 471  TYR A N     1 
ATOM   3720 C  CA    . TYR A 1 489 ? 16.332  41.901 46.365 1.00 35.16  ? 471  TYR A CA    1 
ATOM   3721 C  C     . TYR A 1 489 ? 17.820  41.629 46.349 1.00 37.39  ? 471  TYR A C     1 
ATOM   3722 O  O     . TYR A 1 489 ? 18.255  40.654 45.746 1.00 36.69  ? 471  TYR A O     1 
ATOM   3723 C  CB    . TYR A 1 489 ? 15.636  41.048 47.435 1.00 32.07  ? 471  TYR A CB    1 
ATOM   3724 C  CG    . TYR A 1 489 ? 14.214  41.451 47.665 1.00 29.17  ? 471  TYR A CG    1 
ATOM   3725 C  CD1   . TYR A 1 489 ? 13.882  42.403 48.646 1.00 29.15  ? 471  TYR A CD1   1 
ATOM   3726 C  CD2   . TYR A 1 489 ? 13.185  40.903 46.901 1.00 26.91  ? 471  TYR A CD2   1 
ATOM   3727 C  CE1   . TYR A 1 489 ? 12.556  42.784 48.855 1.00 28.79  ? 471  TYR A CE1   1 
ATOM   3728 C  CE2   . TYR A 1 489 ? 11.863  41.281 47.094 1.00 26.75  ? 471  TYR A CE2   1 
ATOM   3729 C  CZ    . TYR A 1 489 ? 11.553  42.218 48.081 1.00 27.35  ? 471  TYR A CZ    1 
ATOM   3730 O  OH    . TYR A 1 489 ? 10.234  42.573 48.276 1.00 28.03  ? 471  TYR A OH    1 
ATOM   3731 N  N     . PRO A 1 490 ? 18.612  42.514 46.993 1.00 40.31  ? 472  PRO A N     1 
ATOM   3732 C  CA    . PRO A 1 490 ? 20.060  42.369 46.939 1.00 42.88  ? 472  PRO A CA    1 
ATOM   3733 C  C     . PRO A 1 490 ? 20.584  41.094 47.615 1.00 43.75  ? 472  PRO A C     1 
ATOM   3734 O  O     . PRO A 1 490 ? 19.888  40.457 48.425 1.00 41.85  ? 472  PRO A O     1 
ATOM   3735 C  CB    . PRO A 1 490 ? 20.572  43.634 47.639 1.00 43.78  ? 472  PRO A CB    1 
ATOM   3736 C  CG    . PRO A 1 490 ? 19.465  44.061 48.488 1.00 42.89  ? 472  PRO A CG    1 
ATOM   3737 C  CD    . PRO A 1 490 ? 18.211  43.701 47.767 1.00 39.90  ? 472  PRO A CD    1 
ATOM   3738 N  N     . PHE A 1 491 ? 21.816  40.752 47.237 1.00 47.43  ? 473  PHE A N     1 
ATOM   3739 C  CA    . PHE A 1 491 ? 22.530  39.539 47.659 1.00 49.23  ? 473  PHE A CA    1 
ATOM   3740 C  C     . PHE A 1 491 ? 22.358  39.157 49.146 1.00 48.73  ? 473  PHE A C     1 
ATOM   3741 O  O     . PHE A 1 491 ? 22.259  37.952 49.479 1.00 49.55  ? 473  PHE A O     1 
ATOM   3742 C  CB    . PHE A 1 491 ? 24.031  39.642 47.264 1.00 52.18  ? 473  PHE A CB    1 
ATOM   3743 C  CG    . PHE A 1 491 ? 24.332  39.179 45.837 1.00 55.87  ? 473  PHE A CG    1 
ATOM   3744 C  CD1   . PHE A 1 491 ? 23.832  37.940 45.354 1.00 57.92  ? 473  PHE A CD1   1 
ATOM   3745 C  CD2   . PHE A 1 491 ? 25.125  39.956 44.979 1.00 59.64  ? 473  PHE A CD2   1 
ATOM   3746 C  CE1   . PHE A 1 491 ? 24.116  37.498 44.029 1.00 58.31  ? 473  PHE A CE1   1 
ATOM   3747 C  CE2   . PHE A 1 491 ? 25.415  39.523 43.648 1.00 61.09  ? 473  PHE A CE2   1 
ATOM   3748 C  CZ    . PHE A 1 491 ? 24.908  38.290 43.183 1.00 58.16  ? 473  PHE A CZ    1 
ATOM   3749 N  N     . SER A 1 492 ? 22.275  40.175 50.012 1.00 47.14  ? 474  SER A N     1 
ATOM   3750 C  CA    . SER A 1 492 ? 22.345  40.006 51.456 1.00 45.57  ? 474  SER A CA    1 
ATOM   3751 C  C     . SER A 1 492 ? 21.222  40.769 52.192 1.00 43.28  ? 474  SER A C     1 
ATOM   3752 O  O     . SER A 1 492 ? 21.382  41.203 53.342 1.00 43.05  ? 474  SER A O     1 
ATOM   3753 C  CB    . SER A 1 492 ? 23.654  40.616 51.882 1.00 47.73  ? 474  SER A CB    1 
ATOM   3754 O  OG    . SER A 1 492 ? 23.636  41.952 51.407 1.00 50.17  ? 474  SER A OG    1 
ATOM   3755 N  N     . TYR A 1 493 ? 20.086  40.928 51.524 1.00 40.38  ? 475  TYR A N     1 
ATOM   3756 C  CA    . TYR A 1 493 ? 18.960  41.639 52.082 1.00 38.60  ? 475  TYR A CA    1 
ATOM   3757 C  C     . TYR A 1 493 ? 18.522  41.038 53.427 1.00 37.49  ? 475  TYR A C     1 
ATOM   3758 O  O     . TYR A 1 493 ? 18.616  39.827 53.645 1.00 37.10  ? 475  TYR A O     1 
ATOM   3759 C  CB    . TYR A 1 493 ? 17.820  41.581 51.084 1.00 37.75  ? 475  TYR A CB    1 
ATOM   3760 C  CG    . TYR A 1 493 ? 16.673  42.506 51.372 1.00 36.58  ? 475  TYR A CG    1 
ATOM   3761 C  CD1   . TYR A 1 493 ? 16.725  43.857 51.005 1.00 37.95  ? 475  TYR A CD1   1 
ATOM   3762 C  CD2   . TYR A 1 493 ? 15.510  42.027 51.981 1.00 34.48  ? 475  TYR A CD2   1 
ATOM   3763 C  CE1   . TYR A 1 493 ? 15.635  44.708 51.254 1.00 37.58  ? 475  TYR A CE1   1 
ATOM   3764 C  CE2   . TYR A 1 493 ? 14.436  42.866 52.240 1.00 32.61  ? 475  TYR A CE2   1 
ATOM   3765 C  CZ    . TYR A 1 493 ? 14.503  44.194 51.868 1.00 34.92  ? 475  TYR A CZ    1 
ATOM   3766 O  OH    . TYR A 1 493 ? 13.430  44.999 52.135 1.00 38.03  ? 475  TYR A OH    1 
ATOM   3767 N  N     . LEU A 1 494 ? 18.062  41.880 54.339 1.00 36.62  ? 476  LEU A N     1 
ATOM   3768 C  CA    . LEU A 1 494 ? 17.454  41.358 55.561 1.00 35.89  ? 476  LEU A CA    1 
ATOM   3769 C  C     . LEU A 1 494 ? 15.928  41.551 55.506 1.00 33.71  ? 476  LEU A C     1 
ATOM   3770 O  O     . LEU A 1 494 ? 15.438  42.679 55.625 1.00 33.68  ? 476  LEU A O     1 
ATOM   3771 C  CB    . LEU A 1 494 ? 18.097  41.967 56.814 1.00 36.48  ? 476  LEU A CB    1 
ATOM   3772 C  CG    . LEU A 1 494 ? 17.490  41.742 58.211 1.00 37.73  ? 476  LEU A CG    1 
ATOM   3773 C  CD1   . LEU A 1 494 ? 17.206  40.272 58.599 1.00 35.55  ? 476  LEU A CD1   1 
ATOM   3774 C  CD2   . LEU A 1 494 ? 18.407  42.365 59.221 1.00 40.25  ? 476  LEU A CD2   1 
ATOM   3775 N  N     . PHE A 1 495 ? 15.191  40.457 55.265 1.00 40.48  ? 477  PHE A N     1 
ATOM   3776 C  CA    . PHE A 1 495 ? 13.737  40.488 55.368 1.00 35.43  ? 477  PHE A CA    1 
ATOM   3777 C  C     . PHE A 1 495 ? 13.372  40.583 56.855 1.00 35.97  ? 477  PHE A C     1 
ATOM   3778 O  O     . PHE A 1 495 ? 13.834  39.780 57.673 1.00 37.10  ? 477  PHE A O     1 
ATOM   3779 C  CB    . PHE A 1 495 ? 13.078  39.268 54.703 1.00 32.53  ? 477  PHE A CB    1 
ATOM   3780 C  CG    . PHE A 1 495 ? 13.380  39.134 53.229 1.00 31.20  ? 477  PHE A CG    1 
ATOM   3781 C  CD1   . PHE A 1 495 ? 12.664  39.866 52.282 1.00 29.63  ? 477  PHE A CD1   1 
ATOM   3782 C  CD2   . PHE A 1 495 ? 14.399  38.293 52.792 1.00 30.86  ? 477  PHE A CD2   1 
ATOM   3783 C  CE1   . PHE A 1 495 ? 12.968  39.777 50.912 1.00 28.99  ? 477  PHE A CE1   1 
ATOM   3784 C  CE2   . PHE A 1 495 ? 14.685  38.162 51.417 1.00 31.05  ? 477  PHE A CE2   1 
ATOM   3785 C  CZ    . PHE A 1 495 ? 13.972  38.911 50.477 1.00 30.97  ? 477  PHE A CZ    1 
ATOM   3786 N  N     A ARG A 1 496 ? 12.520  41.547 57.186 0.50 35.61  ? 478  ARG A N     1 
ATOM   3787 N  N     B ARG A 1 496 ? 12.579  41.595 57.204 0.50 36.07  ? 478  ARG A N     1 
ATOM   3788 C  CA    A ARG A 1 496 ? 12.198  41.863 58.572 0.50 36.29  ? 478  ARG A CA    1 
ATOM   3789 C  CA    B ARG A 1 496 ? 12.203  41.878 58.594 0.50 36.84  ? 478  ARG A CA    1 
ATOM   3790 C  C     A ARG A 1 496 ? 10.703  41.714 58.808 0.50 33.77  ? 478  ARG A C     1 
ATOM   3791 C  C     B ARG A 1 496 ? 10.709  41.655 58.775 0.50 33.93  ? 478  ARG A C     1 
ATOM   3792 O  O     A ARG A 1 496 ? 9.897   42.214 58.025 0.50 34.64  ? 478  ARG A O     1 
ATOM   3793 O  O     B ARG A 1 496 ? 9.913   42.047 57.923 0.50 34.53  ? 478  ARG A O     1 
ATOM   3794 C  CB    A ARG A 1 496 ? 12.592  43.310 58.885 0.50 40.87  ? 478  ARG A CB    1 
ATOM   3795 C  CB    B ARG A 1 496 ? 12.503  43.344 58.957 0.50 41.32  ? 478  ARG A CB    1 
ATOM   3796 C  CG    A ARG A 1 496 ? 14.045  43.679 58.622 0.50 46.30  ? 478  ARG A CG    1 
ATOM   3797 C  CG    B ARG A 1 496 ? 13.848  43.645 59.634 0.50 48.25  ? 478  ARG A CG    1 
ATOM   3798 C  CD    A ARG A 1 496 ? 14.285  45.180 58.868 0.50 54.25  ? 478  ARG A CD    1 
ATOM   3799 C  CD    B ARG A 1 496 ? 13.803  44.991 60.431 0.50 53.84  ? 478  ARG A CD    1 
ATOM   3800 N  NE    A ARG A 1 496 ? 14.596  45.905 57.634 0.50 61.50  ? 478  ARG A NE    1 
ATOM   3801 N  NE    B ARG A 1 496 ? 13.429  44.782 61.833 0.50 55.95  ? 478  ARG A NE    1 
ATOM   3802 C  CZ    A ARG A 1 496 ? 13.707  46.450 56.802 0.50 61.81  ? 478  ARG A CZ    1 
ATOM   3803 C  CZ    B ARG A 1 496 ? 12.184  44.831 62.317 0.50 53.01  ? 478  ARG A CZ    1 
ATOM   3804 N  NH1   A ARG A 1 496 ? 12.402  46.381 57.039 0.50 59.08  ? 478  ARG A NH1   1 
ATOM   3805 N  NH1   B ARG A 1 496 ? 11.155  45.116 61.523 0.50 51.55  ? 478  ARG A NH1   1 
ATOM   3806 N  NH2   A ARG A 1 496 ? 14.138  47.077 55.717 0.50 67.25  ? 478  ARG A NH2   1 
ATOM   3807 N  NH2   B ARG A 1 496 ? 11.965  44.601 63.608 0.50 51.15  ? 478  ARG A NH2   1 
ATOM   3808 N  N     . ALA A 1 497 ? 10.336  41.025 59.881 1.00 32.60  ? 479  ALA A N     1 
ATOM   3809 C  CA    . ALA A 1 497 ? 8.954   40.980 60.342 1.00 32.90  ? 479  ALA A CA    1 
ATOM   3810 C  C     . ALA A 1 497 ? 8.980   41.570 61.763 1.00 34.71  ? 479  ALA A C     1 
ATOM   3811 O  O     . ALA A 1 497 ? 9.962   41.368 62.488 1.00 36.25  ? 479  ALA A O     1 
ATOM   3812 C  CB    . ALA A 1 497 ? 8.445   39.582 60.353 1.00 30.98  ? 479  ALA A CB    1 
ATOM   3813 N  N     . ALA A 1 498 ? 7.947   42.316 62.164 1.00 37.71  ? 480  ALA A N     1 
ATOM   3814 C  CA    . ALA A 1 498 ? 7.917   42.914 63.533 1.00 40.03  ? 480  ALA A CA    1 
ATOM   3815 C  C     . ALA A 1 498 ? 7.902   41.818 64.578 1.00 38.73  ? 480  ALA A C     1 
ATOM   3816 O  O     . ALA A 1 498 ? 7.278   40.780 64.337 1.00 36.76  ? 480  ALA A O     1 
ATOM   3817 C  CB    . ALA A 1 498 ? 6.704   43.764 63.716 1.00 42.80  ? 480  ALA A CB    1 
ATOM   3818 N  N     . HIS A 1 499 ? 8.553   42.046 65.731 1.00 41.44  ? 481  HIS A N     1 
ATOM   3819 C  CA    . HIS A 1 499 ? 8.455   41.110 66.872 1.00 41.64  ? 481  HIS A CA    1 
ATOM   3820 C  C     . HIS A 1 499 ? 7.001   41.027 67.299 1.00 39.18  ? 481  HIS A C     1 
ATOM   3821 O  O     . HIS A 1 499 ? 6.252   42.000 67.205 1.00 41.05  ? 481  HIS A O     1 
ATOM   3822 C  CB    . HIS A 1 499 ? 9.305   41.513 68.087 1.00 45.07  ? 481  HIS A CB    1 
ATOM   3823 C  CG    . HIS A 1 499 ? 10.788  41.565 67.834 1.00 52.68  ? 481  HIS A CG    1 
ATOM   3824 N  ND1   . HIS A 1 499 ? 11.453  40.656 67.034 1.00 54.98  ? 481  HIS A ND1   1 
ATOM   3825 C  CD2   . HIS A 1 499 ? 11.741  42.402 68.323 1.00 60.27  ? 481  HIS A CD2   1 
ATOM   3826 C  CE1   . HIS A 1 499 ? 12.743  40.950 67.016 1.00 62.16  ? 481  HIS A CE1   1 
ATOM   3827 N  NE2   . HIS A 1 499 ? 12.945  42.002 67.794 1.00 65.76  ? 481  HIS A NE2   1 
ATOM   3828 N  N     . VAL A 1 500 ? 6.630   39.846 67.763 1.00 37.64  ? 482  VAL A N     1 
ATOM   3829 C  CA    . VAL A 1 500 ? 5.277   39.561 68.225 1.00 36.48  ? 482  VAL A CA    1 
ATOM   3830 C  C     . VAL A 1 500 ? 5.261   39.725 69.750 1.00 35.38  ? 482  VAL A C     1 
ATOM   3831 O  O     . VAL A 1 500 ? 6.228   39.331 70.451 1.00 36.70  ? 482  VAL A O     1 
ATOM   3832 C  CB    . VAL A 1 500 ? 4.833   38.135 67.782 1.00 37.09  ? 482  VAL A CB    1 
ATOM   3833 C  CG1   . VAL A 1 500 ? 3.418   37.760 68.358 1.00 38.45  ? 482  VAL A CG1   1 
ATOM   3834 C  CG2   . VAL A 1 500 ? 4.886   38.016 66.259 1.00 37.78  ? 482  VAL A CG2   1 
ATOM   3835 N  N     . LEU A 1 501 ? 4.203   40.375 70.242 1.00 34.19  ? 483  LEU A N     1 
ATOM   3836 C  CA    . LEU A 1 501 ? 3.963   40.522 71.673 1.00 32.54  ? 483  LEU A CA    1 
ATOM   3837 C  C     . LEU A 1 501 ? 2.644   39.851 72.007 1.00 30.42  ? 483  LEU A C     1 
ATOM   3838 O  O     . LEU A 1 501 ? 1.713   39.898 71.198 1.00 31.92  ? 483  LEU A O     1 
ATOM   3839 C  CB    . LEU A 1 501 ? 3.915   42.003 72.110 1.00 34.73  ? 483  LEU A CB    1 
ATOM   3840 C  CG    . LEU A 1 501 ? 5.082   42.967 71.879 1.00 40.17  ? 483  LEU A CG    1 
ATOM   3841 C  CD1   . LEU A 1 501 ? 4.732   44.302 72.526 1.00 44.39  ? 483  LEU A CD1   1 
ATOM   3842 C  CD2   . LEU A 1 501 ? 6.377   42.460 72.446 1.00 42.48  ? 483  LEU A CD2   1 
ATOM   3843 N  N     . MET A 1 502 ? 2.588   39.236 73.189 1.00 27.54  ? 484  MET A N     1 
ATOM   3844 C  CA    . MET A 1 502 ? 1.346   38.704 73.765 1.00 27.15  ? 484  MET A CA    1 
ATOM   3845 C  C     . MET A 1 502 ? 0.482   39.861 74.234 1.00 27.09  ? 484  MET A C     1 
ATOM   3846 O  O     . MET A 1 502 ? 1.010   40.933 74.510 1.00 28.86  ? 484  MET A O     1 
ATOM   3847 C  CB    . MET A 1 502 ? 1.671   37.813 74.966 1.00 25.96  ? 484  MET A CB    1 
ATOM   3848 C  CG    . MET A 1 502 ? 2.525   36.608 74.617 1.00 26.95  ? 484  MET A CG    1 
ATOM   3849 S  SD    . MET A 1 502 ? 2.597   35.398 75.933 1.00 31.71  ? 484  MET A SD    1 
ATOM   3850 C  CE    . MET A 1 502 ? 0.900   34.840 76.111 1.00 33.13  ? 484  MET A CE    1 
ATOM   3851 N  N     . PRO A 1 503 ? -0.850  39.668 74.317 1.00 28.34  ? 485  PRO A N     1 
ATOM   3852 C  CA    . PRO A 1 503 ? -1.739  40.664 74.876 1.00 30.54  ? 485  PRO A CA    1 
ATOM   3853 C  C     . PRO A 1 503 ? -1.299  41.313 76.205 1.00 28.80  ? 485  PRO A C     1 
ATOM   3854 O  O     . PRO A 1 503 ? -1.530  42.517 76.401 1.00 32.24  ? 485  PRO A O     1 
ATOM   3855 C  CB    . PRO A 1 503 ? -3.046  39.878 75.064 1.00 33.12  ? 485  PRO A CB    1 
ATOM   3856 C  CG    . PRO A 1 503 ? -3.029  38.979 73.871 1.00 34.62  ? 485  PRO A CG    1 
ATOM   3857 C  CD    . PRO A 1 503 ? -1.608  38.505 73.821 1.00 29.91  ? 485  PRO A CD    1 
ATOM   3858 N  N     . HIS A 1 504 ? -0.690  40.552 77.105 1.00 25.69  ? 486  HIS A N     1 
ATOM   3859 C  CA    . HIS A 1 504 ? -0.299  41.153 78.399 1.00 26.58  ? 486  HIS A CA    1 
ATOM   3860 C  C     . HIS A 1 504 ? 1.028   41.938 78.311 1.00 28.55  ? 486  HIS A C     1 
ATOM   3861 O  O     . HIS A 1 504 ? 1.373   42.681 79.230 1.00 30.17  ? 486  HIS A O     1 
ATOM   3862 C  CB    . HIS A 1 504 ? -0.214  40.105 79.507 1.00 22.97  ? 486  HIS A CB    1 
ATOM   3863 C  CG    . HIS A 1 504 ? 1.027   39.278 79.454 1.00 21.51  ? 486  HIS A CG    1 
ATOM   3864 N  ND1   . HIS A 1 504 ? 1.104   38.107 78.734 1.00 19.80  ? 486  HIS A ND1   1 
ATOM   3865 C  CD2   . HIS A 1 504 ? 2.238   39.448 80.033 1.00 20.49  ? 486  HIS A CD2   1 
ATOM   3866 C  CE1   . HIS A 1 504 ? 2.304   37.577 78.896 1.00 19.25  ? 486  HIS A CE1   1 
ATOM   3867 N  NE2   . HIS A 1 504 ? 3.021   38.389 79.651 1.00 22.46  ? 486  HIS A NE2   1 
ATOM   3868 N  N     . GLU A 1 505 ? 1.764   41.724 77.218 1.00 28.65  ? 487  GLU A N     1 
ATOM   3869 C  CA    . GLU A 1 505 ? 3.044   42.398 76.968 1.00 32.66  ? 487  GLU A CA    1 
ATOM   3870 C  C     . GLU A 1 505 ? 2.877   43.777 76.270 1.00 39.30  ? 487  GLU A C     1 
ATOM   3871 O  O     . GLU A 1 505 ? 3.812   44.584 76.240 1.00 44.53  ? 487  GLU A O     1 
ATOM   3872 C  CB    . GLU A 1 505 ? 3.959   41.472 76.149 1.00 30.15  ? 487  GLU A CB    1 
ATOM   3873 C  CG    . GLU A 1 505 ? 4.369   40.225 76.910 1.00 24.89  ? 487  GLU A CG    1 
ATOM   3874 C  CD    . GLU A 1 505 ? 5.144   39.254 76.078 1.00 25.01  ? 487  GLU A CD    1 
ATOM   3875 O  OE1   . GLU A 1 505 ? 5.050   39.279 74.809 1.00 27.76  ? 487  GLU A OE1   1 
ATOM   3876 O  OE2   . GLU A 1 505 ? 5.885   38.456 76.686 1.00 27.57  ? 487  GLU A OE2   1 
ATOM   3877 N  N     . SER A 1 506 ? 1.684   44.015 75.709 1.00 42.30  ? 488  SER A N     1 
ATOM   3878 C  CA    . SER A 1 506 ? 1.292   45.288 75.091 1.00 50.22  ? 488  SER A CA    1 
ATOM   3879 C  C     . SER A 1 506 ? 0.625   46.152 76.150 1.00 55.50  ? 488  SER A C     1 
ATOM   3880 O  O     . SER A 1 506 ? 1.031   47.290 76.378 1.00 63.69  ? 488  SER A O     1 
ATOM   3881 C  CB    . SER A 1 506 ? 0.299   45.043 73.963 1.00 51.03  ? 488  SER A CB    1 
ATOM   3882 O  OG    . SER A 1 506 ? 0.667   43.898 73.223 1.00 47.46  ? 488  SER A OG    1 
HETATM 3883 P  P     . 5GP B 2 .   ? 7.063   18.548 42.765 1.00 29.83  ? 1489 5GP A P     1 
HETATM 3884 O  O1P   . 5GP B 2 .   ? 8.093   18.873 41.700 1.00 26.09  ? 1489 5GP A O1P   1 
HETATM 3885 O  O2P   . 5GP B 2 .   ? 5.932   19.531 42.886 1.00 21.59  ? 1489 5GP A O2P   1 
HETATM 3886 O  O3P   . 5GP B 2 .   ? 7.677   18.048 44.071 1.00 22.77  ? 1489 5GP A O3P   1 
HETATM 3887 O  "O5'" . 5GP B 2 .   ? 6.254   17.249 42.267 1.00 27.97  ? 1489 5GP A "O5'" 1 
HETATM 3888 C  "C5'" . 5GP B 2 .   ? 5.306   17.236 41.231 1.00 27.71  ? 1489 5GP A "C5'" 1 
HETATM 3889 C  "C4'" . 5GP B 2 .   ? 5.018   15.792 40.875 1.00 26.98  ? 1489 5GP A "C4'" 1 
HETATM 3890 O  "O4'" . 5GP B 2 .   ? 3.960   15.402 41.727 1.00 24.86  ? 1489 5GP A "O4'" 1 
HETATM 3891 C  "C3'" . 5GP B 2 .   ? 4.524   15.630 39.432 1.00 26.87  ? 1489 5GP A "C3'" 1 
HETATM 3892 O  "O3'" . 5GP B 2 .   ? 5.102   14.482 38.804 1.00 27.94  ? 1489 5GP A "O3'" 1 
HETATM 3893 C  "C2'" . 5GP B 2 .   ? 3.056   15.351 39.600 1.00 26.70  ? 1489 5GP A "C2'" 1 
HETATM 3894 O  "O2'" . 5GP B 2 .   ? 2.571   14.484 38.575 1.00 27.96  ? 1489 5GP A "O2'" 1 
HETATM 3895 C  "C1'" . 5GP B 2 .   ? 2.992   14.699 40.969 1.00 26.54  ? 1489 5GP A "C1'" 1 
HETATM 3896 N  N9    . 5GP B 2 .   ? 1.628   14.820 41.567 1.00 25.71  ? 1489 5GP A N9    1 
HETATM 3897 C  C8    . 5GP B 2 .   ? 1.005   15.948 41.970 1.00 27.26  ? 1489 5GP A C8    1 
HETATM 3898 N  N7    . 5GP B 2 .   ? -0.225  15.646 42.440 1.00 27.04  ? 1489 5GP A N7    1 
HETATM 3899 C  C5    . 5GP B 2 .   ? -0.369  14.309 42.372 1.00 26.12  ? 1489 5GP A C5    1 
HETATM 3900 C  C6    . 5GP B 2 .   ? -1.390  13.447 42.732 1.00 28.55  ? 1489 5GP A C6    1 
HETATM 3901 O  O6    . 5GP B 2 .   ? -2.446  13.925 43.226 1.00 29.23  ? 1489 5GP A O6    1 
HETATM 3902 N  N1    . 5GP B 2 .   ? -1.249  12.111 42.532 1.00 28.10  ? 1489 5GP A N1    1 
HETATM 3903 C  C2    . 5GP B 2 .   ? -0.090  11.642 41.985 1.00 28.01  ? 1489 5GP A C2    1 
HETATM 3904 N  N2    . 5GP B 2 .   ? 0.116   10.323 41.787 1.00 26.72  ? 1489 5GP A N2    1 
HETATM 3905 N  N3    . 5GP B 2 .   ? 0.920   12.474 41.628 1.00 26.28  ? 1489 5GP A N3    1 
HETATM 3906 C  C4    . 5GP B 2 .   ? 0.797   13.805 41.806 1.00 26.02  ? 1489 5GP A C4    1 
HETATM 3907 P  PA    . B4P C 3 .   ? 2.903   20.660 67.394 0.50 28.58  ? 1490 B4P A PA    1 
HETATM 3908 O  O1A   . B4P C 3 .   ? 3.997   20.713 66.244 0.50 24.27  ? 1490 B4P A O1A   1 
HETATM 3909 O  O2A   . B4P C 3 .   ? 2.980   21.794 68.377 0.50 27.44  ? 1490 B4P A O2A   1 
HETATM 3910 O  O3A   . B4P C 3 .   ? 1.532   20.705 66.742 0.50 26.20  ? 1490 B4P A O3A   1 
HETATM 3911 P  PB    . B4P C 3 .   ? 0.200   21.358 67.362 0.50 28.54  ? 1490 B4P A PB    1 
HETATM 3912 O  O1B   . B4P C 3 .   ? 0.432   22.835 68.108 0.50 27.74  ? 1490 B4P A O1B   1 
HETATM 3913 O  O2B   . B4P C 3 .   ? -0.428  20.374 68.283 0.50 26.48  ? 1490 B4P A O2B   1 
HETATM 3914 O  O3B   . B4P C 3 .   ? -0.494  21.840 65.874 0.50 29.62  ? 1490 B4P A O3B   1 
HETATM 3915 P  PG    . B4P C 3 .   ? -0.133  21.139 64.429 0.50 33.17  ? 1490 B4P A PG    1 
HETATM 3916 O  O1G   . B4P C 3 .   ? -0.508  22.165 63.244 0.50 36.38  ? 1490 B4P A O1G   1 
HETATM 3917 O  O2G   . B4P C 3 .   ? 1.303   20.843 64.181 0.50 35.77  ? 1490 B4P A O2G   1 
HETATM 3918 O  O3G   . B4P C 3 .   ? -1.136  19.755 64.247 0.50 29.91  ? 1490 B4P A O3G   1 
HETATM 3919 P  PD    . B4P C 3 .   ? -2.497  20.019 63.483 0.50 24.22  ? 1490 B4P A PD    1 
HETATM 3920 O  O1D   . B4P C 3 .   ? -2.089  21.172 62.646 0.50 24.17  ? 1490 B4P A O1D   1 
HETATM 3921 O  O2D   . B4P C 3 .   ? -3.683  20.104 64.330 0.50 23.51  ? 1490 B4P A O2D   1 
HETATM 3922 O  O5E   . B4P C 3 .   ? 3.059   19.171 68.084 0.50 24.97  ? 1490 B4P A O5E   1 
HETATM 3923 C  C5E   . B4P C 3 .   ? 4.144   18.230 67.950 0.50 21.97  ? 1490 B4P A C5E   1 
HETATM 3924 C  C4E   . B4P C 3 .   ? 3.769   16.966 68.778 0.50 22.47  ? 1490 B4P A C4E   1 
HETATM 3925 O  O4E   . B4P C 3 .   ? 3.882   17.311 70.187 0.50 22.34  ? 1490 B4P A O4E   1 
HETATM 3926 C  C3E   . B4P C 3 .   ? 2.305   16.498 68.586 0.50 21.63  ? 1490 B4P A C3E   1 
HETATM 3927 O  O3E   . B4P C 3 .   ? 2.211   15.085 68.759 0.50 19.68  ? 1490 B4P A O3E   1 
HETATM 3928 C  C2E   . B4P C 3 .   ? 1.523   17.198 69.708 0.50 21.04  ? 1490 B4P A C2E   1 
HETATM 3929 O  O2E   . B4P C 3 .   ? 0.378   16.425 70.114 0.50 23.71  ? 1490 B4P A O2E   1 
HETATM 3930 C  C1E   . B4P C 3 .   ? 2.560   17.217 70.823 0.50 23.10  ? 1490 B4P A C1E   1 
HETATM 3931 N  N9A   . B4P C 3 .   ? 2.460   18.455 71.627 0.50 24.14  ? 1490 B4P A N9A   1 
HETATM 3932 C  C8A   . B4P C 3 .   ? 2.406   19.710 71.159 0.50 24.09  ? 1490 B4P A C8A   1 
HETATM 3933 N  N7A   . B4P C 3 .   ? 2.329   20.549 72.192 0.50 24.54  ? 1490 B4P A N7A   1 
HETATM 3934 C  C5A   . B4P C 3 .   ? 2.317   19.826 73.309 0.50 23.99  ? 1490 B4P A C5A   1 
HETATM 3935 C  C6A   . B4P C 3 .   ? 2.252   20.141 74.664 0.50 23.92  ? 1490 B4P A C6A   1 
HETATM 3936 N  N6A   . B4P C 3 .   ? 2.169   21.421 75.039 0.50 23.43  ? 1490 B4P A N6A   1 
HETATM 3937 N  N1A   . B4P C 3 .   ? 2.268   19.137 75.572 0.50 23.30  ? 1490 B4P A N1A   1 
HETATM 3938 C  C2A   . B4P C 3 .   ? 2.354   17.861 75.206 0.50 23.81  ? 1490 B4P A C2A   1 
HETATM 3939 N  N3A   . B4P C 3 .   ? 2.416   17.535 73.919 0.50 24.82  ? 1490 B4P A N3A   1 
HETATM 3940 C  C4A   . B4P C 3 .   ? 2.405   18.491 72.958 0.50 24.04  ? 1490 B4P A C4A   1 
HETATM 3941 O  O5F   . B4P C 3 .   ? -2.771  18.857 62.418 0.50 23.91  ? 1490 B4P A O5F   1 
HETATM 3942 C  C5F   . B4P C 3 .   ? -3.410  17.619 62.661 0.50 21.65  ? 1490 B4P A C5F   1 
HETATM 3943 C  C4F   . B4P C 3 .   ? -2.902  16.620 61.597 0.50 19.71  ? 1490 B4P A C4F   1 
HETATM 3944 O  O4F   . B4P C 3 .   ? -3.024  17.277 60.292 0.50 18.97  ? 1490 B4P A O4F   1 
HETATM 3945 C  C3F   . B4P C 3 .   ? -1.404  16.364 61.781 0.50 20.18  ? 1490 B4P A C3F   1 
HETATM 3946 O  O3F   . B4P C 3 .   ? -1.120  14.990 61.449 0.50 19.54  ? 1490 B4P A O3F   1 
HETATM 3947 C  C2F   . B4P C 3 .   ? -0.750  17.342 60.780 0.50 16.89  ? 1490 B4P A C2F   1 
HETATM 3948 O  O2F   . B4P C 3 .   ? 0.588   16.919 60.382 0.50 17.10  ? 1490 B4P A O2F   1 
HETATM 3949 C  C1F   . B4P C 3 .   ? -1.731  17.217 59.631 0.50 14.87  ? 1490 B4P A C1F   1 
HETATM 3950 N  N9B   . B4P C 3 .   ? -1.815  18.403 58.724 0.50 15.64  ? 1490 B4P A N9B   1 
HETATM 3951 C  C8B   . B4P C 3 .   ? -1.459  19.661 59.023 0.50 13.92  ? 1490 B4P A C8B   1 
HETATM 3952 N  N7B   . B4P C 3 .   ? -1.697  20.428 57.948 0.50 14.85  ? 1490 B4P A N7B   1 
HETATM 3953 C  C5B   . B4P C 3 .   ? -2.207  19.670 56.979 0.50 13.98  ? 1490 B4P A C5B   1 
HETATM 3954 C  C6B   . B4P C 3 .   ? -2.642  19.923 55.669 0.50 14.76  ? 1490 B4P A C6B   1 
HETATM 3955 N  N6B   . B4P C 3 .   ? -2.573  21.171 55.203 0.50 12.81  ? 1490 B4P A N6B   1 
HETATM 3956 N  N1B   . B4P C 3 .   ? -3.128  18.903 54.906 0.50 14.05  ? 1490 B4P A N1B   1 
HETATM 3957 C  C2B   . B4P C 3 .   ? -3.187  17.659 55.392 0.50 14.64  ? 1490 B4P A C2B   1 
HETATM 3958 N  N3B   . B4P C 3 .   ? -2.788  17.401 56.646 0.50 14.97  ? 1490 B4P A N3B   1 
HETATM 3959 C  C4B   . B4P C 3 .   ? -2.290  18.376 57.459 0.50 14.44  ? 1490 B4P A C4B   1 
HETATM 3960 C  C1    . GOL D 4 .   ? -9.945  31.984 43.800 1.00 41.34  ? 1491 GOL A C1    1 
HETATM 3961 O  O1    . GOL D 4 .   ? -9.981  31.104 42.702 1.00 42.08  ? 1491 GOL A O1    1 
HETATM 3962 C  C2    . GOL D 4 .   ? -9.006  33.021 43.223 1.00 43.56  ? 1491 GOL A C2    1 
HETATM 3963 O  O2    . GOL D 4 .   ? -9.454  34.342 43.395 1.00 48.81  ? 1491 GOL A O2    1 
HETATM 3964 C  C3    . GOL D 4 .   ? -7.539  32.789 43.563 1.00 41.57  ? 1491 GOL A C3    1 
HETATM 3965 O  O3    . GOL D 4 .   ? -7.449  32.120 44.791 1.00 34.52  ? 1491 GOL A O3    1 
HETATM 3966 C  C1    A GOL E 4 .   ? 14.003  30.157 63.049 0.50 25.26  ? 1492 GOL A C1    1 
HETATM 3967 C  C1    B GOL E 4 .   ? 14.948  31.685 63.516 0.50 43.78  ? 1492 GOL A C1    1 
HETATM 3968 O  O1    A GOL E 4 .   ? 14.611  29.727 61.847 0.50 22.99  ? 1492 GOL A O1    1 
HETATM 3969 O  O1    B GOL E 4 .   ? 15.864  30.877 62.786 0.50 41.53  ? 1492 GOL A O1    1 
HETATM 3970 C  C2    A GOL E 4 .   ? 12.493  29.899 63.212 0.50 23.16  ? 1492 GOL A C2    1 
HETATM 3971 C  C2    B GOL E 4 .   ? 13.469  31.379 63.205 0.50 43.38  ? 1492 GOL A C2    1 
HETATM 3972 O  O2    A GOL E 4 .   ? 12.003  30.780 64.211 0.50 22.29  ? 1492 GOL A O2    1 
HETATM 3973 O  O2    B GOL E 4 .   ? 12.645  32.496 63.477 0.50 44.26  ? 1492 GOL A O2    1 
HETATM 3974 C  C3    A GOL E 4 .   ? 11.717  30.149 61.931 0.50 23.85  ? 1492 GOL A C3    1 
HETATM 3975 C  C3    B GOL E 4 .   ? 13.234  30.870 61.775 0.50 42.09  ? 1492 GOL A C3    1 
HETATM 3976 O  O3    A GOL E 4 .   ? 10.488  29.456 61.989 0.50 23.87  ? 1492 GOL A O3    1 
HETATM 3977 O  O3    B GOL E 4 .   ? 12.249  31.615 61.081 0.50 39.22  ? 1492 GOL A O3    1 
HETATM 3978 C  C1    . GOL F 4 .   ? 8.452   33.004 36.847 1.00 67.85  ? 1493 GOL A C1    1 
HETATM 3979 O  O1    . GOL F 4 .   ? 9.869   32.926 36.897 1.00 67.70  ? 1493 GOL A O1    1 
HETATM 3980 C  C2    . GOL F 4 .   ? 7.873   31.629 36.492 1.00 67.28  ? 1493 GOL A C2    1 
HETATM 3981 O  O2    . GOL F 4 .   ? 8.607   30.592 37.110 1.00 67.81  ? 1493 GOL A O2    1 
HETATM 3982 C  C3    . GOL F 4 .   ? 6.383   31.526 36.828 1.00 67.25  ? 1493 GOL A C3    1 
HETATM 3983 O  O3    . GOL F 4 .   ? 6.030   32.203 38.018 1.00 65.41  ? 1493 GOL A O3    1 
HETATM 3984 C  C1    . GOL G 4 .   ? -3.279  15.755 51.358 1.00 31.78  ? 1494 GOL A C1    1 
HETATM 3985 O  O1    . GOL G 4 .   ? -4.084  16.667 52.093 1.00 23.29  ? 1494 GOL A O1    1 
HETATM 3986 C  C2    . GOL G 4 .   ? -1.853  16.301 51.327 1.00 34.95  ? 1494 GOL A C2    1 
HETATM 3987 O  O2    . GOL G 4 .   ? -0.910  15.316 51.006 1.00 43.48  ? 1494 GOL A O2    1 
HETATM 3988 C  C3    . GOL G 4 .   ? -1.664  17.359 50.277 1.00 32.10  ? 1494 GOL A C3    1 
HETATM 3989 O  O3    . GOL G 4 .   ? -2.906  17.644 49.721 1.00 39.85  ? 1494 GOL A O3    1 
HETATM 3990 C  C1    . GOL H 4 .   ? 19.187  17.348 28.328 1.00 59.04  ? 1495 GOL A C1    1 
HETATM 3991 O  O1    . GOL H 4 .   ? 18.865  16.518 29.425 1.00 55.27  ? 1495 GOL A O1    1 
HETATM 3992 C  C2    . GOL H 4 .   ? 19.561  18.743 28.838 1.00 59.53  ? 1495 GOL A C2    1 
HETATM 3993 O  O2    . GOL H 4 .   ? 20.803  18.745 29.506 1.00 59.34  ? 1495 GOL A O2    1 
HETATM 3994 C  C3    . GOL H 4 .   ? 19.607  19.734 27.692 1.00 60.32  ? 1495 GOL A C3    1 
HETATM 3995 O  O3    . GOL H 4 .   ? 18.319  20.290 27.643 1.00 63.19  ? 1495 GOL A O3    1 
HETATM 3996 C  C1    . GOL I 4 .   ? 11.262  7.267  37.770 1.00 48.77  ? 1496 GOL A C1    1 
HETATM 3997 O  O1    . GOL I 4 .   ? 10.608  7.051  38.997 1.00 45.99  ? 1496 GOL A O1    1 
HETATM 3998 C  C2    . GOL I 4 .   ? 12.653  6.647  37.791 1.00 47.42  ? 1496 GOL A C2    1 
HETATM 3999 O  O2    . GOL I 4 .   ? 12.615  5.567  36.876 1.00 51.74  ? 1496 GOL A O2    1 
HETATM 4000 C  C3    . GOL I 4 .   ? 13.734  7.671  37.409 1.00 43.70  ? 1496 GOL A C3    1 
HETATM 4001 O  O3    . GOL I 4 .   ? 13.455  8.934  37.994 1.00 37.24  ? 1496 GOL A O3    1 
HETATM 4002 C  C1    . GOL J 4 .   ? 25.922  16.984 41.032 1.00 48.20  ? 1497 GOL A C1    1 
HETATM 4003 O  O1    . GOL J 4 .   ? 26.946  17.680 41.727 1.00 52.48  ? 1497 GOL A O1    1 
HETATM 4004 C  C2    . GOL J 4 .   ? 25.375  17.966 40.008 1.00 48.01  ? 1497 GOL A C2    1 
HETATM 4005 O  O2    . GOL J 4 .   ? 26.354  18.230 39.019 1.00 48.06  ? 1497 GOL A O2    1 
HETATM 4006 C  C3    . GOL J 4 .   ? 24.040  17.511 39.429 1.00 45.70  ? 1497 GOL A C3    1 
HETATM 4007 O  O3    . GOL J 4 .   ? 24.268  16.703 38.295 1.00 44.43  ? 1497 GOL A O3    1 
HETATM 4008 C  C1    . GOL K 4 .   ? 3.876   9.598  41.016 1.00 53.37  ? 1498 GOL A C1    1 
HETATM 4009 O  O1    . GOL K 4 .   ? 2.499   9.358  40.861 1.00 52.81  ? 1498 GOL A O1    1 
HETATM 4010 C  C2    . GOL K 4 .   ? 4.084   11.103 41.017 1.00 54.35  ? 1498 GOL A C2    1 
HETATM 4011 O  O2    . GOL K 4 .   ? 4.390   11.563 42.319 1.00 51.79  ? 1498 GOL A O2    1 
HETATM 4012 C  C3    . GOL K 4 .   ? 5.169   11.479 40.011 1.00 55.14  ? 1498 GOL A C3    1 
HETATM 4013 O  O3    . GOL K 4 .   ? 4.665   11.271 38.714 1.00 56.04  ? 1498 GOL A O3    1 
HETATM 4014 MG MG    . MG  L 5 .   ? 5.396   21.255 43.533 1.00 21.36  ? 1499 MG  A MG    1 
HETATM 4015 O  O     . HOH M 6 .   ? 7.903   22.122 65.316 1.00 33.12  ? 2001 HOH A O     1 
HETATM 4016 O  O     . HOH M 6 .   ? 22.968  14.740 33.828 1.00 47.69  ? 2002 HOH A O     1 
HETATM 4017 O  O     . HOH M 6 .   ? 5.284   8.062  44.413 1.00 55.69  ? 2003 HOH A O     1 
HETATM 4018 O  O     . HOH M 6 .   ? 5.427   37.387 38.788 1.00 36.25  ? 2004 HOH A O     1 
HETATM 4019 O  O     . HOH M 6 .   ? -1.781  31.896 31.264 1.00 28.38  ? 2005 HOH A O     1 
HETATM 4020 O  O     . HOH M 6 .   ? 8.087   32.628 26.661 1.00 51.70  ? 2006 HOH A O     1 
HETATM 4021 O  O     . HOH M 6 .   ? 15.343  37.658 29.257 1.00 55.45  ? 2007 HOH A O     1 
HETATM 4022 O  O     . HOH M 6 .   ? 12.533  47.636 36.086 1.00 45.67  ? 2008 HOH A O     1 
HETATM 4023 O  O     . HOH M 6 .   ? 6.308   35.905 36.626 1.00 35.48  ? 2009 HOH A O     1 
HETATM 4024 O  O     . HOH M 6 .   ? 8.652   50.125 37.909 1.00 49.18  ? 2010 HOH A O     1 
HETATM 4025 O  O     . HOH M 6 .   ? 5.045   31.354 26.893 1.00 65.14  ? 2011 HOH A O     1 
HETATM 4026 O  O     . HOH M 6 .   ? -0.762  41.486 33.925 1.00 42.96  ? 2012 HOH A O     1 
HETATM 4027 O  O     . HOH M 6 .   ? 10.772  35.641 29.044 1.00 46.41  ? 2013 HOH A O     1 
HETATM 4028 O  O     . HOH M 6 .   ? 2.818   35.337 61.793 1.00 47.11  ? 2014 HOH A O     1 
HETATM 4029 O  O     . HOH M 6 .   ? 12.571  37.743 29.834 1.00 49.14  ? 2015 HOH A O     1 
HETATM 4030 O  O     . HOH M 6 .   ? 11.283  42.826 35.059 1.00 41.99  ? 2016 HOH A O     1 
HETATM 4031 O  O     . HOH M 6 .   ? 16.563  38.771 31.237 1.00 47.35  ? 2017 HOH A O     1 
HETATM 4032 O  O     . HOH M 6 .   ? 16.450  51.968 34.477 1.00 45.53  ? 2018 HOH A O     1 
HETATM 4033 O  O     . HOH M 6 .   ? 13.550  45.713 37.536 1.00 43.22  ? 2019 HOH A O     1 
HETATM 4034 O  O     . HOH M 6 .   ? 12.933  43.734 36.229 1.00 45.51  ? 2020 HOH A O     1 
HETATM 4035 O  O     . HOH M 6 .   ? 19.068  48.486 32.535 1.00 53.25  ? 2021 HOH A O     1 
HETATM 4036 O  O     . HOH M 6 .   ? 11.568  49.506 37.944 1.00 43.23  ? 2022 HOH A O     1 
HETATM 4037 O  O     . HOH M 6 .   ? -9.812  26.365 29.005 1.00 47.90  ? 2023 HOH A O     1 
HETATM 4038 O  O     . HOH M 6 .   ? 8.611   41.064 35.575 1.00 41.28  ? 2024 HOH A O     1 
HETATM 4039 O  O     . HOH M 6 .   ? 14.441  48.357 50.494 1.00 53.19  ? 2025 HOH A O     1 
HETATM 4040 O  O     . HOH M 6 .   ? -4.476  16.394 21.954 1.00 49.94  ? 2026 HOH A O     1 
HETATM 4041 O  O     . HOH M 6 .   ? 15.024  22.156 23.724 1.00 35.99  ? 2027 HOH A O     1 
HETATM 4042 O  O     . HOH M 6 .   ? 3.357   38.397 40.474 1.00 43.87  ? 2028 HOH A O     1 
HETATM 4043 O  O     . HOH M 6 .   ? -11.949 34.182 35.734 1.00 47.16  ? 2029 HOH A O     1 
HETATM 4044 O  O     . HOH M 6 .   ? 1.675   45.410 52.070 1.00 53.36  ? 2030 HOH A O     1 
HETATM 4045 O  O     . HOH M 6 .   ? 4.355   38.599 45.466 1.00 21.97  ? 2031 HOH A O     1 
HETATM 4046 O  O     . HOH M 6 .   ? 8.171   42.659 52.426 1.00 41.89  ? 2032 HOH A O     1 
HETATM 4047 O  O     . HOH M 6 .   ? -19.260 6.670  54.670 1.00 37.99  ? 2033 HOH A O     1 
HETATM 4048 O  O     . HOH M 6 .   ? -16.282 9.117  58.831 1.00 44.46  ? 2034 HOH A O     1 
HETATM 4049 O  O     . HOH M 6 .   ? 6.218   41.668 54.254 1.00 25.16  ? 2035 HOH A O     1 
HETATM 4050 O  O     . HOH M 6 .   ? 5.524   40.475 58.754 1.00 42.75  ? 2036 HOH A O     1 
HETATM 4051 O  O     . HOH M 6 .   ? 2.665   37.120 59.516 1.00 23.92  ? 2037 HOH A O     1 
HETATM 4052 O  O     . HOH M 6 .   ? 5.961   36.747 63.224 1.00 43.72  ? 2038 HOH A O     1 
HETATM 4053 O  O     . HOH M 6 .   ? 26.239  -0.467 52.284 1.00 40.64  ? 2039 HOH A O     1 
HETATM 4054 O  O     . HOH M 6 .   ? 5.621   33.687 63.503 1.00 39.43  ? 2040 HOH A O     1 
HETATM 4055 O  O     . HOH M 6 .   ? 10.634  37.499 63.017 1.00 28.22  ? 2041 HOH A O     1 
HETATM 4056 O  O     . HOH M 6 .   ? 17.687  34.915 59.990 1.00 25.29  ? 2042 HOH A O     1 
HETATM 4057 O  O     . HOH M 6 .   ? 18.660  33.680 57.735 1.00 40.18  ? 2043 HOH A O     1 
HETATM 4058 O  O     . HOH M 6 .   ? 23.011  34.157 50.253 1.00 38.53  ? 2044 HOH A O     1 
HETATM 4059 O  O     . HOH M 6 .   ? 27.436  26.943 50.370 1.00 48.18  ? 2045 HOH A O     1 
HETATM 4060 O  O     . HOH M 6 .   ? -4.263  45.111 64.892 1.00 43.50  ? 2046 HOH A O     1 
HETATM 4061 O  O     . HOH M 6 .   ? -17.515 16.444 65.347 1.00 48.32  ? 2047 HOH A O     1 
HETATM 4062 O  O     . HOH M 6 .   ? -19.645 18.353 66.055 1.00 36.98  ? 2048 HOH A O     1 
HETATM 4063 O  O     . HOH M 6 .   ? -7.772  10.035 52.749 1.00 54.54  ? 2049 HOH A O     1 
HETATM 4064 O  O     . HOH M 6 .   ? 2.993   17.624 36.403 1.00 29.47  ? 2050 HOH A O     1 
HETATM 4065 O  O     . HOH M 6 .   ? 2.005   18.507 44.542 1.00 20.32  ? 2051 HOH A O     1 
HETATM 4066 O  O     . HOH M 6 .   ? 7.112   30.606 40.946 1.00 22.78  ? 2052 HOH A O     1 
HETATM 4067 O  O     . HOH M 6 .   ? 7.260   28.291 35.052 1.00 21.60  ? 2053 HOH A O     1 
HETATM 4068 O  O     . HOH M 6 .   ? -2.551  25.644 36.394 1.00 19.40  ? 2054 HOH A O     1 
HETATM 4069 O  O     . HOH M 6 .   ? -21.918 20.214 35.858 1.00 41.97  ? 2055 HOH A O     1 
HETATM 4070 O  O     . HOH M 6 .   ? -6.218  32.428 31.089 1.00 43.75  ? 2056 HOH A O     1 
HETATM 4071 O  O     . HOH M 6 .   ? -7.550  30.838 36.537 1.00 34.64  ? 2057 HOH A O     1 
HETATM 4072 O  O     . HOH M 6 .   ? -6.551  31.290 28.365 1.00 46.82  ? 2058 HOH A O     1 
HETATM 4073 O  O     . HOH M 6 .   ? -4.674  27.931 25.116 1.00 53.72  ? 2059 HOH A O     1 
HETATM 4074 O  O     . HOH M 6 .   ? -3.407  30.617 29.612 1.00 37.76  ? 2060 HOH A O     1 
HETATM 4075 O  O     . HOH M 6 .   ? -6.830  22.523 28.213 1.00 41.82  ? 2061 HOH A O     1 
HETATM 4076 O  O     . HOH M 6 .   ? -26.023 2.470  53.923 1.00 47.72  ? 2062 HOH A O     1 
HETATM 4077 O  O     . HOH M 6 .   ? -4.203  19.292 36.585 1.00 27.87  ? 2063 HOH A O     1 
HETATM 4078 O  O     . HOH M 6 .   ? -11.735 25.779 31.516 1.00 40.23  ? 2064 HOH A O     1 
HETATM 4079 O  O     . HOH M 6 .   ? -2.169  4.630  39.824 1.00 37.23  ? 2065 HOH A O     1 
HETATM 4080 O  O     . HOH M 6 .   ? -9.054  1.604  48.863 1.00 56.32  ? 2066 HOH A O     1 
HETATM 4081 O  O     . HOH M 6 .   ? -7.454  3.632  49.799 1.00 49.79  ? 2067 HOH A O     1 
HETATM 4082 O  O     . HOH M 6 .   ? -13.769 18.696 28.962 1.00 59.53  ? 2068 HOH A O     1 
HETATM 4083 O  O     . HOH M 6 .   ? -13.461 7.146  28.786 1.00 36.83  ? 2069 HOH A O     1 
HETATM 4084 O  O     . HOH M 6 .   ? -6.421  10.136 26.713 1.00 54.96  ? 2070 HOH A O     1 
HETATM 4085 O  O     . HOH M 6 .   ? -7.708  9.517  31.017 1.00 24.37  ? 2071 HOH A O     1 
HETATM 4086 O  O     . HOH M 6 .   ? -8.961  13.462 26.540 1.00 43.01  ? 2072 HOH A O     1 
HETATM 4087 O  O     . HOH M 6 .   ? -6.961  3.219  39.582 1.00 46.11  ? 2073 HOH A O     1 
HETATM 4088 O  O     . HOH M 6 .   ? -8.638  4.973  38.463 1.00 30.84  ? 2074 HOH A O     1 
HETATM 4089 O  O     . HOH M 6 .   ? -5.880  16.822 24.944 1.00 50.38  ? 2075 HOH A O     1 
HETATM 4090 O  O     . HOH M 6 .   ? -17.717 2.242  31.066 1.00 50.44  ? 2076 HOH A O     1 
HETATM 4091 O  O     . HOH M 6 .   ? -8.604  4.240  31.655 1.00 31.35  ? 2077 HOH A O     1 
HETATM 4092 O  O     . HOH M 6 .   ? -8.989  6.741  30.625 1.00 34.64  ? 2078 HOH A O     1 
HETATM 4093 O  O     . HOH M 6 .   ? -15.414 -0.348 37.773 1.00 39.12  ? 2079 HOH A O     1 
HETATM 4094 O  O     . HOH M 6 .   ? -22.567 3.792  36.058 1.00 44.40  ? 2080 HOH A O     1 
HETATM 4095 O  O     . HOH M 6 .   ? -19.553 4.355  31.390 1.00 52.04  ? 2081 HOH A O     1 
HETATM 4096 O  O     . HOH M 6 .   ? -22.313 10.149 25.408 1.00 50.75  ? 2082 HOH A O     1 
HETATM 4097 O  O     . HOH M 6 .   ? -17.728 3.554  28.822 1.00 54.18  ? 2083 HOH A O     1 
HETATM 4098 O  O     . HOH M 6 .   ? -23.766 5.845  31.256 1.00 36.41  ? 2084 HOH A O     1 
HETATM 4099 O  O     . HOH M 6 .   ? 1.182   13.908 46.549 1.00 58.86  ? 2085 HOH A O     1 
HETATM 4100 O  O     . HOH M 6 .   ? 7.892   8.631  43.635 1.00 32.87  ? 2086 HOH A O     1 
HETATM 4101 O  O     . HOH M 6 .   ? 7.587   12.281 30.192 1.00 37.46  ? 2087 HOH A O     1 
HETATM 4102 O  O     . HOH M 6 .   ? 13.302  18.101 25.746 1.00 28.67  ? 2088 HOH A O     1 
HETATM 4103 O  O     . HOH M 6 .   ? 12.307  22.049 24.967 1.00 37.72  ? 2089 HOH A O     1 
HETATM 4104 O  O     . HOH M 6 .   ? -17.221 18.972 27.906 1.00 51.33  ? 2090 HOH A O     1 
HETATM 4105 O  O     . HOH M 6 .   ? 17.513  23.252 24.979 1.00 33.01  ? 2091 HOH A O     1 
HETATM 4106 O  O     . HOH M 6 .   ? -13.045 20.567 30.872 1.00 32.47  ? 2092 HOH A O     1 
HETATM 4107 O  O     . HOH M 6 .   ? -8.835  26.786 37.912 1.00 27.37  ? 2093 HOH A O     1 
HETATM 4108 O  O     . HOH M 6 .   ? -13.867 24.337 30.454 1.00 34.80  ? 2094 HOH A O     1 
HETATM 4109 O  O     . HOH M 6 .   ? 13.329  30.121 21.883 1.00 50.28  ? 2095 HOH A O     1 
HETATM 4110 O  O     . HOH M 6 .   ? 18.976  28.606 19.587 1.00 47.99  ? 2096 HOH A O     1 
HETATM 4111 O  O     . HOH M 6 .   ? -12.876 27.687 33.272 1.00 28.01  ? 2097 HOH A O     1 
HETATM 4112 O  O     . HOH M 6 .   ? -9.310  31.308 34.749 1.00 45.14  ? 2098 HOH A O     1 
HETATM 4113 O  O     . HOH M 6 .   ? -11.381 32.077 37.353 1.00 31.20  ? 2099 HOH A O     1 
HETATM 4114 O  O     . HOH M 6 .   ? -9.387  28.476 39.952 1.00 43.27  ? 2100 HOH A O     1 
HETATM 4115 O  O     . HOH M 6 .   ? -9.231  30.990 38.716 1.00 46.66  ? 2101 HOH A O     1 
HETATM 4116 O  O     . HOH M 6 .   ? 27.855  32.869 31.167 1.00 38.46  ? 2102 HOH A O     1 
HETATM 4117 O  O     . HOH M 6 .   ? 28.737  28.600 29.241 1.00 40.63  ? 2103 HOH A O     1 
HETATM 4118 O  O     . HOH M 6 .   ? 23.863  25.886 22.328 1.00 52.45  ? 2104 HOH A O     1 
HETATM 4119 O  O     . HOH M 6 .   ? -9.612  23.095 47.005 1.00 17.58  ? 2105 HOH A O     1 
HETATM 4120 O  O     . HOH M 6 .   ? -13.599 30.139 43.925 1.00 23.04  ? 2106 HOH A O     1 
HETATM 4121 O  O     . HOH M 6 .   ? -10.268 25.540 53.996 1.00 23.48  ? 2107 HOH A O     1 
HETATM 4122 O  O     . HOH M 6 .   ? -6.367  24.747 53.649 1.00 15.06  ? 2108 HOH A O     1 
HETATM 4123 O  O     . HOH M 6 .   ? -19.759 8.595  52.863 1.00 17.47  ? 2109 HOH A O     1 
HETATM 4124 O  O     . HOH M 6 .   ? -15.968 9.128  55.924 1.00 28.68  ? 2110 HOH A O     1 
HETATM 4125 O  O     . HOH M 6 .   ? 20.025  3.124  53.141 1.00 46.57  ? 2111 HOH A O     1 
HETATM 4126 O  O     . HOH M 6 .   ? 14.793  -0.091 46.860 1.00 42.16  ? 2112 HOH A O     1 
HETATM 4127 O  O     . HOH M 6 .   ? -24.946 14.808 52.925 1.00 29.15  ? 2113 HOH A O     1 
HETATM 4128 O  O     . HOH M 6 .   ? -20.068 18.482 47.104 1.00 22.83  ? 2114 HOH A O     1 
HETATM 4129 O  O     . HOH M 6 .   ? 23.863  0.445  51.701 1.00 38.13  ? 2115 HOH A O     1 
HETATM 4130 O  O     . HOH M 6 .   ? -15.430 32.581 50.989 1.00 23.64  ? 2116 HOH A O     1 
HETATM 4131 O  O     . HOH M 6 .   ? 32.030  6.560  48.919 1.00 55.39  ? 2117 HOH A O     1 
HETATM 4132 O  O     . HOH M 6 .   ? -5.026  25.809 65.216 1.00 42.61  ? 2118 HOH A O     1 
HETATM 4133 O  O     . HOH M 6 .   ? -6.576  23.836 65.821 1.00 37.22  ? 2119 HOH A O     1 
HETATM 4134 O  O     . HOH M 6 .   ? -4.579  30.697 63.931 1.00 47.86  ? 2120 HOH A O     1 
HETATM 4135 O  O     . HOH M 6 .   ? -11.329 24.482 67.119 1.00 35.54  ? 2121 HOH A O     1 
HETATM 4136 O  O     . HOH M 6 .   ? -13.294 26.161 67.182 1.00 18.99  ? 2122 HOH A O     1 
HETATM 4137 O  O     . HOH M 6 .   ? -17.880 29.532 61.802 1.00 35.76  ? 2123 HOH A O     1 
HETATM 4138 O  O     . HOH M 6 .   ? -20.600 30.561 58.741 1.00 46.21  ? 2124 HOH A O     1 
HETATM 4139 O  O     . HOH M 6 .   ? -19.387 21.096 46.939 1.00 24.69  ? 2125 HOH A O     1 
HETATM 4140 O  O     . HOH M 6 .   ? -27.458 14.671 47.882 1.00 47.09  ? 2126 HOH A O     1 
HETATM 4141 O  O     . HOH M 6 .   ? -26.399 19.027 45.588 1.00 44.27  ? 2127 HOH A O     1 
HETATM 4142 O  O     . HOH M 6 .   ? -27.378 25.847 41.834 1.00 46.41  ? 2128 HOH A O     1 
HETATM 4143 O  O     . HOH M 6 .   ? -26.436 28.020 46.269 1.00 36.93  ? 2129 HOH A O     1 
HETATM 4144 O  O     . HOH M 6 .   ? -21.956 28.017 52.902 1.00 38.29  ? 2130 HOH A O     1 
HETATM 4145 O  O     . HOH M 6 .   ? -21.899 28.407 56.496 1.00 53.91  ? 2131 HOH A O     1 
HETATM 4146 O  O     . HOH M 6 .   ? -29.179 26.614 53.472 1.00 45.45  ? 2132 HOH A O     1 
HETATM 4147 O  O     . HOH M 6 .   ? -22.373 26.051 68.124 1.00 38.11  ? 2133 HOH A O     1 
HETATM 4148 O  O     . HOH M 6 .   ? -27.448 29.085 63.428 1.00 51.29  ? 2134 HOH A O     1 
HETATM 4149 O  O     . HOH M 6 .   ? -24.845 20.606 55.813 1.00 39.39  ? 2135 HOH A O     1 
HETATM 4150 O  O     . HOH M 6 .   ? -20.127 16.503 61.648 1.00 21.83  ? 2136 HOH A O     1 
HETATM 4151 O  O     . HOH M 6 .   ? -4.321  46.149 61.786 1.00 61.22  ? 2137 HOH A O     1 
HETATM 4152 O  O     . HOH M 6 .   ? -26.281 30.752 61.751 1.00 45.11  ? 2138 HOH A O     1 
HETATM 4153 O  O     . HOH M 6 .   ? -23.066 31.432 63.989 1.00 52.61  ? 2139 HOH A O     1 
HETATM 4154 O  O     . HOH M 6 .   ? -17.939 17.505 62.476 1.00 33.00  ? 2140 HOH A O     1 
HETATM 4155 O  O     . HOH M 6 .   ? -19.691 20.200 64.447 1.00 20.16  ? 2141 HOH A O     1 
HETATM 4156 O  O     . HOH M 6 .   ? -10.370 20.819 64.522 1.00 26.21  ? 2142 HOH A O     1 
HETATM 4157 O  O     . HOH M 6 .   ? -15.494 16.465 62.862 1.00 18.57  ? 2143 HOH A O     1 
HETATM 4158 O  O     . HOH M 6 .   ? -14.641 13.773 63.211 1.00 25.69  ? 2144 HOH A O     1 
HETATM 4159 O  O     . HOH M 6 .   ? -13.925 12.614 69.312 1.00 36.12  ? 2145 HOH A O     1 
HETATM 4160 O  O     . HOH M 6 .   ? -7.768  17.854 58.508 1.00 33.72  ? 2146 HOH A O     1 
HETATM 4161 O  O     . HOH M 6 .   ? -11.249 11.594 65.338 1.00 50.14  ? 2147 HOH A O     1 
HETATM 4162 O  O     . HOH M 6 .   ? -2.650  17.581 66.184 1.00 51.15  ? 2148 HOH A O     1 
HETATM 4163 O  O     . HOH M 6 .   ? -9.407  17.557 65.905 0.50 9.87   ? 2149 HOH A O     1 
HETATM 4164 O  O     . HOH M 6 .   ? -13.012 8.818  60.450 1.00 38.81  ? 2150 HOH A O     1 
HETATM 4165 O  O     . HOH M 6 .   ? -8.616  9.896  61.317 1.00 32.01  ? 2151 HOH A O     1 
HETATM 4166 O  O     . HOH M 6 .   ? -5.475  9.647  58.009 1.00 40.59  ? 2152 HOH A O     1 
HETATM 4167 O  O     . HOH M 6 .   ? -6.337  13.169 54.648 1.00 34.29  ? 2153 HOH A O     1 
HETATM 4168 O  O     . HOH M 6 .   ? -19.999 32.268 50.130 1.00 50.70  ? 2154 HOH A O     1 
HETATM 4169 O  O     . HOH M 6 .   ? -9.572  11.526 53.567 1.00 38.78  ? 2155 HOH A O     1 
HETATM 4170 O  O     . HOH M 6 .   ? -16.718 11.125 61.981 1.00 40.17  ? 2156 HOH A O     1 
HETATM 4171 O  O     . HOH M 6 .   ? -6.987  15.974 56.645 1.00 29.83  ? 2157 HOH A O     1 
HETATM 4172 O  O     . HOH M 6 .   ? -2.846  12.397 48.931 1.00 27.90  ? 2158 HOH A O     1 
HETATM 4173 O  O     . HOH M 6 .   ? -7.514  33.661 64.941 1.00 42.36  ? 2159 HOH A O     1 
HETATM 4174 O  O     . HOH M 6 .   ? -3.951  24.310 53.751 1.00 17.43  ? 2160 HOH A O     1 
HETATM 4175 O  O     . HOH M 6 .   ? -0.291  24.180 48.825 1.00 23.47  ? 2161 HOH A O     1 
HETATM 4176 O  O     . HOH M 6 .   ? -0.480  17.670 44.606 1.00 20.56  ? 2162 HOH A O     1 
HETATM 4177 O  O     . HOH M 6 .   ? -6.858  22.662 45.251 1.00 33.77  ? 2163 HOH A O     1 
HETATM 4178 O  O     . HOH M 6 .   ? -3.838  21.723 38.171 1.00 17.48  ? 2164 HOH A O     1 
HETATM 4179 O  O     . HOH M 6 .   ? -3.977  17.286 38.466 1.00 26.92  ? 2165 HOH A O     1 
HETATM 4180 O  O     . HOH M 6 .   ? -7.252  17.122 40.918 1.00 22.57  ? 2166 HOH A O     1 
HETATM 4181 O  O     . HOH M 6 .   ? 18.949  46.851 51.145 1.00 45.02  ? 2167 HOH A O     1 
HETATM 4182 O  O     . HOH M 6 .   ? -19.988 25.072 37.261 1.00 26.25  ? 2168 HOH A O     1 
HETATM 4183 O  O     . HOH M 6 .   ? -27.562 21.822 39.599 1.00 45.02  ? 2169 HOH A O     1 
HETATM 4184 O  O     . HOH M 6 .   ? -25.790 20.819 43.448 1.00 23.64  ? 2170 HOH A O     1 
HETATM 4185 O  O     . HOH M 6 .   ? -22.903 18.306 37.685 1.00 21.63  ? 2171 HOH A O     1 
HETATM 4186 O  O     . HOH M 6 .   ? -27.338 17.890 37.482 1.00 38.43  ? 2172 HOH A O     1 
HETATM 4187 O  O     . HOH M 6 .   ? -28.113 15.360 37.295 1.00 39.57  ? 2173 HOH A O     1 
HETATM 4188 O  O     . HOH M 6 .   ? -32.209 14.129 45.367 1.00 40.59  ? 2174 HOH A O     1 
HETATM 4189 O  O     . HOH M 6 .   ? -32.538 12.144 42.257 1.00 42.04  ? 2175 HOH A O     1 
HETATM 4190 O  O     . HOH M 6 .   ? -26.934 3.619  36.103 0.50 31.31  ? 2176 HOH A O     1 
HETATM 4191 O  O     . HOH M 6 .   ? -30.461 11.462 43.585 1.00 44.86  ? 2177 HOH A O     1 
HETATM 4192 O  O     . HOH M 6 .   ? -30.347 13.227 51.499 1.00 44.12  ? 2178 HOH A O     1 
HETATM 4193 O  O     . HOH M 6 .   ? -33.566 11.243 46.516 1.00 49.04  ? 2179 HOH A O     1 
HETATM 4194 O  O     . HOH M 6 .   ? -30.059 8.886  54.706 1.00 40.49  ? 2180 HOH A O     1 
HETATM 4195 O  O     . HOH M 6 .   ? -24.244 9.847  59.948 1.00 45.79  ? 2181 HOH A O     1 
HETATM 4196 O  O     . HOH M 6 .   ? -27.246 7.315  57.382 1.00 48.88  ? 2182 HOH A O     1 
HETATM 4197 O  O     . HOH M 6 .   ? -26.753 7.127  54.604 1.00 40.43  ? 2183 HOH A O     1 
HETATM 4198 O  O     . HOH M 6 .   ? -22.070 5.249  54.578 1.00 34.90  ? 2184 HOH A O     1 
HETATM 4199 O  O     . HOH M 6 .   ? -33.227 3.423  44.000 1.00 49.17  ? 2185 HOH A O     1 
HETATM 4200 O  O     . HOH M 6 .   ? -33.400 -7.063 43.814 1.00 41.46  ? 2186 HOH A O     1 
HETATM 4201 O  O     . HOH M 6 .   ? -29.165 -2.562 40.723 1.00 51.49  ? 2187 HOH A O     1 
HETATM 4202 O  O     . HOH M 6 .   ? -20.213 2.537  48.837 1.00 29.67  ? 2188 HOH A O     1 
HETATM 4203 O  O     . HOH M 6 .   ? -17.928 3.918  52.482 1.00 41.73  ? 2189 HOH A O     1 
HETATM 4204 O  O     . HOH M 6 .   ? -12.248 4.701  50.643 1.00 49.74  ? 2190 HOH A O     1 
HETATM 4205 O  O     . HOH M 6 .   ? -13.944 3.141  46.181 1.00 51.63  ? 2191 HOH A O     1 
HETATM 4206 O  O     . HOH M 6 .   ? -18.449 4.360  44.557 1.00 37.66  ? 2192 HOH A O     1 
HETATM 4207 O  O     . HOH M 6 .   ? -5.955  8.682  49.250 1.00 40.73  ? 2193 HOH A O     1 
HETATM 4208 O  O     . HOH M 6 .   ? -15.493 2.019  42.120 1.00 46.62  ? 2194 HOH A O     1 
HETATM 4209 O  O     . HOH M 6 .   ? -11.158 3.551  41.725 1.00 33.28  ? 2195 HOH A O     1 
HETATM 4210 O  O     . HOH M 6 .   ? -10.751 5.618  39.887 1.00 27.16  ? 2196 HOH A O     1 
HETATM 4211 O  O     . HOH M 6 .   ? -4.336  9.642  47.311 1.00 44.14  ? 2197 HOH A O     1 
HETATM 4212 O  O     . HOH M 6 .   ? -4.615  4.967  40.925 1.00 35.49  ? 2198 HOH A O     1 
HETATM 4213 O  O     . HOH M 6 .   ? -8.230  2.881  46.485 1.00 44.57  ? 2199 HOH A O     1 
HETATM 4214 O  O     . HOH M 6 .   ? -3.483  0.942  34.021 1.00 47.41  ? 2200 HOH A O     1 
HETATM 4215 O  O     . HOH M 6 .   ? 0.798   11.276 33.117 1.00 26.69  ? 2201 HOH A O     1 
HETATM 4216 O  O     . HOH M 6 .   ? 2.743   9.404  33.415 1.00 32.92  ? 2202 HOH A O     1 
HETATM 4217 O  O     . HOH M 6 .   ? 2.046   7.143  32.147 1.00 51.07  ? 2203 HOH A O     1 
HETATM 4218 O  O     . HOH M 6 .   ? 0.000   0.000  40.198 0.50 60.36  ? 2204 HOH A O     1 
HETATM 4219 O  O     . HOH M 6 .   ? 0.647   8.650  27.756 1.00 50.90  ? 2205 HOH A O     1 
HETATM 4220 O  O     . HOH M 6 .   ? 1.649   10.565 30.220 1.00 34.16  ? 2206 HOH A O     1 
HETATM 4221 O  O     . HOH M 6 .   ? -5.161  9.294  30.446 1.00 36.95  ? 2207 HOH A O     1 
HETATM 4222 O  O     . HOH M 6 .   ? 2.022   15.422 35.476 1.00 45.39  ? 2208 HOH A O     1 
HETATM 4223 O  O     . HOH M 6 .   ? 4.821   13.577 24.545 1.00 50.33  ? 2209 HOH A O     1 
HETATM 4224 O  O     . HOH M 6 .   ? -1.372  18.410 24.097 1.00 33.01  ? 2210 HOH A O     1 
HETATM 4225 O  O     . HOH M 6 .   ? -2.909  20.678 22.646 1.00 50.40  ? 2211 HOH A O     1 
HETATM 4226 O  O     . HOH M 6 .   ? 0.974   26.444 21.613 1.00 43.69  ? 2212 HOH A O     1 
HETATM 4227 O  O     . HOH M 6 .   ? 5.869   21.273 23.292 1.00 38.79  ? 2213 HOH A O     1 
HETATM 4228 O  O     . HOH M 6 .   ? -2.411  28.682 27.245 1.00 31.05  ? 2214 HOH A O     1 
HETATM 4229 O  O     . HOH M 6 .   ? -3.766  18.770 25.322 1.00 36.87  ? 2215 HOH A O     1 
HETATM 4230 O  O     . HOH M 6 .   ? 8.539   37.120 35.944 1.00 36.64  ? 2216 HOH A O     1 
HETATM 4231 O  O     . HOH M 6 .   ? 24.785  35.597 36.648 1.00 44.97  ? 2217 HOH A O     1 
HETATM 4232 O  O     . HOH M 6 .   ? 24.035  38.579 37.439 1.00 51.00  ? 2218 HOH A O     1 
HETATM 4233 O  O     . HOH M 6 .   ? 27.498  22.189 39.503 1.00 46.13  ? 2219 HOH A O     1 
HETATM 4234 O  O     . HOH M 6 .   ? 27.498  26.470 44.120 1.00 42.71  ? 2220 HOH A O     1 
HETATM 4235 O  O     . HOH M 6 .   ? 7.838   11.140 44.514 1.00 18.12  ? 2221 HOH A O     1 
HETATM 4236 O  O     . HOH M 6 .   ? 3.218   13.403 44.808 1.00 39.22  ? 2222 HOH A O     1 
HETATM 4237 O  O     . HOH M 6 .   ? 7.596   10.418 32.340 1.00 38.60  ? 2223 HOH A O     1 
HETATM 4238 O  O     . HOH M 6 .   ? 5.145   8.870  35.197 1.00 49.58  ? 2224 HOH A O     1 
HETATM 4239 O  O     . HOH M 6 .   ? 19.530  13.741 30.668 1.00 34.56  ? 2225 HOH A O     1 
HETATM 4240 O  O     . HOH M 6 .   ? 13.336  12.903 29.016 1.00 32.74  ? 2226 HOH A O     1 
HETATM 4241 O  O     . HOH M 6 .   ? 1.871   17.302 33.472 1.00 23.40  ? 2227 HOH A O     1 
HETATM 4242 O  O     . HOH M 6 .   ? 15.501  12.054 29.898 1.00 38.79  ? 2228 HOH A O     1 
HETATM 4243 O  O     . HOH M 6 .   ? 16.822  15.267 27.087 1.00 42.09  ? 2229 HOH A O     1 
HETATM 4244 O  O     . HOH M 6 .   ? 11.600  19.676 26.428 1.00 24.49  ? 2230 HOH A O     1 
HETATM 4245 O  O     . HOH M 6 .   ? 15.583  17.246 26.703 1.00 44.64  ? 2231 HOH A O     1 
HETATM 4246 O  O     . HOH M 6 .   ? 17.118  24.086 27.577 1.00 22.01  ? 2232 HOH A O     1 
HETATM 4247 O  O     . HOH M 6 .   ? 11.783  29.692 32.565 1.00 28.34  ? 2233 HOH A O     1 
HETATM 4248 O  O     . HOH M 6 .   ? 18.818  29.209 29.455 1.00 19.48  ? 2234 HOH A O     1 
HETATM 4249 O  O     . HOH M 6 .   ? 18.449  25.998 23.229 1.00 45.12  ? 2235 HOH A O     1 
HETATM 4250 O  O     . HOH M 6 .   ? 15.640  28.901 21.968 1.00 39.92  ? 2236 HOH A O     1 
HETATM 4251 O  O     . HOH M 6 .   ? 11.240  25.628 23.882 1.00 42.03  ? 2237 HOH A O     1 
HETATM 4252 O  O     . HOH M 6 .   ? 20.121  27.529 22.309 1.00 44.82  ? 2238 HOH A O     1 
HETATM 4253 O  O     . HOH M 6 .   ? 22.489  29.812 21.432 1.00 52.29  ? 2239 HOH A O     1 
HETATM 4254 O  O     . HOH M 6 .   ? 14.705  36.198 27.571 1.00 46.29  ? 2240 HOH A O     1 
HETATM 4255 O  O     . HOH M 6 .   ? 17.729  36.612 31.614 1.00 45.29  ? 2241 HOH A O     1 
HETATM 4256 O  O     . HOH M 6 .   ? 26.285  42.547 30.708 1.00 33.98  ? 2242 HOH A O     1 
HETATM 4257 O  O     . HOH M 6 .   ? 22.616  40.822 28.663 1.00 27.55  ? 2243 HOH A O     1 
HETATM 4258 O  O     . HOH M 6 .   ? 21.656  36.251 22.782 1.00 49.02  ? 2244 HOH A O     1 
HETATM 4259 O  O     . HOH M 6 .   ? 30.768  29.201 25.550 1.00 30.40  ? 2245 HOH A O     1 
HETATM 4260 O  O     . HOH M 6 .   ? 26.820  30.921 29.641 1.00 29.18  ? 2246 HOH A O     1 
HETATM 4261 O  O     . HOH M 6 .   ? 23.546  23.861 25.579 1.00 33.33  ? 2247 HOH A O     1 
HETATM 4262 O  O     . HOH M 6 .   ? 24.465  28.924 23.061 1.00 29.76  ? 2248 HOH A O     1 
HETATM 4263 O  O     . HOH M 6 .   ? 26.160  23.573 26.353 1.00 44.62  ? 2249 HOH A O     1 
HETATM 4264 O  O     . HOH M 6 .   ? 27.391  26.761 27.847 1.00 53.13  ? 2250 HOH A O     1 
HETATM 4265 O  O     . HOH M 6 .   ? 25.720  26.704 24.066 1.00 35.89  ? 2251 HOH A O     1 
HETATM 4266 O  O     . HOH M 6 .   ? 26.800  31.308 33.519 1.00 48.87  ? 2252 HOH A O     1 
HETATM 4267 O  O     . HOH M 6 .   ? 24.799  28.637 37.494 1.00 38.31  ? 2253 HOH A O     1 
HETATM 4268 O  O     . HOH M 6 .   ? 20.936  28.122 29.945 1.00 21.83  ? 2254 HOH A O     1 
HETATM 4269 O  O     . HOH M 6 .   ? 25.155  20.022 32.676 1.00 48.70  ? 2255 HOH A O     1 
HETATM 4270 O  O     . HOH M 6 .   ? 22.399  28.005 39.178 1.00 31.02  ? 2256 HOH A O     1 
HETATM 4271 O  O     . HOH M 6 .   ? 8.405   10.026 40.857 1.00 21.95  ? 2257 HOH A O     1 
HETATM 4272 O  O     . HOH M 6 .   ? 11.602  7.394  45.401 0.50 15.46  ? 2258 HOH A O     1 
HETATM 4273 O  O     . HOH M 6 .   ? 5.819   7.541  49.448 0.50 36.26  ? 2259 HOH A O     1 
HETATM 4274 O  O     . HOH M 6 .   ? 12.178  4.354  43.279 1.00 38.15  ? 2260 HOH A O     1 
HETATM 4275 O  O     . HOH M 6 .   ? 4.472   10.765 48.386 1.00 50.41  ? 2261 HOH A O     1 
HETATM 4276 O  O     . HOH M 6 .   ? 3.927   16.170 49.091 1.00 29.84  ? 2262 HOH A O     1 
HETATM 4277 O  O     . HOH M 6 .   ? 7.047   13.536 57.258 0.50 19.11  ? 2263 HOH A O     1 
HETATM 4278 O  O     . HOH M 6 .   ? 5.050   10.889 51.442 1.00 29.95  ? 2264 HOH A O     1 
HETATM 4279 O  O     . HOH M 6 .   ? 5.865   11.691 56.408 1.00 56.06  ? 2265 HOH A O     1 
HETATM 4280 O  O     . HOH M 6 .   ? 9.367   9.178  58.617 1.00 32.95  ? 2266 HOH A O     1 
HETATM 4281 O  O     . HOH M 6 .   ? 15.167  4.619  54.442 1.00 42.36  ? 2267 HOH A O     1 
HETATM 4282 O  O     . HOH M 6 .   ? 10.554  4.546  54.026 1.00 49.23  ? 2268 HOH A O     1 
HETATM 4283 O  O     . HOH M 6 .   ? 13.260  2.660  50.597 1.00 31.00  ? 2269 HOH A O     1 
HETATM 4284 O  O     . HOH M 6 .   ? 14.039  5.051  46.867 1.00 22.43  ? 2270 HOH A O     1 
HETATM 4285 O  O     . HOH M 6 .   ? 19.985  5.307  51.518 1.00 29.77  ? 2271 HOH A O     1 
HETATM 4286 O  O     . HOH M 6 .   ? 14.662  -0.467 40.215 1.00 29.45  ? 2272 HOH A O     1 
HETATM 4287 O  O     . HOH M 6 .   ? 13.980  2.493  45.927 1.00 34.80  ? 2273 HOH A O     1 
HETATM 4288 O  O     . HOH M 6 .   ? 27.600  4.490  40.317 1.00 37.69  ? 2274 HOH A O     1 
HETATM 4289 O  O     . HOH M 6 .   ? 23.494  9.643  37.811 1.00 28.82  ? 2275 HOH A O     1 
HETATM 4290 O  O     . HOH M 6 .   ? 24.204  7.898  34.374 1.00 46.32  ? 2276 HOH A O     1 
HETATM 4291 O  O     . HOH M 6 .   ? 16.272  9.776  30.573 1.00 48.59  ? 2277 HOH A O     1 
HETATM 4292 O  O     . HOH M 6 .   ? 19.733  1.809  32.705 1.00 40.19  ? 2278 HOH A O     1 
HETATM 4293 O  O     . HOH M 6 .   ? 12.229  8.465  34.657 1.00 28.19  ? 2279 HOH A O     1 
HETATM 4294 O  O     . HOH M 6 .   ? 13.914  2.265  36.917 1.00 33.79  ? 2280 HOH A O     1 
HETATM 4295 O  O     . HOH M 6 .   ? 19.260  0.716  35.387 1.00 38.97  ? 2281 HOH A O     1 
HETATM 4296 O  O     . HOH M 6 .   ? 22.798  -1.093 37.934 1.00 29.75  ? 2282 HOH A O     1 
HETATM 4297 O  O     . HOH M 6 .   ? 17.877  -1.583 43.902 1.00 30.03  ? 2283 HOH A O     1 
HETATM 4298 O  O     . HOH M 6 .   ? 20.590  3.144  42.439 1.00 25.13  ? 2284 HOH A O     1 
HETATM 4299 O  O     . HOH M 6 .   ? 19.760  0.294  51.525 1.00 55.04  ? 2285 HOH A O     1 
HETATM 4300 O  O     . HOH M 6 .   ? 18.193  -0.782 47.663 1.00 41.02  ? 2286 HOH A O     1 
HETATM 4301 O  O     . HOH M 6 .   ? 23.207  5.572  50.768 1.00 44.58  ? 2287 HOH A O     1 
HETATM 4302 O  O     . HOH M 6 .   ? 30.680  3.400  48.296 1.00 59.88  ? 2288 HOH A O     1 
HETATM 4303 O  O     . HOH M 6 .   ? 30.198  13.911 48.701 1.00 38.30  ? 2289 HOH A O     1 
HETATM 4304 O  O     . HOH M 6 .   ? 25.948  18.902 35.140 1.00 47.97  ? 2290 HOH A O     1 
HETATM 4305 O  O     . HOH M 6 .   ? 23.161  15.775 41.717 1.00 35.86  ? 2291 HOH A O     1 
HETATM 4306 O  O     . HOH M 6 .   ? 13.698  6.081  44.331 1.00 19.84  ? 2292 HOH A O     1 
HETATM 4307 O  O     . HOH M 6 .   ? 12.392  9.579  49.554 1.00 21.84  ? 2293 HOH A O     1 
HETATM 4308 O  O     . HOH M 6 .   ? 19.097  9.230  53.582 1.00 39.32  ? 2294 HOH A O     1 
HETATM 4309 O  O     . HOH M 6 .   ? 17.276  16.942 57.077 1.00 34.87  ? 2295 HOH A O     1 
HETATM 4310 O  O     . HOH M 6 .   ? 15.251  13.394 56.664 1.00 22.35  ? 2296 HOH A O     1 
HETATM 4311 O  O     . HOH M 6 .   ? 21.850  15.734 58.413 1.00 55.83  ? 2297 HOH A O     1 
HETATM 4312 O  O     . HOH M 6 .   ? 21.041  9.902  52.147 1.00 45.23  ? 2298 HOH A O     1 
HETATM 4313 O  O     . HOH M 6 .   ? 29.949  16.029 49.631 1.00 43.63  ? 2299 HOH A O     1 
HETATM 4314 O  O     . HOH M 6 .   ? 26.366  24.541 52.312 1.00 43.60  ? 2300 HOH A O     1 
HETATM 4315 O  O     . HOH M 6 .   ? 25.319  18.757 57.410 1.00 47.88  ? 2301 HOH A O     1 
HETATM 4316 O  O     . HOH M 6 .   ? 20.251  20.051 60.119 1.00 40.61  ? 2302 HOH A O     1 
HETATM 4317 O  O     . HOH M 6 .   ? 18.670  31.065 58.540 1.00 27.95  ? 2303 HOH A O     1 
HETATM 4318 O  O     . HOH M 6 .   ? 18.764  29.307 65.750 1.00 35.18  ? 2304 HOH A O     1 
HETATM 4319 O  O     . HOH M 6 .   ? 3.366   20.884 43.401 1.00 16.51  ? 2305 HOH A O     1 
HETATM 4320 O  O     . HOH M 6 .   ? 0.157   24.232 44.694 1.00 26.70  ? 2306 HOH A O     1 
HETATM 4321 O  O     . HOH M 6 .   ? 5.735   20.511 45.580 1.00 21.19  ? 2307 HOH A O     1 
HETATM 4322 O  O     . HOH M 6 .   ? 5.394   17.972 48.103 1.00 37.71  ? 2308 HOH A O     1 
HETATM 4323 O  O     . HOH M 6 .   ? 5.312   17.073 61.357 1.00 42.51  ? 2309 HOH A O     1 
HETATM 4324 O  O     . HOH M 6 .   ? 1.582   13.998 59.225 1.00 50.22  ? 2310 HOH A O     1 
HETATM 4325 O  O     . HOH M 6 .   ? 6.764   12.900 59.113 0.50 24.90  ? 2311 HOH A O     1 
HETATM 4326 O  O     . HOH M 6 .   ? 18.071  20.062 61.095 1.00 43.85  ? 2312 HOH A O     1 
HETATM 4327 O  O     . HOH M 6 .   ? 17.096  17.634 62.919 1.00 49.62  ? 2313 HOH A O     1 
HETATM 4328 O  O     . HOH M 6 .   ? 18.035  19.301 58.033 1.00 38.84  ? 2314 HOH A O     1 
HETATM 4329 O  O     . HOH M 6 .   ? 1.272   27.510 47.346 1.00 24.32  ? 2315 HOH A O     1 
HETATM 4330 O  O     . HOH M 6 .   ? -6.942  29.301 44.818 1.00 21.88  ? 2316 HOH A O     1 
HETATM 4331 O  O     . HOH M 6 .   ? -9.594  44.312 49.942 1.00 49.90  ? 2317 HOH A O     1 
HETATM 4332 O  O     . HOH M 6 .   ? -7.909  43.543 38.912 1.00 55.45  ? 2318 HOH A O     1 
HETATM 4333 O  O     . HOH M 6 .   ? -11.325 42.574 40.562 1.00 51.54  ? 2319 HOH A O     1 
HETATM 4334 O  O     . HOH M 6 .   ? -7.139  44.973 61.314 1.00 55.54  ? 2320 HOH A O     1 
HETATM 4335 O  O     . HOH M 6 .   ? -17.124 38.710 57.738 1.00 37.38  ? 2321 HOH A O     1 
HETATM 4336 O  O     . HOH M 6 .   ? -19.560 40.398 44.068 1.00 47.68  ? 2322 HOH A O     1 
HETATM 4337 O  O     . HOH M 6 .   ? -13.129 35.766 50.301 1.00 33.68  ? 2323 HOH A O     1 
HETATM 4338 O  O     . HOH M 6 .   ? -19.675 34.051 51.848 1.00 56.46  ? 2324 HOH A O     1 
HETATM 4339 O  O     . HOH M 6 .   ? -16.032 36.600 40.072 1.00 36.89  ? 2325 HOH A O     1 
HETATM 4340 O  O     . HOH M 6 .   ? -18.388 34.356 42.525 1.00 31.78  ? 2326 HOH A O     1 
HETATM 4341 O  O     . HOH M 6 .   ? -10.727 37.052 40.495 1.00 45.31  ? 2327 HOH A O     1 
HETATM 4342 O  O     . HOH M 6 .   ? -12.904 32.899 39.812 1.00 31.69  ? 2328 HOH A O     1 
HETATM 4343 O  O     . HOH M 6 .   ? -11.104 41.917 49.096 1.00 46.10  ? 2329 HOH A O     1 
HETATM 4344 O  O     . HOH M 6 .   ? -17.677 31.451 49.285 1.00 31.19  ? 2330 HOH A O     1 
HETATM 4345 O  O     . HOH M 6 .   ? -21.093 31.078 46.612 1.00 48.58  ? 2331 HOH A O     1 
HETATM 4346 O  O     . HOH M 6 .   ? -8.330  38.105 50.423 1.00 43.75  ? 2332 HOH A O     1 
HETATM 4347 O  O     . HOH M 6 .   ? -8.606  28.325 51.361 1.00 21.15  ? 2333 HOH A O     1 
HETATM 4348 O  O     . HOH M 6 .   ? -5.756  36.224 55.415 1.00 22.31  ? 2334 HOH A O     1 
HETATM 4349 O  O     . HOH M 6 .   ? -16.746 34.429 57.811 1.00 45.85  ? 2335 HOH A O     1 
HETATM 4350 O  O     . HOH M 6 .   ? -16.556 29.766 64.540 1.00 36.45  ? 2336 HOH A O     1 
HETATM 4351 O  O     . HOH M 6 .   ? -9.868  34.308 61.543 1.00 31.74  ? 2337 HOH A O     1 
HETATM 4352 O  O     . HOH M 6 .   ? -7.445  35.372 62.272 1.00 44.74  ? 2338 HOH A O     1 
HETATM 4353 O  O     . HOH M 6 .   ? -8.091  26.986 53.702 1.00 15.21  ? 2339 HOH A O     1 
HETATM 4354 O  O     . HOH M 6 .   ? -3.329  32.484 62.316 1.00 48.10  ? 2340 HOH A O     1 
HETATM 4355 O  O     . HOH M 6 .   ? -1.052  31.356 61.935 1.00 25.29  ? 2341 HOH A O     1 
HETATM 4356 O  O     . HOH M 6 .   ? -7.675  30.742 60.587 1.00 27.38  ? 2342 HOH A O     1 
HETATM 4357 O  O     . HOH M 6 .   ? 3.903   27.969 65.668 1.00 47.46  ? 2343 HOH A O     1 
HETATM 4358 O  O     . HOH M 6 .   ? 2.160   26.726 68.536 1.00 12.91  ? 2344 HOH A O     1 
HETATM 4359 O  O     . HOH M 6 .   ? -1.288  32.516 67.284 1.00 34.97  ? 2345 HOH A O     1 
HETATM 4360 O  O     . HOH M 6 .   ? 4.559   31.509 40.531 1.00 19.54  ? 2346 HOH A O     1 
HETATM 4361 O  O     . HOH M 6 .   ? 7.478   39.142 39.606 1.00 36.31  ? 2347 HOH A O     1 
HETATM 4362 O  O     . HOH M 6 .   ? 8.981   39.227 37.521 1.00 35.75  ? 2348 HOH A O     1 
HETATM 4363 O  O     . HOH M 6 .   ? 19.127  41.057 43.215 1.00 60.68  ? 2349 HOH A O     1 
HETATM 4364 O  O     . HOH M 6 .   ? 21.162  39.245 55.270 1.00 29.49  ? 2350 HOH A O     1 
HETATM 4365 O  O     . HOH M 6 .   ? 17.982  45.159 54.202 1.00 33.51  ? 2351 HOH A O     1 
HETATM 4366 O  O     . HOH M 6 .   ? 11.523  43.364 54.790 1.00 43.28  ? 2352 HOH A O     1 
HETATM 4367 O  O     . HOH M 6 .   ? 10.045  44.710 65.983 1.00 52.22  ? 2353 HOH A O     1 
HETATM 4368 O  O     . HOH M 6 .   ? 9.200   45.774 59.846 1.00 58.80  ? 2354 HOH A O     1 
HETATM 4369 O  O     . HOH M 6 .   ? 15.857  45.958 54.892 0.50 28.47  ? 2355 HOH A O     1 
HETATM 4370 O  O     . HOH M 6 .   ? 13.408  43.588 64.155 0.50 41.35  ? 2356 HOH A O     1 
HETATM 4371 O  O     . HOH M 6 .   ? 8.236   37.686 63.973 1.00 41.03  ? 2357 HOH A O     1 
HETATM 4372 O  O     . HOH M 6 .   ? 5.948   42.498 60.542 1.00 45.95  ? 2358 HOH A O     1 
HETATM 4373 O  O     . HOH M 6 .   ? 5.147   40.003 63.058 1.00 46.69  ? 2359 HOH A O     1 
HETATM 4374 O  O     . HOH M 6 .   ? 8.861   39.319 70.815 1.00 42.93  ? 2360 HOH A O     1 
HETATM 4375 O  O     . HOH M 6 .   ? 2.199   41.430 68.447 1.00 39.09  ? 2361 HOH A O     1 
HETATM 4376 O  O     . HOH M 6 .   ? -1.211  39.301 70.265 1.00 42.74  ? 2362 HOH A O     1 
HETATM 4377 O  O     . HOH M 6 .   ? 5.743   38.310 79.229 1.00 23.25  ? 2363 HOH A O     1 
HETATM 4378 O  O     . HOH M 6 .   ? 3.662   46.747 77.932 1.00 59.62  ? 2364 HOH A O     1 
HETATM 4379 O  O     . HOH M 6 .   ? 5.838   47.095 75.448 1.00 46.76  ? 2365 HOH A O     1 
HETATM 4380 O  O     . HOH M 6 .   ? 5.650   17.983 45.805 1.00 27.11  ? 2366 HOH A O     1 
HETATM 4381 O  O     . HOH M 6 .   ? 3.781   16.578 44.303 1.00 31.96  ? 2367 HOH A O     1 
HETATM 4382 O  O     . HOH M 6 .   ? -2.886  15.330 45.804 1.00 36.83  ? 2368 HOH A O     1 
HETATM 4383 O  O     . HOH M 6 .   ? 0.156   6.820  42.816 1.00 55.90  ? 2369 HOH A O     1 
HETATM 4384 O  O     . HOH M 6 .   ? 5.419   19.114 70.918 1.00 31.62  ? 2370 HOH A O     1 
HETATM 4385 O  O     . HOH M 6 .   ? 6.453   20.082 65.625 1.00 32.11  ? 2371 HOH A O     1 
HETATM 4386 O  O     . HOH M 6 .   ? 1.654   24.040 69.039 1.00 34.71  ? 2372 HOH A O     1 
HETATM 4387 O  O     . HOH M 6 .   ? -2.335  14.491 56.785 1.00 30.08  ? 2373 HOH A O     1 
HETATM 4388 O  O     . HOH M 6 .   ? 1.979   18.377 61.579 1.00 33.01  ? 2374 HOH A O     1 
HETATM 4389 O  O     . HOH M 6 .   ? 3.917   13.916 66.820 1.00 49.32  ? 2375 HOH A O     1 
HETATM 4390 O  O     . HOH M 6 .   ? 0.153   17.471 64.584 0.50 40.83  ? 2376 HOH A O     1 
HETATM 4391 O  O     . HOH M 6 .   ? 0.781   14.834 63.426 1.00 51.78  ? 2377 HOH A O     1 
HETATM 4392 O  O     . HOH M 6 .   ? -1.838  22.996 64.822 1.00 36.37  ? 2378 HOH A O     1 
HETATM 4393 O  O     . HOH M 6 .   ? -12.271 30.704 41.466 1.00 32.45  ? 2379 HOH A O     1 
HETATM 4394 O  O     . HOH M 6 .   ? -8.711  33.109 40.113 1.00 42.70  ? 2380 HOH A O     1 
HETATM 4395 O  O     . HOH M 6 .   ? -8.294  29.029 42.075 1.00 35.13  ? 2381 HOH A O     1 
HETATM 4396 O  O     . HOH M 6 .   ? 14.097  27.346 60.787 1.00 23.22  ? 2382 HOH A O     1 
HETATM 4397 O  O     . HOH M 6 .   ? 13.502  34.714 62.347 1.00 34.48  ? 2383 HOH A O     1 
HETATM 4398 O  O     . HOH M 6 .   ? 10.263  32.973 65.052 1.00 42.00  ? 2384 HOH A O     1 
HETATM 4399 O  O     . HOH M 6 .   ? 19.089  31.283 61.269 1.00 43.94  ? 2385 HOH A O     1 
HETATM 4400 O  O     . HOH M 6 .   ? -5.604  15.868 54.077 1.00 19.82  ? 2386 HOH A O     1 
HETATM 4401 O  O     . HOH M 6 .   ? 0.956   13.724 52.230 1.00 43.44  ? 2387 HOH A O     1 
HETATM 4402 O  O     . HOH M 6 .   ? -0.721  16.450 47.058 1.00 39.42  ? 2388 HOH A O     1 
HETATM 4403 O  O     . HOH M 6 .   ? -2.809  17.329 47.584 1.00 35.22  ? 2389 HOH A O     1 
HETATM 4404 O  O     . HOH M 6 .   ? 18.851  22.360 29.268 1.00 20.82  ? 2390 HOH A O     1 
HETATM 4405 O  O     . HOH M 6 .   ? 26.077  20.750 37.586 1.00 43.05  ? 2391 HOH A O     1 
HETATM 4406 O  O     . HOH M 6 .   ? 23.698  16.343 35.660 1.00 39.28  ? 2392 HOH A O     1 
HETATM 4407 O  O     . HOH M 6 .   ? 2.769   6.820  42.355 1.00 48.30  ? 2393 HOH A O     1 
HETATM 4408 O  O     . HOH M 6 .   ? 5.251   10.815 45.580 1.00 40.84  ? 2394 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 21  ? 0.9052 0.7001 0.7316 0.1626  -0.2786 0.1391  3   THR A N   
2    C CA  . THR A 21  ? 0.8893 0.6566 0.6667 0.1547  -0.2424 0.1277  3   THR A CA  
3    C C   . THR A 21  ? 0.8275 0.6325 0.5938 0.1597  -0.1862 0.0798  3   THR A C   
4    O O   . THR A 21  ? 0.8230 0.6404 0.6474 0.1772  -0.1671 0.0394  3   THR A O   
5    C CB  . THR A 21  ? 0.9248 0.6468 0.7711 0.1730  -0.2595 0.1264  3   THR A CB  
6    O OG1 . THR A 21  ? 0.9956 0.6804 0.8788 0.1694  -0.3240 0.1791  3   THR A OG1 
7    C CG2 . THR A 21  ? 0.9094 0.6017 0.6893 0.1566  -0.2299 0.1254  3   THR A CG2 
8    N N   . SER A 22  ? 0.7853 0.6100 0.4827 0.1369  -0.1601 0.0837  4   SER A N   
9    C CA  . SER A 22  ? 0.7253 0.5819 0.4152 0.1343  -0.1183 0.0545  4   SER A CA  
10   C C   . SER A 22  ? 0.7217 0.5538 0.3911 0.1256  -0.1004 0.0525  4   SER A C   
11   O O   . SER A 22  ? 0.7573 0.5467 0.4091 0.1210  -0.1136 0.0714  4   SER A O   
12   C CB  . SER A 22  ? 0.6977 0.5808 0.3506 0.1137  -0.1011 0.0608  4   SER A CB  
13   O OG  . SER A 22  ? 0.6760 0.5346 0.2866 0.0892  -0.0900 0.0765  4   SER A OG  
14   N N   . TRP A 23  ? 0.6863 0.5461 0.3549 0.1174  -0.0742 0.0345  5   TRP A N   
15   C CA  . TRP A 23  ? 0.6768 0.5200 0.3254 0.1025  -0.0627 0.0385  5   TRP A CA  
16   C C   . TRP A 23  ? 0.6775 0.4965 0.2968 0.0869  -0.0606 0.0650  5   TRP A C   
17   O O   . TRP A 23  ? 0.6858 0.4756 0.2917 0.0789  -0.0599 0.0727  5   TRP A O   
18   C CB  . TRP A 23  ? 0.6604 0.5430 0.3096 0.0844  -0.0449 0.0250  5   TRP A CB  
19   C CG  . TRP A 23  ? 0.6221 0.5410 0.2760 0.0756  -0.0379 0.0324  5   TRP A CG  
20   C CD1 . TRP A 23  ? 0.5999 0.5570 0.2695 0.0784  -0.0318 0.0126  5   TRP A CD1 
21   C CD2 . TRP A 23  ? 0.6070 0.5273 0.2661 0.0612  -0.0344 0.0579  5   TRP A CD2 
22   N NE1 . TRP A 23  ? 0.5738 0.5535 0.2488 0.0664  -0.0265 0.0287  5   TRP A NE1 
23   C CE2 . TRP A 23  ? 0.5865 0.5441 0.2646 0.0565  -0.0280 0.0556  5   TRP A CE2 
24   C CE3 . TRP A 23  ? 0.6167 0.5116 0.2816 0.0506  -0.0338 0.0779  5   TRP A CE3 
25   C CZ2 . TRP A 23  ? 0.5648 0.5323 0.2773 0.0433  -0.0228 0.0740  5   TRP A CZ2 
26   C CZ3 . TRP A 23  ? 0.5752 0.4831 0.2826 0.0374  -0.0264 0.0910  5   TRP A CZ3 
27   C CH2 . TRP A 23  ? 0.5500 0.4926 0.2853 0.0345  -0.0220 0.0899  5   TRP A CH2 
28   N N   . SER A 24  ? 0.6633 0.4970 0.2786 0.0788  -0.0554 0.0717  6   SER A N   
29   C CA  . SER A 24  ? 0.6691 0.4883 0.2724 0.0558  -0.0424 0.0811  6   SER A CA  
30   C C   . SER A 24  ? 0.7265 0.5069 0.2876 0.0448  -0.0560 0.0936  6   SER A C   
31   O O   . SER A 24  ? 0.7416 0.5029 0.2869 0.0207  -0.0425 0.0957  6   SER A O   
32   C CB  . SER A 24  ? 0.6363 0.4891 0.2623 0.0417  -0.0230 0.0725  6   SER A CB  
33   O OG  . SER A 24  ? 0.6358 0.4986 0.2360 0.0381  -0.0310 0.0701  6   SER A OG  
34   N N   . ASP A 25  ? 0.7657 0.5366 0.3177 0.0579  -0.0847 0.1033  7   ASP A N   
35   C CA  . ASP A 25  ? 0.8338 0.5656 0.3497 0.0436  -0.1131 0.1293  7   ASP A CA  
36   C C   . ASP A 25  ? 0.8555 0.5450 0.3737 0.0503  -0.1162 0.1338  7   ASP A C   
37   O O   . ASP A 25  ? 0.8953 0.5542 0.3734 0.0232  -0.1142 0.1472  7   ASP A O   
38   C CB  . ASP A 25  ? 0.8616 0.5943 0.4012 0.0611  -0.1543 0.1450  7   ASP A CB  
39   C CG  . ASP A 25  ? 0.8820 0.6520 0.4024 0.0429  -0.1596 0.1491  7   ASP A CG  
40   O OD1 . ASP A 25  ? 0.9053 0.6956 0.3875 0.0099  -0.1293 0.1383  7   ASP A OD1 
41   O OD2 . ASP A 25  ? 0.9197 0.7017 0.4741 0.0592  -0.1930 0.1591  7   ASP A OD2 
42   N N   . ARG A 26  ? 0.8348 0.5277 0.3988 0.0798  -0.1160 0.1163  8   ARG A N   
43   C CA  . ARG A 26  ? 0.8460 0.5106 0.4188 0.0841  -0.1104 0.1092  8   ARG A CA  
44   C C   . ARG A 26  ? 0.8267 0.4873 0.3690 0.0605  -0.0856 0.1104  8   ARG A C   
45   O O   . ARG A 26  ? 0.8574 0.4802 0.3783 0.0479  -0.0875 0.1205  8   ARG A O   
46   C CB  . ARG A 26  ? 0.8159 0.5064 0.4367 0.1035  -0.0998 0.0758  8   ARG A CB  
47   C CG  . ARG A 26  ? 0.8363 0.5397 0.5175 0.1277  -0.1164 0.0596  8   ARG A CG  
48   C CD  . ARG A 26  ? 0.9315 0.5916 0.6692 0.1430  -0.1410 0.0605  8   ARG A CD  
49   N NE  . ARG A 26  ? 0.9506 0.6265 0.7822 0.1678  -0.1559 0.0372  8   ARG A NE  
50   C CZ  . ARG A 26  ? 1.0038 0.6447 0.9221 0.1857  -0.1894 0.0443  8   ARG A CZ  
51   N NH1 . ARG A 26  ? 1.0526 0.6374 0.9616 0.1792  -0.2130 0.0787  8   ARG A NH1 
52   N NH2 . ARG A 26  ? 1.0096 0.6712 1.0374 0.2088  -0.2014 0.0175  8   ARG A NH2 
53   N N   . LEU A 27  ? 0.7769 0.4755 0.3296 0.0532  -0.0651 0.1016  9   LEU A N   
54   C CA  . LEU A 27  ? 0.7602 0.4595 0.3184 0.0325  -0.0457 0.1022  9   LEU A CA  
55   C C   . LEU A 27  ? 0.7927 0.4721 0.3260 0.0045  -0.0342 0.1051  9   LEU A C   
56   O O   . LEU A 27  ? 0.8034 0.4608 0.3343 -0.0115 -0.0241 0.1041  9   LEU A O   
57   C CB  . LEU A 27  ? 0.7157 0.4586 0.3165 0.0297  -0.0342 0.0983  9   LEU A CB  
58   C CG  . LEU A 27  ? 0.6890 0.4596 0.3047 0.0353  -0.0414 0.0977  9   LEU A CG  
59   C CD1 . LEU A 27  ? 0.6511 0.4594 0.3105 0.0249  -0.0375 0.1064  9   LEU A CD1 
60   C CD2 . LEU A 27  ? 0.6881 0.4459 0.2971 0.0247  -0.0460 0.1011  9   LEU A CD2 
61   N N   . GLN A 28  ? 0.8079 0.4999 0.3207 -0.0090 -0.0329 0.1046  10  GLN A N   
62   C CA  . GLN A 28  ? 0.8613 0.5413 0.3344 -0.0521 -0.0184 0.1014  10  GLN A CA  
63   C C   . GLN A 28  ? 0.9264 0.5565 0.3429 -0.0655 -0.0414 0.1251  10  GLN A C   
64   O O   . GLN A 28  ? 0.9645 0.5780 0.3480 -0.1063 -0.0241 0.1200  10  GLN A O   
65   C CB  . GLN A 28  ? 0.8705 0.5820 0.3222 -0.0763 -0.0125 0.0945  10  GLN A CB  
66   C CG  . GLN A 28  ? 0.9397 0.6529 0.3435 -0.1409 0.0137  0.0791  10  GLN A CG  
67   C CD  . GLN A 28  ? 0.9160 0.6425 0.3808 -0.1627 0.0635  0.0383  10  GLN A CD  
68   O OE1 . GLN A 28  ? 0.9012 0.6644 0.4419 -0.1597 0.0916  0.0093  10  GLN A OE1 
69   N NE2 . GLN A 28  ? 0.9259 0.6224 0.3707 -0.1860 0.0730  0.0357  10  GLN A NE2 
70   N N   . ASN A 29  ? 0.9436 0.5504 0.3602 -0.0351 -0.0782 0.1474  11  ASN A N   
71   C CA  . ASN A 29  ? 1.0123 0.5669 0.3961 -0.0456 -0.1059 0.1750  11  ASN A CA  
72   C C   . ASN A 29  ? 1.0086 0.5376 0.3971 -0.0487 -0.0860 0.1638  11  ASN A C   
73   O O   . ASN A 29  ? 1.0576 0.5549 0.4016 -0.0845 -0.0838 0.1743  11  ASN A O   
74   C CB  . ASN A 29  ? 1.0275 0.5641 0.4496 -0.0088 -0.1481 0.1942  11  ASN A CB  
75   C CG  . ASN A 29  ? 1.0835 0.6319 0.4947 -0.0177 -0.1836 0.2210  11  ASN A CG  
76   O OD1 . ASN A 29  ? 1.1176 0.6834 0.4696 -0.0617 -0.1789 0.2298  11  ASN A OD1 
77   N ND2 . ASN A 29  ? 1.1005 0.6443 0.5771 0.0194  -0.2177 0.2292  11  ASN A ND2 
78   N N   . ALA A 30  ? 0.9510 0.4985 0.3889 -0.0185 -0.0719 0.1429  12  ALA A N   
79   C CA  . ALA A 30  ? 0.9508 0.4853 0.4012 -0.0222 -0.0549 0.1316  12  ALA A CA  
80   C C   . ALA A 30  ? 0.9446 0.4931 0.3979 -0.0558 -0.0229 0.1168  12  ALA A C   
81   O O   . ALA A 30  ? 0.9647 0.4890 0.4102 -0.0752 -0.0112 0.1124  12  ALA A O   
82   C CB  . ALA A 30  ? 0.8940 0.4552 0.3889 0.0049  -0.0530 0.1173  12  ALA A CB  
83   N N   . ALA A 31  ? 0.9148 0.5028 0.3916 -0.0641 -0.0062 0.1038  13  ALA A N   
84   C CA  . ALA A 31  ? 0.9155 0.5227 0.4247 -0.0988 0.0306  0.0773  13  ALA A CA  
85   C C   . ALA A 31  ? 0.9908 0.5739 0.4368 -0.1503 0.0467  0.0701  13  ALA A C   
86   O O   . ALA A 31  ? 0.9957 0.5801 0.4680 -0.1817 0.0792  0.0428  13  ALA A O   
87   C CB  . ALA A 31  ? 0.8683 0.5217 0.4240 -0.0995 0.0463  0.0608  13  ALA A CB  
88   N N   . ASP A 32  ? 1.0665 0.6293 0.4336 -0.1644 0.0210  0.0962  14  ASP A N   
89   C CA  . ASP A 32  ? 1.1713 0.7134 0.4577 -0.2278 0.0276  0.1002  14  ASP A CA  
90   C C   . ASP A 32  ? 1.2240 0.7161 0.4823 -0.2369 0.0194  0.1148  14  ASP A C   
91   O O   . ASP A 32  ? 1.2936 0.7693 0.4894 -0.2982 0.0336  0.1119  14  ASP A O   
92   C CB  . ASP A 32  ? 1.2339 0.7724 0.4485 -0.2472 -0.0107 0.1372  14  ASP A CB  
93   C CG  . ASP A 32  ? 1.2110 0.8021 0.4436 -0.2501 0.0030  0.1176  14  ASP A CG  
94   O OD1 . ASP A 32  ? 1.1776 0.8071 0.4610 -0.2647 0.0525  0.0692  14  ASP A OD1 
95   O OD2 . ASP A 32  ? 1.2555 0.8498 0.4655 -0.2368 -0.0368 0.1494  14  ASP A OD2 
96   N N   . MET A 33  ? 1.1990 0.6701 0.4996 -0.1833 -0.0005 0.1269  15  MET A N   
97   C CA  . MET A 33  ? 1.2576 0.6840 0.5454 -0.1869 -0.0049 0.1350  15  MET A CA  
98   C C   . MET A 33  ? 1.2135 0.6544 0.5429 -0.2067 0.0391  0.0956  15  MET A C   
99   O O   . MET A 33  ? 1.1501 0.6295 0.5582 -0.1846 0.0566  0.0719  15  MET A O   
100  C CB  . MET A 33  ? 1.2234 0.6301 0.5488 -0.1307 -0.0347 0.1505  15  MET A CB  
101  C CG  . MET A 33  ? 1.3084 0.6842 0.6163 -0.1151 -0.0808 0.1881  15  MET A CG  
102  S SD  . MET A 33  ? 1.3475 0.6879 0.7107 -0.0701 -0.0997 0.1882  15  MET A SD  
103  C CE  . MET A 33  ? 1.4183 0.6977 0.7378 -0.1089 -0.0998 0.2043  15  MET A CE  
104  N N   . PRO A 34  ? 1.2629 0.6743 0.5479 -0.2532 0.0545  0.0906  16  PRO A N   
105  C CA  . PRO A 34  ? 1.2279 0.6492 0.5683 -0.2677 0.0926  0.0522  16  PRO A CA  
106  C C   . PRO A 34  ? 1.1786 0.5826 0.5623 -0.2213 0.0738  0.0629  16  PRO A C   
107  O O   . PRO A 34  ? 1.1898 0.5613 0.5419 -0.1939 0.0398  0.0936  16  PRO A O   
108  C CB  . PRO A 34  ? 1.3189 0.7105 0.5804 -0.3368 0.1112  0.0469  16  PRO A CB  
109  C CG  . PRO A 34  ? 1.3925 0.7381 0.5640 -0.3395 0.0620  0.1037  16  PRO A CG  
110  C CD  . PRO A 34  ? 1.3619 0.7308 0.5479 -0.3002 0.0336  0.1235  16  PRO A CD  
111  N N   . ALA A 35  ? 1.1264 0.5557 0.5928 -0.2170 0.0951  0.0355  17  ALA A N   
112  C CA  . ALA A 35  ? 1.0895 0.5112 0.5916 -0.1868 0.0779  0.0442  17  ALA A CA  
113  C C   . ALA A 35  ? 1.1356 0.5128 0.5962 -0.2101 0.0845  0.0423  17  ALA A C   
114  O O   . ALA A 35  ? 1.1544 0.5314 0.6294 -0.2492 0.1165  0.0145  17  ALA A O   
115  C CB  . ALA A 35  ? 1.0262 0.4935 0.6404 -0.1781 0.0853  0.0278  17  ALA A CB  
116  N N   . ASN A 36  ? 1.1509 0.4919 0.5702 -0.1883 0.0575  0.0664  18  ASN A N   
117  C CA  . ASN A 36  ? 1.1866 0.4871 0.5848 -0.2019 0.0603  0.0651  18  ASN A CA  
118  C C   . ASN A 36  ? 1.1347 0.4620 0.5957 -0.1803 0.0573  0.0533  18  ASN A C   
119  O O   . ASN A 36  ? 1.1100 0.4488 0.5796 -0.1509 0.0366  0.0618  18  ASN A O   
120  C CB  . ASN A 36  ? 1.2411 0.4869 0.5830 -0.1939 0.0324  0.0954  18  ASN A CB  
121  C CG  . ASN A 36  ? 1.2766 0.4782 0.6086 -0.2040 0.0341  0.0938  18  ASN A CG  
122  O OD1 . ASN A 36  ? 1.2380 0.4541 0.5999 -0.2129 0.0547  0.0694  18  ASN A OD1 
123  N ND2 . ASN A 36  ? 1.3211 0.4681 0.6225 -0.2034 0.0090  0.1220  18  ASN A ND2 
124  N N   . MET A 37  ? 1.1257 0.4664 0.6320 -0.2027 0.0781  0.0315  19  MET A N   
125  C CA  . MET A 37  ? 1.0862 0.4630 0.6632 -0.1926 0.0684  0.0268  19  MET A CA  
126  C C   . MET A 37  ? 1.1140 0.4656 0.6711 -0.1976 0.0649  0.0233  19  MET A C   
127  O O   . MET A 37  ? 1.0928 0.4752 0.7002 -0.2007 0.0553  0.0206  19  MET A O   
128  C CB  . MET A 37  ? 1.0479 0.4635 0.7243 -0.2106 0.0855  0.0065  19  MET A CB  
129  C CG  . MET A 37  ? 1.0054 0.4579 0.7326 -0.2020 0.0863  0.0071  19  MET A CG  
130  S SD  . MET A 37  ? 0.9333 0.4247 0.6771 -0.1665 0.0422  0.0439  19  MET A SD  
131  C CE  . MET A 37  ? 0.8944 0.4284 0.7565 -0.1760 0.0167  0.0555  19  MET A CE  
132  N N   . ASP A 38  ? 1.1764 0.4729 0.6654 -0.2021 0.0688  0.0269  20  ASP A N   
133  C CA  . ASP A 38  ? 1.2116 0.4775 0.6832 -0.2049 0.0675  0.0211  20  ASP A CA  
134  C C   . ASP A 38  ? 1.1867 0.4888 0.6788 -0.1839 0.0490  0.0198  20  ASP A C   
135  O O   . ASP A 38  ? 1.1692 0.4859 0.6555 -0.1626 0.0360  0.0282  20  ASP A O   
136  C CB  . ASP A 38  ? 1.2821 0.4803 0.6932 -0.2098 0.0653  0.0352  20  ASP A CB  
137  C CG  . ASP A 38  ? 1.3261 0.4873 0.7343 -0.2095 0.0643  0.0274  20  ASP A CG  
138  O OD1 . ASP A 38  ? 1.4017 0.5285 0.7924 -0.2374 0.0792  0.0214  20  ASP A OD1 
139  O OD2 . ASP A 38  ? 1.3328 0.5005 0.7606 -0.1854 0.0528  0.0215  20  ASP A OD2 
140  N N   . LYS A 39  ? 1.1934 0.5162 0.7079 -0.1978 0.0491  0.0068  21  LYS A N   
141  C CA  . LYS A 39  ? 1.1876 0.5605 0.7134 -0.1986 0.0331  0.0032  21  LYS A CA  
142  C C   . LYS A 39  ? 1.2062 0.5660 0.7048 -0.1847 0.0353  -0.0122 21  LYS A C   
143  O O   . LYS A 39  ? 1.1954 0.6029 0.6952 -0.1871 0.0265  -0.0176 21  LYS A O   
144  C CB  . LYS A 39  ? 1.2049 0.6044 0.7537 -0.2278 0.0303  -0.0062 21  LYS A CB  
145  C CG  . LYS A 39  ? 1.1955 0.6255 0.8116 -0.2412 0.0204  0.0080  21  LYS A CG  
146  C CD  . LYS A 39  ? 1.2024 0.6995 0.8677 -0.2473 -0.0151 0.0365  21  LYS A CD  
147  C CE  . LYS A 39  ? 1.2381 0.7857 0.8992 -0.2819 -0.0428 0.0453  21  LYS A CE  
148  N NZ  . LYS A 39  ? 1.2434 0.7961 0.9458 -0.3073 -0.0467 0.0402  21  LYS A NZ  
149  N N   . HIS A 40  ? 1.2372 0.5336 0.7218 -0.1751 0.0464  -0.0198 22  HIS A N   
150  C CA  . HIS A 40  ? 1.2530 0.5266 0.7476 -0.1574 0.0483  -0.0369 22  HIS A CA  
151  C C   . HIS A 40  ? 1.2272 0.4928 0.7246 -0.1292 0.0339  -0.0172 22  HIS A C   
152  O O   . HIS A 40  ? 1.2247 0.5087 0.7486 -0.1154 0.0336  -0.0366 22  HIS A O   
153  C CB  . HIS A 40  ? 1.3116 0.5169 0.8144 -0.1601 0.0576  -0.0458 22  HIS A CB  
154  C CG  . HIS A 40  ? 1.3486 0.5663 0.8571 -0.1864 0.0755  -0.0776 22  HIS A CG  
155  N ND1 . HIS A 40  ? 1.3501 0.5893 0.8414 -0.2105 0.0783  -0.0720 22  HIS A ND1 
156  C CD2 . HIS A 40  ? 1.3971 0.6142 0.9358 -0.1960 0.0931  -0.1201 22  HIS A CD2 
157  C CE1 . HIS A 40  ? 1.3756 0.6266 0.8749 -0.2339 0.0923  -0.1035 22  HIS A CE1 
158  N NE2 . HIS A 40  ? 1.4126 0.6509 0.9364 -0.2276 0.1044  -0.1356 22  HIS A NE2 
159  N N   . ALA A 41  ? 1.2051 0.4472 0.6782 -0.1266 0.0253  0.0154  23  ALA A N   
160  C CA  . ALA A 41  ? 1.1777 0.4212 0.6471 -0.1066 0.0099  0.0366  23  ALA A CA  
161  C C   . ALA A 41  ? 1.1134 0.4268 0.5951 -0.0989 0.0081  0.0298  23  ALA A C   
162  O O   . ALA A 41  ? 1.0967 0.4247 0.5918 -0.0791 -0.0003 0.0282  23  ALA A O   
163  C CB  . ALA A 41  ? 1.1953 0.4096 0.6256 -0.1219 0.0069  0.0662  23  ALA A CB  
164  N N   . LEU A 42  ? 1.0734 0.4296 0.5594 -0.1173 0.0123  0.0284  24  LEU A N   
165  C CA  . LEU A 42  ? 1.0278 0.4491 0.5290 -0.1190 0.0027  0.0317  24  LEU A CA  
166  C C   . LEU A 42  ? 1.0407 0.4931 0.5411 -0.1234 0.0045  0.0057  24  LEU A C   
167  O O   . LEU A 42  ? 1.0197 0.5032 0.5224 -0.1146 -0.0004 0.0040  24  LEU A O   
168  C CB  . LEU A 42  ? 0.9959 0.4540 0.5236 -0.1427 -0.0038 0.0431  24  LEU A CB  
169  C CG  . LEU A 42  ? 0.9702 0.4195 0.5286 -0.1438 0.0012  0.0560  24  LEU A CG  
170  C CD1 . LEU A 42  ? 0.9408 0.4260 0.5597 -0.1659 -0.0086 0.0630  24  LEU A CD1 
171  C CD2 . LEU A 42  ? 0.9133 0.3766 0.4812 -0.1275 -0.0016 0.0680  24  LEU A CD2 
172  N N   . LYS A 43  ? 1.0784 0.5248 0.5773 -0.1421 0.0166  -0.0215 25  LYS A N   
173  C CA  . LYS A 43  ? 1.1028 0.5851 0.6046 -0.1595 0.0295  -0.0620 25  LYS A CA  
174  C C   . LYS A 43  ? 1.1150 0.5753 0.6490 -0.1299 0.0386  -0.0860 25  LYS A C   
175  O O   . LYS A 43  ? 1.1106 0.6178 0.6528 -0.1401 0.0477  -0.1149 25  LYS A O   
176  C CB  . LYS A 43  ? 1.1410 0.6203 0.6414 -0.1896 0.0465  -0.0944 25  LYS A CB  
177  C CG  . LYS A 43  ? 1.1800 0.7241 0.6697 -0.2335 0.0627  -0.1395 25  LYS A CG  
178  C CD  . LYS A 43  ? 1.2335 0.7851 0.7143 -0.2732 0.0784  -0.1694 25  LYS A CD  
179  C CE  . LYS A 43  ? 1.2866 0.9161 0.7409 -0.3358 0.0962  -0.2163 25  LYS A CE  
180  N NZ  . LYS A 43  ? 1.3440 0.9829 0.7893 -0.3794 0.1156  -0.2525 25  LYS A NZ  
181  N N   . LYS A 44  ? 1.1289 0.5208 0.6850 -0.0993 0.0331  -0.0716 26  LYS A N   
182  C CA  . LYS A 44  ? 1.1505 0.5141 0.7598 -0.0691 0.0299  -0.0833 26  LYS A CA  
183  C C   . LYS A 44  ? 1.1145 0.5010 0.7177 -0.0482 0.0132  -0.0594 26  LYS A C   
184  O O   . LYS A 44  ? 1.1120 0.5114 0.7640 -0.0323 0.0154  -0.0835 26  LYS A O   
185  C CB  . LYS A 44  ? 1.1946 0.4765 0.8295 -0.0528 0.0167  -0.0610 26  LYS A CB  
186  C CG  . LYS A 44  ? 1.2333 0.4793 0.9531 -0.0238 0.0030  -0.0671 26  LYS A CG  
187  C CD  . LYS A 44  ? 1.2916 0.4541 1.0242 -0.0163 -0.0266 -0.0198 26  LYS A CD  
188  C CE  . LYS A 44  ? 1.3250 0.4550 1.1257 0.0113  -0.0641 0.0099  26  LYS A CE  
189  N NZ  . LYS A 44  ? 1.3893 0.4355 1.2196 0.0087  -0.1008 0.0589  26  LYS A NZ  
190  N N   . TYR A 45  ? 1.0841 0.4776 0.6396 -0.0498 0.0000  -0.0181 27  TYR A N   
191  C CA  . TYR A 45  ? 1.0565 0.4767 0.6049 -0.0348 -0.0122 0.0019  27  TYR A CA  
192  C C   . TYR A 45  ? 1.0285 0.5180 0.5814 -0.0459 -0.0035 -0.0234 27  TYR A C   
193  O O   . TYR A 45  ? 1.0236 0.5304 0.5993 -0.0294 -0.0054 -0.0332 27  TYR A O   
194  C CB  . TYR A 45  ? 1.0383 0.4588 0.5511 -0.0428 -0.0190 0.0383  27  TYR A CB  
195  C CG  . TYR A 45  ? 1.0365 0.4520 0.5418 -0.0272 -0.0313 0.0625  27  TYR A CG  
196  C CD1 . TYR A 45  ? 1.1031 0.4700 0.6078 -0.0155 -0.0470 0.0795  27  TYR A CD1 
197  C CD2 . TYR A 45  ? 1.0026 0.4621 0.5057 -0.0295 -0.0311 0.0722  27  TYR A CD2 
198  C CE1 . TYR A 45  ? 1.1051 0.4726 0.5938 -0.0107 -0.0612 0.1038  27  TYR A CE1 
199  C CE2 . TYR A 45  ? 1.0081 0.4674 0.5032 -0.0202 -0.0382 0.0888  27  TYR A CE2 
200  C CZ  . TYR A 45  ? 1.0629 0.4786 0.5438 -0.0131 -0.0525 0.1036  27  TYR A CZ  
201  O OH  . TYR A 45  ? 1.0602 0.4815 0.5246 -0.0130 -0.0624 0.1217  27  TYR A OH  
202  N N   . ARG A 46  ? 1.0172 0.5483 0.5468 -0.0801 0.0030  -0.0307 28  ARG A N   
203  C CA  . ARG A 46  ? 1.0060 0.6063 0.5229 -0.1092 0.0075  -0.0481 28  ARG A CA  
204  C C   . ARG A 46  ? 1.0511 0.6709 0.5918 -0.1250 0.0353  -0.1113 28  ARG A C   
205  O O   . ARG A 46  ? 1.0799 0.7618 0.5958 -0.1711 0.0475  -0.1382 28  ARG A O   
206  C CB  . ARG A 46  ? 0.9905 0.6304 0.4767 -0.1507 -0.0063 -0.0225 28  ARG A CB  
207  C CG  . ARG A 46  ? 0.9939 0.6319 0.4686 -0.1827 0.0036  -0.0433 28  ARG A CG  
208  C CD  . ARG A 46  ? 0.9460 0.6234 0.4035 -0.2227 -0.0217 -0.0065 28  ARG A CD  
209  N NE  . ARG A 46  ? 1.0053 0.6999 0.4420 -0.2669 -0.0142 -0.0292 28  ARG A NE  
210  C CZ  . ARG A 46  ? 1.0270 0.6960 0.4745 -0.2697 -0.0204 -0.0162 28  ARG A CZ  
211  N NH1 . ARG A 46  ? 0.9981 0.6243 0.4788 -0.2346 -0.0303 0.0150  28  ARG A NH1 
212  N NH2 . ARG A 46  ? 1.0737 0.7638 0.4997 -0.3135 -0.0121 -0.0410 28  ARG A NH2 
213  N N   . ARG A 47  ? 1.0761 0.6452 0.6726 -0.0942 0.0452  -0.1366 29  ARG A N   
214  C CA  . ARG A 47  ? 1.1123 0.6985 0.7722 -0.1010 0.0753  -0.2064 29  ARG A CA  
215  C C   . ARG A 47  ? 1.0808 0.6901 0.7725 -0.0789 0.0721  -0.2130 29  ARG A C   
216  O O   . ARG A 47  ? 1.0927 0.7583 0.8035 -0.1063 0.0998  -0.2687 29  ARG A O   
217  C CB  . ARG A 47  ? 1.1533 0.6726 0.8939 -0.0740 0.0805  -0.2273 29  ARG A CB  
218  C CG  . ARG A 47  ? 1.2268 0.7259 0.9580 -0.0995 0.0957  -0.2444 29  ARG A CG  
219  C CD  . ARG A 47  ? 1.3364 0.9041 1.0586 -0.1579 0.1365  -0.3154 29  ARG A CD  
220  N NE  . ARG A 47  ? 1.3898 1.0048 1.0084 -0.2027 0.1254  -0.2828 29  ARG A NE  
221  C CZ  . ARG A 47  ? 1.4538 1.0835 1.0362 -0.2455 0.1350  -0.2946 29  ARG A CZ  
222  N NH1 . ARG A 47  ? 1.4954 1.0977 1.1303 -0.2515 0.1641  -0.3466 29  ARG A NH1 
223  N NH2 . ARG A 47  ? 1.4619 1.1354 0.9664 -0.2845 0.1125  -0.2529 29  ARG A NH2 
224  N N   . GLU A 48  ? 1.0371 0.6069 0.7303 -0.0367 0.0408  -0.1593 30  GLU A N   
225  C CA  . GLU A 48  ? 1.0046 0.5887 0.7327 -0.0107 0.0323  -0.1590 30  GLU A CA  
226  C C   . GLU A 48  ? 0.9498 0.5993 0.6176 -0.0365 0.0358  -0.1517 30  GLU A C   
227  O O   . GLU A 48  ? 0.9187 0.5769 0.5222 -0.0514 0.0213  -0.1072 30  GLU A O   
228  C CB  . GLU A 48  ? 0.9982 0.5261 0.7308 0.0289  -0.0043 -0.1004 30  GLU A CB  
229  C CG  . GLU A 48  ? 1.0808 0.5422 0.8875 0.0527  -0.0198 -0.0973 30  GLU A CG  
230  C CD  . GLU A 48  ? 1.1431 0.5501 0.9081 0.0651  -0.0570 -0.0277 30  GLU A CD  
231  O OE1 . GLU A 48  ? 1.1421 0.5574 0.8899 0.0773  -0.0778 0.0036  30  GLU A OE1 
232  O OE2 . GLU A 48  ? 1.2024 0.5622 0.9464 0.0555  -0.0624 -0.0075 30  GLU A OE2 
233  N N   . ALA A 49  ? 0.9314 0.6269 0.6335 -0.0442 0.0546  -0.1969 31  ALA A N   
234  C CA  . ALA A 49  ? 0.8987 0.6592 0.5453 -0.0775 0.0588  -0.1932 31  ALA A CA  
235  C C   . ALA A 49  ? 0.8444 0.5943 0.4489 -0.0563 0.0260  -0.1225 31  ALA A C   
236  O O   . ALA A 49  ? 0.8299 0.6158 0.3812 -0.0886 0.0171  -0.0936 31  ALA A O   
237  C CB  . ALA A 49  ? 0.9094 0.7131 0.6103 -0.0832 0.0855  -0.2550 31  ALA A CB  
238  N N   . TYR A 50  ? 0.8217 0.5231 0.4557 -0.0087 0.0062  -0.0938 32  TYR A N   
239  C CA  . TYR A 50  ? 0.7912 0.4845 0.3945 0.0072  -0.0166 -0.0391 32  TYR A CA  
240  C C   . TYR A 50  ? 0.7663 0.4547 0.3270 -0.0135 -0.0252 -0.0010 32  TYR A C   
241  O O   . TYR A 50  ? 0.7438 0.4505 0.2928 -0.0179 -0.0352 0.0302  32  TYR A O   
242  C CB  . TYR A 50  ? 0.8053 0.4495 0.4376 0.0472  -0.0363 -0.0175 32  TYR A CB  
243  C CG  . TYR A 50  ? 0.8602 0.4976 0.5678 0.0677  -0.0342 -0.0558 32  TYR A CG  
244  C CD1 . TYR A 50  ? 0.8675 0.5498 0.6123 0.0727  -0.0249 -0.0873 32  TYR A CD1 
245  C CD2 . TYR A 50  ? 0.9236 0.5129 0.6830 0.0787  -0.0389 -0.0675 32  TYR A CD2 
246  C CE1 . TYR A 50  ? 0.8999 0.5817 0.7454 0.0905  -0.0189 -0.1344 32  TYR A CE1 
247  C CE2 . TYR A 50  ? 0.9559 0.5401 0.8235 0.0982  -0.0372 -0.1092 32  TYR A CE2 
248  C CZ  . TYR A 50  ? 0.9344 0.5668 0.8505 0.1045  -0.0262 -0.1453 32  TYR A CZ  
249  O OH  . TYR A 50  ? 0.9490 0.5810 0.9978 0.1234  -0.0220 -0.1943 32  TYR A OH  
250  N N   . HIS A 51  ? 0.5431 0.3281 0.3579 -0.0317 0.0167  0.0495  33  HIS A N   
251  C CA  . HIS A 51  ? 0.5247 0.3189 0.3382 -0.0393 0.0184  0.0476  33  HIS A CA  
252  C C   . HIS A 51  ? 0.5119 0.3102 0.3294 -0.0438 0.0196  0.0389  33  HIS A C   
253  O O   . HIS A 51  ? 0.5136 0.3190 0.3312 -0.0508 0.0212  0.0369  33  HIS A O   
254  C CB  . HIS A 51  ? 0.5495 0.3345 0.3597 -0.0453 0.0212  0.0539  33  HIS A CB  
255  C CG  . HIS A 51  ? 0.5657 0.3475 0.3714 -0.0414 0.0198  0.0635  33  HIS A CG  
256  N ND1 . HIS A 51  ? 0.5917 0.3575 0.3960 -0.0415 0.0210  0.0709  33  HIS A ND1 
257  C CD2 . HIS A 51  ? 0.5550 0.3478 0.3574 -0.0371 0.0172  0.0670  33  HIS A CD2 
258  C CE1 . HIS A 51  ? 0.5647 0.3332 0.3646 -0.0376 0.0188  0.0792  33  HIS A CE1 
259  N NE2 . HIS A 51  ? 0.5892 0.3742 0.3877 -0.0353 0.0166  0.0765  33  HIS A NE2 
260  N N   . ARG A 52  ? 0.4958 0.2905 0.3165 -0.0403 0.0188  0.0337  34  ARG A N   
261  C CA  . ARG A 52  ? 0.4854 0.2846 0.3092 -0.0447 0.0197  0.0254  34  ARG A CA  
262  C C   . ARG A 52  ? 0.4471 0.2635 0.2723 -0.0425 0.0170  0.0221  34  ARG A C   
263  O O   . ARG A 52  ? 0.4229 0.2444 0.2475 -0.0360 0.0145  0.0247  34  ARG A O   
264  C CB  . ARG A 52  ? 0.4986 0.2861 0.3250 -0.0427 0.0207  0.0207  34  ARG A CB  
265  C CG  . ARG A 52  ? 0.5867 0.3579 0.4135 -0.0486 0.0247  0.0202  34  ARG A CG  
266  C CD  . ARG A 52  ? 0.6566 0.4164 0.4867 -0.0465 0.0263  0.0142  34  ARG A CD  
267  N NE  . ARG A 52  ? 0.7142 0.4848 0.5459 -0.0499 0.0262  0.0047  34  ARG A NE  
268  C CZ  . ARG A 52  ? 0.7409 0.5063 0.5753 -0.0488 0.0276  -0.0025 34  ARG A CZ  
269  N NH1 . ARG A 52  ? 0.7518 0.5012 0.5885 -0.0435 0.0293  -0.0015 34  ARG A NH1 
270  N NH2 . ARG A 52  ? 0.7382 0.5153 0.5731 -0.0526 0.0272  -0.0106 34  ARG A NH2 
271  N N   . VAL A 53  ? 0.4303 0.2556 0.2578 -0.0481 0.0175  0.0164  35  VAL A N   
272  C CA  . VAL A 53  ? 0.4098 0.2502 0.2397 -0.0463 0.0150  0.0127  35  VAL A CA  
273  C C   . VAL A 53  ? 0.4117 0.2488 0.2430 -0.0465 0.0151  0.0063  35  VAL A C   
274  O O   . VAL A 53  ? 0.4150 0.2470 0.2467 -0.0528 0.0175  0.0020  35  VAL A O   
275  C CB  . VAL A 53  ? 0.3984 0.2532 0.2302 -0.0524 0.0152  0.0113  35  VAL A CB  
276  C CG1 . VAL A 53  ? 0.3828 0.2522 0.2177 -0.0506 0.0125  0.0079  35  VAL A CG1 
277  C CG2 . VAL A 53  ? 0.3728 0.2328 0.2035 -0.0517 0.0155  0.0169  35  VAL A CG2 
278  N N   . PHE A 54  ? 0.4087 0.2487 0.2407 -0.0400 0.0128  0.0055  36  PHE A N   
279  C CA  . PHE A 54  ? 0.4013 0.2396 0.2344 -0.0401 0.0131  -0.0008 36  PHE A CA  
280  C C   . PHE A 54  ? 0.3905 0.2449 0.2249 -0.0436 0.0115  -0.0049 36  PHE A C   
281  O O   . PHE A 54  ? 0.3578 0.2243 0.1931 -0.0422 0.0092  -0.0019 36  PHE A O   
282  C CB  . PHE A 54  ? 0.3967 0.2299 0.2301 -0.0319 0.0119  0.0005  36  PHE A CB  
283  C CG  . PHE A 54  ? 0.4272 0.2449 0.2599 -0.0286 0.0134  0.0046  36  PHE A CG  
284  C CD1 . PHE A 54  ? 0.4265 0.2300 0.2603 -0.0306 0.0166  0.0014  36  PHE A CD1 
285  C CD2 . PHE A 54  ? 0.4104 0.2277 0.2415 -0.0242 0.0119  0.0119  36  PHE A CD2 
286  C CE1 . PHE A 54  ? 0.4652 0.2540 0.2991 -0.0273 0.0179  0.0064  36  PHE A CE1 
287  C CE2 . PHE A 54  ? 0.4471 0.2511 0.2773 -0.0214 0.0129  0.0170  36  PHE A CE2 
288  C CZ  . PHE A 54  ? 0.4593 0.2488 0.2912 -0.0226 0.0157  0.0148  36  PHE A CZ  
289  N N   . VAL A 55  ? 0.3837 0.2383 0.2183 -0.0479 0.0127  -0.0117 37  VAL A N   
290  C CA  . VAL A 55  ? 0.3886 0.2595 0.2240 -0.0530 0.0112  -0.0153 37  VAL A CA  
291  C C   . VAL A 55  ? 0.3825 0.2585 0.2176 -0.0512 0.0101  -0.0197 37  VAL A C   
292  O O   . VAL A 55  ? 0.3908 0.2578 0.2252 -0.0525 0.0126  -0.0253 37  VAL A O   
293  C CB  . VAL A 55  ? 0.3937 0.2643 0.2290 -0.0628 0.0138  -0.0204 37  VAL A CB  
294  C CG1 . VAL A 55  ? 0.4135 0.3036 0.2498 -0.0682 0.0116  -0.0230 37  VAL A CG1 
295  C CG2 . VAL A 55  ? 0.4219 0.2857 0.2573 -0.0654 0.0156  -0.0163 37  VAL A CG2 
296  N N   . ASN A 56  ? 0.3687 0.2588 0.2045 -0.0484 0.0067  -0.0172 38  ASN A N   
297  C CA  . ASN A 56  ? 0.3738 0.2716 0.2088 -0.0479 0.0055  -0.0208 38  ASN A CA  
298  C C   . ASN A 56  ? 0.3850 0.2978 0.2196 -0.0556 0.0046  -0.0248 38  ASN A C   
299  O O   . ASN A 56  ? 0.3919 0.3078 0.2245 -0.0589 0.0054  -0.0309 38  ASN A O   
300  C CB  . ASN A 56  ? 0.3515 0.2555 0.1873 -0.0407 0.0024  -0.0154 38  ASN A CB  
301  C CG  . ASN A 56  ? 0.3629 0.2542 0.1987 -0.0335 0.0031  -0.0128 38  ASN A CG  
302  O OD1 . ASN A 56  ? 0.3549 0.2462 0.1916 -0.0285 0.0015  -0.0070 38  ASN A OD1 
303  N ND2 . ASN A 56  ? 0.3243 0.2056 0.1594 -0.0327 0.0055  -0.0173 38  ASN A ND2 
304  N N   . ARG A 57  ? 0.3896 0.3128 0.2261 -0.0585 0.0029  -0.0213 39  ARG A N   
305  C CA  . ARG A 57  ? 0.3980 0.3377 0.2347 -0.0661 0.0015  -0.0242 39  ARG A CA  
306  C C   . ARG A 57  ? 0.3992 0.3398 0.2380 -0.0714 0.0026  -0.0238 39  ARG A C   
307  O O   . ARG A 57  ? 0.3888 0.3246 0.2296 -0.0676 0.0028  -0.0185 39  ARG A O   
308  C CB  . ARG A 57  ? 0.3819 0.3391 0.2206 -0.0631 -0.0030 -0.0189 39  ARG A CB  
309  C CG  . ARG A 57  ? 0.3768 0.3396 0.2126 -0.0624 -0.0042 -0.0211 39  ARG A CG  
310  C CD  . ARG A 57  ? 0.3982 0.3728 0.2362 -0.0572 -0.0083 -0.0136 39  ARG A CD  
311  N NE  . ARG A 57  ? 0.4276 0.3934 0.2685 -0.0493 -0.0085 -0.0076 39  ARG A NE  
312  C CZ  . ARG A 57  ? 0.4330 0.3857 0.2726 -0.0437 -0.0071 -0.0074 39  ARG A CZ  
313  N NH1 . ARG A 57  ? 0.4202 0.3669 0.2564 -0.0441 -0.0054 -0.0125 39  ARG A NH1 
314  N NH2 . ARG A 57  ? 0.3887 0.3352 0.2306 -0.0377 -0.0074 -0.0024 39  ARG A NH2 
315  N N   . SER A 58  ? 0.4012 0.3484 0.2392 -0.0806 0.0037  -0.0296 40  SER A N   
316  C CA  . SER A 58  ? 0.4093 0.3572 0.2491 -0.0871 0.0054  -0.0302 40  SER A CA  
317  C C   . SER A 58  ? 0.4010 0.3629 0.2455 -0.0846 0.0024  -0.0230 40  SER A C   
318  O O   . SER A 58  ? 0.3862 0.3631 0.2329 -0.0813 -0.0013 -0.0194 40  SER A O   
319  C CB  . SER A 58  ? 0.4174 0.3743 0.2558 -0.0981 0.0064  -0.0381 40  SER A CB  
320  O OG  . SER A 58  ? 0.4247 0.3657 0.2596 -0.1011 0.0104  -0.0457 40  SER A OG  
321  N N   . LEU A 59  ? 0.4095 0.3664 0.2558 -0.0861 0.0045  -0.0209 41  LEU A N   
322  C CA  . LEU A 59  ? 0.4009 0.3701 0.2523 -0.0836 0.0026  -0.0148 41  LEU A CA  
323  C C   . LEU A 59  ? 0.4173 0.3873 0.2702 -0.0915 0.0054  -0.0163 41  LEU A C   
324  O O   . LEU A 59  ? 0.4158 0.3692 0.2661 -0.0928 0.0090  -0.0167 41  LEU A O   
325  C CB  . LEU A 59  ? 0.3823 0.3422 0.2342 -0.0736 0.0024  -0.0087 41  LEU A CB  
326  C CG  . LEU A 59  ? 0.3701 0.3423 0.2278 -0.0686 0.0005  -0.0028 41  LEU A CG  
327  C CD1 . LEU A 59  ? 0.3531 0.3207 0.2110 -0.0588 -0.0011 0.0016  41  LEU A CD1 
328  C CD2 . LEU A 59  ? 0.3640 0.3334 0.2231 -0.0713 0.0035  -0.0014 41  LEU A CD2 
329  N N   . ALA A 60  ? 0.4206 0.4106 0.2778 -0.0968 0.0036  -0.0167 42  ALA A N   
330  C CA  . ALA A 60  ? 0.4279 0.4227 0.2877 -0.1044 0.0059  -0.0176 42  ALA A CA  
331  C C   . ALA A 60  ? 0.4324 0.4316 0.2970 -0.0982 0.0059  -0.0110 42  ALA A C   
332  O O   . ALA A 60  ? 0.4089 0.4251 0.2795 -0.0937 0.0027  -0.0072 42  ALA A O   
333  C CB  . ALA A 60  ? 0.4190 0.4358 0.2819 -0.1130 0.0039  -0.0212 42  ALA A CB  
334  N N   . MET A 61  ? 0.4536 0.4377 0.3158 -0.0982 0.0095  -0.0095 43  MET A N   
335  C CA  . MET A 61  ? 0.4681 0.4555 0.3339 -0.0928 0.0101  -0.0041 43  MET A CA  
336  C C   . MET A 61  ? 0.4756 0.4843 0.3488 -0.0966 0.0098  -0.0034 43  MET A C   
337  O O   . MET A 61  ? 0.4655 0.4834 0.3441 -0.0904 0.0091  0.0006  43  MET A O   
338  C CB  . MET A 61  ? 0.4827 0.4513 0.3437 -0.0931 0.0141  -0.0024 43  MET A CB  
339  C CG  . MET A 61  ? 0.5191 0.4704 0.3750 -0.0855 0.0137  -0.0007 43  MET A CG  
340  S SD  . MET A 61  ? 0.5533 0.5101 0.4122 -0.0735 0.0112  0.0045  43  MET A SD  
341  C CE  . MET A 61  ? 0.5436 0.4990 0.4025 -0.0740 0.0147  0.0082  43  MET A CE  
342  N N   . GLU A 62  ? 0.4896 0.5065 0.3636 -0.1069 0.0104  -0.0078 44  GLU A N   
343  C CA  . GLU A 62  ? 0.5176 0.5577 0.3993 -0.1118 0.0097  -0.0078 44  GLU A CA  
344  C C   . GLU A 62  ? 0.4931 0.5536 0.3822 -0.1047 0.0048  -0.0045 44  GLU A C   
345  O O   . GLU A 62  ? 0.4966 0.5756 0.3942 -0.1038 0.0041  -0.0021 44  GLU A O   
346  C CB  . GLU A 62  ? 0.5261 0.5706 0.4061 -0.1248 0.0108  -0.0140 44  GLU A CB  
347  C CG  . GLU A 62  ? 0.5760 0.6465 0.4619 -0.1285 0.0067  -0.0157 44  GLU A CG  
348  C CD  . GLU A 62  ? 0.6046 0.6761 0.4863 -0.1408 0.0073  -0.0233 44  GLU A CD  
349  O OE1 . GLU A 62  ? 0.6971 0.7589 0.5761 -0.1501 0.0117  -0.0272 44  GLU A OE1 
350  O OE2 . GLU A 62  ? 0.6853 0.7675 0.5665 -0.1415 0.0036  -0.0254 44  GLU A OE2 
351  N N   . LYS A 63  ? 0.4822 0.5394 0.3686 -0.0996 0.0016  -0.0040 45  LYS A N   
352  C CA  . LYS A 63  ? 0.4688 0.5435 0.3617 -0.0930 -0.0031 0.0000  45  LYS A CA  
353  C C   . LYS A 63  ? 0.4399 0.5107 0.3366 -0.0810 -0.0035 0.0058  45  LYS A C   
354  O O   . LYS A 63  ? 0.4199 0.5047 0.3239 -0.0746 -0.0068 0.0101  45  LYS A O   
355  C CB  . LYS A 63  ? 0.4873 0.5616 0.3752 -0.0939 -0.0063 -0.0020 45  LYS A CB  
356  C CG  . LYS A 63  ? 0.5232 0.6069 0.4084 -0.1060 -0.0066 -0.0083 45  LYS A CG  
357  C CD  . LYS A 63  ? 0.5635 0.6572 0.4468 -0.1056 -0.0109 -0.0084 45  LYS A CD  
358  C CE  . LYS A 63  ? 0.6254 0.7313 0.5061 -0.1181 -0.0115 -0.0153 45  LYS A CE  
359  N NZ  . LYS A 63  ? 0.6772 0.7677 0.5483 -0.1226 -0.0096 -0.0223 45  LYS A NZ  
360  N N   . ILE A 64  ? 0.4182 0.4701 0.3103 -0.0782 0.0000  0.0058  46  ILE A N   
361  C CA  . ILE A 64  ? 0.3947 0.4421 0.2897 -0.0680 0.0003  0.0101  46  ILE A CA  
362  C C   . ILE A 64  ? 0.3917 0.4528 0.2956 -0.0668 0.0021  0.0119  46  ILE A C   
363  O O   . ILE A 64  ? 0.3943 0.4540 0.2971 -0.0726 0.0058  0.0100  46  ILE A O   
364  C CB  . ILE A 64  ? 0.3988 0.4226 0.2852 -0.0655 0.0030  0.0096  46  ILE A CB  
365  C CG1 . ILE A 64  ? 0.3599 0.3717 0.2393 -0.0647 0.0012  0.0080  46  ILE A CG1 
366  C CG2 . ILE A 64  ? 0.3694 0.3900 0.2585 -0.0569 0.0041  0.0128  46  ILE A CG2 
367  C CD1 . ILE A 64  ? 0.3212 0.3426 0.2037 -0.0596 -0.0033 0.0102  46  ILE A CD1 
368  N N   . LYS A 65  ? 0.3728 0.4471 0.2859 -0.0593 -0.0002 0.0155  47  LYS A N   
369  C CA  . LYS A 65  ? 0.3764 0.4642 0.2993 -0.0569 0.0018  0.0169  47  LYS A CA  
370  C C   . LYS A 65  ? 0.3595 0.4385 0.2841 -0.0482 0.0044  0.0184  47  LYS A C   
371  O O   . LYS A 65  ? 0.3514 0.4390 0.2826 -0.0472 0.0075  0.0180  47  LYS A O   
372  C CB  . LYS A 65  ? 0.3810 0.4925 0.3155 -0.0548 -0.0020 0.0198  47  LYS A CB  
373  C CG  . LYS A 65  ? 0.4433 0.5661 0.3760 -0.0631 -0.0054 0.0184  47  LYS A CG  
374  C CD  . LYS A 65  ? 0.5420 0.6814 0.4794 -0.0721 -0.0039 0.0157  47  LYS A CD  
375  C CE  . LYS A 65  ? 0.5960 0.7214 0.5241 -0.0818 0.0006  0.0106  47  LYS A CE  
376  N NZ  . LYS A 65  ? 0.6286 0.7529 0.5496 -0.0919 -0.0009 0.0065  47  LYS A NZ  
377  N N   . CYS A 66  ? 0.3516 0.4153 0.2708 -0.0424 0.0033  0.0195  48  CYS A N   
378  C CA  . CYS A 66  ? 0.3590 0.4138 0.2791 -0.0344 0.0056  0.0203  48  CYS A CA  
379  C C   . CYS A 66  ? 0.3464 0.3804 0.2550 -0.0341 0.0060  0.0194  48  CYS A C   
380  O O   . CYS A 66  ? 0.3535 0.3811 0.2574 -0.0341 0.0031  0.0199  48  CYS A O   
381  C CB  . CYS A 66  ? 0.3554 0.4153 0.2840 -0.0250 0.0031  0.0238  48  CYS A CB  
382  S SG  . CYS A 66  ? 0.4534 0.5379 0.3975 -0.0225 0.0014  0.0265  48  CYS A SG  
383  N N   . PHE A 67  ? 0.3363 0.3611 0.2407 -0.0338 0.0097  0.0182  49  PHE A N   
384  C CA  . PHE A 67  ? 0.3302 0.3369 0.2247 -0.0325 0.0101  0.0180  49  PHE A CA  
385  C C   . PHE A 67  ? 0.3303 0.3336 0.2274 -0.0244 0.0107  0.0186  49  PHE A C   
386  O O   . PHE A 67  ? 0.3211 0.3303 0.2230 -0.0224 0.0138  0.0176  49  PHE A O   
387  C CB  . PHE A 67  ? 0.3434 0.3418 0.2301 -0.0387 0.0134  0.0168  49  PHE A CB  
388  C CG  . PHE A 67  ? 0.3610 0.3623 0.2460 -0.0476 0.0137  0.0157  49  PHE A CG  
389  C CD1 . PHE A 67  ? 0.3845 0.3743 0.2623 -0.0514 0.0123  0.0149  49  PHE A CD1 
390  C CD2 . PHE A 67  ? 0.3321 0.3478 0.2230 -0.0525 0.0157  0.0148  49  PHE A CD2 
391  C CE1 . PHE A 67  ? 0.3854 0.3766 0.2616 -0.0603 0.0130  0.0130  49  PHE A CE1 
392  C CE2 . PHE A 67  ? 0.3800 0.3983 0.2692 -0.0617 0.0161  0.0133  49  PHE A CE2 
393  C CZ  . PHE A 67  ? 0.3826 0.3881 0.2644 -0.0658 0.0149  0.0122  49  PHE A CZ  
394  N N   . GLY A 68  ? 0.3062 0.3007 0.2004 -0.0201 0.0082  0.0196  50  GLY A N   
395  C CA  . GLY A 68  ? 0.3036 0.2945 0.2005 -0.0130 0.0088  0.0198  50  GLY A CA  
396  C C   . GLY A 68  ? 0.3109 0.2869 0.1981 -0.0127 0.0093  0.0190  50  GLY A C   
397  O O   . GLY A 68  ? 0.3097 0.2776 0.1897 -0.0157 0.0077  0.0194  50  GLY A O   
398  N N   . PHE A 69  ? 0.3139 0.2869 0.2012 -0.0093 0.0118  0.0177  51  PHE A N   
399  C CA  . PHE A 69  ? 0.3305 0.2917 0.2088 -0.0091 0.0124  0.0170  51  PHE A CA  
400  C C   . PHE A 69  ? 0.3404 0.2978 0.2206 -0.0034 0.0122  0.0161  51  PHE A C   
401  O O   . PHE A 69  ? 0.3510 0.3141 0.2394 0.0005  0.0135  0.0151  51  PHE A O   
402  C CB  . PHE A 69  ? 0.3479 0.3089 0.2213 -0.0126 0.0160  0.0157  51  PHE A CB  
403  C CG  . PHE A 69  ? 0.3552 0.3158 0.2241 -0.0192 0.0165  0.0170  51  PHE A CG  
404  C CD1 . PHE A 69  ? 0.3660 0.3153 0.2255 -0.0219 0.0158  0.0186  51  PHE A CD1 
405  C CD2 . PHE A 69  ? 0.3664 0.3380 0.2411 -0.0227 0.0179  0.0166  51  PHE A CD2 
406  C CE1 . PHE A 69  ? 0.3715 0.3187 0.2272 -0.0282 0.0166  0.0198  51  PHE A CE1 
407  C CE2 . PHE A 69  ? 0.3629 0.3336 0.2335 -0.0297 0.0186  0.0174  51  PHE A CE2 
408  C CZ  . PHE A 69  ? 0.3485 0.3058 0.2093 -0.0325 0.0181  0.0191  51  PHE A CZ  
409  N N   . ASN A 70  ? 0.3389 0.2865 0.2119 -0.0029 0.0107  0.0164  52  ASN A N   
410  C CA  . ASN A 70  ? 0.3473 0.2901 0.2198 0.0009  0.0110  0.0150  52  ASN A CA  
411  C C   . ASN A 70  ? 0.3456 0.2866 0.2119 -0.0011 0.0139  0.0131  52  ASN A C   
412  O O   . ASN A 70  ? 0.3291 0.2696 0.1899 -0.0053 0.0144  0.0143  52  ASN A O   
413  C CB  . ASN A 70  ? 0.3714 0.3062 0.2386 0.0013  0.0077  0.0166  52  ASN A CB  
414  C CG  . ASN A 70  ? 0.4111 0.3412 0.2774 0.0045  0.0075  0.0154  52  ASN A CG  
415  O OD1 . ASN A 70  ? 0.4142 0.3385 0.2736 0.0038  0.0070  0.0152  52  ASN A OD1 
416  N ND2 . ASN A 70  ? 0.4644 0.3971 0.3384 0.0079  0.0082  0.0146  52  ASN A ND2 
417  N N   . MET A 71  ? 0.3434 0.2833 0.2098 0.0012  0.0157  0.0102  53  MET A N   
418  C CA  . MET A 71  ? 0.3523 0.2920 0.2117 -0.0013 0.0181  0.0083  53  MET A CA  
419  C C   . MET A 71  ? 0.3554 0.2875 0.2060 -0.0017 0.0157  0.0097  53  MET A C   
420  O O   . MET A 71  ? 0.3562 0.2856 0.1994 -0.0046 0.0149  0.0124  53  MET A O   
421  C CB  . MET A 71  ? 0.3428 0.2869 0.2065 0.0005  0.0220  0.0033  53  MET A CB  
422  C CG  . MET A 71  ? 0.3760 0.3226 0.2318 -0.0032 0.0248  0.0012  53  MET A CG  
423  S SD  . MET A 71  ? 0.4040 0.3558 0.2631 -0.0022 0.0300  -0.0064 53  MET A SD  
424  C CE  . MET A 71  ? 0.3681 0.3115 0.2281 0.0015  0.0277  -0.0081 53  MET A CE  
425  N N   . ASP A 72  ? 0.3633 0.2921 0.2151 0.0013  0.0146  0.0081  54  ASP A N   
426  C CA  . ASP A 72  ? 0.3679 0.2918 0.2119 0.0009  0.0126  0.0088  54  ASP A CA  
427  C C   . ASP A 72  ? 0.3645 0.2827 0.2048 0.0009  0.0089  0.0129  54  ASP A C   
428  O O   . ASP A 72  ? 0.3677 0.2841 0.2122 0.0025  0.0071  0.0141  54  ASP A O   
429  C CB  . ASP A 72  ? 0.3797 0.3025 0.2259 0.0031  0.0130  0.0052  54  ASP A CB  
430  C CG  . ASP A 72  ? 0.4026 0.3298 0.2474 0.0017  0.0167  0.0003  54  ASP A CG  
431  O OD1 . ASP A 72  ? 0.4640 0.3957 0.3048 -0.0012 0.0187  0.0004  54  ASP A OD1 
432  O OD2 . ASP A 72  ? 0.4348 0.3611 0.2818 0.0029  0.0177  -0.0037 54  ASP A OD2 
433  N N   . TYR A 73  ? 0.3631 0.2791 0.1959 -0.0010 0.0082  0.0154  55  TYR A N   
434  C CA  . TYR A 73  ? 0.3608 0.2708 0.1902 -0.0011 0.0055  0.0193  55  TYR A CA  
435  C C   . TYR A 73  ? 0.3583 0.2669 0.1900 -0.0029 0.0057  0.0209  55  TYR A C   
436  O O   . TYR A 73  ? 0.3590 0.2624 0.1900 -0.0028 0.0038  0.0228  55  TYR A O   
437  C CB  . TYR A 73  ? 0.3515 0.2580 0.1816 0.0019  0.0027  0.0191  55  TYR A CB  
438  C CG  . TYR A 73  ? 0.3611 0.2681 0.1866 0.0027  0.0016  0.0190  55  TYR A CG  
439  C CD1 . TYR A 73  ? 0.3630 0.2686 0.1822 0.0018  0.0006  0.0226  55  TYR A CD1 
440  C CD2 . TYR A 73  ? 0.3705 0.2797 0.1982 0.0041  0.0016  0.0156  55  TYR A CD2 
441  C CE1 . TYR A 73  ? 0.3486 0.2567 0.1637 0.0025  -0.0009 0.0229  55  TYR A CE1 
442  C CE2 . TYR A 73  ? 0.3613 0.2725 0.1847 0.0041  0.0005  0.0150  55  TYR A CE2 
443  C CZ  . TYR A 73  ? 0.3385 0.2499 0.1557 0.0034  -0.0009 0.0188  55  TYR A CZ  
444  O OH  . TYR A 73  ? 0.3758 0.2910 0.1890 0.0034  -0.0026 0.0187  55  TYR A OH  
445  N N   . THR A 74  ? 0.3558 0.2699 0.1905 -0.0051 0.0082  0.0198  56  THR A N   
446  C CA  . THR A 74  ? 0.3489 0.2631 0.1854 -0.0079 0.0086  0.0212  56  THR A CA  
447  C C   . THR A 74  ? 0.3556 0.2730 0.1890 -0.0119 0.0115  0.0221  56  THR A C   
448  O O   . THR A 74  ? 0.3730 0.2853 0.2007 -0.0148 0.0114  0.0253  56  THR A O   
449  C CB  . THR A 74  ? 0.3470 0.2669 0.1919 -0.0067 0.0084  0.0194  56  THR A CB  
450  O OG1 . THR A 74  ? 0.3601 0.2768 0.2066 -0.0038 0.0056  0.0194  56  THR A OG1 
451  C CG2 . THR A 74  ? 0.3244 0.2467 0.1712 -0.0107 0.0088  0.0202  56  THR A CG2 
452  N N   . LEU A 75  ? 0.3457 0.2713 0.1829 -0.0121 0.0142  0.0193  57  LEU A N   
453  C CA  . LEU A 75  ? 0.3644 0.2950 0.1985 -0.0160 0.0175  0.0194  57  LEU A CA  
454  C C   . LEU A 75  ? 0.3666 0.2960 0.1930 -0.0160 0.0178  0.0199  57  LEU A C   
455  O O   . LEU A 75  ? 0.3727 0.3014 0.1921 -0.0197 0.0187  0.0231  57  LEU A O   
456  C CB  . LEU A 75  ? 0.3558 0.2968 0.1977 -0.0156 0.0207  0.0155  57  LEU A CB  
457  C CG  . LEU A 75  ? 0.3926 0.3392 0.2424 -0.0166 0.0210  0.0153  57  LEU A CG  
458  C CD1 . LEU A 75  ? 0.3709 0.3283 0.2294 -0.0148 0.0241  0.0115  57  LEU A CD1 
459  C CD2 . LEU A 75  ? 0.3464 0.2926 0.1925 -0.0226 0.0218  0.0181  57  LEU A CD2 
460  N N   . ALA A 76  ? 0.3586 0.2880 0.1860 -0.0123 0.0169  0.0170  58  ALA A N   
461  C CA  . ALA A 76  ? 0.3525 0.2829 0.1731 -0.0127 0.0170  0.0166  58  ALA A CA  
462  C C   . ALA A 76  ? 0.3633 0.2865 0.1807 -0.0102 0.0130  0.0195  58  ALA A C   
463  O O   . ALA A 76  ? 0.3617 0.2832 0.1827 -0.0069 0.0114  0.0172  58  ALA A O   
464  C CB  . ALA A 76  ? 0.3528 0.2891 0.1775 -0.0110 0.0196  0.0102  58  ALA A CB  
465  N N   . VAL A 77  ? 0.3829 0.3017 0.1936 -0.0118 0.0113  0.0248  59  VAL A N   
466  C CA  . VAL A 77  ? 0.3794 0.2919 0.1881 -0.0089 0.0076  0.0278  59  VAL A CA  
467  C C   . VAL A 77  ? 0.3807 0.2973 0.1828 -0.0091 0.0067  0.0286  59  VAL A C   
468  O O   . VAL A 77  ? 0.3635 0.2832 0.1593 -0.0123 0.0076  0.0316  59  VAL A O   
469  C CB  . VAL A 77  ? 0.3910 0.2952 0.1979 -0.0097 0.0062  0.0332  59  VAL A CB  
470  C CG1 . VAL A 77  ? 0.4056 0.3043 0.2103 -0.0062 0.0027  0.0365  59  VAL A CG1 
471  C CG2 . VAL A 77  ? 0.3944 0.2955 0.2077 -0.0097 0.0066  0.0315  59  VAL A CG2 
472  N N   . TYR A 78  ? 0.3763 0.2940 0.1798 -0.0063 0.0049  0.0258  60  TYR A N   
473  C CA  . TYR A 78  ? 0.3679 0.2915 0.1657 -0.0071 0.0041  0.0255  60  TYR A CA  
474  C C   . TYR A 78  ? 0.3832 0.3040 0.1763 -0.0056 0.0003  0.0321  60  TYR A C   
475  O O   . TYR A 78  ? 0.3862 0.3005 0.1828 -0.0022 -0.0021 0.0341  60  TYR A O   
476  C CB  . TYR A 78  ? 0.3549 0.2810 0.1566 -0.0053 0.0040  0.0193  60  TYR A CB  
477  C CG  . TYR A 78  ? 0.3457 0.2743 0.1529 -0.0061 0.0079  0.0130  60  TYR A CG  
478  C CD1 . TYR A 78  ? 0.3524 0.2884 0.1568 -0.0094 0.0114  0.0091  60  TYR A CD1 
479  C CD2 . TYR A 78  ? 0.3466 0.2708 0.1620 -0.0035 0.0083  0.0111  60  TYR A CD2 
480  C CE1 . TYR A 78  ? 0.3653 0.3034 0.1757 -0.0095 0.0154  0.0032  60  TYR A CE1 
481  C CE2 . TYR A 78  ? 0.3837 0.3104 0.2052 -0.0035 0.0117  0.0062  60  TYR A CE2 
482  C CZ  . TYR A 78  ? 0.3891 0.3224 0.2085 -0.0062 0.0155  0.0020  60  TYR A CZ  
483  O OH  . TYR A 78  ? 0.3957 0.3316 0.2223 -0.0056 0.0194  -0.0033 60  TYR A OH  
484  N N   . LYS A 79  ? 0.3943 0.3212 0.1801 -0.0080 -0.0002 0.0352  61  LYS A N   
485  C CA  . LYS A 79  ? 0.4005 0.3259 0.1818 -0.0065 -0.0038 0.0430  61  LYS A CA  
486  C C   . LYS A 79  ? 0.4036 0.3308 0.1869 -0.0027 -0.0073 0.0421  61  LYS A C   
487  O O   . LYS A 79  ? 0.3943 0.3283 0.1782 -0.0034 -0.0070 0.0361  61  LYS A O   
488  C CB  . LYS A 79  ? 0.4150 0.3482 0.1874 -0.0105 -0.0034 0.0471  61  LYS A CB  
489  C CG  . LYS A 79  ? 0.4219 0.3533 0.1920 -0.0147 0.0001  0.0492  61  LYS A CG  
490  C CD  . LYS A 79  ? 0.4185 0.3582 0.1792 -0.0191 0.0004  0.0540  61  LYS A CD  
491  C CE  . LYS A 79  ? 0.4211 0.3578 0.1799 -0.0233 0.0037  0.0573  61  LYS A CE  
492  N NZ  . LYS A 79  ? 0.5203 0.4658 0.2691 -0.0285 0.0044  0.0627  61  LYS A NZ  
493  N N   . SER A 80  ? 0.4041 0.3253 0.1887 0.0010  -0.0103 0.0481  62  SER A N   
494  C CA  . SER A 80  ? 0.4035 0.3255 0.1914 0.0054  -0.0137 0.0483  62  SER A CA  
495  C C   . SER A 80  ? 0.4099 0.3362 0.1935 0.0071  -0.0173 0.0561  62  SER A C   
496  O O   . SER A 80  ? 0.4213 0.3425 0.2024 0.0073  -0.0176 0.0634  62  SER A O   
497  C CB  . SER A 80  ? 0.3859 0.2972 0.1806 0.0090  -0.0136 0.0481  62  SER A CB  
498  O OG  . SER A 80  ? 0.4109 0.3231 0.2096 0.0132  -0.0164 0.0478  62  SER A OG  
499  N N   . PRO A 81  ? 0.4152 0.3509 0.1985 0.0083  -0.0202 0.0552  63  PRO A N   
500  C CA  . PRO A 81  ? 0.4145 0.3556 0.2012 0.0080  -0.0200 0.0470  63  PRO A CA  
501  C C   . PRO A 81  ? 0.4246 0.3751 0.2069 0.0026  -0.0179 0.0406  63  PRO A C   
502  O O   . PRO A 81  ? 0.4165 0.3712 0.2015 0.0019  -0.0177 0.0342  63  PRO A O   
503  C CB  . PRO A 81  ? 0.4102 0.3577 0.1986 0.0117  -0.0243 0.0504  63  PRO A CB  
504  C CG  . PRO A 81  ? 0.4337 0.3861 0.2158 0.0116  -0.0269 0.0595  63  PRO A CG  
505  C CD  . PRO A 81  ? 0.4201 0.3619 0.2002 0.0105  -0.0242 0.0634  63  PRO A CD  
506  N N   . GLU A 82  ? 0.4229 0.3766 0.1990 -0.0015 -0.0159 0.0419  64  GLU A N   
507  C CA  . GLU A 82  ? 0.4382 0.4022 0.2094 -0.0068 -0.0137 0.0357  64  GLU A CA  
508  C C   . GLU A 82  ? 0.4228 0.3839 0.1994 -0.0080 -0.0100 0.0258  64  GLU A C   
509  O O   . GLU A 82  ? 0.4127 0.3808 0.1888 -0.0105 -0.0094 0.0192  64  GLU A O   
510  C CB  . GLU A 82  ? 0.4510 0.4183 0.2149 -0.0111 -0.0114 0.0385  64  GLU A CB  
511  C CG  . GLU A 82  ? 0.4946 0.4696 0.2505 -0.0120 -0.0150 0.0478  64  GLU A CG  
512  C CD  . GLU A 82  ? 0.5503 0.5152 0.3081 -0.0074 -0.0176 0.0584  64  GLU A CD  
513  O OE1 . GLU A 82  ? 0.5207 0.4731 0.2847 -0.0047 -0.0160 0.0578  64  GLU A OE1 
514  O OE2 . GLU A 82  ? 0.6101 0.5800 0.3633 -0.0065 -0.0212 0.0673  64  GLU A OE2 
515  N N   . TYR A 83  ? 0.3982 0.3491 0.1801 -0.0064 -0.0075 0.0248  65  TYR A N   
516  C CA  . TYR A 83  ? 0.3851 0.3334 0.1729 -0.0069 -0.0041 0.0165  65  TYR A CA  
517  C C   . TYR A 83  ? 0.3859 0.3319 0.1795 -0.0043 -0.0059 0.0135  65  TYR A C   
518  O O   . TYR A 83  ? 0.3833 0.3316 0.1792 -0.0061 -0.0040 0.0065  65  TYR A O   
519  C CB  . TYR A 83  ? 0.3819 0.3224 0.1738 -0.0061 -0.0014 0.0170  65  TYR A CB  
520  C CG  . TYR A 83  ? 0.3595 0.2980 0.1576 -0.0063 0.0021  0.0097  65  TYR A CG  
521  C CD1 . TYR A 83  ? 0.3849 0.3292 0.1819 -0.0097 0.0061  0.0037  65  TYR A CD1 
522  C CD2 . TYR A 83  ? 0.3673 0.2986 0.1731 -0.0031 0.0018  0.0091  65  TYR A CD2 
523  C CE1 . TYR A 83  ? 0.3474 0.2891 0.1515 -0.0091 0.0095  -0.0027 65  TYR A CE1 
524  C CE2 . TYR A 83  ? 0.3436 0.2731 0.1559 -0.0028 0.0048  0.0035  65  TYR A CE2 
525  C CZ  . TYR A 83  ? 0.3598 0.2940 0.1716 -0.0055 0.0087  -0.0022 65  TYR A CZ  
526  O OH  . TYR A 83  ? 0.3443 0.2762 0.1637 -0.0045 0.0120  -0.0075 65  TYR A OH  
527  N N   . GLU A 84  ? 0.3827 0.3242 0.1789 -0.0004 -0.0091 0.0185  66  GLU A N   
528  C CA  . GLU A 84  ? 0.3735 0.3147 0.1744 0.0017  -0.0110 0.0163  66  GLU A CA  
529  C C   . GLU A 84  ? 0.3806 0.3323 0.1784 -0.0009 -0.0124 0.0133  66  GLU A C   
530  O O   . GLU A 84  ? 0.3752 0.3277 0.1766 -0.0021 -0.0115 0.0076  66  GLU A O   
531  C CB  . GLU A 84  ? 0.3868 0.3235 0.1905 0.0062  -0.0140 0.0220  66  GLU A CB  
532  C CG  . GLU A 84  ? 0.3915 0.3181 0.1987 0.0084  -0.0128 0.0240  66  GLU A CG  
533  C CD  . GLU A 84  ? 0.4368 0.3605 0.2401 0.0088  -0.0133 0.0305  66  GLU A CD  
534  O OE1 . GLU A 84  ? 0.4853 0.4124 0.2837 0.0056  -0.0118 0.0309  66  GLU A OE1 
535  O OE2 . GLU A 84  ? 0.4311 0.3490 0.2361 0.0120  -0.0148 0.0350  66  GLU A OE2 
536  N N   A SER A 85  ? 0.3757 0.3357 0.1671 -0.0020 -0.0147 0.0174  67  SER A N   
537  N N   B SER A 85  ? 0.3788 0.3387 0.1702 -0.0020 -0.0147 0.0174  67  SER A N   
538  C CA  A SER A 85  ? 0.3777 0.3502 0.1649 -0.0054 -0.0163 0.0147  67  SER A CA  
539  C CA  B SER A 85  ? 0.3848 0.3572 0.1720 -0.0054 -0.0162 0.0147  67  SER A CA  
540  C C   A SER A 85  ? 0.3766 0.3528 0.1623 -0.0109 -0.0123 0.0054  67  SER A C   
541  C C   B SER A 85  ? 0.3802 0.3562 0.1660 -0.0109 -0.0122 0.0054  67  SER A C   
542  O O   A SER A 85  ? 0.3773 0.3591 0.1638 -0.0136 -0.0123 -0.0004 67  SER A O   
543  O O   B SER A 85  ? 0.3810 0.3624 0.1679 -0.0135 -0.0123 -0.0004 67  SER A O   
544  C CB  A SER A 85  ? 0.3880 0.3694 0.1680 -0.0058 -0.0195 0.0220  67  SER A CB  
545  C CB  B SER A 85  ? 0.3954 0.3763 0.1753 -0.0059 -0.0192 0.0220  67  SER A CB  
546  O OG  A SER A 85  ? 0.3698 0.3639 0.1479 -0.0069 -0.0231 0.0221  67  SER A OG  
547  O OG  B SER A 85  ? 0.4051 0.3836 0.1876 -0.0005 -0.0231 0.0300  67  SER A OG  
548  N N   . LEU A 86  ? 0.3711 0.3441 0.1550 -0.0127 -0.0085 0.0036  68  LEU A N   
549  C CA  . LEU A 86  ? 0.3708 0.3455 0.1547 -0.0171 -0.0037 -0.0057 68  LEU A CA  
550  C C   . LEU A 86  ? 0.3722 0.3388 0.1648 -0.0159 -0.0016 -0.0117 68  LEU A C   
551  O O   . LEU A 86  ? 0.3845 0.3540 0.1780 -0.0194 0.0005  -0.0194 68  LEU A O   
552  C CB  . LEU A 86  ? 0.3761 0.3485 0.1583 -0.0182 0.0002  -0.0059 68  LEU A CB  
553  C CG  . LEU A 86  ? 0.3773 0.3512 0.1608 -0.0220 0.0059  -0.0162 68  LEU A CG  
554  C CD1 . LEU A 86  ? 0.3637 0.3498 0.1405 -0.0277 0.0063  -0.0217 68  LEU A CD1 
555  C CD2 . LEU A 86  ? 0.3503 0.3221 0.1336 -0.0223 0.0097  -0.0158 68  LEU A CD2 
556  N N   . GLY A 87  ? 0.3682 0.3247 0.1670 -0.0113 -0.0020 -0.0082 69  GLY A N   
557  C CA  . GLY A 87  ? 0.3591 0.3080 0.1658 -0.0101 -0.0004 -0.0123 69  GLY A CA  
558  C C   . GLY A 87  ? 0.3669 0.3194 0.1745 -0.0110 -0.0029 -0.0136 69  GLY A C   
559  O O   . GLY A 87  ? 0.3721 0.3230 0.1835 -0.0133 -0.0008 -0.0200 69  GLY A O   
560  N N   . PHE A 88  ? 0.3566 0.3137 0.1617 -0.0090 -0.0074 -0.0076 70  PHE A N   
561  C CA  . PHE A 88  ? 0.3675 0.3307 0.1736 -0.0098 -0.0102 -0.0085 70  PHE A CA  
562  C C   . PHE A 88  ? 0.3742 0.3472 0.1766 -0.0158 -0.0092 -0.0154 70  PHE A C   
563  O O   . PHE A 88  ? 0.3835 0.3566 0.1893 -0.0184 -0.0082 -0.0208 70  PHE A O   
564  C CB  . PHE A 88  ? 0.3615 0.3292 0.1659 -0.0060 -0.0149 -0.0006 70  PHE A CB  
565  C CG  . PHE A 88  ? 0.3465 0.3224 0.1527 -0.0062 -0.0181 -0.0009 70  PHE A CG  
566  C CD1 . PHE A 88  ? 0.3262 0.2975 0.1390 -0.0035 -0.0187 -0.0004 70  PHE A CD1 
567  C CD2 . PHE A 88  ? 0.3676 0.3573 0.1692 -0.0094 -0.0205 -0.0016 70  PHE A CD2 
568  C CE1 . PHE A 88  ? 0.3067 0.2864 0.1217 -0.0037 -0.0214 -0.0006 70  PHE A CE1 
569  C CE2 . PHE A 88  ? 0.3826 0.3814 0.1866 -0.0097 -0.0235 -0.0018 70  PHE A CE2 
570  C CZ  . PHE A 88  ? 0.3255 0.3190 0.1365 -0.0066 -0.0238 -0.0013 70  PHE A CZ  
571  N N   . GLU A 89  ? 0.3998 0.3812 0.1949 -0.0187 -0.0092 -0.0156 71  GLU A N   
572  C CA  . GLU A 89  ? 0.4106 0.4026 0.2012 -0.0254 -0.0079 -0.0231 71  GLU A CA  
573  C C   . GLU A 89  ? 0.3922 0.3774 0.1869 -0.0288 -0.0023 -0.0331 71  GLU A C   
574  O O   . GLU A 89  ? 0.3739 0.3627 0.1695 -0.0333 -0.0014 -0.0398 71  GLU A O   
575  C CB  . GLU A 89  ? 0.4358 0.4369 0.2177 -0.0281 -0.0078 -0.0219 71  GLU A CB  
576  C CG  . GLU A 89  ? 0.5512 0.5613 0.3280 -0.0257 -0.0134 -0.0121 71  GLU A CG  
577  C CD  . GLU A 89  ? 0.6780 0.6982 0.4451 -0.0297 -0.0129 -0.0110 71  GLU A CD  
578  O OE1 . GLU A 89  ? 0.7144 0.7297 0.4793 -0.0275 -0.0121 -0.0054 71  GLU A OE1 
579  O OE2 . GLU A 89  ? 0.7144 0.7478 0.4762 -0.0358 -0.0131 -0.0164 71  GLU A OE2 
580  N N   . LEU A 90  ? 0.3803 0.3557 0.1778 -0.0269 0.0016  -0.0341 72  LEU A N   
581  C CA  . LEU A 90  ? 0.3783 0.3460 0.1812 -0.0291 0.0072  -0.0430 72  LEU A CA  
582  C C   . LEU A 90  ? 0.3713 0.3296 0.1826 -0.0276 0.0075  -0.0440 72  LEU A C   
583  O O   . LEU A 90  ? 0.3807 0.3353 0.1956 -0.0310 0.0112  -0.0518 72  LEU A O   
584  C CB  . LEU A 90  ? 0.3782 0.3390 0.1833 -0.0265 0.0111  -0.0430 72  LEU A CB  
585  C CG  . LEU A 90  ? 0.3691 0.3391 0.1662 -0.0289 0.0120  -0.0428 72  LEU A CG  
586  C CD1 . LEU A 90  ? 0.3755 0.3393 0.1757 -0.0259 0.0155  -0.0416 72  LEU A CD1 
587  C CD2 . LEU A 90  ? 0.3930 0.3727 0.1847 -0.0359 0.0148  -0.0522 72  LEU A CD2 
588  N N   . THR A 91  ? 0.3700 0.3241 0.1843 -0.0227 0.0039  -0.0363 73  THR A N   
589  C CA  . THR A 91  ? 0.3674 0.3142 0.1886 -0.0217 0.0038  -0.0362 73  THR A CA  
590  C C   . THR A 91  ? 0.3798 0.3348 0.1994 -0.0264 0.0021  -0.0398 73  THR A C   
591  O O   . THR A 91  ? 0.3874 0.3381 0.2113 -0.0297 0.0045  -0.0452 73  THR A O   
592  C CB  . THR A 91  ? 0.3692 0.3113 0.1933 -0.0159 0.0006  -0.0276 73  THR A CB  
593  O OG1 . THR A 91  ? 0.3419 0.2775 0.1675 -0.0125 0.0024  -0.0251 73  THR A OG1 
594  C CG2 . THR A 91  ? 0.3550 0.2905 0.1857 -0.0153 0.0006  -0.0272 73  THR A CG2 
595  N N   . VAL A 92  ? 0.3783 0.3455 0.1921 -0.0269 -0.0021 -0.0366 74  VAL A N   
596  C CA  . VAL A 92  ? 0.3853 0.3633 0.1976 -0.0316 -0.0042 -0.0398 74  VAL A CA  
597  C C   . VAL A 92  ? 0.4001 0.3804 0.2106 -0.0391 0.0001  -0.0505 74  VAL A C   
598  O O   . VAL A 92  ? 0.4072 0.3873 0.2208 -0.0436 0.0013  -0.0561 74  VAL A O   
599  C CB  . VAL A 92  ? 0.3945 0.3866 0.2009 -0.0303 -0.0095 -0.0339 74  VAL A CB  
600  C CG1 . VAL A 92  ? 0.4016 0.4082 0.2050 -0.0365 -0.0112 -0.0387 74  VAL A CG1 
601  C CG2 . VAL A 92  ? 0.3458 0.3353 0.1559 -0.0236 -0.0133 -0.0251 74  VAL A CG2 
602  N N   A GLU A 93  ? 0.4023 0.3846 0.2081 -0.0407 0.0026  -0.0538 75  GLU A N   
603  N N   B GLU A 93  ? 0.3994 0.3818 0.2051 -0.0406 0.0025  -0.0536 75  GLU A N   
604  C CA  A GLU A 93  ? 0.4150 0.4004 0.2188 -0.0481 0.0071  -0.0650 75  GLU A CA  
605  C CA  B GLU A 93  ? 0.4090 0.3940 0.2126 -0.0477 0.0072  -0.0648 75  GLU A CA  
606  C C   A GLU A 93  ? 0.4101 0.3804 0.2223 -0.0490 0.0125  -0.0715 75  GLU A C   
607  C C   B GLU A 93  ? 0.4065 0.3770 0.2186 -0.0488 0.0123  -0.0712 75  GLU A C   
608  O O   A GLU A 93  ? 0.4150 0.3860 0.2281 -0.0554 0.0154  -0.0804 75  GLU A O   
609  O O   B GLU A 93  ? 0.4092 0.3811 0.2222 -0.0552 0.0146  -0.0795 75  GLU A O   
610  C CB  A GLU A 93  ? 0.4183 0.4098 0.2152 -0.0497 0.0091  -0.0674 75  GLU A CB  
611  C CB  B GLU A 93  ? 0.4105 0.3985 0.2085 -0.0481 0.0099  -0.0666 75  GLU A CB  
612  C CG  A GLU A 93  ? 0.4443 0.4536 0.2317 -0.0518 0.0042  -0.0633 75  GLU A CG  
613  C CG  B GLU A 93  ? 0.4235 0.4130 0.2201 -0.0552 0.0159  -0.0794 75  GLU A CG  
614  C CD  A GLU A 93  ? 0.4751 0.4894 0.2555 -0.0520 0.0055  -0.0621 75  GLU A CD  
615  C CD  B GLU A 93  ? 0.4296 0.4222 0.2213 -0.0556 0.0193  -0.0816 75  GLU A CD  
616  O OE1 A GLU A 93  ? 0.4981 0.5032 0.2811 -0.0512 0.0107  -0.0662 75  GLU A OE1 
617  O OE1 B GLU A 93  ? 0.3992 0.3836 0.1939 -0.0499 0.0204  -0.0767 75  GLU A OE1 
618  O OE2 A GLU A 93  ? 0.4820 0.5099 0.2546 -0.0528 0.0011  -0.0565 75  GLU A OE2 
619  O OE2 B GLU A 93  ? 0.4806 0.4848 0.2653 -0.0623 0.0210  -0.0890 75  GLU A OE2 
620  N N   . ARG A 94  ? 0.4040 0.3610 0.2225 -0.0428 0.0138  -0.0668 76  ARG A N   
621  C CA  . ARG A 94  ? 0.3941 0.3362 0.2216 -0.0425 0.0183  -0.0705 76  ARG A CA  
622  C C   . ARG A 94  ? 0.4033 0.3433 0.2346 -0.0451 0.0169  -0.0706 76  ARG A C   
623  O O   . ARG A 94  ? 0.3960 0.3294 0.2314 -0.0497 0.0210  -0.0779 76  ARG A O   
624  C CB  . ARG A 94  ? 0.3839 0.3148 0.2170 -0.0350 0.0189  -0.0639 76  ARG A CB  
625  C CG  . ARG A 94  ? 0.3585 0.2743 0.2015 -0.0337 0.0227  -0.0655 76  ARG A CG  
626  C CD  . ARG A 94  ? 0.4053 0.3156 0.2517 -0.0381 0.0293  -0.0767 76  ARG A CD  
627  N NE  . ARG A 94  ? 0.4323 0.3272 0.2890 -0.0354 0.0324  -0.0758 76  ARG A NE  
628  C CZ  . ARG A 94  ? 0.4678 0.3530 0.3309 -0.0376 0.0385  -0.0839 76  ARG A CZ  
629  N NH1 . ARG A 94  ? 0.4564 0.3458 0.3165 -0.0432 0.0427  -0.0950 76  ARG A NH1 
630  N NH2 . ARG A 94  ? 0.4599 0.3311 0.3326 -0.0345 0.0404  -0.0807 76  ARG A NH2 
631  N N   . LEU A 95  ? 0.3974 0.3429 0.2276 -0.0425 0.0115  -0.0626 77  LEU A N   
632  C CA  . LEU A 95  ? 0.4092 0.3561 0.2422 -0.0454 0.0098  -0.0623 77  LEU A CA  
633  C C   . LEU A 95  ? 0.4196 0.3773 0.2493 -0.0539 0.0101  -0.0706 77  LEU A C   
634  O O   . LEU A 95  ? 0.4297 0.3832 0.2636 -0.0588 0.0122  -0.0751 77  LEU A O   
635  C CB  . LEU A 95  ? 0.3824 0.3351 0.2148 -0.0405 0.0042  -0.0528 77  LEU A CB  
636  C CG  . LEU A 95  ? 0.3960 0.3389 0.2323 -0.0331 0.0034  -0.0447 77  LEU A CG  
637  C CD1 . LEU A 95  ? 0.3399 0.2914 0.1738 -0.0291 -0.0019 -0.0373 77  LEU A CD1 
638  C CD2 . LEU A 95  ? 0.3463 0.2770 0.1898 -0.0334 0.0058  -0.0443 77  LEU A CD2 
639  N N   . VAL A 96  ? 0.4327 0.4047 0.2548 -0.0561 0.0079  -0.0722 78  VAL A N   
640  C CA  . VAL A 96  ? 0.4438 0.4281 0.2621 -0.0648 0.0083  -0.0806 78  VAL A CA  
641  C C   . VAL A 96  ? 0.4629 0.4377 0.2836 -0.0707 0.0152  -0.0921 78  VAL A C   
642  O O   . VAL A 96  ? 0.4714 0.4470 0.2938 -0.0780 0.0172  -0.0993 78  VAL A O   
643  C CB  . VAL A 96  ? 0.4432 0.4463 0.2523 -0.0661 0.0043  -0.0794 78  VAL A CB  
644  C CG1 . VAL A 96  ? 0.4588 0.4752 0.2637 -0.0760 0.0051  -0.0891 78  VAL A CG1 
645  C CG2 . VAL A 96  ? 0.4269 0.4396 0.2352 -0.0606 -0.0025 -0.0686 78  VAL A CG2 
646  N N   . SER A 97  ? 0.4743 0.4398 0.2957 -0.0677 0.0193  -0.0940 79  SER A N   
647  C CA  . SER A 97  ? 0.4957 0.4515 0.3204 -0.0725 0.0265  -0.1054 79  SER A CA  
648  C C   . SER A 97  ? 0.4997 0.4378 0.3344 -0.0728 0.0303  -0.1069 79  SER A C   
649  O O   . SER A 97  ? 0.5140 0.4457 0.3518 -0.0791 0.0357  -0.1173 79  SER A O   
650  C CB  . SER A 97  ? 0.5014 0.4535 0.3250 -0.0691 0.0302  -0.1074 79  SER A CB  
651  O OG  . SER A 97  ? 0.5462 0.4828 0.3775 -0.0614 0.0319  -0.1018 79  SER A OG  
652  N N   . ILE A 98  ? 0.4910 0.4215 0.3307 -0.0665 0.0275  -0.0968 80  ILE A N   
653  C CA  . ILE A 98  ? 0.4950 0.4104 0.3433 -0.0672 0.0301  -0.0964 80  ILE A CA  
654  C C   . ILE A 98  ? 0.4928 0.4149 0.3408 -0.0732 0.0275  -0.0964 80  ILE A C   
655  O O   . ILE A 98  ? 0.4981 0.4092 0.3525 -0.0752 0.0296  -0.0959 80  ILE A O   
656  C CB  . ILE A 98  ? 0.4951 0.3981 0.3496 -0.0581 0.0293  -0.0860 80  ILE A CB  
657  C CG1 . ILE A 98  ? 0.4846 0.3966 0.3357 -0.0533 0.0226  -0.0753 80  ILE A CG1 
658  C CG2 . ILE A 98  ? 0.5102 0.4065 0.3668 -0.0528 0.0327  -0.0869 80  ILE A CG2 
659  C CD1 . ILE A 98  ? 0.4823 0.3846 0.3396 -0.0493 0.0216  -0.0670 80  ILE A CD1 
660  N N   . GLY A 99  ? 0.4840 0.4247 0.3250 -0.0763 0.0229  -0.0965 81  GLY A N   
661  C CA  . GLY A 99  ? 0.4783 0.4278 0.3193 -0.0832 0.0210  -0.0985 81  GLY A CA  
662  C C   . GLY A 99  ? 0.4669 0.4317 0.3052 -0.0804 0.0141  -0.0902 81  GLY A C   
663  O O   . GLY A 99  ? 0.4674 0.4420 0.3059 -0.0863 0.0124  -0.0921 81  GLY A O   
664  N N   . TYR A 100 ? 0.4450 0.4115 0.2813 -0.0717 0.0104  -0.0812 82  TYR A N   
665  C CA  . TYR A 100 ? 0.4481 0.4284 0.2824 -0.0679 0.0042  -0.0732 82  TYR A CA  
666  C C   . TYR A 100 ? 0.4565 0.4576 0.2847 -0.0727 0.0008  -0.0767 82  TYR A C   
667  O O   . TYR A 100 ? 0.4628 0.4680 0.2862 -0.0769 0.0027  -0.0835 82  TYR A O   
668  C CB  . TYR A 100 ? 0.4162 0.3923 0.2500 -0.0579 0.0017  -0.0637 82  TYR A CB  
669  C CG  . TYR A 100 ? 0.4214 0.3847 0.2613 -0.0533 0.0022  -0.0575 82  TYR A CG  
670  C CD1 . TYR A 100 ? 0.4125 0.3586 0.2573 -0.0532 0.0069  -0.0590 82  TYR A CD1 
671  C CD2 . TYR A 100 ? 0.3996 0.3690 0.2409 -0.0491 -0.0019 -0.0501 82  TYR A CD2 
672  C CE1 . TYR A 100 ? 0.4156 0.3517 0.2657 -0.0494 0.0071  -0.0526 82  TYR A CE1 
673  C CE2 . TYR A 100 ? 0.4141 0.3733 0.2603 -0.0458 -0.0012 -0.0449 82  TYR A CE2 
674  C CZ  . TYR A 100 ? 0.4080 0.3511 0.2582 -0.0461 0.0030  -0.0458 82  TYR A CZ  
675  O OH  . TYR A 100 ? 0.3990 0.3334 0.2534 -0.0432 0.0033  -0.0399 82  TYR A OH  
676  N N   . PRO A 101 ? 0.4704 0.4856 0.2991 -0.0725 -0.0040 -0.0726 83  PRO A N   
677  C CA  . PRO A 101 ? 0.4874 0.5242 0.3110 -0.0775 -0.0075 -0.0756 83  PRO A CA  
678  C C   . PRO A 101 ? 0.5004 0.5466 0.3167 -0.0739 -0.0104 -0.0725 83  PRO A C   
679  O O   . PRO A 101 ? 0.4939 0.5332 0.3096 -0.0656 -0.0116 -0.0649 83  PRO A O   
680  C CB  . PRO A 101 ? 0.4858 0.5349 0.3131 -0.0760 -0.0121 -0.0703 83  PRO A CB  
681  C CG  . PRO A 101 ? 0.4664 0.5011 0.2992 -0.0687 -0.0114 -0.0632 83  PRO A CG  
682  C CD  . PRO A 101 ? 0.4594 0.4729 0.2937 -0.0687 -0.0059 -0.0659 83  PRO A CD  
683  N N   . GLN A 102 ? 0.5217 0.5842 0.3323 -0.0808 -0.0116 -0.0783 84  GLN A N   
684  C CA  . GLN A 102 ? 0.5342 0.6088 0.3367 -0.0797 -0.0143 -0.0761 84  GLN A CA  
685  C C   . GLN A 102 ? 0.5223 0.6045 0.3243 -0.0705 -0.0205 -0.0636 84  GLN A C   
686  O O   . GLN A 102 ? 0.5233 0.6067 0.3199 -0.0667 -0.0218 -0.0590 84  GLN A O   
687  C CB  . GLN A 102 ? 0.5533 0.6489 0.3505 -0.0895 -0.0158 -0.0836 84  GLN A CB  
688  C CG  . GLN A 102 ? 0.6156 0.7051 0.4114 -0.0995 -0.0093 -0.0973 84  GLN A CG  
689  C CD  . GLN A 102 ? 0.6821 0.7606 0.4735 -0.0984 -0.0048 -0.1006 84  GLN A CD  
690  O OE1 . GLN A 102 ? 0.7260 0.8155 0.5098 -0.0972 -0.0072 -0.0976 84  GLN A OE1 
691  N NE2 . GLN A 102 ? 0.7060 0.7637 0.5025 -0.0989 0.0018  -0.1066 84  GLN A NE2 
692  N N   . GLU A 103 ? 0.5224 0.6098 0.3301 -0.0672 -0.0239 -0.0584 85  GLU A N   
693  C CA  . GLU A 103 ? 0.5230 0.6171 0.3317 -0.0580 -0.0295 -0.0469 85  GLU A CA  
694  C C   . GLU A 103 ? 0.5076 0.5850 0.3162 -0.0494 -0.0284 -0.0402 85  GLU A C   
695  O O   . GLU A 103 ? 0.5141 0.5966 0.3207 -0.0431 -0.0322 -0.0317 85  GLU A O   
696  C CB  . GLU A 103 ? 0.5207 0.6202 0.3372 -0.0552 -0.0320 -0.0435 85  GLU A CB  
697  C CG  . GLU A 103 ? 0.5673 0.6892 0.3845 -0.0615 -0.0353 -0.0468 85  GLU A CG  
698  C CD  . GLU A 103 ? 0.6204 0.7394 0.4404 -0.0713 -0.0310 -0.0571 85  GLU A CD  
699  O OE1 . GLU A 103 ? 0.6231 0.7250 0.4420 -0.0750 -0.0254 -0.0634 85  GLU A OE1 
700  O OE2 . GLU A 103 ? 0.6675 0.8016 0.4915 -0.0752 -0.0332 -0.0588 85  GLU A OE2 
701  N N   . LEU A 104 ? 0.4909 0.5489 0.3022 -0.0493 -0.0232 -0.0435 86  LEU A N   
702  C CA  . LEU A 104 ? 0.4671 0.5098 0.2782 -0.0424 -0.0217 -0.0383 86  LEU A CA  
703  C C   . LEU A 104 ? 0.4744 0.5226 0.2777 -0.0418 -0.0229 -0.0360 86  LEU A C   
704  O O   . LEU A 104 ? 0.4703 0.5130 0.2727 -0.0351 -0.0242 -0.0285 86  LEU A O   
705  C CB  . LEU A 104 ? 0.4666 0.4910 0.2806 -0.0443 -0.0158 -0.0439 86  LEU A CB  
706  C CG  . LEU A 104 ? 0.4663 0.4783 0.2878 -0.0409 -0.0145 -0.0414 86  LEU A CG  
707  C CD1 . LEU A 104 ? 0.4579 0.4774 0.2838 -0.0449 -0.0156 -0.0437 86  LEU A CD1 
708  C CD2 . LEU A 104 ? 0.4627 0.4570 0.2866 -0.0417 -0.0090 -0.0453 86  LEU A CD2 
709  N N   . LEU A 105 ? 0.4738 0.5336 0.2713 -0.0492 -0.0223 -0.0425 87  LEU A N   
710  C CA  . LEU A 105 ? 0.4811 0.5474 0.2701 -0.0502 -0.0228 -0.0412 87  LEU A CA  
711  C C   . LEU A 105 ? 0.4823 0.5608 0.2682 -0.0447 -0.0291 -0.0302 87  LEU A C   
712  O O   . LEU A 105 ? 0.4957 0.5757 0.2754 -0.0433 -0.0297 -0.0258 87  LEU A O   
713  C CB  . LEU A 105 ? 0.4949 0.5722 0.2780 -0.0604 -0.0206 -0.0518 87  LEU A CB  
714  C CG  . LEU A 105 ? 0.4884 0.5512 0.2739 -0.0652 -0.0132 -0.0629 87  LEU A CG  
715  C CD1 . LEU A 105 ? 0.5164 0.5914 0.2959 -0.0759 -0.0108 -0.0744 87  LEU A CD1 
716  C CD2 . LEU A 105 ? 0.4298 0.4760 0.2157 -0.0599 -0.0095 -0.0607 87  LEU A CD2 
717  N N   . SER A 106 ? 0.4723 0.5584 0.2633 -0.0413 -0.0334 -0.0253 88  SER A N   
718  C CA  . SER A 106 ? 0.4767 0.5734 0.2668 -0.0351 -0.0393 -0.0143 88  SER A CA  
719  C C   . SER A 106 ? 0.4642 0.5470 0.2598 -0.0252 -0.0400 -0.0056 88  SER A C   
720  O O   . SER A 106 ? 0.4663 0.5553 0.2625 -0.0191 -0.0445 0.0038  88  SER A O   
721  C CB  . SER A 106 ? 0.4819 0.5988 0.2747 -0.0372 -0.0440 -0.0141 88  SER A CB  
722  O OG  . SER A 106 ? 0.5112 0.6222 0.3131 -0.0344 -0.0434 -0.0150 88  SER A OG  
723  N N   . PHE A 107 ? 0.4498 0.5142 0.2497 -0.0236 -0.0357 -0.0086 89  PHE A N   
724  C CA  . PHE A 107 ? 0.4261 0.4764 0.2299 -0.0154 -0.0355 -0.0017 89  PHE A CA  
725  C C   . PHE A 107 ? 0.4267 0.4726 0.2241 -0.0135 -0.0353 0.0034  89  PHE A C   
726  O O   . PHE A 107 ? 0.4263 0.4737 0.2176 -0.0189 -0.0330 -0.0010 89  PHE A O   
727  C CB  . PHE A 107 ? 0.4144 0.4474 0.2228 -0.0155 -0.0307 -0.0064 89  PHE A CB  
728  C CG  . PHE A 107 ? 0.4080 0.4417 0.2227 -0.0177 -0.0299 -0.0111 89  PHE A CG  
729  C CD1 . PHE A 107 ? 0.4204 0.4697 0.2376 -0.0190 -0.0333 -0.0112 89  PHE A CD1 
730  C CD2 . PHE A 107 ? 0.4281 0.4473 0.2467 -0.0185 -0.0257 -0.0150 89  PHE A CD2 
731  C CE1 . PHE A 107 ? 0.3970 0.4470 0.2201 -0.0217 -0.0322 -0.0155 89  PHE A CE1 
732  C CE2 . PHE A 107 ? 0.4044 0.4235 0.2286 -0.0210 -0.0247 -0.0186 89  PHE A CE2 
733  C CZ  . PHE A 107 ? 0.4025 0.4369 0.2288 -0.0228 -0.0278 -0.0190 89  PHE A CZ  
734  N N   . ALA A 108 ? 0.4244 0.4646 0.2235 -0.0063 -0.0373 0.0122  90  ALA A N   
735  C CA  . ALA A 108 ? 0.4234 0.4572 0.2171 -0.0048 -0.0365 0.0172  90  ALA A CA  
736  C C   . ALA A 108 ? 0.4152 0.4330 0.2140 0.0016  -0.0353 0.0213  90  ALA A C   
737  O O   . ALA A 108 ? 0.3975 0.4147 0.2024 0.0069  -0.0375 0.0250  90  ALA A O   
738  C CB  . ALA A 108 ? 0.4366 0.4837 0.2253 -0.0035 -0.0412 0.0254  90  ALA A CB  
739  N N   . TYR A 109 ? 0.3990 0.4048 0.1956 0.0008  -0.0316 0.0202  91  TYR A N   
740  C CA  . TYR A 109 ? 0.4005 0.3916 0.2015 0.0057  -0.0301 0.0233  91  TYR A CA  
741  C C   . TYR A 109 ? 0.4056 0.3964 0.2082 0.0121  -0.0336 0.0325  91  TYR A C   
742  O O   . TYR A 109 ? 0.4089 0.4066 0.2069 0.0125  -0.0362 0.0385  91  TYR A O   
743  C CB  . TYR A 109 ? 0.4025 0.3838 0.2002 0.0037  -0.0262 0.0219  91  TYR A CB  
744  C CG  . TYR A 109 ? 0.3943 0.3615 0.1967 0.0078  -0.0246 0.0240  91  TYR A CG  
745  C CD1 . TYR A 109 ? 0.3814 0.3422 0.1900 0.0085  -0.0229 0.0195  91  TYR A CD1 
746  C CD2 . TYR A 109 ? 0.3854 0.3462 0.1861 0.0106  -0.0249 0.0306  91  TYR A CD2 
747  C CE1 . TYR A 109 ? 0.3924 0.3424 0.2048 0.0116  -0.0216 0.0211  91  TYR A CE1 
748  C CE2 . TYR A 109 ? 0.3583 0.3071 0.1631 0.0135  -0.0233 0.0317  91  TYR A CE2 
749  C CZ  . TYR A 109 ? 0.3909 0.3350 0.2013 0.0140  -0.0218 0.0268  91  TYR A CZ  
750  O OH  . TYR A 109 ? 0.3885 0.3225 0.2027 0.0163  -0.0204 0.0276  91  TYR A OH  
751  N N   . ASP A 110 ? 0.4037 0.3865 0.2131 0.0170  -0.0335 0.0337  92  ASP A N   
752  C CA  . ASP A 110 ? 0.4173 0.3972 0.2297 0.0235  -0.0359 0.0416  92  ASP A CA  
753  C C   . ASP A 110 ? 0.4076 0.3715 0.2227 0.0258  -0.0329 0.0416  92  ASP A C   
754  O O   . ASP A 110 ? 0.3926 0.3517 0.2129 0.0268  -0.0314 0.0375  92  ASP A O   
755  C CB  . ASP A 110 ? 0.4248 0.4124 0.2442 0.0276  -0.0386 0.0420  92  ASP A CB  
756  C CG  . ASP A 110 ? 0.4733 0.4589 0.2965 0.0351  -0.0412 0.0506  92  ASP A CG  
757  O OD1 . ASP A 110 ? 0.4792 0.4523 0.3017 0.0374  -0.0398 0.0546  92  ASP A OD1 
758  O OD2 . ASP A 110 ? 0.5225 0.5196 0.3496 0.0384  -0.0446 0.0534  92  ASP A OD2 
759  N N   . SER A 111 ? 0.4162 0.3728 0.2278 0.0263  -0.0323 0.0466  93  SER A N   
760  C CA  . SER A 111 ? 0.4157 0.3579 0.2293 0.0275  -0.0293 0.0464  93  SER A CA  
761  C C   . SER A 111 ? 0.4190 0.3545 0.2396 0.0334  -0.0298 0.0483  93  SER A C   
762  O O   . SER A 111 ? 0.4244 0.3491 0.2472 0.0336  -0.0271 0.0463  93  SER A O   
763  C CB  . SER A 111 ? 0.4319 0.3686 0.2398 0.0257  -0.0283 0.0511  93  SER A CB  
764  O OG  . SER A 111 ? 0.4508 0.3866 0.2585 0.0298  -0.0308 0.0597  93  SER A OG  
765  N N   . THR A 112 ? 0.4050 0.3477 0.2293 0.0378  -0.0328 0.0516  94  THR A N   
766  C CA  . THR A 112 ? 0.4059 0.3431 0.2377 0.0440  -0.0329 0.0531  94  THR A CA  
767  C C   . THR A 112 ? 0.4013 0.3407 0.2388 0.0443  -0.0317 0.0461  94  THR A C   
768  O O   . THR A 112 ? 0.3938 0.3280 0.2372 0.0484  -0.0307 0.0454  94  THR A O   
769  C CB  . THR A 112 ? 0.4102 0.3532 0.2451 0.0499  -0.0365 0.0606  94  THR A CB  
770  O OG1 . THR A 112 ? 0.4269 0.3861 0.2635 0.0500  -0.0394 0.0593  94  THR A OG1 
771  C CG2 . THR A 112 ? 0.4225 0.3633 0.2515 0.0496  -0.0378 0.0688  94  THR A CG2 
772  N N   . PHE A 113 ? 0.3909 0.3378 0.2265 0.0395  -0.0314 0.0408  95  PHE A N   
773  C CA  . PHE A 113 ? 0.3882 0.3371 0.2283 0.0388  -0.0301 0.0348  95  PHE A CA  
774  C C   . PHE A 113 ? 0.3848 0.3229 0.2247 0.0363  -0.0266 0.0308  95  PHE A C   
775  O O   . PHE A 113 ? 0.3967 0.3309 0.2411 0.0387  -0.0253 0.0291  95  PHE A O   
776  C CB  . PHE A 113 ? 0.3726 0.3342 0.2124 0.0350  -0.0313 0.0310  95  PHE A CB  
777  C CG  . PHE A 113 ? 0.3725 0.3350 0.2165 0.0334  -0.0295 0.0252  95  PHE A CG  
778  C CD1 . PHE A 113 ? 0.3168 0.2856 0.1671 0.0369  -0.0302 0.0246  95  PHE A CD1 
779  C CD2 . PHE A 113 ? 0.3504 0.3073 0.1924 0.0285  -0.0268 0.0209  95  PHE A CD2 
780  C CE1 . PHE A 113 ? 0.3516 0.3220 0.2053 0.0348  -0.0284 0.0196  95  PHE A CE1 
781  C CE2 . PHE A 113 ? 0.3363 0.2937 0.1818 0.0268  -0.0252 0.0168  95  PHE A CE2 
782  C CZ  . PHE A 113 ? 0.3422 0.3067 0.1931 0.0295  -0.0260 0.0161  95  PHE A CZ  
783  N N   . PRO A 114 ? 0.3820 0.3167 0.2171 0.0315  -0.0250 0.0290  96  PRO A N   
784  C CA  . PRO A 114 ? 0.3771 0.3044 0.2129 0.0291  -0.0222 0.0252  96  PRO A CA  
785  C C   . PRO A 114 ? 0.3768 0.2934 0.2125 0.0304  -0.0206 0.0270  96  PRO A C   
786  O O   . PRO A 114 ? 0.3922 0.3048 0.2250 0.0310  -0.0208 0.0310  96  PRO A O   
787  C CB  . PRO A 114 ? 0.3664 0.2948 0.1984 0.0242  -0.0211 0.0229  96  PRO A CB  
788  C CG  . PRO A 114 ? 0.3624 0.2949 0.1897 0.0239  -0.0226 0.0261  96  PRO A CG  
789  C CD  . PRO A 114 ? 0.3696 0.3080 0.1988 0.0281  -0.0256 0.0301  96  PRO A CD  
790  N N   . THR A 115 ? 0.3736 0.2864 0.2124 0.0305  -0.0190 0.0240  97  THR A N   
791  C CA  . THR A 115 ? 0.3610 0.2648 0.1995 0.0297  -0.0170 0.0239  97  THR A CA  
792  C C   . THR A 115 ? 0.3530 0.2568 0.1908 0.0256  -0.0156 0.0208  97  THR A C   
793  O O   . THR A 115 ? 0.3475 0.2565 0.1866 0.0244  -0.0158 0.0185  97  THR A O   
794  C CB  . THR A 115 ? 0.3712 0.2719 0.2139 0.0327  -0.0162 0.0225  97  THR A CB  
795  O OG1 . THR A 115 ? 0.3927 0.2925 0.2370 0.0373  -0.0175 0.0262  97  THR A OG1 
796  C CG2 . THR A 115 ? 0.3155 0.2077 0.1579 0.0309  -0.0139 0.0210  97  THR A CG2 
797  N N   . ARG A 116 ? 0.3578 0.2562 0.1938 0.0235  -0.0141 0.0212  98  ARG A N   
798  C CA  . ARG A 116 ? 0.3627 0.2616 0.1991 0.0203  -0.0130 0.0191  98  ARG A CA  
799  C C   . ARG A 116 ? 0.3576 0.2568 0.1967 0.0197  -0.0123 0.0166  98  ARG A C   
800  O O   . ARG A 116 ? 0.3722 0.2688 0.2124 0.0210  -0.0119 0.0159  98  ARG A O   
801  C CB  . ARG A 116 ? 0.3745 0.2692 0.2087 0.0183  -0.0117 0.0204  98  ARG A CB  
802  C CG  . ARG A 116 ? 0.3659 0.2622 0.2014 0.0157  -0.0106 0.0189  98  ARG A CG  
803  C CD  . ARG A 116 ? 0.4061 0.3008 0.2396 0.0140  -0.0094 0.0201  98  ARG A CD  
804  N NE  . ARG A 116 ? 0.4009 0.2906 0.2330 0.0133  -0.0087 0.0218  98  ARG A NE  
805  C CZ  . ARG A 116 ? 0.4351 0.3236 0.2682 0.0109  -0.0074 0.0214  98  ARG A CZ  
806  N NH1 . ARG A 116 ? 0.4172 0.3096 0.2533 0.0097  -0.0071 0.0199  98  ARG A NH1 
807  N NH2 . ARG A 116 ? 0.3741 0.2575 0.2056 0.0097  -0.0066 0.0227  98  ARG A NH2 
808  N N   . GLY A 117 ? 0.3473 0.2497 0.1876 0.0176  -0.0121 0.0154  99  GLY A N   
809  C CA  . GLY A 117 ? 0.3323 0.2365 0.1744 0.0162  -0.0117 0.0140  99  GLY A CA  
810  C C   . GLY A 117 ? 0.3319 0.2410 0.1757 0.0169  -0.0122 0.0126  99  GLY A C   
811  O O   . GLY A 117 ? 0.3316 0.2432 0.1764 0.0157  -0.0117 0.0113  99  GLY A O   
812  N N   . LEU A 118 ? 0.3135 0.2253 0.1575 0.0183  -0.0131 0.0126  100 LEU A N   
813  C CA  . LEU A 118 ? 0.3195 0.2375 0.1656 0.0182  -0.0134 0.0111  100 LEU A CA  
814  C C   . LEU A 118 ? 0.3088 0.2289 0.1556 0.0149  -0.0130 0.0111  100 LEU A C   
815  O O   . LEU A 118 ? 0.3139 0.2310 0.1604 0.0134  -0.0126 0.0122  100 LEU A O   
816  C CB  . LEU A 118 ? 0.3030 0.2251 0.1495 0.0203  -0.0147 0.0112  100 LEU A CB  
817  C CG  . LEU A 118 ? 0.3238 0.2435 0.1702 0.0242  -0.0154 0.0126  100 LEU A CG  
818  C CD1 . LEU A 118 ? 0.3002 0.2254 0.1467 0.0260  -0.0172 0.0139  100 LEU A CD1 
819  C CD2 . LEU A 118 ? 0.3243 0.2440 0.1736 0.0266  -0.0145 0.0109  100 LEU A CD2 
820  N N   . VAL A 119 ? 0.3099 0.2353 0.1583 0.0139  -0.0128 0.0099  101 VAL A N   
821  C CA  . VAL A 119 ? 0.3075 0.2349 0.1568 0.0105  -0.0124 0.0106  101 VAL A CA  
822  C C   . VAL A 119 ? 0.3116 0.2436 0.1623 0.0095  -0.0127 0.0094  101 VAL A C   
823  O O   . VAL A 119 ? 0.3029 0.2406 0.1547 0.0108  -0.0130 0.0077  101 VAL A O   
824  C CB  . VAL A 119 ? 0.3104 0.2413 0.1599 0.0090  -0.0118 0.0105  101 VAL A CB  
825  C CG1 . VAL A 119 ? 0.3186 0.2514 0.1688 0.0053  -0.0115 0.0127  101 VAL A CG1 
826  C CG2 . VAL A 119 ? 0.2853 0.2128 0.1333 0.0093  -0.0116 0.0109  101 VAL A CG2 
827  N N   . PHE A 120 ? 0.2942 0.2240 0.1453 0.0071  -0.0123 0.0099  102 PHE A N   
828  C CA  . PHE A 120 ? 0.2958 0.2301 0.1482 0.0048  -0.0123 0.0083  102 PHE A CA  
829  C C   . PHE A 120 ? 0.3122 0.2482 0.1660 0.0013  -0.0114 0.0094  102 PHE A C   
830  O O   . PHE A 120 ? 0.3333 0.2645 0.1876 -0.0002 -0.0107 0.0120  102 PHE A O   
831  C CB  . PHE A 120 ? 0.2977 0.2289 0.1498 0.0034  -0.0120 0.0072  102 PHE A CB  
832  C CG  . PHE A 120 ? 0.2900 0.2270 0.1429 0.0007  -0.0121 0.0045  102 PHE A CG  
833  C CD1 . PHE A 120 ? 0.2997 0.2444 0.1522 0.0024  -0.0137 0.0031  102 PHE A CD1 
834  C CD2 . PHE A 120 ? 0.3042 0.2395 0.1590 -0.0038 -0.0106 0.0037  102 PHE A CD2 
835  C CE1 . PHE A 120 ? 0.3061 0.2586 0.1599 -0.0006 -0.0141 0.0006  102 PHE A CE1 
836  C CE2 . PHE A 120 ? 0.3324 0.2739 0.1880 -0.0073 -0.0106 0.0007  102 PHE A CE2 
837  C CZ  . PHE A 120 ? 0.3123 0.2631 0.1673 -0.0058 -0.0125 -0.0010 102 PHE A CZ  
838  N N   . ASP A 121 ? 0.3147 0.2584 0.1697 0.0000  -0.0114 0.0079  103 ASP A N   
839  C CA  . ASP A 121 ? 0.3165 0.2633 0.1726 -0.0040 -0.0103 0.0091  103 ASP A CA  
840  C C   . ASP A 121 ? 0.3155 0.2618 0.1730 -0.0078 -0.0097 0.0080  103 ASP A C   
841  O O   . ASP A 121 ? 0.3062 0.2592 0.1647 -0.0084 -0.0102 0.0050  103 ASP A O   
842  C CB  . ASP A 121 ? 0.3137 0.2702 0.1705 -0.0036 -0.0102 0.0072  103 ASP A CB  
843  C CG  . ASP A 121 ? 0.3372 0.2987 0.1947 -0.0087 -0.0089 0.0084  103 ASP A CG  
844  O OD1 . ASP A 121 ? 0.3638 0.3208 0.2215 -0.0126 -0.0082 0.0111  103 ASP A OD1 
845  O OD2 . ASP A 121 ? 0.3103 0.2807 0.1685 -0.0087 -0.0083 0.0065  103 ASP A OD2 
846  N N   . THR A 122 ? 0.3195 0.2583 0.1777 -0.0104 -0.0086 0.0104  104 THR A N   
847  C CA  . THR A 122 ? 0.3291 0.2651 0.1891 -0.0145 -0.0074 0.0088  104 THR A CA  
848  C C   . THR A 122 ? 0.3417 0.2839 0.2031 -0.0197 -0.0065 0.0086  104 THR A C   
849  O O   . THR A 122 ? 0.3625 0.3040 0.2255 -0.0239 -0.0054 0.0064  104 THR A O   
850  C CB  . THR A 122 ? 0.3367 0.2618 0.1983 -0.0153 -0.0061 0.0115  104 THR A CB  
851  O OG1 . THR A 122 ? 0.3343 0.2582 0.1965 -0.0165 -0.0058 0.0168  104 THR A OG1 
852  C CG2 . THR A 122 ? 0.2999 0.2200 0.1607 -0.0109 -0.0066 0.0113  104 THR A CG2 
853  N N   . LEU A 123 ? 0.3381 0.2870 0.1989 -0.0199 -0.0067 0.0104  105 LEU A N   
854  C CA  . LEU A 123 ? 0.3289 0.2851 0.1909 -0.0251 -0.0056 0.0102  105 LEU A CA  
855  C C   . LEU A 123 ? 0.3348 0.3017 0.1981 -0.0248 -0.0063 0.0053  105 LEU A C   
856  O O   . LEU A 123 ? 0.3322 0.3021 0.1971 -0.0294 -0.0055 0.0030  105 LEU A O   
857  C CB  . LEU A 123 ? 0.3299 0.2910 0.1906 -0.0262 -0.0051 0.0136  105 LEU A CB  
858  C CG  . LEU A 123 ? 0.3431 0.3122 0.2048 -0.0325 -0.0035 0.0141  105 LEU A CG  
859  C CD1 . LEU A 123 ? 0.3387 0.2995 0.2020 -0.0383 -0.0020 0.0166  105 LEU A CD1 
860  C CD2 . LEU A 123 ? 0.3121 0.2873 0.1716 -0.0336 -0.0030 0.0171  105 LEU A CD2 
861  N N   . TYR A 124 ? 0.3352 0.3077 0.1980 -0.0194 -0.0077 0.0036  106 TYR A N   
862  C CA  . TYR A 124 ? 0.3301 0.3145 0.1952 -0.0180 -0.0086 -0.0001 106 TYR A CA  
863  C C   . TYR A 124 ? 0.3299 0.3143 0.1948 -0.0139 -0.0106 -0.0021 106 TYR A C   
864  O O   . TYR A 124 ? 0.3354 0.3304 0.2026 -0.0124 -0.0118 -0.0044 106 TYR A O   
865  C CB  . TYR A 124 ? 0.3305 0.3234 0.1966 -0.0149 -0.0083 -0.0007 106 TYR A CB  
866  C CG  . TYR A 124 ? 0.3535 0.3504 0.2195 -0.0197 -0.0063 0.0007  106 TYR A CG  
867  C CD1 . TYR A 124 ? 0.3678 0.3711 0.2356 -0.0262 -0.0050 0.0002  106 TYR A CD1 
868  C CD2 . TYR A 124 ? 0.3865 0.3819 0.2503 -0.0185 -0.0055 0.0025  106 TYR A CD2 
869  C CE1 . TYR A 124 ? 0.3581 0.3656 0.2252 -0.0311 -0.0031 0.0021  106 TYR A CE1 
870  C CE2 . TYR A 124 ? 0.3741 0.3747 0.2369 -0.0233 -0.0037 0.0041  106 TYR A CE2 
871  C CZ  . TYR A 124 ? 0.3717 0.3782 0.2362 -0.0295 -0.0025 0.0042  106 TYR A CZ  
872  O OH  . TYR A 124 ? 0.3668 0.3786 0.2298 -0.0347 -0.0006 0.0066  106 TYR A OH  
873  N N   . GLY A 125 ? 0.3244 0.2981 0.1868 -0.0122 -0.0109 -0.0009 107 GLY A N   
874  C CA  . GLY A 125 ? 0.3114 0.2854 0.1727 -0.0096 -0.0126 -0.0024 107 GLY A CA  
875  C C   . GLY A 125 ? 0.3097 0.2862 0.1708 -0.0029 -0.0144 -0.0016 107 GLY A C   
876  O O   . GLY A 125 ? 0.3077 0.2891 0.1689 -0.0005 -0.0162 -0.0023 107 GLY A O   
877  N N   . ASN A 126 ? 0.3028 0.2758 0.1637 0.0000  -0.0137 0.0002  108 ASN A N   
878  C CA  . ASN A 126 ? 0.3081 0.2821 0.1695 0.0060  -0.0148 0.0006  108 ASN A CA  
879  C C   . ASN A 126 ? 0.3004 0.2634 0.1585 0.0084  -0.0149 0.0026  108 ASN A C   
880  O O   . ASN A 126 ? 0.3109 0.2671 0.1674 0.0060  -0.0138 0.0038  108 ASN A O   
881  C CB  . ASN A 126 ? 0.3081 0.2869 0.1718 0.0071  -0.0135 -0.0003 108 ASN A CB  
882  C CG  . ASN A 126 ? 0.3213 0.3128 0.1888 0.0050  -0.0131 -0.0025 108 ASN A CG  
883  O OD1 . ASN A 126 ? 0.3424 0.3413 0.2122 0.0060  -0.0147 -0.0035 108 ASN A OD1 
884  N ND2 . ASN A 126 ? 0.3084 0.3034 0.1765 0.0017  -0.0112 -0.0031 108 ASN A ND2 
885  N N   . LEU A 127 ? 0.2931 0.2550 0.1508 0.0131  -0.0162 0.0034  109 LEU A N   
886  C CA  . LEU A 127 ? 0.3060 0.2585 0.1613 0.0156  -0.0159 0.0052  109 LEU A CA  
887  C C   . LEU A 127 ? 0.3089 0.2615 0.1659 0.0184  -0.0151 0.0046  109 LEU A C   
888  O O   . LEU A 127 ? 0.3143 0.2731 0.1746 0.0216  -0.0154 0.0035  109 LEU A O   
889  C CB  . LEU A 127 ? 0.3000 0.2504 0.1534 0.0185  -0.0176 0.0068  109 LEU A CB  
890  C CG  . LEU A 127 ? 0.3177 0.2658 0.1681 0.0155  -0.0178 0.0069  109 LEU A CG  
891  C CD1 . LEU A 127 ? 0.3357 0.2857 0.1842 0.0180  -0.0196 0.0086  109 LEU A CD1 
892  C CD2 . LEU A 127 ? 0.3298 0.2686 0.1783 0.0138  -0.0161 0.0075  109 LEU A CD2 
893  N N   . LEU A 128 ? 0.3061 0.2526 0.1614 0.0173  -0.0138 0.0049  110 LEU A N   
894  C CA  . LEU A 128 ? 0.3107 0.2572 0.1671 0.0188  -0.0124 0.0033  110 LEU A CA  
895  C C   . LEU A 128 ? 0.3105 0.2482 0.1648 0.0206  -0.0121 0.0041  110 LEU A C   
896  O O   . LEU A 128 ? 0.3035 0.2358 0.1552 0.0188  -0.0124 0.0060  110 LEU A O   
897  C CB  . LEU A 128 ? 0.3115 0.2609 0.1671 0.0145  -0.0111 0.0026  110 LEU A CB  
898  C CG  . LEU A 128 ? 0.3015 0.2588 0.1586 0.0111  -0.0109 0.0022  110 LEU A CG  
899  C CD1 . LEU A 128 ? 0.3048 0.2636 0.1603 0.0067  -0.0096 0.0031  110 LEU A CD1 
900  C CD2 . LEU A 128 ? 0.2750 0.2414 0.1360 0.0135  -0.0106 -0.0005 110 LEU A CD2 
901  N N   . LYS A 129 ? 0.3043 0.2405 0.1605 0.0242  -0.0113 0.0025  111 LYS A N   
902  C CA  . LYS A 129 ? 0.3276 0.2554 0.1820 0.0246  -0.0104 0.0024  111 LYS A CA  
903  C C   . LYS A 129 ? 0.3210 0.2515 0.1757 0.0225  -0.0083 -0.0012 111 LYS A C   
904  O O   . LYS A 129 ? 0.3277 0.2637 0.1855 0.0240  -0.0071 -0.0044 111 LYS A O   
905  C CB  . LYS A 129 ? 0.3213 0.2441 0.1777 0.0295  -0.0104 0.0029  111 LYS A CB  
906  C CG  . LYS A 129 ? 0.3412 0.2541 0.1954 0.0294  -0.0097 0.0037  111 LYS A CG  
907  C CD  . LYS A 129 ? 0.3658 0.2742 0.2232 0.0349  -0.0096 0.0048  111 LYS A CD  
908  C CE  . LYS A 129 ? 0.4032 0.3008 0.2586 0.0350  -0.0089 0.0065  111 LYS A CE  
909  N NZ  . LYS A 129 ? 0.3660 0.2584 0.2250 0.0407  -0.0090 0.0088  111 LYS A NZ  
910  N N   . VAL A 130 ? 0.3145 0.2426 0.1662 0.0187  -0.0079 -0.0009 112 VAL A N   
911  C CA  . VAL A 130 ? 0.3329 0.2656 0.1837 0.0155  -0.0062 -0.0041 112 VAL A CA  
912  C C   . VAL A 130 ? 0.3304 0.2575 0.1792 0.0141  -0.0051 -0.0058 112 VAL A C   
913  O O   . VAL A 130 ? 0.3297 0.2496 0.1774 0.0147  -0.0059 -0.0036 112 VAL A O   
914  C CB  . VAL A 130 ? 0.3241 0.2634 0.1730 0.0109  -0.0069 -0.0018 112 VAL A CB  
915  C CG1 . VAL A 130 ? 0.3323 0.2773 0.1833 0.0112  -0.0076 -0.0008 112 VAL A CG1 
916  C CG2 . VAL A 130 ? 0.3058 0.2409 0.1524 0.0088  -0.0083 0.0022  112 VAL A CG2 
917  N N   . ASP A 131 ? 0.3206 0.2518 0.1690 0.0118  -0.0030 -0.0103 113 ASP A N   
918  C CA  . ASP A 131 ? 0.3358 0.2639 0.1817 0.0086  -0.0020 -0.0125 113 ASP A CA  
919  C C   . ASP A 131 ? 0.3384 0.2720 0.1807 0.0035  -0.0035 -0.0094 113 ASP A C   
920  O O   . ASP A 131 ? 0.3266 0.2642 0.1687 0.0028  -0.0053 -0.0049 113 ASP A O   
921  C CB  . ASP A 131 ? 0.3299 0.2590 0.1767 0.0082  0.0013  -0.0198 113 ASP A CB  
922  C CG  . ASP A 131 ? 0.3719 0.3127 0.2175 0.0047  0.0024  -0.0226 113 ASP A CG  
923  O OD1 . ASP A 131 ? 0.3454 0.2928 0.1886 0.0017  0.0004  -0.0182 113 ASP A OD1 
924  O OD2 . ASP A 131 ? 0.4288 0.3723 0.2760 0.0049  0.0055  -0.0293 113 ASP A OD2 
925  N N   . ALA A 132 ? 0.3459 0.2796 0.1858 -0.0002 -0.0029 -0.0115 114 ALA A N   
926  C CA  . ALA A 132 ? 0.3594 0.2990 0.1968 -0.0047 -0.0048 -0.0077 114 ALA A CA  
927  C C   . ALA A 132 ? 0.3646 0.3152 0.2002 -0.0078 -0.0053 -0.0064 114 ALA A C   
928  O O   . ALA A 132 ? 0.3836 0.3390 0.2179 -0.0104 -0.0074 -0.0013 114 ALA A O   
929  C CB  . ALA A 132 ? 0.3582 0.2974 0.1935 -0.0084 -0.0040 -0.0108 114 ALA A CB  
930  N N   . TYR A 133 ? 0.3557 0.3104 0.1917 -0.0075 -0.0033 -0.0105 115 TYR A N   
931  C CA  . TYR A 133 ? 0.3565 0.3225 0.1903 -0.0113 -0.0031 -0.0102 115 TYR A CA  
932  C C   . TYR A 133 ? 0.3651 0.3325 0.2012 -0.0092 -0.0037 -0.0068 115 TYR A C   
933  O O   . TYR A 133 ? 0.3867 0.3630 0.2215 -0.0122 -0.0033 -0.0061 115 TYR A O   
934  C CB  . TYR A 133 ? 0.3533 0.3249 0.1861 -0.0134 0.0003  -0.0186 115 TYR A CB  
935  C CG  . TYR A 133 ? 0.3395 0.3106 0.1696 -0.0169 0.0011  -0.0225 115 TYR A CG  
936  C CD1 . TYR A 133 ? 0.3637 0.3443 0.1893 -0.0229 -0.0005 -0.0200 115 TYR A CD1 
937  C CD2 . TYR A 133 ? 0.3325 0.2934 0.1646 -0.0145 0.0032  -0.0278 115 TYR A CD2 
938  C CE1 . TYR A 133 ? 0.3556 0.3372 0.1787 -0.0269 -0.0001 -0.0237 115 TYR A CE1 
939  C CE2 . TYR A 133 ? 0.3820 0.3420 0.2119 -0.0185 0.0040  -0.0316 115 TYR A CE2 
940  C CZ  . TYR A 133 ? 0.3610 0.3320 0.1862 -0.0250 0.0024  -0.0300 115 TYR A CZ  
941  O OH  . TYR A 133 ? 0.3710 0.3429 0.1938 -0.0299 0.0030  -0.0340 115 TYR A OH  
942  N N   . GLY A 134 ? 0.3458 0.3050 0.1851 -0.0045 -0.0046 -0.0049 116 GLY A N   
943  C CA  . GLY A 134 ? 0.3378 0.2986 0.1793 -0.0030 -0.0050 -0.0027 116 GLY A CA  
944  C C   . GLY A 134 ? 0.3380 0.3020 0.1823 -0.0005 -0.0029 -0.0080 116 GLY A C   
945  O O   . GLY A 134 ? 0.3303 0.2984 0.1765 -0.0002 -0.0030 -0.0068 116 GLY A O   
946  N N   . ASN A 135 ? 0.3370 0.2993 0.1824 0.0014  -0.0008 -0.0138 117 ASN A N   
947  C CA  . ASN A 135 ? 0.3547 0.3195 0.2044 0.0052  0.0014  -0.0186 117 ASN A CA  
948  C C   . ASN A 135 ? 0.3491 0.3071 0.2027 0.0110  -0.0001 -0.0165 117 ASN A C   
949  O O   . ASN A 135 ? 0.3373 0.2862 0.1905 0.0130  -0.0014 -0.0142 117 ASN A O   
950  C CB  . ASN A 135 ? 0.3609 0.3249 0.2113 0.0057  0.0046  -0.0259 117 ASN A CB  
951  C CG  . ASN A 135 ? 0.3901 0.3625 0.2358 -0.0008 0.0061  -0.0287 117 ASN A CG  
952  O OD1 . ASN A 135 ? 0.3916 0.3744 0.2354 -0.0046 0.0061  -0.0275 117 ASN A OD1 
953  N ND2 . ASN A 135 ? 0.3953 0.3637 0.2391 -0.0025 0.0074  -0.0327 117 ASN A ND2 
954  N N   . LEU A 136 ? 0.3548 0.3190 0.2124 0.0133  0.0001  -0.0172 118 LEU A N   
955  C CA  . LEU A 136 ? 0.3511 0.3122 0.2123 0.0182  -0.0016 -0.0148 118 LEU A CA  
956  C C   . LEU A 136 ? 0.3584 0.3135 0.2235 0.0240  -0.0005 -0.0176 118 LEU A C   
957  O O   . LEU A 136 ? 0.3595 0.3184 0.2282 0.0259  0.0023  -0.0228 118 LEU A O   
958  C CB  . LEU A 136 ? 0.3593 0.3309 0.2238 0.0182  -0.0018 -0.0150 118 LEU A CB  
959  C CG  . LEU A 136 ? 0.3811 0.3545 0.2437 0.0149  -0.0040 -0.0103 118 LEU A CG  
960  C CD1 . LEU A 136 ? 0.3986 0.3705 0.2562 0.0091  -0.0042 -0.0076 118 LEU A CD1 
961  C CD2 . LEU A 136 ? 0.3777 0.3626 0.2441 0.0143  -0.0036 -0.0118 118 LEU A CD2 
962  N N   . LEU A 137 ? 0.3583 0.3040 0.2229 0.0269  -0.0023 -0.0140 119 LEU A N   
963  C CA  . LEU A 137 ? 0.3610 0.2996 0.2296 0.0328  -0.0018 -0.0146 119 LEU A CA  
964  C C   . LEU A 137 ? 0.3708 0.3127 0.2431 0.0375  -0.0042 -0.0110 119 LEU A C   
965  O O   . LEU A 137 ? 0.3681 0.3116 0.2465 0.0432  -0.0035 -0.0122 119 LEU A O   
966  C CB  . LEU A 137 ? 0.3568 0.2833 0.2218 0.0321  -0.0022 -0.0124 119 LEU A CB  
967  C CG  . LEU A 137 ? 0.3192 0.2434 0.1800 0.0268  -0.0004 -0.0155 119 LEU A CG  
968  C CD1 . LEU A 137 ? 0.3135 0.2263 0.1717 0.0262  -0.0008 -0.0133 119 LEU A CD1 
969  C CD2 . LEU A 137 ? 0.3312 0.2585 0.1944 0.0264  0.0034  -0.0229 119 LEU A CD2 
970  N N   . VAL A 138 ? 0.3683 0.3122 0.2376 0.0352  -0.0069 -0.0068 120 VAL A N   
971  C CA  . VAL A 138 ? 0.3698 0.3191 0.2419 0.0384  -0.0094 -0.0037 120 VAL A CA  
972  C C   . VAL A 138 ? 0.3613 0.3184 0.2312 0.0335  -0.0106 -0.0029 120 VAL A C   
973  O O   . VAL A 138 ? 0.3687 0.3227 0.2341 0.0287  -0.0105 -0.0022 120 VAL A O   
974  C CB  . VAL A 138 ? 0.3662 0.3072 0.2364 0.0413  -0.0116 0.0012  120 VAL A CB  
975  C CG1 . VAL A 138 ? 0.3763 0.3250 0.2488 0.0440  -0.0146 0.0045  120 VAL A CG1 
976  C CG2 . VAL A 138 ? 0.3829 0.3143 0.2555 0.0457  -0.0101 0.0010  120 VAL A CG2 
977  N N   . CYS A 139 ? 0.3715 0.3387 0.2452 0.0349  -0.0119 -0.0029 121 CYS A N   
978  C CA  . CYS A 139 ? 0.3690 0.3435 0.2413 0.0300  -0.0129 -0.0024 121 CYS A CA  
979  C C   . CYS A 139 ? 0.3595 0.3406 0.2341 0.0322  -0.0156 -0.0004 121 CYS A C   
980  O O   . CYS A 139 ? 0.3620 0.3514 0.2424 0.0366  -0.0160 -0.0011 121 CYS A O   
981  C CB  . CYS A 139 ? 0.3790 0.3633 0.2539 0.0272  -0.0108 -0.0060 121 CYS A CB  
982  S SG  . CYS A 139 ? 0.4138 0.4060 0.2872 0.0200  -0.0115 -0.0053 121 CYS A SG  
983  N N   . ALA A 140 ? 0.3468 0.3254 0.2172 0.0292  -0.0174 0.0019  122 ALA A N   
984  C CA  . ALA A 140 ? 0.3415 0.3276 0.2129 0.0301  -0.0201 0.0036  122 ALA A CA  
985  C C   . ALA A 140 ? 0.3276 0.3186 0.1970 0.0234  -0.0202 0.0020  122 ALA A C   
986  O O   . ALA A 140 ? 0.3420 0.3251 0.2071 0.0192  -0.0193 0.0021  122 ALA A O   
987  C CB  . ALA A 140 ? 0.3321 0.3108 0.1999 0.0325  -0.0219 0.0073  122 ALA A CB  
988  N N   . HIS A 141 ? 0.3304 0.3344 0.2036 0.0223  -0.0212 0.0006  123 HIS A N   
989  C CA  . HIS A 141 ? 0.3281 0.3372 0.1998 0.0156  -0.0214 -0.0011 123 HIS A CA  
990  C C   . HIS A 141 ? 0.3444 0.3601 0.2153 0.0164  -0.0244 0.0001  123 HIS A C   
991  O O   . HIS A 141 ? 0.3380 0.3652 0.2133 0.0203  -0.0266 0.0010  123 HIS A O   
992  C CB  . HIS A 141 ? 0.3420 0.3627 0.2184 0.0128  -0.0202 -0.0039 123 HIS A CB  
993  C CG  . HIS A 141 ? 0.3502 0.3743 0.2252 0.0049  -0.0197 -0.0059 123 HIS A CG  
994  N ND1 . HIS A 141 ? 0.3595 0.3742 0.2313 -0.0006 -0.0174 -0.0062 123 HIS A ND1 
995  C CD2 . HIS A 141 ? 0.3700 0.4058 0.2468 0.0014  -0.0211 -0.0077 123 HIS A CD2 
996  C CE1 . HIS A 141 ? 0.3477 0.3665 0.2195 -0.0070 -0.0171 -0.0083 123 HIS A CE1 
997  N NE2 . HIS A 141 ? 0.3847 0.4165 0.2592 -0.0064 -0.0192 -0.0096 123 HIS A NE2 
998  N N   . GLY A 142 ? 0.3492 0.3584 0.2147 0.0129  -0.0247 0.0003  124 GLY A N   
999  C CA  . GLY A 142 ? 0.3639 0.3786 0.2272 0.0139  -0.0276 0.0019  124 GLY A CA  
1000 C C   . GLY A 142 ? 0.3684 0.3801 0.2323 0.0216  -0.0292 0.0065  124 GLY A C   
1001 O O   . GLY A 142 ? 0.3729 0.3720 0.2349 0.0240  -0.0277 0.0080  124 GLY A O   
1002 N N   . PHE A 143 ? 0.3631 0.3866 0.2300 0.0255  -0.0323 0.0090  125 PHE A N   
1003 C CA  . PHE A 143 ? 0.3757 0.3967 0.2446 0.0334  -0.0339 0.0141  125 PHE A CA  
1004 C C   . PHE A 143 ? 0.3736 0.4004 0.2510 0.0391  -0.0335 0.0139  125 PHE A C   
1005 O O   . PHE A 143 ? 0.4008 0.4288 0.2824 0.0463  -0.0351 0.0180  125 PHE A O   
1006 C CB  . PHE A 143 ? 0.3744 0.4042 0.2410 0.0346  -0.0378 0.0183  125 PHE A CB  
1007 C CG  . PHE A 143 ? 0.3761 0.4003 0.2341 0.0290  -0.0376 0.0179  125 PHE A CG  
1008 C CD1 . PHE A 143 ? 0.3621 0.3702 0.2158 0.0287  -0.0351 0.0182  125 PHE A CD1 
1009 C CD2 . PHE A 143 ? 0.3483 0.3840 0.2030 0.0240  -0.0396 0.0164  125 PHE A CD2 
1010 C CE1 . PHE A 143 ? 0.3515 0.3551 0.1983 0.0239  -0.0343 0.0172  125 PHE A CE1 
1011 C CE2 . PHE A 143 ? 0.3699 0.4005 0.2170 0.0187  -0.0386 0.0148  125 PHE A CE2 
1012 C CZ  . PHE A 143 ? 0.3443 0.3589 0.1879 0.0190  -0.0359 0.0153  125 PHE A CZ  
1013 N N   . ASN A 144 ? 0.4026 0.4093 0.3782 0.0513  -0.1598 0.0223  126 ASN A N   
1014 C CA  . ASN A 144 ? 0.4162 0.4437 0.4094 0.0938  -0.1546 0.0130  126 ASN A CA  
1015 C C   . ASN A 144 ? 0.4361 0.3957 0.3872 0.0988  -0.1434 0.0009  126 ASN A C   
1016 O O   . ASN A 144 ? 0.3759 0.3604 0.3386 0.0759  -0.1240 -0.0038 126 ASN A O   
1017 C CB  . ASN A 144 ? 0.3844 0.5227 0.4246 0.0791  -0.1390 0.0111  126 ASN A CB  
1018 C CG  . ASN A 144 ? 0.4465 0.6788 0.5173 0.1350  -0.1299 0.0078  126 ASN A CG  
1019 O OD1 . ASN A 144 ? 0.5448 0.7815 0.6031 0.2096  -0.1400 0.0139  126 ASN A OD1 
1020 N ND2 . ASN A 144 ? 0.4332 0.7373 0.5236 0.1102  -0.1093 0.0006  126 ASN A ND2 
1021 N N   . PHE A 145 ? 0.5365 0.3856 0.4072 0.1256  -0.1576 -0.0016 127 PHE A N   
1022 C CA  . PHE A 145 ? 0.6196 0.3705 0.4053 0.1062  -0.1527 -0.0116 127 PHE A CA  
1023 C C   . PHE A 145 ? 0.6424 0.4088 0.4354 0.1679  -0.1274 -0.0326 127 PHE A C   
1024 O O   . PHE A 145 ? 0.6997 0.4520 0.4669 0.2548  -0.1247 -0.0380 127 PHE A O   
1025 C CB  . PHE A 145 ? 0.7936 0.3570 0.4186 0.0759  -0.1837 -0.0036 127 PHE A CB  
1026 C CG  . PHE A 145 ? 0.7555 0.3549 0.3709 -0.0172 -0.2060 0.0221  127 PHE A CG  
1027 C CD1 . PHE A 145 ? 0.7090 0.3772 0.3882 -0.0129 -0.2178 0.0363  127 PHE A CD1 
1028 C CD2 . PHE A 145 ? 0.7979 0.3991 0.3392 -0.1133 -0.2146 0.0372  127 PHE A CD2 
1029 C CE1 . PHE A 145 ? 0.6525 0.3843 0.3222 -0.0872 -0.2339 0.0612  127 PHE A CE1 
1030 C CE2 . PHE A 145 ? 0.7590 0.4646 0.2978 -0.1948 -0.2329 0.0696  127 PHE A CE2 
1031 C CZ  . PHE A 145 ? 0.7103 0.4790 0.3145 -0.1735 -0.2404 0.0797  127 PHE A CZ  
1032 N N   . ILE A 146 ? 0.5880 0.4126 0.4185 0.1327  -0.1066 -0.0398 128 ILE A N   
1033 C CA  . ILE A 146 ? 0.5991 0.4752 0.4525 0.1760  -0.0800 -0.0581 128 ILE A CA  
1034 C C   . ILE A 146 ? 0.7755 0.4848 0.4862 0.1967  -0.0779 -0.0755 128 ILE A C   
1035 O O   . ILE A 146 ? 0.8220 0.4446 0.4547 0.1205  -0.0874 -0.0719 128 ILE A O   
1036 C CB  . ILE A 146 ? 0.4799 0.4648 0.4104 0.1271  -0.0605 -0.0562 128 ILE A CB  
1037 C CG1 . ILE A 146 ? 0.3810 0.4314 0.3671 0.0953  -0.0660 -0.0394 128 ILE A CG1 
1038 C CG2 . ILE A 146 ? 0.4684 0.5378 0.4294 0.1576  -0.0356 -0.0711 128 ILE A CG2 
1039 C CD1 . ILE A 146 ? 0.3138 0.4424 0.3420 0.1099  -0.0736 -0.0337 128 ILE A CD1 
1040 N N   . ARG A 147 ? 0.9062 0.5736 0.5579 0.3016  -0.0661 -0.0900 129 ARG A N   
1041 C CA  . ARG A 147 ? 1.1578 0.6004 0.6113 0.3426  -0.0605 -0.1117 129 ARG A CA  
1042 C C   . ARG A 147 ? 1.1328 0.6265 0.5996 0.3322  -0.0308 -0.1314 129 ARG A C   
1043 O O   . ARG A 147 ? 0.9539 0.6715 0.5848 0.3236  -0.0119 -0.1281 129 ARG A O   
1044 C CB  . ARG A 147 ? 1.3605 0.7019 0.6958 0.4975  -0.0560 -0.1171 129 ARG A CB  
1045 C CG  . ARG A 147 ? 1.5116 0.7128 0.7623 0.4995  -0.0920 -0.0974 129 ARG A CG  
1046 C CD  . ARG A 147 ? 1.6439 0.6616 0.7839 0.3390  -0.1266 -0.0893 129 ARG A CD  
1047 N NE  . ARG A 147 ? 1.6478 0.6724 0.8158 0.2932  -0.1604 -0.0625 129 ARG A NE  
1048 C CZ  . ARG A 147 ? 1.8114 0.6459 0.8183 0.1843  -0.1975 -0.0477 129 ARG A CZ  
1049 N NH1 . ARG A 147 ? 1.7537 0.6249 0.8001 0.1491  -0.2254 -0.0229 129 ARG A NH1 
1050 N NH2 . ARG A 147 ? 2.0412 0.6532 0.8296 0.0944  -0.2094 -0.0546 129 ARG A NH2 
1051 N N   . GLY A 148 ? 1.3436 0.6074 0.6105 0.3134  -0.0305 -0.1498 130 GLY A N   
1052 C CA  . GLY A 148 ? 1.3591 0.6360 0.6043 0.2921  -0.0047 -0.1696 130 GLY A CA  
1053 C C   . GLY A 148 ? 1.1697 0.7179 0.6039 0.3364  0.0286  -0.1739 130 GLY A C   
1054 O O   . GLY A 148 ? 0.9921 0.6863 0.5557 0.2475  0.0294  -0.1612 130 GLY A O   
1055 N N   . PRO A 149 ? 1.2388 0.8615 0.6672 0.4770  0.0562  -0.1869 131 PRO A N   
1056 C CA  . PRO A 149 ? 1.0970 0.9987 0.6733 0.5027  0.0871  -0.1871 131 PRO A CA  
1057 C C   . PRO A 149 ? 0.8501 0.9924 0.6311 0.4055  0.0754  -0.1589 131 PRO A C   
1058 O O   . PRO A 149 ? 0.7394 0.9946 0.5913 0.3346  0.0863  -0.1571 131 PRO A O   
1059 C CB  . PRO A 149 ? 1.2165 1.2079 0.7509 0.6825  0.1111  -0.1897 131 PRO A CB  
1060 C CG  . PRO A 149 ? 1.5160 1.1534 0.7953 0.7705  0.1042  -0.2082 131 PRO A CG  
1061 C CD  . PRO A 149 ? 1.4753 0.9343 0.7333 0.6282  0.0601  -0.1960 131 PRO A CD  
1062 N N   . GLU A 150 ? 0.7955 0.9790 0.6359 0.3986  0.0521  -0.1370 132 GLU A N   
1063 C CA  . GLU A 150 ? 0.6440 0.9907 0.6167 0.3048  0.0397  -0.1122 132 GLU A CA  
1064 C C   . GLU A 150 ? 0.5598 0.8156 0.5390 0.1948  0.0291  -0.1070 132 GLU A C   
1065 O O   . GLU A 150 ? 0.4848 0.8242 0.5155 0.1271  0.0280  -0.0923 132 GLU A O   
1066 C CB  . GLU A 150 ? 0.6216 1.0254 0.6347 0.3243  0.0178  -0.0903 132 GLU A CB  
1067 C CG  . GLU A 150 ? 0.5477 1.1365 0.6540 0.2318  0.0082  -0.0644 132 GLU A CG  
1068 C CD  . GLU A 150 ? 0.5270 1.0813 0.6474 0.1984  -0.0200 -0.0456 132 GLU A CD  
1069 O OE1 . GLU A 150 ? 0.5938 1.1724 0.7130 0.2741  -0.0305 -0.0367 132 GLU A OE1 
1070 O OE2 . GLU A 150 ? 0.5457 1.0366 0.6585 0.1060  -0.0302 -0.0387 132 GLU A OE2 
1071 N N   . THR A 151 ? 0.6030 0.6913 0.5039 0.1766  0.0203  -0.1133 133 THR A N   
1072 C CA  . THR A 151 ? 0.5402 0.6078 0.4496 0.0973  0.0139  -0.0979 133 THR A CA  
1073 C C   . THR A 151 ? 0.5127 0.6304 0.4287 0.0685  0.0343  -0.1025 133 THR A C   
1074 O O   . THR A 151 ? 0.4668 0.5990 0.3921 0.0254  0.0333  -0.0836 133 THR A O   
1075 C CB  . THR A 151 ? 0.6004 0.5491 0.4257 0.0592  -0.0056 -0.0892 133 THR A CB  
1076 O OG1 . THR A 151 ? 0.7290 0.5861 0.4521 0.0452  0.0012  -0.1057 133 THR A OG1 
1077 C CG2 . THR A 151 ? 0.6764 0.5383 0.4572 0.0806  -0.0281 -0.0867 133 THR A CG2 
1078 N N   . ARG A 152 ? 0.5468 0.6941 0.4453 0.1064  0.0543  -0.1249 134 ARG A N   
1079 C CA  . ARG A 152 ? 0.5365 0.7362 0.4363 0.0761  0.0738  -0.1307 134 ARG A CA  
1080 C C   . ARG A 152 ? 0.4626 0.7896 0.4269 0.0327  0.0783  -0.1146 134 ARG A C   
1081 O O   . ARG A 152 ? 0.4575 0.7971 0.4099 -0.0123 0.0864  -0.1089 134 ARG A O   
1082 C CB  . ARG A 152 ? 0.6413 0.8224 0.4740 0.1384  0.0975  -0.1617 134 ARG A CB  
1083 C CG  . ARG A 152 ? 0.7886 0.7617 0.4763 0.1334  0.0909  -0.1769 134 ARG A CG  
1084 C CD  . ARG A 152 ? 0.9569 0.8532 0.5258 0.2005  0.1178  -0.2108 134 ARG A CD  
1085 N NE  . ARG A 152 ? 1.1969 0.8247 0.5544 0.1806  0.1079  -0.2275 134 ARG A NE  
1086 C CZ  . ARG A 152 ? 1.2494 0.7959 0.5226 0.0737  0.0995  -0.2242 134 ARG A CZ  
1087 N NH1 . ARG A 152 ? 1.0728 0.7923 0.4731 0.0004  0.1013  -0.2028 134 ARG A NH1 
1088 N NH2 . ARG A 152 ? 1.4701 0.7513 0.5048 0.0317  0.0859  -0.2374 134 ARG A NH2 
1089 N N   . GLU A 153 ? 0.4301 0.8373 0.4361 0.0320  0.0696  -0.1037 135 GLU A N   
1090 C CA  . GLU A 153 ? 0.4189 0.8886 0.4253 -0.0466 0.0644  -0.0831 135 GLU A CA  
1091 C C   . GLU A 153 ? 0.4223 0.7398 0.3648 -0.0850 0.0556  -0.0661 135 GLU A C   
1092 O O   . GLU A 153 ? 0.4709 0.7655 0.3617 -0.1320 0.0607  -0.0566 135 GLU A O   
1093 C CB  . GLU A 153 ? 0.4203 0.9883 0.4538 -0.0630 0.0499  -0.0687 135 GLU A CB  
1094 C CG  . GLU A 153 ? 0.4329 1.2017 0.5269 0.0098  0.0616  -0.0746 135 GLU A CG  
1095 C CD  . GLU A 153 ? 0.4362 1.3539 0.5658 -0.0070 0.0439  -0.0498 135 GLU A CD  
1096 O OE1 . GLU A 153 ? 0.4710 1.2721 0.5911 -0.0077 0.0241  -0.0446 135 GLU A OE1 
1097 O OE2 . GLU A 153 ? 0.4701 1.6527 0.6367 -0.0224 0.0498  -0.0313 135 GLU A OE2 
1098 N N   . GLN A 154 ? 0.3855 0.6113 0.3199 -0.0518 0.0445  -0.0594 136 GLN A N   
1099 C CA  . GLN A 154 ? 0.3972 0.5189 0.2651 -0.0474 0.0414  -0.0367 136 GLN A CA  
1100 C C   . GLN A 154 ? 0.3844 0.5149 0.2498 -0.0245 0.0476  -0.0272 136 GLN A C   
1101 O O   . GLN A 154 ? 0.4149 0.5119 0.2207 -0.0072 0.0517  -0.0009 136 GLN A O   
1102 C CB  . GLN A 154 ? 0.3989 0.4640 0.2507 -0.0235 0.0283  -0.0265 136 GLN A CB  
1103 C CG  . GLN A 154 ? 0.4451 0.4789 0.2549 -0.0689 0.0189  -0.0256 136 GLN A CG  
1104 C CD  . GLN A 154 ? 0.4644 0.4300 0.2451 -0.0480 0.0069  -0.0181 136 GLN A CD  
1105 O OE1 . GLN A 154 ? 0.3852 0.3747 0.2165 -0.0004 0.0033  -0.0171 136 GLN A OE1 
1106 N NE2 . GLN A 154 ? 0.5379 0.4107 0.2137 -0.0996 -0.0015 -0.0111 136 GLN A NE2 
1107 N N   . TYR A 155 ? 0.3680 0.3559 0.2374 0.0259  0.0573  -0.0309 137 TYR A N   
1108 C CA  . TYR A 155 ? 0.3797 0.3508 0.2293 0.0264  0.0547  -0.0303 137 TYR A CA  
1109 C C   . TYR A 155 ? 0.3926 0.3673 0.2375 0.0267  0.0651  -0.0399 137 TYR A C   
1110 O O   . TYR A 155 ? 0.3899 0.3651 0.2431 0.0353  0.0654  -0.0469 137 TYR A O   
1111 C CB  . TYR A 155 ? 0.3586 0.3206 0.2123 0.0345  0.0440  -0.0284 137 TYR A CB  
1112 C CG  . TYR A 155 ? 0.3353 0.2970 0.1965 0.0346  0.0356  -0.0211 137 TYR A CG  
1113 C CD1 . TYR A 155 ? 0.3405 0.2913 0.1897 0.0302  0.0298  -0.0141 137 TYR A CD1 
1114 C CD2 . TYR A 155 ? 0.3328 0.3053 0.2132 0.0393  0.0331  -0.0218 137 TYR A CD2 
1115 C CE1 . TYR A 155 ? 0.3423 0.2932 0.1985 0.0301  0.0237  -0.0091 137 TYR A CE1 
1116 C CE2 . TYR A 155 ? 0.3105 0.2824 0.1953 0.0382  0.0262  -0.0161 137 TYR A CE2 
1117 C CZ  . TYR A 155 ? 0.3367 0.2978 0.2094 0.0336  0.0224  -0.0104 137 TYR A CZ  
1118 O OH  . TYR A 155 ? 0.3196 0.2804 0.1969 0.0325  0.0170  -0.0065 137 TYR A OH  
1119 N N   . PRO A 156 ? 0.4228 0.3997 0.2540 0.0169  0.0745  -0.0407 138 PRO A N   
1120 C CA  . PRO A 156 ? 0.4390 0.4221 0.2654 0.0153  0.0872  -0.0513 138 PRO A CA  
1121 C C   . PRO A 156 ? 0.4454 0.4142 0.2571 0.0194  0.0853  -0.0561 138 PRO A C   
1122 O O   . PRO A 156 ? 0.4584 0.4320 0.2736 0.0233  0.0940  -0.0676 138 PRO A O   
1123 C CB  . PRO A 156 ? 0.4623 0.4435 0.2677 0.0008  0.0946  -0.0473 138 PRO A CB  
1124 C CG  . PRO A 156 ? 0.4552 0.4369 0.2671 -0.0028 0.0881  -0.0373 138 PRO A CG  
1125 C CD  . PRO A 156 ? 0.4245 0.3965 0.2425 0.0060  0.0739  -0.0319 138 PRO A CD  
1126 N N   . ASN A 157 ? 0.4357 0.3875 0.2326 0.0185  0.0739  -0.0483 139 ASN A N   
1127 C CA  . ASN A 157 ? 0.4429 0.3806 0.2246 0.0205  0.0709  -0.0522 139 ASN A CA  
1128 C C   . ASN A 157 ? 0.4334 0.3646 0.2275 0.0299  0.0601  -0.0507 139 ASN A C   
1129 O O   . ASN A 157 ? 0.4319 0.3496 0.2137 0.0304  0.0546  -0.0515 139 ASN A O   
1130 C CB  . ASN A 157 ? 0.4510 0.3747 0.2034 0.0104  0.0666  -0.0454 139 ASN A CB  
1131 C CG  . ASN A 157 ? 0.4578 0.3690 0.1914 0.0097  0.0660  -0.0516 139 ASN A CG  
1132 O OD1 . ASN A 157 ? 0.4541 0.3677 0.1884 0.0124  0.0754  -0.0634 139 ASN A OD1 
1133 N ND2 . ASN A 157 ? 0.4665 0.3647 0.1839 0.0060  0.0549  -0.0446 139 ASN A ND2 
1134 N N   . LYS A 158 ? 0.4205 0.3613 0.2377 0.0363  0.0570  -0.0484 140 LYS A N   
1135 C CA  . LYS A 158 ? 0.4158 0.3507 0.2441 0.0438  0.0464  -0.0452 140 LYS A CA  
1136 C C   . LYS A 158 ? 0.3887 0.3097 0.2021 0.0397  0.0368  -0.0379 140 LYS A C   
1137 O O   . LYS A 158 ? 0.3866 0.2973 0.1971 0.0426  0.0313  -0.0391 140 LYS A O   
1138 C CB  . LYS A 158 ? 0.4322 0.3634 0.2690 0.0530  0.0478  -0.0542 140 LYS A CB  
1139 C CG  . LYS A 158 ? 0.4863 0.4328 0.3480 0.0613  0.0522  -0.0597 140 LYS A CG  
1140 C CD  . LYS A 158 ? 0.4671 0.4052 0.3386 0.0726  0.0494  -0.0664 140 LYS A CD  
1141 C CE  . LYS A 158 ? 0.5279 0.4829 0.4262 0.0822  0.0537  -0.0732 140 LYS A CE  
1142 N NZ  . LYS A 158 ? 0.5546 0.5010 0.4617 0.0938  0.0538  -0.0826 140 LYS A NZ  
1143 N N   . PHE A 159 ? 0.3778 0.2991 0.1831 0.0329  0.0347  -0.0306 141 PHE A N   
1144 C CA  . PHE A 159 ? 0.3820 0.2926 0.1728 0.0285  0.0267  -0.0248 141 PHE A CA  
1145 C C   . PHE A 159 ? 0.3634 0.2768 0.1570 0.0251  0.0227  -0.0160 141 PHE A C   
1146 O O   . PHE A 159 ? 0.3575 0.2773 0.1526 0.0218  0.0283  -0.0147 141 PHE A O   
1147 C CB  . PHE A 159 ? 0.4121 0.3157 0.1800 0.0222  0.0307  -0.0281 141 PHE A CB  
1148 C CG  . PHE A 159 ? 0.4169 0.3126 0.1683 0.0156  0.0232  -0.0204 141 PHE A CG  
1149 C CD1 . PHE A 159 ? 0.4477 0.3351 0.1930 0.0155  0.0137  -0.0189 141 PHE A CD1 
1150 C CD2 . PHE A 159 ? 0.4473 0.3432 0.1890 0.0093  0.0252  -0.0148 141 PHE A CD2 
1151 C CE1 . PHE A 159 ? 0.4362 0.3178 0.1686 0.0105  0.0052  -0.0119 141 PHE A CE1 
1152 C CE2 . PHE A 159 ? 0.4271 0.3142 0.1541 0.0044  0.0164  -0.0068 141 PHE A CE2 
1153 C CZ  . PHE A 159 ? 0.4398 0.3206 0.1631 0.0056  0.0060  -0.0055 141 PHE A CZ  
1154 N N   . ILE A 160 ? 0.3570 0.2654 0.1512 0.0255  0.0135  -0.0106 142 ILE A N   
1155 C CA  . ILE A 160 ? 0.3672 0.2750 0.1620 0.0228  0.0087  -0.0031 142 ILE A CA  
1156 C C   . ILE A 160 ? 0.3933 0.2921 0.1741 0.0195  0.0010  0.0012  142 ILE A C   
1157 O O   . ILE A 160 ? 0.4067 0.3015 0.1824 0.0199  -0.0030 -0.0014 142 ILE A O   
1158 C CB  . ILE A 160 ? 0.3452 0.2579 0.1573 0.0267  0.0048  -0.0009 142 ILE A CB  
1159 C CG1 . ILE A 160 ? 0.3452 0.2549 0.1605 0.0293  -0.0016 -0.0017 142 ILE A CG1 
1160 C CG2 . ILE A 160 ? 0.3192 0.2413 0.1446 0.0295  0.0105  -0.0042 142 ILE A CG2 
1161 C CD1 . ILE A 160 ? 0.3261 0.2396 0.1543 0.0310  -0.0056 0.0010  142 ILE A CD1 
1162 N N   . GLN A 161 ? 0.4148 0.3101 0.1900 0.0161  -0.0018 0.0077  143 GLN A N   
1163 C CA  . GLN A 161 ? 0.4456 0.3329 0.2107 0.0143  -0.0117 0.0132  143 GLN A CA  
1164 C C   . GLN A 161 ? 0.4434 0.3342 0.2254 0.0192  -0.0191 0.0150  143 GLN A C   
1165 O O   . GLN A 161 ? 0.4361 0.3278 0.2278 0.0208  -0.0201 0.0184  143 GLN A O   
1166 C CB  . GLN A 161 ? 0.4524 0.3317 0.2041 0.0093  -0.0126 0.0202  143 GLN A CB  
1167 C CG  . GLN A 161 ? 0.4883 0.3642 0.2204 0.0023  -0.0046 0.0188  143 GLN A CG  
1168 C CD  . GLN A 161 ? 0.5175 0.3835 0.2342 -0.0044 -0.0052 0.0269  143 GLN A CD  
1169 O OE1 . GLN A 161 ? 0.5515 0.4087 0.2446 -0.0112 -0.0059 0.0295  143 GLN A OE1 
1170 N NE2 . GLN A 161 ? 0.4946 0.3604 0.2227 -0.0035 -0.0051 0.0309  143 GLN A NE2 
1171 N N   . ARG A 162 ? 0.4626 0.3554 0.2481 0.0208  -0.0234 0.0119  144 ARG A N   
1172 C CA  . ARG A 162 ? 0.4711 0.3689 0.2719 0.0240  -0.0298 0.0126  144 ARG A CA  
1173 C C   . ARG A 162 ? 0.4732 0.3691 0.2770 0.0252  -0.0383 0.0184  144 ARG A C   
1174 O O   . ARG A 162 ? 0.4583 0.3595 0.2781 0.0287  -0.0401 0.0185  144 ARG A O   
1175 C CB  . ARG A 162 ? 0.4854 0.3842 0.2850 0.0229  -0.0334 0.0086  144 ARG A CB  
1176 C CG  . ARG A 162 ? 0.5103 0.4100 0.3131 0.0236  -0.0267 0.0030  144 ARG A CG  
1177 C CD  . ARG A 162 ? 0.5217 0.4258 0.3358 0.0236  -0.0304 0.0012  144 ARG A CD  
1178 N NE  . ARG A 162 ? 0.5151 0.4161 0.3209 0.0200  -0.0359 -0.0007 144 ARG A NE  
1179 C CZ  . ARG A 162 ? 0.5144 0.4205 0.3261 0.0181  -0.0434 0.0001  144 ARG A CZ  
1180 N NH1 . ARG A 162 ? 0.4394 0.3546 0.2670 0.0203  -0.0460 0.0023  144 ARG A NH1 
1181 N NH2 . ARG A 162 ? 0.5318 0.4344 0.3339 0.0137  -0.0483 -0.0022 144 ARG A NH2 
1182 N N   A ASP A 163 ? 0.4936 0.3812 0.2814 0.0224  -0.0433 0.0230  145 ASP A N   
1183 N N   B ASP A 163 ? 0.4985 0.3863 0.2864 0.0224  -0.0435 0.0229  145 ASP A N   
1184 C CA  A ASP A 163 ? 0.4980 0.3809 0.2875 0.0245  -0.0526 0.0296  145 ASP A CA  
1185 C CA  B ASP A 163 ? 0.5080 0.3906 0.2971 0.0244  -0.0524 0.0297  145 ASP A CA  
1186 C C   A ASP A 163 ? 0.4909 0.3694 0.2858 0.0260  -0.0488 0.0330  145 ASP A C   
1187 C C   B ASP A 163 ? 0.4939 0.3752 0.2937 0.0271  -0.0484 0.0316  145 ASP A C   
1188 O O   A ASP A 163 ? 0.4914 0.3635 0.2890 0.0286  -0.0561 0.0383  145 ASP A O   
1189 O O   B ASP A 163 ? 0.4976 0.3780 0.3090 0.0315  -0.0546 0.0342  145 ASP A O   
1190 C CB  A ASP A 163 ? 0.5257 0.3985 0.2928 0.0201  -0.0601 0.0349  145 ASP A CB  
1191 C CB  B ASP A 163 ? 0.5385 0.4089 0.3030 0.0192  -0.0562 0.0355  145 ASP A CB  
1192 C CG  A ASP A 163 ? 0.5503 0.4263 0.3101 0.0173  -0.0643 0.0309  145 ASP A CG  
1193 C CG  B ASP A 163 ? 0.5773 0.4428 0.3278 0.0139  -0.0448 0.0352  145 ASP A CG  
1194 O OD1 A ASP A 163 ? 0.5371 0.4187 0.3072 0.0198  -0.0746 0.0313  145 ASP A OD1 
1195 O OD1 B ASP A 163 ? 0.6049 0.4740 0.3490 0.0112  -0.0371 0.0291  145 ASP A OD1 
1196 O OD2 A ASP A 163 ? 0.5470 0.4202 0.2917 0.0126  -0.0570 0.0267  145 ASP A OD2 
1197 O OD2 B ASP A 163 ? 0.6195 0.4776 0.3663 0.0124  -0.0433 0.0404  145 ASP A OD2 
1198 N N   . ASP A 164 ? 0.4787 0.3601 0.2755 0.0244  -0.0380 0.0297  146 ASP A N   
1199 C CA  . ASP A 164 ? 0.4683 0.3465 0.2707 0.0245  -0.0339 0.0317  146 ASP A CA  
1200 C C   . ASP A 164 ? 0.4523 0.3395 0.2760 0.0293  -0.0324 0.0273  146 ASP A C   
1201 O O   . ASP A 164 ? 0.4270 0.3204 0.2571 0.0286  -0.0250 0.0234  146 ASP A O   
1202 C CB  . ASP A 164 ? 0.4608 0.3383 0.2531 0.0189  -0.0239 0.0309  146 ASP A CB  
1203 C CG  . ASP A 164 ? 0.4600 0.3319 0.2539 0.0164  -0.0206 0.0340  146 ASP A CG  
1204 O OD1 . ASP A 164 ? 0.4415 0.3082 0.2439 0.0197  -0.0259 0.0365  146 ASP A OD1 
1205 O OD2 . ASP A 164 ? 0.4814 0.3547 0.2692 0.0109  -0.0121 0.0331  146 ASP A OD2 
1206 N N   . THR A 165 ? 0.4641 0.3526 0.2986 0.0340  -0.0400 0.0277  147 THR A N   
1207 C CA  . THR A 165 ? 0.4769 0.3750 0.3304 0.0378  -0.0385 0.0226  147 THR A CA  
1208 C C   . THR A 165 ? 0.4804 0.3746 0.3408 0.0387  -0.0348 0.0222  147 THR A C   
1209 O O   . THR A 165 ? 0.4906 0.3924 0.3633 0.0400  -0.0308 0.0171  147 THR A O   
1210 C CB  . THR A 165 ? 0.4697 0.3730 0.3347 0.0423  -0.0470 0.0219  147 THR A CB  
1211 O OG1 . THR A 165 ? 0.5274 0.4204 0.3900 0.0452  -0.0553 0.0277  147 THR A OG1 
1212 C CG2 . THR A 165 ? 0.4835 0.3922 0.3428 0.0399  -0.0505 0.0209  147 THR A CG2 
1213 N N   . GLU A 166 ? 0.4951 0.3765 0.3458 0.0368  -0.0357 0.0275  148 GLU A N   
1214 C CA  . GLU A 166 ? 0.4953 0.3717 0.3500 0.0355  -0.0309 0.0266  148 GLU A CA  
1215 C C   . GLU A 166 ? 0.4676 0.3516 0.3209 0.0306  -0.0217 0.0231  148 GLU A C   
1216 O O   . GLU A 166 ? 0.4691 0.3572 0.3316 0.0304  -0.0178 0.0189  148 GLU A O   
1217 C CB  . GLU A 166 ? 0.5311 0.3896 0.3754 0.0338  -0.0347 0.0336  148 GLU A CB  
1218 C CG  . GLU A 166 ? 0.6220 0.4723 0.4782 0.0408  -0.0418 0.0340  148 GLU A CG  
1219 C CD  . GLU A 166 ? 0.7743 0.6041 0.6182 0.0408  -0.0502 0.0432  148 GLU A CD  
1220 O OE1 . GLU A 166 ? 0.8225 0.6406 0.6489 0.0330  -0.0472 0.0486  148 GLU A OE1 
1221 O OE2 . GLU A 166 ? 0.8256 0.6510 0.6779 0.0485  -0.0602 0.0450  148 GLU A OE2 
1222 N N   . ARG A 167 ? 0.4350 0.3216 0.2775 0.0267  -0.0185 0.0242  149 ARG A N   
1223 C CA  . ARG A 167 ? 0.3951 0.2908 0.2391 0.0234  -0.0107 0.0205  149 ARG A CA  
1224 C C   . ARG A 167 ? 0.3675 0.2750 0.2206 0.0265  -0.0096 0.0154  149 ARG A C   
1225 O O   . ARG A 167 ? 0.3379 0.2522 0.1973 0.0255  -0.0058 0.0123  149 ARG A O   
1226 C CB  . ARG A 167 ? 0.3889 0.2835 0.2195 0.0187  -0.0067 0.0225  149 ARG A CB  
1227 C CG  . ARG A 167 ? 0.3902 0.2963 0.2251 0.0169  0.0006  0.0180  149 ARG A CG  
1228 C CD  . ARG A 167 ? 0.3932 0.2988 0.2159 0.0117  0.0063  0.0188  149 ARG A CD  
1229 N NE  . ARG A 167 ? 0.3686 0.2877 0.1993 0.0124  0.0126  0.0131  149 ARG A NE  
1230 C CZ  . ARG A 167 ? 0.3921 0.3157 0.2169 0.0097  0.0191  0.0106  149 ARG A CZ  
1231 N NH1 . ARG A 167 ? 0.3636 0.2786 0.1711 0.0045  0.0207  0.0135  149 ARG A NH1 
1232 N NH2 . ARG A 167 ? 0.3643 0.3008 0.2003 0.0122  0.0238  0.0048  149 ARG A NH2 
1233 N N   . PHE A 168 ? 0.3551 0.2640 0.2076 0.0293  -0.0136 0.0149  150 PHE A N   
1234 C CA  . PHE A 168 ? 0.3434 0.2603 0.2005 0.0306  -0.0125 0.0110  150 PHE A CA  
1235 C C   . PHE A 168 ? 0.3524 0.2729 0.2192 0.0328  -0.0156 0.0089  150 PHE A C   
1236 O O   . PHE A 168 ? 0.3762 0.2949 0.2453 0.0347  -0.0205 0.0100  150 PHE A O   
1237 C CB  . PHE A 168 ? 0.3358 0.2516 0.1836 0.0303  -0.0131 0.0107  150 PHE A CB  
1238 C CG  . PHE A 168 ? 0.3268 0.2407 0.1651 0.0278  -0.0083 0.0112  150 PHE A CG  
1239 C CD1 . PHE A 168 ? 0.2712 0.1915 0.1140 0.0278  -0.0026 0.0082  150 PHE A CD1 
1240 C CD2 . PHE A 168 ? 0.3131 0.2198 0.1383 0.0252  -0.0096 0.0144  150 PHE A CD2 
1241 C CE1 . PHE A 168 ? 0.2974 0.2189 0.1342 0.0254  0.0031  0.0073  150 PHE A CE1 
1242 C CE2 . PHE A 168 ? 0.3473 0.2533 0.1628 0.0215  -0.0035 0.0140  150 PHE A CE2 
1243 C CZ  . PHE A 168 ? 0.3288 0.2435 0.1517 0.0219  0.0036  0.0096  150 PHE A CZ  
1244 N N   . TYR A 169 ? 0.3287 0.2551 0.2015 0.0322  -0.0129 0.0057  151 TYR A N   
1245 C CA  . TYR A 169 ? 0.3197 0.2510 0.2008 0.0327  -0.0140 0.0028  151 TYR A CA  
1246 C C   . TYR A 169 ? 0.2927 0.2276 0.1720 0.0309  -0.0137 0.0013  151 TYR A C   
1247 O O   . TYR A 169 ? 0.2977 0.2326 0.1736 0.0296  -0.0116 0.0011  151 TYR A O   
1248 C CB  . TYR A 169 ? 0.3190 0.2523 0.2066 0.0320  -0.0109 0.0000  151 TYR A CB  
1249 C CG  . TYR A 169 ? 0.3105 0.2499 0.2074 0.0322  -0.0103 -0.0044 151 TYR A CG  
1250 C CD1 . TYR A 169 ? 0.3102 0.2497 0.2166 0.0359  -0.0125 -0.0060 151 TYR A CD1 
1251 C CD2 . TYR A 169 ? 0.3052 0.2502 0.2015 0.0285  -0.0074 -0.0072 151 TYR A CD2 
1252 C CE1 . TYR A 169 ? 0.3226 0.2706 0.2405 0.0362  -0.0106 -0.0117 151 TYR A CE1 
1253 C CE2 . TYR A 169 ? 0.3296 0.2817 0.2338 0.0271  -0.0051 -0.0121 151 TYR A CE2 
1254 C CZ  . TYR A 169 ? 0.3196 0.2745 0.2359 0.0312  -0.0060 -0.0150 151 TYR A CZ  
1255 O OH  . TYR A 169 ? 0.3550 0.3197 0.2822 0.0301  -0.0025 -0.0215 151 TYR A OH  
1256 N N   . ILE A 170 ? 0.3009 0.2381 0.1825 0.0306  -0.0166 0.0004  152 ILE A N   
1257 C CA  . ILE A 170 ? 0.2907 0.2288 0.1692 0.0275  -0.0165 -0.0007 152 ILE A CA  
1258 C C   . ILE A 170 ? 0.2886 0.2331 0.1734 0.0242  -0.0137 -0.0037 152 ILE A C   
1259 O O   . ILE A 170 ? 0.2820 0.2338 0.1771 0.0242  -0.0135 -0.0067 152 ILE A O   
1260 C CB  . ILE A 170 ? 0.2974 0.2350 0.1742 0.0268  -0.0210 -0.0007 152 ILE A CB  
1261 C CG1 . ILE A 170 ? 0.2995 0.2302 0.1669 0.0289  -0.0233 0.0019  152 ILE A CG1 
1262 C CG2 . ILE A 170 ? 0.3018 0.2376 0.1740 0.0224  -0.0206 -0.0019 152 ILE A CG2 
1263 C CD1 . ILE A 170 ? 0.2862 0.2170 0.1517 0.0282  -0.0293 0.0022  152 ILE A CD1 
1264 N N   . LEU A 171 ? 0.2784 0.2201 0.1567 0.0212  -0.0118 -0.0032 153 LEU A N   
1265 C CA  . LEU A 171 ? 0.2981 0.2440 0.1774 0.0163  -0.0086 -0.0053 153 LEU A CA  
1266 C C   . LEU A 171 ? 0.3008 0.2476 0.1786 0.0110  -0.0089 -0.0061 153 LEU A C   
1267 O O   . LEU A 171 ? 0.3332 0.2730 0.2015 0.0072  -0.0095 -0.0039 153 LEU A O   
1268 C CB  . LEU A 171 ? 0.2867 0.2279 0.1580 0.0153  -0.0080 -0.0032 153 LEU A CB  
1269 C CG  . LEU A 171 ? 0.2954 0.2376 0.1698 0.0190  -0.0074 -0.0032 153 LEU A CG  
1270 C CD1 . LEU A 171 ? 0.2982 0.2366 0.1674 0.0207  -0.0092 -0.0002 153 LEU A CD1 
1271 C CD2 . LEU A 171 ? 0.2479 0.1951 0.1264 0.0165  -0.0037 -0.0071 153 LEU A CD2 
1272 N N   . ASN A 172 ? 0.3028 0.2582 0.1910 0.0105  -0.0091 -0.0092 154 ASN A N   
1273 C CA  . ASN A 172 ? 0.3029 0.2612 0.1919 0.0049  -0.0100 -0.0104 154 ASN A CA  
1274 C C   . ASN A 172 ? 0.3163 0.2777 0.2025 -0.0043 -0.0052 -0.0122 154 ASN A C   
1275 O O   . ASN A 172 ? 0.3335 0.2920 0.2149 -0.0107 -0.0061 -0.0117 154 ASN A O   
1276 C CB  . ASN A 172 ? 0.3014 0.2713 0.2055 0.0072  -0.0124 -0.0137 154 ASN A CB  
1277 C CG  . ASN A 172 ? 0.2739 0.2383 0.1760 0.0135  -0.0191 -0.0107 154 ASN A CG  
1278 O OD1 . ASN A 172 ? 0.3192 0.2755 0.2112 0.0121  -0.0222 -0.0086 154 ASN A OD1 
1279 N ND2 . ASN A 172 ? 0.2599 0.2280 0.1708 0.0197  -0.0211 -0.0108 154 ASN A ND2 
1280 N N   . THR A 173 ? 0.3073 0.2745 0.1959 -0.0061 0.0002  -0.0150 155 THR A N   
1281 C CA  . THR A 173 ? 0.3116 0.2845 0.1981 -0.0164 0.0061  -0.0179 155 THR A CA  
1282 C C   . THR A 173 ? 0.3131 0.2768 0.1828 -0.0219 0.0083  -0.0149 155 THR A C   
1283 O O   . THR A 173 ? 0.3046 0.2602 0.1675 -0.0169 0.0056  -0.0115 155 THR A O   
1284 C CB  . THR A 173 ? 0.3120 0.3033 0.2165 -0.0171 0.0120  -0.0260 155 THR A CB  
1285 O OG1 . THR A 173 ? 0.2871 0.2795 0.1920 -0.0142 0.0160  -0.0288 155 THR A OG1 
1286 C CG2 . THR A 173 ? 0.3044 0.3039 0.2267 -0.0089 0.0069  -0.0278 155 THR A CG2 
1287 N N   . LEU A 174 ? 0.3199 0.2849 0.1825 -0.0331 0.0129  -0.0158 156 LEU A N   
1288 C CA  . LEU A 174 ? 0.3366 0.2928 0.1808 -0.0403 0.0148  -0.0126 156 LEU A CA  
1289 C C   . LEU A 174 ? 0.3275 0.2911 0.1741 -0.0386 0.0195  -0.0173 156 LEU A C   
1290 O O   . LEU A 174 ? 0.3332 0.2881 0.1654 -0.0404 0.0178  -0.0138 156 LEU A O   
1291 C CB  . LEU A 174 ? 0.3468 0.3014 0.1799 -0.0549 0.0193  -0.0121 156 LEU A CB  
1292 C CG  . LEU A 174 ? 0.3807 0.3226 0.2078 -0.0571 0.0134  -0.0066 156 LEU A CG  
1293 C CD1 . LEU A 174 ? 0.3950 0.3392 0.2171 -0.0718 0.0186  -0.0078 156 LEU A CD1 
1294 C CD2 . LEU A 174 ? 0.3887 0.3086 0.1975 -0.0541 0.0055  0.0022  156 LEU A CD2 
1295 N N   . PHE A 175 ? 0.3048 0.2832 0.1701 -0.0344 0.0243  -0.0253 157 PHE A N   
1296 C CA  . PHE A 175 ? 0.2969 0.2799 0.1659 -0.0311 0.0283  -0.0306 157 PHE A CA  
1297 C C   . PHE A 175 ? 0.2954 0.2686 0.1614 -0.0222 0.0214  -0.0258 157 PHE A C   
1298 O O   . PHE A 175 ? 0.3272 0.2995 0.1897 -0.0218 0.0231  -0.0282 157 PHE A O   
1299 C CB  . PHE A 175 ? 0.2705 0.2692 0.1628 -0.0261 0.0333  -0.0399 157 PHE A CB  
1300 C CG  . PHE A 175 ? 0.2704 0.2839 0.1692 -0.0352 0.0429  -0.0479 157 PHE A CG  
1301 C CD1 . PHE A 175 ? 0.2448 0.2608 0.1324 -0.0447 0.0518  -0.0530 157 PHE A CD1 
1302 C CD2 . PHE A 175 ? 0.2667 0.2928 0.1830 -0.0347 0.0433  -0.0509 157 PHE A CD2 
1303 C CE1 . PHE A 175 ? 0.2570 0.2879 0.1508 -0.0537 0.0622  -0.0613 157 PHE A CE1 
1304 C CE2 . PHE A 175 ? 0.2393 0.2822 0.1649 -0.0433 0.0530  -0.0593 157 PHE A CE2 
1305 C CZ  . PHE A 175 ? 0.2536 0.2989 0.1676 -0.0530 0.0633  -0.0647 157 PHE A CZ  
1306 N N   . ASN A 176 ? 0.3002 0.2666 0.1675 -0.0160 0.0142  -0.0199 158 ASN A N   
1307 C CA  . ASN A 176 ? 0.2988 0.2577 0.1645 -0.0082 0.0086  -0.0157 158 ASN A CA  
1308 C C   . ASN A 176 ? 0.3131 0.2614 0.1634 -0.0101 0.0038  -0.0092 158 ASN A C   
1309 O O   . ASN A 176 ? 0.3195 0.2641 0.1699 -0.0044 -0.0003 -0.0064 158 ASN A O   
1310 C CB  . ASN A 176 ? 0.2908 0.2485 0.1654 -0.0003 0.0040  -0.0135 158 ASN A CB  
1311 C CG  . ASN A 176 ? 0.3140 0.2810 0.2049 0.0038  0.0058  -0.0186 158 ASN A CG  
1312 O OD1 . ASN A 176 ? 0.3339 0.3040 0.2314 0.0051  0.0035  -0.0185 158 ASN A OD1 
1313 N ND2 . ASN A 176 ? 0.3079 0.2786 0.2055 0.0060  0.0093  -0.0234 158 ASN A ND2 
1314 N N   . LEU A 177 ? 0.3364 0.2796 0.1738 -0.0182 0.0039  -0.0065 159 LEU A N   
1315 C CA  . LEU A 177 ? 0.3461 0.2778 0.1688 -0.0194 -0.0024 0.0004  159 LEU A CA  
1316 C C   . LEU A 177 ? 0.3530 0.2860 0.1708 -0.0198 -0.0035 0.0000  159 LEU A C   
1317 O O   . LEU A 177 ? 0.3470 0.2761 0.1645 -0.0143 -0.0099 0.0041  159 LEU A O   
1318 C CB  . LEU A 177 ? 0.3605 0.2835 0.1680 -0.0290 -0.0028 0.0044  159 LEU A CB  
1319 C CG  . LEU A 177 ? 0.3830 0.2995 0.1924 -0.0283 -0.0049 0.0067  159 LEU A CG  
1320 C CD1 . LEU A 177 ? 0.3564 0.2609 0.1480 -0.0388 -0.0059 0.0116  159 LEU A CD1 
1321 C CD2 . LEU A 177 ? 0.3671 0.2757 0.1805 -0.0176 -0.0120 0.0104  159 LEU A CD2 
1322 N N   . PRO A 178 ? 0.3579 0.2976 0.1730 -0.0263 0.0029  -0.0058 160 PRO A N   
1323 C CA  . PRO A 178 ? 0.3629 0.3035 0.1733 -0.0271 0.0014  -0.0070 160 PRO A CA  
1324 C C   . PRO A 178 ? 0.3522 0.2961 0.1763 -0.0178 -0.0011 -0.0081 160 PRO A C   
1325 O O   . PRO A 178 ? 0.3339 0.2761 0.1548 -0.0163 -0.0070 -0.0050 160 PRO A O   
1326 C CB  . PRO A 178 ? 0.3770 0.3244 0.1840 -0.0353 0.0108  -0.0155 160 PRO A CB  
1327 C CG  . PRO A 178 ? 0.3689 0.3180 0.1739 -0.0413 0.0159  -0.0163 160 PRO A CG  
1328 C CD  . PRO A 178 ? 0.3625 0.3097 0.1791 -0.0336 0.0119  -0.0122 160 PRO A CD  
1329 N N   . GLU A 179 ? 0.3461 0.2946 0.1850 -0.0121 0.0028  -0.0122 161 GLU A N   
1330 C CA  . GLU A 179 ? 0.3389 0.2884 0.1879 -0.0051 0.0008  -0.0124 161 GLU A CA  
1331 C C   . GLU A 179 ? 0.3274 0.2733 0.1779 0.0007  -0.0054 -0.0060 161 GLU A C   
1332 O O   . GLU A 179 ? 0.3199 0.2670 0.1740 0.0036  -0.0080 -0.0049 161 GLU A O   
1333 C CB  . GLU A 179 ? 0.3477 0.3006 0.2103 -0.0006 0.0053  -0.0176 161 GLU A CB  
1334 C CG  . GLU A 179 ? 0.3663 0.3196 0.2362 0.0039  0.0046  -0.0158 161 GLU A CG  
1335 C CD  . GLU A 179 ? 0.3985 0.3562 0.2813 0.0073  0.0082  -0.0212 161 GLU A CD  
1336 O OE1 . GLU A 179 ? 0.3927 0.3476 0.2821 0.0129  0.0064  -0.0205 161 GLU A OE1 
1337 O OE2 . GLU A 179 ? 0.3911 0.3550 0.2779 0.0043  0.0127  -0.0262 161 GLU A OE2 
1338 N N   . THR A 180 ? 0.3192 0.2611 0.1674 0.0017  -0.0073 -0.0025 162 THR A N   
1339 C CA  . THR A 180 ? 0.3126 0.2500 0.1615 0.0074  -0.0126 0.0024  162 THR A CA  
1340 C C   . THR A 180 ? 0.3310 0.2675 0.1749 0.0070  -0.0182 0.0056  162 THR A C   
1341 O O   . THR A 180 ? 0.3329 0.2725 0.1840 0.0122  -0.0208 0.0065  162 THR A O   
1342 C CB  . THR A 180 ? 0.3240 0.2541 0.1676 0.0068  -0.0143 0.0053  162 THR A CB  
1343 O OG1 . THR A 180 ? 0.3197 0.2527 0.1693 0.0067  -0.0103 0.0021  162 THR A OG1 
1344 C CG2 . THR A 180 ? 0.2875 0.2124 0.1326 0.0132  -0.0189 0.0085  162 THR A CG2 
1345 N N   . TYR A 181 ? 0.3305 0.2634 0.1621 0.0004  -0.0202 0.0075  163 TYR A N   
1346 C CA  . TYR A 181 ? 0.3429 0.2746 0.1689 0.0000  -0.0277 0.0114  163 TYR A CA  
1347 C C   . TYR A 181 ? 0.3351 0.2759 0.1664 -0.0011 -0.0270 0.0077  163 TYR A C   
1348 O O   . TYR A 181 ? 0.3219 0.2671 0.1590 0.0024  -0.0328 0.0095  163 TYR A O   
1349 C CB  . TYR A 181 ? 0.3597 0.2831 0.1671 -0.0083 -0.0310 0.0154  163 TYR A CB  
1350 C CG  . TYR A 181 ? 0.3678 0.2888 0.1679 -0.0087 -0.0411 0.0206  163 TYR A CG  
1351 C CD1 . TYR A 181 ? 0.3748 0.2929 0.1819 0.0000  -0.0496 0.0255  163 TYR A CD1 
1352 C CD2 . TYR A 181 ? 0.3915 0.3141 0.1787 -0.0175 -0.0424 0.0201  163 TYR A CD2 
1353 C CE1 . TYR A 181 ? 0.3550 0.2726 0.1583 0.0008  -0.0605 0.0304  163 TYR A CE1 
1354 C CE2 . TYR A 181 ? 0.3839 0.3048 0.1639 -0.0181 -0.0534 0.0253  163 TYR A CE2 
1355 C CZ  . TYR A 181 ? 0.3788 0.2979 0.1682 -0.0085 -0.0630 0.0308  163 TYR A CZ  
1356 O OH  . TYR A 181 ? 0.3781 0.2974 0.1632 -0.0082 -0.0756 0.0361  163 TYR A OH  
1357 N N   . LEU A 182 ? 0.3105 0.2546 0.1414 -0.0058 -0.0199 0.0018  164 LEU A N   
1358 C CA  . LEU A 182 ? 0.3253 0.2752 0.1594 -0.0083 -0.0188 -0.0026 164 LEU A CA  
1359 C C   . LEU A 182 ? 0.3222 0.2770 0.1712 -0.0019 -0.0188 -0.0032 164 LEU A C   
1360 O O   . LEU A 182 ? 0.3293 0.2894 0.1820 -0.0028 -0.0222 -0.0035 164 LEU A O   
1361 C CB  . LEU A 182 ? 0.3120 0.2622 0.1427 -0.0139 -0.0106 -0.0099 164 LEU A CB  
1362 C CG  . LEU A 182 ? 0.3344 0.2875 0.1677 -0.0168 -0.0083 -0.0159 164 LEU A CG  
1363 C CD1 . LEU A 182 ? 0.3168 0.2716 0.1396 -0.0229 -0.0151 -0.0142 164 LEU A CD1 
1364 C CD2 . LEU A 182 ? 0.3275 0.2799 0.1593 -0.0207 0.0007  -0.0243 164 LEU A CD2 
1365 N N   . LEU A 183 ? 0.3169 0.2703 0.1737 0.0035  -0.0153 -0.0032 165 LEU A N   
1366 C CA  . LEU A 183 ? 0.3222 0.2789 0.1899 0.0084  -0.0147 -0.0029 165 LEU A CA  
1367 C C   . LEU A 183 ? 0.3156 0.2776 0.1877 0.0115  -0.0207 0.0005  165 LEU A C   
1368 O O   . LEU A 183 ? 0.3224 0.2914 0.2017 0.0108  -0.0212 -0.0007 165 LEU A O   
1369 C CB  . LEU A 183 ? 0.3078 0.2608 0.1793 0.0132  -0.0113 -0.0024 165 LEU A CB  
1370 C CG  . LEU A 183 ? 0.3204 0.2707 0.1936 0.0122  -0.0063 -0.0062 165 LEU A CG  
1371 C CD1 . LEU A 183 ? 0.2419 0.1892 0.1172 0.0164  -0.0055 -0.0048 165 LEU A CD1 
1372 C CD2 . LEU A 183 ? 0.3011 0.2514 0.1794 0.0113  -0.0041 -0.0086 165 LEU A CD2 
1373 N N   . ALA A 184 ? 0.3159 0.2744 0.1846 0.0148  -0.0253 0.0044  166 ALA A N   
1374 C CA  . ALA A 184 ? 0.3172 0.2804 0.1920 0.0193  -0.0321 0.0073  166 ALA A CA  
1375 C C   . ALA A 184 ? 0.3274 0.2975 0.2015 0.0150  -0.0384 0.0077  166 ALA A C   
1376 O O   . ALA A 184 ? 0.3279 0.3088 0.2140 0.0173  -0.0414 0.0071  166 ALA A O   
1377 C CB  . ALA A 184 ? 0.3042 0.2583 0.1737 0.0236  -0.0366 0.0114  166 ALA A CB  
1378 N N   . CYS A 185 ? 0.3368 0.3017 0.1967 0.0081  -0.0404 0.0083  167 CYS A N   
1379 C CA  . CYS A 185 ? 0.3510 0.3211 0.2061 0.0017  -0.0457 0.0078  167 CYS A CA  
1380 C C   . CYS A 185 ? 0.3444 0.3243 0.2097 -0.0011 -0.0423 0.0026  167 CYS A C   
1381 O O   . CYS A 185 ? 0.3476 0.3374 0.2200 -0.0019 -0.0485 0.0028  167 CYS A O   
1382 C CB  . CYS A 185 ? 0.3557 0.3179 0.1918 -0.0073 -0.0438 0.0067  167 CYS A CB  
1383 S SG  . CYS A 185 ? 0.4022 0.3527 0.2201 -0.0093 -0.0513 0.0143  167 CYS A SG  
1384 N N   . LEU A 186 ? 0.3394 0.3161 0.2056 -0.0030 -0.0330 -0.0020 168 LEU A N   
1385 C CA  . LEU A 186 ? 0.3203 0.3021 0.1938 -0.0067 -0.0292 -0.0066 168 LEU A CA  
1386 C C   . LEU A 186 ? 0.3164 0.3082 0.2059 -0.0022 -0.0299 -0.0055 168 LEU A C   
1387 O O   . LEU A 186 ? 0.3172 0.3188 0.2137 -0.0060 -0.0327 -0.0071 168 LEU A O   
1388 C CB  . LEU A 186 ? 0.3179 0.2913 0.1896 -0.0078 -0.0202 -0.0107 168 LEU A CB  
1389 C CG  . LEU A 186 ? 0.3284 0.2952 0.1877 -0.0135 -0.0174 -0.0150 168 LEU A CG  
1390 C CD1 . LEU A 186 ? 0.3455 0.3051 0.2077 -0.0113 -0.0094 -0.0188 168 LEU A CD1 
1391 C CD2 . LEU A 186 ? 0.3262 0.2960 0.1802 -0.0219 -0.0200 -0.0190 168 LEU A CD2 
1392 N N   . VAL A 187 ? 0.2938 0.2842 0.1888 0.0051  -0.0272 -0.0032 169 VAL A N   
1393 C CA  . VAL A 187 ? 0.2947 0.2956 0.2043 0.0089  -0.0261 -0.0033 169 VAL A CA  
1394 C C   . VAL A 187 ? 0.3035 0.3173 0.2226 0.0109  -0.0349 -0.0021 169 VAL A C   
1395 O O   . VAL A 187 ? 0.3043 0.3319 0.2364 0.0088  -0.0352 -0.0044 169 VAL A O   
1396 C CB  . VAL A 187 ? 0.2805 0.2766 0.1918 0.0159  -0.0217 -0.0020 169 VAL A CB  
1397 C CG1 . VAL A 187 ? 0.2725 0.2814 0.1989 0.0197  -0.0198 -0.0033 169 VAL A CG1 
1398 C CG2 . VAL A 187 ? 0.2845 0.2704 0.1890 0.0137  -0.0147 -0.0030 169 VAL A CG2 
1399 N N   . ASP A 188 ? 0.3065 0.3158 0.2192 0.0144  -0.0426 0.0017  170 ASP A N   
1400 C CA  . ASP A 188 ? 0.3290 0.3484 0.2495 0.0172  -0.0536 0.0040  170 ASP A CA  
1401 C C   . ASP A 188 ? 0.3313 0.3605 0.2526 0.0085  -0.0582 0.0019  170 ASP A C   
1402 O O   . ASP A 188 ? 0.3384 0.3839 0.2757 0.0096  -0.0632 0.0008  170 ASP A O   
1403 C CB  . ASP A 188 ? 0.3359 0.3434 0.2439 0.0206  -0.0619 0.0097  170 ASP A CB  
1404 C CG  . ASP A 188 ? 0.3780 0.3936 0.2919 0.0233  -0.0757 0.0133  170 ASP A CG  
1405 O OD1 . ASP A 188 ? 0.3792 0.4038 0.3111 0.0326  -0.0792 0.0133  170 ASP A OD1 
1406 O OD2 . ASP A 188 ? 0.3859 0.3990 0.2865 0.0163  -0.0833 0.0157  170 ASP A OD2 
1407 N N   . PHE A 189 ? 0.3338 0.3539 0.2386 -0.0003 -0.0562 0.0004  171 PHE A N   
1408 C CA  . PHE A 189 ? 0.3406 0.3674 0.2427 -0.0100 -0.0600 -0.0027 171 PHE A CA  
1409 C C   . PHE A 189 ? 0.3368 0.3761 0.2546 -0.0140 -0.0552 -0.0076 171 PHE A C   
1410 O O   . PHE A 189 ? 0.3297 0.3847 0.2588 -0.0170 -0.0621 -0.0087 171 PHE A O   
1411 C CB  . PHE A 189 ? 0.3492 0.3623 0.2300 -0.0185 -0.0564 -0.0052 171 PHE A CB  
1412 C CG  . PHE A 189 ? 0.3925 0.4106 0.2695 -0.0292 -0.0586 -0.0101 171 PHE A CG  
1413 C CD1 . PHE A 189 ? 0.3890 0.4145 0.2615 -0.0335 -0.0709 -0.0082 171 PHE A CD1 
1414 C CD2 . PHE A 189 ? 0.4032 0.4176 0.2812 -0.0350 -0.0494 -0.0165 171 PHE A CD2 
1415 C CE1 . PHE A 189 ? 0.4211 0.4519 0.2901 -0.0443 -0.0736 -0.0133 171 PHE A CE1 
1416 C CE2 . PHE A 189 ? 0.4233 0.4410 0.2978 -0.0456 -0.0515 -0.0219 171 PHE A CE2 
1417 C CZ  . PHE A 189 ? 0.4043 0.4308 0.2741 -0.0507 -0.0633 -0.0207 171 PHE A CZ  
1418 N N   . PHE A 190 ? 0.3194 0.3519 0.2377 -0.0149 -0.0439 -0.0103 172 PHE A N   
1419 C CA  . PHE A 190 ? 0.3337 0.3749 0.2635 -0.0208 -0.0388 -0.0143 172 PHE A CA  
1420 C C   . PHE A 190 ? 0.3368 0.3968 0.2879 -0.0160 -0.0398 -0.0138 172 PHE A C   
1421 O O   . PHE A 190 ? 0.3510 0.4256 0.3143 -0.0223 -0.0405 -0.0169 172 PHE A O   
1422 C CB  . PHE A 190 ? 0.3355 0.3624 0.2593 -0.0226 -0.0278 -0.0160 172 PHE A CB  
1423 C CG  . PHE A 190 ? 0.3271 0.3380 0.2345 -0.0272 -0.0257 -0.0186 172 PHE A CG  
1424 C CD1 . PHE A 190 ? 0.3761 0.3864 0.2783 -0.0370 -0.0275 -0.0233 172 PHE A CD1 
1425 C CD2 . PHE A 190 ? 0.3365 0.3340 0.2346 -0.0220 -0.0218 -0.0173 172 PHE A CD2 
1426 C CE1 . PHE A 190 ? 0.4231 0.4185 0.3106 -0.0411 -0.0243 -0.0275 172 PHE A CE1 
1427 C CE2 . PHE A 190 ? 0.3602 0.3450 0.2458 -0.0257 -0.0187 -0.0212 172 PHE A CE2 
1428 C CZ  . PHE A 190 ? 0.3815 0.3650 0.2617 -0.0348 -0.0196 -0.0266 172 PHE A CZ  
1429 N N   . THR A 191 ? 0.3392 0.3997 0.2955 -0.0054 -0.0396 -0.0109 173 THR A N   
1430 C CA  . THR A 191 ? 0.3497 0.4291 0.3278 0.0006  -0.0402 -0.0119 173 THR A CA  
1431 C C   . THR A 191 ? 0.3664 0.4645 0.3584 0.0005  -0.0521 -0.0121 173 THR A C   
1432 O O   . THR A 191 ? 0.3647 0.4841 0.3774 -0.0015 -0.0515 -0.0158 173 THR A O   
1433 C CB  . THR A 191 ? 0.3438 0.4174 0.3227 0.0127  -0.0398 -0.0092 173 THR A CB  
1434 O OG1 . THR A 191 ? 0.3500 0.4068 0.3154 0.0125  -0.0304 -0.0087 173 THR A OG1 
1435 C CG2 . THR A 191 ? 0.3597 0.4527 0.3622 0.0198  -0.0384 -0.0121 173 THR A CG2 
1436 N N   . ASN A 192 ? 0.3759 0.4670 0.3566 0.0021  -0.0631 -0.0082 174 ASN A N   
1437 C CA  . ASN A 192 ? 0.4049 0.5121 0.3970 0.0033  -0.0773 -0.0070 174 ASN A CA  
1438 C C   . ASN A 192 ? 0.4192 0.5335 0.4073 -0.0092 -0.0836 -0.0092 174 ASN A C   
1439 O O   . ASN A 192 ? 0.4239 0.5546 0.4236 -0.0091 -0.0963 -0.0085 174 ASN A O   
1440 C CB  . ASN A 192 ? 0.4155 0.5125 0.3995 0.0128  -0.0883 -0.0004 174 ASN A CB  
1441 C CG  . ASN A 192 ? 0.4393 0.5364 0.4364 0.0262  -0.0849 0.0002  174 ASN A CG  
1442 O OD1 . ASN A 192 ? 0.5098 0.5880 0.4928 0.0303  -0.0803 0.0028  174 ASN A OD1 
1443 N ND2 . ASN A 192 ? 0.4502 0.5695 0.4750 0.0322  -0.0857 -0.0035 174 ASN A ND2 
1444 N N   . CYS A 193 ? 0.4237 0.5262 0.3966 -0.0197 -0.0752 -0.0124 175 CYS A N   
1445 C CA  . CYS A 193 ? 0.4351 0.5412 0.4017 -0.0326 -0.0796 -0.0158 175 CYS A CA  
1446 C C   . CYS A 193 ? 0.4321 0.5557 0.4183 -0.0398 -0.0741 -0.0214 175 CYS A C   
1447 O O   . CYS A 193 ? 0.4209 0.5394 0.4097 -0.0409 -0.0612 -0.0234 175 CYS A O   
1448 C CB  . CYS A 193 ? 0.4422 0.5252 0.3831 -0.0398 -0.0728 -0.0176 175 CYS A CB  
1449 S SG  . CYS A 193 ? 0.4669 0.5512 0.3977 -0.0560 -0.0768 -0.0236 175 CYS A SG  
1450 N N   . PRO A 194 ? 0.4403 0.5842 0.4393 -0.0460 -0.0842 -0.0236 176 PRO A N   
1451 C CA  . PRO A 194 ? 0.4332 0.5973 0.4546 -0.0528 -0.0786 -0.0288 176 PRO A CA  
1452 C C   . PRO A 194 ? 0.4349 0.5887 0.4457 -0.0681 -0.0695 -0.0339 176 PRO A C   
1453 O O   . PRO A 194 ? 0.4364 0.6038 0.4632 -0.0753 -0.0632 -0.0378 176 PRO A O   
1454 C CB  . PRO A 194 ? 0.4373 0.6295 0.4797 -0.0529 -0.0940 -0.0293 176 PRO A CB  
1455 C CG  . PRO A 194 ? 0.4695 0.6514 0.4941 -0.0483 -0.1089 -0.0236 176 PRO A CG  
1456 C CD  . PRO A 194 ? 0.4635 0.6133 0.4568 -0.0484 -0.1009 -0.0214 176 PRO A CD  
1457 N N   A ARG A 195 ? 0.4436 0.5730 0.4280 -0.0728 -0.0683 -0.0343 177 ARG A N   
1458 N N   B ARG A 195 ? 0.4483 0.5779 0.4328 -0.0732 -0.0684 -0.0344 177 ARG A N   
1459 C CA  A ARG A 195 ? 0.4462 0.5588 0.4181 -0.0848 -0.0587 -0.0392 177 ARG A CA  
1460 C CA  B ARG A 195 ? 0.4558 0.5691 0.4287 -0.0851 -0.0582 -0.0393 177 ARG A CA  
1461 C C   A ARG A 195 ? 0.4411 0.5394 0.4118 -0.0813 -0.0442 -0.0380 177 ARG A C   
1462 C C   B ARG A 195 ? 0.4443 0.5477 0.4201 -0.0815 -0.0441 -0.0381 177 ARG A C   
1463 O O   A ARG A 195 ? 0.4472 0.5331 0.4120 -0.0907 -0.0363 -0.0413 177 ARG A O   
1464 O O   B ARG A 195 ? 0.4439 0.5433 0.4212 -0.0914 -0.0363 -0.0412 177 ARG A O   
1465 C CB  A ARG A 195 ? 0.4592 0.5505 0.4043 -0.0894 -0.0614 -0.0412 177 ARG A CB  
1466 C CB  B ARG A 195 ? 0.4702 0.5586 0.4156 -0.0884 -0.0583 -0.0410 177 ARG A CB  
1467 C CG  A ARG A 195 ? 0.4644 0.5650 0.4031 -0.0913 -0.0766 -0.0404 177 ARG A CG  
1468 C CG  B ARG A 195 ? 0.4987 0.5919 0.4337 -0.0940 -0.0715 -0.0424 177 ARG A CG  
1469 C CD  A ARG A 195 ? 0.4753 0.5557 0.3858 -0.0996 -0.0771 -0.0446 177 ARG A CD  
1470 C CD  B ARG A 195 ? 0.5396 0.6121 0.4510 -0.1051 -0.0682 -0.0490 177 ARG A CD  
1471 N NE  A ARG A 195 ? 0.4336 0.4909 0.3277 -0.0929 -0.0675 -0.0437 177 ARG A NE  
1472 N NE  B ARG A 195 ? 0.5529 0.6019 0.4460 -0.0989 -0.0600 -0.0486 177 ARG A NE  
1473 C CZ  A ARG A 195 ? 0.4062 0.4561 0.2856 -0.0869 -0.0709 -0.0398 177 ARG A CZ  
1474 C CZ  B ARG A 195 ? 0.5481 0.5791 0.4378 -0.0980 -0.0477 -0.0512 177 ARG A CZ  
1475 N NH1 A ARG A 195 ? 0.3881 0.4488 0.2648 -0.0863 -0.0845 -0.0354 177 ARG A NH1 
1476 N NH1 B ARG A 195 ? 0.5363 0.5669 0.4366 -0.1036 -0.0417 -0.0534 177 ARG A NH1 
1477 N NH2 A ARG A 195 ? 0.3766 0.4082 0.2442 -0.0819 -0.0613 -0.0401 177 ARG A NH2 
1478 N NH2 B ARG A 195 ? 0.5404 0.5537 0.4161 -0.0919 -0.0419 -0.0512 177 ARG A NH2 
1479 N N   . TYR A 196 ? 0.4287 0.5272 0.4038 -0.0681 -0.0415 -0.0333 178 TYR A N   
1480 C CA  . TYR A 196 ? 0.4289 0.5157 0.4025 -0.0640 -0.0293 -0.0314 178 TYR A CA  
1481 C C   . TYR A 196 ? 0.4191 0.5254 0.4134 -0.0592 -0.0252 -0.0304 178 TYR A C   
1482 O O   . TYR A 196 ? 0.4279 0.5527 0.4369 -0.0513 -0.0320 -0.0295 178 TYR A O   
1483 C CB  . TYR A 196 ? 0.4267 0.4938 0.3845 -0.0535 -0.0279 -0.0276 178 TYR A CB  
1484 C CG  . TYR A 196 ? 0.4471 0.4979 0.3861 -0.0572 -0.0310 -0.0295 178 TYR A CG  
1485 C CD1 . TYR A 196 ? 0.4443 0.4742 0.3704 -0.0622 -0.0238 -0.0323 178 TYR A CD1 
1486 C CD2 . TYR A 196 ? 0.4569 0.5128 0.3905 -0.0561 -0.0414 -0.0288 178 TYR A CD2 
1487 C CE1 . TYR A 196 ? 0.4873 0.5035 0.3972 -0.0657 -0.0254 -0.0359 178 TYR A CE1 
1488 C CE2 . TYR A 196 ? 0.4797 0.5213 0.3940 -0.0610 -0.0431 -0.0316 178 TYR A CE2 
1489 C CZ  . TYR A 196 ? 0.4855 0.5084 0.3891 -0.0656 -0.0344 -0.0359 178 TYR A CZ  
1490 O OH  . TYR A 196 ? 0.5073 0.5178 0.3933 -0.0703 -0.0349 -0.0403 178 TYR A OH  
1491 N N   . THR A 197 ? 0.4168 0.5177 0.4113 -0.0636 -0.0140 -0.0307 179 THR A N   
1492 C CA  . THR A 197 ? 0.4052 0.5218 0.4154 -0.0595 -0.0071 -0.0305 179 THR A CA  
1493 C C   . THR A 197 ? 0.4036 0.5022 0.4012 -0.0496 -0.0009 -0.0264 179 THR A C   
1494 O O   . THR A 197 ? 0.4040 0.4792 0.3838 -0.0520 0.0034  -0.0242 179 THR A O   
1495 C CB  . THR A 197 ? 0.4148 0.5403 0.4331 -0.0737 0.0014  -0.0335 179 THR A CB  
1496 O OG1 . THR A 197 ? 0.4223 0.5624 0.4503 -0.0839 -0.0055 -0.0376 179 THR A OG1 
1497 C CG2 . THR A 197 ? 0.4063 0.5542 0.4438 -0.0711 0.0089  -0.0353 179 THR A CG2 
1498 N N   . SER A 198 ? 0.4089 0.4147 0.4684 0.0213  0.0046  0.0749  180 SER A N   
1499 C CA  . SER A 198 ? 0.4287 0.3989 0.4700 0.0258  0.0210  0.0590  180 SER A CA  
1500 C C   . SER A 198 ? 0.4389 0.3877 0.4711 0.0238  0.0334  0.0458  180 SER A C   
1501 O O   . SER A 198 ? 0.4502 0.4017 0.5073 0.0274  0.0449  0.0551  180 SER A O   
1502 C CB  . SER A 198 ? 0.4319 0.3962 0.5015 0.0363  0.0414  0.0735  180 SER A CB  
1503 O OG  . SER A 198 ? 0.4687 0.4512 0.5423 0.0376  0.0306  0.0857  180 SER A OG  
1504 N N   . CYS A 199 ? 0.4408 0.3723 0.4398 0.0173  0.0320  0.0274  181 CYS A N   
1505 C CA  . CYS A 199 ? 0.4588 0.3763 0.4452 0.0115  0.0438  0.0174  181 CYS A CA  
1506 C C   . CYS A 199 ? 0.4628 0.3616 0.4259 0.0052  0.0591  0.0041  181 CYS A C   
1507 O O   . CYS A 199 ? 0.4353 0.3295 0.3939 0.0074  0.0592  0.0025  181 CYS A O   
1508 C CB  . CYS A 199 ? 0.4502 0.3738 0.4224 0.0053  0.0282  0.0133  181 CYS A CB  
1509 S SG  . CYS A 199 ? 0.5638 0.5080 0.5566 0.0060  0.0101  0.0214  181 CYS A SG  
1510 N N   . GLU A 200 ? 0.4725 0.3642 0.4185 -0.0059 0.0713  -0.0056 182 GLU A N   
1511 C CA  . GLU A 200 ? 0.5146 0.3935 0.4339 -0.0196 0.0879  -0.0209 182 GLU A CA  
1512 C C   . GLU A 200 ? 0.4730 0.3576 0.3683 -0.0235 0.0706  -0.0235 182 GLU A C   
1513 O O   . GLU A 200 ? 0.4841 0.3581 0.3683 -0.0281 0.0804  -0.0323 182 GLU A O   
1514 C CB  . GLU A 200 ? 0.5331 0.4150 0.4330 -0.0369 0.0995  -0.0289 182 GLU A CB  
1515 C CG  . GLU A 200 ? 0.6197 0.4894 0.4935 -0.0584 0.1267  -0.0489 182 GLU A CG  
1516 C CD  . GLU A 200 ? 0.6587 0.5453 0.5028 -0.0826 0.1301  -0.0544 182 GLU A CD  
1517 O OE1 . GLU A 200 ? 0.7154 0.6260 0.5567 -0.0816 0.1061  -0.0388 182 GLU A OE1 
1518 O OE2 . GLU A 200 ? 0.7768 0.6542 0.6014 -0.1048 0.1592  -0.0740 182 GLU A OE2 
1519 N N   . THR A 201 ? 0.4284 0.3281 0.3207 -0.0213 0.0478  -0.0154 183 THR A N   
1520 C CA  . THR A 201 ? 0.4025 0.3098 0.2769 -0.0255 0.0340  -0.0151 183 THR A CA  
1521 C C   . THR A 201 ? 0.3885 0.2978 0.2751 -0.0135 0.0179  -0.0102 183 THR A C   
1522 O O   . THR A 201 ? 0.3611 0.2758 0.2389 -0.0152 0.0083  -0.0088 183 THR A O   
1523 C CB  . THR A 201 ? 0.4161 0.3414 0.2806 -0.0359 0.0260  -0.0072 183 THR A CB  
1524 O OG1 . THR A 201 ? 0.4089 0.3388 0.2962 -0.0269 0.0177  0.0026  183 THR A OG1 
1525 C CG2 . THR A 201 ? 0.3930 0.3240 0.2356 -0.0558 0.0415  -0.0136 183 THR A CG2 
1526 N N   . GLY A 202 ? 0.3753 0.2835 0.2823 -0.0037 0.0165  -0.0069 184 GLY A N   
1527 C CA  . GLY A 202 ? 0.3786 0.2927 0.2924 0.0020  0.0036  -0.0049 184 GLY A CA  
1528 C C   . GLY A 202 ? 0.3744 0.3000 0.3106 0.0062  -0.0004 0.0025  184 GLY A C   
1529 O O   . GLY A 202 ? 0.3761 0.3027 0.3285 0.0099  0.0093  0.0097  184 GLY A O   
1530 N N   . PHE A 203 ? 0.3696 0.3057 0.3079 0.0032  -0.0126 0.0010  185 PHE A N   
1531 C CA  . PHE A 203 ? 0.3897 0.3463 0.3435 0.0006  -0.0196 0.0081  185 PHE A CA  
1532 C C   . PHE A 203 ? 0.3960 0.3573 0.3528 -0.0082 -0.0251 0.0009  185 PHE A C   
1533 O O   . PHE A 203 ? 0.4030 0.3533 0.3513 -0.0118 -0.0250 -0.0101 185 PHE A O   
1534 C CB  . PHE A 203 ? 0.3836 0.3542 0.3321 -0.0019 -0.0271 0.0104  185 PHE A CB  
1535 C CG  . PHE A 203 ? 0.4183 0.3839 0.3703 0.0070  -0.0194 0.0195  185 PHE A CG  
1536 C CD1 . PHE A 203 ? 0.4131 0.3892 0.3927 0.0139  -0.0116 0.0383  185 PHE A CD1 
1537 C CD2 . PHE A 203 ? 0.4344 0.3841 0.3677 0.0086  -0.0169 0.0107  185 PHE A CD2 
1538 C CE1 . PHE A 203 ? 0.3985 0.3651 0.3894 0.0226  0.0022  0.0467  185 PHE A CE1 
1539 C CE2 . PHE A 203 ? 0.4353 0.3772 0.3737 0.0152  -0.0060 0.0172  185 PHE A CE2 
1540 C CZ  . PHE A 203 ? 0.4308 0.3789 0.3996 0.0224  0.0054  0.0345  185 PHE A CZ  
1541 N N   A LYS A 204 ? 0.4002 0.3774 0.3738 -0.0116 -0.0270 0.0085  186 LYS A N   
1542 N N   B LYS A 204 ? 0.3997 0.3772 0.3731 -0.0121 -0.0273 0.0081  186 LYS A N   
1543 C CA  A LYS A 204 ? 0.4232 0.4084 0.4023 -0.0239 -0.0307 0.0010  186 LYS A CA  
1544 C CA  B LYS A 204 ? 0.4217 0.4041 0.4001 -0.0237 -0.0300 -0.0004 186 LYS A CA  
1545 C C   A LYS A 204 ? 0.4346 0.4485 0.4100 -0.0397 -0.0407 -0.0005 186 LYS A C   
1546 C C   B LYS A 204 ? 0.4351 0.4482 0.4132 -0.0402 -0.0400 -0.0007 186 LYS A C   
1547 O O   A LYS A 204 ? 0.4257 0.4666 0.4087 -0.0394 -0.0472 0.0166  186 LYS A O   
1548 O O   B LYS A 204 ? 0.4331 0.4747 0.4237 -0.0406 -0.0461 0.0175  186 LYS A O   
1549 C CB  A LYS A 204 ? 0.4237 0.4145 0.4221 -0.0214 -0.0276 0.0111  186 LYS A CB  
1550 C CB  B LYS A 204 ? 0.4205 0.4016 0.4158 -0.0198 -0.0250 0.0076  186 LYS A CB  
1551 C CG  A LYS A 204 ? 0.4424 0.4439 0.4503 -0.0355 -0.0303 0.0052  186 LYS A CG  
1552 C CG  B LYS A 204 ? 0.4333 0.4127 0.4378 -0.0297 -0.0238 -0.0004 186 LYS A CG  
1553 C CD  A LYS A 204 ? 0.4370 0.4437 0.4654 -0.0304 -0.0265 0.0178  186 LYS A CD  
1554 C CD  B LYS A 204 ? 0.4300 0.4120 0.4516 -0.0242 -0.0194 0.0113  186 LYS A CD  
1555 C CE  A LYS A 204 ? 0.4671 0.4878 0.5067 -0.0465 -0.0294 0.0128  186 LYS A CE  
1556 C CE  B LYS A 204 ? 0.4335 0.4295 0.4705 -0.0371 -0.0217 0.0093  186 LYS A CE  
1557 N NZ  A LYS A 204 ? 0.4743 0.5297 0.5110 -0.0658 -0.0406 0.0124  186 LYS A NZ  
1558 N NZ  B LYS A 204 ? 0.4355 0.4126 0.4755 -0.0438 -0.0149 -0.0042 186 LYS A NZ  
1559 N N   . ASP A 205 ? 0.4533 0.4635 0.4190 -0.0554 -0.0395 -0.0199 187 ASP A N   
1560 C CA  . ASP A 205 ? 0.4806 0.5227 0.4379 -0.0800 -0.0469 -0.0268 187 ASP A CA  
1561 C C   . ASP A 205 ? 0.5019 0.5419 0.4644 -0.0991 -0.0404 -0.0441 187 ASP A C   
1562 O O   . ASP A 205 ? 0.5243 0.5450 0.4796 -0.1113 -0.0289 -0.0679 187 ASP A O   
1563 C CB  . ASP A 205 ? 0.4957 0.5342 0.4312 -0.0874 -0.0460 -0.0408 187 ASP A CB  
1564 C CG  . ASP A 205 ? 0.5308 0.6030 0.4500 -0.1206 -0.0504 -0.0543 187 ASP A CG  
1565 O OD1 . ASP A 205 ? 0.5615 0.6727 0.4844 -0.1399 -0.0595 -0.0465 187 ASP A OD1 
1566 O OD2 . ASP A 205 ? 0.6126 0.6753 0.5139 -0.1301 -0.0441 -0.0728 187 ASP A OD2 
1567 N N   . GLY A 206 ? 0.5070 0.5645 0.4859 -0.1016 -0.0445 -0.0321 188 GLY A N   
1568 C CA  . GLY A 206 ? 0.5219 0.5724 0.5097 -0.1172 -0.0362 -0.0474 188 GLY A CA  
1569 C C   . GLY A 206 ? 0.5226 0.5276 0.5226 -0.1012 -0.0203 -0.0554 188 GLY A C   
1570 O O   . GLY A 206 ? 0.5030 0.4963 0.5139 -0.0795 -0.0204 -0.0390 188 GLY A O   
1571 N N   . ASP A 207 ? 0.5449 0.5272 0.5455 -0.1143 -0.0046 -0.0795 189 ASP A N   
1572 C CA  . ASP A 207 ? 0.5436 0.4869 0.5648 -0.1006 0.0133  -0.0828 189 ASP A CA  
1573 C C   . ASP A 207 ? 0.5289 0.4519 0.5460 -0.0844 0.0180  -0.0807 189 ASP A C   
1574 O O   . ASP A 207 ? 0.5365 0.4331 0.5752 -0.0766 0.0344  -0.0815 189 ASP A O   
1575 C CB  . ASP A 207 ? 0.5763 0.5027 0.6118 -0.1232 0.0349  -0.1084 189 ASP A CB  
1576 C CG  . ASP A 207 ? 0.6011 0.5370 0.6508 -0.1350 0.0357  -0.1083 189 ASP A CG  
1577 O OD1 . ASP A 207 ? 0.6029 0.5452 0.6631 -0.1174 0.0258  -0.0852 189 ASP A OD1 
1578 O OD2 . ASP A 207 ? 0.6649 0.6013 0.7149 -0.1646 0.0489  -0.1337 189 ASP A OD2 
1579 N N   . LEU A 208 ? 0.5019 0.4394 0.4962 -0.0801 0.0048  -0.0756 190 LEU A N   
1580 C CA  . LEU A 208 ? 0.4750 0.3973 0.4642 -0.0655 0.0072  -0.0720 190 LEU A CA  
1581 C C   . LEU A 208 ? 0.4496 0.3794 0.4305 -0.0464 -0.0058 -0.0503 190 LEU A C   
1582 O O   . LEU A 208 ? 0.4504 0.4010 0.4226 -0.0469 -0.0171 -0.0421 190 LEU A O   
1583 C CB  . LEU A 208 ? 0.4851 0.4136 0.4543 -0.0798 0.0079  -0.0892 190 LEU A CB  
1584 C CG  . LEU A 208 ? 0.5227 0.4390 0.4959 -0.1033 0.0278  -0.1178 190 LEU A CG  
1585 C CD1 . LEU A 208 ? 0.5347 0.4708 0.4785 -0.1226 0.0230  -0.1325 190 LEU A CD1 
1586 C CD2 . LEU A 208 ? 0.5271 0.4080 0.5277 -0.0920 0.0505  -0.1210 190 LEU A CD2 
1587 N N   . PHE A 209 ? 0.4266 0.3422 0.4133 -0.0317 -0.0019 -0.0395 191 PHE A N   
1588 C CA  . PHE A 209 ? 0.4026 0.3237 0.3767 -0.0197 -0.0098 -0.0250 191 PHE A CA  
1589 C C   . PHE A 209 ? 0.4133 0.3289 0.3748 -0.0144 -0.0103 -0.0248 191 PHE A C   
1590 O O   . PHE A 209 ? 0.4087 0.3152 0.3812 -0.0115 -0.0036 -0.0221 191 PHE A O   
1591 C CB  . PHE A 209 ? 0.3901 0.3092 0.3747 -0.0129 -0.0069 -0.0109 191 PHE A CB  
1592 C CG  . PHE A 209 ? 0.3930 0.3163 0.3608 -0.0069 -0.0098 -0.0019 191 PHE A CG  
1593 C CD1 . PHE A 209 ? 0.4109 0.3403 0.3736 -0.0058 -0.0109 -0.0004 191 PHE A CD1 
1594 C CD2 . PHE A 209 ? 0.3755 0.2982 0.3356 -0.0047 -0.0088 0.0055  191 PHE A CD2 
1595 C CE1 . PHE A 209 ? 0.4308 0.3584 0.3801 -0.0031 -0.0063 0.0031  191 PHE A CE1 
1596 C CE2 . PHE A 209 ? 0.4003 0.3268 0.3409 -0.0056 -0.0081 0.0086  191 PHE A CE2 
1597 C CZ  . PHE A 209 ? 0.4105 0.3358 0.3453 -0.0051 -0.0046 0.0048  191 PHE A CZ  
1598 N N   . MET A 210 ? 0.4052 0.3282 0.3487 -0.0128 -0.0172 -0.0246 192 MET A N   
1599 C CA  . MET A 210 ? 0.4307 0.3495 0.3613 -0.0085 -0.0180 -0.0242 192 MET A CA  
1600 C C   . MET A 210 ? 0.3916 0.3109 0.3116 -0.0029 -0.0183 -0.0148 192 MET A C   
1601 O O   . MET A 210 ? 0.3779 0.3009 0.2941 -0.0013 -0.0183 -0.0125 192 MET A O   
1602 C CB  . MET A 210 ? 0.4188 0.3452 0.3374 -0.0135 -0.0227 -0.0323 192 MET A CB  
1603 C CG  . MET A 210 ? 0.4765 0.3980 0.3823 -0.0096 -0.0230 -0.0329 192 MET A CG  
1604 S SD  . MET A 210 ? 0.5808 0.5180 0.4722 -0.0141 -0.0303 -0.0346 192 MET A SD  
1605 C CE  . MET A 210 ? 0.5574 0.5105 0.4591 -0.0113 -0.0341 -0.0197 192 MET A CE  
1606 N N   . SER A 211 ? 0.3664 0.2840 0.2845 -0.0021 -0.0160 -0.0081 193 SER A N   
1607 C CA  . SER A 211 ? 0.3565 0.2768 0.2589 -0.0043 -0.0138 -0.0035 193 SER A CA  
1608 C C   . SER A 211 ? 0.3525 0.2696 0.2385 -0.0042 -0.0144 -0.0089 193 SER A C   
1609 O O   . SER A 211 ? 0.3328 0.2486 0.2196 -0.0019 -0.0182 -0.0124 193 SER A O   
1610 C CB  . SER A 211 ? 0.3555 0.2865 0.2609 -0.0089 -0.0135 0.0094  193 SER A CB  
1611 O OG  . SER A 211 ? 0.3580 0.2931 0.2687 -0.0076 -0.0161 0.0152  193 SER A OG  
1612 N N   . TYR A 212 ? 0.3521 0.2663 0.2244 -0.0079 -0.0075 -0.0113 194 TYR A N   
1613 C CA  . TYR A 212 ? 0.3595 0.2688 0.2182 -0.0090 -0.0053 -0.0163 194 TYR A CA  
1614 C C   . TYR A 212 ? 0.3531 0.2708 0.2030 -0.0138 -0.0112 -0.0127 194 TYR A C   
1615 O O   . TYR A 212 ? 0.3524 0.2678 0.1970 -0.0118 -0.0137 -0.0156 194 TYR A O   
1616 C CB  . TYR A 212 ? 0.3725 0.2731 0.2211 -0.0155 0.0098  -0.0223 194 TYR A CB  
1617 C CG  . TYR A 212 ? 0.3886 0.2812 0.2555 -0.0080 0.0194  -0.0213 194 TYR A CG  
1618 C CD1 . TYR A 212 ? 0.3901 0.2839 0.2726 0.0020  0.0163  -0.0155 194 TYR A CD1 
1619 C CD2 . TYR A 212 ? 0.4009 0.2892 0.2721 -0.0121 0.0324  -0.0229 194 TYR A CD2 
1620 C CE1 . TYR A 212 ? 0.4140 0.3081 0.3214 0.0091  0.0253  -0.0068 194 TYR A CE1 
1621 C CE2 . TYR A 212 ? 0.4287 0.3114 0.3243 -0.0038 0.0438  -0.0180 194 TYR A CE2 
1622 C CZ  . TYR A 212 ? 0.3989 0.2863 0.3151 0.0074  0.0395  -0.0077 194 TYR A CZ  
1623 O OH  . TYR A 212 ? 0.4508 0.3399 0.3987 0.0158  0.0505  0.0045  194 TYR A OH  
1624 N N   . ARG A 213 ? 0.3535 0.2848 0.2057 -0.0200 -0.0134 -0.0026 195 ARG A N   
1625 C CA  . ARG A 213 ? 0.3605 0.3079 0.2140 -0.0240 -0.0191 0.0093  195 ARG A CA  
1626 C C   . ARG A 213 ? 0.3495 0.2921 0.2244 -0.0127 -0.0224 0.0120  195 ARG A C   
1627 O O   . ARG A 213 ? 0.3499 0.2971 0.2234 -0.0127 -0.0244 0.0150  195 ARG A O   
1628 C CB  . ARG A 213 ? 0.3703 0.3426 0.2291 -0.0337 -0.0214 0.0279  195 ARG A CB  
1629 C CG  . ARG A 213 ? 0.4164 0.4146 0.2707 -0.0436 -0.0271 0.0431  195 ARG A CG  
1630 C CD  . ARG A 213 ? 0.5738 0.6055 0.4500 -0.0484 -0.0322 0.0734  195 ARG A CD  
1631 N NE  . ARG A 213 ? 0.6945 0.7636 0.5629 -0.0643 -0.0392 0.0927  195 ARG A NE  
1632 C CZ  . ARG A 213 ? 0.7361 0.8095 0.6113 -0.0606 -0.0424 0.0979  195 ARG A CZ  
1633 N NH1 . ARG A 213 ? 0.6942 0.7351 0.5816 -0.0420 -0.0382 0.0831  195 ARG A NH1 
1634 N NH2 . ARG A 213 ? 0.7610 0.8768 0.6297 -0.0787 -0.0501 0.1192  195 ARG A NH2 
1635 N N   . SER A 214 ? 0.3511 0.2849 0.2461 -0.0056 -0.0204 0.0099  196 SER A N   
1636 C CA  . SER A 214 ? 0.3602 0.2860 0.2740 0.0005  -0.0173 0.0064  196 SER A CA  
1637 C C   . SER A 214 ? 0.3630 0.2792 0.2599 0.0011  -0.0188 -0.0101 196 SER A C   
1638 O O   . SER A 214 ? 0.3548 0.2683 0.2558 0.0025  -0.0164 -0.0132 196 SER A O   
1639 C CB  . SER A 214 ? 0.3615 0.2802 0.3012 0.0029  -0.0108 0.0059  196 SER A CB  
1640 O OG  . SER A 214 ? 0.4097 0.3216 0.3392 0.0007  -0.0124 -0.0082 196 SER A OG  
1641 N N   . MET A 215 ? 0.3552 0.2694 0.2369 -0.0001 -0.0215 -0.0171 197 MET A N   
1642 C CA  . MET A 215 ? 0.3844 0.2970 0.2538 0.0002  -0.0238 -0.0251 197 MET A CA  
1643 C C   . MET A 215 ? 0.3692 0.2820 0.2260 0.0000  -0.0243 -0.0235 197 MET A C   
1644 O O   . MET A 215 ? 0.3731 0.2854 0.2265 0.0005  -0.0252 -0.0281 197 MET A O   
1645 C CB  . MET A 215 ? 0.3639 0.2782 0.2301 0.0009  -0.0240 -0.0242 197 MET A CB  
1646 C CG  . MET A 215 ? 0.4079 0.3299 0.2719 0.0008  -0.0277 -0.0250 197 MET A CG  
1647 S SD  . MET A 215 ? 0.4603 0.3853 0.3327 0.0055  -0.0229 -0.0140 197 MET A SD  
1648 C CE  . MET A 215 ? 0.4570 0.3652 0.3162 0.0058  -0.0128 -0.0175 197 MET A CE  
1649 N N   . PHE A 216 ? 0.3591 0.2746 0.2071 -0.0039 -0.0228 -0.0180 198 PHE A N   
1650 C CA  . PHE A 216 ? 0.3474 0.2660 0.1821 -0.0082 -0.0229 -0.0170 198 PHE A CA  
1651 C C   . PHE A 216 ? 0.3535 0.2802 0.2000 -0.0063 -0.0257 -0.0095 198 PHE A C   
1652 O O   . PHE A 216 ? 0.3500 0.2769 0.1908 -0.0060 -0.0264 -0.0112 198 PHE A O   
1653 C CB  . PHE A 216 ? 0.3521 0.2774 0.1724 -0.0201 -0.0192 -0.0145 198 PHE A CB  
1654 C CG  . PHE A 216 ? 0.3543 0.2926 0.1622 -0.0304 -0.0211 -0.0101 198 PHE A CG  
1655 C CD1 . PHE A 216 ? 0.3588 0.2884 0.1514 -0.0344 -0.0164 -0.0197 198 PHE A CD1 
1656 C CD2 . PHE A 216 ? 0.3545 0.3174 0.1707 -0.0363 -0.0273 0.0072  198 PHE A CD2 
1657 C CE1 . PHE A 216 ? 0.3439 0.2876 0.1248 -0.0460 -0.0186 -0.0162 198 PHE A CE1 
1658 C CE2 . PHE A 216 ? 0.3211 0.3037 0.1284 -0.0476 -0.0309 0.0153  198 PHE A CE2 
1659 C CZ  . PHE A 216 ? 0.3327 0.3048 0.1200 -0.0531 -0.0269 0.0016  198 PHE A CZ  
1660 N N   . GLN A 217 ? 0.3472 0.2809 0.2149 -0.0045 -0.0249 0.0013  199 GLN A N   
1661 C CA  . GLN A 217 ? 0.3688 0.3092 0.2605 -0.0005 -0.0222 0.0128  199 GLN A CA  
1662 C C   . GLN A 217 ? 0.3624 0.2868 0.2607 0.0049  -0.0158 -0.0021 199 GLN A C   
1663 O O   . GLN A 217 ? 0.3695 0.2955 0.2751 0.0069  -0.0125 0.0006  199 GLN A O   
1664 C CB  . GLN A 217 ? 0.3728 0.3233 0.2965 0.0020  -0.0185 0.0313  199 GLN A CB  
1665 C CG  . GLN A 217 ? 0.4171 0.3844 0.3739 0.0056  -0.0144 0.0552  199 GLN A CG  
1666 C CD  . GLN A 217 ? 0.4684 0.4641 0.4080 -0.0045 -0.0248 0.0705  199 GLN A CD  
1667 O OE1 . GLN A 217 ? 0.5061 0.5236 0.4289 -0.0170 -0.0326 0.0802  199 GLN A OE1 
1668 N NE2 . GLN A 217 ? 0.4435 0.4401 0.3843 -0.0025 -0.0239 0.0703  199 GLN A NE2 
1669 N N   . ASP A 218 ? 0.3699 0.2827 0.2645 0.0044  -0.0137 -0.0173 200 ASP A N   
1670 C CA  . ASP A 218 ? 0.3803 0.2844 0.2719 0.0020  -0.0081 -0.0342 200 ASP A CA  
1671 C C   . ASP A 218 ? 0.3733 0.2812 0.2423 0.0011  -0.0140 -0.0374 200 ASP A C   
1672 O O   . ASP A 218 ? 0.3922 0.2977 0.2633 0.0003  -0.0082 -0.0431 200 ASP A O   
1673 C CB  . ASP A 218 ? 0.3871 0.2893 0.2727 -0.0042 -0.0086 -0.0473 200 ASP A CB  
1674 C CG  . ASP A 218 ? 0.4287 0.3230 0.3391 -0.0059 0.0018  -0.0498 200 ASP A CG  
1675 O OD1 . ASP A 218 ? 0.4671 0.3543 0.4049 -0.0016 0.0138  -0.0436 200 ASP A OD1 
1676 O OD2 . ASP A 218 ? 0.4783 0.3747 0.3848 -0.0116 -0.0007 -0.0563 200 ASP A OD2 
1677 N N   . VAL A 219 ? 0.3623 0.2744 0.2133 0.0010  -0.0221 -0.0335 201 VAL A N   
1678 C CA  . VAL A 219 ? 0.3602 0.2741 0.1947 0.0005  -0.0251 -0.0351 201 VAL A CA  
1679 C C   . VAL A 219 ? 0.3707 0.2872 0.2073 0.0011  -0.0237 -0.0291 201 VAL A C   
1680 O O   . VAL A 219 ? 0.3758 0.2922 0.2096 0.0013  -0.0218 -0.0332 201 VAL A O   
1681 C CB  . VAL A 219 ? 0.3640 0.2772 0.1877 0.0004  -0.0272 -0.0317 201 VAL A CB  
1682 C CG1 . VAL A 219 ? 0.3685 0.2812 0.1812 0.0002  -0.0266 -0.0312 201 VAL A CG1 
1683 C CG2 . VAL A 219 ? 0.3395 0.2560 0.1676 0.0009  -0.0287 -0.0321 201 VAL A CG2 
1684 N N   . ARG A 220 ? 0.3609 0.2846 0.2027 -0.0005 -0.0249 -0.0175 202 ARG A N   
1685 C CA  . ARG A 220 ? 0.3720 0.3084 0.2198 -0.0026 -0.0257 -0.0052 202 ARG A CA  
1686 C C   . ARG A 220 ? 0.3703 0.3051 0.2441 0.0041  -0.0178 -0.0025 202 ARG A C   
1687 O O   . ARG A 220 ? 0.3931 0.3313 0.2676 0.0046  -0.0163 -0.0007 202 ARG A O   
1688 C CB  . ARG A 220 ? 0.3658 0.3196 0.2180 -0.0093 -0.0292 0.0105  202 ARG A CB  
1689 C CG  . ARG A 220 ? 0.4080 0.3866 0.2572 -0.0194 -0.0338 0.0262  202 ARG A CG  
1690 C CD  . ARG A 220 ? 0.4119 0.3900 0.2273 -0.0331 -0.0351 0.0151  202 ARG A CD  
1691 N NE  . ARG A 220 ? 0.3895 0.3525 0.1969 -0.0280 -0.0327 0.0034  202 ARG A NE  
1692 C CZ  . ARG A 220 ? 0.3995 0.3706 0.2161 -0.0252 -0.0339 0.0104  202 ARG A CZ  
1693 N NH1 . ARG A 220 ? 0.3919 0.3872 0.2313 -0.0259 -0.0366 0.0317  202 ARG A NH1 
1694 N NH2 . ARG A 220 ? 0.3676 0.3253 0.1749 -0.0215 -0.0315 -0.0006 202 ARG A NH2 
1695 N N   . ASP A 221 ? 0.3724 0.2998 0.2694 0.0082  -0.0096 -0.0037 203 ASP A N   
1696 C CA  . ASP A 221 ? 0.3643 0.2839 0.2921 0.0129  0.0060  -0.0047 203 ASP A CA  
1697 C C   . ASP A 221 ? 0.3700 0.2778 0.2807 0.0095  0.0117  -0.0267 203 ASP A C   
1698 O O   . ASP A 221 ? 0.3751 0.2802 0.3019 0.0116  0.0233  -0.0267 203 ASP A O   
1699 C CB  . ASP A 221 ? 0.3676 0.2762 0.3216 0.0147  0.0178  -0.0074 203 ASP A CB  
1700 C CG  . ASP A 221 ? 0.3905 0.3145 0.3747 0.0192  0.0166  0.0208  203 ASP A CG  
1701 O OD1 . ASP A 221 ? 0.3946 0.3432 0.3839 0.0191  0.0078  0.0455  203 ASP A OD1 
1702 O OD2 . ASP A 221 ? 0.3886 0.3034 0.3919 0.0205  0.0249  0.0193  203 ASP A OD2 
1703 N N   . ALA A 222 ? 0.3595 0.2645 0.2410 0.0034  0.0042  -0.0420 204 ALA A N   
1704 C CA  . ALA A 222 ? 0.3852 0.2890 0.2461 -0.0040 0.0059  -0.0592 204 ALA A CA  
1705 C C   . ALA A 222 ? 0.3782 0.2885 0.2255 -0.0020 0.0001  -0.0535 204 ALA A C   
1706 O O   . ALA A 222 ? 0.3963 0.3055 0.2406 -0.0058 0.0079  -0.0628 204 ALA A O   
1707 C CB  . ALA A 222 ? 0.3727 0.2830 0.2121 -0.0115 -0.0035 -0.0670 204 ALA A CB  
1708 N N   . VAL A 223 ? 0.3689 0.2854 0.2078 0.0014  -0.0111 -0.0404 205 VAL A N   
1709 C CA  . VAL A 223 ? 0.3661 0.2878 0.1943 0.0015  -0.0148 -0.0351 205 VAL A CA  
1710 C C   . VAL A 223 ? 0.3706 0.2961 0.2209 0.0046  -0.0070 -0.0270 205 VAL A C   
1711 O O   . VAL A 223 ? 0.3802 0.3057 0.2283 0.0043  -0.0025 -0.0309 205 VAL A O   
1712 C CB  . VAL A 223 ? 0.3695 0.2949 0.1847 -0.0007 -0.0230 -0.0268 205 VAL A CB  
1713 C CG1 . VAL A 223 ? 0.3583 0.2884 0.1638 -0.0037 -0.0244 -0.0232 205 VAL A CG1 
1714 C CG2 . VAL A 223 ? 0.3258 0.2459 0.1290 -0.0013 -0.0256 -0.0321 205 VAL A CG2 
1715 N N   . ASP A 224 ? 0.3663 0.2976 0.2421 0.0079  -0.0044 -0.0126 206 ASP A N   
1716 C CA  . ASP A 224 ? 0.3606 0.3011 0.2702 0.0128  0.0046  0.0037  206 ASP A CA  
1717 C C   . ASP A 224 ? 0.3714 0.2960 0.2975 0.0155  0.0241  -0.0107 206 ASP A C   
1718 O O   . ASP A 224 ? 0.3698 0.2978 0.3080 0.0178  0.0315  -0.0061 206 ASP A O   
1719 C CB  . ASP A 224 ? 0.3582 0.3104 0.3014 0.0164  0.0067  0.0257  206 ASP A CB  
1720 C CG  . ASP A 224 ? 0.3658 0.3442 0.2964 0.0087  -0.0101 0.0450  206 ASP A CG  
1721 O OD1 . ASP A 224 ? 0.3808 0.3678 0.2824 0.0000  -0.0201 0.0425  206 ASP A OD1 
1722 O OD2 . ASP A 224 ? 0.3629 0.3543 0.3134 0.0088  -0.0112 0.0622  206 ASP A OD2 
1723 N N   . TRP A 225 ? 0.3755 0.2838 0.3020 0.0126  0.0342  -0.0292 207 TRP A N   
1724 C CA  . TRP A 225 ? 0.4021 0.2938 0.3373 0.0078  0.0566  -0.0509 207 TRP A CA  
1725 C C   . TRP A 225 ? 0.4230 0.3174 0.3260 0.0002  0.0538  -0.0655 207 TRP A C   
1726 O O   . TRP A 225 ? 0.4338 0.3227 0.3510 -0.0004 0.0714  -0.0713 207 TRP A O   
1727 C CB  . TRP A 225 ? 0.4007 0.2798 0.3312 -0.0007 0.0639  -0.0705 207 TRP A CB  
1728 C CG  . TRP A 225 ? 0.4428 0.3049 0.3809 -0.0123 0.0915  -0.0975 207 TRP A CG  
1729 C CD1 . TRP A 225 ? 0.4691 0.3116 0.4515 -0.0107 0.1223  -0.1022 207 TRP A CD1 
1730 C CD2 . TRP A 225 ? 0.4659 0.3303 0.3673 -0.0306 0.0945  -0.1240 207 TRP A CD2 
1731 N NE1 . TRP A 225 ? 0.5154 0.3431 0.4886 -0.0289 0.1477  -0.1357 207 TRP A NE1 
1732 C CE2 . TRP A 225 ? 0.4916 0.3361 0.4119 -0.0428 0.1291  -0.1491 207 TRP A CE2 
1733 C CE3 . TRP A 225 ? 0.4525 0.3365 0.3098 -0.0393 0.0732  -0.1270 207 TRP A CE3 
1734 C CZ2 . TRP A 225 ? 0.5330 0.3795 0.4216 -0.0677 0.1415  -0.1803 207 TRP A CZ2 
1735 C CZ3 . TRP A 225 ? 0.4758 0.3663 0.3058 -0.0614 0.0828  -0.1519 207 TRP A CZ3 
1736 C CH2 . TRP A 225 ? 0.5035 0.3769 0.3454 -0.0772 0.1156  -0.1795 207 TRP A CH2 
1737 N N   . VAL A 226 ? 0.4245 0.3286 0.2897 -0.0048 0.0338  -0.0683 208 VAL A N   
1738 C CA  . VAL A 226 ? 0.4345 0.3461 0.2715 -0.0118 0.0292  -0.0762 208 VAL A CA  
1739 C C   . VAL A 226 ? 0.4351 0.3506 0.2811 -0.0052 0.0307  -0.0645 208 VAL A C   
1740 O O   . VAL A 226 ? 0.4358 0.3513 0.2757 -0.0104 0.0404  -0.0745 208 VAL A O   
1741 C CB  . VAL A 226 ? 0.4386 0.3619 0.2465 -0.0147 0.0091  -0.0720 208 VAL A CB  
1742 C CG1 . VAL A 226 ? 0.4367 0.3710 0.2245 -0.0184 0.0037  -0.0705 208 VAL A CG1 
1743 C CG2 . VAL A 226 ? 0.4419 0.3696 0.2387 -0.0257 0.0083  -0.0841 208 VAL A CG2 
1744 N N   . HIS A 227 ? 0.4158 0.3379 0.2749 0.0032  0.0213  -0.0437 209 HIS A N   
1745 C CA  . HIS A 227 ? 0.4096 0.3417 0.2825 0.0076  0.0213  -0.0278 209 HIS A CA  
1746 C C   . HIS A 227 ? 0.4199 0.3495 0.3348 0.0136  0.0422  -0.0214 209 HIS A C   
1747 O O   . HIS A 227 ? 0.4162 0.3504 0.3398 0.0151  0.0488  -0.0173 209 HIS A O   
1748 C CB  . HIS A 227 ? 0.3918 0.3388 0.2645 0.0080  0.0056  -0.0076 209 HIS A CB  
1749 C CG  . HIS A 227 ? 0.4227 0.3710 0.2609 0.0018  -0.0078 -0.0118 209 HIS A CG  
1750 N ND1 . HIS A 227 ? 0.4420 0.3822 0.2603 -0.0005 -0.0137 -0.0208 209 HIS A ND1 
1751 C CD2 . HIS A 227 ? 0.4111 0.3662 0.2364 -0.0024 -0.0127 -0.0080 209 HIS A CD2 
1752 C CE1 . HIS A 227 ? 0.4006 0.3405 0.1993 -0.0047 -0.0193 -0.0212 209 HIS A CE1 
1753 N NE2 . HIS A 227 ? 0.4415 0.3893 0.2422 -0.0067 -0.0187 -0.0152 209 HIS A NE2 
1754 N N   . TYR A 228 ? 0.4243 0.3462 0.3706 0.0178  0.0550  -0.0187 210 TYR A N   
1755 C CA  . TYR A 228 ? 0.4540 0.3734 0.4544 0.0262  0.0789  -0.0055 210 TYR A CA  
1756 C C   . TYR A 228 ? 0.4786 0.3714 0.4905 0.0215  0.1108  -0.0341 210 TYR A C   
1757 O O   . TYR A 228 ? 0.4831 0.3709 0.5239 0.0248  0.1330  -0.0331 210 TYR A O   
1758 C CB  . TYR A 228 ? 0.4613 0.3915 0.5007 0.0340  0.0777  0.0217  210 TYR A CB  
1759 C CG  . TYR A 228 ? 0.5112 0.4471 0.6201 0.0457  0.1015  0.0485  210 TYR A CG  
1760 C CD1 . TYR A 228 ? 0.5484 0.5009 0.6815 0.0505  0.1061  0.0679  210 TYR A CD1 
1761 C CD2 . TYR A 228 ? 0.5627 0.4888 0.7206 0.0528  0.1214  0.0584  210 TYR A CD2 
1762 C CE1 . TYR A 228 ? 0.5475 0.5084 0.7555 0.0632  0.1308  0.0987  210 TYR A CE1 
1763 C CE2 . TYR A 228 ? 0.5769 0.5089 0.8117 0.0659  0.1478  0.0893  210 TYR A CE2 
1764 C CZ  . TYR A 228 ? 0.5671 0.5177 0.8279 0.0714  0.1523  0.1106  210 TYR A CZ  
1765 O OH  . TYR A 228 ? 0.5720 0.5319 0.9171 0.0859  0.1799  0.1467  210 TYR A OH  
1766 N N   . LYS A 229 ? 0.4965 0.3740 0.4857 0.0109  0.1149  -0.0605 211 LYS A N   
1767 C CA  . LYS A 229 ? 0.5368 0.3907 0.5347 -0.0004 0.1482  -0.0914 211 LYS A CA  
1768 C C   . LYS A 229 ? 0.5514 0.4080 0.4909 -0.0214 0.1408  -0.1226 211 LYS A C   
1769 O O   . LYS A 229 ? 0.5942 0.4379 0.5279 -0.0383 0.1669  -0.1522 211 LYS A O   
1770 C CB  . LYS A 229 ? 0.5583 0.3949 0.5887 0.0002  0.1663  -0.0953 211 LYS A CB  
1771 C CG  . LYS A 229 ? 0.6080 0.4422 0.7111 0.0193  0.1844  -0.0628 211 LYS A CG  
1772 C CD  . LYS A 229 ? 0.6304 0.4654 0.7473 0.0236  0.1758  -0.0505 211 LYS A CD  
1773 C CE  . LYS A 229 ? 0.6824 0.5038 0.8781 0.0360  0.2095  -0.0309 211 LYS A CE  
1774 N NZ  . LYS A 229 ? 0.6589 0.4827 0.8632 0.0385  0.1991  -0.0195 211 LYS A NZ  
1775 N N   . GLY A 230 ? 0.5269 0.4028 0.4253 -0.0227 0.1073  -0.1149 212 GLY A N   
1776 C CA  . GLY A 230 ? 0.5298 0.4179 0.3795 -0.0419 0.0973  -0.1346 212 GLY A CA  
1777 C C   . GLY A 230 ? 0.5352 0.4349 0.3629 -0.0477 0.0957  -0.1373 212 GLY A C   
1778 O O   . GLY A 230 ? 0.5360 0.4283 0.3866 -0.0402 0.1108  -0.1332 212 GLY A O   
1779 N N   . SER A 231 ? 0.5350 0.4564 0.3224 -0.0603 0.0773  -0.1399 213 SER A N   
1780 C CA  . SER A 231 ? 0.5501 0.4859 0.3149 -0.0700 0.0780  -0.1440 213 SER A CA  
1781 C C   . SER A 231 ? 0.5153 0.4665 0.2689 -0.0580 0.0525  -0.1185 213 SER A C   
1782 O O   . SER A 231 ? 0.5135 0.4814 0.2463 -0.0668 0.0495  -0.1182 213 SER A O   
1783 C CB  . SER A 231 ? 0.5870 0.5425 0.3161 -0.1008 0.0835  -0.1673 213 SER A CB  
1784 O OG  . SER A 231 ? 0.6183 0.6003 0.3254 -0.1062 0.0573  -0.1540 213 SER A OG  
1785 N N   . LEU A 232 ? 0.4792 0.4252 0.2464 -0.0407 0.0370  -0.0986 214 LEU A N   
1786 C CA  . LEU A 232 ? 0.4529 0.4073 0.2132 -0.0314 0.0190  -0.0782 214 LEU A CA  
1787 C C   . LEU A 232 ? 0.4535 0.4087 0.2175 -0.0282 0.0246  -0.0740 214 LEU A C   
1788 O O   . LEU A 232 ? 0.4462 0.4142 0.1935 -0.0316 0.0170  -0.0674 214 LEU A O   
1789 C CB  . LEU A 232 ? 0.4363 0.3823 0.2104 -0.0186 0.0084  -0.0637 214 LEU A CB  
1790 C CG  . LEU A 232 ? 0.4189 0.3679 0.1878 -0.0126 -0.0043 -0.0475 214 LEU A CG  
1791 C CD1 . LEU A 232 ? 0.4181 0.3793 0.1705 -0.0170 -0.0124 -0.0421 214 LEU A CD1 
1792 C CD2 . LEU A 232 ? 0.3916 0.3334 0.1701 -0.0069 -0.0101 -0.0397 214 LEU A CD2 
1793 N N   . LYS A 233 ? 0.4480 0.3917 0.2387 -0.0210 0.0382  -0.0738 215 LYS A N   
1794 C CA  . LYS A 233 ? 0.4445 0.3908 0.2443 -0.0176 0.0447  -0.0678 215 LYS A CA  
1795 C C   . LYS A 233 ? 0.4685 0.4205 0.2502 -0.0307 0.0575  -0.0842 215 LYS A C   
1796 O O   . LYS A 233 ? 0.4603 0.4223 0.2304 -0.0317 0.0524  -0.0776 215 LYS A O   
1797 C CB  . LYS A 233 ? 0.4388 0.3783 0.2800 -0.0067 0.0574  -0.0574 215 LYS A CB  
1798 C CG  . LYS A 233 ? 0.4025 0.3488 0.2563 0.0016  0.0406  -0.0351 215 LYS A CG  
1799 C CD  . LYS A 233 ? 0.4122 0.3645 0.3126 0.0107  0.0511  -0.0155 215 LYS A CD  
1800 C CE  . LYS A 233 ? 0.3908 0.3608 0.2976 0.0122  0.0326  0.0082  215 LYS A CE  
1801 N NZ  . LYS A 233 ? 0.4146 0.3778 0.3040 0.0098  0.0224  0.0018  215 LYS A NZ  
1802 N N   . GLU A 234 ? 0.4935 0.4401 0.2710 -0.0437 0.0753  -0.1069 216 GLU A N   
1803 C CA  . GLU A 234 ? 0.5457 0.5018 0.2999 -0.0634 0.0899  -0.1268 216 GLU A CA  
1804 C C   . GLU A 234 ? 0.5280 0.5130 0.2445 -0.0744 0.0675  -0.1182 216 GLU A C   
1805 O O   . GLU A 234 ? 0.5244 0.5243 0.2254 -0.0825 0.0690  -0.1175 216 GLU A O   
1806 C CB  . GLU A 234 ? 0.5663 0.5116 0.3199 -0.0819 0.1161  -0.1573 216 GLU A CB  
1807 C CG  . GLU A 234 ? 0.6677 0.6358 0.3788 -0.1131 0.1222  -0.1790 216 GLU A CG  
1808 C CD  . GLU A 234 ? 0.7166 0.6801 0.4162 -0.1396 0.1444  -0.2120 216 GLU A CD  
1809 O OE1 . GLU A 234 ? 0.8141 0.7984 0.4890 -0.1541 0.1275  -0.2128 216 GLU A OE1 
1810 O OE2 . GLU A 234 ? 0.8318 0.7716 0.5489 -0.1479 0.1816  -0.2375 216 GLU A OE2 
1811 N N   A LYS A 235 ? 0.5122 0.5066 0.2198 -0.0736 0.0481  -0.1081 217 LYS A N   
1812 N N   B LYS A 235 ? 0.5121 0.5069 0.2194 -0.0738 0.0479  -0.1080 217 LYS A N   
1813 C CA  A LYS A 235 ? 0.5066 0.5320 0.1904 -0.0821 0.0285  -0.0926 217 LYS A CA  
1814 C CA  B LYS A 235 ? 0.5057 0.5320 0.1886 -0.0828 0.0288  -0.0928 217 LYS A CA  
1815 C C   A LYS A 235 ? 0.4849 0.5117 0.1760 -0.0667 0.0165  -0.0685 217 LYS A C   
1816 C C   B LYS A 235 ? 0.4837 0.5112 0.1750 -0.0661 0.0146  -0.0667 217 LYS A C   
1817 O O   A LYS A 235 ? 0.4962 0.5476 0.1736 -0.0742 0.0100  -0.0564 217 LYS A O   
1818 O O   B LYS A 235 ? 0.4943 0.5472 0.1736 -0.0719 0.0049  -0.0511 217 LYS A O   
1819 C CB  A LYS A 235 ? 0.4935 0.5279 0.1751 -0.0835 0.0146  -0.0856 217 LYS A CB  
1820 C CB  B LYS A 235 ? 0.5022 0.5427 0.1774 -0.0904 0.0169  -0.0900 217 LYS A CB  
1821 C CG  A LYS A 235 ? 0.5290 0.5716 0.1959 -0.1068 0.0255  -0.1101 217 LYS A CG  
1822 C CG  B LYS A 235 ? 0.5291 0.5869 0.1812 -0.1205 0.0290  -0.1155 217 LYS A CG  
1823 C CD  A LYS A 235 ? 0.5252 0.5841 0.1891 -0.1106 0.0099  -0.1003 217 LYS A CD  
1824 C CD  B LYS A 235 ? 0.5362 0.6139 0.1813 -0.1303 0.0158  -0.1107 217 LYS A CD  
1825 C CE  A LYS A 235 ? 0.5636 0.6376 0.2076 -0.1407 0.0205  -0.1260 217 LYS A CE  
1826 C CE  B LYS A 235 ? 0.5729 0.6570 0.1991 -0.1612 0.0330  -0.1434 217 LYS A CE  
1827 N NZ  A LYS A 235 ? 0.5854 0.6869 0.1985 -0.1725 0.0320  -0.1435 217 LYS A NZ  
1828 N NZ  B LYS A 235 ? 0.5664 0.6580 0.1951 -0.1652 0.0228  -0.1409 217 LYS A NZ  
1829 N N   . THR A 236 ? 0.4574 0.4605 0.1707 -0.0480 0.0151  -0.0612 218 THR A N   
1830 C CA  . THR A 236 ? 0.4357 0.4361 0.1563 -0.0368 0.0072  -0.0429 218 THR A CA  
1831 C C   . THR A 236 ? 0.4423 0.4496 0.1585 -0.0409 0.0154  -0.0442 218 THR A C   
1832 O O   . THR A 236 ? 0.4391 0.4601 0.1479 -0.0424 0.0092  -0.0306 218 THR A O   
1833 C CB  . THR A 236 ? 0.4029 0.3828 0.1437 -0.0236 0.0055  -0.0382 218 THR A CB  
1834 O OG1 . THR A 236 ? 0.4134 0.3877 0.1566 -0.0209 -0.0012 -0.0373 218 THR A OG1 
1835 C CG2 . THR A 236 ? 0.3977 0.3752 0.1425 -0.0184 0.0001  -0.0240 218 THR A CG2 
1836 N N   . VAL A 237 ? 0.4605 0.4580 0.1859 -0.0422 0.0319  -0.0592 219 VAL A N   
1837 C CA  . VAL A 237 ? 0.4825 0.4824 0.2101 -0.0448 0.0447  -0.0630 219 VAL A CA  
1838 C C   . VAL A 237 ? 0.5245 0.5474 0.2236 -0.0638 0.0491  -0.0710 219 VAL A C   
1839 O O   . VAL A 237 ? 0.5245 0.5575 0.2181 -0.0663 0.0513  -0.0651 219 VAL A O   
1840 C CB  . VAL A 237 ? 0.4847 0.4665 0.2412 -0.0393 0.0660  -0.0741 219 VAL A CB  
1841 C CG1 . VAL A 237 ? 0.5438 0.5270 0.3031 -0.0461 0.0873  -0.0848 219 VAL A CG1 
1842 C CG2 . VAL A 237 ? 0.4420 0.4158 0.2278 -0.0227 0.0580  -0.0551 219 VAL A CG2 
1843 N N   . GLU A 238 ? 0.5553 0.5915 0.2347 -0.0802 0.0495  -0.0829 220 GLU A N   
1844 C CA  . GLU A 238 ? 0.6042 0.6735 0.2525 -0.1041 0.0507  -0.0869 220 GLU A CA  
1845 C C   . GLU A 238 ? 0.5814 0.6805 0.2217 -0.1028 0.0274  -0.0555 220 GLU A C   
1846 O O   . GLU A 238 ? 0.6042 0.7395 0.2225 -0.1219 0.0247  -0.0494 220 GLU A O   
1847 C CB  . GLU A 238 ? 0.6284 0.7083 0.2558 -0.1298 0.0626  -0.1130 220 GLU A CB  
1848 C CG  . GLU A 238 ? 0.6682 0.7526 0.2955 -0.1293 0.0477  -0.1073 220 GLU A CG  
1849 C CD  . GLU A 238 ? 0.7066 0.7975 0.3150 -0.1568 0.0626  -0.1373 220 GLU A CD  
1850 O OE1 . GLU A 238 ? 0.8022 0.8830 0.4030 -0.1743 0.0907  -0.1677 220 GLU A OE1 
1851 O OE2 . GLU A 238 ? 0.7795 0.8844 0.3826 -0.1623 0.0488  -0.1316 220 GLU A OE2 
1852 N N   . ASN A 239 ? 0.5464 0.6316 0.2077 -0.0818 0.0137  -0.0347 221 ASN A N   
1853 C CA  . ASN A 239 ? 0.5366 0.6410 0.2036 -0.0761 -0.0007 -0.0030 221 ASN A CA  
1854 C C   . ASN A 239 ? 0.4969 0.5732 0.1888 -0.0546 -0.0036 0.0103  221 ASN A C   
1855 O O   . ASN A 239 ? 0.4885 0.5600 0.1948 -0.0457 -0.0108 0.0258  221 ASN A O   
1856 C CB  . ASN A 239 ? 0.5384 0.6733 0.2027 -0.0837 -0.0139 0.0152  221 ASN A CB  
1857 C CG  . ASN A 239 ? 0.5719 0.7455 0.2405 -0.0875 -0.0231 0.0504  221 ASN A CG  
1858 O OD1 . ASN A 239 ? 0.5686 0.7350 0.2489 -0.0780 -0.0204 0.0636  221 ASN A OD1 
1859 N ND2 . ASN A 239 ? 0.5629 0.7812 0.2253 -0.1026 -0.0338 0.0688  221 ASN A ND2 
1860 N N   . LEU A 240 ? 0.4883 0.5485 0.1856 -0.0492 0.0042  0.0041  222 LEU A N   
1861 C CA  . LEU A 240 ? 0.4649 0.5003 0.1810 -0.0355 0.0035  0.0107  222 LEU A CA  
1862 C C   . LEU A 240 ? 0.4618 0.5002 0.1896 -0.0308 -0.0008 0.0343  222 LEU A C   
1863 O O   . LEU A 240 ? 0.4434 0.4615 0.1850 -0.0235 -0.0007 0.0375  222 LEU A O   
1864 C CB  . LEU A 240 ? 0.4760 0.5028 0.1963 -0.0342 0.0121  0.0024  222 LEU A CB  
1865 C CG  . LEU A 240 ? 0.4753 0.4911 0.2012 -0.0334 0.0209  -0.0161 222 LEU A CG  
1866 C CD1 . LEU A 240 ? 0.5032 0.5196 0.2366 -0.0341 0.0334  -0.0211 222 LEU A CD1 
1867 C CD2 . LEU A 240 ? 0.4408 0.4400 0.1820 -0.0248 0.0159  -0.0145 222 LEU A CD2 
1868 N N   A GLU A 241 ? 0.4633 0.5273 0.1880 -0.0362 -0.0018 0.0514  223 GLU A N   
1869 N N   B GLU A 241 ? 0.4639 0.5286 0.1879 -0.0366 -0.0019 0.0510  223 GLU A N   
1870 C CA  A GLU A 241 ? 0.4636 0.5294 0.2101 -0.0298 -0.0014 0.0785  223 GLU A CA  
1871 C CA  B GLU A 241 ? 0.4659 0.5359 0.2102 -0.0311 -0.0020 0.0790  223 GLU A CA  
1872 C C   A GLU A 241 ? 0.4557 0.5207 0.2185 -0.0243 -0.0047 0.0914  223 GLU A C   
1873 C C   B GLU A 241 ? 0.4579 0.5279 0.2203 -0.0252 -0.0051 0.0942  223 GLU A C   
1874 O O   A GLU A 241 ? 0.4456 0.4897 0.2340 -0.0153 0.0028  0.1026  223 GLU A O   
1875 O O   B GLU A 241 ? 0.4502 0.5038 0.2400 -0.0162 0.0023  0.1099  223 GLU A O   
1876 C CB  A GLU A 241 ? 0.4810 0.5820 0.2265 -0.0367 -0.0026 0.1019  223 GLU A CB  
1877 C CB  B GLU A 241 ? 0.4839 0.5922 0.2216 -0.0405 -0.0039 0.0984  223 GLU A CB  
1878 C CG  A GLU A 241 ? 0.5035 0.5929 0.2769 -0.0281 0.0053  0.1236  223 GLU A CG  
1879 C CG  B GLU A 241 ? 0.5119 0.6188 0.2360 -0.0455 0.0024  0.0855  223 GLU A CG  
1880 C CD  A GLU A 241 ? 0.5386 0.6637 0.3339 -0.0282 0.0036  0.1642  223 GLU A CD  
1881 C CD  B GLU A 241 ? 0.5547 0.6606 0.2544 -0.0549 0.0065  0.0546  223 GLU A CD  
1882 O OE1 A GLU A 241 ? 0.5473 0.6654 0.3753 -0.0186 0.0081  0.1850  223 GLU A OE1 
1883 O OE1 B GLU A 241 ? 0.5428 0.6595 0.2286 -0.0635 0.0039  0.0436  223 GLU A OE1 
1884 O OE2 A GLU A 241 ? 0.5371 0.6991 0.3202 -0.0384 -0.0007 0.1774  223 GLU A OE2 
1885 O OE2 B GLU A 241 ? 0.5735 0.6673 0.2719 -0.0541 0.0150  0.0420  223 GLU A OE2 
1886 N N   . LYS A 242 ? 0.4582 0.5450 0.2077 -0.0314 -0.0129 0.0883  224 LYS A N   
1887 C CA  . LYS A 242 ? 0.4543 0.5447 0.2202 -0.0266 -0.0167 0.1016  224 LYS A CA  
1888 C C   . LYS A 242 ? 0.4425 0.4913 0.2176 -0.0166 -0.0112 0.0846  224 LYS A C   
1889 O O   . LYS A 242 ? 0.4416 0.4803 0.2413 -0.0087 -0.0066 0.0984  224 LYS A O   
1890 C CB  . LYS A 242 ? 0.4631 0.5875 0.2080 -0.0408 -0.0269 0.0975  224 LYS A CB  
1891 C CG  . LYS A 242 ? 0.4553 0.5879 0.2171 -0.0371 -0.0322 0.1116  224 LYS A CG  
1892 C CD  . LYS A 242 ? 0.4791 0.6572 0.2210 -0.0563 -0.0432 0.1142  224 LYS A CD  
1893 C CE  . LYS A 242 ? 0.5079 0.6899 0.2680 -0.0513 -0.0482 0.1256  224 LYS A CE  
1894 N NZ  . LYS A 242 ? 0.5515 0.7928 0.3005 -0.0724 -0.0610 0.1426  224 LYS A NZ  
1895 N N   . TYR A 243 ? 0.4333 0.4616 0.1912 -0.0183 -0.0102 0.0569  225 TYR A N   
1896 C CA  . TYR A 243 ? 0.4193 0.4200 0.1795 -0.0138 -0.0084 0.0408  225 TYR A CA  
1897 C C   . TYR A 243 ? 0.4129 0.3870 0.1778 -0.0122 -0.0009 0.0322  225 TYR A C   
1898 O O   . TYR A 243 ? 0.4016 0.3571 0.1702 -0.0116 0.0017  0.0240  225 TYR A O   
1899 C CB  . TYR A 243 ? 0.4184 0.4220 0.1619 -0.0185 -0.0126 0.0207  225 TYR A CB  
1900 C CG  . TYR A 243 ? 0.4113 0.4375 0.1489 -0.0243 -0.0189 0.0245  225 TYR A CG  
1901 C CD1 . TYR A 243 ? 0.4211 0.4473 0.1725 -0.0194 -0.0221 0.0363  225 TYR A CD1 
1902 C CD2 . TYR A 243 ? 0.4169 0.4667 0.1353 -0.0376 -0.0197 0.0155  225 TYR A CD2 
1903 C CE1 . TYR A 243 ? 0.4011 0.4544 0.1484 -0.0269 -0.0295 0.0428  225 TYR A CE1 
1904 C CE2 . TYR A 243 ? 0.4346 0.5110 0.1442 -0.0489 -0.0259 0.0182  225 TYR A CE2 
1905 C CZ  . TYR A 243 ? 0.4303 0.5106 0.1549 -0.0431 -0.0325 0.0337  225 TYR A CZ  
1906 O OH  . TYR A 243 ? 0.4711 0.5835 0.1877 -0.0566 -0.0400 0.0384  225 TYR A OH  
1907 N N   . VAL A 244 ? 0.4121 0.3876 0.1755 -0.0146 0.0026  0.0340  226 VAL A N   
1908 C CA  . VAL A 244 ? 0.4069 0.3645 0.1709 -0.0185 0.0078  0.0240  226 VAL A CA  
1909 C C   . VAL A 244 ? 0.4139 0.3633 0.1892 -0.0207 0.0180  0.0336  226 VAL A C   
1910 O O   . VAL A 244 ? 0.4143 0.3778 0.1910 -0.0195 0.0180  0.0447  226 VAL A O   
1911 C CB  . VAL A 244 ? 0.4091 0.3756 0.1639 -0.0212 0.0040  0.0141  226 VAL A CB  
1912 C CG1 . VAL A 244 ? 0.3826 0.3419 0.1397 -0.0280 0.0054  0.0089  226 VAL A CG1 
1913 C CG2 . VAL A 244 ? 0.3991 0.3715 0.1491 -0.0187 -0.0005 0.0053  226 VAL A CG2 
1914 N N   . VAL A 245 ? 0.4209 0.3479 0.2041 -0.0262 0.0290  0.0279  227 VAL A N   
1915 C CA  . VAL A 245 ? 0.4491 0.3619 0.2446 -0.0323 0.0441  0.0312  227 VAL A CA  
1916 C C   . VAL A 245 ? 0.4585 0.3822 0.2422 -0.0398 0.0394  0.0266  227 VAL A C   
1917 O O   . VAL A 245 ? 0.4563 0.3886 0.2267 -0.0459 0.0305  0.0161  227 VAL A O   
1918 C CB  . VAL A 245 ? 0.4641 0.3479 0.2661 -0.0435 0.0618  0.0175  227 VAL A CB  
1919 C CG1 . VAL A 245 ? 0.4855 0.3519 0.2971 -0.0556 0.0810  0.0138  227 VAL A CG1 
1920 C CG2 . VAL A 245 ? 0.4542 0.3251 0.2775 -0.0339 0.0721  0.0260  227 VAL A CG2 
1921 N N   . LYS A 246 ? 0.4714 0.3986 0.2643 -0.0385 0.0452  0.0384  228 LYS A N   
1922 C CA  . LYS A 246 ? 0.4791 0.4169 0.2642 -0.0452 0.0423  0.0359  228 LYS A CA  
1923 C C   . LYS A 246 ? 0.4971 0.4180 0.2941 -0.0555 0.0588  0.0360  228 LYS A C   
1924 O O   . LYS A 246 ? 0.5221 0.4309 0.3397 -0.0501 0.0721  0.0484  228 LYS A O   
1925 C CB  . LYS A 246 ? 0.4751 0.4356 0.2581 -0.0361 0.0354  0.0491  228 LYS A CB  
1926 C CG  . LYS A 246 ? 0.4874 0.4616 0.2624 -0.0401 0.0313  0.0449  228 LYS A CG  
1927 C CD  . LYS A 246 ? 0.4968 0.4915 0.2664 -0.0344 0.0280  0.0533  228 LYS A CD  
1928 C CE  . LYS A 246 ? 0.5443 0.5508 0.3106 -0.0372 0.0282  0.0493  228 LYS A CE  
1929 N NZ  . LYS A 246 ? 0.5532 0.5791 0.3094 -0.0351 0.0280  0.0523  228 LYS A NZ  
1930 N N   . ASP A 247 ? 0.5042 0.4277 0.2924 -0.0709 0.0591  0.0254  229 ASP A N   
1931 C CA  . ASP A 247 ? 0.5330 0.4386 0.3292 -0.0872 0.0773  0.0194  229 ASP A CA  
1932 C C   . ASP A 247 ? 0.5408 0.4649 0.3306 -0.0973 0.0719  0.0202  229 ASP A C   
1933 O O   . ASP A 247 ? 0.5469 0.4921 0.3238 -0.1063 0.0588  0.0151  229 ASP A O   
1934 C CB  . ASP A 247 ? 0.5524 0.4406 0.3398 -0.1081 0.0877  -0.0020 229 ASP A CB  
1935 C CG  . ASP A 247 ? 0.6062 0.4683 0.4024 -0.1297 0.1147  -0.0147 229 ASP A CG  
1936 O OD1 . ASP A 247 ? 0.5974 0.4603 0.4022 -0.1332 0.1211  -0.0086 229 ASP A OD1 
1937 O OD2 . ASP A 247 ? 0.6505 0.4895 0.4448 -0.1456 0.1324  -0.0332 229 ASP A OD2 
1938 N N   . GLY A 248 ? 0.5119 0.3492 0.2896 0.0002  0.0562  0.0635  230 GLY A N   
1939 C CA  . GLY A 248 ? 0.5129 0.3430 0.2858 -0.0111 0.0562  0.0601  230 GLY A CA  
1940 C C   . GLY A 248 ? 0.5219 0.3342 0.2890 -0.0179 0.0584  0.0535  230 GLY A C   
1941 O O   . GLY A 248 ? 0.5256 0.3406 0.2929 -0.0285 0.0568  0.0495  230 GLY A O   
1942 N N   . LYS A 249 ? 0.5254 0.3212 0.2870 -0.0119 0.0623  0.0526  231 LYS A N   
1943 C CA  . LYS A 249 ? 0.5411 0.3192 0.2945 -0.0191 0.0646  0.0456  231 LYS A CA  
1944 C C   . LYS A 249 ? 0.5364 0.3313 0.2988 -0.0244 0.0602  0.0383  231 LYS A C   
1945 O O   . LYS A 249 ? 0.5457 0.3320 0.3021 -0.0338 0.0606  0.0330  231 LYS A O   
1946 C CB  . LYS A 249 ? 0.5629 0.3160 0.3054 -0.0103 0.0716  0.0466  231 LYS A CB  
1947 C CG  . LYS A 249 ? 0.5986 0.3277 0.3292 -0.0061 0.0779  0.0541  231 LYS A CG  
1948 C CD  . LYS A 249 ? 0.6179 0.3173 0.3356 0.0032  0.0872  0.0547  231 LYS A CD  
1949 C CE  . LYS A 249 ? 0.6393 0.3525 0.3668 0.0207  0.0887  0.0604  231 LYS A CE  
1950 N NZ  . LYS A 249 ? 0.6091 0.3512 0.3508 0.0271  0.0835  0.0699  231 LYS A NZ  
1951 N N   . LEU A 250 ? 0.5157 0.3342 0.2917 -0.0193 0.0562  0.0385  232 LEU A N   
1952 C CA  . LEU A 250 ? 0.5033 0.3371 0.2887 -0.0232 0.0527  0.0328  232 LEU A CA  
1953 C C   . LEU A 250 ? 0.4907 0.3317 0.2784 -0.0351 0.0506  0.0303  232 LEU A C   
1954 O O   . LEU A 250 ? 0.4931 0.3331 0.2796 -0.0419 0.0502  0.0267  232 LEU A O   
1955 C CB  . LEU A 250 ? 0.4866 0.3412 0.2845 -0.0163 0.0495  0.0337  232 LEU A CB  
1956 C CG  . LEU A 250 ? 0.4743 0.3463 0.2835 -0.0203 0.0462  0.0293  232 LEU A CG  
1957 C CD1 . LEU A 250 ? 0.5017 0.3698 0.3104 -0.0222 0.0467  0.0256  232 LEU A CD1 
1958 C CD2 . LEU A 250 ? 0.4751 0.3632 0.2934 -0.0150 0.0436  0.0302  232 LEU A CD2 
1959 N N   . PRO A 251 ? 0.4848 0.3348 0.2755 -0.0378 0.0496  0.0331  233 PRO A N   
1960 C CA  . PRO A 251 ? 0.4724 0.3299 0.2654 -0.0483 0.0487  0.0324  233 PRO A CA  
1961 C C   . PRO A 251 ? 0.4806 0.3229 0.2624 -0.0587 0.0501  0.0319  233 PRO A C   
1962 O O   . PRO A 251 ? 0.4752 0.3271 0.2600 -0.0681 0.0485  0.0310  233 PRO A O   
1963 C CB  . PRO A 251 ? 0.4661 0.3312 0.2605 -0.0480 0.0489  0.0361  233 PRO A CB  
1964 C CG  . PRO A 251 ? 0.4679 0.3376 0.2651 -0.0384 0.0483  0.0372  233 PRO A CG  
1965 C CD  . PRO A 251 ? 0.4844 0.3423 0.2778 -0.0318 0.0490  0.0370  233 PRO A CD  
1966 N N   . LEU A 252 ? 0.4886 0.3075 0.2569 -0.0578 0.0532  0.0333  234 LEU A N   
1967 C CA  . LEU A 252 ? 0.5020 0.3017 0.2562 -0.0693 0.0552  0.0318  234 LEU A CA  
1968 C C   . LEU A 252 ? 0.4928 0.2891 0.2436 -0.0736 0.0549  0.0259  234 LEU A C   
1969 O O   . LEU A 252 ? 0.4954 0.2945 0.2423 -0.0871 0.0533  0.0242  234 LEU A O   
1970 C CB  . LEU A 252 ? 0.5330 0.3038 0.2719 -0.0666 0.0603  0.0347  234 LEU A CB  
1971 C CG  . LEU A 252 ? 0.5591 0.3031 0.2794 -0.0794 0.0636  0.0325  234 LEU A CG  
1972 C CD1 . LEU A 252 ? 0.5770 0.3313 0.2975 -0.0955 0.0606  0.0345  234 LEU A CD1 
1973 C CD2 . LEU A 252 ? 0.5870 0.2999 0.2935 -0.0720 0.0704  0.0360  234 LEU A CD2 
1974 N N   . LEU A 253 ? 0.4791 0.2720 0.2313 -0.0626 0.0562  0.0236  235 LEU A N   
1975 C CA  . LEU A 253 ? 0.4840 0.2735 0.2318 -0.0660 0.0564  0.0180  235 LEU A CA  
1976 C C   . LEU A 253 ? 0.4617 0.2792 0.2233 -0.0723 0.0512  0.0173  235 LEU A C   
1977 O O   . LEU A 253 ? 0.4712 0.2902 0.2272 -0.0845 0.0498  0.0149  235 LEU A O   
1978 C CB  . LEU A 253 ? 0.4821 0.2641 0.2295 -0.0518 0.0596  0.0168  235 LEU A CB  
1979 C CG  . LEU A 253 ? 0.4936 0.2747 0.2369 -0.0547 0.0599  0.0110  235 LEU A CG  
1980 C CD1 . LEU A 253 ? 0.5031 0.2575 0.2245 -0.0665 0.0640  0.0059  235 LEU A CD1 
1981 C CD2 . LEU A 253 ? 0.5141 0.2938 0.2604 -0.0395 0.0628  0.0112  235 LEU A CD2 
1982 N N   . LEU A 254 ? 0.4468 0.2860 0.2252 -0.0649 0.0485  0.0202  236 LEU A N   
1983 C CA  . LEU A 254 ? 0.4458 0.3105 0.2387 -0.0681 0.0450  0.0211  236 LEU A CA  
1984 C C   . LEU A 254 ? 0.4460 0.3197 0.2385 -0.0813 0.0436  0.0238  236 LEU A C   
1985 O O   . LEU A 254 ? 0.4474 0.3361 0.2446 -0.0887 0.0413  0.0246  236 LEU A O   
1986 C CB  . LEU A 254 ? 0.4290 0.3100 0.2371 -0.0581 0.0441  0.0232  236 LEU A CB  
1987 C CG  . LEU A 254 ? 0.4460 0.3279 0.2590 -0.0473 0.0440  0.0213  236 LEU A CG  
1988 C CD1 . LEU A 254 ? 0.4649 0.3652 0.2928 -0.0423 0.0427  0.0224  236 LEU A CD1 
1989 C CD2 . LEU A 254 ? 0.4645 0.3454 0.2754 -0.0489 0.0436  0.0186  236 LEU A CD2 
1990 N N   . SER A 255 ? 0.4654 0.3318 0.2525 -0.0847 0.0448  0.0264  237 SER A N   
1991 C CA  . SER A 255 ? 0.4764 0.3544 0.2642 -0.0975 0.0435  0.0304  237 SER A CA  
1992 C C   . SER A 255 ? 0.4985 0.3655 0.2714 -0.1132 0.0428  0.0283  237 SER A C   
1993 O O   . SER A 255 ? 0.5043 0.3895 0.2806 -0.1254 0.0401  0.0318  237 SER A O   
1994 C CB  . SER A 255 ? 0.4898 0.3638 0.2756 -0.0973 0.0452  0.0342  237 SER A CB  
1995 O OG  . SER A 255 ? 0.5424 0.3879 0.3107 -0.1001 0.0476  0.0327  237 SER A OG  
1996 N N   . ARG A 256 ? 0.5204 0.3582 0.2761 -0.1130 0.0456  0.0231  238 ARG A N   
1997 C CA  . ARG A 256 ? 0.5530 0.3753 0.2907 -0.1281 0.0459  0.0189  238 ARG A CA  
1998 C C   . ARG A 256 ? 0.5522 0.3904 0.2942 -0.1311 0.0431  0.0164  238 ARG A C   
1999 O O   . ARG A 256 ? 0.5597 0.4043 0.2943 -0.1477 0.0405  0.0159  238 ARG A O   
2000 C CB  . ARG A 256 ? 0.5871 0.3702 0.3042 -0.1248 0.0518  0.0140  238 ARG A CB  
2001 C CG  . ARG A 256 ? 0.6425 0.4086 0.3522 -0.1263 0.0546  0.0179  238 ARG A CG  
2002 C CD  . ARG A 256 ? 0.7385 0.4667 0.4310 -0.1186 0.0617  0.0153  238 ARG A CD  
2003 N NE  . ARG A 256 ? 0.8599 0.5632 0.5318 -0.1279 0.0652  0.0077  238 ARG A NE  
2004 C CZ  . ARG A 256 ? 0.9173 0.5987 0.5685 -0.1463 0.0672  0.0048  238 ARG A CZ  
2005 N NH1 . ARG A 256 ? 0.9341 0.6166 0.5841 -0.1570 0.0656  0.0100  238 ARG A NH1 
2006 N NH2 . ARG A 256 ? 0.9680 0.6261 0.5988 -0.1548 0.0709  -0.0034 238 ARG A NH2 
2007 N N   . MET A 257 ? 0.5387 0.3854 0.2928 -0.1162 0.0431  0.0155  239 MET A N   
2008 C CA  . MET A 257 ? 0.5395 0.4031 0.2997 -0.1174 0.0405  0.0143  239 MET A CA  
2009 C C   . MET A 257 ? 0.5387 0.4365 0.3147 -0.1249 0.0359  0.0213  239 MET A C   
2010 O O   . MET A 257 ? 0.5458 0.4575 0.3200 -0.1365 0.0330  0.0222  239 MET A O   
2011 C CB  . MET A 257 ? 0.5110 0.3777 0.2822 -0.1000 0.0415  0.0131  239 MET A CB  
2012 C CG  . MET A 257 ? 0.5176 0.3564 0.2742 -0.0924 0.0462  0.0072  239 MET A CG  
2013 S SD  . MET A 257 ? 0.5149 0.3627 0.2872 -0.0725 0.0467  0.0083  239 MET A SD  
2014 C CE  . MET A 257 ? 0.5097 0.3309 0.2640 -0.0669 0.0526  0.0023  239 MET A CE  
2015 N N   . LYS A 258 ? 0.5384 0.4502 0.3292 -0.1186 0.0359  0.0270  240 LYS A N   
2016 C CA  . LYS A 258 ? 0.5437 0.4880 0.3510 -0.1227 0.0334  0.0353  240 LYS A CA  
2017 C C   . LYS A 258 ? 0.5611 0.5138 0.3607 -0.1418 0.0310  0.0392  240 LYS A C   
2018 O O   . LYS A 258 ? 0.5598 0.5426 0.3714 -0.1477 0.0284  0.0467  240 LYS A O   
2019 C CB  . LYS A 258 ? 0.5306 0.4854 0.3538 -0.1101 0.0356  0.0395  240 LYS A CB  
2020 C CG  . LYS A 258 ? 0.5532 0.5403 0.3971 -0.1066 0.0353  0.0475  240 LYS A CG  
2021 C CD  . LYS A 258 ? 0.5873 0.5755 0.4439 -0.0897 0.0384  0.0469  240 LYS A CD  
2022 C CE  . LYS A 258 ? 0.5918 0.5969 0.4611 -0.0854 0.0418  0.0535  240 LYS A CE  
2023 N NZ  . LYS A 258 ? 0.6029 0.6365 0.4873 -0.0866 0.0419  0.0625  240 LYS A NZ  
2024 N N   . GLU A 259 ? 0.6021 0.5288 0.3815 -0.1519 0.0321  0.0347  241 GLU A N   
2025 C CA  . GLU A 259 ? 0.6347 0.5664 0.4034 -0.1732 0.0295  0.0375  241 GLU A CA  
2026 C C   . GLU A 259 ? 0.6309 0.5705 0.3908 -0.1878 0.0260  0.0356  241 GLU A C   
2027 O O   . GLU A 259 ? 0.6503 0.6110 0.4092 -0.2055 0.0221  0.0413  241 GLU A O   
2028 C CB  . GLU A 259 ? 0.6641 0.5610 0.4114 -0.1806 0.0325  0.0330  241 GLU A CB  
2029 C CG  . GLU A 259 ? 0.6928 0.5899 0.4485 -0.1721 0.0347  0.0378  241 GLU A CG  
2030 C CD  . GLU A 259 ? 0.7317 0.5910 0.4675 -0.1742 0.0387  0.0337  241 GLU A CD  
2031 O OE1 . GLU A 259 ? 0.8096 0.6418 0.5230 -0.1867 0.0401  0.0278  241 GLU A OE1 
2032 O OE2 . GLU A 259 ? 0.7740 0.6304 0.5161 -0.1634 0.0410  0.0368  241 GLU A OE2 
2033 N N   . VAL A 260 ? 0.6221 0.5467 0.3750 -0.1813 0.0274  0.0281  242 VAL A N   
2034 C CA  . VAL A 260 ? 0.6126 0.5416 0.3535 -0.1954 0.0246  0.0248  242 VAL A CA  
2035 C C   . VAL A 260 ? 0.5825 0.5371 0.3403 -0.1856 0.0225  0.0279  242 VAL A C   
2036 O O   . VAL A 260 ? 0.5800 0.5427 0.3299 -0.1963 0.0199  0.0262  242 VAL A O   
2037 C CB  . VAL A 260 ? 0.6547 0.5402 0.3657 -0.2011 0.0290  0.0123  242 VAL A CB  
2038 C CG1 . VAL A 260 ? 0.6758 0.5342 0.3677 -0.2137 0.0315  0.0100  242 VAL A CG1 
2039 C CG2 . VAL A 260 ? 0.6238 0.4874 0.3362 -0.1789 0.0343  0.0064  242 VAL A CG2 
2040 N N   . GLY A 261 ? 0.5354 0.5017 0.3153 -0.1660 0.0238  0.0322  243 GLY A N   
2041 C CA  . GLY A 261 ? 0.5076 0.4948 0.3033 -0.1560 0.0226  0.0353  243 GLY A CA  
2042 C C   . GLY A 261 ? 0.4698 0.4707 0.2892 -0.1381 0.0243  0.0414  243 GLY A C   
2043 O O   . GLY A 261 ? 0.4772 0.4772 0.3020 -0.1346 0.0261  0.0442  243 GLY A O   
2044 N N   . LYS A 262 ? 0.4458 0.4587 0.2782 -0.1274 0.0243  0.0433  244 LYS A N   
2045 C CA  . LYS A 262 ? 0.4116 0.4331 0.2640 -0.1105 0.0269  0.0475  244 LYS A CA  
2046 C C   . LYS A 262 ? 0.3993 0.3955 0.2468 -0.0980 0.0295  0.0392  244 LYS A C   
2047 O O   . LYS A 262 ? 0.4114 0.3906 0.2449 -0.0997 0.0295  0.0322  244 LYS A O   
2048 C CB  . LYS A 262 ? 0.4089 0.4600 0.2789 -0.1074 0.0255  0.0563  244 LYS A CB  
2049 C CG  . LYS A 262 ? 0.4303 0.5119 0.3125 -0.1141 0.0244  0.0683  244 LYS A CG  
2050 C CD  . LYS A 262 ? 0.4745 0.5861 0.3680 -0.1172 0.0219  0.0778  244 LYS A CD  
2051 C CE  . LYS A 262 ? 0.5005 0.6452 0.4090 -0.1211 0.0218  0.0920  244 LYS A CE  
2052 N NZ  . LYS A 262 ? 0.5234 0.7010 0.4461 -0.1215 0.0197  0.1039  244 LYS A NZ  
2053 N N   . VAL A 263 ? 0.3685 0.3625 0.2265 -0.0859 0.0323  0.0400  245 VAL A N   
2054 C CA  . VAL A 263 ? 0.3538 0.3281 0.2086 -0.0747 0.0343  0.0337  245 VAL A CA  
2055 C C   . VAL A 263 ? 0.3279 0.3135 0.1998 -0.0633 0.0357  0.0369  245 VAL A C   
2056 O O   . VAL A 263 ? 0.3209 0.3200 0.2048 -0.0610 0.0375  0.0425  245 VAL A O   
2057 C CB  . VAL A 263 ? 0.3588 0.3136 0.2039 -0.0736 0.0362  0.0302  245 VAL A CB  
2058 C CG1 . VAL A 263 ? 0.3506 0.2906 0.1942 -0.0620 0.0378  0.0258  245 VAL A CG1 
2059 C CG2 . VAL A 263 ? 0.3901 0.3293 0.2163 -0.0856 0.0357  0.0271  245 VAL A CG2 
2060 N N   . PHE A 264 ? 0.3218 0.3018 0.1945 -0.0565 0.0356  0.0337  246 PHE A N   
2061 C CA  . PHE A 264 ? 0.3012 0.2887 0.1882 -0.0473 0.0372  0.0361  246 PHE A CA  
2062 C C   . PHE A 264 ? 0.3053 0.2787 0.1888 -0.0398 0.0376  0.0308  246 PHE A C   
2063 O O   . PHE A 264 ? 0.3135 0.2745 0.1855 -0.0399 0.0368  0.0264  246 PHE A O   
2064 C CB  . PHE A 264 ? 0.2910 0.2975 0.1894 -0.0477 0.0362  0.0422  246 PHE A CB  
2065 C CG  . PHE A 264 ? 0.2872 0.2920 0.1795 -0.0491 0.0339  0.0394  246 PHE A CG  
2066 C CD1 . PHE A 264 ? 0.2881 0.2889 0.1843 -0.0415 0.0343  0.0376  246 PHE A CD1 
2067 C CD2 . PHE A 264 ? 0.2612 0.2693 0.1431 -0.0591 0.0315  0.0388  246 PHE A CD2 
2068 C CE1 . PHE A 264 ? 0.2618 0.2627 0.1527 -0.0421 0.0328  0.0357  246 PHE A CE1 
2069 C CE2 . PHE A 264 ? 0.2939 0.2997 0.1686 -0.0602 0.0303  0.0356  246 PHE A CE2 
2070 C CZ  . PHE A 264 ? 0.2816 0.2843 0.1615 -0.0508 0.0313  0.0344  246 PHE A CZ  
2071 N N   . LEU A 265 ? 0.3068 0.2822 0.1995 -0.0335 0.0394  0.0317  247 LEU A N   
2072 C CA  . LEU A 265 ? 0.3159 0.2830 0.2072 -0.0280 0.0392  0.0280  247 LEU A CA  
2073 C C   . LEU A 265 ? 0.3048 0.2803 0.2068 -0.0248 0.0394  0.0306  247 LEU A C   
2074 O O   . LEU A 265 ? 0.3116 0.2945 0.2236 -0.0238 0.0418  0.0346  247 LEU A O   
2075 C CB  . LEU A 265 ? 0.3192 0.2799 0.2094 -0.0259 0.0413  0.0262  247 LEU A CB  
2076 C CG  . LEU A 265 ? 0.3191 0.2738 0.2066 -0.0224 0.0405  0.0230  247 LEU A CG  
2077 C CD1 . LEU A 265 ? 0.3342 0.2813 0.2110 -0.0218 0.0386  0.0215  247 LEU A CD1 
2078 C CD2 . LEU A 265 ? 0.3389 0.2895 0.2251 -0.0222 0.0430  0.0211  247 LEU A CD2 
2079 N N   . ALA A 266 ? 0.2998 0.2741 0.2002 -0.0226 0.0375  0.0290  248 ALA A N   
2080 C CA  . ALA A 266 ? 0.3053 0.2870 0.2155 -0.0203 0.0375  0.0318  248 ALA A CA  
2081 C C   . ALA A 266 ? 0.3067 0.2837 0.2140 -0.0176 0.0363  0.0291  248 ALA A C   
2082 O O   . ALA A 266 ? 0.3354 0.3113 0.2365 -0.0161 0.0347  0.0279  248 ALA A O   
2083 C CB  . ALA A 266 ? 0.2846 0.2767 0.1969 -0.0219 0.0359  0.0349  248 ALA A CB  
2084 N N   . THR A 267 ? 0.2980 0.2719 0.2085 -0.0173 0.0375  0.0283  249 THR A N   
2085 C CA  . THR A 267 ? 0.2913 0.2636 0.1984 -0.0169 0.0356  0.0263  249 THR A CA  
2086 C C   . THR A 267 ? 0.2805 0.2563 0.1950 -0.0181 0.0357  0.0280  249 THR A C   
2087 O O   . THR A 267 ? 0.2764 0.2502 0.1970 -0.0188 0.0388  0.0293  249 THR A O   
2088 C CB  . THR A 267 ? 0.2998 0.2645 0.1995 -0.0182 0.0361  0.0229  249 THR A CB  
2089 O OG1 . THR A 267 ? 0.2733 0.2402 0.1709 -0.0195 0.0339  0.0223  249 THR A OG1 
2090 C CG2 . THR A 267 ? 0.2965 0.2551 0.1976 -0.0200 0.0401  0.0214  249 THR A CG2 
2091 N N   . ASN A 268 ? 0.2842 0.2657 0.1985 -0.0183 0.0329  0.0288  250 ASN A N   
2092 C CA  . ASN A 268 ? 0.2830 0.2666 0.2029 -0.0216 0.0329  0.0302  250 ASN A CA  
2093 C C   . ASN A 268 ? 0.2902 0.2649 0.2050 -0.0268 0.0340  0.0263  250 ASN A C   
2094 O O   . ASN A 268 ? 0.2896 0.2613 0.2067 -0.0314 0.0351  0.0262  250 ASN A O   
2095 C CB  . ASN A 268 ? 0.2803 0.2761 0.2023 -0.0212 0.0294  0.0335  250 ASN A CB  
2096 C CG  . ASN A 268 ? 0.2579 0.2621 0.1865 -0.0182 0.0294  0.0376  250 ASN A CG  
2097 O OD1 . ASN A 268 ? 0.2657 0.2682 0.1963 -0.0166 0.0313  0.0382  250 ASN A OD1 
2098 N ND2 . ASN A 268 ? 0.2211 0.2369 0.1531 -0.0180 0.0273  0.0412  250 ASN A ND2 
2099 N N   A SER A 269 ? 0.2981 0.2680 0.2048 -0.0271 0.0340  0.0229  251 SER A N   
2100 N N   B SER A 269 ? 0.2870 0.2567 0.1938 -0.0269 0.0341  0.0229  251 SER A N   
2101 C CA  A SER A 269 ? 0.3146 0.2768 0.2141 -0.0333 0.0350  0.0185  251 SER A CA  
2102 C CA  B SER A 269 ? 0.2918 0.2538 0.1909 -0.0327 0.0351  0.0185  251 SER A CA  
2103 C C   A SER A 269 ? 0.3227 0.2708 0.2223 -0.0338 0.0416  0.0155  251 SER A C   
2104 C C   B SER A 269 ? 0.3098 0.2577 0.2083 -0.0334 0.0416  0.0152  251 SER A C   
2105 O O   A SER A 269 ? 0.3203 0.2677 0.2273 -0.0289 0.0448  0.0184  251 SER A O   
2106 O O   B SER A 269 ? 0.3095 0.2565 0.2140 -0.0284 0.0447  0.0175  251 SER A O   
2107 C CB  A SER A 269 ? 0.3179 0.2824 0.2084 -0.0338 0.0325  0.0170  251 SER A CB  
2108 C CB  B SER A 269 ? 0.2880 0.2529 0.1788 -0.0322 0.0324  0.0175  251 SER A CB  
2109 O OG  A SER A 269 ? 0.3518 0.3103 0.2397 -0.0298 0.0349  0.0159  251 SER A OG  
2110 O OG  B SER A 269 ? 0.2509 0.2138 0.1336 -0.0395 0.0317  0.0142  251 SER A OG  
2111 N N   . ASP A 270 ? 0.3290 0.2669 0.2199 -0.0399 0.0440  0.0104  252 ASP A N   
2112 C CA  . ASP A 270 ? 0.3511 0.2728 0.2396 -0.0398 0.0521  0.0068  252 ASP A CA  
2113 C C   . ASP A 270 ? 0.3330 0.2516 0.2161 -0.0367 0.0548  0.0046  252 ASP A C   
2114 O O   . ASP A 270 ? 0.3084 0.2348 0.1872 -0.0367 0.0501  0.0047  252 ASP A O   
2115 C CB  . ASP A 270 ? 0.3879 0.2970 0.2664 -0.0494 0.0543  0.0011  252 ASP A CB  
2116 C CG  . ASP A 270 ? 0.4588 0.3726 0.3244 -0.0574 0.0494  -0.0031 252 ASP A CG  
2117 O OD1 . ASP A 270 ? 0.5099 0.4144 0.3653 -0.0590 0.0533  -0.0083 252 ASP A OD1 
2118 O OD2 . ASP A 270 ? 0.5349 0.4637 0.4010 -0.0615 0.0418  -0.0002 252 ASP A OD2 
2119 N N   . TYR A 271 ? 0.3484 0.2560 0.2321 -0.0334 0.0630  0.0035  253 TYR A N   
2120 C CA  . TYR A 271 ? 0.3584 0.2653 0.2382 -0.0303 0.0660  0.0024  253 TYR A CA  
2121 C C   . TYR A 271 ? 0.3731 0.2766 0.2381 -0.0364 0.0644  -0.0038 253 TYR A C   
2122 O O   . TYR A 271 ? 0.3753 0.2859 0.2375 -0.0352 0.0614  -0.0027 253 TYR A O   
2123 C CB  . TYR A 271 ? 0.3672 0.2654 0.2516 -0.0241 0.0763  0.0039  253 TYR A CB  
2124 C CG  . TYR A 271 ? 0.3970 0.2987 0.2791 -0.0209 0.0789  0.0043  253 TYR A CG  
2125 C CD1 . TYR A 271 ? 0.3930 0.3095 0.2821 -0.0181 0.0743  0.0101  253 TYR A CD1 
2126 C CD2 . TYR A 271 ? 0.4031 0.2929 0.2743 -0.0218 0.0861  -0.0013 253 TYR A CD2 
2127 C CE1 . TYR A 271 ? 0.3962 0.3167 0.2830 -0.0167 0.0763  0.0111  253 TYR A CE1 
2128 C CE2 . TYR A 271 ? 0.4132 0.3081 0.2825 -0.0191 0.0884  -0.0001 253 TYR A CE2 
2129 C CZ  . TYR A 271 ? 0.3842 0.2949 0.2620 -0.0168 0.0832  0.0064  253 TYR A CZ  
2130 O OH  . TYR A 271 ? 0.4157 0.3318 0.2914 -0.0155 0.0853  0.0082  253 TYR A OH  
2131 N N   . LYS A 272 ? 0.3880 0.2803 0.2425 -0.0438 0.0666  -0.0099 254 LYS A N   
2132 C CA  . LYS A 272 ? 0.4090 0.2990 0.2478 -0.0512 0.0656  -0.0158 254 LYS A CA  
2133 C C   . LYS A 272 ? 0.3761 0.2834 0.2139 -0.0535 0.0556  -0.0124 254 LYS A C   
2134 O O   . LYS A 272 ? 0.3846 0.2964 0.2166 -0.0531 0.0544  -0.0123 254 LYS A O   
2135 C CB  . LYS A 272 ? 0.4420 0.3173 0.2679 -0.0616 0.0689  -0.0233 254 LYS A CB  
2136 C CG  . LYS A 272 ? 0.5443 0.3971 0.3621 -0.0604 0.0815  -0.0295 254 LYS A CG  
2137 C CD  . LYS A 272 ? 0.6453 0.4792 0.4554 -0.0685 0.0861  -0.0350 254 LYS A CD  
2138 C CE  . LYS A 272 ? 0.7328 0.5394 0.5300 -0.0681 0.1003  -0.0428 254 LYS A CE  
2139 N NZ  . LYS A 272 ? 0.7815 0.5660 0.5781 -0.0701 0.1078  -0.0446 254 LYS A NZ  
2140 N N   . TYR A 273 ? 0.3658 0.2833 0.2097 -0.0549 0.0492  -0.0085 255 TYR A N   
2141 C CA  . TYR A 273 ? 0.3626 0.2968 0.2076 -0.0540 0.0413  -0.0034 255 TYR A CA  
2142 C C   . TYR A 273 ? 0.3544 0.2930 0.2057 -0.0446 0.0407  0.0014  255 TYR A C   
2143 O O   . TYR A 273 ? 0.3405 0.2851 0.1871 -0.0436 0.0379  0.0037  255 TYR A O   
2144 C CB  . TYR A 273 ? 0.3590 0.3038 0.2105 -0.0560 0.0359  0.0006  255 TYR A CB  
2145 C CG  . TYR A 273 ? 0.3580 0.3210 0.2104 -0.0543 0.0289  0.0069  255 TYR A CG  
2146 C CD1 . TYR A 273 ? 0.3636 0.3358 0.2064 -0.0612 0.0251  0.0073  255 TYR A CD1 
2147 C CD2 . TYR A 273 ? 0.3301 0.3015 0.1924 -0.0456 0.0266  0.0131  255 TYR A CD2 
2148 C CE1 . TYR A 273 ? 0.3524 0.3427 0.1973 -0.0580 0.0196  0.0151  255 TYR A CE1 
2149 C CE2 . TYR A 273 ? 0.3277 0.3140 0.1907 -0.0421 0.0221  0.0197  255 TYR A CE2 
2150 C CZ  . TYR A 273 ? 0.3565 0.3529 0.2118 -0.0477 0.0186  0.0215  255 TYR A CZ  
2151 O OH  . TYR A 273 ? 0.3375 0.3506 0.1948 -0.0428 0.0148  0.0301  255 TYR A OH  
2152 N N   . THR A 274 ? 0.3512 0.2872 0.2126 -0.0386 0.0433  0.0035  256 THR A N   
2153 C CA  . THR A 274 ? 0.3466 0.2850 0.2122 -0.0323 0.0432  0.0071  256 THR A CA  
2154 C C   . THR A 274 ? 0.3543 0.2883 0.2127 -0.0326 0.0461  0.0054  256 THR A C   
2155 O O   . THR A 274 ? 0.3638 0.3007 0.2194 -0.0308 0.0439  0.0081  256 THR A O   
2156 C CB  . THR A 274 ? 0.3425 0.2800 0.2189 -0.0282 0.0462  0.0094  256 THR A CB  
2157 O OG1 . THR A 274 ? 0.3687 0.3108 0.2517 -0.0282 0.0438  0.0113  256 THR A OG1 
2158 C CG2 . THR A 274 ? 0.3293 0.2704 0.2082 -0.0246 0.0453  0.0129  256 THR A CG2 
2159 N N   . ASP A 275 ? 0.3539 0.2798 0.2089 -0.0346 0.0520  0.0012  257 ASP A N   
2160 C CA  . ASP A 275 ? 0.3677 0.2903 0.2156 -0.0349 0.0558  -0.0005 257 ASP A CA  
2161 C C   . ASP A 275 ? 0.3726 0.2992 0.2092 -0.0394 0.0516  -0.0013 257 ASP A C   
2162 O O   . ASP A 275 ? 0.3660 0.2951 0.1997 -0.0380 0.0510  0.0012  257 ASP A O   
2163 C CB  . ASP A 275 ? 0.3657 0.2777 0.2113 -0.0351 0.0645  -0.0050 257 ASP A CB  
2164 C CG  . ASP A 275 ? 0.4088 0.3189 0.2489 -0.0338 0.0698  -0.0058 257 ASP A CG  
2165 O OD1 . ASP A 275 ? 0.4284 0.3460 0.2703 -0.0321 0.0671  -0.0015 257 ASP A OD1 
2166 O OD2 . ASP A 275 ? 0.4598 0.3596 0.2923 -0.0351 0.0773  -0.0111 257 ASP A OD2 
2167 N N   . LYS A 276 ? 0.3769 0.3059 0.2077 -0.0452 0.0482  -0.0035 258 LYS A N   
2168 C CA  . LYS A 276 ? 0.3948 0.3321 0.2159 -0.0496 0.0435  -0.0022 258 LYS A CA  
2169 C C   . LYS A 276 ? 0.3798 0.3266 0.2058 -0.0439 0.0383  0.0057  258 LYS A C   
2170 O O   . LYS A 276 ? 0.3769 0.3268 0.1976 -0.0431 0.0373  0.0089  258 LYS A O   
2171 C CB  . LYS A 276 ? 0.4099 0.3527 0.2252 -0.0582 0.0397  -0.0043 258 LYS A CB  
2172 C CG  . LYS A 276 ? 0.4885 0.4196 0.2928 -0.0672 0.0446  -0.0132 258 LYS A CG  
2173 C CD  . LYS A 276 ? 0.6105 0.5323 0.4036 -0.0686 0.0511  -0.0184 258 LYS A CD  
2174 C CE  . LYS A 276 ? 0.6713 0.5887 0.4461 -0.0816 0.0522  -0.0262 258 LYS A CE  
2175 N NZ  . LYS A 276 ? 0.7283 0.6412 0.5017 -0.0896 0.0510  -0.0298 258 LYS A NZ  
2176 N N   . ILE A 277 ? 0.3641 0.3145 0.1991 -0.0400 0.0356  0.0090  259 ILE A N   
2177 C CA  . ILE A 277 ? 0.3615 0.3179 0.1999 -0.0336 0.0321  0.0161  259 ILE A CA  
2178 C C   . ILE A 277 ? 0.3613 0.3097 0.2000 -0.0290 0.0348  0.0176  259 ILE A C   
2179 O O   . ILE A 277 ? 0.3711 0.3199 0.2054 -0.0265 0.0338  0.0222  259 ILE A O   
2180 C CB  . ILE A 277 ? 0.3390 0.3001 0.1863 -0.0303 0.0300  0.0184  259 ILE A CB  
2181 C CG1 . ILE A 277 ? 0.3316 0.3041 0.1784 -0.0359 0.0262  0.0190  259 ILE A CG1 
2182 C CG2 . ILE A 277 ? 0.3498 0.3118 0.1995 -0.0222 0.0291  0.0244  259 ILE A CG2 
2183 C CD1 . ILE A 277 ? 0.3320 0.3180 0.1732 -0.0371 0.0222  0.0247  259 ILE A CD1 
2184 N N   . MET A 278 ? 0.3555 0.2973 0.1992 -0.0285 0.0382  0.0148  260 MET A N   
2185 C CA  . MET A 278 ? 0.3539 0.2899 0.1977 -0.0267 0.0405  0.0163  260 MET A CA  
2186 C C   . MET A 278 ? 0.3783 0.3124 0.2147 -0.0291 0.0426  0.0163  260 MET A C   
2187 O O   . MET A 278 ? 0.3859 0.3165 0.2191 -0.0282 0.0425  0.0197  260 MET A O   
2188 C CB  . MET A 278 ? 0.3489 0.2836 0.2009 -0.0266 0.0434  0.0147  260 MET A CB  
2189 C CG  . MET A 278 ? 0.3513 0.2886 0.2108 -0.0242 0.0414  0.0157  260 MET A CG  
2190 S SD  . MET A 278 ? 0.4015 0.3360 0.2583 -0.0213 0.0391  0.0190  260 MET A SD  
2191 C CE  . MET A 278 ? 0.3722 0.3030 0.2284 -0.0247 0.0415  0.0197  260 MET A CE  
2192 N N   . THR A 279 ? 0.3898 0.3248 0.2222 -0.0326 0.0450  0.0124  261 THR A N   
2193 C CA  . THR A 279 ? 0.3955 0.3302 0.2196 -0.0350 0.0471  0.0125  261 THR A CA  
2194 C C   . THR A 279 ? 0.3994 0.3380 0.2171 -0.0346 0.0429  0.0177  261 THR A C   
2195 O O   . THR A 279 ? 0.4099 0.3465 0.2237 -0.0342 0.0435  0.0215  261 THR A O   
2196 C CB  . THR A 279 ? 0.4026 0.3366 0.2203 -0.0393 0.0505  0.0065  261 THR A CB  
2197 O OG1 . THR A 279 ? 0.3957 0.3243 0.2198 -0.0378 0.0559  0.0028  261 THR A OG1 
2198 C CG2 . THR A 279 ? 0.4005 0.3356 0.2081 -0.0421 0.0529  0.0065  261 THR A CG2 
2199 N N   . TYR A 280 ? 0.4015 0.3466 0.2185 -0.0348 0.0388  0.0190  262 TYR A N   
2200 C CA  . TYR A 280 ? 0.4125 0.3642 0.2259 -0.0325 0.0351  0.0262  262 TYR A CA  
2201 C C   . TYR A 280 ? 0.4119 0.3558 0.2280 -0.0259 0.0356  0.0317  262 TYR A C   
2202 O O   . TYR A 280 ? 0.4223 0.3644 0.2333 -0.0243 0.0359  0.0372  262 TYR A O   
2203 C CB  . TYR A 280 ? 0.4190 0.3826 0.2339 -0.0334 0.0308  0.0281  262 TYR A CB  
2204 C CG  . TYR A 280 ? 0.4498 0.4227 0.2643 -0.0281 0.0276  0.0383  262 TYR A CG  
2205 C CD1 . TYR A 280 ? 0.4508 0.4331 0.2579 -0.0300 0.0259  0.0438  262 TYR A CD1 
2206 C CD2 . TYR A 280 ? 0.4369 0.4097 0.2583 -0.0203 0.0270  0.0430  262 TYR A CD2 
2207 C CE1 . TYR A 280 ? 0.4944 0.4864 0.3027 -0.0233 0.0238  0.0555  262 TYR A CE1 
2208 C CE2 . TYR A 280 ? 0.4485 0.4290 0.2702 -0.0134 0.0258  0.0533  262 TYR A CE2 
2209 C CZ  . TYR A 280 ? 0.4550 0.4453 0.2710 -0.0144 0.0243  0.0600  262 TYR A CZ  
2210 O OH  . TYR A 280 ? 0.5100 0.5086 0.3281 -0.0054 0.0239  0.0721  262 TYR A OH  
2211 N N   . LEU A 281 ? 0.3904 0.3287 0.2132 -0.0229 0.0362  0.0302  263 LEU A N   
2212 C CA  . LEU A 281 ? 0.3974 0.3254 0.2195 -0.0181 0.0374  0.0340  263 LEU A CA  
2213 C C   . LEU A 281 ? 0.4051 0.3226 0.2222 -0.0209 0.0402  0.0344  263 LEU A C   
2214 O O   . LEU A 281 ? 0.4209 0.3278 0.2332 -0.0183 0.0415  0.0384  263 LEU A O   
2215 C CB  . LEU A 281 ? 0.3787 0.3035 0.2069 -0.0157 0.0375  0.0316  263 LEU A CB  
2216 C CG  . LEU A 281 ? 0.3761 0.3106 0.2099 -0.0122 0.0351  0.0326  263 LEU A CG  
2217 C CD1 . LEU A 281 ? 0.3664 0.2977 0.2061 -0.0114 0.0358  0.0293  263 LEU A CD1 
2218 C CD2 . LEU A 281 ? 0.4009 0.3386 0.2322 -0.0054 0.0345  0.0401  263 LEU A CD2 
2219 N N   . PHE A 282 ? 0.3891 0.3093 0.2071 -0.0262 0.0417  0.0305  264 PHE A N   
2220 C CA  . PHE A 282 ? 0.4019 0.3166 0.2167 -0.0299 0.0442  0.0316  264 PHE A CA  
2221 C C   . PHE A 282 ? 0.4148 0.3339 0.2231 -0.0321 0.0450  0.0337  264 PHE A C   
2222 O O   . PHE A 282 ? 0.4329 0.3500 0.2385 -0.0357 0.0473  0.0351  264 PHE A O   
2223 C CB  . PHE A 282 ? 0.3868 0.3042 0.2083 -0.0333 0.0463  0.0278  264 PHE A CB  
2224 C CG  . PHE A 282 ? 0.3857 0.2993 0.2118 -0.0330 0.0456  0.0270  264 PHE A CG  
2225 C CD1 . PHE A 282 ? 0.3827 0.2901 0.2063 -0.0374 0.0462  0.0287  264 PHE A CD1 
2226 C CD2 . PHE A 282 ? 0.3656 0.2823 0.1975 -0.0296 0.0440  0.0246  264 PHE A CD2 
2227 C CE1 . PHE A 282 ? 0.3593 0.2638 0.1849 -0.0386 0.0454  0.0275  264 PHE A CE1 
2228 C CE2 . PHE A 282 ? 0.3858 0.3002 0.2210 -0.0296 0.0434  0.0241  264 PHE A CE2 
2229 C CZ  . PHE A 282 ? 0.3766 0.2851 0.2083 -0.0342 0.0441  0.0252  264 PHE A CZ  
2230 N N   . ASP A 283 ? 0.4150 0.3420 0.2204 -0.0310 0.0429  0.0346  265 ASP A N   
2231 C CA  . ASP A 283 ? 0.4383 0.3714 0.2363 -0.0341 0.0435  0.0364  265 ASP A CA  
2232 C C   . ASP A 283 ? 0.4447 0.3737 0.2369 -0.0320 0.0431  0.0451  265 ASP A C   
2233 O O   . ASP A 283 ? 0.4455 0.3794 0.2356 -0.0284 0.0406  0.0510  265 ASP A O   
2234 C CB  . ASP A 283 ? 0.4417 0.3862 0.2367 -0.0361 0.0412  0.0340  265 ASP A CB  
2235 C CG  . ASP A 283 ? 0.4950 0.4470 0.2803 -0.0406 0.0418  0.0353  265 ASP A CG  
2236 O OD1 . ASP A 283 ? 0.5265 0.4758 0.3083 -0.0427 0.0454  0.0354  265 ASP A OD1 
2237 O OD2 . ASP A 283 ? 0.5505 0.5135 0.3313 -0.0428 0.0384  0.0367  265 ASP A OD2 
2238 N N   . PHE A 284 ? 0.4507 0.3717 0.2409 -0.0346 0.0457  0.0466  266 PHE A N   
2239 C CA  . PHE A 284 ? 0.4597 0.3734 0.2434 -0.0340 0.0465  0.0548  266 PHE A CA  
2240 C C   . PHE A 284 ? 0.4717 0.3885 0.2522 -0.0402 0.0491  0.0547  266 PHE A C   
2241 O O   . PHE A 284 ? 0.4641 0.3851 0.2489 -0.0435 0.0509  0.0489  266 PHE A O   
2242 C CB  . PHE A 284 ? 0.4645 0.3604 0.2479 -0.0322 0.0478  0.0569  266 PHE A CB  
2243 C CG  . PHE A 284 ? 0.4680 0.3600 0.2542 -0.0248 0.0466  0.0573  266 PHE A CG  
2244 C CD1 . PHE A 284 ? 0.4748 0.3647 0.2578 -0.0174 0.0467  0.0657  266 PHE A CD1 
2245 C CD2 . PHE A 284 ? 0.4427 0.3343 0.2351 -0.0247 0.0460  0.0507  266 PHE A CD2 
2246 C CE1 . PHE A 284 ? 0.4583 0.3467 0.2447 -0.0095 0.0465  0.0671  266 PHE A CE1 
2247 C CE2 . PHE A 284 ? 0.4752 0.3648 0.2702 -0.0177 0.0452  0.0514  266 PHE A CE2 
2248 C CZ  . PHE A 284 ? 0.4608 0.3494 0.2530 -0.0100 0.0457  0.0595  266 PHE A CZ  
2249 N N   . PRO A 285 ? 0.4915 0.4073 0.2651 -0.0412 0.0497  0.0623  267 PRO A N   
2250 C CA  . PRO A 285 ? 0.5056 0.4264 0.2761 -0.0472 0.0523  0.0629  267 PRO A CA  
2251 C C   . PRO A 285 ? 0.5162 0.4271 0.2886 -0.0520 0.0545  0.0633  267 PRO A C   
2252 O O   . PRO A 285 ? 0.5509 0.4628 0.3197 -0.0570 0.0564  0.0678  267 PRO A O   
2253 C CB  . PRO A 285 ? 0.5182 0.4416 0.2809 -0.0465 0.0518  0.0722  267 PRO A CB  
2254 C CG  . PRO A 285 ? 0.5307 0.4422 0.2930 -0.0401 0.0504  0.0784  267 PRO A CG  
2255 C CD  . PRO A 285 ? 0.4969 0.4083 0.2659 -0.0361 0.0486  0.0717  267 PRO A CD  
2256 N N   . HIS A 286 ? 0.5010 0.4043 0.2787 -0.0516 0.0538  0.0592  268 HIS A N   
2257 C CA  . HIS A 286 ? 0.5052 0.4004 0.2837 -0.0581 0.0549  0.0595  268 HIS A CA  
2258 C C   . HIS A 286 ? 0.4889 0.3845 0.2751 -0.0574 0.0539  0.0532  268 HIS A C   
2259 O O   . HIS A 286 ? 0.4714 0.3700 0.2615 -0.0512 0.0525  0.0492  268 HIS A O   
2260 C CB  . HIS A 286 ? 0.5216 0.3962 0.2910 -0.0600 0.0554  0.0653  268 HIS A CB  
2261 C CG  . HIS A 286 ? 0.5318 0.3930 0.2987 -0.0521 0.0547  0.0655  268 HIS A CG  
2262 N ND1 . HIS A 286 ? 0.5778 0.4322 0.3476 -0.0505 0.0541  0.0600  268 HIS A ND1 
2263 C CD2 . HIS A 286 ? 0.5370 0.3922 0.2993 -0.0446 0.0551  0.0716  268 HIS A CD2 
2264 C CE1 . HIS A 286 ? 0.5584 0.4025 0.3253 -0.0420 0.0546  0.0622  268 HIS A CE1 
2265 N NE2 . HIS A 286 ? 0.5731 0.4181 0.3361 -0.0379 0.0552  0.0697  268 HIS A NE2 
2266 N N   . GLY A 287 ? 0.4880 0.3817 0.2757 -0.0647 0.0544  0.0532  269 GLY A N   
2267 C CA  . GLY A 287 ? 0.4851 0.3800 0.2792 -0.0654 0.0532  0.0487  269 GLY A CA  
2268 C C   . GLY A 287 ? 0.5077 0.3825 0.2944 -0.0657 0.0521  0.0478  269 GLY A C   
2269 O O   . GLY A 287 ? 0.5204 0.3833 0.3014 -0.0591 0.0523  0.0490  269 GLY A O   
2270 N N   . PRO A 288 ? 0.5093 0.3801 0.2948 -0.0737 0.0515  0.0463  270 PRO A N   
2271 C CA  . PRO A 288 ? 0.5289 0.3781 0.3047 -0.0748 0.0517  0.0439  270 PRO A CA  
2272 C C   . PRO A 288 ? 0.5578 0.3833 0.3202 -0.0732 0.0544  0.0474  270 PRO A C   
2273 O O   . PRO A 288 ? 0.5915 0.4013 0.3486 -0.0655 0.0561  0.0464  270 PRO A O   
2274 C CB  . PRO A 288 ? 0.5341 0.3849 0.3077 -0.0882 0.0507  0.0431  270 PRO A CB  
2275 C CG  . PRO A 288 ? 0.5203 0.3986 0.3084 -0.0892 0.0494  0.0444  270 PRO A CG  
2276 C CD  . PRO A 288 ? 0.4988 0.3858 0.2910 -0.0827 0.0510  0.0475  270 PRO A CD  
2277 N N   . LYS A 289 ? 0.5605 0.3832 0.3176 -0.0799 0.0555  0.0524  271 LYS A N   
2278 C CA  . LYS A 289 ? 0.5691 0.3690 0.3139 -0.0779 0.0588  0.0574  271 LYS A CA  
2279 C C   . LYS A 289 ? 0.5468 0.3583 0.2939 -0.0766 0.0589  0.0641  271 LYS A C   
2280 O O   . LYS A 289 ? 0.5139 0.3475 0.2692 -0.0808 0.0572  0.0643  271 LYS A O   
2281 C CB  . LYS A 289 ? 0.6086 0.3839 0.3387 -0.0905 0.0611  0.0570  271 LYS A CB  
2282 C CG  . LYS A 289 ? 0.6330 0.4214 0.3645 -0.1059 0.0591  0.0586  271 LYS A CG  
2283 C CD  . LYS A 289 ? 0.6983 0.4650 0.4146 -0.1220 0.0603  0.0567  271 LYS A CD  
2284 C CE  . LYS A 289 ? 0.6931 0.4774 0.4118 -0.1379 0.0581  0.0617  271 LYS A CE  
2285 N NZ  . LYS A 289 ? 0.6561 0.4224 0.3591 -0.1576 0.0584  0.0611  271 LYS A NZ  
2286 N N   . PRO A 290 ? 0.5482 0.3458 0.2881 -0.0699 0.0614  0.0704  272 PRO A N   
2287 C CA  . PRO A 290 ? 0.5372 0.3446 0.2771 -0.0694 0.0616  0.0778  272 PRO A CA  
2288 C C   . PRO A 290 ? 0.5210 0.3348 0.2596 -0.0830 0.0615  0.0797  272 PRO A C   
2289 O O   . PRO A 290 ? 0.5281 0.3263 0.2591 -0.0938 0.0626  0.0791  272 PRO A O   
2290 C CB  . PRO A 290 ? 0.5616 0.3449 0.2909 -0.0631 0.0655  0.0854  272 PRO A CB  
2291 C CG  . PRO A 290 ? 0.5557 0.3270 0.2848 -0.0535 0.0667  0.0815  272 PRO A CG  
2292 C CD  . PRO A 290 ? 0.5653 0.3374 0.2965 -0.0616 0.0650  0.0718  272 PRO A CD  
2293 N N   . GLY A 291 ? 0.5037 0.3411 0.2490 -0.0830 0.0605  0.0819  273 GLY A N   
2294 C CA  . GLY A 291 ? 0.4896 0.3389 0.2358 -0.0942 0.0610  0.0851  273 GLY A CA  
2295 C C   . GLY A 291 ? 0.4787 0.3493 0.2360 -0.0983 0.0597  0.0799  273 GLY A C   
2296 O O   . GLY A 291 ? 0.4652 0.3541 0.2270 -0.1041 0.0607  0.0830  273 GLY A O   
2297 N N   . SER A 292 ? 0.4633 0.3332 0.2256 -0.0946 0.0582  0.0731  274 SER A N   
2298 C CA  . SER A 292 ? 0.4571 0.3474 0.2310 -0.0971 0.0574  0.0696  274 SER A CA  
2299 C C   . SER A 292 ? 0.4544 0.3628 0.2378 -0.0867 0.0584  0.0664  274 SER A C   
2300 O O   . SER A 292 ? 0.4619 0.3651 0.2430 -0.0778 0.0580  0.0642  274 SER A O   
2301 C CB  . SER A 292 ? 0.4491 0.3306 0.2232 -0.0998 0.0554  0.0646  274 SER A CB  
2302 O OG  . SER A 292 ? 0.4427 0.3198 0.2196 -0.0886 0.0547  0.0592  274 SER A OG  
2303 N N   . SER A 293 ? 0.4474 0.3768 0.2407 -0.0878 0.0603  0.0664  275 SER A N   
2304 C CA  . SER A 293 ? 0.4343 0.3767 0.2344 -0.0785 0.0628  0.0624  275 SER A CA  
2305 C C   . SER A 293 ? 0.4292 0.3653 0.2326 -0.0711 0.0608  0.0556  275 SER A C   
2306 O O   . SER A 293 ? 0.4259 0.3583 0.2328 -0.0730 0.0586  0.0540  275 SER A O   
2307 C CB  . SER A 293 ? 0.4299 0.3937 0.2405 -0.0791 0.0668  0.0644  275 SER A CB  
2308 O OG  . SER A 293 ? 0.4694 0.4430 0.2784 -0.0853 0.0692  0.0712  275 SER A OG  
2309 N N   . HIS A 294 ? 0.4203 0.3570 0.2222 -0.0638 0.0616  0.0518  276 HIS A N   
2310 C CA  . HIS A 294 ? 0.4130 0.3470 0.2189 -0.0576 0.0601  0.0458  276 HIS A CA  
2311 C C   . HIS A 294 ? 0.4066 0.3516 0.2239 -0.0564 0.0627  0.0436  276 HIS A C   
2312 O O   . HIS A 294 ? 0.3936 0.3508 0.2151 -0.0567 0.0674  0.0455  276 HIS A O   
2313 C CB  . HIS A 294 ? 0.4103 0.3458 0.2115 -0.0528 0.0605  0.0426  276 HIS A CB  
2314 C CG  . HIS A 294 ? 0.4110 0.3450 0.2161 -0.0479 0.0590  0.0368  276 HIS A CG  
2315 N ND1 . HIS A 294 ? 0.4208 0.3607 0.2318 -0.0455 0.0624  0.0317  276 HIS A ND1 
2316 C CD2 . HIS A 294 ? 0.4092 0.3365 0.2132 -0.0450 0.0549  0.0359  276 HIS A CD2 
2317 C CE1 . HIS A 294 ? 0.4155 0.3520 0.2285 -0.0425 0.0599  0.0277  276 HIS A CE1 
2318 N NE2 . HIS A 294 ? 0.4178 0.3481 0.2271 -0.0421 0.0551  0.0303  276 HIS A NE2 
2319 N N   . ARG A 295 ? 0.3934 0.3352 0.2160 -0.0546 0.0603  0.0409  277 ARG A N   
2320 C CA  . ARG A 295 ? 0.4096 0.3619 0.2436 -0.0516 0.0631  0.0396  277 ARG A CA  
2321 C C   . ARG A 295 ? 0.3920 0.3393 0.2285 -0.0457 0.0620  0.0339  277 ARG A C   
2322 O O   . ARG A 295 ? 0.3938 0.3314 0.2251 -0.0449 0.0579  0.0318  277 ARG A O   
2323 C CB  . ARG A 295 ? 0.4070 0.3674 0.2482 -0.0570 0.0619  0.0442  277 ARG A CB  
2324 C CG  . ARG A 295 ? 0.4655 0.4166 0.2991 -0.0654 0.0575  0.0463  277 ARG A CG  
2325 C CD  . ARG A 295 ? 0.5227 0.4864 0.3631 -0.0726 0.0566  0.0508  277 ARG A CD  
2326 N NE  . ARG A 295 ? 0.5499 0.5017 0.3821 -0.0810 0.0523  0.0502  277 ARG A NE  
2327 C CZ  . ARG A 295 ? 0.5740 0.5237 0.4077 -0.0817 0.0497  0.0476  277 ARG A CZ  
2328 N NH1 . ARG A 295 ? 0.4904 0.4501 0.3353 -0.0742 0.0503  0.0462  277 ARG A NH1 
2329 N NH2 . ARG A 295 ? 0.5775 0.5134 0.4000 -0.0905 0.0470  0.0463  277 ARG A NH2 
2330 N N   . PRO A 296 ? 0.3900 0.3439 0.2344 -0.0411 0.0664  0.0319  278 PRO A N   
2331 C CA  . PRO A 296 ? 0.3808 0.3295 0.2272 -0.0365 0.0661  0.0266  278 PRO A CA  
2332 C C   . PRO A 296 ? 0.3616 0.3075 0.2115 -0.0373 0.0606  0.0270  278 PRO A C   
2333 O O   . PRO A 296 ? 0.3593 0.3101 0.2135 -0.0406 0.0592  0.0311  278 PRO A O   
2334 C CB  . PRO A 296 ? 0.3752 0.3313 0.2313 -0.0321 0.0730  0.0273  278 PRO A CB  
2335 C CG  . PRO A 296 ? 0.3926 0.3561 0.2479 -0.0328 0.0780  0.0309  278 PRO A CG  
2336 C CD  . PRO A 296 ? 0.3891 0.3553 0.2411 -0.0396 0.0729  0.0356  278 PRO A CD  
2337 N N   . TRP A 297 ? 0.3622 0.3015 0.2097 -0.0350 0.0577  0.0232  279 TRP A N   
2338 C CA  . TRP A 297 ? 0.3418 0.2789 0.1924 -0.0346 0.0535  0.0234  279 TRP A CA  
2339 C C   . TRP A 297 ? 0.3253 0.2706 0.1869 -0.0344 0.0547  0.0257  279 TRP A C   
2340 O O   . TRP A 297 ? 0.3146 0.2608 0.1772 -0.0372 0.0517  0.0275  279 TRP A O   
2341 C CB  . TRP A 297 ? 0.3437 0.2766 0.1921 -0.0316 0.0509  0.0199  279 TRP A CB  
2342 C CG  . TRP A 297 ? 0.3499 0.2847 0.2033 -0.0295 0.0533  0.0166  279 TRP A CG  
2343 C CD1 . TRP A 297 ? 0.3586 0.2914 0.2072 -0.0299 0.0561  0.0128  279 TRP A CD1 
2344 C CD2 . TRP A 297 ? 0.3521 0.2895 0.2149 -0.0274 0.0536  0.0165  279 TRP A CD2 
2345 N NE1 . TRP A 297 ? 0.3523 0.2834 0.2057 -0.0285 0.0587  0.0099  279 TRP A NE1 
2346 C CE2 . TRP A 297 ? 0.3597 0.2942 0.2228 -0.0264 0.0571  0.0127  279 TRP A CE2 
2347 C CE3 . TRP A 297 ? 0.3513 0.2926 0.2210 -0.0270 0.0515  0.0193  279 TRP A CE3 
2348 C CZ2 . TRP A 297 ? 0.3547 0.2893 0.2259 -0.0244 0.0587  0.0125  279 TRP A CZ2 
2349 C CZ3 . TRP A 297 ? 0.3190 0.2634 0.1974 -0.0247 0.0525  0.0195  279 TRP A CZ3 
2350 C CH2 . TRP A 297 ? 0.3330 0.2737 0.2127 -0.0230 0.0563  0.0166  279 TRP A CH2 
2351 N N   . GLN A 298 ? 0.3160 0.2673 0.1852 -0.0311 0.0597  0.0259  280 GLN A N   
2352 C CA  . GLN A 298 ? 0.3082 0.2693 0.1895 -0.0294 0.0614  0.0300  280 GLN A CA  
2353 C C   . GLN A 298 ? 0.3236 0.2963 0.2083 -0.0344 0.0603  0.0363  280 GLN A C   
2354 O O   . GLN A 298 ? 0.3363 0.3184 0.2284 -0.0358 0.0587  0.0403  280 GLN A O   
2355 C CB  . GLN A 298 ? 0.3103 0.2739 0.1984 -0.0236 0.0691  0.0305  280 GLN A CB  
2356 C CG  . GLN A 298 ? 0.3087 0.2605 0.1935 -0.0206 0.0706  0.0241  280 GLN A CG  
2357 C CD  . GLN A 298 ? 0.3593 0.3021 0.2324 -0.0216 0.0732  0.0185  280 GLN A CD  
2358 O OE1 . GLN A 298 ? 0.3212 0.2649 0.1872 -0.0248 0.0711  0.0188  280 GLN A OE1 
2359 N NE2 . GLN A 298 ? 0.3689 0.3025 0.2388 -0.0198 0.0777  0.0134  280 GLN A NE2 
2360 N N   . SER A 299 ? 0.3240 0.2971 0.2028 -0.0384 0.0609  0.0378  281 SER A N   
2361 C CA  . SER A 299 ? 0.3314 0.3167 0.2124 -0.0455 0.0597  0.0444  281 SER A CA  
2362 C C   . SER A 299 ? 0.3297 0.3096 0.2041 -0.0533 0.0534  0.0436  281 SER A C   
2363 O O   . SER A 299 ? 0.3303 0.3207 0.2059 -0.0614 0.0515  0.0485  281 SER A O   
2364 C CB  . SER A 299 ? 0.3323 0.3188 0.2078 -0.0488 0.0620  0.0464  281 SER A CB  
2365 O OG  . SER A 299 ? 0.3578 0.3286 0.2198 -0.0530 0.0583  0.0427  281 SER A OG  
2366 N N   . TYR A 300 ? 0.3315 0.2958 0.1982 -0.0512 0.0506  0.0377  282 TYR A N   
2367 C CA  . TYR A 300 ? 0.3460 0.3015 0.2042 -0.0571 0.0465  0.0360  282 TYR A CA  
2368 C C   . TYR A 300 ? 0.3496 0.3134 0.2146 -0.0572 0.0446  0.0366  282 TYR A C   
2369 O O   . TYR A 300 ? 0.3504 0.3079 0.2076 -0.0627 0.0418  0.0348  282 TYR A O   
2370 C CB  . TYR A 300 ? 0.3516 0.2879 0.1988 -0.0535 0.0455  0.0311  282 TYR A CB  
2371 C CG  . TYR A 300 ? 0.3622 0.2899 0.2006 -0.0554 0.0466  0.0319  282 TYR A CG  
2372 C CD1 . TYR A 300 ? 0.3503 0.2651 0.1767 -0.0624 0.0457  0.0325  282 TYR A CD1 
2373 C CD2 . TYR A 300 ? 0.3343 0.2657 0.1750 -0.0507 0.0490  0.0320  282 TYR A CD2 
2374 C CE1 . TYR A 300 ? 0.4082 0.3148 0.2267 -0.0640 0.0470  0.0344  282 TYR A CE1 
2375 C CE2 . TYR A 300 ? 0.3689 0.2940 0.2011 -0.0526 0.0499  0.0336  282 TYR A CE2 
2376 C CZ  . TYR A 300 ? 0.3662 0.2800 0.1886 -0.0589 0.0488  0.0354  282 TYR A CZ  
2377 O OH  . TYR A 300 ? 0.4332 0.3408 0.2478 -0.0608 0.0498  0.0381  282 TYR A OH  
2378 N N   . PHE A 301 ? 0.3464 0.3228 0.2247 -0.0510 0.0468  0.0391  283 PHE A N   
2379 C CA  . PHE A 301 ? 0.3447 0.3298 0.2306 -0.0498 0.0454  0.0407  283 PHE A CA  
2380 C C   . PHE A 301 ? 0.3517 0.3592 0.2516 -0.0502 0.0473  0.0493  283 PHE A C   
2381 O O   . PHE A 301 ? 0.3621 0.3765 0.2702 -0.0449 0.0522  0.0529  283 PHE A O   
2382 C CB  . PHE A 301 ? 0.3352 0.3133 0.2246 -0.0410 0.0464  0.0369  283 PHE A CB  
2383 C CG  . PHE A 301 ? 0.3334 0.2947 0.2116 -0.0396 0.0444  0.0307  283 PHE A CG  
2384 C CD1 . PHE A 301 ? 0.3052 0.2612 0.1785 -0.0401 0.0416  0.0284  283 PHE A CD1 
2385 C CD2 . PHE A 301 ? 0.3509 0.3032 0.2233 -0.0373 0.0459  0.0281  283 PHE A CD2 
2386 C CE1 . PHE A 301 ? 0.2919 0.2341 0.1558 -0.0372 0.0407  0.0244  283 PHE A CE1 
2387 C CE2 . PHE A 301 ? 0.3226 0.2624 0.1856 -0.0353 0.0440  0.0246  283 PHE A CE2 
2388 C CZ  . PHE A 301 ? 0.3255 0.2605 0.1851 -0.0345 0.0418  0.0232  283 PHE A CZ  
2389 N N   . ASP A 302 ? 0.3476 0.3667 0.2495 -0.0561 0.0440  0.0528  284 ASP A N   
2390 C CA  . ASP A 302 ? 0.3494 0.3939 0.2659 -0.0564 0.0451  0.0630  284 ASP A CA  
2391 C C   . ASP A 302 ? 0.3265 0.3746 0.2555 -0.0458 0.0482  0.0654  284 ASP A C   
2392 O O   . ASP A 302 ? 0.3184 0.3848 0.2618 -0.0413 0.0518  0.0748  284 ASP A O   
2393 C CB  . ASP A 302 ? 0.3607 0.4177 0.2727 -0.0688 0.0397  0.0662  284 ASP A CB  
2394 C CG  . ASP A 302 ? 0.4119 0.4667 0.3117 -0.0815 0.0373  0.0654  284 ASP A CG  
2395 O OD1 . ASP A 302 ? 0.4224 0.4951 0.3295 -0.0847 0.0387  0.0734  284 ASP A OD1 
2396 O OD2 . ASP A 302 ? 0.4078 0.4422 0.2905 -0.0880 0.0347  0.0572  284 ASP A OD2 
2397 N N   . LEU A 303 ? 0.3112 0.3420 0.2349 -0.0415 0.0472  0.0577  285 LEU A N   
2398 C CA  . LEU A 303 ? 0.2948 0.3265 0.2286 -0.0331 0.0499  0.0593  285 LEU A CA  
2399 C C   . LEU A 303 ? 0.2927 0.3032 0.2184 -0.0292 0.0496  0.0499  285 LEU A C   
2400 O O   . LEU A 303 ? 0.2859 0.2872 0.2009 -0.0328 0.0455  0.0443  285 LEU A O   
2401 C CB  . LEU A 303 ? 0.2762 0.3226 0.2151 -0.0363 0.0463  0.0645  285 LEU A CB  
2402 C CG  . LEU A 303 ? 0.2980 0.3495 0.2492 -0.0287 0.0487  0.0691  285 LEU A CG  
2403 C CD1 . LEU A 303 ? 0.2890 0.3640 0.2480 -0.0328 0.0458  0.0785  285 LEU A CD1 
2404 C CD2 . LEU A 303 ? 0.2672 0.3010 0.2122 -0.0258 0.0474  0.0608  285 LEU A CD2 
2405 N N   . ILE A 304 ? 0.2832 0.2865 0.2136 -0.0221 0.0546  0.0488  286 ILE A N   
2406 C CA  . ILE A 304 ? 0.2873 0.2742 0.2108 -0.0200 0.0541  0.0410  286 ILE A CA  
2407 C C   . ILE A 304 ? 0.2878 0.2746 0.2196 -0.0157 0.0560  0.0428  286 ILE A C   
2408 O O   . ILE A 304 ? 0.2968 0.2875 0.2383 -0.0110 0.0618  0.0481  286 ILE A O   
2409 C CB  . ILE A 304 ? 0.3018 0.2776 0.2196 -0.0181 0.0583  0.0366  286 ILE A CB  
2410 C CG1 . ILE A 304 ? 0.3022 0.2792 0.2125 -0.0226 0.0568  0.0363  286 ILE A CG1 
2411 C CG2 . ILE A 304 ? 0.2991 0.2615 0.2095 -0.0178 0.0570  0.0295  286 ILE A CG2 
2412 C CD1 . ILE A 304 ? 0.3015 0.2723 0.2071 -0.0211 0.0616  0.0339  286 ILE A CD1 
2413 N N   . LEU A 305 ? 0.3967 0.2916 0.1901 -0.0244 0.0413  0.0189  287 LEU A N   
2414 C CA  . LEU A 305 ? 0.3821 0.2806 0.1805 -0.0230 0.0363  0.0179  287 LEU A CA  
2415 C C   . LEU A 305 ? 0.3894 0.2800 0.1750 -0.0242 0.0287  0.0156  287 LEU A C   
2416 O O   . LEU A 305 ? 0.3958 0.2881 0.1798 -0.0256 0.0223  0.0161  287 LEU A O   
2417 C CB  . LEU A 305 ? 0.3669 0.2800 0.1825 -0.0225 0.0320  0.0197  287 LEU A CB  
2418 C CG  . LEU A 305 ? 0.3817 0.2968 0.2022 -0.0204 0.0296  0.0198  287 LEU A CG  
2419 C CD1 . LEU A 305 ? 0.3572 0.2838 0.1922 -0.0176 0.0290  0.0224  287 LEU A CD1 
2420 C CD2 . LEU A 305 ? 0.3954 0.3086 0.2118 -0.0227 0.0226  0.0187  287 LEU A CD2 
2421 N N   . VAL A 306 ? 0.3780 0.2605 0.1565 -0.0236 0.0294  0.0126  288 VAL A N   
2422 C CA  . VAL A 306 ? 0.3855 0.2606 0.1538 -0.0250 0.0218  0.0088  288 VAL A CA  
2423 C C   . VAL A 306 ? 0.3714 0.2512 0.1517 -0.0256 0.0195  0.0070  288 VAL A C   
2424 O O   . VAL A 306 ? 0.3652 0.2512 0.1570 -0.0242 0.0240  0.0096  288 VAL A O   
2425 C CB  . VAL A 306 ? 0.4119 0.2705 0.1585 -0.0245 0.0244  0.0054  288 VAL A CB  
2426 C CG1 . VAL A 306 ? 0.4129 0.2642 0.1452 -0.0239 0.0280  0.0081  288 VAL A CG1 
2427 C CG2 . VAL A 306 ? 0.3813 0.2347 0.1281 -0.0232 0.0341  0.0039  288 VAL A CG2 
2428 N N   . ASP A 307 ? 0.3905 0.2668 0.1683 -0.0277 0.0125  0.0024  289 ASP A N   
2429 C CA  . ASP A 307 ? 0.3820 0.2611 0.1719 -0.0293 0.0118  0.0002  289 ASP A CA  
2430 C C   . ASP A 307 ? 0.3819 0.2717 0.1861 -0.0287 0.0140  0.0052  289 ASP A C   
2431 O O   . ASP A 307 ? 0.3878 0.2772 0.1982 -0.0277 0.0191  0.0066  289 ASP A O   
2432 C CB  . ASP A 307 ? 0.3779 0.2479 0.1647 -0.0288 0.0186  -0.0023 289 ASP A CB  
2433 C CG  . ASP A 307 ? 0.4312 0.2886 0.2002 -0.0290 0.0183  -0.0072 289 ASP A CG  
2434 O OD1 . ASP A 307 ? 0.4289 0.2823 0.1905 -0.0311 0.0093  -0.0125 289 ASP A OD1 
2435 O OD2 . ASP A 307 ? 0.4276 0.2785 0.1897 -0.0266 0.0268  -0.0060 289 ASP A OD2 
2436 N N   . ALA A 308 ? 0.3760 0.2737 0.1835 -0.0288 0.0104  0.0078  290 ALA A N   
2437 C CA  . ALA A 308 ? 0.3444 0.2510 0.1616 -0.0280 0.0121  0.0121  290 ALA A CA  
2438 C C   . ALA A 308 ? 0.3481 0.2560 0.1740 -0.0294 0.0125  0.0115  290 ALA A C   
2439 O O   . ALA A 308 ? 0.3289 0.2394 0.1583 -0.0278 0.0159  0.0152  290 ALA A O   
2440 C CB  . ALA A 308 ? 0.3462 0.2590 0.1641 -0.0284 0.0086  0.0139  290 ALA A CB  
2441 N N   A ARG A 309 ? 0.3556 0.2607 0.1844 -0.0324 0.0093  0.0065  291 ARG A N   
2442 N N   B ARG A 309 ? 0.3530 0.2581 0.1819 -0.0324 0.0094  0.0066  291 ARG A N   
2443 C CA  A ARG A 309 ? 0.3576 0.2639 0.1972 -0.0350 0.0107  0.0048  291 ARG A CA  
2444 C CA  B ARG A 309 ? 0.3526 0.2588 0.1924 -0.0350 0.0111  0.0050  291 ARG A CA  
2445 C C   A ARG A 309 ? 0.3507 0.2639 0.1956 -0.0349 0.0114  0.0082  291 ARG A C   
2446 C C   B ARG A 309 ? 0.3476 0.2608 0.1926 -0.0349 0.0114  0.0082  291 ARG A C   
2447 O O   A ARG A 309 ? 0.3487 0.2604 0.1959 -0.0348 0.0170  0.0106  291 ARG A O   
2448 O O   B ARG A 309 ? 0.3452 0.2571 0.1928 -0.0349 0.0169  0.0106  291 ARG A O   
2449 C CB  A ARG A 309 ? 0.3681 0.2666 0.2088 -0.0352 0.0178  0.0048  291 ARG A CB  
2450 C CB  B ARG A 309 ? 0.3605 0.2591 0.2008 -0.0346 0.0187  0.0059  291 ARG A CB  
2451 C CG  A ARG A 309 ? 0.3952 0.2865 0.2339 -0.0373 0.0164  -0.0015 291 ARG A CG  
2452 C CG  B ARG A 309 ? 0.3745 0.2647 0.2111 -0.0357 0.0191  0.0010  291 ARG A CG  
2453 C CD  A ARG A 309 ? 0.4459 0.3280 0.2872 -0.0382 0.0241  -0.0025 291 ARG A CD  
2454 C CD  B ARG A 309 ? 0.4270 0.3086 0.2619 -0.0339 0.0275  0.0034  291 ARG A CD  
2455 N NE  A ARG A 309 ? 0.4611 0.3429 0.3142 -0.0415 0.0284  -0.0034 291 ARG A NE  
2456 N NE  B ARG A 309 ? 0.4457 0.3182 0.2756 -0.0346 0.0288  -0.0015 291 ARG A NE  
2457 C CZ  A ARG A 309 ? 0.4636 0.3357 0.3191 -0.0424 0.0373  -0.0028 291 ARG A CZ  
2458 C CZ  B ARG A 309 ? 0.4563 0.3249 0.2768 -0.0312 0.0307  -0.0003 291 ARG A CZ  
2459 N NH1 A ARG A 309 ? 0.4572 0.3199 0.3049 -0.0397 0.0417  -0.0016 291 ARG A NH1 
2460 N NH1 B ARG A 309 ? 0.4261 0.3006 0.2437 -0.0269 0.0313  0.0055  291 ARG A NH1 
2461 N NH2 A ARG A 309 ? 0.4389 0.3093 0.3047 -0.0459 0.0430  -0.0035 291 ARG A NH2 
2462 N NH2 B ARG A 309 ? 0.4720 0.3305 0.2869 -0.0324 0.0327  -0.0058 291 ARG A NH2 
2463 N N   . LYS A 310 ? 0.3433 0.2621 0.1880 -0.0347 0.0061  0.0083  292 LYS A N   
2464 C CA  . LYS A 310 ? 0.3409 0.2654 0.1910 -0.0352 0.0064  0.0098  292 LYS A CA  
2465 C C   . LYS A 310 ? 0.3543 0.2795 0.2171 -0.0383 0.0072  0.0055  292 LYS A C   
2466 O O   . LYS A 310 ? 0.3495 0.2741 0.2180 -0.0398 0.0029  0.0006  292 LYS A O   
2467 C CB  . LYS A 310 ? 0.3252 0.2537 0.1729 -0.0343 0.0010  0.0103  292 LYS A CB  
2468 C CG  . LYS A 310 ? 0.3476 0.2765 0.1867 -0.0323 0.0022  0.0140  292 LYS A CG  
2469 C CD  . LYS A 310 ? 0.3553 0.2852 0.1911 -0.0319 -0.0012 0.0146  292 LYS A CD  
2470 C CE  . LYS A 310 ? 0.3990 0.3222 0.2263 -0.0312 -0.0045 0.0131  292 LYS A CE  
2471 N NZ  . LYS A 310 ? 0.4091 0.3313 0.2386 -0.0311 -0.0114 0.0105  292 LYS A NZ  
2472 N N   . PRO A 311 ? 0.3615 0.2874 0.2290 -0.0393 0.0130  0.0068  293 PRO A N   
2473 C CA  . PRO A 311 ? 0.3598 0.2852 0.2186 -0.0373 0.0168  0.0117  293 PRO A CA  
2474 C C   . PRO A 311 ? 0.3667 0.2854 0.2159 -0.0351 0.0223  0.0160  293 PRO A C   
2475 O O   . PRO A 311 ? 0.3560 0.2754 0.1966 -0.0324 0.0224  0.0199  293 PRO A O   
2476 C CB  . PRO A 311 ? 0.3725 0.2991 0.2392 -0.0395 0.0209  0.0100  293 PRO A CB  
2477 C CG  . PRO A 311 ? 0.3557 0.2802 0.2357 -0.0428 0.0242  0.0054  293 PRO A CG  
2478 C CD  . PRO A 311 ? 0.3681 0.2950 0.2509 -0.0427 0.0158  0.0022  293 PRO A CD  
2479 N N   . LEU A 312 ? 0.3796 0.2917 0.2303 -0.0358 0.0262  0.0152  294 LEU A N   
2480 C CA  . LEU A 312 ? 0.3988 0.3025 0.2399 -0.0324 0.0313  0.0199  294 LEU A CA  
2481 C C   . LEU A 312 ? 0.3835 0.2916 0.2164 -0.0276 0.0266  0.0239  294 LEU A C   
2482 O O   . LEU A 312 ? 0.3880 0.2929 0.2128 -0.0236 0.0280  0.0285  294 LEU A O   
2483 C CB  . LEU A 312 ? 0.4125 0.3084 0.2572 -0.0339 0.0352  0.0175  294 LEU A CB  
2484 C CG  . LEU A 312 ? 0.4181 0.3041 0.2539 -0.0296 0.0401  0.0222  294 LEU A CG  
2485 C CD1 . LEU A 312 ? 0.4458 0.3221 0.2733 -0.0274 0.0475  0.0276  294 LEU A CD1 
2486 C CD2 . LEU A 312 ? 0.4419 0.3201 0.2823 -0.0319 0.0435  0.0181  294 LEU A CD2 
2487 N N   . PHE A 313 ? 0.3578 0.2727 0.1933 -0.0280 0.0209  0.0217  295 PHE A N   
2488 C CA  . PHE A 313 ? 0.3382 0.2588 0.1705 -0.0248 0.0174  0.0241  295 PHE A CA  
2489 C C   . PHE A 313 ? 0.3412 0.2665 0.1703 -0.0228 0.0156  0.0269  295 PHE A C   
2490 O O   . PHE A 313 ? 0.3300 0.2586 0.1574 -0.0189 0.0136  0.0295  295 PHE A O   
2491 C CB  . PHE A 313 ? 0.3268 0.2520 0.1614 -0.0269 0.0133  0.0211  295 PHE A CB  
2492 C CG  . PHE A 313 ? 0.3402 0.2701 0.1737 -0.0248 0.0120  0.0226  295 PHE A CG  
2493 C CD1 . PHE A 313 ? 0.3439 0.2711 0.1761 -0.0223 0.0147  0.0234  295 PHE A CD1 
2494 C CD2 . PHE A 313 ? 0.3287 0.2653 0.1641 -0.0258 0.0092  0.0227  295 PHE A CD2 
2495 C CE1 . PHE A 313 ? 0.3147 0.2468 0.1492 -0.0208 0.0153  0.0241  295 PHE A CE1 
2496 C CE2 . PHE A 313 ? 0.3505 0.2915 0.1879 -0.0248 0.0095  0.0233  295 PHE A CE2 
2497 C CZ  . PHE A 313 ? 0.3483 0.2877 0.1862 -0.0223 0.0128  0.0240  295 PHE A CZ  
2498 N N   . PHE A 314 ? 0.3477 0.2738 0.1771 -0.0255 0.0156  0.0256  296 PHE A N   
2499 C CA  . PHE A 314 ? 0.3750 0.3037 0.1990 -0.0242 0.0138  0.0271  296 PHE A CA  
2500 C C   . PHE A 314 ? 0.4053 0.3256 0.2187 -0.0213 0.0174  0.0306  296 PHE A C   
2501 O O   . PHE A 314 ? 0.4362 0.3569 0.2414 -0.0196 0.0150  0.0316  296 PHE A O   
2502 C CB  . PHE A 314 ? 0.3646 0.2965 0.1924 -0.0280 0.0132  0.0238  296 PHE A CB  
2503 C CG  . PHE A 314 ? 0.3326 0.2706 0.1674 -0.0298 0.0093  0.0215  296 PHE A CG  
2504 C CD1 . PHE A 314 ? 0.2817 0.2257 0.1168 -0.0289 0.0058  0.0219  296 PHE A CD1 
2505 C CD2 . PHE A 314 ? 0.3109 0.2481 0.1522 -0.0322 0.0091  0.0188  296 PHE A CD2 
2506 C CE1 . PHE A 314 ? 0.2933 0.2399 0.1326 -0.0305 0.0041  0.0205  296 PHE A CE1 
2507 C CE2 . PHE A 314 ? 0.3185 0.2583 0.1620 -0.0328 0.0053  0.0176  296 PHE A CE2 
2508 C CZ  . PHE A 314 ? 0.2972 0.2404 0.1385 -0.0321 0.0038  0.0188  296 PHE A CZ  
2509 N N   . GLY A 315 ? 0.4114 0.3224 0.2233 -0.0207 0.0232  0.0321  297 GLY A N   
2510 C CA  . GLY A 315 ? 0.4491 0.3485 0.2483 -0.0167 0.0277  0.0370  297 GLY A CA  
2511 C C   . GLY A 315 ? 0.4584 0.3557 0.2557 -0.0111 0.0260  0.0406  297 GLY A C   
2512 O O   . GLY A 315 ? 0.4595 0.3665 0.2609 -0.0082 0.0192  0.0407  297 GLY A O   
2513 N N   . GLU A 316 ? 0.4769 0.3615 0.2702 -0.0097 0.0330  0.0432  298 GLU A N   
2514 C CA  . GLU A 316 ? 0.5037 0.3845 0.2960 -0.0037 0.0325  0.0468  298 GLU A CA  
2515 C C   . GLU A 316 ? 0.4734 0.3622 0.2789 -0.0053 0.0308  0.0429  298 GLU A C   
2516 O O   . GLU A 316 ? 0.4720 0.3624 0.2797 -0.0001 0.0290  0.0449  298 GLU A O   
2517 C CB  . GLU A 316 ? 0.5508 0.4131 0.3346 -0.0021 0.0422  0.0506  298 GLU A CB  
2518 C CG  . GLU A 316 ? 0.6360 0.4933 0.4293 -0.0100 0.0504  0.0455  298 GLU A CG  
2519 C CD  . GLU A 316 ? 0.7918 0.6318 0.5772 -0.0118 0.0619  0.0479  298 GLU A CD  
2520 O OE1 . GLU A 316 ? 0.8514 0.6776 0.6205 -0.0053 0.0653  0.0551  298 GLU A OE1 
2521 O OE2 . GLU A 316 ? 0.8092 0.6488 0.6050 -0.0194 0.0679  0.0425  298 GLU A OE2 
2522 N N   . GLY A 317 ? 0.4341 0.3272 0.2476 -0.0121 0.0312  0.0373  299 GLY A N   
2523 C CA  . GLY A 317 ? 0.4068 0.3047 0.2280 -0.0140 0.0297  0.0334  299 GLY A CA  
2524 C C   . GLY A 317 ? 0.4070 0.2939 0.2281 -0.0129 0.0356  0.0332  299 GLY A C   
2525 O O   . GLY A 317 ? 0.4132 0.2886 0.2313 -0.0133 0.0419  0.0345  299 GLY A O   
2526 N N   . THR A 318 ? 0.3956 0.2846 0.2196 -0.0118 0.0349  0.0313  300 THR A N   
2527 C CA  . THR A 318 ? 0.4188 0.2970 0.2423 -0.0102 0.0408  0.0306  300 THR A CA  
2528 C C   . THR A 318 ? 0.4157 0.2974 0.2410 -0.0039 0.0405  0.0330  300 THR A C   
2529 O O   . THR A 318 ? 0.4026 0.2956 0.2311 -0.0016 0.0357  0.0345  300 THR A O   
2530 C CB  . THR A 318 ? 0.4107 0.2848 0.2361 -0.0165 0.0418  0.0231  300 THR A CB  
2531 O OG1 . THR A 318 ? 0.4330 0.3151 0.2581 -0.0180 0.0368  0.0201  300 THR A OG1 
2532 C CG2 . THR A 318 ? 0.4271 0.2997 0.2560 -0.0225 0.0419  0.0198  300 THR A CG2 
2533 N N   . VAL A 319 ? 0.4367 0.3085 0.2619 -0.0012 0.0463  0.0328  301 VAL A N   
2534 C CA  . VAL A 319 ? 0.4374 0.3118 0.2670 0.0052  0.0477  0.0347  301 VAL A CA  
2535 C C   . VAL A 319 ? 0.4152 0.2984 0.2481 0.0025  0.0462  0.0303  301 VAL A C   
2536 O O   . VAL A 319 ? 0.4037 0.2837 0.2318 -0.0035 0.0467  0.0251  301 VAL A O   
2537 C CB  . VAL A 319 ? 0.4675 0.3264 0.2956 0.0082  0.0557  0.0349  301 VAL A CB  
2538 C CG1 . VAL A 319 ? 0.4830 0.3397 0.3139 0.0091  0.0604  0.0309  301 VAL A CG1 
2539 C CG2 . VAL A 319 ? 0.4841 0.3374 0.3108 0.0167  0.0564  0.0428  301 VAL A CG2 
2540 N N   . LEU A 320 ? 0.4016 0.2959 0.2427 0.0068  0.0442  0.0324  302 LEU A N   
2541 C CA  . LEU A 320 ? 0.3922 0.2930 0.2368 0.0045  0.0454  0.0290  302 LEU A CA  
2542 C C   . LEU A 320 ? 0.3996 0.2900 0.2421 0.0053  0.0543  0.0256  302 LEU A C   
2543 O O   . LEU A 320 ? 0.4117 0.2978 0.2596 0.0111  0.0589  0.0273  302 LEU A O   
2544 C CB  . LEU A 320 ? 0.3761 0.2916 0.2338 0.0088  0.0420  0.0315  302 LEU A CB  
2545 C CG  . LEU A 320 ? 0.3542 0.2768 0.2173 0.0055  0.0446  0.0282  302 LEU A CG  
2546 C CD1 . LEU A 320 ? 0.3614 0.2835 0.2146 -0.0018 0.0418  0.0258  302 LEU A CD1 
2547 C CD2 . LEU A 320 ? 0.3776 0.3158 0.2592 0.0097  0.0423  0.0293  302 LEU A CD2 
2548 N N   . ARG A 321 ? 0.4045 0.2895 0.2376 -0.0001 0.0564  0.0207  303 ARG A N   
2549 C CA  . ARG A 321 ? 0.4096 0.2828 0.2366 0.0000  0.0651  0.0165  303 ARG A CA  
2550 C C   . ARG A 321 ? 0.4170 0.2932 0.2422 -0.0015 0.0688  0.0147  303 ARG A C   
2551 O O   . ARG A 321 ? 0.4035 0.2888 0.2299 -0.0042 0.0637  0.0159  303 ARG A O   
2552 C CB  . ARG A 321 ? 0.4295 0.2892 0.2415 -0.0053 0.0643  0.0113  303 ARG A CB  
2553 C CG  . ARG A 321 ? 0.4428 0.2983 0.2566 -0.0059 0.0616  0.0122  303 ARG A CG  
2554 C CD  . ARG A 321 ? 0.4466 0.2935 0.2655 -0.0004 0.0689  0.0141  303 ARG A CD  
2555 N NE  . ARG A 321 ? 0.4972 0.3304 0.3088 -0.0011 0.0767  0.0083  303 ARG A NE  
2556 C CZ  . ARG A 321 ? 0.4864 0.3071 0.2882 -0.0065 0.0771  0.0017  303 ARG A CZ  
2557 N NH1 . ARG A 321 ? 0.4968 0.3186 0.2982 -0.0116 0.0705  0.0003  303 ARG A NH1 
2558 N NH2 . ARG A 321 ? 0.4860 0.2931 0.2793 -0.0068 0.0842  -0.0042 303 ARG A NH2 
2559 N N   . GLN A 322 ? 0.4078 0.2748 0.2296 -0.0001 0.0789  0.0117  304 GLN A N   
2560 C CA  . GLN A 322 ? 0.4183 0.2829 0.2342 -0.0020 0.0855  0.0096  304 GLN A CA  
2561 C C   . GLN A 322 ? 0.4421 0.2880 0.2328 -0.0060 0.0880  0.0042  304 GLN A C   
2562 O O   . GLN A 322 ? 0.4428 0.2765 0.2265 -0.0053 0.0915  0.0007  304 GLN A O   
2563 C CB  . GLN A 322 ? 0.4171 0.2849 0.2489 0.0030  0.0968  0.0098  304 GLN A CB  
2564 C CG  . GLN A 322 ? 0.4606 0.3236 0.2868 0.0007  0.1072  0.0074  304 GLN A CG  
2565 C CD  . GLN A 322 ? 0.4626 0.3298 0.3087 0.0055  0.1199  0.0068  304 GLN A CD  
2566 O OE1 . GLN A 322 ? 0.5018 0.3760 0.3665 0.0115  0.1196  0.0084  304 GLN A OE1 
2567 N NE2 . GLN A 322 ? 0.4650 0.3274 0.3079 0.0032  0.1316  0.0047  304 GLN A NE2 
2568 N N   . VAL A 323 ? 0.4542 0.2967 0.2301 -0.0099 0.0855  0.0033  305 VAL A N   
2569 C CA  . VAL A 323 ? 0.4736 0.2974 0.2224 -0.0127 0.0872  -0.0017 305 VAL A CA  
2570 C C   . VAL A 323 ? 0.5166 0.3278 0.2569 -0.0110 0.1028  -0.0040 305 VAL A C   
2571 O O   . VAL A 323 ? 0.5111 0.3279 0.2614 -0.0099 0.1117  -0.0014 305 VAL A O   
2572 C CB  . VAL A 323 ? 0.4773 0.2999 0.2111 -0.0161 0.0785  -0.0009 305 VAL A CB  
2573 C CG1 . VAL A 323 ? 0.5116 0.3129 0.2134 -0.0179 0.0782  -0.0061 305 VAL A CG1 
2574 C CG2 . VAL A 323 ? 0.4327 0.2681 0.1772 -0.0177 0.0645  0.0009  305 VAL A CG2 
2575 N N   . ASP A 324 ? 0.5509 0.3445 0.2733 -0.0113 0.1070  -0.0096 306 ASP A N   
2576 C CA  . ASP A 324 ? 0.5966 0.3725 0.3008 -0.0108 0.1212  -0.0130 306 ASP A CA  
2577 C C   . ASP A 324 ? 0.6306 0.3934 0.3041 -0.0140 0.1169  -0.0139 306 ASP A C   
2578 O O   . ASP A 324 ? 0.6453 0.3970 0.2969 -0.0160 0.1068  -0.0182 306 ASP A O   
2579 C CB  . ASP A 324 ? 0.6128 0.3730 0.3064 -0.0101 0.1260  -0.0195 306 ASP A CB  
2580 C CG  . ASP A 324 ? 0.6751 0.4153 0.3498 -0.0091 0.1434  -0.0235 306 ASP A CG  
2581 O OD1 . ASP A 324 ? 0.6869 0.4185 0.3433 -0.0104 0.1488  -0.0226 306 ASP A OD1 
2582 O OD2 . ASP A 324 ? 0.7001 0.4319 0.3778 -0.0069 0.1528  -0.0275 306 ASP A OD2 
2583 N N   . THR A 325 ? 0.6495 0.4137 0.3223 -0.0142 0.1239  -0.0099 307 THR A N   
2584 C CA  . THR A 325 ? 0.6854 0.4366 0.3291 -0.0163 0.1196  -0.0090 307 THR A CA  
2585 C C   . THR A 325 ? 0.7441 0.4660 0.3475 -0.0163 0.1263  -0.0141 307 THR A C   
2586 O O   . THR A 325 ? 0.7782 0.4863 0.3514 -0.0170 0.1179  -0.0143 307 THR A O   
2587 C CB  . THR A 325 ? 0.6778 0.4370 0.3324 -0.0169 0.1264  -0.0030 307 THR A CB  
2588 O OG1 . THR A 325 ? 0.6906 0.4489 0.3580 -0.0158 0.1459  -0.0033 307 THR A OG1 
2589 C CG2 . THR A 325 ? 0.6253 0.4104 0.3112 -0.0174 0.1152  0.0011  307 THR A CG2 
2590 N N   . LYS A 326 ? 0.7657 0.4774 0.3675 -0.0150 0.1409  -0.0183 308 LYS A N   
2591 C CA  . LYS A 326 ? 0.8158 0.4986 0.3786 -0.0150 0.1475  -0.0246 308 LYS A CA  
2592 C C   . LYS A 326 ? 0.8224 0.4968 0.3654 -0.0163 0.1299  -0.0312 308 LYS A C   
2593 O O   . LYS A 326 ? 0.8476 0.5007 0.3520 -0.0167 0.1248  -0.0348 308 LYS A O   
2594 C CB  . LYS A 326 ? 0.8349 0.5101 0.4053 -0.0132 0.1678  -0.0284 308 LYS A CB  
2595 C CG  . LYS A 326 ? 0.8927 0.5629 0.4664 -0.0123 0.1897  -0.0253 308 LYS A CG  
2596 C CD  . LYS A 326 ? 0.9815 0.6236 0.5276 -0.0115 0.2092  -0.0316 308 LYS A CD  
2597 C CE  . LYS A 326 ? 1.0311 0.6543 0.5538 -0.0123 0.2275  -0.0289 308 LYS A CE  
2598 N NZ  . LYS A 326 ? 1.0545 0.6498 0.5520 -0.0114 0.2503  -0.0348 308 LYS A NZ  
2599 N N   . THR A 327 ? 0.7917 0.4822 0.3610 -0.0169 0.1209  -0.0332 309 THR A N   
2600 C CA  . THR A 327 ? 0.7826 0.4663 0.3399 -0.0190 0.1069  -0.0410 309 THR A CA  
2601 C C   . THR A 327 ? 0.7586 0.4591 0.3280 -0.0208 0.0863  -0.0390 309 THR A C   
2602 O O   . THR A 327 ? 0.7758 0.4709 0.3327 -0.0229 0.0718  -0.0456 309 THR A O   
2603 C CB  . THR A 327 ? 0.7736 0.4596 0.3507 -0.0187 0.1133  -0.0453 309 THR A CB  
2604 O OG1 . THR A 327 ? 0.7373 0.4479 0.3536 -0.0174 0.1127  -0.0386 309 THR A OG1 
2605 C CG2 . THR A 327 ? 0.7849 0.4541 0.3520 -0.0165 0.1346  -0.0479 309 THR A CG2 
2606 N N   . GLY A 328 ? 0.7131 0.4343 0.3085 -0.0200 0.0852  -0.0308 310 GLY A N   
2607 C CA  . GLY A 328 ? 0.6780 0.4169 0.2897 -0.0216 0.0684  -0.0284 310 GLY A CA  
2608 C C   . GLY A 328 ? 0.6480 0.4004 0.2874 -0.0229 0.0642  -0.0302 310 GLY A C   
2609 O O   . GLY A 328 ? 0.6300 0.3961 0.2841 -0.0246 0.0516  -0.0293 310 GLY A O   
2610 N N   . LYS A 329 ? 0.6351 0.3829 0.2820 -0.0217 0.0761  -0.0323 311 LYS A N   
2611 C CA  . LYS A 329 ? 0.6090 0.3656 0.2798 -0.0223 0.0749  -0.0333 311 LYS A CA  
2612 C C   . LYS A 329 ? 0.5728 0.3468 0.2716 -0.0188 0.0809  -0.0247 311 LYS A C   
2613 O O   . LYS A 329 ? 0.5753 0.3521 0.2771 -0.0160 0.0901  -0.0203 311 LYS A O   
2614 C CB  . LYS A 329 ? 0.6230 0.3629 0.2858 -0.0223 0.0841  -0.0404 311 LYS A CB  
2615 C CG  . LYS A 329 ? 0.6762 0.3994 0.3134 -0.0261 0.0760  -0.0507 311 LYS A CG  
2616 C CD  . LYS A 329 ? 0.7193 0.4229 0.3448 -0.0260 0.0878  -0.0582 311 LYS A CD  
2617 C CE  . LYS A 329 ? 0.7642 0.4479 0.3560 -0.0294 0.0800  -0.0692 311 LYS A CE  
2618 N NZ  . LYS A 329 ? 0.8117 0.4747 0.3904 -0.0294 0.0929  -0.0772 311 LYS A NZ  
2619 N N   . LEU A 330 ? 0.5468 0.3314 0.2660 -0.0191 0.0763  -0.0228 312 LEU A N   
2620 C CA  . LEU A 330 ? 0.5255 0.3236 0.2687 -0.0147 0.0814  -0.0154 312 LEU A CA  
2621 C C   . LEU A 330 ? 0.5339 0.3244 0.2827 -0.0101 0.0951  -0.0158 312 LEU A C   
2622 O O   . LEU A 330 ? 0.5490 0.3245 0.2895 -0.0109 0.0997  -0.0218 312 LEU A O   
2623 C CB  . LEU A 330 ? 0.5048 0.3125 0.2633 -0.0158 0.0735  -0.0129 312 LEU A CB  
2624 C CG  . LEU A 330 ? 0.4914 0.3082 0.2486 -0.0199 0.0609  -0.0126 312 LEU A CG  
2625 C CD1 . LEU A 330 ? 0.5303 0.3562 0.3040 -0.0206 0.0564  -0.0095 312 LEU A CD1 
2626 C CD2 . LEU A 330 ? 0.4616 0.2877 0.2176 -0.0188 0.0592  -0.0078 312 LEU A CD2 
2627 N N   . LYS A 331 ? 0.5223 0.3233 0.2868 -0.0052 0.1016  -0.0100 313 LYS A N   
2628 C CA  . LYS A 331 ? 0.5336 0.3312 0.3106 0.0006  0.1130  -0.0093 313 LYS A CA  
2629 C C   . LYS A 331 ? 0.5231 0.3231 0.3130 0.0030  0.1089  -0.0063 313 LYS A C   
2630 O O   . LYS A 331 ? 0.5188 0.3288 0.3137 0.0012  0.0985  -0.0027 313 LYS A O   
2631 C CB  . LYS A 331 ? 0.5232 0.3345 0.3188 0.0056  0.1189  -0.0043 313 LYS A CB  
2632 C CG  . LYS A 331 ? 0.5743 0.3840 0.3595 0.0029  0.1242  -0.0059 313 LYS A CG  
2633 C CD  . LYS A 331 ? 0.5995 0.4148 0.4029 0.0078  0.1371  -0.0046 313 LYS A CD  
2634 C CE  . LYS A 331 ? 0.6689 0.4819 0.4618 0.0041  0.1434  -0.0056 313 LYS A CE  
2635 N NZ  . LYS A 331 ? 0.7197 0.5330 0.5270 0.0075  0.1602  -0.0067 313 LYS A NZ  
2636 N N   . ILE A 332 ? 0.5290 0.3181 0.3231 0.0071  0.1180  -0.0078 314 ILE A N   
2637 C CA  . ILE A 332 ? 0.5352 0.3220 0.3387 0.0097  0.1161  -0.0045 314 ILE A CA  
2638 C C   . ILE A 332 ? 0.5132 0.3159 0.3373 0.0176  0.1137  0.0047  314 ILE A C   
2639 O O   . ILE A 332 ? 0.5171 0.3261 0.3536 0.0237  0.1196  0.0068  314 ILE A O   
2640 C CB  . ILE A 332 ? 0.5601 0.3262 0.3590 0.0109  0.1266  -0.0098 314 ILE A CB  
2641 C CG1 . ILE A 332 ? 0.5707 0.3212 0.3476 0.0031  0.1277  -0.0204 314 ILE A CG1 
2642 C CG2 . ILE A 332 ? 0.5667 0.3276 0.3722 0.0120  0.1246  -0.0064 314 ILE A CG2 
2643 C CD1 . ILE A 332 ? 0.5265 0.2811 0.2940 -0.0051 0.1145  -0.0234 314 ILE A CD1 
2644 N N   . GLY A 333 ? 0.5001 0.3096 0.3276 0.0171  0.1046  0.0097  315 GLY A N   
2645 C CA  . GLY A 333 ? 0.4951 0.3167 0.3377 0.0249  0.1005  0.0182  315 GLY A CA  
2646 C C   . GLY A 333 ? 0.4789 0.3185 0.3246 0.0227  0.0900  0.0214  315 GLY A C   
2647 O O   . GLY A 333 ? 0.4657 0.3092 0.3038 0.0159  0.0871  0.0176  315 GLY A O   
2648 N N   . THR A 334 ? 0.4706 0.3192 0.3258 0.0288  0.0840  0.0285  316 THR A N   
2649 C CA  . THR A 334 ? 0.4585 0.3243 0.3178 0.0276  0.0739  0.0314  316 THR A CA  
2650 C C   . THR A 334 ? 0.4538 0.3341 0.3285 0.0309  0.0748  0.0309  316 THR A C   
2651 O O   . THR A 334 ? 0.4535 0.3353 0.3418 0.0388  0.0792  0.0323  316 THR A O   
2652 C CB  . THR A 334 ? 0.4514 0.3193 0.3114 0.0330  0.0666  0.0387  316 THR A CB  
2653 O OG1 . THR A 334 ? 0.4855 0.3381 0.3327 0.0293  0.0687  0.0390  316 THR A OG1 
2654 C CG2 . THR A 334 ? 0.4375 0.3213 0.2993 0.0308  0.0564  0.0404  316 THR A CG2 
2655 N N   . TYR A 335 ? 0.4503 0.3410 0.3245 0.0250  0.0712  0.0286  317 TYR A N   
2656 C CA  . TYR A 335 ? 0.4671 0.3716 0.3574 0.0266  0.0732  0.0274  317 TYR A CA  
2657 C C   . TYR A 335 ? 0.4623 0.3836 0.3694 0.0325  0.0637  0.0316  317 TYR A C   
2658 O O   . TYR A 335 ? 0.4527 0.3798 0.3547 0.0301  0.0542  0.0337  317 TYR A O   
2659 C CB  . TYR A 335 ? 0.4720 0.3785 0.3543 0.0180  0.0742  0.0235  317 TYR A CB  
2660 C CG  . TYR A 335 ? 0.4814 0.4001 0.3812 0.0187  0.0791  0.0219  317 TYR A CG  
2661 C CD1 . TYR A 335 ? 0.5066 0.4199 0.4128 0.0209  0.0921  0.0189  317 TYR A CD1 
2662 C CD2 . TYR A 335 ? 0.4674 0.4024 0.3788 0.0170  0.0720  0.0227  317 TYR A CD2 
2663 C CE1 . TYR A 335 ? 0.5294 0.4537 0.4548 0.0211  0.0987  0.0169  317 TYR A CE1 
2664 C CE2 . TYR A 335 ? 0.4899 0.4364 0.4210 0.0169  0.0775  0.0204  317 TYR A CE2 
2665 C CZ  . TYR A 335 ? 0.5156 0.4572 0.4546 0.0189  0.0913  0.0176  317 TYR A CZ  
2666 O OH  . TYR A 335 ? 0.5249 0.4775 0.4860 0.0182  0.0991  0.0147  317 TYR A OH  
2667 N N   . THR A 336 ? 0.4951 0.4243 0.4226 0.0403  0.0661  0.0323  318 THR A N   
2668 C CA  . THR A 336 ? 0.5209 0.4660 0.4656 0.0478  0.0552  0.0359  318 THR A CA  
2669 C C   . THR A 336 ? 0.5241 0.4891 0.4935 0.0469  0.0548  0.0321  318 THR A C   
2670 O O   . THR A 336 ? 0.5312 0.5123 0.5159 0.0514  0.0436  0.0332  318 THR A O   
2671 C CB  . THR A 336 ? 0.5316 0.4721 0.4853 0.0597  0.0556  0.0400  318 THR A CB  
2672 O OG1 . THR A 336 ? 0.5535 0.4925 0.5220 0.0621  0.0681  0.0363  318 THR A OG1 
2673 C CG2 . THR A 336 ? 0.5371 0.4566 0.4673 0.0607  0.0564  0.0443  318 THR A CG2 
2674 N N   . GLY A 337 ? 0.5303 0.4932 0.5027 0.0412  0.0671  0.0272  319 GLY A N   
2675 C CA  . GLY A 337 ? 0.5284 0.5075 0.5257 0.0394  0.0712  0.0229  319 GLY A CA  
2676 C C   . GLY A 337 ? 0.5213 0.5112 0.5182 0.0318  0.0640  0.0214  319 GLY A C   
2677 O O   . GLY A 337 ? 0.5137 0.5000 0.4918 0.0287  0.0544  0.0239  319 GLY A O   
2678 N N   . PRO A 338 ? 0.5206 0.5230 0.5395 0.0286  0.0696  0.0169  320 PRO A N   
2679 C CA  . PRO A 338 ? 0.5106 0.5229 0.5321 0.0211  0.0643  0.0148  320 PRO A CA  
2680 C C   . PRO A 338 ? 0.5070 0.5049 0.5071 0.0115  0.0748  0.0134  320 PRO A C   
2681 O O   . PRO A 338 ? 0.5125 0.4939 0.4973 0.0106  0.0866  0.0133  320 PRO A O   
2682 C CB  . PRO A 338 ? 0.5037 0.5362 0.5637 0.0228  0.0670  0.0100  320 PRO A CB  
2683 C CG  . PRO A 338 ? 0.5197 0.5443 0.5878 0.0256  0.0842  0.0084  320 PRO A CG  
2684 C CD  . PRO A 338 ? 0.5301 0.5384 0.5756 0.0317  0.0824  0.0132  320 PRO A CD  
2685 N N   . LEU A 339 ? 0.5028 0.5059 0.5009 0.0049  0.0701  0.0123  321 LEU A N   
2686 C CA  . LEU A 339 ? 0.5155 0.5062 0.4971 -0.0033 0.0799  0.0112  321 LEU A CA  
2687 C C   . LEU A 339 ? 0.5340 0.5222 0.5292 -0.0047 0.0978  0.0078  321 LEU A C   
2688 O O   . LEU A 339 ? 0.5393 0.5439 0.5663 -0.0043 0.1006  0.0043  321 LEU A O   
2689 C CB  . LEU A 339 ? 0.5023 0.5015 0.4867 -0.0092 0.0724  0.0102  321 LEU A CB  
2690 C CG  . LEU A 339 ? 0.5129 0.4972 0.4752 -0.0167 0.0789  0.0106  321 LEU A CG  
2691 C CD1 . LEU A 339 ? 0.4922 0.4603 0.4222 -0.0165 0.0739  0.0141  321 LEU A CD1 
2692 C CD2 . LEU A 339 ? 0.5094 0.5034 0.4812 -0.0221 0.0735  0.0087  321 LEU A CD2 
2693 N N   . GLN A 340 ? 0.5556 0.5232 0.5275 -0.0063 0.1102  0.0083  322 GLN A N   
2694 C CA  . GLN A 340 ? 0.5834 0.5445 0.5629 -0.0085 0.1298  0.0052  322 GLN A CA  
2695 C C   . GLN A 340 ? 0.5853 0.5263 0.5349 -0.0153 0.1381  0.0060  322 GLN A C   
2696 O O   . GLN A 340 ? 0.5771 0.5059 0.4973 -0.0164 0.1298  0.0087  322 GLN A O   
2697 C CB  . GLN A 340 ? 0.5965 0.5474 0.5735 -0.0030 0.1404  0.0043  322 GLN A CB  
2698 C CG  . GLN A 340 ? 0.6173 0.5789 0.6094 0.0056  0.1302  0.0056  322 GLN A CG  
2699 C CD  . GLN A 340 ? 0.6354 0.5848 0.6256 0.0107  0.1432  0.0042  322 GLN A CD  
2700 O OE1 . GLN A 340 ? 0.6603 0.6041 0.6582 0.0094  0.1613  0.0007  322 GLN A OE1 
2701 N NE2 . GLN A 340 ? 0.6641 0.6080 0.6442 0.0164  0.1353  0.0066  322 GLN A NE2 
2702 N N   . HIS A 341 ? 0.5886 0.5250 0.5457 -0.0194 0.1550  0.0037  323 HIS A N   
2703 C CA  . HIS A 341 ? 0.6047 0.5183 0.5300 -0.0249 0.1644  0.0053  323 HIS A CA  
2704 C C   . HIS A 341 ? 0.6026 0.4920 0.4895 -0.0226 0.1666  0.0067  323 HIS A C   
2705 O O   . HIS A 341 ? 0.6060 0.4908 0.4943 -0.0187 0.1744  0.0048  323 HIS A O   
2706 C CB  . HIS A 341 ? 0.6260 0.5354 0.5648 -0.0295 0.1858  0.0026  323 HIS A CB  
2707 C CG  . HIS A 341 ? 0.6869 0.5695 0.5893 -0.0343 0.1960  0.0053  323 HIS A CG  
2708 N ND1 . HIS A 341 ? 0.7151 0.5951 0.6063 -0.0385 0.1882  0.0081  323 HIS A ND1 
2709 C CD2 . HIS A 341 ? 0.7512 0.6063 0.6227 -0.0348 0.2128  0.0060  323 HIS A CD2 
2710 C CE1 . HIS A 341 ? 0.7696 0.6221 0.6258 -0.0409 0.1994  0.0109  323 HIS A CE1 
2711 N NE2 . HIS A 341 ? 0.7835 0.6200 0.6255 -0.0387 0.2141  0.0097  323 HIS A NE2 
2712 N N   . GLY A 342 ? 0.5959 0.4706 0.4498 -0.0247 0.1587  0.0096  324 GLY A N   
2713 C CA  . GLY A 342 ? 0.5991 0.4502 0.4154 -0.0231 0.1597  0.0099  324 GLY A CA  
2714 C C   . GLY A 342 ? 0.5816 0.4364 0.3936 -0.0192 0.1454  0.0096  324 GLY A C   
2715 O O   . GLY A 342 ? 0.6016 0.4384 0.3841 -0.0185 0.1437  0.0087  324 GLY A O   
2716 N N   . ILE A 343 ? 0.5501 0.4270 0.3902 -0.0166 0.1350  0.0099  325 ILE A N   
2717 C CA  . ILE A 343 ? 0.5285 0.4077 0.3642 -0.0133 0.1219  0.0104  325 ILE A CA  
2718 C C   . ILE A 343 ? 0.5083 0.3839 0.3243 -0.0159 0.1073  0.0123  325 ILE A C   
2719 O O   . ILE A 343 ? 0.4909 0.3726 0.3098 -0.0189 0.1027  0.0142  325 ILE A O   
2720 C CB  . ILE A 343 ? 0.5109 0.4124 0.3792 -0.0090 0.1149  0.0112  325 ILE A CB  
2721 C CG1 . ILE A 343 ? 0.5380 0.4375 0.4003 -0.0051 0.1057  0.0120  325 ILE A CG1 
2722 C CG2 . ILE A 343 ? 0.5175 0.4363 0.4005 -0.0114 0.1038  0.0131  325 ILE A CG2 
2723 C CD1 . ILE A 343 ? 0.5624 0.4765 0.4514 0.0013  0.1033  0.0130  325 ILE A CD1 
2724 N N   . VAL A 344 ? 0.4931 0.3590 0.2915 -0.0149 0.1005  0.0113  326 VAL A N   
2725 C CA  . VAL A 344 ? 0.4619 0.3275 0.2482 -0.0169 0.0863  0.0123  326 VAL A CA  
2726 C C   . VAL A 344 ? 0.4477 0.3214 0.2444 -0.0145 0.0776  0.0124  326 VAL A C   
2727 O O   . VAL A 344 ? 0.4535 0.3202 0.2477 -0.0122 0.0814  0.0103  326 VAL A O   
2728 C CB  . VAL A 344 ? 0.4898 0.3348 0.2437 -0.0186 0.0851  0.0103  326 VAL A CB  
2729 C CG1 . VAL A 344 ? 0.4652 0.3123 0.2123 -0.0200 0.0692  0.0103  326 VAL A CG1 
2730 C CG2 . VAL A 344 ? 0.4737 0.3074 0.2130 -0.0204 0.0937  0.0115  326 VAL A CG2 
2731 N N   . TYR A 345 ? 0.4200 0.3064 0.2269 -0.0152 0.0672  0.0148  327 TYR A N   
2732 C CA  . TYR A 345 ? 0.4097 0.3020 0.2245 -0.0132 0.0600  0.0156  327 TYR A CA  
2733 C C   . TYR A 345 ? 0.3946 0.2799 0.1959 -0.0157 0.0518  0.0140  327 TYR A C   
2734 O O   . TYR A 345 ? 0.3994 0.2805 0.1889 -0.0188 0.0474  0.0130  327 TYR A O   
2735 C CB  . TYR A 345 ? 0.4068 0.3158 0.2393 -0.0122 0.0538  0.0187  327 TYR A CB  
2736 C CG  . TYR A 345 ? 0.4418 0.3614 0.2930 -0.0095 0.0592  0.0195  327 TYR A CG  
2737 C CD1 . TYR A 345 ? 0.4481 0.3706 0.3117 -0.0041 0.0628  0.0199  327 TYR A CD1 
2738 C CD2 . TYR A 345 ? 0.4674 0.3943 0.3261 -0.0124 0.0608  0.0193  327 TYR A CD2 
2739 C CE1 . TYR A 345 ? 0.4454 0.3801 0.3308 -0.0011 0.0666  0.0199  327 TYR A CE1 
2740 C CE2 . TYR A 345 ? 0.4956 0.4342 0.3760 -0.0105 0.0656  0.0187  327 TYR A CE2 
2741 C CZ  . TYR A 345 ? 0.4841 0.4277 0.3788 -0.0046 0.0677  0.0188  327 TYR A CZ  
2742 O OH  . TYR A 345 ? 0.5038 0.4610 0.4240 -0.0023 0.0714  0.0175  327 TYR A OH  
2743 N N   . SER A 346 ? 0.3843 0.2689 0.1897 -0.0142 0.0499  0.0137  328 SER A N   
2744 C CA  . SER A 346 ? 0.3868 0.2664 0.1856 -0.0169 0.0434  0.0114  328 SER A CA  
2745 C C   . SER A 346 ? 0.3810 0.2678 0.1917 -0.0156 0.0402  0.0144  328 SER A C   
2746 O O   . SER A 346 ? 0.3896 0.2778 0.2083 -0.0113 0.0441  0.0171  328 SER A O   
2747 C CB  . SER A 346 ? 0.3940 0.2589 0.1815 -0.0174 0.0474  0.0065  328 SER A CB  
2748 O OG  . SER A 346 ? 0.3715 0.2328 0.1566 -0.0206 0.0411  0.0031  328 SER A OG  
2749 N N   . GLY A 347 ? 0.3826 0.2730 0.1939 -0.0186 0.0334  0.0143  329 GLY A N   
2750 C CA  . GLY A 347 ? 0.3663 0.2597 0.1850 -0.0179 0.0320  0.0168  329 GLY A CA  
2751 C C   . GLY A 347 ? 0.3744 0.2789 0.2004 -0.0150 0.0303  0.0216  329 GLY A C   
2752 O O   . GLY A 347 ? 0.3672 0.2790 0.1943 -0.0164 0.0272  0.0218  329 GLY A O   
2753 N N   . GLY A 348 ? 0.3673 0.2721 0.1976 -0.0104 0.0321  0.0254  330 GLY A N   
2754 C CA  . GLY A 348 ? 0.3682 0.2833 0.2046 -0.0069 0.0286  0.0294  330 GLY A CA  
2755 C C   . GLY A 348 ? 0.3579 0.2764 0.1919 -0.0094 0.0238  0.0303  330 GLY A C   
2756 O O   . GLY A 348 ? 0.3643 0.2763 0.1943 -0.0127 0.0247  0.0290  330 GLY A O   
2757 N N   . SER A 349 ? 0.3465 0.2751 0.1844 -0.0082 0.0192  0.0317  331 SER A N   
2758 C CA  . SER A 349 ? 0.3554 0.2870 0.1902 -0.0102 0.0151  0.0323  331 SER A CA  
2759 C C   . SER A 349 ? 0.3484 0.2910 0.1887 -0.0120 0.0109  0.0306  331 SER A C   
2760 O O   . SER A 349 ? 0.3333 0.2819 0.1812 -0.0112 0.0114  0.0297  331 SER A O   
2761 C CB  . SER A 349 ? 0.3631 0.2913 0.1924 -0.0052 0.0138  0.0365  331 SER A CB  
2762 O OG  . SER A 349 ? 0.4112 0.3479 0.2458 0.0001  0.0091  0.0382  331 SER A OG  
2763 N N   . SER A 350 ? 0.3503 0.2949 0.1877 -0.0149 0.0079  0.0298  332 SER A N   
2764 C CA  . SER A 350 ? 0.3580 0.3121 0.2010 -0.0170 0.0043  0.0277  332 SER A CA  
2765 C C   . SER A 350 ? 0.3648 0.3280 0.2153 -0.0130 0.0004  0.0282  332 SER A C   
2766 O O   . SER A 350 ? 0.3706 0.3423 0.2310 -0.0149 -0.0006 0.0257  332 SER A O   
2767 C CB  . SER A 350 ? 0.3569 0.3104 0.1951 -0.0200 0.0022  0.0265  332 SER A CB  
2768 O OG  . SER A 350 ? 0.3802 0.3298 0.2103 -0.0171 0.0011  0.0287  332 SER A OG  
2769 N N   . ASP A 351 ? 0.3839 0.3450 0.2308 -0.0072 -0.0017 0.0314  333 ASP A N   
2770 C CA  . ASP A 351 ? 0.4136 0.3839 0.2694 -0.0017 -0.0072 0.0319  333 ASP A CA  
2771 C C   . ASP A 351 ? 0.4179 0.3945 0.2891 -0.0004 -0.0036 0.0307  333 ASP A C   
2772 O O   . ASP A 351 ? 0.4183 0.4066 0.3039 0.0021  -0.0077 0.0290  333 ASP A O   
2773 C CB  . ASP A 351 ? 0.4399 0.4038 0.2859 0.0056  -0.0105 0.0365  333 ASP A CB  
2774 C CG  . ASP A 351 ? 0.5004 0.4600 0.3311 0.0058  -0.0154 0.0373  333 ASP A CG  
2775 O OD1 . ASP A 351 ? 0.5401 0.5057 0.3715 0.0013  -0.0189 0.0334  333 ASP A OD1 
2776 O OD2 . ASP A 351 ? 0.5706 0.5187 0.3870 0.0105  -0.0148 0.0419  333 ASP A OD2 
2777 N N   . THR A 352 ? 0.4164 0.3847 0.2849 -0.0020 0.0042  0.0310  334 THR A N   
2778 C CA  . THR A 352 ? 0.4355 0.4061 0.3147 -0.0021 0.0103  0.0293  334 THR A CA  
2779 C C   . THR A 352 ? 0.4282 0.4072 0.3169 -0.0072 0.0111  0.0256  334 THR A C   
2780 O O   . THR A 352 ? 0.4269 0.4152 0.3319 -0.0061 0.0127  0.0237  334 THR A O   
2781 C CB  . THR A 352 ? 0.4433 0.4008 0.3122 -0.0045 0.0178  0.0291  334 THR A CB  
2782 O OG1 . THR A 352 ? 0.4733 0.4213 0.3338 -0.0012 0.0183  0.0319  334 THR A OG1 
2783 C CG2 . THR A 352 ? 0.4387 0.3955 0.3147 -0.0044 0.0257  0.0272  334 THR A CG2 
2784 N N   . ILE A 353 ? 0.4305 0.4058 0.3104 -0.0128 0.0106  0.0245  335 ILE A N   
2785 C CA  . ILE A 353 ? 0.4322 0.4124 0.3190 -0.0178 0.0123  0.0216  335 ILE A CA  
2786 C C   . ILE A 353 ? 0.4255 0.4197 0.3271 -0.0174 0.0062  0.0191  335 ILE A C   
2787 O O   . ILE A 353 ? 0.4177 0.4201 0.3357 -0.0188 0.0093  0.0162  335 ILE A O   
2788 C CB  . ILE A 353 ? 0.4403 0.4133 0.3150 -0.0228 0.0120  0.0212  335 ILE A CB  
2789 C CG1 . ILE A 353 ? 0.4483 0.4089 0.3087 -0.0226 0.0141  0.0228  335 ILE A CG1 
2790 C CG2 . ILE A 353 ? 0.4475 0.4215 0.3275 -0.0274 0.0160  0.0190  335 ILE A CG2 
2791 C CD1 . ILE A 353 ? 0.4755 0.4274 0.3302 -0.0236 0.0206  0.0225  335 ILE A CD1 
2792 N N   . CYS A 354 ? 0.4224 0.4191 0.3186 -0.0154 -0.0023 0.0196  336 CYS A N   
2793 C CA  . CYS A 354 ? 0.4339 0.4436 0.3423 -0.0145 -0.0103 0.0164  336 CYS A CA  
2794 C C   . CYS A 354 ? 0.4287 0.4496 0.3561 -0.0094 -0.0123 0.0154  336 CYS A C   
2795 O O   . CYS A 354 ? 0.4279 0.4612 0.3746 -0.0116 -0.0140 0.0106  336 CYS A O   
2796 C CB  . CYS A 354 ? 0.4497 0.4569 0.3440 -0.0121 -0.0189 0.0175  336 CYS A CB  
2797 S SG  . CYS A 354 ? 0.5018 0.4986 0.3804 -0.0186 -0.0157 0.0170  336 CYS A SG  
2798 N N   . ASP A 355 ? 0.4371 0.4539 0.3611 -0.0027 -0.0118 0.0195  337 ASP A N   
2799 C CA  . ASP A 355 ? 0.4477 0.4751 0.3915 0.0035  -0.0139 0.0188  337 ASP A CA  
2800 C C   . ASP A 355 ? 0.4324 0.4653 0.3959 -0.0001 -0.0035 0.0154  337 ASP A C   
2801 O O   . ASP A 355 ? 0.4257 0.4736 0.4138 0.0003  -0.0057 0.0110  337 ASP A O   
2802 C CB  . ASP A 355 ? 0.4733 0.4917 0.4080 0.0116  -0.0133 0.0244  337 ASP A CB  
2803 C CG  . ASP A 355 ? 0.5451 0.5570 0.4607 0.0166  -0.0229 0.0284  337 ASP A CG  
2804 O OD1 . ASP A 355 ? 0.5816 0.5975 0.4915 0.0146  -0.0313 0.0264  337 ASP A OD1 
2805 O OD2 . ASP A 355 ? 0.6064 0.6071 0.5112 0.0225  -0.0208 0.0337  337 ASP A OD2 
2806 N N   . LEU A 356 ? 0.4210 0.4411 0.3735 -0.0037 0.0079  0.0169  338 LEU A N   
2807 C CA  . LEU A 356 ? 0.4245 0.4449 0.3899 -0.0068 0.0204  0.0145  338 LEU A CA  
2808 C C   . LEU A 356 ? 0.4181 0.4444 0.3945 -0.0143 0.0238  0.0100  338 LEU A C   
2809 O O   . LEU A 356 ? 0.4215 0.4554 0.4196 -0.0159 0.0314  0.0064  338 LEU A O   
2810 C CB  . LEU A 356 ? 0.4254 0.4279 0.3715 -0.0077 0.0305  0.0172  338 LEU A CB  
2811 C CG  . LEU A 356 ? 0.4545 0.4507 0.3951 -0.0005 0.0307  0.0205  338 LEU A CG  
2812 C CD1 . LEU A 356 ? 0.4465 0.4248 0.3671 -0.0024 0.0394  0.0216  338 LEU A CD1 
2813 C CD2 . LEU A 356 ? 0.4325 0.4392 0.3974 0.0058  0.0331  0.0193  338 LEU A CD2 
2814 N N   . LEU A 357 ? 0.4030 0.4258 0.3667 -0.0190 0.0190  0.0097  339 LEU A N   
2815 C CA  . LEU A 357 ? 0.3983 0.4255 0.3725 -0.0261 0.0222  0.0055  339 LEU A CA  
2816 C C   . LEU A 357 ? 0.3971 0.4413 0.3901 -0.0268 0.0113  0.0003  339 LEU A C   
2817 O O   . LEU A 357 ? 0.3966 0.4453 0.4011 -0.0332 0.0139  -0.0043 339 LEU A O   
2818 C CB  . LEU A 357 ? 0.3934 0.4060 0.3451 -0.0312 0.0249  0.0075  339 LEU A CB  
2819 C CG  . LEU A 357 ? 0.3957 0.3913 0.3285 -0.0310 0.0342  0.0114  339 LEU A CG  
2820 C CD1 . LEU A 357 ? 0.3815 0.3646 0.2950 -0.0348 0.0344  0.0130  339 LEU A CD1 
2821 C CD2 . LEU A 357 ? 0.3845 0.3774 0.3273 -0.0323 0.0480  0.0102  339 LEU A CD2 
2822 N N   . GLY A 358 ? 0.4022 0.4549 0.3974 -0.0202 -0.0008 0.0008  340 GLY A N   
2823 C CA  . GLY A 358 ? 0.4013 0.4694 0.4112 -0.0199 -0.0137 -0.0047 340 GLY A CA  
2824 C C   . GLY A 358 ? 0.4057 0.4686 0.4008 -0.0258 -0.0178 -0.0066 340 GLY A C   
2825 O O   . GLY A 358 ? 0.4175 0.4893 0.4271 -0.0312 -0.0205 -0.0132 340 GLY A O   
2826 N N   . ALA A 359 ? 0.4117 0.4597 0.3795 -0.0252 -0.0171 -0.0014 341 ALA A N   
2827 C CA  . ALA A 359 ? 0.4162 0.4570 0.3696 -0.0307 -0.0183 -0.0028 341 ALA A CA  
2828 C C   . ALA A 359 ? 0.4218 0.4577 0.3544 -0.0265 -0.0282 -0.0007 341 ALA A C   
2829 O O   . ALA A 359 ? 0.4327 0.4639 0.3546 -0.0201 -0.0300 0.0045  341 ALA A O   
2830 C CB  . ALA A 359 ? 0.4070 0.4333 0.3478 -0.0344 -0.0070 0.0008  341 ALA A CB  
2831 N N   . LYS A 360 ? 0.4108 0.4469 0.3379 -0.0302 -0.0335 -0.0049 342 LYS A N   
2832 C CA  . LYS A 360 ? 0.4205 0.4477 0.3241 -0.0277 -0.0391 -0.0030 342 LYS A CA  
2833 C C   . LYS A 360 ? 0.3983 0.4128 0.2898 -0.0324 -0.0301 -0.0010 342 LYS A C   
2834 O O   . LYS A 360 ? 0.3997 0.4137 0.3006 -0.0377 -0.0231 -0.0026 342 LYS A O   
2835 C CB  . LYS A 360 ? 0.4194 0.4527 0.3227 -0.0293 -0.0496 -0.0098 342 LYS A CB  
2836 C CG  . LYS A 360 ? 0.4902 0.5401 0.4129 -0.0262 -0.0605 -0.0148 342 LYS A CG  
2837 C CD  . LYS A 360 ? 0.5626 0.6141 0.4830 -0.0164 -0.0653 -0.0089 342 LYS A CD  
2838 C CE  . LYS A 360 ? 0.6189 0.6897 0.5665 -0.0131 -0.0753 -0.0142 342 LYS A CE  
2839 N NZ  . LYS A 360 ? 0.6255 0.7004 0.5847 -0.0057 -0.0733 -0.0090 342 LYS A NZ  
2840 N N   . GLY A 361 ? 0.3942 0.3980 0.2659 -0.0303 -0.0299 0.0024  343 GLY A N   
2841 C CA  . GLY A 361 ? 0.3726 0.3656 0.2356 -0.0339 -0.0223 0.0040  343 GLY A CA  
2842 C C   . GLY A 361 ? 0.3709 0.3634 0.2393 -0.0403 -0.0197 -0.0008 343 GLY A C   
2843 O O   . GLY A 361 ? 0.3724 0.3591 0.2420 -0.0428 -0.0130 0.0007  343 GLY A O   
2844 N N   . LYS A 362 ? 0.3669 0.3641 0.2371 -0.0426 -0.0253 -0.0067 344 LYS A N   
2845 C CA  . LYS A 362 ? 0.3785 0.3732 0.2528 -0.0488 -0.0222 -0.0118 344 LYS A CA  
2846 C C   . LYS A 362 ? 0.3711 0.3709 0.2646 -0.0533 -0.0174 -0.0139 344 LYS A C   
2847 O O   . LYS A 362 ? 0.3870 0.3820 0.2841 -0.0584 -0.0125 -0.0167 344 LYS A O   
2848 C CB  . LYS A 362 ? 0.3843 0.3807 0.2528 -0.0504 -0.0295 -0.0185 344 LYS A CB  
2849 C CG  . LYS A 362 ? 0.3804 0.3654 0.2271 -0.0483 -0.0288 -0.0171 344 LYS A CG  
2850 C CD  . LYS A 362 ? 0.3678 0.3526 0.2024 -0.0479 -0.0373 -0.0229 344 LYS A CD  
2851 C CE  . LYS A 362 ? 0.4085 0.3804 0.2193 -0.0445 -0.0347 -0.0196 344 LYS A CE  
2852 N NZ  . LYS A 362 ? 0.4009 0.3707 0.1941 -0.0417 -0.0440 -0.0232 344 LYS A NZ  
2853 N N   . ASP A 363 ? 0.3713 0.3794 0.2767 -0.0512 -0.0178 -0.0124 345 ASP A N   
2854 C CA  . ASP A 363 ? 0.3588 0.3701 0.2814 -0.0548 -0.0106 -0.0133 345 ASP A CA  
2855 C C   . ASP A 363 ? 0.3509 0.3502 0.2643 -0.0538 -0.0014 -0.0065 345 ASP A C   
2856 O O   . ASP A 363 ? 0.3481 0.3444 0.2692 -0.0565 0.0068  -0.0059 345 ASP A O   
2857 C CB  . ASP A 363 ? 0.3600 0.3833 0.2971 -0.0514 -0.0131 -0.0132 345 ASP A CB  
2858 C CG  . ASP A 363 ? 0.4262 0.4639 0.3755 -0.0507 -0.0242 -0.0197 345 ASP A CG  
2859 O OD1 . ASP A 363 ? 0.4450 0.4855 0.3977 -0.0553 -0.0287 -0.0267 345 ASP A OD1 
2860 O OD2 . ASP A 363 ? 0.4577 0.5039 0.4140 -0.0450 -0.0290 -0.0182 345 ASP A OD2 
2861 N N   . ILE A 364 ? 0.3348 0.3265 0.2318 -0.0498 -0.0026 -0.0018 346 ILE A N   
2862 C CA  . ILE A 364 ? 0.3251 0.3066 0.2137 -0.0483 0.0035  0.0037  346 ILE A CA  
2863 C C   . ILE A 364 ? 0.3323 0.3031 0.2114 -0.0497 0.0055  0.0046  346 ILE A C   
2864 O O   . ILE A 364 ? 0.3315 0.3013 0.2045 -0.0491 0.0019  0.0036  346 ILE A O   
2865 C CB  . ILE A 364 ? 0.3225 0.3033 0.2028 -0.0429 0.0011  0.0078  346 ILE A CB  
2866 C CG1 . ILE A 364 ? 0.3285 0.3185 0.2190 -0.0402 -0.0001 0.0076  346 ILE A CG1 
2867 C CG2 . ILE A 364 ? 0.2828 0.2532 0.1539 -0.0416 0.0055  0.0119  346 ILE A CG2 
2868 C CD1 . ILE A 364 ? 0.3071 0.2973 0.1903 -0.0344 -0.0040 0.0109  346 ILE A CD1 
2869 N N   . LEU A 365 ? 0.3170 0.2789 0.1942 -0.0509 0.0115  0.0069  347 LEU A N   
2870 C CA  . LEU A 365 ? 0.3197 0.2710 0.1875 -0.0500 0.0121  0.0090  347 LEU A CA  
2871 C C   . LEU A 365 ? 0.3305 0.2758 0.1890 -0.0461 0.0122  0.0136  347 LEU A C   
2872 O O   . LEU A 365 ? 0.3303 0.2704 0.1857 -0.0458 0.0165  0.0158  347 LEU A O   
2873 C CB  . LEU A 365 ? 0.3300 0.2727 0.1993 -0.0533 0.0175  0.0084  347 LEU A CB  
2874 C CG  . LEU A 365 ? 0.3255 0.2566 0.1863 -0.0511 0.0175  0.0110  347 LEU A CG  
2875 C CD1 . LEU A 365 ? 0.3161 0.2504 0.1778 -0.0505 0.0131  0.0083  347 LEU A CD1 
2876 C CD2 . LEU A 365 ? 0.3523 0.2717 0.2125 -0.0534 0.0240  0.0119  347 LEU A CD2 
2877 N N   . TYR A 366 ? 0.3354 0.2807 0.1893 -0.0435 0.0080  0.0143  348 TYR A N   
2878 C CA  . TYR A 366 ? 0.3326 0.2728 0.1791 -0.0403 0.0068  0.0171  348 TYR A CA  
2879 C C   . TYR A 366 ? 0.3367 0.2687 0.1789 -0.0388 0.0048  0.0181  348 TYR A C   
2880 O O   . TYR A 366 ? 0.3355 0.2689 0.1819 -0.0390 0.0032  0.0164  348 TYR A O   
2881 C CB  . TYR A 366 ? 0.3228 0.2686 0.1697 -0.0385 0.0040  0.0169  348 TYR A CB  
2882 C CG  . TYR A 366 ? 0.3417 0.2827 0.1830 -0.0361 0.0029  0.0185  348 TYR A CG  
2883 C CD1 . TYR A 366 ? 0.3786 0.3151 0.2144 -0.0352 0.0052  0.0200  348 TYR A CD1 
2884 C CD2 . TYR A 366 ? 0.3578 0.2980 0.1997 -0.0351 0.0001  0.0176  348 TYR A CD2 
2885 C CE1 . TYR A 366 ? 0.3790 0.3101 0.2081 -0.0333 0.0036  0.0204  348 TYR A CE1 
2886 C CE2 . TYR A 366 ? 0.3813 0.3175 0.2197 -0.0336 -0.0018 0.0177  348 TYR A CE2 
2887 C CZ  . TYR A 366 ? 0.3883 0.3197 0.2192 -0.0326 -0.0007 0.0190  348 TYR A CZ  
2888 O OH  . TYR A 366 ? 0.3977 0.3239 0.2231 -0.0313 -0.0030 0.0181  348 TYR A OH  
2889 N N   . ILE A 367 ? 0.3447 0.2676 0.1779 -0.0367 0.0049  0.0208  349 ILE A N   
2890 C CA  . ILE A 367 ? 0.3485 0.2618 0.1759 -0.0340 0.0018  0.0224  349 ILE A CA  
2891 C C   . ILE A 367 ? 0.3515 0.2642 0.1751 -0.0309 -0.0044 0.0221  349 ILE A C   
2892 O O   . ILE A 367 ? 0.3669 0.2763 0.1820 -0.0301 -0.0041 0.0229  349 ILE A O   
2893 C CB  . ILE A 367 ? 0.3639 0.2647 0.1805 -0.0339 0.0067  0.0256  349 ILE A CB  
2894 C CG1 . ILE A 367 ? 0.3541 0.2577 0.1790 -0.0385 0.0137  0.0243  349 ILE A CG1 
2895 C CG2 . ILE A 367 ? 0.3884 0.2765 0.1957 -0.0297 0.0027  0.0283  349 ILE A CG2 
2896 C CD1 . ILE A 367 ? 0.3867 0.2795 0.2042 -0.0400 0.0221  0.0268  349 ILE A CD1 
2897 N N   . GLY A 368 ? 0.3440 0.2603 0.1756 -0.0295 -0.0093 0.0202  350 GLY A N   
2898 C CA  . GLY A 368 ? 0.3362 0.2537 0.1687 -0.0274 -0.0154 0.0184  350 GLY A CA  
2899 C C   . GLY A 368 ? 0.3488 0.2663 0.1895 -0.0244 -0.0217 0.0169  350 GLY A C   
2900 O O   . GLY A 368 ? 0.3355 0.2516 0.1806 -0.0239 -0.0203 0.0176  350 GLY A O   
2901 N N   . ASP A 369 ? 0.3340 0.2532 0.1783 -0.0226 -0.0286 0.0143  351 ASP A N   
2902 C CA  . ASP A 369 ? 0.3336 0.2547 0.1895 -0.0190 -0.0366 0.0118  351 ASP A CA  
2903 C C   . ASP A 369 ? 0.3174 0.2496 0.1932 -0.0215 -0.0359 0.0067  351 ASP A C   
2904 O O   . ASP A 369 ? 0.3214 0.2583 0.2133 -0.0194 -0.0403 0.0036  351 ASP A O   
2905 C CB  . ASP A 369 ? 0.3491 0.2629 0.1940 -0.0144 -0.0476 0.0117  351 ASP A CB  
2906 C CG  . ASP A 369 ? 0.3695 0.2853 0.2117 -0.0164 -0.0499 0.0083  351 ASP A CG  
2907 O OD1 . ASP A 369 ? 0.3388 0.2512 0.1690 -0.0191 -0.0431 0.0102  351 ASP A OD1 
2908 O OD2 . ASP A 369 ? 0.3756 0.2971 0.2301 -0.0158 -0.0577 0.0030  351 ASP A OD2 
2909 N N   . HIS A 370 ? 0.3003 0.2358 0.1756 -0.0255 -0.0300 0.0058  352 HIS A N   
2910 C CA  . HIS A 370 ? 0.3058 0.2488 0.1978 -0.0283 -0.0270 0.0014  352 HIS A CA  
2911 C C   . HIS A 370 ? 0.2945 0.2404 0.1922 -0.0308 -0.0173 0.0019  352 HIS A C   
2912 O O   . HIS A 370 ? 0.2892 0.2337 0.1768 -0.0329 -0.0113 0.0045  352 HIS A O   
2913 C CB  . HIS A 370 ? 0.2945 0.2366 0.1812 -0.0306 -0.0255 0.0004  352 HIS A CB  
2914 C CG  . HIS A 370 ? 0.3105 0.2578 0.2147 -0.0333 -0.0240 -0.0048 352 HIS A CG  
2915 N ND1 . HIS A 370 ? 0.3099 0.2563 0.2152 -0.0344 -0.0276 -0.0084 352 HIS A ND1 
2916 C CD2 . HIS A 370 ? 0.2801 0.2327 0.2025 -0.0353 -0.0183 -0.0078 352 HIS A CD2 
2917 C CE1 . HIS A 370 ? 0.2506 0.2020 0.1754 -0.0375 -0.0241 -0.0133 352 HIS A CE1 
2918 N NE2 . HIS A 370 ? 0.3101 0.2652 0.2455 -0.0380 -0.0180 -0.0128 352 HIS A NE2 
2919 N N   . ILE A 371 ? 0.2979 0.2476 0.2115 -0.0302 -0.0166 -0.0009 353 ILE A N   
2920 C CA  . ILE A 371 ? 0.2981 0.2485 0.2158 -0.0321 -0.0076 -0.0012 353 ILE A CA  
2921 C C   . ILE A 371 ? 0.3033 0.2536 0.2184 -0.0359 0.0013  -0.0016 353 ILE A C   
2922 O O   . ILE A 371 ? 0.3072 0.2549 0.2136 -0.0373 0.0079  -0.0001 353 ILE A O   
2923 C CB  . ILE A 371 ? 0.2915 0.2458 0.2299 -0.0304 -0.0076 -0.0051 353 ILE A CB  
2924 C CG1 . ILE A 371 ? 0.3044 0.2570 0.2444 -0.0321 0.0026  -0.0059 353 ILE A CG1 
2925 C CG2 . ILE A 371 ? 0.2973 0.2577 0.2548 -0.0315 -0.0078 -0.0099 353 ILE A CG2 
2926 C CD1 . ILE A 371 ? 0.3536 0.3005 0.2757 -0.0323 0.0039  -0.0024 353 ILE A CD1 
2927 N N   . PHE A 372 ? 0.2970 0.2487 0.2177 -0.0372 0.0010  -0.0035 354 PHE A N   
2928 C CA  . PHE A 372 ? 0.3011 0.2501 0.2187 -0.0402 0.0101  -0.0032 354 PHE A CA  
2929 C C   . PHE A 372 ? 0.3135 0.2586 0.2126 -0.0398 0.0088  0.0011  354 PHE A C   
2930 O O   . PHE A 372 ? 0.3343 0.2763 0.2204 -0.0398 0.0131  0.0044  354 PHE A O   
2931 C CB  . PHE A 372 ? 0.2919 0.2435 0.2282 -0.0425 0.0125  -0.0081 354 PHE A CB  
2932 C CG  . PHE A 372 ? 0.3158 0.2616 0.2478 -0.0456 0.0233  -0.0073 354 PHE A CG  
2933 C CD1 . PHE A 372 ? 0.3404 0.2808 0.2660 -0.0466 0.0343  -0.0057 354 PHE A CD1 
2934 C CD2 . PHE A 372 ? 0.3274 0.2708 0.2590 -0.0470 0.0231  -0.0079 354 PHE A CD2 
2935 C CE1 . PHE A 372 ? 0.3598 0.2915 0.2774 -0.0486 0.0449  -0.0039 354 PHE A CE1 
2936 C CE2 . PHE A 372 ? 0.3412 0.2764 0.2672 -0.0493 0.0342  -0.0062 354 PHE A CE2 
2937 C CZ  . PHE A 372 ? 0.3333 0.2623 0.2512 -0.0497 0.0449  -0.0036 354 PHE A CZ  
2938 N N   . GLY A 373 ? 0.3075 0.2529 0.2052 -0.0389 0.0019  0.0008  355 GLY A N   
2939 C CA  . GLY A 373 ? 0.3098 0.2513 0.1941 -0.0385 0.0020  0.0036  355 GLY A CA  
2940 C C   . GLY A 373 ? 0.3259 0.2664 0.1963 -0.0366 0.0000  0.0077  355 GLY A C   
2941 O O   . GLY A 373 ? 0.3448 0.2834 0.2061 -0.0361 0.0027  0.0105  355 GLY A O   
2942 N N   . ASP A 374 ? 0.3163 0.2579 0.1865 -0.0354 -0.0040 0.0080  356 ASP A N   
2943 C CA  . ASP A 374 ? 0.3179 0.2585 0.1777 -0.0346 -0.0042 0.0112  356 ASP A CA  
2944 C C   . ASP A 374 ? 0.3121 0.2548 0.1723 -0.0357 -0.0004 0.0116  356 ASP A C   
2945 O O   . ASP A 374 ? 0.3297 0.2734 0.1836 -0.0360 0.0013  0.0133  356 ASP A O   
2946 C CB  . ASP A 374 ? 0.3122 0.2495 0.1685 -0.0327 -0.0095 0.0118  356 ASP A CB  
2947 C CG  . ASP A 374 ? 0.3500 0.2828 0.2001 -0.0313 -0.0142 0.0114  356 ASP A CG  
2948 O OD1 . ASP A 374 ? 0.3610 0.2928 0.2063 -0.0319 -0.0119 0.0117  356 ASP A OD1 
2949 O OD2 . ASP A 374 ? 0.2827 0.2120 0.1312 -0.0290 -0.0206 0.0107  356 ASP A OD2 
2950 N N   . ILE A 375 ? 0.2990 0.2424 0.1675 -0.0361 0.0005  0.0093  357 ILE A N   
2951 C CA  . ILE A 375 ? 0.2907 0.2341 0.1585 -0.0370 0.0031  0.0087  357 ILE A CA  
2952 C C   . ILE A 375 ? 0.2885 0.2314 0.1545 -0.0385 0.0092  0.0075  357 ILE A C   
2953 O O   . ILE A 375 ? 0.2853 0.2279 0.1419 -0.0391 0.0103  0.0083  357 ILE A O   
2954 C CB  . ILE A 375 ? 0.2902 0.2325 0.1668 -0.0357 0.0009  0.0072  357 ILE A CB  
2955 C CG1 . ILE A 375 ? 0.3267 0.2658 0.1983 -0.0335 -0.0049 0.0096  357 ILE A CG1 
2956 C CG2 . ILE A 375 ? 0.2731 0.2141 0.1502 -0.0370 0.0051  0.0055  357 ILE A CG2 
2957 C CD1 . ILE A 375 ? 0.3070 0.2439 0.1679 -0.0347 -0.0034 0.0121  357 ILE A CD1 
2958 N N   . LEU A 376 ? 0.2920 0.2343 0.1668 -0.0391 0.0132  0.0052  358 LEU A N   
2959 C CA  . LEU A 376 ? 0.3020 0.2405 0.1724 -0.0404 0.0210  0.0045  358 LEU A CA  
2960 C C   . LEU A 376 ? 0.3246 0.2602 0.1810 -0.0398 0.0219  0.0078  358 LEU A C   
2961 O O   . LEU A 376 ? 0.3392 0.2708 0.1827 -0.0397 0.0245  0.0086  358 LEU A O   
2962 C CB  . LEU A 376 ? 0.2957 0.2340 0.1814 -0.0415 0.0267  0.0013  358 LEU A CB  
2963 C CG  . LEU A 376 ? 0.3040 0.2355 0.1853 -0.0433 0.0380  0.0004  358 LEU A CG  
2964 C CD1 . LEU A 376 ? 0.2921 0.2252 0.1945 -0.0447 0.0446  -0.0043 358 LEU A CD1 
2965 C CD2 . LEU A 376 ? 0.2684 0.1942 0.1378 -0.0433 0.0414  0.0038  358 LEU A CD2 
2966 N N   . LYS A 377 ? 0.3115 0.2480 0.1693 -0.0390 0.0193  0.0096  359 LYS A N   
2967 C CA  . LYS A 377 ? 0.3240 0.2569 0.1705 -0.0376 0.0206  0.0130  359 LYS A CA  
2968 C C   . LYS A 377 ? 0.3287 0.2645 0.1656 -0.0356 0.0153  0.0153  359 LYS A C   
2969 O O   . LYS A 377 ? 0.3463 0.2791 0.1721 -0.0337 0.0159  0.0175  359 LYS A O   
2970 C CB  . LYS A 377 ? 0.3176 0.2495 0.1691 -0.0374 0.0205  0.0135  359 LYS A CB  
2971 C CG  . LYS A 377 ? 0.3342 0.2620 0.1948 -0.0398 0.0276  0.0111  359 LYS A CG  
2972 C CD  . LYS A 377 ? 0.3707 0.2893 0.2198 -0.0395 0.0363  0.0136  359 LYS A CD  
2973 C CE  . LYS A 377 ? 0.4306 0.3439 0.2901 -0.0425 0.0455  0.0112  359 LYS A CE  
2974 N NZ  . LYS A 377 ? 0.4922 0.3926 0.3377 -0.0422 0.0564  0.0143  359 LYS A NZ  
2975 N N   . SER A 378 ? 0.3170 0.2581 0.1584 -0.0359 0.0102  0.0147  360 SER A N   
2976 C CA  . SER A 378 ? 0.3168 0.2620 0.1536 -0.0349 0.0064  0.0157  360 SER A CA  
2977 C C   . SER A 378 ? 0.3287 0.2742 0.1603 -0.0358 0.0061  0.0137  360 SER A C   
2978 O O   . SER A 378 ? 0.3375 0.2848 0.1626 -0.0343 0.0031  0.0143  360 SER A O   
2979 C CB  . SER A 378 ? 0.2998 0.2485 0.1420 -0.0354 0.0034  0.0156  360 SER A CB  
2980 O OG  . SER A 378 ? 0.3134 0.2616 0.1598 -0.0372 0.0031  0.0136  360 SER A OG  
2981 N N   . LYS A 379 ? 0.3268 0.2701 0.1614 -0.0379 0.0087  0.0109  361 LYS A N   
2982 C CA  . LYS A 379 ? 0.3435 0.2846 0.1711 -0.0391 0.0097  0.0081  361 LYS A CA  
2983 C C   . LYS A 379 ? 0.3559 0.2906 0.1689 -0.0374 0.0124  0.0093  361 LYS A C   
2984 O O   . LYS A 379 ? 0.3479 0.2829 0.1500 -0.0360 0.0080  0.0090  361 LYS A O   
2985 C CB  . LYS A 379 ? 0.3424 0.2810 0.1771 -0.0412 0.0137  0.0048  361 LYS A CB  
2986 C CG  . LYS A 379 ? 0.3466 0.2808 0.1731 -0.0428 0.0164  0.0010  361 LYS A CG  
2987 C CD  . LYS A 379 ? 0.3349 0.2728 0.1581 -0.0442 0.0107  -0.0015 361 LYS A CD  
2988 C CE  . LYS A 379 ? 0.3314 0.2732 0.1672 -0.0459 0.0088  -0.0022 361 LYS A CE  
2989 N NZ  . LYS A 379 ? 0.3546 0.2998 0.1897 -0.0484 0.0048  -0.0057 361 LYS A NZ  
2990 N N   . LYS A 380 ? 0.3574 0.2856 0.1699 -0.0372 0.0193  0.0105  362 LYS A N   
2991 C CA  . LYS A 380 ? 0.3796 0.2977 0.1753 -0.0356 0.0243  0.0121  362 LYS A CA  
2992 C C   . LYS A 380 ? 0.3872 0.3042 0.1721 -0.0315 0.0197  0.0166  362 LYS A C   
2993 O O   . LYS A 380 ? 0.3918 0.3018 0.1583 -0.0289 0.0186  0.0179  362 LYS A O   
2994 C CB  . LYS A 380 ? 0.3879 0.2984 0.1875 -0.0370 0.0349  0.0124  362 LYS A CB  
2995 C CG  . LYS A 380 ? 0.4040 0.3137 0.2136 -0.0400 0.0414  0.0078  362 LYS A CG  
2996 C CD  . LYS A 380 ? 0.4242 0.3263 0.2388 -0.0414 0.0531  0.0079  362 LYS A CD  
2997 C CE  . LYS A 380 ? 0.4763 0.3770 0.3029 -0.0440 0.0617  0.0030  362 LYS A CE  
2998 N NZ  . LYS A 380 ? 0.5325 0.4233 0.3401 -0.0442 0.0673  0.0012  362 LYS A NZ  
2999 N N   . ARG A 381 ? 0.3597 0.2818 0.1546 -0.0304 0.0172  0.0191  363 ARG A N   
3000 C CA  . ARG A 381 ? 0.3729 0.2918 0.1589 -0.0260 0.0152  0.0236  363 ARG A CA  
3001 C C   . ARG A 381 ? 0.3719 0.2996 0.1574 -0.0234 0.0053  0.0235  363 ARG A C   
3002 O O   . ARG A 381 ? 0.3618 0.2867 0.1368 -0.0185 0.0016  0.0267  363 ARG A O   
3003 C CB  . ARG A 381 ? 0.3757 0.2945 0.1714 -0.0257 0.0178  0.0258  363 ARG A CB  
3004 C CG  . ARG A 381 ? 0.4380 0.3512 0.2413 -0.0292 0.0264  0.0244  363 ARG A CG  
3005 C CD  . ARG A 381 ? 0.5582 0.4579 0.3501 -0.0282 0.0352  0.0272  363 ARG A CD  
3006 N NE  . ARG A 381 ? 0.6645 0.5589 0.4493 -0.0239 0.0346  0.0320  363 ARG A NE  
3007 C CZ  . ARG A 381 ? 0.7069 0.5917 0.4726 -0.0189 0.0346  0.0367  363 ARG A CZ  
3008 N NH1 . ARG A 381 ? 0.7342 0.6132 0.4839 -0.0179 0.0350  0.0368  363 ARG A NH1 
3009 N NH2 . ARG A 381 ? 0.7077 0.5875 0.4689 -0.0142 0.0339  0.0413  363 ARG A NH2 
3010 N N   . GLN A 382 ? 0.3601 0.2981 0.1582 -0.0263 0.0012  0.0199  364 GLN A N   
3011 C CA  . GLN A 382 ? 0.3627 0.3109 0.1666 -0.0246 -0.0069 0.0191  364 GLN A CA  
3012 C C   . GLN A 382 ? 0.3599 0.3147 0.1679 -0.0279 -0.0112 0.0139  364 GLN A C   
3013 O O   . GLN A 382 ? 0.3517 0.3156 0.1665 -0.0271 -0.0178 0.0121  364 GLN A O   
3014 C CB  . GLN A 382 ? 0.3495 0.3035 0.1672 -0.0246 -0.0063 0.0205  364 GLN A CB  
3015 C CG  . GLN A 382 ? 0.3705 0.3183 0.1852 -0.0213 -0.0027 0.0249  364 GLN A CG  
3016 C CD  . GLN A 382 ? 0.4185 0.3640 0.2242 -0.0151 -0.0064 0.0284  364 GLN A CD  
3017 O OE1 . GLN A 382 ? 0.4764 0.4290 0.2827 -0.0127 -0.0137 0.0272  364 GLN A OE1 
3018 N NE2 . GLN A 382 ? 0.4422 0.3776 0.2402 -0.0122 -0.0017 0.0324  364 GLN A NE2 
3019 N N   . GLY A 383 ? 0.3619 0.3125 0.1680 -0.0317 -0.0072 0.0109  365 GLY A N   
3020 C CA  . GLY A 383 ? 0.3678 0.3227 0.1773 -0.0352 -0.0105 0.0054  365 GLY A CA  
3021 C C   . GLY A 383 ? 0.3553 0.3186 0.1820 -0.0380 -0.0113 0.0040  365 GLY A C   
3022 O O   . GLY A 383 ? 0.3670 0.3365 0.2000 -0.0404 -0.0153 -0.0003 365 GLY A O   
3023 N N   . TRP A 384 ? 0.3339 0.2960 0.1673 -0.0379 -0.0071 0.0072  366 TRP A N   
3024 C CA  . TRP A 384 ? 0.3112 0.2768 0.1563 -0.0403 -0.0058 0.0068  366 TRP A CA  
3025 C C   . TRP A 384 ? 0.3209 0.2825 0.1682 -0.0439 -0.0031 0.0038  366 TRP A C   
3026 O O   . TRP A 384 ? 0.3253 0.2814 0.1674 -0.0440 -0.0008 0.0030  366 TRP A O   
3027 C CB  . TRP A 384 ? 0.3093 0.2723 0.1562 -0.0385 -0.0030 0.0109  366 TRP A CB  
3028 C CG  . TRP A 384 ? 0.2927 0.2595 0.1407 -0.0352 -0.0044 0.0135  366 TRP A CG  
3029 C CD1 . TRP A 384 ? 0.3160 0.2876 0.1627 -0.0324 -0.0085 0.0136  366 TRP A CD1 
3030 C CD2 . TRP A 384 ? 0.3145 0.2793 0.1644 -0.0338 -0.0017 0.0162  366 TRP A CD2 
3031 N NE1 . TRP A 384 ? 0.3122 0.2857 0.1625 -0.0291 -0.0080 0.0164  366 TRP A NE1 
3032 C CE2 . TRP A 384 ? 0.3109 0.2799 0.1626 -0.0304 -0.0032 0.0177  366 TRP A CE2 
3033 C CE3 . TRP A 384 ? 0.2970 0.2562 0.1462 -0.0348 0.0012  0.0171  366 TRP A CE3 
3034 C CZ2 . TRP A 384 ? 0.3047 0.2721 0.1582 -0.0284 -0.0003 0.0198  366 TRP A CZ2 
3035 C CZ3 . TRP A 384 ? 0.3087 0.2657 0.1570 -0.0329 0.0031  0.0190  366 TRP A CZ3 
3036 C CH2 . TRP A 384 ? 0.3097 0.2706 0.1605 -0.0301 0.0032  0.0202  366 TRP A CH2 
3037 N N   . ARG A 385 ? 0.3114 0.2749 0.1669 -0.0468 -0.0023 0.0021  367 ARG A N   
3038 C CA  . ARG A 385 ? 0.3187 0.2761 0.1765 -0.0493 0.0013  0.0005  367 ARG A CA  
3039 C C   . ARG A 385 ? 0.3222 0.2738 0.1793 -0.0471 0.0036  0.0050  367 ARG A C   
3040 O O   . ARG A 385 ? 0.3205 0.2733 0.1772 -0.0452 0.0033  0.0081  367 ARG A O   
3041 C CB  . ARG A 385 ? 0.3286 0.2877 0.1947 -0.0534 0.0026  -0.0027 367 ARG A CB  
3042 C CG  . ARG A 385 ? 0.3347 0.3020 0.2044 -0.0558 -0.0019 -0.0083 367 ARG A CG  
3043 C CD  . ARG A 385 ? 0.3492 0.3141 0.2088 -0.0557 -0.0047 -0.0119 367 ARG A CD  
3044 N NE  . ARG A 385 ? 0.3845 0.3404 0.2419 -0.0578 0.0000  -0.0141 367 ARG A NE  
3045 C CZ  . ARG A 385 ? 0.3864 0.3402 0.2481 -0.0623 0.0013  -0.0200 367 ARG A CZ  
3046 N NH1 . ARG A 385 ? 0.3817 0.3427 0.2518 -0.0660 -0.0021 -0.0248 367 ARG A NH1 
3047 N NH2 . ARG A 385 ? 0.3805 0.3250 0.2400 -0.0632 0.0062  -0.0215 367 ARG A NH2 
3048 N N   . THR A 386 ? 0.3040 0.2494 0.1611 -0.0467 0.0053  0.0047  368 THR A N   
3049 C CA  . THR A 386 ? 0.3146 0.2556 0.1713 -0.0437 0.0050  0.0080  368 THR A CA  
3050 C C   . THR A 386 ? 0.3123 0.2456 0.1708 -0.0431 0.0062  0.0089  368 THR A C   
3051 O O   . THR A 386 ? 0.3132 0.2436 0.1744 -0.0450 0.0086  0.0063  368 THR A O   
3052 C CB  . THR A 386 ? 0.3009 0.2424 0.1584 -0.0421 0.0050  0.0071  368 THR A CB  
3053 O OG1 . THR A 386 ? 0.3469 0.2866 0.2056 -0.0438 0.0077  0.0035  368 THR A OG1 
3054 C CG2 . THR A 386 ? 0.3014 0.2470 0.1547 -0.0415 0.0045  0.0080  368 THR A CG2 
3055 N N   . PHE A 387 ? 0.3242 0.2527 0.1794 -0.0402 0.0044  0.0125  369 PHE A N   
3056 C CA  . PHE A 387 ? 0.3276 0.2463 0.1809 -0.0378 0.0041  0.0148  369 PHE A CA  
3057 C C   . PHE A 387 ? 0.3371 0.2548 0.1897 -0.0332 -0.0016 0.0164  369 PHE A C   
3058 O O   . PHE A 387 ? 0.3380 0.2558 0.1845 -0.0321 -0.0040 0.0181  369 PHE A O   
3059 C CB  . PHE A 387 ? 0.3432 0.2545 0.1892 -0.0389 0.0076  0.0177  369 PHE A CB  
3060 C CG  . PHE A 387 ? 0.3439 0.2411 0.1834 -0.0358 0.0082  0.0212  369 PHE A CG  
3061 C CD1 . PHE A 387 ? 0.3333 0.2225 0.1729 -0.0385 0.0145  0.0214  369 PHE A CD1 
3062 C CD2 . PHE A 387 ? 0.3666 0.2576 0.1994 -0.0301 0.0021  0.0243  369 PHE A CD2 
3063 C CE1 . PHE A 387 ? 0.3879 0.2609 0.2191 -0.0348 0.0158  0.0257  369 PHE A CE1 
3064 C CE2 . PHE A 387 ? 0.3813 0.2573 0.2052 -0.0258 0.0015  0.0284  369 PHE A CE2 
3065 C CZ  . PHE A 387 ? 0.3790 0.2453 0.2013 -0.0279 0.0088  0.0296  369 PHE A CZ  
3066 N N   . LEU A 388 ? 0.3353 0.2524 0.1957 -0.0306 -0.0039 0.0151  370 LEU A N   
3067 C CA  . LEU A 388 ? 0.3245 0.2421 0.1884 -0.0263 -0.0106 0.0153  370 LEU A CA  
3068 C C   . LEU A 388 ? 0.3395 0.2462 0.1965 -0.0211 -0.0156 0.0188  370 LEU A C   
3069 O O   . LEU A 388 ? 0.3456 0.2464 0.2055 -0.0194 -0.0141 0.0195  370 LEU A O   
3070 C CB  . LEU A 388 ? 0.3163 0.2406 0.1963 -0.0259 -0.0103 0.0112  370 LEU A CB  
3071 C CG  . LEU A 388 ? 0.3229 0.2509 0.2129 -0.0221 -0.0176 0.0096  370 LEU A CG  
3072 C CD1 . LEU A 388 ? 0.2862 0.2193 0.1739 -0.0239 -0.0196 0.0087  370 LEU A CD1 
3073 C CD2 . LEU A 388 ? 0.3329 0.2662 0.2416 -0.0217 -0.0147 0.0055  370 LEU A CD2 
3074 N N   . VAL A 389 ? 0.3404 0.2434 0.1875 -0.0182 -0.0217 0.0208  371 VAL A N   
3075 C CA  . VAL A 389 ? 0.3553 0.2464 0.1919 -0.0119 -0.0288 0.0243  371 VAL A CA  
3076 C C   . VAL A 389 ? 0.3489 0.2464 0.2004 -0.0073 -0.0384 0.0211  371 VAL A C   
3077 O O   . VAL A 389 ? 0.3478 0.2557 0.2090 -0.0089 -0.0416 0.0170  371 VAL A O   
3078 C CB  . VAL A 389 ? 0.3749 0.2575 0.1906 -0.0111 -0.0308 0.0271  371 VAL A CB  
3079 C CG1 . VAL A 389 ? 0.3967 0.2662 0.1982 -0.0035 -0.0407 0.0302  371 VAL A CG1 
3080 C CG2 . VAL A 389 ? 0.3615 0.2372 0.1657 -0.0154 -0.0199 0.0302  371 VAL A CG2 
3081 N N   . ILE A 390 ? 0.3477 0.2397 0.2039 -0.0018 -0.0423 0.0226  372 ILE A N   
3082 C CA  . ILE A 390 ? 0.3476 0.2467 0.2218 0.0035  -0.0523 0.0191  372 ILE A CA  
3083 C C   . ILE A 390 ? 0.3753 0.2616 0.2358 0.0124  -0.0640 0.0233  372 ILE A C   
3084 O O   . ILE A 390 ? 0.3995 0.2768 0.2599 0.0174  -0.0641 0.0266  372 ILE A O   
3085 C CB  . ILE A 390 ? 0.3354 0.2411 0.2329 0.0035  -0.0470 0.0160  372 ILE A CB  
3086 C CG1 . ILE A 390 ? 0.3296 0.2428 0.2329 -0.0049 -0.0342 0.0130  372 ILE A CG1 
3087 C CG2 . ILE A 390 ? 0.3274 0.2434 0.2492 0.0084  -0.0563 0.0113  372 ILE A CG2 
3088 C CD1 . ILE A 390 ? 0.2890 0.2071 0.2123 -0.0057 -0.0272 0.0090  372 ILE A CD1 
3089 N N   . PRO A 391 ? 0.3919 0.2753 0.2390 0.0149  -0.0741 0.0232  373 PRO A N   
3090 C CA  . PRO A 391 ? 0.4210 0.2886 0.2479 0.0239  -0.0857 0.0278  373 PRO A CA  
3091 C C   . PRO A 391 ? 0.4314 0.3001 0.2745 0.0330  -0.0965 0.0275  373 PRO A C   
3092 O O   . PRO A 391 ? 0.4447 0.2964 0.2710 0.0404  -0.1001 0.0338  373 PRO A O   
3093 C CB  . PRO A 391 ? 0.4283 0.2974 0.2444 0.0241  -0.0956 0.0246  373 PRO A CB  
3094 C CG  . PRO A 391 ? 0.4210 0.2985 0.2395 0.0144  -0.0838 0.0220  373 PRO A CG  
3095 C CD  . PRO A 391 ? 0.3876 0.2798 0.2347 0.0099  -0.0751 0.0189  373 PRO A CD  
3096 N N   . GLU A 392 ? 0.4175 0.3049 0.2937 0.0326  -0.1004 0.0205  374 GLU A N   
3097 C CA  . GLU A 392 ? 0.4280 0.3187 0.3249 0.0417  -0.1106 0.0193  374 GLU A CA  
3098 C C   . GLU A 392 ? 0.4446 0.3274 0.3457 0.0440  -0.1011 0.0235  374 GLU A C   
3099 O O   . GLU A 392 ? 0.4420 0.3237 0.3568 0.0530  -0.1092 0.0240  374 GLU A O   
3100 C CB  . GLU A 392 ? 0.4174 0.3312 0.3533 0.0399  -0.1146 0.0097  374 GLU A CB  
3101 C CG  . GLU A 392 ? 0.4125 0.3365 0.3517 0.0362  -0.1224 0.0036  374 GLU A CG  
3102 C CD  . GLU A 392 ? 0.3889 0.3218 0.3334 0.0246  -0.1074 0.0002  374 GLU A CD  
3103 O OE1 . GLU A 392 ? 0.3403 0.2642 0.2638 0.0196  -0.0952 0.0052  374 GLU A OE1 
3104 O OE2 . GLU A 392 ? 0.3976 0.3463 0.3684 0.0208  -0.1082 -0.0076 374 GLU A OE2 
3105 N N   . LEU A 393 ? 0.4561 0.3339 0.3477 0.0360  -0.0845 0.0258  375 LEU A N   
3106 C CA  . LEU A 393 ? 0.4790 0.3489 0.3748 0.0366  -0.0740 0.0285  375 LEU A CA  
3107 C C   . LEU A 393 ? 0.5289 0.3764 0.4033 0.0462  -0.0796 0.0368  375 LEU A C   
3108 O O   . LEU A 393 ? 0.5471 0.3879 0.4306 0.0515  -0.0774 0.0387  375 LEU A O   
3109 C CB  . LEU A 393 ? 0.4645 0.3334 0.3522 0.0257  -0.0571 0.0284  375 LEU A CB  
3110 C CG  . LEU A 393 ? 0.4714 0.3364 0.3676 0.0228  -0.0442 0.0279  375 LEU A CG  
3111 C CD1 . LEU A 393 ? 0.4281 0.3051 0.3555 0.0245  -0.0428 0.0218  375 LEU A CD1 
3112 C CD2 . LEU A 393 ? 0.4428 0.3097 0.3305 0.0120  -0.0316 0.0265  375 LEU A CD2 
3113 N N   . ALA A 394 ? 0.5658 0.4002 0.4102 0.0486  -0.0860 0.0418  376 ALA A N   
3114 C CA  . ALA A 394 ? 0.6159 0.4262 0.4336 0.0589  -0.0932 0.0504  376 ALA A CA  
3115 C C   . ALA A 394 ? 0.6365 0.4485 0.4726 0.0713  -0.1073 0.0502  376 ALA A C   
3116 O O   . ALA A 394 ? 0.6626 0.4613 0.4988 0.0768  -0.1032 0.0550  376 ALA A O   
3117 C CB  . ALA A 394 ? 0.6353 0.4361 0.4222 0.0603  -0.1015 0.0529  376 ALA A CB  
3118 N N   . GLN A 395 ? 0.6372 0.4664 0.4924 0.0751  -0.1231 0.0439  377 GLN A N   
3119 C CA  . GLN A 395 ? 0.6424 0.4782 0.5225 0.0868  -0.1380 0.0420  377 GLN A CA  
3120 C C   . GLN A 395 ? 0.6126 0.4636 0.5324 0.0845  -0.1280 0.0366  377 GLN A C   
3121 O O   . GLN A 395 ? 0.6220 0.4662 0.5522 0.0939  -0.1308 0.0394  377 GLN A O   
3122 C CB  . GLN A 395 ? 0.6557 0.5061 0.5458 0.0912  -0.1589 0.0356  377 GLN A CB  
3123 C CG  . GLN A 395 ? 0.6810 0.5361 0.5923 0.1058  -0.1797 0.0341  377 GLN A CG  
3124 C CD  . GLN A 395 ? 0.7696 0.5969 0.6532 0.1199  -0.1870 0.0453  377 GLN A CD  
3125 O OE1 . GLN A 395 ? 0.7977 0.5994 0.6415 0.1189  -0.1775 0.0546  377 GLN A OE1 
3126 N NE2 . GLN A 395 ? 0.8035 0.6356 0.7099 0.1333  -0.2034 0.0443  377 GLN A NE2 
3127 N N   . GLU A 396 ? 0.5710 0.4404 0.5107 0.0726  -0.1159 0.0292  378 GLU A N   
3128 C CA  . GLU A 396 ? 0.5426 0.4251 0.5164 0.0689  -0.1038 0.0233  378 GLU A CA  
3129 C C   . GLU A 396 ? 0.5532 0.4193 0.5215 0.0705  -0.0910 0.0283  378 GLU A C   
3130 O O   . GLU A 396 ? 0.5489 0.4202 0.5445 0.0745  -0.0879 0.0251  378 GLU A O   
3131 C CB  . GLU A 396 ? 0.5123 0.4103 0.4956 0.0551  -0.0906 0.0167  378 GLU A CB  
3132 C CG  . GLU A 396 ? 0.4849 0.4024 0.4861 0.0525  -0.0997 0.0092  378 GLU A CG  
3133 C CD  . GLU A 396 ? 0.4510 0.3887 0.4948 0.0502  -0.0945 0.0000  378 GLU A CD  
3134 O OE1 . GLU A 396 ? 0.4325 0.3697 0.4911 0.0498  -0.0825 -0.0011 378 GLU A OE1 
3135 O OE2 . GLU A 396 ? 0.3962 0.3496 0.4592 0.0483  -0.1013 -0.0066 378 GLU A OE2 
3136 N N   . LEU A 397 ? 0.5559 0.4026 0.4911 0.0669  -0.0826 0.0353  379 LEU A N   
3137 C CA  . LEU A 397 ? 0.5744 0.4024 0.5020 0.0686  -0.0714 0.0402  379 LEU A CA  
3138 C C   . LEU A 397 ? 0.6096 0.4234 0.5371 0.0840  -0.0832 0.0461  379 LEU A C   
3139 O O   . LEU A 397 ? 0.6086 0.4187 0.5538 0.0884  -0.0777 0.0456  379 LEU A O   
3140 C CB  . LEU A 397 ? 0.5774 0.3875 0.4714 0.0615  -0.0606 0.0460  379 LEU A CB  
3141 C CG  . LEU A 397 ? 0.5520 0.3743 0.4499 0.0470  -0.0465 0.0400  379 LEU A CG  
3142 C CD1 . LEU A 397 ? 0.5089 0.3206 0.3769 0.0400  -0.0406 0.0443  379 LEU A CD1 
3143 C CD2 . LEU A 397 ? 0.5510 0.3733 0.4661 0.0429  -0.0326 0.0358  379 LEU A CD2 
3144 N N   . HIS A 398 ? 0.6374 0.4431 0.5454 0.0929  -0.1000 0.0514  380 HIS A N   
3145 C CA  . HIS A 398 ? 0.6822 0.4742 0.5888 0.1092  -0.1138 0.0574  380 HIS A CA  
3146 C C   . HIS A 398 ? 0.6567 0.4683 0.6083 0.1158  -0.1203 0.0502  380 HIS A C   
3147 O O   . HIS A 398 ? 0.6604 0.4619 0.6221 0.1238  -0.1176 0.0531  380 HIS A O   
3148 C CB  . HIS A 398 ? 0.7238 0.5033 0.5997 0.1185  -0.1330 0.0635  380 HIS A CB  
3149 C CG  . HIS A 398 ? 0.8207 0.5704 0.6494 0.1168  -0.1246 0.0736  380 HIS A CG  
3150 N ND1 . HIS A 398 ? 0.9006 0.6200 0.7057 0.1263  -0.1225 0.0842  380 HIS A ND1 
3151 C CD2 . HIS A 398 ? 0.8576 0.6025 0.6598 0.1063  -0.1162 0.0746  380 HIS A CD2 
3152 C CE1 . HIS A 398 ? 0.9387 0.6357 0.7047 0.1213  -0.1123 0.0910  380 HIS A CE1 
3153 N NE2 . HIS A 398 ? 0.9082 0.6209 0.6727 0.1092  -0.1085 0.0852  380 HIS A NE2 
3154 N N   . VAL A 399 ? 0.6217 0.4605 0.6014 0.1120  -0.1272 0.0407  381 VAL A N   
3155 C CA  . VAL A 399 ? 0.5961 0.4561 0.6237 0.1167  -0.1308 0.0324  381 VAL A CA  
3156 C C   . VAL A 399 ? 0.5866 0.4486 0.6350 0.1102  -0.1089 0.0286  381 VAL A C   
3157 O O   . VAL A 399 ? 0.5935 0.4573 0.6697 0.1188  -0.1088 0.0269  381 VAL A O   
3158 C CB  . VAL A 399 ? 0.5702 0.4584 0.6246 0.1122  -0.1402 0.0222  381 VAL A CB  
3159 C CG1 . VAL A 399 ? 0.5465 0.4546 0.6509 0.1197  -0.1468 0.0144  381 VAL A CG1 
3160 C CG2 . VAL A 399 ? 0.5858 0.4707 0.6160 0.1170  -0.1608 0.0249  381 VAL A CG2 
3161 N N   . TRP A 400 ? 0.5761 0.4369 0.6105 0.0958  -0.0908 0.0270  382 TRP A N   
3162 C CA  . TRP A 400 ? 0.5696 0.4299 0.6171 0.0884  -0.0701 0.0229  382 TRP A CA  
3163 C C   . TRP A 400 ? 0.6065 0.4433 0.6451 0.0962  -0.0650 0.0295  382 TRP A C   
3164 O O   . TRP A 400 ? 0.6089 0.4468 0.6729 0.0995  -0.0570 0.0257  382 TRP A O   
3165 C CB  . TRP A 400 ? 0.5463 0.4072 0.5744 0.0725  -0.0548 0.0209  382 TRP A CB  
3166 C CG  . TRP A 400 ? 0.5316 0.3919 0.5710 0.0648  -0.0351 0.0154  382 TRP A CG  
3167 C CD1 . TRP A 400 ? 0.5236 0.3658 0.5448 0.0605  -0.0221 0.0181  382 TRP A CD1 
3168 C CD2 . TRP A 400 ? 0.5100 0.3868 0.5804 0.0608  -0.0258 0.0059  382 TRP A CD2 
3169 N NE1 . TRP A 400 ? 0.5080 0.3545 0.5453 0.0542  -0.0069 0.0105  382 TRP A NE1 
3170 C CE2 . TRP A 400 ? 0.5028 0.3696 0.5689 0.0545  -0.0081 0.0033  382 TRP A CE2 
3171 C CE3 . TRP A 400 ? 0.5176 0.4159 0.6189 0.0614  -0.0299 -0.0012 382 TRP A CE3 
3172 C CZ2 . TRP A 400 ? 0.4775 0.3532 0.5653 0.0494  0.0057  -0.0056 382 TRP A CZ2 
3173 C CZ3 . TRP A 400 ? 0.4816 0.3891 0.6069 0.0561  -0.0146 -0.0097 382 TRP A CZ3 
3174 C CH2 . TRP A 400 ? 0.4983 0.3936 0.6148 0.0504  0.0029  -0.0116 382 TRP A CH2 
3175 N N   . THR A 401 ? 0.6400 0.4541 0.6422 0.0992  -0.0684 0.0393  383 THR A N   
3176 C CA  . THR A 401 ? 0.6748 0.4626 0.6642 0.1065  -0.0628 0.0468  383 THR A CA  
3177 C C   . THR A 401 ? 0.6898 0.4747 0.6992 0.1243  -0.0768 0.0495  383 THR A C   
3178 O O   . THR A 401 ? 0.6990 0.4815 0.7311 0.1280  -0.0681 0.0469  383 THR A O   
3179 C CB  . THR A 401 ? 0.7023 0.4635 0.6462 0.1036  -0.0589 0.0568  383 THR A CB  
3180 O OG1 . THR A 401 ? 0.7476 0.4832 0.6826 0.1077  -0.0484 0.0625  383 THR A OG1 
3181 C CG2 . THR A 401 ? 0.7415 0.4937 0.6599 0.1133  -0.0777 0.0648  383 THR A CG2 
3182 N N   . ASP A 402 ? 1.3464 0.9015 1.4360 0.0548  0.2345  0.0521  384 ASP A N   
3183 C CA  . ASP A 402 ? 1.5022 1.0061 1.4051 0.1814  0.2714  0.1714  384 ASP A CA  
3184 C C   . ASP A 402 ? 1.4027 0.9848 1.3141 0.2756  0.1908  0.1952  384 ASP A C   
3185 O O   . ASP A 402 ? 1.5371 1.0960 1.3094 0.3954  0.2091  0.2822  384 ASP A O   
3186 C CB  . ASP A 402 ? 1.5976 1.2275 1.4002 0.2265  0.3016  0.2102  384 ASP A CB  
3187 C CG  . ASP A 402 ? 1.3918 1.3400 1.3177 0.2478  0.1965  0.1361  384 ASP A CG  
3188 O OD1 . ASP A 402 ? 1.3025 1.3620 1.2605 0.3235  0.1236  0.1372  384 ASP A OD1 
3189 O OD2 . ASP A 402 ? 1.3386 1.4337 1.3410 0.1839  0.1965  0.0636  384 ASP A OD2 
3190 N N   . LYS A 403 ? 1.1866 0.8598 1.2570 0.2256  0.1070  0.1200  385 LYS A N   
3191 C CA  . LYS A 403 ? 1.1053 0.8384 1.1926 0.2897  0.0474  0.1313  385 LYS A CA  
3192 C C   . LYS A 403 ? 1.0736 0.6795 1.2021 0.2373  0.0407  0.1110  385 LYS A C   
3193 O O   . LYS A 403 ? 0.9813 0.6543 1.1537 0.2563  -0.0121 0.1010  385 LYS A O   
3194 C CB  . LYS A 403 ? 0.9148 0.9025 1.1419 0.2920  -0.0384 0.0686  385 LYS A CB  
3195 C CG  . LYS A 403 ? 0.9268 1.1152 1.1195 0.3651  -0.0435 0.0669  385 LYS A CG  
3196 C CD  . LYS A 403 ? 1.0482 1.2714 1.0976 0.5055  -0.0358 0.1344  385 LYS A CD  
3197 C CE  . LYS A 403 ? 1.1122 1.5476 1.0916 0.5902  -0.0370 0.1388  385 LYS A CE  
3198 N NZ  . LYS A 403 ? 1.2755 1.7309 1.0810 0.7531  -0.0269 0.2234  385 LYS A NZ  
3199 N N   . SER A 404 ? 1.1598 0.6000 1.2736 0.1680  0.1020  0.0950  386 SER A N   
3200 C CA  . SER A 404 ? 1.1412 0.4992 1.3010 0.1098  0.0973  0.0510  386 SER A CA  
3201 C C   . SER A 404 ? 1.2264 0.4958 1.3074 0.1731  0.1193  0.0883  386 SER A C   
3202 O O   . SER A 404 ? 1.1753 0.4550 1.2996 0.1386  0.0899  0.0478  386 SER A O   
3203 C CB  . SER A 404 ? 1.2298 0.4642 1.4106 0.0174  0.1699  -0.0050 386 SER A CB  
3204 O OG  . SER A 404 ? 1.4353 0.4826 1.4945 0.0426  0.2892  0.0492  386 SER A OG  
3205 N N   . SER A 405 ? 1.3671 0.5634 1.3309 0.2727  0.1696  0.1636  387 SER A N   
3206 C CA  . SER A 405 ? 1.4573 0.5851 1.3595 0.3531  0.1875  0.1939  387 SER A CA  
3207 C C   . SER A 405 ? 1.2955 0.6158 1.2526 0.3859  0.0968  0.1729  387 SER A C   
3208 O O   . SER A 405 ? 1.3157 0.6169 1.2708 0.4024  0.0971  0.1554  387 SER A O   
3209 C CB  . SER A 405 ? 1.6840 0.6834 1.4448 0.4743  0.2604  0.2899  387 SER A CB  
3210 O OG  . SER A 405 ? 1.6913 0.7982 1.4048 0.5166  0.2443  0.3351  387 SER A OG  
3211 N N   . LEU A 406 ? 1.1500 0.6582 1.1669 0.3873  0.0309  0.1629  388 LEU A N   
3212 C CA  . LEU A 406 ? 1.0001 0.6871 1.1011 0.3846  -0.0400 0.1273  388 LEU A CA  
3213 C C   . LEU A 406 ? 0.9066 0.5858 1.0834 0.2836  -0.0711 0.0871  388 LEU A C   
3214 O O   . LEU A 406 ? 0.8831 0.6004 1.0641 0.2832  -0.0855 0.0751  388 LEU A O   
3215 C CB  . LEU A 406 ? 0.8845 0.7684 1.0640 0.3928  -0.0873 0.1053  388 LEU A CB  
3216 C CG  . LEU A 406 ? 0.9335 0.9603 1.0645 0.5082  -0.0904 0.1190  388 LEU A CG  
3217 C CD1 . LEU A 406 ? 0.8331 1.0393 1.0525 0.4847  -0.1208 0.0756  388 LEU A CD1 
3218 C CD2 . LEU A 406 ? 0.9081 1.0650 1.0606 0.5706  -0.1148 0.0905  388 LEU A CD2 
3219 N N   . PHE A 407 ? 0.8617 0.5106 1.0940 0.2047  -0.0825 0.0649  389 PHE A N   
3220 C CA  . PHE A 407 ? 0.8038 0.4622 1.0948 0.1283  -0.1215 0.0345  389 PHE A CA  
3221 C C   . PHE A 407 ? 0.9016 0.4650 1.1267 0.1158  -0.0836 0.0167  389 PHE A C   
3222 O O   . PHE A 407 ? 0.8731 0.4875 1.0993 0.0930  -0.1125 0.0061  389 PHE A O   
3223 C CB  . PHE A 407 ? 0.7515 0.4141 1.1232 0.0648  -0.1443 0.0009  389 PHE A CB  
3224 C CG  . PHE A 407 ? 0.7195 0.4176 1.1469 0.0111  -0.1993 -0.0233 389 PHE A CG  
3225 C CD1 . PHE A 407 ? 0.6409 0.4262 1.1401 0.0063  -0.2618 0.0002  389 PHE A CD1 
3226 C CD2 . PHE A 407 ? 0.7827 0.4329 1.1927 -0.0306 -0.1838 -0.0720 389 PHE A CD2 
3227 C CE1 . PHE A 407 ? 0.6427 0.4533 1.1671 -0.0221 -0.3139 0.0014  389 PHE A CE1 
3228 C CE2 . PHE A 407 ? 0.7541 0.4746 1.2011 -0.0610 -0.2453 -0.0940 389 PHE A CE2 
3229 C CZ  . PHE A 407 ? 0.6982 0.4925 1.1885 -0.0483 -0.3136 -0.0440 389 PHE A CZ  
3230 N N   . GLU A 408 ? 1.0305 0.4561 1.1999 0.1282  -0.0090 0.0108  390 GLU A N   
3231 C CA  . GLU A 408 ? 1.1477 0.4758 1.2813 0.1122  0.0450  -0.0284 390 GLU A CA  
3232 C C   . GLU A 408 ? 1.1683 0.5285 1.2598 0.1710  0.0445  -0.0155 390 GLU A C   
3233 O O   . GLU A 408 ? 1.1982 0.5752 1.2902 0.1378  0.0498  -0.0655 390 GLU A O   
3234 C CB  . GLU A 408 ? 1.3101 0.4506 1.4054 0.1140  0.1481  -0.0329 390 GLU A CB  
3235 C CG  . GLU A 408 ? 1.3190 0.4344 1.4749 0.0225  0.1688  -0.0918 390 GLU A CG  
3236 C CD  . GLU A 408 ? 1.5147 0.4260 1.6289 0.0138  0.2940  -0.0868 390 GLU A CD  
3237 O OE1 . GLU A 408 ? 1.6851 0.4493 1.7825 0.0090  0.3833  -0.1179 390 GLU A OE1 
3238 O OE2 . GLU A 408 ? 1.5556 0.4502 1.6585 0.0071  0.3127  -0.0547 390 GLU A OE2 
3239 N N   . GLU A 409 ? 1.1572 0.5572 1.2195 0.2572  0.0363  0.0358  391 GLU A N   
3240 C CA  . GLU A 409 ? 1.1661 0.6333 1.2081 0.3166  0.0313  0.0315  391 GLU A CA  
3241 C C   . GLU A 409 ? 1.0449 0.6606 1.1312 0.2530  -0.0262 0.0063  391 GLU A C   
3242 O O   . GLU A 409 ? 1.0729 0.7234 1.1439 0.2405  -0.0166 -0.0286 391 GLU A O   
3243 C CB  . GLU A 409 ? 1.1776 0.7094 1.1942 0.4290  0.0237  0.0736  391 GLU A CB  
3244 C CG  . GLU A 409 ? 1.1765 0.8263 1.1999 0.4864  0.0114  0.0440  391 GLU A CG  
3245 C CD  . GLU A 409 ? 1.2125 0.9600 1.2163 0.6179  0.0006  0.0641  391 GLU A CD  
3246 O OE1 . GLU A 409 ? 1.2671 0.9990 1.2340 0.6729  0.0005  0.1130  391 GLU A OE1 
3247 O OE2 . GLU A 409 ? 1.2125 1.0769 1.2372 0.6692  -0.0083 0.0221  391 GLU A OE2 
3248 N N   . LEU A 410 ? 0.9314 0.6279 1.0725 0.2132  -0.0781 0.0259  392 LEU A N   
3249 C CA  . LEU A 410 ? 0.8495 0.6501 1.0284 0.1541  -0.1235 0.0276  392 LEU A CA  
3250 C C   . LEU A 410 ? 0.8884 0.6697 1.0357 0.0915  -0.1306 0.0055  392 LEU A C   
3251 O O   . LEU A 410 ? 0.9036 0.7547 1.0195 0.0673  -0.1361 0.0019  392 LEU A O   
3252 C CB  . LEU A 410 ? 0.7579 0.6081 1.0213 0.1298  -0.1668 0.0508  392 LEU A CB  
3253 C CG  . LEU A 410 ? 0.7027 0.6340 1.0236 0.0843  -0.1997 0.0718  392 LEU A CG  
3254 C CD1 . LEU A 410 ? 0.6884 0.7176 1.0251 0.1080  -0.1753 0.0571  392 LEU A CD1 
3255 C CD2 . LEU A 410 ? 0.6292 0.5720 1.0554 0.0640  -0.2343 0.0804  392 LEU A CD2 
3256 N N   . GLN A 411 ? 0.9072 0.6162 1.0627 0.0639  -0.1262 -0.0194 393 GLN A N   
3257 C CA  . GLN A 411 ? 0.9557 0.6847 1.0928 0.0115  -0.1339 -0.0681 393 GLN A CA  
3258 C C   . GLN A 411 ? 1.0418 0.7686 1.1275 0.0153  -0.0827 -0.1228 393 GLN A C   
3259 O O   . GLN A 411 ? 1.0705 0.8926 1.1250 -0.0225 -0.1007 -0.1564 393 GLN A O   
3260 C CB  . GLN A 411 ? 0.9684 0.6374 1.1492 -0.0212 -0.1243 -0.1152 393 GLN A CB  
3261 C CG  . GLN A 411 ? 0.9034 0.6356 1.1471 -0.0442 -0.1965 -0.0939 393 GLN A CG  
3262 C CD  . GLN A 411 ? 0.9326 0.6755 1.2247 -0.0905 -0.2000 -0.1763 393 GLN A CD  
3263 O OE1 . GLN A 411 ? 0.9726 0.6324 1.2698 -0.1130 -0.1265 -0.2438 393 GLN A OE1 
3264 N NE2 . GLN A 411 ? 0.8989 0.7441 1.2357 -0.1020 -0.2802 -0.1755 393 GLN A NE2 
3265 N N   . SER A 412 ? 1.0939 0.7212 1.1702 0.0687  -0.0199 -0.1313 394 SER A N   
3266 C CA  . SER A 412 ? 1.1852 0.7943 1.2379 0.0875  0.0366  -0.1902 394 SER A CA  
3267 C C   . SER A 412 ? 1.1534 0.9072 1.1775 0.0889  0.0113  -0.1875 394 SER A C   
3268 O O   . SER A 412 ? 1.1952 1.0330 1.1970 0.0461  0.0189  -0.2481 394 SER A O   
3269 C CB  . SER A 412 ? 1.2777 0.7343 1.3256 0.1712  0.1037  -0.1747 394 SER A CB  
3270 O OG  . SER A 412 ? 1.3741 0.6686 1.4383 0.1517  0.1676  -0.2008 394 SER A OG  
3271 N N   . LEU A 413 ? 1.0847 0.8863 1.1149 0.1305  -0.0126 -0.1295 395 LEU A N   
3272 C CA  . LEU A 413 ? 1.0603 0.9989 1.0781 0.1234  -0.0212 -0.1310 395 LEU A CA  
3273 C C   . LEU A 413 ? 1.0624 1.1033 1.0388 0.0410  -0.0515 -0.1170 395 LEU A C   
3274 O O   . LEU A 413 ? 1.0969 1.2420 1.0383 0.0172  -0.0339 -0.1390 395 LEU A O   
3275 C CB  . LEU A 413 ? 0.9819 0.9713 1.0426 0.1664  -0.0393 -0.0883 395 LEU A CB  
3276 C CG  . LEU A 413 ? 0.9972 0.9405 1.0776 0.2711  -0.0214 -0.0891 395 LEU A CG  
3277 C CD1 . LEU A 413 ? 0.9064 0.9183 1.0391 0.2927  -0.0546 -0.0534 395 LEU A CD1 
3278 C CD2 . LEU A 413 ? 1.0538 1.0552 1.1332 0.3399  0.0119  -0.1449 395 LEU A CD2 
3279 N N   . ASP A 414 ? 1.0445 1.0631 1.0190 0.0041  -0.0954 -0.0794 396 ASP A N   
3280 C CA  . ASP A 414 ? 1.0769 1.1846 0.9974 -0.0491 -0.1347 -0.0361 396 ASP A CA  
3281 C C   . ASP A 414 ? 1.1608 1.3544 1.0125 -0.0831 -0.1302 -0.1020 396 ASP A C   
3282 O O   . ASP A 414 ? 1.1949 1.3938 1.0517 -0.0775 -0.0815 -0.1940 396 ASP A O   
3283 C CB  . ASP A 414 ? 1.0370 1.1027 0.9967 -0.0551 -0.1931 0.0298  396 ASP A CB  
3284 C CG  . ASP A 414 ? 0.9688 1.0006 1.0025 -0.0396 -0.1979 0.0910  396 ASP A CG  
3285 O OD1 . ASP A 414 ? 0.9938 1.0734 1.0236 -0.0509 -0.1709 0.1143  396 ASP A OD1 
3286 O OD2 . ASP A 414 ? 0.9027 0.8769 1.0106 -0.0242 -0.2226 0.1011  396 ASP A OD2 
3287 N N   . GLN A 438 ? 1.0132 1.6617 1.2431 0.0652  0.0687  -0.2437 420 GLN A N   
3288 C CA  . GLN A 438 ? 1.0146 1.6348 1.2604 -0.0288 0.0765  -0.1730 420 GLN A CA  
3289 C C   . GLN A 438 ? 0.9294 1.6037 1.3088 -0.0119 0.0715  -0.1950 420 GLN A C   
3290 O O   . GLN A 438 ? 0.9017 1.4929 1.3175 -0.0426 0.0506  -0.1310 420 GLN A O   
3291 C CB  . GLN A 438 ? 1.1066 1.8040 1.3166 -0.1270 0.1411  -0.1797 420 GLN A CB  
3292 C CG  . GLN A 438 ? 1.1732 1.7891 1.3675 -0.2200 0.1610  -0.0741 420 GLN A CG  
3293 C CD  . GLN A 438 ? 1.2808 1.9805 1.4863 -0.3180 0.2544  -0.0913 420 GLN A CD  
3294 O OE1 . GLN A 438 ? 1.3074 2.1408 1.5006 -0.3318 0.3010  -0.1817 420 GLN A OE1 
3295 N NE2 . GLN A 438 ? 1.3540 1.9673 1.5916 -0.3892 0.2916  -0.0080 420 GLN A NE2 
3296 N N   . ARG A 439 ? 0.8943 1.7323 1.3591 0.0399  0.0900  -0.3004 421 ARG A N   
3297 C CA  . ARG A 439 ? 0.8115 1.7574 1.4115 0.0717  0.0802  -0.3534 421 ARG A CA  
3298 C C   . ARG A 439 ? 0.7700 1.6866 1.3449 0.1993  0.0177  -0.3414 421 ARG A C   
3299 O O   . ARG A 439 ? 0.7021 1.6997 1.3607 0.2391  -0.0054 -0.3689 421 ARG A O   
3300 C CB  . ARG A 439 ? 0.8021 1.9819 1.5190 0.0605  0.1322  -0.4890 421 ARG A CB  
3301 C CG  . ARG A 439 ? 0.8624 2.0471 1.6288 -0.0903 0.2162  -0.4900 421 ARG A CG  
3302 C CD  . ARG A 439 ? 0.9012 2.2857 1.7267 -0.1264 0.2876  -0.6193 421 ARG A CD  
3303 N NE  . ARG A 439 ? 0.9304 2.3599 1.6643 -0.0457 0.2642  -0.6550 421 ARG A NE  
3304 C CZ  . ARG A 439 ? 0.8952 2.5186 1.6965 0.0650  0.2439  -0.7809 421 ARG A CZ  
3305 N NH1 . ARG A 439 ? 0.8213 2.6456 1.7727 0.1088  0.2380  -0.8898 421 ARG A NH1 
3306 N NH2 . ARG A 439 ? 0.9402 2.5712 1.6680 0.1389  0.2286  -0.8069 421 ARG A NH2 
3307 N N   . ARG A 440 ? 0.8293 1.6281 1.2878 0.2568  0.0004  -0.3020 422 ARG A N   
3308 C CA  . ARG A 440 ? 0.8417 1.5263 1.2428 0.3512  -0.0392 -0.2516 422 ARG A CA  
3309 C C   . ARG A 440 ? 0.8074 1.3483 1.1976 0.2850  -0.0629 -0.1683 422 ARG A C   
3310 O O   . ARG A 440 ? 0.7667 1.2889 1.1738 0.3308  -0.0899 -0.1474 422 ARG A O   
3311 C CB  . ARG A 440 ? 0.9386 1.5129 1.2422 0.4097  -0.0277 -0.2443 422 ARG A CB  
3312 C CG  . ARG A 440 ? 0.9959 1.4145 1.2337 0.5022  -0.0425 -0.1871 422 ARG A CG  
3313 C CD  . ARG A 440 ? 1.0199 1.5401 1.2715 0.6461  -0.0597 -0.2052 422 ARG A CD  
3314 N NE  . ARG A 440 ? 1.0386 1.4528 1.2416 0.6940  -0.0760 -0.1305 422 ARG A NE  
3315 C CZ  . ARG A 440 ? 1.0682 1.5939 1.2695 0.8057  -0.1004 -0.1272 422 ARG A CZ  
3316 N NH1 . ARG A 440 ? 1.0530 1.8153 1.3128 0.8887  -0.1189 -0.2061 422 ARG A NH1 
3317 N NH2 . ARG A 440 ? 1.0976 1.5238 1.2383 0.8355  -0.1052 -0.0546 422 ARG A NH2 
3318 N N   . ILE A 441 ? 0.8346 1.2936 1.1932 0.1845  -0.0536 -0.1248 423 ILE A N   
3319 C CA  . ILE A 441 ? 0.8170 1.1673 1.1835 0.1220  -0.0805 -0.0542 423 ILE A CA  
3320 C C   . ILE A 441 ? 0.7507 1.1747 1.2499 0.0989  -0.0851 -0.0691 423 ILE A C   
3321 O O   . ILE A 441 ? 0.7022 1.0784 1.2389 0.1087  -0.1167 -0.0471 423 ILE A O   
3322 C CB  . ILE A 441 ? 0.8840 1.1746 1.1845 0.0357  -0.0723 -0.0026 423 ILE A CB  
3323 C CG1 . ILE A 441 ? 0.9488 1.1828 1.1363 0.0506  -0.0721 -0.0082 423 ILE A CG1 
3324 C CG2 . ILE A 441 ? 0.8720 1.0765 1.2031 -0.0116 -0.1057 0.0691  423 ILE A CG2 
3325 C CD1 . ILE A 441 ? 1.0350 1.2740 1.1380 -0.0219 -0.0641 0.0253  423 ILE A CD1 
3326 N N   . LYS A 442 ? 0.7567 1.3084 1.3420 0.0616  -0.0448 -0.1240 424 LYS A N   
3327 C CA  . LYS A 442 ? 0.7048 1.3509 1.4505 0.0319  -0.0327 -0.1719 424 LYS A CA  
3328 C C   . LYS A 442 ? 0.6358 1.4008 1.4357 0.1228  -0.0663 -0.2333 424 LYS A C   
3329 O O   . LYS A 442 ? 0.5798 1.3500 1.4692 0.1093  -0.0847 -0.2385 424 LYS A O   
3330 C CB  . LYS A 442 ? 0.7290 1.4975 1.5710 -0.0378 0.0374  -0.2413 424 LYS A CB  
3331 C CG  . LYS A 442 ? 0.8098 1.4520 1.6835 -0.1519 0.0829  -0.1689 424 LYS A CG  
3332 C CD  . LYS A 442 ? 0.8917 1.6196 1.8254 -0.2370 0.1778  -0.2238 424 LYS A CD  
3333 C CE  . LYS A 442 ? 0.8301 1.7639 1.9767 -0.2540 0.2252  -0.3776 424 LYS A CE  
3334 N NZ  . LYS A 442 ? 0.8253 1.7051 2.1461 -0.3207 0.2577  -0.3832 424 LYS A NZ  
3335 N N   . LYS A 443 ? 0.6487 0.6818 0.7976 0.2062  -0.0521 -0.0560 425 LYS A N   
3336 C CA  . LYS A 443 ? 0.6733 0.6940 0.8241 0.2116  -0.0730 -0.0408 425 LYS A CA  
3337 C C   . LYS A 443 ? 0.6867 0.6617 0.8002 0.2040  -0.0806 -0.0315 425 LYS A C   
3338 O O   . LYS A 443 ? 0.6913 0.6589 0.7897 0.1948  -0.0940 -0.0178 425 LYS A O   
3339 C CB  . LYS A 443 ? 0.6952 0.7225 0.8818 0.2361  -0.0806 -0.0419 425 LYS A CB  
3340 C CG  . LYS A 443 ? 0.7116 0.7505 0.9129 0.2404  -0.1022 -0.0261 425 LYS A CG  
3341 C CD  . LYS A 443 ? 0.7688 0.7787 0.9773 0.2596  -0.1164 -0.0187 425 LYS A CD  
3342 C CE  . LYS A 443 ? 0.8064 0.8243 1.0218 0.2606  -0.1404 0.0000  425 LYS A CE  
3343 N NZ  . LYS A 443 ? 0.7919 0.7986 0.9699 0.2370  -0.1480 0.0118  425 LYS A NZ  
3344 N N   . VAL A 444 ? 0.6928 0.6386 0.7914 0.2070  -0.0714 -0.0396 426 VAL A N   
3345 C CA  . VAL A 444 ? 0.7020 0.6046 0.7684 0.2010  -0.0773 -0.0323 426 VAL A CA  
3346 C C   . VAL A 444 ? 0.6782 0.5756 0.7126 0.1789  -0.0730 -0.0286 426 VAL A C   
3347 O O   . VAL A 444 ? 0.6798 0.5553 0.6914 0.1700  -0.0826 -0.0170 426 VAL A O   
3348 C CB  . VAL A 444 ? 0.7257 0.5993 0.7885 0.2111  -0.0690 -0.0434 426 VAL A CB  
3349 C CG1 . VAL A 444 ? 0.7287 0.5615 0.7555 0.1998  -0.0712 -0.0381 426 VAL A CG1 
3350 C CG2 . VAL A 444 ? 0.7512 0.6195 0.8422 0.2341  -0.0769 -0.0436 426 VAL A CG2 
3351 N N   . THR A 445 ? 0.6540 0.5711 0.6872 0.1705  -0.0582 -0.0384 427 THR A N   
3352 C CA  . THR A 445 ? 0.6311 0.5509 0.6409 0.1512  -0.0534 -0.0353 427 THR A CA  
3353 C C   . THR A 445 ? 0.6287 0.5576 0.6365 0.1436  -0.0660 -0.0224 427 THR A C   
3354 O O   . THR A 445 ? 0.6155 0.5260 0.5983 0.1320  -0.0707 -0.0141 427 THR A O   
3355 C CB  . THR A 445 ? 0.6201 0.5684 0.6372 0.1455  -0.0378 -0.0459 427 THR A CB  
3356 O OG1 . THR A 445 ? 0.6180 0.5575 0.6328 0.1506  -0.0257 -0.0586 427 THR A OG1 
3357 C CG2 . THR A 445 ? 0.5692 0.5206 0.5649 0.1268  -0.0341 -0.0412 427 THR A CG2 
3358 N N   . HIS A 446 ? 0.6259 0.5841 0.6605 0.1499  -0.0711 -0.0214 428 HIS A N   
3359 C CA  . HIS A 446 ? 0.6318 0.6014 0.6663 0.1425  -0.0840 -0.0102 428 HIS A CA  
3360 C C   . HIS A 446 ? 0.6461 0.5876 0.6643 0.1434  -0.0998 0.0024  428 HIS A C   
3361 O O   . HIS A 446 ? 0.6420 0.5741 0.6369 0.1294  -0.1046 0.0102  428 HIS A O   
3362 C CB  . HIS A 446 ? 0.6355 0.6434 0.7046 0.1499  -0.0879 -0.0115 428 HIS A CB  
3363 C CG  . HIS A 446 ? 0.6608 0.6827 0.7289 0.1401  -0.1012 -0.0010 428 HIS A CG  
3364 N ND1 . HIS A 446 ? 0.6923 0.7163 0.7717 0.1482  -0.1193 0.0090  428 HIS A ND1 
3365 C CD2 . HIS A 446 ? 0.6558 0.6876 0.7105 0.1222  -0.0995 0.0011  428 HIS A CD2 
3366 C CE1 . HIS A 446 ? 0.6951 0.7316 0.7673 0.1346  -0.1281 0.0163  428 HIS A CE1 
3367 N NE2 . HIS A 446 ? 0.6744 0.7150 0.7319 0.1188  -0.1158 0.0110  428 HIS A NE2 
3368 N N   . ASP A 447 ? 0.6601 0.5869 0.6894 0.1594  -0.1071 0.0042  429 ASP A N   
3369 C CA  . ASP A 447 ? 0.6794 0.5770 0.6923 0.1605  -0.1225 0.0173  429 ASP A CA  
3370 C C   . ASP A 447 ? 0.6692 0.5326 0.6460 0.1480  -0.1184 0.0198  429 ASP A C   
3371 O O   . ASP A 447 ? 0.6731 0.5205 0.6283 0.1389  -0.1285 0.0313  429 ASP A O   
3372 C CB  . ASP A 447 ? 0.7132 0.5990 0.7462 0.1813  -0.1303 0.0185  429 ASP A CB  
3373 C CG  . ASP A 447 ? 0.7439 0.6628 0.8130 0.1943  -0.1399 0.0208  429 ASP A CG  
3374 O OD1 . ASP A 447 ? 0.7624 0.7070 0.8342 0.1846  -0.1468 0.0266  429 ASP A OD1 
3375 O OD2 . ASP A 447 ? 0.7725 0.6918 0.8678 0.2141  -0.1405 0.0163  429 ASP A OD2 
3376 N N   . MET A 448 ? 0.6438 0.4978 0.6145 0.1471  -0.1037 0.0089  430 MET A N   
3377 C CA  . MET A 448 ? 0.6429 0.4709 0.5832 0.1346  -0.0981 0.0096  430 MET A CA  
3378 C C   . MET A 448 ? 0.5968 0.4351 0.5205 0.1176  -0.0975 0.0145  430 MET A C   
3379 O O   . MET A 448 ? 0.5914 0.4118 0.4926 0.1081  -0.1035 0.0234  430 MET A O   
3380 C CB  . MET A 448 ? 0.6309 0.4564 0.5704 0.1351  -0.0822 -0.0040 430 MET A CB  
3381 C CG  . MET A 448 ? 0.6708 0.4648 0.5837 0.1267  -0.0788 -0.0036 430 MET A CG  
3382 S SD  . MET A 448 ? 0.6968 0.4932 0.6011 0.1197  -0.0613 -0.0172 430 MET A SD  
3383 C CE  . MET A 448 ? 0.6678 0.4724 0.5520 0.1009  -0.0584 -0.0109 430 MET A CE  
3384 N N   . ASP A 449 ? 0.5620 0.4290 0.4972 0.1138  -0.0896 0.0083  431 ASP A N   
3385 C CA  . ASP A 449 ? 0.5336 0.4101 0.4548 0.0981  -0.0864 0.0105  431 ASP A CA  
3386 C C   . ASP A 449 ? 0.5336 0.4102 0.4465 0.0917  -0.0996 0.0212  431 ASP A C   
3387 O O   . ASP A 449 ? 0.5237 0.3899 0.4137 0.0787  -0.0988 0.0251  431 ASP A O   
3388 C CB  . ASP A 449 ? 0.5159 0.4226 0.4534 0.0960  -0.0769 0.0027  431 ASP A CB  
3389 C CG  . ASP A 449 ? 0.5152 0.4215 0.4521 0.0968  -0.0621 -0.0074 431 ASP A CG  
3390 O OD1 . ASP A 449 ? 0.5017 0.3849 0.4242 0.0972  -0.0590 -0.0089 431 ASP A OD1 
3391 O OD2 . ASP A 449 ? 0.5042 0.4345 0.4548 0.0960  -0.0538 -0.0138 431 ASP A OD2 
3392 N N   . MET A 450 ? 0.5326 0.4215 0.4644 0.1010  -0.1117 0.0257  432 MET A N   
3393 C CA  . MET A 450 ? 0.5456 0.4385 0.4711 0.0949  -0.1261 0.0361  432 MET A CA  
3394 C C   . MET A 450 ? 0.5636 0.4253 0.4598 0.0885  -0.1334 0.0458  432 MET A C   
3395 O O   . MET A 450 ? 0.5733 0.4344 0.4532 0.0775  -0.1413 0.0530  432 MET A O   
3396 C CB  . MET A 450 ? 0.5539 0.4673 0.5081 0.1080  -0.1390 0.0399  432 MET A CB  
3397 C CG  . MET A 450 ? 0.5460 0.4983 0.5268 0.1079  -0.1346 0.0329  432 MET A CG  
3398 S SD  . MET A 450 ? 0.5569 0.5228 0.5218 0.0857  -0.1263 0.0295  432 MET A SD  
3399 C CE  . MET A 450 ? 0.5037 0.4575 0.4568 0.0815  -0.1051 0.0191  432 MET A CE  
3400 N N   . CYS A 451 ? 0.5736 0.4097 0.4621 0.0941  -0.1302 0.0454  433 CYS A N   
3401 C CA  . CYS A 451 ? 0.6061 0.4118 0.4674 0.0876  -0.1364 0.0549  433 CYS A CA  
3402 C C   . CYS A 451 ? 0.5879 0.3882 0.4231 0.0700  -0.1282 0.0541  433 CYS A C   
3403 O O   . CYS A 451 ? 0.6051 0.3886 0.4162 0.0604  -0.1337 0.0625  433 CYS A O   
3404 C CB  . CYS A 451 ? 0.6197 0.3995 0.4791 0.0956  -0.1328 0.0529  433 CYS A CB  
3405 S SG  . CYS A 451 ? 0.7013 0.4745 0.5853 0.1171  -0.1439 0.0558  433 CYS A SG  
3406 N N   . TYR A 452 ? 0.5556 0.3697 0.3957 0.0662  -0.1143 0.0440  434 TYR A N   
3407 C CA  . TYR A 452 ? 0.5388 0.3491 0.3587 0.0519  -0.1047 0.0418  434 TYR A CA  
3408 C C   . TYR A 452 ? 0.5251 0.3517 0.3415 0.0422  -0.1067 0.0425  434 TYR A C   
3409 O O   . TYR A 452 ? 0.5333 0.3529 0.3297 0.0301  -0.1019 0.0426  434 TYR A O   
3410 C CB  . TYR A 452 ? 0.5119 0.3270 0.3376 0.0523  -0.0897 0.0319  434 TYR A CB  
3411 C CG  . TYR A 452 ? 0.5130 0.3115 0.3387 0.0587  -0.0861 0.0294  434 TYR A CG  
3412 C CD1 . TYR A 452 ? 0.5397 0.3191 0.3459 0.0508  -0.0814 0.0307  434 TYR A CD1 
3413 C CD2 . TYR A 452 ? 0.5136 0.3160 0.3590 0.0721  -0.0868 0.0249  434 TYR A CD2 
3414 C CE1 . TYR A 452 ? 0.5386 0.3022 0.3436 0.0548  -0.0785 0.0281  434 TYR A CE1 
3415 C CE2 . TYR A 452 ? 0.5591 0.3435 0.4027 0.0771  -0.0834 0.0214  434 TYR A CE2 
3416 C CZ  . TYR A 452 ? 0.5696 0.3343 0.3922 0.0677  -0.0796 0.0231  434 TYR A CZ  
3417 O OH  . TYR A 452 ? 0.5859 0.3326 0.4056 0.0707  -0.0763 0.0191  434 TYR A OH  
3418 N N   . GLY A 453 ? 0.5035 0.3521 0.3399 0.0472  -0.1132 0.0421  435 GLY A N   
3419 C CA  . GLY A 453 ? 0.4741 0.3404 0.3100 0.0373  -0.1139 0.0407  435 GLY A CA  
3420 C C   . GLY A 453 ? 0.4494 0.3425 0.3126 0.0427  -0.1099 0.0339  435 GLY A C   
3421 O O   . GLY A 453 ? 0.4407 0.3383 0.3214 0.0540  -0.1046 0.0293  435 GLY A O   
3422 N N   . MET A 454 ? 0.4264 0.3370 0.2922 0.0336  -0.1114 0.0326  436 MET A N   
3423 C CA  . MET A 454 ? 0.4012 0.3402 0.2927 0.0358  -0.1082 0.0270  436 MET A CA  
3424 C C   . MET A 454 ? 0.3942 0.3354 0.2913 0.0368  -0.0917 0.0187  436 MET A C   
3425 O O   . MET A 454 ? 0.3803 0.3423 0.3000 0.0425  -0.0874 0.0139  436 MET A O   
3426 C CB  . MET A 454 ? 0.3975 0.3501 0.2849 0.0219  -0.1127 0.0272  436 MET A CB  
3427 C CG  . MET A 454 ? 0.4008 0.3591 0.2875 0.0212  -0.1310 0.0355  436 MET A CG  
3428 S SD  . MET A 454 ? 0.4994 0.4863 0.4252 0.0383  -0.1419 0.0381  436 MET A SD  
3429 C CE  . MET A 454 ? 0.4532 0.4762 0.3962 0.0267  -0.1451 0.0347  436 MET A CE  
3430 N N   . MET A 455 ? 0.3926 0.3134 0.2690 0.0309  -0.0828 0.0174  437 MET A N   
3431 C CA  . MET A 455 ? 0.3909 0.3127 0.2698 0.0310  -0.0685 0.0112  437 MET A CA  
3432 C C   . MET A 455 ? 0.3930 0.2991 0.2682 0.0396  -0.0642 0.0102  437 MET A C   
3433 O O   . MET A 455 ? 0.3908 0.2936 0.2629 0.0388  -0.0537 0.0062  437 MET A O   
3434 C CB  . MET A 455 ? 0.3811 0.2951 0.2435 0.0182  -0.0608 0.0098  437 MET A CB  
3435 C CG  . MET A 455 ? 0.4003 0.3311 0.2693 0.0089  -0.0615 0.0082  437 MET A CG  
3436 S SD  . MET A 455 ? 0.5097 0.4644 0.4022 0.0121  -0.0527 0.0030  437 MET A SD  
3437 C CE  . MET A 455 ? 0.4421 0.4163 0.3426 0.0002  -0.0574 0.0026  437 MET A CE  
3438 N N   . GLY A 456 ? 0.3968 0.2928 0.2720 0.0475  -0.0731 0.0141  438 GLY A N   
3439 C CA  . GLY A 456 ? 0.3989 0.2813 0.2741 0.0562  -0.0697 0.0121  438 GLY A CA  
3440 C C   . GLY A 456 ? 0.4004 0.2612 0.2533 0.0494  -0.0646 0.0134  438 GLY A C   
3441 O O   . GLY A 456 ? 0.3886 0.2445 0.2267 0.0394  -0.0641 0.0162  438 GLY A O   
3442 N N   . SER A 457 ? 0.4096 0.2580 0.2606 0.0547  -0.0610 0.0110  439 SER A N   
3443 C CA  . SER A 457 ? 0.4145 0.2455 0.2475 0.0484  -0.0559 0.0118  439 SER A CA  
3444 C C   . SER A 457 ? 0.4095 0.2481 0.2384 0.0410  -0.0454 0.0085  439 SER A C   
3445 O O   . SER A 457 ? 0.3980 0.2524 0.2381 0.0424  -0.0399 0.0041  439 SER A O   
3446 C CB  . SER A 457 ? 0.4288 0.2488 0.2642 0.0554  -0.0539 0.0080  439 SER A CB  
3447 O OG  . SER A 457 ? 0.4139 0.2202 0.2340 0.0486  -0.0489 0.0083  439 SER A OG  
3448 N N   . LEU A 458 ? 0.4138 0.2413 0.2271 0.0332  -0.0427 0.0112  440 LEU A N   
3449 C CA  . LEU A 458 ? 0.4088 0.2400 0.2186 0.0280  -0.0334 0.0090  440 LEU A CA  
3450 C C   . LEU A 458 ? 0.3951 0.2321 0.2123 0.0322  -0.0274 0.0042  440 LEU A C   
3451 O O   . LEU A 458 ? 0.3823 0.2294 0.2028 0.0302  -0.0210 0.0024  440 LEU A O   
3452 C CB  . LEU A 458 ? 0.4214 0.2389 0.2156 0.0213  -0.0319 0.0122  440 LEU A CB  
3453 C CG  . LEU A 458 ? 0.4353 0.2548 0.2256 0.0163  -0.0232 0.0112  440 LEU A CG  
3454 C CD1 . LEU A 458 ? 0.4536 0.2821 0.2475 0.0137  -0.0192 0.0100  440 LEU A CD1 
3455 C CD2 . LEU A 458 ? 0.4693 0.2774 0.2462 0.0101  -0.0226 0.0140  440 LEU A CD2 
3456 N N   . PHE A 459 ? 0.4003 0.2299 0.2190 0.0376  -0.0299 0.0022  441 PHE A N   
3457 C CA  . PHE A 459 ? 0.4048 0.2343 0.2239 0.0389  -0.0246 -0.0026 441 PHE A CA  
3458 C C   . PHE A 459 ? 0.4124 0.2520 0.2437 0.0463  -0.0226 -0.0092 441 PHE A C   
3459 O O   . PHE A 459 ? 0.4200 0.2623 0.2506 0.0464  -0.0173 -0.0143 441 PHE A O   
3460 C CB  . PHE A 459 ? 0.4119 0.2229 0.2214 0.0378  -0.0275 -0.0018 441 PHE A CB  
3461 C CG  . PHE A 459 ? 0.4165 0.2194 0.2136 0.0294  -0.0273 0.0036  441 PHE A CG  
3462 C CD1 . PHE A 459 ? 0.4024 0.2130 0.1972 0.0239  -0.0210 0.0038  441 PHE A CD1 
3463 C CD2 . PHE A 459 ? 0.4379 0.2261 0.2262 0.0271  -0.0332 0.0086  441 PHE A CD2 
3464 C CE1 . PHE A 459 ? 0.4156 0.2213 0.2017 0.0169  -0.0195 0.0076  441 PHE A CE1 
3465 C CE2 . PHE A 459 ? 0.4539 0.2362 0.2301 0.0183  -0.0315 0.0128  441 PHE A CE2 
3466 C CZ  . PHE A 459 ? 0.4229 0.2149 0.1994 0.0136  -0.0240 0.0115  441 PHE A CZ  
3467 N N   . ARG A 460 ? 0.4218 0.2675 0.2645 0.0524  -0.0271 -0.0094 442 ARG A N   
3468 C CA  . ARG A 460 ? 0.4233 0.2804 0.2805 0.0606  -0.0244 -0.0166 442 ARG A CA  
3469 C C   . ARG A 460 ? 0.4280 0.2987 0.3010 0.0661  -0.0290 -0.0157 442 ARG A C   
3470 O O   . ARG A 460 ? 0.4150 0.2832 0.2862 0.0640  -0.0365 -0.0091 442 ARG A O   
3471 C CB  . ARG A 460 ? 0.4468 0.2887 0.3033 0.0674  -0.0253 -0.0217 442 ARG A CB  
3472 C CG  . ARG A 460 ? 0.4469 0.2658 0.2952 0.0683  -0.0341 -0.0158 442 ARG A CG  
3473 C CD  . ARG A 460 ? 0.4755 0.2775 0.3238 0.0749  -0.0341 -0.0220 442 ARG A CD  
3474 N NE  . ARG A 460 ? 0.4876 0.2826 0.3235 0.0680  -0.0277 -0.0267 442 ARG A NE  
3475 C CZ  . ARG A 460 ? 0.5024 0.3046 0.3408 0.0696  -0.0201 -0.0365 442 ARG A CZ  
3476 N NH1 . ARG A 460 ? 0.5063 0.3024 0.3319 0.0620  -0.0161 -0.0400 442 ARG A NH1 
3477 N NH2 . ARG A 460 ? 0.4764 0.2932 0.3301 0.0783  -0.0165 -0.0431 442 ARG A NH2 
3478 N N   . SER A 461 ? 0.4309 0.3187 0.3192 0.0719  -0.0240 -0.0227 443 SER A N   
3479 C CA  . SER A 461 ? 0.4482 0.3509 0.3571 0.0805  -0.0282 -0.0241 443 SER A CA  
3480 C C   . SER A 461 ? 0.4613 0.3618 0.3802 0.0918  -0.0244 -0.0333 443 SER A C   
3481 O O   . SER A 461 ? 0.4713 0.3814 0.3918 0.0913  -0.0142 -0.0415 443 SER A O   
3482 C CB  . SER A 461 ? 0.4356 0.3648 0.3554 0.0754  -0.0237 -0.0249 443 SER A CB  
3483 O OG  . SER A 461 ? 0.4594 0.4080 0.4029 0.0840  -0.0267 -0.0275 443 SER A OG  
3484 N N   . GLY A 462 ? 0.4825 0.3679 0.4062 0.1014  -0.0325 -0.0318 444 GLY A N   
3485 C CA  . GLY A 462 ? 0.5006 0.3769 0.4315 0.1126  -0.0292 -0.0409 444 GLY A CA  
3486 C C   . GLY A 462 ? 0.5081 0.3693 0.4205 0.1064  -0.0210 -0.0469 444 GLY A C   
3487 O O   . GLY A 462 ? 0.5235 0.3662 0.4164 0.0979  -0.0240 -0.0411 444 GLY A O   
3488 N N   . SER A 463 ? 0.5088 0.3797 0.4268 0.1097  -0.0105 -0.0588 445 SER A N   
3489 C CA  . SER A 463 ? 0.5190 0.3780 0.4184 0.1025  -0.0033 -0.0650 445 SER A CA  
3490 C C   . SER A 463 ? 0.4959 0.3693 0.3829 0.0890  0.0028  -0.0625 445 SER A C   
3491 O O   . SER A 463 ? 0.4982 0.3657 0.3697 0.0819  0.0079  -0.0665 445 SER A O   
3492 C CB  . SER A 463 ? 0.5416 0.4010 0.4486 0.1111  0.0054  -0.0798 445 SER A CB  
3493 O OG  . SER A 463 ? 0.5853 0.4748 0.5077 0.1133  0.0139  -0.0857 445 SER A OG  
3494 N N   . ARG A 464 ? 0.4713 0.3624 0.3644 0.0850  0.0014  -0.0554 446 ARG A N   
3495 C CA  . ARG A 464 ? 0.4468 0.3499 0.3296 0.0733  0.0069  -0.0523 446 ARG A CA  
3496 C C   . ARG A 464 ? 0.4296 0.3200 0.2988 0.0653  0.0006  -0.0414 446 ARG A C   
3497 O O   . ARG A 464 ? 0.4161 0.3032 0.2891 0.0663  -0.0066 -0.0346 446 ARG A O   
3498 C CB  . ARG A 464 ? 0.4402 0.3698 0.3374 0.0725  0.0113  -0.0525 446 ARG A CB  
3499 C CG  . ARG A 464 ? 0.4914 0.4358 0.4065 0.0822  0.0175  -0.0636 446 ARG A CG  
3500 C CD  . ARG A 464 ? 0.5913 0.5634 0.5151 0.0776  0.0265  -0.0665 446 ARG A CD  
3501 N NE  . ARG A 464 ? 0.6552 0.6292 0.5603 0.0648  0.0323  -0.0635 446 ARG A NE  
3502 C CZ  . ARG A 464 ? 0.6785 0.6731 0.5853 0.0571  0.0399  -0.0632 446 ARG A CZ  
3503 N NH1 . ARG A 464 ? 0.6973 0.7153 0.6248 0.0601  0.0437  -0.0670 446 ARG A NH1 
3504 N NH2 . ARG A 464 ? 0.7010 0.6936 0.5894 0.0461  0.0433  -0.0585 446 ARG A NH2 
3505 N N   . GLN A 465 ? 0.4104 0.2950 0.2640 0.0573  0.0034  -0.0402 447 GLN A N   
3506 C CA  . GLN A 465 ? 0.4026 0.2778 0.2456 0.0504  -0.0010 -0.0310 447 GLN A CA  
3507 C C   . GLN A 465 ? 0.3856 0.2740 0.2308 0.0450  0.0007  -0.0249 447 GLN A C   
3508 O O   . GLN A 465 ? 0.3749 0.2789 0.2239 0.0431  0.0066  -0.0270 447 GLN A O   
3509 C CB  . GLN A 465 ? 0.4011 0.2682 0.2301 0.0445  0.0008  -0.0318 447 GLN A CB  
3510 C CG  . GLN A 465 ? 0.4368 0.2864 0.2608 0.0474  -0.0013 -0.0377 447 GLN A CG  
3511 C CD  . GLN A 465 ? 0.4868 0.3303 0.2969 0.0389  -0.0009 -0.0370 447 GLN A CD  
3512 O OE1 . GLN A 465 ? 0.5293 0.3821 0.3341 0.0349  0.0037  -0.0408 447 GLN A OE1 
3513 N NE2 . GLN A 465 ? 0.4912 0.3212 0.2952 0.0352  -0.0058 -0.0315 447 GLN A NE2 
3514 N N   . THR A 466 ? 0.3707 0.2518 0.2123 0.0418  -0.0039 -0.0176 448 THR A N   
3515 C CA  . THR A 466 ? 0.3496 0.2386 0.1919 0.0365  -0.0023 -0.0124 448 THR A CA  
3516 C C   . THR A 466 ? 0.3472 0.2355 0.1800 0.0305  0.0017  -0.0089 448 THR A C   
3517 O O   . THR A 466 ? 0.3192 0.2015 0.1449 0.0299  0.0018  -0.0098 448 THR A O   
3518 C CB  . THR A 466 ? 0.3630 0.2435 0.2035 0.0349  -0.0081 -0.0073 448 THR A CB  
3519 O OG1 . THR A 466 ? 0.3842 0.2494 0.2141 0.0333  -0.0104 -0.0047 448 THR A OG1 
3520 C CG2 . THR A 466 ? 0.3447 0.2282 0.1951 0.0402  -0.0141 -0.0085 448 THR A CG2 
3521 N N   . LEU A 467 ? 0.3317 0.2262 0.1653 0.0261  0.0045  -0.0048 449 LEU A N   
3522 C CA  . LEU A 467 ? 0.3425 0.2348 0.1691 0.0217  0.0070  0.0004  449 LEU A CA  
3523 C C   . LEU A 467 ? 0.3481 0.2282 0.1693 0.0216  0.0040  0.0033  449 LEU A C   
3524 O O   . LEU A 467 ? 0.3628 0.2419 0.1795 0.0203  0.0046  0.0055  449 LEU A O   
3525 C CB  . LEU A 467 ? 0.3222 0.2175 0.1508 0.0175  0.0095  0.0048  449 LEU A CB  
3526 C CG  . LEU A 467 ? 0.3477 0.2373 0.1712 0.0146  0.0112  0.0115  449 LEU A CG  
3527 C CD1 . LEU A 467 ? 0.3279 0.2240 0.1467 0.0135  0.0131  0.0138  449 LEU A CD1 
3528 C CD2 . LEU A 467 ? 0.3047 0.1921 0.1299 0.0105  0.0133  0.0147  449 LEU A CD2 
3529 N N   . PHE A 468 ? 0.3472 0.2195 0.1687 0.0223  0.0007  0.0034  450 PHE A N   
3530 C CA  . PHE A 468 ? 0.3592 0.2209 0.1748 0.0208  -0.0007 0.0058  450 PHE A CA  
3531 C C   . PHE A 468 ? 0.3574 0.2153 0.1692 0.0216  -0.0024 0.0039  450 PHE A C   
3532 O O   . PHE A 468 ? 0.3654 0.2221 0.1742 0.0193  -0.0014 0.0061  450 PHE A O   
3533 C CB  . PHE A 468 ? 0.3573 0.2112 0.1707 0.0201  -0.0042 0.0061  450 PHE A CB  
3534 C CG  . PHE A 468 ? 0.3402 0.1844 0.1461 0.0171  -0.0039 0.0082  450 PHE A CG  
3535 C CD1 . PHE A 468 ? 0.3719 0.2146 0.1764 0.0143  0.0005  0.0101  450 PHE A CD1 
3536 C CD2 . PHE A 468 ? 0.3821 0.2181 0.1825 0.0167  -0.0073 0.0082  450 PHE A CD2 
3537 C CE1 . PHE A 468 ? 0.3812 0.2172 0.1799 0.0116  0.0025  0.0109  450 PHE A CE1 
3538 C CE2 . PHE A 468 ? 0.3825 0.2113 0.1755 0.0124  -0.0059 0.0101  450 PHE A CE2 
3539 C CZ  . PHE A 468 ? 0.3592 0.1895 0.1520 0.0100  -0.0005 0.0110  450 PHE A CZ  
3540 N N   . ALA A 469 ? 0.3610 0.2166 0.1740 0.0249  -0.0052 -0.0004 451 ALA A N   
3541 C CA  . ALA A 469 ? 0.3762 0.2256 0.1850 0.0252  -0.0066 -0.0036 451 ALA A CA  
3542 C C   . ALA A 469 ? 0.3769 0.2343 0.1832 0.0223  -0.0035 -0.0044 451 ALA A C   
3543 O O   . ALA A 469 ? 0.3781 0.2317 0.1793 0.0186  -0.0045 -0.0039 451 ALA A O   
3544 C CB  . ALA A 469 ? 0.3765 0.2225 0.1892 0.0309  -0.0089 -0.0093 451 ALA A CB  
3545 N N   A SER A 470 ? 0.3770 0.2461 0.1860 0.0227  -0.0001 -0.0051 452 SER A N   
3546 N N   B SER A 470 ? 0.3692 0.2383 0.1783 0.0228  -0.0001 -0.0051 452 SER A N   
3547 C CA  A SER A 470 ? 0.3788 0.2559 0.1831 0.0192  0.0017  -0.0048 452 SER A CA  
3548 C CA  B SER A 470 ? 0.3618 0.2391 0.1664 0.0193  0.0018  -0.0047 452 SER A CA  
3549 C C   A SER A 470 ? 0.3685 0.2479 0.1723 0.0160  0.0011  0.0028  452 SER A C   
3550 C C   B SER A 470 ? 0.3600 0.2396 0.1638 0.0160  0.0012  0.0027  452 SER A C   
3551 O O   A SER A 470 ? 0.3693 0.2521 0.1695 0.0126  -0.0004 0.0038  452 SER A O   
3552 O O   B SER A 470 ? 0.3617 0.2448 0.1618 0.0127  -0.0003 0.0036  452 SER A O   
3553 C CB  A SER A 470 ? 0.3852 0.2740 0.1901 0.0191  0.0057  -0.0066 452 SER A CB  
3554 C CB  B SER A 470 ? 0.3656 0.2547 0.1713 0.0194  0.0058  -0.0063 452 SER A CB  
3555 O OG  A SER A 470 ? 0.4150 0.3084 0.2245 0.0188  0.0075  -0.0011 452 SER A OG  
3556 O OG  B SER A 470 ? 0.3368 0.2266 0.1467 0.0235  0.0074  -0.0140 452 SER A OG  
3557 N N   . GLN A 471 ? 0.3541 0.2322 0.1623 0.0171  0.0022  0.0075  453 GLN A N   
3558 C CA  . GLN A 471 ? 0.3442 0.2237 0.1546 0.0160  0.0027  0.0139  453 GLN A CA  
3559 C C   . GLN A 471 ? 0.3402 0.2150 0.1500 0.0143  0.0010  0.0137  453 GLN A C   
3560 O O   . GLN A 471 ? 0.3423 0.2234 0.1547 0.0128  0.0007  0.0173  453 GLN A O   
3561 C CB  . GLN A 471 ? 0.3483 0.2246 0.1626 0.0174  0.0053  0.0175  453 GLN A CB  
3562 C CG  . GLN A 471 ? 0.3478 0.2295 0.1627 0.0170  0.0073  0.0194  453 GLN A CG  
3563 C CD  . GLN A 471 ? 0.3701 0.2472 0.1880 0.0171  0.0098  0.0244  453 GLN A CD  
3564 O OE1 . GLN A 471 ? 0.3997 0.2689 0.2188 0.0173  0.0109  0.0228  453 GLN A OE1 
3565 N NE2 . GLN A 471 ? 0.3880 0.2687 0.2059 0.0166  0.0106  0.0306  453 GLN A NE2 
3566 N N   . VAL A 472 ? 0.3312 0.1959 0.1381 0.0141  -0.0002 0.0102  454 VAL A N   
3567 C CA  . VAL A 472 ? 0.3388 0.1981 0.1427 0.0106  -0.0015 0.0098  454 VAL A CA  
3568 C C   . VAL A 472 ? 0.3474 0.2114 0.1489 0.0071  -0.0037 0.0080  454 VAL A C   
3569 O O   . VAL A 472 ? 0.3566 0.2266 0.1601 0.0033  -0.0039 0.0103  454 VAL A O   
3570 C CB  . VAL A 472 ? 0.3452 0.1908 0.1438 0.0103  -0.0038 0.0075  454 VAL A CB  
3571 C CG1 . VAL A 472 ? 0.3503 0.1896 0.1440 0.0046  -0.0048 0.0079  454 VAL A CG1 
3572 C CG2 . VAL A 472 ? 0.3404 0.1823 0.1394 0.0117  -0.0024 0.0094  454 VAL A CG2 
3573 N N   . MET A 473 ? 0.3480 0.2105 0.1456 0.0079  -0.0050 0.0030  455 MET A N   
3574 C CA  . MET A 473 ? 0.3762 0.2414 0.1688 0.0034  -0.0068 -0.0004 455 MET A CA  
3575 C C   . MET A 473 ? 0.3628 0.2440 0.1575 0.0007  -0.0073 0.0041  455 MET A C   
3576 O O   . MET A 473 ? 0.3712 0.2576 0.1647 -0.0051 -0.0098 0.0045  455 MET A O   
3577 C CB  . MET A 473 ? 0.3818 0.2421 0.1697 0.0056  -0.0065 -0.0081 455 MET A CB  
3578 C CG  . MET A 473 ? 0.4185 0.2617 0.2050 0.0086  -0.0079 -0.0123 455 MET A CG  
3579 S SD  . MET A 473 ? 0.4784 0.3175 0.2632 0.0135  -0.0062 -0.0226 455 MET A SD  
3580 C CE  . MET A 473 ? 0.5594 0.3925 0.3333 0.0057  -0.0073 -0.0291 455 MET A CE  
3581 N N   A ARG A 474 ? 0.3483 0.2374 0.1464 0.0043  -0.0055 0.0082  456 ARG A N   
3582 N N   B ARG A 474 ? 0.3468 0.2359 0.1450 0.0043  -0.0055 0.0082  456 ARG A N   
3583 C CA  A ARG A 474 ? 0.3485 0.2518 0.1480 0.0025  -0.0071 0.0142  456 ARG A CA  
3584 C CA  B ARG A 474 ? 0.3448 0.2479 0.1443 0.0027  -0.0070 0.0142  456 ARG A CA  
3585 C C   A ARG A 474 ? 0.3370 0.2472 0.1463 0.0030  -0.0081 0.0213  456 ARG A C   
3586 C C   B ARG A 474 ? 0.3355 0.2455 0.1447 0.0031  -0.0080 0.0213  456 ARG A C   
3587 O O   A ARG A 474 ? 0.3400 0.2627 0.1517 0.0002  -0.0117 0.0255  456 ARG A O   
3588 O O   B ARG A 474 ? 0.3383 0.2609 0.1497 0.0003  -0.0116 0.0255  456 ARG A O   
3589 C CB  A ARG A 474 ? 0.3427 0.2501 0.1414 0.0053  -0.0049 0.0172  456 ARG A CB  
3590 C CB  B ARG A 474 ? 0.3399 0.2464 0.1390 0.0057  -0.0046 0.0172  456 ARG A CB  
3591 C CG  A ARG A 474 ? 0.3606 0.2808 0.1571 0.0029  -0.0077 0.0244  456 ARG A CG  
3592 C CG  B ARG A 474 ? 0.3530 0.2721 0.1499 0.0035  -0.0071 0.0242  456 ARG A CG  
3593 C CD  A ARG A 474 ? 0.3611 0.2839 0.1517 0.0028  -0.0051 0.0259  456 ARG A CD  
3594 C CD  B ARG A 474 ? 0.3461 0.2663 0.1397 0.0045  -0.0040 0.0267  456 ARG A CD  
3595 N NE  A ARG A 474 ? 0.3928 0.3124 0.1763 0.0015  -0.0017 0.0156  456 ARG A NE  
3596 N NE  B ARG A 474 ? 0.3651 0.2960 0.1526 0.0010  -0.0071 0.0340  456 ARG A NE  
3597 C CZ  A ARG A 474 ? 0.4034 0.3271 0.1764 -0.0033 -0.0021 0.0092  456 ARG A CZ  
3598 C CZ  B ARG A 474 ? 0.3765 0.3093 0.1600 0.0003  -0.0052 0.0394  456 ARG A CZ  
3599 N NH1 A ARG A 474 ? 0.3966 0.3287 0.1630 -0.0089 -0.0069 0.0124  456 ARG A NH1 
3600 N NH1 B ARG A 474 ? 0.3774 0.3033 0.1639 0.0025  0.0001  0.0376  456 ARG A NH1 
3601 N NH2 A ARG A 474 ? 0.3865 0.3063 0.1560 -0.0024 0.0022  -0.0010 456 ARG A NH2 
3602 N NH2 B ARG A 474 ? 0.3896 0.3315 0.1655 -0.0037 -0.0090 0.0472  456 ARG A NH2 
3603 N N   . TYR A 475 ? 0.3369 0.2400 0.1522 0.0067  -0.0048 0.0225  457 TYR A N   
3604 C CA  . TYR A 475 ? 0.3392 0.2489 0.1656 0.0092  -0.0034 0.0285  457 TYR A CA  
3605 C C   . TYR A 475 ? 0.3334 0.2421 0.1639 0.0066  -0.0016 0.0267  457 TYR A C   
3606 O O   . TYR A 475 ? 0.3270 0.2471 0.1685 0.0075  -0.0009 0.0307  457 TYR A O   
3607 C CB  . TYR A 475 ? 0.3346 0.2385 0.1649 0.0152  0.0005  0.0319  457 TYR A CB  
3608 C CG  . TYR A 475 ? 0.3625 0.2698 0.1898 0.0163  -0.0010 0.0359  457 TYR A CG  
3609 C CD1 . TYR A 475 ? 0.3773 0.2965 0.2077 0.0164  -0.0049 0.0430  457 TYR A CD1 
3610 C CD2 . TYR A 475 ? 0.3443 0.2443 0.1653 0.0164  0.0010  0.0330  457 TYR A CD2 
3611 C CE1 . TYR A 475 ? 0.4094 0.3313 0.2339 0.0158  -0.0066 0.0477  457 TYR A CE1 
3612 C CE2 . TYR A 475 ? 0.3747 0.2788 0.1917 0.0156  0.0005  0.0368  457 TYR A CE2 
3613 C CZ  . TYR A 475 ? 0.3750 0.2888 0.1923 0.0150  -0.0031 0.0443  457 TYR A CZ  
3614 O OH  . TYR A 475 ? 0.4268 0.3439 0.2375 0.0130  -0.0037 0.0492  457 TYR A OH  
3615 N N   . ALA A 476 ? 0.3356 0.2314 0.1580 0.0035  -0.0008 0.0213  458 ALA A N   
3616 C CA  . ALA A 476 ? 0.3174 0.2109 0.1405 -0.0010 0.0012  0.0200  458 ALA A CA  
3617 C C   . ALA A 476 ? 0.3279 0.2247 0.1472 -0.0089 -0.0028 0.0179  458 ALA A C   
3618 O O   . ALA A 476 ? 0.3304 0.2161 0.1393 -0.0116 -0.0057 0.0134  458 ALA A O   
3619 C CB  . ALA A 476 ? 0.3222 0.1991 0.1369 -0.0013 0.0029  0.0171  458 ALA A CB  
3620 N N   . ASP A 477 ? 0.3194 0.2318 0.1479 -0.0127 -0.0029 0.0206  459 ASP A N   
3621 C CA  . ASP A 477 ? 0.3306 0.2473 0.1557 -0.0224 -0.0069 0.0184  459 ASP A CA  
3622 C C   . ASP A 477 ? 0.3438 0.2425 0.1583 -0.0289 -0.0056 0.0145  459 ASP A C   
3623 O O   . ASP A 477 ? 0.3806 0.2689 0.1848 -0.0347 -0.0093 0.0104  459 ASP A O   
3624 C CB  . ASP A 477 ? 0.3191 0.2594 0.1591 -0.0258 -0.0073 0.0225  459 ASP A CB  
3625 C CG  . ASP A 477 ? 0.3418 0.2993 0.1928 -0.0186 -0.0102 0.0283  459 ASP A CG  
3626 O OD1 . ASP A 477 ? 0.3843 0.3367 0.2273 -0.0155 -0.0133 0.0283  459 ASP A OD1 
3627 O OD2 . ASP A 477 ? 0.3257 0.3022 0.1935 -0.0161 -0.0095 0.0331  459 ASP A OD2 
3628 N N   . LEU A 478 ? 0.3520 0.2464 0.1680 -0.0283 -0.0005 0.0159  460 LEU A N   
3629 C CA  . LEU A 478 ? 0.3613 0.2373 0.1655 -0.0344 0.0007  0.0143  460 LEU A CA  
3630 C C   . LEU A 478 ? 0.3654 0.2286 0.1645 -0.0276 0.0034  0.0148  460 LEU A C   
3631 O O   . LEU A 478 ? 0.3605 0.2317 0.1675 -0.0203 0.0067  0.0161  460 LEU A O   
3632 C CB  . LEU A 478 ? 0.3668 0.2526 0.1756 -0.0434 0.0052  0.0160  460 LEU A CB  
3633 C CG  . LEU A 478 ? 0.3601 0.2659 0.1788 -0.0510 0.0033  0.0164  460 LEU A CG  
3634 C CD1 . LEU A 478 ? 0.3578 0.2772 0.1846 -0.0586 0.0097  0.0180  460 LEU A CD1 
3635 C CD2 . LEU A 478 ? 0.3544 0.2478 0.1611 -0.0600 -0.0030 0.0131  460 LEU A CD2 
3636 N N   . TYR A 479 ? 0.3808 0.2236 0.1667 -0.0302 0.0012  0.0139  461 TYR A N   
3637 C CA  . TYR A 479 ? 0.3837 0.2153 0.1633 -0.0261 0.0024  0.0149  461 TYR A CA  
3638 C C   . TYR A 479 ? 0.4072 0.2195 0.1721 -0.0329 0.0003  0.0165  461 TYR A C   
3639 O O   . TYR A 479 ? 0.4289 0.2311 0.1874 -0.0392 -0.0032 0.0164  461 TYR A O   
3640 C CB  . TYR A 479 ? 0.3745 0.2028 0.1556 -0.0165 -0.0006 0.0135  461 TYR A CB  
3641 C CG  . TYR A 479 ? 0.3857 0.2005 0.1608 -0.0145 -0.0066 0.0110  461 TYR A CG  
3642 C CD1 . TYR A 479 ? 0.3999 0.1982 0.1670 -0.0127 -0.0104 0.0118  461 TYR A CD1 
3643 C CD2 . TYR A 479 ? 0.3497 0.1686 0.1274 -0.0144 -0.0086 0.0076  461 TYR A CD2 
3644 C CE1 . TYR A 479 ? 0.4124 0.1983 0.1767 -0.0089 -0.0155 0.0092  461 TYR A CE1 
3645 C CE2 . TYR A 479 ? 0.3861 0.1916 0.1588 -0.0117 -0.0127 0.0035  461 TYR A CE2 
3646 C CZ  . TYR A 479 ? 0.4172 0.2065 0.1848 -0.0080 -0.0159 0.0043  461 TYR A CZ  
3647 O OH  . TYR A 479 ? 0.4383 0.2144 0.2039 -0.0033 -0.0196 0.0002  461 TYR A OH  
3648 N N   . ALA A 480 ? 0.4162 0.2221 0.1741 -0.0326 0.0021  0.0184  462 ALA A N   
3649 C CA  . ALA A 480 ? 0.4309 0.2191 0.1728 -0.0400 -0.0002 0.0218  462 ALA A CA  
3650 C C   . ALA A 480 ? 0.4382 0.2221 0.1732 -0.0375 0.0003  0.0230  462 ALA A C   
3651 O O   . ALA A 480 ? 0.4341 0.2294 0.1771 -0.0320 0.0045  0.0206  462 ALA A O   
3652 C CB  . ALA A 480 ? 0.4343 0.2271 0.1728 -0.0522 0.0053  0.0232  462 ALA A CB  
3653 N N   . ALA A 481 ? 0.4616 0.2278 0.1807 -0.0422 -0.0047 0.0273  463 ALA A N   
3654 C CA  . ALA A 481 ? 0.4697 0.2303 0.1777 -0.0429 -0.0058 0.0294  463 ALA A CA  
3655 C C   . ALA A 481 ? 0.4734 0.2444 0.1779 -0.0497 0.0048  0.0274  463 ALA A C   
3656 O O   . ALA A 481 ? 0.4817 0.2547 0.1823 -0.0484 0.0071  0.0256  463 ALA A O   
3657 C CB  . ALA A 481 ? 0.4871 0.2259 0.1774 -0.0482 -0.0144 0.0362  463 ALA A CB  
3658 N N   . SER A 482 ? 0.4759 0.2546 0.1830 -0.0569 0.0118  0.0268  464 SER A N   
3659 C CA  . SER A 482 ? 0.4753 0.2658 0.1812 -0.0634 0.0235  0.0241  464 SER A CA  
3660 C C   . SER A 482 ? 0.4741 0.2824 0.1965 -0.0652 0.0300  0.0220  464 SER A C   
3661 O O   . SER A 482 ? 0.4826 0.2876 0.2061 -0.0691 0.0253  0.0244  464 SER A O   
3662 C CB  . SER A 482 ? 0.5060 0.2842 0.1891 -0.0765 0.0244  0.0283  464 SER A CB  
3663 O OG  . SER A 482 ? 0.5121 0.3028 0.1936 -0.0833 0.0374  0.0243  464 SER A OG  
3664 N N   . PHE A 483 ? 0.4682 0.2947 0.2031 -0.0632 0.0406  0.0174  465 PHE A N   
3665 C CA  . PHE A 483 ? 0.4721 0.3193 0.2246 -0.0656 0.0466  0.0161  465 PHE A CA  
3666 C C   . PHE A 483 ? 0.4782 0.3244 0.2195 -0.0812 0.0503  0.0186  465 PHE A C   
3667 O O   . PHE A 483 ? 0.4849 0.3442 0.2372 -0.0867 0.0516  0.0191  465 PHE A O   
3668 C CB  . PHE A 483 ? 0.4699 0.3367 0.2398 -0.0588 0.0576  0.0110  465 PHE A CB  
3669 C CG  . PHE A 483 ? 0.5020 0.3690 0.2615 -0.0655 0.0686  0.0075  465 PHE A CG  
3670 C CD1 . PHE A 483 ? 0.5201 0.4021 0.2834 -0.0752 0.0784  0.0062  465 PHE A CD1 
3671 C CD2 . PHE A 483 ? 0.5476 0.3994 0.2909 -0.0642 0.0691  0.0053  465 PHE A CD2 
3672 C CE1 . PHE A 483 ? 0.5230 0.4055 0.2746 -0.0826 0.0897  0.0023  465 PHE A CE1 
3673 C CE2 . PHE A 483 ? 0.5859 0.4366 0.3155 -0.0721 0.0795  0.0013  465 PHE A CE2 
3674 C CZ  . PHE A 483 ? 0.5949 0.4608 0.3279 -0.0815 0.0905  -0.0004 465 PHE A CZ  
3675 N N   . ILE A 484 ? 0.4892 0.3203 0.2080 -0.0896 0.0518  0.0205  466 ILE A N   
3676 C CA  . ILE A 484 ? 0.5088 0.3358 0.2128 -0.1062 0.0552  0.0241  466 ILE A CA  
3677 C C   . ILE A 484 ? 0.5089 0.3258 0.2108 -0.1127 0.0462  0.0292  466 ILE A C   
3678 O O   . ILE A 484 ? 0.5207 0.3401 0.2178 -0.1270 0.0500  0.0316  466 ILE A O   
3679 C CB  . ILE A 484 ? 0.5368 0.3455 0.2121 -0.1148 0.0559  0.0270  466 ILE A CB  
3680 C CG1 . ILE A 484 ? 0.5877 0.4040 0.2527 -0.1317 0.0673  0.0275  466 ILE A CG1 
3681 C CG2 . ILE A 484 ? 0.5643 0.3451 0.2207 -0.1164 0.0415  0.0350  466 ILE A CG2 
3682 C CD1 . ILE A 484 ? 0.6174 0.4604 0.2982 -0.1295 0.0839  0.0184  466 ILE A CD1 
3683 N N   . ASN A 485 ? 0.4995 0.3048 0.2048 -0.1030 0.0350  0.0303  467 ASN A N   
3684 C CA  . ASN A 485 ? 0.5039 0.2958 0.2060 -0.1080 0.0264  0.0334  467 ASN A CA  
3685 C C   . ASN A 485 ? 0.5025 0.3158 0.2219 -0.1137 0.0305  0.0308  467 ASN A C   
3686 O O   . ASN A 485 ? 0.5243 0.3283 0.2383 -0.1237 0.0266  0.0329  467 ASN A O   
3687 C CB  . ASN A 485 ? 0.4921 0.2694 0.1957 -0.0951 0.0155  0.0332  467 ASN A CB  
3688 C CG  . ASN A 485 ? 0.5093 0.2646 0.1956 -0.0915 0.0091  0.0373  467 ASN A CG  
3689 O OD1 . ASN A 485 ? 0.5462 0.2949 0.2163 -0.0998 0.0120  0.0410  467 ASN A OD1 
3690 N ND2 . ASN A 485 ? 0.4867 0.2319 0.1761 -0.0798 0.0004  0.0368  467 ASN A ND2 
3691 N N   . LEU A 486 ? 0.4938 0.3355 0.2341 -0.1077 0.0382  0.0263  468 LEU A N   
3692 C CA  . LEU A 486 ? 0.4843 0.3526 0.2439 -0.1135 0.0425  0.0244  468 LEU A CA  
3693 C C   . LEU A 486 ? 0.5083 0.3812 0.2609 -0.1318 0.0496  0.0264  468 LEU A C   
3694 O O   . LEU A 486 ? 0.5122 0.4003 0.2755 -0.1414 0.0500  0.0262  468 LEU A O   
3695 C CB  . LEU A 486 ? 0.4675 0.3646 0.2517 -0.1015 0.0494  0.0204  468 LEU A CB  
3696 C CG  . LEU A 486 ? 0.4459 0.3422 0.2398 -0.0854 0.0419  0.0193  468 LEU A CG  
3697 C CD1 . LEU A 486 ? 0.4437 0.3604 0.2573 -0.0727 0.0487  0.0166  468 LEU A CD1 
3698 C CD2 . LEU A 486 ? 0.4509 0.3522 0.2521 -0.0871 0.0332  0.0198  468 LEU A CD2 
3699 N N   . LEU A 487 ? 0.5214 0.3823 0.2553 -0.1382 0.0552  0.0284  469 LEU A N   
3700 C CA  . LEU A 487 ? 0.5484 0.4118 0.2716 -0.1578 0.0628  0.0310  469 LEU A CA  
3701 C C   . LEU A 487 ? 0.5722 0.4153 0.2823 -0.1716 0.0543  0.0362  469 LEU A C   
3702 O O   . LEU A 487 ? 0.5967 0.4480 0.3052 -0.1891 0.0598  0.0379  469 LEU A O   
3703 C CB  . LEU A 487 ? 0.5559 0.4054 0.2557 -0.1627 0.0686  0.0330  469 LEU A CB  
3704 C CG  . LEU A 487 ? 0.5731 0.4259 0.2580 -0.1830 0.0791  0.0355  469 LEU A CG  
3705 C CD1 . LEU A 487 ? 0.5031 0.3951 0.2122 -0.1856 0.0946  0.0288  469 LEU A CD1 
3706 C CD2 . LEU A 487 ? 0.5714 0.4035 0.2287 -0.1842 0.0801  0.0381  469 LEU A CD2 
3707 N N   . TYR A 488 ? 0.5835 0.4001 0.2848 -0.1639 0.0417  0.0382  470 TYR A N   
3708 C CA  . TYR A 488 ? 0.6212 0.4101 0.3064 -0.1752 0.0333  0.0428  470 TYR A CA  
3709 C C   . TYR A 488 ? 0.6225 0.4210 0.3230 -0.1775 0.0288  0.0389  470 TYR A C   
3710 O O   . TYR A 488 ? 0.6631 0.4370 0.3516 -0.1858 0.0215  0.0408  470 TYR A O   
3711 C CB  . TYR A 488 ? 0.6376 0.3893 0.3027 -0.1670 0.0225  0.0474  470 TYR A CB  
3712 C CG  . TYR A 488 ? 0.6539 0.3998 0.3045 -0.1644 0.0256  0.0509  470 TYR A CG  
3713 C CD1 . TYR A 488 ? 0.6878 0.4394 0.3258 -0.1797 0.0352  0.0541  470 TYR A CD1 
3714 C CD2 . TYR A 488 ? 0.6332 0.3709 0.2830 -0.1478 0.0197  0.0503  470 TYR A CD2 
3715 C CE1 . TYR A 488 ? 0.6796 0.4270 0.3020 -0.1787 0.0386  0.0563  470 TYR A CE1 
3716 C CE2 . TYR A 488 ? 0.6377 0.3720 0.2737 -0.1469 0.0223  0.0528  470 TYR A CE2 
3717 C CZ  . TYR A 488 ? 0.6596 0.3978 0.2808 -0.1626 0.0315  0.0557  470 TYR A CZ  
3718 O OH  . TYR A 488 ? 0.6996 0.4344 0.3045 -0.1632 0.0342  0.0573  470 TYR A OH  
3719 N N   . TYR A 489 ? 0.5948 0.4284 0.3210 -0.1712 0.0331  0.0336  471 TYR A N   
3720 C CA  . TYR A 489 ? 0.5819 0.4300 0.3239 -0.1726 0.0282  0.0297  471 TYR A CA  
3721 C C   . TYR A 489 ? 0.5911 0.4769 0.3528 -0.1837 0.0366  0.0284  471 TYR A C   
3722 O O   . TYR A 489 ? 0.5700 0.4797 0.3442 -0.1792 0.0463  0.0277  471 TYR A O   
3723 C CB  . TYR A 489 ? 0.5356 0.3918 0.2913 -0.1529 0.0229  0.0257  471 TYR A CB  
3724 C CG  . TYR A 489 ? 0.5152 0.3379 0.2550 -0.1430 0.0143  0.0259  471 TYR A CG  
3725 C CD1 . TYR A 489 ? 0.5230 0.3278 0.2567 -0.1451 0.0058  0.0232  471 TYR A CD1 
3726 C CD2 . TYR A 489 ? 0.4939 0.3032 0.2252 -0.1318 0.0149  0.0279  471 TYR A CD2 
3727 C CE1 . TYR A 489 ? 0.5323 0.3077 0.2540 -0.1346 -0.0011 0.0225  471 TYR A CE1 
3728 C CE2 . TYR A 489 ? 0.5049 0.2867 0.2247 -0.1223 0.0068  0.0282  471 TYR A CE2 
3729 C CZ  . TYR A 489 ? 0.5192 0.2847 0.2354 -0.1229 -0.0008 0.0254  471 TYR A CZ  
3730 O OH  . TYR A 489 ? 0.5388 0.2793 0.2467 -0.1120 -0.0078 0.0249  471 TYR A OH  
3731 N N   . PRO A 490 ? 0.6252 0.5165 0.3900 -0.1988 0.0331  0.0277  472 PRO A N   
3732 C CA  . PRO A 490 ? 0.6383 0.5678 0.4232 -0.2114 0.0406  0.0269  472 PRO A CA  
3733 C C   . PRO A 490 ? 0.6247 0.5958 0.4416 -0.1971 0.0428  0.0237  472 PRO A C   
3734 O O   . PRO A 490 ? 0.5992 0.5688 0.4220 -0.1798 0.0364  0.0221  472 PRO A O   
3735 C CB  . PRO A 490 ? 0.6543 0.5758 0.4334 -0.2300 0.0336  0.0264  472 PRO A CB  
3736 C CG  . PRO A 490 ? 0.6581 0.5479 0.4236 -0.2206 0.0222  0.0244  472 PRO A CG  
3737 C CD  . PRO A 490 ? 0.6343 0.4970 0.3846 -0.2056 0.0226  0.0268  472 PRO A CD  
3738 N N   . PHE A 491 ? 0.6523 0.6601 0.4898 -0.2050 0.0523  0.0234  473 PHE A N   
3739 C CA  . PHE A 491 ? 0.6493 0.7003 0.5209 -0.1924 0.0562  0.0214  473 PHE A CA  
3740 C C   . PHE A 491 ? 0.6346 0.6963 0.5205 -0.1802 0.0442  0.0207  473 PHE A C   
3741 O O   . PHE A 491 ? 0.6330 0.7120 0.5376 -0.1615 0.0448  0.0205  473 PHE A O   
3742 C CB  . PHE A 491 ? 0.6662 0.7569 0.5595 -0.2076 0.0658  0.0209  473 PHE A CB  
3743 C CG  . PHE A 491 ? 0.7105 0.8088 0.6034 -0.2094 0.0824  0.0199  473 PHE A CG  
3744 C CD1 . PHE A 491 ? 0.7346 0.8334 0.6328 -0.1893 0.0894  0.0176  473 PHE A CD1 
3745 C CD2 . PHE A 491 ? 0.7582 0.8631 0.6446 -0.2321 0.0917  0.0207  473 PHE A CD2 
3746 C CE1 . PHE A 491 ? 0.7381 0.8434 0.6338 -0.1917 0.1057  0.0150  473 PHE A CE1 
3747 C CE2 . PHE A 491 ? 0.7748 0.8877 0.6586 -0.2350 0.1083  0.0190  473 PHE A CE2 
3748 C CZ  . PHE A 491 ? 0.7360 0.8492 0.6244 -0.2144 0.1153  0.0156  473 PHE A CZ  
3749 N N   . SER A 492 ? 0.6227 0.6710 0.4973 -0.1912 0.0334  0.0203  474 SER A N   
3750 C CA  . SER A 492 ? 0.5942 0.6568 0.4805 -0.1857 0.0220  0.0194  474 SER A CA  
3751 C C   . SER A 492 ? 0.5870 0.6105 0.4471 -0.1852 0.0117  0.0172  474 SER A C   
3752 O O   . SER A 492 ? 0.5826 0.6104 0.4427 -0.1906 0.0021  0.0150  474 SER A O   
3753 C CB  . SER A 492 ? 0.6064 0.6994 0.5077 -0.2048 0.0198  0.0192  474 SER A CB  
3754 O OG  . SER A 492 ? 0.6546 0.7197 0.5319 -0.2255 0.0203  0.0183  474 SER A OG  
3755 N N   . TYR A 493 ? 0.5699 0.5565 0.4080 -0.1786 0.0136  0.0173  475 TYR A N   
3756 C CA  . TYR A 493 ? 0.5674 0.5167 0.3827 -0.1761 0.0055  0.0148  475 TYR A CA  
3757 C C   . TYR A 493 ? 0.5476 0.5063 0.3705 -0.1628 -0.0024 0.0124  475 TYR A C   
3758 O O   . TYR A 493 ? 0.5285 0.5115 0.3696 -0.1490 -0.0009 0.0145  475 TYR A O   
3759 C CB  . TYR A 493 ? 0.5733 0.4902 0.3708 -0.1670 0.0091  0.0165  475 TYR A CB  
3760 C CG  . TYR A 493 ? 0.5800 0.4558 0.3541 -0.1657 0.0020  0.0144  475 TYR A CG  
3761 C CD1 . TYR A 493 ? 0.6133 0.4603 0.3682 -0.1817 0.0002  0.0148  475 TYR A CD1 
3762 C CD2 . TYR A 493 ? 0.5579 0.4226 0.3296 -0.1483 -0.0023 0.0122  475 TYR A CD2 
3763 C CE1 . TYR A 493 ? 0.6285 0.4358 0.3637 -0.1782 -0.0061 0.0126  475 TYR A CE1 
3764 C CE2 . TYR A 493 ? 0.5522 0.3814 0.3055 -0.1456 -0.0079 0.0094  475 TYR A CE2 
3765 C CZ  . TYR A 493 ? 0.5968 0.3972 0.3327 -0.1595 -0.0098 0.0095  475 TYR A CZ  
3766 O OH  . TYR A 493 ? 0.6534 0.4182 0.3735 -0.1546 -0.0151 0.0065  475 TYR A OH  
3767 N N   . LEU A 494 ? 0.5482 0.4868 0.3563 -0.1675 -0.0103 0.0080  476 LEU A N   
3768 C CA  . LEU A 494 ? 0.5372 0.4797 0.3469 -0.1553 -0.0169 0.0055  476 LEU A CA  
3769 C C   . LEU A 494 ? 0.5281 0.4338 0.3190 -0.1435 -0.0176 0.0028  476 LEU A C   
3770 O O   . LEU A 494 ? 0.5441 0.4192 0.3164 -0.1503 -0.0204 -0.0017 476 LEU A O   
3771 C CB  . LEU A 494 ? 0.5407 0.4953 0.3502 -0.1682 -0.0250 0.0014  476 LEU A CB  
3772 C CG  . LEU A 494 ? 0.5582 0.5128 0.3624 -0.1607 -0.0325 -0.0026 476 LEU A CG  
3773 C CD1 . LEU A 494 ? 0.5182 0.4951 0.3375 -0.1422 -0.0328 0.0023  476 LEU A CD1 
3774 C CD2 . LEU A 494 ? 0.5846 0.5558 0.3889 -0.1778 -0.0400 -0.0062 476 LEU A CD2 
3775 N N   . PHE A 495 ? 0.5677 0.6409 0.3294 -0.2399 0.1683  0.0444  477 PHE A N   
3776 C CA  . PHE A 495 ? 0.5577 0.4893 0.2993 -0.2227 0.1606  0.0431  477 PHE A CA  
3777 C C   . PHE A 495 ? 0.5595 0.4998 0.3074 -0.2111 0.1481  0.0396  477 PHE A C   
3778 O O   . PHE A 495 ? 0.5354 0.5635 0.3108 -0.1697 0.1527  0.0498  477 PHE A O   
3779 C CB  . PHE A 495 ? 0.5392 0.4215 0.2755 -0.1849 0.1791  0.0492  477 PHE A CB  
3780 C CG  . PHE A 495 ? 0.5293 0.4026 0.2536 -0.2027 0.1942  0.0495  477 PHE A CG  
3781 C CD1 . PHE A 495 ? 0.5266 0.3676 0.2317 -0.2306 0.1837  0.0473  477 PHE A CD1 
3782 C CD2 . PHE A 495 ? 0.5148 0.4230 0.2349 -0.1737 0.2255  0.0604  477 PHE A CD2 
3783 C CE1 . PHE A 495 ? 0.5200 0.3660 0.2155 -0.2495 0.1963  0.0478  477 PHE A CE1 
3784 C CE2 . PHE A 495 ? 0.5274 0.4201 0.2323 -0.1930 0.2419  0.0590  477 PHE A CE2 
3785 C CZ  . PHE A 495 ? 0.5377 0.4015 0.2376 -0.2413 0.2229  0.0485  477 PHE A CZ  
3786 N N   A ARG A 496 ? 0.6014 0.4442 0.3074 -0.2297 0.1413  0.0330  478 ARG A N   
3787 N N   B ARG A 496 ? 0.6071 0.4517 0.3117 -0.2329 0.1416  0.0323  478 ARG A N   
3788 C CA  A ARG A 496 ? 0.6162 0.4493 0.3135 -0.2308 0.1330  0.0260  478 ARG A CA  
3789 C CA  B ARG A 496 ? 0.6233 0.4564 0.3201 -0.2315 0.1330  0.0257  478 ARG A CA  
3790 C C   A ARG A 496 ? 0.6112 0.3730 0.2990 -0.1809 0.1247  0.0368  478 ARG A C   
3791 C C   B ARG A 496 ? 0.6112 0.3763 0.3016 -0.1799 0.1245  0.0370  478 ARG A C   
3792 O O   A ARG A 496 ? 0.6549 0.3612 0.3002 -0.1604 0.1313  0.0501  478 ARG A O   
3793 O O   B ARG A 496 ? 0.6465 0.3647 0.3006 -0.1601 0.1301  0.0498  478 ARG A O   
3794 C CB  A ARG A 496 ? 0.7304 0.4857 0.3368 -0.3070 0.1547  0.0055  478 ARG A CB  
3795 C CB  B ARG A 496 ? 0.7403 0.4865 0.3432 -0.3046 0.1547  0.0058  478 ARG A CB  
3796 C CG  A ARG A 496 ? 0.7698 0.6299 0.3596 -0.4000 0.1698  -0.0190 478 ARG A CG  
3797 C CG  B ARG A 496 ? 0.7845 0.6674 0.3813 -0.3981 0.1623  -0.0245 478 ARG A CG  
3798 C CD  A ARG A 496 ? 0.9736 0.6813 0.4062 -0.5142 0.2193  -0.0544 478 ARG A CD  
3799 C CD  B ARG A 496 ? 0.9485 0.6908 0.4064 -0.4952 0.2018  -0.0590 478 ARG A CD  
3800 N NE  A ARG A 496 ? 1.1400 0.7211 0.4755 -0.5604 0.2591  -0.0596 478 ARG A NE  
3801 N NE  B ARG A 496 ? 0.9509 0.7389 0.4361 -0.4797 0.1850  -0.0634 478 ARG A NE  
3802 C CZ  A ARG A 496 ? 1.2481 0.6078 0.4926 -0.4951 0.2893  -0.0304 478 ARG A CZ  
3803 C CZ  B ARG A 496 ? 0.9669 0.6124 0.4350 -0.4036 0.1813  -0.0441 478 ARG A CZ  
3804 N NH1 A ARG A 496 ? 1.2430 0.5164 0.4855 -0.3816 0.2816  0.0063  478 ARG A NH1 
3805 N NH1 B ARG A 496 ? 1.0194 0.5006 0.4386 -0.3279 0.1949  -0.0144 478 ARG A NH1 
3806 N NH2 A ARG A 496 ? 1.3846 0.6382 0.5323 -0.5381 0.3312  -0.0339 478 ARG A NH2 
3807 N NH2 B ARG A 496 ? 0.9137 0.6180 0.4119 -0.3979 0.1648  -0.0509 478 ARG A NH2 
3808 N N   . ALA A 497 ? 0.5748 0.3689 0.2950 -0.1556 0.1138  0.0350  479 ALA A N   
3809 C CA  . ALA A 497 ? 0.5926 0.3569 0.3004 -0.1242 0.1052  0.0394  479 ALA A CA  
3810 C C   . ALA A 497 ? 0.6280 0.3674 0.3235 -0.1267 0.0988  0.0337  479 ALA A C   
3811 O O   . ALA A 497 ? 0.6184 0.4184 0.3406 -0.1496 0.0966  0.0241  479 ALA A O   
3812 C CB  . ALA A 497 ? 0.5514 0.3474 0.2784 -0.1160 0.1118  0.0326  479 ALA A CB  
3813 N N   . ALA A 498 ? 0.7041 0.3795 0.3493 -0.0974 0.1012  0.0433  480 ALA A N   
3814 C CA  . ALA A 498 ? 0.7619 0.3848 0.3742 -0.1061 0.1043  0.0344  480 ALA A CA  
3815 C C   . ALA A 498 ? 0.6890 0.4042 0.3785 -0.0990 0.0801  0.0256  480 ALA A C   
3816 O O   . ALA A 498 ? 0.6378 0.3968 0.3620 -0.0740 0.0734  0.0292  480 ALA A O   
3817 C CB  . ALA A 498 ? 0.8554 0.3873 0.3837 -0.0446 0.1225  0.0578  480 ALA A CB  
3818 N N   . HIS A 499 ? 0.7141 0.4546 0.4060 -0.1302 0.0781  0.0113  481 HIS A N   
3819 C CA  . HIS A 499 ? 0.6733 0.4902 0.4186 -0.1022 0.0625  0.0123  481 HIS A CA  
3820 C C   . HIS A 499 ? 0.6652 0.4251 0.3986 -0.0643 0.0545  0.0170  481 HIS A C   
3821 O O   . HIS A 499 ? 0.7329 0.4175 0.4094 -0.0514 0.0617  0.0231  481 HIS A O   
3822 C CB  . HIS A 499 ? 0.6889 0.5891 0.4343 -0.1444 0.0603  -0.0025 481 HIS A CB  
3823 C CG  . HIS A 499 ? 0.7283 0.7853 0.4880 -0.1925 0.0670  -0.0090 481 HIS A CG  
3824 N ND1 . HIS A 499 ? 0.7118 0.8635 0.5138 -0.1455 0.0713  0.0142  481 HIS A ND1 
3825 C CD2 . HIS A 499 ? 0.8009 0.9653 0.5236 -0.2927 0.0771  -0.0390 481 HIS A CD2 
3826 C CE1 . HIS A 499 ? 0.7369 1.0796 0.5452 -0.1962 0.0759  0.0069  481 HIS A CE1 
3827 N NE2 . HIS A 499 ? 0.7886 1.1599 0.5502 -0.3010 0.0782  -0.0307 481 HIS A NE2 
3828 N N   . VAL A 500 ? 0.6244 0.4183 0.3875 -0.0398 0.0524  0.0179  482 VAL A N   
3829 C CA  . VAL A 500 ? 0.6161 0.4015 0.3684 -0.0247 0.0466  0.0143  482 VAL A CA  
3830 C C   . VAL A 500 ? 0.5988 0.3846 0.3609 -0.0137 0.0353  0.0114  482 VAL A C   
3831 O O   . VAL A 500 ? 0.5953 0.4204 0.3787 -0.0094 0.0383  0.0137  482 VAL A O   
3832 C CB  . VAL A 500 ? 0.6316 0.4144 0.3632 -0.0401 0.0722  0.0032  482 VAL A CB  
3833 C CG1 . VAL A 500 ? 0.6466 0.4606 0.3538 -0.0580 0.0716  -0.0129 482 VAL A CG1 
3834 C CG2 . VAL A 500 ? 0.6423 0.4355 0.3576 -0.0663 0.0860  0.0006  482 VAL A CG2 
3835 N N   . LEU A 501 ? 0.5966 0.3659 0.3366 0.0021  0.0257  0.0125  483 LEU A N   
3836 C CA  . LEU A 501 ? 0.5771 0.3396 0.3197 0.0105  0.0162  0.0075  483 LEU A CA  
3837 C C   . LEU A 501 ? 0.5360 0.3402 0.2797 0.0259  0.0109  0.0044  483 LEU A C   
3838 O O   . LEU A 501 ? 0.5411 0.4046 0.2671 0.0328  0.0123  0.0092  483 LEU A O   
3839 C CB  . LEU A 501 ? 0.6552 0.3316 0.3326 0.0115  0.0271  0.0094  483 LEU A CB  
3840 C CG  . LEU A 501 ? 0.7668 0.3726 0.3871 -0.0458 0.0519  -0.0034 483 LEU A CG  
3841 C CD1 . LEU A 501 ? 0.9175 0.3607 0.4085 -0.0528 0.0921  -0.0082 483 LEU A CD1 
3842 C CD2 . LEU A 501 ? 0.7370 0.4636 0.4134 -0.1015 0.0399  -0.0218 483 LEU A CD2 
3843 N N   . MET A 502 ? 0.4951 0.2992 0.2522 0.0257  0.0080  -0.0039 484 MET A N   
3844 C CA  . MET A 502 ? 0.4820 0.3236 0.2261 0.0222  0.0067  -0.0145 484 MET A CA  
3845 C C   . MET A 502 ? 0.4754 0.3461 0.2079 0.0626  -0.0100 -0.0014 484 MET A C   
3846 O O   . MET A 502 ? 0.5305 0.3245 0.2416 0.0838  -0.0075 0.0094  484 MET A O   
3847 C CB  . MET A 502 ? 0.4811 0.2816 0.2237 0.0232  0.0179  -0.0209 484 MET A CB  
3848 C CG  . MET A 502 ? 0.5284 0.2620 0.2335 0.0246  0.0610  -0.0173 484 MET A CG  
3849 S SD  . MET A 502 ? 0.6372 0.2880 0.2794 0.0569  0.1039  -0.0113 484 MET A SD  
3850 C CE  . MET A 502 ? 0.6879 0.3101 0.2609 -0.0237 0.1229  -0.0534 484 MET A CE  
3851 N N   . PRO A 503 ? 0.4585 0.4402 0.1783 0.0696  -0.0142 -0.0029 485 PRO A N   
3852 C CA  . PRO A 503 ? 0.4821 0.5044 0.1739 0.1395  -0.0194 0.0216  485 PRO A CA  
3853 C C   . PRO A 503 ? 0.5088 0.3982 0.1872 0.1600  -0.0192 0.0224  485 PRO A C   
3854 O O   . PRO A 503 ? 0.6033 0.4128 0.2088 0.2237  0.0025  0.0478  485 PRO A O   
3855 C CB  . PRO A 503 ? 0.4498 0.6622 0.1463 0.1114  -0.0264 0.0060  485 PRO A CB  
3856 C CG  . PRO A 503 ? 0.4437 0.7352 0.1365 0.0324  -0.0139 -0.0183 485 PRO A CG  
3857 C CD  . PRO A 503 ? 0.4468 0.5380 0.1518 0.0018  -0.0018 -0.0304 485 PRO A CD  
3858 N N   . HIS A 504 ? 0.4667 0.3230 0.1865 0.1125  -0.0295 -0.0017 486 HIS A N   
3859 C CA  . HIS A 504 ? 0.5078 0.2869 0.2154 0.1161  -0.0307 -0.0058 486 HIS A CA  
3860 C C   . HIS A 504 ? 0.5721 0.2616 0.2511 0.0802  -0.0151 -0.0125 486 HIS A C   
3861 O O   . HIS A 504 ? 0.6297 0.2536 0.2631 0.0550  -0.0021 -0.0249 486 HIS A O   
3862 C CB  . HIS A 504 ? 0.4358 0.2497 0.1871 0.0935  -0.0435 -0.0215 486 HIS A CB  
3863 C CG  . HIS A 504 ? 0.4071 0.2239 0.1864 0.0728  -0.0369 -0.0233 486 HIS A CG  
3864 N ND1 . HIS A 504 ? 0.3904 0.2014 0.1606 0.0669  -0.0158 -0.0230 486 HIS A ND1 
3865 C CD2 . HIS A 504 ? 0.3787 0.2252 0.1748 0.0637  -0.0380 -0.0214 486 HIS A CD2 
3866 C CE1 . HIS A 504 ? 0.3801 0.1955 0.1558 0.0866  -0.0003 -0.0088 486 HIS A CE1 
3867 N NE2 . HIS A 504 ? 0.3896 0.2684 0.1952 0.0847  -0.0204 -0.0065 486 HIS A NE2 
3868 N N   . GLU A 505 ? 0.5638 0.2658 0.2589 0.0594  -0.0113 -0.0111 487 GLU A N   
3869 C CA  . GLU A 505 ? 0.6385 0.2998 0.3026 0.0042  0.0060  -0.0234 487 GLU A CA  
3870 C C   . GLU A 505 ? 0.8174 0.3183 0.3574 0.0076  0.0502  -0.0174 487 GLU A C   
3871 O O   . GLU A 505 ? 0.9380 0.3552 0.3986 -0.0672 0.0844  -0.0399 487 GLU A O   
3872 C CB  . GLU A 505 ? 0.5541 0.3084 0.2830 -0.0086 -0.0036 -0.0201 487 GLU A CB  
3873 C CG  . GLU A 505 ? 0.4333 0.2908 0.2217 0.0113  -0.0148 -0.0142 487 GLU A CG  
3874 C CD  . GLU A 505 ? 0.4112 0.3179 0.2213 0.0331  -0.0018 0.0018  487 GLU A CD  
3875 O OE1 . GLU A 505 ? 0.4638 0.3269 0.2639 0.0259  0.0059  0.0028  487 GLU A OE1 
3876 O OE2 . GLU A 505 ? 0.4100 0.4034 0.2339 0.0713  0.0085  0.0200  487 GLU A OE2 
3877 N N   . SER A 506 ? 0.8776 0.3498 0.3797 0.0945  0.0602  0.0148  488 SER A N   
3878 C CA  . SER A 506 ? 1.0862 0.3886 0.4332 0.1540  0.1209  0.0433  488 SER A CA  
3879 C C   . SER A 506 ? 1.2427 0.4011 0.4648 0.2016  0.1652  0.0535  488 SER A C   
3880 O O   . SER A 506 ? 1.4892 0.3999 0.5308 0.1739  0.2414  0.0442  488 SER A O   
3881 C CB  . SER A 506 ? 1.0499 0.4722 0.4168 0.2523  0.1122  0.0870  488 SER A CB  
3882 O OG  . SER A 506 ? 0.9088 0.4894 0.4050 0.1986  0.0659  0.0696  488 SER A OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -17 ?   ?   ?   A . n 
A 1 2   SER 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   HIS 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  SER 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  GLY 12  -6  ?   ?   ?   A . n 
A 1 13  LEU 13  -5  ?   ?   ?   A . n 
A 1 14  VAL 14  -4  ?   ?   ?   A . n 
A 1 15  PRO 15  -3  ?   ?   ?   A . n 
A 1 16  ARG 16  -2  ?   ?   ?   A . n 
A 1 17  GLY 17  -1  ?   ?   ?   A . n 
A 1 18  SER 18  0   ?   ?   ?   A . n 
A 1 19  MET 19  1   ?   ?   ?   A . n 
A 1 20  SER 20  2   ?   ?   ?   A . n 
A 1 21  THR 21  3   3   THR THR A . n 
A 1 22  SER 22  4   4   SER SER A . n 
A 1 23  TRP 23  5   5   TRP TRP A . n 
A 1 24  SER 24  6   6   SER SER A . n 
A 1 25  ASP 25  7   7   ASP ASP A . n 
A 1 26  ARG 26  8   8   ARG ARG A . n 
A 1 27  LEU 27  9   9   LEU LEU A . n 
A 1 28  GLN 28  10  10  GLN GLN A . n 
A 1 29  ASN 29  11  11  ASN ASN A . n 
A 1 30  ALA 30  12  12  ALA ALA A . n 
A 1 31  ALA 31  13  13  ALA ALA A . n 
A 1 32  ASP 32  14  14  ASP ASP A . n 
A 1 33  MET 33  15  15  MET MET A . n 
A 1 34  PRO 34  16  16  PRO PRO A . n 
A 1 35  ALA 35  17  17  ALA ALA A . n 
A 1 36  ASN 36  18  18  ASN ASN A . n 
A 1 37  MET 37  19  19  MET MET A . n 
A 1 38  ASP 38  20  20  ASP ASP A . n 
A 1 39  LYS 39  21  21  LYS LYS A . n 
A 1 40  HIS 40  22  22  HIS HIS A . n 
A 1 41  ALA 41  23  23  ALA ALA A . n 
A 1 42  LEU 42  24  24  LEU LEU A . n 
A 1 43  LYS 43  25  25  LYS LYS A . n 
A 1 44  LYS 44  26  26  LYS LYS A . n 
A 1 45  TYR 45  27  27  TYR TYR A . n 
A 1 46  ARG 46  28  28  ARG ARG A . n 
A 1 47  ARG 47  29  29  ARG ARG A . n 
A 1 48  GLU 48  30  30  GLU GLU A . n 
A 1 49  ALA 49  31  31  ALA ALA A . n 
A 1 50  TYR 50  32  32  TYR TYR A . n 
A 1 51  HIS 51  33  33  HIS HIS A . n 
A 1 52  ARG 52  34  34  ARG ARG A . n 
A 1 53  VAL 53  35  35  VAL VAL A . n 
A 1 54  PHE 54  36  36  PHE PHE A . n 
A 1 55  VAL 55  37  37  VAL VAL A . n 
A 1 56  ASN 56  38  38  ASN ASN A . n 
A 1 57  ARG 57  39  39  ARG ARG A . n 
A 1 58  SER 58  40  40  SER SER A . n 
A 1 59  LEU 59  41  41  LEU LEU A . n 
A 1 60  ALA 60  42  42  ALA ALA A . n 
A 1 61  MET 61  43  43  MET MET A . n 
A 1 62  GLU 62  44  44  GLU GLU A . n 
A 1 63  LYS 63  45  45  LYS LYS A . n 
A 1 64  ILE 64  46  46  ILE ILE A . n 
A 1 65  LYS 65  47  47  LYS LYS A . n 
A 1 66  CYS 66  48  48  CYS CYS A . n 
A 1 67  PHE 67  49  49  PHE PHE A . n 
A 1 68  GLY 68  50  50  GLY GLY A . n 
A 1 69  PHE 69  51  51  PHE PHE A . n 
A 1 70  ASN 70  52  52  ASN ASN A . n 
A 1 71  MET 71  53  53  MET MET A . n 
A 1 72  ASP 72  54  54  ASP ASP A . n 
A 1 73  TYR 73  55  55  TYR TYR A . n 
A 1 74  THR 74  56  56  THR THR A . n 
A 1 75  LEU 75  57  57  LEU LEU A . n 
A 1 76  ALA 76  58  58  ALA ALA A . n 
A 1 77  VAL 77  59  59  VAL VAL A . n 
A 1 78  TYR 78  60  60  TYR TYR A . n 
A 1 79  LYS 79  61  61  LYS LYS A . n 
A 1 80  SER 80  62  62  SER SER A . n 
A 1 81  PRO 81  63  63  PRO PRO A . n 
A 1 82  GLU 82  64  64  GLU GLU A . n 
A 1 83  TYR 83  65  65  TYR TYR A . n 
A 1 84  GLU 84  66  66  GLU GLU A . n 
A 1 85  SER 85  67  67  SER SER A . n 
A 1 86  LEU 86  68  68  LEU LEU A . n 
A 1 87  GLY 87  69  69  GLY GLY A . n 
A 1 88  PHE 88  70  70  PHE PHE A . n 
A 1 89  GLU 89  71  71  GLU GLU A . n 
A 1 90  LEU 90  72  72  LEU LEU A . n 
A 1 91  THR 91  73  73  THR THR A . n 
A 1 92  VAL 92  74  74  VAL VAL A . n 
A 1 93  GLU 93  75  75  GLU GLU A . n 
A 1 94  ARG 94  76  76  ARG ARG A . n 
A 1 95  LEU 95  77  77  LEU LEU A . n 
A 1 96  VAL 96  78  78  VAL VAL A . n 
A 1 97  SER 97  79  79  SER SER A . n 
A 1 98  ILE 98  80  80  ILE ILE A . n 
A 1 99  GLY 99  81  81  GLY GLY A . n 
A 1 100 TYR 100 82  82  TYR TYR A . n 
A 1 101 PRO 101 83  83  PRO PRO A . n 
A 1 102 GLN 102 84  84  GLN GLN A . n 
A 1 103 GLU 103 85  85  GLU GLU A . n 
A 1 104 LEU 104 86  86  LEU LEU A . n 
A 1 105 LEU 105 87  87  LEU LEU A . n 
A 1 106 SER 106 88  88  SER SER A . n 
A 1 107 PHE 107 89  89  PHE PHE A . n 
A 1 108 ALA 108 90  90  ALA ALA A . n 
A 1 109 TYR 109 91  91  TYR TYR A . n 
A 1 110 ASP 110 92  92  ASP ASP A . n 
A 1 111 SER 111 93  93  SER SER A . n 
A 1 112 THR 112 94  94  THR THR A . n 
A 1 113 PHE 113 95  95  PHE PHE A . n 
A 1 114 PRO 114 96  96  PRO PRO A . n 
A 1 115 THR 115 97  97  THR THR A . n 
A 1 116 ARG 116 98  98  ARG ARG A . n 
A 1 117 GLY 117 99  99  GLY GLY A . n 
A 1 118 LEU 118 100 100 LEU LEU A . n 
A 1 119 VAL 119 101 101 VAL VAL A . n 
A 1 120 PHE 120 102 102 PHE PHE A . n 
A 1 121 ASP 121 103 103 ASP ASP A . n 
A 1 122 THR 122 104 104 THR THR A . n 
A 1 123 LEU 123 105 105 LEU LEU A . n 
A 1 124 TYR 124 106 106 TYR TYR A . n 
A 1 125 GLY 125 107 107 GLY GLY A . n 
A 1 126 ASN 126 108 108 ASN ASN A . n 
A 1 127 LEU 127 109 109 LEU LEU A . n 
A 1 128 LEU 128 110 110 LEU LEU A . n 
A 1 129 LYS 129 111 111 LYS LYS A . n 
A 1 130 VAL 130 112 112 VAL VAL A . n 
A 1 131 ASP 131 113 113 ASP ASP A . n 
A 1 132 ALA 132 114 114 ALA ALA A . n 
A 1 133 TYR 133 115 115 TYR TYR A . n 
A 1 134 GLY 134 116 116 GLY GLY A . n 
A 1 135 ASN 135 117 117 ASN ASN A . n 
A 1 136 LEU 136 118 118 LEU LEU A . n 
A 1 137 LEU 137 119 119 LEU LEU A . n 
A 1 138 VAL 138 120 120 VAL VAL A . n 
A 1 139 CYS 139 121 121 CYS CYS A . n 
A 1 140 ALA 140 122 122 ALA ALA A . n 
A 1 141 HIS 141 123 123 HIS HIS A . n 
A 1 142 GLY 142 124 124 GLY GLY A . n 
A 1 143 PHE 143 125 125 PHE PHE A . n 
A 1 144 ASN 144 126 126 ASN ASN A . n 
A 1 145 PHE 145 127 127 PHE PHE A . n 
A 1 146 ILE 146 128 128 ILE ILE A . n 
A 1 147 ARG 147 129 129 ARG ARG A . n 
A 1 148 GLY 148 130 130 GLY GLY A . n 
A 1 149 PRO 149 131 131 PRO PRO A . n 
A 1 150 GLU 150 132 132 GLU GLU A . n 
A 1 151 THR 151 133 133 THR THR A . n 
A 1 152 ARG 152 134 134 ARG ARG A . n 
A 1 153 GLU 153 135 135 GLU GLU A . n 
A 1 154 GLN 154 136 136 GLN GLN A . n 
A 1 155 TYR 155 137 137 TYR TYR A . n 
A 1 156 PRO 156 138 138 PRO PRO A . n 
A 1 157 ASN 157 139 139 ASN ASN A . n 
A 1 158 LYS 158 140 140 LYS LYS A . n 
A 1 159 PHE 159 141 141 PHE PHE A . n 
A 1 160 ILE 160 142 142 ILE ILE A . n 
A 1 161 GLN 161 143 143 GLN GLN A . n 
A 1 162 ARG 162 144 144 ARG ARG A . n 
A 1 163 ASP 163 145 145 ASP ASP A . n 
A 1 164 ASP 164 146 146 ASP ASP A . n 
A 1 165 THR 165 147 147 THR THR A . n 
A 1 166 GLU 166 148 148 GLU GLU A . n 
A 1 167 ARG 167 149 149 ARG ARG A . n 
A 1 168 PHE 168 150 150 PHE PHE A . n 
A 1 169 TYR 169 151 151 TYR TYR A . n 
A 1 170 ILE 170 152 152 ILE ILE A . n 
A 1 171 LEU 171 153 153 LEU LEU A . n 
A 1 172 ASN 172 154 154 ASN ASN A . n 
A 1 173 THR 173 155 155 THR THR A . n 
A 1 174 LEU 174 156 156 LEU LEU A . n 
A 1 175 PHE 175 157 157 PHE PHE A . n 
A 1 176 ASN 176 158 158 ASN ASN A . n 
A 1 177 LEU 177 159 159 LEU LEU A . n 
A 1 178 PRO 178 160 160 PRO PRO A . n 
A 1 179 GLU 179 161 161 GLU GLU A . n 
A 1 180 THR 180 162 162 THR THR A . n 
A 1 181 TYR 181 163 163 TYR TYR A . n 
A 1 182 LEU 182 164 164 LEU LEU A . n 
A 1 183 LEU 183 165 165 LEU LEU A . n 
A 1 184 ALA 184 166 166 ALA ALA A . n 
A 1 185 CYS 185 167 167 CYS CYS A . n 
A 1 186 LEU 186 168 168 LEU LEU A . n 
A 1 187 VAL 187 169 169 VAL VAL A . n 
A 1 188 ASP 188 170 170 ASP ASP A . n 
A 1 189 PHE 189 171 171 PHE PHE A . n 
A 1 190 PHE 190 172 172 PHE PHE A . n 
A 1 191 THR 191 173 173 THR THR A . n 
A 1 192 ASN 192 174 174 ASN ASN A . n 
A 1 193 CYS 193 175 175 CYS CYS A . n 
A 1 194 PRO 194 176 176 PRO PRO A . n 
A 1 195 ARG 195 177 177 ARG ARG A . n 
A 1 196 TYR 196 178 178 TYR TYR A . n 
A 1 197 THR 197 179 179 THR THR A . n 
A 1 198 SER 198 180 180 SER SER A . n 
A 1 199 CYS 199 181 181 CYS CYS A . n 
A 1 200 GLU 200 182 182 GLU GLU A . n 
A 1 201 THR 201 183 183 THR THR A . n 
A 1 202 GLY 202 184 184 GLY GLY A . n 
A 1 203 PHE 203 185 185 PHE PHE A . n 
A 1 204 LYS 204 186 186 LYS LYS A . n 
A 1 205 ASP 205 187 187 ASP ASP A . n 
A 1 206 GLY 206 188 188 GLY GLY A . n 
A 1 207 ASP 207 189 189 ASP ASP A . n 
A 1 208 LEU 208 190 190 LEU LEU A . n 
A 1 209 PHE 209 191 191 PHE PHE A . n 
A 1 210 MET 210 192 192 MET MET A . n 
A 1 211 SER 211 193 193 SER SER A . n 
A 1 212 TYR 212 194 194 TYR TYR A . n 
A 1 213 ARG 213 195 195 ARG ARG A . n 
A 1 214 SER 214 196 196 SER SER A . n 
A 1 215 MET 215 197 197 MET MET A . n 
A 1 216 PHE 216 198 198 PHE PHE A . n 
A 1 217 GLN 217 199 199 GLN GLN A . n 
A 1 218 ASP 218 200 200 ASP ASP A . n 
A 1 219 VAL 219 201 201 VAL VAL A . n 
A 1 220 ARG 220 202 202 ARG ARG A . n 
A 1 221 ASP 221 203 203 ASP ASP A . n 
A 1 222 ALA 222 204 204 ALA ALA A . n 
A 1 223 VAL 223 205 205 VAL VAL A . n 
A 1 224 ASP 224 206 206 ASP ASP A . n 
A 1 225 TRP 225 207 207 TRP TRP A . n 
A 1 226 VAL 226 208 208 VAL VAL A . n 
A 1 227 HIS 227 209 209 HIS HIS A . n 
A 1 228 TYR 228 210 210 TYR TYR A . n 
A 1 229 LYS 229 211 211 LYS LYS A . n 
A 1 230 GLY 230 212 212 GLY GLY A . n 
A 1 231 SER 231 213 213 SER SER A . n 
A 1 232 LEU 232 214 214 LEU LEU A . n 
A 1 233 LYS 233 215 215 LYS LYS A . n 
A 1 234 GLU 234 216 216 GLU GLU A . n 
A 1 235 LYS 235 217 217 LYS LYS A . n 
A 1 236 THR 236 218 218 THR THR A . n 
A 1 237 VAL 237 219 219 VAL VAL A . n 
A 1 238 GLU 238 220 220 GLU GLU A . n 
A 1 239 ASN 239 221 221 ASN ASN A . n 
A 1 240 LEU 240 222 222 LEU LEU A . n 
A 1 241 GLU 241 223 223 GLU GLU A . n 
A 1 242 LYS 242 224 224 LYS LYS A . n 
A 1 243 TYR 243 225 225 TYR TYR A . n 
A 1 244 VAL 244 226 226 VAL VAL A . n 
A 1 245 VAL 245 227 227 VAL VAL A . n 
A 1 246 LYS 246 228 228 LYS LYS A . n 
A 1 247 ASP 247 229 229 ASP ASP A . n 
A 1 248 GLY 248 230 230 GLY GLY A . n 
A 1 249 LYS 249 231 231 LYS LYS A . n 
A 1 250 LEU 250 232 232 LEU LEU A . n 
A 1 251 PRO 251 233 233 PRO PRO A . n 
A 1 252 LEU 252 234 234 LEU LEU A . n 
A 1 253 LEU 253 235 235 LEU LEU A . n 
A 1 254 LEU 254 236 236 LEU LEU A . n 
A 1 255 SER 255 237 237 SER SER A . n 
A 1 256 ARG 256 238 238 ARG ARG A . n 
A 1 257 MET 257 239 239 MET MET A . n 
A 1 258 LYS 258 240 240 LYS LYS A . n 
A 1 259 GLU 259 241 241 GLU GLU A . n 
A 1 260 VAL 260 242 242 VAL VAL A . n 
A 1 261 GLY 261 243 243 GLY GLY A . n 
A 1 262 LYS 262 244 244 LYS LYS A . n 
A 1 263 VAL 263 245 245 VAL VAL A . n 
A 1 264 PHE 264 246 246 PHE PHE A . n 
A 1 265 LEU 265 247 247 LEU LEU A . n 
A 1 266 ALA 266 248 248 ALA ALA A . n 
A 1 267 THR 267 249 249 THR THR A . n 
A 1 268 ASN 268 250 250 ASN ASN A . n 
A 1 269 SER 269 251 251 SER SER A . n 
A 1 270 ASP 270 252 252 ASP ASP A . n 
A 1 271 TYR 271 253 253 TYR TYR A . n 
A 1 272 LYS 272 254 254 LYS LYS A . n 
A 1 273 TYR 273 255 255 TYR TYR A . n 
A 1 274 THR 274 256 256 THR THR A . n 
A 1 275 ASP 275 257 257 ASP ASP A . n 
A 1 276 LYS 276 258 258 LYS LYS A . n 
A 1 277 ILE 277 259 259 ILE ILE A . n 
A 1 278 MET 278 260 260 MET MET A . n 
A 1 279 THR 279 261 261 THR THR A . n 
A 1 280 TYR 280 262 262 TYR TYR A . n 
A 1 281 LEU 281 263 263 LEU LEU A . n 
A 1 282 PHE 282 264 264 PHE PHE A . n 
A 1 283 ASP 283 265 265 ASP ASP A . n 
A 1 284 PHE 284 266 266 PHE PHE A . n 
A 1 285 PRO 285 267 267 PRO PRO A . n 
A 1 286 HIS 286 268 268 HIS HIS A . n 
A 1 287 GLY 287 269 269 GLY GLY A . n 
A 1 288 PRO 288 270 270 PRO PRO A . n 
A 1 289 LYS 289 271 271 LYS LYS A . n 
A 1 290 PRO 290 272 272 PRO PRO A . n 
A 1 291 GLY 291 273 273 GLY GLY A . n 
A 1 292 SER 292 274 274 SER SER A . n 
A 1 293 SER 293 275 275 SER SER A . n 
A 1 294 HIS 294 276 276 HIS HIS A . n 
A 1 295 ARG 295 277 277 ARG ARG A . n 
A 1 296 PRO 296 278 278 PRO PRO A . n 
A 1 297 TRP 297 279 279 TRP TRP A . n 
A 1 298 GLN 298 280 280 GLN GLN A . n 
A 1 299 SER 299 281 281 SER SER A . n 
A 1 300 TYR 300 282 282 TYR TYR A . n 
A 1 301 PHE 301 283 283 PHE PHE A . n 
A 1 302 ASP 302 284 284 ASP ASP A . n 
A 1 303 LEU 303 285 285 LEU LEU A . n 
A 1 304 ILE 304 286 286 ILE ILE A . n 
A 1 305 LEU 305 287 287 LEU LEU A . n 
A 1 306 VAL 306 288 288 VAL VAL A . n 
A 1 307 ASP 307 289 289 ASP ASP A . n 
A 1 308 ALA 308 290 290 ALA ALA A . n 
A 1 309 ARG 309 291 291 ARG ARG A . n 
A 1 310 LYS 310 292 292 LYS LYS A . n 
A 1 311 PRO 311 293 293 PRO PRO A . n 
A 1 312 LEU 312 294 294 LEU LEU A . n 
A 1 313 PHE 313 295 295 PHE PHE A . n 
A 1 314 PHE 314 296 296 PHE PHE A . n 
A 1 315 GLY 315 297 297 GLY GLY A . n 
A 1 316 GLU 316 298 298 GLU GLU A . n 
A 1 317 GLY 317 299 299 GLY GLY A . n 
A 1 318 THR 318 300 300 THR THR A . n 
A 1 319 VAL 319 301 301 VAL VAL A . n 
A 1 320 LEU 320 302 302 LEU LEU A . n 
A 1 321 ARG 321 303 303 ARG ARG A . n 
A 1 322 GLN 322 304 304 GLN GLN A . n 
A 1 323 VAL 323 305 305 VAL VAL A . n 
A 1 324 ASP 324 306 306 ASP ASP A . n 
A 1 325 THR 325 307 307 THR THR A . n 
A 1 326 LYS 326 308 308 LYS LYS A . n 
A 1 327 THR 327 309 309 THR THR A . n 
A 1 328 GLY 328 310 310 GLY GLY A . n 
A 1 329 LYS 329 311 311 LYS LYS A . n 
A 1 330 LEU 330 312 312 LEU LEU A . n 
A 1 331 LYS 331 313 313 LYS LYS A . n 
A 1 332 ILE 332 314 314 ILE ILE A . n 
A 1 333 GLY 333 315 315 GLY GLY A . n 
A 1 334 THR 334 316 316 THR THR A . n 
A 1 335 TYR 335 317 317 TYR TYR A . n 
A 1 336 THR 336 318 318 THR THR A . n 
A 1 337 GLY 337 319 319 GLY GLY A . n 
A 1 338 PRO 338 320 320 PRO PRO A . n 
A 1 339 LEU 339 321 321 LEU LEU A . n 
A 1 340 GLN 340 322 322 GLN GLN A . n 
A 1 341 HIS 341 323 323 HIS HIS A . n 
A 1 342 GLY 342 324 324 GLY GLY A . n 
A 1 343 ILE 343 325 325 ILE ILE A . n 
A 1 344 VAL 344 326 326 VAL VAL A . n 
A 1 345 TYR 345 327 327 TYR TYR A . n 
A 1 346 SER 346 328 328 SER SER A . n 
A 1 347 GLY 347 329 329 GLY GLY A . n 
A 1 348 GLY 348 330 330 GLY GLY A . n 
A 1 349 SER 349 331 331 SER SER A . n 
A 1 350 SER 350 332 332 SER SER A . n 
A 1 351 ASP 351 333 333 ASP ASP A . n 
A 1 352 THR 352 334 334 THR THR A . n 
A 1 353 ILE 353 335 335 ILE ILE A . n 
A 1 354 CYS 354 336 336 CYS CYS A . n 
A 1 355 ASP 355 337 337 ASP ASP A . n 
A 1 356 LEU 356 338 338 LEU LEU A . n 
A 1 357 LEU 357 339 339 LEU LEU A . n 
A 1 358 GLY 358 340 340 GLY GLY A . n 
A 1 359 ALA 359 341 341 ALA ALA A . n 
A 1 360 LYS 360 342 342 LYS LYS A . n 
A 1 361 GLY 361 343 343 GLY GLY A . n 
A 1 362 LYS 362 344 344 LYS LYS A . n 
A 1 363 ASP 363 345 345 ASP ASP A . n 
A 1 364 ILE 364 346 346 ILE ILE A . n 
A 1 365 LEU 365 347 347 LEU LEU A . n 
A 1 366 TYR 366 348 348 TYR TYR A . n 
A 1 367 ILE 367 349 349 ILE ILE A . n 
A 1 368 GLY 368 350 350 GLY GLY A . n 
A 1 369 ASP 369 351 351 ASP ASP A . n 
A 1 370 HIS 370 352 352 HIS HIS A . n 
A 1 371 ILE 371 353 353 ILE ILE A . n 
A 1 372 PHE 372 354 354 PHE PHE A . n 
A 1 373 GLY 373 355 355 GLY GLY A . n 
A 1 374 ASP 374 356 356 ASP ASP A . n 
A 1 375 ILE 375 357 357 ILE ILE A . n 
A 1 376 LEU 376 358 358 LEU LEU A . n 
A 1 377 LYS 377 359 359 LYS LYS A . n 
A 1 378 SER 378 360 360 SER SER A . n 
A 1 379 LYS 379 361 361 LYS LYS A . n 
A 1 380 LYS 380 362 362 LYS LYS A . n 
A 1 381 ARG 381 363 363 ARG ARG A . n 
A 1 382 GLN 382 364 364 GLN GLN A . n 
A 1 383 GLY 383 365 365 GLY GLY A . n 
A 1 384 TRP 384 366 366 TRP TRP A . n 
A 1 385 ARG 385 367 367 ARG ARG A . n 
A 1 386 THR 386 368 368 THR THR A . n 
A 1 387 PHE 387 369 369 PHE PHE A . n 
A 1 388 LEU 388 370 370 LEU LEU A . n 
A 1 389 VAL 389 371 371 VAL VAL A . n 
A 1 390 ILE 390 372 372 ILE ILE A . n 
A 1 391 PRO 391 373 373 PRO PRO A . n 
A 1 392 GLU 392 374 374 GLU GLU A . n 
A 1 393 LEU 393 375 375 LEU LEU A . n 
A 1 394 ALA 394 376 376 ALA ALA A . n 
A 1 395 GLN 395 377 377 GLN GLN A . n 
A 1 396 GLU 396 378 378 GLU GLU A . n 
A 1 397 LEU 397 379 379 LEU LEU A . n 
A 1 398 HIS 398 380 380 HIS HIS A . n 
A 1 399 VAL 399 381 381 VAL VAL A . n 
A 1 400 TRP 400 382 382 TRP TRP A . n 
A 1 401 THR 401 383 383 THR THR A . n 
A 1 402 ASP 402 384 384 ASP ASP A . n 
A 1 403 LYS 403 385 385 LYS LYS A . n 
A 1 404 SER 404 386 386 SER SER A . n 
A 1 405 SER 405 387 387 SER SER A . n 
A 1 406 LEU 406 388 388 LEU LEU A . n 
A 1 407 PHE 407 389 389 PHE PHE A . n 
A 1 408 GLU 408 390 390 GLU GLU A . n 
A 1 409 GLU 409 391 391 GLU GLU A . n 
A 1 410 LEU 410 392 392 LEU LEU A . n 
A 1 411 GLN 411 393 393 GLN GLN A . n 
A 1 412 SER 412 394 394 SER SER A . n 
A 1 413 LEU 413 395 395 LEU LEU A . n 
A 1 414 ASP 414 396 396 ASP ASP A . n 
A 1 415 ILE 415 397 ?   ?   ?   A . n 
A 1 416 PHE 416 398 ?   ?   ?   A . n 
A 1 417 LEU 417 399 ?   ?   ?   A . n 
A 1 418 ALA 418 400 ?   ?   ?   A . n 
A 1 419 GLU 419 401 ?   ?   ?   A . n 
A 1 420 LEU 420 402 ?   ?   ?   A . n 
A 1 421 TYR 421 403 ?   ?   ?   A . n 
A 1 422 LYS 422 404 ?   ?   ?   A . n 
A 1 423 HIS 423 405 ?   ?   ?   A . n 
A 1 424 LEU 424 406 ?   ?   ?   A . n 
A 1 425 ASP 425 407 ?   ?   ?   A . n 
A 1 426 SER 426 408 ?   ?   ?   A . n 
A 1 427 SER 427 409 ?   ?   ?   A . n 
A 1 428 SER 428 410 ?   ?   ?   A . n 
A 1 429 ASN 429 411 ?   ?   ?   A . n 
A 1 430 GLU 430 412 ?   ?   ?   A . n 
A 1 431 ARG 431 413 ?   ?   ?   A . n 
A 1 432 PRO 432 414 ?   ?   ?   A . n 
A 1 433 ASP 433 415 ?   ?   ?   A . n 
A 1 434 ILE 434 416 ?   ?   ?   A . n 
A 1 435 SER 435 417 ?   ?   ?   A . n 
A 1 436 SER 436 418 ?   ?   ?   A . n 
A 1 437 ILE 437 419 ?   ?   ?   A . n 
A 1 438 GLN 438 420 420 GLN GLN A . n 
A 1 439 ARG 439 421 421 ARG ARG A . n 
A 1 440 ARG 440 422 422 ARG ARG A . n 
A 1 441 ILE 441 423 423 ILE ILE A . n 
A 1 442 LYS 442 424 424 LYS LYS A . n 
A 1 443 LYS 443 425 425 LYS LYS A . n 
A 1 444 VAL 444 426 426 VAL VAL A . n 
A 1 445 THR 445 427 427 THR THR A . n 
A 1 446 HIS 446 428 428 HIS HIS A . n 
A 1 447 ASP 447 429 429 ASP ASP A . n 
A 1 448 MET 448 430 430 MET MET A . n 
A 1 449 ASP 449 431 431 ASP ASP A . n 
A 1 450 MET 450 432 432 MET MET A . n 
A 1 451 CYS 451 433 433 CYS CYS A . n 
A 1 452 TYR 452 434 434 TYR TYR A . n 
A 1 453 GLY 453 435 435 GLY GLY A . n 
A 1 454 MET 454 436 436 MET MET A . n 
A 1 455 MET 455 437 437 MET MET A . n 
A 1 456 GLY 456 438 438 GLY GLY A . n 
A 1 457 SER 457 439 439 SER SER A . n 
A 1 458 LEU 458 440 440 LEU LEU A . n 
A 1 459 PHE 459 441 441 PHE PHE A . n 
A 1 460 ARG 460 442 442 ARG ARG A . n 
A 1 461 SER 461 443 443 SER SER A . n 
A 1 462 GLY 462 444 444 GLY GLY A . n 
A 1 463 SER 463 445 445 SER SER A . n 
A 1 464 ARG 464 446 446 ARG ARG A . n 
A 1 465 GLN 465 447 447 GLN GLN A . n 
A 1 466 THR 466 448 448 THR THR A . n 
A 1 467 LEU 467 449 449 LEU LEU A . n 
A 1 468 PHE 468 450 450 PHE PHE A . n 
A 1 469 ALA 469 451 451 ALA ALA A . n 
A 1 470 SER 470 452 452 SER SER A . n 
A 1 471 GLN 471 453 453 GLN GLN A . n 
A 1 472 VAL 472 454 454 VAL VAL A . n 
A 1 473 MET 473 455 455 MET MET A . n 
A 1 474 ARG 474 456 456 ARG ARG A . n 
A 1 475 TYR 475 457 457 TYR TYR A . n 
A 1 476 ALA 476 458 458 ALA ALA A . n 
A 1 477 ASP 477 459 459 ASP ASP A . n 
A 1 478 LEU 478 460 460 LEU LEU A . n 
A 1 479 TYR 479 461 461 TYR TYR A . n 
A 1 480 ALA 480 462 462 ALA ALA A . n 
A 1 481 ALA 481 463 463 ALA ALA A . n 
A 1 482 SER 482 464 464 SER SER A . n 
A 1 483 PHE 483 465 465 PHE PHE A . n 
A 1 484 ILE 484 466 466 ILE ILE A . n 
A 1 485 ASN 485 467 467 ASN ASN A . n 
A 1 486 LEU 486 468 468 LEU LEU A . n 
A 1 487 LEU 487 469 469 LEU LEU A . n 
A 1 488 TYR 488 470 470 TYR TYR A . n 
A 1 489 TYR 489 471 471 TYR TYR A . n 
A 1 490 PRO 490 472 472 PRO PRO A . n 
A 1 491 PHE 491 473 473 PHE PHE A . n 
A 1 492 SER 492 474 474 SER SER A . n 
A 1 493 TYR 493 475 475 TYR TYR A . n 
A 1 494 LEU 494 476 476 LEU LEU A . n 
A 1 495 PHE 495 477 477 PHE PHE A . n 
A 1 496 ARG 496 478 478 ARG ARG A . n 
A 1 497 ALA 497 479 479 ALA ALA A . n 
A 1 498 ALA 498 480 480 ALA ALA A . n 
A 1 499 HIS 499 481 481 HIS HIS A . n 
A 1 500 VAL 500 482 482 VAL VAL A . n 
A 1 501 LEU 501 483 483 LEU LEU A . n 
A 1 502 MET 502 484 484 MET MET A . n 
A 1 503 PRO 503 485 485 PRO PRO A . n 
A 1 504 HIS 504 486 486 HIS HIS A . n 
A 1 505 GLU 505 487 487 GLU GLU A . n 
A 1 506 SER 506 488 488 SER SER A . n 
A 1 507 THR 507 489 ?   ?   ?   A . n 
A 1 508 VAL 508 490 ?   ?   ?   A . n 
A 1 509 GLU 509 491 ?   ?   ?   A . n 
A 1 510 HIS 510 492 ?   ?   ?   A . n 
A 1 511 THR 511 493 ?   ?   ?   A . n 
A 1 512 HIS 512 494 ?   ?   ?   A . n 
A 1 513 VAL 513 495 ?   ?   ?   A . n 
A 1 514 ASP 514 496 ?   ?   ?   A . n 
A 1 515 ILE 515 497 ?   ?   ?   A . n 
A 1 516 ASN 516 498 ?   ?   ?   A . n 
A 1 517 GLU 517 499 ?   ?   ?   A . n 
A 1 518 MET 518 500 ?   ?   ?   A . n 
A 1 519 GLU 519 501 ?   ?   ?   A . n 
A 1 520 SER 520 502 ?   ?   ?   A . n 
A 1 521 PRO 521 503 ?   ?   ?   A . n 
A 1 522 LEU 522 504 ?   ?   ?   A . n 
A 1 523 ALA 523 505 ?   ?   ?   A . n 
A 1 524 THR 524 506 ?   ?   ?   A . n 
A 1 525 ARG 525 507 ?   ?   ?   A . n 
A 1 526 ASN 526 508 ?   ?   ?   A . n 
A 1 527 ARG 527 509 ?   ?   ?   A . n 
A 1 528 THR 528 510 ?   ?   ?   A . n 
A 1 529 SER 529 511 ?   ?   ?   A . n 
A 1 530 VAL 530 512 ?   ?   ?   A . n 
A 1 531 ASP 531 513 ?   ?   ?   A . n 
A 1 532 PHE 532 514 ?   ?   ?   A . n 
A 1 533 LYS 533 515 ?   ?   ?   A . n 
A 1 534 ASP 534 516 ?   ?   ?   A . n 
A 1 535 THR 535 517 ?   ?   ?   A . n 
A 1 536 ASP 536 518 ?   ?   ?   A . n 
A 1 537 TYR 537 519 ?   ?   ?   A . n 
A 1 538 LYS 538 520 ?   ?   ?   A . n 
A 1 539 ARG 539 521 ?   ?   ?   A . n 
A 1 540 HIS 540 522 ?   ?   ?   A . n 
A 1 541 GLN 541 523 ?   ?   ?   A . n 
A 1 542 LEU 542 524 ?   ?   ?   A . n 
A 1 543 THR 543 525 ?   ?   ?   A . n 
A 1 544 ARG 544 526 ?   ?   ?   A . n 
A 1 545 SER 545 527 ?   ?   ?   A . n 
A 1 546 ILE 546 528 ?   ?   ?   A . n 
A 1 547 SER 547 529 ?   ?   ?   A . n 
A 1 548 GLU 548 530 ?   ?   ?   A . n 
A 1 549 ILE 549 531 ?   ?   ?   A . n 
A 1 550 LYS 550 532 ?   ?   ?   A . n 
A 1 551 PRO 551 533 ?   ?   ?   A . n 
A 1 552 PRO 552 534 ?   ?   ?   A . n 
A 1 553 ASN 553 535 ?   ?   ?   A . n 
A 1 554 LEU 554 536 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 5GP 1   1489 1489 5GP 5GP A . 
C 3 B4P 1   1490 1490 B4P B4P A . 
D 4 GOL 1   1491 1491 GOL GOL A . 
E 4 GOL 1   1492 1492 GOL GOL A . 
F 4 GOL 1   1493 1493 GOL GOL A . 
G 4 GOL 1   1494 1494 GOL GOL A . 
H 4 GOL 1   1495 1495 GOL GOL A . 
I 4 GOL 1   1496 1496 GOL GOL A . 
J 4 GOL 1   1497 1497 GOL GOL A . 
K 4 GOL 1   1498 1498 GOL GOL A . 
L 5 MG  1   1499 1499 MG  MG  A . 
M 6 HOH 1   2001 2001 HOH HOH A . 
M 6 HOH 2   2002 2002 HOH HOH A . 
M 6 HOH 3   2003 2003 HOH HOH A . 
M 6 HOH 4   2004 2004 HOH HOH A . 
M 6 HOH 5   2005 2005 HOH HOH A . 
M 6 HOH 6   2006 2006 HOH HOH A . 
M 6 HOH 7   2007 2007 HOH HOH A . 
M 6 HOH 8   2008 2008 HOH HOH A . 
M 6 HOH 9   2009 2009 HOH HOH A . 
M 6 HOH 10  2010 2010 HOH HOH A . 
M 6 HOH 11  2011 2011 HOH HOH A . 
M 6 HOH 12  2012 2012 HOH HOH A . 
M 6 HOH 13  2013 2013 HOH HOH A . 
M 6 HOH 14  2014 2014 HOH HOH A . 
M 6 HOH 15  2015 2015 HOH HOH A . 
M 6 HOH 16  2016 2016 HOH HOH A . 
M 6 HOH 17  2017 2017 HOH HOH A . 
M 6 HOH 18  2018 2018 HOH HOH A . 
M 6 HOH 19  2019 2019 HOH HOH A . 
M 6 HOH 20  2020 2020 HOH HOH A . 
M 6 HOH 21  2021 2021 HOH HOH A . 
M 6 HOH 22  2022 2022 HOH HOH A . 
M 6 HOH 23  2023 2023 HOH HOH A . 
M 6 HOH 24  2024 2024 HOH HOH A . 
M 6 HOH 25  2025 2025 HOH HOH A . 
M 6 HOH 26  2026 2026 HOH HOH A . 
M 6 HOH 27  2027 2027 HOH HOH A . 
M 6 HOH 28  2028 2028 HOH HOH A . 
M 6 HOH 29  2029 2029 HOH HOH A . 
M 6 HOH 30  2030 2030 HOH HOH A . 
M 6 HOH 31  2031 2031 HOH HOH A . 
M 6 HOH 32  2032 2032 HOH HOH A . 
M 6 HOH 33  2033 2033 HOH HOH A . 
M 6 HOH 34  2034 2034 HOH HOH A . 
M 6 HOH 35  2035 2035 HOH HOH A . 
M 6 HOH 36  2036 2036 HOH HOH A . 
M 6 HOH 37  2037 2037 HOH HOH A . 
M 6 HOH 38  2038 2038 HOH HOH A . 
M 6 HOH 39  2039 2039 HOH HOH A . 
M 6 HOH 40  2040 2040 HOH HOH A . 
M 6 HOH 41  2041 2041 HOH HOH A . 
M 6 HOH 42  2042 2042 HOH HOH A . 
M 6 HOH 43  2043 2043 HOH HOH A . 
M 6 HOH 44  2044 2044 HOH HOH A . 
M 6 HOH 45  2045 2045 HOH HOH A . 
M 6 HOH 46  2046 2046 HOH HOH A . 
M 6 HOH 47  2047 2047 HOH HOH A . 
M 6 HOH 48  2048 2048 HOH HOH A . 
M 6 HOH 49  2049 2049 HOH HOH A . 
M 6 HOH 50  2050 2050 HOH HOH A . 
M 6 HOH 51  2051 2051 HOH HOH A . 
M 6 HOH 52  2052 2052 HOH HOH A . 
M 6 HOH 53  2053 2053 HOH HOH A . 
M 6 HOH 54  2054 2054 HOH HOH A . 
M 6 HOH 55  2055 2055 HOH HOH A . 
M 6 HOH 56  2056 2056 HOH HOH A . 
M 6 HOH 57  2057 2057 HOH HOH A . 
M 6 HOH 58  2058 2058 HOH HOH A . 
M 6 HOH 59  2059 2059 HOH HOH A . 
M 6 HOH 60  2060 2060 HOH HOH A . 
M 6 HOH 61  2061 2061 HOH HOH A . 
M 6 HOH 62  2062 2062 HOH HOH A . 
M 6 HOH 63  2063 2063 HOH HOH A . 
M 6 HOH 64  2064 2064 HOH HOH A . 
M 6 HOH 65  2065 2065 HOH HOH A . 
M 6 HOH 66  2066 2066 HOH HOH A . 
M 6 HOH 67  2067 2067 HOH HOH A . 
M 6 HOH 68  2068 2068 HOH HOH A . 
M 6 HOH 69  2069 2069 HOH HOH A . 
M 6 HOH 70  2070 2070 HOH HOH A . 
M 6 HOH 71  2071 2071 HOH HOH A . 
M 6 HOH 72  2072 2072 HOH HOH A . 
M 6 HOH 73  2073 2073 HOH HOH A . 
M 6 HOH 74  2074 2074 HOH HOH A . 
M 6 HOH 75  2075 2075 HOH HOH A . 
M 6 HOH 76  2076 2076 HOH HOH A . 
M 6 HOH 77  2077 2077 HOH HOH A . 
M 6 HOH 78  2078 2078 HOH HOH A . 
M 6 HOH 79  2079 2079 HOH HOH A . 
M 6 HOH 80  2080 2080 HOH HOH A . 
M 6 HOH 81  2081 2081 HOH HOH A . 
M 6 HOH 82  2082 2082 HOH HOH A . 
M 6 HOH 83  2083 2083 HOH HOH A . 
M 6 HOH 84  2084 2084 HOH HOH A . 
M 6 HOH 85  2085 2085 HOH HOH A . 
M 6 HOH 86  2086 2086 HOH HOH A . 
M 6 HOH 87  2087 2087 HOH HOH A . 
M 6 HOH 88  2088 2088 HOH HOH A . 
M 6 HOH 89  2089 2089 HOH HOH A . 
M 6 HOH 90  2090 2090 HOH HOH A . 
M 6 HOH 91  2091 2091 HOH HOH A . 
M 6 HOH 92  2092 2092 HOH HOH A . 
M 6 HOH 93  2093 2093 HOH HOH A . 
M 6 HOH 94  2094 2094 HOH HOH A . 
M 6 HOH 95  2095 2095 HOH HOH A . 
M 6 HOH 96  2096 2096 HOH HOH A . 
M 6 HOH 97  2097 2097 HOH HOH A . 
M 6 HOH 98  2098 2098 HOH HOH A . 
M 6 HOH 99  2099 2099 HOH HOH A . 
M 6 HOH 100 2100 2100 HOH HOH A . 
M 6 HOH 101 2101 2101 HOH HOH A . 
M 6 HOH 102 2102 2102 HOH HOH A . 
M 6 HOH 103 2103 2103 HOH HOH A . 
M 6 HOH 104 2104 2104 HOH HOH A . 
M 6 HOH 105 2105 2105 HOH HOH A . 
M 6 HOH 106 2106 2106 HOH HOH A . 
M 6 HOH 107 2107 2107 HOH HOH A . 
M 6 HOH 108 2108 2108 HOH HOH A . 
M 6 HOH 109 2109 2109 HOH HOH A . 
M 6 HOH 110 2110 2110 HOH HOH A . 
M 6 HOH 111 2111 2111 HOH HOH A . 
M 6 HOH 112 2112 2112 HOH HOH A . 
M 6 HOH 113 2113 2113 HOH HOH A . 
M 6 HOH 114 2114 2114 HOH HOH A . 
M 6 HOH 115 2115 2115 HOH HOH A . 
M 6 HOH 116 2116 2116 HOH HOH A . 
M 6 HOH 117 2117 2117 HOH HOH A . 
M 6 HOH 118 2118 2118 HOH HOH A . 
M 6 HOH 119 2119 2119 HOH HOH A . 
M 6 HOH 120 2120 2120 HOH HOH A . 
M 6 HOH 121 2121 2121 HOH HOH A . 
M 6 HOH 122 2122 2122 HOH HOH A . 
M 6 HOH 123 2123 2123 HOH HOH A . 
M 6 HOH 124 2124 2124 HOH HOH A . 
M 6 HOH 125 2125 2125 HOH HOH A . 
M 6 HOH 126 2126 2126 HOH HOH A . 
M 6 HOH 127 2127 2127 HOH HOH A . 
M 6 HOH 128 2128 2128 HOH HOH A . 
M 6 HOH 129 2129 2129 HOH HOH A . 
M 6 HOH 130 2130 2130 HOH HOH A . 
M 6 HOH 131 2131 2131 HOH HOH A . 
M 6 HOH 132 2132 2132 HOH HOH A . 
M 6 HOH 133 2133 2133 HOH HOH A . 
M 6 HOH 134 2134 2134 HOH HOH A . 
M 6 HOH 135 2135 2135 HOH HOH A . 
M 6 HOH 136 2136 2136 HOH HOH A . 
M 6 HOH 137 2137 2137 HOH HOH A . 
M 6 HOH 138 2138 2138 HOH HOH A . 
M 6 HOH 139 2139 2139 HOH HOH A . 
M 6 HOH 140 2140 2140 HOH HOH A . 
M 6 HOH 141 2141 2141 HOH HOH A . 
M 6 HOH 142 2142 2142 HOH HOH A . 
M 6 HOH 143 2143 2143 HOH HOH A . 
M 6 HOH 144 2144 2144 HOH HOH A . 
M 6 HOH 145 2145 2145 HOH HOH A . 
M 6 HOH 146 2146 2146 HOH HOH A . 
M 6 HOH 147 2147 2147 HOH HOH A . 
M 6 HOH 148 2148 2148 HOH HOH A . 
M 6 HOH 149 2149 2149 HOH HOH A . 
M 6 HOH 150 2150 2150 HOH HOH A . 
M 6 HOH 151 2151 2151 HOH HOH A . 
M 6 HOH 152 2152 2152 HOH HOH A . 
M 6 HOH 153 2153 2153 HOH HOH A . 
M 6 HOH 154 2154 2154 HOH HOH A . 
M 6 HOH 155 2155 2155 HOH HOH A . 
M 6 HOH 156 2156 2156 HOH HOH A . 
M 6 HOH 157 2157 2157 HOH HOH A . 
M 6 HOH 158 2158 2158 HOH HOH A . 
M 6 HOH 159 2159 2159 HOH HOH A . 
M 6 HOH 160 2160 2160 HOH HOH A . 
M 6 HOH 161 2161 2161 HOH HOH A . 
M 6 HOH 162 2162 2162 HOH HOH A . 
M 6 HOH 163 2163 2163 HOH HOH A . 
M 6 HOH 164 2164 2164 HOH HOH A . 
M 6 HOH 165 2165 2165 HOH HOH A . 
M 6 HOH 166 2166 2166 HOH HOH A . 
M 6 HOH 167 2167 2167 HOH HOH A . 
M 6 HOH 168 2168 2168 HOH HOH A . 
M 6 HOH 169 2169 2169 HOH HOH A . 
M 6 HOH 170 2170 2170 HOH HOH A . 
M 6 HOH 171 2171 2171 HOH HOH A . 
M 6 HOH 172 2172 2172 HOH HOH A . 
M 6 HOH 173 2173 2173 HOH HOH A . 
M 6 HOH 174 2174 2174 HOH HOH A . 
M 6 HOH 175 2175 2175 HOH HOH A . 
M 6 HOH 176 2176 2176 HOH HOH A . 
M 6 HOH 177 2177 2177 HOH HOH A . 
M 6 HOH 178 2178 2178 HOH HOH A . 
M 6 HOH 179 2179 2179 HOH HOH A . 
M 6 HOH 180 2180 2180 HOH HOH A . 
M 6 HOH 181 2181 2181 HOH HOH A . 
M 6 HOH 182 2182 2182 HOH HOH A . 
M 6 HOH 183 2183 2183 HOH HOH A . 
M 6 HOH 184 2184 2184 HOH HOH A . 
M 6 HOH 185 2185 2185 HOH HOH A . 
M 6 HOH 186 2186 2186 HOH HOH A . 
M 6 HOH 187 2187 2187 HOH HOH A . 
M 6 HOH 188 2188 2188 HOH HOH A . 
M 6 HOH 189 2189 2189 HOH HOH A . 
M 6 HOH 190 2190 2190 HOH HOH A . 
M 6 HOH 191 2191 2191 HOH HOH A . 
M 6 HOH 192 2192 2192 HOH HOH A . 
M 6 HOH 193 2193 2193 HOH HOH A . 
M 6 HOH 194 2194 2194 HOH HOH A . 
M 6 HOH 195 2195 2195 HOH HOH A . 
M 6 HOH 196 2196 2196 HOH HOH A . 
M 6 HOH 197 2197 2197 HOH HOH A . 
M 6 HOH 198 2198 2198 HOH HOH A . 
M 6 HOH 199 2199 2199 HOH HOH A . 
M 6 HOH 200 2200 2200 HOH HOH A . 
M 6 HOH 201 2201 2201 HOH HOH A . 
M 6 HOH 202 2202 2202 HOH HOH A . 
M 6 HOH 203 2203 2203 HOH HOH A . 
M 6 HOH 204 2204 2204 HOH HOH A . 
M 6 HOH 205 2205 2205 HOH HOH A . 
M 6 HOH 206 2206 2206 HOH HOH A . 
M 6 HOH 207 2207 2207 HOH HOH A . 
M 6 HOH 208 2208 2208 HOH HOH A . 
M 6 HOH 209 2209 2209 HOH HOH A . 
M 6 HOH 210 2210 2210 HOH HOH A . 
M 6 HOH 211 2211 2211 HOH HOH A . 
M 6 HOH 212 2212 2212 HOH HOH A . 
M 6 HOH 213 2213 2213 HOH HOH A . 
M 6 HOH 214 2214 2214 HOH HOH A . 
M 6 HOH 215 2215 2215 HOH HOH A . 
M 6 HOH 216 2216 2216 HOH HOH A . 
M 6 HOH 217 2217 2217 HOH HOH A . 
M 6 HOH 218 2218 2218 HOH HOH A . 
M 6 HOH 219 2219 2219 HOH HOH A . 
M 6 HOH 220 2220 2220 HOH HOH A . 
M 6 HOH 221 2221 2221 HOH HOH A . 
M 6 HOH 222 2222 2222 HOH HOH A . 
M 6 HOH 223 2223 2223 HOH HOH A . 
M 6 HOH 224 2224 2224 HOH HOH A . 
M 6 HOH 225 2225 2225 HOH HOH A . 
M 6 HOH 226 2226 2226 HOH HOH A . 
M 6 HOH 227 2227 2227 HOH HOH A . 
M 6 HOH 228 2228 2228 HOH HOH A . 
M 6 HOH 229 2229 2229 HOH HOH A . 
M 6 HOH 230 2230 2230 HOH HOH A . 
M 6 HOH 231 2231 2231 HOH HOH A . 
M 6 HOH 232 2232 2232 HOH HOH A . 
M 6 HOH 233 2233 2233 HOH HOH A . 
M 6 HOH 234 2234 2234 HOH HOH A . 
M 6 HOH 235 2235 2235 HOH HOH A . 
M 6 HOH 236 2236 2236 HOH HOH A . 
M 6 HOH 237 2237 2237 HOH HOH A . 
M 6 HOH 238 2238 2238 HOH HOH A . 
M 6 HOH 239 2239 2239 HOH HOH A . 
M 6 HOH 240 2240 2240 HOH HOH A . 
M 6 HOH 241 2241 2241 HOH HOH A . 
M 6 HOH 242 2242 2242 HOH HOH A . 
M 6 HOH 243 2243 2243 HOH HOH A . 
M 6 HOH 244 2244 2244 HOH HOH A . 
M 6 HOH 245 2245 2245 HOH HOH A . 
M 6 HOH 246 2246 2246 HOH HOH A . 
M 6 HOH 247 2247 2247 HOH HOH A . 
M 6 HOH 248 2248 2248 HOH HOH A . 
M 6 HOH 249 2249 2249 HOH HOH A . 
M 6 HOH 250 2250 2250 HOH HOH A . 
M 6 HOH 251 2251 2251 HOH HOH A . 
M 6 HOH 252 2252 2252 HOH HOH A . 
M 6 HOH 253 2253 2253 HOH HOH A . 
M 6 HOH 254 2254 2254 HOH HOH A . 
M 6 HOH 255 2255 2255 HOH HOH A . 
M 6 HOH 256 2256 2256 HOH HOH A . 
M 6 HOH 257 2257 2257 HOH HOH A . 
M 6 HOH 258 2258 2258 HOH HOH A . 
M 6 HOH 259 2259 2259 HOH HOH A . 
M 6 HOH 260 2260 2260 HOH HOH A . 
M 6 HOH 261 2261 2261 HOH HOH A . 
M 6 HOH 262 2262 2262 HOH HOH A . 
M 6 HOH 263 2263 2263 HOH HOH A . 
M 6 HOH 264 2264 2264 HOH HOH A . 
M 6 HOH 265 2265 2265 HOH HOH A . 
M 6 HOH 266 2266 2266 HOH HOH A . 
M 6 HOH 267 2267 2267 HOH HOH A . 
M 6 HOH 268 2268 2268 HOH HOH A . 
M 6 HOH 269 2269 2269 HOH HOH A . 
M 6 HOH 270 2270 2270 HOH HOH A . 
M 6 HOH 271 2271 2271 HOH HOH A . 
M 6 HOH 272 2272 2272 HOH HOH A . 
M 6 HOH 273 2273 2273 HOH HOH A . 
M 6 HOH 274 2274 2274 HOH HOH A . 
M 6 HOH 275 2275 2275 HOH HOH A . 
M 6 HOH 276 2276 2276 HOH HOH A . 
M 6 HOH 277 2277 2277 HOH HOH A . 
M 6 HOH 278 2278 2278 HOH HOH A . 
M 6 HOH 279 2279 2279 HOH HOH A . 
M 6 HOH 280 2280 2280 HOH HOH A . 
M 6 HOH 281 2281 2281 HOH HOH A . 
M 6 HOH 282 2282 2282 HOH HOH A . 
M 6 HOH 283 2283 2283 HOH HOH A . 
M 6 HOH 284 2284 2284 HOH HOH A . 
M 6 HOH 285 2285 2285 HOH HOH A . 
M 6 HOH 286 2286 2286 HOH HOH A . 
M 6 HOH 287 2287 2287 HOH HOH A . 
M 6 HOH 288 2288 2288 HOH HOH A . 
M 6 HOH 289 2289 2289 HOH HOH A . 
M 6 HOH 290 2290 2290 HOH HOH A . 
M 6 HOH 291 2291 2291 HOH HOH A . 
M 6 HOH 292 2292 2292 HOH HOH A . 
M 6 HOH 293 2293 2293 HOH HOH A . 
M 6 HOH 294 2294 2294 HOH HOH A . 
M 6 HOH 295 2295 2295 HOH HOH A . 
M 6 HOH 296 2296 2296 HOH HOH A . 
M 6 HOH 297 2297 2297 HOH HOH A . 
M 6 HOH 298 2298 2298 HOH HOH A . 
M 6 HOH 299 2299 2299 HOH HOH A . 
M 6 HOH 300 2300 2300 HOH HOH A . 
M 6 HOH 301 2301 2301 HOH HOH A . 
M 6 HOH 302 2302 2302 HOH HOH A . 
M 6 HOH 303 2303 2303 HOH HOH A . 
M 6 HOH 304 2304 2304 HOH HOH A . 
M 6 HOH 305 2305 2305 HOH HOH A . 
M 6 HOH 306 2306 2306 HOH HOH A . 
M 6 HOH 307 2307 2307 HOH HOH A . 
M 6 HOH 308 2308 2308 HOH HOH A . 
M 6 HOH 309 2309 2309 HOH HOH A . 
M 6 HOH 310 2310 2310 HOH HOH A . 
M 6 HOH 311 2311 2311 HOH HOH A . 
M 6 HOH 312 2312 2312 HOH HOH A . 
M 6 HOH 313 2313 2313 HOH HOH A . 
M 6 HOH 314 2314 2314 HOH HOH A . 
M 6 HOH 315 2315 2315 HOH HOH A . 
M 6 HOH 316 2316 2316 HOH HOH A . 
M 6 HOH 317 2317 2317 HOH HOH A . 
M 6 HOH 318 2318 2318 HOH HOH A . 
M 6 HOH 319 2319 2319 HOH HOH A . 
M 6 HOH 320 2320 2320 HOH HOH A . 
M 6 HOH 321 2321 2321 HOH HOH A . 
M 6 HOH 322 2322 2322 HOH HOH A . 
M 6 HOH 323 2323 2323 HOH HOH A . 
M 6 HOH 324 2324 2324 HOH HOH A . 
M 6 HOH 325 2325 2325 HOH HOH A . 
M 6 HOH 326 2326 2326 HOH HOH A . 
M 6 HOH 327 2327 2327 HOH HOH A . 
M 6 HOH 328 2328 2328 HOH HOH A . 
M 6 HOH 329 2329 2329 HOH HOH A . 
M 6 HOH 330 2330 2330 HOH HOH A . 
M 6 HOH 331 2331 2331 HOH HOH A . 
M 6 HOH 332 2332 2332 HOH HOH A . 
M 6 HOH 333 2333 2333 HOH HOH A . 
M 6 HOH 334 2334 2334 HOH HOH A . 
M 6 HOH 335 2335 2335 HOH HOH A . 
M 6 HOH 336 2336 2336 HOH HOH A . 
M 6 HOH 337 2337 2337 HOH HOH A . 
M 6 HOH 338 2338 2338 HOH HOH A . 
M 6 HOH 339 2339 2339 HOH HOH A . 
M 6 HOH 340 2340 2340 HOH HOH A . 
M 6 HOH 341 2341 2341 HOH HOH A . 
M 6 HOH 342 2342 2342 HOH HOH A . 
M 6 HOH 343 2343 2343 HOH HOH A . 
M 6 HOH 344 2344 2344 HOH HOH A . 
M 6 HOH 345 2345 2345 HOH HOH A . 
M 6 HOH 346 2346 2346 HOH HOH A . 
M 6 HOH 347 2347 2347 HOH HOH A . 
M 6 HOH 348 2348 2348 HOH HOH A . 
M 6 HOH 349 2349 2349 HOH HOH A . 
M 6 HOH 350 2350 2350 HOH HOH A . 
M 6 HOH 351 2351 2351 HOH HOH A . 
M 6 HOH 352 2352 2352 HOH HOH A . 
M 6 HOH 353 2353 2353 HOH HOH A . 
M 6 HOH 354 2354 2354 HOH HOH A . 
M 6 HOH 355 2355 2355 HOH HOH A . 
M 6 HOH 356 2356 2356 HOH HOH A . 
M 6 HOH 357 2357 2357 HOH HOH A . 
M 6 HOH 358 2358 2358 HOH HOH A . 
M 6 HOH 359 2359 2359 HOH HOH A . 
M 6 HOH 360 2360 2360 HOH HOH A . 
M 6 HOH 361 2361 2361 HOH HOH A . 
M 6 HOH 362 2362 2362 HOH HOH A . 
M 6 HOH 363 2363 2363 HOH HOH A . 
M 6 HOH 364 2364 2364 HOH HOH A . 
M 6 HOH 365 2365 2365 HOH HOH A . 
M 6 HOH 366 2366 2366 HOH HOH A . 
M 6 HOH 367 2367 2367 HOH HOH A . 
M 6 HOH 368 2368 2368 HOH HOH A . 
M 6 HOH 369 2369 2369 HOH HOH A . 
M 6 HOH 370 2370 2370 HOH HOH A . 
M 6 HOH 371 2371 2371 HOH HOH A . 
M 6 HOH 372 2372 2372 HOH HOH A . 
M 6 HOH 373 2373 2373 HOH HOH A . 
M 6 HOH 374 2374 2374 HOH HOH A . 
M 6 HOH 375 2375 2375 HOH HOH A . 
M 6 HOH 376 2376 2376 HOH HOH A . 
M 6 HOH 377 2377 2377 HOH HOH A . 
M 6 HOH 378 2378 2378 HOH HOH A . 
M 6 HOH 379 2379 2379 HOH HOH A . 
M 6 HOH 380 2380 2380 HOH HOH A . 
M 6 HOH 381 2381 2381 HOH HOH A . 
M 6 HOH 382 2382 2382 HOH HOH A . 
M 6 HOH 383 2383 2383 HOH HOH A . 
M 6 HOH 384 2384 2384 HOH HOH A . 
M 6 HOH 385 2385 2385 HOH HOH A . 
M 6 HOH 386 2386 2386 HOH HOH A . 
M 6 HOH 387 2387 2387 HOH HOH A . 
M 6 HOH 388 2388 2388 HOH HOH A . 
M 6 HOH 389 2389 2389 HOH HOH A . 
M 6 HOH 390 2390 2390 HOH HOH A . 
M 6 HOH 391 2391 2391 HOH HOH A . 
M 6 HOH 392 2392 2392 HOH HOH A . 
M 6 HOH 393 2393 2393 HOH HOH A . 
M 6 HOH 394 2394 2394 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13190 ? 
1 MORE         -59.2 ? 
1 'SSA (A^2)'  36810 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.2400000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2204 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   M 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2P ? B 5GP .   ? A 5GP 1489 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? M HOH .   ? A HOH 2307 ? 1_555 88.1  ? 
2  O2P ? B 5GP .   ? A 5GP 1489 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? A ASP 72  ? A ASP 54   ? 1_555 106.3 ? 
3  O   ? M HOH .   ? A HOH 2307 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? A ASP 72  ? A ASP 54   ? 1_555 162.8 ? 
4  O2P ? B 5GP .   ? A 5GP 1489 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 96.8  ? 
5  O   ? M HOH .   ? A HOH 2307 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 80.5  ? 
6  O   ? A ASP 72  ? A ASP 54   ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 88.4  ? 
7  O2P ? B 5GP .   ? A 5GP 1489 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 172.6 ? 
8  O   ? M HOH .   ? A HOH 2307 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 84.6  ? 
9  O   ? A ASP 72  ? A ASP 54   ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 80.7  ? 
10 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 80.9  ? 
11 O2P ? B 5GP .   ? A 5GP 1489 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? M HOH .   ? A HOH 2305 ? 1_555 95.3  ? 
12 O   ? M HOH .   ? A HOH 2307 ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? M HOH .   ? A HOH 2305 ? 1_555 98.6  ? 
13 O   ? A ASP 72  ? A ASP 54   ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? M HOH .   ? A HOH 2305 ? 1_555 89.4  ? 
14 OD1 ? A ASN 70  ? A ASN 52   ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? M HOH .   ? A HOH 2305 ? 1_555 167.9 ? 
15 OD1 ? A ASP 369 ? A ASP 351  ? 1_555 MG ? L MG . ? A MG 1499 ? 1_555 O   ? M HOH .   ? A HOH 2305 ? 1_555 87.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-16 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 7.7440   42.6650 37.9040 0.4431 -0.0711 -0.0514 0.0012  -0.0492 0.0921  11.8208 8.0949 1.5173  
8.7333  0.5471   1.9697  -0.1292 -0.1898 0.8815  -0.4778 0.0030  0.2894  -0.8846 -0.1999 0.1262  
'X-RAY DIFFRACTION' 2  ? refined -6.0140  22.9420 44.0760 0.0335 -0.0606 -0.1341 0.0143  -0.0109 0.0168  1.1889  0.4147 0.8489  
0.3266  -0.2069  0.0321  -0.0210 0.1172  0.0153  -0.0729 0.0072  -0.0028 -0.0539 -0.0625 0.0138  
'X-RAY DIFFRACTION' 3  ? refined -26.4460 24.6250 55.9870 0.2181 0.2554  0.1245  0.1949  -0.0140 -0.0938 3.4261  2.7761 39.9784 
2.3361  1.0463   -6.1368 -0.0789 -0.5275 0.6673  0.5122  -0.0629 0.8973  -2.7293 -2.3345 0.1418  
'X-RAY DIFFRACTION' 4  ? refined -16.3830 16.4600 48.8400 0.0021 -0.0451 -0.1138 0.0246  -0.0064 0.0006  1.3069  1.7136 1.6620  
0.6802  0.2053   0.4129  -0.0688 0.0473  -0.0302 -0.0046 0.0339  0.0978  -0.0022 -0.1374 0.0349  
'X-RAY DIFFRACTION' 5  ? refined -9.4640  11.9410 38.7120 0.0435 -0.0329 -0.1492 -0.0050 -0.0236 -0.0476 5.7009  2.2545 2.0975  
2.7714  -2.8477  -1.7846 -0.1616 0.3150  -0.3190 -0.1669 0.0757  -0.0404 0.0823  -0.0774 0.0859  
'X-RAY DIFFRACTION' 6  ? refined 18.0130  25.2130 35.3610 0.0353 -0.0432 -0.1219 -0.0359 0.0450  0.0243  1.3230  0.6793 2.1077  
0.4153  -0.6587  -0.8972 0.0013  0.0552  0.0127  -0.0682 -0.0368 -0.0519 -0.2118 0.1065  0.0355  
'X-RAY DIFFRACTION' 7  ? refined 13.0720  18.4660 48.4630 0.0405 -0.0260 -0.1299 -0.0300 0.0061  0.0200  0.9685  2.3828 0.9597  
-0.2193 -0.4947  0.4687  -0.0147 0.0066  -0.0173 -0.1569 -0.0230 -0.0275 0.0318  0.0588  0.0377  
'X-RAY DIFFRACTION' 8  ? refined -18.8740 45.4690 57.6150 0.5951 0.5404  0.7414  0.2019  -0.0904 -0.0088 24.9831 9.4195 15.9329 
-1.8545 -7.9800  11.7381 1.3285  -1.0223 0.6281  0.6721  -1.1598 0.1694  -1.7647 -2.0364 -0.1688 
'X-RAY DIFFRACTION' 9  ? refined -1.4880  35.0130 51.2390 0.1549 -0.0535 -0.0672 0.0121  -0.0205 0.0066  1.6676  1.5676 1.9329  
0.7460  -0.0201  0.0335  -0.0985 -0.0369 0.2031  -0.1400 0.0220  0.1077  -0.3075 0.0041  0.0765  
'X-RAY DIFFRACTION' 10 ? refined 6.1490   41.0570 68.3270 0.2124 -0.0414 -0.0589 -0.0434 0.0455  0.0159  7.6399  0.2774 42.0766 
0.9921  -16.8085 -1.3124 0.0952  -0.0033 0.3007  -0.1900 0.0999  -0.3489 -1.4338 0.5541  -0.1952 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 3   ? ? A 32  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 33  ? ? A 125 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 126 ? ? A 136 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 137 ? ? A 179 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 180 ? ? A 229 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 230 ? ? A 286 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 287 ? ? A 383 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 384 ? ? A 424 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 425 ? ? A 476 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 477 ? ? A 488 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2XJC 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ASP  52 TO ASN' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O1B A B4P 1490 ? ? O A HOH 2372 ? ? 1.95 
2 1 O3B A B4P 1490 ? ? O A HOH 2378 ? ? 2.06 
3 1 O3  A GOL 1494 ? ? O A HOH 2389 ? ? 2.16 
4 1 OD2 A ASP 265  ? ? O A HOH 2237 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 144 ? ? CZ A ARG 144 ? ? NH2 A ARG 144 ? ? 116.85 120.30 -3.45 0.50 N 
2 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH2 A ARG 277 ? ? 117.24 120.30 -3.06 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 53  ? ? -93.20  -66.21 
2 1 THR A 56  ? ? -128.84 -72.70 
3 1 ASP A 187 ? ? -112.72 79.92  
4 1 PRO A 267 ? ? -76.36  28.28  
5 1 ILE A 357 ? ? -98.94  -65.21 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2046 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   7.52 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -17 ? A GLY 1   
2  1 Y 1 A SER -16 ? A SER 2   
3  1 Y 1 A SER -15 ? A SER 3   
4  1 Y 1 A HIS -14 ? A HIS 4   
5  1 Y 1 A HIS -13 ? A HIS 5   
6  1 Y 1 A HIS -12 ? A HIS 6   
7  1 Y 1 A HIS -11 ? A HIS 7   
8  1 Y 1 A HIS -10 ? A HIS 8   
9  1 Y 1 A HIS -9  ? A HIS 9   
10 1 Y 1 A SER -8  ? A SER 10  
11 1 Y 1 A SER -7  ? A SER 11  
12 1 Y 1 A GLY -6  ? A GLY 12  
13 1 Y 1 A LEU -5  ? A LEU 13  
14 1 Y 1 A VAL -4  ? A VAL 14  
15 1 Y 1 A PRO -3  ? A PRO 15  
16 1 Y 1 A ARG -2  ? A ARG 16  
17 1 Y 1 A GLY -1  ? A GLY 17  
18 1 Y 1 A SER 0   ? A SER 18  
19 1 Y 1 A MET 1   ? A MET 19  
20 1 Y 1 A SER 2   ? A SER 20  
21 1 Y 1 A ILE 397 ? A ILE 415 
22 1 Y 1 A PHE 398 ? A PHE 416 
23 1 Y 1 A LEU 399 ? A LEU 417 
24 1 Y 1 A ALA 400 ? A ALA 418 
25 1 Y 1 A GLU 401 ? A GLU 419 
26 1 Y 1 A LEU 402 ? A LEU 420 
27 1 Y 1 A TYR 403 ? A TYR 421 
28 1 Y 1 A LYS 404 ? A LYS 422 
29 1 Y 1 A HIS 405 ? A HIS 423 
30 1 Y 1 A LEU 406 ? A LEU 424 
31 1 Y 1 A ASP 407 ? A ASP 425 
32 1 Y 1 A SER 408 ? A SER 426 
33 1 Y 1 A SER 409 ? A SER 427 
34 1 Y 1 A SER 410 ? A SER 428 
35 1 Y 1 A ASN 411 ? A ASN 429 
36 1 Y 1 A GLU 412 ? A GLU 430 
37 1 Y 1 A ARG 413 ? A ARG 431 
38 1 Y 1 A PRO 414 ? A PRO 432 
39 1 Y 1 A ASP 415 ? A ASP 433 
40 1 Y 1 A ILE 416 ? A ILE 434 
41 1 Y 1 A SER 417 ? A SER 435 
42 1 Y 1 A SER 418 ? A SER 436 
43 1 Y 1 A ILE 419 ? A ILE 437 
44 1 Y 1 A THR 489 ? A THR 507 
45 1 Y 1 A VAL 490 ? A VAL 508 
46 1 Y 1 A GLU 491 ? A GLU 509 
47 1 Y 1 A HIS 492 ? A HIS 510 
48 1 Y 1 A THR 493 ? A THR 511 
49 1 Y 1 A HIS 494 ? A HIS 512 
50 1 Y 1 A VAL 495 ? A VAL 513 
51 1 Y 1 A ASP 496 ? A ASP 514 
52 1 Y 1 A ILE 497 ? A ILE 515 
53 1 Y 1 A ASN 498 ? A ASN 516 
54 1 Y 1 A GLU 499 ? A GLU 517 
55 1 Y 1 A MET 500 ? A MET 518 
56 1 Y 1 A GLU 501 ? A GLU 519 
57 1 Y 1 A SER 502 ? A SER 520 
58 1 Y 1 A PRO 503 ? A PRO 521 
59 1 Y 1 A LEU 504 ? A LEU 522 
60 1 Y 1 A ALA 505 ? A ALA 523 
61 1 Y 1 A THR 506 ? A THR 524 
62 1 Y 1 A ARG 507 ? A ARG 525 
63 1 Y 1 A ASN 508 ? A ASN 526 
64 1 Y 1 A ARG 509 ? A ARG 527 
65 1 Y 1 A THR 510 ? A THR 528 
66 1 Y 1 A SER 511 ? A SER 529 
67 1 Y 1 A VAL 512 ? A VAL 530 
68 1 Y 1 A ASP 513 ? A ASP 531 
69 1 Y 1 A PHE 514 ? A PHE 532 
70 1 Y 1 A LYS 515 ? A LYS 533 
71 1 Y 1 A ASP 516 ? A ASP 534 
72 1 Y 1 A THR 517 ? A THR 535 
73 1 Y 1 A ASP 518 ? A ASP 536 
74 1 Y 1 A TYR 519 ? A TYR 537 
75 1 Y 1 A LYS 520 ? A LYS 538 
76 1 Y 1 A ARG 521 ? A ARG 539 
77 1 Y 1 A HIS 522 ? A HIS 540 
78 1 Y 1 A GLN 523 ? A GLN 541 
79 1 Y 1 A LEU 524 ? A LEU 542 
80 1 Y 1 A THR 525 ? A THR 543 
81 1 Y 1 A ARG 526 ? A ARG 544 
82 1 Y 1 A SER 527 ? A SER 545 
83 1 Y 1 A ILE 528 ? A ILE 546 
84 1 Y 1 A SER 529 ? A SER 547 
85 1 Y 1 A GLU 530 ? A GLU 548 
86 1 Y 1 A ILE 531 ? A ILE 549 
87 1 Y 1 A LYS 532 ? A LYS 550 
88 1 Y 1 A PRO 533 ? A PRO 551 
89 1 Y 1 A PRO 534 ? A PRO 552 
90 1 Y 1 A ASN 535 ? A ASN 553 
91 1 Y 1 A LEU 536 ? A LEU 554 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "GUANOSINE-5'-MONOPHOSPHATE"       5GP 
3 "BIS(ADENOSINE)-5'-TETRAPHOSPHATE" B4P 
4 GLYCEROL                           GOL 
5 'MAGNESIUM ION'                    MG  
6 water                              HOH 
#