data_2XJF
# 
_entry.id   2XJF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XJF         
PDBE  EBI-44484    
WWPDB D_1290044484 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JC9 unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH ADENOSINE
;
PDB 2XCV unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND 2,3- BISPHOSPHOGLYCERATE
;
PDB 2XJD unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INORGANIC PHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2J2C unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II (NT5C2, CN-II)
;
PDB 2JCM unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH BERYLLIUM TRIFLUORIDE
;
PDB 2XCX unspecified 
;CRYSTAL STRUCTURE OF THE APOFORM OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II
;
PDB 2XJE unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH URIDINE 5'-MONOPHOSPHATE AND ADENOSINE TRIPHOSPHATE
;
PDB 2XCW unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5 '-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND AT
;
PDB 2XJB unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH DEOXYGUANOSINE MONOPHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2XJC unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH GUANOSINE MONOPHOSPHATE AND DIADENOSINE TETRAPHOSPHATE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XJF 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-04 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wallden, K.'  1 
'Nordlund, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                684 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21396942 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2011.02.059 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wallden, K.'  1 
primary 'Nordlund, P.' 2 
# 
_cell.entry_id           2XJF 
_cell.length_a           92.095 
_cell.length_b           128.222 
_cell.length_c           130.439 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XJF 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE
;
64131.953 1   3.1.3.5 YES 'RESIDUES 1-536' ? 
2 non-polymer syn '(2R)-2,3-diphosphoglyceric acid'  266.037   1   ?       ?   ?                ? 
3 non-polymer syn GLYCEROL                           92.094    3   ?       ?   ?                ? 
4 water       nat water                              18.015    250 ?       ?   ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CYTOSOLIC 5'-NUCLEOTIDASE II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGF(A5N)MDYTL
AVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQY
PNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEK
TVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFG
EGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQ
ELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRY
ADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYK
SPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKF
IQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVEN
LEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTV
LRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHV
WTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLY
AASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  MET n 
1 21  SER n 
1 22  THR n 
1 23  SER n 
1 24  TRP n 
1 25  SER n 
1 26  ASP n 
1 27  ARG n 
1 28  LEU n 
1 29  GLN n 
1 30  ASN n 
1 31  ALA n 
1 32  ALA n 
1 33  ASP n 
1 34  MET n 
1 35  PRO n 
1 36  ALA n 
1 37  ASN n 
1 38  MET n 
1 39  ASP n 
1 40  LYS n 
1 41  HIS n 
1 42  ALA n 
1 43  LEU n 
1 44  LYS n 
1 45  LYS n 
1 46  TYR n 
1 47  ARG n 
1 48  ARG n 
1 49  GLU n 
1 50  ALA n 
1 51  TYR n 
1 52  HIS n 
1 53  ARG n 
1 54  VAL n 
1 55  PHE n 
1 56  VAL n 
1 57  ASN n 
1 58  ARG n 
1 59  SER n 
1 60  LEU n 
1 61  ALA n 
1 62  MET n 
1 63  GLU n 
1 64  LYS n 
1 65  ILE n 
1 66  LYS n 
1 67  CYS n 
1 68  PHE n 
1 69  GLY n 
1 70  PHE n 
1 71  A5N n 
1 72  MET n 
1 73  ASP n 
1 74  TYR n 
1 75  THR n 
1 76  LEU n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LYS n 
1 81  SER n 
1 82  PRO n 
1 83  GLU n 
1 84  TYR n 
1 85  GLU n 
1 86  SER n 
1 87  LEU n 
1 88  GLY n 
1 89  PHE n 
1 90  GLU n 
1 91  LEU n 
1 92  THR n 
1 93  VAL n 
1 94  GLU n 
1 95  ARG n 
1 96  LEU n 
1 97  VAL n 
1 98  SER n 
1 99  ILE n 
1 100 GLY n 
1 101 TYR n 
1 102 PRO n 
1 103 GLN n 
1 104 GLU n 
1 105 LEU n 
1 106 LEU n 
1 107 SER n 
1 108 PHE n 
1 109 ALA n 
1 110 TYR n 
1 111 ASP n 
1 112 SER n 
1 113 THR n 
1 114 PHE n 
1 115 PRO n 
1 116 THR n 
1 117 ARG n 
1 118 GLY n 
1 119 LEU n 
1 120 VAL n 
1 121 PHE n 
1 122 ASP n 
1 123 THR n 
1 124 LEU n 
1 125 TYR n 
1 126 GLY n 
1 127 ASN n 
1 128 LEU n 
1 129 LEU n 
1 130 LYS n 
1 131 VAL n 
1 132 ASP n 
1 133 ALA n 
1 134 TYR n 
1 135 GLY n 
1 136 ASN n 
1 137 LEU n 
1 138 LEU n 
1 139 VAL n 
1 140 CYS n 
1 141 ALA n 
1 142 HIS n 
1 143 GLY n 
1 144 PHE n 
1 145 ASN n 
1 146 PHE n 
1 147 ILE n 
1 148 ARG n 
1 149 GLY n 
1 150 PRO n 
1 151 GLU n 
1 152 THR n 
1 153 ARG n 
1 154 GLU n 
1 155 GLN n 
1 156 TYR n 
1 157 PRO n 
1 158 ASN n 
1 159 LYS n 
1 160 PHE n 
1 161 ILE n 
1 162 GLN n 
1 163 ARG n 
1 164 ASP n 
1 165 ASP n 
1 166 THR n 
1 167 GLU n 
1 168 ARG n 
1 169 PHE n 
1 170 TYR n 
1 171 ILE n 
1 172 LEU n 
1 173 ASN n 
1 174 THR n 
1 175 LEU n 
1 176 PHE n 
1 177 ASN n 
1 178 LEU n 
1 179 PRO n 
1 180 GLU n 
1 181 THR n 
1 182 TYR n 
1 183 LEU n 
1 184 LEU n 
1 185 ALA n 
1 186 CYS n 
1 187 LEU n 
1 188 VAL n 
1 189 ASP n 
1 190 PHE n 
1 191 PHE n 
1 192 THR n 
1 193 ASN n 
1 194 CYS n 
1 195 PRO n 
1 196 ARG n 
1 197 TYR n 
1 198 THR n 
1 199 SER n 
1 200 CYS n 
1 201 GLU n 
1 202 THR n 
1 203 GLY n 
1 204 PHE n 
1 205 LYS n 
1 206 ASP n 
1 207 GLY n 
1 208 ASP n 
1 209 LEU n 
1 210 PHE n 
1 211 MET n 
1 212 SER n 
1 213 TYR n 
1 214 ARG n 
1 215 SER n 
1 216 MET n 
1 217 PHE n 
1 218 GLN n 
1 219 ASP n 
1 220 VAL n 
1 221 ARG n 
1 222 ASP n 
1 223 ALA n 
1 224 VAL n 
1 225 ASP n 
1 226 TRP n 
1 227 VAL n 
1 228 HIS n 
1 229 TYR n 
1 230 LYS n 
1 231 GLY n 
1 232 SER n 
1 233 LEU n 
1 234 LYS n 
1 235 GLU n 
1 236 LYS n 
1 237 THR n 
1 238 VAL n 
1 239 GLU n 
1 240 ASN n 
1 241 LEU n 
1 242 GLU n 
1 243 LYS n 
1 244 TYR n 
1 245 VAL n 
1 246 VAL n 
1 247 LYS n 
1 248 ASP n 
1 249 GLY n 
1 250 LYS n 
1 251 LEU n 
1 252 PRO n 
1 253 LEU n 
1 254 LEU n 
1 255 LEU n 
1 256 SER n 
1 257 ARG n 
1 258 MET n 
1 259 LYS n 
1 260 GLU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 VAL n 
1 265 PHE n 
1 266 LEU n 
1 267 ALA n 
1 268 THR n 
1 269 ASN n 
1 270 SER n 
1 271 ASP n 
1 272 TYR n 
1 273 LYS n 
1 274 TYR n 
1 275 THR n 
1 276 ASP n 
1 277 LYS n 
1 278 ILE n 
1 279 MET n 
1 280 THR n 
1 281 TYR n 
1 282 LEU n 
1 283 PHE n 
1 284 ASP n 
1 285 PHE n 
1 286 PRO n 
1 287 HIS n 
1 288 GLY n 
1 289 PRO n 
1 290 LYS n 
1 291 PRO n 
1 292 GLY n 
1 293 SER n 
1 294 SER n 
1 295 HIS n 
1 296 ARG n 
1 297 PRO n 
1 298 TRP n 
1 299 GLN n 
1 300 SER n 
1 301 TYR n 
1 302 PHE n 
1 303 ASP n 
1 304 LEU n 
1 305 ILE n 
1 306 LEU n 
1 307 VAL n 
1 308 ASP n 
1 309 ALA n 
1 310 ARG n 
1 311 LYS n 
1 312 PRO n 
1 313 LEU n 
1 314 PHE n 
1 315 PHE n 
1 316 GLY n 
1 317 GLU n 
1 318 GLY n 
1 319 THR n 
1 320 VAL n 
1 321 LEU n 
1 322 ARG n 
1 323 GLN n 
1 324 VAL n 
1 325 ASP n 
1 326 THR n 
1 327 LYS n 
1 328 THR n 
1 329 GLY n 
1 330 LYS n 
1 331 LEU n 
1 332 LYS n 
1 333 ILE n 
1 334 GLY n 
1 335 THR n 
1 336 TYR n 
1 337 THR n 
1 338 GLY n 
1 339 PRO n 
1 340 LEU n 
1 341 GLN n 
1 342 HIS n 
1 343 GLY n 
1 344 ILE n 
1 345 VAL n 
1 346 TYR n 
1 347 SER n 
1 348 GLY n 
1 349 GLY n 
1 350 SER n 
1 351 SER n 
1 352 ASP n 
1 353 THR n 
1 354 ILE n 
1 355 CYS n 
1 356 ASP n 
1 357 LEU n 
1 358 LEU n 
1 359 GLY n 
1 360 ALA n 
1 361 LYS n 
1 362 GLY n 
1 363 LYS n 
1 364 ASP n 
1 365 ILE n 
1 366 LEU n 
1 367 TYR n 
1 368 ILE n 
1 369 GLY n 
1 370 ASP n 
1 371 HIS n 
1 372 ILE n 
1 373 PHE n 
1 374 GLY n 
1 375 ASP n 
1 376 ILE n 
1 377 LEU n 
1 378 LYS n 
1 379 SER n 
1 380 LYS n 
1 381 LYS n 
1 382 ARG n 
1 383 GLN n 
1 384 GLY n 
1 385 TRP n 
1 386 ARG n 
1 387 THR n 
1 388 PHE n 
1 389 LEU n 
1 390 VAL n 
1 391 ILE n 
1 392 PRO n 
1 393 GLU n 
1 394 LEU n 
1 395 ALA n 
1 396 GLN n 
1 397 GLU n 
1 398 LEU n 
1 399 HIS n 
1 400 VAL n 
1 401 TRP n 
1 402 THR n 
1 403 ASP n 
1 404 LYS n 
1 405 SER n 
1 406 SER n 
1 407 LEU n 
1 408 PHE n 
1 409 GLU n 
1 410 GLU n 
1 411 LEU n 
1 412 GLN n 
1 413 SER n 
1 414 LEU n 
1 415 ASP n 
1 416 ILE n 
1 417 PHE n 
1 418 LEU n 
1 419 ALA n 
1 420 GLU n 
1 421 LEU n 
1 422 TYR n 
1 423 LYS n 
1 424 HIS n 
1 425 LEU n 
1 426 ASP n 
1 427 SER n 
1 428 SER n 
1 429 SER n 
1 430 ASN n 
1 431 GLU n 
1 432 ARG n 
1 433 PRO n 
1 434 ASP n 
1 435 ILE n 
1 436 SER n 
1 437 SER n 
1 438 ILE n 
1 439 GLN n 
1 440 ARG n 
1 441 ARG n 
1 442 ILE n 
1 443 LYS n 
1 444 LYS n 
1 445 VAL n 
1 446 THR n 
1 447 HIS n 
1 448 ASP n 
1 449 MET n 
1 450 ASP n 
1 451 MET n 
1 452 CYS n 
1 453 TYR n 
1 454 GLY n 
1 455 MET n 
1 456 MET n 
1 457 GLY n 
1 458 SER n 
1 459 LEU n 
1 460 PHE n 
1 461 ARG n 
1 462 SER n 
1 463 GLY n 
1 464 SER n 
1 465 ARG n 
1 466 GLN n 
1 467 THR n 
1 468 LEU n 
1 469 PHE n 
1 470 ALA n 
1 471 SER n 
1 472 GLN n 
1 473 VAL n 
1 474 MET n 
1 475 ARG n 
1 476 TYR n 
1 477 ALA n 
1 478 ASP n 
1 479 LEU n 
1 480 TYR n 
1 481 ALA n 
1 482 ALA n 
1 483 SER n 
1 484 PHE n 
1 485 ILE n 
1 486 ASN n 
1 487 LEU n 
1 488 LEU n 
1 489 TYR n 
1 490 TYR n 
1 491 PRO n 
1 492 PHE n 
1 493 SER n 
1 494 TYR n 
1 495 LEU n 
1 496 PHE n 
1 497 ARG n 
1 498 ALA n 
1 499 ALA n 
1 500 HIS n 
1 501 VAL n 
1 502 LEU n 
1 503 MET n 
1 504 PRO n 
1 505 HIS n 
1 506 GLU n 
1 507 SER n 
1 508 THR n 
1 509 VAL n 
1 510 GLU n 
1 511 HIS n 
1 512 THR n 
1 513 HIS n 
1 514 VAL n 
1 515 ASP n 
1 516 ILE n 
1 517 ASN n 
1 518 GLU n 
1 519 MET n 
1 520 GLU n 
1 521 SER n 
1 522 PRO n 
1 523 LEU n 
1 524 ALA n 
1 525 THR n 
1 526 ARG n 
1 527 ASN n 
1 528 ARG n 
1 529 THR n 
1 530 SER n 
1 531 VAL n 
1 532 ASP n 
1 533 PHE n 
1 534 LYS n 
1 535 ASP n 
1 536 THR n 
1 537 ASP n 
1 538 TYR n 
1 539 LYS n 
1 540 ARG n 
1 541 HIS n 
1 542 GLN n 
1 543 LEU n 
1 544 THR n 
1 545 ARG n 
1 546 SER n 
1 547 ILE n 
1 548 SER n 
1 549 GLU n 
1 550 ILE n 
1 551 LYS n 
1 552 PRO n 
1 553 PRO n 
1 554 ASN n 
1 555 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'R3 PRARE2' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               P28A-LIC 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    5NTC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P49902 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XJF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 555 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49902 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  536 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       536 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XJF MET A 1  ? UNP P49902 ?   ?  'expression tag'      -18 1  
1 2XJF GLY A 2  ? UNP P49902 ?   ?  'expression tag'      -17 2  
1 2XJF SER A 3  ? UNP P49902 ?   ?  'expression tag'      -16 3  
1 2XJF SER A 4  ? UNP P49902 ?   ?  'expression tag'      -15 4  
1 2XJF HIS A 5  ? UNP P49902 ?   ?  'expression tag'      -14 5  
1 2XJF HIS A 6  ? UNP P49902 ?   ?  'expression tag'      -13 6  
1 2XJF HIS A 7  ? UNP P49902 ?   ?  'expression tag'      -12 7  
1 2XJF HIS A 8  ? UNP P49902 ?   ?  'expression tag'      -11 8  
1 2XJF HIS A 9  ? UNP P49902 ?   ?  'expression tag'      -10 9  
1 2XJF HIS A 10 ? UNP P49902 ?   ?  'expression tag'      -9  10 
1 2XJF SER A 11 ? UNP P49902 ?   ?  'expression tag'      -8  11 
1 2XJF SER A 12 ? UNP P49902 ?   ?  'expression tag'      -7  12 
1 2XJF GLY A 13 ? UNP P49902 ?   ?  'expression tag'      -6  13 
1 2XJF LEU A 14 ? UNP P49902 ?   ?  'expression tag'      -5  14 
1 2XJF VAL A 15 ? UNP P49902 ?   ?  'expression tag'      -4  15 
1 2XJF PRO A 16 ? UNP P49902 ?   ?  'expression tag'      -3  16 
1 2XJF ARG A 17 ? UNP P49902 ?   ?  'expression tag'      -2  17 
1 2XJF GLY A 18 ? UNP P49902 ?   ?  'expression tag'      -1  18 
1 2XJF SER A 19 ? UNP P49902 ?   ?  'expression tag'      0   19 
1 2XJF A5N A 71 ? UNP P49902 ASP 52 'engineered mutation' 52  20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A5N 'L-peptide linking' n O-carboxy-4-imino-L-homoserine    ? 'C5 H8 N2 O5'    176.127 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'   121.158 
DG2 non-polymer         . '(2R)-2,3-diphosphoglyceric acid' 
;2,3-Bisphosphoglyceric acid; 2,3-bisphosphoglycerate; 2,3-BPG; 2,3-diphosphoglyceric acid; 2,3-diphosphoglycerate; 2,3-DPG; (2~{R})-2,3-diphosphonooxypropanoic acid
;
'C3 H8 O10 P2'   266.037 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                          'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XJF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.19 
_exptl_crystal.density_percent_sol   61.5 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BICINE PH 9.0, 10% PEG 6000.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-11-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87260 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             0.87260 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XJF 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   43556 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.70 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   98.1 
_reflns_shell.Rmerge_I_obs           0.44 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.90 
_reflns_shell.pdbx_redundancy        5.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XJF 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     41334 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             65.23 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    96.04 
_refine.ls_R_factor_obs                          0.18084 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17845 
_refine.ls_R_factor_R_free                       0.22517 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2224 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.B_iso_mean                               25.414 
_refine.aniso_B[1][1]                            0.13 
_refine.aniso_B[2][2]                            -0.04 
_refine.aniso_B[3][3]                            -0.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2JC9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.157 
_refine.pdbx_overall_ESU_R_Free                  0.154 
_refine.overall_SU_ML                            0.104 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.573 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3764 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             250 
_refine_hist.number_atoms_total               4047 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        65.23 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.022  ? 3963 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.625  1.968  ? 5352 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.326  5.000  ? 471  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.111 22.872 ? 188  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.721 15.000 ? 683  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.763 15.000 ? 28   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.121  0.200  ? 562  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 3013 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.214  0.200  ? 1713 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.307  0.200  ? 2668 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.142  0.200  ? 247  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.198  0.200  ? 58   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.155  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.012  1.500  ? 2418 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.577  2.000  ? 3766 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.689  3.000  ? 1794 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.740  4.500  ? 1586 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             3053 
_refine_ls_shell.R_factor_R_work                  0.221 
_refine_ls_shell.percent_reflns_obs               98.03 
_refine_ls_shell.R_factor_R_free                  0.294 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             179 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XJF 
_struct.title                     
;Crystal structure of the D52N variant of cytosolic 5'-nucleotidase II with a covalently modified Asn52
;
_struct.pdbx_descriptor           
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE (E.C.3.1.3.5)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XJF 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;ALLOSTERIC ENZYME, CN-II, GMP-IMP SPECIFIC NUCLEOTIDASE, HIGH KM 5-PRIME NUCLEOTIDASE, HYDROLASE, METAL-BINDING, NT5C2, NUCLEOTIDE METABOLISM, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 23  ? ASP A 33  ? SER A 4   ASP A 14  1 ? 11 
HELX_P HELX_P2  2  ASP A 39  ? ARG A 47  ? ASP A 20  ARG A 28  1 ? 9  
HELX_P HELX_P3  3  ARG A 48  ? ARG A 53  ? ARG A 29  ARG A 34  5 ? 6  
HELX_P HELX_P4  4  GLU A 63  ? ILE A 65  ? GLU A 44  ILE A 46  5 ? 3  
HELX_P HELX_P5  5  PRO A 82  ? ILE A 99  ? PRO A 63  ILE A 80  1 ? 18 
HELX_P HELX_P6  6  PRO A 102 ? PHE A 108 ? PRO A 83  PHE A 89  5 ? 7  
HELX_P HELX_P7  7  ARG A 148 ? TYR A 156 ? ARG A 129 TYR A 137 1 ? 9  
HELX_P HELX_P8  8  THR A 174 ? PHE A 176 ? THR A 155 PHE A 157 5 ? 3  
HELX_P HELX_P9  9  ASN A 177 ? CYS A 194 ? ASN A 158 CYS A 175 1 ? 18 
HELX_P HELX_P10 10 TYR A 213 ? LYS A 230 ? TYR A 194 LYS A 211 1 ? 18 
HELX_P HELX_P11 11 SER A 232 ? GLU A 239 ? SER A 213 GLU A 220 1 ? 8  
HELX_P HELX_P12 12 ASN A 240 ? VAL A 245 ? ASN A 221 VAL A 226 1 ? 6  
HELX_P HELX_P13 13 GLY A 249 ? GLY A 262 ? GLY A 230 GLY A 243 1 ? 14 
HELX_P HELX_P14 14 ASP A 271 ? PHE A 283 ? ASP A 252 PHE A 264 1 ? 13 
HELX_P HELX_P15 15 PRO A 297 ? PHE A 302 ? PRO A 278 PHE A 283 5 ? 6  
HELX_P HELX_P16 16 PRO A 312 ? GLY A 316 ? PRO A 293 GLY A 297 5 ? 5  
HELX_P HELX_P17 17 SER A 350 ? GLY A 359 ? SER A 331 GLY A 340 1 ? 10 
HELX_P HELX_P18 18 LYS A 361 ? LYS A 363 ? LYS A 342 LYS A 344 5 ? 3  
HELX_P HELX_P19 19 ASP A 375 ? GLY A 384 ? ASP A 356 GLY A 365 1 ? 10 
HELX_P HELX_P20 20 GLU A 393 ? LYS A 404 ? GLU A 374 LYS A 385 1 ? 12 
HELX_P HELX_P21 21 LYS A 404 ? LEU A 414 ? LYS A 385 LEU A 395 1 ? 11 
HELX_P HELX_P22 22 ARG A 440 ? CYS A 452 ? ARG A 421 CYS A 433 1 ? 13 
HELX_P HELX_P23 23 THR A 467 ? ALA A 477 ? THR A 448 ALA A 458 1 ? 11 
HELX_P HELX_P24 24 SER A 483 ? TYR A 490 ? SER A 464 TYR A 471 5 ? 8  
HELX_P HELX_P25 25 MET A 503 ? SER A 507 ? MET A 484 SER A 488 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A PHE 70 C ? ? ? 1_555 A A5N 71 N ? ? A PHE 51 A A5N 52 1_555 ? ? ? ? ? ? ? 1.482 ? 
covale2 covale ? ? A A5N 71 C ? ? ? 1_555 A MET 72 N ? ? A A5N 52 A MET 53 1_555 ? ? ? ? ? ? ? 1.462 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 81  A . ? SER 62  A PRO 82  A ? PRO 63  A 1 -0.25 
2 LYS 311 A . ? LYS 292 A PRO 312 A ? PRO 293 A 1 6.90  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 9 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 3 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
AA 8 9 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 55  ? VAL A 56  ? PHE A 36  VAL A 37  
AA 2 LEU A 479 ? ALA A 481 ? LEU A 460 ALA A 462 
AA 3 ARG A 386 ? VAL A 390 ? ARG A 367 VAL A 371 
AA 4 ILE A 365 ? GLY A 369 ? ILE A 346 GLY A 350 
AA 5 CYS A 67  ? PHE A 70  ? CYS A 48  PHE A 51  
AA 6 LYS A 263 ? ALA A 267 ? LYS A 244 ALA A 248 
AA 7 LEU A 304 ? VAL A 307 ? LEU A 285 VAL A 288 
AA 8 VAL A 345 ? GLY A 348 ? VAL A 326 GLY A 329 
AA 9 LEU A 321 ? VAL A 324 ? LEU A 302 VAL A 305 
AB 1 LEU A 60  ? ALA A 61  ? LEU A 41  ALA A 42  
AB 2 LEU A 495 ? PHE A 496 ? LEU A 476 PHE A 477 
AC 1 ASN A 145 ? PHE A 146 ? ASN A 126 PHE A 127 
AC 2 LEU A 137 ? HIS A 142 ? LEU A 118 HIS A 123 
AC 3 ASN A 127 ? VAL A 131 ? ASN A 108 VAL A 112 
AC 4 LEU A 119 ? ASP A 122 ? LEU A 100 ASP A 103 
AC 5 PHE A 169 ? LEU A 172 ? PHE A 150 LEU A 153 
AD 1 THR A 198 ? SER A 199 ? THR A 179 SER A 180 
AD 2 GLY A 203 ? ASP A 206 ? GLY A 184 ASP A 187 
AD 3 LEU A 209 ? SER A 212 ? LEU A 190 SER A 193 
AE 1 ARG A 461 ? SER A 462 ? ARG A 442 SER A 443 
AE 2 ARG A 465 ? GLN A 466 ? ARG A 446 GLN A 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N PHE A 55  ? N PHE A 36  O TYR A 480 ? O TYR A 461 
AA 2 3 N LEU A 479 ? N LEU A 460 O THR A 387 ? O THR A 368 
AA 3 4 N ARG A 386 ? N ARG A 367 O ILE A 365 ? O ILE A 346 
AA 4 5 N LEU A 366 ? N LEU A 347 O CYS A 67  ? O CYS A 48  
AA 5 6 N PHE A 68  ? N PHE A 49  O LYS A 263 ? O LYS A 244 
AA 6 7 N LEU A 266 ? N LEU A 247 O LEU A 304 ? O LEU A 285 
AA 7 8 N VAL A 307 ? N VAL A 288 O TYR A 346 ? O TYR A 327 
AA 8 9 N SER A 347 ? N SER A 328 O ARG A 322 ? O ARG A 303 
AB 1 2 N LEU A 60  ? N LEU A 41  O PHE A 496 ? O PHE A 477 
AC 1 2 N ASN A 145 ? N ASN A 126 O HIS A 142 ? O HIS A 123 
AC 2 3 N ALA A 141 ? N ALA A 122 O LEU A 128 ? O LEU A 109 
AC 3 4 N LEU A 129 ? N LEU A 110 O VAL A 120 ? O VAL A 101 
AC 4 5 N PHE A 121 ? N PHE A 102 O TYR A 170 ? O TYR A 151 
AD 1 2 N THR A 198 ? N THR A 179 O LYS A 205 ? O LYS A 186 
AD 2 3 N ASP A 206 ? N ASP A 187 O LEU A 209 ? O LEU A 190 
AE 1 2 N SER A 462 ? N SER A 443 O ARG A 465 ? O ARG A 446 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE DG2 A 1489' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 1490' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 1491' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 1492' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ARG A 163 ? ARG A 144  . ? 3_556 ? 
2  AC1 10 ARG A 163 ? ARG A 144  . ? 1_555 ? 
3  AC1 10 LYS A 381 ? LYS A 362  . ? 1_555 ? 
4  AC1 10 LYS A 381 ? LYS A 362  . ? 3_556 ? 
5  AC1 10 GLN A 472 ? GLN A 453  . ? 3_556 ? 
6  AC1 10 GLN A 472 ? GLN A 453  . ? 1_555 ? 
7  AC1 10 ARG A 475 ? ARG A 456  . ? 3_556 ? 
8  AC1 10 ARG A 475 ? ARG A 456  . ? 1_555 ? 
9  AC1 10 TYR A 476 ? TYR A 457  . ? 3_556 ? 
10 AC1 10 TYR A 476 ? TYR A 457  . ? 1_555 ? 
11 AC2 9  PHE A 302 ? PHE A 283  . ? 1_555 ? 
12 AC2 9  ASP A 303 ? ASP A 284  . ? 1_555 ? 
13 AC2 9  LEU A 304 ? LEU A 285  . ? 1_555 ? 
14 AC2 9  ILE A 305 ? ILE A 286  . ? 1_555 ? 
15 AC2 9  GLN A 341 ? GLN A 322  . ? 1_555 ? 
16 AC2 9  HIS A 342 ? HIS A 323  . ? 1_555 ? 
17 AC2 9  GLY A 343 ? GLY A 324  . ? 1_555 ? 
18 AC2 9  ILE A 344 ? ILE A 325  . ? 1_555 ? 
19 AC2 9  HOH F .   ? HOH A 2250 . ? 1_555 ? 
20 AC3 6  PHE A 176 ? PHE A 157  . ? 1_555 ? 
21 AC3 6  ARG A 221 ? ARG A 202  . ? 1_555 ? 
22 AC3 6  VAL A 224 ? VAL A 205  . ? 1_555 ? 
23 AC3 6  ASP A 225 ? ASP A 206  . ? 1_555 ? 
24 AC3 6  TYR A 229 ? TYR A 210  . ? 1_555 ? 
25 AC3 6  HOH F .   ? HOH A 2103 . ? 1_555 ? 
26 AC4 5  ASP A 271 ? ASP A 252  . ? 1_555 ? 
27 AC4 5  TYR A 272 ? TYR A 253  . ? 1_555 ? 
28 AC4 5  VAL A 307 ? VAL A 288  . ? 1_555 ? 
29 AC4 5  ASP A 308 ? ASP A 289  . ? 1_555 ? 
30 AC4 5  GLY A 329 ? GLY A 310  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XJF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XJF 
_atom_sites.fract_transf_matrix[1][1]   0.010858 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007799 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007666 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 22  ? -8.322  37.390 32.998 1.00 28.12 ? 3    THR A N   1 
ATOM   2    C CA  . THR A 1 22  ? -6.946  37.503 33.561 1.00 28.24 ? 3    THR A CA  1 
ATOM   3    C C   . THR A 1 22  ? -6.783  36.512 34.736 1.00 27.89 ? 3    THR A C   1 
ATOM   4    O O   . THR A 1 22  ? -7.165  36.798 35.890 1.00 29.15 ? 3    THR A O   1 
ATOM   5    C CB  . THR A 1 22  ? -6.607  38.929 34.054 1.00 28.08 ? 3    THR A CB  1 
ATOM   6    O OG1 . THR A 1 22  ? -7.224  39.910 33.216 1.00 30.85 ? 3    THR A OG1 1 
ATOM   7    C CG2 . THR A 1 22  ? -5.098  39.150 34.048 1.00 28.83 ? 3    THR A CG2 1 
ATOM   8    N N   . SER A 1 23  ? -6.241  35.342 34.432 1.00 26.07 ? 4    SER A N   1 
ATOM   9    C CA  . SER A 1 23  ? -5.898  34.372 35.458 1.00 25.08 ? 4    SER A CA  1 
ATOM   10   C C   . SER A 1 23  ? -4.591  34.777 36.169 1.00 24.01 ? 4    SER A C   1 
ATOM   11   O O   . SER A 1 23  ? -3.849  35.658 35.696 1.00 23.22 ? 4    SER A O   1 
ATOM   12   C CB  . SER A 1 23  ? -5.723  33.001 34.824 1.00 24.53 ? 4    SER A CB  1 
ATOM   13   O OG  . SER A 1 23  ? -4.443  32.912 34.266 1.00 24.34 ? 4    SER A OG  1 
ATOM   14   N N   . TRP A 1 24  ? -4.295  34.126 37.294 1.00 22.22 ? 5    TRP A N   1 
ATOM   15   C CA  . TRP A 1 24  ? -3.048  34.418 37.995 1.00 21.48 ? 5    TRP A CA  1 
ATOM   16   C C   . TRP A 1 24  ? -1.809  34.067 37.135 1.00 21.13 ? 5    TRP A C   1 
ATOM   17   O O   . TRP A 1 24  ? -0.785  34.735 37.229 1.00 19.31 ? 5    TRP A O   1 
ATOM   18   C CB  . TRP A 1 24  ? -2.997  33.698 39.343 1.00 21.84 ? 5    TRP A CB  1 
ATOM   19   C CG  . TRP A 1 24  ? -3.471  32.223 39.331 1.00 20.99 ? 5    TRP A CG  1 
ATOM   20   C CD1 . TRP A 1 24  ? -4.720  31.752 39.704 1.00 21.86 ? 5    TRP A CD1 1 
ATOM   21   C CD2 . TRP A 1 24  ? -2.685  31.060 39.026 1.00 20.66 ? 5    TRP A CD2 1 
ATOM   22   N NE1 . TRP A 1 24  ? -4.752  30.373 39.623 1.00 19.61 ? 5    TRP A NE1 1 
ATOM   23   C CE2 . TRP A 1 24  ? -3.518  29.921 39.224 1.00 20.63 ? 5    TRP A CE2 1 
ATOM   24   C CE3 . TRP A 1 24  ? -1.357  30.862 38.618 1.00 21.71 ? 5    TRP A CE3 1 
ATOM   25   C CZ2 . TRP A 1 24  ? -3.065  28.601 39.004 1.00 22.08 ? 5    TRP A CZ2 1 
ATOM   26   C CZ3 . TRP A 1 24  ? -0.908  29.539 38.384 1.00 22.05 ? 5    TRP A CZ3 1 
ATOM   27   C CH2 . TRP A 1 24  ? -1.759  28.435 38.586 1.00 21.59 ? 5    TRP A CH2 1 
ATOM   28   N N   . SER A 1 25  ? -1.924  33.041 36.282 1.00 20.94 ? 6    SER A N   1 
ATOM   29   C CA  . SER A 1 25  ? -0.792  32.643 35.424 1.00 21.65 ? 6    SER A CA  1 
ATOM   30   C C   . SER A 1 25  ? -0.587  33.603 34.219 1.00 21.81 ? 6    SER A C   1 
ATOM   31   O O   . SER A 1 25  ? 0.546   33.730 33.730 1.00 21.42 ? 6    SER A O   1 
ATOM   32   C CB  . SER A 1 25  ? -0.918  31.174 34.966 1.00 21.80 ? 6    SER A CB  1 
ATOM   33   O OG  . SER A 1 25  ? -2.001  31.043 34.055 1.00 20.64 ? 6    SER A OG  1 
ATOM   34   N N   . ASP A 1 26  ? -1.671  34.255 33.757 1.00 21.84 ? 7    ASP A N   1 
ATOM   35   C CA  . ASP A 1 26  ? -1.575  35.425 32.864 1.00 22.91 ? 7    ASP A CA  1 
ATOM   36   C C   . ASP A 1 26  ? -0.764  36.547 33.526 1.00 22.96 ? 7    ASP A C   1 
ATOM   37   O O   . ASP A 1 26  ? 0.071   37.175 32.875 1.00 23.27 ? 7    ASP A O   1 
ATOM   38   C CB  . ASP A 1 26  ? -2.955  36.014 32.514 1.00 22.59 ? 7    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 26  ? -3.793  35.102 31.643 1.00 24.74 ? 7    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 26  ? -3.246  34.105 31.123 1.00 25.03 ? 7    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 26  ? -5.007  35.407 31.462 1.00 27.08 ? 7    ASP A OD2 1 
ATOM   42   N N   . ARG A 1 27  ? -1.052  36.829 34.797 1.00 22.88 ? 8    ARG A N   1 
ATOM   43   C CA  . ARG A 1 27  ? -0.296  37.846 35.549 1.00 23.50 ? 8    ARG A CA  1 
ATOM   44   C C   . ARG A 1 27  ? 1.156   37.409 35.601 1.00 23.15 ? 8    ARG A C   1 
ATOM   45   O O   . ARG A 1 27  ? 2.056   38.198 35.289 1.00 23.20 ? 8    ARG A O   1 
ATOM   46   C CB  . ARG A 1 27  ? -0.830  38.027 36.993 1.00 23.57 ? 8    ARG A CB  1 
ATOM   47   C CG  . ARG A 1 27  ? -2.303  38.465 37.081 1.00 23.57 ? 8    ARG A CG  1 
ATOM   48   C CD  . ARG A 1 27  ? -2.528  39.882 36.551 1.00 26.68 ? 8    ARG A CD  1 
ATOM   49   N NE  . ARG A 1 27  ? -3.902  40.326 36.805 1.00 29.08 ? 8    ARG A NE  1 
ATOM   50   C CZ  . ARG A 1 27  ? -4.380  41.539 36.529 1.00 29.19 ? 8    ARG A CZ  1 
ATOM   51   N NH1 . ARG A 1 27  ? -3.593  42.465 35.993 1.00 29.85 ? 8    ARG A NH1 1 
ATOM   52   N NH2 . ARG A 1 27  ? -5.652  41.824 36.788 1.00 29.37 ? 8    ARG A NH2 1 
ATOM   53   N N   . LEU A 1 28  ? 1.375   36.141 35.953 1.00 22.12 ? 9    LEU A N   1 
ATOM   54   C CA  . LEU A 1 28  ? 2.732   35.622 36.083 1.00 22.13 ? 9    LEU A CA  1 
ATOM   55   C C   . LEU A 1 28  ? 3.518   35.658 34.747 1.00 22.06 ? 9    LEU A C   1 
ATOM   56   O O   . LEU A 1 28  ? 4.681   36.084 34.707 1.00 21.58 ? 9    LEU A O   1 
ATOM   57   C CB  . LEU A 1 28  ? 2.723   34.198 36.680 1.00 23.11 ? 9    LEU A CB  1 
ATOM   58   C CG  . LEU A 1 28  ? 2.446   34.023 38.188 1.00 22.23 ? 9    LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 28  ? 2.476   32.530 38.535 1.00 19.59 ? 9    LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 28  ? 3.435   34.807 39.077 1.00 22.27 ? 9    LEU A CD2 1 
ATOM   61   N N   . GLN A 1 29  ? 2.873   35.220 33.663 1.00 21.63 ? 10   GLN A N   1 
ATOM   62   C CA  . GLN A 1 29  ? 3.505   35.211 32.350 1.00 21.31 ? 10   GLN A CA  1 
ATOM   63   C C   . GLN A 1 29  ? 3.747   36.637 31.835 1.00 21.79 ? 10   GLN A C   1 
ATOM   64   O O   . GLN A 1 29  ? 4.755   36.876 31.175 1.00 22.14 ? 10   GLN A O   1 
ATOM   65   C CB  . GLN A 1 29  ? 2.706   34.371 31.345 1.00 20.33 ? 10   GLN A CB  1 
ATOM   66   C CG  . GLN A 1 29  ? 3.391   34.242 29.995 1.00 20.30 ? 10   GLN A CG  1 
ATOM   67   C CD  . GLN A 1 29  ? 4.682   33.441 30.064 1.00 21.37 ? 10   GLN A CD  1 
ATOM   68   O OE1 . GLN A 1 29  ? 4.651   32.226 30.232 1.00 21.89 ? 10   GLN A OE1 1 
ATOM   69   N NE2 . GLN A 1 29  ? 5.824   34.114 29.889 1.00 19.27 ? 10   GLN A NE2 1 
ATOM   70   N N   . ASN A 1 30  ? 2.831   37.569 32.126 1.00 22.13 ? 11   ASN A N   1 
ATOM   71   C CA  . ASN A 1 30  ? 3.008   38.995 31.760 1.00 22.51 ? 11   ASN A CA  1 
ATOM   72   C C   . ASN A 1 30  ? 4.305   39.514 32.405 1.00 22.01 ? 11   ASN A C   1 
ATOM   73   O O   . ASN A 1 30  ? 5.156   40.138 31.769 1.00 22.10 ? 11   ASN A O   1 
ATOM   74   C CB  . ASN A 1 30  ? 1.789   39.849 32.197 1.00 22.42 ? 11   ASN A CB  1 
ATOM   75   C CG  . ASN A 1 30  ? 0.576   39.696 31.261 1.00 24.63 ? 11   ASN A CG  1 
ATOM   76   O OD1 . ASN A 1 30  ? 0.617   38.965 30.270 1.00 25.18 ? 11   ASN A OD1 1 
ATOM   77   N ND2 . ASN A 1 30  ? -0.511  40.400 31.582 1.00 26.63 ? 11   ASN A ND2 1 
ATOM   78   N N   . ALA A 1 31  ? 4.476   39.184 33.669 1.00 21.46 ? 12   ALA A N   1 
ATOM   79   C CA  . ALA A 1 31  ? 5.700   39.539 34.398 1.00 21.42 ? 12   ALA A CA  1 
ATOM   80   C C   . ALA A 1 31  ? 6.963   38.809 33.848 1.00 21.14 ? 12   ALA A C   1 
ATOM   81   O O   . ALA A 1 31  ? 8.053   39.407 33.763 1.00 21.37 ? 12   ALA A O   1 
ATOM   82   C CB  . ALA A 1 31  ? 5.503   39.313 35.913 1.00 20.53 ? 12   ALA A CB  1 
ATOM   83   N N   . ALA A 1 32  ? 6.808   37.536 33.465 1.00 21.21 ? 13   ALA A N   1 
ATOM   84   C CA  . ALA A 1 32  ? 7.912   36.731 32.903 1.00 21.39 ? 13   ALA A CA  1 
ATOM   85   C C   . ALA A 1 32  ? 8.409   37.290 31.573 1.00 22.07 ? 13   ALA A C   1 
ATOM   86   O O   . ALA A 1 32  ? 9.594   37.152 31.239 1.00 21.91 ? 13   ALA A O   1 
ATOM   87   C CB  . ALA A 1 32  ? 7.490   35.286 32.734 1.00 20.25 ? 13   ALA A CB  1 
ATOM   88   N N   . ASP A 1 33  ? 7.515   37.929 30.818 1.00 22.81 ? 14   ASP A N   1 
ATOM   89   C CA  . ASP A 1 33  ? 7.885   38.485 29.491 1.00 24.70 ? 14   ASP A CA  1 
ATOM   90   C C   . ASP A 1 33  ? 8.766   39.742 29.586 1.00 25.30 ? 14   ASP A C   1 
ATOM   91   O O   . ASP A 1 33  ? 9.353   40.198 28.587 1.00 24.85 ? 14   ASP A O   1 
ATOM   92   C CB  . ASP A 1 33  ? 6.635   38.729 28.628 1.00 24.68 ? 14   ASP A CB  1 
ATOM   93   C CG  . ASP A 1 33  ? 5.907   37.433 28.286 1.00 26.48 ? 14   ASP A CG  1 
ATOM   94   O OD1 . ASP A 1 33  ? 6.586   36.392 28.127 1.00 27.10 ? 14   ASP A OD1 1 
ATOM   95   O OD2 . ASP A 1 33  ? 4.658   37.445 28.170 1.00 30.49 ? 14   ASP A OD2 1 
ATOM   96   N N   . MET A 1 34  ? 8.854   40.287 30.803 1.00 26.21 ? 15   MET A N   1 
ATOM   97   C CA  . MET A 1 34  ? 9.714   41.444 31.101 1.00 27.34 ? 15   MET A CA  1 
ATOM   98   C C   . MET A 1 34  ? 11.201  41.068 31.298 1.00 26.91 ? 15   MET A C   1 
ATOM   99   O O   . MET A 1 34  ? 11.526  40.245 32.174 1.00 26.72 ? 15   MET A O   1 
ATOM   100  C CB  . MET A 1 34  ? 9.174   42.208 32.323 1.00 28.22 ? 15   MET A CB  1 
ATOM   101  C CG  . MET A 1 34  ? 7.749   42.760 32.133 1.00 31.92 ? 15   MET A CG  1 
ATOM   102  S SD  . MET A 1 34  ? 7.682   44.018 30.829 1.00 44.03 ? 15   MET A SD  1 
ATOM   103  C CE  . MET A 1 34  ? 7.450   43.142 29.249 1.00 42.45 ? 15   MET A CE  1 
ATOM   104  N N   . PRO A 1 35  ? 12.107  41.674 30.487 1.00 26.24 ? 16   PRO A N   1 
ATOM   105  C CA  . PRO A 1 35  ? 13.540  41.477 30.726 1.00 25.61 ? 16   PRO A CA  1 
ATOM   106  C C   . PRO A 1 35  ? 13.940  42.098 32.066 1.00 25.07 ? 16   PRO A C   1 
ATOM   107  O O   . PRO A 1 35  ? 13.278  43.018 32.543 1.00 24.39 ? 16   PRO A O   1 
ATOM   108  C CB  . PRO A 1 35  ? 14.202  42.239 29.571 1.00 25.92 ? 16   PRO A CB  1 
ATOM   109  C CG  . PRO A 1 35  ? 13.174  43.239 29.120 1.00 26.08 ? 16   PRO A CG  1 
ATOM   110  C CD  . PRO A 1 35  ? 11.851  42.576 29.342 1.00 26.36 ? 16   PRO A CD  1 
ATOM   111  N N   . ALA A 1 36  ? 14.998  41.578 32.676 1.00 24.87 ? 17   ALA A N   1 
ATOM   112  C CA  . ALA A 1 36  ? 15.492  42.108 33.949 1.00 24.35 ? 17   ALA A CA  1 
ATOM   113  C C   . ALA A 1 36  ? 16.377  43.329 33.748 1.00 23.74 ? 17   ALA A C   1 
ATOM   114  O O   . ALA A 1 36  ? 17.363  43.274 33.018 1.00 23.47 ? 17   ALA A O   1 
ATOM   115  C CB  . ALA A 1 36  ? 16.264  41.041 34.704 1.00 24.72 ? 17   ALA A CB  1 
ATOM   116  N N   . ASN A 1 37  ? 16.010  44.413 34.422 1.00 23.23 ? 18   ASN A N   1 
ATOM   117  C CA  . ASN A 1 37  ? 16.823  45.609 34.543 1.00 22.94 ? 18   ASN A CA  1 
ATOM   118  C C   . ASN A 1 37  ? 17.425  45.513 35.938 1.00 22.68 ? 18   ASN A C   1 
ATOM   119  O O   . ASN A 1 37  ? 16.690  45.598 36.924 1.00 22.49 ? 18   ASN A O   1 
ATOM   120  C CB  . ASN A 1 37  ? 15.923  46.842 34.403 1.00 22.66 ? 18   ASN A CB  1 
ATOM   121  C CG  . ASN A 1 37  ? 16.683  48.169 34.538 1.00 23.88 ? 18   ASN A CG  1 
ATOM   122  O OD1 . ASN A 1 37  ? 17.865  48.211 34.910 1.00 24.66 ? 18   ASN A OD1 1 
ATOM   123  N ND2 . ASN A 1 37  ? 15.991  49.269 34.224 1.00 22.06 ? 18   ASN A ND2 1 
ATOM   124  N N   . MET A 1 38  ? 18.745  45.316 36.021 1.00 22.37 ? 19   MET A N   1 
ATOM   125  C CA  . MET A 1 38  ? 19.416  44.981 37.302 1.00 22.21 ? 19   MET A CA  1 
ATOM   126  C C   . MET A 1 38  ? 20.108  46.182 37.924 1.00 22.28 ? 19   MET A C   1 
ATOM   127  O O   . MET A 1 38  ? 20.899  46.049 38.865 1.00 22.28 ? 19   MET A O   1 
ATOM   128  C CB  . MET A 1 38  ? 20.400  43.805 37.138 1.00 21.63 ? 19   MET A CB  1 
ATOM   129  C CG  . MET A 1 38  ? 19.748  42.474 36.739 1.00 21.56 ? 19   MET A CG  1 
ATOM   130  S SD  . MET A 1 38  ? 18.606  41.857 38.011 1.00 21.91 ? 19   MET A SD  1 
ATOM   131  C CE  . MET A 1 38  ? 19.746  41.314 39.305 1.00 20.37 ? 19   MET A CE  1 
ATOM   132  N N   . ASP A 1 39  ? 19.816  47.352 37.362 1.00 22.91 ? 20   ASP A N   1 
ATOM   133  C CA  . ASP A 1 39  ? 20.188  48.638 37.936 1.00 22.91 ? 20   ASP A CA  1 
ATOM   134  C C   . ASP A 1 39  ? 19.637  48.617 39.374 1.00 23.08 ? 20   ASP A C   1 
ATOM   135  O O   . ASP A 1 39  ? 18.450  48.358 39.568 1.00 21.89 ? 20   ASP A O   1 
ATOM   136  C CB  . ASP A 1 39  ? 19.583  49.770 37.088 1.00 22.65 ? 20   ASP A CB  1 
ATOM   137  C CG  . ASP A 1 39  ? 19.937  51.175 37.609 1.00 24.87 ? 20   ASP A CG  1 
ATOM   138  O OD1 . ASP A 1 39  ? 20.640  51.924 36.889 1.00 26.07 ? 20   ASP A OD1 1 
ATOM   139  O OD2 . ASP A 1 39  ? 19.500  51.550 38.724 1.00 25.74 ? 20   ASP A OD2 1 
ATOM   140  N N   . LYS A 1 40  ? 20.514  48.856 40.357 1.00 23.94 ? 21   LYS A N   1 
ATOM   141  C CA  . LYS A 1 40  ? 20.189  48.788 41.797 1.00 25.30 ? 21   LYS A CA  1 
ATOM   142  C C   . LYS A 1 40  ? 18.951  49.597 42.201 1.00 24.93 ? 21   LYS A C   1 
ATOM   143  O O   . LYS A 1 40  ? 18.195  49.179 43.081 1.00 24.95 ? 21   LYS A O   1 
ATOM   144  C CB  . LYS A 1 40  ? 21.398  49.224 42.644 1.00 25.99 ? 21   LYS A CB  1 
ATOM   145  C CG  . LYS A 1 40  ? 22.478  48.128 42.818 1.00 27.30 ? 21   LYS A CG  1 
ATOM   146  C CD  . LYS A 1 40  ? 23.816  48.708 43.361 1.00 26.98 ? 21   LYS A CD  1 
ATOM   147  C CE  . LYS A 1 40  ? 25.027  47.768 43.097 1.00 28.08 ? 21   LYS A CE  1 
ATOM   148  N NZ  . LYS A 1 40  ? 24.740  46.295 43.338 1.00 25.84 ? 21   LYS A NZ  1 
ATOM   149  N N   . HIS A 1 41  ? 18.755  50.747 41.548 1.00 24.40 ? 22   HIS A N   1 
ATOM   150  C CA  . HIS A 1 41  ? 17.602  51.615 41.812 1.00 24.08 ? 22   HIS A CA  1 
ATOM   151  C C   . HIS A 1 41  ? 16.334  51.160 41.110 1.00 23.13 ? 22   HIS A C   1 
ATOM   152  O O   . HIS A 1 41  ? 15.222  51.356 41.627 1.00 23.12 ? 22   HIS A O   1 
ATOM   153  C CB  . HIS A 1 41  ? 17.921  53.054 41.427 1.00 23.93 ? 22   HIS A CB  1 
ATOM   154  C CG  . HIS A 1 41  ? 18.949  53.685 42.306 1.00 26.25 ? 22   HIS A CG  1 
ATOM   155  N ND1 . HIS A 1 41  ? 20.175  54.102 41.836 1.00 28.68 ? 22   HIS A ND1 1 
ATOM   156  C CD2 . HIS A 1 41  ? 18.938  53.962 43.633 1.00 28.09 ? 22   HIS A CD2 1 
ATOM   157  C CE1 . HIS A 1 41  ? 20.869  54.627 42.832 1.00 29.74 ? 22   HIS A CE1 1 
ATOM   158  N NE2 . HIS A 1 41  ? 20.143  54.548 43.934 1.00 29.66 ? 22   HIS A NE2 1 
ATOM   159  N N   . ALA A 1 42  ? 16.501  50.571 39.925 1.00 22.25 ? 23   ALA A N   1 
ATOM   160  C CA  . ALA A 1 42  ? 15.388  49.989 39.195 1.00 21.32 ? 23   ALA A CA  1 
ATOM   161  C C   . ALA A 1 42  ? 14.830  48.806 40.005 1.00 21.04 ? 23   ALA A C   1 
ATOM   162  O O   . ALA A 1 42  ? 13.610  48.621 40.066 1.00 20.69 ? 23   ALA A O   1 
ATOM   163  C CB  . ALA A 1 42  ? 15.821  49.563 37.800 1.00 20.88 ? 23   ALA A CB  1 
ATOM   164  N N   . LEU A 1 43  ? 15.709  48.042 40.659 1.00 20.96 ? 24   LEU A N   1 
ATOM   165  C CA  . LEU A 1 43  ? 15.270  46.919 41.510 1.00 21.72 ? 24   LEU A CA  1 
ATOM   166  C C   . LEU A 1 43  ? 14.468  47.369 42.730 1.00 22.34 ? 24   LEU A C   1 
ATOM   167  O O   . LEU A 1 43  ? 13.376  46.874 42.944 1.00 22.28 ? 24   LEU A O   1 
ATOM   168  C CB  . LEU A 1 43  ? 16.438  46.032 41.945 1.00 21.32 ? 24   LEU A CB  1 
ATOM   169  C CG  . LEU A 1 43  ? 17.221  45.305 40.851 1.00 20.19 ? 24   LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 43  ? 18.482  44.692 41.468 1.00 20.49 ? 24   LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 43  ? 16.417  44.273 40.077 1.00 18.00 ? 24   LEU A CD2 1 
ATOM   172  N N   . LYS A 1 44  ? 15.005  48.318 43.504 1.00 23.78 ? 25   LYS A N   1 
ATOM   173  C CA  . LYS A 1 44  ? 14.282  48.922 44.634 1.00 25.12 ? 25   LYS A CA  1 
ATOM   174  C C   . LYS A 1 44  ? 12.900  49.448 44.205 1.00 25.84 ? 25   LYS A C   1 
ATOM   175  O O   . LYS A 1 44  ? 11.888  49.149 44.855 1.00 25.61 ? 25   LYS A O   1 
ATOM   176  C CB  . LYS A 1 44  ? 15.122  50.030 45.269 1.00 25.40 ? 25   LYS A CB  1 
ATOM   177  C CG  . LYS A 1 44  ? 14.707  50.446 46.685 1.00 25.90 ? 25   LYS A CG  1 
ATOM   178  C CD  . LYS A 1 44  ? 15.788  51.352 47.302 1.00 25.69 ? 25   LYS A CD  1 
ATOM   179  C CE  . LYS A 1 44  ? 15.397  51.935 48.673 1.00 27.29 ? 25   LYS A CE  1 
ATOM   180  N NZ  . LYS A 1 44  ? 15.161  50.909 49.746 1.00 28.22 ? 25   LYS A NZ  1 
ATOM   181  N N   . LYS A 1 45  ? 12.859  50.189 43.093 1.00 26.68 ? 26   LYS A N   1 
ATOM   182  C CA  . LYS A 1 45  ? 11.606  50.715 42.538 1.00 27.96 ? 26   LYS A CA  1 
ATOM   183  C C   . LYS A 1 45  ? 10.595  49.609 42.201 1.00 28.52 ? 26   LYS A C   1 
ATOM   184  O O   . LYS A 1 45  ? 9.420   49.728 42.546 1.00 28.56 ? 26   LYS A O   1 
ATOM   185  C CB  . LYS A 1 45  ? 11.883  51.593 41.315 1.00 28.38 ? 26   LYS A CB  1 
ATOM   186  C CG  . LYS A 1 45  ? 10.656  52.324 40.784 1.00 30.65 ? 26   LYS A CG  1 
ATOM   187  C CD  . LYS A 1 45  ? 11.024  53.654 40.094 1.00 33.19 ? 26   LYS A CD  1 
ATOM   188  C CE  . LYS A 1 45  ? 9.787   54.278 39.436 1.00 34.51 ? 26   LYS A CE  1 
ATOM   189  N NZ  . LYS A 1 45  ? 10.112  55.412 38.521 1.00 34.95 ? 26   LYS A NZ  1 
ATOM   190  N N   . TYR A 1 46  ? 11.066  48.543 41.549 1.00 28.77 ? 27   TYR A N   1 
ATOM   191  C CA  . TYR A 1 46  ? 10.244  47.381 41.194 1.00 30.02 ? 27   TYR A CA  1 
ATOM   192  C C   . TYR A 1 46  ? 9.534   46.646 42.349 1.00 30.50 ? 27   TYR A C   1 
ATOM   193  O O   . TYR A 1 46  ? 8.369   46.299 42.219 1.00 30.46 ? 27   TYR A O   1 
ATOM   194  C CB  . TYR A 1 46  ? 11.081  46.366 40.409 1.00 30.22 ? 27   TYR A CB  1 
ATOM   195  C CG  . TYR A 1 46  ? 10.315  45.626 39.333 1.00 30.73 ? 27   TYR A CG  1 
ATOM   196  C CD1 . TYR A 1 46  ? 9.728   46.323 38.261 1.00 32.88 ? 27   TYR A CD1 1 
ATOM   197  C CD2 . TYR A 1 46  ? 10.198  44.234 39.366 1.00 29.54 ? 27   TYR A CD2 1 
ATOM   198  C CE1 . TYR A 1 46  ? 9.031   45.647 37.250 1.00 33.27 ? 27   TYR A CE1 1 
ATOM   199  C CE2 . TYR A 1 46  ? 9.514   43.540 38.365 1.00 30.65 ? 27   TYR A CE2 1 
ATOM   200  C CZ  . TYR A 1 46  ? 8.935   44.246 37.311 1.00 32.18 ? 27   TYR A CZ  1 
ATOM   201  O OH  . TYR A 1 46  ? 8.246   43.576 36.319 1.00 31.70 ? 27   TYR A OH  1 
ATOM   202  N N   . ARG A 1 47  ? 10.257  46.372 43.441 1.00 31.79 ? 28   ARG A N   1 
ATOM   203  C CA  . ARG A 1 47  ? 9.738   45.632 44.611 1.00 32.97 ? 28   ARG A CA  1 
ATOM   204  C C   . ARG A 1 47  ? 8.866   46.505 45.522 1.00 34.67 ? 28   ARG A C   1 
ATOM   205  O O   . ARG A 1 47  ? 8.511   46.098 46.634 1.00 35.86 ? 28   ARG A O   1 
ATOM   206  C CB  . ARG A 1 47  ? 10.873  44.932 45.415 1.00 32.34 ? 28   ARG A CB  1 
ATOM   207  C CG  . ARG A 1 47  ? 11.817  45.869 46.222 1.00 31.50 ? 28   ARG A CG  1 
ATOM   208  C CD  . ARG A 1 47  ? 13.074  45.162 46.774 1.00 31.23 ? 28   ARG A CD  1 
ATOM   209  N NE  . ARG A 1 47  ? 13.896  46.025 47.630 1.00 31.30 ? 28   ARG A NE  1 
ATOM   210  C CZ  . ARG A 1 47  ? 15.161  46.403 47.379 1.00 35.49 ? 28   ARG A CZ  1 
ATOM   211  N NH1 . ARG A 1 47  ? 15.844  45.989 46.296 1.00 34.70 ? 28   ARG A NH1 1 
ATOM   212  N NH2 . ARG A 1 47  ? 15.771  47.228 48.227 1.00 35.72 ? 28   ARG A NH2 1 
ATOM   213  N N   . ARG A 1 48  ? 8.541   47.699 45.047 1.00 36.17 ? 29   ARG A N   1 
ATOM   214  C CA  . ARG A 1 48  ? 7.572   48.570 45.686 1.00 37.68 ? 29   ARG A CA  1 
ATOM   215  C C   . ARG A 1 48  ? 6.159   48.101 45.328 1.00 37.23 ? 29   ARG A C   1 
ATOM   216  O O   . ARG A 1 48  ? 5.217   48.272 46.130 1.00 37.38 ? 29   ARG A O   1 
ATOM   217  C CB  . ARG A 1 48  ? 7.755   50.033 45.239 1.00 38.51 ? 29   ARG A CB  1 
ATOM   218  C CG  . ARG A 1 48  ? 8.875   50.835 45.943 1.00 42.21 ? 29   ARG A CG  1 
ATOM   219  C CD  . ARG A 1 48  ? 8.914   50.619 47.479 1.00 47.43 ? 29   ARG A CD  1 
ATOM   220  N NE  . ARG A 1 48  ? 10.141  49.944 47.926 1.00 50.02 ? 29   ARG A NE  1 
ATOM   221  C CZ  . ARG A 1 48  ? 11.236  50.582 48.346 1.00 51.52 ? 29   ARG A CZ  1 
ATOM   222  N NH1 . ARG A 1 48  ? 11.267  51.922 48.391 1.00 50.37 ? 29   ARG A NH1 1 
ATOM   223  N NH2 . ARG A 1 48  ? 12.302  49.879 48.723 1.00 51.08 ? 29   ARG A NH2 1 
ATOM   224  N N   . GLU A 1 49  ? 6.019   47.551 44.115 1.00 35.63 ? 30   GLU A N   1 
ATOM   225  C CA  . GLU A 1 49  ? 4.752   46.990 43.666 1.00 34.26 ? 30   GLU A CA  1 
ATOM   226  C C   . GLU A 1 49  ? 4.495   45.666 44.403 1.00 32.17 ? 30   GLU A C   1 
ATOM   227  O O   . GLU A 1 49  ? 5.373   44.792 44.442 1.00 31.08 ? 30   GLU A O   1 
ATOM   228  C CB  . GLU A 1 49  ? 4.758   46.794 42.152 1.00 34.77 ? 30   GLU A CB  1 
ATOM   229  C CG  . GLU A 1 49  ? 4.675   48.076 41.364 1.00 39.00 ? 30   GLU A CG  1 
ATOM   230  C CD  . GLU A 1 49  ? 5.106   47.878 39.913 1.00 44.80 ? 30   GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 49  ? 4.213   47.710 39.050 1.00 45.99 ? 30   GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 49  ? 6.336   47.872 39.638 1.00 47.07 ? 30   GLU A OE2 1 
ATOM   233  N N   . ALA A 1 50  ? 3.306   45.538 44.998 1.00 29.70 ? 31   ALA A N   1 
ATOM   234  C CA  . ALA A 1 50  ? 2.938   44.345 45.785 1.00 27.79 ? 31   ALA A CA  1 
ATOM   235  C C   . ALA A 1 50  ? 3.178   43.057 45.009 1.00 26.20 ? 31   ALA A C   1 
ATOM   236  O O   . ALA A 1 50  ? 3.636   42.066 45.559 1.00 25.77 ? 31   ALA A O   1 
ATOM   237  C CB  . ALA A 1 50  ? 1.468   44.439 46.267 1.00 27.06 ? 31   ALA A CB  1 
ATOM   238  N N   . TYR A 1 51  ? 2.923   43.123 43.700 1.00 25.77 ? 32   TYR A N   1 
ATOM   239  C CA  . TYR A 1 51  ? 3.049   41.991 42.764 1.00 25.12 ? 32   TYR A CA  1 
ATOM   240  C C   . TYR A 1 51  ? 4.476   41.449 42.678 1.00 22.75 ? 32   TYR A C   1 
ATOM   241  O O   . TYR A 1 51  ? 4.681   40.270 42.424 1.00 23.08 ? 32   TYR A O   1 
ATOM   242  C CB  . TYR A 1 51  ? 2.467   42.362 41.354 1.00 26.25 ? 32   TYR A CB  1 
ATOM   243  C CG  . TYR A 1 51  ? 1.262   43.282 41.478 1.00 29.34 ? 32   TYR A CG  1 
ATOM   244  C CD1 . TYR A 1 51  ? 0.086   42.834 42.120 1.00 30.53 ? 32   TYR A CD1 1 
ATOM   245  C CD2 . TYR A 1 51  ? 1.304   44.621 41.026 1.00 30.22 ? 32   TYR A CD2 1 
ATOM   246  C CE1 . TYR A 1 51  ? -1.014  43.668 42.287 1.00 29.87 ? 32   TYR A CE1 1 
ATOM   247  C CE2 . TYR A 1 51  ? 0.195   45.467 41.186 1.00 30.41 ? 32   TYR A CE2 1 
ATOM   248  C CZ  . TYR A 1 51  ? -0.961  44.975 41.824 1.00 30.65 ? 32   TYR A CZ  1 
ATOM   249  O OH  . TYR A 1 51  ? -2.088  45.770 41.995 1.00 31.75 ? 32   TYR A OH  1 
ATOM   250  N N   . HIS A 1 52  ? 5.460   42.288 42.957 1.00 21.05 ? 33   HIS A N   1 
ATOM   251  C CA  . HIS A 1 52  ? 6.853   41.864 42.820 1.00 19.79 ? 33   HIS A CA  1 
ATOM   252  C C   . HIS A 1 52  ? 7.571   41.758 44.150 1.00 19.41 ? 33   HIS A C   1 
ATOM   253  O O   . HIS A 1 52  ? 8.787   41.615 44.178 1.00 19.05 ? 33   HIS A O   1 
ATOM   254  C CB  . HIS A 1 52  ? 7.575   42.790 41.859 1.00 19.31 ? 33   HIS A CB  1 
ATOM   255  C CG  . HIS A 1 52  ? 6.885   42.902 40.537 1.00 18.77 ? 33   HIS A CG  1 
ATOM   256  N ND1 . HIS A 1 52  ? 6.355   44.086 40.064 1.00 20.41 ? 33   HIS A ND1 1 
ATOM   257  C CD2 . HIS A 1 52  ? 6.571   41.957 39.619 1.00 17.45 ? 33   HIS A CD2 1 
ATOM   258  C CE1 . HIS A 1 52  ? 5.786   43.874 38.890 1.00 17.20 ? 33   HIS A CE1 1 
ATOM   259  N NE2 . HIS A 1 52  ? 5.895   42.589 38.604 1.00 18.60 ? 33   HIS A NE2 1 
ATOM   260  N N   . ARG A 1 53  ? 6.806   41.811 45.242 1.00 18.25 ? 34   ARG A N   1 
ATOM   261  C CA  . ARG A 1 53  ? 7.351   41.776 46.585 1.00 19.22 ? 34   ARG A CA  1 
ATOM   262  C C   . ARG A 1 53  ? 7.487   40.365 47.140 1.00 18.01 ? 34   ARG A C   1 
ATOM   263  O O   . ARG A 1 53  ? 6.775   39.447 46.731 1.00 17.74 ? 34   ARG A O   1 
ATOM   264  C CB  . ARG A 1 53  ? 6.466   42.605 47.540 1.00 18.95 ? 34   ARG A CB  1 
ATOM   265  C CG  . ARG A 1 53  ? 6.571   44.122 47.294 1.00 22.39 ? 34   ARG A CG  1 
ATOM   266  C CD  . ARG A 1 53  ? 5.765   44.957 48.314 1.00 22.74 ? 34   ARG A CD  1 
ATOM   267  N NE  . ARG A 1 53  ? 5.889   44.404 49.669 1.00 33.19 ? 34   ARG A NE  1 
ATOM   268  C CZ  . ARG A 1 53  ? 5.472   45.034 50.770 1.00 35.88 ? 34   ARG A CZ  1 
ATOM   269  N NH1 . ARG A 1 53  ? 4.926   46.242 50.657 1.00 36.95 ? 34   ARG A NH1 1 
ATOM   270  N NH2 . ARG A 1 53  ? 5.617   44.481 51.976 1.00 35.37 ? 34   ARG A NH2 1 
ATOM   271  N N   . VAL A 1 54  ? 8.401   40.216 48.094 1.00 17.88 ? 35   VAL A N   1 
ATOM   272  C CA  . VAL A 1 54  ? 8.480   39.001 48.912 1.00 17.74 ? 35   VAL A CA  1 
ATOM   273  C C   . VAL A 1 54  ? 7.942   39.437 50.294 1.00 18.28 ? 35   VAL A C   1 
ATOM   274  O O   . VAL A 1 54  ? 8.425   40.426 50.873 1.00 16.72 ? 35   VAL A O   1 
ATOM   275  C CB  . VAL A 1 54  ? 9.934   38.519 49.036 1.00 18.49 ? 35   VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 54  ? 10.080  37.446 50.161 1.00 16.78 ? 35   VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 54  ? 10.412  37.991 47.695 1.00 19.20 ? 35   VAL A CG2 1 
ATOM   278  N N   . PHE A 1 55  ? 6.949   38.694 50.772 1.00 17.54 ? 36   PHE A N   1 
ATOM   279  C CA  . PHE A 1 55  ? 6.220   38.982 52.002 1.00 18.19 ? 36   PHE A CA  1 
ATOM   280  C C   . PHE A 1 55  ? 6.849   38.151 53.141 1.00 19.36 ? 36   PHE A C   1 
ATOM   281  O O   . PHE A 1 55  ? 7.317   37.021 52.911 1.00 19.82 ? 36   PHE A O   1 
ATOM   282  C CB  . PHE A 1 55  ? 4.748   38.668 51.787 1.00 16.14 ? 36   PHE A CB  1 
ATOM   283  C CG  . PHE A 1 55  ? 4.078   39.600 50.779 1.00 16.75 ? 36   PHE A CG  1 
ATOM   284  C CD1 . PHE A 1 55  ? 3.950   40.964 51.060 1.00 13.23 ? 36   PHE A CD1 1 
ATOM   285  C CD2 . PHE A 1 55  ? 3.676   39.118 49.504 1.00 16.21 ? 36   PHE A CD2 1 
ATOM   286  C CE1 . PHE A 1 55  ? 3.338   41.844 50.119 1.00 17.55 ? 36   PHE A CE1 1 
ATOM   287  C CE2 . PHE A 1 55  ? 3.071   39.979 48.558 1.00 17.97 ? 36   PHE A CE2 1 
ATOM   288  C CZ  . PHE A 1 55  ? 2.923   41.352 48.855 1.00 14.75 ? 36   PHE A CZ  1 
ATOM   289  N N   . VAL A 1 56  ? 6.933   38.749 54.332 1.00 19.83 ? 37   VAL A N   1 
ATOM   290  C CA  . VAL A 1 56  ? 7.773   38.194 55.407 1.00 19.05 ? 37   VAL A CA  1 
ATOM   291  C C   . VAL A 1 56  ? 6.893   37.845 56.611 1.00 19.47 ? 37   VAL A C   1 
ATOM   292  O O   . VAL A 1 56  ? 6.269   38.733 57.204 1.00 17.69 ? 37   VAL A O   1 
ATOM   293  C CB  . VAL A 1 56  ? 8.838   39.194 55.860 1.00 19.34 ? 37   VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 56  ? 9.777   38.535 56.882 1.00 20.51 ? 37   VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 56  ? 9.633   39.747 54.633 1.00 17.82 ? 37   VAL A CG2 1 
ATOM   296  N N   . ASN A 1 57  ? 6.848   36.556 56.962 1.00 18.17 ? 38   ASN A N   1 
ATOM   297  C CA  . ASN A 1 57  ? 6.233   36.152 58.236 1.00 18.45 ? 38   ASN A CA  1 
ATOM   298  C C   . ASN A 1 57  ? 7.184   36.135 59.395 1.00 18.43 ? 38   ASN A C   1 
ATOM   299  O O   . ASN A 1 57  ? 6.777   36.436 60.519 1.00 17.30 ? 38   ASN A O   1 
ATOM   300  C CB  . ASN A 1 57  ? 5.543   34.782 58.130 1.00 18.42 ? 38   ASN A CB  1 
ATOM   301  C CG  . ASN A 1 57  ? 4.367   34.810 57.177 1.00 19.83 ? 38   ASN A CG  1 
ATOM   302  O OD1 . ASN A 1 57  ? 4.256   33.991 56.243 1.00 21.34 ? 38   ASN A OD1 1 
ATOM   303  N ND2 . ASN A 1 57  ? 3.469   35.712 57.426 1.00 18.18 ? 38   ASN A ND2 1 
ATOM   304  N N   . ARG A 1 58  ? 8.439   35.747 59.146 1.00 19.43 ? 39   ARG A N   1 
ATOM   305  C CA  . ARG A 1 58  ? 9.449   35.781 60.207 1.00 20.99 ? 39   ARG A CA  1 
ATOM   306  C C   . ARG A 1 58  ? 10.707  36.303 59.555 1.00 21.02 ? 39   ARG A C   1 
ATOM   307  O O   . ARG A 1 58  ? 10.952  35.993 58.381 1.00 23.30 ? 39   ARG A O   1 
ATOM   308  C CB  . ARG A 1 58  ? 9.680   34.382 60.848 1.00 19.88 ? 39   ARG A CB  1 
ATOM   309  C CG  . ARG A 1 58  ? 8.764   34.089 62.097 1.00 21.54 ? 39   ARG A CG  1 
ATOM   310  C CD  . ARG A 1 58  ? 8.594   32.564 62.347 1.00 21.82 ? 39   ARG A CD  1 
ATOM   311  N NE  . ARG A 1 58  ? 8.325   31.868 61.080 1.00 24.60 ? 39   ARG A NE  1 
ATOM   312  C CZ  . ARG A 1 58  ? 7.120   31.750 60.497 1.00 26.23 ? 39   ARG A CZ  1 
ATOM   313  N NH1 . ARG A 1 58  ? 6.030   32.263 61.064 1.00 27.35 ? 39   ARG A NH1 1 
ATOM   314  N NH2 . ARG A 1 58  ? 6.996   31.117 59.333 1.00 26.44 ? 39   ARG A NH2 1 
ATOM   315  N N   . SER A 1 59  ? 11.499  37.062 60.306 1.00 20.54 ? 40   SER A N   1 
ATOM   316  C CA  . SER A 1 59  ? 12.752  37.599 59.806 1.00 20.77 ? 40   SER A CA  1 
ATOM   317  C C   . SER A 1 59  ? 13.702  36.520 59.288 1.00 20.37 ? 40   SER A C   1 
ATOM   318  O O   . SER A 1 59  ? 13.821  35.429 59.874 1.00 19.45 ? 40   SER A O   1 
ATOM   319  C CB  . SER A 1 59  ? 13.476  38.398 60.881 1.00 19.93 ? 40   SER A CB  1 
ATOM   320  O OG  . SER A 1 59  ? 12.654  39.425 61.311 1.00 22.12 ? 40   SER A OG  1 
ATOM   321  N N   . LEU A 1 60  ? 14.434  36.902 58.241 1.00 20.35 ? 41   LEU A N   1 
ATOM   322  C CA  . LEU A 1 60  ? 15.342  36.033 57.545 1.00 20.42 ? 41   LEU A CA  1 
ATOM   323  C C   . LEU A 1 60  ? 16.444  36.900 56.942 1.00 21.09 ? 41   LEU A C   1 
ATOM   324  O O   . LEU A 1 60  ? 16.191  37.741 56.057 1.00 20.22 ? 41   LEU A O   1 
ATOM   325  C CB  . LEU A 1 60  ? 14.615  35.237 56.462 1.00 20.77 ? 41   LEU A CB  1 
ATOM   326  C CG  . LEU A 1 60  ? 15.406  34.096 55.792 1.00 22.67 ? 41   LEU A CG  1 
ATOM   327  C CD1 . LEU A 1 60  ? 14.445  33.031 55.307 1.00 23.53 ? 41   LEU A CD1 1 
ATOM   328  C CD2 . LEU A 1 60  ? 16.269  34.589 54.622 1.00 20.16 ? 41   LEU A CD2 1 
ATOM   329  N N   . ALA A 1 61  ? 17.659  36.693 57.473 1.00 20.73 ? 42   ALA A N   1 
ATOM   330  C CA  . ALA A 1 61  ? 18.877  37.295 56.989 1.00 20.67 ? 42   ALA A CA  1 
ATOM   331  C C   . ALA A 1 61  ? 19.399  36.462 55.799 1.00 21.27 ? 42   ALA A C   1 
ATOM   332  O O   . ALA A 1 61  ? 19.863  35.343 55.963 1.00 20.07 ? 42   ALA A O   1 
ATOM   333  C CB  . ALA A 1 61  ? 19.901  37.339 58.110 1.00 19.88 ? 42   ALA A CB  1 
ATOM   334  N N   . MET A 1 62  ? 19.274  37.011 54.593 1.00 22.53 ? 43   MET A N   1 
ATOM   335  C CA  . MET A 1 62  ? 19.665  36.292 53.368 1.00 23.55 ? 43   MET A CA  1 
ATOM   336  C C   . MET A 1 62  ? 21.152  35.971 53.342 1.00 23.09 ? 43   MET A C   1 
ATOM   337  O O   . MET A 1 62  ? 21.551  34.958 52.773 1.00 22.71 ? 43   MET A O   1 
ATOM   338  C CB  . MET A 1 62  ? 19.261  37.080 52.117 1.00 23.20 ? 43   MET A CB  1 
ATOM   339  C CG  . MET A 1 62  ? 17.851  36.875 51.712 1.00 28.15 ? 43   MET A CG  1 
ATOM   340  S SD  . MET A 1 62  ? 17.451  35.196 51.091 1.00 35.38 ? 43   MET A SD  1 
ATOM   341  C CE  . MET A 1 62  ? 18.085  35.254 49.409 1.00 34.57 ? 43   MET A CE  1 
ATOM   342  N N   . GLU A 1 63  ? 21.965  36.801 53.988 1.00 23.27 ? 44   GLU A N   1 
ATOM   343  C CA  . GLU A 1 63  ? 23.390  36.504 54.089 1.00 24.53 ? 44   GLU A CA  1 
ATOM   344  C C   . GLU A 1 63  ? 23.709  35.184 54.814 1.00 23.40 ? 44   GLU A C   1 
ATOM   345  O O   . GLU A 1 63  ? 24.739  34.584 54.550 1.00 23.06 ? 44   GLU A O   1 
ATOM   346  C CB  . GLU A 1 63  ? 24.168  37.673 54.679 1.00 24.96 ? 44   GLU A CB  1 
ATOM   347  C CG  . GLU A 1 63  ? 23.802  38.034 56.125 1.00 28.91 ? 44   GLU A CG  1 
ATOM   348  C CD  . GLU A 1 63  ? 24.477  39.350 56.591 1.00 29.10 ? 44   GLU A CD  1 
ATOM   349  O OE1 . GLU A 1 63  ? 24.011  39.973 57.588 1.00 32.93 ? 44   GLU A OE1 1 
ATOM   350  O OE2 . GLU A 1 63  ? 25.470  39.763 55.927 1.00 34.62 ? 44   GLU A OE2 1 
ATOM   351  N N   . LYS A 1 64  ? 22.804  34.701 55.678 1.00 23.11 ? 45   LYS A N   1 
ATOM   352  C CA  . LYS A 1 64  ? 23.025  33.428 56.369 1.00 22.90 ? 45   LYS A CA  1 
ATOM   353  C C   . LYS A 1 64  ? 22.637  32.214 55.510 1.00 21.92 ? 45   LYS A C   1 
ATOM   354  O O   . LYS A 1 64  ? 22.940  31.084 55.862 1.00 21.92 ? 45   LYS A O   1 
ATOM   355  C CB  . LYS A 1 64  ? 22.293  33.382 57.733 1.00 22.80 ? 45   LYS A CB  1 
ATOM   356  C CG  . LYS A 1 64  ? 22.820  34.321 58.808 1.00 25.73 ? 45   LYS A CG  1 
ATOM   357  C CD  . LYS A 1 64  ? 22.267  33.860 60.167 1.00 30.44 ? 45   LYS A CD  1 
ATOM   358  C CE  . LYS A 1 64  ? 22.705  34.757 61.313 1.00 36.92 ? 45   LYS A CE  1 
ATOM   359  N NZ  . LYS A 1 64  ? 21.782  35.939 61.440 1.00 39.64 ? 45   LYS A NZ  1 
ATOM   360  N N   . ILE A 1 65  ? 21.978  32.445 54.384 1.00 21.85 ? 46   ILE A N   1 
ATOM   361  C CA  . ILE A 1 65  ? 21.494  31.341 53.578 1.00 21.70 ? 46   ILE A CA  1 
ATOM   362  C C   . ILE A 1 65  ? 22.639  30.810 52.745 1.00 21.86 ? 46   ILE A C   1 
ATOM   363  O O   . ILE A 1 65  ? 23.226  31.533 51.942 1.00 22.66 ? 46   ILE A O   1 
ATOM   364  C CB  . ILE A 1 65  ? 20.278  31.720 52.681 1.00 21.84 ? 46   ILE A CB  1 
ATOM   365  C CG1 . ILE A 1 65  ? 19.035  32.087 53.513 1.00 21.48 ? 46   ILE A CG1 1 
ATOM   366  C CG2 . ILE A 1 65  ? 19.929  30.541 51.735 1.00 21.10 ? 46   ILE A CG2 1 
ATOM   367  C CD1 . ILE A 1 65  ? 18.749  31.086 54.694 1.00 22.82 ? 46   ILE A CD1 1 
ATOM   368  N N   . LYS A 1 66  ? 22.964  29.542 52.946 1.00 22.43 ? 47   LYS A N   1 
ATOM   369  C CA  . LYS A 1 66  ? 24.022  28.910 52.185 1.00 23.68 ? 47   LYS A CA  1 
ATOM   370  C C   . LYS A 1 66  ? 23.548  28.005 51.058 1.00 23.30 ? 47   LYS A C   1 
ATOM   371  O O   . LYS A 1 66  ? 24.301  27.808 50.139 1.00 25.38 ? 47   LYS A O   1 
ATOM   372  C CB  . LYS A 1 66  ? 24.980  28.154 53.114 1.00 24.59 ? 47   LYS A CB  1 
ATOM   373  C CG  . LYS A 1 66  ? 25.558  28.988 54.269 1.00 27.90 ? 47   LYS A CG  1 
ATOM   374  C CD  . LYS A 1 66  ? 26.751  29.880 53.895 1.00 32.54 ? 47   LYS A CD  1 
ATOM   375  C CE  . LYS A 1 66  ? 26.332  31.353 53.673 1.00 35.15 ? 47   LYS A CE  1 
ATOM   376  N NZ  . LYS A 1 66  ? 27.083  32.316 54.566 1.00 34.63 ? 47   LYS A NZ  1 
ATOM   377  N N   . CYS A 1 67  ? 22.338  27.428 51.135 1.00 24.15 ? 48   CYS A N   1 
ATOM   378  C CA  . CYS A 1 67  ? 21.777  26.585 50.062 1.00 23.97 ? 48   CYS A CA  1 
ATOM   379  C C   . CYS A 1 67  ? 20.386  27.009 49.730 1.00 22.31 ? 48   CYS A C   1 
ATOM   380  O O   . CYS A 1 67  ? 19.568  27.237 50.626 1.00 22.26 ? 48   CYS A O   1 
ATOM   381  C CB  . CYS A 1 67  ? 21.707  25.071 50.403 1.00 23.77 ? 48   CYS A CB  1 
ATOM   382  S SG  . CYS A 1 67  ? 23.227  24.364 51.021 1.00 34.12 ? 48   CYS A SG  1 
ATOM   383  N N   . PHE A 1 68  ? 20.115  27.100 48.431 1.00 20.43 ? 49   PHE A N   1 
ATOM   384  C CA  . PHE A 1 68  ? 18.784  27.325 47.961 1.00 20.46 ? 49   PHE A CA  1 
ATOM   385  C C   . PHE A 1 68  ? 18.275  26.008 47.375 1.00 20.92 ? 49   PHE A C   1 
ATOM   386  O O   . PHE A 1 68  ? 18.888  25.453 46.469 1.00 20.21 ? 49   PHE A O   1 
ATOM   387  C CB  . PHE A 1 68  ? 18.776  28.449 46.914 1.00 19.63 ? 49   PHE A CB  1 
ATOM   388  C CG  . PHE A 1 68  ? 19.426  29.775 47.422 1.00 21.36 ? 49   PHE A CG  1 
ATOM   389  C CD1 . PHE A 1 68  ? 18.639  30.792 47.964 1.00 23.80 ? 49   PHE A CD1 1 
ATOM   390  C CD2 . PHE A 1 68  ? 20.801  29.955 47.378 1.00 20.74 ? 49   PHE A CD2 1 
ATOM   391  C CE1 . PHE A 1 68  ? 19.198  31.991 48.432 1.00 20.67 ? 49   PHE A CE1 1 
ATOM   392  C CE2 . PHE A 1 68  ? 21.410  31.168 47.821 1.00 23.45 ? 49   PHE A CE2 1 
ATOM   393  C CZ  . PHE A 1 68  ? 20.586  32.186 48.361 1.00 22.88 ? 49   PHE A CZ  1 
ATOM   394  N N   . GLY A 1 69  ? 17.151  25.522 47.890 1.00 20.98 ? 50   GLY A N   1 
ATOM   395  C CA  . GLY A 1 69  ? 16.562  24.292 47.407 1.00 21.20 ? 50   GLY A CA  1 
ATOM   396  C C   . GLY A 1 69  ? 15.214  24.539 46.748 1.00 22.07 ? 50   GLY A C   1 
ATOM   397  O O   . GLY A 1 69  ? 14.469  25.428 47.172 1.00 22.02 ? 50   GLY A O   1 
ATOM   398  N N   . PHE A 1 70  ? 14.921  23.757 45.712 1.00 20.45 ? 51   PHE A N   1 
ATOM   399  C CA  . PHE A 1 70  ? 13.668  23.891 44.931 1.00 21.41 ? 51   PHE A CA  1 
ATOM   400  C C   . PHE A 1 70  ? 12.946  22.556 44.851 1.00 20.68 ? 51   PHE A C   1 
ATOM   401  O O   . PHE A 1 70  ? 13.559  21.505 44.615 1.00 20.01 ? 51   PHE A O   1 
ATOM   402  C CB  . PHE A 1 70  ? 13.953  24.374 43.513 1.00 21.76 ? 51   PHE A CB  1 
ATOM   403  C CG  . PHE A 1 70  ? 14.497  25.773 43.452 1.00 21.73 ? 51   PHE A CG  1 
ATOM   404  C CD1 . PHE A 1 70  ? 13.630  26.846 43.300 1.00 22.53 ? 51   PHE A CD1 1 
ATOM   405  C CD2 . PHE A 1 70  ? 15.864  26.012 43.627 1.00 20.34 ? 51   PHE A CD2 1 
ATOM   406  C CE1 . PHE A 1 70  ? 14.123  28.171 43.232 1.00 23.56 ? 51   PHE A CE1 1 
ATOM   407  C CE2 . PHE A 1 70  ? 16.372  27.318 43.581 1.00 24.17 ? 51   PHE A CE2 1 
ATOM   408  C CZ  . PHE A 1 70  ? 15.477  28.408 43.366 1.00 22.59 ? 51   PHE A CZ  1 
HETATM 409  N N   . A5N A 1 71  ? 11.477  22.753 44.866 1.00 26.03 ? 52   A5N A N   1 
HETATM 410  C CA  . A5N A 1 71  ? 10.579  21.815 44.207 1.00 26.96 ? 52   A5N A CA  1 
HETATM 411  C C   . A5N A 1 71  ? 10.438  22.313 42.755 1.00 25.92 ? 52   A5N A C   1 
HETATM 412  O O   . A5N A 1 71  ? 10.891  23.379 42.337 1.00 25.86 ? 52   A5N A O   1 
HETATM 413  C CB  . A5N A 1 71  ? 9.228   21.799 44.949 1.00 27.43 ? 52   A5N A CB  1 
HETATM 414  C CG  . A5N A 1 71  ? 8.343   20.700 44.383 1.00 34.72 ? 52   A5N A CG  1 
HETATM 415  O OD1 . A5N A 1 71  ? 8.808   19.405 44.154 1.00 38.31 ? 52   A5N A OD1 1 
HETATM 416  N ND2 . A5N A 1 71  ? 7.082   21.087 44.121 1.00 42.05 ? 52   A5N A ND2 1 
HETATM 417  C C1  . A5N A 1 71  ? 8.022   18.579 43.372 1.00 39.73 ? 52   A5N A C1  1 
HETATM 418  O O2  . A5N A 1 71  ? 7.313   17.761 44.001 1.00 38.26 ? 52   A5N A O2  1 
HETATM 419  O O3  . A5N A 1 71  ? 8.083   18.655 42.096 1.00 41.32 ? 52   A5N A O3  1 
ATOM   420  N N   . MET A 1 72  ? 10.021  21.354 41.734 1.00 20.53 ? 53   MET A N   1 
ATOM   421  C CA  . MET A 1 72  ? 9.818   21.727 40.325 1.00 21.05 ? 53   MET A CA  1 
ATOM   422  C C   . MET A 1 72  ? 8.389   22.200 40.146 1.00 21.46 ? 53   MET A C   1 
ATOM   423  O O   . MET A 1 72  ? 8.160   23.339 39.742 1.00 20.03 ? 53   MET A O   1 
ATOM   424  C CB  . MET A 1 72  ? 10.085  20.552 39.427 1.00 20.50 ? 53   MET A CB  1 
ATOM   425  C CG  . MET A 1 72  ? 10.176  21.036 37.969 1.00 19.45 ? 53   MET A CG  1 
ATOM   426  S SD  . MET A 1 72  ? 10.480  19.708 36.917 1.00 23.78 ? 53   MET A SD  1 
ATOM   427  C CE  . MET A 1 72  ? 9.046   18.626 37.199 1.00 19.06 ? 53   MET A CE  1 
ATOM   428  N N   . ASP A 1 73  ? 7.445   21.316 40.463 1.00 22.58 ? 54   ASP A N   1 
ATOM   429  C CA  . ASP A 1 73  ? 6.030   21.509 40.111 1.00 24.75 ? 54   ASP A CA  1 
ATOM   430  C C   . ASP A 1 73  ? 5.365   22.683 40.823 1.00 24.37 ? 54   ASP A C   1 
ATOM   431  O O   . ASP A 1 73  ? 5.488   22.829 42.019 1.00 25.20 ? 54   ASP A O   1 
ATOM   432  C CB  . ASP A 1 73  ? 5.269   20.198 40.229 1.00 25.31 ? 54   ASP A CB  1 
ATOM   433  C CG  . ASP A 1 73  ? 5.548   19.276 39.034 1.00 27.08 ? 54   ASP A CG  1 
ATOM   434  O OD1 . ASP A 1 73  ? 5.975   19.757 37.956 1.00 31.44 ? 54   ASP A OD1 1 
ATOM   435  O OD2 . ASP A 1 73  ? 5.349   18.065 39.142 1.00 33.14 ? 54   ASP A OD2 1 
ATOM   436  N N   . TYR A 1 74  ? 4.793   23.598 40.035 1.00 25.27 ? 55   TYR A N   1 
ATOM   437  C CA  . TYR A 1 74  ? 4.277   24.900 40.532 1.00 24.60 ? 55   TYR A CA  1 
ATOM   438  C C   . TYR A 1 74  ? 5.253   25.771 41.288 1.00 25.86 ? 55   TYR A C   1 
ATOM   439  O O   . TYR A 1 74  ? 4.830   26.627 42.086 1.00 27.35 ? 55   TYR A O   1 
ATOM   440  C CB  . TYR A 1 74  ? 3.013   24.696 41.377 1.00 25.23 ? 55   TYR A CB  1 
ATOM   441  C CG  . TYR A 1 74  ? 1.765   24.411 40.520 1.00 24.51 ? 55   TYR A CG  1 
ATOM   442  C CD1 . TYR A 1 74  ? 1.198   25.425 39.725 1.00 22.62 ? 55   TYR A CD1 1 
ATOM   443  C CD2 . TYR A 1 74  ? 1.171   23.130 40.509 1.00 25.29 ? 55   TYR A CD2 1 
ATOM   444  C CE1 . TYR A 1 74  ? 0.026   25.163 38.921 1.00 21.76 ? 55   TYR A CE1 1 
ATOM   445  C CE2 . TYR A 1 74  ? 0.030   22.861 39.707 1.00 23.66 ? 55   TYR A CE2 1 
ATOM   446  C CZ  . TYR A 1 74  ? -0.536  23.899 38.947 1.00 20.14 ? 55   TYR A CZ  1 
ATOM   447  O OH  . TYR A 1 74  ? -1.691  23.653 38.212 1.00 25.19 ? 55   TYR A OH  1 
ATOM   448  N N   . THR A 1 75  ? 6.548   25.570 41.046 1.00 23.68 ? 56   THR A N   1 
ATOM   449  C CA  . THR A 1 75  ? 7.588   26.393 41.657 1.00 23.66 ? 56   THR A CA  1 
ATOM   450  C C   . THR A 1 75  ? 8.493   26.913 40.556 1.00 22.45 ? 56   THR A C   1 
ATOM   451  O O   . THR A 1 75  ? 8.475   28.107 40.253 1.00 23.12 ? 56   THR A O   1 
ATOM   452  C CB  . THR A 1 75  ? 8.398   25.575 42.732 1.00 23.84 ? 56   THR A CB  1 
ATOM   453  O OG1 . THR A 1 75  ? 7.484   25.005 43.688 1.00 27.50 ? 56   THR A OG1 1 
ATOM   454  C CG2 . THR A 1 75  ? 9.381   26.473 43.464 1.00 22.86 ? 56   THR A CG2 1 
ATOM   455  N N   . LEU A 1 76  ? 9.242   25.998 39.940 1.00 21.47 ? 57   LEU A N   1 
ATOM   456  C CA  . LEU A 1 76  ? 10.040  26.270 38.763 1.00 21.16 ? 57   LEU A CA  1 
ATOM   457  C C   . LEU A 1 76  ? 9.128   26.178 37.503 1.00 21.22 ? 57   LEU A C   1 
ATOM   458  O O   . LEU A 1 76  ? 9.197   27.016 36.591 1.00 21.94 ? 57   LEU A O   1 
ATOM   459  C CB  . LEU A 1 76  ? 11.214  25.267 38.669 1.00 20.87 ? 57   LEU A CB  1 
ATOM   460  C CG  . LEU A 1 76  ? 12.402  25.441 39.676 1.00 21.26 ? 57   LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 76  ? 13.344  24.282 39.571 1.00 18.58 ? 57   LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 76  ? 13.227  26.718 39.595 1.00 18.18 ? 57   LEU A CD2 1 
ATOM   463  N N   . ALA A 1 77  ? 8.252   25.188 37.491 1.00 20.21 ? 58   ALA A N   1 
ATOM   464  C CA  . ALA A 1 77  ? 7.356   24.941 36.387 1.00 20.81 ? 58   ALA A CA  1 
ATOM   465  C C   . ALA A 1 77  ? 5.953   25.287 36.867 1.00 21.35 ? 58   ALA A C   1 
ATOM   466  O O   . ALA A 1 77  ? 5.286   24.507 37.539 1.00 20.35 ? 58   ALA A O   1 
ATOM   467  C CB  . ALA A 1 77  ? 7.441   23.480 35.959 1.00 20.03 ? 58   ALA A CB  1 
ATOM   468  N N   . VAL A 1 78  ? 5.510   26.483 36.503 1.00 22.16 ? 59   VAL A N   1 
ATOM   469  C CA  . VAL A 1 78  ? 4.197   26.931 36.932 1.00 22.68 ? 59   VAL A CA  1 
ATOM   470  C C   . VAL A 1 78  ? 3.214   26.649 35.791 1.00 22.83 ? 59   VAL A C   1 
ATOM   471  O O   . VAL A 1 78  ? 3.362   27.174 34.688 1.00 21.63 ? 59   VAL A O   1 
ATOM   472  C CB  . VAL A 1 78  ? 4.230   28.416 37.265 1.00 23.95 ? 59   VAL A CB  1 
ATOM   473  C CG1 . VAL A 1 78  ? 2.803   28.902 37.597 1.00 22.41 ? 59   VAL A CG1 1 
ATOM   474  C CG2 . VAL A 1 78  ? 5.202   28.635 38.476 1.00 23.10 ? 59   VAL A CG2 1 
ATOM   475  N N   . TYR A 1 79  ? 2.256   25.773 36.042 1.00 22.27 ? 60   TYR A N   1 
ATOM   476  C CA  . TYR A 1 79  ? 1.337   25.384 34.971 1.00 22.88 ? 60   TYR A CA  1 
ATOM   477  C C   . TYR A 1 79  ? 0.274   26.452 34.736 1.00 23.28 ? 60   TYR A C   1 
ATOM   478  O O   . TYR A 1 79  ? -0.337  26.977 35.684 1.00 23.73 ? 60   TYR A O   1 
ATOM   479  C CB  . TYR A 1 79  ? 0.700   24.039 35.286 1.00 22.39 ? 60   TYR A CB  1 
ATOM   480  C CG  . TYR A 1 79  ? 1.725   22.939 35.443 1.00 23.35 ? 60   TYR A CG  1 
ATOM   481  C CD1 . TYR A 1 79  ? 2.391   22.414 34.311 1.00 22.34 ? 60   TYR A CD1 1 
ATOM   482  C CD2 . TYR A 1 79  ? 2.078   22.451 36.722 1.00 20.93 ? 60   TYR A CD2 1 
ATOM   483  C CE1 . TYR A 1 79  ? 3.332   21.411 34.434 1.00 19.25 ? 60   TYR A CE1 1 
ATOM   484  C CE2 . TYR A 1 79  ? 3.054   21.416 36.865 1.00 21.00 ? 60   TYR A CE2 1 
ATOM   485  C CZ  . TYR A 1 79  ? 3.656   20.897 35.696 1.00 23.98 ? 60   TYR A CZ  1 
ATOM   486  O OH  . TYR A 1 79  ? 4.626   19.894 35.764 1.00 22.85 ? 60   TYR A OH  1 
ATOM   487  N N   . LYS A 1 80  ? 0.034   26.754 33.468 1.00 23.29 ? 61   LYS A N   1 
ATOM   488  C CA  . LYS A 1 80  ? -0.951  27.790 33.094 1.00 23.66 ? 61   LYS A CA  1 
ATOM   489  C C   . LYS A 1 80  ? -2.409  27.453 33.415 1.00 23.86 ? 61   LYS A C   1 
ATOM   490  O O   . LYS A 1 80  ? -2.872  26.311 33.233 1.00 23.73 ? 61   LYS A O   1 
ATOM   491  C CB  . LYS A 1 80  ? -0.793  28.154 31.628 1.00 23.30 ? 61   LYS A CB  1 
ATOM   492  C CG  . LYS A 1 80  ? 0.500   28.936 31.372 1.00 21.35 ? 61   LYS A CG  1 
ATOM   493  C CD  . LYS A 1 80  ? 0.676   29.296 29.907 1.00 22.32 ? 61   LYS A CD  1 
ATOM   494  C CE  . LYS A 1 80  ? 1.955   30.100 29.776 1.00 22.71 ? 61   LYS A CE  1 
ATOM   495  N NZ  . LYS A 1 80  ? 2.285   30.330 28.341 1.00 25.00 ? 61   LYS A NZ  1 
ATOM   496  N N   . SER A 1 81  ? -3.119  28.466 33.897 1.00 23.74 ? 62   SER A N   1 
ATOM   497  C CA  . SER A 1 81  ? -4.470  28.310 34.362 1.00 23.51 ? 62   SER A CA  1 
ATOM   498  C C   . SER A 1 81  ? -5.410  29.151 33.503 1.00 23.42 ? 62   SER A C   1 
ATOM   499  O O   . SER A 1 81  ? -5.061  30.266 33.138 1.00 22.66 ? 62   SER A O   1 
ATOM   500  C CB  . SER A 1 81  ? -4.546  28.758 35.822 1.00 24.76 ? 62   SER A CB  1 
ATOM   501  O OG  . SER A 1 81  ? -5.907  28.831 36.286 1.00 24.97 ? 62   SER A OG  1 
ATOM   502  N N   . PRO A 1 82  ? -6.636  28.654 33.218 1.00 23.40 ? 63   PRO A N   1 
ATOM   503  C CA  . PRO A 1 82  ? -7.265  27.378 33.601 1.00 23.72 ? 63   PRO A CA  1 
ATOM   504  C C   . PRO A 1 82  ? -6.880  26.198 32.720 1.00 23.71 ? 63   PRO A C   1 
ATOM   505  O O   . PRO A 1 82  ? -7.396  25.108 32.936 1.00 23.41 ? 63   PRO A O   1 
ATOM   506  C CB  . PRO A 1 82  ? -8.762  27.672 33.382 1.00 24.06 ? 63   PRO A CB  1 
ATOM   507  C CG  . PRO A 1 82  ? -8.771  28.613 32.174 1.00 24.73 ? 63   PRO A CG  1 
ATOM   508  C CD  . PRO A 1 82  ? -7.574  29.528 32.462 1.00 23.97 ? 63   PRO A CD  1 
ATOM   509  N N   . GLU A 1 83  ? -6.037  26.422 31.698 1.00 23.25 ? 64   GLU A N   1 
ATOM   510  C CA  . GLU A 1 83  ? -5.717  25.360 30.720 1.00 23.71 ? 64   GLU A CA  1 
ATOM   511  C C   . GLU A 1 83  ? -5.246  24.059 31.345 1.00 22.61 ? 64   GLU A C   1 
ATOM   512  O O   . GLU A 1 83  ? -5.761  23.013 31.013 1.00 21.80 ? 64   GLU A O   1 
ATOM   513  C CB  . GLU A 1 83  ? -4.690  25.818 29.675 1.00 23.29 ? 64   GLU A CB  1 
ATOM   514  C CG  . GLU A 1 83  ? -5.293  26.693 28.592 1.00 25.25 ? 64   GLU A CG  1 
ATOM   515  C CD  . GLU A 1 83  ? -5.458  28.165 29.032 1.00 29.31 ? 64   GLU A CD  1 
ATOM   516  O OE1 . GLU A 1 83  ? -4.989  28.557 30.154 1.00 28.33 ? 64   GLU A OE1 1 
ATOM   517  O OE2 . GLU A 1 83  ? -6.076  28.940 28.243 1.00 32.48 ? 64   GLU A OE2 1 
ATOM   518  N N   . TYR A 1 84  ? -4.276  24.107 32.268 1.00 22.19 ? 65   TYR A N   1 
ATOM   519  C CA  . TYR A 1 84  ? -3.766  22.854 32.812 1.00 22.13 ? 65   TYR A CA  1 
ATOM   520  C C   . TYR A 1 84  ? -4.808  22.162 33.720 1.00 22.77 ? 65   TYR A C   1 
ATOM   521  O O   . TYR A 1 84  ? -4.997  20.943 33.644 1.00 22.68 ? 65   TYR A O   1 
ATOM   522  C CB  . TYR A 1 84  ? -2.432  23.117 33.512 1.00 22.37 ? 65   TYR A CB  1 
ATOM   523  C CG  . TYR A 1 84  ? -1.734  21.902 34.033 1.00 22.66 ? 65   TYR A CG  1 
ATOM   524  C CD1 . TYR A 1 84  ? -1.029  21.053 33.178 1.00 22.08 ? 65   TYR A CD1 1 
ATOM   525  C CD2 . TYR A 1 84  ? -1.751  21.606 35.389 1.00 22.57 ? 65   TYR A CD2 1 
ATOM   526  C CE1 . TYR A 1 84  ? -0.352  19.928 33.670 1.00 20.67 ? 65   TYR A CE1 1 
ATOM   527  C CE2 . TYR A 1 84  ? -1.098  20.478 35.872 1.00 20.59 ? 65   TYR A CE2 1 
ATOM   528  C CZ  . TYR A 1 84  ? -0.406  19.660 35.001 1.00 21.38 ? 65   TYR A CZ  1 
ATOM   529  O OH  . TYR A 1 84  ? 0.267   18.567 35.483 1.00 23.58 ? 65   TYR A OH  1 
ATOM   530  N N   . GLU A 1 85  ? -5.529  22.936 34.545 1.00 23.62 ? 66   GLU A N   1 
ATOM   531  C CA  . GLU A 1 85  ? -6.592  22.350 35.399 1.00 23.69 ? 66   GLU A CA  1 
ATOM   532  C C   . GLU A 1 85  ? -7.665  21.703 34.512 1.00 23.99 ? 66   GLU A C   1 
ATOM   533  O O   . GLU A 1 85  ? -8.152  20.603 34.796 1.00 23.35 ? 66   GLU A O   1 
ATOM   534  C CB  . GLU A 1 85  ? -7.284  23.417 36.263 1.00 24.86 ? 66   GLU A CB  1 
ATOM   535  C CG  . GLU A 1 85  ? -6.434  24.156 37.323 1.00 25.57 ? 66   GLU A CG  1 
ATOM   536  C CD  . GLU A 1 85  ? -5.904  25.463 36.763 1.00 30.64 ? 66   GLU A CD  1 
ATOM   537  O OE1 . GLU A 1 85  ? -5.174  25.393 35.749 1.00 28.40 ? 66   GLU A OE1 1 
ATOM   538  O OE2 . GLU A 1 85  ? -6.243  26.559 37.308 1.00 33.14 ? 66   GLU A OE2 1 
ATOM   539  N N   . SER A 1 86  ? -8.057  22.442 33.459 1.00 22.42 ? 67   SER A N   1 
ATOM   540  C CA  . SER A 1 86  ? -9.059  21.965 32.561 1.00 24.15 ? 67   SER A CA  1 
ATOM   541  C C   . SER A 1 86  ? -8.664  20.609 31.850 1.00 23.66 ? 67   SER A C   1 
ATOM   542  O O   . SER A 1 86  ? -9.498  19.703 31.755 1.00 23.25 ? 67   SER A O   1 
ATOM   543  C CB  . SER A 1 86  ? -9.482  23.093 31.617 1.00 23.45 ? 67   SER A CB  1 
ATOM   544  O OG  . SER A 1 86  ? -10.179 22.490 30.587 1.00 29.03 ? 67   SER A OG  1 
ATOM   545  N N   . LEU A 1 87  ? -7.392  20.465 31.449 1.00 23.22 ? 68   LEU A N   1 
ATOM   546  C CA  . LEU A 1 87  ? -6.813  19.219 30.921 1.00 23.79 ? 68   LEU A CA  1 
ATOM   547  C C   . LEU A 1 87  ? -6.823  18.078 31.963 1.00 23.92 ? 68   LEU A C   1 
ATOM   548  O O   . LEU A 1 87  ? -7.186  16.957 31.639 1.00 25.14 ? 68   LEU A O   1 
ATOM   549  C CB  . LEU A 1 87  ? -5.355  19.450 30.441 1.00 23.51 ? 68   LEU A CB  1 
ATOM   550  C CG  . LEU A 1 87  ? -4.568  18.238 29.851 1.00 24.71 ? 68   LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 87  ? -5.225  17.650 28.596 1.00 25.20 ? 68   LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 87  ? -3.071  18.486 29.547 1.00 24.22 ? 68   LEU A CD2 1 
ATOM   553  N N   . GLY A 1 88  ? -6.399  18.352 33.194 1.00 22.74 ? 69   GLY A N   1 
ATOM   554  C CA  . GLY A 1 88  ? -6.541  17.356 34.282 1.00 23.41 ? 69   GLY A CA  1 
ATOM   555  C C   . GLY A 1 88  ? -7.973  16.910 34.521 1.00 22.54 ? 69   GLY A C   1 
ATOM   556  O O   . GLY A 1 88  ? -8.262  15.713 34.694 1.00 21.82 ? 69   GLY A O   1 
ATOM   557  N N   . PHE A 1 89  ? -8.869  17.891 34.556 1.00 21.44 ? 70   PHE A N   1 
ATOM   558  C CA  . PHE A 1 89  ? -10.293 17.634 34.707 1.00 21.88 ? 70   PHE A CA  1 
ATOM   559  C C   . PHE A 1 89  ? -10.824 16.704 33.580 1.00 21.66 ? 70   PHE A C   1 
ATOM   560  O O   . PHE A 1 89  ? -11.473 15.686 33.855 1.00 20.67 ? 70   PHE A O   1 
ATOM   561  C CB  . PHE A 1 89  ? -11.084 18.970 34.763 1.00 20.44 ? 70   PHE A CB  1 
ATOM   562  C CG  . PHE A 1 89  ? -12.599 18.808 34.905 1.00 20.96 ? 70   PHE A CG  1 
ATOM   563  C CD1 . PHE A 1 89  ? -13.190 18.746 36.190 1.00 22.29 ? 70   PHE A CD1 1 
ATOM   564  C CD2 . PHE A 1 89  ? -13.423 18.761 33.758 1.00 22.30 ? 70   PHE A CD2 1 
ATOM   565  C CE1 . PHE A 1 89  ? -14.557 18.611 36.345 1.00 21.77 ? 70   PHE A CE1 1 
ATOM   566  C CE2 . PHE A 1 89  ? -14.827 18.638 33.879 1.00 22.44 ? 70   PHE A CE2 1 
ATOM   567  C CZ  . PHE A 1 89  ? -15.402 18.568 35.169 1.00 22.17 ? 70   PHE A CZ  1 
ATOM   568  N N   . GLU A 1 90  ? -10.544 17.053 32.329 1.00 22.89 ? 71   GLU A N   1 
ATOM   569  C CA  . GLU A 1 90  ? -10.991 16.239 31.174 1.00 24.88 ? 71   GLU A CA  1 
ATOM   570  C C   . GLU A 1 90  ? -10.482 14.822 31.237 1.00 21.56 ? 71   GLU A C   1 
ATOM   571  O O   . GLU A 1 90  ? -11.233 13.873 31.028 1.00 21.39 ? 71   GLU A O   1 
ATOM   572  C CB  . GLU A 1 90  ? -10.498 16.832 29.854 1.00 24.23 ? 71   GLU A CB  1 
ATOM   573  C CG  . GLU A 1 90  ? -11.074 18.174 29.540 1.00 31.57 ? 71   GLU A CG  1 
ATOM   574  C CD  . GLU A 1 90  ? -10.674 18.692 28.116 1.00 33.60 ? 71   GLU A CD  1 
ATOM   575  O OE1 . GLU A 1 90  ? -10.334 19.914 28.010 1.00 45.34 ? 71   GLU A OE1 1 
ATOM   576  O OE2 . GLU A 1 90  ? -10.685 17.876 27.128 1.00 42.08 ? 71   GLU A OE2 1 
ATOM   577  N N   . LEU A 1 91  ? -9.197  14.655 31.532 1.00 21.19 ? 72   LEU A N   1 
ATOM   578  C CA  . LEU A 1 91  ? -8.620  13.308 31.573 1.00 21.56 ? 72   LEU A CA  1 
ATOM   579  C C   . LEU A 1 91  ? -9.149  12.490 32.762 1.00 21.92 ? 72   LEU A C   1 
ATOM   580  O O   . LEU A 1 91  ? -9.319  11.247 32.644 1.00 21.80 ? 72   LEU A O   1 
ATOM   581  C CB  . LEU A 1 91  ? -7.106  13.367 31.581 1.00 21.90 ? 72   LEU A CB  1 
ATOM   582  C CG  . LEU A 1 91  ? -6.460  13.990 30.304 1.00 23.18 ? 72   LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 91  ? -4.961  14.088 30.541 1.00 23.78 ? 72   LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 91  ? -6.768  13.202 29.017 1.00 21.54 ? 72   LEU A CD2 1 
ATOM   585  N N   . THR A 1 92  ? -9.459  13.175 33.870 1.00 20.85 ? 73   THR A N   1 
ATOM   586  C CA  . THR A 1 92  ? -10.025 12.473 35.059 1.00 21.67 ? 73   THR A CA  1 
ATOM   587  C C   . THR A 1 92  ? -11.428 12.026 34.788 1.00 21.12 ? 73   THR A C   1 
ATOM   588  O O   . THR A 1 92  ? -11.785 10.886 35.059 1.00 21.85 ? 73   THR A O   1 
ATOM   589  C CB  . THR A 1 92  ? -10.012 13.366 36.321 1.00 21.80 ? 73   THR A CB  1 
ATOM   590  O OG1 . THR A 1 92  ? -8.665  13.776 36.551 1.00 24.57 ? 73   THR A OG1 1 
ATOM   591  C CG2 . THR A 1 92  ? -10.605 12.620 37.581 1.00 19.57 ? 73   THR A CG2 1 
ATOM   592  N N   . VAL A 1 93  ? -12.226 12.925 34.232 1.00 21.36 ? 74   VAL A N   1 
ATOM   593  C CA  . VAL A 1 93  ? -13.551 12.530 33.736 1.00 21.80 ? 74   VAL A CA  1 
ATOM   594  C C   . VAL A 1 93  ? -13.508 11.331 32.778 1.00 21.97 ? 74   VAL A C   1 
ATOM   595  O O   . VAL A 1 93  ? -14.250 10.374 32.966 1.00 22.47 ? 74   VAL A O   1 
ATOM   596  C CB  . VAL A 1 93  ? -14.311 13.751 33.134 1.00 22.80 ? 74   VAL A CB  1 
ATOM   597  C CG1 . VAL A 1 93  ? -15.479 13.309 32.265 1.00 22.71 ? 74   VAL A CG1 1 
ATOM   598  C CG2 . VAL A 1 93  ? -14.757 14.694 34.288 1.00 19.97 ? 74   VAL A CG2 1 
ATOM   599  N N   A GLU A 1 94  ? -12.630 11.387 31.780 0.50 21.64 ? 75   GLU A N   1 
ATOM   600  N N   B GLU A 1 94  ? -12.636 11.400 31.766 0.50 21.12 ? 75   GLU A N   1 
ATOM   601  C CA  A GLU A 1 94  ? -12.485 10.319 30.811 0.50 21.65 ? 75   GLU A CA  1 
ATOM   602  C CA  B GLU A 1 94  ? -12.443 10.326 30.798 0.50 20.40 ? 75   GLU A CA  1 
ATOM   603  C C   A GLU A 1 94  ? -12.122 9.000  31.481 0.50 20.45 ? 75   GLU A C   1 
ATOM   604  C C   B GLU A 1 94  ? -12.154 9.011  31.511 0.50 19.86 ? 75   GLU A C   1 
ATOM   605  O O   A GLU A 1 94  ? -12.657 7.963  31.121 0.50 19.71 ? 75   GLU A O   1 
ATOM   606  O O   B GLU A 1 94  ? -12.752 7.989  31.195 0.50 19.07 ? 75   GLU A O   1 
ATOM   607  C CB  A GLU A 1 94  ? -11.492 10.713 29.715 0.50 21.19 ? 75   GLU A CB  1 
ATOM   608  C CB  B GLU A 1 94  ? -11.328 10.660 29.788 0.50 20.08 ? 75   GLU A CB  1 
ATOM   609  C CG  A GLU A 1 94  ? -12.097 11.679 28.710 0.50 23.06 ? 75   GLU A CG  1 
ATOM   610  C CG  B GLU A 1 94  ? -10.830 9.428  29.015 0.50 20.66 ? 75   GLU A CG  1 
ATOM   611  C CD  A GLU A 1 94  ? -11.131 12.138 27.622 0.50 24.46 ? 75   GLU A CD  1 
ATOM   612  C CD  B GLU A 1 94  ? -9.777  9.718  27.957 0.50 20.62 ? 75   GLU A CD  1 
ATOM   613  O OE1 A GLU A 1 94  ? -10.002 11.598 27.519 0.50 27.83 ? 75   GLU A OE1 1 
ATOM   614  O OE1 B GLU A 1 94  ? -8.680  10.234 28.273 0.50 15.43 ? 75   GLU A OE1 1 
ATOM   615  O OE2 A GLU A 1 94  ? -11.514 13.057 26.861 0.50 27.58 ? 75   GLU A OE2 1 
ATOM   616  O OE2 B GLU A 1 94  ? -10.041 9.364  26.791 0.50 20.85 ? 75   GLU A OE2 1 
ATOM   617  N N   . ARG A 1 95  ? -11.249 9.061  32.483 1.00 20.27 ? 76   ARG A N   1 
ATOM   618  C CA  . ARG A 1 95  ? -10.876 7.875  33.298 1.00 20.35 ? 76   ARG A CA  1 
ATOM   619  C C   . ARG A 1 95  ? -12.088 7.310  34.105 1.00 20.65 ? 76   ARG A C   1 
ATOM   620  O O   . ARG A 1 95  ? -12.359 6.112  34.081 1.00 20.26 ? 76   ARG A O   1 
ATOM   621  C CB  . ARG A 1 95  ? -9.662  8.211  34.221 1.00 19.48 ? 76   ARG A CB  1 
ATOM   622  C CG  . ARG A 1 95  ? -9.284  7.097  35.217 1.00 19.08 ? 76   ARG A CG  1 
ATOM   623  C CD  . ARG A 1 95  ? -8.996  5.747  34.505 1.00 21.46 ? 76   ARG A CD  1 
ATOM   624  N NE  . ARG A 1 95  ? -8.674  4.733  35.504 1.00 20.86 ? 76   ARG A NE  1 
ATOM   625  C CZ  . ARG A 1 95  ? -8.355  3.466  35.231 1.00 25.98 ? 76   ARG A CZ  1 
ATOM   626  N NH1 . ARG A 1 95  ? -8.344  3.016  33.958 1.00 21.89 ? 76   ARG A NH1 1 
ATOM   627  N NH2 . ARG A 1 95  ? -8.086  2.645  36.250 1.00 23.73 ? 76   ARG A NH2 1 
ATOM   628  N N   . LEU A 1 96  ? -12.834 8.188  34.773 1.00 20.61 ? 77   LEU A N   1 
ATOM   629  C CA  . LEU A 1 96  ? -14.074 7.748  35.475 1.00 20.85 ? 77   LEU A CA  1 
ATOM   630  C C   . LEU A 1 96  ? -15.102 7.099  34.546 1.00 21.01 ? 77   LEU A C   1 
ATOM   631  O O   . LEU A 1 96  ? -15.640 6.038  34.874 1.00 20.36 ? 77   LEU A O   1 
ATOM   632  C CB  . LEU A 1 96  ? -14.719 8.903  36.225 1.00 19.38 ? 77   LEU A CB  1 
ATOM   633  C CG  . LEU A 1 96  ? -13.967 9.453  37.456 1.00 21.34 ? 77   LEU A CG  1 
ATOM   634  C CD1 . LEU A 1 96  ? -14.758 10.648 37.934 1.00 20.71 ? 77   LEU A CD1 1 
ATOM   635  C CD2 . LEU A 1 96  ? -13.874 8.373  38.558 1.00 16.02 ? 77   LEU A CD2 1 
ATOM   636  N N   . VAL A 1 97  ? -15.386 7.737  33.405 1.00 21.41 ? 78   VAL A N   1 
ATOM   637  C CA  . VAL A 1 97  ? -16.277 7.154  32.405 1.00 22.13 ? 78   VAL A CA  1 
ATOM   638  C C   . VAL A 1 97  ? -15.780 5.787  31.925 1.00 23.37 ? 78   VAL A C   1 
ATOM   639  O O   . VAL A 1 97  ? -16.545 4.851  31.804 1.00 23.86 ? 78   VAL A O   1 
ATOM   640  C CB  . VAL A 1 97  ? -16.552 8.101  31.212 1.00 22.08 ? 78   VAL A CB  1 
ATOM   641  C CG1 . VAL A 1 97  ? -17.437 7.386  30.105 1.00 21.89 ? 78   VAL A CG1 1 
ATOM   642  C CG2 . VAL A 1 97  ? -17.233 9.337  31.695 1.00 19.96 ? 78   VAL A CG2 1 
ATOM   643  N N   . SER A 1 98  ? -14.494 5.655  31.651 1.00 25.19 ? 79   SER A N   1 
ATOM   644  C CA  . SER A 1 98  ? -14.006 4.362  31.181 1.00 26.24 ? 79   SER A CA  1 
ATOM   645  C C   . SER A 1 98  ? -14.082 3.227  32.247 1.00 26.80 ? 79   SER A C   1 
ATOM   646  O O   . SER A 1 98  ? -14.145 2.049  31.881 1.00 26.77 ? 79   SER A O   1 
ATOM   647  C CB  . SER A 1 98  ? -12.604 4.485  30.597 1.00 26.44 ? 79   SER A CB  1 
ATOM   648  O OG  . SER A 1 98  ? -11.653 4.435  31.617 1.00 29.26 ? 79   SER A OG  1 
ATOM   649  N N   . ILE A 1 99  ? -14.086 3.565  33.540 1.00 27.24 ? 80   ILE A N   1 
ATOM   650  C CA  . ILE A 1 99  ? -14.289 2.519  34.567 1.00 28.23 ? 80   ILE A CA  1 
ATOM   651  C C   . ILE A 1 99  ? -15.773 2.317  34.904 1.00 27.45 ? 80   ILE A C   1 
ATOM   652  O O   . ILE A 1 99  ? -16.097 1.508  35.747 1.00 28.24 ? 80   ILE A O   1 
ATOM   653  C CB  . ILE A 1 99  ? -13.420 2.692  35.868 1.00 28.72 ? 80   ILE A CB  1 
ATOM   654  C CG1 . ILE A 1 99  ? -13.711 4.013  36.583 1.00 29.87 ? 80   ILE A CG1 1 
ATOM   655  C CG2 . ILE A 1 99  ? -11.901 2.520  35.564 1.00 30.78 ? 80   ILE A CG2 1 
ATOM   656  C CD1 . ILE A 1 99  ? -13.565 3.960  38.047 1.00 30.44 ? 80   ILE A CD1 1 
ATOM   657  N N   . GLY A 1 100 ? -16.665 3.047  34.233 1.00 26.93 ? 81   GLY A N   1 
ATOM   658  C CA  . GLY A 1 100 ? -18.093 2.761  34.289 1.00 26.15 ? 81   GLY A CA  1 
ATOM   659  C C   . GLY A 1 100 ? -19.007 3.809  34.886 1.00 25.69 ? 81   GLY A C   1 
ATOM   660  O O   . GLY A 1 100 ? -20.181 3.527  35.068 1.00 24.83 ? 81   GLY A O   1 
ATOM   661  N N   . TYR A 1 101 ? -18.486 5.004  35.207 1.00 24.60 ? 82   TYR A N   1 
ATOM   662  C CA  . TYR A 1 101 ? -19.339 6.157  35.551 1.00 24.17 ? 82   TYR A CA  1 
ATOM   663  C C   . TYR A 1 101 ? -20.192 6.586  34.341 1.00 25.23 ? 82   TYR A C   1 
ATOM   664  O O   . TYR A 1 101 ? -19.789 6.392  33.168 1.00 23.55 ? 82   TYR A O   1 
ATOM   665  C CB  . TYR A 1 101 ? -18.490 7.344  36.094 1.00 24.88 ? 82   TYR A CB  1 
ATOM   666  C CG  . TYR A 1 101 ? -18.224 7.221  37.576 1.00 26.02 ? 82   TYR A CG  1 
ATOM   667  C CD1 . TYR A 1 101 ? -17.397 6.211  38.068 1.00 26.03 ? 82   TYR A CD1 1 
ATOM   668  C CD2 . TYR A 1 101 ? -18.826 8.097  38.501 1.00 28.36 ? 82   TYR A CD2 1 
ATOM   669  C CE1 . TYR A 1 101 ? -17.190 6.047  39.466 1.00 26.94 ? 82   TYR A CE1 1 
ATOM   670  C CE2 . TYR A 1 101 ? -18.593 7.969  39.889 1.00 27.59 ? 82   TYR A CE2 1 
ATOM   671  C CZ  . TYR A 1 101 ? -17.787 6.927  40.348 1.00 27.57 ? 82   TYR A CZ  1 
ATOM   672  O OH  . TYR A 1 101 ? -17.571 6.764  41.691 1.00 30.62 ? 82   TYR A OH  1 
ATOM   673  N N   . PRO A 1 102 ? -21.393 7.135  34.606 1.00 25.32 ? 83   PRO A N   1 
ATOM   674  C CA  . PRO A 1 102 ? -22.269 7.451  33.480 1.00 26.14 ? 83   PRO A CA  1 
ATOM   675  C C   . PRO A 1 102 ? -21.705 8.431  32.426 1.00 26.27 ? 83   PRO A C   1 
ATOM   676  O O   . PRO A 1 102 ? -20.825 9.264  32.702 1.00 25.24 ? 83   PRO A O   1 
ATOM   677  C CB  . PRO A 1 102 ? -23.541 8.002  34.164 1.00 25.77 ? 83   PRO A CB  1 
ATOM   678  C CG  . PRO A 1 102 ? -23.118 8.368  35.555 1.00 26.71 ? 83   PRO A CG  1 
ATOM   679  C CD  . PRO A 1 102 ? -22.023 7.443  35.909 1.00 26.24 ? 83   PRO A CD  1 
ATOM   680  N N   . GLN A 1 103 ? -22.234 8.300  31.220 1.00 27.25 ? 84   GLN A N   1 
ATOM   681  C CA  . GLN A 1 103 ? -21.864 9.092  30.073 1.00 28.66 ? 84   GLN A CA  1 
ATOM   682  C C   . GLN A 1 103 ? -22.032 10.583 30.257 1.00 27.89 ? 84   GLN A C   1 
ATOM   683  O O   . GLN A 1 103 ? -21.299 11.332 29.666 1.00 27.79 ? 84   GLN A O   1 
ATOM   684  C CB  . GLN A 1 103 ? -22.720 8.646  28.875 1.00 30.00 ? 84   GLN A CB  1 
ATOM   685  C CG  . GLN A 1 103 ? -22.322 7.262  28.358 1.00 35.11 ? 84   GLN A CG  1 
ATOM   686  C CD  . GLN A 1 103 ? -21.009 7.284  27.600 1.00 39.57 ? 84   GLN A CD  1 
ATOM   687  O OE1 . GLN A 1 103 ? -20.943 7.780  26.469 1.00 44.95 ? 84   GLN A OE1 1 
ATOM   688  N NE2 . GLN A 1 103 ? -19.976 6.704  28.186 1.00 38.15 ? 84   GLN A NE2 1 
ATOM   689  N N   . GLU A 1 104 ? -22.993 10.997 31.081 1.00 28.56 ? 85   GLU A N   1 
ATOM   690  C CA  . GLU A 1 104 ? -23.276 12.404 31.321 1.00 28.59 ? 85   GLU A CA  1 
ATOM   691  C C   . GLU A 1 104 ? -22.111 13.206 31.853 1.00 28.26 ? 85   GLU A C   1 
ATOM   692  O O   . GLU A 1 104 ? -22.046 14.415 31.607 1.00 28.66 ? 85   GLU A O   1 
ATOM   693  C CB  . GLU A 1 104 ? -24.458 12.575 32.253 1.00 29.62 ? 85   GLU A CB  1 
ATOM   694  C CG  . GLU A 1 104 ? -25.766 12.212 31.589 1.00 31.96 ? 85   GLU A CG  1 
ATOM   695  C CD  . GLU A 1 104 ? -26.290 10.821 31.967 1.00 36.60 ? 85   GLU A CD  1 
ATOM   696  O OE1 . GLU A 1 104 ? -25.541 9.961  32.493 1.00 35.54 ? 85   GLU A OE1 1 
ATOM   697  O OE2 . GLU A 1 104 ? -27.494 10.598 31.735 1.00 40.18 ? 85   GLU A OE2 1 
ATOM   698  N N   . LEU A 1 105 ? -21.196 12.548 32.575 1.00 26.49 ? 86   LEU A N   1 
ATOM   699  C CA  . LEU A 1 105 ? -19.943 13.156 32.984 1.00 25.52 ? 86   LEU A CA  1 
ATOM   700  C C   . LEU A 1 105 ? -19.221 13.869 31.838 1.00 24.72 ? 86   LEU A C   1 
ATOM   701  O O   . LEU A 1 105 ? -18.571 14.895 32.067 1.00 23.91 ? 86   LEU A O   1 
ATOM   702  C CB  . LEU A 1 105 ? -19.001 12.110 33.584 1.00 24.87 ? 86   LEU A CB  1 
ATOM   703  C CG  . LEU A 1 105 ? -19.116 11.840 35.081 1.00 27.07 ? 86   LEU A CG  1 
ATOM   704  C CD1 . LEU A 1 105 ? -20.448 11.262 35.476 1.00 27.49 ? 86   LEU A CD1 1 
ATOM   705  C CD2 . LEU A 1 105 ? -17.937 10.943 35.558 1.00 27.04 ? 86   LEU A CD2 1 
ATOM   706  N N   . LEU A 1 106 ? -19.311 13.307 30.638 1.00 24.66 ? 87   LEU A N   1 
ATOM   707  C CA  . LEU A 1 106 ? -18.679 13.909 29.451 1.00 25.89 ? 87   LEU A CA  1 
ATOM   708  C C   . LEU A 1 106 ? -19.195 15.314 29.135 1.00 26.08 ? 87   LEU A C   1 
ATOM   709  O O   . LEU A 1 106 ? -18.533 16.061 28.426 1.00 27.25 ? 87   LEU A O   1 
ATOM   710  C CB  . LEU A 1 106 ? -18.818 13.005 28.212 1.00 25.59 ? 87   LEU A CB  1 
ATOM   711  C CG  . LEU A 1 106 ? -18.177 11.605 28.315 1.00 25.83 ? 87   LEU A CG  1 
ATOM   712  C CD1 . LEU A 1 106 ? -18.328 10.775 26.989 1.00 25.13 ? 87   LEU A CD1 1 
ATOM   713  C CD2 . LEU A 1 106 ? -16.724 11.670 28.786 1.00 23.41 ? 87   LEU A CD2 1 
ATOM   714  N N   . SER A 1 107 ? -20.347 15.688 29.679 1.00 26.19 ? 88   SER A N   1 
ATOM   715  C CA  . SER A 1 107 ? -20.908 16.999 29.387 1.00 27.79 ? 88   SER A CA  1 
ATOM   716  C C   . SER A 1 107 ? -20.500 18.055 30.467 1.00 28.44 ? 88   SER A C   1 
ATOM   717  O O   . SER A 1 107 ? -20.900 19.252 30.376 1.00 28.69 ? 88   SER A O   1 
ATOM   718  C CB  . SER A 1 107 ? -22.433 16.879 29.194 1.00 28.11 ? 88   SER A CB  1 
ATOM   719  O OG  . SER A 1 107 ? -23.013 16.779 30.493 1.00 32.47 ? 88   SER A OG  1 
ATOM   720  N N   . PHE A 1 108 ? -19.696 17.631 31.471 1.00 26.75 ? 89   PHE A N   1 
ATOM   721  C CA  . PHE A 1 108 ? -19.127 18.573 32.458 1.00 25.41 ? 89   PHE A CA  1 
ATOM   722  C C   . PHE A 1 108 ? -18.045 19.394 31.731 1.00 24.47 ? 89   PHE A C   1 
ATOM   723  O O   . PHE A 1 108 ? -17.425 18.913 30.804 1.00 23.81 ? 89   PHE A O   1 
ATOM   724  C CB  . PHE A 1 108 ? -18.426 17.865 33.638 1.00 24.56 ? 89   PHE A CB  1 
ATOM   725  C CG  . PHE A 1 108 ? -19.309 16.967 34.498 1.00 24.51 ? 89   PHE A CG  1 
ATOM   726  C CD1 . PHE A 1 108 ? -20.699 16.982 34.412 1.00 26.83 ? 89   PHE A CD1 1 
ATOM   727  C CD2 . PHE A 1 108 ? -18.702 16.116 35.441 1.00 24.29 ? 89   PHE A CD2 1 
ATOM   728  C CE1 . PHE A 1 108 ? -21.509 16.116 35.227 1.00 24.44 ? 89   PHE A CE1 1 
ATOM   729  C CE2 . PHE A 1 108 ? -19.490 15.257 36.291 1.00 24.70 ? 89   PHE A CE2 1 
ATOM   730  C CZ  . PHE A 1 108 ? -20.909 15.272 36.171 1.00 26.23 ? 89   PHE A CZ  1 
ATOM   731  N N   . ALA A 1 109 ? -17.828 20.633 32.132 1.00 24.14 ? 90   ALA A N   1 
ATOM   732  C CA  . ALA A 1 109 ? -16.692 21.394 31.614 1.00 24.84 ? 90   ALA A CA  1 
ATOM   733  C C   . ALA A 1 109 ? -16.094 22.120 32.790 1.00 24.44 ? 90   ALA A C   1 
ATOM   734  O O   . ALA A 1 109 ? -16.831 22.686 33.594 1.00 24.48 ? 90   ALA A O   1 
ATOM   735  C CB  . ALA A 1 109 ? -17.113 22.386 30.511 1.00 24.26 ? 90   ALA A CB  1 
ATOM   736  N N   . TYR A 1 110 ? -14.766 22.090 32.899 1.00 25.40 ? 91   TYR A N   1 
ATOM   737  C CA  . TYR A 1 110 ? -14.064 22.749 34.040 1.00 25.45 ? 91   TYR A CA  1 
ATOM   738  C C   . TYR A 1 110 ? -14.487 24.228 34.136 1.00 25.89 ? 91   TYR A C   1 
ATOM   739  O O   . TYR A 1 110 ? -14.554 24.913 33.141 1.00 24.34 ? 91   TYR A O   1 
ATOM   740  C CB  . TYR A 1 110 ? -12.553 22.632 33.944 1.00 25.01 ? 91   TYR A CB  1 
ATOM   741  C CG  . TYR A 1 110 ? -11.827 23.216 35.145 1.00 25.89 ? 91   TYR A CG  1 
ATOM   742  C CD1 . TYR A 1 110 ? -11.861 22.556 36.405 1.00 23.32 ? 91   TYR A CD1 1 
ATOM   743  C CD2 . TYR A 1 110 ? -11.139 24.439 35.051 1.00 25.73 ? 91   TYR A CD2 1 
ATOM   744  C CE1 . TYR A 1 110 ? -11.226 23.074 37.508 1.00 25.95 ? 91   TYR A CE1 1 
ATOM   745  C CE2 . TYR A 1 110 ? -10.470 24.982 36.183 1.00 25.57 ? 91   TYR A CE2 1 
ATOM   746  C CZ  . TYR A 1 110 ? -10.521 24.283 37.397 1.00 27.28 ? 91   TYR A CZ  1 
ATOM   747  O OH  . TYR A 1 110 ? -9.877  24.775 38.524 1.00 28.34 ? 91   TYR A OH  1 
ATOM   748  N N   . ASP A 1 111 ? -14.752 24.689 35.353 1.00 25.04 ? 92   ASP A N   1 
ATOM   749  C CA  . ASP A 1 111 ? -15.125 26.065 35.588 1.00 26.59 ? 92   ASP A CA  1 
ATOM   750  C C   . ASP A 1 111 ? -14.177 26.594 36.665 1.00 26.19 ? 92   ASP A C   1 
ATOM   751  O O   . ASP A 1 111 ? -14.293 26.238 37.848 1.00 25.03 ? 92   ASP A O   1 
ATOM   752  C CB  . ASP A 1 111 ? -16.574 26.101 36.059 1.00 26.72 ? 92   ASP A CB  1 
ATOM   753  C CG  . ASP A 1 111 ? -17.052 27.507 36.500 1.00 33.52 ? 92   ASP A CG  1 
ATOM   754  O OD1 . ASP A 1 111 ? -16.445 28.565 36.179 1.00 33.00 ? 92   ASP A OD1 1 
ATOM   755  O OD2 . ASP A 1 111 ? -18.087 27.509 37.218 1.00 40.59 ? 92   ASP A OD2 1 
ATOM   756  N N   . SER A 1 112 ? -13.237 27.420 36.248 1.00 25.54 ? 93   SER A N   1 
ATOM   757  C CA  . SER A 1 112 ? -12.242 27.964 37.137 1.00 26.31 ? 93   SER A CA  1 
ATOM   758  C C   . SER A 1 112 ? -12.842 28.973 38.153 1.00 26.46 ? 93   SER A C   1 
ATOM   759  O O   . SER A 1 112 ? -12.191 29.297 39.115 1.00 28.20 ? 93   SER A O   1 
ATOM   760  C CB  . SER A 1 112 ? -11.121 28.637 36.330 1.00 26.07 ? 93   SER A CB  1 
ATOM   761  O OG  . SER A 1 112 ? -11.612 29.838 35.745 1.00 28.12 ? 93   SER A OG  1 
ATOM   762  N N   . THR A 1 113 ? -14.058 29.460 37.958 1.00 26.03 ? 94   THR A N   1 
ATOM   763  C CA  . THR A 1 113 ? -14.659 30.363 38.942 1.00 26.63 ? 94   THR A CA  1 
ATOM   764  C C   . THR A 1 113 ? -15.263 29.651 40.181 1.00 27.24 ? 94   THR A C   1 
ATOM   765  O O   . THR A 1 113 ? -15.628 30.316 41.150 1.00 28.85 ? 94   THR A O   1 
ATOM   766  C CB  . THR A 1 113 ? -15.745 31.256 38.343 1.00 26.27 ? 94   THR A CB  1 
ATOM   767  O OG1 . THR A 1 113 ? -16.924 30.474 38.078 1.00 25.96 ? 94   THR A OG1 1 
ATOM   768  C CG2 . THR A 1 113 ? -15.239 31.981 37.073 1.00 27.71 ? 94   THR A CG2 1 
ATOM   769  N N   . PHE A 1 114 ? -15.405 28.327 40.152 1.00 26.27 ? 95   PHE A N   1 
ATOM   770  C CA  . PHE A 1 114 ? -15.879 27.621 41.356 1.00 25.70 ? 95   PHE A CA  1 
ATOM   771  C C   . PHE A 1 114 ? -14.801 27.321 42.439 1.00 26.36 ? 95   PHE A C   1 
ATOM   772  O O   . PHE A 1 114 ? -14.980 27.740 43.590 1.00 28.58 ? 95   PHE A O   1 
ATOM   773  C CB  . PHE A 1 114 ? -16.643 26.341 41.009 1.00 22.16 ? 95   PHE A CB  1 
ATOM   774  C CG  . PHE A 1 114 ? -17.135 25.560 42.227 1.00 22.45 ? 95   PHE A CG  1 
ATOM   775  C CD1 . PHE A 1 114 ? -18.338 25.878 42.837 1.00 21.29 ? 95   PHE A CD1 1 
ATOM   776  C CD2 . PHE A 1 114 ? -16.384 24.471 42.745 1.00 20.89 ? 95   PHE A CD2 1 
ATOM   777  C CE1 . PHE A 1 114 ? -18.793 25.133 43.982 1.00 21.86 ? 95   PHE A CE1 1 
ATOM   778  C CE2 . PHE A 1 114 ? -16.811 23.770 43.867 1.00 17.94 ? 95   PHE A CE2 1 
ATOM   779  C CZ  . PHE A 1 114 ? -18.028 24.078 44.467 1.00 20.00 ? 95   PHE A CZ  1 
ATOM   780  N N   . PRO A 1 115 ? -13.748 26.552 42.106 1.00 26.72 ? 96   PRO A N   1 
ATOM   781  C CA  . PRO A 1 115 ? -12.919 26.006 43.196 1.00 27.80 ? 96   PRO A CA  1 
ATOM   782  C C   . PRO A 1 115 ? -11.917 27.026 43.703 1.00 28.78 ? 96   PRO A C   1 
ATOM   783  O O   . PRO A 1 115 ? -11.398 27.865 42.927 1.00 28.68 ? 96   PRO A O   1 
ATOM   784  C CB  . PRO A 1 115 ? -12.185 24.834 42.549 1.00 26.95 ? 96   PRO A CB  1 
ATOM   785  C CG  . PRO A 1 115 ? -12.062 25.229 41.090 1.00 27.07 ? 96   PRO A CG  1 
ATOM   786  C CD  . PRO A 1 115 ? -13.272 26.081 40.777 1.00 27.17 ? 96   PRO A CD  1 
ATOM   787  N N   . THR A 1 116 ? -11.749 26.999 45.015 1.00 28.36 ? 97   THR A N   1 
ATOM   788  C CA  . THR A 1 116 ? -10.688 27.729 45.686 1.00 27.06 ? 97   THR A CA  1 
ATOM   789  C C   . THR A 1 116 ? -9.889  26.627 46.304 1.00 25.13 ? 97   THR A C   1 
ATOM   790  O O   . THR A 1 116 ? -10.435 25.623 46.662 1.00 25.25 ? 97   THR A O   1 
ATOM   791  C CB  . THR A 1 116 ? -11.268 28.686 46.766 1.00 27.91 ? 97   THR A CB  1 
ATOM   792  O OG1 . THR A 1 116 ? -12.002 29.708 46.094 1.00 28.66 ? 97   THR A OG1 1 
ATOM   793  C CG2 . THR A 1 116 ? -10.153 29.369 47.602 1.00 25.74 ? 97   THR A CG2 1 
ATOM   794  N N   . ARG A 1 117 ? -8.579  26.801 46.354 1.00 24.86 ? 98   ARG A N   1 
ATOM   795  C CA  . ARG A 1 117 ? -7.720  25.836 46.999 1.00 25.83 ? 98   ARG A CA  1 
ATOM   796  C C   . ARG A 1 117 ? -7.910  25.784 48.536 1.00 25.24 ? 98   ARG A C   1 
ATOM   797  O O   . ARG A 1 117 ? -8.223  26.809 49.151 1.00 25.10 ? 98   ARG A O   1 
ATOM   798  C CB  . ARG A 1 117 ? -6.272  26.141 46.671 1.00 25.05 ? 98   ARG A CB  1 
ATOM   799  C CG  . ARG A 1 117 ? -5.359  25.015 47.049 1.00 26.15 ? 98   ARG A CG  1 
ATOM   800  C CD  . ARG A 1 117 ? -4.116  25.021 46.166 1.00 26.01 ? 98   ARG A CD  1 
ATOM   801  N NE  . ARG A 1 117 ? -3.373  26.299 46.161 1.00 25.49 ? 98   ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 117 ? -2.168  26.457 46.687 1.00 21.22 ? 98   ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 117 ? -1.583  25.435 47.341 1.00 21.25 ? 98   ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 117 ? -1.541  27.609 46.548 1.00 21.82 ? 98   ARG A NH2 1 
ATOM   805  N N   . GLY A 1 118 ? -7.730  24.588 49.110 1.00 25.50 ? 99   GLY A N   1 
ATOM   806  C CA  . GLY A 1 118 ? -7.746  24.378 50.564 1.00 24.43 ? 99   GLY A CA  1 
ATOM   807  C C   . GLY A 1 118 ? -9.079  23.956 51.123 1.00 24.20 ? 99   GLY A C   1 
ATOM   808  O O   . GLY A 1 118 ? -9.254  23.886 52.329 1.00 24.88 ? 99   GLY A O   1 
ATOM   809  N N   . LEU A 1 119 ? -10.023 23.625 50.252 1.00 23.57 ? 100  LEU A N   1 
ATOM   810  C CA  . LEU A 1 119 ? -11.343 23.213 50.711 1.00 23.21 ? 100  LEU A CA  1 
ATOM   811  C C   . LEU A 1 119 ? -11.250 21.829 51.320 1.00 23.31 ? 100  LEU A C   1 
ATOM   812  O O   . LEU A 1 119 ? -10.368 21.047 50.983 1.00 23.02 ? 100  LEU A O   1 
ATOM   813  C CB  . LEU A 1 119 ? -12.384 23.263 49.576 1.00 21.05 ? 100  LEU A CB  1 
ATOM   814  C CG  . LEU A 1 119 ? -12.663 24.676 48.999 1.00 24.12 ? 100  LEU A CG  1 
ATOM   815  C CD1 . LEU A 1 119 ? -13.710 24.602 47.864 1.00 22.68 ? 100  LEU A CD1 1 
ATOM   816  C CD2 . LEU A 1 119 ? -13.076 25.769 50.017 1.00 19.85 ? 100  LEU A CD2 1 
ATOM   817  N N   . VAL A 1 120 ? -12.183 21.523 52.215 1.00 22.88 ? 101  VAL A N   1 
ATOM   818  C CA  . VAL A 1 120 ? -12.271 20.190 52.814 1.00 22.47 ? 101  VAL A CA  1 
ATOM   819  C C   . VAL A 1 120 ? -13.444 19.432 52.204 1.00 22.52 ? 101  VAL A C   1 
ATOM   820  O O   . VAL A 1 120 ? -14.567 19.951 52.196 1.00 22.16 ? 101  VAL A O   1 
ATOM   821  C CB  . VAL A 1 120 ? -12.511 20.349 54.359 1.00 23.53 ? 101  VAL A CB  1 
ATOM   822  C CG1 . VAL A 1 120 ? -12.600 18.975 55.065 1.00 24.37 ? 101  VAL A CG1 1 
ATOM   823  C CG2 . VAL A 1 120 ? -11.367 21.261 54.980 1.00 23.18 ? 101  VAL A CG2 1 
ATOM   824  N N   . PHE A 1 121 ? -13.223 18.207 51.724 1.00 21.13 ? 102  PHE A N   1 
ATOM   825  C CA  . PHE A 1 121 ? -14.363 17.392 51.316 1.00 21.35 ? 102  PHE A CA  1 
ATOM   826  C C   . PHE A 1 121 ? -14.803 16.518 52.490 1.00 21.95 ? 102  PHE A C   1 
ATOM   827  O O   . PHE A 1 121 ? -14.009 15.745 53.025 1.00 21.66 ? 102  PHE A O   1 
ATOM   828  C CB  . PHE A 1 121 ? -14.071 16.475 50.104 1.00 21.19 ? 102  PHE A CB  1 
ATOM   829  C CG  . PHE A 1 121 ? -15.315 15.846 49.521 1.00 21.84 ? 102  PHE A CG  1 
ATOM   830  C CD1 . PHE A 1 121 ? -16.265 16.643 48.859 1.00 22.23 ? 102  PHE A CD1 1 
ATOM   831  C CD2 . PHE A 1 121 ? -15.575 14.486 49.683 1.00 23.66 ? 102  PHE A CD2 1 
ATOM   832  C CE1 . PHE A 1 121 ? -17.442 16.089 48.344 1.00 23.96 ? 102  PHE A CE1 1 
ATOM   833  C CE2 . PHE A 1 121 ? -16.750 13.912 49.170 1.00 22.49 ? 102  PHE A CE2 1 
ATOM   834  C CZ  . PHE A 1 121 ? -17.671 14.723 48.486 1.00 22.34 ? 102  PHE A CZ  1 
ATOM   835  N N   . ASP A 1 122 ? -16.064 16.667 52.900 1.00 21.20 ? 103  ASP A N   1 
ATOM   836  C CA  . ASP A 1 122 ? -16.585 15.871 53.967 1.00 21.87 ? 103  ASP A CA  1 
ATOM   837  C C   . ASP A 1 122 ? -17.107 14.593 53.307 1.00 22.87 ? 103  ASP A C   1 
ATOM   838  O O   . ASP A 1 122 ? -18.115 14.638 52.608 1.00 22.89 ? 103  ASP A O   1 
ATOM   839  C CB  . ASP A 1 122 ? -17.712 16.610 54.714 1.00 21.40 ? 103  ASP A CB  1 
ATOM   840  C CG  . ASP A 1 122 ? -18.283 15.771 55.829 1.00 21.63 ? 103  ASP A CG  1 
ATOM   841  O OD1 . ASP A 1 122 ? -17.964 14.570 55.896 1.00 21.04 ? 103  ASP A OD1 1 
ATOM   842  O OD2 . ASP A 1 122 ? -19.087 16.287 56.609 1.00 21.80 ? 103  ASP A OD2 1 
ATOM   843  N N   . THR A 1 123 ? -16.389 13.468 53.464 1.00 24.17 ? 104  THR A N   1 
ATOM   844  C CA  . THR A 1 123 ? -16.793 12.249 52.752 1.00 24.46 ? 104  THR A CA  1 
ATOM   845  C C   . THR A 1 123 ? -18.054 11.563 53.343 1.00 24.99 ? 104  THR A C   1 
ATOM   846  O O   . THR A 1 123 ? -18.622 10.662 52.719 1.00 23.71 ? 104  THR A O   1 
ATOM   847  C CB  . THR A 1 123 ? -15.689 11.172 52.701 1.00 25.15 ? 104  THR A CB  1 
ATOM   848  O OG1 . THR A 1 123 ? -15.416 10.760 54.032 1.00 24.38 ? 104  THR A OG1 1 
ATOM   849  C CG2 . THR A 1 123 ? -14.386 11.648 51.990 1.00 24.42 ? 104  THR A CG2 1 
ATOM   850  N N   . LEU A 1 124 ? -18.465 11.954 54.561 1.00 24.44 ? 105  LEU A N   1 
ATOM   851  C CA  . LEU A 1 124 ? -19.670 11.376 55.135 1.00 23.32 ? 105  LEU A CA  1 
ATOM   852  C C   . LEU A 1 124 ? -20.894 11.991 54.452 1.00 23.45 ? 105  LEU A C   1 
ATOM   853  O O   . LEU A 1 124 ? -21.796 11.272 54.027 1.00 23.85 ? 105  LEU A O   1 
ATOM   854  C CB  . LEU A 1 124 ? -19.736 11.623 56.656 1.00 23.01 ? 105  LEU A CB  1 
ATOM   855  C CG  . LEU A 1 124 ? -20.883 10.968 57.434 1.00 24.67 ? 105  LEU A CG  1 
ATOM   856  C CD1 . LEU A 1 124 ? -20.820 9.432  57.306 1.00 24.32 ? 105  LEU A CD1 1 
ATOM   857  C CD2 . LEU A 1 124 ? -20.815 11.387 58.927 1.00 22.24 ? 105  LEU A CD2 1 
ATOM   858  N N   . TYR A 1 125 ? -20.939 13.322 54.371 1.00 22.64 ? 106  TYR A N   1 
ATOM   859  C CA  . TYR A 1 125 ? -22.139 14.005 53.891 1.00 22.45 ? 106  TYR A CA  1 
ATOM   860  C C   . TYR A 1 125 ? -22.039 14.626 52.514 1.00 21.84 ? 106  TYR A C   1 
ATOM   861  O O   . TYR A 1 125 ? -23.033 15.172 52.023 1.00 22.41 ? 106  TYR A O   1 
ATOM   862  C CB  . TYR A 1 125 ? -22.554 15.100 54.877 1.00 23.78 ? 106  TYR A CB  1 
ATOM   863  C CG  . TYR A 1 125 ? -22.969 14.564 56.212 1.00 25.49 ? 106  TYR A CG  1 
ATOM   864  C CD1 . TYR A 1 125 ? -23.843 13.476 56.315 1.00 26.44 ? 106  TYR A CD1 1 
ATOM   865  C CD2 . TYR A 1 125 ? -22.513 15.166 57.373 1.00 28.73 ? 106  TYR A CD2 1 
ATOM   866  C CE1 . TYR A 1 125 ? -24.241 12.979 57.562 1.00 28.76 ? 106  TYR A CE1 1 
ATOM   867  C CE2 . TYR A 1 125 ? -22.917 14.697 58.625 1.00 30.79 ? 106  TYR A CE2 1 
ATOM   868  C CZ  . TYR A 1 125 ? -23.771 13.605 58.706 1.00 28.45 ? 106  TYR A CZ  1 
ATOM   869  O OH  . TYR A 1 125 ? -24.130 13.162 59.956 1.00 30.97 ? 106  TYR A OH  1 
ATOM   870  N N   . GLY A 1 126 ? -20.857 14.548 51.906 1.00 21.06 ? 107  GLY A N   1 
ATOM   871  C CA  . GLY A 1 126 ? -20.674 14.969 50.513 1.00 21.39 ? 107  GLY A CA  1 
ATOM   872  C C   . GLY A 1 126 ? -20.615 16.461 50.312 1.00 22.17 ? 107  GLY A C   1 
ATOM   873  O O   . GLY A 1 126 ? -21.031 16.940 49.277 1.00 23.78 ? 107  GLY A O   1 
ATOM   874  N N   . ASN A 1 127 ? -20.090 17.200 51.287 1.00 21.37 ? 108  ASN A N   1 
ATOM   875  C CA  . ASN A 1 127 ? -20.048 18.668 51.242 1.00 21.91 ? 108  ASN A CA  1 
ATOM   876  C C   . ASN A 1 127 ? -18.614 19.098 51.040 1.00 21.32 ? 108  ASN A C   1 
ATOM   877  O O   . ASN A 1 127 ? -17.717 18.444 51.550 1.00 21.02 ? 108  ASN A O   1 
ATOM   878  C CB  . ASN A 1 127 ? -20.520 19.262 52.574 1.00 21.88 ? 108  ASN A CB  1 
ATOM   879  C CG  . ASN A 1 127 ? -21.968 18.970 52.839 1.00 24.74 ? 108  ASN A CG  1 
ATOM   880  O OD1 . ASN A 1 127 ? -22.778 19.070 51.919 1.00 26.16 ? 108  ASN A OD1 1 
ATOM   881  N ND2 . ASN A 1 127 ? -22.305 18.561 54.070 1.00 18.90 ? 108  ASN A ND2 1 
ATOM   882  N N   . LEU A 1 128 ? -18.416 20.189 50.303 1.00 20.74 ? 109  LEU A N   1 
ATOM   883  C CA  . LEU A 1 128 ? -17.149 20.930 50.347 1.00 21.71 ? 109  LEU A CA  1 
ATOM   884  C C   . LEU A 1 128 ? -17.230 22.041 51.409 1.00 21.85 ? 109  LEU A C   1 
ATOM   885  O O   . LEU A 1 128 ? -18.186 22.785 51.471 1.00 22.34 ? 109  LEU A O   1 
ATOM   886  C CB  . LEU A 1 128 ? -16.834 21.579 48.993 1.00 21.69 ? 109  LEU A CB  1 
ATOM   887  C CG  . LEU A 1 128 ? -16.243 20.639 47.949 1.00 21.67 ? 109  LEU A CG  1 
ATOM   888  C CD1 . LEU A 1 128 ? -16.226 21.404 46.636 1.00 23.03 ? 109  LEU A CD1 1 
ATOM   889  C CD2 . LEU A 1 128 ? -14.827 20.204 48.337 1.00 23.76 ? 109  LEU A CD2 1 
ATOM   890  N N   . LEU A 1 129 ? -16.183 22.179 52.205 1.00 21.84 ? 110  LEU A N   1 
ATOM   891  C CA  . LEU A 1 129 ? -16.210 23.112 53.303 1.00 22.15 ? 110  LEU A CA  1 
ATOM   892  C C   . LEU A 1 129 ? -14.999 24.015 53.229 1.00 21.48 ? 110  LEU A C   1 
ATOM   893  O O   . LEU A 1 129 ? -13.885 23.550 52.950 1.00 21.00 ? 110  LEU A O   1 
ATOM   894  C CB  . LEU A 1 129 ? -16.196 22.337 54.646 1.00 22.51 ? 110  LEU A CB  1 
ATOM   895  C CG  . LEU A 1 129 ? -17.227 21.192 54.802 1.00 22.94 ? 110  LEU A CG  1 
ATOM   896  C CD1 . LEU A 1 129 ? -16.896 20.372 56.034 1.00 22.15 ? 110  LEU A CD1 1 
ATOM   897  C CD2 . LEU A 1 129 ? -18.620 21.779 54.970 1.00 20.37 ? 110  LEU A CD2 1 
ATOM   898  N N   . LYS A 1 130 ? -15.219 25.294 53.513 1.00 20.10 ? 111  LYS A N   1 
ATOM   899  C CA  . LYS A 1 130 ? -14.137 26.215 53.712 1.00 21.12 ? 111  LYS A CA  1 
ATOM   900  C C   . LYS A 1 130 ? -14.116 26.439 55.231 1.00 20.93 ? 111  LYS A C   1 
ATOM   901  O O   . LYS A 1 130 ? -15.168 26.739 55.828 1.00 20.72 ? 111  LYS A O   1 
ATOM   902  C CB  . LYS A 1 130 ? -14.388 27.524 52.978 1.00 20.49 ? 111  LYS A CB  1 
ATOM   903  C CG  . LYS A 1 130 ? -13.146 28.428 52.902 1.00 23.06 ? 111  LYS A CG  1 
ATOM   904  C CD  . LYS A 1 130 ? -13.626 29.812 52.287 1.00 23.61 ? 111  LYS A CD  1 
ATOM   905  C CE  . LYS A 1 130 ? -12.548 30.603 51.664 1.00 30.95 ? 111  LYS A CE  1 
ATOM   906  N NZ  . LYS A 1 130 ? -13.165 31.800 51.023 1.00 29.28 ? 111  LYS A NZ  1 
ATOM   907  N N   . VAL A 1 131 ? -12.953 26.211 55.853 1.00 20.10 ? 112  VAL A N   1 
ATOM   908  C CA  . VAL A 1 131 ? -12.849 26.221 57.357 1.00 21.20 ? 112  VAL A CA  1 
ATOM   909  C C   . VAL A 1 131 ? -11.718 27.176 57.814 1.00 20.94 ? 112  VAL A C   1 
ATOM   910  O O   . VAL A 1 131 ? -10.824 27.481 57.007 1.00 19.53 ? 112  VAL A O   1 
ATOM   911  C CB  . VAL A 1 131 ? -12.664 24.754 57.996 1.00 21.12 ? 112  VAL A CB  1 
ATOM   912  C CG1 . VAL A 1 131 ? -13.834 23.859 57.632 1.00 21.19 ? 112  VAL A CG1 1 
ATOM   913  C CG2 . VAL A 1 131 ? -11.353 24.136 57.598 1.00 18.57 ? 112  VAL A CG2 1 
ATOM   914  N N   . ASP A 1 132 ? -11.798 27.686 59.052 1.00 20.20 ? 113  ASP A N   1 
ATOM   915  C CA  . ASP A 1 132 ? -10.687 28.447 59.636 1.00 21.42 ? 113  ASP A CA  1 
ATOM   916  C C   . ASP A 1 132 ? -9.680  27.481 60.324 1.00 21.33 ? 113  ASP A C   1 
ATOM   917  O O   . ASP A 1 132 ? -9.868  26.253 60.251 1.00 20.58 ? 113  ASP A O   1 
ATOM   918  C CB  . ASP A 1 132 ? -11.195 29.535 60.607 1.00 21.78 ? 113  ASP A CB  1 
ATOM   919  C CG  . ASP A 1 132 ? -11.782 28.961 61.903 1.00 26.32 ? 113  ASP A CG  1 
ATOM   920  O OD1 . ASP A 1 132 ? -11.697 27.700 62.153 1.00 26.27 ? 113  ASP A OD1 1 
ATOM   921  O OD2 . ASP A 1 132 ? -12.324 29.806 62.671 1.00 26.96 ? 113  ASP A OD2 1 
ATOM   922  N N   . ALA A 1 133 ? -8.664  28.014 61.033 1.00 22.29 ? 114  ALA A N   1 
ATOM   923  C CA  . ALA A 1 133 ? -7.611  27.150 61.630 1.00 22.20 ? 114  ALA A CA  1 
ATOM   924  C C   . ALA A 1 133 ? -8.127  26.279 62.766 1.00 22.99 ? 114  ALA A C   1 
ATOM   925  O O   . ALA A 1 133 ? -7.487  25.290 63.130 1.00 23.10 ? 114  ALA A O   1 
ATOM   926  C CB  . ALA A 1 133 ? -6.424  27.988 62.130 1.00 23.58 ? 114  ALA A CB  1 
ATOM   927  N N   . TYR A 1 134 ? -9.305  26.605 63.291 1.00 22.50 ? 115  TYR A N   1 
ATOM   928  C CA  . TYR A 1 134 ? -9.892  25.868 64.418 1.00 22.31 ? 115  TYR A CA  1 
ATOM   929  C C   . TYR A 1 134 ? -10.994 24.905 63.984 1.00 23.48 ? 115  TYR A C   1 
ATOM   930  O O   . TYR A 1 134 ? -11.708 24.394 64.820 1.00 25.63 ? 115  TYR A O   1 
ATOM   931  C CB  . TYR A 1 134 ? -10.408 26.890 65.440 1.00 22.11 ? 115  TYR A CB  1 
ATOM   932  C CG  . TYR A 1 134 ? -9.269  27.744 65.916 1.00 20.28 ? 115  TYR A CG  1 
ATOM   933  C CD1 . TYR A 1 134 ? -8.343  27.227 66.844 1.00 24.38 ? 115  TYR A CD1 1 
ATOM   934  C CD2 . TYR A 1 134 ? -9.051  29.022 65.390 1.00 19.92 ? 115  TYR A CD2 1 
ATOM   935  C CE1 . TYR A 1 134 ? -7.252  27.989 67.287 1.00 22.28 ? 115  TYR A CE1 1 
ATOM   936  C CE2 . TYR A 1 134 ? -7.941  29.788 65.784 1.00 21.74 ? 115  TYR A CE2 1 
ATOM   937  C CZ  . TYR A 1 134 ? -7.054  29.259 66.758 1.00 22.34 ? 115  TYR A CZ  1 
ATOM   938  O OH  . TYR A 1 134 ? -5.965  29.993 67.210 1.00 23.05 ? 115  TYR A OH  1 
ATOM   939  N N   . GLY A 1 135 ? -11.165 24.695 62.679 1.00 22.21 ? 116  GLY A N   1 
ATOM   940  C CA  . GLY A 1 135 ? -12.231 23.822 62.213 1.00 21.88 ? 116  GLY A CA  1 
ATOM   941  C C   . GLY A 1 135 ? -13.622 24.458 62.188 1.00 21.48 ? 116  GLY A C   1 
ATOM   942  O O   . GLY A 1 135 ? -14.566 23.757 61.952 1.00 21.24 ? 116  GLY A O   1 
ATOM   943  N N   . ASN A 1 136 ? -13.747 25.769 62.433 1.00 21.46 ? 117  ASN A N   1 
ATOM   944  C CA  . ASN A 1 136 ? -15.018 26.459 62.232 1.00 22.54 ? 117  ASN A CA  1 
ATOM   945  C C   . ASN A 1 136 ? -15.367 26.638 60.748 1.00 22.96 ? 117  ASN A C   1 
ATOM   946  O O   . ASN A 1 136 ? -14.526 27.032 59.963 1.00 23.17 ? 117  ASN A O   1 
ATOM   947  C CB  . ASN A 1 136 ? -15.046 27.813 62.921 1.00 22.33 ? 117  ASN A CB  1 
ATOM   948  C CG  . ASN A 1 136 ? -14.633 27.711 64.345 1.00 26.49 ? 117  ASN A CG  1 
ATOM   949  O OD1 . ASN A 1 136 ? -15.017 26.770 65.029 1.00 27.39 ? 117  ASN A OD1 1 
ATOM   950  N ND2 . ASN A 1 136 ? -13.791 28.628 64.794 1.00 26.26 ? 117  ASN A ND2 1 
ATOM   951  N N   . LEU A 1 137 ? -16.625 26.376 60.411 1.00 24.10 ? 118  LEU A N   1 
ATOM   952  C CA  . LEU A 1 137 ? -17.111 26.416 59.033 1.00 25.19 ? 118  LEU A CA  1 
ATOM   953  C C   . LEU A 1 137 ? -17.362 27.829 58.632 1.00 25.14 ? 118  LEU A C   1 
ATOM   954  O O   . LEU A 1 137 ? -18.084 28.559 59.325 1.00 23.65 ? 118  LEU A O   1 
ATOM   955  C CB  . LEU A 1 137 ? -18.452 25.699 58.953 1.00 26.29 ? 118  LEU A CB  1 
ATOM   956  C CG  . LEU A 1 137 ? -18.505 24.279 58.427 1.00 31.42 ? 118  LEU A CG  1 
ATOM   957  C CD1 . LEU A 1 137 ? -17.740 23.379 59.351 1.00 37.06 ? 118  LEU A CD1 1 
ATOM   958  C CD2 . LEU A 1 137 ? -19.955 23.852 58.345 1.00 34.39 ? 118  LEU A CD2 1 
ATOM   959  N N   . LEU A 1 138 ? -16.762 28.195 57.506 1.00 24.71 ? 119  LEU A N   1 
ATOM   960  C CA  . LEU A 1 138 ? -16.939 29.485 56.868 1.00 24.67 ? 119  LEU A CA  1 
ATOM   961  C C   . LEU A 1 138 ? -17.934 29.365 55.694 1.00 25.54 ? 119  LEU A C   1 
ATOM   962  O O   . LEU A 1 138 ? -18.750 30.247 55.506 1.00 25.01 ? 119  LEU A O   1 
ATOM   963  C CB  . LEU A 1 138 ? -15.575 29.992 56.362 1.00 24.24 ? 119  LEU A CB  1 
ATOM   964  C CG  . LEU A 1 138 ? -14.422 30.043 57.416 1.00 25.31 ? 119  LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 138 ? -13.123 30.609 56.845 1.00 25.65 ? 119  LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 138 ? -14.835 30.819 58.691 1.00 26.76 ? 119  LEU A CD2 1 
ATOM   967  N N   . VAL A 1 139 ? -17.836 28.276 54.917 1.00 24.87 ? 120  VAL A N   1 
ATOM   968  C CA  . VAL A 1 139 ? -18.671 28.045 53.736 1.00 25.17 ? 120  VAL A CA  1 
ATOM   969  C C   . VAL A 1 139 ? -18.967 26.549 53.693 1.00 25.69 ? 120  VAL A C   1 
ATOM   970  O O   . VAL A 1 139 ? -18.097 25.722 53.985 1.00 24.65 ? 120  VAL A O   1 
ATOM   971  C CB  . VAL A 1 139 ? -17.971 28.439 52.409 1.00 25.77 ? 120  VAL A CB  1 
ATOM   972  C CG1 . VAL A 1 139 ? -18.904 28.209 51.185 1.00 27.78 ? 120  VAL A CG1 1 
ATOM   973  C CG2 . VAL A 1 139 ? -17.504 29.897 52.423 1.00 25.38 ? 120  VAL A CG2 1 
ATOM   974  N N   . CYS A 1 140 ? -20.198 26.217 53.338 1.00 25.57 ? 121  CYS A N   1 
ATOM   975  C CA  . CYS A 1 140 ? -20.596 24.849 53.105 1.00 25.52 ? 121  CYS A CA  1 
ATOM   976  C C   . CYS A 1 140 ? -21.354 24.795 51.788 1.00 24.38 ? 121  CYS A C   1 
ATOM   977  O O   . CYS A 1 140 ? -22.342 25.511 51.616 1.00 25.05 ? 121  CYS A O   1 
ATOM   978  C CB  . CYS A 1 140 ? -21.474 24.369 54.258 1.00 24.37 ? 121  CYS A CB  1 
ATOM   979  S SG  . CYS A 1 140 ? -22.057 22.631 54.172 1.00 30.62 ? 121  CYS A SG  1 
ATOM   980  N N   . ALA A 1 141 ? -20.904 23.951 50.863 1.00 23.57 ? 122  ALA A N   1 
ATOM   981  C CA  . ALA A 1 141 ? -21.666 23.729 49.618 1.00 22.82 ? 122  ALA A CA  1 
ATOM   982  C C   . ALA A 1 141 ? -21.858 22.242 49.385 1.00 21.71 ? 122  ALA A C   1 
ATOM   983  O O   . ALA A 1 141 ? -20.923 21.473 49.482 1.00 21.44 ? 122  ALA A O   1 
ATOM   984  C CB  . ALA A 1 141 ? -20.990 24.358 48.432 1.00 22.22 ? 122  ALA A CB  1 
ATOM   985  N N   . HIS A 1 142 ? -23.089 21.873 49.079 1.00 21.16 ? 123  HIS A N   1 
ATOM   986  C CA  . HIS A 1 142 ? -23.434 20.528 48.679 1.00 21.15 ? 123  HIS A CA  1 
ATOM   987  C C   . HIS A 1 142 ? -23.725 20.546 47.158 1.00 21.10 ? 123  HIS A C   1 
ATOM   988  O O   . HIS A 1 142 ? -24.746 21.091 46.728 1.00 22.07 ? 123  HIS A O   1 
ATOM   989  C CB  . HIS A 1 142 ? -24.663 20.078 49.453 1.00 21.09 ? 123  HIS A CB  1 
ATOM   990  C CG  . HIS A 1 142 ? -25.009 18.643 49.227 1.00 21.83 ? 123  HIS A CG  1 
ATOM   991  N ND1 . HIS A 1 142 ? -24.318 17.613 49.824 1.00 22.35 ? 123  HIS A ND1 1 
ATOM   992  C CD2 . HIS A 1 142 ? -25.937 18.068 48.424 1.00 21.96 ? 123  HIS A CD2 1 
ATOM   993  C CE1 . HIS A 1 142 ? -24.828 16.459 49.429 1.00 22.87 ? 123  HIS A CE1 1 
ATOM   994  N NE2 . HIS A 1 142 ? -25.801 16.706 48.570 1.00 24.23 ? 123  HIS A NE2 1 
ATOM   995  N N   . GLY A 1 143 ? -22.833 19.960 46.360 1.00 20.89 ? 124  GLY A N   1 
ATOM   996  C CA  . GLY A 1 143 ? -22.862 20.196 44.905 1.00 21.00 ? 124  GLY A CA  1 
ATOM   997  C C   . GLY A 1 143 ? -22.644 21.685 44.698 1.00 21.47 ? 124  GLY A C   1 
ATOM   998  O O   . GLY A 1 143 ? -21.618 22.227 45.128 1.00 21.03 ? 124  GLY A O   1 
ATOM   999  N N   . PHE A 1 144 ? -23.609 22.341 44.046 1.00 20.80 ? 125  PHE A N   1 
ATOM   1000 C CA  . PHE A 1 144 ? -23.548 23.762 43.781 1.00 21.89 ? 125  PHE A CA  1 
ATOM   1001 C C   . PHE A 1 144 ? -24.555 24.580 44.624 1.00 22.59 ? 125  PHE A C   1 
ATOM   1002 O O   . PHE A 1 144 ? -24.823 25.747 44.304 1.00 22.73 ? 125  PHE A O   1 
ATOM   1003 C CB  . PHE A 1 144 ? -23.715 24.033 42.241 1.00 21.50 ? 125  PHE A CB  1 
ATOM   1004 C CG  . PHE A 1 144 ? -22.647 23.328 41.362 1.00 20.02 ? 125  PHE A CG  1 
ATOM   1005 C CD1 . PHE A 1 144 ? -21.288 23.472 41.644 1.00 20.79 ? 125  PHE A CD1 1 
ATOM   1006 C CD2 . PHE A 1 144 ? -23.022 22.565 40.273 1.00 20.77 ? 125  PHE A CD2 1 
ATOM   1007 C CE1 . PHE A 1 144 ? -20.307 22.858 40.862 1.00 19.44 ? 125  PHE A CE1 1 
ATOM   1008 C CE2 . PHE A 1 144 ? -22.036 21.920 39.484 1.00 21.27 ? 125  PHE A CE2 1 
ATOM   1009 C CZ  . PHE A 1 144 ? -20.702 22.073 39.785 1.00 20.78 ? 125  PHE A CZ  1 
ATOM   1010 N N   . ASN A 1 145 ? -25.126 23.957 45.653 1.00 22.45 ? 126  ASN A N   1 
ATOM   1011 C CA  . ASN A 1 145 ? -26.048 24.626 46.558 1.00 24.71 ? 126  ASN A CA  1 
ATOM   1012 C C   . ASN A 1 145 ? -25.220 25.062 47.781 1.00 24.88 ? 126  ASN A C   1 
ATOM   1013 O O   . ASN A 1 145 ? -24.713 24.215 48.509 1.00 22.40 ? 126  ASN A O   1 
ATOM   1014 C CB  . ASN A 1 145 ? -27.198 23.653 46.946 1.00 25.55 ? 126  ASN A CB  1 
ATOM   1015 C CG  . ASN A 1 145 ? -28.279 24.275 47.908 1.00 31.37 ? 126  ASN A CG  1 
ATOM   1016 O OD1 . ASN A 1 145 ? -28.621 25.487 47.855 1.00 37.26 ? 126  ASN A OD1 1 
ATOM   1017 N ND2 . ASN A 1 145 ? -28.868 23.407 48.756 1.00 32.89 ? 126  ASN A ND2 1 
ATOM   1018 N N   . PHE A 1 146 ? -25.071 26.378 47.962 1.00 26.04 ? 127  PHE A N   1 
ATOM   1019 C CA  . PHE A 1 146 ? -24.437 26.958 49.149 1.00 28.40 ? 127  PHE A CA  1 
ATOM   1020 C C   . PHE A 1 146 ? -25.416 26.990 50.307 1.00 28.19 ? 127  PHE A C   1 
ATOM   1021 O O   . PHE A 1 146 ? -26.438 27.593 50.237 1.00 27.34 ? 127  PHE A O   1 
ATOM   1022 C CB  . PHE A 1 146 ? -23.771 28.323 48.837 1.00 29.96 ? 127  PHE A CB  1 
ATOM   1023 C CG  . PHE A 1 146 ? -22.557 28.176 47.929 1.00 31.12 ? 127  PHE A CG  1 
ATOM   1024 C CD1 . PHE A 1 146 ? -22.723 27.855 46.544 1.00 33.24 ? 127  PHE A CD1 1 
ATOM   1025 C CD2 . PHE A 1 146 ? -21.267 28.268 48.452 1.00 31.27 ? 127  PHE A CD2 1 
ATOM   1026 C CE1 . PHE A 1 146 ? -21.615 27.667 45.665 1.00 32.94 ? 127  PHE A CE1 1 
ATOM   1027 C CE2 . PHE A 1 146 ? -20.157 28.094 47.612 1.00 33.18 ? 127  PHE A CE2 1 
ATOM   1028 C CZ  . PHE A 1 146 ? -20.333 27.790 46.204 1.00 34.15 ? 127  PHE A CZ  1 
ATOM   1029 N N   . ILE A 1 147 ? -25.088 26.227 51.338 1.00 28.92 ? 128  ILE A N   1 
ATOM   1030 C CA  . ILE A 1 147 ? -25.946 25.994 52.495 1.00 30.29 ? 128  ILE A CA  1 
ATOM   1031 C C   . ILE A 1 147 ? -25.718 27.120 53.514 1.00 30.16 ? 128  ILE A C   1 
ATOM   1032 O O   . ILE A 1 147 ? -24.576 27.413 53.878 1.00 29.00 ? 128  ILE A O   1 
ATOM   1033 C CB  . ILE A 1 147 ? -25.629 24.573 53.111 1.00 30.08 ? 128  ILE A CB  1 
ATOM   1034 C CG1 . ILE A 1 147 ? -25.500 23.511 52.008 1.00 32.45 ? 128  ILE A CG1 1 
ATOM   1035 C CG2 . ILE A 1 147 ? -26.657 24.144 54.158 1.00 30.37 ? 128  ILE A CG2 1 
ATOM   1036 C CD1 . ILE A 1 147 ? -26.690 23.379 51.068 1.00 33.67 ? 128  ILE A CD1 1 
ATOM   1037 N N   . ARG A 1 148 ? -26.804 27.776 53.934 1.00 31.94 ? 129  ARG A N   1 
ATOM   1038 C CA  . ARG A 1 148 ? -26.738 28.875 54.907 1.00 33.11 ? 129  ARG A CA  1 
ATOM   1039 C C   . ARG A 1 148 ? -26.805 28.318 56.332 1.00 32.85 ? 129  ARG A C   1 
ATOM   1040 O O   . ARG A 1 148 ? -27.053 27.125 56.526 1.00 31.84 ? 129  ARG A O   1 
ATOM   1041 C CB  . ARG A 1 148 ? -27.854 29.920 54.688 1.00 33.34 ? 129  ARG A CB  1 
ATOM   1042 C CG  . ARG A 1 148 ? -28.404 29.973 53.257 1.00 37.06 ? 129  ARG A CG  1 
ATOM   1043 C CD  . ARG A 1 148 ? -28.663 31.409 52.727 1.00 41.12 ? 129  ARG A CD  1 
ATOM   1044 N NE  . ARG A 1 148 ? -29.649 32.181 53.497 1.00 44.70 ? 129  ARG A NE  1 
ATOM   1045 C CZ  . ARG A 1 148 ? -29.347 33.190 54.322 1.00 47.04 ? 129  ARG A CZ  1 
ATOM   1046 N NH1 . ARG A 1 148 ? -28.078 33.558 54.500 1.00 47.90 ? 129  ARG A NH1 1 
ATOM   1047 N NH2 . ARG A 1 148 ? -30.309 33.840 54.974 1.00 46.02 ? 129  ARG A NH2 1 
ATOM   1048 N N   . GLY A 1 149 ? -26.617 29.213 57.309 1.00 33.34 ? 130  GLY A N   1 
ATOM   1049 C CA  . GLY A 1 149 ? -26.538 28.883 58.743 1.00 33.43 ? 130  GLY A CA  1 
ATOM   1050 C C   . GLY A 1 149 ? -27.407 27.783 59.348 1.00 33.61 ? 130  GLY A C   1 
ATOM   1051 O O   . GLY A 1 149 ? -26.874 26.779 59.839 1.00 33.02 ? 130  GLY A O   1 
ATOM   1052 N N   . PRO A 1 150 ? -28.740 27.989 59.391 1.00 33.80 ? 131  PRO A N   1 
ATOM   1053 C CA  . PRO A 1 150 ? -29.626 26.978 60.002 1.00 33.94 ? 131  PRO A CA  1 
ATOM   1054 C C   . PRO A 1 150 ? -29.549 25.573 59.416 1.00 34.05 ? 131  PRO A C   1 
ATOM   1055 O O   . PRO A 1 150 ? -29.546 24.595 60.175 1.00 34.09 ? 131  PRO A O   1 
ATOM   1056 C CB  . PRO A 1 150 ? -31.028 27.583 59.824 1.00 34.18 ? 131  PRO A CB  1 
ATOM   1057 C CG  . PRO A 1 150 ? -30.766 29.091 59.786 1.00 33.60 ? 131  PRO A CG  1 
ATOM   1058 C CD  . PRO A 1 150 ? -29.488 29.200 58.985 1.00 33.91 ? 131  PRO A CD  1 
ATOM   1059 N N   . GLU A 1 151 ? -29.476 25.467 58.085 1.00 33.97 ? 132  GLU A N   1 
ATOM   1060 C CA  . GLU A 1 151 ? -29.415 24.164 57.423 1.00 33.46 ? 132  GLU A CA  1 
ATOM   1061 C C   . GLU A 1 151 ? -28.094 23.436 57.708 1.00 31.95 ? 132  GLU A C   1 
ATOM   1062 O O   . GLU A 1 151 ? -28.073 22.211 57.788 1.00 31.54 ? 132  GLU A O   1 
ATOM   1063 C CB  . GLU A 1 151 ? -29.667 24.301 55.911 1.00 33.39 ? 132  GLU A CB  1 
ATOM   1064 C CG  . GLU A 1 151 ? -30.142 22.997 55.214 1.00 35.70 ? 132  GLU A CG  1 
ATOM   1065 C CD  . GLU A 1 151 ? -30.115 23.049 53.644 1.00 36.00 ? 132  GLU A CD  1 
ATOM   1066 O OE1 . GLU A 1 151 ? -30.312 24.155 53.057 1.00 38.50 ? 132  GLU A OE1 1 
ATOM   1067 O OE2 . GLU A 1 151 ? -29.914 21.975 53.013 1.00 35.00 ? 132  GLU A OE2 1 
ATOM   1068 N N   . THR A 1 152 ? -27.002 24.188 57.861 1.00 31.00 ? 133  THR A N   1 
ATOM   1069 C CA  . THR A 1 152 ? -25.672 23.580 58.106 1.00 30.57 ? 133  THR A CA  1 
ATOM   1070 C C   . THR A 1 152 ? -25.614 22.981 59.513 1.00 28.94 ? 133  THR A C   1 
ATOM   1071 O O   . THR A 1 152 ? -24.968 21.962 59.731 1.00 27.60 ? 133  THR A O   1 
ATOM   1072 C CB  . THR A 1 152 ? -24.459 24.571 57.922 1.00 30.52 ? 133  THR A CB  1 
ATOM   1073 O OG1 . THR A 1 152 ? -24.419 25.466 59.034 1.00 35.17 ? 133  THR A OG1 1 
ATOM   1074 C CG2 . THR A 1 152 ? -24.587 25.408 56.676 1.00 29.09 ? 133  THR A CG2 1 
ATOM   1075 N N   . ARG A 1 153 ? -26.308 23.622 60.450 1.00 27.96 ? 134  ARG A N   1 
ATOM   1076 C CA  . ARG A 1 153 ? -26.394 23.143 61.837 1.00 27.89 ? 134  ARG A CA  1 
ATOM   1077 C C   . ARG A 1 153 ? -27.040 21.761 61.944 1.00 27.14 ? 134  ARG A C   1 
ATOM   1078 O O   . ARG A 1 153 ? -26.766 21.023 62.868 1.00 26.46 ? 134  ARG A O   1 
ATOM   1079 C CB  . ARG A 1 153 ? -27.081 24.187 62.767 1.00 28.00 ? 134  ARG A CB  1 
ATOM   1080 C CG  . ARG A 1 153 ? -26.175 25.372 63.113 1.00 29.64 ? 134  ARG A CG  1 
ATOM   1081 C CD  . ARG A 1 153 ? -26.766 26.197 64.222 1.00 35.59 ? 134  ARG A CD  1 
ATOM   1082 N NE  . ARG A 1 153 ? -26.034 27.439 64.494 1.00 41.21 ? 134  ARG A NE  1 
ATOM   1083 C CZ  . ARG A 1 153 ? -24.953 27.559 65.281 1.00 41.91 ? 134  ARG A CZ  1 
ATOM   1084 N NH1 . ARG A 1 153 ? -24.408 26.500 65.876 1.00 41.43 ? 134  ARG A NH1 1 
ATOM   1085 N NH2 . ARG A 1 153 ? -24.399 28.754 65.459 1.00 40.62 ? 134  ARG A NH2 1 
ATOM   1086 N N   . GLU A 1 154 ? -27.859 21.391 60.967 1.00 27.26 ? 135  GLU A N   1 
ATOM   1087 C CA  . GLU A 1 154 ? -28.432 20.029 60.917 1.00 27.68 ? 135  GLU A CA  1 
ATOM   1088 C C   . GLU A 1 154 ? -27.343 18.949 60.872 1.00 25.49 ? 135  GLU A C   1 
ATOM   1089 O O   . GLU A 1 154 ? -27.435 17.992 61.637 1.00 25.36 ? 135  GLU A O   1 
ATOM   1090 C CB  . GLU A 1 154 ? -29.442 19.872 59.756 1.00 27.57 ? 135  GLU A CB  1 
ATOM   1091 C CG  . GLU A 1 154 ? -30.547 20.942 59.770 1.00 30.47 ? 135  GLU A CG  1 
ATOM   1092 C CD  . GLU A 1 154 ? -31.640 20.691 58.707 1.00 31.99 ? 135  GLU A CD  1 
ATOM   1093 O OE1 . GLU A 1 154 ? -31.347 20.759 57.476 1.00 36.88 ? 135  GLU A OE1 1 
ATOM   1094 O OE2 . GLU A 1 154 ? -32.801 20.435 59.126 1.00 37.67 ? 135  GLU A OE2 1 
ATOM   1095 N N   . GLN A 1 155 ? -26.330 19.120 60.001 1.00 22.73 ? 136  GLN A N   1 
ATOM   1096 C CA  . GLN A 1 155 ? -25.168 18.213 59.896 1.00 21.96 ? 136  GLN A CA  1 
ATOM   1097 C C   . GLN A 1 155 ? -23.934 18.556 60.777 1.00 21.45 ? 136  GLN A C   1 
ATOM   1098 O O   . GLN A 1 155 ? -23.114 17.671 61.051 1.00 22.87 ? 136  GLN A O   1 
ATOM   1099 C CB  . GLN A 1 155 ? -24.706 18.085 58.427 1.00 22.09 ? 136  GLN A CB  1 
ATOM   1100 C CG  . GLN A 1 155 ? -25.753 17.342 57.570 1.00 23.21 ? 136  GLN A CG  1 
ATOM   1101 C CD  . GLN A 1 155 ? -25.399 17.196 56.091 1.00 22.54 ? 136  GLN A CD  1 
ATOM   1102 O OE1 . GLN A 1 155 ? -24.638 17.975 55.521 1.00 22.07 ? 136  GLN A OE1 1 
ATOM   1103 N NE2 . GLN A 1 155 ? -25.973 16.187 55.466 1.00 21.96 ? 136  GLN A NE2 1 
ATOM   1104 N N   . TYR A 1 156 ? -23.804 19.821 61.194 1.00 19.23 ? 137  TYR A N   1 
ATOM   1105 C CA  . TYR A 1 156 ? -22.629 20.359 61.917 1.00 17.54 ? 137  TYR A CA  1 
ATOM   1106 C C   . TYR A 1 156 ? -23.214 21.225 63.005 1.00 16.80 ? 137  TYR A C   1 
ATOM   1107 O O   . TYR A 1 156 ? -23.286 22.452 62.847 1.00 16.10 ? 137  TYR A O   1 
ATOM   1108 C CB  . TYR A 1 156 ? -21.746 21.233 60.980 1.00 16.55 ? 137  TYR A CB  1 
ATOM   1109 C CG  . TYR A 1 156 ? -21.339 20.547 59.692 1.00 15.64 ? 137  TYR A CG  1 
ATOM   1110 C CD1 . TYR A 1 156 ? -20.258 19.654 59.678 1.00 12.49 ? 137  TYR A CD1 1 
ATOM   1111 C CD2 . TYR A 1 156 ? -22.064 20.755 58.486 1.00 15.13 ? 137  TYR A CD2 1 
ATOM   1112 C CE1 . TYR A 1 156 ? -19.909 18.977 58.520 1.00 14.46 ? 137  TYR A CE1 1 
ATOM   1113 C CE2 . TYR A 1 156 ? -21.702 20.110 57.300 1.00 15.06 ? 137  TYR A CE2 1 
ATOM   1114 C CZ  . TYR A 1 156 ? -20.614 19.230 57.320 1.00 17.88 ? 137  TYR A CZ  1 
ATOM   1115 O OH  . TYR A 1 156 ? -20.241 18.548 56.173 1.00 17.08 ? 137  TYR A OH  1 
ATOM   1116 N N   . PRO A 1 157 ? -23.691 20.590 64.099 1.00 17.40 ? 138  PRO A N   1 
ATOM   1117 C CA  . PRO A 1 157 ? -24.411 21.236 65.190 1.00 17.46 ? 138  PRO A CA  1 
ATOM   1118 C C   . PRO A 1 157 ? -23.605 22.329 65.883 1.00 17.90 ? 138  PRO A C   1 
ATOM   1119 O O   . PRO A 1 157 ? -24.190 23.217 66.499 1.00 18.57 ? 138  PRO A O   1 
ATOM   1120 C CB  . PRO A 1 157 ? -24.652 20.087 66.179 1.00 18.41 ? 138  PRO A CB  1 
ATOM   1121 C CG  . PRO A 1 157 ? -24.580 18.857 65.352 1.00 17.55 ? 138  PRO A CG  1 
ATOM   1122 C CD  . PRO A 1 157 ? -23.555 19.139 64.321 1.00 17.60 ? 138  PRO A CD  1 
ATOM   1123 N N   . ASN A 1 158 ? -22.279 22.265 65.799 1.00 17.40 ? 139  ASN A N   1 
ATOM   1124 C CA  . ASN A 1 158 ? -21.455 23.252 66.457 1.00 17.10 ? 139  ASN A CA  1 
ATOM   1125 C C   . ASN A 1 158 ? -20.781 24.128 65.391 1.00 17.94 ? 139  ASN A C   1 
ATOM   1126 O O   . ASN A 1 158 ? -19.944 24.953 65.720 1.00 18.16 ? 139  ASN A O   1 
ATOM   1127 C CB  . ASN A 1 158 ? -20.455 22.550 67.384 1.00 16.15 ? 139  ASN A CB  1 
ATOM   1128 C CG  . ASN A 1 158 ? -19.767 23.496 68.331 1.00 16.02 ? 139  ASN A CG  1 
ATOM   1129 O OD1 . ASN A 1 158 ? -20.392 24.390 68.909 1.00 15.78 ? 139  ASN A OD1 1 
ATOM   1130 N ND2 . ASN A 1 158 ? -18.455 23.315 68.493 1.00 14.25 ? 139  ASN A ND2 1 
ATOM   1131 N N   . LYS A 1 159 ? -21.204 23.982 64.120 1.00 18.72 ? 140  LYS A N   1 
ATOM   1132 C CA  . LYS A 1 159 ? -20.535 24.608 62.922 1.00 19.20 ? 140  LYS A CA  1 
ATOM   1133 C C   . LYS A 1 159 ? -19.013 24.397 62.909 1.00 16.47 ? 140  LYS A C   1 
ATOM   1134 O O   . LYS A 1 159 ? -18.246 25.308 62.701 1.00 15.27 ? 140  LYS A O   1 
ATOM   1135 C CB  . LYS A 1 159 ? -20.879 26.108 62.825 1.00 21.05 ? 140  LYS A CB  1 
ATOM   1136 C CG  . LYS A 1 159 ? -22.096 26.461 61.915 1.00 23.02 ? 140  LYS A CG  1 
ATOM   1137 C CD  . LYS A 1 159 ? -22.383 27.996 61.974 1.00 21.99 ? 140  LYS A CD  1 
ATOM   1138 C CE  . LYS A 1 159 ? -23.641 28.347 61.185 1.00 24.20 ? 140  LYS A CE  1 
ATOM   1139 N NZ  . LYS A 1 159 ? -24.239 29.587 61.735 1.00 25.13 ? 140  LYS A NZ  1 
ATOM   1140 N N   . PHE A 1 160 ? -18.608 23.156 63.115 1.00 15.53 ? 141  PHE A N   1 
ATOM   1141 C CA  . PHE A 1 160 ? -17.248 22.798 63.486 1.00 14.72 ? 141  PHE A CA  1 
ATOM   1142 C C   . PHE A 1 160 ? -17.017 21.386 62.976 1.00 14.38 ? 141  PHE A C   1 
ATOM   1143 O O   . PHE A 1 160 ? -17.935 20.535 63.051 1.00 13.71 ? 141  PHE A O   1 
ATOM   1144 C CB  . PHE A 1 160 ? -17.125 22.870 65.037 1.00 13.98 ? 141  PHE A CB  1 
ATOM   1145 C CG  . PHE A 1 160 ? -15.927 22.162 65.617 1.00 14.07 ? 141  PHE A CG  1 
ATOM   1146 C CD1 . PHE A 1 160 ? -14.687 22.800 65.691 1.00 14.17 ? 141  PHE A CD1 1 
ATOM   1147 C CD2 . PHE A 1 160 ? -16.047 20.842 66.105 1.00 14.15 ? 141  PHE A CD2 1 
ATOM   1148 C CE1 . PHE A 1 160 ? -13.563 22.142 66.262 1.00 15.91 ? 141  PHE A CE1 1 
ATOM   1149 C CE2 . PHE A 1 160 ? -14.947 20.175 66.653 1.00 13.13 ? 141  PHE A CE2 1 
ATOM   1150 C CZ  . PHE A 1 160 ? -13.703 20.829 66.756 1.00 12.05 ? 141  PHE A CZ  1 
ATOM   1151 N N   . ILE A 1 161 ? -15.814 21.149 62.453 1.00 13.59 ? 142  ILE A N   1 
ATOM   1152 C CA  . ILE A 1 161 ? -15.346 19.786 62.143 1.00 15.56 ? 142  ILE A CA  1 
ATOM   1153 C C   . ILE A 1 161 ? -14.032 19.533 62.883 1.00 17.08 ? 142  ILE A C   1 
ATOM   1154 O O   . ILE A 1 161 ? -13.256 20.476 63.160 1.00 15.89 ? 142  ILE A O   1 
ATOM   1155 C CB  . ILE A 1 161 ? -15.131 19.556 60.633 1.00 14.26 ? 142  ILE A CB  1 
ATOM   1156 C CG1 . ILE A 1 161 ? -14.015 20.484 60.112 1.00 14.12 ? 142  ILE A CG1 1 
ATOM   1157 C CG2 . ILE A 1 161 ? -16.450 19.806 59.859 1.00 15.73 ? 142  ILE A CG2 1 
ATOM   1158 C CD1 . ILE A 1 161 ? -13.383 20.032 58.762 1.00 16.66 ? 142  ILE A CD1 1 
ATOM   1159 N N   . GLN A 1 162 ? -13.794 18.266 63.200 1.00 19.96 ? 143  GLN A N   1 
ATOM   1160 C CA  . GLN A 1 162 ? -12.546 17.852 63.827 1.00 22.26 ? 143  GLN A CA  1 
ATOM   1161 C C   . GLN A 1 162 ? -11.624 17.520 62.678 1.00 23.68 ? 143  GLN A C   1 
ATOM   1162 O O   . GLN A 1 162 ? -11.787 16.462 62.071 1.00 23.50 ? 143  GLN A O   1 
ATOM   1163 C CB  . GLN A 1 162 ? -12.743 16.588 64.652 1.00 21.74 ? 143  GLN A CB  1 
ATOM   1164 C CG  . GLN A 1 162 ? -13.794 16.648 65.694 1.00 22.98 ? 143  GLN A CG  1 
ATOM   1165 C CD  . GLN A 1 162 ? -13.920 15.334 66.477 1.00 24.24 ? 143  GLN A CD  1 
ATOM   1166 O OE1 . GLN A 1 162 ? -13.926 15.330 67.714 1.00 23.36 ? 143  GLN A OE1 1 
ATOM   1167 N NE2 . GLN A 1 162 ? -14.053 14.222 65.758 1.00 26.22 ? 143  GLN A NE2 1 
ATOM   1168 N N   . ARG A 1 163 ? -10.680 18.392 62.325 1.00 26.20 ? 144  ARG A N   1 
ATOM   1169 C CA  . ARG A 1 163 ? -9.892  18.071 61.109 1.00 29.50 ? 144  ARG A CA  1 
ATOM   1170 C C   . ARG A 1 163 ? -8.844  16.948 61.254 1.00 30.55 ? 144  ARG A C   1 
ATOM   1171 O O   . ARG A 1 163 ? -8.422  16.382 60.255 1.00 32.72 ? 144  ARG A O   1 
ATOM   1172 C CB  . ARG A 1 163 ? -9.349  19.303 60.372 1.00 30.28 ? 144  ARG A CB  1 
ATOM   1173 C CG  . ARG A 1 163 ? -8.728  20.297 61.271 1.00 32.03 ? 144  ARG A CG  1 
ATOM   1174 C CD  . ARG A 1 163 ? -8.287  21.548 60.532 1.00 32.10 ? 144  ARG A CD  1 
ATOM   1175 N NE  . ARG A 1 163 ? -7.486  22.332 61.459 1.00 34.88 ? 144  ARG A NE  1 
ATOM   1176 C CZ  . ARG A 1 163 ? -6.164  22.233 61.569 1.00 34.55 ? 144  ARG A CZ  1 
ATOM   1177 N NH1 . ARG A 1 163 ? -5.478  21.407 60.765 1.00 33.64 ? 144  ARG A NH1 1 
ATOM   1178 N NH2 . ARG A 1 163 ? -5.529  22.991 62.457 1.00 30.63 ? 144  ARG A NH2 1 
ATOM   1179 N N   . ASP A 1 164 ? -8.505  16.576 62.482 1.00 31.34 ? 145  ASP A N   1 
ATOM   1180 C CA  . ASP A 1 164 ? -7.743  15.356 62.741 1.00 32.19 ? 145  ASP A CA  1 
ATOM   1181 C C   . ASP A 1 164 ? -8.496  14.053 62.397 1.00 31.05 ? 145  ASP A C   1 
ATOM   1182 O O   . ASP A 1 164 ? -7.930  12.960 62.521 1.00 31.68 ? 145  ASP A O   1 
ATOM   1183 C CB  . ASP A 1 164 ? -7.258  15.329 64.204 1.00 32.26 ? 145  ASP A CB  1 
ATOM   1184 C CG  . ASP A 1 164 ? -8.413  15.194 65.234 1.00 37.97 ? 145  ASP A CG  1 
ATOM   1185 O OD1 . ASP A 1 164 ? -9.619  15.359 64.865 1.00 42.81 ? 145  ASP A OD1 1 
ATOM   1186 O OD2 . ASP A 1 164 ? -8.103  14.952 66.448 1.00 40.48 ? 145  ASP A OD2 1 
ATOM   1187 N N   . ASP A 1 165 ? -9.768  14.162 61.995 1.00 28.91 ? 146  ASP A N   1 
ATOM   1188 C CA  . ASP A 1 165 ? -10.557 13.004 61.567 1.00 27.09 ? 146  ASP A CA  1 
ATOM   1189 C C   . ASP A 1 165 ? -10.303 12.799 60.069 1.00 26.30 ? 146  ASP A C   1 
ATOM   1190 O O   . ASP A 1 165 ? -11.145 13.084 59.211 1.00 24.83 ? 146  ASP A O   1 
ATOM   1191 C CB  . ASP A 1 165 ? -12.035 13.185 61.911 1.00 25.93 ? 146  ASP A CB  1 
ATOM   1192 C CG  . ASP A 1 165 ? -12.874 11.948 61.607 1.00 28.38 ? 146  ASP A CG  1 
ATOM   1193 O OD1 . ASP A 1 165 ? -12.321 10.931 61.121 1.00 27.88 ? 146  ASP A OD1 1 
ATOM   1194 O OD2 . ASP A 1 165 ? -14.114 11.996 61.849 1.00 28.11 ? 146  ASP A OD2 1 
ATOM   1195 N N   . THR A 1 166 ? -9.109  12.302 59.780 1.00 26.41 ? 147  THR A N   1 
ATOM   1196 C CA  . THR A 1 166 ? -8.587  12.221 58.413 1.00 27.47 ? 147  THR A CA  1 
ATOM   1197 C C   . THR A 1 166 ? -9.242  11.107 57.576 1.00 28.06 ? 147  THR A C   1 
ATOM   1198 O O   . THR A 1 166 ? -9.168  11.126 56.355 1.00 29.06 ? 147  THR A O   1 
ATOM   1199 C CB  . THR A 1 166 ? -7.076  12.032 58.426 1.00 27.71 ? 147  THR A CB  1 
ATOM   1200 O OG1 . THR A 1 166 ? -6.760  10.854 59.183 1.00 27.04 ? 147  THR A OG1 1 
ATOM   1201 C CG2 . THR A 1 166 ? -6.381  13.242 59.057 1.00 28.77 ? 147  THR A CG2 1 
ATOM   1202 N N   . GLU A 1 167 ? -9.914  10.171 58.234 1.00 27.62 ? 148  GLU A N   1 
ATOM   1203 C CA  . GLU A 1 167 ? -10.762 9.201  57.571 1.00 28.38 ? 148  GLU A CA  1 
ATOM   1204 C C   . GLU A 1 167 ? -11.990 9.863  56.938 1.00 27.38 ? 148  GLU A C   1 
ATOM   1205 O O   . GLU A 1 167 ? -12.418 9.494  55.830 1.00 28.93 ? 148  GLU A O   1 
ATOM   1206 C CB  . GLU A 1 167 ? -11.229 8.184  58.603 1.00 29.34 ? 148  GLU A CB  1 
ATOM   1207 C CG  . GLU A 1 167 ? -11.065 6.783  58.181 1.00 35.58 ? 148  GLU A CG  1 
ATOM   1208 C CD  . GLU A 1 167 ? -9.643  6.310  58.416 1.00 42.81 ? 148  GLU A CD  1 
ATOM   1209 O OE1 . GLU A 1 167 ? -9.393  5.637  59.454 1.00 45.74 ? 148  GLU A OE1 1 
ATOM   1210 O OE2 . GLU A 1 167 ? -8.782  6.641  57.561 1.00 46.90 ? 148  GLU A OE2 1 
ATOM   1211 N N   . ARG A 1 168 ? -12.542 10.873 57.610 1.00 24.84 ? 149  ARG A N   1 
ATOM   1212 C CA  . ARG A 1 168 ? -13.751 11.514 57.122 1.00 22.43 ? 149  ARG A CA  1 
ATOM   1213 C C   . ARG A 1 168 ? -13.478 12.722 56.230 1.00 21.82 ? 149  ARG A C   1 
ATOM   1214 O O   . ARG A 1 168 ? -14.173 12.951 55.239 1.00 21.24 ? 149  ARG A O   1 
ATOM   1215 C CB  . ARG A 1 168 ? -14.645 11.903 58.313 1.00 22.01 ? 149  ARG A CB  1 
ATOM   1216 C CG  . ARG A 1 168 ? -15.890 12.708 57.934 1.00 20.12 ? 149  ARG A CG  1 
ATOM   1217 C CD  . ARG A 1 168 ? -16.864 12.820 59.124 1.00 22.18 ? 149  ARG A CD  1 
ATOM   1218 N NE  . ARG A 1 168 ? -17.848 13.863 58.797 1.00 17.78 ? 149  ARG A NE  1 
ATOM   1219 C CZ  . ARG A 1 168 ? -18.642 14.451 59.687 1.00 20.08 ? 149  ARG A CZ  1 
ATOM   1220 N NH1 . ARG A 1 168 ? -18.545 14.122 60.977 1.00 13.49 ? 149  ARG A NH1 1 
ATOM   1221 N NH2 . ARG A 1 168 ? -19.497 15.403 59.282 1.00 15.37 ? 149  ARG A NH2 1 
ATOM   1222 N N   . PHE A 1 169 ? -12.489 13.515 56.614 1.00 21.14 ? 150  PHE A N   1 
ATOM   1223 C CA  . PHE A 1 169 ? -12.242 14.818 55.995 1.00 21.79 ? 150  PHE A CA  1 
ATOM   1224 C C   . PHE A 1 169 ? -10.967 14.804 55.161 1.00 22.98 ? 150  PHE A C   1 
ATOM   1225 O O   . PHE A 1 169 ? -9.919  14.495 55.657 1.00 23.69 ? 150  PHE A O   1 
ATOM   1226 C CB  . PHE A 1 169 ? -12.148 15.940 57.078 1.00 20.40 ? 150  PHE A CB  1 
ATOM   1227 C CG  . PHE A 1 169 ? -13.427 16.114 57.894 1.00 19.81 ? 150  PHE A CG  1 
ATOM   1228 C CD1 . PHE A 1 169 ? -14.609 16.614 57.285 1.00 17.35 ? 150  PHE A CD1 1 
ATOM   1229 C CD2 . PHE A 1 169 ? -13.462 15.764 59.234 1.00 18.77 ? 150  PHE A CD2 1 
ATOM   1230 C CE1 . PHE A 1 169 ? -15.802 16.739 57.998 1.00 16.58 ? 150  PHE A CE1 1 
ATOM   1231 C CE2 . PHE A 1 169 ? -14.643 15.904 59.972 1.00 20.20 ? 150  PHE A CE2 1 
ATOM   1232 C CZ  . PHE A 1 169 ? -15.824 16.411 59.336 1.00 17.02 ? 150  PHE A CZ  1 
ATOM   1233 N N   . TYR A 1 170 ? -11.060 15.215 53.907 1.00 23.32 ? 151  TYR A N   1 
ATOM   1234 C CA  . TYR A 1 170 ? -9.874  15.304 53.108 1.00 23.47 ? 151  TYR A CA  1 
ATOM   1235 C C   . TYR A 1 170 ? -9.636  16.760 52.661 1.00 22.20 ? 151  TYR A C   1 
ATOM   1236 O O   . TYR A 1 170 ? -10.490 17.400 52.073 1.00 20.99 ? 151  TYR A O   1 
ATOM   1237 C CB  . TYR A 1 170 ? -10.009 14.365 51.896 1.00 25.13 ? 151  TYR A CB  1 
ATOM   1238 C CG  . TYR A 1 170 ? -8.723  14.199 51.119 1.00 25.63 ? 151  TYR A CG  1 
ATOM   1239 C CD1 . TYR A 1 170 ? -7.885  13.107 51.350 1.00 28.09 ? 151  TYR A CD1 1 
ATOM   1240 C CD2 . TYR A 1 170 ? -8.384  15.112 50.120 1.00 27.25 ? 151  TYR A CD2 1 
ATOM   1241 C CE1 . TYR A 1 170 ? -6.679  12.941 50.594 1.00 28.15 ? 151  TYR A CE1 1 
ATOM   1242 C CE2 . TYR A 1 170 ? -7.242  14.957 49.367 1.00 29.09 ? 151  TYR A CE2 1 
ATOM   1243 C CZ  . TYR A 1 170 ? -6.389  13.877 49.626 1.00 28.38 ? 151  TYR A CZ  1 
ATOM   1244 O OH  . TYR A 1 170 ? -5.251  13.784 48.868 1.00 31.46 ? 151  TYR A OH  1 
ATOM   1245 N N   . ILE A 1 171 ? -8.446  17.255 52.909 1.00 22.17 ? 152  ILE A N   1 
ATOM   1246 C CA  . ILE A 1 171 ? -8.135  18.653 52.628 1.00 23.81 ? 152  ILE A CA  1 
ATOM   1247 C C   . ILE A 1 171 ? -7.406  18.787 51.293 1.00 22.74 ? 152  ILE A C   1 
ATOM   1248 O O   . ILE A 1 171 ? -6.375  18.170 51.081 1.00 23.47 ? 152  ILE A O   1 
ATOM   1249 C CB  . ILE A 1 171 ? -7.377  19.316 53.793 1.00 23.82 ? 152  ILE A CB  1 
ATOM   1250 C CG1 . ILE A 1 171 ? -8.245  19.133 55.058 1.00 25.61 ? 152  ILE A CG1 1 
ATOM   1251 C CG2 . ILE A 1 171 ? -7.143  20.827 53.509 1.00 26.09 ? 152  ILE A CG2 1 
ATOM   1252 C CD1 . ILE A 1 171 ? -7.676  19.653 56.298 1.00 28.94 ? 152  ILE A CD1 1 
ATOM   1253 N N   . LEU A 1 172 ? -7.990  19.602 50.418 1.00 22.39 ? 153  LEU A N   1 
ATOM   1254 C CA  . LEU A 1 172 ? -7.616  19.704 48.999 1.00 22.68 ? 153  LEU A CA  1 
ATOM   1255 C C   . LEU A 1 172 ? -6.696  20.893 48.854 1.00 21.11 ? 153  LEU A C   1 
ATOM   1256 O O   . LEU A 1 172 ? -7.035  21.902 48.257 1.00 21.32 ? 153  LEU A O   1 
ATOM   1257 C CB  . LEU A 1 172 ? -8.897  19.887 48.138 1.00 21.70 ? 153  LEU A CB  1 
ATOM   1258 C CG  . LEU A 1 172 ? -9.760  18.619 48.178 1.00 23.66 ? 153  LEU A CG  1 
ATOM   1259 C CD1 . LEU A 1 172 ? -11.281 18.941 47.952 1.00 22.23 ? 153  LEU A CD1 1 
ATOM   1260 C CD2 . LEU A 1 172 ? -9.253  17.569 47.176 1.00 23.55 ? 153  LEU A CD2 1 
ATOM   1261 N N   . ASN A 1 173 ? -5.489  20.703 49.358 1.00 20.80 ? 154  ASN A N   1 
ATOM   1262 C CA  . ASN A 1 173 ? -4.502  21.735 49.561 1.00 21.87 ? 154  ASN A CA  1 
ATOM   1263 C C   . ASN A 1 173 ? -3.562  22.078 48.425 1.00 19.45 ? 154  ASN A C   1 
ATOM   1264 O O   . ASN A 1 173 ? -2.845  23.053 48.530 1.00 18.63 ? 154  ASN A O   1 
ATOM   1265 C CB  . ASN A 1 173 ? -3.588  21.276 50.715 1.00 21.96 ? 154  ASN A CB  1 
ATOM   1266 C CG  . ASN A 1 173 ? -4.063  21.791 51.971 1.00 29.92 ? 154  ASN A CG  1 
ATOM   1267 O OD1 . ASN A 1 173 ? -4.806  22.827 51.995 1.00 33.95 ? 154  ASN A OD1 1 
ATOM   1268 N ND2 . ASN A 1 173 ? -3.715  21.092 53.073 1.00 31.84 ? 154  ASN A ND2 1 
ATOM   1269 N N   . THR A 1 174 ? -3.525  21.267 47.388 1.00 19.23 ? 155  THR A N   1 
ATOM   1270 C CA  . THR A 1 174 ? -2.567  21.487 46.299 1.00 18.89 ? 155  THR A CA  1 
ATOM   1271 C C   . THR A 1 174 ? -3.255  22.025 45.057 1.00 18.75 ? 155  THR A C   1 
ATOM   1272 O O   . THR A 1 174 ? -4.452  21.860 44.872 1.00 17.79 ? 155  THR A O   1 
ATOM   1273 C CB  . THR A 1 174 ? -1.794  20.185 45.970 1.00 19.81 ? 155  THR A CB  1 
ATOM   1274 O OG1 . THR A 1 174 ? -2.628  19.319 45.210 1.00 21.07 ? 155  THR A OG1 1 
ATOM   1275 C CG2 . THR A 1 174 ? -1.362  19.410 47.290 1.00 19.47 ? 155  THR A CG2 1 
ATOM   1276 N N   . LEU A 1 175 ? -2.487  22.674 44.181 1.00 19.60 ? 156  LEU A N   1 
ATOM   1277 C CA  . LEU A 1 175 ? -3.056  23.170 42.948 1.00 19.53 ? 156  LEU A CA  1 
ATOM   1278 C C   . LEU A 1 175 ? -3.452  21.998 42.037 1.00 20.25 ? 156  LEU A C   1 
ATOM   1279 O O   . LEU A 1 175 ? -4.392  22.104 41.230 1.00 19.03 ? 156  LEU A O   1 
ATOM   1280 C CB  . LEU A 1 175 ? -2.049  24.109 42.280 1.00 21.64 ? 156  LEU A CB  1 
ATOM   1281 C CG  . LEU A 1 175 ? -2.001  25.488 42.964 1.00 21.97 ? 156  LEU A CG  1 
ATOM   1282 C CD1 . LEU A 1 175 ? -0.790  26.191 42.584 1.00 24.81 ? 156  LEU A CD1 1 
ATOM   1283 C CD2 . LEU A 1 175 ? -3.177  26.232 42.429 1.00 23.44 ? 156  LEU A CD2 1 
ATOM   1284 N N   . PHE A 1 176 ? -2.761  20.869 42.178 1.00 19.47 ? 157  PHE A N   1 
ATOM   1285 C CA  . PHE A 1 176 ? -3.199  19.652 41.488 1.00 21.08 ? 157  PHE A CA  1 
ATOM   1286 C C   . PHE A 1 176 ? -4.599  19.202 41.907 1.00 20.85 ? 157  PHE A C   1 
ATOM   1287 O O   . PHE A 1 176 ? -5.259  18.514 41.142 1.00 22.98 ? 157  PHE A O   1 
ATOM   1288 C CB  . PHE A 1 176 ? -2.176  18.524 41.679 1.00 19.56 ? 157  PHE A CB  1 
ATOM   1289 C CG  . PHE A 1 176 ? -0.858  18.766 40.977 1.00 23.02 ? 157  PHE A CG  1 
ATOM   1290 C CD1 . PHE A 1 176 ? -0.783  18.897 39.573 1.00 19.00 ? 157  PHE A CD1 1 
ATOM   1291 C CD2 . PHE A 1 176 ? 0.331   18.872 41.711 1.00 24.85 ? 157  PHE A CD2 1 
ATOM   1292 C CE1 . PHE A 1 176 ? 0.418   19.122 38.943 1.00 20.16 ? 157  PHE A CE1 1 
ATOM   1293 C CE2 . PHE A 1 176 ? 1.542   19.101 41.070 1.00 25.03 ? 157  PHE A CE2 1 
ATOM   1294 C CZ  . PHE A 1 176 ? 1.582   19.209 39.656 1.00 19.77 ? 157  PHE A CZ  1 
ATOM   1295 N N   . ASN A 1 177 ? -5.073  19.584 43.099 1.00 21.74 ? 158  ASN A N   1 
ATOM   1296 C CA  . ASN A 1 177 ? -6.422  19.192 43.552 1.00 22.21 ? 158  ASN A CA  1 
ATOM   1297 C C   . ASN A 1 177 ? -7.527  20.137 43.045 1.00 22.48 ? 158  ASN A C   1 
ATOM   1298 O O   . ASN A 1 177 ? -8.677  19.941 43.406 1.00 22.22 ? 158  ASN A O   1 
ATOM   1299 C CB  . ASN A 1 177 ? -6.584  19.195 45.101 1.00 22.23 ? 158  ASN A CB  1 
ATOM   1300 C CG  . ASN A 1 177 ? -5.676  18.205 45.833 1.00 25.64 ? 158  ASN A CG  1 
ATOM   1301 O OD1 . ASN A 1 177 ? -5.056  18.590 46.837 1.00 25.79 ? 158  ASN A OD1 1 
ATOM   1302 N ND2 . ASN A 1 177 ? -5.603  16.942 45.364 1.00 22.18 ? 158  ASN A ND2 1 
ATOM   1303 N N   . LEU A 1 178 ? -7.204  21.202 42.306 1.00 22.17 ? 159  LEU A N   1 
ATOM   1304 C CA  . LEU A 1 178 ? -8.286  22.095 41.849 1.00 23.69 ? 159  LEU A CA  1 
ATOM   1305 C C   . LEU A 1 178 ? -9.298  21.413 40.916 1.00 24.28 ? 159  LEU A C   1 
ATOM   1306 O O   . LEU A 1 178 ? -10.496 21.544 41.161 1.00 24.72 ? 159  LEU A O   1 
ATOM   1307 C CB  . LEU A 1 178 ? -7.777  23.372 41.227 1.00 23.75 ? 159  LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 178 ? -7.200  24.420 42.209 1.00 25.06 ? 159  LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 178 ? -6.482  25.505 41.404 1.00 24.20 ? 159  LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 178 ? -8.212  25.047 43.158 1.00 23.57 ? 159  LEU A CD2 1 
ATOM   1311 N N   . PRO A 1 179 ? -8.844  20.658 39.875 1.00 24.54 ? 160  PRO A N   1 
ATOM   1312 C CA  . PRO A 1 179 ? -9.852  19.935 39.075 1.00 24.94 ? 160  PRO A CA  1 
ATOM   1313 C C   . PRO A 1 179 ? -10.766 18.986 39.858 1.00 25.17 ? 160  PRO A C   1 
ATOM   1314 O O   . PRO A 1 179 ? -11.930 18.903 39.546 1.00 24.24 ? 160  PRO A O   1 
ATOM   1315 C CB  . PRO A 1 179 ? -9.017  19.075 38.096 1.00 23.65 ? 160  PRO A CB  1 
ATOM   1316 C CG  . PRO A 1 179 ? -7.710  19.680 38.063 1.00 24.10 ? 160  PRO A CG  1 
ATOM   1317 C CD  . PRO A 1 179 ? -7.483  20.428 39.362 1.00 24.20 ? 160  PRO A CD  1 
ATOM   1318 N N   . GLU A 1 180 ? -10.211 18.193 40.777 1.00 25.55 ? 161  GLU A N   1 
ATOM   1319 C CA  . GLU A 1 180 ? -11.038 17.324 41.570 1.00 25.39 ? 161  GLU A CA  1 
ATOM   1320 C C   . GLU A 1 180 ? -11.927 18.052 42.558 1.00 24.73 ? 161  GLU A C   1 
ATOM   1321 O O   . GLU A 1 180 ? -12.980 17.554 42.822 1.00 26.05 ? 161  GLU A O   1 
ATOM   1322 C CB  . GLU A 1 180 ? -10.230 16.224 42.240 1.00 27.36 ? 161  GLU A CB  1 
ATOM   1323 C CG  . GLU A 1 180 ? -9.799  16.467 43.629 1.00 29.44 ? 161  GLU A CG  1 
ATOM   1324 C CD  . GLU A 1 180 ? -8.658  15.544 44.042 1.00 34.16 ? 161  GLU A CD  1 
ATOM   1325 O OE1 . GLU A 1 180 ? -8.933  14.609 44.844 1.00 35.98 ? 161  GLU A OE1 1 
ATOM   1326 O OE2 . GLU A 1 180 ? -7.507  15.723 43.542 1.00 33.39 ? 161  GLU A OE2 1 
ATOM   1327 N N   . THR A 1 181 ? -11.535 19.222 43.079 1.00 23.25 ? 162  THR A N   1 
ATOM   1328 C CA  . THR A 1 181 ? -12.453 20.026 43.896 1.00 23.35 ? 162  THR A CA  1 
ATOM   1329 C C   . THR A 1 181 ? -13.755 20.313 43.057 1.00 23.96 ? 162  THR A C   1 
ATOM   1330 O O   . THR A 1 181 ? -14.898 20.184 43.549 1.00 22.97 ? 162  THR A O   1 
ATOM   1331 C CB  . THR A 1 181 ? -11.793 21.378 44.302 1.00 23.26 ? 162  THR A CB  1 
ATOM   1332 O OG1 . THR A 1 181 ? -10.592 21.145 45.065 1.00 23.92 ? 162  THR A OG1 1 
ATOM   1333 C CG2 . THR A 1 181 ? -12.716 22.259 45.104 1.00 22.45 ? 162  THR A CG2 1 
ATOM   1334 N N   . TYR A 1 182 ? -13.566 20.760 41.816 1.00 22.45 ? 163  TYR A N   1 
ATOM   1335 C CA  . TYR A 1 182 ? -14.714 21.122 40.981 1.00 22.89 ? 163  TYR A CA  1 
ATOM   1336 C C   . TYR A 1 182 ? -15.479 19.855 40.616 1.00 21.96 ? 163  TYR A C   1 
ATOM   1337 O O   . TYR A 1 182 ? -16.698 19.836 40.679 1.00 23.24 ? 163  TYR A O   1 
ATOM   1338 C CB  . TYR A 1 182 ? -14.276 21.898 39.696 1.00 22.69 ? 163  TYR A CB  1 
ATOM   1339 C CG  . TYR A 1 182 ? -15.448 22.258 38.787 1.00 22.36 ? 163  TYR A CG  1 
ATOM   1340 C CD1 . TYR A 1 182 ? -16.458 23.125 39.234 1.00 20.36 ? 163  TYR A CD1 1 
ATOM   1341 C CD2 . TYR A 1 182 ? -15.558 21.711 37.519 1.00 21.23 ? 163  TYR A CD2 1 
ATOM   1342 C CE1 . TYR A 1 182 ? -17.555 23.473 38.419 1.00 20.48 ? 163  TYR A CE1 1 
ATOM   1343 C CE2 . TYR A 1 182 ? -16.670 22.018 36.682 1.00 21.30 ? 163  TYR A CE2 1 
ATOM   1344 C CZ  . TYR A 1 182 ? -17.636 22.927 37.121 1.00 22.29 ? 163  TYR A CZ  1 
ATOM   1345 O OH  . TYR A 1 182 ? -18.741 23.220 36.319 1.00 21.74 ? 163  TYR A OH  1 
ATOM   1346 N N   . LEU A 1 183 ? -14.752 18.800 40.278 1.00 21.43 ? 164  LEU A N   1 
ATOM   1347 C CA  . LEU A 1 183 ? -15.375 17.543 39.874 1.00 22.60 ? 164  LEU A CA  1 
ATOM   1348 C C   . LEU A 1 183 ? -16.222 16.882 40.980 1.00 23.06 ? 164  LEU A C   1 
ATOM   1349 O O   . LEU A 1 183 ? -17.308 16.369 40.736 1.00 22.29 ? 164  LEU A O   1 
ATOM   1350 C CB  . LEU A 1 183 ? -14.310 16.583 39.373 1.00 21.83 ? 164  LEU A CB  1 
ATOM   1351 C CG  . LEU A 1 183 ? -14.778 15.222 38.875 1.00 23.65 ? 164  LEU A CG  1 
ATOM   1352 C CD1 . LEU A 1 183 ? -15.832 15.394 37.737 1.00 23.80 ? 164  LEU A CD1 1 
ATOM   1353 C CD2 . LEU A 1 183 ? -13.620 14.332 38.422 1.00 23.29 ? 164  LEU A CD2 1 
ATOM   1354 N N   . LEU A 1 184 ? -15.744 16.947 42.216 1.00 22.76 ? 165  LEU A N   1 
ATOM   1355 C CA  . LEU A 1 184 ? -16.567 16.455 43.332 1.00 23.17 ? 165  LEU A CA  1 
ATOM   1356 C C   . LEU A 1 184 ? -17.908 17.176 43.391 1.00 22.28 ? 165  LEU A C   1 
ATOM   1357 O O   . LEU A 1 184 ? -18.931 16.527 43.538 1.00 23.25 ? 165  LEU A O   1 
ATOM   1358 C CB  . LEU A 1 184 ? -15.801 16.591 44.689 1.00 22.24 ? 165  LEU A CB  1 
ATOM   1359 C CG  . LEU A 1 184 ? -14.574 15.665 44.792 1.00 23.13 ? 165  LEU A CG  1 
ATOM   1360 C CD1 . LEU A 1 184 ? -13.608 16.183 45.954 1.00 24.68 ? 165  LEU A CD1 1 
ATOM   1361 C CD2 . LEU A 1 184 ? -14.979 14.190 45.007 1.00 22.51 ? 165  LEU A CD2 1 
ATOM   1362 N N   . ALA A 1 185 ? -17.911 18.511 43.261 1.00 22.80 ? 166  ALA A N   1 
ATOM   1363 C CA  . ALA A 1 185 ? -19.138 19.253 43.262 1.00 21.42 ? 166  ALA A CA  1 
ATOM   1364 C C   . ALA A 1 185 ? -20.051 18.928 42.021 1.00 21.95 ? 166  ALA A C   1 
ATOM   1365 O O   . ALA A 1 185 ? -21.277 18.777 42.164 1.00 21.21 ? 166  ALA A O   1 
ATOM   1366 C CB  . ALA A 1 185 ? -18.876 20.750 43.380 1.00 20.44 ? 166  ALA A CB  1 
ATOM   1367 N N   . CYS A 1 186 ? -19.455 18.853 40.830 1.00 22.35 ? 167  CYS A N   1 
ATOM   1368 C CA  . CYS A 1 186 ? -20.165 18.372 39.622 1.00 22.14 ? 167  CYS A CA  1 
ATOM   1369 C C   . CYS A 1 186 ? -20.814 17.009 39.840 1.00 22.10 ? 167  CYS A C   1 
ATOM   1370 O O   . CYS A 1 186 ? -21.972 16.829 39.478 1.00 21.90 ? 167  CYS A O   1 
ATOM   1371 C CB  . CYS A 1 186 ? -19.188 18.212 38.429 1.00 21.85 ? 167  CYS A CB  1 
ATOM   1372 S SG  . CYS A 1 186 ? -18.588 19.697 37.775 1.00 25.61 ? 167  CYS A SG  1 
ATOM   1373 N N   . LEU A 1 187 ? -20.066 16.038 40.383 1.00 22.16 ? 168  LEU A N   1 
ATOM   1374 C CA  . LEU A 1 187 ? -20.640 14.707 40.664 1.00 22.21 ? 168  LEU A CA  1 
ATOM   1375 C C   . LEU A 1 187 ? -21.825 14.745 41.655 1.00 21.97 ? 168  LEU A C   1 
ATOM   1376 O O   . LEU A 1 187 ? -22.886 14.193 41.356 1.00 22.34 ? 168  LEU A O   1 
ATOM   1377 C CB  . LEU A 1 187 ? -19.568 13.698 41.139 1.00 23.11 ? 168  LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 187 ? -18.494 13.351 40.075 1.00 24.22 ? 168  LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 187 ? -17.308 12.704 40.754 1.00 23.88 ? 168  LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 187 ? -19.037 12.442 38.936 1.00 18.95 ? 168  LEU A CD2 1 
ATOM   1381 N N   . VAL A 1 188 ? -21.638 15.339 42.843 1.00 21.89 ? 169  VAL A N   1 
ATOM   1382 C CA  . VAL A 1 188 ? -22.726 15.499 43.829 1.00 20.57 ? 169  VAL A CA  1 
ATOM   1383 C C   . VAL A 1 188 ? -23.937 16.179 43.174 1.00 21.20 ? 169  VAL A C   1 
ATOM   1384 O O   . VAL A 1 188 ? -25.096 15.705 43.293 1.00 20.78 ? 169  VAL A O   1 
ATOM   1385 C CB  . VAL A 1 188 ? -22.265 16.239 45.116 1.00 20.69 ? 169  VAL A CB  1 
ATOM   1386 C CG1 . VAL A 1 188 ? -23.467 16.475 46.014 1.00 16.73 ? 169  VAL A CG1 1 
ATOM   1387 C CG2 . VAL A 1 188 ? -21.172 15.406 45.856 1.00 19.03 ? 169  VAL A CG2 1 
ATOM   1388 N N   . ASP A 1 189 ? -23.664 17.237 42.396 1.00 20.54 ? 170  ASP A N   1 
ATOM   1389 C CA  . ASP A 1 189 ? -24.742 17.917 41.691 1.00 20.79 ? 170  ASP A CA  1 
ATOM   1390 C C   . ASP A 1 189 ? -25.422 16.998 40.692 1.00 20.36 ? 170  ASP A C   1 
ATOM   1391 O O   . ASP A 1 189 ? -26.656 16.990 40.596 1.00 20.33 ? 170  ASP A O   1 
ATOM   1392 C CB  . ASP A 1 189 ? -24.265 19.194 40.984 1.00 19.91 ? 170  ASP A CB  1 
ATOM   1393 C CG  . ASP A 1 189 ? -25.345 19.783 40.069 1.00 23.69 ? 170  ASP A CG  1 
ATOM   1394 O OD1 . ASP A 1 189 ? -26.290 20.424 40.581 1.00 23.21 ? 170  ASP A OD1 1 
ATOM   1395 O OD2 . ASP A 1 189 ? -25.254 19.611 38.832 1.00 26.13 ? 170  ASP A OD2 1 
ATOM   1396 N N   . PHE A 1 190 ? -24.649 16.222 39.943 1.00 20.51 ? 171  PHE A N   1 
ATOM   1397 C CA  . PHE A 1 190 ? -25.271 15.371 38.905 1.00 21.05 ? 171  PHE A CA  1 
ATOM   1398 C C   . PHE A 1 190 ? -26.136 14.269 39.520 1.00 20.76 ? 171  PHE A C   1 
ATOM   1399 O O   . PHE A 1 190 ? -27.256 14.077 39.124 1.00 20.83 ? 171  PHE A O   1 
ATOM   1400 C CB  . PHE A 1 190 ? -24.234 14.761 37.953 1.00 21.69 ? 171  PHE A CB  1 
ATOM   1401 C CG  . PHE A 1 190 ? -24.783 13.641 37.088 1.00 22.26 ? 171  PHE A CG  1 
ATOM   1402 C CD1 . PHE A 1 190 ? -25.528 13.924 35.958 1.00 22.13 ? 171  PHE A CD1 1 
ATOM   1403 C CD2 . PHE A 1 190 ? -24.540 12.307 37.413 1.00 21.27 ? 171  PHE A CD2 1 
ATOM   1404 C CE1 . PHE A 1 190 ? -26.048 12.911 35.185 1.00 23.57 ? 171  PHE A CE1 1 
ATOM   1405 C CE2 . PHE A 1 190 ? -25.056 11.289 36.657 1.00 23.94 ? 171  PHE A CE2 1 
ATOM   1406 C CZ  . PHE A 1 190 ? -25.822 11.583 35.535 1.00 25.04 ? 171  PHE A CZ  1 
ATOM   1407 N N   . PHE A 1 191 ? -25.588 13.505 40.454 1.00 20.71 ? 172  PHE A N   1 
ATOM   1408 C CA  . PHE A 1 191 ? -26.327 12.405 41.076 1.00 21.04 ? 172  PHE A CA  1 
ATOM   1409 C C   . PHE A 1 191 ? -27.546 12.875 41.874 1.00 20.93 ? 172  PHE A C   1 
ATOM   1410 O O   . PHE A 1 191 ? -28.558 12.188 41.890 1.00 19.76 ? 172  PHE A O   1 
ATOM   1411 C CB  . PHE A 1 191 ? -25.406 11.515 41.953 1.00 21.67 ? 172  PHE A CB  1 
ATOM   1412 C CG  . PHE A 1 191 ? -24.365 10.752 41.158 1.00 23.77 ? 172  PHE A CG  1 
ATOM   1413 C CD1 . PHE A 1 191 ? -24.751 9.741  40.270 1.00 26.81 ? 172  PHE A CD1 1 
ATOM   1414 C CD2 . PHE A 1 191 ? -23.010 11.044 41.281 1.00 26.04 ? 172  PHE A CD2 1 
ATOM   1415 C CE1 . PHE A 1 191 ? -23.801 9.021  39.515 1.00 27.65 ? 172  PHE A CE1 1 
ATOM   1416 C CE2 . PHE A 1 191 ? -22.051 10.340 40.513 1.00 25.57 ? 172  PHE A CE2 1 
ATOM   1417 C CZ  . PHE A 1 191 ? -22.443 9.346  39.640 1.00 25.76 ? 172  PHE A CZ  1 
ATOM   1418 N N   . THR A 1 192 ? -27.452 14.036 42.532 1.00 21.30 ? 173  THR A N   1 
ATOM   1419 C CA  . THR A 1 192 ? -28.596 14.599 43.242 1.00 22.84 ? 173  THR A CA  1 
ATOM   1420 C C   . THR A 1 192 ? -29.754 14.890 42.276 1.00 23.53 ? 173  THR A C   1 
ATOM   1421 O O   . THR A 1 192 ? -30.925 14.644 42.599 1.00 23.54 ? 173  THR A O   1 
ATOM   1422 C CB  . THR A 1 192 ? -28.236 15.902 43.989 1.00 22.27 ? 173  THR A CB  1 
ATOM   1423 O OG1 . THR A 1 192 ? -27.161 15.636 44.901 1.00 26.49 ? 173  THR A OG1 1 
ATOM   1424 C CG2 . THR A 1 192 ? -29.432 16.428 44.752 1.00 24.34 ? 173  THR A CG2 1 
ATOM   1425 N N   . ASN A 1 193 ? -29.439 15.413 41.097 1.00 23.68 ? 174  ASN A N   1 
ATOM   1426 C CA  . ASN A 1 193 ? -30.506 15.853 40.213 1.00 25.49 ? 174  ASN A CA  1 
ATOM   1427 C C   . ASN A 1 193 ? -30.928 14.836 39.143 1.00 25.63 ? 174  ASN A C   1 
ATOM   1428 O O   . ASN A 1 193 ? -31.836 15.105 38.375 1.00 25.82 ? 174  ASN A O   1 
ATOM   1429 C CB  . ASN A 1 193 ? -30.202 17.264 39.670 1.00 25.34 ? 174  ASN A CB  1 
ATOM   1430 C CG  . ASN A 1 193 ? -30.187 18.318 40.786 1.00 26.09 ? 174  ASN A CG  1 
ATOM   1431 O OD1 . ASN A 1 193 ? -29.139 18.821 41.181 1.00 29.99 ? 174  ASN A OD1 1 
ATOM   1432 N ND2 . ASN A 1 193 ? -31.361 18.628 41.323 1.00 28.97 ? 174  ASN A ND2 1 
ATOM   1433 N N   . CYS A 1 194 ? -30.283 13.660 39.111 1.00 26.59 ? 175  CYS A N   1 
ATOM   1434 C CA  . CYS A 1 194 ? -30.606 12.616 38.141 1.00 25.67 ? 175  CYS A CA  1 
ATOM   1435 C C   . CYS A 1 194 ? -31.657 11.650 38.732 1.00 25.82 ? 175  CYS A C   1 
ATOM   1436 O O   . CYS A 1 194 ? -31.413 11.018 39.777 1.00 26.39 ? 175  CYS A O   1 
ATOM   1437 C CB  . CYS A 1 194 ? -29.348 11.848 37.713 1.00 26.31 ? 175  CYS A CB  1 
ATOM   1438 S SG  . CYS A 1 194 ? -29.669 10.557 36.458 1.00 29.05 ? 175  CYS A SG  1 
ATOM   1439 N N   . PRO A 1 195 ? -32.838 11.565 38.098 1.00 24.83 ? 176  PRO A N   1 
ATOM   1440 C CA  . PRO A 1 195 ? -33.909 10.740 38.667 1.00 25.01 ? 176  PRO A CA  1 
ATOM   1441 C C   . PRO A 1 195 ? -33.634 9.219  38.711 1.00 24.48 ? 176  PRO A C   1 
ATOM   1442 O O   . PRO A 1 195 ? -34.367 8.516  39.382 1.00 23.39 ? 176  PRO A O   1 
ATOM   1443 C CB  . PRO A 1 195 ? -35.133 11.080 37.792 1.00 24.89 ? 176  PRO A CB  1 
ATOM   1444 C CG  . PRO A 1 195 ? -34.570 11.571 36.499 1.00 25.48 ? 176  PRO A CG  1 
ATOM   1445 C CD  . PRO A 1 195 ? -33.258 12.252 36.860 1.00 24.78 ? 176  PRO A CD  1 
ATOM   1446 N N   . ARG A 1 196 ? -32.580 8.735  38.044 1.00 24.42 ? 177  ARG A N   1 
ATOM   1447 C CA  . ARG A 1 196 ? -32.096 7.337  38.212 1.00 25.61 ? 177  ARG A CA  1 
ATOM   1448 C C   . ARG A 1 196 ? -31.601 7.022  39.649 1.00 24.99 ? 177  ARG A C   1 
ATOM   1449 O O   . ARG A 1 196 ? -31.637 5.876  40.090 1.00 24.17 ? 177  ARG A O   1 
ATOM   1450 C CB  . ARG A 1 196 ? -30.974 7.022  37.197 1.00 25.64 ? 177  ARG A CB  1 
ATOM   1451 C CG  . ARG A 1 196 ? -31.421 7.176  35.736 1.00 28.02 ? 177  ARG A CG  1 
ATOM   1452 C CD  . ARG A 1 196 ? -30.480 6.557  34.692 1.00 28.66 ? 177  ARG A CD  1 
ATOM   1453 N NE  . ARG A 1 196 ? -29.063 6.913  34.833 1.00 31.91 ? 177  ARG A NE  1 
ATOM   1454 C CZ  . ARG A 1 196 ? -28.446 7.900  34.163 1.00 34.62 ? 177  ARG A CZ  1 
ATOM   1455 N NH1 . ARG A 1 196 ? -29.117 8.683  33.309 1.00 33.99 ? 177  ARG A NH1 1 
ATOM   1456 N NH2 . ARG A 1 196 ? -27.145 8.109  34.344 1.00 30.03 ? 177  ARG A NH2 1 
ATOM   1457 N N   . TYR A 1 197 ? -31.161 8.055  40.369 1.00 24.34 ? 178  TYR A N   1 
ATOM   1458 C CA  . TYR A 1 197 ? -30.564 7.878  41.683 1.00 25.49 ? 178  TYR A CA  1 
ATOM   1459 C C   . TYR A 1 197 ? -31.432 8.469  42.771 1.00 25.42 ? 178  TYR A C   1 
ATOM   1460 O O   . TYR A 1 197 ? -32.025 9.527  42.595 1.00 26.16 ? 178  TYR A O   1 
ATOM   1461 C CB  . TYR A 1 197 ? -29.190 8.546  41.705 1.00 25.85 ? 178  TYR A CB  1 
ATOM   1462 C CG  . TYR A 1 197 ? -28.307 8.053  40.601 1.00 26.90 ? 178  TYR A CG  1 
ATOM   1463 C CD1 . TYR A 1 197 ? -27.556 6.885  40.755 1.00 27.46 ? 178  TYR A CD1 1 
ATOM   1464 C CD2 . TYR A 1 197 ? -28.243 8.739  39.387 1.00 27.97 ? 178  TYR A CD2 1 
ATOM   1465 C CE1 . TYR A 1 197 ? -26.752 6.408  39.712 1.00 29.70 ? 178  TYR A CE1 1 
ATOM   1466 C CE2 . TYR A 1 197 ? -27.448 8.298  38.359 1.00 29.76 ? 178  TYR A CE2 1 
ATOM   1467 C CZ  . TYR A 1 197 ? -26.692 7.131  38.526 1.00 30.15 ? 178  TYR A CZ  1 
ATOM   1468 O OH  . TYR A 1 197 ? -25.897 6.704  37.485 1.00 33.22 ? 178  TYR A OH  1 
ATOM   1469 N N   . THR A 1 198 ? -31.486 7.791  43.903 1.00 25.47 ? 179  THR A N   1 
ATOM   1470 C CA  . THR A 1 198 ? -32.136 8.324  45.090 1.00 25.24 ? 179  THR A CA  1 
ATOM   1471 C C   . THR A 1 198 ? -31.086 8.881  46.065 1.00 25.36 ? 179  THR A C   1 
ATOM   1472 O O   . THR A 1 198 ? -30.115 8.187  46.444 1.00 25.50 ? 179  THR A O   1 
ATOM   1473 C CB  . THR A 1 198 ? -32.982 7.253  45.746 1.00 24.91 ? 179  THR A CB  1 
ATOM   1474 O OG1 . THR A 1 198 ? -33.984 6.841  44.820 1.00 26.75 ? 179  THR A OG1 1 
ATOM   1475 C CG2 . THR A 1 198 ? -33.674 7.771  46.999 1.00 25.19 ? 179  THR A CG2 1 
ATOM   1476 N N   . SER A 1 199 ? -31.278 10.130 46.479 1.00 25.10 ? 180  SER A N   1 
ATOM   1477 C CA  . SER A 1 199 ? -30.336 10.788 47.374 1.00 25.11 ? 180  SER A CA  1 
ATOM   1478 C C   . SER A 1 199 ? -30.571 10.347 48.801 1.00 24.88 ? 180  SER A C   1 
ATOM   1479 O O   . SER A 1 199 ? -31.699 10.328 49.266 1.00 24.44 ? 180  SER A O   1 
ATOM   1480 C CB  . SER A 1 199 ? -30.499 12.303 47.276 1.00 26.49 ? 180  SER A CB  1 
ATOM   1481 O OG  . SER A 1 199 ? -30.301 12.729 45.924 1.00 29.39 ? 180  SER A OG  1 
ATOM   1482 N N   . CYS A 1 200 ? -29.499 9.976  49.487 1.00 24.61 ? 181  CYS A N   1 
ATOM   1483 C CA  . CYS A 1 200 ? -29.544 9.572  50.894 1.00 25.61 ? 181  CYS A CA  1 
ATOM   1484 C C   . CYS A 1 200 ? -28.585 10.488 51.667 1.00 24.61 ? 181  CYS A C   1 
ATOM   1485 O O   . CYS A 1 200 ? -27.799 11.241 51.070 1.00 23.16 ? 181  CYS A O   1 
ATOM   1486 C CB  . CYS A 1 200 ? -29.129 8.103  51.040 1.00 26.08 ? 181  CYS A CB  1 
ATOM   1487 S SG  . CYS A 1 200 ? -30.187 6.926  50.075 1.00 35.05 ? 181  CYS A SG  1 
ATOM   1488 N N   . GLU A 1 201 ? -28.606 10.398 52.985 1.00 24.12 ? 182  GLU A N   1 
ATOM   1489 C CA  . GLU A 1 201 ? -27.743 11.258 53.786 1.00 25.29 ? 182  GLU A CA  1 
ATOM   1490 C C   . GLU A 1 201 ? -26.239 11.044 53.469 1.00 22.90 ? 182  GLU A C   1 
ATOM   1491 O O   . GLU A 1 201 ? -25.462 11.989 53.449 1.00 22.86 ? 182  GLU A O   1 
ATOM   1492 C CB  . GLU A 1 201 ? -28.056 11.098 55.304 1.00 25.74 ? 182  GLU A CB  1 
ATOM   1493 C CG  . GLU A 1 201 ? -28.089 12.469 56.035 1.00 29.34 ? 182  GLU A CG  1 
ATOM   1494 C CD  . GLU A 1 201 ? -28.148 12.375 57.562 1.00 29.54 ? 182  GLU A CD  1 
ATOM   1495 O OE1 . GLU A 1 201 ? -28.268 11.234 58.091 1.00 32.42 ? 182  GLU A OE1 1 
ATOM   1496 O OE2 . GLU A 1 201 ? -28.045 13.466 58.217 1.00 35.59 ? 182  GLU A OE2 1 
ATOM   1497 N N   . THR A 1 202 ? -25.841 9.810  53.181 1.00 21.34 ? 183  THR A N   1 
ATOM   1498 C CA  . THR A 1 202 ? -24.434 9.505  53.049 1.00 20.24 ? 183  THR A CA  1 
ATOM   1499 C C   . THR A 1 202 ? -24.033 9.047  51.635 1.00 20.67 ? 183  THR A C   1 
ATOM   1500 O O   . THR A 1 202 ? -22.884 8.627  51.406 1.00 19.13 ? 183  THR A O   1 
ATOM   1501 C CB  . THR A 1 202 ? -23.973 8.454  54.092 1.00 20.51 ? 183  THR A CB  1 
ATOM   1502 O OG1 . THR A 1 202 ? -24.496 7.170  53.734 1.00 21.15 ? 183  THR A OG1 1 
ATOM   1503 C CG2 . THR A 1 202 ? -24.434 8.833  55.534 1.00 19.43 ? 183  THR A CG2 1 
ATOM   1504 N N   . GLY A 1 203 ? -24.974 9.135  50.697 1.00 20.43 ? 184  GLY A N   1 
ATOM   1505 C CA  . GLY A 1 203 ? -24.690 8.806  49.291 1.00 21.21 ? 184  GLY A CA  1 
ATOM   1506 C C   . GLY A 1 203 ? -25.937 8.656  48.443 1.00 21.05 ? 184  GLY A C   1 
ATOM   1507 O O   . GLY A 1 203 ? -26.961 9.269  48.745 1.00 20.95 ? 184  GLY A O   1 
ATOM   1508 N N   . PHE A 1 204 ? -25.841 7.826  47.404 1.00 20.25 ? 185  PHE A N   1 
ATOM   1509 C CA  . PHE A 1 204 ? -26.883 7.676  46.381 1.00 20.47 ? 185  PHE A CA  1 
ATOM   1510 C C   . PHE A 1 204 ? -27.200 6.205  46.188 1.00 21.28 ? 185  PHE A C   1 
ATOM   1511 O O   . PHE A 1 204 ? -26.305 5.364  46.121 1.00 22.05 ? 185  PHE A O   1 
ATOM   1512 C CB  . PHE A 1 204 ? -26.470 8.301  45.026 1.00 19.68 ? 185  PHE A CB  1 
ATOM   1513 C CG  . PHE A 1 204 ? -26.076 9.749  45.131 1.00 21.14 ? 185  PHE A CG  1 
ATOM   1514 C CD1 . PHE A 1 204 ? -27.046 10.746 45.208 1.00 19.93 ? 185  PHE A CD1 1 
ATOM   1515 C CD2 . PHE A 1 204 ? -24.740 10.111 45.189 1.00 21.33 ? 185  PHE A CD2 1 
ATOM   1516 C CE1 . PHE A 1 204 ? -26.715 12.090 45.333 1.00 19.82 ? 185  PHE A CE1 1 
ATOM   1517 C CE2 . PHE A 1 204 ? -24.379 11.462 45.315 1.00 21.31 ? 185  PHE A CE2 1 
ATOM   1518 C CZ  . PHE A 1 204 ? -25.394 12.466 45.388 1.00 21.79 ? 185  PHE A CZ  1 
ATOM   1519 N N   . LYS A 1 205 ? -28.483 5.916  46.117 1.00 21.78 ? 186  LYS A N   1 
ATOM   1520 C CA  . LYS A 1 205 ? -28.989 4.590  45.799 1.00 24.67 ? 186  LYS A CA  1 
ATOM   1521 C C   . LYS A 1 205 ? -29.381 4.528  44.309 1.00 24.99 ? 186  LYS A C   1 
ATOM   1522 O O   . LYS A 1 205 ? -30.125 5.397  43.813 1.00 23.90 ? 186  LYS A O   1 
ATOM   1523 C CB  . LYS A 1 205 ? -30.177 4.324  46.709 1.00 24.48 ? 186  LYS A CB  1 
ATOM   1524 C CG  . LYS A 1 205 ? -30.698 2.953  46.729 1.00 29.29 ? 186  LYS A CG  1 
ATOM   1525 C CD  . LYS A 1 205 ? -31.918 2.925  47.656 1.00 34.21 ? 186  LYS A CD  1 
ATOM   1526 C CE  . LYS A 1 205 ? -32.484 1.481  47.844 1.00 38.06 ? 186  LYS A CE  1 
ATOM   1527 N NZ  . LYS A 1 205 ? -32.885 0.821  46.559 1.00 40.05 ? 186  LYS A NZ  1 
ATOM   1528 N N   . ASP A 1 206 ? -28.841 3.530  43.603 1.00 25.75 ? 187  ASP A N   1 
ATOM   1529 C CA  . ASP A 1 206 ? -29.225 3.195  42.211 1.00 27.34 ? 187  ASP A CA  1 
ATOM   1530 C C   . ASP A 1 206 ? -29.763 1.742  42.168 1.00 27.85 ? 187  ASP A C   1 
ATOM   1531 O O   . ASP A 1 206 ? -29.037 0.822  41.797 1.00 27.28 ? 187  ASP A O   1 
ATOM   1532 C CB  . ASP A 1 206 ? -27.980 3.333  41.317 1.00 28.63 ? 187  ASP A CB  1 
ATOM   1533 C CG  . ASP A 1 206 ? -28.198 2.901  39.834 1.00 30.40 ? 187  ASP A CG  1 
ATOM   1534 O OD1 . ASP A 1 206 ? -29.299 2.515  39.386 1.00 31.52 ? 187  ASP A OD1 1 
ATOM   1535 O OD2 . ASP A 1 206 ? -27.185 2.962  39.105 1.00 35.70 ? 187  ASP A OD2 1 
ATOM   1536 N N   . GLY A 1 207 ? -31.023 1.549  42.553 1.00 28.06 ? 188  GLY A N   1 
ATOM   1537 C CA  . GLY A 1 207 ? -31.577 0.198  42.713 1.00 28.38 ? 188  GLY A CA  1 
ATOM   1538 C C   . GLY A 1 207 ? -30.858 -0.547 43.832 1.00 28.13 ? 188  GLY A C   1 
ATOM   1539 O O   . GLY A 1 207 ? -30.891 -0.128 44.994 1.00 28.52 ? 188  GLY A O   1 
ATOM   1540 N N   . ASP A 1 208 ? -30.176 -1.629 43.465 1.00 27.58 ? 189  ASP A N   1 
ATOM   1541 C CA  . ASP A 1 208 ? -29.436 -2.476 44.408 1.00 27.15 ? 189  ASP A CA  1 
ATOM   1542 C C   . ASP A 1 208 ? -27.947 -2.101 44.531 1.00 26.48 ? 189  ASP A C   1 
ATOM   1543 O O   . ASP A 1 208 ? -27.129 -2.916 44.975 1.00 26.67 ? 189  ASP A O   1 
ATOM   1544 C CB  . ASP A 1 208 ? -29.551 -3.952 43.987 1.00 27.20 ? 189  ASP A CB  1 
ATOM   1545 C CG  . ASP A 1 208 ? -30.944 -4.514 44.180 1.00 28.89 ? 189  ASP A CG  1 
ATOM   1546 O OD1 . ASP A 1 208 ? -31.650 -4.106 45.143 1.00 30.96 ? 189  ASP A OD1 1 
ATOM   1547 O OD2 . ASP A 1 208 ? -31.332 -5.381 43.367 1.00 31.28 ? 189  ASP A OD2 1 
ATOM   1548 N N   . LEU A 1 209 ? -27.595 -0.897 44.106 1.00 24.13 ? 190  LEU A N   1 
ATOM   1549 C CA  . LEU A 1 209 ? -26.263 -0.431 44.256 1.00 23.47 ? 190  LEU A CA  1 
ATOM   1550 C C   . LEU A 1 209 ? -26.332 0.836  45.100 1.00 23.38 ? 190  LEU A C   1 
ATOM   1551 O O   . LEU A 1 209 ? -27.167 1.717  44.849 1.00 22.40 ? 190  LEU A O   1 
ATOM   1552 C CB  . LEU A 1 209 ? -25.623 -0.166 42.894 1.00 23.44 ? 190  LEU A CB  1 
ATOM   1553 C CG  . LEU A 1 209 ? -25.441 -1.358 41.932 1.00 24.98 ? 190  LEU A CG  1 
ATOM   1554 C CD1 . LEU A 1 209 ? -25.278 -0.827 40.501 1.00 24.97 ? 190  LEU A CD1 1 
ATOM   1555 C CD2 . LEU A 1 209 ? -24.221 -2.157 42.331 1.00 24.44 ? 190  LEU A CD2 1 
ATOM   1556 N N   . PHE A 1 210 ? -25.475 0.895  46.117 1.00 22.65 ? 191  PHE A N   1 
ATOM   1557 C CA  . PHE A 1 210 ? -25.325 2.087  46.935 1.00 22.92 ? 191  PHE A CA  1 
ATOM   1558 C C   . PHE A 1 210 ? -23.908 2.630  46.787 1.00 23.17 ? 191  PHE A C   1 
ATOM   1559 O O   . PHE A 1 210 ? -22.926 1.924  47.053 1.00 22.69 ? 191  PHE A O   1 
ATOM   1560 C CB  . PHE A 1 210 ? -25.647 1.823  48.408 1.00 22.69 ? 191  PHE A CB  1 
ATOM   1561 C CG  . PHE A 1 210 ? -25.491 3.033  49.264 1.00 23.12 ? 191  PHE A CG  1 
ATOM   1562 C CD1 . PHE A 1 210 ? -26.455 4.038  49.239 1.00 25.72 ? 191  PHE A CD1 1 
ATOM   1563 C CD2 . PHE A 1 210 ? -24.375 3.198  50.065 1.00 23.03 ? 191  PHE A CD2 1 
ATOM   1564 C CE1 . PHE A 1 210 ? -26.306 5.193  50.019 1.00 24.52 ? 191  PHE A CE1 1 
ATOM   1565 C CE2 . PHE A 1 210 ? -24.220 4.345  50.852 1.00 21.44 ? 191  PHE A CE2 1 
ATOM   1566 C CZ  . PHE A 1 210 ? -25.200 5.330  50.831 1.00 22.56 ? 191  PHE A CZ  1 
ATOM   1567 N N   . MET A 1 211 ? -23.820 3.877  46.326 1.00 22.79 ? 192  MET A N   1 
ATOM   1568 C CA  . MET A 1 211 ? -22.561 4.578  46.224 1.00 24.89 ? 192  MET A CA  1 
ATOM   1569 C C   . MET A 1 211 ? -22.517 5.689  47.272 1.00 22.19 ? 192  MET A C   1 
ATOM   1570 O O   . MET A 1 211 ? -23.241 6.681  47.184 1.00 22.32 ? 192  MET A O   1 
ATOM   1571 C CB  . MET A 1 211 ? -22.394 5.170  44.813 1.00 24.88 ? 192  MET A CB  1 
ATOM   1572 C CG  . MET A 1 211 ? -21.038 5.868  44.570 1.00 28.15 ? 192  MET A CG  1 
ATOM   1573 S SD  . MET A 1 211 ? -21.047 6.882  43.041 1.00 35.14 ? 192  MET A SD  1 
ATOM   1574 C CE  . MET A 1 211 ? -22.241 8.163  43.464 1.00 36.81 ? 192  MET A CE  1 
ATOM   1575 N N   . SER A 1 212 ? -21.656 5.517  48.260 1.00 20.73 ? 193  SER A N   1 
ATOM   1576 C CA  . SER A 1 212 ? -21.470 6.493  49.293 1.00 18.45 ? 193  SER A CA  1 
ATOM   1577 C C   . SER A 1 212 ? -20.642 7.643  48.749 1.00 18.86 ? 193  SER A C   1 
ATOM   1578 O O   . SER A 1 212 ? -19.883 7.474  47.785 1.00 18.91 ? 193  SER A O   1 
ATOM   1579 C CB  . SER A 1 212 ? -20.819 5.823  50.490 1.00 19.09 ? 193  SER A CB  1 
ATOM   1580 O OG  . SER A 1 212 ? -19.535 5.399  50.158 1.00 20.35 ? 193  SER A OG  1 
ATOM   1581 N N   . TYR A 1 213 ? -20.823 8.847  49.313 1.00 17.91 ? 194  TYR A N   1 
ATOM   1582 C CA  . TYR A 1 213 ? -19.912 9.953  48.985 1.00 18.54 ? 194  TYR A CA  1 
ATOM   1583 C C   . TYR A 1 213 ? -18.442 9.555  49.170 1.00 19.05 ? 194  TYR A C   1 
ATOM   1584 O O   . TYR A 1 213 ? -17.566 10.058 48.462 1.00 19.00 ? 194  TYR A O   1 
ATOM   1585 C CB  . TYR A 1 213 ? -20.218 11.168 49.839 1.00 17.30 ? 194  TYR A CB  1 
ATOM   1586 C CG  . TYR A 1 213 ? -21.574 11.737 49.567 1.00 17.74 ? 194  TYR A CG  1 
ATOM   1587 C CD1 . TYR A 1 213 ? -21.865 12.282 48.312 1.00 21.26 ? 194  TYR A CD1 1 
ATOM   1588 C CD2 . TYR A 1 213 ? -22.563 11.763 50.552 1.00 13.87 ? 194  TYR A CD2 1 
ATOM   1589 C CE1 . TYR A 1 213 ? -23.133 12.860 48.038 1.00 21.15 ? 194  TYR A CE1 1 
ATOM   1590 C CE2 . TYR A 1 213 ? -23.816 12.320 50.288 1.00 18.59 ? 194  TYR A CE2 1 
ATOM   1591 C CZ  . TYR A 1 213 ? -24.092 12.841 49.022 1.00 19.30 ? 194  TYR A CZ  1 
ATOM   1592 O OH  . TYR A 1 213 ? -25.315 13.405 48.744 1.00 21.90 ? 194  TYR A OH  1 
ATOM   1593 N N   . ARG A 1 214 ? -18.190 8.683  50.151 1.00 18.64 ? 195  ARG A N   1 
ATOM   1594 C CA  . ARG A 1 214 ? -16.840 8.262  50.481 1.00 20.34 ? 195  ARG A CA  1 
ATOM   1595 C C   . ARG A 1 214 ? -16.218 7.423  49.362 1.00 20.60 ? 195  ARG A C   1 
ATOM   1596 O O   . ARG A 1 214 ? -15.044 7.615  49.000 1.00 19.83 ? 195  ARG A O   1 
ATOM   1597 C CB  . ARG A 1 214 ? -16.828 7.507  51.805 1.00 19.94 ? 195  ARG A CB  1 
ATOM   1598 C CG  . ARG A 1 214 ? -15.507 6.817  52.140 1.00 26.77 ? 195  ARG A CG  1 
ATOM   1599 C CD  . ARG A 1 214 ? -14.469 7.798  52.620 1.00 32.89 ? 195  ARG A CD  1 
ATOM   1600 N NE  . ARG A 1 214 ? -13.139 7.241  52.975 1.00 41.71 ? 195  ARG A NE  1 
ATOM   1601 C CZ  . ARG A 1 214 ? -12.158 6.963  52.093 1.00 43.88 ? 195  ARG A CZ  1 
ATOM   1602 N NH1 . ARG A 1 214 ? -12.339 7.122  50.777 1.00 43.72 ? 195  ARG A NH1 1 
ATOM   1603 N NH2 . ARG A 1 214 ? -10.989 6.509  52.527 1.00 43.54 ? 195  ARG A NH2 1 
ATOM   1604 N N   . SER A 1 215 ? -16.992 6.490  48.806 1.00 21.31 ? 196  SER A N   1 
ATOM   1605 C CA  . SER A 1 215 ? -16.429 5.655  47.761 1.00 22.49 ? 196  SER A CA  1 
ATOM   1606 C C   . SER A 1 215 ? -16.371 6.411  46.438 1.00 22.82 ? 196  SER A C   1 
ATOM   1607 O O   . SER A 1 215 ? -15.449 6.213  45.652 1.00 23.06 ? 196  SER A O   1 
ATOM   1608 C CB  . SER A 1 215 ? -17.190 4.356  47.636 1.00 22.63 ? 196  SER A CB  1 
ATOM   1609 O OG  . SER A 1 215 ? -18.366 4.606  46.938 1.00 27.82 ? 196  SER A OG  1 
ATOM   1610 N N   . MET A 1 216 ? -17.308 7.327  46.238 1.00 23.07 ? 197  MET A N   1 
ATOM   1611 C CA  . MET A 1 216 ? -17.229 8.261  45.120 1.00 24.58 ? 197  MET A CA  1 
ATOM   1612 C C   . MET A 1 216 ? -15.959 9.129  45.188 1.00 23.00 ? 197  MET A C   1 
ATOM   1613 O O   . MET A 1 216 ? -15.241 9.254  44.199 1.00 21.99 ? 197  MET A O   1 
ATOM   1614 C CB  . MET A 1 216 ? -18.483 9.125  45.053 1.00 23.21 ? 197  MET A CB  1 
ATOM   1615 C CG  . MET A 1 216 ? -18.617 9.931  43.775 1.00 28.05 ? 197  MET A CG  1 
ATOM   1616 S SD  . MET A 1 216 ? -19.817 11.269 43.950 1.00 29.63 ? 197  MET A SD  1 
ATOM   1617 C CE  . MET A 1 216 ? -18.895 12.424 44.958 1.00 28.26 ? 197  MET A CE  1 
ATOM   1618 N N   . PHE A 1 217 ? -15.718 9.744  46.349 1.00 21.36 ? 198  PHE A N   1 
ATOM   1619 C CA  . PHE A 1 217 ? -14.501 10.484 46.567 1.00 21.24 ? 198  PHE A CA  1 
ATOM   1620 C C   . PHE A 1 217 ? -13.246 9.639  46.257 1.00 21.08 ? 198  PHE A C   1 
ATOM   1621 O O   . PHE A 1 217 ? -12.306 10.148 45.629 1.00 19.43 ? 198  PHE A O   1 
ATOM   1622 C CB  . PHE A 1 217 ? -14.437 11.009 48.009 1.00 20.96 ? 198  PHE A CB  1 
ATOM   1623 C CG  . PHE A 1 217 ? -13.091 11.486 48.392 1.00 21.18 ? 198  PHE A CG  1 
ATOM   1624 C CD1 . PHE A 1 217 ? -12.669 12.766 48.011 1.00 20.27 ? 198  PHE A CD1 1 
ATOM   1625 C CD2 . PHE A 1 217 ? -12.227 10.655 49.074 1.00 21.69 ? 198  PHE A CD2 1 
ATOM   1626 C CE1 . PHE A 1 217 ? -11.424 13.209 48.336 1.00 24.58 ? 198  PHE A CE1 1 
ATOM   1627 C CE2 . PHE A 1 217 ? -10.959 11.100 49.422 1.00 22.60 ? 198  PHE A CE2 1 
ATOM   1628 C CZ  . PHE A 1 217 ? -10.556 12.377 49.046 1.00 21.83 ? 198  PHE A CZ  1 
ATOM   1629 N N   . GLN A 1 218 ? -13.229 8.384  46.730 1.00 20.85 ? 199  GLN A N   1 
ATOM   1630 C CA  . GLN A 1 218 ? -12.089 7.490  46.511 1.00 22.02 ? 199  GLN A CA  1 
ATOM   1631 C C   . GLN A 1 218 ? -11.871 7.195  45.031 1.00 21.48 ? 199  GLN A C   1 
ATOM   1632 O O   . GLN A 1 218 ? -10.732 7.240  44.574 1.00 21.00 ? 199  GLN A O   1 
ATOM   1633 C CB  . GLN A 1 218 ? -12.164 6.181  47.314 1.00 22.50 ? 199  GLN A CB  1 
ATOM   1634 C CG  . GLN A 1 218 ? -10.800 5.434  47.396 1.00 26.14 ? 199  GLN A CG  1 
ATOM   1635 C CD  . GLN A 1 218 ? -9.698  6.274  48.067 1.00 30.52 ? 199  GLN A CD  1 
ATOM   1636 O OE1 . GLN A 1 218 ? -9.906  6.842  49.147 1.00 30.07 ? 199  GLN A OE1 1 
ATOM   1637 N NE2 . GLN A 1 218 ? -8.524  6.356  47.424 1.00 28.04 ? 199  GLN A NE2 1 
ATOM   1638 N N   . ASP A 1 219 ? -12.949 6.939  44.292 1.00 20.80 ? 200  ASP A N   1 
ATOM   1639 C CA  . ASP A 1 219 ? -12.862 6.815  42.817 1.00 21.70 ? 200  ASP A CA  1 
ATOM   1640 C C   . ASP A 1 219 ? -12.228 8.051  42.141 1.00 21.49 ? 200  ASP A C   1 
ATOM   1641 O O   . ASP A 1 219 ? -11.334 7.924  41.295 1.00 21.48 ? 200  ASP A O   1 
ATOM   1642 C CB  . ASP A 1 219 ? -14.238 6.547  42.223 1.00 20.80 ? 200  ASP A CB  1 
ATOM   1643 C CG  . ASP A 1 219 ? -14.740 5.163  42.528 1.00 24.22 ? 200  ASP A CG  1 
ATOM   1644 O OD1 . ASP A 1 219 ? -13.910 4.275  42.836 1.00 28.41 ? 200  ASP A OD1 1 
ATOM   1645 O OD2 . ASP A 1 219 ? -15.973 4.927  42.424 1.00 28.03 ? 200  ASP A OD2 1 
ATOM   1646 N N   . VAL A 1 220 ? -12.684 9.238  42.534 1.00 20.99 ? 201  VAL A N   1 
ATOM   1647 C CA  . VAL A 1 220 ? -12.155 10.478 42.004 1.00 20.78 ? 201  VAL A CA  1 
ATOM   1648 C C   . VAL A 1 220 ? -10.666 10.610 42.282 1.00 21.49 ? 201  VAL A C   1 
ATOM   1649 O O   . VAL A 1 220 ? -9.874  10.919 41.367 1.00 20.23 ? 201  VAL A O   1 
ATOM   1650 C CB  . VAL A 1 220 ? -12.942 11.710 42.513 1.00 21.62 ? 201  VAL A CB  1 
ATOM   1651 C CG1 . VAL A 1 220 ? -12.207 13.012 42.184 1.00 20.48 ? 201  VAL A CG1 1 
ATOM   1652 C CG2 . VAL A 1 220 ? -14.274 11.729 41.875 1.00 19.85 ? 201  VAL A CG2 1 
ATOM   1653 N N   . ARG A 1 221 ? -10.284 10.365 43.538 1.00 21.23 ? 202  ARG A N   1 
ATOM   1654 C CA  . ARG A 1 221 ? -8.908  10.509 43.995 1.00 22.33 ? 202  ARG A CA  1 
ATOM   1655 C C   . ARG A 1 221 ? -7.992  9.505  43.229 1.00 21.62 ? 202  ARG A C   1 
ATOM   1656 O O   . ARG A 1 221 ? -6.887  9.837  42.825 1.00 21.62 ? 202  ARG A O   1 
ATOM   1657 C CB  . ARG A 1 221 ? -8.912  10.226 45.529 1.00 22.59 ? 202  ARG A CB  1 
ATOM   1658 C CG  . ARG A 1 221 ? -7.707  10.575 46.318 1.00 28.56 ? 202  ARG A CG  1 
ATOM   1659 C CD  . ARG A 1 221 ? -7.646  12.075 46.736 1.00 27.77 ? 202  ARG A CD  1 
ATOM   1660 N NE  . ARG A 1 221 ? -7.117  12.873 45.635 1.00 27.67 ? 202  ARG A NE  1 
ATOM   1661 C CZ  . ARG A 1 221 ? -5.952  12.667 45.011 1.00 27.15 ? 202  ARG A CZ  1 
ATOM   1662 N NH1 . ARG A 1 221 ? -5.144  11.685 45.366 1.00 29.14 ? 202  ARG A NH1 1 
ATOM   1663 N NH2 . ARG A 1 221 ? -5.591  13.460 44.006 1.00 28.29 ? 202  ARG A NH2 1 
ATOM   1664 N N   . ASP A 1 222 ? -8.500  8.294  43.020 1.00 21.11 ? 203  ASP A N   1 
ATOM   1665 C CA  . ASP A 1 222 ? -7.812  7.219  42.312 1.00 21.60 ? 203  ASP A CA  1 
ATOM   1666 C C   . ASP A 1 222 ? -7.614  7.573  40.838 1.00 21.24 ? 203  ASP A C   1 
ATOM   1667 O O   . ASP A 1 222 ? -6.564  7.282  40.261 1.00 20.84 ? 203  ASP A O   1 
ATOM   1668 C CB  . ASP A 1 222 ? -8.629  5.911  42.408 1.00 21.89 ? 203  ASP A CB  1 
ATOM   1669 C CG  . ASP A 1 222 ? -8.531  5.217  43.807 1.00 24.65 ? 203  ASP A CG  1 
ATOM   1670 O OD1 . ASP A 1 222 ? -7.788  5.688  44.711 1.00 27.33 ? 203  ASP A OD1 1 
ATOM   1671 O OD2 . ASP A 1 222 ? -9.212  4.188  43.988 1.00 25.74 ? 203  ASP A OD2 1 
ATOM   1672 N N   . ALA A 1 223 ? -8.652  8.153  40.231 1.00 20.94 ? 204  ALA A N   1 
ATOM   1673 C CA  . ALA A 1 223 ? -8.633  8.549  38.805 1.00 21.60 ? 204  ALA A CA  1 
ATOM   1674 C C   . ALA A 1 223 ? -7.640  9.726  38.547 1.00 21.83 ? 204  ALA A C   1 
ATOM   1675 O O   . ALA A 1 223 ? -6.904  9.692  37.550 1.00 22.11 ? 204  ALA A O   1 
ATOM   1676 C CB  . ALA A 1 223 ? -10.074 8.868  38.295 1.00 20.01 ? 204  ALA A CB  1 
ATOM   1677 N N   . VAL A 1 224 ? -7.596  10.702 39.464 1.00 20.90 ? 205  VAL A N   1 
ATOM   1678 C CA  . VAL A 1 224 ? -6.583  11.781 39.464 1.00 22.24 ? 205  VAL A CA  1 
ATOM   1679 C C   . VAL A 1 224 ? -5.163  11.213 39.567 1.00 22.88 ? 205  VAL A C   1 
ATOM   1680 O O   . VAL A 1 224 ? -4.303  11.496 38.710 1.00 23.22 ? 205  VAL A O   1 
ATOM   1681 C CB  . VAL A 1 224 ? -6.844  12.861 40.576 1.00 23.23 ? 205  VAL A CB  1 
ATOM   1682 C CG1 . VAL A 1 224 ? -5.656  13.897 40.654 1.00 22.14 ? 205  VAL A CG1 1 
ATOM   1683 C CG2 . VAL A 1 224 ? -8.146  13.588 40.284 1.00 22.85 ? 205  VAL A CG2 1 
ATOM   1684 N N   . ASP A 1 225 ? -4.942  10.348 40.556 1.00 22.72 ? 206  ASP A N   1 
ATOM   1685 C CA  . ASP A 1 225 ? -3.659  9.628  40.680 1.00 23.37 ? 206  ASP A CA  1 
ATOM   1686 C C   . ASP A 1 225 ? -3.277  8.892  39.383 1.00 22.82 ? 206  ASP A C   1 
ATOM   1687 O O   . ASP A 1 225 ? -2.152  9.009  38.923 1.00 21.99 ? 206  ASP A O   1 
ATOM   1688 C CB  . ASP A 1 225 ? -3.667  8.614  41.821 1.00 23.83 ? 206  ASP A CB  1 
ATOM   1689 C CG  . ASP A 1 225 ? -3.601  9.261  43.214 1.00 27.68 ? 206  ASP A CG  1 
ATOM   1690 O OD1 . ASP A 1 225 ? -3.404  10.489 43.325 1.00 32.66 ? 206  ASP A OD1 1 
ATOM   1691 O OD2 . ASP A 1 225 ? -3.768  8.519  44.211 1.00 30.76 ? 206  ASP A OD2 1 
ATOM   1692 N N   . TRP A 1 226 ? -4.211  8.109  38.846 1.00 22.33 ? 207  TRP A N   1 
ATOM   1693 C CA  . TRP A 1 226 ? -4.029  7.355  37.611 1.00 21.91 ? 207  TRP A CA  1 
ATOM   1694 C C   . TRP A 1 226 ? -3.645  8.309  36.458 1.00 21.98 ? 207  TRP A C   1 
ATOM   1695 O O   . TRP A 1 226 ? -2.682  8.065  35.744 1.00 21.99 ? 207  TRP A O   1 
ATOM   1696 C CB  . TRP A 1 226 ? -5.297  6.547  37.294 1.00 21.11 ? 207  TRP A CB  1 
ATOM   1697 C CG  . TRP A 1 226 ? -5.152  5.641  36.115 1.00 20.47 ? 207  TRP A CG  1 
ATOM   1698 C CD1 . TRP A 1 226 ? -4.739  4.334  36.127 1.00 20.21 ? 207  TRP A CD1 1 
ATOM   1699 C CD2 . TRP A 1 226 ? -5.382  5.973  34.739 1.00 20.39 ? 207  TRP A CD2 1 
ATOM   1700 N NE1 . TRP A 1 226 ? -4.688  3.849  34.858 1.00 19.87 ? 207  TRP A NE1 1 
ATOM   1701 C CE2 . TRP A 1 226 ? -5.064  4.835  33.982 1.00 20.26 ? 207  TRP A CE2 1 
ATOM   1702 C CE3 . TRP A 1 226 ? -5.804  7.138  34.075 1.00 19.92 ? 207  TRP A CE3 1 
ATOM   1703 C CZ2 . TRP A 1 226 ? -5.192  4.798  32.581 1.00 23.03 ? 207  TRP A CZ2 1 
ATOM   1704 C CZ3 . TRP A 1 226 ? -5.904  7.110  32.703 1.00 19.87 ? 207  TRP A CZ3 1 
ATOM   1705 C CH2 . TRP A 1 226 ? -5.604  5.953  31.963 1.00 20.27 ? 207  TRP A CH2 1 
ATOM   1706 N N   . VAL A 1 227 ? -4.393  9.395  36.294 1.00 22.17 ? 208  VAL A N   1 
ATOM   1707 C CA  . VAL A 1 227 ? -4.156  10.351 35.230 1.00 23.59 ? 208  VAL A CA  1 
ATOM   1708 C C   . VAL A 1 227 ? -2.709  10.878 35.241 1.00 24.95 ? 208  VAL A C   1 
ATOM   1709 O O   . VAL A 1 227 ? -2.078  10.949 34.186 1.00 23.94 ? 208  VAL A O   1 
ATOM   1710 C CB  . VAL A 1 227 ? -5.229  11.479 35.278 1.00 24.83 ? 208  VAL A CB  1 
ATOM   1711 C CG1 . VAL A 1 227 ? -4.703  12.779 34.724 1.00 25.03 ? 208  VAL A CG1 1 
ATOM   1712 C CG2 . VAL A 1 227 ? -6.492  11.018 34.563 1.00 22.23 ? 208  VAL A CG2 1 
ATOM   1713 N N   . HIS A 1 228 ? -2.183  11.201 36.433 1.00 25.40 ? 209  HIS A N   1 
ATOM   1714 C CA  . HIS A 1 228 ? -0.788  11.636 36.594 1.00 26.56 ? 209  HIS A CA  1 
ATOM   1715 C C   . HIS A 1 228 ? 0.250   10.520 36.425 1.00 27.45 ? 209  HIS A C   1 
ATOM   1716 O O   . HIS A 1 228 ? 1.329   10.759 35.874 1.00 27.48 ? 209  HIS A O   1 
ATOM   1717 C CB  . HIS A 1 228 ? -0.566  12.289 37.992 1.00 26.25 ? 209  HIS A CB  1 
ATOM   1718 C CG  . HIS A 1 228 ? -1.068  13.698 38.091 1.00 28.80 ? 209  HIS A CG  1 
ATOM   1719 N ND1 . HIS A 1 228 ? -2.386  14.003 38.370 1.00 28.20 ? 209  HIS A ND1 1 
ATOM   1720 C CD2 . HIS A 1 228 ? -0.431  14.888 37.937 1.00 29.01 ? 209  HIS A CD2 1 
ATOM   1721 C CE1 . HIS A 1 228 ? -2.536  15.323 38.397 1.00 25.61 ? 209  HIS A CE1 1 
ATOM   1722 N NE2 . HIS A 1 228 ? -1.364  15.879 38.155 1.00 30.99 ? 209  HIS A NE2 1 
ATOM   1723 N N   . TYR A 1 229 ? -0.045  9.319  36.901 1.00 27.71 ? 210  TYR A N   1 
ATOM   1724 C CA  . TYR A 1 229 ? 0.980   8.271  36.911 1.00 30.03 ? 210  TYR A CA  1 
ATOM   1725 C C   . TYR A 1 229 ? 0.918   7.281  35.775 1.00 29.11 ? 210  TYR A C   1 
ATOM   1726 O O   . TYR A 1 229 ? 1.947   6.810  35.359 1.00 29.05 ? 210  TYR A O   1 
ATOM   1727 C CB  . TYR A 1 229 ? 1.055   7.550  38.267 1.00 32.53 ? 210  TYR A CB  1 
ATOM   1728 C CG  . TYR A 1 229 ? 1.278   8.585  39.338 1.00 38.28 ? 210  TYR A CG  1 
ATOM   1729 C CD1 . TYR A 1 229 ? 0.343   8.778  40.371 1.00 39.86 ? 210  TYR A CD1 1 
ATOM   1730 C CD2 . TYR A 1 229 ? 2.371   9.479  39.243 1.00 41.91 ? 210  TYR A CD2 1 
ATOM   1731 C CE1 . TYR A 1 229 ? 0.519   9.783  41.317 1.00 43.07 ? 210  TYR A CE1 1 
ATOM   1732 C CE2 . TYR A 1 229 ? 2.563   10.490 40.185 1.00 44.13 ? 210  TYR A CE2 1 
ATOM   1733 C CZ  . TYR A 1 229 ? 1.639   10.632 41.224 1.00 43.43 ? 210  TYR A CZ  1 
ATOM   1734 O OH  . TYR A 1 229 ? 1.843   11.636 42.173 1.00 45.00 ? 210  TYR A OH  1 
ATOM   1735 N N   . LYS A 1 230 ? -0.280  6.958  35.299 1.00 27.48 ? 211  LYS A N   1 
ATOM   1736 C CA  . LYS A 1 230 ? -0.458  5.911  34.298 1.00 26.80 ? 211  LYS A CA  1 
ATOM   1737 C C   . LYS A 1 230 ? -1.143  6.438  33.016 1.00 25.79 ? 211  LYS A C   1 
ATOM   1738 O O   . LYS A 1 230 ? -1.101  5.777  31.989 1.00 25.17 ? 211  LYS A O   1 
ATOM   1739 C CB  . LYS A 1 230 ? -1.271  4.764  34.890 1.00 26.52 ? 211  LYS A CB  1 
ATOM   1740 C CG  . LYS A 1 230 ? -0.613  3.997  36.059 1.00 28.30 ? 211  LYS A CG  1 
ATOM   1741 C CD  . LYS A 1 230 ? -1.551  2.870  36.537 1.00 29.73 ? 211  LYS A CD  1 
ATOM   1742 C CE  . LYS A 1 230 ? -0.819  1.741  37.278 1.00 34.51 ? 211  LYS A CE  1 
ATOM   1743 N NZ  . LYS A 1 230 ? -1.488  0.379  37.144 1.00 36.55 ? 211  LYS A NZ  1 
ATOM   1744 N N   . GLY A 1 231 ? -1.765  7.617  33.091 1.00 24.12 ? 212  GLY A N   1 
ATOM   1745 C CA  . GLY A 1 231 ? -2.507  8.165  31.974 1.00 24.82 ? 212  GLY A CA  1 
ATOM   1746 C C   . GLY A 1 231 ? -1.744  9.155  31.115 1.00 24.82 ? 212  GLY A C   1 
ATOM   1747 O O   . GLY A 1 231 ? -0.516  9.155  31.085 1.00 24.26 ? 212  GLY A O   1 
ATOM   1748 N N   . SER A 1 232 ? -2.477  10.050 30.463 1.00 24.83 ? 213  SER A N   1 
ATOM   1749 C CA  . SER A 1 232 ? -1.891  10.821 29.363 1.00 25.25 ? 213  SER A CA  1 
ATOM   1750 C C   . SER A 1 232 ? -1.541  12.253 29.700 1.00 24.29 ? 213  SER A C   1 
ATOM   1751 O O   . SER A 1 232 ? -1.154  13.004 28.802 1.00 24.30 ? 213  SER A O   1 
ATOM   1752 C CB  . SER A 1 232 ? -2.795  10.760 28.100 1.00 26.57 ? 213  SER A CB  1 
ATOM   1753 O OG  . SER A 1 232 ? -3.949  11.569 28.297 1.00 27.67 ? 213  SER A OG  1 
ATOM   1754 N N   . LEU A 1 233 ? -1.661  12.626 30.977 1.00 23.29 ? 214  LEU A N   1 
ATOM   1755 C CA  . LEU A 1 233 ? -1.461  14.021 31.392 1.00 22.99 ? 214  LEU A CA  1 
ATOM   1756 C C   . LEU A 1 233 ? -0.049  14.547 31.090 1.00 22.56 ? 214  LEU A C   1 
ATOM   1757 O O   . LEU A 1 233 ? 0.086   15.612 30.506 1.00 21.74 ? 214  LEU A O   1 
ATOM   1758 C CB  . LEU A 1 233 ? -1.832  14.288 32.847 1.00 22.75 ? 214  LEU A CB  1 
ATOM   1759 C CG  . LEU A 1 233 ? -1.669  15.742 33.382 1.00 22.03 ? 214  LEU A CG  1 
ATOM   1760 C CD1 . LEU A 1 233 ? -2.492  16.740 32.636 1.00 22.54 ? 214  LEU A CD1 1 
ATOM   1761 C CD2 . LEU A 1 233 ? -2.017  15.847 34.853 1.00 23.30 ? 214  LEU A CD2 1 
ATOM   1762 N N   . LYS A 1 234 ? 0.961   13.797 31.509 1.00 22.52 ? 215  LYS A N   1 
ATOM   1763 C CA  . LYS A 1 234 ? 2.348   14.148 31.283 1.00 23.10 ? 215  LYS A CA  1 
ATOM   1764 C C   . LYS A 1 234 ? 2.671   14.253 29.773 1.00 22.39 ? 215  LYS A C   1 
ATOM   1765 O O   . LYS A 1 234 ? 3.268   15.243 29.338 1.00 20.37 ? 215  LYS A O   1 
ATOM   1766 C CB  . LYS A 1 234 ? 3.271   13.135 31.970 1.00 23.40 ? 215  LYS A CB  1 
ATOM   1767 C CG  . LYS A 1 234 ? 3.419   13.356 33.495 1.00 23.74 ? 215  LYS A CG  1 
ATOM   1768 C CD  . LYS A 1 234 ? 4.544   12.440 34.045 1.00 24.99 ? 215  LYS A CD  1 
ATOM   1769 C CE  . LYS A 1 234 ? 4.862   12.756 35.509 1.00 28.57 ? 215  LYS A CE  1 
ATOM   1770 N NZ  . LYS A 1 234 ? 3.610   12.905 36.364 1.00 31.67 ? 215  LYS A NZ  1 
ATOM   1771 N N   . GLU A 1 235 ? 2.244   13.236 29.023 1.00 22.32 ? 216  GLU A N   1 
ATOM   1772 C CA  . GLU A 1 235 ? 2.364   13.185 27.550 1.00 24.13 ? 216  GLU A CA  1 
ATOM   1773 C C   . GLU A 1 235 ? 1.740   14.432 26.896 1.00 22.73 ? 216  GLU A C   1 
ATOM   1774 O O   . GLU A 1 235 ? 2.379   15.111 26.082 1.00 21.00 ? 216  GLU A O   1 
ATOM   1775 C CB  . GLU A 1 235 ? 1.754   11.877 27.000 1.00 23.43 ? 216  GLU A CB  1 
ATOM   1776 C CG  . GLU A 1 235 ? 1.639   11.787 25.471 1.00 27.73 ? 216  GLU A CG  1 
ATOM   1777 C CD  . GLU A 1 235 ? 1.065   10.440 24.976 1.00 28.98 ? 216  GLU A CD  1 
ATOM   1778 O OE1 . GLU A 1 235 ? -0.021  9.984  25.477 1.00 33.92 ? 216  GLU A OE1 1 
ATOM   1779 O OE2 . GLU A 1 235 ? 1.699   9.843  24.068 1.00 35.71 ? 216  GLU A OE2 1 
ATOM   1780 N N   . LYS A 1 236 ? 0.506   14.745 27.278 1.00 22.35 ? 217  LYS A N   1 
ATOM   1781 C CA  . LYS A 1 236 ? -0.190  15.893 26.703 1.00 22.96 ? 217  LYS A CA  1 
ATOM   1782 C C   . LYS A 1 236 ? 0.448   17.240 27.127 1.00 22.90 ? 217  LYS A C   1 
ATOM   1783 O O   . LYS A 1 236 ? 0.503   18.190 26.336 1.00 22.17 ? 217  LYS A O   1 
ATOM   1784 C CB  . LYS A 1 236 ? -1.697  15.784 26.987 1.00 23.13 ? 217  LYS A CB  1 
ATOM   1785 C CG  . LYS A 1 236 ? -2.427  14.759 26.059 1.00 24.26 ? 217  LYS A CG  1 
ATOM   1786 C CD  . LYS A 1 236 ? -3.898  14.628 26.434 1.00 25.86 ? 217  LYS A CD  1 
ATOM   1787 C CE  . LYS A 1 236 ? -4.536  13.391 25.784 1.00 26.18 ? 217  LYS A CE  1 
ATOM   1788 N NZ  . LYS A 1 236 ? -3.941  13.275 24.456 1.00 33.10 ? 217  LYS A NZ  1 
ATOM   1789 N N   . THR A 1 237 ? 0.980   17.317 28.359 1.00 21.71 ? 218  THR A N   1 
ATOM   1790 C CA  . THR A 1 237 ? 1.688   18.521 28.811 1.00 20.96 ? 218  THR A CA  1 
ATOM   1791 C C   . THR A 1 237 ? 2.923   18.837 27.932 1.00 20.81 ? 218  THR A C   1 
ATOM   1792 O O   . THR A 1 237 ? 3.029   19.917 27.361 1.00 19.84 ? 218  THR A O   1 
ATOM   1793 C CB  . THR A 1 237 ? 2.104   18.343 30.274 1.00 21.91 ? 218  THR A CB  1 
ATOM   1794 O OG1 . THR A 1 237 ? 0.912   18.048 31.023 1.00 19.38 ? 218  THR A OG1 1 
ATOM   1795 C CG2 . THR A 1 237 ? 2.821   19.600 30.807 1.00 19.43 ? 218  THR A CG2 1 
ATOM   1796 N N   . VAL A 1 238 ? 3.802   17.853 27.828 1.00 20.41 ? 219  VAL A N   1 
ATOM   1797 C CA  . VAL A 1 238 ? 5.082   17.904 27.154 1.00 22.97 ? 219  VAL A CA  1 
ATOM   1798 C C   . VAL A 1 238 ? 4.936   18.111 25.630 1.00 23.58 ? 219  VAL A C   1 
ATOM   1799 O O   . VAL A 1 238 ? 5.817   18.706 25.007 1.00 23.42 ? 219  VAL A O   1 
ATOM   1800 C CB  . VAL A 1 238 ? 5.868   16.596 27.491 1.00 23.11 ? 219  VAL A CB  1 
ATOM   1801 C CG1 . VAL A 1 238 ? 6.827   16.225 26.436 1.00 26.76 ? 219  VAL A CG1 1 
ATOM   1802 C CG2 . VAL A 1 238 ? 6.568   16.723 28.868 1.00 23.37 ? 219  VAL A CG2 1 
ATOM   1803 N N   . GLU A 1 239 ? 3.824   17.656 25.041 1.00 23.49 ? 220  GLU A N   1 
ATOM   1804 C CA  . GLU A 1 239 ? 3.600   17.916 23.622 1.00 26.19 ? 220  GLU A CA  1 
ATOM   1805 C C   . GLU A 1 239 ? 3.108   19.336 23.366 1.00 25.17 ? 220  GLU A C   1 
ATOM   1806 O O   . GLU A 1 239 ? 3.042   19.752 22.229 1.00 25.59 ? 220  GLU A O   1 
ATOM   1807 C CB  . GLU A 1 239 ? 2.698   16.870 22.951 1.00 25.48 ? 220  GLU A CB  1 
ATOM   1808 C CG  . GLU A 1 239 ? 1.286   16.829 23.482 1.00 29.29 ? 220  GLU A CG  1 
ATOM   1809 C CD  . GLU A 1 239 ? 0.388   15.781 22.782 1.00 30.68 ? 220  GLU A CD  1 
ATOM   1810 O OE1 . GLU A 1 239 ? 0.897   14.688 22.385 1.00 34.34 ? 220  GLU A OE1 1 
ATOM   1811 O OE2 . GLU A 1 239 ? -0.837  16.063 22.647 1.00 35.83 ? 220  GLU A OE2 1 
ATOM   1812 N N   . ASN A 1 240 ? 2.770   20.086 24.408 1.00 24.00 ? 221  ASN A N   1 
ATOM   1813 C CA  . ASN A 1 240 ? 2.417   21.490 24.208 1.00 23.53 ? 221  ASN A CA  1 
ATOM   1814 C C   . ASN A 1 240 ? 2.853   22.397 25.354 1.00 22.18 ? 221  ASN A C   1 
ATOM   1815 O O   . ASN A 1 240 ? 2.022   23.045 26.007 1.00 21.41 ? 221  ASN A O   1 
ATOM   1816 C CB  . ASN A 1 240 ? 0.926   21.679 23.891 1.00 23.50 ? 221  ASN A CB  1 
ATOM   1817 C CG  . ASN A 1 240 ? 0.657   22.954 23.099 1.00 25.67 ? 221  ASN A CG  1 
ATOM   1818 O OD1 . ASN A 1 240 ? 1.470   23.918 23.103 1.00 26.95 ? 221  ASN A OD1 1 
ATOM   1819 N ND2 . ASN A 1 240 ? -0.491  22.986 22.430 1.00 22.83 ? 221  ASN A ND2 1 
ATOM   1820 N N   . LEU A 1 241 ? 4.165   22.451 25.579 1.00 21.61 ? 222  LEU A N   1 
ATOM   1821 C CA  . LEU A 1 241 ? 4.708   23.149 26.743 1.00 21.32 ? 222  LEU A CA  1 
ATOM   1822 C C   . LEU A 1 241 ? 4.376   24.629 26.746 1.00 21.72 ? 222  LEU A C   1 
ATOM   1823 O O   . LEU A 1 241 ? 4.115   25.193 27.804 1.00 20.21 ? 222  LEU A O   1 
ATOM   1824 C CB  . LEU A 1 241 ? 6.206   22.893 26.876 1.00 22.29 ? 222  LEU A CB  1 
ATOM   1825 C CG  . LEU A 1 241 ? 6.517   21.476 27.363 1.00 23.12 ? 222  LEU A CG  1 
ATOM   1826 C CD1 . LEU A 1 241 ? 7.924   21.078 27.010 1.00 23.95 ? 222  LEU A CD1 1 
ATOM   1827 C CD2 . LEU A 1 241 ? 6.223   21.322 28.858 1.00 24.73 ? 222  LEU A CD2 1 
ATOM   1828 N N   . GLU A 1 242 ? 4.338   25.260 25.566 1.00 21.77 ? 223  GLU A N   1 
ATOM   1829 C CA  . GLU A 1 242 ? 3.987   26.688 25.486 1.00 23.07 ? 223  GLU A CA  1 
ATOM   1830 C C   . GLU A 1 242 ? 2.575   26.983 25.997 1.00 22.10 ? 223  GLU A C   1 
ATOM   1831 O O   . GLU A 1 242 ? 2.328   28.029 26.653 1.00 21.98 ? 223  GLU A O   1 
ATOM   1832 C CB  . GLU A 1 242 ? 4.171   27.252 24.061 1.00 23.52 ? 223  GLU A CB  1 
ATOM   1833 C CG  . GLU A 1 242 ? 5.628   27.217 23.596 1.00 30.25 ? 223  GLU A CG  1 
ATOM   1834 C CD  . GLU A 1 242 ? 6.048   25.880 22.937 1.00 38.69 ? 223  GLU A CD  1 
ATOM   1835 O OE1 . GLU A 1 242 ? 5.261   24.873 22.920 1.00 38.81 ? 223  GLU A OE1 1 
ATOM   1836 O OE2 . GLU A 1 242 ? 7.189   25.861 22.400 1.00 42.64 ? 223  GLU A OE2 1 
ATOM   1837 N N   . LYS A 1 243 ? 1.657   26.075 25.681 1.00 20.90 ? 224  LYS A N   1 
ATOM   1838 C CA  . LYS A 1 243 ? 0.289   26.151 26.163 1.00 21.02 ? 224  LYS A CA  1 
ATOM   1839 C C   . LYS A 1 243 ? 0.125   25.925 27.703 1.00 20.24 ? 224  LYS A C   1 
ATOM   1840 O O   . LYS A 1 243 ? -0.737  26.537 28.347 1.00 18.52 ? 224  LYS A O   1 
ATOM   1841 C CB  . LYS A 1 243 ? -0.577  25.149 25.409 1.00 21.12 ? 224  LYS A CB  1 
ATOM   1842 C CG  . LYS A 1 243 ? -1.981  25.000 25.950 1.00 22.61 ? 224  LYS A CG  1 
ATOM   1843 C CD  . LYS A 1 243 ? -2.882  24.227 25.007 1.00 26.89 ? 224  LYS A CD  1 
ATOM   1844 C CE  . LYS A 1 243 ? -4.231  24.097 25.651 1.00 28.44 ? 224  LYS A CE  1 
ATOM   1845 N NZ  . LYS A 1 243 ? -5.361  23.849 24.701 1.00 32.61 ? 224  LYS A NZ  1 
ATOM   1846 N N   . TYR A 1 244 ? 0.943   25.043 28.266 1.00 19.77 ? 225  TYR A N   1 
ATOM   1847 C CA  . TYR A 1 244 ? 0.746   24.596 29.638 1.00 19.62 ? 225  TYR A CA  1 
ATOM   1848 C C   . TYR A 1 244 ? 1.702   25.134 30.691 1.00 19.96 ? 225  TYR A C   1 
ATOM   1849 O O   . TYR A 1 244 ? 1.395   25.004 31.871 1.00 20.27 ? 225  TYR A O   1 
ATOM   1850 C CB  . TYR A 1 244 ? 0.732   23.064 29.695 1.00 19.66 ? 225  TYR A CB  1 
ATOM   1851 C CG  . TYR A 1 244 ? -0.487  22.522 28.979 1.00 20.60 ? 225  TYR A CG  1 
ATOM   1852 C CD1 . TYR A 1 244 ? -1.784  22.808 29.459 1.00 19.97 ? 225  TYR A CD1 1 
ATOM   1853 C CD2 . TYR A 1 244 ? -0.360  21.749 27.814 1.00 18.50 ? 225  TYR A CD2 1 
ATOM   1854 C CE1 . TYR A 1 244 ? -2.923  22.352 28.783 1.00 18.55 ? 225  TYR A CE1 1 
ATOM   1855 C CE2 . TYR A 1 244 ? -1.506  21.272 27.144 1.00 19.68 ? 225  TYR A CE2 1 
ATOM   1856 C CZ  . TYR A 1 244 ? -2.762  21.580 27.656 1.00 19.15 ? 225  TYR A CZ  1 
ATOM   1857 O OH  . TYR A 1 244 ? -3.875  21.120 27.041 1.00 24.04 ? 225  TYR A OH  1 
ATOM   1858 N N   . VAL A 1 245 ? 2.856   25.695 30.303 1.00 19.33 ? 226  VAL A N   1 
ATOM   1859 C CA  . VAL A 1 245 ? 3.900   25.997 31.298 1.00 18.70 ? 226  VAL A CA  1 
ATOM   1860 C C   . VAL A 1 245 ? 4.458   27.403 31.081 1.00 19.32 ? 226  VAL A C   1 
ATOM   1861 O O   . VAL A 1 245 ? 4.982   27.712 29.991 1.00 18.99 ? 226  VAL A O   1 
ATOM   1862 C CB  . VAL A 1 245 ? 5.107   24.946 31.292 1.00 18.15 ? 226  VAL A CB  1 
ATOM   1863 C CG1 . VAL A 1 245 ? 6.092   25.214 32.419 1.00 15.38 ? 226  VAL A CG1 1 
ATOM   1864 C CG2 . VAL A 1 245 ? 4.627   23.519 31.415 1.00 19.18 ? 226  VAL A CG2 1 
ATOM   1865 N N   . VAL A 1 246 ? 4.373   28.222 32.129 1.00 19.37 ? 227  VAL A N   1 
ATOM   1866 C CA  . VAL A 1 246 ? 4.978   29.589 32.176 1.00 20.24 ? 227  VAL A CA  1 
ATOM   1867 C C   . VAL A 1 246 ? 6.495   29.505 31.956 1.00 21.13 ? 227  VAL A C   1 
ATOM   1868 O O   . VAL A 1 246 ? 7.186   28.680 32.563 1.00 20.83 ? 227  VAL A O   1 
ATOM   1869 C CB  . VAL A 1 246 ? 4.663   30.292 33.553 1.00 19.72 ? 227  VAL A CB  1 
ATOM   1870 C CG1 . VAL A 1 246 ? 5.451   31.638 33.751 1.00 18.95 ? 227  VAL A CG1 1 
ATOM   1871 C CG2 . VAL A 1 246 ? 3.173   30.482 33.709 1.00 19.96 ? 227  VAL A CG2 1 
ATOM   1872 N N   . LYS A 1 247 ? 7.020   30.351 31.074 1.00 22.44 ? 228  LYS A N   1 
ATOM   1873 C CA  . LYS A 1 247 ? 8.453   30.361 30.825 1.00 22.44 ? 228  LYS A CA  1 
ATOM   1874 C C   . LYS A 1 247 ? 9.003   31.784 30.978 1.00 22.78 ? 228  LYS A C   1 
ATOM   1875 O O   . LYS A 1 247 ? 8.352   32.755 30.581 1.00 23.51 ? 228  LYS A O   1 
ATOM   1876 C CB  . LYS A 1 247 ? 8.685   29.804 29.438 1.00 22.90 ? 228  LYS A CB  1 
ATOM   1877 C CG  . LYS A 1 247 ? 10.084  29.736 29.038 1.00 20.94 ? 228  LYS A CG  1 
ATOM   1878 C CD  . LYS A 1 247 ? 10.189  28.868 27.832 1.00 21.68 ? 228  LYS A CD  1 
ATOM   1879 C CE  . LYS A 1 247 ? 11.493  29.039 27.144 1.00 20.51 ? 228  LYS A CE  1 
ATOM   1880 N NZ  . LYS A 1 247 ? 11.595  27.984 26.125 1.00 21.13 ? 228  LYS A NZ  1 
ATOM   1881 N N   . ASP A 1 248 ? 10.204  31.923 31.527 1.00 22.93 ? 229  ASP A N   1 
ATOM   1882 C CA  . ASP A 1 248 ? 10.683  33.258 31.967 1.00 23.10 ? 229  ASP A CA  1 
ATOM   1883 C C   . ASP A 1 248 ? 12.175  33.325 31.797 1.00 22.97 ? 229  ASP A C   1 
ATOM   1884 O O   . ASP A 1 248 ? 12.872  32.573 32.421 1.00 23.50 ? 229  ASP A O   1 
ATOM   1885 C CB  . ASP A 1 248 ? 10.323  33.475 33.467 1.00 22.21 ? 229  ASP A CB  1 
ATOM   1886 C CG  . ASP A 1 248 ? 10.772  34.854 34.018 1.00 25.02 ? 229  ASP A CG  1 
ATOM   1887 O OD1 . ASP A 1 248 ? 11.451  35.655 33.303 1.00 22.81 ? 229  ASP A OD1 1 
ATOM   1888 O OD2 . ASP A 1 248 ? 10.454  35.142 35.204 1.00 27.12 ? 229  ASP A OD2 1 
ATOM   1889 N N   . GLY A 1 249 ? 12.677  34.257 30.985 1.00 24.94 ? 230  GLY A N   1 
ATOM   1890 C CA  . GLY A 1 249 ? 14.121  34.451 30.829 1.00 24.14 ? 230  GLY A CA  1 
ATOM   1891 C C   . GLY A 1 249 ? 14.829  34.772 32.139 1.00 25.30 ? 230  GLY A C   1 
ATOM   1892 O O   . GLY A 1 249 ? 16.023  34.475 32.269 1.00 26.05 ? 230  GLY A O   1 
ATOM   1893 N N   . LYS A 1 250 ? 14.112  35.329 33.118 1.00 24.50 ? 231  LYS A N   1 
ATOM   1894 C CA  . LYS A 1 250 ? 14.736  35.671 34.427 1.00 25.99 ? 231  LYS A CA  1 
ATOM   1895 C C   . LYS A 1 250 ? 15.090  34.500 35.352 1.00 26.69 ? 231  LYS A C   1 
ATOM   1896 O O   . LYS A 1 250 ? 15.936  34.648 36.264 1.00 27.39 ? 231  LYS A O   1 
ATOM   1897 C CB  . LYS A 1 250 ? 13.935  36.723 35.170 1.00 25.46 ? 231  LYS A CB  1 
ATOM   1898 C CG  . LYS A 1 250 ? 13.836  38.027 34.391 1.00 26.30 ? 231  LYS A CG  1 
ATOM   1899 C CD  . LYS A 1 250 ? 12.933  39.015 35.119 1.00 27.35 ? 231  LYS A CD  1 
ATOM   1900 C CE  . LYS A 1 250 ? 11.564  38.414 35.286 1.00 29.19 ? 231  LYS A CE  1 
ATOM   1901 N NZ  . LYS A 1 250 ? 10.720  38.482 34.062 1.00 27.78 ? 231  LYS A NZ  1 
ATOM   1902 N N   . LEU A 1 251 ? 14.490  33.334 35.081 1.00 26.74 ? 232  LEU A N   1 
ATOM   1903 C CA  . LEU A 1 251 ? 14.798  32.104 35.804 1.00 27.20 ? 232  LEU A CA  1 
ATOM   1904 C C   . LEU A 1 251 ? 16.263  31.710 35.790 1.00 26.10 ? 232  LEU A C   1 
ATOM   1905 O O   . LEU A 1 251 ? 16.845  31.612 36.851 1.00 25.33 ? 232  LEU A O   1 
ATOM   1906 C CB  . LEU A 1 251 ? 13.853  30.924 35.445 1.00 27.82 ? 232  LEU A CB  1 
ATOM   1907 C CG  . LEU A 1 251 ? 14.300  29.578 36.074 1.00 29.77 ? 232  LEU A CG  1 
ATOM   1908 C CD1 . LEU A 1 251 ? 14.074  29.665 37.559 1.00 30.74 ? 232  LEU A CD1 1 
ATOM   1909 C CD2 . LEU A 1 251 ? 13.628  28.316 35.561 1.00 30.02 ? 232  LEU A CD2 1 
ATOM   1910 N N   . PRO A 1 252 ? 16.880  31.484 34.595 1.00 26.26 ? 233  PRO A N   1 
ATOM   1911 C CA  . PRO A 1 252 ? 18.343  31.231 34.598 1.00 25.35 ? 233  PRO A CA  1 
ATOM   1912 C C   . PRO A 1 252 ? 19.174  32.308 35.295 1.00 24.36 ? 233  PRO A C   1 
ATOM   1913 O O   . PRO A 1 252 ? 20.168  31.981 35.938 1.00 24.98 ? 233  PRO A O   1 
ATOM   1914 C CB  . PRO A 1 252 ? 18.709  31.103 33.085 1.00 25.17 ? 233  PRO A CB  1 
ATOM   1915 C CG  . PRO A 1 252 ? 17.329  30.676 32.419 1.00 27.72 ? 233  PRO A CG  1 
ATOM   1916 C CD  . PRO A 1 252 ? 16.263  31.350 33.245 1.00 25.81 ? 233  PRO A CD  1 
ATOM   1917 N N   . LEU A 1 253 ? 18.789  33.576 35.124 1.00 23.36 ? 234  LEU A N   1 
ATOM   1918 C CA  . LEU A 1 253 ? 19.453  34.710 35.757 1.00 22.26 ? 234  LEU A CA  1 
ATOM   1919 C C   . LEU A 1 253 ? 19.412  34.569 37.301 1.00 22.07 ? 234  LEU A C   1 
ATOM   1920 O O   . LEU A 1 253 ? 20.441  34.686 37.949 1.00 22.05 ? 234  LEU A O   1 
ATOM   1921 C CB  . LEU A 1 253 ? 18.806  36.038 35.348 1.00 21.05 ? 234  LEU A CB  1 
ATOM   1922 C CG  . LEU A 1 253 ? 19.374  37.319 35.959 1.00 22.91 ? 234  LEU A CG  1 
ATOM   1923 C CD1 . LEU A 1 253 ? 20.877  37.466 35.650 1.00 25.48 ? 234  LEU A CD1 1 
ATOM   1924 C CD2 . LEU A 1 253 ? 18.609  38.573 35.494 1.00 22.10 ? 234  LEU A CD2 1 
ATOM   1925 N N   . LEU A 1 254 ? 18.226  34.336 37.869 1.00 21.47 ? 235  LEU A N   1 
ATOM   1926 C CA  . LEU A 1 254 ? 18.159  34.236 39.329 1.00 21.16 ? 235  LEU A CA  1 
ATOM   1927 C C   . LEU A 1 254 ? 18.933  33.013 39.862 1.00 20.76 ? 235  LEU A C   1 
ATOM   1928 O O   . LEU A 1 254 ? 19.700  33.142 40.808 1.00 20.73 ? 235  LEU A O   1 
ATOM   1929 C CB  . LEU A 1 254 ? 16.729  34.209 39.835 1.00 20.22 ? 235  LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 254 ? 16.630  34.130 41.384 1.00 20.07 ? 235  LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 254 ? 17.289  35.325 42.147 1.00 16.23 ? 235  LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 254 ? 15.147  34.088 41.686 1.00 21.25 ? 235  LEU A CD2 1 
ATOM   1933 N N   . LEU A 1 255 ? 18.738  31.851 39.252 1.00 20.40 ? 236  LEU A N   1 
ATOM   1934 C CA  . LEU A 1 255 ? 19.492  30.678 39.655 1.00 22.03 ? 236  LEU A CA  1 
ATOM   1935 C C   . LEU A 1 255 ? 21.003  30.861 39.581 1.00 22.11 ? 236  LEU A C   1 
ATOM   1936 O O   . LEU A 1 255 ? 21.736  30.428 40.512 1.00 21.83 ? 236  LEU A O   1 
ATOM   1937 C CB  . LEU A 1 255 ? 19.023  29.393 38.904 1.00 22.78 ? 236  LEU A CB  1 
ATOM   1938 C CG  . LEU A 1 255 ? 17.631  28.900 39.319 1.00 27.72 ? 236  LEU A CG  1 
ATOM   1939 C CD1 . LEU A 1 255 ? 17.244  27.661 38.529 1.00 33.81 ? 236  LEU A CD1 1 
ATOM   1940 C CD2 . LEU A 1 255 ? 17.581  28.584 40.735 1.00 27.47 ? 236  LEU A CD2 1 
ATOM   1941 N N   . SER A 1 256 ? 21.492  31.514 38.509 1.00 22.12 ? 237  SER A N   1 
ATOM   1942 C CA  . SER A 1 256 ? 22.915  31.782 38.398 1.00 21.81 ? 237  SER A CA  1 
ATOM   1943 C C   . SER A 1 256 ? 23.368  32.715 39.510 1.00 22.34 ? 237  SER A C   1 
ATOM   1944 O O   . SER A 1 256 ? 24.442  32.520 40.057 1.00 23.02 ? 237  SER A O   1 
ATOM   1945 C CB  . SER A 1 256 ? 23.330  32.346 37.003 1.00 22.58 ? 237  SER A CB  1 
ATOM   1946 O OG  . SER A 1 256 ? 22.895  33.689 36.840 1.00 22.16 ? 237  SER A OG  1 
ATOM   1947 N N   . ARG A 1 257 ? 22.564  33.720 39.874 1.00 22.07 ? 238  ARG A N   1 
ATOM   1948 C CA  . ARG A 1 257 ? 22.964  34.600 40.982 1.00 22.11 ? 238  ARG A CA  1 
ATOM   1949 C C   . ARG A 1 257 ? 22.972  33.879 42.339 1.00 22.59 ? 238  ARG A C   1 
ATOM   1950 O O   . ARG A 1 257 ? 23.856  34.100 43.149 1.00 21.87 ? 238  ARG A O   1 
ATOM   1951 C CB  . ARG A 1 257 ? 22.107  35.843 41.005 1.00 23.39 ? 238  ARG A CB  1 
ATOM   1952 C CG  . ARG A 1 257 ? 22.396  36.787 39.760 1.00 27.07 ? 238  ARG A CG  1 
ATOM   1953 C CD  . ARG A 1 257 ? 21.400  37.933 39.700 1.00 31.48 ? 238  ARG A CD  1 
ATOM   1954 N NE  . ARG A 1 257 ? 21.311  38.561 41.027 1.00 37.73 ? 238  ARG A NE  1 
ATOM   1955 C CZ  . ARG A 1 257 ? 22.030  39.622 41.398 1.00 39.85 ? 238  ARG A CZ  1 
ATOM   1956 N NH1 . ARG A 1 257 ? 22.854  40.184 40.524 1.00 39.85 ? 238  ARG A NH1 1 
ATOM   1957 N NH2 . ARG A 1 257 ? 21.915  40.124 42.625 1.00 40.64 ? 238  ARG A NH2 1 
ATOM   1958 N N   . MET A 1 258 ? 22.012  32.980 42.562 1.00 21.88 ? 239  MET A N   1 
ATOM   1959 C CA  . MET A 1 258 ? 22.027  32.148 43.764 1.00 23.39 ? 239  MET A CA  1 
ATOM   1960 C C   . MET A 1 258 ? 23.282  31.288 43.858 1.00 24.01 ? 239  MET A C   1 
ATOM   1961 O O   . MET A 1 258 ? 23.836  31.128 44.930 1.00 24.14 ? 239  MET A O   1 
ATOM   1962 C CB  . MET A 1 258 ? 20.780  31.274 43.843 1.00 22.67 ? 239  MET A CB  1 
ATOM   1963 C CG  . MET A 1 258 ? 19.477  32.104 44.134 1.00 22.55 ? 239  MET A CG  1 
ATOM   1964 S SD  . MET A 1 258 ? 18.111  30.954 43.870 1.00 25.53 ? 239  MET A SD  1 
ATOM   1965 C CE  . MET A 1 258 ? 16.729  31.907 44.562 1.00 21.49 ? 239  MET A CE  1 
ATOM   1966 N N   . LYS A 1 259 ? 23.735  30.750 42.726 1.00 25.52 ? 240  LYS A N   1 
ATOM   1967 C CA  . LYS A 1 259 ? 24.900  29.868 42.685 1.00 27.29 ? 240  LYS A CA  1 
ATOM   1968 C C   . LYS A 1 259 ? 26.198  30.613 42.972 1.00 27.78 ? 240  LYS A C   1 
ATOM   1969 O O   . LYS A 1 259 ? 27.152  30.018 43.437 1.00 28.14 ? 240  LYS A O   1 
ATOM   1970 C CB  . LYS A 1 259 ? 24.963  29.130 41.338 1.00 28.26 ? 240  LYS A CB  1 
ATOM   1971 C CG  . LYS A 1 259 ? 25.924  27.946 41.253 1.00 32.94 ? 240  LYS A CG  1 
ATOM   1972 C CD  . LYS A 1 259 ? 25.200  26.614 41.344 1.00 38.42 ? 240  LYS A CD  1 
ATOM   1973 C CE  . LYS A 1 259 ? 25.770  25.607 40.352 1.00 40.87 ? 240  LYS A CE  1 
ATOM   1974 N NZ  . LYS A 1 259 ? 27.213  25.331 40.533 1.00 43.21 ? 240  LYS A NZ  1 
ATOM   1975 N N   . GLU A 1 260 ? 26.227  31.920 42.727 1.00 28.89 ? 241  GLU A N   1 
ATOM   1976 C CA  . GLU A 1 260 ? 27.387  32.760 43.054 1.00 29.98 ? 241  GLU A CA  1 
ATOM   1977 C C   . GLU A 1 260 ? 27.575  32.892 44.560 1.00 29.60 ? 241  GLU A C   1 
ATOM   1978 O O   . GLU A 1 260 ? 28.694  33.036 45.058 1.00 29.52 ? 241  GLU A O   1 
ATOM   1979 C CB  . GLU A 1 260 ? 27.249  34.165 42.433 1.00 30.01 ? 241  GLU A CB  1 
ATOM   1980 C CG  . GLU A 1 260 ? 27.107  34.169 40.898 1.00 31.77 ? 241  GLU A CG  1 
ATOM   1981 C CD  . GLU A 1 260 ? 26.737  35.548 40.291 1.00 33.53 ? 241  GLU A CD  1 
ATOM   1982 O OE1 . GLU A 1 260 ? 26.720  36.600 41.016 1.00 35.70 ? 241  GLU A OE1 1 
ATOM   1983 O OE2 . GLU A 1 260 ? 26.456  35.573 39.056 1.00 39.14 ? 241  GLU A OE2 1 
ATOM   1984 N N   . VAL A 1 261 ? 26.486  32.869 45.312 1.00 29.54 ? 242  VAL A N   1 
ATOM   1985 C CA  . VAL A 1 261 ? 26.649  33.034 46.764 1.00 28.70 ? 242  VAL A CA  1 
ATOM   1986 C C   . VAL A 1 261 ? 26.398  31.765 47.580 1.00 28.38 ? 242  VAL A C   1 
ATOM   1987 O O   . VAL A 1 261 ? 26.651  31.747 48.762 1.00 28.78 ? 242  VAL A O   1 
ATOM   1988 C CB  . VAL A 1 261 ? 25.815  34.190 47.310 1.00 28.38 ? 242  VAL A CB  1 
ATOM   1989 C CG1 . VAL A 1 261 ? 26.245  35.487 46.647 1.00 29.69 ? 242  VAL A CG1 1 
ATOM   1990 C CG2 . VAL A 1 261 ? 24.314  33.916 47.140 1.00 26.88 ? 242  VAL A CG2 1 
ATOM   1991 N N   . GLY A 1 262 ? 25.903  30.704 46.954 1.00 27.62 ? 243  GLY A N   1 
ATOM   1992 C CA  . GLY A 1 262 ? 25.590  29.493 47.705 1.00 26.68 ? 243  GLY A CA  1 
ATOM   1993 C C   . GLY A 1 262 ? 25.499  28.261 46.824 1.00 26.54 ? 243  GLY A C   1 
ATOM   1994 O O   . GLY A 1 262 ? 25.812  28.291 45.622 1.00 26.99 ? 243  GLY A O   1 
ATOM   1995 N N   . LYS A 1 263 ? 25.071  27.158 47.406 1.00 25.26 ? 244  LYS A N   1 
ATOM   1996 C CA  . LYS A 1 263 ? 24.781  25.981 46.619 1.00 25.07 ? 244  LYS A CA  1 
ATOM   1997 C C   . LYS A 1 263 ? 23.319  26.012 46.223 1.00 24.53 ? 244  LYS A C   1 
ATOM   1998 O O   . LYS A 1 263 ? 22.495  26.679 46.887 1.00 26.07 ? 244  LYS A O   1 
ATOM   1999 C CB  . LYS A 1 263 ? 25.085  24.709 47.410 1.00 25.87 ? 244  LYS A CB  1 
ATOM   2000 C CG  . LYS A 1 263 ? 26.362  24.784 48.159 1.00 29.14 ? 244  LYS A CG  1 
ATOM   2001 C CD  . LYS A 1 263 ? 27.271  23.693 47.747 1.00 34.89 ? 244  LYS A CD  1 
ATOM   2002 C CE  . LYS A 1 263 ? 28.479  23.712 48.608 1.00 37.67 ? 244  LYS A CE  1 
ATOM   2003 N NZ  . LYS A 1 263 ? 28.684  22.352 49.210 1.00 39.78 ? 244  LYS A NZ  1 
ATOM   2004 N N   . VAL A 1 264 ? 22.987  25.314 45.141 1.00 22.44 ? 245  VAL A N   1 
ATOM   2005 C CA  . VAL A 1 264 ? 21.616  25.246 44.637 1.00 22.03 ? 245  VAL A CA  1 
ATOM   2006 C C   . VAL A 1 264 ? 21.229  23.794 44.427 1.00 21.29 ? 245  VAL A C   1 
ATOM   2007 O O   . VAL A 1 264 ? 21.983  23.059 43.837 1.00 21.11 ? 245  VAL A O   1 
ATOM   2008 C CB  . VAL A 1 264 ? 21.427  26.057 43.342 1.00 21.93 ? 245  VAL A CB  1 
ATOM   2009 C CG1 . VAL A 1 264 ? 19.973  25.922 42.833 1.00 21.07 ? 245  VAL A CG1 1 
ATOM   2010 C CG2 . VAL A 1 264 ? 21.782  27.539 43.616 1.00 22.72 ? 245  VAL A CG2 1 
ATOM   2011 N N   . PHE A 1 265 ? 20.069  23.365 44.935 1.00 20.79 ? 246  PHE A N   1 
ATOM   2012 C CA  . PHE A 1 265 ? 19.665  21.975 44.683 1.00 21.23 ? 246  PHE A CA  1 
ATOM   2013 C C   . PHE A 1 265 ? 18.200  21.829 44.198 1.00 21.43 ? 246  PHE A C   1 
ATOM   2014 O O   . PHE A 1 265 ? 17.350  22.692 44.440 1.00 21.13 ? 246  PHE A O   1 
ATOM   2015 C CB  . PHE A 1 265 ? 19.983  21.070 45.912 1.00 19.95 ? 246  PHE A CB  1 
ATOM   2016 C CG  . PHE A 1 265 ? 19.106  21.330 47.130 1.00 20.60 ? 246  PHE A CG  1 
ATOM   2017 C CD1 . PHE A 1 265 ? 17.903  20.660 47.287 1.00 19.70 ? 246  PHE A CD1 1 
ATOM   2018 C CD2 . PHE A 1 265 ? 19.523  22.233 48.151 1.00 17.80 ? 246  PHE A CD2 1 
ATOM   2019 C CE1 . PHE A 1 265 ? 17.082  20.878 48.465 1.00 17.77 ? 246  PHE A CE1 1 
ATOM   2020 C CE2 . PHE A 1 265 ? 18.723  22.451 49.306 1.00 20.48 ? 246  PHE A CE2 1 
ATOM   2021 C CZ  . PHE A 1 265 ? 17.513  21.769 49.455 1.00 18.20 ? 246  PHE A CZ  1 
ATOM   2022 N N   . LEU A 1 266 ? 17.922  20.707 43.569 1.00 21.28 ? 247  LEU A N   1 
ATOM   2023 C CA  . LEU A 1 266 ? 16.593  20.408 43.129 1.00 22.50 ? 247  LEU A CA  1 
ATOM   2024 C C   . LEU A 1 266 ? 16.207  19.116 43.878 1.00 22.70 ? 247  LEU A C   1 
ATOM   2025 O O   . LEU A 1 266 ? 16.966  18.164 43.871 1.00 21.91 ? 247  LEU A O   1 
ATOM   2026 C CB  . LEU A 1 266 ? 16.554  20.182 41.577 1.00 22.27 ? 247  LEU A CB  1 
ATOM   2027 C CG  . LEU A 1 266 ? 15.158  19.864 40.934 1.00 23.62 ? 247  LEU A CG  1 
ATOM   2028 C CD1 . LEU A 1 266 ? 14.181  21.019 41.154 1.00 26.53 ? 247  LEU A CD1 1 
ATOM   2029 C CD2 . LEU A 1 266 ? 15.187  19.561 39.373 1.00 23.16 ? 247  LEU A CD2 1 
ATOM   2030 N N   . ALA A 1 267 ? 15.036  19.095 44.508 1.00 22.86 ? 248  ALA A N   1 
ATOM   2031 C CA  . ALA A 1 267 ? 14.514  17.872 45.116 1.00 24.99 ? 248  ALA A CA  1 
ATOM   2032 C C   . ALA A 1 267 ? 13.039  17.779 44.750 1.00 25.03 ? 248  ALA A C   1 
ATOM   2033 O O   . ALA A 1 267 ? 12.226  18.505 45.314 1.00 27.07 ? 248  ALA A O   1 
ATOM   2034 C CB  . ALA A 1 267 ? 14.700  17.903 46.666 1.00 25.09 ? 248  ALA A CB  1 
ATOM   2035 N N   . THR A 1 268 ? 12.701  16.926 43.793 1.00 24.17 ? 249  THR A N   1 
ATOM   2036 C CA  . THR A 1 268 ? 11.340  16.854 43.244 1.00 23.79 ? 249  THR A CA  1 
ATOM   2037 C C   . THR A 1 268 ? 10.757  15.466 43.405 1.00 22.92 ? 249  THR A C   1 
ATOM   2038 O O   . THR A 1 268 ? 11.466  14.463 43.360 1.00 21.83 ? 249  THR A O   1 
ATOM   2039 C CB  . THR A 1 268 ? 11.295  17.243 41.688 1.00 24.20 ? 249  THR A CB  1 
ATOM   2040 O OG1 . THR A 1 268 ? 10.003  16.908 41.147 1.00 25.86 ? 249  THR A OG1 1 
ATOM   2041 C CG2 . THR A 1 268 ? 12.340  16.435 40.886 1.00 22.91 ? 249  THR A CG2 1 
ATOM   2042 N N   . ASN A 1 269 ? 9.443   15.399 43.575 1.00 23.08 ? 250  ASN A N   1 
ATOM   2043 C CA  . ASN A 1 269 ? 8.743   14.127 43.534 1.00 23.85 ? 250  ASN A CA  1 
ATOM   2044 C C   . ASN A 1 269 ? 8.692   13.504 42.156 1.00 23.32 ? 250  ASN A C   1 
ATOM   2045 O O   . ASN A 1 269 ? 8.601   12.298 42.044 1.00 23.97 ? 250  ASN A O   1 
ATOM   2046 C CB  . ASN A 1 269 ? 7.322   14.250 44.133 1.00 23.63 ? 250  ASN A CB  1 
ATOM   2047 C CG  . ASN A 1 269 ? 7.353   14.216 45.668 1.00 27.29 ? 250  ASN A CG  1 
ATOM   2048 O OD1 . ASN A 1 269 ? 8.430   14.187 46.270 1.00 29.61 ? 250  ASN A OD1 1 
ATOM   2049 N ND2 . ASN A 1 269 ? 6.187   14.179 46.293 1.00 29.57 ? 250  ASN A ND2 1 
ATOM   2050 N N   . SER A 1 270 ? 8.738   14.317 41.104 1.00 24.24 ? 251  SER A N   1 
ATOM   2051 C CA  . SER A 1 270 ? 8.748   13.781 39.701 1.00 24.51 ? 251  SER A CA  1 
ATOM   2052 C C   . SER A 1 270 ? 9.933   12.867 39.359 1.00 24.12 ? 251  SER A C   1 
ATOM   2053 O O   . SER A 1 270 ? 11.008  12.940 39.987 1.00 24.34 ? 251  SER A O   1 
ATOM   2054 C CB  . SER A 1 270 ? 8.725   14.937 38.686 1.00 25.26 ? 251  SER A CB  1 
ATOM   2055 O OG  . SER A 1 270 ? 7.498   15.609 38.816 1.00 28.99 ? 251  SER A OG  1 
ATOM   2056 N N   . ASP A 1 271 ? 9.736   12.010 38.358 1.00 23.18 ? 252  ASP A N   1 
ATOM   2057 C CA  . ASP A 1 271 ? 10.775  11.129 37.824 1.00 23.99 ? 252  ASP A CA  1 
ATOM   2058 C C   . ASP A 1 271 ? 11.760  11.925 36.944 1.00 22.93 ? 252  ASP A C   1 
ATOM   2059 O O   . ASP A 1 271 ? 11.470  13.051 36.508 1.00 22.64 ? 252  ASP A O   1 
ATOM   2060 C CB  . ASP A 1 271 ? 10.112  10.020 36.982 1.00 25.72 ? 252  ASP A CB  1 
ATOM   2061 C CG  . ASP A 1 271 ? 9.239   10.613 35.815 1.00 32.33 ? 252  ASP A CG  1 
ATOM   2062 O OD1 . ASP A 1 271 ? 9.809   10.960 34.756 1.00 32.45 ? 252  ASP A OD1 1 
ATOM   2063 O OD2 . ASP A 1 271 ? 7.996   10.830 35.996 1.00 39.78 ? 252  ASP A OD2 1 
ATOM   2064 N N   . TYR A 1 272 ? 12.912  11.329 36.655 1.00 22.21 ? 253  TYR A N   1 
ATOM   2065 C CA  . TYR A 1 272 ? 13.905  11.993 35.803 1.00 22.49 ? 253  TYR A CA  1 
ATOM   2066 C C   . TYR A 1 272 ? 13.459  12.414 34.376 1.00 22.21 ? 253  TYR A C   1 
ATOM   2067 O O   . TYR A 1 272 ? 13.792  13.516 33.928 1.00 21.84 ? 253  TYR A O   1 
ATOM   2068 C CB  . TYR A 1 272 ? 15.256  11.256 35.778 1.00 22.50 ? 253  TYR A CB  1 
ATOM   2069 C CG  . TYR A 1 272 ? 16.348  12.055 35.028 1.00 24.76 ? 253  TYR A CG  1 
ATOM   2070 C CD1 . TYR A 1 272 ? 16.937  13.200 35.600 1.00 25.39 ? 253  TYR A CD1 1 
ATOM   2071 C CD2 . TYR A 1 272 ? 16.717  11.706 33.723 1.00 25.02 ? 253  TYR A CD2 1 
ATOM   2072 C CE1 . TYR A 1 272 ? 17.890  13.958 34.904 1.00 25.31 ? 253  TYR A CE1 1 
ATOM   2073 C CE2 . TYR A 1 272 ? 17.699  12.448 33.030 1.00 26.50 ? 253  TYR A CE2 1 
ATOM   2074 C CZ  . TYR A 1 272 ? 18.269  13.559 33.642 1.00 26.05 ? 253  TYR A CZ  1 
ATOM   2075 O OH  . TYR A 1 272 ? 19.208  14.285 32.969 1.00 27.00 ? 253  TYR A OH  1 
ATOM   2076 N N   . LYS A 1 273 ? 12.753  11.539 33.660 1.00 22.64 ? 254  LYS A N   1 
ATOM   2077 C CA  . LYS A 1 273 ? 12.409  11.828 32.258 1.00 23.13 ? 254  LYS A CA  1 
ATOM   2078 C C   . LYS A 1 273 ? 11.508  13.034 32.136 1.00 21.93 ? 254  LYS A C   1 
ATOM   2079 O O   . LYS A 1 273 ? 11.699  13.855 31.242 1.00 21.69 ? 254  LYS A O   1 
ATOM   2080 C CB  . LYS A 1 273 ? 11.748  10.630 31.584 1.00 24.17 ? 254  LYS A CB  1 
ATOM   2081 C CG  . LYS A 1 273 ? 12.749  9.662  30.995 1.00 29.15 ? 254  LYS A CG  1 
ATOM   2082 C CD  . LYS A 1 273 ? 12.088  8.303  30.639 1.00 33.02 ? 254  LYS A CD  1 
ATOM   2083 C CE  . LYS A 1 273 ? 13.092  7.247  30.141 1.00 32.98 ? 254  LYS A CE  1 
ATOM   2084 N NZ  . LYS A 1 273 ? 12.601  5.784  30.373 1.00 35.07 ? 254  LYS A NZ  1 
ATOM   2085 N N   . TYR A 1 274 ? 10.497  13.112 32.997 1.00 20.25 ? 255  TYR A N   1 
ATOM   2086 C CA  . TYR A 1 274 ? 9.586   14.225 33.008 1.00 20.81 ? 255  TYR A CA  1 
ATOM   2087 C C   . TYR A 1 274 ? 10.322  15.531 33.393 1.00 21.51 ? 255  TYR A C   1 
ATOM   2088 O O   . TYR A 1 274 ? 10.196  16.559 32.730 1.00 21.80 ? 255  TYR A O   1 
ATOM   2089 C CB  . TYR A 1 274 ? 8.399   13.928 33.959 1.00 20.32 ? 255  TYR A CB  1 
ATOM   2090 C CG  . TYR A 1 274 ? 7.365   15.034 33.941 1.00 20.70 ? 255  TYR A CG  1 
ATOM   2091 C CD1 . TYR A 1 274 ? 6.575   15.257 32.806 1.00 19.27 ? 255  TYR A CD1 1 
ATOM   2092 C CD2 . TYR A 1 274 ? 7.204   15.888 35.042 1.00 20.61 ? 255  TYR A CD2 1 
ATOM   2093 C CE1 . TYR A 1 274 ? 5.641   16.277 32.776 1.00 20.64 ? 255  TYR A CE1 1 
ATOM   2094 C CE2 . TYR A 1 274 ? 6.282   16.924 35.012 1.00 19.35 ? 255  TYR A CE2 1 
ATOM   2095 C CZ  . TYR A 1 274 ? 5.495   17.114 33.902 1.00 21.58 ? 255  TYR A CZ  1 
ATOM   2096 O OH  . TYR A 1 274 ? 4.561   18.148 33.881 1.00 19.88 ? 255  TYR A OH  1 
ATOM   2097 N N   . THR A 1 275 ? 11.112  15.458 34.456 1.00 22.10 ? 256  THR A N   1 
ATOM   2098 C CA  . THR A 1 275 ? 11.879  16.576 34.960 1.00 22.68 ? 256  THR A CA  1 
ATOM   2099 C C   . THR A 1 275 ? 12.837  17.091 33.903 1.00 22.95 ? 256  THR A C   1 
ATOM   2100 O O   . THR A 1 275 ? 13.003  18.291 33.722 1.00 24.11 ? 256  THR A O   1 
ATOM   2101 C CB  . THR A 1 275 ? 12.719  16.136 36.210 1.00 23.17 ? 256  THR A CB  1 
ATOM   2102 O OG1 . THR A 1 275 ? 11.839  15.669 37.227 1.00 20.91 ? 256  THR A OG1 1 
ATOM   2103 C CG2 . THR A 1 275 ? 13.531  17.287 36.772 1.00 21.87 ? 256  THR A CG2 1 
ATOM   2104 N N   . ASP A 1 276 ? 13.521  16.179 33.233 1.00 23.47 ? 257  ASP A N   1 
ATOM   2105 C CA  . ASP A 1 276 ? 14.410  16.592 32.144 1.00 22.80 ? 257  ASP A CA  1 
ATOM   2106 C C   . ASP A 1 276 ? 13.639  17.314 30.996 1.00 22.17 ? 257  ASP A C   1 
ATOM   2107 O O   . ASP A 1 276 ? 14.093  18.364 30.531 1.00 22.95 ? 257  ASP A O   1 
ATOM   2108 C CB  . ASP A 1 276 ? 15.214  15.401 31.676 1.00 22.12 ? 257  ASP A CB  1 
ATOM   2109 C CG  . ASP A 1 276 ? 16.251  15.755 30.636 1.00 25.00 ? 257  ASP A CG  1 
ATOM   2110 O OD1 . ASP A 1 276 ? 16.811  16.887 30.641 1.00 26.03 ? 257  ASP A OD1 1 
ATOM   2111 O OD2 . ASP A 1 276 ? 16.535  14.839 29.832 1.00 27.66 ? 257  ASP A OD2 1 
ATOM   2112 N N   . LYS A 1 277 ? 12.474  16.804 30.594 1.00 21.15 ? 258  LYS A N   1 
ATOM   2113 C CA  . LYS A 1 277 ? 11.668  17.473 29.575 1.00 21.58 ? 258  LYS A CA  1 
ATOM   2114 C C   . LYS A 1 277 ? 11.221  18.870 29.989 1.00 21.30 ? 258  LYS A C   1 
ATOM   2115 O O   . LYS A 1 277 ? 11.292  19.811 29.202 1.00 21.11 ? 258  LYS A O   1 
ATOM   2116 C CB  . LYS A 1 277 ? 10.412  16.684 29.224 1.00 21.00 ? 258  LYS A CB  1 
ATOM   2117 C CG  . LYS A 1 277 ? 10.658  15.380 28.476 1.00 28.42 ? 258  LYS A CG  1 
ATOM   2118 C CD  . LYS A 1 277 ? 10.992  15.563 26.994 1.00 35.18 ? 258  LYS A CD  1 
ATOM   2119 C CE  . LYS A 1 277 ? 10.626  14.312 26.185 1.00 39.72 ? 258  LYS A CE  1 
ATOM   2120 N NZ  . LYS A 1 277 ? 10.146  13.204 27.098 1.00 42.93 ? 258  LYS A NZ  1 
ATOM   2121 N N   . ILE A 1 278 ? 10.705  18.987 31.205 1.00 19.27 ? 259  ILE A N   1 
ATOM   2122 C CA  . ILE A 1 278 ? 10.190  20.273 31.690 1.00 19.71 ? 259  ILE A CA  1 
ATOM   2123 C C   . ILE A 1 278 ? 11.280  21.289 31.864 1.00 19.69 ? 259  ILE A C   1 
ATOM   2124 O O   . ILE A 1 278 ? 11.137  22.439 31.432 1.00 20.38 ? 259  ILE A O   1 
ATOM   2125 C CB  . ILE A 1 278 ? 9.469   20.135 33.082 1.00 19.03 ? 259  ILE A CB  1 
ATOM   2126 C CG1 . ILE A 1 278 ? 8.198   19.281 32.940 1.00 19.25 ? 259  ILE A CG1 1 
ATOM   2127 C CG2 . ILE A 1 278 ? 9.162   21.504 33.652 1.00 18.94 ? 259  ILE A CG2 1 
ATOM   2128 C CD1 . ILE A 1 278 ? 7.167   19.870 31.987 1.00 15.44 ? 259  ILE A CD1 1 
ATOM   2129 N N   . MET A 1 279 ? 12.352  20.860 32.510 1.00 20.46 ? 260  MET A N   1 
ATOM   2130 C CA  . MET A 1 279 ? 13.466  21.719 32.818 1.00 21.44 ? 260  MET A CA  1 
ATOM   2131 C C   . MET A 1 279 ? 14.203  22.178 31.545 1.00 22.56 ? 260  MET A C   1 
ATOM   2132 O O   . MET A 1 279 ? 14.644  23.335 31.477 1.00 24.00 ? 260  MET A O   1 
ATOM   2133 C CB  . MET A 1 279 ? 14.413  21.009 33.793 1.00 21.41 ? 260  MET A CB  1 
ATOM   2134 C CG  . MET A 1 279 ? 13.839  20.799 35.271 1.00 21.93 ? 260  MET A CG  1 
ATOM   2135 S SD  . MET A 1 279 ? 13.515  22.358 36.155 1.00 26.83 ? 260  MET A SD  1 
ATOM   2136 C CE  . MET A 1 279 ? 15.218  22.868 36.495 1.00 25.36 ? 260  MET A CE  1 
ATOM   2137 N N   . THR A 1 280 ? 14.353  21.277 30.564 1.00 22.79 ? 261  THR A N   1 
ATOM   2138 C CA  . THR A 1 280 ? 14.910  21.635 29.299 1.00 22.26 ? 261  THR A CA  1 
ATOM   2139 C C   . THR A 1 280 ? 14.124  22.787 28.707 1.00 23.01 ? 261  THR A C   1 
ATOM   2140 O O   . THR A 1 280 ? 14.730  23.786 28.244 1.00 24.90 ? 261  THR A O   1 
ATOM   2141 C CB  . THR A 1 280 ? 15.035  20.447 28.332 1.00 21.76 ? 261  THR A CB  1 
ATOM   2142 O OG1 . THR A 1 280 ? 15.899  19.480 28.929 1.00 22.03 ? 261  THR A OG1 1 
ATOM   2143 C CG2 . THR A 1 280 ? 15.679  20.902 26.941 1.00 22.55 ? 261  THR A CG2 1 
ATOM   2144 N N   . TYR A 1 281 ? 12.797  22.678 28.732 1.00 22.76 ? 262  TYR A N   1 
ATOM   2145 C CA  . TYR A 1 281 ? 11.925  23.744 28.221 1.00 22.38 ? 262  TYR A CA  1 
ATOM   2146 C C   . TYR A 1 281 ? 12.107  25.058 28.962 1.00 23.05 ? 262  TYR A C   1 
ATOM   2147 O O   . TYR A 1 281 ? 12.193  26.094 28.336 1.00 23.08 ? 262  TYR A O   1 
ATOM   2148 C CB  . TYR A 1 281 ? 10.464  23.318 28.276 1.00 23.00 ? 262  TYR A CB  1 
ATOM   2149 C CG  . TYR A 1 281 ? 9.451   24.423 28.062 1.00 22.83 ? 262  TYR A CG  1 
ATOM   2150 C CD1 . TYR A 1 281 ? 9.113   24.888 26.764 1.00 23.76 ? 262  TYR A CD1 1 
ATOM   2151 C CD2 . TYR A 1 281 ? 8.827   25.009 29.156 1.00 21.87 ? 262  TYR A CD2 1 
ATOM   2152 C CE1 . TYR A 1 281 ? 8.130   25.939 26.604 1.00 24.23 ? 262  TYR A CE1 1 
ATOM   2153 C CE2 . TYR A 1 281 ? 7.894   26.008 29.004 1.00 24.68 ? 262  TYR A CE2 1 
ATOM   2154 C CZ  . TYR A 1 281 ? 7.524   26.453 27.764 1.00 23.72 ? 262  TYR A CZ  1 
ATOM   2155 O OH  . TYR A 1 281 ? 6.561   27.451 27.757 1.00 25.76 ? 262  TYR A OH  1 
ATOM   2156 N N   . LEU A 1 282 ? 12.187  25.013 30.293 1.00 22.99 ? 263  LEU A N   1 
ATOM   2157 C CA  . LEU A 1 282 ? 12.267  26.242 31.097 1.00 23.23 ? 263  LEU A CA  1 
ATOM   2158 C C   . LEU A 1 282 ? 13.552  27.012 30.840 1.00 22.98 ? 263  LEU A C   1 
ATOM   2159 O O   . LEU A 1 282 ? 13.608  28.222 31.059 1.00 24.02 ? 263  LEU A O   1 
ATOM   2160 C CB  . LEU A 1 282 ? 12.147  25.946 32.608 1.00 22.34 ? 263  LEU A CB  1 
ATOM   2161 C CG  . LEU A 1 282 ? 10.804  25.399 33.099 1.00 20.14 ? 263  LEU A CG  1 
ATOM   2162 C CD1 . LEU A 1 282 ? 10.942  24.909 34.559 1.00 18.04 ? 263  LEU A CD1 1 
ATOM   2163 C CD2 . LEU A 1 282 ? 9.736   26.466 32.929 1.00 19.00 ? 263  LEU A CD2 1 
ATOM   2164 N N   . PHE A 1 283 ? 14.576  26.295 30.405 1.00 22.79 ? 264  PHE A N   1 
ATOM   2165 C CA  . PHE A 1 283 ? 15.872  26.870 30.104 1.00 22.93 ? 264  PHE A CA  1 
ATOM   2166 C C   . PHE A 1 283 ? 16.113  27.071 28.594 1.00 23.79 ? 264  PHE A C   1 
ATOM   2167 O O   . PHE A 1 283 ? 17.242  27.423 28.187 1.00 24.34 ? 264  PHE A O   1 
ATOM   2168 C CB  . PHE A 1 283 ? 16.979  26.000 30.727 1.00 22.80 ? 264  PHE A CB  1 
ATOM   2169 C CG  . PHE A 1 283 ? 17.067  26.150 32.225 1.00 24.97 ? 264  PHE A CG  1 
ATOM   2170 C CD1 . PHE A 1 283 ? 18.027  27.007 32.817 1.00 25.09 ? 264  PHE A CD1 1 
ATOM   2171 C CD2 . PHE A 1 283 ? 16.154  25.480 33.055 1.00 22.46 ? 264  PHE A CD2 1 
ATOM   2172 C CE1 . PHE A 1 283 ? 18.055  27.157 34.259 1.00 24.21 ? 264  PHE A CE1 1 
ATOM   2173 C CE2 . PHE A 1 283 ? 16.202  25.616 34.458 1.00 23.51 ? 264  PHE A CE2 1 
ATOM   2174 C CZ  . PHE A 1 283 ? 17.164  26.467 35.039 1.00 23.74 ? 264  PHE A CZ  1 
ATOM   2175 N N   . ASP A 1 284 ? 15.084  26.864 27.770 1.00 24.11 ? 265  ASP A N   1 
ATOM   2176 C CA  . ASP A 1 284 ? 15.299  26.860 26.310 1.00 24.82 ? 265  ASP A CA  1 
ATOM   2177 C C   . ASP A 1 284 ? 15.229  28.290 25.760 1.00 24.52 ? 265  ASP A C   1 
ATOM   2178 O O   . ASP A 1 284 ? 14.176  28.749 25.333 1.00 23.94 ? 265  ASP A O   1 
ATOM   2179 C CB  . ASP A 1 284 ? 14.333  25.917 25.578 1.00 24.79 ? 265  ASP A CB  1 
ATOM   2180 C CG  . ASP A 1 284 ? 14.541  25.915 24.022 1.00 27.84 ? 265  ASP A CG  1 
ATOM   2181 O OD1 . ASP A 1 284 ? 15.653  26.219 23.538 1.00 32.01 ? 265  ASP A OD1 1 
ATOM   2182 O OD2 . ASP A 1 284 ? 13.573  25.592 23.293 1.00 34.88 ? 265  ASP A OD2 1 
ATOM   2183 N N   . PHE A 1 285 ? 16.371  28.963 25.834 1.00 23.95 ? 266  PHE A N   1 
ATOM   2184 C CA  . PHE A 1 285 ? 16.588  30.312 25.361 1.00 24.45 ? 266  PHE A CA  1 
ATOM   2185 C C   . PHE A 1 285 ? 17.835  30.273 24.509 1.00 24.92 ? 266  PHE A C   1 
ATOM   2186 O O   . PHE A 1 285 ? 18.689  29.387 24.698 1.00 25.01 ? 266  PHE A O   1 
ATOM   2187 C CB  . PHE A 1 285 ? 16.764  31.284 26.556 1.00 23.63 ? 266  PHE A CB  1 
ATOM   2188 C CG  . PHE A 1 285 ? 15.485  31.495 27.334 1.00 24.89 ? 266  PHE A CG  1 
ATOM   2189 C CD1 . PHE A 1 285 ? 14.513  32.389 26.873 1.00 25.39 ? 266  PHE A CD1 1 
ATOM   2190 C CD2 . PHE A 1 285 ? 15.221  30.755 28.481 1.00 23.35 ? 266  PHE A CD2 1 
ATOM   2191 C CE1 . PHE A 1 285 ? 13.318  32.543 27.584 1.00 25.00 ? 266  PHE A CE1 1 
ATOM   2192 C CE2 . PHE A 1 285 ? 14.042  30.923 29.189 1.00 22.38 ? 266  PHE A CE2 1 
ATOM   2193 C CZ  . PHE A 1 285 ? 13.092  31.786 28.731 1.00 21.90 ? 266  PHE A CZ  1 
ATOM   2194 N N   . PRO A 1 286 ? 17.958  31.210 23.548 1.00 25.46 ? 267  PRO A N   1 
ATOM   2195 C CA  . PRO A 1 286 ? 19.184  31.174 22.751 1.00 26.28 ? 267  PRO A CA  1 
ATOM   2196 C C   . PRO A 1 286 ? 20.317  31.880 23.480 1.00 26.34 ? 267  PRO A C   1 
ATOM   2197 O O   . PRO A 1 286 ? 21.080  32.565 22.840 1.00 28.40 ? 267  PRO A O   1 
ATOM   2198 C CB  . PRO A 1 286 ? 18.808  31.976 21.482 1.00 26.54 ? 267  PRO A CB  1 
ATOM   2199 C CG  . PRO A 1 286 ? 17.763  32.964 21.965 1.00 25.93 ? 267  PRO A CG  1 
ATOM   2200 C CD  . PRO A 1 286 ? 17.033  32.285 23.129 1.00 25.35 ? 267  PRO A CD  1 
ATOM   2201 N N   . HIS A 1 287 ? 20.369  31.764 24.802 1.00 24.78 ? 268  HIS A N   1 
ATOM   2202 C CA  . HIS A 1 287 ? 21.384  32.378 25.659 1.00 24.08 ? 268  HIS A CA  1 
ATOM   2203 C C   . HIS A 1 287 ? 21.318  31.719 27.045 1.00 23.49 ? 268  HIS A C   1 
ATOM   2204 O O   . HIS A 1 287 ? 20.383  30.971 27.340 1.00 22.20 ? 268  HIS A O   1 
ATOM   2205 C CB  . HIS A 1 287 ? 21.188  33.887 25.786 1.00 23.15 ? 268  HIS A CB  1 
ATOM   2206 C CG  . HIS A 1 287 ? 19.843  34.293 26.306 1.00 23.76 ? 268  HIS A CG  1 
ATOM   2207 N ND1 . HIS A 1 287 ? 19.450  34.092 27.619 1.00 23.18 ? 268  HIS A ND1 1 
ATOM   2208 C CD2 . HIS A 1 287 ? 18.802  34.902 25.686 1.00 21.89 ? 268  HIS A CD2 1 
ATOM   2209 C CE1 . HIS A 1 287 ? 18.223  34.556 27.784 1.00 22.79 ? 268  HIS A CE1 1 
ATOM   2210 N NE2 . HIS A 1 287 ? 17.812  35.056 26.631 1.00 26.38 ? 268  HIS A NE2 1 
ATOM   2211 N N   . GLY A 1 288 ? 22.328  31.992 27.873 1.00 23.13 ? 269  GLY A N   1 
ATOM   2212 C CA  . GLY A 1 288 ? 22.387  31.442 29.215 1.00 23.47 ? 269  GLY A CA  1 
ATOM   2213 C C   . GLY A 1 288 ? 21.696  32.435 30.121 1.00 23.57 ? 269  GLY A C   1 
ATOM   2214 O O   . GLY A 1 288 ? 20.730  33.057 29.708 1.00 24.76 ? 269  GLY A O   1 
ATOM   2215 N N   . PRO A 1 289 ? 22.273  32.703 31.296 1.00 23.91 ? 270  PRO A N   1 
ATOM   2216 C CA  . PRO A 1 289 ? 21.686  33.630 32.316 1.00 24.21 ? 270  PRO A CA  1 
ATOM   2217 C C   . PRO A 1 289 ? 21.228  34.969 31.753 1.00 24.88 ? 270  PRO A C   1 
ATOM   2218 O O   . PRO A 1 289 ? 20.061  35.351 31.945 1.00 26.77 ? 270  PRO A O   1 
ATOM   2219 C CB  . PRO A 1 289 ? 22.829  33.832 33.337 1.00 22.98 ? 270  PRO A CB  1 
ATOM   2220 C CG  . PRO A 1 289 ? 23.584  32.594 33.297 1.00 24.79 ? 270  PRO A CG  1 
ATOM   2221 C CD  . PRO A 1 289 ? 23.548  32.124 31.746 1.00 23.07 ? 270  PRO A CD  1 
ATOM   2222 N N   . LYS A 1 290 ? 22.141  35.671 31.070 1.00 24.59 ? 271  LYS A N   1 
ATOM   2223 C CA  . LYS A 1 290 ? 21.886  36.974 30.463 1.00 24.54 ? 271  LYS A CA  1 
ATOM   2224 C C   . LYS A 1 290 ? 21.888  36.851 28.928 1.00 22.92 ? 271  LYS A C   1 
ATOM   2225 O O   . LYS A 1 290 ? 22.612  36.030 28.377 1.00 21.18 ? 271  LYS A O   1 
ATOM   2226 C CB  . LYS A 1 290 ? 22.993  37.955 30.867 1.00 25.43 ? 271  LYS A CB  1 
ATOM   2227 C CG  . LYS A 1 290 ? 23.083  38.281 32.363 1.00 28.20 ? 271  LYS A CG  1 
ATOM   2228 C CD  . LYS A 1 290 ? 23.859  39.629 32.565 1.00 27.37 ? 271  LYS A CD  1 
ATOM   2229 C CE  . LYS A 1 290 ? 24.249  39.844 34.047 1.00 32.66 ? 271  LYS A CE  1 
ATOM   2230 N NZ  . LYS A 1 290 ? 24.695  41.267 34.387 1.00 34.76 ? 271  LYS A NZ  1 
ATOM   2231 N N   . PRO A 1 291 ? 21.066  37.665 28.228 1.00 22.76 ? 272  PRO A N   1 
ATOM   2232 C CA  . PRO A 1 291 ? 21.264  37.736 26.778 1.00 21.45 ? 272  PRO A CA  1 
ATOM   2233 C C   . PRO A 1 291 ? 22.736  38.023 26.406 1.00 20.37 ? 272  PRO A C   1 
ATOM   2234 O O   . PRO A 1 291 ? 23.396  38.870 27.031 1.00 18.62 ? 272  PRO A O   1 
ATOM   2235 C CB  . PRO A 1 291 ? 20.348  38.903 26.335 1.00 21.94 ? 272  PRO A CB  1 
ATOM   2236 C CG  . PRO A 1 291 ? 19.347  39.051 27.437 1.00 22.94 ? 272  PRO A CG  1 
ATOM   2237 C CD  . PRO A 1 291 ? 19.940  38.510 28.697 1.00 22.85 ? 272  PRO A CD  1 
ATOM   2238 N N   . GLY A 1 292 ? 23.227  37.306 25.394 1.00 19.78 ? 273  GLY A N   1 
ATOM   2239 C CA  . GLY A 1 292 ? 24.628  37.416 24.959 1.00 18.56 ? 273  GLY A CA  1 
ATOM   2240 C C   . GLY A 1 292 ? 25.493  36.267 25.438 1.00 18.86 ? 273  GLY A C   1 
ATOM   2241 O O   . GLY A 1 292 ? 26.494  35.926 24.806 1.00 17.34 ? 273  GLY A O   1 
ATOM   2242 N N   . SER A 1 293 ? 25.056  35.595 26.509 1.00 18.09 ? 274  SER A N   1 
ATOM   2243 C CA  . SER A 1 293 ? 25.862  34.544 27.085 1.00 18.77 ? 274  SER A CA  1 
ATOM   2244 C C   . SER A 1 293 ? 25.550  33.194 26.437 1.00 19.46 ? 274  SER A C   1 
ATOM   2245 O O   . SER A 1 293 ? 24.431  32.965 26.007 1.00 20.58 ? 274  SER A O   1 
ATOM   2246 C CB  . SER A 1 293 ? 25.651  34.480 28.599 1.00 18.99 ? 274  SER A CB  1 
ATOM   2247 O OG  . SER A 1 293 ? 24.387  33.884 28.919 1.00 18.67 ? 274  SER A OG  1 
ATOM   2248 N N   . SER A 1 294 ? 26.534  32.301 26.363 1.00 19.18 ? 275  SER A N   1 
ATOM   2249 C CA  . SER A 1 294 ? 26.262  30.940 25.893 1.00 19.61 ? 275  SER A CA  1 
ATOM   2250 C C   . SER A 1 294 ? 25.174  30.256 26.703 1.00 20.30 ? 275  SER A C   1 
ATOM   2251 O O   . SER A 1 294 ? 25.150  30.307 27.946 1.00 20.65 ? 275  SER A O   1 
ATOM   2252 C CB  . SER A 1 294 ? 27.527  30.082 25.927 1.00 18.11 ? 275  SER A CB  1 
ATOM   2253 O OG  . SER A 1 294 ? 28.499  30.620 25.093 1.00 19.94 ? 275  SER A OG  1 
ATOM   2254 N N   . HIS A 1 295 ? 24.270  29.580 25.999 1.00 21.40 ? 276  HIS A N   1 
ATOM   2255 C CA  . HIS A 1 295 ? 23.314  28.705 26.670 1.00 21.15 ? 276  HIS A CA  1 
ATOM   2256 C C   . HIS A 1 295 ? 24.077  27.581 27.440 1.00 22.02 ? 276  HIS A C   1 
ATOM   2257 O O   . HIS A 1 295 ? 25.079  27.044 26.947 1.00 20.81 ? 276  HIS A O   1 
ATOM   2258 C CB  . HIS A 1 295 ? 22.383  28.093 25.626 1.00 21.76 ? 276  HIS A CB  1 
ATOM   2259 C CG  . HIS A 1 295 ? 21.351  27.188 26.213 1.00 19.11 ? 276  HIS A CG  1 
ATOM   2260 N ND1 . HIS A 1 295 ? 21.567  25.835 26.383 1.00 21.92 ? 276  HIS A ND1 1 
ATOM   2261 C CD2 . HIS A 1 295 ? 20.096  27.434 26.667 1.00 18.03 ? 276  HIS A CD2 1 
ATOM   2262 C CE1 . HIS A 1 295 ? 20.499  25.289 26.949 1.00 24.40 ? 276  HIS A CE1 1 
ATOM   2263 N NE2 . HIS A 1 295 ? 19.597  26.243 27.150 1.00 21.52 ? 276  HIS A NE2 1 
ATOM   2264 N N   . ARG A 1 296 ? 23.601  27.221 28.622 1.00 22.38 ? 277  ARG A N   1 
ATOM   2265 C CA  . ARG A 1 296 ? 24.058  25.987 29.298 1.00 23.86 ? 277  ARG A CA  1 
ATOM   2266 C C   . ARG A 1 296 ? 22.902  25.084 29.718 1.00 23.35 ? 277  ARG A C   1 
ATOM   2267 O O   . ARG A 1 296 ? 21.802  25.602 29.990 1.00 24.33 ? 277  ARG A O   1 
ATOM   2268 C CB  . ARG A 1 296 ? 24.904  26.320 30.532 1.00 25.98 ? 277  ARG A CB  1 
ATOM   2269 C CG  . ARG A 1 296 ? 24.903  27.731 31.013 1.00 27.16 ? 277  ARG A CG  1 
ATOM   2270 C CD  . ARG A 1 296 ? 26.075  27.877 31.962 1.00 32.93 ? 277  ARG A CD  1 
ATOM   2271 N NE  . ARG A 1 296 ? 25.849  28.872 33.003 1.00 33.61 ? 277  ARG A NE  1 
ATOM   2272 C CZ  . ARG A 1 296 ? 25.483  28.645 34.273 1.00 34.37 ? 277  ARG A CZ  1 
ATOM   2273 N NH1 . ARG A 1 296 ? 25.226  27.403 34.787 1.00 28.79 ? 277  ARG A NH1 1 
ATOM   2274 N NH2 . ARG A 1 296 ? 25.360  29.728 35.052 1.00 31.30 ? 277  ARG A NH2 1 
ATOM   2275 N N   . PRO A 1 297 ? 23.149  23.752 29.812 1.00 23.97 ? 278  PRO A N   1 
ATOM   2276 C CA  . PRO A 1 297 ? 22.099  22.776 30.147 1.00 23.33 ? 278  PRO A CA  1 
ATOM   2277 C C   . PRO A 1 297 ? 21.553  23.107 31.520 1.00 22.55 ? 278  PRO A C   1 
ATOM   2278 O O   . PRO A 1 297 ? 22.288  23.616 32.383 1.00 22.58 ? 278  PRO A O   1 
ATOM   2279 C CB  . PRO A 1 297 ? 22.802  21.437 30.183 1.00 23.28 ? 278  PRO A CB  1 
ATOM   2280 C CG  . PRO A 1 297 ? 24.240  21.679 29.912 1.00 25.94 ? 278  PRO A CG  1 
ATOM   2281 C CD  . PRO A 1 297 ? 24.488  23.125 29.663 1.00 24.77 ? 278  PRO A CD  1 
ATOM   2282 N N   . TRP A 1 298 ? 20.253  22.935 31.679 1.00 22.86 ? 279  TRP A N   1 
ATOM   2283 C CA  . TRP A 1 298 ? 19.594  23.109 32.976 1.00 22.56 ? 279  TRP A CA  1 
ATOM   2284 C C   . TRP A 1 298 ? 20.359  22.467 34.168 1.00 22.12 ? 279  TRP A C   1 
ATOM   2285 O O   . TRP A 1 298 ? 20.376  23.047 35.252 1.00 22.30 ? 279  TRP A O   1 
ATOM   2286 C CB  . TRP A 1 298 ? 18.111  22.684 32.893 1.00 22.74 ? 279  TRP A CB  1 
ATOM   2287 C CG  . TRP A 1 298 ? 17.810  21.204 32.912 1.00 25.19 ? 279  TRP A CG  1 
ATOM   2288 C CD1 . TRP A 1 298 ? 17.484  20.415 31.838 1.00 25.42 ? 279  TRP A CD1 1 
ATOM   2289 C CD2 . TRP A 1 298 ? 17.760  20.342 34.070 1.00 26.36 ? 279  TRP A CD2 1 
ATOM   2290 N NE1 . TRP A 1 298 ? 17.259  19.120 32.246 1.00 24.01 ? 279  TRP A NE1 1 
ATOM   2291 C CE2 . TRP A 1 298 ? 17.393  19.048 33.609 1.00 26.71 ? 279  TRP A CE2 1 
ATOM   2292 C CE3 . TRP A 1 298 ? 17.946  20.552 35.462 1.00 22.24 ? 279  TRP A CE3 1 
ATOM   2293 C CZ2 . TRP A 1 298 ? 17.241  17.942 34.486 1.00 25.84 ? 279  TRP A CZ2 1 
ATOM   2294 C CZ3 . TRP A 1 298 ? 17.802  19.477 36.323 1.00 22.61 ? 279  TRP A CZ3 1 
ATOM   2295 C CH2 . TRP A 1 298 ? 17.495  18.164 35.825 1.00 25.60 ? 279  TRP A CH2 1 
ATOM   2296 N N   . GLN A 1 299 ? 21.006  21.314 33.949 1.00 21.54 ? 280  GLN A N   1 
ATOM   2297 C CA  . GLN A 1 299 ? 21.632  20.581 35.046 1.00 22.02 ? 280  GLN A CA  1 
ATOM   2298 C C   . GLN A 1 299 ? 22.822  21.329 35.624 1.00 21.69 ? 280  GLN A C   1 
ATOM   2299 O O   . GLN A 1 299 ? 23.059  21.177 36.815 1.00 20.82 ? 280  GLN A O   1 
ATOM   2300 C CB  . GLN A 1 299 ? 22.073  19.143 34.701 1.00 21.52 ? 280  GLN A CB  1 
ATOM   2301 C CG  . GLN A 1 299 ? 20.945  18.172 34.282 1.00 19.87 ? 280  GLN A CG  1 
ATOM   2302 C CD  . GLN A 1 299 ? 20.712  18.198 32.763 1.00 22.87 ? 280  GLN A CD  1 
ATOM   2303 O OE1 . GLN A 1 299 ? 20.915  19.228 32.118 1.00 22.78 ? 280  GLN A OE1 1 
ATOM   2304 N NE2 . GLN A 1 299 ? 20.281  17.079 32.199 1.00 22.12 ? 280  GLN A NE2 1 
ATOM   2305 N N   . SER A 1 300 ? 23.547  22.129 34.803 1.00 21.11 ? 281  SER A N   1 
ATOM   2306 C CA  . SER A 1 300 ? 24.678  22.900 35.286 1.00 20.96 ? 281  SER A CA  1 
ATOM   2307 C C   . SER A 1 300 ? 24.254  23.985 36.307 1.00 20.67 ? 281  SER A C   1 
ATOM   2308 O O   . SER A 1 300 ? 25.083  24.585 36.979 1.00 20.73 ? 281  SER A O   1 
ATOM   2309 C CB  . SER A 1 300 ? 25.460  23.556 34.114 1.00 21.94 ? 281  SER A CB  1 
ATOM   2310 O OG  . SER A 1 300 ? 24.652  24.600 33.535 1.00 23.52 ? 281  SER A OG  1 
ATOM   2311 N N   . TYR A 1 301 ? 22.968  24.249 36.446 1.00 21.77 ? 282  TYR A N   1 
ATOM   2312 C CA  . TYR A 1 301 ? 22.559  25.261 37.430 1.00 22.88 ? 282  TYR A CA  1 
ATOM   2313 C C   . TYR A 1 301 ? 22.410  24.694 38.877 1.00 23.94 ? 282  TYR A C   1 
ATOM   2314 O O   . TYR A 1 301 ? 22.099  25.457 39.835 1.00 24.55 ? 282  TYR A O   1 
ATOM   2315 C CB  . TYR A 1 301 ? 21.248  25.905 36.975 1.00 22.29 ? 282  TYR A CB  1 
ATOM   2316 C CG  . TYR A 1 301 ? 21.440  26.836 35.781 1.00 23.12 ? 282  TYR A CG  1 
ATOM   2317 C CD1 . TYR A 1 301 ? 21.586  28.216 35.960 1.00 21.30 ? 282  TYR A CD1 1 
ATOM   2318 C CD2 . TYR A 1 301 ? 21.457  26.325 34.479 1.00 22.38 ? 282  TYR A CD2 1 
ATOM   2319 C CE1 . TYR A 1 301 ? 21.754  29.074 34.860 1.00 22.16 ? 282  TYR A CE1 1 
ATOM   2320 C CE2 . TYR A 1 301 ? 21.644  27.182 33.352 1.00 22.89 ? 282  TYR A CE2 1 
ATOM   2321 C CZ  . TYR A 1 301 ? 21.783  28.528 33.549 1.00 20.40 ? 282  TYR A CZ  1 
ATOM   2322 O OH  . TYR A 1 301 ? 21.916  29.343 32.457 1.00 21.20 ? 282  TYR A OH  1 
ATOM   2323 N N   . PHE A 1 302 ? 22.620  23.382 39.025 1.00 23.22 ? 283  PHE A N   1 
ATOM   2324 C CA  . PHE A 1 302 ? 22.403  22.690 40.316 1.00 23.58 ? 283  PHE A CA  1 
ATOM   2325 C C   . PHE A 1 302 ? 23.621  21.946 40.812 1.00 23.93 ? 283  PHE A C   1 
ATOM   2326 O O   . PHE A 1 302 ? 24.272  21.254 40.043 1.00 25.16 ? 283  PHE A O   1 
ATOM   2327 C CB  . PHE A 1 302 ? 21.205  21.739 40.208 1.00 22.73 ? 283  PHE A CB  1 
ATOM   2328 C CG  . PHE A 1 302 ? 19.933  22.437 39.850 1.00 22.73 ? 283  PHE A CG  1 
ATOM   2329 C CD1 . PHE A 1 302 ? 19.093  22.964 40.850 1.00 23.12 ? 283  PHE A CD1 1 
ATOM   2330 C CD2 . PHE A 1 302 ? 19.581  22.623 38.500 1.00 23.46 ? 283  PHE A CD2 1 
ATOM   2331 C CE1 . PHE A 1 302 ? 17.914  23.674 40.503 1.00 23.03 ? 283  PHE A CE1 1 
ATOM   2332 C CE2 . PHE A 1 302 ? 18.418  23.307 38.148 1.00 22.00 ? 283  PHE A CE2 1 
ATOM   2333 C CZ  . PHE A 1 302 ? 17.557  23.826 39.156 1.00 20.93 ? 283  PHE A CZ  1 
ATOM   2334 N N   . ASP A 1 303 ? 23.961  22.125 42.087 1.00 23.57 ? 284  ASP A N   1 
ATOM   2335 C CA  . ASP A 1 303 ? 25.011  21.341 42.731 1.00 24.12 ? 284  ASP A CA  1 
ATOM   2336 C C   . ASP A 1 303 ? 24.483  19.959 43.078 1.00 23.69 ? 284  ASP A C   1 
ATOM   2337 O O   . ASP A 1 303 ? 25.242  19.030 43.230 1.00 25.16 ? 284  ASP A O   1 
ATOM   2338 C CB  . ASP A 1 303 ? 25.506  22.029 43.997 1.00 22.96 ? 284  ASP A CB  1 
ATOM   2339 C CG  . ASP A 1 303 ? 26.114  23.405 43.701 1.00 27.02 ? 284  ASP A CG  1 
ATOM   2340 O OD1 . ASP A 1 303 ? 27.218  23.458 43.103 1.00 32.11 ? 284  ASP A OD1 1 
ATOM   2341 O OD2 . ASP A 1 303 ? 25.479  24.447 43.979 1.00 26.28 ? 284  ASP A OD2 1 
ATOM   2342 N N   . LEU A 1 304 ? 23.170  19.809 43.179 1.00 24.05 ? 285  LEU A N   1 
ATOM   2343 C CA  . LEU A 1 304 ? 22.604  18.494 43.490 1.00 22.39 ? 285  LEU A CA  1 
ATOM   2344 C C   . LEU A 1 304 ? 21.229  18.394 42.879 1.00 21.60 ? 285  LEU A C   1 
ATOM   2345 O O   . LEU A 1 304 ? 20.408  19.299 43.023 1.00 21.83 ? 285  LEU A O   1 
ATOM   2346 C CB  . LEU A 1 304 ? 22.592  18.240 45.014 1.00 22.40 ? 285  LEU A CB  1 
ATOM   2347 C CG  . LEU A 1 304 ? 22.022  16.899 45.535 1.00 25.07 ? 285  LEU A CG  1 
ATOM   2348 C CD1 . LEU A 1 304 ? 22.625  16.632 46.906 1.00 31.06 ? 285  LEU A CD1 1 
ATOM   2349 C CD2 . LEU A 1 304 ? 20.487  16.945 45.697 1.00 25.39 ? 285  LEU A CD2 1 
ATOM   2350 N N   . ILE A 1 305 ? 20.951  17.264 42.242 1.00 20.49 ? 286  ILE A N   1 
ATOM   2351 C CA  . ILE A 1 305 ? 19.660  17.052 41.620 1.00 21.21 ? 286  ILE A CA  1 
ATOM   2352 C C   . ILE A 1 305 ? 19.116  15.755 42.165 1.00 21.99 ? 286  ILE A C   1 
ATOM   2353 O O   . ILE A 1 305 ? 19.753  14.699 42.071 1.00 21.76 ? 286  ILE A O   1 
ATOM   2354 C CB  . ILE A 1 305 ? 19.763  16.964 40.076 1.00 21.65 ? 286  ILE A CB  1 
ATOM   2355 C CG1 . ILE A 1 305 ? 20.331  18.263 39.519 1.00 23.27 ? 286  ILE A CG1 1 
ATOM   2356 C CG2 . ILE A 1 305 ? 18.358  16.682 39.445 1.00 19.52 ? 286  ILE A CG2 1 
ATOM   2357 C CD1 . ILE A 1 305 ? 20.747  18.170 38.009 1.00 20.71 ? 286  ILE A CD1 1 
ATOM   2358 N N   . LEU A 1 306 ? 17.933  15.830 42.756 1.00 22.27 ? 287  LEU A N   1 
ATOM   2359 C CA  . LEU A 1 306 ? 17.313  14.615 43.300 1.00 22.94 ? 287  LEU A CA  1 
ATOM   2360 C C   . LEU A 1 306 ? 15.854  14.537 42.806 1.00 23.34 ? 287  LEU A C   1 
ATOM   2361 O O   . LEU A 1 306 ? 15.054  15.485 42.968 1.00 24.26 ? 287  LEU A O   1 
ATOM   2362 C CB  . LEU A 1 306 ? 17.446  14.598 44.813 1.00 21.77 ? 287  LEU A CB  1 
ATOM   2363 C CG  . LEU A 1 306 ? 16.933  13.412 45.632 1.00 26.79 ? 287  LEU A CG  1 
ATOM   2364 C CD1 . LEU A 1 306 ? 17.696  13.366 46.964 1.00 25.96 ? 287  LEU A CD1 1 
ATOM   2365 C CD2 . LEU A 1 306 ? 15.421  13.628 45.888 1.00 26.03 ? 287  LEU A CD2 1 
ATOM   2366 N N   . VAL A 1 307 ? 15.538  13.406 42.198 1.00 22.55 ? 288  VAL A N   1 
ATOM   2367 C CA  . VAL A 1 307 ? 14.216  13.110 41.706 1.00 22.12 ? 288  VAL A CA  1 
ATOM   2368 C C   . VAL A 1 307 ? 13.610  11.960 42.552 1.00 22.41 ? 288  VAL A C   1 
ATOM   2369 O O   . VAL A 1 307 ? 14.299  11.382 43.419 1.00 22.57 ? 288  VAL A O   1 
ATOM   2370 C CB  . VAL A 1 307 ? 14.229  12.769 40.156 1.00 22.29 ? 288  VAL A CB  1 
ATOM   2371 C CG1 . VAL A 1 307 ? 14.811  13.944 39.318 1.00 21.72 ? 288  VAL A CG1 1 
ATOM   2372 C CG2 . VAL A 1 307 ? 14.984  11.473 39.863 1.00 21.53 ? 288  VAL A CG2 1 
ATOM   2373 N N   . ASP A 1 308 ? 12.344  11.636 42.289 1.00 21.67 ? 289  ASP A N   1 
ATOM   2374 C CA  . ASP A 1 308 ? 11.581  10.602 43.027 1.00 22.62 ? 289  ASP A CA  1 
ATOM   2375 C C   . ASP A 1 308 ? 11.732  10.801 44.548 1.00 22.35 ? 289  ASP A C   1 
ATOM   2376 O O   . ASP A 1 308 ? 11.937  9.818  45.278 1.00 21.21 ? 289  ASP A O   1 
ATOM   2377 C CB  . ASP A 1 308 ? 12.050  9.181  42.663 1.00 22.00 ? 289  ASP A CB  1 
ATOM   2378 C CG  . ASP A 1 308 ? 12.216  8.961  41.177 1.00 26.96 ? 289  ASP A CG  1 
ATOM   2379 O OD1 . ASP A 1 308 ? 11.275  9.289  40.423 1.00 30.62 ? 289  ASP A OD1 1 
ATOM   2380 O OD2 . ASP A 1 308 ? 13.275  8.419  40.752 1.00 28.62 ? 289  ASP A OD2 1 
ATOM   2381 N N   . ALA A 1 309 ? 11.645  12.053 45.018 1.00 22.60 ? 290  ALA A N   1 
ATOM   2382 C CA  . ALA A 1 309 ? 11.985  12.390 46.406 1.00 23.86 ? 290  ALA A CA  1 
ATOM   2383 C C   . ALA A 1 309 ? 11.081  11.759 47.434 1.00 24.81 ? 290  ALA A C   1 
ATOM   2384 O O   . ALA A 1 309 ? 11.508  11.539 48.580 1.00 25.45 ? 290  ALA A O   1 
ATOM   2385 C CB  . ALA A 1 309 ? 12.029  13.937 46.627 1.00 23.63 ? 290  ALA A CB  1 
ATOM   2386 N N   A ARG A 1 310 ? 9.846   11.447 47.033 0.50 25.77 ? 291  ARG A N   1 
ATOM   2387 N N   B ARG A 1 310 ? 9.831   11.508 47.044 0.50 25.39 ? 291  ARG A N   1 
ATOM   2388 C CA  A ARG A 1 310 ? 8.784   10.963 47.938 0.50 26.15 ? 291  ARG A CA  1 
ATOM   2389 C CA  B ARG A 1 310 ? 8.793   10.964 47.935 0.50 25.26 ? 291  ARG A CA  1 
ATOM   2390 C C   A ARG A 1 310 ? 8.607   11.810 49.200 0.50 26.32 ? 291  ARG A C   1 
ATOM   2391 C C   B ARG A 1 310 ? 8.579   11.806 49.194 0.50 25.89 ? 291  ARG A C   1 
ATOM   2392 O O   A ARG A 1 310 ? 8.663   11.307 50.325 0.50 26.09 ? 291  ARG A O   1 
ATOM   2393 O O   B ARG A 1 310 ? 8.582   11.292 50.316 0.50 25.64 ? 291  ARG A O   1 
ATOM   2394 C CB  A ARG A 1 310 ? 8.897   9.453  48.248 0.50 26.53 ? 291  ARG A CB  1 
ATOM   2395 C CB  B ARG A 1 310 ? 9.047   9.486  48.268 0.50 25.62 ? 291  ARG A CB  1 
ATOM   2396 C CG  A ARG A 1 310 ? 7.986   8.606  47.350 0.50 27.08 ? 291  ARG A CG  1 
ATOM   2397 C CG  B ARG A 1 310 ? 8.905   8.576  47.055 0.50 24.29 ? 291  ARG A CG  1 
ATOM   2398 C CD  A ARG A 1 310 ? 8.286   7.120  47.354 0.50 27.21 ? 291  ARG A CD  1 
ATOM   2399 C CD  B ARG A 1 310 ? 9.570   7.259  47.269 0.50 25.61 ? 291  ARG A CD  1 
ATOM   2400 N NE  A ARG A 1 310 ? 7.801   6.413  48.546 0.50 29.19 ? 291  ARG A NE  1 
ATOM   2401 N NE  B ARG A 1 310 ? 9.662   6.534  46.006 0.50 26.94 ? 291  ARG A NE  1 
ATOM   2402 C CZ  A ARG A 1 310 ? 7.758   5.090  48.666 0.50 28.58 ? 291  ARG A CZ  1 
ATOM   2403 C CZ  B ARG A 1 310 ? 10.711  6.558  45.195 0.50 24.63 ? 291  ARG A CZ  1 
ATOM   2404 N NH1 A ARG A 1 310 ? 8.142   4.308  47.665 0.50 28.64 ? 291  ARG A NH1 1 
ATOM   2405 N NH1 B ARG A 1 310 ? 11.807  7.246  45.517 0.50 15.79 ? 291  ARG A NH1 1 
ATOM   2406 N NH2 A ARG A 1 310 ? 7.328   4.540  49.790 0.50 28.31 ? 291  ARG A NH2 1 
ATOM   2407 N NH2 B ARG A 1 310 ? 10.653  5.865  44.069 0.50 26.92 ? 291  ARG A NH2 1 
ATOM   2408 N N   . LYS A 1 311 ? 8.392   13.107 48.985 1.00 26.11 ? 292  LYS A N   1 
ATOM   2409 C CA  . LYS A 1 311 ? 8.036   14.030 50.060 1.00 27.35 ? 292  LYS A CA  1 
ATOM   2410 C C   . LYS A 1 311 ? 6.550   13.768 50.336 1.00 27.64 ? 292  LYS A C   1 
ATOM   2411 O O   . LYS A 1 311 ? 5.808   13.521 49.381 1.00 29.06 ? 292  LYS A O   1 
ATOM   2412 C CB  . LYS A 1 311 ? 8.240   15.468 49.592 1.00 25.86 ? 292  LYS A CB  1 
ATOM   2413 C CG  . LYS A 1 311 ? 9.678   15.801 49.301 1.00 30.25 ? 292  LYS A CG  1 
ATOM   2414 C CD  . LYS A 1 311 ? 9.874   17.246 48.877 1.00 29.90 ? 292  LYS A CD  1 
ATOM   2415 C CE  . LYS A 1 311 ? 10.036  17.360 47.386 1.00 34.09 ? 292  LYS A CE  1 
ATOM   2416 N NZ  . LYS A 1 311 ? 8.825   17.831 46.681 1.00 36.73 ? 292  LYS A NZ  1 
ATOM   2417 N N   . PRO A 1 312 ? 6.088   13.851 51.608 1.00 27.64 ? 293  PRO A N   1 
ATOM   2418 C CA  . PRO A 1 312 ? 6.788   14.300 52.810 1.00 27.41 ? 293  PRO A CA  1 
ATOM   2419 C C   . PRO A 1 312 ? 7.711   13.286 53.555 1.00 26.91 ? 293  PRO A C   1 
ATOM   2420 O O   . PRO A 1 312 ? 8.557   13.729 54.365 1.00 27.80 ? 293  PRO A O   1 
ATOM   2421 C CB  . PRO A 1 312 ? 5.645   14.774 53.714 1.00 26.97 ? 293  PRO A CB  1 
ATOM   2422 C CG  . PRO A 1 312 ? 4.535   13.882 53.387 1.00 27.48 ? 293  PRO A CG  1 
ATOM   2423 C CD  . PRO A 1 312 ? 4.695   13.476 51.917 1.00 27.24 ? 293  PRO A CD  1 
ATOM   2424 N N   . LEU A 1 313 ? 7.586   11.983 53.275 1.00 25.80 ? 294  LEU A N   1 
ATOM   2425 C CA  . LEU A 1 313 ? 8.438   10.936 53.895 1.00 25.09 ? 294  LEU A CA  1 
ATOM   2426 C C   . LEU A 1 313 ? 9.952   11.258 53.835 1.00 23.07 ? 294  LEU A C   1 
ATOM   2427 O O   . LEU A 1 313 ? 10.737  10.897 54.734 1.00 21.62 ? 294  LEU A O   1 
ATOM   2428 C CB  . LEU A 1 313 ? 8.148   9.590  53.217 1.00 25.92 ? 294  LEU A CB  1 
ATOM   2429 C CG  . LEU A 1 313 ? 8.972   8.296  53.372 1.00 27.30 ? 294  LEU A CG  1 
ATOM   2430 C CD1 . LEU A 1 313 ? 8.717   7.656  54.727 1.00 27.83 ? 294  LEU A CD1 1 
ATOM   2431 C CD2 . LEU A 1 313 ? 8.680   7.268  52.217 1.00 26.74 ? 294  LEU A CD2 1 
ATOM   2432 N N   . PHE A 1 314 ? 10.337  11.924 52.754 1.00 20.64 ? 295  PHE A N   1 
ATOM   2433 C CA  . PHE A 1 314 ? 11.675  12.460 52.535 1.00 20.44 ? 295  PHE A CA  1 
ATOM   2434 C C   . PHE A 1 314 ? 12.258  13.200 53.748 1.00 20.12 ? 295  PHE A C   1 
ATOM   2435 O O   . PHE A 1 314 ? 13.445  13.107 54.030 1.00 20.13 ? 295  PHE A O   1 
ATOM   2436 C CB  . PHE A 1 314 ? 11.570  13.438 51.376 1.00 19.80 ? 295  PHE A CB  1 
ATOM   2437 C CG  . PHE A 1 314 ? 12.869  13.981 50.916 1.00 18.62 ? 295  PHE A CG  1 
ATOM   2438 C CD1 . PHE A 1 314 ? 13.744  13.194 50.188 1.00 17.70 ? 295  PHE A CD1 1 
ATOM   2439 C CD2 . PHE A 1 314 ? 13.199  15.311 51.172 1.00 15.88 ? 295  PHE A CD2 1 
ATOM   2440 C CE1 . PHE A 1 314 ? 14.950  13.727 49.732 1.00 18.99 ? 295  PHE A CE1 1 
ATOM   2441 C CE2 . PHE A 1 314 ? 14.387  15.833 50.744 1.00 16.53 ? 295  PHE A CE2 1 
ATOM   2442 C CZ  . PHE A 1 314 ? 15.267  15.038 50.012 1.00 18.82 ? 295  PHE A CZ  1 
ATOM   2443 N N   . PHE A 1 315 ? 11.422  13.939 54.455 1.00 20.87 ? 296  PHE A N   1 
ATOM   2444 C CA  . PHE A 1 315 ? 11.876  14.706 55.616 1.00 22.01 ? 296  PHE A CA  1 
ATOM   2445 C C   . PHE A 1 315 ? 11.938  13.910 56.922 1.00 23.16 ? 296  PHE A C   1 
ATOM   2446 O O   . PHE A 1 315 ? 12.281  14.486 57.963 1.00 23.63 ? 296  PHE A O   1 
ATOM   2447 C CB  . PHE A 1 315 ? 11.031  15.982 55.784 1.00 21.91 ? 296  PHE A CB  1 
ATOM   2448 C CG  . PHE A 1 315 ? 11.147  16.908 54.636 1.00 20.21 ? 296  PHE A CG  1 
ATOM   2449 C CD1 . PHE A 1 315 ? 12.284  17.701 54.491 1.00 17.29 ? 296  PHE A CD1 1 
ATOM   2450 C CD2 . PHE A 1 315 ? 10.142  16.991 53.686 1.00 21.43 ? 296  PHE A CD2 1 
ATOM   2451 C CE1 . PHE A 1 315 ? 12.454  18.524 53.417 1.00 18.30 ? 296  PHE A CE1 1 
ATOM   2452 C CE2 . PHE A 1 315 ? 10.288  17.867 52.585 1.00 23.01 ? 296  PHE A CE2 1 
ATOM   2453 C CZ  . PHE A 1 315 ? 11.454  18.635 52.458 1.00 23.29 ? 296  PHE A CZ  1 
ATOM   2454 N N   . GLY A 1 316 ? 11.597  12.613 56.870 1.00 23.67 ? 297  GLY A N   1 
ATOM   2455 C CA  . GLY A 1 316 ? 11.884  11.654 57.953 1.00 25.50 ? 297  GLY A CA  1 
ATOM   2456 C C   . GLY A 1 316 ? 12.903  10.586 57.547 1.00 26.57 ? 297  GLY A C   1 
ATOM   2457 O O   . GLY A 1 316 ? 14.056  10.908 57.169 1.00 26.99 ? 297  GLY A O   1 
ATOM   2458 N N   . GLU A 1 317 ? 12.481  9.322  57.595 1.00 26.46 ? 298  GLU A N   1 
ATOM   2459 C CA  . GLU A 1 317 ? 13.367  8.198  57.249 1.00 28.10 ? 298  GLU A CA  1 
ATOM   2460 C C   . GLU A 1 317 ? 13.756  8.188  55.769 1.00 26.49 ? 298  GLU A C   1 
ATOM   2461 O O   . GLU A 1 317 ? 14.812  7.688  55.399 1.00 26.36 ? 298  GLU A O   1 
ATOM   2462 C CB  . GLU A 1 317 ? 12.719  6.852  57.629 1.00 28.76 ? 298  GLU A CB  1 
ATOM   2463 C CG  . GLU A 1 317 ? 13.047  6.372  59.055 1.00 35.87 ? 298  GLU A CG  1 
ATOM   2464 C CD  . GLU A 1 317 ? 14.552  6.086  59.232 1.00 44.74 ? 298  GLU A CD  1 
ATOM   2465 O OE1 . GLU A 1 317 ? 14.999  4.945  58.921 1.00 47.20 ? 298  GLU A OE1 1 
ATOM   2466 O OE2 . GLU A 1 317 ? 15.287  7.012  59.678 1.00 47.57 ? 298  GLU A OE2 1 
ATOM   2467 N N   . GLY A 1 318 ? 12.884  8.756  54.943 1.00 25.64 ? 299  GLY A N   1 
ATOM   2468 C CA  . GLY A 1 318 ? 13.085  8.797  53.505 1.00 24.85 ? 299  GLY A CA  1 
ATOM   2469 C C   . GLY A 1 318 ? 13.050  7.396  52.921 1.00 24.47 ? 299  GLY A C   1 
ATOM   2470 O O   . GLY A 1 318 ? 12.511  6.462  53.516 1.00 22.73 ? 299  GLY A O   1 
ATOM   2471 N N   . THR A 1 319 ? 13.651  7.265  51.747 1.00 24.44 ? 300  THR A N   1 
ATOM   2472 C CA  . THR A 1 319 ? 13.850  5.955  51.130 1.00 25.20 ? 300  THR A CA  1 
ATOM   2473 C C   . THR A 1 319 ? 15.304  5.784  50.808 1.00 24.82 ? 300  THR A C   1 
ATOM   2474 O O   . THR A 1 319 ? 16.121  6.706  50.941 1.00 25.47 ? 300  THR A O   1 
ATOM   2475 C CB  . THR A 1 319 ? 12.998  5.771  49.817 1.00 25.65 ? 300  THR A CB  1 
ATOM   2476 O OG1 . THR A 1 319 ? 13.356  6.759  48.829 1.00 26.51 ? 300  THR A OG1 1 
ATOM   2477 C CG2 . THR A 1 319 ? 11.523  5.880  50.146 1.00 26.45 ? 300  THR A CG2 1 
ATOM   2478 N N   . VAL A 1 320 ? 15.636  4.598  50.352 1.00 24.54 ? 301  VAL A N   1 
ATOM   2479 C CA  . VAL A 1 320 ? 16.984  4.309  49.955 1.00 23.38 ? 301  VAL A CA  1 
ATOM   2480 C C   . VAL A 1 320 ? 17.493  5.276  48.839 1.00 22.38 ? 301  VAL A C   1 
ATOM   2481 O O   . VAL A 1 320 ? 16.754  5.668  47.916 1.00 21.29 ? 301  VAL A O   1 
ATOM   2482 C CB  . VAL A 1 320 ? 17.059  2.778  49.696 1.00 24.12 ? 301  VAL A CB  1 
ATOM   2483 C CG1 . VAL A 1 320 ? 17.728  2.412  48.415 1.00 23.77 ? 301  VAL A CG1 1 
ATOM   2484 C CG2 . VAL A 1 320 ? 17.605  2.069  50.958 1.00 24.96 ? 301  VAL A CG2 1 
ATOM   2485 N N   . LEU A 1 321 ? 18.741  5.716  48.990 1.00 21.78 ? 302  LEU A N   1 
ATOM   2486 C CA  . LEU A 1 321 ? 19.379  6.560  47.998 1.00 21.23 ? 302  LEU A CA  1 
ATOM   2487 C C   . LEU A 1 321 ? 19.776  5.752  46.719 1.00 20.87 ? 302  LEU A C   1 
ATOM   2488 O O   . LEU A 1 321 ? 20.559  4.787  46.762 1.00 20.68 ? 302  LEU A O   1 
ATOM   2489 C CB  . LEU A 1 321 ? 20.589  7.281  48.599 1.00 20.57 ? 302  LEU A CB  1 
ATOM   2490 C CG  . LEU A 1 321 ? 21.215  8.312  47.628 1.00 22.17 ? 302  LEU A CG  1 
ATOM   2491 C CD1 . LEU A 1 321 ? 20.278  9.505  47.311 1.00 21.84 ? 302  LEU A CD1 1 
ATOM   2492 C CD2 . LEU A 1 321 ? 22.627  8.797  48.077 1.00 21.52 ? 302  LEU A CD2 1 
ATOM   2493 N N   . ARG A 1 322 ? 19.211  6.160  45.597 1.00 20.87 ? 303  ARG A N   1 
ATOM   2494 C CA  . ARG A 1 322 ? 19.468  5.516  44.306 1.00 21.15 ? 303  ARG A CA  1 
ATOM   2495 C C   . ARG A 1 322 ? 20.168  6.478  43.375 1.00 21.19 ? 303  ARG A C   1 
ATOM   2496 O O   . ARG A 1 322 ? 20.085  7.699  43.558 1.00 21.35 ? 303  ARG A O   1 
ATOM   2497 C CB  . ARG A 1 322 ? 18.146  5.097  43.636 1.00 20.63 ? 303  ARG A CB  1 
ATOM   2498 C CG  . ARG A 1 322 ? 17.282  4.122  44.461 1.00 20.77 ? 303  ARG A CG  1 
ATOM   2499 C CD  . ARG A 1 322 ? 17.907  2.775  44.632 1.00 22.41 ? 303  ARG A CD  1 
ATOM   2500 N NE  . ARG A 1 322 ? 17.956  2.016  43.398 1.00 24.87 ? 303  ARG A NE  1 
ATOM   2501 C CZ  . ARG A 1 322 ? 16.938  1.356  42.855 1.00 24.82 ? 303  ARG A CZ  1 
ATOM   2502 N NH1 . ARG A 1 322 ? 15.729  1.367  43.438 1.00 24.42 ? 303  ARG A NH1 1 
ATOM   2503 N NH2 . ARG A 1 322 ? 17.141  0.676  41.719 1.00 23.49 ? 303  ARG A NH2 1 
ATOM   2504 N N   . GLN A 1 323 ? 20.803  5.917  42.349 1.00 20.83 ? 304  GLN A N   1 
ATOM   2505 C CA  . GLN A 1 323 ? 21.399  6.701  41.287 1.00 21.54 ? 304  GLN A CA  1 
ATOM   2506 C C   . GLN A 1 323 ? 20.666  6.522  39.955 1.00 22.00 ? 304  GLN A C   1 
ATOM   2507 O O   . GLN A 1 323 ? 20.381  5.405  39.540 1.00 21.78 ? 304  GLN A O   1 
ATOM   2508 C CB  . GLN A 1 323 ? 22.856  6.294  41.109 1.00 21.29 ? 304  GLN A CB  1 
ATOM   2509 C CG  . GLN A 1 323 ? 23.503  6.970  39.947 1.00 24.14 ? 304  GLN A CG  1 
ATOM   2510 C CD  . GLN A 1 323 ? 24.958  6.615  39.783 1.00 25.46 ? 304  GLN A CD  1 
ATOM   2511 O OE1 . GLN A 1 323 ? 25.473  5.732  40.452 1.00 26.20 ? 304  GLN A OE1 1 
ATOM   2512 N NE2 . GLN A 1 323 ? 25.626  7.308  38.876 1.00 25.99 ? 304  GLN A NE2 1 
ATOM   2513 N N   . VAL A 1 324 ? 20.352  7.631  39.291 1.00 22.59 ? 305  VAL A N   1 
ATOM   2514 C CA  . VAL A 1 324 ? 19.706  7.575  37.976 1.00 23.54 ? 305  VAL A CA  1 
ATOM   2515 C C   . VAL A 1 324 ? 20.759  7.326  36.903 1.00 24.81 ? 305  VAL A C   1 
ATOM   2516 O O   . VAL A 1 324 ? 21.821  7.969  36.883 1.00 25.64 ? 305  VAL A O   1 
ATOM   2517 C CB  . VAL A 1 324 ? 18.945  8.889  37.676 1.00 23.94 ? 305  VAL A CB  1 
ATOM   2518 C CG1 . VAL A 1 324 ? 18.329  8.910  36.273 1.00 25.03 ? 305  VAL A CG1 1 
ATOM   2519 C CG2 . VAL A 1 324 ? 17.895  9.146  38.754 1.00 21.85 ? 305  VAL A CG2 1 
ATOM   2520 N N   . ASP A 1 325 ? 20.466  6.387  36.015 1.00 24.68 ? 306  ASP A N   1 
ATOM   2521 C CA  . ASP A 1 325 ? 21.180  6.296  34.752 1.00 25.23 ? 306  ASP A CA  1 
ATOM   2522 C C   . ASP A 1 325 ? 20.560  7.291  33.741 1.00 25.46 ? 306  ASP A C   1 
ATOM   2523 O O   . ASP A 1 325 ? 19.539  7.021  33.122 1.00 25.38 ? 306  ASP A O   1 
ATOM   2524 C CB  . ASP A 1 325 ? 21.133  4.869  34.225 1.00 25.34 ? 306  ASP A CB  1 
ATOM   2525 C CG  . ASP A 1 325 ? 21.856  4.703  32.877 1.00 26.91 ? 306  ASP A CG  1 
ATOM   2526 O OD1 . ASP A 1 325 ? 22.063  5.708  32.133 1.00 27.88 ? 306  ASP A OD1 1 
ATOM   2527 O OD2 . ASP A 1 325 ? 22.203  3.541  32.576 1.00 27.26 ? 306  ASP A OD2 1 
ATOM   2528 N N   . THR A 1 326 ? 21.197  8.440  33.564 1.00 25.97 ? 307  THR A N   1 
ATOM   2529 C CA  . THR A 1 326 ? 20.574  9.536  32.805 1.00 26.52 ? 307  THR A CA  1 
ATOM   2530 C C   . THR A 1 326 ? 20.438  9.283  31.291 1.00 27.88 ? 307  THR A C   1 
ATOM   2531 O O   . THR A 1 326 ? 19.699  10.002 30.611 1.00 28.60 ? 307  THR A O   1 
ATOM   2532 C CB  . THR A 1 326 ? 21.238  10.908 33.096 1.00 26.28 ? 307  THR A CB  1 
ATOM   2533 O OG1 . THR A 1 326 ? 22.571  10.933 32.567 1.00 24.43 ? 307  THR A OG1 1 
ATOM   2534 C CG2 . THR A 1 326 ? 21.252  11.192 34.603 1.00 23.76 ? 307  THR A CG2 1 
ATOM   2535 N N   . LYS A 1 327 ? 21.117  8.260  30.778 1.00 28.82 ? 308  LYS A N   1 
ATOM   2536 C CA  . LYS A 1 327 ? 20.958  7.841  29.371 1.00 30.30 ? 308  LYS A CA  1 
ATOM   2537 C C   . LYS A 1 327 ? 19.605  7.155  29.072 1.00 29.95 ? 308  LYS A C   1 
ATOM   2538 O O   . LYS A 1 327 ? 18.950  7.451  28.055 1.00 30.20 ? 308  LYS A O   1 
ATOM   2539 C CB  . LYS A 1 327 ? 22.085  6.876  28.939 1.00 31.10 ? 308  LYS A CB  1 
ATOM   2540 C CG  . LYS A 1 327 ? 23.473  7.241  29.451 1.00 35.12 ? 308  LYS A CG  1 
ATOM   2541 C CD  . LYS A 1 327 ? 24.540  7.107  28.348 1.00 40.94 ? 308  LYS A CD  1 
ATOM   2542 C CE  . LYS A 1 327 ? 25.594  8.227  28.494 1.00 42.45 ? 308  LYS A CE  1 
ATOM   2543 N NZ  . LYS A 1 327 ? 26.256  8.577  27.209 1.00 44.07 ? 308  LYS A NZ  1 
ATOM   2544 N N   . THR A 1 328 ? 19.221  6.214  29.942 1.00 28.91 ? 309  THR A N   1 
ATOM   2545 C CA  . THR A 1 328 ? 18.015  5.422  29.766 1.00 27.69 ? 309  THR A CA  1 
ATOM   2546 C C   . THR A 1 328 ? 16.870  6.039  30.555 1.00 27.41 ? 309  THR A C   1 
ATOM   2547 O O   . THR A 1 328 ? 15.699  5.785  30.252 1.00 27.97 ? 309  THR A O   1 
ATOM   2548 C CB  . THR A 1 328 ? 18.214  3.998  30.250 1.00 27.40 ? 309  THR A CB  1 
ATOM   2549 O OG1 . THR A 1 328 ? 18.579  4.025  31.637 1.00 28.26 ? 309  THR A OG1 1 
ATOM   2550 C CG2 . THR A 1 328 ? 19.311  3.321  29.477 1.00 26.21 ? 309  THR A CG2 1 
ATOM   2551 N N   . GLY A 1 329 ? 17.211  6.819  31.580 1.00 25.61 ? 310  GLY A N   1 
ATOM   2552 C CA  . GLY A 1 329 ? 16.217  7.317  32.526 1.00 24.72 ? 310  GLY A CA  1 
ATOM   2553 C C   . GLY A 1 329 ? 15.778  6.294  33.570 1.00 23.77 ? 310  GLY A C   1 
ATOM   2554 O O   . GLY A 1 329 ? 14.917  6.603  34.401 1.00 24.84 ? 310  GLY A O   1 
ATOM   2555 N N   . LYS A 1 330 ? 16.370  5.099  33.547 1.00 21.85 ? 311  LYS A N   1 
ATOM   2556 C CA  . LYS A 1 330 ? 16.139  4.089  34.575 1.00 21.39 ? 311  LYS A CA  1 
ATOM   2557 C C   . LYS A 1 330 ? 17.083  4.276  35.781 1.00 20.77 ? 311  LYS A C   1 
ATOM   2558 O O   . LYS A 1 330 ? 18.187  4.823  35.656 1.00 21.67 ? 311  LYS A O   1 
ATOM   2559 C CB  . LYS A 1 330 ? 16.356  2.690  33.998 1.00 20.73 ? 311  LYS A CB  1 
ATOM   2560 C CG  . LYS A 1 330 ? 15.476  2.388  32.783 1.00 22.61 ? 311  LYS A CG  1 
ATOM   2561 C CD  . LYS A 1 330 ? 15.753  0.991  32.180 1.00 23.07 ? 311  LYS A CD  1 
ATOM   2562 C CE  . LYS A 1 330 ? 14.955  0.854  30.863 1.00 25.59 ? 311  LYS A CE  1 
ATOM   2563 N NZ  . LYS A 1 330 ? 15.387  -0.341 30.042 1.00 29.12 ? 311  LYS A NZ  1 
ATOM   2564 N N   . LEU A 1 331 ? 16.674  3.759  36.933 1.00 19.15 ? 312  LEU A N   1 
ATOM   2565 C CA  . LEU A 1 331 ? 17.559  3.684  38.085 1.00 18.77 ? 312  LEU A CA  1 
ATOM   2566 C C   . LEU A 1 331 ? 18.605  2.595  37.887 1.00 17.81 ? 312  LEU A C   1 
ATOM   2567 O O   . LEU A 1 331 ? 18.293  1.556  37.329 1.00 18.14 ? 312  LEU A O   1 
ATOM   2568 C CB  . LEU A 1 331 ? 16.751  3.436  39.362 1.00 17.03 ? 312  LEU A CB  1 
ATOM   2569 C CG  . LEU A 1 331 ? 15.684  4.494  39.665 1.00 19.52 ? 312  LEU A CG  1 
ATOM   2570 C CD1 . LEU A 1 331 ? 14.886  4.170  40.967 1.00 14.39 ? 312  LEU A CD1 1 
ATOM   2571 C CD2 . LEU A 1 331 ? 16.268  5.916  39.686 1.00 13.75 ? 312  LEU A CD2 1 
ATOM   2572 N N   . LYS A 1 332 ? 19.849  2.839  38.298 1.00 17.92 ? 313  LYS A N   1 
ATOM   2573 C CA  . LYS A 1 332 ? 20.837  1.745  38.419 1.00 17.92 ? 313  LYS A CA  1 
ATOM   2574 C C   . LYS A 1 332 ? 20.369  0.838  39.540 1.00 18.26 ? 313  LYS A C   1 
ATOM   2575 O O   . LYS A 1 332 ? 19.646  1.284  40.457 1.00 18.33 ? 313  LYS A O   1 
ATOM   2576 C CB  . LYS A 1 332 ? 22.221  2.276  38.788 1.00 18.34 ? 313  LYS A CB  1 
ATOM   2577 C CG  . LYS A 1 332 ? 22.707  3.309  37.798 1.00 20.57 ? 313  LYS A CG  1 
ATOM   2578 C CD  . LYS A 1 332 ? 24.195  3.477  37.805 1.00 24.03 ? 313  LYS A CD  1 
ATOM   2579 C CE  . LYS A 1 332 ? 24.544  4.703  36.966 1.00 29.08 ? 313  LYS A CE  1 
ATOM   2580 N NZ  . LYS A 1 332 ? 25.999  4.676  36.603 1.00 34.79 ? 313  LYS A NZ  1 
ATOM   2581 N N   . ILE A 1 333 ? 20.780  -0.418 39.478 1.00 18.12 ? 314  ILE A N   1 
ATOM   2582 C CA  . ILE A 1 333 ? 20.350  -1.399 40.444 1.00 18.05 ? 314  ILE A CA  1 
ATOM   2583 C C   . ILE A 1 333 ? 21.236  -1.262 41.676 1.00 17.34 ? 314  ILE A C   1 
ATOM   2584 O O   . ILE A 1 333 ? 22.467  -1.206 41.579 1.00 16.43 ? 314  ILE A O   1 
ATOM   2585 C CB  . ILE A 1 333 ? 20.363  -2.855 39.854 1.00 18.74 ? 314  ILE A CB  1 
ATOM   2586 C CG1 . ILE A 1 333 ? 19.516  -2.927 38.563 1.00 19.13 ? 314  ILE A CG1 1 
ATOM   2587 C CG2 . ILE A 1 333 ? 19.910  -3.904 40.919 1.00 19.05 ? 314  ILE A CG2 1 
ATOM   2588 C CD1 . ILE A 1 333 ? 18.029  -2.552 38.707 1.00 17.74 ? 314  ILE A CD1 1 
ATOM   2589 N N   . GLY A 1 334 ? 20.591  -1.165 42.828 1.00 17.37 ? 315  GLY A N   1 
ATOM   2590 C CA  . GLY A 1 334 ? 21.300  -1.036 44.094 1.00 18.23 ? 315  GLY A CA  1 
ATOM   2591 C C   . GLY A 1 334 ? 21.221  0.342  44.762 1.00 17.81 ? 315  GLY A C   1 
ATOM   2592 O O   . GLY A 1 334 ? 20.884  1.328  44.136 1.00 17.64 ? 315  GLY A O   1 
ATOM   2593 N N   . THR A 1 335 ? 21.559  0.372  46.048 1.00 17.99 ? 316  THR A N   1 
ATOM   2594 C CA  . THR A 1 335 ? 21.741  1.612  46.816 1.00 18.70 ? 316  THR A CA  1 
ATOM   2595 C C   . THR A 1 335 ? 23.067  2.282  46.498 1.00 17.99 ? 316  THR A C   1 
ATOM   2596 O O   . THR A 1 335 ? 24.101  1.633  46.443 1.00 16.62 ? 316  THR A O   1 
ATOM   2597 C CB  . THR A 1 335 ? 21.608  1.354  48.359 1.00 18.32 ? 316  THR A CB  1 
ATOM   2598 O OG1 . THR A 1 335 ? 20.302  0.855  48.613 1.00 20.48 ? 316  THR A OG1 1 
ATOM   2599 C CG2 . THR A 1 335 ? 21.780  2.647  49.182 1.00 18.95 ? 316  THR A CG2 1 
ATOM   2600 N N   . TYR A 1 336 ? 23.009  3.595  46.266 1.00 19.26 ? 317  TYR A N   1 
ATOM   2601 C CA  . TYR A 1 336 ? 24.198  4.379  45.942 1.00 20.31 ? 317  TYR A CA  1 
ATOM   2602 C C   . TYR A 1 336 ? 24.885  4.806  47.230 1.00 20.13 ? 317  TYR A C   1 
ATOM   2603 O O   . TYR A 1 336 ? 24.271  5.402  48.110 1.00 19.75 ? 317  TYR A O   1 
ATOM   2604 C CB  . TYR A 1 336 ? 23.840  5.599  45.060 1.00 21.23 ? 317  TYR A CB  1 
ATOM   2605 C CG  . TYR A 1 336 ? 25.047  6.405  44.696 1.00 22.28 ? 317  TYR A CG  1 
ATOM   2606 C CD1 . TYR A 1 336 ? 25.890  5.998  43.648 1.00 22.67 ? 317  TYR A CD1 1 
ATOM   2607 C CD2 . TYR A 1 336 ? 25.372  7.564  45.415 1.00 20.94 ? 317  TYR A CD2 1 
ATOM   2608 C CE1 . TYR A 1 336 ? 27.007  6.748  43.315 1.00 24.63 ? 317  TYR A CE1 1 
ATOM   2609 C CE2 . TYR A 1 336 ? 26.477  8.309  45.104 1.00 20.46 ? 317  TYR A CE2 1 
ATOM   2610 C CZ  . TYR A 1 336 ? 27.282  7.914  44.057 1.00 24.02 ? 317  TYR A CZ  1 
ATOM   2611 O OH  . TYR A 1 336 ? 28.373  8.661  43.763 1.00 22.03 ? 317  TYR A OH  1 
ATOM   2612 N N   . THR A 1 337 ? 26.165  4.487  47.304 1.00 21.49 ? 318  THR A N   1 
ATOM   2613 C CA  . THR A 1 337 ? 27.000  4.562  48.506 1.00 23.88 ? 318  THR A CA  1 
ATOM   2614 C C   . THR A 1 337 ? 28.205  5.501  48.254 1.00 25.24 ? 318  THR A C   1 
ATOM   2615 O O   . THR A 1 337 ? 28.991  5.764  49.171 1.00 25.79 ? 318  THR A O   1 
ATOM   2616 C CB  . THR A 1 337 ? 27.599  3.140  48.862 1.00 24.05 ? 318  THR A CB  1 
ATOM   2617 O OG1 . THR A 1 337 ? 28.439  2.726  47.785 1.00 24.67 ? 318  THR A OG1 1 
ATOM   2618 C CG2 . THR A 1 337 ? 26.470  2.026  49.059 1.00 22.60 ? 318  THR A CG2 1 
ATOM   2619 N N   . GLY A 1 338 ? 28.364  5.952  47.005 1.00 25.81 ? 319  GLY A N   1 
ATOM   2620 C CA  . GLY A 1 338 ? 29.460  6.850  46.607 1.00 26.56 ? 319  GLY A CA  1 
ATOM   2621 C C   . GLY A 1 338 ? 29.255  8.318  46.992 1.00 26.93 ? 319  GLY A C   1 
ATOM   2622 O O   . GLY A 1 338 ? 28.237  8.667  47.609 1.00 27.10 ? 319  GLY A O   1 
ATOM   2623 N N   . PRO A 1 339 ? 30.228  9.189  46.634 1.00 27.19 ? 320  PRO A N   1 
ATOM   2624 C CA  . PRO A 1 339 ? 30.158  10.634 46.971 1.00 27.32 ? 320  PRO A CA  1 
ATOM   2625 C C   . PRO A 1 339 ? 29.315  11.461 46.006 1.00 27.20 ? 320  PRO A C   1 
ATOM   2626 O O   . PRO A 1 339 ? 28.812  10.952 45.002 1.00 26.08 ? 320  PRO A O   1 
ATOM   2627 C CB  . PRO A 1 339 ? 31.623  11.103 46.861 1.00 27.41 ? 320  PRO A CB  1 
ATOM   2628 C CG  . PRO A 1 339 ? 32.242  10.181 45.794 1.00 28.22 ? 320  PRO A CG  1 
ATOM   2629 C CD  . PRO A 1 339 ? 31.468  8.832  45.899 1.00 27.17 ? 320  PRO A CD  1 
ATOM   2630 N N   . LEU A 1 340 ? 29.197  12.748 46.300 1.00 28.15 ? 321  LEU A N   1 
ATOM   2631 C CA  . LEU A 1 340 ? 28.604  13.687 45.357 1.00 29.03 ? 321  LEU A CA  1 
ATOM   2632 C C   . LEU A 1 340 ? 29.588  13.879 44.218 1.00 29.18 ? 321  LEU A C   1 
ATOM   2633 O O   . LEU A 1 340 ? 30.686  14.366 44.451 1.00 30.24 ? 321  LEU A O   1 
ATOM   2634 C CB  . LEU A 1 340 ? 28.309  15.026 46.060 1.00 28.47 ? 321  LEU A CB  1 
ATOM   2635 C CG  . LEU A 1 340 ? 27.621  16.119 45.245 1.00 28.76 ? 321  LEU A CG  1 
ATOM   2636 C CD1 . LEU A 1 340 ? 26.209  15.722 44.919 1.00 27.14 ? 321  LEU A CD1 1 
ATOM   2637 C CD2 . LEU A 1 340 ? 27.629  17.465 46.002 1.00 29.57 ? 321  LEU A CD2 1 
ATOM   2638 N N   . GLN A 1 341 ? 29.242  13.462 43.002 1.00 29.78 ? 322  GLN A N   1 
ATOM   2639 C CA  . GLN A 1 341 ? 30.147  13.717 41.851 1.00 31.01 ? 322  GLN A CA  1 
ATOM   2640 C C   . GLN A 1 341 ? 29.448  14.580 40.843 1.00 30.76 ? 322  GLN A C   1 
ATOM   2641 O O   . GLN A 1 341 ? 28.219  14.572 40.746 1.00 30.44 ? 322  GLN A O   1 
ATOM   2642 C CB  . GLN A 1 341 ? 30.611  12.455 41.123 1.00 30.73 ? 322  GLN A CB  1 
ATOM   2643 C CG  . GLN A 1 341 ? 30.256  11.146 41.769 1.00 31.89 ? 322  GLN A CG  1 
ATOM   2644 C CD  . GLN A 1 341 ? 30.652  9.952  40.906 1.00 33.02 ? 322  GLN A CD  1 
ATOM   2645 O OE1 . GLN A 1 341 ? 31.471  10.074 39.972 1.00 33.44 ? 322  GLN A OE1 1 
ATOM   2646 N NE2 . GLN A 1 341 ? 30.076  8.775  41.221 1.00 34.63 ? 322  GLN A NE2 1 
ATOM   2647 N N   . HIS A 1 342 ? 30.235  15.318 40.079 1.00 31.08 ? 323  HIS A N   1 
ATOM   2648 C CA  . HIS A 1 342 ? 29.674  16.123 39.011 1.00 31.24 ? 323  HIS A CA  1 
ATOM   2649 C C   . HIS A 1 342 ? 28.887  15.237 38.059 1.00 29.56 ? 323  HIS A C   1 
ATOM   2650 O O   . HIS A 1 342 ? 29.358  14.174 37.641 1.00 28.71 ? 323  HIS A O   1 
ATOM   2651 C CB  . HIS A 1 342 ? 30.741  16.857 38.209 1.00 32.17 ? 323  HIS A CB  1 
ATOM   2652 C CG  . HIS A 1 342 ? 30.181  17.549 37.007 1.00 36.21 ? 323  HIS A CG  1 
ATOM   2653 N ND1 . HIS A 1 342 ? 29.480  18.740 37.095 1.00 39.49 ? 323  HIS A ND1 1 
ATOM   2654 C CD2 . HIS A 1 342 ? 30.163  17.191 35.697 1.00 39.72 ? 323  HIS A CD2 1 
ATOM   2655 C CE1 . HIS A 1 342 ? 29.089  19.102 35.884 1.00 42.48 ? 323  HIS A CE1 1 
ATOM   2656 N NE2 . HIS A 1 342 ? 29.488  18.179 35.019 1.00 42.15 ? 323  HIS A NE2 1 
ATOM   2657 N N   . GLY A 1 343 ? 27.679  15.678 37.730 1.00 27.98 ? 324  GLY A N   1 
ATOM   2658 C CA  . GLY A 1 343 ? 26.880  14.980 36.728 1.00 27.10 ? 324  GLY A CA  1 
ATOM   2659 C C   . GLY A 1 343 ? 25.994  13.863 37.256 1.00 25.96 ? 324  GLY A C   1 
ATOM   2660 O O   . GLY A 1 343 ? 25.167  13.342 36.530 1.00 26.59 ? 324  GLY A O   1 
ATOM   2661 N N   . ILE A 1 344 ? 26.163  13.479 38.515 1.00 24.94 ? 325  ILE A N   1 
ATOM   2662 C CA  . ILE A 1 344 ? 25.353  12.391 39.064 1.00 23.36 ? 325  ILE A CA  1 
ATOM   2663 C C   . ILE A 1 344 ? 23.916  12.878 39.368 1.00 22.07 ? 325  ILE A C   1 
ATOM   2664 O O   . ILE A 1 344 ? 23.723  13.984 39.808 1.00 20.76 ? 325  ILE A O   1 
ATOM   2665 C CB  . ILE A 1 344 ? 26.021  11.758 40.301 1.00 23.23 ? 325  ILE A CB  1 
ATOM   2666 C CG1 . ILE A 1 344 ? 25.240  10.540 40.750 1.00 24.78 ? 325  ILE A CG1 1 
ATOM   2667 C CG2 . ILE A 1 344 ? 26.037  12.737 41.454 1.00 24.59 ? 325  ILE A CG2 1 
ATOM   2668 C CD1 . ILE A 1 344 ? 25.658  10.036 42.056 1.00 27.50 ? 325  ILE A CD1 1 
ATOM   2669 N N   . VAL A 1 345 ? 22.910  12.057 39.065 1.00 21.08 ? 326  VAL A N   1 
ATOM   2670 C CA  . VAL A 1 345 ? 21.559  12.354 39.435 1.00 19.68 ? 326  VAL A CA  1 
ATOM   2671 C C   . VAL A 1 345 ? 21.040  11.287 40.417 1.00 19.85 ? 326  VAL A C   1 
ATOM   2672 O O   . VAL A 1 345 ? 21.119  10.066 40.155 1.00 19.65 ? 326  VAL A O   1 
ATOM   2673 C CB  . VAL A 1 345 ? 20.629  12.520 38.206 1.00 20.04 ? 326  VAL A CB  1 
ATOM   2674 C CG1 . VAL A 1 345 ? 19.200  12.810 38.696 1.00 18.17 ? 326  VAL A CG1 1 
ATOM   2675 C CG2 . VAL A 1 345 ? 21.127  13.657 37.297 1.00 18.15 ? 326  VAL A CG2 1 
ATOM   2676 N N   . TYR A 1 346 ? 20.530  11.762 41.547 1.00 19.58 ? 327  TYR A N   1 
ATOM   2677 C CA  . TYR A 1 346 ? 19.992  10.883 42.605 1.00 19.37 ? 327  TYR A CA  1 
ATOM   2678 C C   . TYR A 1 346 ? 18.479  10.701 42.548 1.00 18.22 ? 327  TYR A C   1 
ATOM   2679 O O   . TYR A 1 346 ? 17.754  11.587 42.057 1.00 17.26 ? 327  TYR A O   1 
ATOM   2680 C CB  . TYR A 1 346 ? 20.306  11.450 43.988 1.00 20.07 ? 327  TYR A CB  1 
ATOM   2681 C CG  . TYR A 1 346 ? 21.757  11.695 44.260 1.00 23.94 ? 327  TYR A CG  1 
ATOM   2682 C CD1 . TYR A 1 346 ? 22.582  10.650 44.640 1.00 25.12 ? 327  TYR A CD1 1 
ATOM   2683 C CD2 . TYR A 1 346 ? 22.309  12.983 44.171 1.00 27.27 ? 327  TYR A CD2 1 
ATOM   2684 C CE1 . TYR A 1 346 ? 23.890  10.846 44.932 1.00 25.04 ? 327  TYR A CE1 1 
ATOM   2685 C CE2 . TYR A 1 346 ? 23.671  13.198 44.457 1.00 26.56 ? 327  TYR A CE2 1 
ATOM   2686 C CZ  . TYR A 1 346 ? 24.442  12.103 44.829 1.00 26.13 ? 327  TYR A CZ  1 
ATOM   2687 O OH  . TYR A 1 346 ? 25.765  12.226 45.130 1.00 26.46 ? 327  TYR A OH  1 
ATOM   2688 N N   . SER A 1 347 ? 18.033  9.578  43.131 1.00 16.78 ? 328  SER A N   1 
ATOM   2689 C CA  . SER A 1 347 ? 16.626  9.258  43.293 1.00 17.02 ? 328  SER A CA  1 
ATOM   2690 C C   . SER A 1 347 ? 16.365  8.809  44.719 1.00 16.45 ? 328  SER A C   1 
ATOM   2691 O O   . SER A 1 347 ? 17.150  8.035  45.293 1.00 17.72 ? 328  SER A O   1 
ATOM   2692 C CB  . SER A 1 347 ? 16.224  8.138  42.309 1.00 16.61 ? 328  SER A CB  1 
ATOM   2693 O OG  . SER A 1 347 ? 14.910  7.694  42.569 1.00 19.92 ? 328  SER A OG  1 
ATOM   2694 N N   . GLY A 1 348 ? 15.272  9.294  45.303 1.00 16.98 ? 329  GLY A N   1 
ATOM   2695 C CA  . GLY A 1 348 ? 14.837  8.864  46.630 1.00 16.57 ? 329  GLY A CA  1 
ATOM   2696 C C   . GLY A 1 348 ? 15.638  9.555  47.701 1.00 17.52 ? 329  GLY A C   1 
ATOM   2697 O O   . GLY A 1 348 ? 15.766  10.786 47.693 1.00 17.91 ? 329  GLY A O   1 
ATOM   2698 N N   . GLY A 1 349 ? 16.209  8.792  48.630 1.00 17.68 ? 330  GLY A N   1 
ATOM   2699 C CA  . GLY A 1 349 ? 17.102  9.398  49.652 1.00 18.02 ? 330  GLY A CA  1 
ATOM   2700 C C   . GLY A 1 349 ? 16.265  10.090 50.730 1.00 18.54 ? 330  GLY A C   1 
ATOM   2701 O O   . GLY A 1 349 ? 15.079  9.760  50.909 1.00 18.26 ? 330  GLY A O   1 
ATOM   2702 N N   . SER A 1 350 ? 16.869  11.037 51.446 1.00 18.92 ? 331  SER A N   1 
ATOM   2703 C CA  . SER A 1 350 ? 16.145  11.779 52.481 1.00 18.56 ? 331  SER A CA  1 
ATOM   2704 C C   . SER A 1 350 ? 16.691  13.178 52.588 1.00 18.41 ? 331  SER A C   1 
ATOM   2705 O O   . SER A 1 350 ? 17.671  13.530 51.910 1.00 17.64 ? 331  SER A O   1 
ATOM   2706 C CB  . SER A 1 350 ? 16.209  11.037 53.813 1.00 18.23 ? 331  SER A CB  1 
ATOM   2707 O OG  . SER A 1 350 ? 17.488  11.179 54.410 1.00 20.24 ? 331  SER A OG  1 
ATOM   2708 N N   . SER A 1 351 ? 16.052  14.022 53.392 1.00 18.92 ? 332  SER A N   1 
ATOM   2709 C CA  . SER A 1 351 ? 16.603  15.381 53.593 1.00 19.81 ? 332  SER A CA  1 
ATOM   2710 C C   . SER A 1 351 ? 18.041  15.360 54.176 1.00 20.24 ? 332  SER A C   1 
ATOM   2711 O O   . SER A 1 351 ? 18.869  16.239 53.848 1.00 18.70 ? 332  SER A O   1 
ATOM   2712 C CB  . SER A 1 351 ? 15.646  16.275 54.425 1.00 20.14 ? 332  SER A CB  1 
ATOM   2713 O OG  . SER A 1 351 ? 15.453  15.717 55.722 1.00 20.51 ? 332  SER A OG  1 
ATOM   2714 N N   . ASP A 1 352 ? 18.355  14.345 54.988 1.00 20.78 ? 333  ASP A N   1 
ATOM   2715 C CA  . ASP A 1 352 ? 19.718  14.217 55.511 1.00 24.18 ? 333  ASP A CA  1 
ATOM   2716 C C   . ASP A 1 352 ? 20.788  14.038 54.419 1.00 25.04 ? 333  ASP A C   1 
ATOM   2717 O O   . ASP A 1 352 ? 21.888  14.548 54.562 1.00 25.16 ? 333  ASP A O   1 
ATOM   2718 C CB  . ASP A 1 352 ? 19.824  13.113 56.557 1.00 25.12 ? 333  ASP A CB  1 
ATOM   2719 C CG  . ASP A 1 352 ? 19.148  13.499 57.880 1.00 29.50 ? 333  ASP A CG  1 
ATOM   2720 O OD1 . ASP A 1 352 ? 19.109  14.705 58.220 1.00 32.82 ? 333  ASP A OD1 1 
ATOM   2721 O OD2 . ASP A 1 352 ? 18.646  12.588 58.575 1.00 33.90 ? 333  ASP A OD2 1 
ATOM   2722 N N   . THR A 1 353 ? 20.434  13.348 53.331 1.00 26.21 ? 334  THR A N   1 
ATOM   2723 C CA  . THR A 1 353 ? 21.274  13.205 52.151 1.00 27.33 ? 334  THR A CA  1 
ATOM   2724 C C   . THR A 1 353 ? 21.725  14.552 51.655 1.00 27.67 ? 334  THR A C   1 
ATOM   2725 O O   . THR A 1 353 ? 22.934  14.796 51.441 1.00 27.92 ? 334  THR A O   1 
ATOM   2726 C CB  . THR A 1 353 ? 20.464  12.536 50.985 1.00 27.82 ? 334  THR A CB  1 
ATOM   2727 O OG1 . THR A 1 353 ? 20.316  11.144 51.256 1.00 29.71 ? 334  THR A OG1 1 
ATOM   2728 C CG2 . THR A 1 353 ? 21.152  12.750 49.611 1.00 28.42 ? 334  THR A CG2 1 
ATOM   2729 N N   . ILE A 1 354 ? 20.751  15.426 51.445 1.00 27.20 ? 335  ILE A N   1 
ATOM   2730 C CA  . ILE A 1 354 ? 21.035  16.769 50.989 1.00 27.70 ? 335  ILE A CA  1 
ATOM   2731 C C   . ILE A 1 354 ? 21.988  17.534 51.926 1.00 27.14 ? 335  ILE A C   1 
ATOM   2732 O O   . ILE A 1 354 ? 22.993  18.129 51.491 1.00 25.44 ? 335  ILE A O   1 
ATOM   2733 C CB  . ILE A 1 354 ? 19.702  17.523 50.700 1.00 29.28 ? 335  ILE A CB  1 
ATOM   2734 C CG1 . ILE A 1 354 ? 19.052  16.853 49.464 1.00 28.17 ? 335  ILE A CG1 1 
ATOM   2735 C CG2 . ILE A 1 354 ? 19.966  19.044 50.597 1.00 29.61 ? 335  ILE A CG2 1 
ATOM   2736 C CD1 . ILE A 1 354 ? 17.779  17.428 48.961 1.00 32.72 ? 335  ILE A CD1 1 
ATOM   2737 N N   . CYS A 1 355 ? 21.708  17.469 53.216 1.00 26.63 ? 336  CYS A N   1 
ATOM   2738 C CA  . CYS A 1 355 ? 22.541  18.144 54.196 1.00 28.44 ? 336  CYS A CA  1 
ATOM   2739 C C   . CYS A 1 355 ? 23.953  17.602 54.263 1.00 28.13 ? 336  CYS A C   1 
ATOM   2740 O O   . CYS A 1 355 ? 24.906  18.387 54.331 1.00 28.35 ? 336  CYS A O   1 
ATOM   2741 C CB  . CYS A 1 355 ? 21.906  18.072 55.589 1.00 28.80 ? 336  CYS A CB  1 
ATOM   2742 S SG  . CYS A 1 355 ? 20.408  19.025 55.622 1.00 35.14 ? 336  CYS A SG  1 
ATOM   2743 N N   . ASP A 1 356 ? 24.077  16.278 54.294 1.00 28.23 ? 337  ASP A N   1 
ATOM   2744 C CA  . ASP A 1 356 ? 25.361  15.630 54.307 1.00 29.20 ? 337  ASP A CA  1 
ATOM   2745 C C   . ASP A 1 356 ? 26.166  16.019 53.061 1.00 28.79 ? 337  ASP A C   1 
ATOM   2746 O O   . ASP A 1 356 ? 27.270  16.532 53.181 1.00 28.74 ? 337  ASP A O   1 
ATOM   2747 C CB  . ASP A 1 356 ? 25.206  14.106 54.353 1.00 30.93 ? 337  ASP A CB  1 
ATOM   2748 C CG  . ASP A 1 356 ? 24.706  13.577 55.725 1.00 35.04 ? 337  ASP A CG  1 
ATOM   2749 O OD1 . ASP A 1 356 ? 24.621  14.360 56.716 1.00 38.52 ? 337  ASP A OD1 1 
ATOM   2750 O OD2 . ASP A 1 356 ? 24.396  12.349 55.787 1.00 40.06 ? 337  ASP A OD2 1 
ATOM   2751 N N   . LEU A 1 357 ? 25.603  15.804 51.870 1.00 27.82 ? 338  LEU A N   1 
ATOM   2752 C CA  . LEU A 1 357 ? 26.328  16.056 50.603 1.00 26.56 ? 338  LEU A CA  1 
ATOM   2753 C C   . LEU A 1 357 ? 26.667  17.524 50.350 1.00 25.66 ? 338  LEU A C   1 
ATOM   2754 O O   . LEU A 1 357 ? 27.744  17.846 49.830 1.00 24.33 ? 338  LEU A O   1 
ATOM   2755 C CB  . LEU A 1 357 ? 25.558  15.461 49.430 1.00 26.63 ? 338  LEU A CB  1 
ATOM   2756 C CG  . LEU A 1 357 ? 25.383  13.927 49.494 1.00 27.52 ? 338  LEU A CG  1 
ATOM   2757 C CD1 . LEU A 1 357 ? 24.365  13.429 48.445 1.00 27.69 ? 338  LEU A CD1 1 
ATOM   2758 C CD2 . LEU A 1 357 ? 26.706  13.163 49.378 1.00 25.95 ? 338  LEU A CD2 1 
ATOM   2759 N N   . LEU A 1 358 ? 25.768  18.424 50.730 1.00 24.16 ? 339  LEU A N   1 
ATOM   2760 C CA  . LEU A 1 358 ? 26.083  19.832 50.602 1.00 24.53 ? 339  LEU A CA  1 
ATOM   2761 C C   . LEU A 1 358 ? 26.763  20.483 51.822 1.00 24.46 ? 339  LEU A C   1 
ATOM   2762 O O   . LEU A 1 358 ? 27.107  21.663 51.774 1.00 24.75 ? 339  LEU A O   1 
ATOM   2763 C CB  . LEU A 1 358 ? 24.850  20.618 50.159 1.00 25.54 ? 339  LEU A CB  1 
ATOM   2764 C CG  . LEU A 1 358 ? 24.155  20.140 48.875 1.00 26.13 ? 339  LEU A CG  1 
ATOM   2765 C CD1 . LEU A 1 358 ? 22.970  21.009 48.669 1.00 27.36 ? 339  LEU A CD1 1 
ATOM   2766 C CD2 . LEU A 1 358 ? 25.093  20.211 47.645 1.00 24.65 ? 339  LEU A CD2 1 
ATOM   2767 N N   . GLY A 1 359 ? 26.976  19.726 52.899 1.00 24.62 ? 340  GLY A N   1 
ATOM   2768 C CA  . GLY A 1 359 ? 27.621  20.261 54.112 1.00 24.41 ? 340  GLY A CA  1 
ATOM   2769 C C   . GLY A 1 359 ? 26.825  21.405 54.712 1.00 25.04 ? 340  GLY A C   1 
ATOM   2770 O O   . GLY A 1 359 ? 27.386  22.431 55.088 1.00 24.90 ? 340  GLY A O   1 
ATOM   2771 N N   . ALA A 1 360 ? 25.503  21.245 54.759 1.00 25.80 ? 341  ALA A N   1 
ATOM   2772 C CA  . ALA A 1 360 ? 24.595  22.303 55.250 1.00 26.97 ? 341  ALA A CA  1 
ATOM   2773 C C   . ALA A 1 360 ? 23.902  21.892 56.558 1.00 27.19 ? 341  ALA A C   1 
ATOM   2774 O O   . ALA A 1 360 ? 23.656  20.710 56.789 1.00 27.68 ? 341  ALA A O   1 
ATOM   2775 C CB  . ALA A 1 360 ? 23.561  22.615 54.229 1.00 26.47 ? 341  ALA A CB  1 
ATOM   2776 N N   . LYS A 1 361 ? 23.655  22.875 57.416 1.00 27.45 ? 342  LYS A N   1 
ATOM   2777 C CA  . LYS A 1 361 ? 22.756  22.754 58.565 1.00 27.98 ? 342  LYS A CA  1 
ATOM   2778 C C   . LYS A 1 361 ? 21.413  23.264 58.034 1.00 26.62 ? 342  LYS A C   1 
ATOM   2779 O O   . LYS A 1 361 ? 21.390  24.114 57.115 1.00 27.39 ? 342  LYS A O   1 
ATOM   2780 C CB  . LYS A 1 361 ? 23.230  23.678 59.696 1.00 28.00 ? 342  LYS A CB  1 
ATOM   2781 C CG  . LYS A 1 361 ? 24.284  23.102 60.612 1.00 32.71 ? 342  LYS A CG  1 
ATOM   2782 C CD  . LYS A 1 361 ? 25.388  22.394 59.849 1.00 37.50 ? 342  LYS A CD  1 
ATOM   2783 C CE  . LYS A 1 361 ? 25.901  21.152 60.571 1.00 38.42 ? 342  LYS A CE  1 
ATOM   2784 N NZ  . LYS A 1 361 ? 26.843  20.406 59.670 1.00 39.95 ? 342  LYS A NZ  1 
ATOM   2785 N N   . GLY A 1 362 ? 20.321  22.799 58.638 1.00 25.40 ? 343  GLY A N   1 
ATOM   2786 C CA  . GLY A 1 362 ? 18.966  23.204 58.284 1.00 22.56 ? 343  GLY A CA  1 
ATOM   2787 C C   . GLY A 1 362 ? 18.771  24.691 58.136 1.00 22.22 ? 343  GLY A C   1 
ATOM   2788 O O   . GLY A 1 362 ? 18.155  25.157 57.163 1.00 21.06 ? 343  GLY A O   1 
ATOM   2789 N N   . LYS A 1 363 ? 19.285  25.465 59.084 1.00 21.31 ? 344  LYS A N   1 
ATOM   2790 C CA  . LYS A 1 363 ? 19.065  26.907 59.036 1.00 21.10 ? 344  LYS A CA  1 
ATOM   2791 C C   . LYS A 1 363 ? 19.857  27.654 57.940 1.00 20.77 ? 344  LYS A C   1 
ATOM   2792 O O   . LYS A 1 363 ? 19.635  28.849 57.725 1.00 21.60 ? 344  LYS A O   1 
ATOM   2793 C CB  . LYS A 1 363 ? 19.345  27.524 60.411 1.00 22.23 ? 344  LYS A CB  1 
ATOM   2794 C CG  . LYS A 1 363 ? 18.137  27.487 61.319 1.00 23.86 ? 344  LYS A CG  1 
ATOM   2795 C CD  . LYS A 1 363 ? 18.566  27.666 62.778 1.00 24.43 ? 344  LYS A CD  1 
ATOM   2796 C CE  . LYS A 1 363 ? 17.551  27.001 63.685 1.00 25.80 ? 344  LYS A CE  1 
ATOM   2797 N NZ  . LYS A 1 363 ? 18.001  26.986 65.103 1.00 23.83 ? 344  LYS A NZ  1 
ATOM   2798 N N   . ASP A 1 364 ? 20.768  26.953 57.271 1.00 20.54 ? 345  ASP A N   1 
ATOM   2799 C CA  . ASP A 1 364 ? 21.561  27.486 56.168 1.00 21.06 ? 345  ASP A CA  1 
ATOM   2800 C C   . ASP A 1 364 ? 20.777  27.287 54.880 1.00 19.64 ? 345  ASP A C   1 
ATOM   2801 O O   . ASP A 1 364 ? 21.239  27.709 53.828 1.00 20.18 ? 345  ASP A O   1 
ATOM   2802 C CB  . ASP A 1 364 ? 22.796  26.599 55.918 1.00 21.80 ? 345  ASP A CB  1 
ATOM   2803 C CG  . ASP A 1 364 ? 23.781  26.595 57.029 1.00 25.79 ? 345  ASP A CG  1 
ATOM   2804 O OD1 . ASP A 1 364 ? 23.926  27.627 57.761 1.00 29.65 ? 345  ASP A OD1 1 
ATOM   2805 O OD2 . ASP A 1 364 ? 24.443  25.520 57.145 1.00 28.75 ? 345  ASP A OD2 1 
ATOM   2806 N N   . ILE A 1 365 ? 19.680  26.541 54.942 1.00 18.48 ? 346  ILE A N   1 
ATOM   2807 C CA  . ILE A 1 365 ? 18.880  26.192 53.745 1.00 17.31 ? 346  ILE A CA  1 
ATOM   2808 C C   . ILE A 1 365 ? 17.591  27.006 53.608 1.00 17.97 ? 346  ILE A C   1 
ATOM   2809 O O   . ILE A 1 365 ? 16.781  27.035 54.552 1.00 17.40 ? 346  ILE A O   1 
ATOM   2810 C CB  . ILE A 1 365 ? 18.472  24.690 53.761 1.00 17.42 ? 346  ILE A CB  1 
ATOM   2811 C CG1 . ILE A 1 365 ? 19.719  23.796 53.774 1.00 17.14 ? 346  ILE A CG1 1 
ATOM   2812 C CG2 . ILE A 1 365 ? 17.558  24.361 52.558 1.00 13.43 ? 346  ILE A CG2 1 
ATOM   2813 C CD1 . ILE A 1 365 ? 19.442  22.312 54.082 1.00 17.09 ? 346  ILE A CD1 1 
ATOM   2814 N N   . LEU A 1 366 ? 17.422  27.666 52.462 1.00 16.71 ? 347  LEU A N   1 
ATOM   2815 C CA  . LEU A 1 366 ? 16.148  28.220 52.083 1.00 17.12 ? 347  LEU A CA  1 
ATOM   2816 C C   . LEU A 1 366 ? 15.484  27.267 51.086 1.00 17.98 ? 347  LEU A C   1 
ATOM   2817 O O   . LEU A 1 366 ? 15.920  27.152 49.951 1.00 17.35 ? 347  LEU A O   1 
ATOM   2818 C CB  . LEU A 1 366 ? 16.281  29.637 51.469 1.00 17.02 ? 347  LEU A CB  1 
ATOM   2819 C CG  . LEU A 1 366 ? 14.948  30.256 51.015 1.00 18.80 ? 347  LEU A CG  1 
ATOM   2820 C CD1 . LEU A 1 366 ? 13.977  30.400 52.246 1.00 18.00 ? 347  LEU A CD1 1 
ATOM   2821 C CD2 . LEU A 1 366 ? 15.179  31.628 50.339 1.00 17.92 ? 347  LEU A CD2 1 
ATOM   2822 N N   . TYR A 1 367 ? 14.426  26.592 51.539 1.00 18.81 ? 348  TYR A N   1 
ATOM   2823 C CA  . TYR A 1 367 ? 13.697  25.673 50.692 1.00 19.86 ? 348  TYR A CA  1 
ATOM   2824 C C   . TYR A 1 367 ? 12.465  26.349 50.070 1.00 18.72 ? 348  TYR A C   1 
ATOM   2825 O O   . TYR A 1 367 ? 11.607  26.912 50.789 1.00 17.05 ? 348  TYR A O   1 
ATOM   2826 C CB  . TYR A 1 367 ? 13.340  24.381 51.455 1.00 21.04 ? 348  TYR A CB  1 
ATOM   2827 C CG  . TYR A 1 367 ? 12.768  23.329 50.557 1.00 25.20 ? 348  TYR A CG  1 
ATOM   2828 C CD1 . TYR A 1 367 ? 13.535  22.798 49.526 1.00 27.87 ? 348  TYR A CD1 1 
ATOM   2829 C CD2 . TYR A 1 367 ? 11.458  22.877 50.702 1.00 28.65 ? 348  TYR A CD2 1 
ATOM   2830 C CE1 . TYR A 1 367 ? 13.038  21.863 48.668 1.00 29.18 ? 348  TYR A CE1 1 
ATOM   2831 C CE2 . TYR A 1 367 ? 10.928  21.914 49.817 1.00 33.41 ? 348  TYR A CE2 1 
ATOM   2832 C CZ  . TYR A 1 367 ? 11.740  21.416 48.807 1.00 32.89 ? 348  TYR A CZ  1 
ATOM   2833 O OH  . TYR A 1 367 ? 11.297  20.474 47.880 1.00 36.35 ? 348  TYR A OH  1 
ATOM   2834 N N   . ILE A 1 368 ? 12.376  26.241 48.738 1.00 17.92 ? 349  ILE A N   1 
ATOM   2835 C CA  . ILE A 1 368 ? 11.381  26.965 47.938 1.00 17.88 ? 349  ILE A CA  1 
ATOM   2836 C C   . ILE A 1 368 ? 10.386  25.973 47.324 1.00 19.13 ? 349  ILE A C   1 
ATOM   2837 O O   . ILE A 1 368 ? 10.791  25.120 46.522 1.00 20.43 ? 349  ILE A O   1 
ATOM   2838 C CB  . ILE A 1 368 ? 12.082  27.818 46.834 1.00 17.68 ? 349  ILE A CB  1 
ATOM   2839 C CG1 . ILE A 1 368 ? 13.124  28.723 47.501 1.00 16.64 ? 349  ILE A CG1 1 
ATOM   2840 C CG2 . ILE A 1 368 ? 11.027  28.574 45.951 1.00 12.53 ? 349  ILE A CG2 1 
ATOM   2841 C CD1 . ILE A 1 368 ? 14.033  29.506 46.564 1.00 17.51 ? 349  ILE A CD1 1 
ATOM   2842 N N   . GLY A 1 369 ? 9.102   26.095 47.688 1.00 18.94 ? 350  GLY A N   1 
ATOM   2843 C CA  . GLY A 1 369 ? 8.051   25.163 47.229 1.00 18.43 ? 350  GLY A CA  1 
ATOM   2844 C C   . GLY A 1 369 ? 6.647   25.745 47.233 1.00 17.94 ? 350  GLY A C   1 
ATOM   2845 O O   . GLY A 1 369 ? 6.435   26.876 47.641 1.00 16.46 ? 350  GLY A O   1 
ATOM   2846 N N   . ASP A 1 370 ? 5.682   24.971 46.755 1.00 18.77 ? 351  ASP A N   1 
ATOM   2847 C CA  . ASP A 1 370 ? 4.300   25.416 46.660 1.00 19.71 ? 351  ASP A CA  1 
ATOM   2848 C C   . ASP A 1 370 ? 3.381   24.594 47.586 1.00 19.62 ? 351  ASP A C   1 
ATOM   2849 O O   . ASP A 1 370 ? 2.182   24.858 47.625 1.00 20.23 ? 351  ASP A O   1 
ATOM   2850 C CB  . ASP A 1 370 ? 3.770   25.241 45.218 1.00 19.64 ? 351  ASP A CB  1 
ATOM   2851 C CG  . ASP A 1 370 ? 3.716   23.755 44.812 1.00 21.23 ? 351  ASP A CG  1 
ATOM   2852 O OD1 . ASP A 1 370 ? 4.740   23.038 44.965 1.00 24.15 ? 351  ASP A OD1 1 
ATOM   2853 O OD2 . ASP A 1 370 ? 2.644   23.274 44.388 1.00 28.11 ? 351  ASP A OD2 1 
ATOM   2854 N N   . HIS A 1 371 ? 3.902   23.569 48.261 1.00 20.83 ? 352  HIS A N   1 
ATOM   2855 C CA  . HIS A 1 371 ? 3.025   22.668 49.041 1.00 22.66 ? 352  HIS A CA  1 
ATOM   2856 C C   . HIS A 1 371 ? 3.110   22.993 50.519 1.00 23.58 ? 352  HIS A C   1 
ATOM   2857 O O   . HIS A 1 371 ? 4.042   22.574 51.182 1.00 24.68 ? 352  HIS A O   1 
ATOM   2858 C CB  . HIS A 1 371 ? 3.302   21.157 48.841 1.00 22.33 ? 352  HIS A CB  1 
ATOM   2859 C CG  . HIS A 1 371 ? 2.234   20.289 49.449 1.00 25.29 ? 352  HIS A CG  1 
ATOM   2860 N ND1 . HIS A 1 371 ? 2.083   18.950 49.150 1.00 27.78 ? 352  HIS A ND1 1 
ATOM   2861 C CD2 . HIS A 1 371 ? 1.211   20.599 50.290 1.00 24.38 ? 352  HIS A CD2 1 
ATOM   2862 C CE1 . HIS A 1 371 ? 1.026   18.469 49.788 1.00 25.88 ? 352  HIS A CE1 1 
ATOM   2863 N NE2 . HIS A 1 371 ? 0.476   19.453 50.483 1.00 27.39 ? 352  HIS A NE2 1 
ATOM   2864 N N   . ILE A 1 372 ? 2.103   23.660 51.043 1.00 24.41 ? 353  ILE A N   1 
ATOM   2865 C CA  . ILE A 1 372 ? 2.181   24.213 52.363 1.00 27.24 ? 353  ILE A CA  1 
ATOM   2866 C C   . ILE A 1 372 ? 2.290   23.133 53.466 1.00 28.93 ? 353  ILE A C   1 
ATOM   2867 O O   . ILE A 1 372 ? 2.518   23.475 54.628 1.00 29.65 ? 353  ILE A O   1 
ATOM   2868 C CB  . ILE A 1 372 ? 0.973   25.164 52.606 1.00 27.34 ? 353  ILE A CB  1 
ATOM   2869 C CG1 . ILE A 1 372 ? 1.162   26.042 53.849 1.00 27.46 ? 353  ILE A CG1 1 
ATOM   2870 C CG2 . ILE A 1 372 ? -0.339  24.329 52.721 1.00 28.79 ? 353  ILE A CG2 1 
ATOM   2871 C CD1 . ILE A 1 372 ? 2.591   26.512 54.159 1.00 26.14 ? 353  ILE A CD1 1 
ATOM   2872 N N   . PHE A 1 373 ? 2.082   21.861 53.101 1.00 29.75 ? 354  PHE A N   1 
ATOM   2873 C CA  . PHE A 1 373 ? 2.310   20.720 53.975 1.00 30.92 ? 354  PHE A CA  1 
ATOM   2874 C C   . PHE A 1 373 ? 3.610   19.947 53.648 1.00 32.05 ? 354  PHE A C   1 
ATOM   2875 O O   . PHE A 1 373 ? 4.630   20.000 54.402 1.00 31.60 ? 354  PHE A O   1 
ATOM   2876 C CB  . PHE A 1 373 ? 1.111   19.792 53.931 1.00 31.31 ? 354  PHE A CB  1 
ATOM   2877 C CG  . PHE A 1 373 ? 1.232   18.603 54.824 1.00 32.59 ? 354  PHE A CG  1 
ATOM   2878 C CD1 . PHE A 1 373 ? 0.937   18.703 56.186 1.00 35.84 ? 354  PHE A CD1 1 
ATOM   2879 C CD2 . PHE A 1 373 ? 1.596   17.347 54.300 1.00 36.16 ? 354  PHE A CD2 1 
ATOM   2880 C CE1 . PHE A 1 373 ? 1.029   17.578 57.031 1.00 34.46 ? 354  PHE A CE1 1 
ATOM   2881 C CE2 . PHE A 1 373 ? 1.720   16.225 55.124 1.00 35.23 ? 354  PHE A CE2 1 
ATOM   2882 C CZ  . PHE A 1 373 ? 1.439   16.342 56.497 1.00 36.05 ? 354  PHE A CZ  1 
ATOM   2883 N N   . GLY A 1 374 ? 3.601   19.246 52.516 1.00 32.22 ? 355  GLY A N   1 
ATOM   2884 C CA  . GLY A 1 374 ? 4.707   18.372 52.167 1.00 32.85 ? 355  GLY A CA  1 
ATOM   2885 C C   . GLY A 1 374 ? 6.054   19.038 52.020 1.00 33.50 ? 355  GLY A C   1 
ATOM   2886 O O   . GLY A 1 374 ? 7.086   18.463 52.352 1.00 35.49 ? 355  GLY A O   1 
ATOM   2887 N N   . ASP A 1 375 ? 6.072   20.229 51.467 1.00 33.12 ? 356  ASP A N   1 
ATOM   2888 C CA  . ASP A 1 375 ? 7.329   20.899 51.249 1.00 32.52 ? 356  ASP A CA  1 
ATOM   2889 C C   . ASP A 1 375 ? 7.630   21.621 52.569 1.00 30.95 ? 356  ASP A C   1 
ATOM   2890 O O   . ASP A 1 375 ? 8.450   21.145 53.358 1.00 31.73 ? 356  ASP A O   1 
ATOM   2891 C CB  . ASP A 1 375 ? 7.240   21.899 50.082 1.00 32.32 ? 356  ASP A CB  1 
ATOM   2892 C CG  . ASP A 1 375 ? 7.325   21.227 48.715 1.00 34.10 ? 356  ASP A CG  1 
ATOM   2893 O OD1 . ASP A 1 375 ? 7.783   20.058 48.657 1.00 35.72 ? 356  ASP A OD1 1 
ATOM   2894 O OD2 . ASP A 1 375 ? 6.917   21.872 47.711 1.00 32.63 ? 356  ASP A OD2 1 
ATOM   2895 N N   . ILE A 1 376 ? 6.836   22.656 52.815 1.00 27.71 ? 357  ILE A N   1 
ATOM   2896 C CA  . ILE A 1 376 ? 7.071   23.729 53.728 1.00 26.71 ? 357  ILE A CA  1 
ATOM   2897 C C   . ILE A 1 376 ? 6.848   23.364 55.202 1.00 25.58 ? 357  ILE A C   1 
ATOM   2898 O O   . ILE A 1 376 ? 7.758   23.523 55.973 1.00 23.16 ? 357  ILE A O   1 
ATOM   2899 C CB  . ILE A 1 376 ? 6.204   24.944 53.324 1.00 26.75 ? 357  ILE A CB  1 
ATOM   2900 C CG1 . ILE A 1 376 ? 6.502   25.397 51.879 1.00 29.52 ? 357  ILE A CG1 1 
ATOM   2901 C CG2 . ILE A 1 376 ? 6.308   26.085 54.347 1.00 28.08 ? 357  ILE A CG2 1 
ATOM   2902 C CD1 . ILE A 1 376 ? 7.947   25.630 51.540 1.00 26.85 ? 357  ILE A CD1 1 
ATOM   2903 N N   . LEU A 1 377 ? 5.643   22.891 55.583 1.00 26.09 ? 358  LEU A N   1 
ATOM   2904 C CA  . LEU A 1 377 ? 5.381   22.440 56.939 1.00 24.61 ? 358  LEU A CA  1 
ATOM   2905 C C   . LEU A 1 377 ? 6.424   21.407 57.409 1.00 24.36 ? 358  LEU A C   1 
ATOM   2906 O O   . LEU A 1 377 ? 7.067   21.576 58.439 1.00 23.28 ? 358  LEU A O   1 
ATOM   2907 C CB  . LEU A 1 377 ? 3.971   21.874 57.049 1.00 25.33 ? 358  LEU A CB  1 
ATOM   2908 C CG  . LEU A 1 377 ? 3.406   21.620 58.453 1.00 26.08 ? 358  LEU A CG  1 
ATOM   2909 C CD1 . LEU A 1 377 ? 1.894   21.889 58.451 1.00 32.48 ? 358  LEU A CD1 1 
ATOM   2910 C CD2 . LEU A 1 377 ? 3.645   20.208 58.838 1.00 29.14 ? 358  LEU A CD2 1 
ATOM   2911 N N   . LYS A 1 378 ? 6.624   20.363 56.629 1.00 23.96 ? 359  LYS A N   1 
ATOM   2912 C CA  . LYS A 1 378 ? 7.500   19.274 57.059 1.00 24.79 ? 359  LYS A CA  1 
ATOM   2913 C C   . LYS A 1 378 ? 9.005   19.584 57.091 1.00 24.14 ? 359  LYS A C   1 
ATOM   2914 O O   . LYS A 1 378 ? 9.700   19.108 57.979 1.00 23.66 ? 359  LYS A O   1 
ATOM   2915 C CB  . LYS A 1 378 ? 7.203   17.979 56.283 1.00 25.08 ? 359  LYS A CB  1 
ATOM   2916 C CG  . LYS A 1 378 ? 5.839   17.420 56.525 1.00 28.24 ? 359  LYS A CG  1 
ATOM   2917 C CD  . LYS A 1 378 ? 5.727   16.711 57.828 1.00 29.27 ? 359  LYS A CD  1 
ATOM   2918 C CE  . LYS A 1 378 ? 4.361   16.096 57.938 1.00 32.69 ? 359  LYS A CE  1 
ATOM   2919 N NZ  . LYS A 1 378 ? 4.215   15.343 59.225 1.00 35.34 ? 359  LYS A NZ  1 
ATOM   2920 N N   . SER A 1 379 ? 9.520   20.392 56.163 1.00 23.46 ? 360  SER A N   1 
ATOM   2921 C CA  . SER A 1 379 ? 10.938  20.772 56.256 1.00 24.01 ? 360  SER A CA  1 
ATOM   2922 C C   . SER A 1 379 ? 11.200  21.741 57.457 1.00 24.48 ? 360  SER A C   1 
ATOM   2923 O O   . SER A 1 379 ? 12.299  21.774 58.041 1.00 24.45 ? 360  SER A O   1 
ATOM   2924 C CB  . SER A 1 379 ? 11.421  21.424 54.956 1.00 24.45 ? 360  SER A CB  1 
ATOM   2925 O OG  . SER A 1 379 ? 10.703  22.624 54.718 1.00 25.64 ? 360  SER A OG  1 
ATOM   2926 N N   . LYS A 1 380 ? 10.209  22.558 57.777 1.00 24.18 ? 361  LYS A N   1 
ATOM   2927 C CA  . LYS A 1 380 ? 10.297  23.469 58.908 1.00 25.01 ? 361  LYS A CA  1 
ATOM   2928 C C   . LYS A 1 380 ? 10.210  22.664 60.209 1.00 23.36 ? 361  LYS A C   1 
ATOM   2929 O O   . LYS A 1 380 ? 11.146  22.722 60.997 1.00 22.71 ? 361  LYS A O   1 
ATOM   2930 C CB  . LYS A 1 380 ? 9.199   24.540 58.844 1.00 25.48 ? 361  LYS A CB  1 
ATOM   2931 C CG  . LYS A 1 380 ? 9.090   25.417 60.071 1.00 27.89 ? 361  LYS A CG  1 
ATOM   2932 C CD  . LYS A 1 380 ? 10.321  26.308 60.257 1.00 30.95 ? 361  LYS A CD  1 
ATOM   2933 C CE  . LYS A 1 380 ? 10.485  27.420 59.201 1.00 32.29 ? 361  LYS A CE  1 
ATOM   2934 N NZ  . LYS A 1 380 ? 11.709  28.267 59.618 1.00 32.36 ? 361  LYS A NZ  1 
ATOM   2935 N N   . LYS A 1 381 ? 9.146   21.880 60.406 1.00 22.71 ? 362  LYS A N   1 
ATOM   2936 C CA  . LYS A 1 381 ? 8.990   21.165 61.654 1.00 22.96 ? 362  LYS A CA  1 
ATOM   2937 C C   . LYS A 1 381 ? 9.988   20.032 61.891 1.00 21.90 ? 362  LYS A C   1 
ATOM   2938 O O   . LYS A 1 381 ? 10.248  19.679 63.035 1.00 20.32 ? 362  LYS A O   1 
ATOM   2939 C CB  . LYS A 1 381 ? 7.567   20.619 61.887 1.00 23.76 ? 362  LYS A CB  1 
ATOM   2940 C CG  . LYS A 1 381 ? 6.425   21.639 61.763 1.00 26.46 ? 362  LYS A CG  1 
ATOM   2941 C CD  . LYS A 1 381 ? 5.078   20.941 62.035 1.00 24.63 ? 362  LYS A CD  1 
ATOM   2942 C CE  . LYS A 1 381 ? 4.914   20.619 63.507 1.00 28.87 ? 362  LYS A CE  1 
ATOM   2943 N NZ  . LYS A 1 381 ? 3.515   20.150 63.717 1.00 34.21 ? 362  LYS A NZ  1 
ATOM   2944 N N   . ARG A 1 382 ? 10.485  19.408 60.834 1.00 20.97 ? 363  ARG A N   1 
ATOM   2945 C CA  . ARG A 1 382 ? 11.248  18.153 61.028 1.00 21.50 ? 363  ARG A CA  1 
ATOM   2946 C C   . ARG A 1 382 ? 12.742  18.421 60.981 1.00 20.20 ? 363  ARG A C   1 
ATOM   2947 O O   . ARG A 1 382 ? 13.535  17.690 61.563 1.00 18.68 ? 363  ARG A O   1 
ATOM   2948 C CB  . ARG A 1 382 ? 10.844  17.079 59.987 1.00 22.48 ? 363  ARG A CB  1 
ATOM   2949 C CG  . ARG A 1 382 ? 9.393   16.518 60.062 1.00 23.52 ? 363  ARG A CG  1 
ATOM   2950 C CD  . ARG A 1 382 ? 9.301   15.335 61.015 1.00 32.90 ? 363  ARG A CD  1 
ATOM   2951 N NE  . ARG A 1 382 ? 10.463  14.462 60.867 1.00 39.32 ? 363  ARG A NE  1 
ATOM   2952 C CZ  . ARG A 1 382 ? 10.748  13.398 61.621 1.00 43.50 ? 363  ARG A CZ  1 
ATOM   2953 N NH1 . ARG A 1 382 ? 9.950   13.024 62.617 1.00 44.75 ? 363  ARG A NH1 1 
ATOM   2954 N NH2 . ARG A 1 382 ? 11.857  12.700 61.374 1.00 45.76 ? 363  ARG A NH2 1 
ATOM   2955 N N   . GLN A 1 383 ? 13.114  19.501 60.292 1.00 20.94 ? 364  GLN A N   1 
ATOM   2956 C CA  . GLN A 1 383 ? 14.504  19.769 59.988 1.00 21.17 ? 364  GLN A CA  1 
ATOM   2957 C C   . GLN A 1 383 ? 14.939  21.206 60.297 1.00 21.29 ? 364  GLN A C   1 
ATOM   2958 O O   . GLN A 1 383 ? 16.128  21.512 60.266 1.00 22.91 ? 364  GLN A O   1 
ATOM   2959 C CB  . GLN A 1 383 ? 14.815  19.382 58.522 1.00 21.60 ? 364  GLN A CB  1 
ATOM   2960 C CG  . GLN A 1 383 ? 14.562  17.880 58.147 1.00 21.66 ? 364  GLN A CG  1 
ATOM   2961 C CD  . GLN A 1 383 ? 15.313  16.881 59.043 1.00 28.07 ? 364  GLN A CD  1 
ATOM   2962 O OE1 . GLN A 1 383 ? 16.319  17.234 59.667 1.00 30.17 ? 364  GLN A OE1 1 
ATOM   2963 N NE2 . GLN A 1 383 ? 14.814  15.636 59.131 1.00 25.79 ? 364  GLN A NE2 1 
ATOM   2964 N N   . GLY A 1 384 ? 14.009  22.087 60.611 1.00 20.55 ? 365  GLY A N   1 
ATOM   2965 C CA  . GLY A 1 384 ? 14.398  23.459 60.893 1.00 21.70 ? 365  GLY A CA  1 
ATOM   2966 C C   . GLY A 1 384 ? 14.904  24.209 59.652 1.00 23.37 ? 365  GLY A C   1 
ATOM   2967 O O   . GLY A 1 384 ? 15.731  25.149 59.780 1.00 24.14 ? 365  GLY A O   1 
ATOM   2968 N N   . TRP A 1 385 ? 14.469  23.784 58.459 1.00 22.47 ? 366  TRP A N   1 
ATOM   2969 C CA  . TRP A 1 385 ? 14.845  24.501 57.205 1.00 23.16 ? 366  TRP A CA  1 
ATOM   2970 C C   . TRP A 1 385 ? 14.134  25.882 57.170 1.00 23.15 ? 366  TRP A C   1 
ATOM   2971 O O   . TRP A 1 385 ? 13.055  26.040 57.758 1.00 23.91 ? 366  TRP A O   1 
ATOM   2972 C CB  . TRP A 1 385 ? 14.463  23.686 55.992 1.00 22.72 ? 366  TRP A CB  1 
ATOM   2973 C CG  . TRP A 1 385 ? 15.321  22.462 55.774 1.00 22.62 ? 366  TRP A CG  1 
ATOM   2974 C CD1 . TRP A 1 385 ? 16.205  21.908 56.652 1.00 21.53 ? 366  TRP A CD1 1 
ATOM   2975 C CD2 . TRP A 1 385 ? 15.393  21.679 54.579 1.00 23.30 ? 366  TRP A CD2 1 
ATOM   2976 N NE1 . TRP A 1 385 ? 16.833  20.836 56.078 1.00 23.49 ? 366  TRP A NE1 1 
ATOM   2977 C CE2 . TRP A 1 385 ? 16.336  20.650 54.812 1.00 22.56 ? 366  TRP A CE2 1 
ATOM   2978 C CE3 . TRP A 1 385 ? 14.758  21.757 53.311 1.00 21.46 ? 366  TRP A CE3 1 
ATOM   2979 C CZ2 . TRP A 1 385 ? 16.684  19.705 53.827 1.00 22.28 ? 366  TRP A CZ2 1 
ATOM   2980 C CZ3 . TRP A 1 385 ? 15.082  20.816 52.346 1.00 22.06 ? 366  TRP A CZ3 1 
ATOM   2981 C CH2 . TRP A 1 385 ? 16.041  19.793 52.606 1.00 22.64 ? 366  TRP A CH2 1 
ATOM   2982 N N   . ARG A 1 386 ? 14.739  26.872 56.534 1.00 21.81 ? 367  ARG A N   1 
ATOM   2983 C CA  . ARG A 1 386 ? 14.018  28.110 56.244 1.00 23.14 ? 367  ARG A CA  1 
ATOM   2984 C C   . ARG A 1 386 ? 13.172  27.894 55.002 1.00 23.71 ? 367  ARG A C   1 
ATOM   2985 O O   . ARG A 1 386 ? 13.519  27.095 54.132 1.00 23.65 ? 367  ARG A O   1 
ATOM   2986 C CB  . ARG A 1 386 ? 14.988  29.294 56.084 1.00 22.69 ? 367  ARG A CB  1 
ATOM   2987 C CG  . ARG A 1 386 ? 15.984  29.461 57.228 1.00 22.87 ? 367  ARG A CG  1 
ATOM   2988 C CD  . ARG A 1 386 ? 15.273  29.567 58.628 1.00 24.26 ? 367  ARG A CD  1 
ATOM   2989 N NE  . ARG A 1 386 ? 14.331  30.689 58.786 1.00 22.50 ? 367  ARG A NE  1 
ATOM   2990 C CZ  . ARG A 1 386 ? 14.687  31.896 59.188 1.00 22.27 ? 367  ARG A CZ  1 
ATOM   2991 N NH1 . ARG A 1 386 ? 15.977  32.178 59.423 1.00 25.34 ? 367  ARG A NH1 1 
ATOM   2992 N NH2 . ARG A 1 386 ? 13.779  32.835 59.334 1.00 23.72 ? 367  ARG A NH2 1 
ATOM   2993 N N   . THR A 1 387 ? 12.021  28.561 54.937 1.00 24.39 ? 368  THR A N   1 
ATOM   2994 C CA  . THR A 1 387 ? 11.010  28.186 53.958 1.00 23.74 ? 368  THR A CA  1 
ATOM   2995 C C   . THR A 1 387 ? 10.564  29.444 53.177 1.00 23.56 ? 368  THR A C   1 
ATOM   2996 O O   . THR A 1 387 ? 10.490  30.560 53.725 1.00 22.43 ? 368  THR A O   1 
ATOM   2997 C CB  . THR A 1 387 ? 9.780   27.542 54.633 1.00 24.06 ? 368  THR A CB  1 
ATOM   2998 O OG1 . THR A 1 387 ? 9.360   28.403 55.700 1.00 24.62 ? 368  THR A OG1 1 
ATOM   2999 C CG2 . THR A 1 387 ? 10.086  26.135 55.196 1.00 21.41 ? 368  THR A CG2 1 
ATOM   3000 N N   . PHE A 1 388 ? 10.328  29.238 51.885 1.00 22.96 ? 369  PHE A N   1 
ATOM   3001 C CA  . PHE A 1 388 ? 9.779   30.269 50.983 1.00 22.52 ? 369  PHE A CA  1 
ATOM   3002 C C   . PHE A 1 388 ? 8.595   29.585 50.287 1.00 22.60 ? 369  PHE A C   1 
ATOM   3003 O O   . PHE A 1 388 ? 8.788   28.672 49.509 1.00 22.59 ? 369  PHE A O   1 
ATOM   3004 C CB  . PHE A 1 388 ? 10.841  30.757 49.950 1.00 21.46 ? 369  PHE A CB  1 
ATOM   3005 C CG  . PHE A 1 388 ? 10.336  31.867 49.016 1.00 22.20 ? 369  PHE A CG  1 
ATOM   3006 C CD1 . PHE A 1 388 ? 10.904  33.106 49.046 1.00 21.31 ? 369  PHE A CD1 1 
ATOM   3007 C CD2 . PHE A 1 388 ? 9.288   31.638 48.098 1.00 24.22 ? 369  PHE A CD2 1 
ATOM   3008 C CE1 . PHE A 1 388 ? 10.450  34.142 48.171 1.00 22.14 ? 369  PHE A CE1 1 
ATOM   3009 C CE2 . PHE A 1 388 ? 8.833   32.668 47.218 1.00 23.53 ? 369  PHE A CE2 1 
ATOM   3010 C CZ  . PHE A 1 388 ? 9.436   33.916 47.266 1.00 22.29 ? 369  PHE A CZ  1 
ATOM   3011 N N   . LEU A 1 389 ? 7.362   30.000 50.597 1.00 21.32 ? 370  LEU A N   1 
ATOM   3012 C CA  . LEU A 1 389 ? 6.219   29.441 49.898 1.00 21.53 ? 370  LEU A CA  1 
ATOM   3013 C C   . LEU A 1 389 ? 5.825   30.271 48.648 1.00 22.23 ? 370  LEU A C   1 
ATOM   3014 O O   . LEU A 1 389 ? 5.625   31.496 48.722 1.00 22.01 ? 370  LEU A O   1 
ATOM   3015 C CB  . LEU A 1 389 ? 5.013   29.338 50.849 1.00 21.32 ? 370  LEU A CB  1 
ATOM   3016 C CG  . LEU A 1 389 ? 3.749   28.758 50.268 1.00 22.63 ? 370  LEU A CG  1 
ATOM   3017 C CD1 . LEU A 1 389 ? 3.893   27.245 49.990 1.00 24.79 ? 370  LEU A CD1 1 
ATOM   3018 C CD2 . LEU A 1 389 ? 2.607   29.055 51.265 1.00 23.58 ? 370  LEU A CD2 1 
ATOM   3019 N N   . VAL A 1 390 ? 5.654   29.565 47.530 1.00 21.87 ? 371  VAL A N   1 
ATOM   3020 C CA  . VAL A 1 390 ? 5.244   30.161 46.280 1.00 23.00 ? 371  VAL A CA  1 
ATOM   3021 C C   . VAL A 1 390 ? 3.765   29.961 46.290 1.00 22.51 ? 371  VAL A C   1 
ATOM   3022 O O   . VAL A 1 390 ? 3.271   28.853 46.511 1.00 21.96 ? 371  VAL A O   1 
ATOM   3023 C CB  . VAL A 1 390 ? 5.905   29.430 45.054 1.00 23.78 ? 371  VAL A CB  1 
ATOM   3024 C CG1 . VAL A 1 390 ? 5.179   29.776 43.786 1.00 24.63 ? 371  VAL A CG1 1 
ATOM   3025 C CG2 . VAL A 1 390 ? 7.426   29.795 44.944 1.00 23.47 ? 371  VAL A CG2 1 
ATOM   3026 N N   . ILE A 1 391 ? 3.017   31.037 46.090 1.00 21.69 ? 372  ILE A N   1 
ATOM   3027 C CA  . ILE A 1 391 ? 1.543   30.868 46.064 1.00 21.76 ? 372  ILE A CA  1 
ATOM   3028 C C   . ILE A 1 391 ? 1.023   31.446 44.745 1.00 20.76 ? 372  ILE A C   1 
ATOM   3029 O O   . ILE A 1 391 ? 0.807   32.652 44.685 1.00 20.79 ? 372  ILE A O   1 
ATOM   3030 C CB  . ILE A 1 391 ? 0.872   31.663 47.223 1.00 21.68 ? 372  ILE A CB  1 
ATOM   3031 C CG1 . ILE A 1 391 ? 1.521   31.322 48.576 1.00 22.99 ? 372  ILE A CG1 1 
ATOM   3032 C CG2 . ILE A 1 391 ? -0.620  31.426 47.210 1.00 21.52 ? 372  ILE A CG2 1 
ATOM   3033 C CD1 . ILE A 1 391 ? 0.881   32.053 49.785 1.00 20.29 ? 372  ILE A CD1 1 
ATOM   3034 N N   . PRO A 1 392 ? 0.872   30.613 43.692 1.00 21.56 ? 373  PRO A N   1 
ATOM   3035 C CA  . PRO A 1 392 ? 0.583   31.196 42.367 1.00 21.46 ? 373  PRO A CA  1 
ATOM   3036 C C   . PRO A 1 392 ? -0.642  32.106 42.325 1.00 22.01 ? 373  PRO A C   1 
ATOM   3037 O O   . PRO A 1 392 ? -0.596  33.136 41.651 1.00 21.39 ? 373  PRO A O   1 
ATOM   3038 C CB  . PRO A 1 392 ? 0.396   29.959 41.470 1.00 21.19 ? 373  PRO A CB  1 
ATOM   3039 C CG  . PRO A 1 392 ? 1.276   28.894 42.134 1.00 22.14 ? 373  PRO A CG  1 
ATOM   3040 C CD  . PRO A 1 392 ? 1.046   29.142 43.607 1.00 21.07 ? 373  PRO A CD  1 
ATOM   3041 N N   . GLU A 1 393 ? -1.701  31.771 43.072 1.00 21.94 ? 374  GLU A N   1 
ATOM   3042 C CA  . GLU A 1 393 ? -2.951  32.549 43.014 1.00 22.79 ? 374  GLU A CA  1 
ATOM   3043 C C   . GLU A 1 393 ? -2.806  33.944 43.564 1.00 23.12 ? 374  GLU A C   1 
ATOM   3044 O O   . GLU A 1 393 ? -3.661  34.796 43.293 1.00 22.63 ? 374  GLU A O   1 
ATOM   3045 C CB  . GLU A 1 393 ? -4.121  31.855 43.739 1.00 23.38 ? 374  GLU A CB  1 
ATOM   3046 C CG  . GLU A 1 393 ? -4.327  30.400 43.325 1.00 25.50 ? 374  GLU A CG  1 
ATOM   3047 C CD  . GLU A 1 393 ? -3.729  29.399 44.333 1.00 25.50 ? 374  GLU A CD  1 
ATOM   3048 O OE1 . GLU A 1 393 ? -2.516  29.500 44.613 1.00 20.36 ? 374  GLU A OE1 1 
ATOM   3049 O OE2 . GLU A 1 393 ? -4.500  28.523 44.827 1.00 22.82 ? 374  GLU A OE2 1 
ATOM   3050 N N   . LEU A 1 394 ? -1.739  34.187 44.325 1.00 22.47 ? 375  LEU A N   1 
ATOM   3051 C CA  . LEU A 1 394 ? -1.528  35.479 44.936 1.00 24.52 ? 375  LEU A CA  1 
ATOM   3052 C C   . LEU A 1 394 ? -1.337  36.540 43.845 1.00 25.18 ? 375  LEU A C   1 
ATOM   3053 O O   . LEU A 1 394 ? -1.693  37.693 44.050 1.00 24.85 ? 375  LEU A O   1 
ATOM   3054 C CB  . LEU A 1 394 ? -0.319  35.430 45.900 1.00 24.58 ? 375  LEU A CB  1 
ATOM   3055 C CG  . LEU A 1 394 ? 0.015   36.602 46.821 1.00 25.56 ? 375  LEU A CG  1 
ATOM   3056 C CD1 . LEU A 1 394 ? -1.175  36.951 47.744 1.00 21.64 ? 375  LEU A CD1 1 
ATOM   3057 C CD2 . LEU A 1 394 ? 1.304   36.259 47.618 1.00 24.49 ? 375  LEU A CD2 1 
ATOM   3058 N N   . ALA A 1 395 ? -0.817  36.119 42.677 1.00 25.69 ? 376  ALA A N   1 
ATOM   3059 C CA  . ALA A 1 395 ? -0.551  37.019 41.551 1.00 26.90 ? 376  ALA A CA  1 
ATOM   3060 C C   . ALA A 1 395 ? -1.837  37.697 41.101 1.00 27.53 ? 376  ALA A C   1 
ATOM   3061 O O   . ALA A 1 395 ? -1.774  38.767 40.510 1.00 28.28 ? 376  ALA A O   1 
ATOM   3062 C CB  . ALA A 1 395 ? 0.053   36.239 40.368 1.00 27.49 ? 376  ALA A CB  1 
ATOM   3063 N N   . GLN A 1 396 ? -2.982  37.073 41.405 1.00 27.72 ? 377  GLN A N   1 
ATOM   3064 C CA  . GLN A 1 396 ? -4.321  37.611 41.119 1.00 27.66 ? 377  GLN A CA  1 
ATOM   3065 C C   . GLN A 1 396 ? -5.116  38.047 42.362 1.00 27.18 ? 377  GLN A C   1 
ATOM   3066 O O   . GLN A 1 396 ? -5.830  39.032 42.297 1.00 27.13 ? 377  GLN A O   1 
ATOM   3067 C CB  . GLN A 1 396 ? -5.142  36.660 40.205 1.00 27.86 ? 377  GLN A CB  1 
ATOM   3068 C CG  . GLN A 1 396 ? -6.571  37.176 39.737 1.00 29.24 ? 377  GLN A CG  1 
ATOM   3069 C CD  . GLN A 1 396 ? -6.574  38.521 38.964 1.00 33.37 ? 377  GLN A CD  1 
ATOM   3070 O OE1 . GLN A 1 396 ? -5.579  38.923 38.357 1.00 36.61 ? 377  GLN A OE1 1 
ATOM   3071 N NE2 . GLN A 1 396 ? -7.705  39.214 38.997 1.00 33.52 ? 377  GLN A NE2 1 
ATOM   3072 N N   . GLU A 1 397 ? -4.993  37.333 43.475 1.00 26.46 ? 378  GLU A N   1 
ATOM   3073 C CA  . GLU A 1 397 ? -5.609  37.743 44.753 1.00 25.60 ? 378  GLU A CA  1 
ATOM   3074 C C   . GLU A 1 397 ? -5.166  39.133 45.228 1.00 24.97 ? 378  GLU A C   1 
ATOM   3075 O O   . GLU A 1 397 ? -5.901  39.771 45.973 1.00 24.65 ? 378  GLU A O   1 
ATOM   3076 C CB  . GLU A 1 397 ? -5.264  36.765 45.869 1.00 25.24 ? 378  GLU A CB  1 
ATOM   3077 C CG  . GLU A 1 397 ? -5.851  35.363 45.681 1.00 27.22 ? 378  GLU A CG  1 
ATOM   3078 C CD  . GLU A 1 397 ? -6.930  34.997 46.733 1.00 24.57 ? 378  GLU A CD  1 
ATOM   3079 O OE1 . GLU A 1 397 ? -7.211  35.796 47.667 1.00 26.39 ? 378  GLU A OE1 1 
ATOM   3080 O OE2 . GLU A 1 397 ? -7.531  33.928 46.584 1.00 26.05 ? 378  GLU A OE2 1 
ATOM   3081 N N   . LEU A 1 398 ? -3.936  39.532 44.876 1.00 23.95 ? 379  LEU A N   1 
ATOM   3082 C CA  . LEU A 1 398 ? -3.424  40.860 45.161 1.00 24.16 ? 379  LEU A CA  1 
ATOM   3083 C C   . LEU A 1 398 ? -4.184  41.902 44.360 1.00 24.20 ? 379  LEU A C   1 
ATOM   3084 O O   . LEU A 1 398 ? -4.499  42.958 44.902 1.00 24.16 ? 379  LEU A O   1 
ATOM   3085 C CB  . LEU A 1 398 ? -1.926  40.982 44.872 1.00 23.86 ? 379  LEU A CB  1 
ATOM   3086 C CG  . LEU A 1 398 ? -1.046  40.432 45.994 1.00 24.97 ? 379  LEU A CG  1 
ATOM   3087 C CD1 . LEU A 1 398 ? 0.384   40.275 45.541 1.00 23.84 ? 379  LEU A CD1 1 
ATOM   3088 C CD2 . LEU A 1 398 ? -1.165  41.382 47.181 1.00 24.65 ? 379  LEU A CD2 1 
ATOM   3089 N N   A HIS A 1 399 ? -4.486  41.610 43.092 0.50 23.81 ? 380  HIS A N   1 
ATOM   3090 N N   B HIS A 1 399 ? -4.471  41.604 43.083 0.50 23.80 ? 380  HIS A N   1 
ATOM   3091 C CA  A HIS A 1 399 ? -5.234  42.555 42.285 0.50 23.91 ? 380  HIS A CA  1 
ATOM   3092 C CA  B HIS A 1 399 ? -5.281  42.487 42.250 0.50 23.90 ? 380  HIS A CA  1 
ATOM   3093 C C   A HIS A 1 399 ? -6.659  42.734 42.822 0.50 23.88 ? 380  HIS A C   1 
ATOM   3094 C C   B HIS A 1 399 ? -6.591  42.736 42.963 0.50 23.80 ? 380  HIS A C   1 
ATOM   3095 O O   A HIS A 1 399 ? -7.163  43.848 42.817 0.50 23.20 ? 380  HIS A O   1 
ATOM   3096 O O   B HIS A 1 399 ? -6.947  43.875 43.215 0.50 22.99 ? 380  HIS A O   1 
ATOM   3097 C CB  A HIS A 1 399 ? -5.214  42.194 40.789 0.50 24.02 ? 380  HIS A CB  1 
ATOM   3098 C CB  B HIS A 1 399 ? -5.546  41.883 40.858 0.50 24.01 ? 380  HIS A CB  1 
ATOM   3099 C CG  A HIS A 1 399 ? -3.917  42.520 40.103 0.50 23.91 ? 380  HIS A CG  1 
ATOM   3100 C CG  B HIS A 1 399 ? -6.539  42.649 40.029 0.50 24.11 ? 380  HIS A CG  1 
ATOM   3101 N ND1 A HIS A 1 399 ? -3.638  43.770 39.592 0.50 23.95 ? 380  HIS A ND1 1 
ATOM   3102 N ND1 B HIS A 1 399 ? -6.235  43.844 39.408 0.50 25.23 ? 380  HIS A ND1 1 
ATOM   3103 C CD2 A HIS A 1 399 ? -2.826  41.757 39.845 0.50 23.42 ? 380  HIS A CD2 1 
ATOM   3104 C CD2 B HIS A 1 399 ? -7.823  42.370 39.693 0.50 23.85 ? 380  HIS A CD2 1 
ATOM   3105 C CE1 A HIS A 1 399 ? -2.432  43.764 39.051 0.50 23.64 ? 380  HIS A CE1 1 
ATOM   3106 C CE1 B HIS A 1 399 ? -7.290  44.271 38.735 0.50 23.87 ? 380  HIS A CE1 1 
ATOM   3107 N NE2 A HIS A 1 399 ? -1.919  42.553 39.187 0.50 22.63 ? 380  HIS A NE2 1 
ATOM   3108 N NE2 B HIS A 1 399 ? -8.265  43.392 38.886 0.50 23.62 ? 380  HIS A NE2 1 
ATOM   3109 N N   . VAL A 1 400 ? -7.293  41.658 43.301 1.00 23.64 ? 381  VAL A N   1 
ATOM   3110 C CA  . VAL A 1 400 ? -8.625  41.774 43.925 1.00 23.99 ? 381  VAL A CA  1 
ATOM   3111 C C   . VAL A 1 400 ? -8.560  42.526 45.268 1.00 24.54 ? 381  VAL A C   1 
ATOM   3112 O O   . VAL A 1 400 ? -9.382  43.420 45.514 1.00 24.55 ? 381  VAL A O   1 
ATOM   3113 C CB  . VAL A 1 400 ? -9.361  40.431 44.106 1.00 23.70 ? 381  VAL A CB  1 
ATOM   3114 C CG1 . VAL A 1 400 ? -10.781 40.673 44.658 1.00 22.61 ? 381  VAL A CG1 1 
ATOM   3115 C CG2 . VAL A 1 400 ? -9.455  39.675 42.783 1.00 25.53 ? 381  VAL A CG2 1 
ATOM   3116 N N   . TRP A 1 401 ? -7.582  42.176 46.106 1.00 25.14 ? 382  TRP A N   1 
ATOM   3117 C CA  . TRP A 1 401 ? -7.381  42.806 47.424 1.00 25.99 ? 382  TRP A CA  1 
ATOM   3118 C C   . TRP A 1 401 ? -7.241  44.323 47.279 1.00 26.61 ? 382  TRP A C   1 
ATOM   3119 O O   . TRP A 1 401 ? -7.869  45.090 48.033 1.00 25.87 ? 382  TRP A O   1 
ATOM   3120 C CB  . TRP A 1 401 ? -6.179  42.186 48.168 1.00 26.07 ? 382  TRP A CB  1 
ATOM   3121 C CG  . TRP A 1 401 ? -5.979  42.782 49.547 1.00 26.38 ? 382  TRP A CG  1 
ATOM   3122 C CD1 . TRP A 1 401 ? -5.080  43.761 49.902 1.00 26.06 ? 382  TRP A CD1 1 
ATOM   3123 C CD2 . TRP A 1 401 ? -6.725  42.477 50.734 1.00 26.37 ? 382  TRP A CD2 1 
ATOM   3124 N NE1 . TRP A 1 401 ? -5.220  44.074 51.235 1.00 25.73 ? 382  TRP A NE1 1 
ATOM   3125 C CE2 . TRP A 1 401 ? -6.223  43.313 51.772 1.00 25.29 ? 382  TRP A CE2 1 
ATOM   3126 C CE3 . TRP A 1 401 ? -7.782  41.592 51.022 1.00 25.90 ? 382  TRP A CE3 1 
ATOM   3127 C CZ2 . TRP A 1 401 ? -6.734  43.289 53.074 1.00 25.10 ? 382  TRP A CZ2 1 
ATOM   3128 C CZ3 . TRP A 1 401 ? -8.290  41.562 52.322 1.00 25.70 ? 382  TRP A CZ3 1 
ATOM   3129 C CH2 . TRP A 1 401 ? -7.758  42.412 53.337 1.00 25.97 ? 382  TRP A CH2 1 
ATOM   3130 N N   . THR A 1 402 ? -6.445  44.750 46.292 1.00 27.75 ? 383  THR A N   1 
ATOM   3131 C CA  . THR A 1 402 ? -6.277  46.186 46.017 1.00 28.78 ? 383  THR A CA  1 
ATOM   3132 C C   . THR A 1 402 ? -7.518  46.923 45.505 1.00 28.26 ? 383  THR A C   1 
ATOM   3133 O O   . THR A 1 402 ? -7.840  47.969 46.057 1.00 28.74 ? 383  THR A O   1 
ATOM   3134 C CB  . THR A 1 402 ? -5.003  46.575 45.168 1.00 29.59 ? 383  THR A CB  1 
ATOM   3135 O OG1 . THR A 1 402 ? -4.833  48.008 45.207 1.00 31.15 ? 383  THR A OG1 1 
ATOM   3136 C CG2 . THR A 1 402 ? -5.129  46.165 43.698 1.00 30.68 ? 383  THR A CG2 1 
ATOM   3137 N N   . ASP A 1 403 ? -8.210  46.421 44.481 1.00 27.62 ? 384  ASP A N   1 
ATOM   3138 C CA  . ASP A 1 403 ? -9.400  47.147 43.996 1.00 27.09 ? 384  ASP A CA  1 
ATOM   3139 C C   . ASP A 1 403 ? -10.756 46.682 44.556 1.00 26.51 ? 384  ASP A C   1 
ATOM   3140 O O   . ASP A 1 403 ? -11.806 46.940 43.965 1.00 26.25 ? 384  ASP A O   1 
ATOM   3141 C CB  . ASP A 1 403 ? -9.412  47.426 42.465 1.00 27.35 ? 384  ASP A CB  1 
ATOM   3142 C CG  . ASP A 1 403 ? -8.828  46.291 41.624 1.00 27.48 ? 384  ASP A CG  1 
ATOM   3143 O OD1 . ASP A 1 403 ? -9.511  45.248 41.459 1.00 27.57 ? 384  ASP A OD1 1 
ATOM   3144 O OD2 . ASP A 1 403 ? -7.702  46.473 41.090 1.00 26.97 ? 384  ASP A OD2 1 
ATOM   3145 N N   . LYS A 1 404 ? -10.705 46.006 45.702 1.00 26.01 ? 385  LYS A N   1 
ATOM   3146 C CA  . LYS A 1 404 ? -11.843 45.924 46.625 1.00 25.83 ? 385  LYS A CA  1 
ATOM   3147 C C   . LYS A 1 404 ? -11.352 46.415 47.980 1.00 25.53 ? 385  LYS A C   1 
ATOM   3148 O O   . LYS A 1 404 ? -11.825 45.950 49.020 1.00 25.30 ? 385  LYS A O   1 
ATOM   3149 C CB  . LYS A 1 404 ? -12.440 44.501 46.769 1.00 26.20 ? 385  LYS A CB  1 
ATOM   3150 C CG  . LYS A 1 404 ? -12.661 43.672 45.492 1.00 26.10 ? 385  LYS A CG  1 
ATOM   3151 C CD  . LYS A 1 404 ? -13.503 44.338 44.417 1.00 25.95 ? 385  LYS A CD  1 
ATOM   3152 C CE  . LYS A 1 404 ? -13.073 43.805 43.059 1.00 25.51 ? 385  LYS A CE  1 
ATOM   3153 N NZ  . LYS A 1 404 ? -14.074 44.098 42.008 1.00 26.30 ? 385  LYS A NZ  1 
ATOM   3154 N N   . SER A 1 405 ? -10.369 47.323 47.943 1.00 25.60 ? 386  SER A N   1 
ATOM   3155 C CA  . SER A 1 405 ? -9.860  48.059 49.112 1.00 25.60 ? 386  SER A CA  1 
ATOM   3156 C C   . SER A 1 405 ? -10.998 48.430 50.047 1.00 25.58 ? 386  SER A C   1 
ATOM   3157 O O   . SER A 1 405 ? -11.095 47.943 51.186 1.00 25.26 ? 386  SER A O   1 
ATOM   3158 C CB  . SER A 1 405 ? -9.195  49.378 48.664 1.00 25.73 ? 386  SER A CB  1 
ATOM   3159 O OG  . SER A 1 405 ? -7.819  49.240 48.357 1.00 25.81 ? 386  SER A OG  1 
ATOM   3160 N N   . SER A 1 406 ? -11.865 49.292 49.514 1.00 25.59 ? 387  SER A N   1 
ATOM   3161 C CA  . SER A 1 406 ? -12.907 49.971 50.270 1.00 25.66 ? 387  SER A CA  1 
ATOM   3162 C C   . SER A 1 406 ? -14.096 49.079 50.640 1.00 25.48 ? 387  SER A C   1 
ATOM   3163 O O   . SER A 1 406 ? -14.980 49.502 51.388 1.00 25.59 ? 387  SER A O   1 
ATOM   3164 C CB  . SER A 1 406 ? -13.366 51.227 49.513 1.00 25.74 ? 387  SER A CB  1 
ATOM   3165 O OG  . SER A 1 406 ? -13.605 50.935 48.147 1.00 25.62 ? 387  SER A OG  1 
ATOM   3166 N N   . LEU A 1 407 ? -14.110 47.852 50.121 1.00 25.40 ? 388  LEU A N   1 
ATOM   3167 C CA  . LEU A 1 407 ? -15.084 46.829 50.534 1.00 25.25 ? 388  LEU A CA  1 
ATOM   3168 C C   . LEU A 1 407 ? -14.650 46.142 51.848 1.00 24.98 ? 388  LEU A C   1 
ATOM   3169 O O   . LEU A 1 407 ? -15.480 45.909 52.735 1.00 24.65 ? 388  LEU A O   1 
ATOM   3170 C CB  . LEU A 1 407 ? -15.299 45.798 49.414 1.00 25.32 ? 388  LEU A CB  1 
ATOM   3171 C CG  . LEU A 1 407 ? -16.735 45.364 49.097 1.00 25.70 ? 388  LEU A CG  1 
ATOM   3172 C CD1 . LEU A 1 407 ? -16.864 44.871 47.645 1.00 25.07 ? 388  LEU A CD1 1 
ATOM   3173 C CD2 . LEU A 1 407 ? -17.228 44.316 50.104 1.00 26.41 ? 388  LEU A CD2 1 
ATOM   3174 N N   . PHE A 1 408 ? -13.355 45.824 51.963 1.00 24.67 ? 389  PHE A N   1 
ATOM   3175 C CA  . PHE A 1 408 ? -12.804 45.277 53.207 1.00 24.59 ? 389  PHE A CA  1 
ATOM   3176 C C   . PHE A 1 408 ? -12.788 46.340 54.298 1.00 24.51 ? 389  PHE A C   1 
ATOM   3177 O O   . PHE A 1 408 ? -13.089 46.047 55.464 1.00 24.08 ? 389  PHE A O   1 
ATOM   3178 C CB  . PHE A 1 408 ? -11.389 44.692 53.015 1.00 24.52 ? 389  PHE A CB  1 
ATOM   3179 C CG  . PHE A 1 408 ? -10.799 44.082 54.283 1.00 24.38 ? 389  PHE A CG  1 
ATOM   3180 C CD1 . PHE A 1 408 ? -11.220 42.822 54.738 1.00 24.54 ? 389  PHE A CD1 1 
ATOM   3181 C CD2 . PHE A 1 408 ? -9.823  44.757 55.013 1.00 23.81 ? 389  PHE A CD2 1 
ATOM   3182 C CE1 . PHE A 1 408 ? -10.684 42.260 55.907 1.00 24.18 ? 389  PHE A CE1 1 
ATOM   3183 C CE2 . PHE A 1 408 ? -9.270  44.193 56.173 1.00 23.39 ? 389  PHE A CE2 1 
ATOM   3184 C CZ  . PHE A 1 408 ? -9.706  42.953 56.626 1.00 23.91 ? 389  PHE A CZ  1 
ATOM   3185 N N   . GLU A 1 409 ? -12.429 47.566 53.908 1.00 24.57 ? 390  GLU A N   1 
ATOM   3186 C CA  . GLU A 1 409 ? -12.394 48.687 54.838 1.00 24.90 ? 390  GLU A CA  1 
ATOM   3187 C C   . GLU A 1 409 ? -13.781 48.906 55.429 1.00 24.68 ? 390  GLU A C   1 
ATOM   3188 O O   . GLU A 1 409 ? -13.919 49.073 56.646 1.00 24.77 ? 390  GLU A O   1 
ATOM   3189 C CB  . GLU A 1 409 ? -11.857 49.953 54.166 1.00 24.92 ? 390  GLU A CB  1 
ATOM   3190 C CG  . GLU A 1 409 ? -10.355 49.904 53.869 1.00 25.48 ? 390  GLU A CG  1 
ATOM   3191 C CD  . GLU A 1 409 ? -9.888  51.046 52.973 1.00 25.70 ? 390  GLU A CD  1 
ATOM   3192 O OE1 . GLU A 1 409 ? -9.856  52.209 53.454 1.00 26.20 ? 390  GLU A OE1 1 
ATOM   3193 O OE2 . GLU A 1 409 ? -9.543  50.774 51.794 1.00 25.84 ? 390  GLU A OE2 1 
ATOM   3194 N N   . GLU A 1 410 ? -14.801 48.857 54.568 1.00 24.38 ? 391  GLU A N   1 
ATOM   3195 C CA  . GLU A 1 410 ? -16.198 48.897 55.013 1.00 24.46 ? 391  GLU A CA  1 
ATOM   3196 C C   . GLU A 1 410 ? -16.509 47.794 56.030 1.00 24.33 ? 391  GLU A C   1 
ATOM   3197 O O   . GLU A 1 410 ? -17.129 48.065 57.059 1.00 23.97 ? 391  GLU A O   1 
ATOM   3198 C CB  . GLU A 1 410 ? -17.183 48.844 53.831 1.00 24.43 ? 391  GLU A CB  1 
ATOM   3199 C CG  . GLU A 1 410 ? -18.642 49.100 54.242 1.00 24.50 ? 391  GLU A CG  1 
ATOM   3200 C CD  . GLU A 1 410 ? -19.609 49.235 53.070 1.00 24.91 ? 391  GLU A CD  1 
ATOM   3201 O OE1 . GLU A 1 410 ? -19.230 49.810 52.022 1.00 25.63 ? 391  GLU A OE1 1 
ATOM   3202 O OE2 . GLU A 1 410 ? -20.769 48.786 53.213 1.00 24.95 ? 391  GLU A OE2 1 
ATOM   3203 N N   . LEU A 1 411 ? -16.067 46.562 55.740 1.00 24.38 ? 392  LEU A N   1 
ATOM   3204 C CA  . LEU A 1 411 ? -16.198 45.444 56.683 1.00 24.13 ? 392  LEU A CA  1 
ATOM   3205 C C   . LEU A 1 411 ? -15.514 45.740 58.018 1.00 24.11 ? 392  LEU A C   1 
ATOM   3206 O O   . LEU A 1 411 ? -16.074 45.469 59.072 1.00 23.49 ? 392  LEU A O   1 
ATOM   3207 C CB  . LEU A 1 411 ? -15.663 44.134 56.075 1.00 24.19 ? 392  LEU A CB  1 
ATOM   3208 C CG  . LEU A 1 411 ? -15.760 42.796 56.833 1.00 24.10 ? 392  LEU A CG  1 
ATOM   3209 C CD1 . LEU A 1 411 ? -17.110 42.555 57.529 1.00 22.93 ? 392  LEU A CD1 1 
ATOM   3210 C CD2 . LEU A 1 411 ? -15.442 41.663 55.872 1.00 23.19 ? 392  LEU A CD2 1 
ATOM   3211 N N   . GLN A 1 412 ? -14.311 46.299 57.946 1.00 24.43 ? 393  GLN A N   1 
ATOM   3212 C CA  . GLN A 1 412 ? -13.543 46.661 59.130 1.00 25.44 ? 393  GLN A CA  1 
ATOM   3213 C C   . GLN A 1 412 ? -14.207 47.766 59.968 1.00 25.39 ? 393  GLN A C   1 
ATOM   3214 O O   . GLN A 1 412 ? -14.096 47.776 61.208 1.00 25.27 ? 393  GLN A O   1 
ATOM   3215 C CB  . GLN A 1 412 ? -12.151 47.126 58.722 1.00 25.64 ? 393  GLN A CB  1 
ATOM   3216 C CG  . GLN A 1 412 ? -11.176 46.026 58.410 1.00 26.81 ? 393  GLN A CG  1 
ATOM   3217 C CD  . GLN A 1 412 ? -9.751  46.556 58.357 1.00 28.67 ? 393  GLN A CD  1 
ATOM   3218 O OE1 . GLN A 1 412 ? -9.498  47.630 57.801 1.00 28.92 ? 393  GLN A OE1 1 
ATOM   3219 N NE2 . GLN A 1 412 ? -8.812  45.809 58.941 1.00 29.46 ? 393  GLN A NE2 1 
ATOM   3220 N N   . SER A 1 413 ? -14.884 48.693 59.289 1.00 25.35 ? 394  SER A N   1 
ATOM   3221 C CA  . SER A 1 413 ? -15.562 49.809 59.974 1.00 25.50 ? 394  SER A CA  1 
ATOM   3222 C C   . SER A 1 413 ? -16.765 49.353 60.801 1.00 25.52 ? 394  SER A C   1 
ATOM   3223 O O   . SER A 1 413 ? -17.018 49.890 61.875 1.00 25.48 ? 394  SER A O   1 
ATOM   3224 C CB  . SER A 1 413 ? -15.971 50.905 58.985 1.00 25.36 ? 394  SER A CB  1 
ATOM   3225 O OG  . SER A 1 413 ? -14.859 51.709 58.639 1.00 24.67 ? 394  SER A OG  1 
ATOM   3226 N N   . LEU A 1 414 ? -17.463 48.331 60.310 1.00 25.75 ? 395  LEU A N   1 
ATOM   3227 C CA  . LEU A 1 414 ? -18.685 47.825 60.936 1.00 25.91 ? 395  LEU A CA  1 
ATOM   3228 C C   . LEU A 1 414 ? -18.513 47.096 62.288 1.00 26.09 ? 395  LEU A C   1 
ATOM   3229 O O   . LEU A 1 414 ? -19.500 46.847 62.974 1.00 26.26 ? 395  LEU A O   1 
ATOM   3230 C CB  . LEU A 1 414 ? -19.457 46.940 59.943 1.00 25.77 ? 395  LEU A CB  1 
ATOM   3231 C CG  . LEU A 1 414 ? -19.872 47.559 58.598 1.00 26.11 ? 395  LEU A CG  1 
ATOM   3232 C CD1 . LEU A 1 414 ? -20.079 46.485 57.548 1.00 26.07 ? 395  LEU A CD1 1 
ATOM   3233 C CD2 . LEU A 1 414 ? -21.112 48.471 58.699 1.00 25.88 ? 395  LEU A CD2 1 
ATOM   3234 N N   . ASP A 1 415 ? -17.291 46.753 62.689 1.00 26.33 ? 396  ASP A N   1 
ATOM   3235 C CA  . ASP A 1 415 ? -17.114 46.025 63.953 1.00 26.32 ? 396  ASP A CA  1 
ATOM   3236 C C   . ASP A 1 415 ? -16.515 46.931 65.027 1.00 26.55 ? 396  ASP A C   1 
ATOM   3237 O O   . ASP A 1 415 ? -16.790 48.144 65.066 1.00 26.50 ? 396  ASP A O   1 
ATOM   3238 C CB  . ASP A 1 415 ? -16.265 44.742 63.776 1.00 26.74 ? 396  ASP A CB  1 
ATOM   3239 C CG  . ASP A 1 415 ? -16.256 44.200 62.317 1.00 26.60 ? 396  ASP A CG  1 
ATOM   3240 O OD1 . ASP A 1 415 ? -16.650 43.020 62.076 1.00 26.22 ? 396  ASP A OD1 1 
ATOM   3241 O OD2 . ASP A 1 415 ? -15.812 44.946 61.416 1.00 25.40 ? 396  ASP A OD2 1 
ATOM   3242 N N   . ARG A 1 440 ? -26.105 41.985 59.891 1.00 21.28 ? 421  ARG A N   1 
ATOM   3243 C CA  . ARG A 1 440 ? -26.932 41.838 58.692 1.00 21.33 ? 421  ARG A CA  1 
ATOM   3244 C C   . ARG A 1 440 ? -26.267 42.495 57.484 1.00 21.45 ? 421  ARG A C   1 
ATOM   3245 O O   . ARG A 1 440 ? -26.160 41.875 56.415 1.00 21.31 ? 421  ARG A O   1 
ATOM   3246 C CB  . ARG A 1 440 ? -28.338 42.409 58.923 1.00 21.67 ? 421  ARG A CB  1 
ATOM   3247 N N   . ARG A 1 441 ? -25.826 43.747 57.659 1.00 21.11 ? 422  ARG A N   1 
ATOM   3248 C CA  . ARG A 1 441 ? -24.929 44.418 56.692 1.00 20.93 ? 422  ARG A CA  1 
ATOM   3249 C C   . ARG A 1 441 ? -23.559 43.718 56.634 1.00 20.51 ? 422  ARG A C   1 
ATOM   3250 O O   . ARG A 1 441 ? -22.946 43.632 55.561 1.00 20.42 ? 422  ARG A O   1 
ATOM   3251 C CB  . ARG A 1 441 ? -24.757 45.918 57.023 1.00 20.86 ? 422  ARG A CB  1 
ATOM   3252 C CG  . ARG A 1 441 ? -23.758 46.696 56.120 1.00 20.50 ? 422  ARG A CG  1 
ATOM   3253 C CD  . ARG A 1 441 ? -24.407 47.206 54.833 1.00 18.30 ? 422  ARG A CD  1 
ATOM   3254 N NE  . ARG A 1 441 ? -23.440 47.476 53.765 1.00 16.45 ? 422  ARG A NE  1 
ATOM   3255 C CZ  . ARG A 1 441 ? -23.761 47.679 52.482 1.00 16.65 ? 422  ARG A CZ  1 
ATOM   3256 N NH1 . ARG A 1 441 ? -25.038 47.661 52.086 1.00 17.06 ? 422  ARG A NH1 1 
ATOM   3257 N NH2 . ARG A 1 441 ? -22.810 47.909 51.582 1.00 14.53 ? 422  ARG A NH2 1 
ATOM   3258 N N   . ILE A 1 442 ? -23.105 43.221 57.790 1.00 20.17 ? 423  ILE A N   1 
ATOM   3259 C CA  . ILE A 1 442 ? -21.848 42.473 57.906 1.00 19.78 ? 423  ILE A CA  1 
ATOM   3260 C C   . ILE A 1 442 ? -21.860 41.181 57.067 1.00 20.17 ? 423  ILE A C   1 
ATOM   3261 O O   . ILE A 1 442 ? -20.854 40.849 56.427 1.00 19.96 ? 423  ILE A O   1 
ATOM   3262 C CB  . ILE A 1 442 ? -21.456 42.177 59.395 1.00 19.76 ? 423  ILE A CB  1 
ATOM   3263 C CG1 . ILE A 1 442 ? -21.076 43.480 60.128 1.00 20.28 ? 423  ILE A CG1 1 
ATOM   3264 C CG2 . ILE A 1 442 ? -20.302 41.163 59.484 1.00 19.09 ? 423  ILE A CG2 1 
ATOM   3265 C CD1 . ILE A 1 442 ? -20.444 43.302 61.529 1.00 19.24 ? 423  ILE A CD1 1 
ATOM   3266 N N   . LYS A 1 443 ? -22.984 40.463 57.044 1.00 20.29 ? 424  LYS A N   1 
ATOM   3267 C CA  . LYS A 1 443 ? -23.047 39.246 56.235 1.00 20.69 ? 424  LYS A CA  1 
ATOM   3268 C C   . LYS A 1 443 ? -23.068 39.554 54.743 1.00 21.11 ? 424  LYS A C   1 
ATOM   3269 O O   . LYS A 1 443 ? -22.459 38.808 53.935 1.00 20.57 ? 424  LYS A O   1 
ATOM   3270 C CB  . LYS A 1 443 ? -24.188 38.317 56.649 1.00 20.60 ? 424  LYS A CB  1 
ATOM   3271 C CG  . LYS A 1 443 ? -23.772 37.266 57.689 1.00 21.19 ? 424  LYS A CG  1 
ATOM   3272 C CD  . LYS A 1 443 ? -24.128 37.690 59.115 1.00 23.22 ? 424  LYS A CD  1 
ATOM   3273 C CE  . LYS A 1 443 ? -23.199 38.794 59.665 1.00 23.70 ? 424  LYS A CE  1 
ATOM   3274 N NZ  . LYS A 1 443 ? -23.926 39.902 60.376 1.00 21.50 ? 424  LYS A NZ  1 
ATOM   3275 N N   . LYS A 1 444 ? -23.704 40.676 54.399 1.00 21.33 ? 425  LYS A N   1 
ATOM   3276 C CA  . LYS A 1 444 ? -23.881 41.081 53.004 1.00 22.65 ? 425  LYS A CA  1 
ATOM   3277 C C   . LYS A 1 444 ? -22.578 41.562 52.376 1.00 23.49 ? 425  LYS A C   1 
ATOM   3278 O O   . LYS A 1 444 ? -22.240 41.185 51.244 1.00 23.37 ? 425  LYS A O   1 
ATOM   3279 C CB  . LYS A 1 444 ? -24.988 42.140 52.880 1.00 22.51 ? 425  LYS A CB  1 
ATOM   3280 C CG  . LYS A 1 444 ? -25.427 42.454 51.452 1.00 22.31 ? 425  LYS A CG  1 
ATOM   3281 C CD  . LYS A 1 444 ? -24.846 43.775 50.982 1.00 22.27 ? 425  LYS A CD  1 
ATOM   3282 C CE  . LYS A 1 444 ? -25.835 44.535 50.106 1.00 22.03 ? 425  LYS A CE  1 
ATOM   3283 N NZ  . LYS A 1 444 ? -25.832 44.041 48.701 1.00 21.89 ? 425  LYS A NZ  1 
ATOM   3284 N N   . VAL A 1 445 ? -21.869 42.410 53.117 1.00 24.69 ? 426  VAL A N   1 
ATOM   3285 C CA  . VAL A 1 445 ? -20.531 42.877 52.741 1.00 26.10 ? 426  VAL A CA  1 
ATOM   3286 C C   . VAL A 1 445 ? -19.515 41.716 52.586 1.00 26.31 ? 426  VAL A C   1 
ATOM   3287 O O   . VAL A 1 445 ? -18.760 41.689 51.600 1.00 26.64 ? 426  VAL A O   1 
ATOM   3288 C CB  . VAL A 1 445 ? -20.030 44.002 53.719 1.00 25.87 ? 426  VAL A CB  1 
ATOM   3289 C CG1 . VAL A 1 445 ? -18.488 44.073 53.798 1.00 26.65 ? 426  VAL A CG1 1 
ATOM   3290 C CG2 . VAL A 1 445 ? -20.654 45.381 53.303 1.00 27.47 ? 426  VAL A CG2 1 
ATOM   3291 N N   . THR A 1 446 ? -19.512 40.806 53.569 1.00 26.65 ? 427  THR A N   1 
ATOM   3292 C CA  . THR A 1 446 ? -18.768 39.537 53.552 1.00 27.59 ? 427  THR A CA  1 
ATOM   3293 C C   . THR A 1 446 ? -19.047 38.775 52.247 1.00 28.37 ? 427  THR A C   1 
ATOM   3294 O O   . THR A 1 446 ? -18.113 38.403 51.524 1.00 28.83 ? 427  THR A O   1 
ATOM   3295 C CB  . THR A 1 446 ? -19.148 38.655 54.788 1.00 27.66 ? 427  THR A CB  1 
ATOM   3296 O OG1 . THR A 1 446 ? -18.743 39.301 56.007 1.00 27.31 ? 427  THR A OG1 1 
ATOM   3297 C CG2 . THR A 1 446 ? -18.542 37.226 54.716 1.00 26.97 ? 427  THR A CG2 1 
ATOM   3298 N N   . HIS A 1 447 ? -20.326 38.590 51.925 1.00 29.58 ? 428  HIS A N   1 
ATOM   3299 C CA  . HIS A 1 447 ? -20.694 37.891 50.698 1.00 30.40 ? 428  HIS A CA  1 
ATOM   3300 C C   . HIS A 1 447 ? -20.167 38.567 49.445 1.00 30.54 ? 428  HIS A C   1 
ATOM   3301 O O   . HIS A 1 447 ? -19.634 37.897 48.577 1.00 29.84 ? 428  HIS A O   1 
ATOM   3302 C CB  . HIS A 1 447 ? -22.194 37.678 50.562 1.00 30.82 ? 428  HIS A CB  1 
ATOM   3303 C CG  . HIS A 1 447 ? -22.551 36.789 49.406 1.00 32.99 ? 428  HIS A CG  1 
ATOM   3304 N ND1 . HIS A 1 447 ? -23.070 37.274 48.220 1.00 35.03 ? 428  HIS A ND1 1 
ATOM   3305 C CD2 . HIS A 1 447 ? -22.400 35.452 49.233 1.00 33.00 ? 428  HIS A CD2 1 
ATOM   3306 C CE1 . HIS A 1 447 ? -23.253 36.270 47.381 1.00 34.81 ? 428  HIS A CE1 1 
ATOM   3307 N NE2 . HIS A 1 447 ? -22.851 35.155 47.970 1.00 34.39 ? 428  HIS A NE2 1 
ATOM   3308 N N   . ASP A 1 448 ? -20.311 39.886 49.347 1.00 31.29 ? 429  ASP A N   1 
ATOM   3309 C CA  . ASP A 1 448 ? -19.874 40.598 48.130 1.00 32.40 ? 429  ASP A CA  1 
ATOM   3310 C C   . ASP A 1 448 ? -18.352 40.714 48.026 1.00 31.90 ? 429  ASP A C   1 
ATOM   3311 O O   . ASP A 1 448 ? -17.798 40.747 46.925 1.00 31.60 ? 429  ASP A O   1 
ATOM   3312 C CB  . ASP A 1 448 ? -20.514 41.981 48.017 1.00 32.98 ? 429  ASP A CB  1 
ATOM   3313 C CG  . ASP A 1 448 ? -22.035 41.925 47.913 1.00 36.40 ? 429  ASP A CG  1 
ATOM   3314 O OD1 . ASP A 1 448 ? -22.574 41.154 47.062 1.00 39.70 ? 429  ASP A OD1 1 
ATOM   3315 O OD2 . ASP A 1 448 ? -22.681 42.679 48.678 1.00 38.80 ? 429  ASP A OD2 1 
ATOM   3316 N N   . MET A 1 449 ? -17.682 40.781 49.169 1.00 31.67 ? 430  MET A N   1 
ATOM   3317 C CA  . MET A 1 449 ? -16.240 40.703 49.169 1.00 32.97 ? 430  MET A CA  1 
ATOM   3318 C C   . MET A 1 449 ? -15.862 39.362 48.551 1.00 31.09 ? 430  MET A C   1 
ATOM   3319 O O   . MET A 1 449 ? -15.102 39.325 47.577 1.00 30.71 ? 430  MET A O   1 
ATOM   3320 C CB  . MET A 1 449 ? -15.676 40.815 50.589 1.00 32.68 ? 430  MET A CB  1 
ATOM   3321 C CG  . MET A 1 449 ? -14.255 41.386 50.693 1.00 34.89 ? 430  MET A CG  1 
ATOM   3322 S SD  . MET A 1 449 ? -13.685 41.237 52.412 1.00 38.97 ? 430  MET A SD  1 
ATOM   3323 C CE  . MET A 1 449 ? -12.514 39.873 52.242 1.00 37.49 ? 430  MET A CE  1 
ATOM   3324 N N   . ASP A 1 450 ? -16.411 38.277 49.105 1.00 29.66 ? 431  ASP A N   1 
ATOM   3325 C CA  . ASP A 1 450 ? -16.022 36.909 48.704 1.00 28.93 ? 431  ASP A CA  1 
ATOM   3326 C C   . ASP A 1 450 ? -16.306 36.581 47.219 1.00 27.78 ? 431  ASP A C   1 
ATOM   3327 O O   . ASP A 1 450 ? -15.507 35.904 46.576 1.00 27.07 ? 431  ASP A O   1 
ATOM   3328 C CB  . ASP A 1 450 ? -16.689 35.879 49.603 1.00 29.02 ? 431  ASP A CB  1 
ATOM   3329 C CG  . ASP A 1 450 ? -16.212 35.947 51.060 1.00 32.63 ? 431  ASP A CG  1 
ATOM   3330 O OD1 . ASP A 1 450 ? -15.234 36.687 51.403 1.00 33.26 ? 431  ASP A OD1 1 
ATOM   3331 O OD2 . ASP A 1 450 ? -16.844 35.234 51.881 1.00 35.56 ? 431  ASP A OD2 1 
ATOM   3332 N N   . MET A 1 451 ? -17.400 37.108 46.672 1.00 27.06 ? 432  MET A N   1 
ATOM   3333 C CA  . MET A 1 451 ? -17.771 36.773 45.302 1.00 27.44 ? 432  MET A CA  1 
ATOM   3334 C C   . MET A 1 451 ? -16.781 37.289 44.260 1.00 28.12 ? 432  MET A C   1 
ATOM   3335 O O   . MET A 1 451 ? -16.643 36.696 43.183 1.00 28.66 ? 432  MET A O   1 
ATOM   3336 C CB  . MET A 1 451 ? -19.196 37.195 44.976 1.00 26.89 ? 432  MET A CB  1 
ATOM   3337 C CG  . MET A 1 451 ? -20.248 36.333 45.670 1.00 27.57 ? 432  MET A CG  1 
ATOM   3338 S SD  . MET A 1 451 ? -20.144 34.509 45.455 1.00 26.86 ? 432  MET A SD  1 
ATOM   3339 C CE  . MET A 1 451 ? -19.091 33.974 46.856 1.00 26.64 ? 432  MET A CE  1 
ATOM   3340 N N   . CYS A 1 452 ? -16.088 38.380 44.582 1.00 27.50 ? 433  CYS A N   1 
ATOM   3341 C CA  . CYS A 1 452 ? -15.067 38.930 43.697 1.00 27.43 ? 433  CYS A CA  1 
ATOM   3342 C C   . CYS A 1 452 ? -13.939 37.948 43.414 1.00 26.11 ? 433  CYS A C   1 
ATOM   3343 O O   . CYS A 1 452 ? -13.265 38.053 42.393 1.00 26.45 ? 433  CYS A O   1 
ATOM   3344 C CB  . CYS A 1 452 ? -14.474 40.185 44.313 1.00 27.33 ? 433  CYS A CB  1 
ATOM   3345 S SG  . CYS A 1 452 ? -15.597 41.517 44.332 1.00 34.94 ? 433  CYS A SG  1 
ATOM   3346 N N   . TYR A 1 453 ? -13.735 37.004 44.326 1.00 24.64 ? 434  TYR A N   1 
ATOM   3347 C CA  . TYR A 1 453 ? -12.693 35.989 44.195 1.00 24.23 ? 434  TYR A CA  1 
ATOM   3348 C C   . TYR A 1 453 ? -13.135 34.763 43.442 1.00 23.74 ? 434  TYR A C   1 
ATOM   3349 O O   . TYR A 1 453 ? -12.295 34.097 42.863 1.00 25.65 ? 434  TYR A O   1 
ATOM   3350 C CB  . TYR A 1 453 ? -12.159 35.532 45.571 1.00 22.60 ? 434  TYR A CB  1 
ATOM   3351 C CG  . TYR A 1 453 ? -11.507 36.635 46.302 1.00 22.78 ? 434  TYR A CG  1 
ATOM   3352 C CD1 . TYR A 1 453 ? -10.152 36.919 46.079 1.00 21.24 ? 434  TYR A CD1 1 
ATOM   3353 C CD2 . TYR A 1 453 ? -12.240 37.437 47.203 1.00 22.76 ? 434  TYR A CD2 1 
ATOM   3354 C CE1 . TYR A 1 453 ? -9.530  37.944 46.720 1.00 21.19 ? 434  TYR A CE1 1 
ATOM   3355 C CE2 . TYR A 1 453 ? -11.610 38.493 47.903 1.00 23.04 ? 434  TYR A CE2 1 
ATOM   3356 C CZ  . TYR A 1 453 ? -10.247 38.735 47.648 1.00 23.56 ? 434  TYR A CZ  1 
ATOM   3357 O OH  . TYR A 1 453 ? -9.586  39.779 48.282 1.00 25.58 ? 434  TYR A OH  1 
ATOM   3358 N N   . GLY A 1 454 ? -14.437 34.454 43.492 1.00 22.44 ? 435  GLY A N   1 
ATOM   3359 C CA  . GLY A 1 454 ? -14.972 33.192 42.977 1.00 18.90 ? 435  GLY A CA  1 
ATOM   3360 C C   . GLY A 1 454 ? -16.070 32.701 43.902 1.00 17.15 ? 435  GLY A C   1 
ATOM   3361 O O   . GLY A 1 454 ? -16.316 33.281 44.966 1.00 15.63 ? 435  GLY A O   1 
ATOM   3362 N N   . MET A 1 455 ? -16.699 31.598 43.526 1.00 15.41 ? 436  MET A N   1 
ATOM   3363 C CA  . MET A 1 455 ? -17.795 31.045 44.317 1.00 15.75 ? 436  MET A CA  1 
ATOM   3364 C C   . MET A 1 455 ? -17.425 30.553 45.702 1.00 15.92 ? 436  MET A C   1 
ATOM   3365 O O   . MET A 1 455 ? -18.263 30.526 46.597 1.00 15.37 ? 436  MET A O   1 
ATOM   3366 C CB  . MET A 1 455 ? -18.483 29.937 43.528 1.00 16.13 ? 436  MET A CB  1 
ATOM   3367 C CG  . MET A 1 455 ? -19.118 30.513 42.232 1.00 14.54 ? 436  MET A CG  1 
ATOM   3368 S SD  . MET A 1 455 ? -20.542 31.615 42.622 1.00 19.64 ? 436  MET A SD  1 
ATOM   3369 C CE  . MET A 1 455 ? -21.970 30.511 42.476 1.00 14.89 ? 436  MET A CE  1 
ATOM   3370 N N   . MET A 1 456 ? -16.165 30.173 45.857 1.00 17.42 ? 437  MET A N   1 
ATOM   3371 C CA  . MET A 1 456 ? -15.663 29.643 47.127 1.00 19.26 ? 437  MET A CA  1 
ATOM   3372 C C   . MET A 1 456 ? -14.732 30.658 47.781 1.00 19.56 ? 437  MET A C   1 
ATOM   3373 O O   . MET A 1 456 ? -14.014 30.320 48.712 1.00 19.93 ? 437  MET A O   1 
ATOM   3374 C CB  . MET A 1 456 ? -14.962 28.294 46.883 1.00 19.41 ? 437  MET A CB  1 
ATOM   3375 C CG  . MET A 1 456 ? -15.981 27.178 46.574 1.00 19.04 ? 437  MET A CG  1 
ATOM   3376 S SD  . MET A 1 456 ? -16.786 26.834 48.155 1.00 31.64 ? 437  MET A SD  1 
ATOM   3377 C CE  . MET A 1 456 ? -18.127 25.857 47.618 1.00 17.09 ? 437  MET A CE  1 
ATOM   3378 N N   . GLY A 1 457 ? -14.730 31.881 47.242 1.00 18.46 ? 438  GLY A N   1 
ATOM   3379 C CA  . GLY A 1 457 ? -14.087 33.023 47.854 1.00 17.80 ? 438  GLY A CA  1 
ATOM   3380 C C   . GLY A 1 457 ? -12.582 32.975 47.816 1.00 18.50 ? 438  GLY A C   1 
ATOM   3381 O O   . GLY A 1 457 ? -11.969 32.182 47.073 1.00 18.46 ? 438  GLY A O   1 
ATOM   3382 N N   . SER A 1 458 ? -11.993 33.827 48.633 1.00 17.23 ? 439  SER A N   1 
ATOM   3383 C CA  . SER A 1 458 ? -10.557 33.998 48.704 1.00 18.84 ? 439  SER A CA  1 
ATOM   3384 C C   . SER A 1 458 ? -9.879  32.772 49.306 1.00 18.92 ? 439  SER A C   1 
ATOM   3385 O O   . SER A 1 458 ? -10.421 32.128 50.252 1.00 20.26 ? 439  SER A O   1 
ATOM   3386 C CB  . SER A 1 458 ? -10.242 35.218 49.603 1.00 18.26 ? 439  SER A CB  1 
ATOM   3387 O OG  . SER A 1 458 ? -8.836  35.369 49.745 1.00 18.49 ? 439  SER A OG  1 
ATOM   3388 N N   . LEU A 1 459 ? -8.693  32.469 48.788 1.00 19.61 ? 440  LEU A N   1 
ATOM   3389 C CA  . LEU A 1 459 ? -7.817  31.453 49.333 1.00 20.43 ? 440  LEU A CA  1 
ATOM   3390 C C   . LEU A 1 459 ? -7.527  31.732 50.848 1.00 20.08 ? 440  LEU A C   1 
ATOM   3391 O O   . LEU A 1 459 ? -7.390  30.782 51.665 1.00 20.20 ? 440  LEU A O   1 
ATOM   3392 C CB  . LEU A 1 459 ? -6.511  31.489 48.526 1.00 21.04 ? 440  LEU A CB  1 
ATOM   3393 C CG  . LEU A 1 459 ? -5.364  30.562 48.940 1.00 21.81 ? 440  LEU A CG  1 
ATOM   3394 C CD1 . LEU A 1 459 ? -5.764  29.066 48.981 1.00 20.09 ? 440  LEU A CD1 1 
ATOM   3395 C CD2 . LEU A 1 459 ? -4.231  30.769 47.955 1.00 22.76 ? 440  LEU A CD2 1 
ATOM   3396 N N   . PHE A 1 460 ? -7.484  33.015 51.204 1.00 20.29 ? 441  PHE A N   1 
ATOM   3397 C CA  . PHE A 1 460 ? -7.005  33.491 52.535 1.00 21.99 ? 441  PHE A CA  1 
ATOM   3398 C C   . PHE A 1 460 ? -8.032  33.847 53.581 1.00 22.14 ? 441  PHE A C   1 
ATOM   3399 O O   . PHE A 1 460 ? -7.679  33.994 54.739 1.00 22.42 ? 441  PHE A O   1 
ATOM   3400 C CB  . PHE A 1 460 ? -6.049  34.686 52.401 1.00 21.30 ? 441  PHE A CB  1 
ATOM   3401 C CG  . PHE A 1 460 ? -4.893  34.420 51.494 1.00 23.20 ? 441  PHE A CG  1 
ATOM   3402 C CD1 . PHE A 1 460 ? -3.878  33.542 51.875 1.00 23.87 ? 441  PHE A CD1 1 
ATOM   3403 C CD2 . PHE A 1 460 ? -4.841  35.021 50.217 1.00 22.72 ? 441  PHE A CD2 1 
ATOM   3404 C CE1 . PHE A 1 460 ? -2.816  33.287 51.010 1.00 25.55 ? 441  PHE A CE1 1 
ATOM   3405 C CE2 . PHE A 1 460 ? -3.782  34.768 49.372 1.00 24.75 ? 441  PHE A CE2 1 
ATOM   3406 C CZ  . PHE A 1 460 ? -2.781  33.910 49.759 1.00 23.34 ? 441  PHE A CZ  1 
ATOM   3407 N N   . ARG A 1 461 ? -9.272  34.046 53.181 1.00 22.68 ? 442  ARG A N   1 
ATOM   3408 C CA  . ARG A 1 461 ? -10.315 34.482 54.102 1.00 24.31 ? 442  ARG A CA  1 
ATOM   3409 C C   . ARG A 1 461 ? -11.748 34.246 53.579 1.00 26.66 ? 442  ARG A C   1 
ATOM   3410 O O   . ARG A 1 461 ? -11.967 33.945 52.391 1.00 26.48 ? 442  ARG A O   1 
ATOM   3411 C CB  . ARG A 1 461 ? -10.158 35.960 54.555 1.00 24.08 ? 442  ARG A CB  1 
ATOM   3412 C CG  . ARG A 1 461 ? -9.677  36.992 53.544 1.00 24.88 ? 442  ARG A CG  1 
ATOM   3413 C CD  . ARG A 1 461 ? -9.632  38.454 54.109 1.00 22.90 ? 442  ARG A CD  1 
ATOM   3414 N NE  . ARG A 1 461 ? -8.496  38.674 55.029 1.00 23.61 ? 442  ARG A NE  1 
ATOM   3415 C CZ  . ARG A 1 461 ? -8.586  38.704 56.357 1.00 24.43 ? 442  ARG A CZ  1 
ATOM   3416 N NH1 . ARG A 1 461 ? -7.495  38.880 57.114 1.00 23.96 ? 442  ARG A NH1 1 
ATOM   3417 N NH2 . ARG A 1 461 ? -9.775  38.552 56.940 1.00 25.45 ? 442  ARG A NH2 1 
ATOM   3418 N N   . SER A 1 462 ? -12.713 34.357 54.497 1.00 28.10 ? 443  SER A N   1 
ATOM   3419 C CA  . SER A 1 462 ? -14.084 34.756 54.157 1.00 29.39 ? 443  SER A CA  1 
ATOM   3420 C C   . SER A 1 462 ? -14.454 36.004 55.016 1.00 29.63 ? 443  SER A C   1 
ATOM   3421 O O   . SER A 1 462 ? -14.773 35.896 56.203 1.00 30.04 ? 443  SER A O   1 
ATOM   3422 C CB  . SER A 1 462 ? -15.040 33.546 54.325 1.00 29.21 ? 443  SER A CB  1 
ATOM   3423 O OG  . SER A 1 462 ? -16.385 33.930 54.583 1.00 31.45 ? 443  SER A OG  1 
ATOM   3424 N N   . GLY A 1 463 ? -14.364 37.191 54.415 1.00 29.86 ? 444  GLY A N   1 
ATOM   3425 C CA  . GLY A 1 463 ? -14.536 38.450 55.155 1.00 28.88 ? 444  GLY A CA  1 
ATOM   3426 C C   . GLY A 1 463 ? -13.412 38.628 56.163 1.00 28.47 ? 444  GLY A C   1 
ATOM   3427 O O   . GLY A 1 463 ? -12.226 38.580 55.794 1.00 29.42 ? 444  GLY A O   1 
ATOM   3428 N N   . SER A 1 464 ? -13.777 38.772 57.436 1.00 27.02 ? 445  SER A N   1 
ATOM   3429 C CA  . SER A 1 464 ? -12.815 38.963 58.534 1.00 26.30 ? 445  SER A CA  1 
ATOM   3430 C C   . SER A 1 464 ? -12.315 37.661 59.178 1.00 25.14 ? 445  SER A C   1 
ATOM   3431 O O   . SER A 1 464 ? -11.543 37.688 60.124 1.00 26.66 ? 445  SER A O   1 
ATOM   3432 C CB  . SER A 1 464 ? -13.414 39.887 59.614 1.00 27.61 ? 445  SER A CB  1 
ATOM   3433 O OG  . SER A 1 464 ? -14.374 39.197 60.428 1.00 29.95 ? 445  SER A OG  1 
ATOM   3434 N N   A ARG A 1 465 ? -12.697 36.522 58.615 0.50 24.11 ? 446  ARG A N   1 
ATOM   3435 N N   B ARG A 1 465 ? -12.803 36.519 58.702 0.50 24.25 ? 446  ARG A N   1 
ATOM   3436 C CA  A ARG A 1 465 ? -12.278 35.248 59.171 0.50 21.98 ? 446  ARG A CA  1 
ATOM   3437 C CA  B ARG A 1 465 ? -12.313 35.230 59.181 0.50 22.31 ? 446  ARG A CA  1 
ATOM   3438 C C   A ARG A 1 465 ? -11.259 34.571 58.269 0.50 21.57 ? 446  ARG A C   1 
ATOM   3439 C C   B ARG A 1 465 ? -11.197 34.801 58.229 0.50 21.66 ? 446  ARG A C   1 
ATOM   3440 O O   A ARG A 1 465 ? -11.579 34.153 57.150 0.50 20.82 ? 446  ARG A O   1 
ATOM   3441 O O   B ARG A 1 465 ? -11.387 34.813 57.023 0.50 21.07 ? 446  ARG A O   1 
ATOM   3442 C CB  A ARG A 1 465 ? -13.494 34.356 59.416 0.50 21.92 ? 446  ARG A CB  1 
ATOM   3443 C CB  B ARG A 1 465 ? -13.437 34.166 59.216 0.50 22.25 ? 446  ARG A CB  1 
ATOM   3444 C CG  A ARG A 1 465 ? -14.533 35.037 60.309 0.50 21.38 ? 446  ARG A CG  1 
ATOM   3445 C CG  B ARG A 1 465 ? -14.668 34.479 60.103 0.50 23.08 ? 446  ARG A CG  1 
ATOM   3446 C CD  A ARG A 1 465 ? -15.458 34.048 60.903 0.50 20.16 ? 446  ARG A CD  1 
ATOM   3447 C CD  B ARG A 1 465 ? -15.784 35.258 59.364 0.50 24.31 ? 446  ARG A CD  1 
ATOM   3448 N NE  A ARG A 1 465 ? -14.696 33.049 61.637 0.50 22.74 ? 446  ARG A NE  1 
ATOM   3449 N NE  B ARG A 1 465 ? -16.426 34.554 58.243 0.50 23.83 ? 446  ARG A NE  1 
ATOM   3450 C CZ  A ARG A 1 465 ? -15.232 32.033 62.306 0.50 24.64 ? 446  ARG A CZ  1 
ATOM   3451 C CZ  B ARG A 1 465 ? -17.384 33.631 58.358 0.50 24.11 ? 446  ARG A CZ  1 
ATOM   3452 N NH1 A ARG A 1 465 ? -16.554 31.869 62.350 0.50 23.85 ? 446  ARG A NH1 1 
ATOM   3453 N NH1 B ARG A 1 465 ? -17.838 33.248 59.548 0.50 22.66 ? 446  ARG A NH1 1 
ATOM   3454 N NH2 A ARG A 1 465 ? -14.438 31.184 62.935 0.50 24.91 ? 446  ARG A NH2 1 
ATOM   3455 N NH2 B ARG A 1 465 ? -17.885 33.069 57.262 0.50 25.37 ? 446  ARG A NH2 1 
ATOM   3456 N N   . GLN A 1 466 ? -10.032 34.456 58.776 1.00 20.43 ? 447  GLN A N   1 
ATOM   3457 C CA  . GLN A 1 466 ? -8.937  33.865 58.024 1.00 20.08 ? 447  GLN A CA  1 
ATOM   3458 C C   . GLN A 1 466 ? -9.140  32.355 57.809 1.00 18.75 ? 447  GLN A C   1 
ATOM   3459 O O   . GLN A 1 466 ? -9.708  31.656 58.682 1.00 18.40 ? 447  GLN A O   1 
ATOM   3460 C CB  . GLN A 1 466 ? -7.617  34.106 58.774 1.00 19.98 ? 447  GLN A CB  1 
ATOM   3461 C CG  . GLN A 1 466 ? -7.140  35.559 58.756 1.00 22.40 ? 447  GLN A CG  1 
ATOM   3462 C CD  . GLN A 1 466 ? -5.705  35.668 59.184 1.00 26.06 ? 447  GLN A CD  1 
ATOM   3463 O OE1 . GLN A 1 466 ? -5.408  35.453 60.335 1.00 29.15 ? 447  GLN A OE1 1 
ATOM   3464 N NE2 . GLN A 1 466 ? -4.798  35.981 58.256 1.00 23.69 ? 447  GLN A NE2 1 
ATOM   3465 N N   . THR A 1 467 ? -8.668  31.836 56.674 1.00 18.09 ? 448  THR A N   1 
ATOM   3466 C CA  . THR A 1 467 ? -8.763  30.394 56.449 1.00 17.60 ? 448  THR A CA  1 
ATOM   3467 C C   . THR A 1 467 ? -7.654  29.594 57.158 1.00 18.40 ? 448  THR A C   1 
ATOM   3468 O O   . THR A 1 467 ? -6.641  30.165 57.584 1.00 19.11 ? 448  THR A O   1 
ATOM   3469 C CB  . THR A 1 467 ? -8.735  30.044 54.970 1.00 18.14 ? 448  THR A CB  1 
ATOM   3470 O OG1 . THR A 1 467 ? -7.542  30.561 54.387 1.00 15.14 ? 448  THR A OG1 1 
ATOM   3471 C CG2 . THR A 1 467 ? -10.027 30.585 54.190 1.00 15.53 ? 448  THR A CG2 1 
ATOM   3472 N N   . LEU A 1 468 ? -7.880  28.286 57.287 1.00 19.08 ? 449  LEU A N   1 
ATOM   3473 C CA  . LEU A 1 468 ? -6.858  27.319 57.664 1.00 19.39 ? 449  LEU A CA  1 
ATOM   3474 C C   . LEU A 1 468 ? -5.636  27.560 56.804 1.00 19.73 ? 449  LEU A C   1 
ATOM   3475 O O   . LEU A 1 468 ? -4.507  27.643 57.310 1.00 19.26 ? 449  LEU A O   1 
ATOM   3476 C CB  . LEU A 1 468 ? -7.377  25.872 57.500 1.00 18.69 ? 449  LEU A CB  1 
ATOM   3477 C CG  . LEU A 1 468 ? -6.383  24.723 57.707 1.00 21.22 ? 449  LEU A CG  1 
ATOM   3478 C CD1 . LEU A 1 468 ? -5.813  24.723 59.226 1.00 18.68 ? 449  LEU A CD1 1 
ATOM   3479 C CD2 . LEU A 1 468 ? -7.051  23.384 57.360 1.00 18.10 ? 449  LEU A CD2 1 
ATOM   3480 N N   . PHE A 1 469 ? -5.842  27.733 55.500 1.00 19.19 ? 450  PHE A N   1 
ATOM   3481 C CA  . PHE A 1 469 ? -4.702  27.895 54.612 1.00 19.17 ? 450  PHE A CA  1 
ATOM   3482 C C   . PHE A 1 469 ? -3.866  29.123 54.981 1.00 19.82 ? 450  PHE A C   1 
ATOM   3483 O O   . PHE A 1 469 ? -2.659  29.026 55.064 1.00 19.21 ? 450  PHE A O   1 
ATOM   3484 C CB  . PHE A 1 469 ? -5.154  27.976 53.138 1.00 20.54 ? 450  PHE A CB  1 
ATOM   3485 C CG  . PHE A 1 469 ? -4.013  27.952 52.153 1.00 21.51 ? 450  PHE A CG  1 
ATOM   3486 C CD1 . PHE A 1 469 ? -3.566  26.740 51.610 1.00 25.59 ? 450  PHE A CD1 1 
ATOM   3487 C CD2 . PHE A 1 469 ? -3.412  29.132 51.742 1.00 22.82 ? 450  PHE A CD2 1 
ATOM   3488 C CE1 . PHE A 1 469 ? -2.484  26.725 50.696 1.00 23.23 ? 450  PHE A CE1 1 
ATOM   3489 C CE2 . PHE A 1 469 ? -2.343  29.137 50.811 1.00 22.80 ? 450  PHE A CE2 1 
ATOM   3490 C CZ  . PHE A 1 469 ? -1.874  27.923 50.319 1.00 22.51 ? 450  PHE A CZ  1 
ATOM   3491 N N   . ALA A 1 470 ? -4.511  30.288 55.117 1.00 18.67 ? 451  ALA A N   1 
ATOM   3492 C CA  . ALA A 1 470 ? -3.866  31.479 55.612 1.00 20.40 ? 451  ALA A CA  1 
ATOM   3493 C C   . ALA A 1 470 ? -3.091  31.305 56.944 1.00 20.33 ? 451  ALA A C   1 
ATOM   3494 O O   . ALA A 1 470 ? -1.971  31.825 57.080 1.00 20.48 ? 451  ALA A O   1 
ATOM   3495 C CB  . ALA A 1 470 ? -4.881  32.622 55.748 1.00 19.43 ? 451  ALA A CB  1 
ATOM   3496 N N   A SER A 1 471 ? -3.653  30.557 57.900 0.50 21.54 ? 452  SER A N   1 
ATOM   3497 N N   B SER A 1 471 ? -3.735  30.663 57.919 0.50 21.47 ? 452  SER A N   1 
ATOM   3498 C CA  A SER A 1 471 ? -2.946  30.298 59.175 0.50 21.54 ? 452  SER A CA  1 
ATOM   3499 C CA  B SER A 1 471 ? -3.146  30.481 59.243 0.50 21.34 ? 452  SER A CA  1 
ATOM   3500 C C   A SER A 1 471 ? -1.746  29.350 59.007 0.50 21.30 ? 452  SER A C   1 
ATOM   3501 C C   B SER A 1 471 ? -1.871  29.650 59.110 0.50 21.42 ? 452  SER A C   1 
ATOM   3502 O O   A SER A 1 471 ? -0.739  29.512 59.697 0.50 20.25 ? 452  SER A O   1 
ATOM   3503 O O   B SER A 1 471 ? -0.849  30.009 59.687 0.50 20.39 ? 452  SER A O   1 
ATOM   3504 C CB  A SER A 1 471 ? -3.883  29.789 60.269 0.50 21.43 ? 452  SER A CB  1 
ATOM   3505 C CB  B SER A 1 471 ? -4.133  29.832 60.206 0.50 21.37 ? 452  SER A CB  1 
ATOM   3506 O OG  A SER A 1 471 ? -4.296  28.473 59.990 0.50 22.50 ? 452  SER A OG  1 
ATOM   3507 O OG  B SER A 1 471 ? -5.349  30.566 60.227 0.50 21.32 ? 452  SER A OG  1 
ATOM   3508 N N   A GLN A 1 472 ? -1.837  28.383 58.089 0.50 20.93 ? 453  GLN A N   1 
ATOM   3509 N N   B GLN A 1 472 ? -1.917  28.589 58.298 0.50 21.34 ? 453  GLN A N   1 
ATOM   3510 C CA  A GLN A 1 472 ? -0.680  27.506 57.791 0.50 21.73 ? 453  GLN A CA  1 
ATOM   3511 C CA  B GLN A 1 472 ? -0.725  27.745 58.065 0.50 22.28 ? 453  GLN A CA  1 
ATOM   3512 C C   A GLN A 1 472 ? 0.439   28.307 57.128 0.50 21.93 ? 453  GLN A C   1 
ATOM   3513 C C   B GLN A 1 472 ? 0.402   28.472 57.308 0.50 22.38 ? 453  GLN A C   1 
ATOM   3514 O O   A GLN A 1 472 ? 1.621   28.084 57.387 0.50 22.16 ? 453  GLN A O   1 
ATOM   3515 O O   B GLN A 1 472 ? 1.571   28.338 57.674 0.50 22.47 ? 453  GLN A O   1 
ATOM   3516 C CB  A GLN A 1 472 ? -1.068  26.312 56.883 0.50 21.45 ? 453  GLN A CB  1 
ATOM   3517 C CB  B GLN A 1 472 ? -1.095  26.410 57.384 0.50 22.82 ? 453  GLN A CB  1 
ATOM   3518 C CG  A GLN A 1 472 ? -2.026  25.336 57.529 0.50 23.43 ? 453  GLN A CG  1 
ATOM   3519 C CG  B GLN A 1 472 ? -2.011  25.506 58.234 0.50 26.91 ? 453  GLN A CG  1 
ATOM   3520 C CD  A GLN A 1 472 ? -2.631  24.317 56.568 0.50 22.86 ? 453  GLN A CD  1 
ATOM   3521 C CD  B GLN A 1 472 ? -1.254  24.468 59.031 0.50 30.21 ? 453  GLN A CD  1 
ATOM   3522 O OE1 A GLN A 1 472 ? -3.021  24.621 55.426 0.50 23.44 ? 453  GLN A OE1 1 
ATOM   3523 O OE1 B GLN A 1 472 ? -0.301  23.876 58.530 0.50 35.26 ? 453  GLN A OE1 1 
ATOM   3524 N NE2 A GLN A 1 472 ? -2.740  23.109 57.044 0.50 22.70 ? 453  GLN A NE2 1 
ATOM   3525 N NE2 B GLN A 1 472 ? -1.676  24.231 60.282 0.50 36.68 ? 453  GLN A NE2 1 
ATOM   3526 N N   . VAL A 1 473 ? 0.061   29.249 56.273 1.00 21.53 ? 454  VAL A N   1 
ATOM   3527 C CA  . VAL A 1 473 ? 1.054   30.115 55.629 1.00 21.97 ? 454  VAL A CA  1 
ATOM   3528 C C   . VAL A 1 473 ? 1.800   30.989 56.681 1.00 22.18 ? 454  VAL A C   1 
ATOM   3529 O O   . VAL A 1 473 ? 3.025   30.973 56.729 1.00 21.64 ? 454  VAL A O   1 
ATOM   3530 C CB  . VAL A 1 473 ? 0.458   31.026 54.528 1.00 21.26 ? 454  VAL A CB  1 
ATOM   3531 C CG1 . VAL A 1 473 ? 1.511   32.001 54.045 1.00 21.90 ? 454  VAL A CG1 1 
ATOM   3532 C CG2 . VAL A 1 473 ? -0.099  30.198 53.312 1.00 19.95 ? 454  VAL A CG2 1 
ATOM   3533 N N   . MET A 1 474 ? 1.055   31.671 57.551 1.00 21.98 ? 455  MET A N   1 
ATOM   3534 C CA  . MET A 1 474 ? 1.638   32.589 58.511 1.00 24.46 ? 455  MET A CA  1 
ATOM   3535 C C   . MET A 1 474 ? 2.569   31.836 59.449 1.00 23.38 ? 455  MET A C   1 
ATOM   3536 O O   . MET A 1 474 ? 3.638   32.323 59.764 1.00 23.65 ? 455  MET A O   1 
ATOM   3537 C CB  . MET A 1 474 ? 0.554   33.332 59.297 1.00 23.60 ? 455  MET A CB  1 
ATOM   3538 C CG  . MET A 1 474 ? -0.269  34.296 58.457 1.00 26.38 ? 455  MET A CG  1 
ATOM   3539 S SD  . MET A 1 474 ? -1.535  35.081 59.482 1.00 31.89 ? 455  MET A SD  1 
ATOM   3540 C CE  . MET A 1 474 ? -0.639  36.434 60.181 1.00 33.73 ? 455  MET A CE  1 
ATOM   3541 N N   A ARG A 1 475 ? 2.176   30.626 59.861 0.50 23.16 ? 456  ARG A N   1 
ATOM   3542 N N   B ARG A 1 475 ? 2.138   30.624 59.800 0.50 23.15 ? 456  ARG A N   1 
ATOM   3543 C CA  A ARG A 1 475 ? 2.944   29.841 60.829 0.50 23.45 ? 456  ARG A CA  1 
ATOM   3544 C CA  B ARG A 1 475 ? 2.772   29.737 60.746 0.50 23.17 ? 456  ARG A CA  1 
ATOM   3545 C C   A ARG A 1 475 ? 4.141   29.065 60.262 0.50 23.14 ? 456  ARG A C   1 
ATOM   3546 C C   B ARG A 1 475 ? 4.065   29.080 60.259 0.50 23.07 ? 456  ARG A C   1 
ATOM   3547 O O   A ARG A 1 475 ? 5.127   28.860 60.974 0.50 22.28 ? 456  ARG A O   1 
ATOM   3548 O O   B ARG A 1 475 ? 5.034   28.976 61.018 0.50 22.16 ? 456  ARG A O   1 
ATOM   3549 C CB  A ARG A 1 475 ? 2.031   28.897 61.634 0.50 23.30 ? 456  ARG A CB  1 
ATOM   3550 C CB  B ARG A 1 475 ? 1.764   28.651 61.134 0.50 23.37 ? 456  ARG A CB  1 
ATOM   3551 C CG  A ARG A 1 475 ? 2.664   28.381 62.941 0.50 25.04 ? 456  ARG A CG  1 
ATOM   3552 C CG  B ARG A 1 475 ? 2.077   28.003 62.410 0.50 24.64 ? 456  ARG A CG  1 
ATOM   3553 C CD  A ARG A 1 475 ? 1.723   27.485 63.761 0.50 24.35 ? 456  ARG A CD  1 
ATOM   3554 C CD  B ARG A 1 475 ? 1.042   27.028 62.887 0.50 24.28 ? 456  ARG A CD  1 
ATOM   3555 N NE  A ARG A 1 475 ? 0.331   27.952 63.760 0.50 28.51 ? 456  ARG A NE  1 
ATOM   3556 N NE  B ARG A 1 475 ? 1.564   26.513 64.144 0.50 26.45 ? 456  ARG A NE  1 
ATOM   3557 C CZ  A ARG A 1 475 ? -0.133  28.983 64.469 0.50 28.74 ? 456  ARG A CZ  1 
ATOM   3558 C CZ  B ARG A 1 475 ? 1.010   25.569 64.893 0.50 28.12 ? 456  ARG A CZ  1 
ATOM   3559 N NH1 A ARG A 1 475 ? 0.689   29.702 65.228 0.50 28.01 ? 456  ARG A NH1 1 
ATOM   3560 N NH1 B ARG A 1 475 ? -0.127  24.983 64.519 0.50 30.38 ? 456  ARG A NH1 1 
ATOM   3561 N NH2 A ARG A 1 475 ? -1.422  29.320 64.390 0.50 28.59 ? 456  ARG A NH2 1 
ATOM   3562 N NH2 B ARG A 1 475 ? 1.607   25.212 66.024 0.50 25.90 ? 456  ARG A NH2 1 
ATOM   3563 N N   . TYR A 1 476 ? 4.066   28.616 59.013 1.00 22.10 ? 457  TYR A N   1 
ATOM   3564 C CA  . TYR A 1 476 ? 5.148   27.774 58.505 1.00 22.56 ? 457  TYR A CA  1 
ATOM   3565 C C   . TYR A 1 476 ? 5.981   28.328 57.332 1.00 20.91 ? 457  TYR A C   1 
ATOM   3566 O O   . TYR A 1 476 ? 7.059   27.809 57.123 1.00 21.64 ? 457  TYR A O   1 
ATOM   3567 C CB  . TYR A 1 476 ? 4.686   26.318 58.192 1.00 22.98 ? 457  TYR A CB  1 
ATOM   3568 C CG  . TYR A 1 476 ? 4.105   25.620 59.383 1.00 24.06 ? 457  TYR A CG  1 
ATOM   3569 C CD1 . TYR A 1 476 ? 4.922   25.159 60.418 1.00 24.88 ? 457  TYR A CD1 1 
ATOM   3570 C CD2 . TYR A 1 476 ? 2.714   25.437 59.494 1.00 26.73 ? 457  TYR A CD2 1 
ATOM   3571 C CE1 . TYR A 1 476 ? 4.350   24.539 61.581 1.00 28.43 ? 457  TYR A CE1 1 
ATOM   3572 C CE2 . TYR A 1 476 ? 2.134   24.793 60.615 1.00 26.14 ? 457  TYR A CE2 1 
ATOM   3573 C CZ  . TYR A 1 476 ? 2.952   24.357 61.638 1.00 28.63 ? 457  TYR A CZ  1 
ATOM   3574 O OH  . TYR A 1 476 ? 2.374   23.739 62.710 1.00 32.13 ? 457  TYR A OH  1 
ATOM   3575 N N   . ALA A 1 477 ? 5.500   29.354 56.625 1.00 19.74 ? 458  ALA A N   1 
ATOM   3576 C CA  . ALA A 1 477 ? 6.239   29.942 55.495 1.00 20.00 ? 458  ALA A CA  1 
ATOM   3577 C C   . ALA A 1 477 ? 6.984   31.169 56.037 1.00 19.38 ? 458  ALA A C   1 
ATOM   3578 O O   . ALA A 1 477 ? 6.363   32.139 56.406 1.00 20.81 ? 458  ALA A O   1 
ATOM   3579 C CB  . ALA A 1 477 ? 5.291   30.371 54.373 1.00 18.51 ? 458  ALA A CB  1 
ATOM   3580 N N   . ASP A 1 478 ? 8.306   31.148 56.071 1.00 19.97 ? 459  ASP A N   1 
ATOM   3581 C CA  . ASP A 1 478 ? 9.027   32.341 56.583 1.00 19.28 ? 459  ASP A CA  1 
ATOM   3582 C C   . ASP A 1 478 ? 8.828   33.467 55.663 1.00 18.52 ? 459  ASP A C   1 
ATOM   3583 O O   . ASP A 1 478 ? 8.656   34.614 56.100 1.00 17.93 ? 459  ASP A O   1 
ATOM   3584 C CB  . ASP A 1 478 ? 10.518  32.074 56.761 1.00 19.73 ? 459  ASP A CB  1 
ATOM   3585 C CG  . ASP A 1 478 ? 10.790  30.971 57.789 1.00 22.23 ? 459  ASP A CG  1 
ATOM   3586 O OD1 . ASP A 1 478 ? 10.013  30.905 58.785 1.00 26.76 ? 459  ASP A OD1 1 
ATOM   3587 O OD2 . ASP A 1 478 ? 11.746  30.161 57.620 1.00 20.58 ? 459  ASP A OD2 1 
ATOM   3588 N N   . LEU A 1 479 ? 8.883   33.147 54.364 1.00 18.54 ? 460  LEU A N   1 
ATOM   3589 C CA  . LEU A 1 479 ? 8.700   34.121 53.287 1.00 18.70 ? 460  LEU A CA  1 
ATOM   3590 C C   . LEU A 1 479 ? 7.690   33.542 52.315 1.00 18.65 ? 460  LEU A C   1 
ATOM   3591 O O   . LEU A 1 479 ? 7.588   32.315 52.217 1.00 17.72 ? 460  LEU A O   1 
ATOM   3592 C CB  . LEU A 1 479 ? 10.039  34.317 52.510 1.00 19.28 ? 460  LEU A CB  1 
ATOM   3593 C CG  . LEU A 1 479 ? 11.339  34.714 53.211 1.00 20.19 ? 460  LEU A CG  1 
ATOM   3594 C CD1 . LEU A 1 479 ? 12.528  34.777 52.159 1.00 19.76 ? 460  LEU A CD1 1 
ATOM   3595 C CD2 . LEU A 1 479 ? 11.161  36.079 53.885 1.00 21.87 ? 460  LEU A CD2 1 
ATOM   3596 N N   . TYR A 1 480 ? 6.967   34.406 51.585 1.00 18.71 ? 461  TYR A N   1 
ATOM   3597 C CA  . TYR A 1 480 ? 6.051   33.924 50.552 1.00 19.20 ? 461  TYR A CA  1 
ATOM   3598 C C   . TYR A 1 480 ? 5.877   34.961 49.474 1.00 19.57 ? 461  TYR A C   1 
ATOM   3599 O O   . TYR A 1 480 ? 6.154   36.141 49.683 1.00 19.47 ? 461  TYR A O   1 
ATOM   3600 C CB  . TYR A 1 480 ? 4.694   33.434 51.129 1.00 19.43 ? 461  TYR A CB  1 
ATOM   3601 C CG  . TYR A 1 480 ? 3.749   34.495 51.644 1.00 20.47 ? 461  TYR A CG  1 
ATOM   3602 C CD1 . TYR A 1 480 ? 2.746   35.012 50.836 1.00 20.55 ? 461  TYR A CD1 1 
ATOM   3603 C CD2 . TYR A 1 480 ? 3.846   34.964 52.971 1.00 19.45 ? 461  TYR A CD2 1 
ATOM   3604 C CE1 . TYR A 1 480 ? 1.882   36.010 51.289 1.00 22.93 ? 461  TYR A CE1 1 
ATOM   3605 C CE2 . TYR A 1 480 ? 2.971   35.940 53.463 1.00 19.57 ? 461  TYR A CE2 1 
ATOM   3606 C CZ  . TYR A 1 480 ? 1.968   36.432 52.645 1.00 23.54 ? 461  TYR A CZ  1 
ATOM   3607 O OH  . TYR A 1 480 ? 1.094   37.389 53.129 1.00 21.70 ? 461  TYR A OH  1 
ATOM   3608 N N   . ALA A 1 481 ? 5.417   34.525 48.303 1.00 20.62 ? 462  ALA A N   1 
ATOM   3609 C CA  . ALA A 1 481 ? 5.227   35.435 47.157 1.00 20.06 ? 462  ALA A CA  1 
ATOM   3610 C C   . ALA A 1 481 ? 4.444   34.716 46.084 1.00 21.17 ? 462  ALA A C   1 
ATOM   3611 O O   . ALA A 1 481 ? 4.294   33.500 46.165 1.00 20.68 ? 462  ALA A O   1 
ATOM   3612 C CB  . ALA A 1 481 ? 6.576   35.891 46.611 1.00 21.07 ? 462  ALA A CB  1 
ATOM   3613 N N   . ALA A 1 482 ? 3.957   35.455 45.074 1.00 22.86 ? 463  ALA A N   1 
ATOM   3614 C CA  . ALA A 1 482 ? 3.274   34.835 43.927 1.00 24.76 ? 463  ALA A CA  1 
ATOM   3615 C C   . ALA A 1 482 ? 4.255   33.999 43.112 1.00 25.97 ? 463  ALA A C   1 
ATOM   3616 O O   . ALA A 1 482 ? 3.851   33.022 42.492 1.00 27.56 ? 463  ALA A O   1 
ATOM   3617 C CB  . ALA A 1 482 ? 2.618   35.901 43.027 1.00 24.56 ? 463  ALA A CB  1 
ATOM   3618 N N   . SER A 1 483 ? 5.539   34.383 43.132 1.00 24.97 ? 464  SER A N   1 
ATOM   3619 C CA  . SER A 1 483 ? 6.606   33.661 42.401 1.00 24.38 ? 464  SER A CA  1 
ATOM   3620 C C   . SER A 1 483 ? 7.906   33.775 43.184 1.00 23.38 ? 464  SER A C   1 
ATOM   3621 O O   . SER A 1 483 ? 8.153   34.811 43.776 1.00 22.90 ? 464  SER A O   1 
ATOM   3622 C CB  . SER A 1 483 ? 6.867   34.320 41.028 1.00 24.42 ? 464  SER A CB  1 
ATOM   3623 O OG  . SER A 1 483 ? 7.915   33.617 40.367 1.00 25.40 ? 464  SER A OG  1 
ATOM   3624 N N   . PHE A 1 484 ? 8.774   32.764 43.134 1.00 22.74 ? 465  PHE A N   1 
ATOM   3625 C CA  . PHE A 1 484 ? 10.097  32.945 43.774 1.00 23.05 ? 465  PHE A CA  1 
ATOM   3626 C C   . PHE A 1 484 ? 11.009  33.891 42.948 1.00 22.29 ? 465  PHE A C   1 
ATOM   3627 O O   . PHE A 1 484 ? 12.075  34.316 43.422 1.00 21.06 ? 465  PHE A O   1 
ATOM   3628 C CB  . PHE A 1 484 ? 10.781  31.582 44.015 1.00 24.16 ? 465  PHE A CB  1 
ATOM   3629 C CG  . PHE A 1 484 ? 11.453  31.065 42.795 1.00 24.03 ? 465  PHE A CG  1 
ATOM   3630 C CD1 . PHE A 1 484 ? 12.731  31.497 42.463 1.00 25.69 ? 465  PHE A CD1 1 
ATOM   3631 C CD2 . PHE A 1 484 ? 10.789  30.227 41.947 1.00 28.03 ? 465  PHE A CD2 1 
ATOM   3632 C CE1 . PHE A 1 484 ? 13.385  31.067 41.293 1.00 27.64 ? 465  PHE A CE1 1 
ATOM   3633 C CE2 . PHE A 1 484 ? 11.403  29.802 40.741 1.00 33.09 ? 465  PHE A CE2 1 
ATOM   3634 C CZ  . PHE A 1 484 ? 12.714  30.228 40.423 1.00 31.96 ? 465  PHE A CZ  1 
ATOM   3635 N N   . ILE A 1 485 ? 10.628  34.192 41.697 1.00 21.88 ? 466  ILE A N   1 
ATOM   3636 C CA  . ILE A 1 485 ? 11.394  35.153 40.912 1.00 22.62 ? 466  ILE A CA  1 
ATOM   3637 C C   . ILE A 1 485 ? 11.551  36.512 41.645 1.00 22.04 ? 466  ILE A C   1 
ATOM   3638 O O   . ILE A 1 485 ? 12.473  37.278 41.352 1.00 21.26 ? 466  ILE A O   1 
ATOM   3639 C CB  . ILE A 1 485 ? 10.811  35.417 39.457 1.00 23.67 ? 466  ILE A CB  1 
ATOM   3640 C CG1 . ILE A 1 485 ? 11.948  35.917 38.549 1.00 23.97 ? 466  ILE A CG1 1 
ATOM   3641 C CG2 . ILE A 1 485 ? 9.765   36.545 39.467 1.00 23.67 ? 466  ILE A CG2 1 
ATOM   3642 C CD1 . ILE A 1 485 ? 13.068  34.841 38.389 1.00 29.59 ? 466  ILE A CD1 1 
ATOM   3643 N N   . ASN A 1 486 ? 10.636  36.805 42.581 1.00 21.79 ? 467  ASN A N   1 
ATOM   3644 C CA  . ASN A 1 486 ? 10.613  38.112 43.261 1.00 22.15 ? 467  ASN A CA  1 
ATOM   3645 C C   . ASN A 1 486 ? 11.857  38.330 44.094 1.00 21.81 ? 467  ASN A C   1 
ATOM   3646 O O   . ASN A 1 486 ? 12.224  39.459 44.336 1.00 22.03 ? 467  ASN A O   1 
ATOM   3647 C CB  . ASN A 1 486 ? 9.317   38.279 44.099 1.00 23.07 ? 467  ASN A CB  1 
ATOM   3648 C CG  . ASN A 1 486 ? 8.083   38.419 43.217 1.00 25.42 ? 467  ASN A CG  1 
ATOM   3649 O OD1 . ASN A 1 486 ? 8.225   38.534 41.987 1.00 25.56 ? 467  ASN A OD1 1 
ATOM   3650 N ND2 . ASN A 1 486 ? 6.874   38.394 43.819 1.00 25.20 ? 467  ASN A ND2 1 
ATOM   3651 N N   . LEU A 1 487 ? 12.536  37.234 44.457 1.00 21.21 ? 468  LEU A N   1 
ATOM   3652 C CA  . LEU A 1 487 ? 13.871  37.264 45.070 1.00 20.51 ? 468  LEU A CA  1 
ATOM   3653 C C   . LEU A 1 487 ? 14.939  38.026 44.271 1.00 20.63 ? 468  LEU A C   1 
ATOM   3654 O O   . LEU A 1 487 ? 15.898  38.562 44.857 1.00 19.82 ? 468  LEU A O   1 
ATOM   3655 C CB  . LEU A 1 487 ? 14.353  35.836 45.417 1.00 20.65 ? 468  LEU A CB  1 
ATOM   3656 C CG  . LEU A 1 487 ? 13.561  35.133 46.517 1.00 20.66 ? 468  LEU A CG  1 
ATOM   3657 C CD1 . LEU A 1 487 ? 13.976  33.653 46.612 1.00 20.75 ? 468  LEU A CD1 1 
ATOM   3658 C CD2 . LEU A 1 487 ? 13.818  35.861 47.839 1.00 19.38 ? 468  LEU A CD2 1 
ATOM   3659 N N   . LEU A 1 488 ? 14.751  38.102 42.947 1.00 20.38 ? 469  LEU A N   1 
ATOM   3660 C CA  . LEU A 1 488 ? 15.673  38.791 42.054 1.00 20.31 ? 469  LEU A CA  1 
ATOM   3661 C C   . LEU A 1 488 ? 15.711  40.284 42.344 1.00 20.55 ? 469  LEU A C   1 
ATOM   3662 O O   . LEU A 1 488 ? 16.700  40.958 42.000 1.00 19.42 ? 469  LEU A O   1 
ATOM   3663 C CB  . LEU A 1 488 ? 15.287  38.561 40.584 1.00 20.32 ? 469  LEU A CB  1 
ATOM   3664 C CG  . LEU A 1 488 ? 16.228  38.999 39.446 1.00 20.20 ? 469  LEU A CG  1 
ATOM   3665 C CD1 . LEU A 1 488 ? 17.590  38.286 39.449 1.00 19.84 ? 469  LEU A CD1 1 
ATOM   3666 C CD2 . LEU A 1 488 ? 15.524  38.778 38.155 1.00 20.78 ? 469  LEU A CD2 1 
ATOM   3667 N N   . TYR A 1 489 ? 14.650  40.780 42.992 1.00 21.41 ? 470  TYR A N   1 
ATOM   3668 C CA  . TYR A 1 489 ? 14.495  42.211 43.236 1.00 23.38 ? 470  TYR A CA  1 
ATOM   3669 C C   . TYR A 1 489 ? 15.087  42.650 44.549 1.00 23.40 ? 470  TYR A C   1 
ATOM   3670 O O   . TYR A 1 489 ? 14.995  43.826 44.891 1.00 24.03 ? 470  TYR A O   1 
ATOM   3671 C CB  . TYR A 1 489 ? 13.033  42.706 43.026 1.00 24.55 ? 470  TYR A CB  1 
ATOM   3672 C CG  . TYR A 1 489 ? 12.508  42.129 41.739 1.00 25.45 ? 470  TYR A CG  1 
ATOM   3673 C CD1 . TYR A 1 489 ? 13.261  42.251 40.564 1.00 28.97 ? 470  TYR A CD1 1 
ATOM   3674 C CD2 . TYR A 1 489 ? 11.330  41.403 41.703 1.00 24.97 ? 470  TYR A CD2 1 
ATOM   3675 C CE1 . TYR A 1 489 ? 12.852  41.683 39.382 1.00 28.65 ? 470  TYR A CE1 1 
ATOM   3676 C CE2 . TYR A 1 489 ? 10.908  40.816 40.517 1.00 29.30 ? 470  TYR A CE2 1 
ATOM   3677 C CZ  . TYR A 1 489 ? 11.691  40.976 39.366 1.00 27.86 ? 470  TYR A CZ  1 
ATOM   3678 O OH  . TYR A 1 489 ? 11.324  40.418 38.197 1.00 30.26 ? 470  TYR A OH  1 
ATOM   3679 N N   . TYR A 1 490 ? 15.743  41.729 45.248 1.00 23.35 ? 471  TYR A N   1 
ATOM   3680 C CA  . TYR A 1 490 ? 16.321  42.017 46.576 1.00 23.64 ? 471  TYR A CA  1 
ATOM   3681 C C   . TYR A 1 490 ? 17.802  41.742 46.509 1.00 24.60 ? 471  TYR A C   1 
ATOM   3682 O O   . TYR A 1 490 ? 18.220  40.802 45.833 1.00 25.16 ? 471  TYR A O   1 
ATOM   3683 C CB  . TYR A 1 490 ? 15.645  41.185 47.700 1.00 22.29 ? 471  TYR A CB  1 
ATOM   3684 C CG  . TYR A 1 490 ? 14.194  41.549 47.899 1.00 22.56 ? 471  TYR A CG  1 
ATOM   3685 C CD1 . TYR A 1 490 ? 13.808  42.501 48.872 1.00 22.18 ? 471  TYR A CD1 1 
ATOM   3686 C CD2 . TYR A 1 490 ? 13.196  40.973 47.110 1.00 20.39 ? 471  TYR A CD2 1 
ATOM   3687 C CE1 . TYR A 1 490 ? 12.477  42.846 49.049 1.00 20.30 ? 471  TYR A CE1 1 
ATOM   3688 C CE2 . TYR A 1 490 ? 11.893  41.309 47.272 1.00 18.25 ? 471  TYR A CE2 1 
ATOM   3689 C CZ  . TYR A 1 490 ? 11.533  42.241 48.256 1.00 20.73 ? 471  TYR A CZ  1 
ATOM   3690 O OH  . TYR A 1 490 ? 10.220  42.583 48.407 1.00 21.84 ? 471  TYR A OH  1 
ATOM   3691 N N   . PRO A 1 491 ? 18.618  42.566 47.196 1.00 25.76 ? 472  PRO A N   1 
ATOM   3692 C CA  . PRO A 1 491 ? 20.057  42.284 47.095 1.00 26.32 ? 472  PRO A CA  1 
ATOM   3693 C C   . PRO A 1 491 ? 20.455  41.007 47.810 1.00 26.86 ? 472  PRO A C   1 
ATOM   3694 O O   . PRO A 1 491 ? 19.738  40.515 48.681 1.00 25.83 ? 472  PRO A O   1 
ATOM   3695 C CB  . PRO A 1 491 ? 20.713  43.495 47.774 1.00 25.96 ? 472  PRO A CB  1 
ATOM   3696 C CG  . PRO A 1 491 ? 19.660  43.947 48.787 1.00 26.24 ? 472  PRO A CG  1 
ATOM   3697 C CD  . PRO A 1 491 ? 18.332  43.723 48.071 1.00 24.67 ? 472  PRO A CD  1 
ATOM   3698 N N   . PHE A 1 492 ? 21.633  40.529 47.441 1.00 29.35 ? 473  PHE A N   1 
ATOM   3699 C CA  . PHE A 1 492 ? 22.275  39.308 47.969 1.00 31.67 ? 473  PHE A CA  1 
ATOM   3700 C C   . PHE A 1 492 ? 22.108  39.072 49.503 1.00 31.83 ? 473  PHE A C   1 
ATOM   3701 O O   . PHE A 1 492 ? 21.799  37.955 49.937 1.00 32.97 ? 473  PHE A O   1 
ATOM   3702 C CB  . PHE A 1 492 ? 23.789  39.327 47.558 1.00 32.73 ? 473  PHE A CB  1 
ATOM   3703 C CG  . PHE A 1 492 ? 24.055  38.895 46.107 1.00 35.03 ? 473  PHE A CG  1 
ATOM   3704 C CD1 . PHE A 1 492 ? 23.485  37.702 45.580 1.00 37.59 ? 473  PHE A CD1 1 
ATOM   3705 C CD2 . PHE A 1 492 ? 24.910  39.643 45.280 1.00 36.74 ? 473  PHE A CD2 1 
ATOM   3706 C CE1 . PHE A 1 492 ? 23.764  37.284 44.225 1.00 35.57 ? 473  PHE A CE1 1 
ATOM   3707 C CE2 . PHE A 1 492 ? 25.181  39.239 43.944 1.00 37.19 ? 473  PHE A CE2 1 
ATOM   3708 C CZ  . PHE A 1 492 ? 24.596  38.050 43.426 1.00 35.37 ? 473  PHE A CZ  1 
ATOM   3709 N N   . SER A 1 493 ? 22.295  40.132 50.293 1.00 30.61 ? 474  SER A N   1 
ATOM   3710 C CA  . SER A 1 493 ? 22.361  40.054 51.752 1.00 29.65 ? 474  SER A CA  1 
ATOM   3711 C C   . SER A 1 493 ? 21.226  40.802 52.464 1.00 28.34 ? 474  SER A C   1 
ATOM   3712 O O   . SER A 1 493 ? 21.370  41.207 53.632 1.00 27.24 ? 474  SER A O   1 
ATOM   3713 C CB  . SER A 1 493 ? 23.690  40.649 52.230 1.00 29.92 ? 474  SER A CB  1 
ATOM   3714 O OG  . SER A 1 493 ? 24.797  39.983 51.655 1.00 32.18 ? 474  SER A OG  1 
ATOM   3715 N N   . TYR A 1 494 ? 20.114  40.984 51.757 1.00 26.73 ? 475  TYR A N   1 
ATOM   3716 C CA  . TYR A 1 494 ? 18.933  41.601 52.325 1.00 25.83 ? 475  TYR A CA  1 
ATOM   3717 C C   . TYR A 1 494 ? 18.478  40.929 53.641 1.00 26.03 ? 475  TYR A C   1 
ATOM   3718 O O   . TYR A 1 494 ? 18.516  39.695 53.788 1.00 24.65 ? 475  TYR A O   1 
ATOM   3719 C CB  . TYR A 1 494 ? 17.818  41.605 51.278 1.00 25.70 ? 475  TYR A CB  1 
ATOM   3720 C CG  . TYR A 1 494 ? 16.631  42.493 51.607 1.00 25.11 ? 475  TYR A CG  1 
ATOM   3721 C CD1 . TYR A 1 494 ? 16.662  43.882 51.363 1.00 26.30 ? 475  TYR A CD1 1 
ATOM   3722 C CD2 . TYR A 1 494 ? 15.479  41.954 52.158 1.00 23.24 ? 475  TYR A CD2 1 
ATOM   3723 C CE1 . TYR A 1 494 ? 15.544  44.716 51.677 1.00 24.41 ? 475  TYR A CE1 1 
ATOM   3724 C CE2 . TYR A 1 494 ? 14.382  42.755 52.481 1.00 24.25 ? 475  TYR A CE2 1 
ATOM   3725 C CZ  . TYR A 1 494 ? 14.427  44.133 52.234 1.00 26.04 ? 475  TYR A CZ  1 
ATOM   3726 O OH  . TYR A 1 494 ? 13.326  44.890 52.554 1.00 27.34 ? 475  TYR A OH  1 
ATOM   3727 N N   . LEU A 1 495 ? 18.045  41.748 54.607 1.00 26.30 ? 476  LEU A N   1 
ATOM   3728 C CA  . LEU A 1 495 ? 17.380  41.225 55.810 1.00 26.03 ? 476  LEU A CA  1 
ATOM   3729 C C   . LEU A 1 495 ? 15.890  41.399 55.639 1.00 26.39 ? 476  LEU A C   1 
ATOM   3730 O O   . LEU A 1 495 ? 15.382  42.544 55.675 1.00 27.41 ? 476  LEU A O   1 
ATOM   3731 C CB  . LEU A 1 495 ? 17.879  41.921 57.101 1.00 25.63 ? 476  LEU A CB  1 
ATOM   3732 C CG  . LEU A 1 495 ? 17.307  41.503 58.492 1.00 26.27 ? 476  LEU A CG  1 
ATOM   3733 C CD1 . LEU A 1 495 ? 17.010  40.002 58.710 1.00 24.07 ? 476  LEU A CD1 1 
ATOM   3734 C CD2 . LEU A 1 495 ? 18.158  42.007 59.650 1.00 26.93 ? 476  LEU A CD2 1 
ATOM   3735 N N   . PHE A 1 496 ? 15.176  40.303 55.392 1.00 25.02 ? 477  PHE A N   1 
ATOM   3736 C CA  . PHE A 1 496 ? 13.734  40.376 55.413 1.00 25.55 ? 477  PHE A CA  1 
ATOM   3737 C C   . PHE A 1 496 ? 13.353  40.482 56.911 1.00 26.75 ? 477  PHE A C   1 
ATOM   3738 O O   . PHE A 1 496 ? 13.868  39.730 57.746 1.00 25.83 ? 477  PHE A O   1 
ATOM   3739 C CB  . PHE A 1 496 ? 13.088  39.166 54.716 1.00 24.80 ? 477  PHE A CB  1 
ATOM   3740 C CG  . PHE A 1 496 ? 13.376  39.092 53.239 1.00 24.15 ? 477  PHE A CG  1 
ATOM   3741 C CD1 . PHE A 1 496 ? 12.564  39.769 52.319 1.00 23.01 ? 477  PHE A CD1 1 
ATOM   3742 C CD2 . PHE A 1 496 ? 14.452  38.352 52.764 1.00 22.39 ? 477  PHE A CD2 1 
ATOM   3743 C CE1 . PHE A 1 496 ? 12.836  39.710 50.956 1.00 24.86 ? 477  PHE A CE1 1 
ATOM   3744 C CE2 . PHE A 1 496 ? 14.713  38.268 51.375 1.00 25.47 ? 477  PHE A CE2 1 
ATOM   3745 C CZ  . PHE A 1 496 ? 13.912  38.957 50.479 1.00 23.73 ? 477  PHE A CZ  1 
ATOM   3746 N N   . ARG A 1 497 ? 12.508  41.451 57.244 1.00 28.13 ? 478  ARG A N   1 
ATOM   3747 C CA  . ARG A 1 497 ? 12.221  41.752 58.642 1.00 29.76 ? 478  ARG A CA  1 
ATOM   3748 C C   . ARG A 1 497 ? 10.707  41.649 58.918 1.00 28.57 ? 478  ARG A C   1 
ATOM   3749 O O   . ARG A 1 497 ? 9.880   42.068 58.108 1.00 27.84 ? 478  ARG A O   1 
ATOM   3750 C CB  . ARG A 1 497 ? 12.804  43.126 59.017 1.00 30.02 ? 478  ARG A CB  1 
ATOM   3751 C CG  . ARG A 1 497 ? 13.591  43.130 60.375 1.00 34.44 ? 478  ARG A CG  1 
ATOM   3752 C CD  . ARG A 1 497 ? 13.826  44.579 61.015 1.00 35.29 ? 478  ARG A CD  1 
ATOM   3753 N NE  . ARG A 1 497 ? 12.579  45.355 61.205 1.00 45.37 ? 478  ARG A NE  1 
ATOM   3754 C CZ  . ARG A 1 497 ? 11.667  45.132 62.167 1.00 48.59 ? 478  ARG A CZ  1 
ATOM   3755 N NH1 . ARG A 1 497 ? 11.821  44.155 63.082 1.00 48.79 ? 478  ARG A NH1 1 
ATOM   3756 N NH2 . ARG A 1 497 ? 10.574  45.890 62.208 1.00 50.66 ? 478  ARG A NH2 1 
ATOM   3757 N N   . ALA A 1 498 ? 10.349  41.001 60.023 1.00 27.84 ? 479  ALA A N   1 
ATOM   3758 C CA  . ALA A 1 498 ? 8.985   41.048 60.514 1.00 28.45 ? 479  ALA A CA  1 
ATOM   3759 C C   . ALA A 1 498 ? 9.096   41.639 61.922 1.00 28.40 ? 479  ALA A C   1 
ATOM   3760 O O   . ALA A 1 498 ? 10.088  41.391 62.607 1.00 27.73 ? 479  ALA A O   1 
ATOM   3761 C CB  . ALA A 1 498 ? 8.370   39.639 60.542 1.00 27.48 ? 479  ALA A CB  1 
ATOM   3762 N N   . ALA A 1 499 ? 8.108   42.436 62.339 1.00 29.83 ? 480  ALA A N   1 
ATOM   3763 C CA  . ALA A 1 499 ? 8.068   43.009 63.707 1.00 31.17 ? 480  ALA A CA  1 
ATOM   3764 C C   . ALA A 1 499 ? 8.051   41.883 64.759 1.00 32.00 ? 480  ALA A C   1 
ATOM   3765 O O   . ALA A 1 499 ? 7.447   40.835 64.521 1.00 32.24 ? 480  ALA A O   1 
ATOM   3766 C CB  . ALA A 1 499 ? 6.833   43.887 63.880 1.00 31.24 ? 480  ALA A CB  1 
ATOM   3767 N N   . HIS A 1 500 ? 8.711   42.093 65.906 1.00 33.39 ? 481  HIS A N   1 
ATOM   3768 C CA  . HIS A 1 500 ? 8.638   41.100 66.994 1.00 34.99 ? 481  HIS A CA  1 
ATOM   3769 C C   . HIS A 1 500 ? 7.187   40.941 67.462 1.00 34.66 ? 481  HIS A C   1 
ATOM   3770 O O   . HIS A 1 500 ? 6.426   41.905 67.536 1.00 35.49 ? 481  HIS A O   1 
ATOM   3771 C CB  . HIS A 1 500 ? 9.562   41.426 68.186 1.00 35.49 ? 481  HIS A CB  1 
ATOM   3772 C CG  . HIS A 1 500 ? 11.030  41.462 67.851 1.00 38.36 ? 481  HIS A CG  1 
ATOM   3773 N ND1 . HIS A 1 500 ? 11.618  40.597 66.947 1.00 39.82 ? 481  HIS A ND1 1 
ATOM   3774 C CD2 . HIS A 1 500 ? 12.034  42.247 68.329 1.00 39.39 ? 481  HIS A CD2 1 
ATOM   3775 C CE1 . HIS A 1 500 ? 12.911  40.870 66.856 1.00 41.40 ? 481  HIS A CE1 1 
ATOM   3776 N NE2 . HIS A 1 500 ? 13.193  41.854 67.699 1.00 41.25 ? 481  HIS A NE2 1 
ATOM   3777 N N   . VAL A 1 501 ? 6.810   39.701 67.739 1.00 33.81 ? 482  VAL A N   1 
ATOM   3778 C CA  . VAL A 1 501 ? 5.490   39.375 68.275 1.00 31.96 ? 482  VAL A CA  1 
ATOM   3779 C C   . VAL A 1 501 ? 5.443   39.571 69.811 1.00 29.86 ? 482  VAL A C   1 
ATOM   3780 O O   . VAL A 1 501 ? 6.397   39.224 70.529 1.00 29.05 ? 482  VAL A O   1 
ATOM   3781 C CB  . VAL A 1 501 ? 5.070   37.956 67.814 1.00 31.75 ? 482  VAL A CB  1 
ATOM   3782 C CG1 . VAL A 1 501 ? 3.764   37.512 68.462 1.00 32.21 ? 482  VAL A CG1 1 
ATOM   3783 C CG2 . VAL A 1 501 ? 4.951   37.943 66.287 1.00 32.57 ? 482  VAL A CG2 1 
ATOM   3784 N N   . LEU A 1 502 ? 4.345   40.175 70.268 1.00 28.42 ? 483  LEU A N   1 
ATOM   3785 C CA  . LEU A 1 502 ? 4.019   40.378 71.702 1.00 26.28 ? 483  LEU A CA  1 
ATOM   3786 C C   . LEU A 1 502 ? 2.698   39.704 72.059 1.00 25.12 ? 483  LEU A C   1 
ATOM   3787 O O   . LEU A 1 502 ? 1.736   39.742 71.290 1.00 25.42 ? 483  LEU A O   1 
ATOM   3788 C CB  . LEU A 1 502 ? 3.942   41.870 72.065 1.00 26.84 ? 483  LEU A CB  1 
ATOM   3789 C CG  . LEU A 1 502 ? 5.242   42.688 72.070 1.00 27.90 ? 483  LEU A CG  1 
ATOM   3790 C CD1 . LEU A 1 502 ? 4.938   44.144 72.348 1.00 28.51 ? 483  LEU A CD1 1 
ATOM   3791 C CD2 . LEU A 1 502 ? 6.152   42.154 73.150 1.00 29.12 ? 483  LEU A CD2 1 
ATOM   3792 N N   . MET A 1 503 ? 2.641   39.089 73.228 1.00 22.94 ? 484  MET A N   1 
ATOM   3793 C CA  . MET A 1 503 ? 1.376   38.555 73.755 1.00 22.28 ? 484  MET A CA  1 
ATOM   3794 C C   . MET A 1 503 ? 0.516   39.755 74.204 1.00 21.23 ? 484  MET A C   1 
ATOM   3795 O O   . MET A 1 503 ? 1.060   40.801 74.413 1.00 21.43 ? 484  MET A O   1 
ATOM   3796 C CB  . MET A 1 503 ? 1.678   37.612 74.938 1.00 21.64 ? 484  MET A CB  1 
ATOM   3797 C CG  . MET A 1 503 ? 2.379   36.266 74.468 1.00 21.04 ? 484  MET A CG  1 
ATOM   3798 S SD  . MET A 1 503 ? 2.685   35.287 75.943 1.00 22.38 ? 484  MET A SD  1 
ATOM   3799 C CE  . MET A 1 503 ? 1.020   34.676 76.253 1.00 18.80 ? 484  MET A CE  1 
ATOM   3800 N N   . PRO A 1 504 ? -0.823  39.590 74.348 1.00 20.89 ? 485  PRO A N   1 
ATOM   3801 C CA  . PRO A 1 504 ? -1.744  40.589 74.915 1.00 20.35 ? 485  PRO A CA  1 
ATOM   3802 C C   . PRO A 1 504 ? -1.341  41.226 76.238 1.00 19.53 ? 485  PRO A C   1 
ATOM   3803 O O   . PRO A 1 504 ? -1.446  42.460 76.379 1.00 19.36 ? 485  PRO A O   1 
ATOM   3804 C CB  . PRO A 1 504 ? -3.024  39.803 75.110 1.00 20.57 ? 485  PRO A CB  1 
ATOM   3805 C CG  . PRO A 1 504 ? -2.976  38.812 74.063 1.00 21.06 ? 485  PRO A CG  1 
ATOM   3806 C CD  . PRO A 1 504 ? -1.553  38.380 73.922 1.00 21.34 ? 485  PRO A CD  1 
ATOM   3807 N N   . HIS A 1 505 ? -0.865  40.434 77.206 1.00 18.34 ? 486  HIS A N   1 
ATOM   3808 C CA  . HIS A 1 505 ? -0.395  41.028 78.485 1.00 17.92 ? 486  HIS A CA  1 
ATOM   3809 C C   . HIS A 1 505 ? 0.915   41.815 78.373 1.00 18.38 ? 486  HIS A C   1 
ATOM   3810 O O   . HIS A 1 505 ? 1.275   42.561 79.256 1.00 18.21 ? 486  HIS A O   1 
ATOM   3811 C CB  . HIS A 1 505 ? -0.279  39.956 79.596 1.00 17.35 ? 486  HIS A CB  1 
ATOM   3812 C CG  . HIS A 1 505 ? 0.982   39.149 79.521 1.00 16.56 ? 486  HIS A CG  1 
ATOM   3813 N ND1 . HIS A 1 505 ? 1.089   38.020 78.746 1.00 14.36 ? 486  HIS A ND1 1 
ATOM   3814 C CD2 . HIS A 1 505 ? 2.193   39.318 80.114 1.00 15.30 ? 486  HIS A CD2 1 
ATOM   3815 C CE1 . HIS A 1 505 ? 2.305   37.519 78.862 1.00 13.42 ? 486  HIS A CE1 1 
ATOM   3816 N NE2 . HIS A 1 505 ? 2.997   38.291 79.678 1.00 13.13 ? 486  HIS A NE2 1 
ATOM   3817 N N   . GLU A 1 506 ? 1.637   41.601 77.298 1.00 20.29 ? 487  GLU A N   1 
ATOM   3818 C CA  . GLU A 1 506 ? 2.902   42.258 77.061 1.00 23.90 ? 487  GLU A CA  1 
ATOM   3819 C C   . GLU A 1 506 ? 2.762   43.597 76.273 1.00 25.84 ? 487  GLU A C   1 
ATOM   3820 O O   . GLU A 1 506 ? 3.727   44.305 76.164 1.00 26.04 ? 487  GLU A O   1 
ATOM   3821 C CB  . GLU A 1 506 ? 3.795   41.335 76.241 1.00 21.91 ? 487  GLU A CB  1 
ATOM   3822 C CG  . GLU A 1 506 ? 4.286   40.110 76.977 1.00 20.04 ? 487  GLU A CG  1 
ATOM   3823 C CD  . GLU A 1 506 ? 5.122   39.215 76.102 1.00 19.12 ? 487  GLU A CD  1 
ATOM   3824 O OE1 . GLU A 1 506 ? 4.962   39.229 74.842 1.00 18.47 ? 487  GLU A OE1 1 
ATOM   3825 O OE2 . GLU A 1 506 ? 5.961   38.483 76.673 1.00 19.08 ? 487  GLU A OE2 1 
ATOM   3826 N N   . SER A 1 507 ? 1.568   43.876 75.712 1.00 28.64 ? 488  SER A N   1 
ATOM   3827 C CA  . SER A 1 507 ? 1.283   45.016 74.808 1.00 29.16 ? 488  SER A CA  1 
ATOM   3828 C C   . SER A 1 507 ? 0.922   46.306 75.547 1.00 30.85 ? 488  SER A C   1 
ATOM   3829 O O   . SER A 1 507 ? 0.898   46.334 76.797 1.00 32.93 ? 488  SER A O   1 
ATOM   3830 C CB  . SER A 1 507 ? 0.147   44.653 73.861 1.00 29.92 ? 488  SER A CB  1 
ATOM   3831 O OG  . SER A 1 507 ? 0.448   43.470 73.130 1.00 30.84 ? 488  SER A OG  1 
HETATM 3832 C C3  . DG2 B 2 .   ? 0.421   21.220 66.206 0.50 46.03 ? 1489 DG2 A C3  1 
HETATM 3833 C C4  . DG2 B 2 .   ? -0.524  20.631 65.148 0.50 45.43 ? 1489 DG2 A C4  1 
HETATM 3834 O O2  . DG2 B 2 .   ? 1.349   22.143 65.615 0.50 47.21 ? 1489 DG2 A O2  1 
HETATM 3835 O O5  . DG2 B 2 .   ? -0.979  21.573 64.161 0.50 45.14 ? 1489 DG2 A O5  1 
HETATM 3836 O O7  . DG2 B 2 .   ? 0.017   23.032 67.659 0.50 44.10 ? 1489 DG2 A O7  1 
HETATM 3837 O O8  . DG2 B 2 .   ? -1.217  21.243 67.961 0.50 44.73 ? 1489 DG2 A O8  1 
HETATM 3838 O O9  . DG2 B 2 .   ? 2.808   23.337 67.244 0.50 47.05 ? 1489 DG2 A O9  1 
HETATM 3839 O O10 . DG2 B 2 .   ? 3.278   20.927 66.619 0.50 44.75 ? 1489 DG2 A O10 1 
HETATM 3840 O O11 . DG2 B 2 .   ? 3.627   22.807 64.915 0.50 45.85 ? 1489 DG2 A O11 1 
HETATM 3841 P P1  . DG2 B 2 .   ? 2.875   22.302 66.144 0.50 46.86 ? 1489 DG2 A P1  1 
HETATM 3842 C C7  . DG2 B 2 .   ? -0.314  21.871 67.350 0.50 45.28 ? 1489 DG2 A C7  1 
HETATM 3843 P P6  . DG2 B 2 .   ? -2.279  21.236 63.249 0.50 42.28 ? 1489 DG2 A P6  1 
HETATM 3844 O O15 . DG2 B 2 .   ? -1.712  20.334 62.177 0.50 44.11 ? 1489 DG2 A O15 1 
HETATM 3845 O O14 . DG2 B 2 .   ? -3.263  20.534 64.148 0.50 42.39 ? 1489 DG2 A O14 1 
HETATM 3846 O O13 . DG2 B 2 .   ? -2.789  22.569 62.769 0.50 44.17 ? 1489 DG2 A O13 1 
HETATM 3847 C C1  . GOL C 3 .   ? 25.260  16.461 41.164 1.00 50.69 ? 1490 GOL A C1  1 
HETATM 3848 O O1  . GOL C 3 .   ? 23.925  16.016 41.527 1.00 47.67 ? 1490 GOL A O1  1 
HETATM 3849 C C2  . GOL C 3 .   ? 25.349  17.755 40.306 1.00 52.44 ? 1490 GOL A C2  1 
HETATM 3850 O O2  . GOL C 3 .   ? 26.604  17.974 39.655 1.00 52.56 ? 1490 GOL A O2  1 
HETATM 3851 C C3  . GOL C 3 .   ? 24.267  17.832 39.247 1.00 50.61 ? 1490 GOL A C3  1 
HETATM 3852 O O3  . GOL C 3 .   ? 24.389  16.664 38.465 1.00 51.79 ? 1490 GOL A O3  1 
HETATM 3853 C C1  . GOL D 3 .   ? -1.613  12.987 42.465 1.00 65.05 ? 1491 GOL A C1  1 
HETATM 3854 O O1  . GOL D 3 .   ? -2.961  12.889 42.872 1.00 63.26 ? 1491 GOL A O1  1 
HETATM 3855 C C2  . GOL D 3 .   ? -1.317  14.432 42.100 1.00 65.73 ? 1491 GOL A C2  1 
HETATM 3856 O O2  . GOL D 3 .   ? -2.293  15.253 42.700 1.00 65.90 ? 1491 GOL A O2  1 
HETATM 3857 C C3  . GOL D 3 .   ? 0.069   14.801 42.621 1.00 67.16 ? 1491 GOL A C3  1 
HETATM 3858 O O3  . GOL D 3 .   ? 1.025   14.596 41.602 1.00 68.22 ? 1491 GOL A O3  1 
HETATM 3859 C C1  . GOL E 3 .   ? 11.535  7.056  38.000 1.00 45.70 ? 1492 GOL A C1  1 
HETATM 3860 O O1  . GOL E 3 .   ? 11.034  6.723  39.258 1.00 44.08 ? 1492 GOL A O1  1 
HETATM 3861 C C2  . GOL E 3 .   ? 12.948  6.518  37.817 1.00 43.50 ? 1492 GOL A C2  1 
HETATM 3862 O O2  . GOL E 3 .   ? 12.825  5.433  36.919 1.00 48.75 ? 1492 GOL A O2  1 
HETATM 3863 C C3  . GOL E 3 .   ? 13.874  7.600  37.223 1.00 40.64 ? 1492 GOL A C3  1 
HETATM 3864 O O3  . GOL E 3 .   ? 13.629  8.903  37.747 1.00 30.59 ? 1492 GOL A O3  1 
HETATM 3865 O O   . HOH F 4 .   ? -6.973  33.537 38.448 1.00 35.53 ? 2001 HOH A O   1 
HETATM 3866 O O   . HOH F 4 .   ? -6.000  28.575 40.082 1.00 53.12 ? 2002 HOH A O   1 
HETATM 3867 O O   . HOH F 4 .   ? 0.009   32.963 29.696 1.00 46.30 ? 2003 HOH A O   1 
HETATM 3868 O O   . HOH F 4 .   ? 5.566   37.698 39.011 1.00 31.06 ? 2004 HOH A O   1 
HETATM 3869 O O   . HOH F 4 .   ? -1.923  31.981 31.556 1.00 26.13 ? 2005 HOH A O   1 
HETATM 3870 O O   . HOH F 4 .   ? 6.485   36.150 37.003 1.00 33.84 ? 2006 HOH A O   1 
HETATM 3871 O O   . HOH F 4 .   ? -0.058  35.972 29.417 1.00 38.77 ? 2007 HOH A O   1 
HETATM 3872 O O   . HOH F 4 .   ? -0.541  41.780 34.133 1.00 35.14 ? 2008 HOH A O   1 
HETATM 3873 O O   . HOH F 4 .   ? 4.308   42.025 29.784 1.00 41.20 ? 2009 HOH A O   1 
HETATM 3874 O O   . HOH F 4 .   ? 2.822   40.765 28.018 1.00 43.15 ? 2010 HOH A O   1 
HETATM 3875 O O   . HOH F 4 .   ? 10.888  35.915 29.386 1.00 38.74 ? 2011 HOH A O   1 
HETATM 3876 O O   . HOH F 4 .   ? 11.848  45.175 32.123 1.00 41.26 ? 2012 HOH A O   1 
HETATM 3877 O O   . HOH F 4 .   ? 13.765  45.766 37.581 1.00 44.36 ? 2013 HOH A O   1 
HETATM 3878 O O   . HOH F 4 .   ? -8.873  6.954  30.473 1.00 22.98 ? 2014 HOH A O   1 
HETATM 3879 O O   . HOH F 4 .   ? 9.045   41.126 35.700 1.00 34.05 ? 2015 HOH A O   1 
HETATM 3880 O O   . HOH F 4 .   ? 9.170   46.532 48.871 1.00 42.52 ? 2016 HOH A O   1 
HETATM 3881 O O   . HOH F 4 .   ? -14.754 19.955 28.506 1.00 50.45 ? 2017 HOH A O   1 
HETATM 3882 O O   . HOH F 4 .   ? 4.214   38.610 45.502 1.00 23.97 ? 2018 HOH A O   1 
HETATM 3883 O O   . HOH F 4 .   ? 7.975   42.628 52.313 1.00 34.31 ? 2019 HOH A O   1 
HETATM 3884 O O   . HOH F 4 .   ? 6.082   41.622 54.378 1.00 18.59 ? 2020 HOH A O   1 
HETATM 3885 O O   . HOH F 4 .   ? 2.646   36.920 59.721 1.00 26.45 ? 2021 HOH A O   1 
HETATM 3886 O O   . HOH F 4 .   ? 13.455  34.881 62.437 1.00 29.93 ? 2022 HOH A O   1 
HETATM 3887 O O   . HOH F 4 .   ? 10.437  37.738 63.048 1.00 34.23 ? 2023 HOH A O   1 
HETATM 3888 O O   . HOH F 4 .   ? 17.595  34.853 60.065 1.00 26.54 ? 2024 HOH A O   1 
HETATM 3889 O O   . HOH F 4 .   ? 18.715  33.584 57.919 1.00 37.36 ? 2025 HOH A O   1 
HETATM 3890 O O   . HOH F 4 .   ? 22.941  34.405 50.463 1.00 33.25 ? 2026 HOH A O   1 
HETATM 3891 O O   . HOH F 4 .   ? 23.859  38.254 59.661 1.00 57.86 ? 2027 HOH A O   1 
HETATM 3892 O O   . HOH F 4 .   ? -2.484  25.583 36.772 1.00 17.12 ? 2028 HOH A O   1 
HETATM 3893 O O   . HOH F 4 .   ? 7.625   30.478 41.152 1.00 24.29 ? 2029 HOH A O   1 
HETATM 3894 O O   . HOH F 4 .   ? -21.904 20.452 35.885 1.00 32.58 ? 2030 HOH A O   1 
HETATM 3895 O O   . HOH F 4 .   ? -24.998 17.718 35.590 1.00 33.02 ? 2031 HOH A O   1 
HETATM 3896 O O   . HOH F 4 .   ? -7.539  30.675 36.572 1.00 32.24 ? 2032 HOH A O   1 
HETATM 3897 O O   . HOH F 4 .   ? -5.789  32.281 31.345 1.00 29.85 ? 2033 HOH A O   1 
HETATM 3898 O O   . HOH F 4 .   ? -6.622  22.649 28.338 1.00 28.34 ? 2034 HOH A O   1 
HETATM 3899 O O   . HOH F 4 .   ? -2.913  30.430 29.702 1.00 36.97 ? 2035 HOH A O   1 
HETATM 3900 O O   . HOH F 4 .   ? -6.601  31.474 28.837 1.00 28.39 ? 2036 HOH A O   1 
HETATM 3901 O O   . HOH F 4 .   ? -4.497  19.670 36.857 1.00 27.91 ? 2037 HOH A O   1 
HETATM 3902 O O   . HOH F 4 .   ? 1.798   17.341 33.664 1.00 24.93 ? 2038 HOH A O   1 
HETATM 3903 O O   . HOH F 4 .   ? -27.473 7.372  56.842 1.00 41.38 ? 2039 HOH A O   1 
HETATM 3904 O O   . HOH F 4 .   ? -7.883  9.695  30.882 1.00 23.32 ? 2040 HOH A O   1 
HETATM 3905 O O   . HOH F 4 .   ? -13.520 7.325  28.639 1.00 25.68 ? 2041 HOH A O   1 
HETATM 3906 O O   . HOH F 4 .   ? -5.026  7.642  28.421 1.00 39.13 ? 2042 HOH A O   1 
HETATM 3907 O O   . HOH F 4 .   ? -7.061  3.451  39.544 1.00 33.05 ? 2043 HOH A O   1 
HETATM 3908 O O   . HOH F 4 .   ? -8.934  5.167  38.391 1.00 23.21 ? 2044 HOH A O   1 
HETATM 3909 O O   . HOH F 4 .   ? -8.920  4.423  31.372 1.00 27.04 ? 2045 HOH A O   1 
HETATM 3910 O O   . HOH F 4 .   ? 7.822   30.832 36.224 1.00 46.70 ? 2046 HOH A O   1 
HETATM 3911 O O   . HOH F 4 .   ? -15.785 -0.383 37.314 1.00 34.54 ? 2047 HOH A O   1 
HETATM 3912 O O   . HOH F 4 .   ? -19.884 4.737  31.245 1.00 41.88 ? 2048 HOH A O   1 
HETATM 3913 O O   . HOH F 4 .   ? -24.361 6.274  30.921 1.00 36.24 ? 2049 HOH A O   1 
HETATM 3914 O O   . HOH F 4 .   ? 29.742  25.795 46.158 1.00 44.92 ? 2050 HOH A O   1 
HETATM 3915 O O   . HOH F 4 .   ? -17.940 19.171 27.547 1.00 49.24 ? 2051 HOH A O   1 
HETATM 3916 O O   . HOH F 4 .   ? 8.094   8.629  43.419 1.00 39.17 ? 2052 HOH A O   1 
HETATM 3917 O O   . HOH F 4 .   ? 7.682   12.262 30.508 1.00 40.41 ? 2053 HOH A O   1 
HETATM 3918 O O   . HOH F 4 .   ? -18.785 24.451 33.255 1.00 36.28 ? 2054 HOH A O   1 
HETATM 3919 O O   . HOH F 4 .   ? -12.825 20.830 31.075 1.00 34.03 ? 2055 HOH A O   1 
HETATM 3920 O O   . HOH F 4 .   ? -13.798 24.630 30.630 1.00 32.85 ? 2056 HOH A O   1 
HETATM 3921 O O   . HOH F 4 .   ? -8.857  26.871 38.204 1.00 29.15 ? 2057 HOH A O   1 
HETATM 3922 O O   . HOH F 4 .   ? -11.515 26.187 31.590 1.00 40.05 ? 2058 HOH A O   1 
HETATM 3923 O O   . HOH F 4 .   ? 13.504  17.910 25.696 1.00 33.80 ? 2059 HOH A O   1 
HETATM 3924 O O   . HOH F 4 .   ? 12.170  22.169 25.099 1.00 36.10 ? 2060 HOH A O   1 
HETATM 3925 O O   . HOH F 4 .   ? -19.482 26.515 34.407 1.00 34.32 ? 2061 HOH A O   1 
HETATM 3926 O O   . HOH F 4 .   ? 17.656  23.506 24.998 1.00 27.69 ? 2062 HOH A O   1 
HETATM 3927 O O   . HOH F 4 .   ? -12.717 27.837 33.314 1.00 26.16 ? 2063 HOH A O   1 
HETATM 3928 O O   . HOH F 4 .   ? -12.038 30.860 41.611 1.00 34.63 ? 2064 HOH A O   1 
HETATM 3929 O O   . HOH F 4 .   ? -13.881 30.180 43.999 1.00 20.84 ? 2065 HOH A O   1 
HETATM 3930 O O   . HOH F 4 .   ? 27.550  33.288 31.334 1.00 37.38 ? 2066 HOH A O   1 
HETATM 3931 O O   . HOH F 4 .   ? -10.012 23.011 47.243 1.00 15.49 ? 2067 HOH A O   1 
HETATM 3932 O O   . HOH F 4 .   ? 28.801  28.538 29.275 1.00 39.15 ? 2068 HOH A O   1 
HETATM 3933 O O   . HOH F 4 .   ? -8.400  28.135 51.630 1.00 16.46 ? 2069 HOH A O   1 
HETATM 3934 O O   . HOH F 4 .   ? -10.667 25.500 54.095 1.00 18.95 ? 2070 HOH A O   1 
HETATM 3935 O O   . HOH F 4 .   ? -6.940  24.411 53.784 1.00 15.90 ? 2071 HOH A O   1 
HETATM 3936 O O   . HOH F 4 .   ? -20.239 8.669  52.685 1.00 14.50 ? 2072 HOH A O   1 
HETATM 3937 O O   . HOH F 4 .   ? -16.953 8.987  55.810 1.00 24.78 ? 2073 HOH A O   1 
HETATM 3938 O O   . HOH F 4 .   ? -25.490 14.828 52.918 1.00 31.36 ? 2074 HOH A O   1 
HETATM 3939 O O   . HOH F 4 .   ? -15.762 32.748 51.174 1.00 29.10 ? 2075 HOH A O   1 
HETATM 3940 O O   . HOH F 4 .   ? -8.134  30.596 60.843 1.00 28.30 ? 2076 HOH A O   1 
HETATM 3941 O O   . HOH F 4 .   ? -10.873 24.188 67.246 1.00 38.12 ? 2077 HOH A O   1 
HETATM 3942 O O   . HOH F 4 .   ? -13.557 26.153 67.243 1.00 25.89 ? 2078 HOH A O   1 
HETATM 3943 O O   . HOH F 4 .   ? -18.590 29.468 61.772 1.00 39.17 ? 2079 HOH A O   1 
HETATM 3944 O O   . HOH F 4 .   ? -27.842 14.976 47.629 1.00 35.56 ? 2080 HOH A O   1 
HETATM 3945 O O   . HOH F 4 .   ? -26.746 19.491 45.027 1.00 40.57 ? 2081 HOH A O   1 
HETATM 3946 O O   . HOH F 4 .   ? -19.739 21.238 46.821 1.00 19.90 ? 2082 HOH A O   1 
HETATM 3947 O O   . HOH F 4 .   ? -20.455 18.740 47.065 1.00 16.25 ? 2083 HOH A O   1 
HETATM 3948 O O   . HOH F 4 .   ? 2.115   19.427 45.381 1.00 41.23 ? 2084 HOH A O   1 
HETATM 3949 O O   . HOH F 4 .   ? -26.355 28.401 46.137 1.00 29.27 ? 2085 HOH A O   1 
HETATM 3950 O O   . HOH F 4 .   ? -22.286 28.192 53.045 1.00 40.76 ? 2086 HOH A O   1 
HETATM 3951 O O   . HOH F 4 .   ? -31.001 27.698 56.475 1.00 51.32 ? 2087 HOH A O   1 
HETATM 3952 O O   . HOH F 4 .   ? -29.634 26.763 53.334 1.00 37.57 ? 2088 HOH A O   1 
HETATM 3953 O O   . HOH F 4 .   ? -20.957 16.588 61.503 1.00 25.12 ? 2089 HOH A O   1 
HETATM 3954 O O   . HOH F 4 .   ? -20.355 20.590 64.394 1.00 22.28 ? 2090 HOH A O   1 
HETATM 3955 O O   . HOH F 4 .   ? -18.466 17.709 62.413 1.00 32.75 ? 2091 HOH A O   1 
HETATM 3956 O O   . HOH F 4 .   ? -10.964 20.782 64.461 1.00 30.21 ? 2092 HOH A O   1 
HETATM 3957 O O   . HOH F 4 .   ? -16.037 16.457 63.077 1.00 20.60 ? 2093 HOH A O   1 
HETATM 3958 O O   . HOH F 4 .   ? -8.456  15.960 57.650 1.00 38.60 ? 2094 HOH A O   1 
HETATM 3959 O O   . HOH F 4 .   ? -15.527 13.961 63.214 1.00 26.46 ? 2095 HOH A O   1 
HETATM 3960 O O   . HOH F 4 .   ? -10.010 9.587  61.305 1.00 38.65 ? 2096 HOH A O   1 
HETATM 3961 O O   . HOH F 4 .   ? -14.086 8.767  60.702 1.00 47.45 ? 2097 HOH A O   1 
HETATM 3962 O O   . HOH F 4 .   ? -7.527  12.856 54.937 1.00 34.79 ? 2098 HOH A O   1 
HETATM 3963 O O   . HOH F 4 .   ? -4.699  16.398 52.646 1.00 39.81 ? 2099 HOH A O   1 
HETATM 3964 O O   . HOH F 4 .   ? -6.418  15.596 54.223 1.00 29.83 ? 2100 HOH A O   1 
HETATM 3965 O O   . HOH F 4 .   ? -7.225  22.623 45.425 1.00 28.35 ? 2101 HOH A O   1 
HETATM 3966 O O   . HOH F 4 .   ? -2.937  18.290 54.514 1.00 50.71 ? 2102 HOH A O   1 
HETATM 3967 O O   . HOH F 4 .   ? -1.990  16.875 45.004 1.00 27.75 ? 2103 HOH A O   1 
HETATM 3968 O O   . HOH F 4 .   ? -3.728  21.838 38.585 1.00 21.61 ? 2104 HOH A O   1 
HETATM 3969 O O   . HOH F 4 .   ? -7.509  17.045 40.881 1.00 25.54 ? 2105 HOH A O   1 
HETATM 3970 O O   . HOH F 4 .   ? -4.463  17.525 38.555 1.00 23.34 ? 2106 HOH A O   1 
HETATM 3971 O O   . HOH F 4 .   ? -4.042  17.505 49.021 1.00 32.18 ? 2107 HOH A O   1 
HETATM 3972 O O   . HOH F 4 .   ? 5.687   32.026 37.727 1.00 45.38 ? 2108 HOH A O   1 
HETATM 3973 O O   . HOH F 4 .   ? -19.904 25.335 37.192 1.00 25.92 ? 2109 HOH A O   1 
HETATM 3974 O O   . HOH F 4 .   ? -19.538 21.590 34.447 1.00 26.74 ? 2110 HOH A O   1 
HETATM 3975 O O   . HOH F 4 .   ? -27.405 17.845 36.884 1.00 40.86 ? 2111 HOH A O   1 
HETATM 3976 O O   . HOH F 4 .   ? -26.179 21.192 43.295 1.00 24.53 ? 2112 HOH A O   1 
HETATM 3977 O O   . HOH F 4 .   ? -25.834 21.826 37.088 1.00 36.51 ? 2113 HOH A O   1 
HETATM 3978 O O   . HOH F 4 .   ? -23.089 18.599 37.464 1.00 18.88 ? 2114 HOH A O   1 
HETATM 3979 O O   . HOH F 4 .   ? -28.325 15.612 36.909 1.00 34.00 ? 2115 HOH A O   1 
HETATM 3980 O O   . HOH F 4 .   ? -32.519 12.378 42.050 1.00 40.87 ? 2116 HOH A O   1 
HETATM 3981 O O   . HOH F 4 .   ? -33.415 17.246 42.039 1.00 49.00 ? 2117 HOH A O   1 
HETATM 3982 O O   . HOH F 4 .   ? -28.431 4.589  36.296 1.00 44.27 ? 2118 HOH A O   1 
HETATM 3983 O O   . HOH F 4 .   ? -30.672 11.495 43.485 1.00 34.06 ? 2119 HOH A O   1 
HETATM 3984 O O   . HOH F 4 .   ? -27.185 7.290  54.185 1.00 34.84 ? 2120 HOH A O   1 
HETATM 3985 O O   . HOH F 4 .   ? -22.664 5.156  54.526 1.00 36.74 ? 2121 HOH A O   1 
HETATM 3986 O O   . HOH F 4 .   ? -20.620 2.805  48.578 1.00 29.46 ? 2122 HOH A O   1 
HETATM 3987 O O   . HOH F 4 .   ? -18.233 4.202  44.297 1.00 37.20 ? 2123 HOH A O   1 
HETATM 3988 O O   . HOH F 4 .   ? -14.210 3.356  45.836 1.00 45.27 ? 2124 HOH A O   1 
HETATM 3989 O O   . HOH F 4 .   ? -11.828 3.587  41.400 1.00 37.85 ? 2125 HOH A O   1 
HETATM 3990 O O   . HOH F 4 .   ? -11.096 5.675  39.786 1.00 20.80 ? 2126 HOH A O   1 
HETATM 3991 O O   . HOH F 4 .   ? -5.237  5.215  40.711 1.00 29.92 ? 2127 HOH A O   1 
HETATM 3992 O O   . HOH F 4 .   ? -5.853  7.344  45.422 1.00 33.23 ? 2128 HOH A O   1 
HETATM 3993 O O   . HOH F 4 .   ? -2.400  5.105  39.638 1.00 35.36 ? 2129 HOH A O   1 
HETATM 3994 O O   . HOH F 4 .   ? 2.648   9.398  33.296 1.00 34.12 ? 2130 HOH A O   1 
HETATM 3995 O O   . HOH F 4 .   ? -0.362  -0.331 40.228 0.50 38.91 ? 2131 HOH A O   1 
HETATM 3996 O O   . HOH F 4 .   ? 1.431   10.691 30.186 1.00 33.41 ? 2132 HOH A O   1 
HETATM 3997 O O   . HOH F 4 .   ? -5.241  9.692  30.260 1.00 28.42 ? 2133 HOH A O   1 
HETATM 3998 O O   . HOH F 4 .   ? 0.665   11.249 33.015 1.00 25.21 ? 2134 HOH A O   1 
HETATM 3999 O O   . HOH F 4 .   ? 2.331   15.158 36.267 1.00 38.66 ? 2135 HOH A O   1 
HETATM 4000 O O   . HOH F 4 .   ? 0.748   8.698  28.025 1.00 38.53 ? 2136 HOH A O   1 
HETATM 4001 O O   . HOH F 4 .   ? 4.510   13.702 24.556 1.00 45.53 ? 2137 HOH A O   1 
HETATM 4002 O O   . HOH F 4 .   ? -1.446  18.418 24.338 1.00 27.74 ? 2138 HOH A O   1 
HETATM 4003 O O   . HOH F 4 .   ? 1.007   26.776 21.934 1.00 47.94 ? 2139 HOH A O   1 
HETATM 4004 O O   . HOH F 4 .   ? -1.698  25.655 21.462 1.00 39.89 ? 2140 HOH A O   1 
HETATM 4005 O O   . HOH F 4 .   ? 5.880   21.392 23.643 1.00 41.17 ? 2141 HOH A O   1 
HETATM 4006 O O   . HOH F 4 .   ? -2.010  28.664 27.614 1.00 24.54 ? 2142 HOH A O   1 
HETATM 4007 O O   . HOH F 4 .   ? -3.734  19.071 25.373 1.00 38.86 ? 2143 HOH A O   1 
HETATM 4008 O O   . HOH F 4 .   ? 7.398   28.181 35.096 1.00 19.85 ? 2144 HOH A O   1 
HETATM 4009 O O   . HOH F 4 .   ? 9.402   33.954 27.591 1.00 52.80 ? 2145 HOH A O   1 
HETATM 4010 O O   . HOH F 4 .   ? 8.856   37.310 36.041 1.00 31.66 ? 2146 HOH A O   1 
HETATM 4011 O O   . HOH F 4 .   ? 25.403  38.574 39.530 1.00 48.84 ? 2147 HOH A O   1 
HETATM 4012 O O   . HOH F 4 .   ? 27.297  26.747 44.242 1.00 37.13 ? 2148 HOH A O   1 
HETATM 4013 O O   . HOH F 4 .   ? 8.229   10.810 44.393 1.00 23.70 ? 2149 HOH A O   1 
HETATM 4014 O O   . HOH F 4 .   ? 8.612   9.924  40.737 1.00 30.90 ? 2150 HOH A O   1 
HETATM 4015 O O   . HOH F 4 .   ? 7.933   10.544 32.441 1.00 34.36 ? 2151 HOH A O   1 
HETATM 4016 O O   . HOH F 4 .   ? 19.517  13.776 30.627 1.00 28.96 ? 2152 HOH A O   1 
HETATM 4017 O O   . HOH F 4 .   ? 22.481  14.621 33.692 1.00 44.96 ? 2153 HOH A O   1 
HETATM 4018 O O   . HOH F 4 .   ? 13.389  13.182 29.048 1.00 27.26 ? 2154 HOH A O   1 
HETATM 4019 O O   . HOH F 4 .   ? 19.067  16.903 29.340 1.00 33.14 ? 2155 HOH A O   1 
HETATM 4020 O O   . HOH F 4 .   ? 15.675  12.368 29.806 1.00 35.70 ? 2156 HOH A O   1 
HETATM 4021 O O   . HOH F 4 .   ? 11.813  19.759 26.579 1.00 23.47 ? 2157 HOH A O   1 
HETATM 4022 O O   . HOH F 4 .   ? 15.879  16.968 26.951 1.00 39.54 ? 2158 HOH A O   1 
HETATM 4023 O O   . HOH F 4 .   ? 17.338  24.214 27.698 1.00 16.98 ? 2159 HOH A O   1 
HETATM 4024 O O   . HOH F 4 .   ? 6.968   29.328 25.693 1.00 55.83 ? 2160 HOH A O   1 
HETATM 4025 O O   . HOH F 4 .   ? 11.924  29.730 32.482 1.00 25.09 ? 2161 HOH A O   1 
HETATM 4026 O O   . HOH F 4 .   ? 18.927  29.137 29.614 1.00 18.87 ? 2162 HOH A O   1 
HETATM 4027 O O   . HOH F 4 .   ? 18.190  25.751 23.631 1.00 42.29 ? 2163 HOH A O   1 
HETATM 4028 O O   . HOH F 4 .   ? 20.365  27.540 22.655 1.00 44.92 ? 2164 HOH A O   1 
HETATM 4029 O O   . HOH F 4 .   ? 17.872  37.396 31.631 1.00 45.16 ? 2165 HOH A O   1 
HETATM 4030 O O   . HOH F 4 .   ? 25.297  35.284 31.762 1.00 36.80 ? 2166 HOH A O   1 
HETATM 4031 O O   . HOH F 4 .   ? 22.830  41.081 28.724 1.00 27.64 ? 2167 HOH A O   1 
HETATM 4032 O O   . HOH F 4 .   ? 21.722  36.591 23.211 1.00 42.39 ? 2168 HOH A O   1 
HETATM 4033 O O   . HOH F 4 .   ? 27.241  30.896 29.705 1.00 27.47 ? 2169 HOH A O   1 
HETATM 4034 O O   . HOH F 4 .   ? 31.117  29.276 25.557 1.00 29.33 ? 2170 HOH A O   1 
HETATM 4035 O O   . HOH F 4 .   ? 27.621  29.545 22.715 1.00 30.59 ? 2171 HOH A O   1 
HETATM 4036 O O   . HOH F 4 .   ? 23.835  23.830 25.844 1.00 34.08 ? 2172 HOH A O   1 
HETATM 4037 O O   . HOH F 4 .   ? 27.741  26.686 27.695 1.00 31.54 ? 2173 HOH A O   1 
HETATM 4038 O O   . HOH F 4 .   ? 24.715  29.258 23.160 1.00 32.24 ? 2174 HOH A O   1 
HETATM 4039 O O   . HOH F 4 .   ? 26.957  31.396 33.632 1.00 38.36 ? 2175 HOH A O   1 
HETATM 4040 O O   . HOH F 4 .   ? 24.737  28.729 37.471 1.00 27.19 ? 2176 HOH A O   1 
HETATM 4041 O O   . HOH F 4 .   ? 21.138  28.140 30.095 1.00 13.75 ? 2177 HOH A O   1 
HETATM 4042 O O   . HOH F 4 .   ? 18.988  22.496 29.317 1.00 21.07 ? 2178 HOH A O   1 
HETATM 4043 O O   . HOH F 4 .   ? 19.565  19.415 28.906 1.00 42.86 ? 2179 HOH A O   1 
HETATM 4044 O O   . HOH F 4 .   ? 22.392  28.047 39.292 1.00 22.55 ? 2180 HOH A O   1 
HETATM 4045 O O   . HOH F 4 .   ? 26.727  21.841 38.875 1.00 43.42 ? 2181 HOH A O   1 
HETATM 4046 O O   . HOH F 4 .   ? 4.562   10.783 47.748 1.00 44.71 ? 2182 HOH A O   1 
HETATM 4047 O O   . HOH F 4 .   ? 5.662   10.368 51.497 1.00 41.66 ? 2183 HOH A O   1 
HETATM 4048 O O   . HOH F 4 .   ? 13.593  2.586  50.386 1.00 42.53 ? 2184 HOH A O   1 
HETATM 4049 O O   . HOH F 4 .   ? 14.507  4.884  46.655 1.00 26.37 ? 2185 HOH A O   1 
HETATM 4050 O O   . HOH F 4 .   ? 20.214  5.223  51.256 1.00 33.77 ? 2186 HOH A O   1 
HETATM 4051 O O   . HOH F 4 .   ? 14.503  2.295  45.876 1.00 30.50 ? 2187 HOH A O   1 
HETATM 4052 O O   . HOH F 4 .   ? 15.005  -0.532 40.004 1.00 34.50 ? 2188 HOH A O   1 
HETATM 4053 O O   . HOH F 4 .   ? 27.925  4.350  40.368 1.00 38.82 ? 2189 HOH A O   1 
HETATM 4054 O O   . HOH F 4 .   ? 23.563  9.729  37.836 1.00 20.74 ? 2190 HOH A O   1 
HETATM 4055 O O   . HOH F 4 .   ? 24.342  7.961  34.154 1.00 46.83 ? 2191 HOH A O   1 
HETATM 4056 O O   . HOH F 4 .   ? 16.477  9.959  30.533 1.00 41.42 ? 2192 HOH A O   1 
HETATM 4057 O O   . HOH F 4 .   ? 19.994  1.947  32.306 1.00 42.86 ? 2193 HOH A O   1 
HETATM 4058 O O   . HOH F 4 .   ? 12.555  8.468  34.498 1.00 25.71 ? 2194 HOH A O   1 
HETATM 4059 O O   . HOH F 4 .   ? 19.322  0.559  35.181 1.00 38.39 ? 2195 HOH A O   1 
HETATM 4060 O O   . HOH F 4 .   ? 13.987  2.373  37.033 1.00 34.32 ? 2196 HOH A O   1 
HETATM 4061 O O   . HOH F 4 .   ? 22.787  -1.008 37.455 1.00 35.34 ? 2197 HOH A O   1 
HETATM 4062 O O   . HOH F 4 .   ? 18.035  -1.745 43.691 1.00 29.26 ? 2198 HOH A O   1 
HETATM 4063 O O   . HOH F 4 .   ? 20.872  3.102  42.185 1.00 22.58 ? 2199 HOH A O   1 
HETATM 4064 O O   . HOH F 4 .   ? 23.654  5.535  50.573 1.00 34.92 ? 2200 HOH A O   1 
HETATM 4065 O O   . HOH F 4 .   ? 30.368  13.913 48.488 1.00 49.93 ? 2201 HOH A O   1 
HETATM 4066 O O   . HOH F 4 .   ? 29.815  19.727 39.675 1.00 52.80 ? 2202 HOH A O   1 
HETATM 4067 O O   . HOH F 4 .   ? 13.979  5.997  44.202 1.00 19.79 ? 2203 HOH A O   1 
HETATM 4068 O O   . HOH F 4 .   ? 12.883  9.418  49.668 1.00 26.45 ? 2204 HOH A O   1 
HETATM 4069 O O   . HOH F 4 .   ? 15.682  13.258 56.688 1.00 28.25 ? 2205 HOH A O   1 
HETATM 4070 O O   . HOH F 4 .   ? 17.630  16.925 57.053 1.00 36.27 ? 2206 HOH A O   1 
HETATM 4071 O O   . HOH F 4 .   ? 24.560  17.371 57.439 1.00 47.57 ? 2207 HOH A O   1 
HETATM 4072 O O   . HOH F 4 .   ? 29.829  16.058 49.413 1.00 35.68 ? 2208 HOH A O   1 
HETATM 4073 O O   . HOH F 4 .   ? 18.655  31.129 58.670 1.00 25.32 ? 2209 HOH A O   1 
HETATM 4074 O O   . HOH F 4 .   ? 0.200   23.215 45.470 1.00 43.89 ? 2210 HOH A O   1 
HETATM 4075 O O   . HOH F 4 .   ? 2.949   20.817 43.324 1.00 44.85 ? 2211 HOH A O   1 
HETATM 4076 O O   . HOH F 4 .   ? 10.801  29.649 61.686 1.00 33.70 ? 2212 HOH A O   1 
HETATM 4077 O O   . HOH F 4 .   ? 14.453  12.463 61.064 1.00 46.42 ? 2213 HOH A O   1 
HETATM 4078 O O   . HOH F 4 .   ? 13.374  9.718  61.533 1.00 49.56 ? 2214 HOH A O   1 
HETATM 4079 O O   . HOH F 4 .   ? 18.256  20.347 61.686 1.00 37.94 ? 2215 HOH A O   1 
HETATM 4080 O O   . HOH F 4 .   ? 14.153  27.281 60.863 1.00 26.21 ? 2216 HOH A O   1 
HETATM 4081 O O   . HOH F 4 .   ? 18.461  19.100 57.973 1.00 28.57 ? 2217 HOH A O   1 
HETATM 4082 O O   . HOH F 4 .   ? 1.257   27.636 47.708 1.00 16.71 ? 2218 HOH A O   1 
HETATM 4083 O O   . HOH F 4 .   ? -7.119  29.054 45.082 1.00 19.65 ? 2219 HOH A O   1 
HETATM 4084 O O   . HOH F 4 .   ? -7.598  31.944 44.867 1.00 30.58 ? 2220 HOH A O   1 
HETATM 4085 O O   . HOH F 4 .   ? -9.316  44.714 50.124 1.00 37.71 ? 2221 HOH A O   1 
HETATM 4086 O O   . HOH F 4 .   ? -13.150 35.591 50.377 1.00 34.40 ? 2222 HOH A O   1 
HETATM 4087 O O   . HOH F 4 .   ? -7.392  38.380 49.036 1.00 41.77 ? 2223 HOH A O   1 
HETATM 4088 O O   . HOH F 4 .   ? -12.807 33.215 40.086 1.00 33.26 ? 2224 HOH A O   1 
HETATM 4089 O O   . HOH F 4 .   ? -17.603 31.826 49.311 1.00 27.01 ? 2225 HOH A O   1 
HETATM 4090 O O   . HOH F 4 .   ? -10.256 31.889 44.259 1.00 46.42 ? 2226 HOH A O   1 
HETATM 4091 O O   . HOH F 4 .   ? -16.530 38.683 58.149 1.00 46.65 ? 2227 HOH A O   1 
HETATM 4092 O O   . HOH F 4 .   ? -5.826  36.205 55.604 1.00 19.84 ? 2228 HOH A O   1 
HETATM 4093 O O   . HOH F 4 .   ? -9.858  34.554 61.723 1.00 30.17 ? 2229 HOH A O   1 
HETATM 4094 O O   . HOH F 4 .   ? -8.249  26.811 53.909 1.00 15.09 ? 2230 HOH A O   1 
HETATM 4095 O O   . HOH F 4 .   ? -1.133  31.217 62.031 1.00 22.46 ? 2231 HOH A O   1 
HETATM 4096 O O   . HOH F 4 .   ? -2.589  26.551 61.626 1.00 44.73 ? 2232 HOH A O   1 
HETATM 4097 O O   . HOH F 4 .   ? 1.241   32.397 62.943 1.00 29.73 ? 2233 HOH A O   1 
HETATM 4098 O O   . HOH F 4 .   ? 4.604   31.429 40.572 1.00 24.78 ? 2234 HOH A O   1 
HETATM 4099 O O   . HOH F 4 .   ? 7.595   39.269 39.743 1.00 34.38 ? 2235 HOH A O   1 
HETATM 4100 O O   . HOH F 4 .   ? 9.059   39.377 37.735 1.00 26.63 ? 2236 HOH A O   1 
HETATM 4101 O O   . HOH F 4 .   ? 9.257   44.421 50.312 1.00 42.62 ? 2237 HOH A O   1 
HETATM 4102 O O   . HOH F 4 .   ? 18.953  41.169 43.371 1.00 43.72 ? 2238 HOH A O   1 
HETATM 4103 O O   . HOH F 4 .   ? 21.060  39.254 55.519 1.00 25.36 ? 2239 HOH A O   1 
HETATM 4104 O O   . HOH F 4 .   ? 18.333  44.718 54.471 1.00 31.47 ? 2240 HOH A O   1 
HETATM 4105 O O   . HOH F 4 .   ? 11.646  43.436 54.968 1.00 35.52 ? 2241 HOH A O   1 
HETATM 4106 O O   . HOH F 4 .   ? 13.816  46.294 58.212 1.00 50.46 ? 2242 HOH A O   1 
HETATM 4107 O O   . HOH F 4 .   ? 8.136   38.200 64.035 1.00 35.86 ? 2243 HOH A O   1 
HETATM 4108 O O   . HOH F 4 .   ? 6.103   42.954 60.452 1.00 39.57 ? 2244 HOH A O   1 
HETATM 4109 O O   . HOH F 4 .   ? 10.175  44.743 66.243 1.00 38.47 ? 2245 HOH A O   1 
HETATM 4110 O O   . HOH F 4 .   ? 8.997   39.051 70.417 1.00 36.15 ? 2246 HOH A O   1 
HETATM 4111 O O   . HOH F 4 .   ? 2.689   41.351 68.488 1.00 43.50 ? 2247 HOH A O   1 
HETATM 4112 O O   . HOH F 4 .   ? -0.854  39.165 70.383 1.00 47.44 ? 2248 HOH A O   1 
HETATM 4113 O O   . HOH F 4 .   ? 5.988   38.168 79.216 1.00 26.06 ? 2249 HOH A O   1 
HETATM 4114 O O   . HOH F 4 .   ? 23.714  16.285 35.886 1.00 39.62 ? 2250 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -18 ?   ?   ?   A . n 
A 1 2   GLY 2   -17 ?   ?   ?   A . n 
A 1 3   SER 3   -16 ?   ?   ?   A . n 
A 1 4   SER 4   -15 ?   ?   ?   A . n 
A 1 5   HIS 5   -14 ?   ?   ?   A . n 
A 1 6   HIS 6   -13 ?   ?   ?   A . n 
A 1 7   HIS 7   -12 ?   ?   ?   A . n 
A 1 8   HIS 8   -11 ?   ?   ?   A . n 
A 1 9   HIS 9   -10 ?   ?   ?   A . n 
A 1 10  HIS 10  -9  ?   ?   ?   A . n 
A 1 11  SER 11  -8  ?   ?   ?   A . n 
A 1 12  SER 12  -7  ?   ?   ?   A . n 
A 1 13  GLY 13  -6  ?   ?   ?   A . n 
A 1 14  LEU 14  -5  ?   ?   ?   A . n 
A 1 15  VAL 15  -4  ?   ?   ?   A . n 
A 1 16  PRO 16  -3  ?   ?   ?   A . n 
A 1 17  ARG 17  -2  ?   ?   ?   A . n 
A 1 18  GLY 18  -1  ?   ?   ?   A . n 
A 1 19  SER 19  0   ?   ?   ?   A . n 
A 1 20  MET 20  1   ?   ?   ?   A . n 
A 1 21  SER 21  2   ?   ?   ?   A . n 
A 1 22  THR 22  3   3   THR THR A . n 
A 1 23  SER 23  4   4   SER SER A . n 
A 1 24  TRP 24  5   5   TRP TRP A . n 
A 1 25  SER 25  6   6   SER SER A . n 
A 1 26  ASP 26  7   7   ASP ASP A . n 
A 1 27  ARG 27  8   8   ARG ARG A . n 
A 1 28  LEU 28  9   9   LEU LEU A . n 
A 1 29  GLN 29  10  10  GLN GLN A . n 
A 1 30  ASN 30  11  11  ASN ASN A . n 
A 1 31  ALA 31  12  12  ALA ALA A . n 
A 1 32  ALA 32  13  13  ALA ALA A . n 
A 1 33  ASP 33  14  14  ASP ASP A . n 
A 1 34  MET 34  15  15  MET MET A . n 
A 1 35  PRO 35  16  16  PRO PRO A . n 
A 1 36  ALA 36  17  17  ALA ALA A . n 
A 1 37  ASN 37  18  18  ASN ASN A . n 
A 1 38  MET 38  19  19  MET MET A . n 
A 1 39  ASP 39  20  20  ASP ASP A . n 
A 1 40  LYS 40  21  21  LYS LYS A . n 
A 1 41  HIS 41  22  22  HIS HIS A . n 
A 1 42  ALA 42  23  23  ALA ALA A . n 
A 1 43  LEU 43  24  24  LEU LEU A . n 
A 1 44  LYS 44  25  25  LYS LYS A . n 
A 1 45  LYS 45  26  26  LYS LYS A . n 
A 1 46  TYR 46  27  27  TYR TYR A . n 
A 1 47  ARG 47  28  28  ARG ARG A . n 
A 1 48  ARG 48  29  29  ARG ARG A . n 
A 1 49  GLU 49  30  30  GLU GLU A . n 
A 1 50  ALA 50  31  31  ALA ALA A . n 
A 1 51  TYR 51  32  32  TYR TYR A . n 
A 1 52  HIS 52  33  33  HIS HIS A . n 
A 1 53  ARG 53  34  34  ARG ARG A . n 
A 1 54  VAL 54  35  35  VAL VAL A . n 
A 1 55  PHE 55  36  36  PHE PHE A . n 
A 1 56  VAL 56  37  37  VAL VAL A . n 
A 1 57  ASN 57  38  38  ASN ASN A . n 
A 1 58  ARG 58  39  39  ARG ARG A . n 
A 1 59  SER 59  40  40  SER SER A . n 
A 1 60  LEU 60  41  41  LEU LEU A . n 
A 1 61  ALA 61  42  42  ALA ALA A . n 
A 1 62  MET 62  43  43  MET MET A . n 
A 1 63  GLU 63  44  44  GLU GLU A . n 
A 1 64  LYS 64  45  45  LYS LYS A . n 
A 1 65  ILE 65  46  46  ILE ILE A . n 
A 1 66  LYS 66  47  47  LYS LYS A . n 
A 1 67  CYS 67  48  48  CYS CYS A . n 
A 1 68  PHE 68  49  49  PHE PHE A . n 
A 1 69  GLY 69  50  50  GLY GLY A . n 
A 1 70  PHE 70  51  51  PHE PHE A . n 
A 1 71  A5N 71  52  52  A5N A5N A . n 
A 1 72  MET 72  53  53  MET MET A . n 
A 1 73  ASP 73  54  54  ASP ASP A . n 
A 1 74  TYR 74  55  55  TYR TYR A . n 
A 1 75  THR 75  56  56  THR THR A . n 
A 1 76  LEU 76  57  57  LEU LEU A . n 
A 1 77  ALA 77  58  58  ALA ALA A . n 
A 1 78  VAL 78  59  59  VAL VAL A . n 
A 1 79  TYR 79  60  60  TYR TYR A . n 
A 1 80  LYS 80  61  61  LYS LYS A . n 
A 1 81  SER 81  62  62  SER SER A . n 
A 1 82  PRO 82  63  63  PRO PRO A . n 
A 1 83  GLU 83  64  64  GLU GLU A . n 
A 1 84  TYR 84  65  65  TYR TYR A . n 
A 1 85  GLU 85  66  66  GLU GLU A . n 
A 1 86  SER 86  67  67  SER SER A . n 
A 1 87  LEU 87  68  68  LEU LEU A . n 
A 1 88  GLY 88  69  69  GLY GLY A . n 
A 1 89  PHE 89  70  70  PHE PHE A . n 
A 1 90  GLU 90  71  71  GLU GLU A . n 
A 1 91  LEU 91  72  72  LEU LEU A . n 
A 1 92  THR 92  73  73  THR THR A . n 
A 1 93  VAL 93  74  74  VAL VAL A . n 
A 1 94  GLU 94  75  75  GLU GLU A . n 
A 1 95  ARG 95  76  76  ARG ARG A . n 
A 1 96  LEU 96  77  77  LEU LEU A . n 
A 1 97  VAL 97  78  78  VAL VAL A . n 
A 1 98  SER 98  79  79  SER SER A . n 
A 1 99  ILE 99  80  80  ILE ILE A . n 
A 1 100 GLY 100 81  81  GLY GLY A . n 
A 1 101 TYR 101 82  82  TYR TYR A . n 
A 1 102 PRO 102 83  83  PRO PRO A . n 
A 1 103 GLN 103 84  84  GLN GLN A . n 
A 1 104 GLU 104 85  85  GLU GLU A . n 
A 1 105 LEU 105 86  86  LEU LEU A . n 
A 1 106 LEU 106 87  87  LEU LEU A . n 
A 1 107 SER 107 88  88  SER SER A . n 
A 1 108 PHE 108 89  89  PHE PHE A . n 
A 1 109 ALA 109 90  90  ALA ALA A . n 
A 1 110 TYR 110 91  91  TYR TYR A . n 
A 1 111 ASP 111 92  92  ASP ASP A . n 
A 1 112 SER 112 93  93  SER SER A . n 
A 1 113 THR 113 94  94  THR THR A . n 
A 1 114 PHE 114 95  95  PHE PHE A . n 
A 1 115 PRO 115 96  96  PRO PRO A . n 
A 1 116 THR 116 97  97  THR THR A . n 
A 1 117 ARG 117 98  98  ARG ARG A . n 
A 1 118 GLY 118 99  99  GLY GLY A . n 
A 1 119 LEU 119 100 100 LEU LEU A . n 
A 1 120 VAL 120 101 101 VAL VAL A . n 
A 1 121 PHE 121 102 102 PHE PHE A . n 
A 1 122 ASP 122 103 103 ASP ASP A . n 
A 1 123 THR 123 104 104 THR THR A . n 
A 1 124 LEU 124 105 105 LEU LEU A . n 
A 1 125 TYR 125 106 106 TYR TYR A . n 
A 1 126 GLY 126 107 107 GLY GLY A . n 
A 1 127 ASN 127 108 108 ASN ASN A . n 
A 1 128 LEU 128 109 109 LEU LEU A . n 
A 1 129 LEU 129 110 110 LEU LEU A . n 
A 1 130 LYS 130 111 111 LYS LYS A . n 
A 1 131 VAL 131 112 112 VAL VAL A . n 
A 1 132 ASP 132 113 113 ASP ASP A . n 
A 1 133 ALA 133 114 114 ALA ALA A . n 
A 1 134 TYR 134 115 115 TYR TYR A . n 
A 1 135 GLY 135 116 116 GLY GLY A . n 
A 1 136 ASN 136 117 117 ASN ASN A . n 
A 1 137 LEU 137 118 118 LEU LEU A . n 
A 1 138 LEU 138 119 119 LEU LEU A . n 
A 1 139 VAL 139 120 120 VAL VAL A . n 
A 1 140 CYS 140 121 121 CYS CYS A . n 
A 1 141 ALA 141 122 122 ALA ALA A . n 
A 1 142 HIS 142 123 123 HIS HIS A . n 
A 1 143 GLY 143 124 124 GLY GLY A . n 
A 1 144 PHE 144 125 125 PHE PHE A . n 
A 1 145 ASN 145 126 126 ASN ASN A . n 
A 1 146 PHE 146 127 127 PHE PHE A . n 
A 1 147 ILE 147 128 128 ILE ILE A . n 
A 1 148 ARG 148 129 129 ARG ARG A . n 
A 1 149 GLY 149 130 130 GLY GLY A . n 
A 1 150 PRO 150 131 131 PRO PRO A . n 
A 1 151 GLU 151 132 132 GLU GLU A . n 
A 1 152 THR 152 133 133 THR THR A . n 
A 1 153 ARG 153 134 134 ARG ARG A . n 
A 1 154 GLU 154 135 135 GLU GLU A . n 
A 1 155 GLN 155 136 136 GLN GLN A . n 
A 1 156 TYR 156 137 137 TYR TYR A . n 
A 1 157 PRO 157 138 138 PRO PRO A . n 
A 1 158 ASN 158 139 139 ASN ASN A . n 
A 1 159 LYS 159 140 140 LYS LYS A . n 
A 1 160 PHE 160 141 141 PHE PHE A . n 
A 1 161 ILE 161 142 142 ILE ILE A . n 
A 1 162 GLN 162 143 143 GLN GLN A . n 
A 1 163 ARG 163 144 144 ARG ARG A . n 
A 1 164 ASP 164 145 145 ASP ASP A . n 
A 1 165 ASP 165 146 146 ASP ASP A . n 
A 1 166 THR 166 147 147 THR THR A . n 
A 1 167 GLU 167 148 148 GLU GLU A . n 
A 1 168 ARG 168 149 149 ARG ARG A . n 
A 1 169 PHE 169 150 150 PHE PHE A . n 
A 1 170 TYR 170 151 151 TYR TYR A . n 
A 1 171 ILE 171 152 152 ILE ILE A . n 
A 1 172 LEU 172 153 153 LEU LEU A . n 
A 1 173 ASN 173 154 154 ASN ASN A . n 
A 1 174 THR 174 155 155 THR THR A . n 
A 1 175 LEU 175 156 156 LEU LEU A . n 
A 1 176 PHE 176 157 157 PHE PHE A . n 
A 1 177 ASN 177 158 158 ASN ASN A . n 
A 1 178 LEU 178 159 159 LEU LEU A . n 
A 1 179 PRO 179 160 160 PRO PRO A . n 
A 1 180 GLU 180 161 161 GLU GLU A . n 
A 1 181 THR 181 162 162 THR THR A . n 
A 1 182 TYR 182 163 163 TYR TYR A . n 
A 1 183 LEU 183 164 164 LEU LEU A . n 
A 1 184 LEU 184 165 165 LEU LEU A . n 
A 1 185 ALA 185 166 166 ALA ALA A . n 
A 1 186 CYS 186 167 167 CYS CYS A . n 
A 1 187 LEU 187 168 168 LEU LEU A . n 
A 1 188 VAL 188 169 169 VAL VAL A . n 
A 1 189 ASP 189 170 170 ASP ASP A . n 
A 1 190 PHE 190 171 171 PHE PHE A . n 
A 1 191 PHE 191 172 172 PHE PHE A . n 
A 1 192 THR 192 173 173 THR THR A . n 
A 1 193 ASN 193 174 174 ASN ASN A . n 
A 1 194 CYS 194 175 175 CYS CYS A . n 
A 1 195 PRO 195 176 176 PRO PRO A . n 
A 1 196 ARG 196 177 177 ARG ARG A . n 
A 1 197 TYR 197 178 178 TYR TYR A . n 
A 1 198 THR 198 179 179 THR THR A . n 
A 1 199 SER 199 180 180 SER SER A . n 
A 1 200 CYS 200 181 181 CYS CYS A . n 
A 1 201 GLU 201 182 182 GLU GLU A . n 
A 1 202 THR 202 183 183 THR THR A . n 
A 1 203 GLY 203 184 184 GLY GLY A . n 
A 1 204 PHE 204 185 185 PHE PHE A . n 
A 1 205 LYS 205 186 186 LYS LYS A . n 
A 1 206 ASP 206 187 187 ASP ASP A . n 
A 1 207 GLY 207 188 188 GLY GLY A . n 
A 1 208 ASP 208 189 189 ASP ASP A . n 
A 1 209 LEU 209 190 190 LEU LEU A . n 
A 1 210 PHE 210 191 191 PHE PHE A . n 
A 1 211 MET 211 192 192 MET MET A . n 
A 1 212 SER 212 193 193 SER SER A . n 
A 1 213 TYR 213 194 194 TYR TYR A . n 
A 1 214 ARG 214 195 195 ARG ARG A . n 
A 1 215 SER 215 196 196 SER SER A . n 
A 1 216 MET 216 197 197 MET MET A . n 
A 1 217 PHE 217 198 198 PHE PHE A . n 
A 1 218 GLN 218 199 199 GLN GLN A . n 
A 1 219 ASP 219 200 200 ASP ASP A . n 
A 1 220 VAL 220 201 201 VAL VAL A . n 
A 1 221 ARG 221 202 202 ARG ARG A . n 
A 1 222 ASP 222 203 203 ASP ASP A . n 
A 1 223 ALA 223 204 204 ALA ALA A . n 
A 1 224 VAL 224 205 205 VAL VAL A . n 
A 1 225 ASP 225 206 206 ASP ASP A . n 
A 1 226 TRP 226 207 207 TRP TRP A . n 
A 1 227 VAL 227 208 208 VAL VAL A . n 
A 1 228 HIS 228 209 209 HIS HIS A . n 
A 1 229 TYR 229 210 210 TYR TYR A . n 
A 1 230 LYS 230 211 211 LYS LYS A . n 
A 1 231 GLY 231 212 212 GLY GLY A . n 
A 1 232 SER 232 213 213 SER SER A . n 
A 1 233 LEU 233 214 214 LEU LEU A . n 
A 1 234 LYS 234 215 215 LYS LYS A . n 
A 1 235 GLU 235 216 216 GLU GLU A . n 
A 1 236 LYS 236 217 217 LYS LYS A . n 
A 1 237 THR 237 218 218 THR THR A . n 
A 1 238 VAL 238 219 219 VAL VAL A . n 
A 1 239 GLU 239 220 220 GLU GLU A . n 
A 1 240 ASN 240 221 221 ASN ASN A . n 
A 1 241 LEU 241 222 222 LEU LEU A . n 
A 1 242 GLU 242 223 223 GLU GLU A . n 
A 1 243 LYS 243 224 224 LYS LYS A . n 
A 1 244 TYR 244 225 225 TYR TYR A . n 
A 1 245 VAL 245 226 226 VAL VAL A . n 
A 1 246 VAL 246 227 227 VAL VAL A . n 
A 1 247 LYS 247 228 228 LYS LYS A . n 
A 1 248 ASP 248 229 229 ASP ASP A . n 
A 1 249 GLY 249 230 230 GLY GLY A . n 
A 1 250 LYS 250 231 231 LYS LYS A . n 
A 1 251 LEU 251 232 232 LEU LEU A . n 
A 1 252 PRO 252 233 233 PRO PRO A . n 
A 1 253 LEU 253 234 234 LEU LEU A . n 
A 1 254 LEU 254 235 235 LEU LEU A . n 
A 1 255 LEU 255 236 236 LEU LEU A . n 
A 1 256 SER 256 237 237 SER SER A . n 
A 1 257 ARG 257 238 238 ARG ARG A . n 
A 1 258 MET 258 239 239 MET MET A . n 
A 1 259 LYS 259 240 240 LYS LYS A . n 
A 1 260 GLU 260 241 241 GLU GLU A . n 
A 1 261 VAL 261 242 242 VAL VAL A . n 
A 1 262 GLY 262 243 243 GLY GLY A . n 
A 1 263 LYS 263 244 244 LYS LYS A . n 
A 1 264 VAL 264 245 245 VAL VAL A . n 
A 1 265 PHE 265 246 246 PHE PHE A . n 
A 1 266 LEU 266 247 247 LEU LEU A . n 
A 1 267 ALA 267 248 248 ALA ALA A . n 
A 1 268 THR 268 249 249 THR THR A . n 
A 1 269 ASN 269 250 250 ASN ASN A . n 
A 1 270 SER 270 251 251 SER SER A . n 
A 1 271 ASP 271 252 252 ASP ASP A . n 
A 1 272 TYR 272 253 253 TYR TYR A . n 
A 1 273 LYS 273 254 254 LYS LYS A . n 
A 1 274 TYR 274 255 255 TYR TYR A . n 
A 1 275 THR 275 256 256 THR THR A . n 
A 1 276 ASP 276 257 257 ASP ASP A . n 
A 1 277 LYS 277 258 258 LYS LYS A . n 
A 1 278 ILE 278 259 259 ILE ILE A . n 
A 1 279 MET 279 260 260 MET MET A . n 
A 1 280 THR 280 261 261 THR THR A . n 
A 1 281 TYR 281 262 262 TYR TYR A . n 
A 1 282 LEU 282 263 263 LEU LEU A . n 
A 1 283 PHE 283 264 264 PHE PHE A . n 
A 1 284 ASP 284 265 265 ASP ASP A . n 
A 1 285 PHE 285 266 266 PHE PHE A . n 
A 1 286 PRO 286 267 267 PRO PRO A . n 
A 1 287 HIS 287 268 268 HIS HIS A . n 
A 1 288 GLY 288 269 269 GLY GLY A . n 
A 1 289 PRO 289 270 270 PRO PRO A . n 
A 1 290 LYS 290 271 271 LYS LYS A . n 
A 1 291 PRO 291 272 272 PRO PRO A . n 
A 1 292 GLY 292 273 273 GLY GLY A . n 
A 1 293 SER 293 274 274 SER SER A . n 
A 1 294 SER 294 275 275 SER SER A . n 
A 1 295 HIS 295 276 276 HIS HIS A . n 
A 1 296 ARG 296 277 277 ARG ARG A . n 
A 1 297 PRO 297 278 278 PRO PRO A . n 
A 1 298 TRP 298 279 279 TRP TRP A . n 
A 1 299 GLN 299 280 280 GLN GLN A . n 
A 1 300 SER 300 281 281 SER SER A . n 
A 1 301 TYR 301 282 282 TYR TYR A . n 
A 1 302 PHE 302 283 283 PHE PHE A . n 
A 1 303 ASP 303 284 284 ASP ASP A . n 
A 1 304 LEU 304 285 285 LEU LEU A . n 
A 1 305 ILE 305 286 286 ILE ILE A . n 
A 1 306 LEU 306 287 287 LEU LEU A . n 
A 1 307 VAL 307 288 288 VAL VAL A . n 
A 1 308 ASP 308 289 289 ASP ASP A . n 
A 1 309 ALA 309 290 290 ALA ALA A . n 
A 1 310 ARG 310 291 291 ARG ARG A . n 
A 1 311 LYS 311 292 292 LYS LYS A . n 
A 1 312 PRO 312 293 293 PRO PRO A . n 
A 1 313 LEU 313 294 294 LEU LEU A . n 
A 1 314 PHE 314 295 295 PHE PHE A . n 
A 1 315 PHE 315 296 296 PHE PHE A . n 
A 1 316 GLY 316 297 297 GLY GLY A . n 
A 1 317 GLU 317 298 298 GLU GLU A . n 
A 1 318 GLY 318 299 299 GLY GLY A . n 
A 1 319 THR 319 300 300 THR THR A . n 
A 1 320 VAL 320 301 301 VAL VAL A . n 
A 1 321 LEU 321 302 302 LEU LEU A . n 
A 1 322 ARG 322 303 303 ARG ARG A . n 
A 1 323 GLN 323 304 304 GLN GLN A . n 
A 1 324 VAL 324 305 305 VAL VAL A . n 
A 1 325 ASP 325 306 306 ASP ASP A . n 
A 1 326 THR 326 307 307 THR THR A . n 
A 1 327 LYS 327 308 308 LYS LYS A . n 
A 1 328 THR 328 309 309 THR THR A . n 
A 1 329 GLY 329 310 310 GLY GLY A . n 
A 1 330 LYS 330 311 311 LYS LYS A . n 
A 1 331 LEU 331 312 312 LEU LEU A . n 
A 1 332 LYS 332 313 313 LYS LYS A . n 
A 1 333 ILE 333 314 314 ILE ILE A . n 
A 1 334 GLY 334 315 315 GLY GLY A . n 
A 1 335 THR 335 316 316 THR THR A . n 
A 1 336 TYR 336 317 317 TYR TYR A . n 
A 1 337 THR 337 318 318 THR THR A . n 
A 1 338 GLY 338 319 319 GLY GLY A . n 
A 1 339 PRO 339 320 320 PRO PRO A . n 
A 1 340 LEU 340 321 321 LEU LEU A . n 
A 1 341 GLN 341 322 322 GLN GLN A . n 
A 1 342 HIS 342 323 323 HIS HIS A . n 
A 1 343 GLY 343 324 324 GLY GLY A . n 
A 1 344 ILE 344 325 325 ILE ILE A . n 
A 1 345 VAL 345 326 326 VAL VAL A . n 
A 1 346 TYR 346 327 327 TYR TYR A . n 
A 1 347 SER 347 328 328 SER SER A . n 
A 1 348 GLY 348 329 329 GLY GLY A . n 
A 1 349 GLY 349 330 330 GLY GLY A . n 
A 1 350 SER 350 331 331 SER SER A . n 
A 1 351 SER 351 332 332 SER SER A . n 
A 1 352 ASP 352 333 333 ASP ASP A . n 
A 1 353 THR 353 334 334 THR THR A . n 
A 1 354 ILE 354 335 335 ILE ILE A . n 
A 1 355 CYS 355 336 336 CYS CYS A . n 
A 1 356 ASP 356 337 337 ASP ASP A . n 
A 1 357 LEU 357 338 338 LEU LEU A . n 
A 1 358 LEU 358 339 339 LEU LEU A . n 
A 1 359 GLY 359 340 340 GLY GLY A . n 
A 1 360 ALA 360 341 341 ALA ALA A . n 
A 1 361 LYS 361 342 342 LYS LYS A . n 
A 1 362 GLY 362 343 343 GLY GLY A . n 
A 1 363 LYS 363 344 344 LYS LYS A . n 
A 1 364 ASP 364 345 345 ASP ASP A . n 
A 1 365 ILE 365 346 346 ILE ILE A . n 
A 1 366 LEU 366 347 347 LEU LEU A . n 
A 1 367 TYR 367 348 348 TYR TYR A . n 
A 1 368 ILE 368 349 349 ILE ILE A . n 
A 1 369 GLY 369 350 350 GLY GLY A . n 
A 1 370 ASP 370 351 351 ASP ASP A . n 
A 1 371 HIS 371 352 352 HIS HIS A . n 
A 1 372 ILE 372 353 353 ILE ILE A . n 
A 1 373 PHE 373 354 354 PHE PHE A . n 
A 1 374 GLY 374 355 355 GLY GLY A . n 
A 1 375 ASP 375 356 356 ASP ASP A . n 
A 1 376 ILE 376 357 357 ILE ILE A . n 
A 1 377 LEU 377 358 358 LEU LEU A . n 
A 1 378 LYS 378 359 359 LYS LYS A . n 
A 1 379 SER 379 360 360 SER SER A . n 
A 1 380 LYS 380 361 361 LYS LYS A . n 
A 1 381 LYS 381 362 362 LYS LYS A . n 
A 1 382 ARG 382 363 363 ARG ARG A . n 
A 1 383 GLN 383 364 364 GLN GLN A . n 
A 1 384 GLY 384 365 365 GLY GLY A . n 
A 1 385 TRP 385 366 366 TRP TRP A . n 
A 1 386 ARG 386 367 367 ARG ARG A . n 
A 1 387 THR 387 368 368 THR THR A . n 
A 1 388 PHE 388 369 369 PHE PHE A . n 
A 1 389 LEU 389 370 370 LEU LEU A . n 
A 1 390 VAL 390 371 371 VAL VAL A . n 
A 1 391 ILE 391 372 372 ILE ILE A . n 
A 1 392 PRO 392 373 373 PRO PRO A . n 
A 1 393 GLU 393 374 374 GLU GLU A . n 
A 1 394 LEU 394 375 375 LEU LEU A . n 
A 1 395 ALA 395 376 376 ALA ALA A . n 
A 1 396 GLN 396 377 377 GLN GLN A . n 
A 1 397 GLU 397 378 378 GLU GLU A . n 
A 1 398 LEU 398 379 379 LEU LEU A . n 
A 1 399 HIS 399 380 380 HIS HIS A . n 
A 1 400 VAL 400 381 381 VAL VAL A . n 
A 1 401 TRP 401 382 382 TRP TRP A . n 
A 1 402 THR 402 383 383 THR THR A . n 
A 1 403 ASP 403 384 384 ASP ASP A . n 
A 1 404 LYS 404 385 385 LYS LYS A . n 
A 1 405 SER 405 386 386 SER SER A . n 
A 1 406 SER 406 387 387 SER SER A . n 
A 1 407 LEU 407 388 388 LEU LEU A . n 
A 1 408 PHE 408 389 389 PHE PHE A . n 
A 1 409 GLU 409 390 390 GLU GLU A . n 
A 1 410 GLU 410 391 391 GLU GLU A . n 
A 1 411 LEU 411 392 392 LEU LEU A . n 
A 1 412 GLN 412 393 393 GLN GLN A . n 
A 1 413 SER 413 394 394 SER SER A . n 
A 1 414 LEU 414 395 395 LEU LEU A . n 
A 1 415 ASP 415 396 396 ASP ASP A . n 
A 1 416 ILE 416 397 ?   ?   ?   A . n 
A 1 417 PHE 417 398 ?   ?   ?   A . n 
A 1 418 LEU 418 399 ?   ?   ?   A . n 
A 1 419 ALA 419 400 ?   ?   ?   A . n 
A 1 420 GLU 420 401 ?   ?   ?   A . n 
A 1 421 LEU 421 402 ?   ?   ?   A . n 
A 1 422 TYR 422 403 ?   ?   ?   A . n 
A 1 423 LYS 423 404 ?   ?   ?   A . n 
A 1 424 HIS 424 405 ?   ?   ?   A . n 
A 1 425 LEU 425 406 ?   ?   ?   A . n 
A 1 426 ASP 426 407 ?   ?   ?   A . n 
A 1 427 SER 427 408 ?   ?   ?   A . n 
A 1 428 SER 428 409 ?   ?   ?   A . n 
A 1 429 SER 429 410 ?   ?   ?   A . n 
A 1 430 ASN 430 411 ?   ?   ?   A . n 
A 1 431 GLU 431 412 ?   ?   ?   A . n 
A 1 432 ARG 432 413 ?   ?   ?   A . n 
A 1 433 PRO 433 414 ?   ?   ?   A . n 
A 1 434 ASP 434 415 ?   ?   ?   A . n 
A 1 435 ILE 435 416 ?   ?   ?   A . n 
A 1 436 SER 436 417 ?   ?   ?   A . n 
A 1 437 SER 437 418 ?   ?   ?   A . n 
A 1 438 ILE 438 419 ?   ?   ?   A . n 
A 1 439 GLN 439 420 ?   ?   ?   A . n 
A 1 440 ARG 440 421 421 ARG ARG A . n 
A 1 441 ARG 441 422 422 ARG ARG A . n 
A 1 442 ILE 442 423 423 ILE ILE A . n 
A 1 443 LYS 443 424 424 LYS LYS A . n 
A 1 444 LYS 444 425 425 LYS LYS A . n 
A 1 445 VAL 445 426 426 VAL VAL A . n 
A 1 446 THR 446 427 427 THR THR A . n 
A 1 447 HIS 447 428 428 HIS HIS A . n 
A 1 448 ASP 448 429 429 ASP ASP A . n 
A 1 449 MET 449 430 430 MET MET A . n 
A 1 450 ASP 450 431 431 ASP ASP A . n 
A 1 451 MET 451 432 432 MET MET A . n 
A 1 452 CYS 452 433 433 CYS CYS A . n 
A 1 453 TYR 453 434 434 TYR TYR A . n 
A 1 454 GLY 454 435 435 GLY GLY A . n 
A 1 455 MET 455 436 436 MET MET A . n 
A 1 456 MET 456 437 437 MET MET A . n 
A 1 457 GLY 457 438 438 GLY GLY A . n 
A 1 458 SER 458 439 439 SER SER A . n 
A 1 459 LEU 459 440 440 LEU LEU A . n 
A 1 460 PHE 460 441 441 PHE PHE A . n 
A 1 461 ARG 461 442 442 ARG ARG A . n 
A 1 462 SER 462 443 443 SER SER A . n 
A 1 463 GLY 463 444 444 GLY GLY A . n 
A 1 464 SER 464 445 445 SER SER A . n 
A 1 465 ARG 465 446 446 ARG ARG A . n 
A 1 466 GLN 466 447 447 GLN GLN A . n 
A 1 467 THR 467 448 448 THR THR A . n 
A 1 468 LEU 468 449 449 LEU LEU A . n 
A 1 469 PHE 469 450 450 PHE PHE A . n 
A 1 470 ALA 470 451 451 ALA ALA A . n 
A 1 471 SER 471 452 452 SER SER A . n 
A 1 472 GLN 472 453 453 GLN GLN A . n 
A 1 473 VAL 473 454 454 VAL VAL A . n 
A 1 474 MET 474 455 455 MET MET A . n 
A 1 475 ARG 475 456 456 ARG ARG A . n 
A 1 476 TYR 476 457 457 TYR TYR A . n 
A 1 477 ALA 477 458 458 ALA ALA A . n 
A 1 478 ASP 478 459 459 ASP ASP A . n 
A 1 479 LEU 479 460 460 LEU LEU A . n 
A 1 480 TYR 480 461 461 TYR TYR A . n 
A 1 481 ALA 481 462 462 ALA ALA A . n 
A 1 482 ALA 482 463 463 ALA ALA A . n 
A 1 483 SER 483 464 464 SER SER A . n 
A 1 484 PHE 484 465 465 PHE PHE A . n 
A 1 485 ILE 485 466 466 ILE ILE A . n 
A 1 486 ASN 486 467 467 ASN ASN A . n 
A 1 487 LEU 487 468 468 LEU LEU A . n 
A 1 488 LEU 488 469 469 LEU LEU A . n 
A 1 489 TYR 489 470 470 TYR TYR A . n 
A 1 490 TYR 490 471 471 TYR TYR A . n 
A 1 491 PRO 491 472 472 PRO PRO A . n 
A 1 492 PHE 492 473 473 PHE PHE A . n 
A 1 493 SER 493 474 474 SER SER A . n 
A 1 494 TYR 494 475 475 TYR TYR A . n 
A 1 495 LEU 495 476 476 LEU LEU A . n 
A 1 496 PHE 496 477 477 PHE PHE A . n 
A 1 497 ARG 497 478 478 ARG ARG A . n 
A 1 498 ALA 498 479 479 ALA ALA A . n 
A 1 499 ALA 499 480 480 ALA ALA A . n 
A 1 500 HIS 500 481 481 HIS HIS A . n 
A 1 501 VAL 501 482 482 VAL VAL A . n 
A 1 502 LEU 502 483 483 LEU LEU A . n 
A 1 503 MET 503 484 484 MET MET A . n 
A 1 504 PRO 504 485 485 PRO PRO A . n 
A 1 505 HIS 505 486 486 HIS HIS A . n 
A 1 506 GLU 506 487 487 GLU GLU A . n 
A 1 507 SER 507 488 488 SER SER A . n 
A 1 508 THR 508 489 ?   ?   ?   A . n 
A 1 509 VAL 509 490 ?   ?   ?   A . n 
A 1 510 GLU 510 491 ?   ?   ?   A . n 
A 1 511 HIS 511 492 ?   ?   ?   A . n 
A 1 512 THR 512 493 ?   ?   ?   A . n 
A 1 513 HIS 513 494 ?   ?   ?   A . n 
A 1 514 VAL 514 495 ?   ?   ?   A . n 
A 1 515 ASP 515 496 ?   ?   ?   A . n 
A 1 516 ILE 516 497 ?   ?   ?   A . n 
A 1 517 ASN 517 498 ?   ?   ?   A . n 
A 1 518 GLU 518 499 ?   ?   ?   A . n 
A 1 519 MET 519 500 ?   ?   ?   A . n 
A 1 520 GLU 520 501 ?   ?   ?   A . n 
A 1 521 SER 521 502 ?   ?   ?   A . n 
A 1 522 PRO 522 503 ?   ?   ?   A . n 
A 1 523 LEU 523 504 ?   ?   ?   A . n 
A 1 524 ALA 524 505 ?   ?   ?   A . n 
A 1 525 THR 525 506 ?   ?   ?   A . n 
A 1 526 ARG 526 507 ?   ?   ?   A . n 
A 1 527 ASN 527 508 ?   ?   ?   A . n 
A 1 528 ARG 528 509 ?   ?   ?   A . n 
A 1 529 THR 529 510 ?   ?   ?   A . n 
A 1 530 SER 530 511 ?   ?   ?   A . n 
A 1 531 VAL 531 512 ?   ?   ?   A . n 
A 1 532 ASP 532 513 ?   ?   ?   A . n 
A 1 533 PHE 533 514 ?   ?   ?   A . n 
A 1 534 LYS 534 515 ?   ?   ?   A . n 
A 1 535 ASP 535 516 ?   ?   ?   A . n 
A 1 536 THR 536 517 ?   ?   ?   A . n 
A 1 537 ASP 537 518 ?   ?   ?   A . n 
A 1 538 TYR 538 519 ?   ?   ?   A . n 
A 1 539 LYS 539 520 ?   ?   ?   A . n 
A 1 540 ARG 540 521 ?   ?   ?   A . n 
A 1 541 HIS 541 522 ?   ?   ?   A . n 
A 1 542 GLN 542 523 ?   ?   ?   A . n 
A 1 543 LEU 543 524 ?   ?   ?   A . n 
A 1 544 THR 544 525 ?   ?   ?   A . n 
A 1 545 ARG 545 526 ?   ?   ?   A . n 
A 1 546 SER 546 527 ?   ?   ?   A . n 
A 1 547 ILE 547 528 ?   ?   ?   A . n 
A 1 548 SER 548 529 ?   ?   ?   A . n 
A 1 549 GLU 549 530 ?   ?   ?   A . n 
A 1 550 ILE 550 531 ?   ?   ?   A . n 
A 1 551 LYS 551 532 ?   ?   ?   A . n 
A 1 552 PRO 552 533 ?   ?   ?   A . n 
A 1 553 PRO 553 534 ?   ?   ?   A . n 
A 1 554 ASN 554 535 ?   ?   ?   A . n 
A 1 555 LEU 555 536 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DG2 1   1489 1489 DG2 DG2 A . 
C 3 GOL 1   1490 1490 GOL GOL A . 
D 3 GOL 1   1491 1491 GOL GOL A . 
E 3 GOL 1   1492 1492 GOL GOL A . 
F 4 HOH 1   2001 2001 HOH HOH A . 
F 4 HOH 2   2002 2002 HOH HOH A . 
F 4 HOH 3   2003 2003 HOH HOH A . 
F 4 HOH 4   2004 2004 HOH HOH A . 
F 4 HOH 5   2005 2005 HOH HOH A . 
F 4 HOH 6   2006 2006 HOH HOH A . 
F 4 HOH 7   2007 2007 HOH HOH A . 
F 4 HOH 8   2008 2008 HOH HOH A . 
F 4 HOH 9   2009 2009 HOH HOH A . 
F 4 HOH 10  2010 2010 HOH HOH A . 
F 4 HOH 11  2011 2011 HOH HOH A . 
F 4 HOH 12  2012 2012 HOH HOH A . 
F 4 HOH 13  2013 2013 HOH HOH A . 
F 4 HOH 14  2014 2014 HOH HOH A . 
F 4 HOH 15  2015 2015 HOH HOH A . 
F 4 HOH 16  2016 2016 HOH HOH A . 
F 4 HOH 17  2017 2017 HOH HOH A . 
F 4 HOH 18  2018 2018 HOH HOH A . 
F 4 HOH 19  2019 2019 HOH HOH A . 
F 4 HOH 20  2020 2020 HOH HOH A . 
F 4 HOH 21  2021 2021 HOH HOH A . 
F 4 HOH 22  2022 2022 HOH HOH A . 
F 4 HOH 23  2023 2023 HOH HOH A . 
F 4 HOH 24  2024 2024 HOH HOH A . 
F 4 HOH 25  2025 2025 HOH HOH A . 
F 4 HOH 26  2026 2026 HOH HOH A . 
F 4 HOH 27  2027 2027 HOH HOH A . 
F 4 HOH 28  2028 2028 HOH HOH A . 
F 4 HOH 29  2029 2029 HOH HOH A . 
F 4 HOH 30  2030 2030 HOH HOH A . 
F 4 HOH 31  2031 2031 HOH HOH A . 
F 4 HOH 32  2032 2032 HOH HOH A . 
F 4 HOH 33  2033 2033 HOH HOH A . 
F 4 HOH 34  2034 2034 HOH HOH A . 
F 4 HOH 35  2035 2035 HOH HOH A . 
F 4 HOH 36  2036 2036 HOH HOH A . 
F 4 HOH 37  2037 2037 HOH HOH A . 
F 4 HOH 38  2038 2038 HOH HOH A . 
F 4 HOH 39  2039 2039 HOH HOH A . 
F 4 HOH 40  2040 2040 HOH HOH A . 
F 4 HOH 41  2041 2041 HOH HOH A . 
F 4 HOH 42  2042 2042 HOH HOH A . 
F 4 HOH 43  2043 2043 HOH HOH A . 
F 4 HOH 44  2044 2044 HOH HOH A . 
F 4 HOH 45  2045 2045 HOH HOH A . 
F 4 HOH 46  2046 2046 HOH HOH A . 
F 4 HOH 47  2047 2047 HOH HOH A . 
F 4 HOH 48  2048 2048 HOH HOH A . 
F 4 HOH 49  2049 2049 HOH HOH A . 
F 4 HOH 50  2050 2050 HOH HOH A . 
F 4 HOH 51  2051 2051 HOH HOH A . 
F 4 HOH 52  2052 2052 HOH HOH A . 
F 4 HOH 53  2053 2053 HOH HOH A . 
F 4 HOH 54  2054 2054 HOH HOH A . 
F 4 HOH 55  2055 2055 HOH HOH A . 
F 4 HOH 56  2056 2056 HOH HOH A . 
F 4 HOH 57  2057 2057 HOH HOH A . 
F 4 HOH 58  2058 2058 HOH HOH A . 
F 4 HOH 59  2059 2059 HOH HOH A . 
F 4 HOH 60  2060 2060 HOH HOH A . 
F 4 HOH 61  2061 2061 HOH HOH A . 
F 4 HOH 62  2062 2062 HOH HOH A . 
F 4 HOH 63  2063 2063 HOH HOH A . 
F 4 HOH 64  2064 2064 HOH HOH A . 
F 4 HOH 65  2065 2065 HOH HOH A . 
F 4 HOH 66  2066 2066 HOH HOH A . 
F 4 HOH 67  2067 2067 HOH HOH A . 
F 4 HOH 68  2068 2068 HOH HOH A . 
F 4 HOH 69  2069 2069 HOH HOH A . 
F 4 HOH 70  2070 2070 HOH HOH A . 
F 4 HOH 71  2071 2071 HOH HOH A . 
F 4 HOH 72  2072 2072 HOH HOH A . 
F 4 HOH 73  2073 2073 HOH HOH A . 
F 4 HOH 74  2074 2074 HOH HOH A . 
F 4 HOH 75  2075 2075 HOH HOH A . 
F 4 HOH 76  2076 2076 HOH HOH A . 
F 4 HOH 77  2077 2077 HOH HOH A . 
F 4 HOH 78  2078 2078 HOH HOH A . 
F 4 HOH 79  2079 2079 HOH HOH A . 
F 4 HOH 80  2080 2080 HOH HOH A . 
F 4 HOH 81  2081 2081 HOH HOH A . 
F 4 HOH 82  2082 2082 HOH HOH A . 
F 4 HOH 83  2083 2083 HOH HOH A . 
F 4 HOH 84  2084 2084 HOH HOH A . 
F 4 HOH 85  2085 2085 HOH HOH A . 
F 4 HOH 86  2086 2086 HOH HOH A . 
F 4 HOH 87  2087 2087 HOH HOH A . 
F 4 HOH 88  2088 2088 HOH HOH A . 
F 4 HOH 89  2089 2089 HOH HOH A . 
F 4 HOH 90  2090 2090 HOH HOH A . 
F 4 HOH 91  2091 2091 HOH HOH A . 
F 4 HOH 92  2092 2092 HOH HOH A . 
F 4 HOH 93  2093 2093 HOH HOH A . 
F 4 HOH 94  2094 2094 HOH HOH A . 
F 4 HOH 95  2095 2095 HOH HOH A . 
F 4 HOH 96  2096 2096 HOH HOH A . 
F 4 HOH 97  2097 2097 HOH HOH A . 
F 4 HOH 98  2098 2098 HOH HOH A . 
F 4 HOH 99  2099 2099 HOH HOH A . 
F 4 HOH 100 2100 2100 HOH HOH A . 
F 4 HOH 101 2101 2101 HOH HOH A . 
F 4 HOH 102 2102 2102 HOH HOH A . 
F 4 HOH 103 2103 2103 HOH HOH A . 
F 4 HOH 104 2104 2104 HOH HOH A . 
F 4 HOH 105 2105 2105 HOH HOH A . 
F 4 HOH 106 2106 2106 HOH HOH A . 
F 4 HOH 107 2107 2107 HOH HOH A . 
F 4 HOH 108 2108 2108 HOH HOH A . 
F 4 HOH 109 2109 2109 HOH HOH A . 
F 4 HOH 110 2110 2110 HOH HOH A . 
F 4 HOH 111 2111 2111 HOH HOH A . 
F 4 HOH 112 2112 2112 HOH HOH A . 
F 4 HOH 113 2113 2113 HOH HOH A . 
F 4 HOH 114 2114 2114 HOH HOH A . 
F 4 HOH 115 2115 2115 HOH HOH A . 
F 4 HOH 116 2116 2116 HOH HOH A . 
F 4 HOH 117 2117 2117 HOH HOH A . 
F 4 HOH 118 2118 2118 HOH HOH A . 
F 4 HOH 119 2119 2119 HOH HOH A . 
F 4 HOH 120 2120 2120 HOH HOH A . 
F 4 HOH 121 2121 2121 HOH HOH A . 
F 4 HOH 122 2122 2122 HOH HOH A . 
F 4 HOH 123 2123 2123 HOH HOH A . 
F 4 HOH 124 2124 2124 HOH HOH A . 
F 4 HOH 125 2125 2125 HOH HOH A . 
F 4 HOH 126 2126 2126 HOH HOH A . 
F 4 HOH 127 2127 2127 HOH HOH A . 
F 4 HOH 128 2128 2128 HOH HOH A . 
F 4 HOH 129 2129 2129 HOH HOH A . 
F 4 HOH 130 2130 2130 HOH HOH A . 
F 4 HOH 131 2131 2131 HOH HOH A . 
F 4 HOH 132 2132 2132 HOH HOH A . 
F 4 HOH 133 2133 2133 HOH HOH A . 
F 4 HOH 134 2134 2134 HOH HOH A . 
F 4 HOH 135 2135 2135 HOH HOH A . 
F 4 HOH 136 2136 2136 HOH HOH A . 
F 4 HOH 137 2137 2137 HOH HOH A . 
F 4 HOH 138 2138 2138 HOH HOH A . 
F 4 HOH 139 2139 2139 HOH HOH A . 
F 4 HOH 140 2140 2140 HOH HOH A . 
F 4 HOH 141 2141 2141 HOH HOH A . 
F 4 HOH 142 2142 2142 HOH HOH A . 
F 4 HOH 143 2143 2143 HOH HOH A . 
F 4 HOH 144 2144 2144 HOH HOH A . 
F 4 HOH 145 2145 2145 HOH HOH A . 
F 4 HOH 146 2146 2146 HOH HOH A . 
F 4 HOH 147 2147 2147 HOH HOH A . 
F 4 HOH 148 2148 2148 HOH HOH A . 
F 4 HOH 149 2149 2149 HOH HOH A . 
F 4 HOH 150 2150 2150 HOH HOH A . 
F 4 HOH 151 2151 2151 HOH HOH A . 
F 4 HOH 152 2152 2152 HOH HOH A . 
F 4 HOH 153 2153 2153 HOH HOH A . 
F 4 HOH 154 2154 2154 HOH HOH A . 
F 4 HOH 155 2155 2155 HOH HOH A . 
F 4 HOH 156 2156 2156 HOH HOH A . 
F 4 HOH 157 2157 2157 HOH HOH A . 
F 4 HOH 158 2158 2158 HOH HOH A . 
F 4 HOH 159 2159 2159 HOH HOH A . 
F 4 HOH 160 2160 2160 HOH HOH A . 
F 4 HOH 161 2161 2161 HOH HOH A . 
F 4 HOH 162 2162 2162 HOH HOH A . 
F 4 HOH 163 2163 2163 HOH HOH A . 
F 4 HOH 164 2164 2164 HOH HOH A . 
F 4 HOH 165 2165 2165 HOH HOH A . 
F 4 HOH 166 2166 2166 HOH HOH A . 
F 4 HOH 167 2167 2167 HOH HOH A . 
F 4 HOH 168 2168 2168 HOH HOH A . 
F 4 HOH 169 2169 2169 HOH HOH A . 
F 4 HOH 170 2170 2170 HOH HOH A . 
F 4 HOH 171 2171 2171 HOH HOH A . 
F 4 HOH 172 2172 2172 HOH HOH A . 
F 4 HOH 173 2173 2173 HOH HOH A . 
F 4 HOH 174 2174 2174 HOH HOH A . 
F 4 HOH 175 2175 2175 HOH HOH A . 
F 4 HOH 176 2176 2176 HOH HOH A . 
F 4 HOH 177 2177 2177 HOH HOH A . 
F 4 HOH 178 2178 2178 HOH HOH A . 
F 4 HOH 179 2179 2179 HOH HOH A . 
F 4 HOH 180 2180 2180 HOH HOH A . 
F 4 HOH 181 2181 2181 HOH HOH A . 
F 4 HOH 182 2182 2182 HOH HOH A . 
F 4 HOH 183 2183 2183 HOH HOH A . 
F 4 HOH 184 2184 2184 HOH HOH A . 
F 4 HOH 185 2185 2185 HOH HOH A . 
F 4 HOH 186 2186 2186 HOH HOH A . 
F 4 HOH 187 2187 2187 HOH HOH A . 
F 4 HOH 188 2188 2188 HOH HOH A . 
F 4 HOH 189 2189 2189 HOH HOH A . 
F 4 HOH 190 2190 2190 HOH HOH A . 
F 4 HOH 191 2191 2191 HOH HOH A . 
F 4 HOH 192 2192 2192 HOH HOH A . 
F 4 HOH 193 2193 2193 HOH HOH A . 
F 4 HOH 194 2194 2194 HOH HOH A . 
F 4 HOH 195 2195 2195 HOH HOH A . 
F 4 HOH 196 2196 2196 HOH HOH A . 
F 4 HOH 197 2197 2197 HOH HOH A . 
F 4 HOH 198 2198 2198 HOH HOH A . 
F 4 HOH 199 2199 2199 HOH HOH A . 
F 4 HOH 200 2200 2200 HOH HOH A . 
F 4 HOH 201 2201 2201 HOH HOH A . 
F 4 HOH 202 2202 2202 HOH HOH A . 
F 4 HOH 203 2203 2203 HOH HOH A . 
F 4 HOH 204 2204 2204 HOH HOH A . 
F 4 HOH 205 2205 2205 HOH HOH A . 
F 4 HOH 206 2206 2206 HOH HOH A . 
F 4 HOH 207 2207 2207 HOH HOH A . 
F 4 HOH 208 2208 2208 HOH HOH A . 
F 4 HOH 209 2209 2209 HOH HOH A . 
F 4 HOH 210 2210 2210 HOH HOH A . 
F 4 HOH 211 2211 2211 HOH HOH A . 
F 4 HOH 212 2212 2212 HOH HOH A . 
F 4 HOH 213 2213 2213 HOH HOH A . 
F 4 HOH 214 2214 2214 HOH HOH A . 
F 4 HOH 215 2215 2215 HOH HOH A . 
F 4 HOH 216 2216 2216 HOH HOH A . 
F 4 HOH 217 2217 2217 HOH HOH A . 
F 4 HOH 218 2218 2218 HOH HOH A . 
F 4 HOH 219 2219 2219 HOH HOH A . 
F 4 HOH 220 2220 2220 HOH HOH A . 
F 4 HOH 221 2221 2221 HOH HOH A . 
F 4 HOH 222 2222 2222 HOH HOH A . 
F 4 HOH 223 2223 2223 HOH HOH A . 
F 4 HOH 224 2224 2224 HOH HOH A . 
F 4 HOH 225 2225 2225 HOH HOH A . 
F 4 HOH 226 2226 2226 HOH HOH A . 
F 4 HOH 227 2227 2227 HOH HOH A . 
F 4 HOH 228 2228 2228 HOH HOH A . 
F 4 HOH 229 2229 2229 HOH HOH A . 
F 4 HOH 230 2230 2230 HOH HOH A . 
F 4 HOH 231 2231 2231 HOH HOH A . 
F 4 HOH 232 2232 2232 HOH HOH A . 
F 4 HOH 233 2233 2233 HOH HOH A . 
F 4 HOH 234 2234 2234 HOH HOH A . 
F 4 HOH 235 2235 2235 HOH HOH A . 
F 4 HOH 236 2236 2236 HOH HOH A . 
F 4 HOH 237 2237 2237 HOH HOH A . 
F 4 HOH 238 2238 2238 HOH HOH A . 
F 4 HOH 239 2239 2239 HOH HOH A . 
F 4 HOH 240 2240 2240 HOH HOH A . 
F 4 HOH 241 2241 2241 HOH HOH A . 
F 4 HOH 242 2242 2242 HOH HOH A . 
F 4 HOH 243 2243 2243 HOH HOH A . 
F 4 HOH 244 2244 2244 HOH HOH A . 
F 4 HOH 245 2245 2245 HOH HOH A . 
F 4 HOH 246 2246 2246 HOH HOH A . 
F 4 HOH 247 2247 2247 HOH HOH A . 
F 4 HOH 248 2248 2248 HOH HOH A . 
F 4 HOH 249 2249 2249 HOH HOH A . 
F 4 HOH 250 2250 2250 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    A5N 
_pdbx_struct_mod_residue.label_seq_id     71 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     A5N 
_pdbx_struct_mod_residue.auth_seq_id      52 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          O-CARBOXY-4-IMINO-L-HOMOSERINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6870  ? 
1 MORE         -1.9  ? 
1 'SSA (A^2)'  38470 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.4390000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-16 
2 'Structure model' 1 1 2016-07-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Non-polymer description' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2XJF 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   'THE IDENTITY OF THE CARBOXY GROUP OF ASN52 (A5N) IS UNCERTAIN' 
_pdbx_entry_details.sequence_details     
;ASP52 MUTATED TO AN ASPARAGINE WHICH WAS SUBSEQUENTLY
MODIFIED TO CARBOXY ASPARAGINE (A5N)
;
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PHE 
_pdbx_validate_rmsd_bond.auth_seq_id_1             51 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            A5N 
_pdbx_validate_rmsd_bond.auth_seq_id_2             52 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.482 
_pdbx_validate_rmsd_bond.bond_target_value         1.336 
_pdbx_validate_rmsd_bond.bond_deviation            0.146 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH1 A ARG 277 ? ? 124.10 120.30 3.80  0.50 N 
2 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH2 A ARG 277 ? ? 116.03 120.30 -4.27 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 56  ? ? -127.78 -68.24 
2 1 PRO A 267 ? ? -82.54  35.88  
3 1 PHE A 354 ? ? -103.72 -70.76 
4 1 ASP A 356 ? ? -85.76  -70.54 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 421 ? CG  ? A ARG 440 CG  
2 1 Y 1 A ARG 421 ? CD  ? A ARG 440 CD  
3 1 Y 1 A ARG 421 ? NE  ? A ARG 440 NE  
4 1 Y 1 A ARG 421 ? CZ  ? A ARG 440 CZ  
5 1 Y 1 A ARG 421 ? NH1 ? A ARG 440 NH1 
6 1 Y 1 A ARG 421 ? NH2 ? A ARG 440 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -18 ? A MET 1   
2  1 Y 1 A GLY -17 ? A GLY 2   
3  1 Y 1 A SER -16 ? A SER 3   
4  1 Y 1 A SER -15 ? A SER 4   
5  1 Y 1 A HIS -14 ? A HIS 5   
6  1 Y 1 A HIS -13 ? A HIS 6   
7  1 Y 1 A HIS -12 ? A HIS 7   
8  1 Y 1 A HIS -11 ? A HIS 8   
9  1 Y 1 A HIS -10 ? A HIS 9   
10 1 Y 1 A HIS -9  ? A HIS 10  
11 1 Y 1 A SER -8  ? A SER 11  
12 1 Y 1 A SER -7  ? A SER 12  
13 1 Y 1 A GLY -6  ? A GLY 13  
14 1 Y 1 A LEU -5  ? A LEU 14  
15 1 Y 1 A VAL -4  ? A VAL 15  
16 1 Y 1 A PRO -3  ? A PRO 16  
17 1 Y 1 A ARG -2  ? A ARG 17  
18 1 Y 1 A GLY -1  ? A GLY 18  
19 1 Y 1 A SER 0   ? A SER 19  
20 1 Y 1 A MET 1   ? A MET 20  
21 1 Y 1 A SER 2   ? A SER 21  
22 1 Y 1 A ILE 397 ? A ILE 416 
23 1 Y 1 A PHE 398 ? A PHE 417 
24 1 Y 1 A LEU 399 ? A LEU 418 
25 1 Y 1 A ALA 400 ? A ALA 419 
26 1 Y 1 A GLU 401 ? A GLU 420 
27 1 Y 1 A LEU 402 ? A LEU 421 
28 1 Y 1 A TYR 403 ? A TYR 422 
29 1 Y 1 A LYS 404 ? A LYS 423 
30 1 Y 1 A HIS 405 ? A HIS 424 
31 1 Y 1 A LEU 406 ? A LEU 425 
32 1 Y 1 A ASP 407 ? A ASP 426 
33 1 Y 1 A SER 408 ? A SER 427 
34 1 Y 1 A SER 409 ? A SER 428 
35 1 Y 1 A SER 410 ? A SER 429 
36 1 Y 1 A ASN 411 ? A ASN 430 
37 1 Y 1 A GLU 412 ? A GLU 431 
38 1 Y 1 A ARG 413 ? A ARG 432 
39 1 Y 1 A PRO 414 ? A PRO 433 
40 1 Y 1 A ASP 415 ? A ASP 434 
41 1 Y 1 A ILE 416 ? A ILE 435 
42 1 Y 1 A SER 417 ? A SER 436 
43 1 Y 1 A SER 418 ? A SER 437 
44 1 Y 1 A ILE 419 ? A ILE 438 
45 1 Y 1 A GLN 420 ? A GLN 439 
46 1 Y 1 A THR 489 ? A THR 508 
47 1 Y 1 A VAL 490 ? A VAL 509 
48 1 Y 1 A GLU 491 ? A GLU 510 
49 1 Y 1 A HIS 492 ? A HIS 511 
50 1 Y 1 A THR 493 ? A THR 512 
51 1 Y 1 A HIS 494 ? A HIS 513 
52 1 Y 1 A VAL 495 ? A VAL 514 
53 1 Y 1 A ASP 496 ? A ASP 515 
54 1 Y 1 A ILE 497 ? A ILE 516 
55 1 Y 1 A ASN 498 ? A ASN 517 
56 1 Y 1 A GLU 499 ? A GLU 518 
57 1 Y 1 A MET 500 ? A MET 519 
58 1 Y 1 A GLU 501 ? A GLU 520 
59 1 Y 1 A SER 502 ? A SER 521 
60 1 Y 1 A PRO 503 ? A PRO 522 
61 1 Y 1 A LEU 504 ? A LEU 523 
62 1 Y 1 A ALA 505 ? A ALA 524 
63 1 Y 1 A THR 506 ? A THR 525 
64 1 Y 1 A ARG 507 ? A ARG 526 
65 1 Y 1 A ASN 508 ? A ASN 527 
66 1 Y 1 A ARG 509 ? A ARG 528 
67 1 Y 1 A THR 510 ? A THR 529 
68 1 Y 1 A SER 511 ? A SER 530 
69 1 Y 1 A VAL 512 ? A VAL 531 
70 1 Y 1 A ASP 513 ? A ASP 532 
71 1 Y 1 A PHE 514 ? A PHE 533 
72 1 Y 1 A LYS 515 ? A LYS 534 
73 1 Y 1 A ASP 516 ? A ASP 535 
74 1 Y 1 A THR 517 ? A THR 536 
75 1 Y 1 A ASP 518 ? A ASP 537 
76 1 Y 1 A TYR 519 ? A TYR 538 
77 1 Y 1 A LYS 520 ? A LYS 539 
78 1 Y 1 A ARG 521 ? A ARG 540 
79 1 Y 1 A HIS 522 ? A HIS 541 
80 1 Y 1 A GLN 523 ? A GLN 542 
81 1 Y 1 A LEU 524 ? A LEU 543 
82 1 Y 1 A THR 525 ? A THR 544 
83 1 Y 1 A ARG 526 ? A ARG 545 
84 1 Y 1 A SER 527 ? A SER 546 
85 1 Y 1 A ILE 528 ? A ILE 547 
86 1 Y 1 A SER 529 ? A SER 548 
87 1 Y 1 A GLU 530 ? A GLU 549 
88 1 Y 1 A ILE 531 ? A ILE 550 
89 1 Y 1 A LYS 532 ? A LYS 551 
90 1 Y 1 A PRO 533 ? A PRO 552 
91 1 Y 1 A PRO 534 ? A PRO 553 
92 1 Y 1 A ASN 535 ? A ASN 554 
93 1 Y 1 A LEU 536 ? A LEU 555 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2R)-2,3-diphosphoglyceric acid' DG2 
3 GLYCEROL                          GOL 
4 water                             HOH 
#