data_2XK3
# 
_entry.id   2XK3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XK3         
PDBE  EBI-44534    
WWPDB D_1290044534 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2XKC unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 14'   
PDB 2W5B unspecified 'HUMAN NEK2 KINASE ATPGAMMAS-BOUND'                      
PDB 2XNP unspecified 'STRUCTURE OF NEK2 BOUND TO CCT244858'                   
PDB 2WQO unspecified 'STRUCTURE OF NEK2 BOUND TO THE AMINOPYRIDINE CCT241950' 
PDB 2JAV unspecified 'HUMAN KINASE WITH PYRROLE-INDOLINONE LIGAND'            
PDB 2XKE unspecified 'STRUCTURE OF NEK2 BOUND TO AMINIPYRAZINE COMPOUND 5'    
PDB 2XKD unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 12'   
PDB 2XK7 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 23'   
PDB 2W5H unspecified 'HUMAN NEK2 KINASE APO'                                  
PDB 2XKF unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 2'    
PDB 2XK8 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 15'   
PDB 2XNO unspecified 'STRUCTURE OF NEK2 BOUND TO CCT243779'                   
PDB 2XK6 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 36'   
PDB 2XNN unspecified 'STRUCTURE OF NEK2 BOUND TO CCT242430'                   
PDB 2XK4 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 17'   
PDB 2W5A unspecified 'HUMAN NEK2 KINASE ADP-BOUND'                            
PDB 2XNM unspecified 'STRUCTURE OF NEK2 BOUND TO CCT'                         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XK3 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-07 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mas-Droux, C.' 1 
'Bayliss, R.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Aminopyrazine Inhibitors Binding to an Unusual Inactive Conformation of the Mitotic Kinase Nek2: Sar and Structural Characterization.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            53 
_citation.page_first                7682 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20936789 
_citation.pdbx_database_id_DOI      10.1021/JM1008727 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Whelligan, D.K.'    1  
primary 'Solanki, S.'        2  
primary 'Taylor, D.'         3  
primary 'Thomson, D.W.'      4  
primary 'Cheung, K.M.'       5  
primary 'Boxall, K.'         6  
primary 'Mas-Droux, C.'      7  
primary 'Barillari, C.'      8  
primary 'Burns, S.'          9  
primary 'Grummitt, C.G.'     10 
primary 'Collins, I.'        11 
primary 'Van Montfort, R.L.' 12 
primary 'Aherne, G.W.'       13 
primary 'Bayliss, R.'        14 
primary 'Hoelder, S.'        15 
# 
_cell.entry_id           2XK3 
_cell.length_a           101.030 
_cell.length_b           57.090 
_cell.length_c           81.410 
_cell.angle_alpha        90.00 
_cell.angle_beta         133.50 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XK3 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE-PROTEIN KINASE NEK2'                                          32662.479 1   2.7.11.1 ? 
'CATALYTIC DOMAIN, RESIDUES 1-271' ? 
2 non-polymer syn '4-[3-AMINO-6-(3-ETHYLTHIOPHEN-2-YL)PYRAZIN-2-YL]CYCLOHEXANE-1-CARBOXYLIC ACID' 331.433   1   ?        ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                                                                  35.453    2   ?        ? ? ? 
4 water       nat water                                                                           18.015    177 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'NEK2, NEVER IN MITOSIS A-RELATED KINASE 2, NIMA-RELATED PROTEIN KINASE 2, NIMA-LIKE PROTEIN KINASE 1, HSPK 21' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   SER n 
1 4   ARG n 
1 5   ALA n 
1 6   GLU n 
1 7   ASP n 
1 8   TYR n 
1 9   GLU n 
1 10  VAL n 
1 11  LEU n 
1 12  TYR n 
1 13  THR n 
1 14  ILE n 
1 15  GLY n 
1 16  THR n 
1 17  GLY n 
1 18  SER n 
1 19  TYR n 
1 20  GLY n 
1 21  ARG n 
1 22  CYS n 
1 23  GLN n 
1 24  LYS n 
1 25  ILE n 
1 26  ARG n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ASP n 
1 31  GLY n 
1 32  LYS n 
1 33  ILE n 
1 34  LEU n 
1 35  VAL n 
1 36  TRP n 
1 37  LYS n 
1 38  GLU n 
1 39  LEU n 
1 40  ASP n 
1 41  TYR n 
1 42  GLY n 
1 43  SER n 
1 44  MET n 
1 45  THR n 
1 46  GLU n 
1 47  ALA n 
1 48  GLU n 
1 49  LYS n 
1 50  GLN n 
1 51  MET n 
1 52  LEU n 
1 53  VAL n 
1 54  SER n 
1 55  GLU n 
1 56  VAL n 
1 57  ASN n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  GLU n 
1 62  LEU n 
1 63  LYS n 
1 64  HIS n 
1 65  PRO n 
1 66  ASN n 
1 67  ILE n 
1 68  VAL n 
1 69  ARG n 
1 70  TYR n 
1 71  TYR n 
1 72  ASP n 
1 73  ARG n 
1 74  ILE n 
1 75  ILE n 
1 76  ASP n 
1 77  ARG n 
1 78  THR n 
1 79  ASN n 
1 80  THR n 
1 81  THR n 
1 82  LEU n 
1 83  TYR n 
1 84  ILE n 
1 85  VAL n 
1 86  MET n 
1 87  GLU n 
1 88  TYR n 
1 89  CYS n 
1 90  GLU n 
1 91  GLY n 
1 92  GLY n 
1 93  ASP n 
1 94  LEU n 
1 95  ALA n 
1 96  SER n 
1 97  VAL n 
1 98  ILE n 
1 99  THR n 
1 100 LYS n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 GLU n 
1 105 ARG n 
1 106 GLN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASP n 
1 110 GLU n 
1 111 GLU n 
1 112 PHE n 
1 113 VAL n 
1 114 LEU n 
1 115 ARG n 
1 116 VAL n 
1 117 MET n 
1 118 THR n 
1 119 GLN n 
1 120 LEU n 
1 121 THR n 
1 122 LEU n 
1 123 ALA n 
1 124 LEU n 
1 125 LYS n 
1 126 GLU n 
1 127 CYS n 
1 128 HIS n 
1 129 ARG n 
1 130 ARG n 
1 131 SER n 
1 132 ASP n 
1 133 GLY n 
1 134 GLY n 
1 135 HIS n 
1 136 THR n 
1 137 VAL n 
1 138 LEU n 
1 139 HIS n 
1 140 ARG n 
1 141 ASP n 
1 142 LEU n 
1 143 LYS n 
1 144 PRO n 
1 145 ALA n 
1 146 ASN n 
1 147 VAL n 
1 148 PHE n 
1 149 LEU n 
1 150 ASP n 
1 151 GLY n 
1 152 LYS n 
1 153 GLN n 
1 154 ASN n 
1 155 VAL n 
1 156 LYS n 
1 157 LEU n 
1 158 GLY n 
1 159 ASP n 
1 160 PHE n 
1 161 GLY n 
1 162 LEU n 
1 163 ALA n 
1 164 ARG n 
1 165 ILE n 
1 166 LEU n 
1 167 ASN n 
1 168 HIS n 
1 169 ASP n 
1 170 THR n 
1 171 SER n 
1 172 PHE n 
1 173 ALA n 
1 174 LYS n 
1 175 THR n 
1 176 PHE n 
1 177 VAL n 
1 178 GLY n 
1 179 THR n 
1 180 PRO n 
1 181 TYR n 
1 182 TYR n 
1 183 MET n 
1 184 SER n 
1 185 PRO n 
1 186 GLU n 
1 187 GLN n 
1 188 MET n 
1 189 ASN n 
1 190 ARG n 
1 191 MET n 
1 192 SER n 
1 193 TYR n 
1 194 ASN n 
1 195 GLU n 
1 196 LYS n 
1 197 SER n 
1 198 ASP n 
1 199 ILE n 
1 200 TRP n 
1 201 SER n 
1 202 LEU n 
1 203 GLY n 
1 204 CYS n 
1 205 LEU n 
1 206 LEU n 
1 207 TYR n 
1 208 GLU n 
1 209 LEU n 
1 210 CYS n 
1 211 ALA n 
1 212 LEU n 
1 213 MET n 
1 214 PRO n 
1 215 PRO n 
1 216 PHE n 
1 217 THR n 
1 218 ALA n 
1 219 PHE n 
1 220 SER n 
1 221 GLN n 
1 222 LYS n 
1 223 GLU n 
1 224 LEU n 
1 225 ALA n 
1 226 GLY n 
1 227 LYS n 
1 228 ILE n 
1 229 ARG n 
1 230 GLU n 
1 231 GLY n 
1 232 LYS n 
1 233 PHE n 
1 234 ARG n 
1 235 ARG n 
1 236 ILE n 
1 237 PRO n 
1 238 TYR n 
1 239 ARG n 
1 240 TYR n 
1 241 SER n 
1 242 ASP n 
1 243 GLU n 
1 244 LEU n 
1 245 ASN n 
1 246 GLU n 
1 247 ILE n 
1 248 ILE n 
1 249 THR n 
1 250 ARG n 
1 251 MET n 
1 252 LEU n 
1 253 ASN n 
1 254 LEU n 
1 255 LYS n 
1 256 ASP n 
1 257 TYR n 
1 258 HIS n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 VAL n 
1 263 GLU n 
1 264 GLU n 
1 265 ILE n 
1 266 LEU n 
1 267 GLU n 
1 268 ASN n 
1 269 PRO n 
1 270 LEU n 
1 271 ILE n 
1 272 LEU n 
1 273 GLU n 
1 274 HIS n 
1 275 HIS n 
1 276 HIS n 
1 277 HIS n 
1 278 HIS n 
1 279 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NEK2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P51955 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XK3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 271 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P51955 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  271 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       271 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XK3 LEU A 272 ? UNP P51955 ? ? 'expression tag' 272 1 
1 2XK3 GLU A 273 ? UNP P51955 ? ? 'expression tag' 273 2 
1 2XK3 HIS A 274 ? UNP P51955 ? ? 'expression tag' 274 3 
1 2XK3 HIS A 275 ? UNP P51955 ? ? 'expression tag' 275 4 
1 2XK3 HIS A 276 ? UNP P51955 ? ? 'expression tag' 276 5 
1 2XK3 HIS A 277 ? UNP P51955 ? ? 'expression tag' 277 6 
1 2XK3 HIS A 278 ? UNP P51955 ? ? 'expression tag' 278 7 
1 2XK3 HIS A 279 ? UNP P51955 ? ? 'expression tag' 279 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                         ? 'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking' y ARGININE                                                                        ? 'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                      ? 'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                 ? 'C4 H7 N O4'      
133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                                  ? 'Cl -1'           
35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                        ? 'C3 H7 N O2 S'    
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                       ? 'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                 ? 'C5 H9 N O4'      
147.129 
GLY 'peptide linking'   y GLYCINE                                                                         ? 'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                       ? 'C6 H10 N3 O2 1'  
156.162 
HOH non-polymer         . WATER                                                                           ? 'H2 O'            
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                      ? 'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                         ? 'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking' y LYSINE                                                                          ? 'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking' y METHIONINE                                                                      ? 'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                   ? 'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking' y PROLINE                                                                         ? 'C5 H9 N O2'      
115.130 
SER 'L-peptide linking' y SERINE                                                                          ? 'C3 H7 N O3'      
105.093 
THR 'L-peptide linking' y THREONINE                                                                       ? 'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                      ? 'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                        ? 'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking' y VALINE                                                                          ? 'C5 H11 N O2'     
117.146 
XK3 non-polymer         . '4-[3-AMINO-6-(3-ETHYLTHIOPHEN-2-YL)PYRAZIN-2-YL]CYCLOHEXANE-1-CARBOXYLIC ACID' ? 'C17 H21 N3 O2 S' 
331.433 
# 
_exptl.entry_id          2XK3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   52.80 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '2-10% PEG8000, 100MM TRIS PH6.8' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             0.9763 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XK3 
_reflns.observed_criterion_sigma_I   6.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.30 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   13956 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         81.2 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.70 
_reflns.B_iso_Wilson_estimate        21.00 
_reflns.pdbx_redundancy              3.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.563 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        3.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XK3 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     13232 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.03 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.684 
_refine.ls_d_res_high                            2.200 
_refine.ls_percent_reflns_obs                    76.97 
_refine.ls_R_factor_obs                          0.1876 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1847 
_refine.ls_R_factor_R_free                       0.2379 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_number_reflns_R_free                  710 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -1.0768 
_refine.aniso_B[2][2]                            -8.0380 
_refine.aniso_B[3][3]                            9.1148 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -7.2548 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.330 
_refine.solvent_model_param_bsol                 43.127 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2WQO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.27 
_refine.pdbx_overall_phase_error                 23.70 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1978 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         25 
_refine_hist.number_atoms_solvent             177 
_refine_hist.number_atoms_total               2180 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        19.684 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 2060 'X-RAY DIFFRACTION' ? 
f_angle_d          1.051  ? ? 2784 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.730 ? ? 774  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.077  ? ? 307  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.008  ? ? 354  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.2002 2.3698  2818 0.2285 88.00 0.2647 . . 157 . . 
'X-RAY DIFFRACTION' . 2.3698 2.6078  1747 0.2133 91.00 0.2440 . . 96  . . 
'X-RAY DIFFRACTION' . 2.6078 2.9840  1542 0.1870 95.00 0.2292 . . 94  . . 
'X-RAY DIFFRACTION' . 2.9840 3.7552  3177 0.1708 97.00 0.2242 . . 169 . . 
'X-RAY DIFFRACTION' . 3.7552 19.6850 3238 0.1733 98.00 0.2382 . . 194 . . 
# 
_struct.entry_id                  2XK3 
_struct.title                     'Structure of Nek2 bound to Aminopyrazine compound 35' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN KINASE NEK2 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XK3 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, CENTROSOME, MITOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 4   ? GLU A 6   ? ARG A 4   GLU A 6   5 ? 3  
HELX_P HELX_P2  2  GLY A 42  ? MET A 44  ? GLY A 42  MET A 44  5 ? 3  
HELX_P HELX_P3  3  THR A 45  ? LEU A 62  ? THR A 45  LEU A 62  1 ? 18 
HELX_P HELX_P4  4  LEU A 94  ? GLU A 104 ? LEU A 94  GLU A 104 1 ? 11 
HELX_P HELX_P5  5  ASP A 109 ? ARG A 130 ? ASP A 109 ARG A 130 1 ? 22 
HELX_P HELX_P6  6  LYS A 143 ? ALA A 145 ? LYS A 143 ALA A 145 5 ? 3  
HELX_P HELX_P7  7  ASN A 194 ? LEU A 212 ? ASN A 194 LEU A 212 1 ? 19 
HELX_P HELX_P8  8  SER A 220 ? GLY A 231 ? SER A 220 GLY A 231 1 ? 12 
HELX_P HELX_P9  9  SER A 241 ? LEU A 252 ? SER A 241 LEU A 252 1 ? 12 
HELX_P HELX_P10 10 LYS A 255 ? ARG A 259 ? LYS A 255 ARG A 259 5 ? 5  
HELX_P HELX_P11 11 SER A 261 ? GLU A 267 ? SER A 261 GLU A 267 1 ? 7  
HELX_P HELX_P12 12 LEU A 272 ? HIS A 276 ? LEU A 272 HIS A 276 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PHE 
_struct_mon_prot_cis.label_seq_id           160 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PHE 
_struct_mon_prot_cis.auth_seq_id            160 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    161 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     161 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 8   ? GLY A 15  ? TYR A 8   GLY A 15  
AA 2 CYS A 22  ? ARG A 27  ? CYS A 22  ARG A 27  
AA 3 ILE A 33  ? ASP A 40  ? ILE A 33  ASP A 40  
AA 4 THR A 81  ? GLU A 87  ? THR A 81  GLU A 87  
AA 5 TYR A 70  ? ASP A 76  ? TYR A 70  ASP A 76  
AB 1 GLY A 92  ? ASP A 93  ? GLY A 92  ASP A 93  
AB 2 VAL A 147 ? LEU A 149 ? VAL A 147 LEU A 149 
AB 3 VAL A 155 ? LEU A 157 ? VAL A 155 LEU A 157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 14  ? N ILE A 14  O CYS A 22  ? O CYS A 22  
AA 2 3 N ILE A 25  ? N ILE A 25  O LEU A 34  ? O LEU A 34  
AA 3 4 N LEU A 39  ? N LEU A 39  O LEU A 82  ? O LEU A 82  
AA 4 5 O VAL A 85  ? O VAL A 85  N TYR A 71  ? N TYR A 71  
AB 1 2 O GLY A 92  ? O GLY A 92  N LEU A 149 ? N LEU A 149 
AB 2 3 N PHE A 148 ? N PHE A 148 O LYS A 156 ? O LYS A 156 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE XK3 A 1280' 
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1281'  
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1282'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ILE A 14  ? ILE A 14   . ? 1_555 ? 
2  AC1 13 CYS A 22  ? CYS A 22   . ? 1_555 ? 
3  AC1 13 VAL A 35  ? VAL A 35   . ? 1_555 ? 
4  AC1 13 LYS A 37  ? LYS A 37   . ? 1_555 ? 
5  AC1 13 TYR A 70  ? TYR A 70   . ? 1_555 ? 
6  AC1 13 MET A 86  ? MET A 86   . ? 1_555 ? 
7  AC1 13 GLU A 87  ? GLU A 87   . ? 1_555 ? 
8  AC1 13 CYS A 89  ? CYS A 89   . ? 1_555 ? 
9  AC1 13 GLU A 90  ? GLU A 90   . ? 1_555 ? 
10 AC1 13 ASP A 93  ? ASP A 93   . ? 1_555 ? 
11 AC1 13 PHE A 148 ? PHE A 148  . ? 1_555 ? 
12 AC1 13 ASP A 159 ? ASP A 159  . ? 1_555 ? 
13 AC1 13 PHE A 160 ? PHE A 160  . ? 1_555 ? 
14 AC2 1  ARG A 235 ? ARG A 235  . ? 1_555 ? 
15 AC3 1  HOH E .   ? HOH A 2067 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XK3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XK3 
_atom_sites.fract_transf_matrix[1][1]   0.009898 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009393 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017516 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016934 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 3   ? 29.394  -8.656  -7.852  1.00 62.96  ? 3    SER A N   1 
ATOM   2    C  CA  . SER A 1 3   ? 30.514  -9.486  -8.290  1.00 64.91  ? 3    SER A CA  1 
ATOM   3    C  C   . SER A 1 3   ? 31.862  -8.833  -7.975  1.00 61.08  ? 3    SER A C   1 
ATOM   4    O  O   . SER A 1 3   ? 32.108  -8.447  -6.832  1.00 64.63  ? 3    SER A O   1 
ATOM   5    C  CB  . SER A 1 3   ? 30.397  -9.808  -9.782  1.00 67.20  ? 3    SER A CB  1 
ATOM   6    O  OG  . SER A 1 3   ? 29.204  -10.526 -10.049 1.00 69.05  ? 3    SER A OG  1 
ATOM   7    N  N   . ARG A 1 4   ? 32.734  -8.713  -8.975  1.00 54.20  ? 4    ARG A N   1 
ATOM   8    C  CA  . ARG A 1 4   ? 34.074  -8.160  -8.741  1.00 49.39  ? 4    ARG A CA  1 
ATOM   9    C  C   . ARG A 1 4   ? 34.563  -7.231  -9.851  1.00 42.50  ? 4    ARG A C   1 
ATOM   10   O  O   . ARG A 1 4   ? 34.319  -7.470  -11.034 1.00 37.93  ? 4    ARG A O   1 
ATOM   11   C  CB  . ARG A 1 4   ? 35.098  -9.278  -8.508  1.00 49.19  ? 4    ARG A CB  1 
ATOM   12   N  N   . ALA A 1 5   ? 35.273  -6.181  -9.452  1.00 41.05  ? 5    ALA A N   1 
ATOM   13   C  CA  . ALA A 1 5   ? 35.751  -5.163  -10.383 1.00 38.90  ? 5    ALA A CA  1 
ATOM   14   C  C   . ALA A 1 5   ? 36.714  -5.737  -11.419 1.00 37.75  ? 5    ALA A C   1 
ATOM   15   O  O   . ALA A 1 5   ? 36.759  -5.279  -12.561 1.00 34.91  ? 5    ALA A O   1 
ATOM   16   C  CB  . ALA A 1 5   ? 36.411  -4.029  -9.618  1.00 39.29  ? 5    ALA A CB  1 
ATOM   17   N  N   . GLU A 1 6   ? 37.484  -6.742  -11.016 1.00 38.77  ? 6    GLU A N   1 
ATOM   18   C  CA  . GLU A 1 6   ? 38.466  -7.360  -11.896 1.00 37.63  ? 6    GLU A CA  1 
ATOM   19   C  C   . GLU A 1 6   ? 37.807  -8.013  -13.106 1.00 36.30  ? 6    GLU A C   1 
ATOM   20   O  O   . GLU A 1 6   ? 38.485  -8.335  -14.088 1.00 38.39  ? 6    GLU A O   1 
ATOM   21   C  CB  . GLU A 1 6   ? 39.293  -8.396  -11.124 1.00 37.49  ? 6    GLU A CB  1 
ATOM   22   N  N   . ASP A 1 7   ? 36.487  -8.203  -13.034 1.00 32.26  ? 7    ASP A N   1 
ATOM   23   C  CA  . ASP A 1 7   ? 35.726  -8.795  -14.132 1.00 32.05  ? 7    ASP A CA  1 
ATOM   24   C  C   . ASP A 1 7   ? 35.503  -7.823  -15.285 1.00 31.67  ? 7    ASP A C   1 
ATOM   25   O  O   . ASP A 1 7   ? 34.953  -8.195  -16.328 1.00 31.37  ? 7    ASP A O   1 
ATOM   26   C  CB  . ASP A 1 7   ? 34.368  -9.291  -13.631 1.00 34.13  ? 7    ASP A CB  1 
ATOM   27   C  CG  . ASP A 1 7   ? 34.483  -10.542 -12.787 1.00 40.12  ? 7    ASP A CG  1 
ATOM   28   O  OD1 . ASP A 1 7   ? 35.449  -11.315 -12.997 1.00 37.26  ? 7    ASP A OD1 1 
ATOM   29   O  OD2 . ASP A 1 7   ? 33.605  -10.749 -11.923 1.00 42.35  ? 7    ASP A OD2 1 
ATOM   30   N  N   . TYR A 1 8   ? 35.922  -6.577  -15.088 1.00 30.21  ? 8    TYR A N   1 
ATOM   31   C  CA  . TYR A 1 8   ? 35.676  -5.520  -16.065 1.00 28.38  ? 8    TYR A CA  1 
ATOM   32   C  C   . TYR A 1 8   ? 36.946  -4.732  -16.339 1.00 27.13  ? 8    TYR A C   1 
ATOM   33   O  O   . TYR A 1 8   ? 37.812  -4.629  -15.479 1.00 24.26  ? 8    TYR A O   1 
ATOM   34   C  CB  . TYR A 1 8   ? 34.632  -4.549  -15.534 1.00 24.36  ? 8    TYR A CB  1 
ATOM   35   C  CG  . TYR A 1 8   ? 33.317  -5.170  -15.156 1.00 27.04  ? 8    TYR A CG  1 
ATOM   36   C  CD1 . TYR A 1 8   ? 33.091  -5.645  -13.870 1.00 28.49  ? 8    TYR A CD1 1 
ATOM   37   C  CD2 . TYR A 1 8   ? 32.278  -5.254  -16.083 1.00 28.60  ? 8    TYR A CD2 1 
ATOM   38   C  CE1 . TYR A 1 8   ? 31.859  -6.205  -13.519 1.00 30.24  ? 8    TYR A CE1 1 
ATOM   39   C  CE2 . TYR A 1 8   ? 31.055  -5.811  -15.746 1.00 28.40  ? 8    TYR A CE2 1 
ATOM   40   C  CZ  . TYR A 1 8   ? 30.848  -6.280  -14.464 1.00 33.29  ? 8    TYR A CZ  1 
ATOM   41   O  OH  . TYR A 1 8   ? 29.622  -6.829  -14.137 1.00 39.27  ? 8    TYR A OH  1 
ATOM   42   N  N   . GLU A 1 9   ? 37.038  -4.156  -17.531 1.00 30.12  ? 9    GLU A N   1 
ATOM   43   C  CA  . GLU A 1 9   ? 38.156  -3.287  -17.850 1.00 32.49  ? 9    GLU A CA  1 
ATOM   44   C  C   . GLU A 1 9   ? 37.680  -1.867  -18.165 1.00 28.17  ? 9    GLU A C   1 
ATOM   45   O  O   . GLU A 1 9   ? 36.877  -1.671  -19.078 1.00 25.44  ? 9    GLU A O   1 
ATOM   46   C  CB  . GLU A 1 9   ? 38.921  -3.850  -19.042 1.00 38.38  ? 9    GLU A CB  1 
ATOM   47   C  CG  . GLU A 1 9   ? 40.326  -3.307  -19.175 1.00 44.98  ? 9    GLU A CG  1 
ATOM   48   C  CD  . GLU A 1 9   ? 41.129  -4.073  -20.201 1.00 51.31  ? 9    GLU A CD  1 
ATOM   49   O  OE1 . GLU A 1 9   ? 40.570  -5.017  -20.811 1.00 50.84  ? 9    GLU A OE1 1 
ATOM   50   O  OE2 . GLU A 1 9   ? 42.316  -3.732  -20.394 1.00 55.18  ? 9    GLU A OE2 1 
ATOM   51   N  N   . VAL A 1 10  ? 38.170  -0.876  -17.420 1.00 25.37  ? 10   VAL A N   1 
ATOM   52   C  CA  . VAL A 1 10  ? 37.838  0.510   -17.739 1.00 28.27  ? 10   VAL A CA  1 
ATOM   53   C  C   . VAL A 1 10  ? 38.436  0.856   -19.099 1.00 32.46  ? 10   VAL A C   1 
ATOM   54   O  O   . VAL A 1 10  ? 39.584  0.532   -19.373 1.00 36.59  ? 10   VAL A O   1 
ATOM   55   C  CB  . VAL A 1 10  ? 38.371  1.506   -16.680 1.00 31.32  ? 10   VAL A CB  1 
ATOM   56   C  CG1 . VAL A 1 10  ? 38.038  2.949   -17.078 1.00 31.38  ? 10   VAL A CG1 1 
ATOM   57   C  CG2 . VAL A 1 10  ? 37.806  1.193   -15.296 1.00 30.22  ? 10   VAL A CG2 1 
ATOM   58   N  N   . LEU A 1 11  ? 37.645  1.490   -19.958 1.00 31.79  ? 11   LEU A N   1 
ATOM   59   C  CA  . LEU A 1 11  ? 38.129  1.970   -21.250 1.00 32.90  ? 11   LEU A CA  1 
ATOM   60   C  C   . LEU A 1 11  ? 38.496  3.445   -21.142 1.00 40.80  ? 11   LEU A C   1 
ATOM   61   O  O   . LEU A 1 11  ? 39.539  3.875   -21.638 1.00 44.92  ? 11   LEU A O   1 
ATOM   62   C  CB  . LEU A 1 11  ? 37.062  1.788   -22.338 1.00 31.12  ? 11   LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 11  ? 36.659  0.348   -22.682 1.00 27.60  ? 11   LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 11  ? 35.497  0.317   -23.669 1.00 25.10  ? 11   LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 11  ? 37.857  -0.411  -23.225 1.00 25.50  ? 11   LEU A CD2 1 
ATOM   66   N  N   . TYR A 1 12  ? 37.616  4.221   -20.512 1.00 37.68  ? 12   TYR A N   1 
ATOM   67   C  CA  . TYR A 1 12  ? 37.889  5.625   -20.219 1.00 34.89  ? 12   TYR A CA  1 
ATOM   68   C  C   . TYR A 1 12  ? 36.773  6.260   -19.408 1.00 31.65  ? 12   TYR A C   1 
ATOM   69   O  O   . TYR A 1 12  ? 35.682  5.704   -19.259 1.00 29.81  ? 12   TYR A O   1 
ATOM   70   C  CB  . TYR A 1 12  ? 38.133  6.449   -21.488 1.00 33.22  ? 12   TYR A CB  1 
ATOM   71   C  CG  . TYR A 1 12  ? 36.991  6.434   -22.481 1.00 30.00  ? 12   TYR A CG  1 
ATOM   72   C  CD1 . TYR A 1 12  ? 35.952  7.352   -22.400 1.00 27.70  ? 12   TYR A CD1 1 
ATOM   73   C  CD2 . TYR A 1 12  ? 36.964  5.506   -23.509 1.00 32.47  ? 12   TYR A CD2 1 
ATOM   74   C  CE1 . TYR A 1 12  ? 34.906  7.343   -23.330 1.00 27.47  ? 12   TYR A CE1 1 
ATOM   75   C  CE2 . TYR A 1 12  ? 35.931  5.482   -24.426 1.00 32.35  ? 12   TYR A CE2 1 
ATOM   76   C  CZ  . TYR A 1 12  ? 34.910  6.396   -24.332 1.00 32.18  ? 12   TYR A CZ  1 
ATOM   77   O  OH  . TYR A 1 12  ? 33.896  6.353   -25.256 1.00 38.89  ? 12   TYR A OH  1 
ATOM   78   N  N   . THR A 1 13  ? 37.072  7.441   -18.898 1.00 27.81  ? 13   THR A N   1 
ATOM   79   C  CA  . THR A 1 13  ? 36.161  8.180   -18.043 1.00 29.92  ? 13   THR A CA  1 
ATOM   80   C  C   . THR A 1 13  ? 35.213  9.007   -18.895 1.00 27.94  ? 13   THR A C   1 
ATOM   81   O  O   . THR A 1 13  ? 35.635  9.653   -19.853 1.00 25.12  ? 13   THR A O   1 
ATOM   82   C  CB  . THR A 1 13  ? 36.958  9.090   -17.083 1.00 29.56  ? 13   THR A CB  1 
ATOM   83   O  OG1 . THR A 1 13  ? 37.754  8.273   -16.216 1.00 31.83  ? 13   THR A OG1 1 
ATOM   84   C  CG2 . THR A 1 13  ? 36.026  9.976   -16.246 1.00 28.99  ? 13   THR A CG2 1 
ATOM   85   N  N   . ILE A 1 14  ? 33.931  8.967   -18.555 1.00 30.48  ? 14   ILE A N   1 
ATOM   86   C  CA  . ILE A 1 14  ? 32.938  9.782   -19.241 1.00 37.85  ? 14   ILE A CA  1 
ATOM   87   C  C   . ILE A 1 14  ? 32.813  11.145  -18.573 1.00 45.91  ? 14   ILE A C   1 
ATOM   88   O  O   . ILE A 1 14  ? 33.178  12.165  -19.157 1.00 49.61  ? 14   ILE A O   1 
ATOM   89   C  CB  . ILE A 1 14  ? 31.568  9.099   -19.255 1.00 37.36  ? 14   ILE A CB  1 
ATOM   90   C  CG1 . ILE A 1 14  ? 31.601  7.882   -20.166 1.00 30.27  ? 14   ILE A CG1 1 
ATOM   91   C  CG2 . ILE A 1 14  ? 30.492  10.070  -19.736 1.00 43.53  ? 14   ILE A CG2 1 
ATOM   92   C  CD1 . ILE A 1 14  ? 30.563  6.835   -19.797 1.00 29.70  ? 14   ILE A CD1 1 
ATOM   93   N  N   . GLY A 1 15  ? 32.302  11.156  -17.345 1.00 50.18  ? 15   GLY A N   1 
ATOM   94   C  CA  . GLY A 1 15  ? 32.185  12.382  -16.581 1.00 56.02  ? 15   GLY A CA  1 
ATOM   95   C  C   . GLY A 1 15  ? 32.549  12.213  -15.118 1.00 62.95  ? 15   GLY A C   1 
ATOM   96   O  O   . GLY A 1 15  ? 32.591  11.095  -14.606 1.00 64.41  ? 15   GLY A O   1 
ATOM   97   N  N   . THR A 1 16  ? 32.825  13.331  -14.450 1.00 67.36  ? 16   THR A N   1 
ATOM   98   C  CA  . THR A 1 16  ? 33.102  13.330  -13.017 1.00 70.66  ? 16   THR A CA  1 
ATOM   99   C  C   . THR A 1 16  ? 31.985  14.045  -12.266 1.00 73.06  ? 16   THR A C   1 
ATOM   100  O  O   . THR A 1 16  ? 30.883  14.208  -12.790 1.00 74.60  ? 16   THR A O   1 
ATOM   101  C  CB  . THR A 1 16  ? 34.445  14.013  -12.694 1.00 72.66  ? 16   THR A CB  1 
ATOM   102  O  OG1 . THR A 1 16  ? 34.601  14.129  -11.272 1.00 72.98  ? 16   THR A OG1 1 
ATOM   103  C  CG2 . THR A 1 16  ? 34.498  15.400  -13.324 1.00 74.03  ? 16   THR A CG2 1 
ATOM   104  N  N   . ARG A 1 21  ? 32.461  9.615   -10.085 1.00 38.74  ? 21   ARG A N   1 
ATOM   105  C  CA  . ARG A 1 21  ? 33.038  9.388   -11.409 1.00 39.31  ? 21   ARG A CA  1 
ATOM   106  C  C   . ARG A 1 21  ? 32.340  8.287   -12.222 1.00 37.29  ? 21   ARG A C   1 
ATOM   107  O  O   . ARG A 1 21  ? 32.051  7.207   -11.713 1.00 39.10  ? 21   ARG A O   1 
ATOM   108  C  CB  . ARG A 1 21  ? 34.528  9.077   -11.294 1.00 41.25  ? 21   ARG A CB  1 
ATOM   109  C  CG  . ARG A 1 21  ? 35.228  8.996   -12.629 1.00 42.98  ? 21   ARG A CG  1 
ATOM   110  C  CD  . ARG A 1 21  ? 36.724  8.870   -12.453 1.00 47.01  ? 21   ARG A CD  1 
ATOM   111  N  NE  . ARG A 1 21  ? 37.093  7.693   -11.674 1.00 48.83  ? 21   ARG A NE  1 
ATOM   112  C  CZ  . ARG A 1 21  ? 38.318  7.177   -11.646 1.00 51.33  ? 21   ARG A CZ  1 
ATOM   113  N  NH1 . ARG A 1 21  ? 39.285  7.734   -12.360 1.00 50.07  ? 21   ARG A NH1 1 
ATOM   114  N  NH2 . ARG A 1 21  ? 38.575  6.097   -10.916 1.00 53.93  ? 21   ARG A NH2 1 
ATOM   115  N  N   . CYS A 1 22  ? 32.099  8.582   -13.495 1.00 31.15  ? 22   CYS A N   1 
ATOM   116  C  CA  A CYS A 1 22  ? 31.433  7.647   -14.390 0.50 28.37  ? 22   CYS A CA  1 
ATOM   117  C  CA  B CYS A 1 22  ? 31.412  7.685   -14.415 0.50 28.46  ? 22   CYS A CA  1 
ATOM   118  C  C   . CYS A 1 22  ? 32.395  7.190   -15.479 1.00 26.64  ? 22   CYS A C   1 
ATOM   119  O  O   . CYS A 1 22  ? 33.147  7.987   -16.047 1.00 29.40  ? 22   CYS A O   1 
ATOM   120  C  CB  A CYS A 1 22  ? 30.173  8.270   -15.005 0.50 28.82  ? 22   CYS A CB  1 
ATOM   121  C  CB  B CYS A 1 22  ? 30.275  8.451   -15.093 0.50 28.78  ? 22   CYS A CB  1 
ATOM   122  S  SG  A CYS A 1 22  ? 28.644  8.072   -14.019 0.50 21.14  ? 22   CYS A SG  1 
ATOM   123  S  SG  B CYS A 1 22  ? 29.042  7.439   -15.933 0.50 32.59  ? 22   CYS A SG  1 
ATOM   124  N  N   . GLN A 1 23  ? 32.386  5.890   -15.762 1.00 19.77  ? 23   GLN A N   1 
ATOM   125  C  CA  . GLN A 1 23  ? 33.320  5.344   -16.738 1.00 20.29  ? 23   GLN A CA  1 
ATOM   126  C  C   . GLN A 1 23  ? 32.699  4.303   -17.651 1.00 19.47  ? 23   GLN A C   1 
ATOM   127  O  O   . GLN A 1 23  ? 31.873  3.500   -17.223 1.00 18.61  ? 23   GLN A O   1 
ATOM   128  C  CB  . GLN A 1 23  ? 34.521  4.716   -16.027 1.00 22.00  ? 23   GLN A CB  1 
ATOM   129  C  CG  . GLN A 1 23  ? 35.158  5.607   -14.962 1.00 21.97  ? 23   GLN A CG  1 
ATOM   130  C  CD  . GLN A 1 23  ? 36.401  4.970   -14.372 1.00 24.54  ? 23   GLN A CD  1 
ATOM   131  O  OE1 . GLN A 1 23  ? 36.317  3.988   -13.638 1.00 24.92  ? 23   GLN A OE1 1 
ATOM   132  N  NE2 . GLN A 1 23  ? 37.566  5.520   -14.703 1.00 27.99  ? 23   GLN A NE2 1 
ATOM   133  N  N   . LYS A 1 24  ? 33.117  4.324   -18.912 1.00 18.27  ? 24   LYS A N   1 
ATOM   134  C  CA  . LYS A 1 24  ? 32.742  3.307   -19.874 1.00 19.25  ? 24   LYS A CA  1 
ATOM   135  C  C   . LYS A 1 24  ? 33.638  2.108   -19.633 1.00 20.96  ? 24   LYS A C   1 
ATOM   136  O  O   . LYS A 1 24  ? 34.845  2.266   -19.524 1.00 21.87  ? 24   LYS A O   1 
ATOM   137  C  CB  . LYS A 1 24  ? 32.928  3.841   -21.293 1.00 22.63  ? 24   LYS A CB  1 
ATOM   138  C  CG  . LYS A 1 24  ? 32.593  2.859   -22.417 1.00 26.67  ? 24   LYS A CG  1 
ATOM   139  C  CD  . LYS A 1 24  ? 32.714  3.599   -23.739 1.00 29.85  ? 24   LYS A CD  1 
ATOM   140  C  CE  . LYS A 1 24  ? 32.535  2.705   -24.928 1.00 34.03  ? 24   LYS A CE  1 
ATOM   141  N  NZ  . LYS A 1 24  ? 32.551  3.525   -26.166 1.00 36.45  ? 24   LYS A NZ  1 
ATOM   142  N  N   . ILE A 1 25  ? 33.043  0.919   -19.525 1.00 20.43  ? 25   ILE A N   1 
ATOM   143  C  CA  . ILE A 1 25  ? 33.792  -0.292  -19.191 1.00 23.63  ? 25   ILE A CA  1 
ATOM   144  C  C   . ILE A 1 25  ? 33.402  -1.462  -20.089 1.00 24.95  ? 25   ILE A C   1 
ATOM   145  O  O   . ILE A 1 25  ? 32.345  -1.449  -20.719 1.00 25.47  ? 25   ILE A O   1 
ATOM   146  C  CB  . ILE A 1 25  ? 33.532  -0.721  -17.726 1.00 22.18  ? 25   ILE A CB  1 
ATOM   147  C  CG1 . ILE A 1 25  ? 32.060  -1.131  -17.561 1.00 22.29  ? 25   ILE A CG1 1 
ATOM   148  C  CG2 . ILE A 1 25  ? 33.896  0.404   -16.762 1.00 19.80  ? 25   ILE A CG2 1 
ATOM   149  C  CD1 . ILE A 1 25  ? 31.645  -1.369  -16.136 1.00 23.57  ? 25   ILE A CD1 1 
ATOM   150  N  N   . ARG A 1 26  ? 34.258  -2.481  -20.120 0.94 26.35  ? 26   ARG A N   1 
ATOM   151  C  CA  . ARG A 1 26  ? 34.004  -3.687  -20.887 0.94 29.38  ? 26   ARG A CA  1 
ATOM   152  C  C   . ARG A 1 26  ? 34.054  -4.952  -20.016 0.94 31.20  ? 26   ARG A C   1 
ATOM   153  O  O   . ARG A 1 26  ? 35.075  -5.260  -19.411 0.94 34.82  ? 26   ARG A O   1 
ATOM   154  C  CB  . ARG A 1 26  ? 35.015  -3.806  -22.023 0.94 33.44  ? 26   ARG A CB  1 
ATOM   155  C  CG  . ARG A 1 26  ? 34.816  -5.034  -22.872 0.94 34.80  ? 26   ARG A CG  1 
ATOM   156  C  CD  . ARG A 1 26  ? 36.030  -5.305  -23.721 0.94 36.86  ? 26   ARG A CD  1 
ATOM   157  N  NE  . ARG A 1 26  ? 36.049  -4.484  -24.924 0.94 35.93  ? 26   ARG A NE  1 
ATOM   158  C  CZ  . ARG A 1 26  ? 37.162  -4.113  -25.551 0.94 38.55  ? 26   ARG A CZ  1 
ATOM   159  N  NH1 . ARG A 1 26  ? 37.090  -3.369  -26.642 0.94 40.15  ? 26   ARG A NH1 1 
ATOM   160  N  NH2 . ARG A 1 26  ? 38.351  -4.479  -25.083 0.94 39.65  ? 26   ARG A NH2 1 
ATOM   161  N  N   . ARG A 1 27  ? 32.940  -5.672  -19.954 1.00 29.48  ? 27   ARG A N   1 
ATOM   162  C  CA  . ARG A 1 27  ? 32.886  -6.945  -19.250 1.00 30.59  ? 27   ARG A CA  1 
ATOM   163  C  C   . ARG A 1 27  ? 33.743  -7.982  -19.989 1.00 31.88  ? 27   ARG A C   1 
ATOM   164  O  O   . ARG A 1 27  ? 33.535  -8.232  -21.173 1.00 33.24  ? 27   ARG A O   1 
ATOM   165  C  CB  . ARG A 1 27  ? 31.436  -7.415  -19.140 1.00 31.66  ? 27   ARG A CB  1 
ATOM   166  C  CG  . ARG A 1 27  ? 31.244  -8.742  -18.415 1.00 36.42  ? 27   ARG A CG  1 
ATOM   167  C  CD  . ARG A 1 27  ? 29.774  -8.964  -18.052 1.00 39.01  ? 27   ARG A CD  1 
ATOM   168  N  NE  . ARG A 1 27  ? 28.916  -9.127  -19.224 1.00 40.79  ? 27   ARG A NE  1 
ATOM   169  C  CZ  . ARG A 1 27  ? 27.590  -9.021  -19.198 1.00 41.77  ? 27   ARG A CZ  1 
ATOM   170  N  NH1 . ARG A 1 27  ? 26.968  -8.743  -18.058 1.00 42.10  ? 27   ARG A NH1 1 
ATOM   171  N  NH2 . ARG A 1 27  ? 26.885  -9.180  -20.312 1.00 41.56  ? 27   ARG A NH2 1 
ATOM   172  N  N   . LYS A 1 28  ? 34.715  -8.564  -19.295 1.00 32.05  ? 28   LYS A N   1 
ATOM   173  C  CA  . LYS A 1 28  ? 35.641  -9.523  -19.909 1.00 38.37  ? 28   LYS A CA  1 
ATOM   174  C  C   . LYS A 1 28  ? 34.994  -10.805 -20.463 1.00 41.39  ? 28   LYS A C   1 
ATOM   175  O  O   . LYS A 1 28  ? 35.401  -11.307 -21.514 1.00 40.56  ? 28   LYS A O   1 
ATOM   176  C  CB  . LYS A 1 28  ? 36.746  -9.904  -18.920 1.00 40.86  ? 28   LYS A CB  1 
ATOM   177  C  CG  . LYS A 1 28  ? 37.722  -8.790  -18.601 1.00 38.96  ? 28   LYS A CG  1 
ATOM   178  C  CD  . LYS A 1 28  ? 38.669  -9.216  -17.494 1.00 40.17  ? 28   LYS A CD  1 
ATOM   179  C  CE  . LYS A 1 28  ? 39.820  -8.237  -17.362 1.00 40.29  ? 28   LYS A CE  1 
ATOM   180  N  NZ  . LYS A 1 28  ? 40.634  -8.546  -16.173 1.00 41.76  ? 28   LYS A NZ  1 
ATOM   181  N  N   . SER A 1 29  ? 34.006  -11.343 -19.754 1.00 44.43  ? 29   SER A N   1 
ATOM   182  C  CA  . SER A 1 29  ? 33.390  -12.617 -20.151 1.00 46.08  ? 29   SER A CA  1 
ATOM   183  C  C   . SER A 1 29  ? 32.902  -12.641 -21.608 1.00 46.79  ? 29   SER A C   1 
ATOM   184  O  O   . SER A 1 29  ? 33.135  -13.617 -22.323 1.00 48.53  ? 29   SER A O   1 
ATOM   185  C  CB  . SER A 1 29  ? 32.243  -12.996 -19.205 1.00 42.39  ? 29   SER A CB  1 
ATOM   186  O  OG  . SER A 1 29  ? 31.164  -12.077 -19.309 1.00 41.79  ? 29   SER A OG  1 
ATOM   187  N  N   . ASP A 1 30  ? 32.241  -11.568 -22.044 1.00 44.05  ? 30   ASP A N   1 
ATOM   188  C  CA  . ASP A 1 30  ? 31.647  -11.522 -23.383 1.00 41.71  ? 30   ASP A CA  1 
ATOM   189  C  C   . ASP A 1 30  ? 31.917  -10.209 -24.112 1.00 39.76  ? 30   ASP A C   1 
ATOM   190  O  O   . ASP A 1 30  ? 31.352  -9.958  -25.178 1.00 35.93  ? 30   ASP A O   1 
ATOM   191  C  CB  . ASP A 1 30  ? 30.134  -11.746 -23.299 1.00 43.59  ? 30   ASP A CB  1 
ATOM   192  C  CG  . ASP A 1 30  ? 29.433  -10.656 -22.514 1.00 46.02  ? 30   ASP A CG  1 
ATOM   193  O  OD1 . ASP A 1 30  ? 30.097  -9.653  -22.188 1.00 45.47  ? 30   ASP A OD1 1 
ATOM   194  O  OD2 . ASP A 1 30  ? 28.230  -10.803 -22.210 1.00 47.24  ? 30   ASP A OD2 1 
ATOM   195  N  N   . GLY A 1 31  ? 32.765  -9.366  -23.529 1.00 38.43  ? 31   GLY A N   1 
ATOM   196  C  CA  . GLY A 1 31  ? 33.109  -8.083  -24.126 1.00 35.49  ? 31   GLY A CA  1 
ATOM   197  C  C   . GLY A 1 31  ? 31.994  -7.046  -24.175 1.00 37.42  ? 31   GLY A C   1 
ATOM   198  O  O   . GLY A 1 31  ? 32.105  -6.046  -24.885 1.00 37.42  ? 31   GLY A O   1 
ATOM   199  N  N   . LYS A 1 32  ? 30.919  -7.265  -23.422 1.00 34.67  ? 32   LYS A N   1 
ATOM   200  C  CA  . LYS A 1 32  ? 29.797  -6.327  -23.431 1.00 31.44  ? 32   LYS A CA  1 
ATOM   201  C  C   . LYS A 1 32  ? 30.200  -4.937  -22.930 1.00 27.24  ? 32   LYS A C   1 
ATOM   202  O  O   . LYS A 1 32  ? 30.865  -4.816  -21.899 1.00 29.01  ? 32   LYS A O   1 
ATOM   203  C  CB  . LYS A 1 32  ? 28.625  -6.862  -22.597 1.00 33.16  ? 32   LYS A CB  1 
ATOM   204  C  CG  . LYS A 1 32  ? 27.425  -5.915  -22.593 1.00 35.34  ? 32   LYS A CG  1 
ATOM   205  C  CD  . LYS A 1 32  ? 26.110  -6.663  -22.500 1.00 37.47  ? 32   LYS A CD  1 
ATOM   206  C  CE  . LYS A 1 32  ? 24.917  -5.715  -22.677 1.00 38.72  ? 32   LYS A CE  1 
ATOM   207  N  NZ  . LYS A 1 32  ? 24.833  -5.160  -24.055 1.00 37.94  ? 32   LYS A NZ  1 
ATOM   208  N  N   . ILE A 1 33  ? 29.793  -3.901  -23.660 1.00 26.81  ? 33   ILE A N   1 
ATOM   209  C  CA  . ILE A 1 33  ? 30.079  -2.513  -23.278 1.00 30.07  ? 33   ILE A CA  1 
ATOM   210  C  C   . ILE A 1 33  ? 29.082  -1.976  -22.247 1.00 27.62  ? 33   ILE A C   1 
ATOM   211  O  O   . ILE A 1 33  ? 27.883  -1.955  -22.489 1.00 28.14  ? 33   ILE A O   1 
ATOM   212  C  CB  . ILE A 1 33  ? 30.114  -1.573  -24.510 1.00 21.53  ? 33   ILE A CB  1 
ATOM   213  C  CG1 . ILE A 1 33  ? 31.187  -2.040  -25.500 1.00 24.50  ? 33   ILE A CG1 1 
ATOM   214  C  CG2 . ILE A 1 33  ? 30.423  -0.154  -24.090 1.00 18.04  ? 33   ILE A CG2 1 
ATOM   215  C  CD1 . ILE A 1 33  ? 32.602  -1.990  -24.924 1.00 22.29  ? 33   ILE A CD1 1 
ATOM   216  N  N   . LEU A 1 34  ? 29.591  -1.559  -21.089 1.00 25.93  ? 34   LEU A N   1 
ATOM   217  C  CA  . LEU A 1 34  ? 28.744  -1.055  -20.018 1.00 21.25  ? 34   LEU A CA  1 
ATOM   218  C  C   . LEU A 1 34  ? 29.299  0.268   -19.509 1.00 22.23  ? 34   LEU A C   1 
ATOM   219  O  O   . LEU A 1 34  ? 30.205  0.856   -20.111 1.00 23.25  ? 34   LEU A O   1 
ATOM   220  C  CB  . LEU A 1 34  ? 28.623  -2.087  -18.880 1.00 22.61  ? 34   LEU A CB  1 
ATOM   221  C  CG  . LEU A 1 34  ? 27.922  -3.409  -19.270 1.00 22.30  ? 34   LEU A CG  1 
ATOM   222  C  CD1 . LEU A 1 34  ? 28.236  -4.581  -18.354 1.00 23.06  ? 34   LEU A CD1 1 
ATOM   223  C  CD2 . LEU A 1 34  ? 26.398  -3.201  -19.374 1.00 26.57  ? 34   LEU A CD2 1 
ATOM   224  N  N   . VAL A 1 35  ? 28.792  0.726   -18.490 1.00 14.61  ? 35   VAL A N   1 
ATOM   225  C  CA  . VAL A 1 35  ? 29.104  1.949   -17.779 1.00 18.18  ? 35   VAL A CA  1 
ATOM   226  C  C   . VAL A 1 35  ? 29.099  1.565   -16.318 1.00 15.08  ? 35   VAL A C   1 
ATOM   227  O  O   . VAL A 1 35  ? 28.361  0.658   -15.919 1.00 21.44  ? 35   VAL A O   1 
ATOM   228  C  CB  . VAL A 1 35  ? 28.095  3.080   -18.050 1.00 25.60  ? 35   VAL A CB  1 
ATOM   229  C  CG1 . VAL A 1 35  ? 28.407  4.291   -17.184 1.00 27.60  ? 35   VAL A CG1 1 
ATOM   230  C  CG2 . VAL A 1 35  ? 28.098  3.456   -19.524 1.00 28.45  ? 35   VAL A CG2 1 
ATOM   231  N  N   . TRP A 1 36  ? 30.062  2.131   -15.463 1.00 17.14  ? 36   TRP A N   1 
ATOM   232  C  CA  . TRP A 1 36  ? 29.814  2.112   -14.029 1.00 18.21  ? 36   TRP A CA  1 
ATOM   233  C  C   . TRP A 1 36  ? 30.022  3.474   -13.395 1.00 21.52  ? 36   TRP A C   1 
ATOM   234  O  O   . TRP A 1 36  ? 30.718  4.330   -13.939 1.00 22.54  ? 36   TRP A O   1 
ATOM   235  C  CB  . TRP A 1 36  ? 30.605  1.017   -13.294 1.00 21.89  ? 36   TRP A CB  1 
ATOM   236  C  CG  . TRP A 1 36  ? 32.121  1.191   -13.233 1.00 26.34  ? 36   TRP A CG  1 
ATOM   237  C  CD1 . TRP A 1 36  ? 32.831  2.349   -13.372 1.00 26.60  ? 36   TRP A CD1 1 
ATOM   238  C  CD2 . TRP A 1 36  ? 33.088  0.158   -12.980 1.00 26.60  ? 36   TRP A CD2 1 
ATOM   239  N  NE1 . TRP A 1 36  ? 34.174  2.095   -13.250 1.00 27.71  ? 36   TRP A NE1 1 
ATOM   240  C  CE2 . TRP A 1 36  ? 34.359  0.758   -13.014 1.00 26.06  ? 36   TRP A CE2 1 
ATOM   241  C  CE3 . TRP A 1 36  ? 32.999  -1.226  -12.761 1.00 30.07  ? 36   TRP A CE3 1 
ATOM   242  C  CZ2 . TRP A 1 36  ? 35.544  0.025   -12.817 1.00 25.42  ? 36   TRP A CZ2 1 
ATOM   243  C  CZ3 . TRP A 1 36  ? 34.173  -1.950  -12.567 1.00 30.28  ? 36   TRP A CZ3 1 
ATOM   244  C  CH2 . TRP A 1 36  ? 35.426  -1.318  -12.595 1.00 28.39  ? 36   TRP A CH2 1 
ATOM   245  N  N   . LYS A 1 37  ? 29.402  3.661   -12.237 1.00 26.23  ? 37   LYS A N   1 
ATOM   246  C  CA  . LYS A 1 37  ? 29.550  4.877   -11.460 1.00 27.30  ? 37   LYS A CA  1 
ATOM   247  C  C   . LYS A 1 37  ? 30.324  4.543   -10.180 1.00 29.39  ? 37   LYS A C   1 
ATOM   248  O  O   . LYS A 1 37  ? 29.968  3.610   -9.458  1.00 26.29  ? 37   LYS A O   1 
ATOM   249  C  CB  . LYS A 1 37  ? 28.161  5.431   -11.145 1.00 29.59  ? 37   LYS A CB  1 
ATOM   250  C  CG  . LYS A 1 37  ? 28.127  6.703   -10.339 1.00 34.21  ? 37   LYS A CG  1 
ATOM   251  C  CD  . LYS A 1 37  ? 26.694  7.233   -10.256 1.00 39.60  ? 37   LYS A CD  1 
ATOM   252  C  CE  . LYS A 1 37  ? 25.732  6.163   -9.727  1.00 42.45  ? 37   LYS A CE  1 
ATOM   253  N  NZ  . LYS A 1 37  ? 24.291  6.561   -9.789  1.00 44.54  ? 37   LYS A NZ  1 
ATOM   254  N  N   . GLU A 1 38  ? 31.398  5.287   -9.928  1.00 32.96  ? 38   GLU A N   1 
ATOM   255  C  CA  . GLU A 1 38  ? 32.248  5.083   -8.754  1.00 40.25  ? 38   GLU A CA  1 
ATOM   256  C  C   . GLU A 1 38  ? 31.749  5.915   -7.592  1.00 44.75  ? 38   GLU A C   1 
ATOM   257  O  O   . GLU A 1 38  ? 31.503  7.110   -7.742  1.00 49.54  ? 38   GLU A O   1 
ATOM   258  C  CB  . GLU A 1 38  ? 33.677  5.539   -9.038  1.00 44.15  ? 38   GLU A CB  1 
ATOM   259  C  CG  . GLU A 1 38  ? 34.540  4.591   -9.829  1.00 49.39  ? 38   GLU A CG  1 
ATOM   260  C  CD  . GLU A 1 38  ? 36.022  4.839   -9.566  1.00 53.68  ? 38   GLU A CD  1 
ATOM   261  O  OE1 . GLU A 1 38  ? 36.373  5.985   -9.204  1.00 52.17  ? 38   GLU A OE1 1 
ATOM   262  O  OE2 . GLU A 1 38  ? 36.832  3.893   -9.708  1.00 56.85  ? 38   GLU A OE2 1 
ATOM   263  N  N   . LEU A 1 39  ? 31.619  5.291   -6.428  0.97 46.10  ? 39   LEU A N   1 
ATOM   264  C  CA  . LEU A 1 39  ? 31.239  6.011   -5.218  1.00 48.40  ? 39   LEU A CA  1 
ATOM   265  C  C   . LEU A 1 39  ? 32.188  5.636   -4.088  1.00 50.45  ? 39   LEU A C   1 
ATOM   266  O  O   . LEU A 1 39  ? 32.357  4.457   -3.782  0.90 51.75  ? 39   LEU A O   1 
ATOM   267  C  CB  . LEU A 1 39  ? 29.793  5.692   -4.836  1.00 48.54  ? 39   LEU A CB  1 
ATOM   268  N  N   . ASP A 1 40  ? 32.816  6.635   -3.474  1.00 51.58  ? 40   ASP A N   1 
ATOM   269  C  CA  . ASP A 1 40  ? 33.754  6.385   -2.374  1.00 53.79  ? 40   ASP A CA  1 
ATOM   270  C  C   . ASP A 1 40  ? 33.090  6.610   -1.023  1.00 52.64  ? 40   ASP A C   1 
ATOM   271  O  O   . ASP A 1 40  ? 32.938  7.746   -0.584  1.00 50.92  ? 40   ASP A O   1 
ATOM   272  C  CB  . ASP A 1 40  ? 35.002  7.267   -2.510  1.00 55.95  ? 40   ASP A CB  1 
ATOM   273  C  CG  . ASP A 1 40  ? 35.954  7.144   -1.318  1.00 59.63  ? 40   ASP A CG  1 
ATOM   274  O  OD1 . ASP A 1 40  ? 35.980  6.080   -0.661  1.00 60.72  ? 40   ASP A OD1 1 
ATOM   275  O  OD2 . ASP A 1 40  ? 36.689  8.119   -1.047  1.00 60.05  ? 40   ASP A OD2 1 
ATOM   276  N  N   . TYR A 1 41  ? 32.714  5.516   -0.366  1.00 53.96  ? 41   TYR A N   1 
ATOM   277  C  CA  . TYR A 1 41  ? 31.985  5.561   0.903   1.00 56.35  ? 41   TYR A CA  1 
ATOM   278  C  C   . TYR A 1 41  ? 32.910  5.581   2.122   1.00 57.99  ? 41   TYR A C   1 
ATOM   279  O  O   . TYR A 1 41  ? 32.443  5.598   3.259   1.00 58.92  ? 41   TYR A O   1 
ATOM   280  C  CB  . TYR A 1 41  ? 31.066  4.344   1.009   1.00 58.02  ? 41   TYR A CB  1 
ATOM   281  C  CG  . TYR A 1 41  ? 31.820  3.034   0.978   1.00 59.78  ? 41   TYR A CG  1 
ATOM   282  C  CD1 . TYR A 1 41  ? 32.387  2.508   2.136   1.00 60.32  ? 41   TYR A CD1 1 
ATOM   283  C  CD2 . TYR A 1 41  ? 31.983  2.331   -0.209  1.00 60.07  ? 41   TYR A CD2 1 
ATOM   284  C  CE1 . TYR A 1 41  ? 33.086  1.315   2.112   1.00 61.93  ? 41   TYR A CE1 1 
ATOM   285  C  CE2 . TYR A 1 41  ? 32.681  1.134   -0.241  1.00 61.50  ? 41   TYR A CE2 1 
ATOM   286  C  CZ  . TYR A 1 41  ? 33.229  0.631   0.922   1.00 62.81  ? 41   TYR A CZ  1 
ATOM   287  O  OH  . TYR A 1 41  ? 33.924  -0.556  0.897   1.00 64.16  ? 41   TYR A OH  1 
ATOM   288  N  N   . GLY A 1 42  ? 34.216  5.561   1.881   1.00 57.87  ? 42   GLY A N   1 
ATOM   289  C  CA  . GLY A 1 42  ? 35.195  5.544   2.951   1.00 59.68  ? 42   GLY A CA  1 
ATOM   290  C  C   . GLY A 1 42  ? 34.947  6.570   4.040   1.00 60.54  ? 42   GLY A C   1 
ATOM   291  O  O   . GLY A 1 42  ? 35.279  6.333   5.203   1.00 63.41  ? 42   GLY A O   1 
ATOM   292  N  N   . SER A 1 43  ? 34.359  7.705   3.668   1.00 57.00  ? 43   SER A N   1 
ATOM   293  C  CA  . SER A 1 43  ? 34.136  8.800   4.611   1.00 56.10  ? 43   SER A CA  1 
ATOM   294  C  C   . SER A 1 43  ? 32.691  8.892   5.092   1.00 52.01  ? 43   SER A C   1 
ATOM   295  O  O   . SER A 1 43  ? 32.292  9.893   5.690   1.00 49.16  ? 43   SER A O   1 
ATOM   296  C  CB  . SER A 1 43  ? 34.555  10.133  3.986   1.00 59.92  ? 43   SER A CB  1 
ATOM   297  O  OG  . SER A 1 43  ? 34.339  11.210  4.882   1.00 63.88  ? 43   SER A OG  1 
ATOM   298  N  N   . MET A 1 44  ? 31.909  7.849   4.833   1.00 50.16  ? 44   MET A N   1 
ATOM   299  C  CA  . MET A 1 44  ? 30.507  7.841   5.226   1.00 48.50  ? 44   MET A CA  1 
ATOM   300  C  C   . MET A 1 44  ? 30.304  7.220   6.594   1.00 48.82  ? 44   MET A C   1 
ATOM   301  O  O   . MET A 1 44  ? 31.079  6.359   7.022   1.00 49.09  ? 44   MET A O   1 
ATOM   302  C  CB  . MET A 1 44  ? 29.663  7.085   4.205   1.00 49.10  ? 44   MET A CB  1 
ATOM   303  C  CG  . MET A 1 44  ? 29.547  7.778   2.863   1.00 50.35  ? 44   MET A CG  1 
ATOM   304  S  SD  . MET A 1 44  ? 28.475  6.874   1.736   1.00 78.38  ? 44   MET A SD  1 
ATOM   305  C  CE  . MET A 1 44  ? 28.659  7.858   0.252   1.00 94.12  ? 44   MET A CE  1 
ATOM   306  N  N   . THR A 1 45  ? 29.253  7.668   7.273   1.00 48.45  ? 45   THR A N   1 
ATOM   307  C  CA  . THR A 1 45  ? 28.839  7.086   8.543   1.00 51.63  ? 45   THR A CA  1 
ATOM   308  C  C   . THR A 1 45  ? 28.115  5.778   8.261   1.00 51.38  ? 45   THR A C   1 
ATOM   309  O  O   . THR A 1 45  ? 27.762  5.496   7.116   1.00 50.97  ? 45   THR A O   1 
ATOM   310  C  CB  . THR A 1 45  ? 27.869  8.015   9.287   1.00 55.37  ? 45   THR A CB  1 
ATOM   311  O  OG1 . THR A 1 45  ? 26.602  8.022   8.613   1.00 55.92  ? 45   THR A OG1 1 
ATOM   312  C  CG2 . THR A 1 45  ? 28.424  9.439   9.344   1.00 55.96  ? 45   THR A CG2 1 
ATOM   313  N  N   . GLU A 1 46  ? 27.887  4.978   9.295   1.00 50.82  ? 46   GLU A N   1 
ATOM   314  C  CA  . GLU A 1 46  ? 27.186  3.717   9.101   1.00 50.57  ? 46   GLU A CA  1 
ATOM   315  C  C   . GLU A 1 46  ? 25.751  3.977   8.653   1.00 52.63  ? 46   GLU A C   1 
ATOM   316  O  O   . GLU A 1 46  ? 25.186  3.199   7.881   1.00 49.72  ? 46   GLU A O   1 
ATOM   317  C  CB  . GLU A 1 46  ? 27.218  2.865   10.366  1.00 52.49  ? 46   GLU A CB  1 
ATOM   318  C  CG  . GLU A 1 46  ? 28.602  2.324   10.696  1.00 55.81  ? 46   GLU A CG  1 
ATOM   319  C  CD  . GLU A 1 46  ? 28.575  1.284   11.806  1.00 62.07  ? 46   GLU A CD  1 
ATOM   320  O  OE1 . GLU A 1 46  ? 27.464  0.910   12.243  1.00 66.25  ? 46   GLU A OE1 1 
ATOM   321  O  OE2 . GLU A 1 46  ? 29.661  0.838   12.239  1.00 61.02  ? 46   GLU A OE2 1 
ATOM   322  N  N   . ALA A 1 47  ? 25.179  5.078   9.139   1.00 56.81  ? 47   ALA A N   1 
ATOM   323  C  CA  . ALA A 1 47  ? 23.830  5.495   8.763   1.00 59.76  ? 47   ALA A CA  1 
ATOM   324  C  C   . ALA A 1 47  ? 23.750  5.854   7.282   1.00 60.31  ? 47   ALA A C   1 
ATOM   325  O  O   . ALA A 1 47  ? 22.866  5.382   6.565   1.00 61.02  ? 47   ALA A O   1 
ATOM   326  C  CB  . ALA A 1 47  ? 23.382  6.671   9.616   1.00 60.68  ? 47   ALA A CB  1 
ATOM   327  N  N   . GLU A 1 48  ? 24.671  6.697   6.829   1.00 59.42  ? 48   GLU A N   1 
ATOM   328  C  CA  . GLU A 1 48  ? 24.726  7.063   5.420   1.00 60.10  ? 48   GLU A CA  1 
ATOM   329  C  C   . GLU A 1 48  ? 24.875  5.824   4.540   1.00 58.40  ? 48   GLU A C   1 
ATOM   330  O  O   . GLU A 1 48  ? 24.338  5.773   3.438   1.00 57.90  ? 48   GLU A O   1 
ATOM   331  C  CB  . GLU A 1 48  ? 25.866  8.051   5.154   1.00 62.57  ? 48   GLU A CB  1 
ATOM   332  C  CG  . GLU A 1 48  ? 25.704  9.403   5.846   1.00 65.80  ? 48   GLU A CG  1 
ATOM   333  C  CD  . GLU A 1 48  ? 26.946  10.269  5.725   1.00 69.84  ? 48   GLU A CD  1 
ATOM   334  O  OE1 . GLU A 1 48  ? 27.943  9.799   5.137   1.00 70.45  ? 48   GLU A OE1 1 
ATOM   335  O  OE2 . GLU A 1 48  ? 26.931  11.415  6.223   1.00 72.52  ? 48   GLU A OE2 1 
ATOM   336  N  N   . LYS A 1 49  ? 25.595  4.820   5.030   1.00 58.23  ? 49   LYS A N   1 
ATOM   337  C  CA  . LYS A 1 49  ? 25.831  3.614   4.243   1.00 54.50  ? 49   LYS A CA  1 
ATOM   338  C  C   . LYS A 1 49  ? 24.609  2.699   4.199   1.00 53.50  ? 49   LYS A C   1 
ATOM   339  O  O   . LYS A 1 49  ? 24.371  2.023   3.199   1.00 50.44  ? 49   LYS A O   1 
ATOM   340  C  CB  . LYS A 1 49  ? 27.056  2.855   4.756   1.00 52.03  ? 49   LYS A CB  1 
ATOM   341  C  CG  . LYS A 1 49  ? 28.360  3.625   4.605   1.00 49.67  ? 49   LYS A CG  1 
ATOM   342  C  CD  . LYS A 1 49  ? 29.547  2.683   4.598   1.00 47.88  ? 49   LYS A CD  1 
ATOM   343  C  CE  . LYS A 1 49  ? 29.645  1.905   5.889   1.00 48.54  ? 49   LYS A CE  1 
ATOM   344  N  NZ  . LYS A 1 49  ? 30.362  2.667   6.944   1.00 48.78  ? 49   LYS A NZ  1 
ATOM   345  N  N   . GLN A 1 50  ? 23.835  2.681   5.280   1.00 56.67  ? 50   GLN A N   1 
ATOM   346  C  CA  . GLN A 1 50  ? 22.617  1.876   5.322   1.00 61.77  ? 50   GLN A CA  1 
ATOM   347  C  C   . GLN A 1 50  ? 21.578  2.425   4.349   1.00 63.04  ? 50   GLN A C   1 
ATOM   348  O  O   . GLN A 1 50  ? 20.854  1.665   3.709   1.00 62.16  ? 50   GLN A O   1 
ATOM   349  C  CB  . GLN A 1 50  ? 22.042  1.828   6.739   1.00 65.93  ? 50   GLN A CB  1 
ATOM   350  C  CG  . GLN A 1 50  ? 20.802  0.960   6.872   1.00 69.30  ? 50   GLN A CG  1 
ATOM   351  C  CD  . GLN A 1 50  ? 21.070  -0.496  6.538   1.00 73.31  ? 50   GLN A CD  1 
ATOM   352  O  OE1 . GLN A 1 50  ? 21.946  -1.132  7.128   1.00 75.13  ? 50   GLN A OE1 1 
ATOM   353  N  NE2 . GLN A 1 50  ? 20.310  -1.034  5.589   1.00 73.59  ? 50   GLN A NE2 1 
ATOM   354  N  N   . MET A 1 51  ? 21.510  3.750   4.253   1.00 63.88  ? 51   MET A N   1 
ATOM   355  C  CA  . MET A 1 51  ? 20.633  4.415   3.298   1.00 62.48  ? 51   MET A CA  1 
ATOM   356  C  C   . MET A 1 51  ? 21.087  4.086   1.884   1.00 60.79  ? 51   MET A C   1 
ATOM   357  O  O   . MET A 1 51  ? 20.272  3.799   1.006   1.00 60.63  ? 51   MET A O   1 
ATOM   358  C  CB  . MET A 1 51  ? 20.652  5.929   3.513   1.00 62.15  ? 51   MET A CB  1 
ATOM   359  N  N   . LEU A 1 52  ? 22.398  4.125   1.676   0.99 59.11  ? 52   LEU A N   1 
ATOM   360  C  CA  . LEU A 1 52  ? 22.981  3.801   0.383   0.99 57.18  ? 52   LEU A CA  1 
ATOM   361  C  C   . LEU A 1 52  ? 22.623  2.377   -0.035  0.99 56.80  ? 52   LEU A C   1 
ATOM   362  O  O   . LEU A 1 52  ? 22.261  2.122   -1.188  0.99 55.38  ? 52   LEU A O   1 
ATOM   363  C  CB  . LEU A 1 52  ? 24.494  3.951   0.442   0.99 56.91  ? 52   LEU A CB  1 
ATOM   364  C  CG  . LEU A 1 52  ? 25.196  4.110   -0.901  0.99 57.68  ? 52   LEU A CG  1 
ATOM   365  C  CD1 . LEU A 1 52  ? 24.998  5.524   -1.417  0.99 57.36  ? 52   LEU A CD1 1 
ATOM   366  C  CD2 . LEU A 1 52  ? 26.670  3.798   -0.753  0.99 59.07  ? 52   LEU A CD2 1 
ATOM   367  N  N   . VAL A 1 53  ? 22.726  1.449   0.910   1.00 56.54  ? 53   VAL A N   1 
ATOM   368  C  CA  . VAL A 1 53  ? 22.407  0.049   0.649   1.00 55.04  ? 53   VAL A CA  1 
ATOM   369  C  C   . VAL A 1 53  ? 20.965  -0.112  0.184   1.00 54.88  ? 53   VAL A C   1 
ATOM   370  O  O   . VAL A 1 53  ? 20.706  -0.784  -0.811  1.00 52.10  ? 53   VAL A O   1 
ATOM   371  C  CB  . VAL A 1 53  ? 22.664  -0.840  1.890   1.00 51.94  ? 53   VAL A CB  1 
ATOM   372  C  CG1 . VAL A 1 53  ? 21.977  -2.198  1.741   1.00 49.91  ? 53   VAL A CG1 1 
ATOM   373  C  CG2 . VAL A 1 53  ? 24.158  -1.010  2.114   1.00 49.78  ? 53   VAL A CG2 1 
ATOM   374  N  N   . SER A 1 54  ? 20.034  0.511   0.901   0.97 58.71  ? 54   SER A N   1 
ATOM   375  C  CA  . SER A 1 54  ? 18.618  0.408   0.559   0.97 62.32  ? 54   SER A CA  1 
ATOM   376  C  C   . SER A 1 54  ? 18.302  1.146   -0.746  0.97 63.01  ? 54   SER A C   1 
ATOM   377  O  O   . SER A 1 54  ? 17.600  0.626   -1.609  0.97 63.02  ? 54   SER A O   1 
ATOM   378  C  CB  . SER A 1 54  ? 17.741  0.916   1.710   0.97 64.63  ? 54   SER A CB  1 
ATOM   379  O  OG  . SER A 1 54  ? 18.161  2.194   2.155   0.97 65.14  ? 54   SER A OG  1 
ATOM   380  N  N   . GLU A 1 55  ? 18.799  2.351   -0.863  1.00 62.80  ? 55   GLU A N   1 
ATOM   381  C  CA  . GLU A 1 55  ? 18.744  3.058   -2.100  1.00 62.78  ? 55   GLU A CA  1 
ATOM   382  C  C   . GLU A 1 55  ? 19.184  2.246   -3.298  1.00 61.33  ? 55   GLU A C   1 
ATOM   383  O  O   . GLU A 1 55  ? 18.498  2.234   -4.275  1.00 62.88  ? 55   GLU A O   1 
ATOM   384  C  CB  . GLU A 1 55  ? 19.518  4.343   -2.007  1.00 65.27  ? 55   GLU A CB  1 
ATOM   385  C  CG  . GLU A 1 55  ? 19.521  5.111   -3.226  1.00 69.60  ? 55   GLU A CG  1 
ATOM   386  C  CD  . GLU A 1 55  ? 20.550  6.199   -3.201  1.00 73.75  ? 55   GLU A CD  1 
ATOM   387  O  OE1 . GLU A 1 55  ? 20.826  6.780   -2.132  1.00 74.74  ? 55   GLU A OE1 1 
ATOM   388  O  OE2 . GLU A 1 55  ? 21.076  6.476   -4.280  1.00 74.71  ? 55   GLU A OE2 1 
ATOM   389  N  N   . VAL A 1 56  ? 20.304  1.559   -3.232  1.00 58.46  ? 56   VAL A N   1 
ATOM   390  C  CA  . VAL A 1 56  ? 20.780  0.813   -4.356  1.00 56.31  ? 56   VAL A CA  1 
ATOM   391  C  C   . VAL A 1 56  ? 19.876  -0.354  -4.612  1.00 58.84  ? 56   VAL A C   1 
ATOM   392  O  O   . VAL A 1 56  ? 19.788  -0.874  -5.714  1.00 55.13  ? 56   VAL A O   1 
ATOM   393  C  CB  . VAL A 1 56  ? 22.186  0.284   -4.151  1.00 53.85  ? 56   VAL A CB  1 
ATOM   394  C  CG1 . VAL A 1 56  ? 22.549  -0.637  -5.262  1.00 52.69  ? 56   VAL A CG1 1 
ATOM   395  C  CG2 . VAL A 1 56  ? 23.172  1.397   -4.070  1.00 52.63  ? 56   VAL A CG2 1 
ATOM   396  N  N   . ASN A 1 57  ? 19.205  -0.747  -3.552  1.00 63.92  ? 57   ASN A N   1 
ATOM   397  C  CA  . ASN A 1 57  ? 18.305  -1.870  -3.550  1.00 68.77  ? 57   ASN A CA  1 
ATOM   398  C  C   . ASN A 1 57  ? 17.065  -1.579  -4.405  1.00 68.23  ? 57   ASN A C   1 
ATOM   399  O  O   . ASN A 1 57  ? 16.671  -2.404  -5.188  1.00 68.51  ? 57   ASN A O   1 
ATOM   400  C  CB  . ASN A 1 57  ? 17.934  -2.208  -2.100  1.00 74.88  ? 57   ASN A CB  1 
ATOM   401  C  CG  . ASN A 1 57  ? 18.290  -3.637  -1.699  1.00 79.77  ? 57   ASN A CG  1 
ATOM   402  O  OD1 . ASN A 1 57  ? 19.069  -3.860  -0.764  1.00 79.06  ? 57   ASN A OD1 1 
ATOM   403  N  ND2 . ASN A 1 57  ? 17.751  -4.607  -2.421  1.00 82.77  ? 57   ASN A ND2 1 
ATOM   404  N  N   . LEU A 1 58  ? 16.498  -0.388  -4.261  1.00 66.83  ? 58   LEU A N   1 
ATOM   405  C  CA  . LEU A 1 58  ? 15.395  0.098   -5.087  1.00 66.16  ? 58   LEU A CA  1 
ATOM   406  C  C   . LEU A 1 58  ? 15.714  0.303   -6.560  1.00 65.19  ? 58   LEU A C   1 
ATOM   407  O  O   . LEU A 1 58  ? 14.821  0.481   -7.360  1.00 65.00  ? 58   LEU A O   1 
ATOM   408  C  CB  . LEU A 1 58  ? 14.893  1.425   -4.555  1.00 64.87  ? 58   LEU A CB  1 
ATOM   409  N  N   . LEU A 1 59  ? 16.993  0.313   -6.901  1.00 63.97  ? 59   LEU A N   1 
ATOM   410  C  CA  . LEU A 1 59  ? 17.421  0.525   -8.259  1.00 59.86  ? 59   LEU A CA  1 
ATOM   411  C  C   . LEU A 1 59  ? 17.398  -0.768  -9.010  1.00 59.03  ? 59   LEU A C   1 
ATOM   412  O  O   . LEU A 1 59  ? 17.029  -0.795  -10.138 1.00 57.31  ? 59   LEU A O   1 
ATOM   413  C  CB  . LEU A 1 59  ? 18.826  1.049   -8.306  1.00 56.81  ? 59   LEU A CB  1 
ATOM   414  C  CG  . LEU A 1 59  ? 19.006  2.517   -8.475  1.00 55.82  ? 59   LEU A CG  1 
ATOM   415  C  CD1 . LEU A 1 59  ? 17.931  3.253   -7.824  1.00 56.29  ? 59   LEU A CD1 1 
ATOM   416  C  CD2 . LEU A 1 59  ? 20.285  2.902   -7.929  1.00 55.80  ? 59   LEU A CD2 1 
ATOM   417  N  N   . ARG A 1 60  ? 17.797  -1.847  -8.382  1.00 59.25  ? 60   ARG A N   1 
ATOM   418  C  CA  . ARG A 1 60  ? 17.762  -3.143  -9.027  1.00 60.61  ? 60   ARG A CA  1 
ATOM   419  C  C   . ARG A 1 60  ? 16.355  -3.600  -9.328  1.00 61.24  ? 60   ARG A C   1 
ATOM   420  O  O   . ARG A 1 60  ? 16.155  -4.397  -10.196 1.00 62.68  ? 60   ARG A O   1 
ATOM   421  C  CB  . ARG A 1 60  ? 18.452  -4.192  -8.171  1.00 61.76  ? 60   ARG A CB  1 
ATOM   422  N  N   . GLU A 1 61  ? 15.389  -3.094  -8.579  1.00 59.89  ? 61   GLU A N   1 
ATOM   423  C  CA  . GLU A 1 61  ? 13.985  -3.465  -8.740  1.00 59.07  ? 61   GLU A CA  1 
ATOM   424  C  C   . GLU A 1 61  ? 13.358  -2.921  -10.030 1.00 57.24  ? 61   GLU A C   1 
ATOM   425  O  O   . GLU A 1 61  ? 12.501  -3.572  -10.634 1.00 54.94  ? 61   GLU A O   1 
ATOM   426  C  CB  . GLU A 1 61  ? 13.172  -2.994  -7.529  1.00 58.95  ? 61   GLU A CB  1 
ATOM   427  N  N   . LEU A 1 62  ? 13.783  -1.730  -10.443 1.00 56.30  ? 62   LEU A N   1 
ATOM   428  C  CA  . LEU A 1 62  ? 13.196  -1.060  -11.601 1.00 58.00  ? 62   LEU A CA  1 
ATOM   429  C  C   . LEU A 1 62  ? 13.702  -1.587  -12.938 1.00 54.99  ? 62   LEU A C   1 
ATOM   430  O  O   . LEU A 1 62  ? 14.829  -1.300  -13.349 1.00 54.97  ? 62   LEU A O   1 
ATOM   431  C  CB  . LEU A 1 62  ? 13.431  0.449   -11.529 1.00 61.06  ? 62   LEU A CB  1 
ATOM   432  C  CG  . LEU A 1 62  ? 12.269  1.294   -11.011 1.00 63.44  ? 62   LEU A CG  1 
ATOM   433  C  CD1 . LEU A 1 62  ? 12.724  2.728   -10.811 1.00 64.58  ? 62   LEU A CD1 1 
ATOM   434  C  CD2 . LEU A 1 62  ? 11.079  1.224   -11.961 1.00 63.18  ? 62   LEU A CD2 1 
ATOM   435  N  N   . LYS A 1 63  ? 12.851  -2.350  -13.615 1.00 50.00  ? 63   LYS A N   1 
ATOM   436  C  CA  . LYS A 1 63  ? 13.141  -2.821  -14.959 1.00 45.66  ? 63   LYS A CA  1 
ATOM   437  C  C   . LYS A 1 63  ? 12.091  -2.240  -15.900 1.00 42.41  ? 63   LYS A C   1 
ATOM   438  O  O   . LYS A 1 63  ? 10.897  -2.455  -15.719 1.00 43.58  ? 63   LYS A O   1 
ATOM   439  C  CB  . LYS A 1 63  ? 13.134  -4.348  -15.013 1.00 45.18  ? 63   LYS A CB  1 
ATOM   440  C  CG  . LYS A 1 63  ? 13.963  -4.999  -13.918 1.00 47.80  ? 63   LYS A CG  1 
ATOM   441  C  CD  . LYS A 1 63  ? 13.963  -6.521  -14.024 1.00 52.28  ? 63   LYS A CD  1 
ATOM   442  C  CE  . LYS A 1 63  ? 14.404  -7.143  -12.701 1.00 57.58  ? 63   LYS A CE  1 
ATOM   443  N  NZ  . LYS A 1 63  ? 14.870  -8.556  -12.829 1.00 60.76  ? 63   LYS A NZ  1 
ATOM   444  N  N   . HIS A 1 64  ? 12.553  -1.480  -16.883 1.00 28.64  ? 64   HIS A N   1 
ATOM   445  C  CA  . HIS A 1 64  ? 11.677  -0.824  -17.837 1.00 23.52  ? 64   HIS A CA  1 
ATOM   446  C  C   . HIS A 1 64  ? 12.518  -0.332  -19.012 1.00 19.24  ? 64   HIS A C   1 
ATOM   447  O  O   . HIS A 1 64  ? 13.622  0.191   -18.823 1.00 19.82  ? 64   HIS A O   1 
ATOM   448  C  CB  . HIS A 1 64  ? 10.933  0.337   -17.177 1.00 24.57  ? 64   HIS A CB  1 
ATOM   449  C  CG  . HIS A 1 64  ? 9.777   0.843   -17.986 1.00 26.99  ? 64   HIS A CG  1 
ATOM   450  N  ND1 . HIS A 1 64  ? 9.927   1.764   -19.000 1.00 24.72  ? 64   HIS A ND1 1 
ATOM   451  C  CD2 . HIS A 1 64  ? 8.456   0.532   -17.950 1.00 29.40  ? 64   HIS A CD2 1 
ATOM   452  C  CE1 . HIS A 1 64  ? 8.749   2.009   -19.549 1.00 27.28  ? 64   HIS A CE1 1 
ATOM   453  N  NE2 . HIS A 1 64  ? 7.841   1.272   -18.931 1.00 28.89  ? 64   HIS A NE2 1 
ATOM   454  N  N   . PRO A 1 65  ? 12.011  -0.508  -20.235 1.00 19.52  ? 65   PRO A N   1 
ATOM   455  C  CA  . PRO A 1 65  ? 12.772  -0.121  -21.434 1.00 21.64  ? 65   PRO A CA  1 
ATOM   456  C  C   . PRO A 1 65  ? 13.192  1.342   -21.407 1.00 20.84  ? 65   PRO A C   1 
ATOM   457  O  O   . PRO A 1 65  ? 14.219  1.708   -21.986 1.00 19.74  ? 65   PRO A O   1 
ATOM   458  C  CB  . PRO A 1 65  ? 11.774  -0.341  -22.582 1.00 24.77  ? 65   PRO A CB  1 
ATOM   459  C  CG  . PRO A 1 65  ? 10.716  -1.245  -22.028 1.00 24.91  ? 65   PRO A CG  1 
ATOM   460  C  CD  . PRO A 1 65  ? 10.659  -1.003  -20.550 1.00 21.83  ? 65   PRO A CD  1 
ATOM   461  N  N   . ASN A 1 66  ? 12.397  2.177   -20.747 1.00 15.58  ? 66   ASN A N   1 
ATOM   462  C  CA  . ASN A 1 66  ? 12.632  3.616   -20.786 1.00 22.12  ? 66   ASN A CA  1 
ATOM   463  C  C   . ASN A 1 66  ? 13.273  4.157   -19.504 1.00 22.51  ? 66   ASN A C   1 
ATOM   464  O  O   . ASN A 1 66  ? 13.268  5.362   -19.265 1.00 21.74  ? 66   ASN A O   1 
ATOM   465  C  CB  . ASN A 1 66  ? 11.335  4.371   -21.134 1.00 21.39  ? 66   ASN A CB  1 
ATOM   466  C  CG  . ASN A 1 66  ? 10.858  4.086   -22.550 1.00 18.74  ? 66   ASN A CG  1 
ATOM   467  O  OD1 . ASN A 1 66  ? 9.720   3.652   -22.753 1.00 19.59  ? 66   ASN A OD1 1 
ATOM   468  N  ND2 . ASN A 1 66  ? 11.727  4.337   -23.543 1.00 12.31  ? 66   ASN A ND2 1 
ATOM   469  N  N   . ILE A 1 67  ? 13.832  3.247   -18.703 1.00 23.44  ? 67   ILE A N   1 
ATOM   470  C  CA  . ILE A 1 67  ? 14.613  3.585   -17.518 1.00 19.21  ? 67   ILE A CA  1 
ATOM   471  C  C   . ILE A 1 67  ? 16.012  2.948   -17.597 1.00 16.09  ? 67   ILE A C   1 
ATOM   472  O  O   . ILE A 1 67  ? 16.138  1.751   -17.850 1.00 19.37  ? 67   ILE A O   1 
ATOM   473  C  CB  . ILE A 1 67  ? 13.915  3.101   -16.241 1.00 23.11  ? 67   ILE A CB  1 
ATOM   474  C  CG1 . ILE A 1 67  ? 12.646  3.925   -15.984 1.00 27.19  ? 67   ILE A CG1 1 
ATOM   475  C  CG2 . ILE A 1 67  ? 14.854  3.199   -15.048 1.00 23.80  ? 67   ILE A CG2 1 
ATOM   476  C  CD1 . ILE A 1 67  ? 11.853  3.457   -14.798 1.00 28.07  ? 67   ILE A CD1 1 
ATOM   477  N  N   . VAL A 1 68  ? 17.059  3.746   -17.391 1.00 17.23  ? 68   VAL A N   1 
ATOM   478  C  CA  . VAL A 1 68  ? 18.420  3.223   -17.478 1.00 21.11  ? 68   VAL A CA  1 
ATOM   479  C  C   . VAL A 1 68  ? 18.514  1.941   -16.649 1.00 25.24  ? 68   VAL A C   1 
ATOM   480  O  O   . VAL A 1 68  ? 18.148  1.917   -15.474 1.00 25.96  ? 68   VAL A O   1 
ATOM   481  C  CB  . VAL A 1 68  ? 19.480  4.252   -17.023 1.00 21.96  ? 68   VAL A CB  1 
ATOM   482  C  CG1 . VAL A 1 68  ? 20.860  3.595   -16.890 1.00 22.83  ? 68   VAL A CG1 1 
ATOM   483  C  CG2 . VAL A 1 68  ? 19.540  5.424   -17.993 1.00 18.10  ? 68   VAL A CG2 1 
ATOM   484  N  N   . ARG A 1 69  ? 18.968  0.868   -17.282 1.00 26.18  ? 69   ARG A N   1 
ATOM   485  C  CA  . ARG A 1 69  ? 19.048  -0.440  -16.628 1.00 29.48  ? 69   ARG A CA  1 
ATOM   486  C  C   . ARG A 1 69  ? 20.311  -0.581  -15.779 1.00 28.04  ? 69   ARG A C   1 
ATOM   487  O  O   . ARG A 1 69  ? 21.426  -0.372  -16.274 1.00 23.35  ? 69   ARG A O   1 
ATOM   488  C  CB  . ARG A 1 69  ? 19.037  -1.535  -17.689 1.00 35.12  ? 69   ARG A CB  1 
ATOM   489  C  CG  . ARG A 1 69  ? 19.172  -2.934  -17.142 1.00 43.90  ? 69   ARG A CG  1 
ATOM   490  C  CD  . ARG A 1 69  ? 17.916  -3.378  -16.412 1.00 52.40  ? 69   ARG A CD  1 
ATOM   491  N  NE  . ARG A 1 69  ? 18.091  -4.712  -15.845 1.00 59.78  ? 69   ARG A NE  1 
ATOM   492  C  CZ  . ARG A 1 69  ? 18.042  -4.989  -14.547 1.00 62.28  ? 69   ARG A CZ  1 
ATOM   493  N  NH1 . ARG A 1 69  ? 18.224  -6.235  -14.135 1.00 62.99  ? 69   ARG A NH1 1 
ATOM   494  N  NH2 . ARG A 1 69  ? 17.804  -4.027  -13.664 1.00 62.23  ? 69   ARG A NH2 1 
ATOM   495  N  N   . TYR A 1 70  ? 20.133  -0.932  -14.507 1.00 29.96  ? 70   TYR A N   1 
ATOM   496  C  CA  . TYR A 1 70  ? 21.256  -1.270  -13.638 1.00 38.76  ? 70   TYR A CA  1 
ATOM   497  C  C   . TYR A 1 70  ? 21.470  -2.785  -13.583 1.00 39.66  ? 70   TYR A C   1 
ATOM   498  O  O   . TYR A 1 70  ? 20.517  -3.564  -13.602 1.00 38.20  ? 70   TYR A O   1 
ATOM   499  C  CB  . TYR A 1 70  ? 21.074  -0.638  -12.257 1.00 48.23  ? 70   TYR A CB  1 
ATOM   500  C  CG  . TYR A 1 70  ? 20.862  0.855   -12.388 1.00 57.20  ? 70   TYR A CG  1 
ATOM   501  C  CD1 . TYR A 1 70  ? 21.930  1.745   -12.322 1.00 59.91  ? 70   TYR A CD1 1 
ATOM   502  C  CD2 . TYR A 1 70  ? 19.598  1.369   -12.648 1.00 60.34  ? 70   TYR A CD2 1 
ATOM   503  C  CE1 . TYR A 1 70  ? 21.733  3.111   -12.476 1.00 61.60  ? 70   TYR A CE1 1 
ATOM   504  C  CE2 . TYR A 1 70  ? 19.394  2.717   -12.801 1.00 62.84  ? 70   TYR A CE2 1 
ATOM   505  C  CZ  . TYR A 1 70  ? 20.458  3.591   -12.716 1.00 63.26  ? 70   TYR A CZ  1 
ATOM   506  O  OH  . TYR A 1 70  ? 20.233  4.945   -12.880 1.00 62.17  ? 70   TYR A OH  1 
ATOM   507  N  N   . TYR A 1 71  ? 22.732  -3.195  -13.555 1.00 39.40  ? 71   TYR A N   1 
ATOM   508  C  CA  . TYR A 1 71  ? 23.079  -4.601  -13.709 1.00 38.36  ? 71   TYR A CA  1 
ATOM   509  C  C   . TYR A 1 71  ? 23.644  -5.194  -12.436 1.00 40.75  ? 71   TYR A C   1 
ATOM   510  O  O   . TYR A 1 71  ? 23.487  -6.387  -12.176 1.00 45.33  ? 71   TYR A O   1 
ATOM   511  C  CB  . TYR A 1 71  ? 24.100  -4.775  -14.842 1.00 37.98  ? 71   TYR A CB  1 
ATOM   512  C  CG  . TYR A 1 71  ? 23.499  -4.641  -16.218 1.00 42.38  ? 71   TYR A CG  1 
ATOM   513  C  CD1 . TYR A 1 71  ? 23.421  -3.405  -16.848 1.00 43.83  ? 71   TYR A CD1 1 
ATOM   514  C  CD2 . TYR A 1 71  ? 22.987  -5.747  -16.880 1.00 46.49  ? 71   TYR A CD2 1 
ATOM   515  C  CE1 . TYR A 1 71  ? 22.862  -3.274  -18.099 1.00 45.03  ? 71   TYR A CE1 1 
ATOM   516  C  CE2 . TYR A 1 71  ? 22.422  -5.626  -18.136 1.00 49.29  ? 71   TYR A CE2 1 
ATOM   517  C  CZ  . TYR A 1 71  ? 22.361  -4.386  -18.740 1.00 46.93  ? 71   TYR A CZ  1 
ATOM   518  O  OH  . TYR A 1 71  ? 21.800  -4.263  -19.991 1.00 47.24  ? 71   TYR A OH  1 
ATOM   519  N  N   . ASP A 1 72  ? 24.312  -4.371  -11.639 1.00 38.08  ? 72   ASP A N   1 
ATOM   520  C  CA  . ASP A 1 72  ? 25.150  -4.924  -10.586 1.00 40.37  ? 72   ASP A CA  1 
ATOM   521  C  C   . ASP A 1 72  ? 25.655  -3.840  -9.662  1.00 41.39  ? 72   ASP A C   1 
ATOM   522  O  O   . ASP A 1 72  ? 25.754  -2.673  -10.046 1.00 43.91  ? 72   ASP A O   1 
ATOM   523  C  CB  . ASP A 1 72  ? 26.348  -5.633  -11.230 1.00 45.77  ? 72   ASP A CB  1 
ATOM   524  C  CG  . ASP A 1 72  ? 26.928  -6.734  -10.357 1.00 51.45  ? 72   ASP A CG  1 
ATOM   525  O  OD1 . ASP A 1 72  ? 26.349  -7.019  -9.286  1.00 53.56  ? 72   ASP A OD1 1 
ATOM   526  O  OD2 . ASP A 1 72  ? 27.968  -7.313  -10.749 1.00 51.00  ? 72   ASP A OD2 1 
ATOM   527  N  N   . ARG A 1 73  ? 25.971  -4.235  -8.435  1.00 38.75  ? 73   ARG A N   1 
ATOM   528  C  CA  . ARG A 1 73  ? 26.717  -3.390  -7.525  1.00 40.84  ? 73   ARG A CA  1 
ATOM   529  C  C   . ARG A 1 73  ? 27.999  -4.145  -7.189  1.00 45.79  ? 73   ARG A C   1 
ATOM   530  O  O   . ARG A 1 73  ? 27.992  -5.372  -7.083  1.00 46.07  ? 73   ARG A O   1 
ATOM   531  C  CB  . ARG A 1 73  ? 25.895  -3.086  -6.267  1.00 40.90  ? 73   ARG A CB  1 
ATOM   532  C  CG  . ARG A 1 73  ? 25.409  -4.318  -5.511  1.00 40.91  ? 73   ARG A CG  1 
ATOM   533  N  N   . ILE A 1 74  ? 29.104  -3.422  -7.053  1.00 47.37  ? 74   ILE A N   1 
ATOM   534  C  CA  . ILE A 1 74  ? 30.394  -4.050  -6.795  1.00 48.44  ? 74   ILE A CA  1 
ATOM   535  C  C   . ILE A 1 74  ? 31.106  -3.342  -5.662  1.00 52.65  ? 74   ILE A C   1 
ATOM   536  O  O   . ILE A 1 74  ? 31.361  -2.139  -5.735  1.00 53.27  ? 74   ILE A O   1 
ATOM   537  C  CB  . ILE A 1 74  ? 31.309  -4.006  -8.033  1.00 48.33  ? 74   ILE A CB  1 
ATOM   538  C  CG1 . ILE A 1 74  ? 30.746  -4.884  -9.151  1.00 47.16  ? 74   ILE A CG1 1 
ATOM   539  C  CG2 . ILE A 1 74  ? 32.736  -4.425  -7.664  1.00 48.20  ? 74   ILE A CG2 1 
ATOM   540  C  CD1 . ILE A 1 74  ? 31.616  -4.916  -10.385 1.00 46.50  ? 74   ILE A CD1 1 
ATOM   541  N  N   . ILE A 1 75  ? 31.433  -4.091  -4.615  1.00 56.61  ? 75   ILE A N   1 
ATOM   542  C  CA  . ILE A 1 75  ? 32.114  -3.517  -3.458  1.00 58.28  ? 75   ILE A CA  1 
ATOM   543  C  C   . ILE A 1 75  ? 33.616  -3.792  -3.491  1.00 57.20  ? 75   ILE A C   1 
ATOM   544  O  O   . ILE A 1 75  ? 34.049  -4.943  -3.562  1.00 52.72  ? 75   ILE A O   1 
ATOM   545  C  CB  . ILE A 1 75  ? 31.529  -4.036  -2.119  1.00 63.84  ? 75   ILE A CB  1 
ATOM   546  C  CG1 . ILE A 1 75  ? 30.029  -3.724  -2.013  1.00 65.02  ? 75   ILE A CG1 1 
ATOM   547  C  CG2 . ILE A 1 75  ? 32.274  -3.429  -0.947  1.00 62.36  ? 75   ILE A CG2 1 
ATOM   548  C  CD1 . ILE A 1 75  ? 29.133  -4.752  -2.669  1.00 65.27  ? 75   ILE A CD1 1 
ATOM   549  N  N   . ASP A 1 76  ? 34.406  -2.726  -3.457  1.00 61.19  ? 76   ASP A N   1 
ATOM   550  C  CA  . ASP A 1 76  ? 35.846  -2.864  -3.282  1.00 65.37  ? 76   ASP A CA  1 
ATOM   551  C  C   . ASP A 1 76  ? 36.237  -2.255  -1.941  1.00 69.25  ? 76   ASP A C   1 
ATOM   552  O  O   . ASP A 1 76  ? 36.580  -1.075  -1.861  1.00 69.05  ? 76   ASP A O   1 
ATOM   553  C  CB  . ASP A 1 76  ? 36.603  -2.187  -4.423  1.00 64.98  ? 76   ASP A CB  1 
ATOM   554  C  CG  . ASP A 1 76  ? 38.076  -2.552  -4.440  1.00 63.88  ? 76   ASP A CG  1 
ATOM   555  O  OD1 . ASP A 1 76  ? 38.533  -3.129  -5.449  1.00 62.42  ? 76   ASP A OD1 1 
ATOM   556  O  OD2 . ASP A 1 76  ? 38.772  -2.271  -3.442  1.00 63.53  ? 76   ASP A OD2 1 
ATOM   557  N  N   . ARG A 1 77  ? 36.167  -3.066  -0.890  1.00 72.79  ? 77   ARG A N   1 
ATOM   558  C  CA  . ARG A 1 77  ? 36.408  -2.592  0.472   1.00 76.79  ? 77   ARG A CA  1 
ATOM   559  C  C   . ARG A 1 77  ? 37.839  -2.093  0.687   1.00 78.73  ? 77   ARG A C   1 
ATOM   560  O  O   . ARG A 1 77  ? 38.103  -1.334  1.621   1.00 77.72  ? 77   ARG A O   1 
ATOM   561  C  CB  . ARG A 1 77  ? 36.069  -3.686  1.490   1.00 76.42  ? 77   ARG A CB  1 
ATOM   562  N  N   . THR A 1 78  ? 38.754  -2.513  -0.183  1.00 81.17  ? 78   THR A N   1 
ATOM   563  C  CA  . THR A 1 78  ? 40.152  -2.106  -0.075  1.00 84.34  ? 78   THR A CA  1 
ATOM   564  C  C   . THR A 1 78  ? 40.345  -0.616  -0.351  1.00 84.05  ? 78   THR A C   1 
ATOM   565  O  O   . THR A 1 78  ? 41.084  0.063   0.365   1.00 85.77  ? 78   THR A O   1 
ATOM   566  C  CB  . THR A 1 78  ? 41.055  -2.913  -1.019  1.00 86.80  ? 78   THR A CB  1 
ATOM   567  O  OG1 . THR A 1 78  ? 41.004  -4.299  -0.658  1.00 87.39  ? 78   THR A OG1 1 
ATOM   568  C  CG2 . THR A 1 78  ? 42.492  -2.423  -0.919  1.00 88.16  ? 78   THR A CG2 1 
ATOM   569  N  N   . ASN A 1 79  ? 39.689  -0.111  -1.392  1.00 80.22  ? 79   ASN A N   1 
ATOM   570  C  CA  . ASN A 1 79  ? 39.734  1.318   -1.691  1.00 74.85  ? 79   ASN A CA  1 
ATOM   571  C  C   . ASN A 1 79  ? 38.406  1.990   -1.352  1.00 67.57  ? 79   ASN A C   1 
ATOM   572  O  O   . ASN A 1 79  ? 38.120  3.093   -1.823  1.00 66.08  ? 79   ASN A O   1 
ATOM   573  C  CB  . ASN A 1 79  ? 40.103  1.561   -3.156  1.00 74.78  ? 79   ASN A CB  1 
ATOM   574  N  N   . THR A 1 80  ? 37.608  1.313   -0.528  1.00 61.81  ? 80   THR A N   1 
ATOM   575  C  CA  . THR A 1 80  ? 36.303  1.808   -0.086  1.00 57.61  ? 80   THR A CA  1 
ATOM   576  C  C   . THR A 1 80  ? 35.479  2.411   -1.224  1.00 53.44  ? 80   THR A C   1 
ATOM   577  O  O   . THR A 1 80  ? 34.922  3.504   -1.086  1.00 52.83  ? 80   THR A O   1 
ATOM   578  C  CB  . THR A 1 80  ? 36.426  2.837   1.069   1.00 55.12  ? 80   THR A CB  1 
ATOM   579  O  OG1 . THR A 1 80  ? 37.131  3.999   0.615   1.00 55.04  ? 80   THR A OG1 1 
ATOM   580  C  CG2 . THR A 1 80  ? 37.158  2.233   2.257   1.00 55.65  ? 80   THR A CG2 1 
ATOM   581  N  N   . THR A 1 81  ? 35.406  1.700   -2.346  1.00 49.10  ? 81   THR A N   1 
ATOM   582  C  CA  . THR A 1 81  ? 34.629  2.173   -3.481  1.00 46.13  ? 81   THR A CA  1 
ATOM   583  C  C   . THR A 1 81  ? 33.509  1.198   -3.840  1.00 43.85  ? 81   THR A C   1 
ATOM   584  O  O   . THR A 1 81  ? 33.710  -0.021  -3.896  1.00 40.72  ? 81   THR A O   1 
ATOM   585  C  CB  . THR A 1 81  ? 35.510  2.453   -4.715  1.00 43.46  ? 81   THR A CB  1 
ATOM   586  O  OG1 . THR A 1 81  ? 36.481  3.456   -4.396  1.00 45.13  ? 81   THR A OG1 1 
ATOM   587  C  CG2 . THR A 1 81  ? 34.666  2.938   -5.874  1.00 41.61  ? 81   THR A CG2 1 
ATOM   588  N  N   . LEU A 1 82  ? 32.323  1.755   -4.055  1.00 40.72  ? 82   LEU A N   1 
ATOM   589  C  CA  . LEU A 1 82  ? 31.183  1.003   -4.557  1.00 37.87  ? 82   LEU A CA  1 
ATOM   590  C  C   . LEU A 1 82  ? 30.981  1.354   -6.028  1.00 37.57  ? 82   LEU A C   1 
ATOM   591  O  O   . LEU A 1 82  ? 30.957  2.534   -6.389  1.00 35.27  ? 82   LEU A O   1 
ATOM   592  C  CB  . LEU A 1 82  ? 29.934  1.359   -3.752  1.00 38.90  ? 82   LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 82  ? 28.582  0.826   -4.232  1.00 41.61  ? 82   LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 82  ? 28.552  -0.687  -4.221  1.00 44.25  ? 82   LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 82  ? 27.457  1.390   -3.367  1.00 42.35  ? 82   LEU A CD2 1 
ATOM   596  N  N   . TYR A 1 83  ? 30.861  0.338   -6.878  1.00 38.52  ? 83   TYR A N   1 
ATOM   597  C  CA  . TYR A 1 83  ? 30.610  0.552   -8.302  1.00 34.80  ? 83   TYR A CA  1 
ATOM   598  C  C   . TYR A 1 83  ? 29.198  0.133   -8.662  1.00 32.60  ? 83   TYR A C   1 
ATOM   599  O  O   . TYR A 1 83  ? 28.762  -0.966  -8.329  1.00 33.34  ? 83   TYR A O   1 
ATOM   600  C  CB  . TYR A 1 83  ? 31.588  -0.246  -9.162  1.00 36.22  ? 83   TYR A CB  1 
ATOM   601  C  CG  . TYR A 1 83  ? 33.043  0.091   -8.940  1.00 40.67  ? 83   TYR A CG  1 
ATOM   602  C  CD1 . TYR A 1 83  ? 33.853  -0.712  -8.144  1.00 43.25  ? 83   TYR A CD1 1 
ATOM   603  C  CD2 . TYR A 1 83  ? 33.607  1.209   -9.531  1.00 41.95  ? 83   TYR A CD2 1 
ATOM   604  C  CE1 . TYR A 1 83  ? 35.186  -0.404  -7.945  1.00 44.38  ? 83   TYR A CE1 1 
ATOM   605  C  CE2 . TYR A 1 83  ? 34.933  1.520   -9.340  1.00 45.49  ? 83   TYR A CE2 1 
ATOM   606  C  CZ  . TYR A 1 83  ? 35.718  0.716   -8.546  1.00 48.23  ? 83   TYR A CZ  1 
ATOM   607  O  OH  . TYR A 1 83  ? 37.039  1.050   -8.367  1.00 51.96  ? 83   TYR A OH  1 
ATOM   608  N  N   . ILE A 1 84  ? 28.473  1.008   -9.340  0.95 30.50  ? 84   ILE A N   1 
ATOM   609  C  CA  . ILE A 1 84  ? 27.163  0.625   -9.851  0.95 27.80  ? 84   ILE A CA  1 
ATOM   610  C  C   . ILE A 1 84  ? 27.259  0.477   -11.360 0.95 22.57  ? 84   ILE A C   1 
ATOM   611  O  O   . ILE A 1 84  ? 27.572  1.427   -12.065 0.95 23.48  ? 84   ILE A O   1 
ATOM   612  C  CB  . ILE A 1 84  ? 26.071  1.622   -9.440  0.95 30.88  ? 84   ILE A CB  1 
ATOM   613  C  CG1 . ILE A 1 84  ? 25.897  1.589   -7.919  0.95 30.88  ? 84   ILE A CG1 1 
ATOM   614  C  CG2 . ILE A 1 84  ? 24.758  1.269   -10.114 0.95 33.04  ? 84   ILE A CG2 1 
ATOM   615  C  CD1 . ILE A 1 84  ? 25.862  2.954   -7.274  0.95 30.48  ? 84   ILE A CD1 1 
ATOM   616  N  N   . VAL A 1 85  ? 27.051  -0.748  -11.824 1.00 19.79  ? 85   VAL A N   1 
ATOM   617  C  CA  . VAL A 1 85  ? 27.223  -1.113  -13.217 1.00 22.02  ? 85   VAL A CA  1 
ATOM   618  C  C   . VAL A 1 85  ? 25.898  -0.948  -13.943 1.00 25.98  ? 85   VAL A C   1 
ATOM   619  O  O   . VAL A 1 85  ? 24.853  -1.423  -13.494 1.00 24.44  ? 85   VAL A O   1 
ATOM   620  C  CB  . VAL A 1 85  ? 27.699  -2.571  -13.346 1.00 22.96  ? 85   VAL A CB  1 
ATOM   621  C  CG1 . VAL A 1 85  ? 27.937  -2.945  -14.811 1.00 21.99  ? 85   VAL A CG1 1 
ATOM   622  C  CG2 . VAL A 1 85  ? 28.975  -2.777  -12.531 1.00 24.64  ? 85   VAL A CG2 1 
ATOM   623  N  N   . MET A 1 86  ? 25.935  -0.254  -15.065 1.00 26.77  ? 86   MET A N   1 
ATOM   624  C  CA  . MET A 1 86  ? 24.712  -0.026  -15.786 1.00 24.62  ? 86   MET A CA  1 
ATOM   625  C  C   . MET A 1 86  ? 24.917  -0.069  -17.286 1.00 21.07  ? 86   MET A C   1 
ATOM   626  O  O   . MET A 1 86  ? 26.034  -0.213  -17.790 1.00 20.35  ? 86   MET A O   1 
ATOM   627  C  CB  . MET A 1 86  ? 24.073  1.306   -15.349 1.00 27.67  ? 86   MET A CB  1 
ATOM   628  C  CG  . MET A 1 86  ? 24.940  2.544   -15.567 1.00 30.30  ? 86   MET A CG  1 
ATOM   629  S  SD  . MET A 1 86  ? 24.343  4.020   -14.706 1.00 40.41  ? 86   MET A SD  1 
ATOM   630  C  CE  . MET A 1 86  ? 25.023  3.807   -13.072 1.00 22.43  ? 86   MET A CE  1 
ATOM   631  N  N   . GLU A 1 87  ? 23.789  0.037   -17.969 1.00 13.30  ? 87   GLU A N   1 
ATOM   632  C  CA  . GLU A 1 87  ? 23.683  0.242   -19.395 1.00 17.00  ? 87   GLU A CA  1 
ATOM   633  C  C   . GLU A 1 87  ? 24.530  1.413   -19.874 1.00 17.05  ? 87   GLU A C   1 
ATOM   634  O  O   . GLU A 1 87  ? 24.604  2.451   -19.214 1.00 16.65  ? 87   GLU A O   1 
ATOM   635  C  CB  . GLU A 1 87  ? 22.230  0.624   -19.643 1.00 25.12  ? 87   GLU A CB  1 
ATOM   636  C  CG  . GLU A 1 87  ? 21.623  0.133   -20.892 1.00 29.66  ? 87   GLU A CG  1 
ATOM   637  C  CD  . GLU A 1 87  ? 20.236  0.703   -21.070 1.00 28.00  ? 87   GLU A CD  1 
ATOM   638  O  OE1 . GLU A 1 87  ? 19.889  1.013   -22.220 1.00 32.84  ? 87   GLU A OE1 1 
ATOM   639  O  OE2 . GLU A 1 87  ? 19.511  0.860   -20.058 1.00 18.69  ? 87   GLU A OE2 1 
ATOM   640  N  N   . TYR A 1 88  ? 25.122  1.260   -21.051 1.00 15.19  ? 88   TYR A N   1 
ATOM   641  C  CA  . TYR A 1 88  ? 25.766  2.364   -21.757 1.00 18.40  ? 88   TYR A CA  1 
ATOM   642  C  C   . TYR A 1 88  ? 24.751  3.017   -22.686 1.00 23.31  ? 88   TYR A C   1 
ATOM   643  O  O   . TYR A 1 88  ? 24.101  2.340   -23.487 1.00 23.58  ? 88   TYR A O   1 
ATOM   644  C  CB  . TYR A 1 88  ? 26.935  1.829   -22.576 1.00 19.55  ? 88   TYR A CB  1 
ATOM   645  C  CG  . TYR A 1 88  ? 27.637  2.858   -23.415 1.00 22.18  ? 88   TYR A CG  1 
ATOM   646  C  CD1 . TYR A 1 88  ? 28.171  4.003   -22.836 1.00 21.90  ? 88   TYR A CD1 1 
ATOM   647  C  CD2 . TYR A 1 88  ? 27.780  2.683   -24.790 1.00 19.37  ? 88   TYR A CD2 1 
ATOM   648  C  CE1 . TYR A 1 88  ? 28.808  4.949   -23.598 1.00 19.87  ? 88   TYR A CE1 1 
ATOM   649  C  CE2 . TYR A 1 88  ? 28.413  3.631   -25.561 1.00 18.32  ? 88   TYR A CE2 1 
ATOM   650  C  CZ  . TYR A 1 88  ? 28.937  4.758   -24.958 1.00 20.06  ? 88   TYR A CZ  1 
ATOM   651  O  OH  . TYR A 1 88  ? 29.592  5.708   -25.713 1.00 24.66  ? 88   TYR A OH  1 
ATOM   652  N  N   . CYS A 1 89  ? 24.604  4.331   -22.573 1.00 19.85  ? 89   CYS A N   1 
ATOM   653  C  CA  . CYS A 1 89  ? 23.681  5.061   -23.433 1.00 17.60  ? 89   CYS A CA  1 
ATOM   654  C  C   . CYS A 1 89  ? 24.479  5.921   -24.395 1.00 17.62  ? 89   CYS A C   1 
ATOM   655  O  O   . CYS A 1 89  ? 24.846  7.048   -24.076 1.00 18.04  ? 89   CYS A O   1 
ATOM   656  C  CB  . CYS A 1 89  ? 22.751  5.913   -22.593 1.00 12.52  ? 89   CYS A CB  1 
ATOM   657  S  SG  . CYS A 1 89  ? 21.673  4.961   -21.495 1.00 19.99  ? 89   CYS A SG  1 
ATOM   658  N  N   . GLU A 1 90  ? 24.763  5.383   -25.575 1.00 19.19  ? 90   GLU A N   1 
ATOM   659  C  CA  . GLU A 1 90  ? 25.788  5.988   -26.414 1.00 24.51  ? 90   GLU A CA  1 
ATOM   660  C  C   . GLU A 1 90  ? 25.494  7.417   -26.882 1.00 26.12  ? 90   GLU A C   1 
ATOM   661  O  O   . GLU A 1 90  ? 26.398  8.112   -27.330 1.00 21.69  ? 90   GLU A O   1 
ATOM   662  C  CB  . GLU A 1 90  ? 26.135  5.085   -27.593 1.00 26.39  ? 90   GLU A CB  1 
ATOM   663  C  CG  . GLU A 1 90  ? 25.113  5.063   -28.716 1.00 28.89  ? 90   GLU A CG  1 
ATOM   664  C  CD  . GLU A 1 90  ? 25.730  4.554   -30.000 1.00 33.00  ? 90   GLU A CD  1 
ATOM   665  O  OE1 . GLU A 1 90  ? 25.828  5.339   -30.969 1.00 35.37  ? 90   GLU A OE1 1 
ATOM   666  O  OE2 . GLU A 1 90  ? 26.147  3.377   -30.027 1.00 35.79  ? 90   GLU A OE2 1 
ATOM   667  N  N   . GLY A 1 91  ? 24.237  7.851   -26.787 1.00 25.05  ? 91   GLY A N   1 
ATOM   668  C  CA  . GLY A 1 91  ? 23.855  9.171   -27.263 1.00 21.15  ? 91   GLY A CA  1 
ATOM   669  C  C   . GLY A 1 91  ? 24.106  10.268  -26.239 1.00 21.92  ? 91   GLY A C   1 
ATOM   670  O  O   . GLY A 1 91  ? 23.945  11.451  -26.537 1.00 18.85  ? 91   GLY A O   1 
ATOM   671  N  N   . GLY A 1 92  ? 24.491  9.883   -25.025 1.00 23.21  ? 92   GLY A N   1 
ATOM   672  C  CA  . GLY A 1 92  ? 24.733  10.862  -23.973 1.00 21.13  ? 92   GLY A CA  1 
ATOM   673  C  C   . GLY A 1 92  ? 23.407  11.372  -23.424 1.00 19.59  ? 92   GLY A C   1 
ATOM   674  O  O   . GLY A 1 92  ? 22.374  10.743  -23.636 1.00 18.55  ? 92   GLY A O   1 
ATOM   675  N  N   . ASP A 1 93  ? 23.451  12.508  -22.726 1.00 19.08  ? 93   ASP A N   1 
ATOM   676  C  CA  . ASP A 1 93  ? 22.315  13.075  -22.016 1.00 23.92  ? 93   ASP A CA  1 
ATOM   677  C  C   . ASP A 1 93  ? 21.647  14.126  -22.865 1.00 24.06  ? 93   ASP A C   1 
ATOM   678  O  O   . ASP A 1 93  ? 22.216  14.579  -23.860 1.00 22.53  ? 93   ASP A O   1 
ATOM   679  C  CB  . ASP A 1 93  ? 22.784  13.729  -20.722 1.00 29.59  ? 93   ASP A CB  1 
ATOM   680  C  CG  . ASP A 1 93  ? 23.703  14.902  -20.974 1.00 34.24  ? 93   ASP A CG  1 
ATOM   681  O  OD1 . ASP A 1 93  ? 24.846  14.692  -21.422 1.00 38.48  ? 93   ASP A OD1 1 
ATOM   682  O  OD2 . ASP A 1 93  ? 23.277  16.046  -20.748 1.00 39.44  ? 93   ASP A OD2 1 
ATOM   683  N  N   . LEU A 1 94  ? 20.446  14.521  -22.453 1.00 21.93  ? 94   LEU A N   1 
ATOM   684  C  CA  . LEU A 1 94  ? 19.618  15.454  -23.213 1.00 20.83  ? 94   LEU A CA  1 
ATOM   685  C  C   . LEU A 1 94  ? 20.066  16.918  -23.061 1.00 24.18  ? 94   LEU A C   1 
ATOM   686  O  O   . LEU A 1 94  ? 19.828  17.752  -23.943 1.00 19.95  ? 94   LEU A O   1 
ATOM   687  C  CB  . LEU A 1 94  ? 18.170  15.335  -22.757 1.00 20.90  ? 94   LEU A CB  1 
ATOM   688  C  CG  . LEU A 1 94  ? 17.180  15.875  -23.780 1.00 26.40  ? 94   LEU A CG  1 
ATOM   689  C  CD1 . LEU A 1 94  ? 17.212  14.955  -24.994 1.00 27.89  ? 94   LEU A CD1 1 
ATOM   690  C  CD2 . LEU A 1 94  ? 15.794  15.949  -23.180 1.00 29.67  ? 94   LEU A CD2 1 
ATOM   691  N  N   . ALA A 1 95  ? 20.697  17.225  -21.933 1.00 26.09  ? 95   ALA A N   1 
ATOM   692  C  CA  . ALA A 1 95  ? 21.258  18.556  -21.701 1.00 27.26  ? 95   ALA A CA  1 
ATOM   693  C  C   . ALA A 1 95  ? 22.257  18.938  -22.794 1.00 26.33  ? 95   ALA A C   1 
ATOM   694  O  O   . ALA A 1 95  ? 22.239  20.059  -23.302 1.00 24.24  ? 95   ALA A O   1 
ATOM   695  C  CB  . ALA A 1 95  ? 21.931  18.616  -20.339 1.00 25.34  ? 95   ALA A CB  1 
ATOM   696  N  N   . SER A 1 96  ? 23.131  18.003  -23.152 1.00 24.06  ? 96   SER A N   1 
ATOM   697  C  CA  . SER A 1 96  ? 24.161  18.271  -24.147 1.00 24.22  ? 96   SER A CA  1 
ATOM   698  C  C   . SER A 1 96  ? 23.555  18.430  -25.522 1.00 24.78  ? 96   SER A C   1 
ATOM   699  O  O   . SER A 1 96  ? 24.057  19.180  -26.355 1.00 24.68  ? 96   SER A O   1 
ATOM   700  C  CB  . SER A 1 96  ? 25.184  17.134  -24.162 1.00 26.82  ? 96   SER A CB  1 
ATOM   701  O  OG  . SER A 1 96  ? 25.742  16.964  -22.870 1.00 30.33  ? 96   SER A OG  1 
ATOM   702  N  N   . VAL A 1 97  ? 22.475  17.700  -25.773 1.00 26.73  ? 97   VAL A N   1 
ATOM   703  C  CA  . VAL A 1 97  ? 21.792  17.808  -27.052 1.00 24.62  ? 97   VAL A CA  1 
ATOM   704  C  C   . VAL A 1 97  ? 21.179  19.208  -27.216 1.00 21.23  ? 97   VAL A C   1 
ATOM   705  O  O   . VAL A 1 97  ? 21.205  19.793  -28.307 1.00 21.12  ? 97   VAL A O   1 
ATOM   706  C  CB  . VAL A 1 97  ? 20.711  16.722  -27.181 1.00 24.18  ? 97   VAL A CB  1 
ATOM   707  C  CG1 . VAL A 1 97  ? 19.728  17.063  -28.291 1.00 20.80  ? 97   VAL A CG1 1 
ATOM   708  C  CG2 . VAL A 1 97  ? 21.364  15.339  -27.382 1.00 21.74  ? 97   VAL A CG2 1 
ATOM   709  N  N   . ILE A 1 98  ? 20.616  19.726  -26.128 1.00 21.31  ? 98   ILE A N   1 
ATOM   710  C  CA  . ILE A 1 98  ? 19.996  21.053  -26.123 1.00 21.15  ? 98   ILE A CA  1 
ATOM   711  C  C   . ILE A 1 98  ? 21.085  22.110  -26.211 1.00 27.31  ? 98   ILE A C   1 
ATOM   712  O  O   . ILE A 1 98  ? 20.946  23.100  -26.924 1.00 30.02  ? 98   ILE A O   1 
ATOM   713  C  CB  . ILE A 1 98  ? 19.186  21.290  -24.834 1.00 21.09  ? 98   ILE A CB  1 
ATOM   714  C  CG1 . ILE A 1 98  ? 17.798  20.648  -24.955 1.00 22.69  ? 98   ILE A CG1 1 
ATOM   715  C  CG2 . ILE A 1 98  ? 19.098  22.790  -24.514 1.00 15.82  ? 98   ILE A CG2 1 
ATOM   716  C  CD1 . ILE A 1 98  ? 17.148  20.293  -23.618 1.00 22.06  ? 98   ILE A CD1 1 
ATOM   717  N  N   . THR A 1 99  ? 22.174  21.892  -25.480 1.00 25.81  ? 99   THR A N   1 
ATOM   718  C  CA  . THR A 1 99  ? 23.290  22.824  -25.508 1.00 30.66  ? 99   THR A CA  1 
ATOM   719  C  C   . THR A 1 99  ? 23.811  22.899  -26.930 1.00 32.54  ? 99   THR A C   1 
ATOM   720  O  O   . THR A 1 99  ? 23.977  23.980  -27.489 1.00 31.82  ? 99   THR A O   1 
ATOM   721  C  CB  . THR A 1 99  ? 24.423  22.381  -24.561 1.00 29.53  ? 99   THR A CB  1 
ATOM   722  O  OG1 . THR A 1 99  ? 24.054  22.674  -23.205 1.00 24.28  ? 99   THR A OG1 1 
ATOM   723  C  CG2 . THR A 1 99  ? 25.716  23.108  -24.906 1.00 31.12  ? 99   THR A CG2 1 
ATOM   724  N  N   . LYS A 1 100 ? 24.050  21.734  -27.518 1.00 33.67  ? 100  LYS A N   1 
ATOM   725  C  CA  . LYS A 1 100 ? 24.542  21.653  -28.884 1.00 35.31  ? 100  LYS A CA  1 
ATOM   726  C  C   . LYS A 1 100 ? 23.645  22.386  -29.874 1.00 37.83  ? 100  LYS A C   1 
ATOM   727  O  O   . LYS A 1 100 ? 24.130  23.135  -30.713 1.00 40.91  ? 100  LYS A O   1 
ATOM   728  C  CB  . LYS A 1 100 ? 24.675  20.199  -29.307 1.00 34.14  ? 100  LYS A CB  1 
ATOM   729  C  CG  . LYS A 1 100 ? 25.009  20.028  -30.775 1.00 35.92  ? 100  LYS A CG  1 
ATOM   730  C  CD  . LYS A 1 100 ? 25.034  18.552  -31.152 1.00 40.12  ? 100  LYS A CD  1 
ATOM   731  C  CE  . LYS A 1 100 ? 25.451  18.369  -32.597 1.00 44.71  ? 100  LYS A CE  1 
ATOM   732  N  NZ  . LYS A 1 100 ? 24.975  17.060  -33.112 1.00 49.25  ? 100  LYS A NZ  1 
ATOM   733  N  N   . GLY A 1 101 ? 22.338  22.143  -29.788 1.00 34.94  ? 101  GLY A N   1 
ATOM   734  C  CA  . GLY A 1 101 ? 21.382  22.803  -30.655 1.00 30.53  ? 101  GLY A CA  1 
ATOM   735  C  C   . GLY A 1 101 ? 21.537  24.311  -30.582 1.00 31.47  ? 101  GLY A C   1 
ATOM   736  O  O   . GLY A 1 101 ? 21.533  24.992  -31.606 1.00 31.68  ? 101  GLY A O   1 
ATOM   737  N  N   . THR A 1 102 ? 21.676  24.830  -29.364 1.00 34.97  ? 102  THR A N   1 
ATOM   738  C  CA  . THR A 1 102 ? 21.800  26.265  -29.152 1.00 40.87  ? 102  THR A CA  1 
ATOM   739  C  C   . THR A 1 102 ? 22.982  26.856  -29.912 1.00 49.43  ? 102  THR A C   1 
ATOM   740  O  O   . THR A 1 102 ? 22.875  27.943  -30.481 1.00 52.14  ? 102  THR A O   1 
ATOM   741  C  CB  . THR A 1 102 ? 21.962  26.612  -27.664 1.00 39.52  ? 102  THR A CB  1 
ATOM   742  O  OG1 . THR A 1 102 ? 20.800  26.189  -26.941 1.00 38.02  ? 102  THR A OG1 1 
ATOM   743  C  CG2 . THR A 1 102 ? 22.129  28.110  -27.500 1.00 37.56  ? 102  THR A CG2 1 
ATOM   744  N  N   . LYS A 1 103 ? 24.101  26.134  -29.917 1.00 57.19  ? 103  LYS A N   1 
ATOM   745  C  CA  . LYS A 1 103 ? 25.328  26.603  -30.555 1.00 64.38  ? 103  LYS A CA  1 
ATOM   746  C  C   . LYS A 1 103 ? 25.175  26.723  -32.064 1.00 70.30  ? 103  LYS A C   1 
ATOM   747  O  O   . LYS A 1 103 ? 25.277  27.817  -32.622 1.00 74.53  ? 103  LYS A O   1 
ATOM   748  C  CB  . LYS A 1 103 ? 26.495  25.669  -30.229 1.00 66.01  ? 103  LYS A CB  1 
ATOM   749  N  N   . GLU A 1 104 ? 24.933  25.592  -32.718 1.00 70.63  ? 104  GLU A N   1 
ATOM   750  C  CA  . GLU A 1 104 ? 24.806  25.553  -34.169 1.00 73.27  ? 104  GLU A CA  1 
ATOM   751  C  C   . GLU A 1 104 ? 23.502  26.192  -34.644 1.00 72.91  ? 104  GLU A C   1 
ATOM   752  O  O   . GLU A 1 104 ? 23.136  26.070  -35.816 1.00 74.86  ? 104  GLU A O   1 
ATOM   753  C  CB  . GLU A 1 104 ? 24.889  24.109  -34.658 1.00 76.81  ? 104  GLU A CB  1 
ATOM   754  C  CG  . GLU A 1 104 ? 26.164  23.390  -34.235 1.00 80.71  ? 104  GLU A CG  1 
ATOM   755  C  CD  . GLU A 1 104 ? 26.075  21.888  -34.422 1.00 84.17  ? 104  GLU A CD  1 
ATOM   756  O  OE1 . GLU A 1 104 ? 27.106  21.202  -34.250 1.00 85.44  ? 104  GLU A OE1 1 
ATOM   757  O  OE2 . GLU A 1 104 ? 24.970  21.394  -34.738 1.00 86.00  ? 104  GLU A OE2 1 
ATOM   758  N  N   . ARG A 1 105 ? 22.810  26.873  -33.733 1.00 69.54  ? 105  ARG A N   1 
ATOM   759  C  CA  . ARG A 1 105 ? 21.531  27.498  -34.044 1.00 64.80  ? 105  ARG A CA  1 
ATOM   760  C  C   . ARG A 1 105 ? 20.665  26.573  -34.894 1.00 60.55  ? 105  ARG A C   1 
ATOM   761  O  O   . ARG A 1 105 ? 20.107  26.990  -35.912 1.00 59.17  ? 105  ARG A O   1 
ATOM   762  C  CB  . ARG A 1 105 ? 21.745  28.829  -34.767 1.00 64.54  ? 105  ARG A CB  1 
ATOM   763  N  N   . GLN A 1 106 ? 20.565  25.313  -34.476 1.00 56.14  ? 106  GLN A N   1 
ATOM   764  C  CA  . GLN A 1 106 ? 19.776  24.332  -35.210 0.98 51.54  ? 106  GLN A CA  1 
ATOM   765  C  C   . GLN A 1 106 ? 18.751  23.644  -34.309 1.00 44.13  ? 106  GLN A C   1 
ATOM   766  O  O   . GLN A 1 106 ? 19.106  22.984  -33.326 1.00 43.61  ? 106  GLN A O   1 
ATOM   767  C  CB  . GLN A 1 106 ? 20.690  23.299  -35.875 0.98 57.56  ? 106  GLN A CB  1 
ATOM   768  C  CG  . GLN A 1 106 ? 19.946  22.179  -36.594 0.98 62.47  ? 106  GLN A CG  1 
ATOM   769  C  CD  . GLN A 1 106 ? 19.271  22.643  -37.871 0.98 65.41  ? 106  GLN A CD  1 
ATOM   770  O  OE1 . GLN A 1 106 ? 19.837  23.422  -38.637 0.98 67.53  ? 106  GLN A OE1 1 
ATOM   771  N  NE2 . GLN A 1 106 ? 18.058  22.156  -38.112 0.98 64.65  ? 106  GLN A NE2 1 
ATOM   772  N  N   . TYR A 1 107 ? 17.476  23.795  -34.653 1.00 38.14  ? 107  TYR A N   1 
ATOM   773  C  CA  . TYR A 1 107 ? 16.408  23.208  -33.859 1.00 34.02  ? 107  TYR A CA  1 
ATOM   774  C  C   . TYR A 1 107 ? 16.324  21.680  -34.053 1.00 27.91  ? 107  TYR A C   1 
ATOM   775  O  O   . TYR A 1 107 ? 16.709  21.147  -35.093 1.00 31.96  ? 107  TYR A O   1 
ATOM   776  C  CB  . TYR A 1 107 ? 15.067  23.864  -34.203 1.00 35.37  ? 107  TYR A CB  1 
ATOM   777  C  CG  . TYR A 1 107 ? 14.855  25.269  -33.658 1.00 36.54  ? 107  TYR A CG  1 
ATOM   778  C  CD1 . TYR A 1 107 ? 14.448  26.304  -34.497 1.00 37.98  ? 107  TYR A CD1 1 
ATOM   779  C  CD2 . TYR A 1 107 ? 15.034  25.560  -32.309 1.00 37.11  ? 107  TYR A CD2 1 
ATOM   780  C  CE1 . TYR A 1 107 ? 14.234  27.594  -34.014 1.00 37.61  ? 107  TYR A CE1 1 
ATOM   781  C  CE2 . TYR A 1 107 ? 14.824  26.850  -31.812 1.00 34.97  ? 107  TYR A CE2 1 
ATOM   782  C  CZ  . TYR A 1 107 ? 14.419  27.861  -32.675 1.00 35.34  ? 107  TYR A CZ  1 
ATOM   783  O  OH  . TYR A 1 107 ? 14.200  29.148  -32.206 1.00 30.50  ? 107  TYR A OH  1 
ATOM   784  N  N   . LEU A 1 108 ? 15.818  20.978  -33.051 1.00 19.66  ? 108  LEU A N   1 
ATOM   785  C  CA  . LEU A 1 108 ? 15.594  19.525  -33.164 1.00 17.43  ? 108  LEU A CA  1 
ATOM   786  C  C   . LEU A 1 108 ? 14.324  19.183  -33.950 1.00 22.24  ? 108  LEU A C   1 
ATOM   787  O  O   . LEU A 1 108 ? 13.344  19.930  -33.910 1.00 23.12  ? 108  LEU A O   1 
ATOM   788  C  CB  . LEU A 1 108 ? 15.519  18.914  -31.776 1.00 20.12  ? 108  LEU A CB  1 
ATOM   789  C  CG  . LEU A 1 108 ? 16.827  19.090  -30.997 1.00 25.10  ? 108  LEU A CG  1 
ATOM   790  C  CD1 . LEU A 1 108 ? 16.614  18.898  -29.504 1.00 29.00  ? 108  LEU A CD1 1 
ATOM   791  C  CD2 . LEU A 1 108 ? 17.890  18.131  -31.543 1.00 18.45  ? 108  LEU A CD2 1 
ATOM   792  N  N   . ASP A 1 109 ? 14.347  18.059  -34.662 1.00 20.12  ? 109  ASP A N   1 
ATOM   793  C  CA  . ASP A 1 109 ? 13.169  17.570  -35.398 1.00 21.73  ? 109  ASP A CA  1 
ATOM   794  C  C   . ASP A 1 109 ? 11.987  17.310  -34.475 1.00 16.54  ? 109  ASP A C   1 
ATOM   795  O  O   . ASP A 1 109 ? 12.157  16.761  -33.380 1.00 16.44  ? 109  ASP A O   1 
ATOM   796  C  CB  . ASP A 1 109 ? 13.489  16.253  -36.127 1.00 28.70  ? 109  ASP A CB  1 
ATOM   797  C  CG  . ASP A 1 109 ? 14.568  16.411  -37.189 1.00 40.15  ? 109  ASP A CG  1 
ATOM   798  O  OD1 . ASP A 1 109 ? 14.741  17.537  -37.719 1.00 41.57  ? 109  ASP A OD1 1 
ATOM   799  O  OD2 . ASP A 1 109 ? 15.238  15.400  -37.498 1.00 42.19  ? 109  ASP A OD2 1 
ATOM   800  N  N   . GLU A 1 110 ? 10.788  17.673  -34.926 1.00 13.52  ? 110  GLU A N   1 
ATOM   801  C  CA  . GLU A 1 110 ? 9.572   17.318  -34.190 1.00 13.61  ? 110  GLU A CA  1 
ATOM   802  C  C   . GLU A 1 110 ? 9.509   15.832  -33.880 1.00 15.29  ? 110  GLU A C   1 
ATOM   803  O  O   . GLU A 1 110 ? 9.059   15.437  -32.796 1.00 12.51  ? 110  GLU A O   1 
ATOM   804  C  CB  . GLU A 1 110 ? 8.318   17.727  -34.967 1.00 11.94  ? 110  GLU A CB  1 
ATOM   805  C  CG  . GLU A 1 110 ? 7.030   17.346  -34.251 1.00 15.12  ? 110  GLU A CG  1 
ATOM   806  C  CD  . GLU A 1 110 ? 5.850   18.249  -34.593 1.00 23.66  ? 110  GLU A CD  1 
ATOM   807  O  OE1 . GLU A 1 110 ? 6.047   19.305  -35.241 1.00 25.69  ? 110  GLU A OE1 1 
ATOM   808  O  OE2 . GLU A 1 110 ? 4.716   17.906  -34.184 1.00 27.96  ? 110  GLU A OE2 1 
ATOM   809  N  N   . GLU A 1 111 ? 9.938   15.004  -34.837 1.00 18.24  ? 111  GLU A N   1 
ATOM   810  C  CA  . GLU A 1 111 ? 9.958   13.544  -34.638 1.00 19.78  ? 111  GLU A CA  1 
ATOM   811  C  C   . GLU A 1 111 ? 10.758  13.135  -33.407 1.00 20.58  ? 111  GLU A C   1 
ATOM   812  O  O   . GLU A 1 111 ? 10.373  12.217  -32.683 1.00 21.37  ? 111  GLU A O   1 
ATOM   813  C  CB  . GLU A 1 111 ? 10.480  12.822  -35.888 1.00 20.94  ? 111  GLU A CB  1 
ATOM   814  C  CG  . GLU A 1 111 ? 9.428   12.769  -37.010 1.00 21.08  ? 111  GLU A CG  1 
ATOM   815  C  CD  . GLU A 1 111 ? 8.367   11.716  -36.729 1.00 26.56  ? 111  GLU A CD  1 
ATOM   816  O  OE1 . GLU A 1 111 ? 7.324   12.048  -36.128 1.00 28.16  ? 111  GLU A OE1 1 
ATOM   817  O  OE2 . GLU A 1 111 ? 8.591   10.545  -37.106 1.00 28.21  ? 111  GLU A OE2 1 
ATOM   818  N  N   . PHE A 1 112 ? 11.856  13.839  -33.143 1.00 16.20  ? 112  PHE A N   1 
ATOM   819  C  CA  . PHE A 1 112 ? 12.667  13.544  -31.959 1.00 14.72  ? 112  PHE A CA  1 
ATOM   820  C  C   . PHE A 1 112 ? 11.940  14.023  -30.705 1.00 15.04  ? 112  PHE A C   1 
ATOM   821  O  O   . PHE A 1 112 ? 11.907  13.335  -29.672 1.00 9.78   ? 112  PHE A O   1 
ATOM   822  C  CB  . PHE A 1 112 ? 14.046  14.202  -32.056 1.00 15.70  ? 112  PHE A CB  1 
ATOM   823  C  CG  . PHE A 1 112 ? 14.896  14.020  -30.814 1.00 14.86  ? 112  PHE A CG  1 
ATOM   824  C  CD1 . PHE A 1 112 ? 15.469  12.790  -30.518 1.00 15.21  ? 112  PHE A CD1 1 
ATOM   825  C  CD2 . PHE A 1 112 ? 15.132  15.081  -29.960 1.00 14.62  ? 112  PHE A CD2 1 
ATOM   826  C  CE1 . PHE A 1 112 ? 16.259  12.629  -29.399 1.00 18.56  ? 112  PHE A CE1 1 
ATOM   827  C  CE2 . PHE A 1 112 ? 15.903  14.924  -28.834 1.00 16.39  ? 112  PHE A CE2 1 
ATOM   828  C  CZ  . PHE A 1 112 ? 16.474  13.693  -28.550 1.00 17.77  ? 112  PHE A CZ  1 
ATOM   829  N  N   . VAL A 1 113 ? 11.331  15.201  -30.790 1.00 16.69  ? 113  VAL A N   1 
ATOM   830  C  CA  . VAL A 1 113 ? 10.546  15.684  -29.662 1.00 16.78  ? 113  VAL A CA  1 
ATOM   831  C  C   . VAL A 1 113 ? 9.373   14.724  -29.344 1.00 15.06  ? 113  VAL A C   1 
ATOM   832  O  O   . VAL A 1 113 ? 9.062   14.484  -28.182 1.00 18.00  ? 113  VAL A O   1 
ATOM   833  C  CB  . VAL A 1 113 ? 10.085  17.159  -29.850 1.00 15.33  ? 113  VAL A CB  1 
ATOM   834  C  CG1 . VAL A 1 113 ? 9.236   17.604  -28.668 1.00 11.52  ? 113  VAL A CG1 1 
ATOM   835  C  CG2 . VAL A 1 113 ? 11.309  18.084  -30.030 1.00 10.90  ? 113  VAL A CG2 1 
ATOM   836  N  N   . LEU A 1 114 ? 8.738   14.158  -30.360 1.00 12.35  ? 114  LEU A N   1 
ATOM   837  C  CA  . LEU A 1 114 ? 7.645   13.200  -30.102 1.00 12.87  ? 114  LEU A CA  1 
ATOM   838  C  C   . LEU A 1 114 ? 8.130   11.895  -29.454 1.00 15.22  ? 114  LEU A C   1 
ATOM   839  O  O   . LEU A 1 114 ? 7.487   11.372  -28.538 1.00 13.99  ? 114  LEU A O   1 
ATOM   840  C  CB  . LEU A 1 114 ? 6.859   12.914  -31.376 1.00 14.73  ? 114  LEU A CB  1 
ATOM   841  C  CG  . LEU A 1 114 ? 6.136   14.131  -31.947 1.00 13.73  ? 114  LEU A CG  1 
ATOM   842  C  CD1 . LEU A 1 114 ? 5.419   13.762  -33.250 1.00 12.49  ? 114  LEU A CD1 1 
ATOM   843  C  CD2 . LEU A 1 114 ? 5.142   14.649  -30.920 1.00 12.79  ? 114  LEU A CD2 1 
ATOM   844  N  N   . ARG A 1 115 ? 9.271   11.374  -29.908 1.00 13.29  ? 115  ARG A N   1 
ATOM   845  C  CA  A ARG A 1 115 ? 9.878   10.215  -29.253 0.61 14.12  ? 115  ARG A CA  1 
ATOM   846  C  CA  B ARG A 1 115 ? 9.887   10.215  -29.260 0.39 14.25  ? 115  ARG A CA  1 
ATOM   847  C  C   . ARG A 1 115 ? 10.184  10.492  -27.785 1.00 13.18  ? 115  ARG A C   1 
ATOM   848  O  O   . ARG A 1 115 ? 9.888   9.670   -26.909 1.00 13.09  ? 115  ARG A O   1 
ATOM   849  C  CB  A ARG A 1 115 ? 11.159  9.776   -29.968 0.61 16.23  ? 115  ARG A CB  1 
ATOM   850  C  CB  B ARG A 1 115 ? 11.185  9.805   -29.967 0.39 16.08  ? 115  ARG A CB  1 
ATOM   851  C  CG  A ARG A 1 115 ? 10.937  9.212   -31.353 0.61 16.92  ? 115  ARG A CG  1 
ATOM   852  C  CG  B ARG A 1 115 ? 11.063  9.517   -31.457 0.39 16.56  ? 115  ARG A CG  1 
ATOM   853  C  CD  A ARG A 1 115 ? 12.203  8.574   -31.903 0.61 18.33  ? 115  ARG A CD  1 
ATOM   854  C  CD  B ARG A 1 115 ? 12.146  8.536   -31.927 0.39 17.96  ? 115  ARG A CD  1 
ATOM   855  N  NE  A ARG A 1 115 ? 11.909  7.733   -33.058 0.61 18.22  ? 115  ARG A NE  1 
ATOM   856  N  NE  B ARG A 1 115 ? 13.482  9.122   -32.053 0.39 15.70  ? 115  ARG A NE  1 
ATOM   857  C  CZ  A ARG A 1 115 ? 12.004  8.128   -34.322 0.61 21.35  ? 115  ARG A CZ  1 
ATOM   858  C  CZ  B ARG A 1 115 ? 14.309  9.337   -31.033 0.39 13.75  ? 115  ARG A CZ  1 
ATOM   859  N  NH1 A ARG A 1 115 ? 12.391  9.360   -34.620 0.61 17.58  ? 115  ARG A NH1 1 
ATOM   860  N  NH1 B ARG A 1 115 ? 13.930  9.035   -29.799 0.39 15.02  ? 115  ARG A NH1 1 
ATOM   861  N  NH2 A ARG A 1 115 ? 11.713  7.279   -35.296 0.61 28.48  ? 115  ARG A NH2 1 
ATOM   862  N  NH2 B ARG A 1 115 ? 15.516  9.859   -31.241 0.39 8.68   ? 115  ARG A NH2 1 
ATOM   863  N  N   . VAL A 1 116 ? 10.775  11.648  -27.499 1.00 12.36  ? 116  VAL A N   1 
ATOM   864  C  CA  . VAL A 1 116 ? 11.088  11.977  -26.108 1.00 8.68   ? 116  VAL A CA  1 
ATOM   865  C  C   . VAL A 1 116 ? 9.819   12.096  -25.265 1.00 11.44  ? 116  VAL A C   1 
ATOM   866  O  O   . VAL A 1 116 ? 9.751   11.569  -24.156 1.00 14.36  ? 116  VAL A O   1 
ATOM   867  C  CB  . VAL A 1 116 ? 11.954  13.280  -25.991 1.00 17.34  ? 116  VAL A CB  1 
ATOM   868  C  CG1 . VAL A 1 116 ? 12.084  13.710  -24.539 1.00 18.97  ? 116  VAL A CG1 1 
ATOM   869  C  CG2 . VAL A 1 116 ? 13.342  13.058  -26.600 1.00 13.08  ? 116  VAL A CG2 1 
ATOM   870  N  N   . MET A 1 117 ? 8.808   12.783  -25.790 1.00 7.72   ? 117  MET A N   1 
ATOM   871  C  CA  . MET A 1 117 ? 7.544   12.926  -25.062 1.00 8.14   ? 117  MET A CA  1 
ATOM   872  C  C   . MET A 1 117 ? 6.952   11.542  -24.741 1.00 9.02   ? 117  MET A C   1 
ATOM   873  O  O   . MET A 1 117 ? 6.575   11.258  -23.606 1.00 8.21   ? 117  MET A O   1 
ATOM   874  C  CB  . MET A 1 117 ? 6.544   13.746  -25.902 1.00 10.90  ? 117  MET A CB  1 
ATOM   875  C  CG  . MET A 1 117 ? 5.145   13.823  -25.298 1.00 12.44  ? 117  MET A CG  1 
ATOM   876  S  SD  . MET A 1 117 ? 4.099   15.056  -26.114 1.00 19.90  ? 117  MET A SD  1 
ATOM   877  C  CE  . MET A 1 117 ? 3.924   14.354  -27.734 1.00 11.64  ? 117  MET A CE  1 
ATOM   878  N  N   . THR A 1 118 ? 6.871   10.689  -25.759 1.00 12.16  ? 118  THR A N   1 
ATOM   879  C  CA  . THR A 1 118 ? 6.271   9.363   -25.625 1.00 15.93  ? 118  THR A CA  1 
ATOM   880  C  C   . THR A 1 118 ? 7.014   8.516   -24.597 1.00 15.97  ? 118  THR A C   1 
ATOM   881  O  O   . THR A 1 118 ? 6.442   8.025   -23.635 1.00 18.27  ? 118  THR A O   1 
ATOM   882  C  CB  . THR A 1 118 ? 6.281   8.648   -26.983 1.00 15.98  ? 118  THR A CB  1 
ATOM   883  O  OG1 . THR A 1 118 ? 5.561   9.453   -27.934 1.00 15.35  ? 118  THR A OG1 1 
ATOM   884  C  CG2 . THR A 1 118 ? 5.626   7.258   -26.885 1.00 7.72   ? 118  THR A CG2 1 
ATOM   885  N  N   . GLN A 1 119 ? 8.311   8.386   -24.805 1.00 12.33  ? 119  GLN A N   1 
ATOM   886  C  CA  . GLN A 1 119 ? 9.153   7.524   -24.000 1.00 7.81   ? 119  GLN A CA  1 
ATOM   887  C  C   . GLN A 1 119 ? 9.366   7.997   -22.551 1.00 13.46  ? 119  GLN A C   1 
ATOM   888  O  O   . GLN A 1 119 ? 9.387   7.174   -21.634 1.00 13.05  ? 119  GLN A O   1 
ATOM   889  C  CB  . GLN A 1 119 ? 10.450  7.292   -24.768 1.00 7.92   ? 119  GLN A CB  1 
ATOM   890  C  CG  . GLN A 1 119 ? 10.173  6.555   -26.092 1.00 11.46  ? 119  GLN A CG  1 
ATOM   891  C  CD  . GLN A 1 119 ? 11.413  6.016   -26.774 1.00 14.21  ? 119  GLN A CD  1 
ATOM   892  O  OE1 . GLN A 1 119 ? 12.303  5.438   -26.132 1.00 14.27  ? 119  GLN A OE1 1 
ATOM   893  N  NE2 . GLN A 1 119 ? 11.481  6.199   -28.091 1.00 14.17  ? 119  GLN A NE2 1 
ATOM   894  N  N   . LEU A 1 120 ? 9.461   9.309   -22.325 1.00 13.35  ? 120  LEU A N   1 
ATOM   895  C  CA  . LEU A 1 120 ? 9.488   9.831   -20.947 1.00 14.67  ? 120  LEU A CA  1 
ATOM   896  C  C   . LEU A 1 120 ? 8.148   9.716   -20.214 1.00 13.66  ? 120  LEU A C   1 
ATOM   897  O  O   . LEU A 1 120 ? 8.109   9.519   -18.992 1.00 17.73  ? 120  LEU A O   1 
ATOM   898  C  CB  . LEU A 1 120 ? 9.971   11.289  -20.921 1.00 17.06  ? 120  LEU A CB  1 
ATOM   899  C  CG  . LEU A 1 120 ? 11.445  11.449  -21.290 1.00 15.47  ? 120  LEU A CG  1 
ATOM   900  C  CD1 . LEU A 1 120 ? 11.903  12.918  -21.161 1.00 14.47  ? 120  LEU A CD1 1 
ATOM   901  C  CD2 . LEU A 1 120 ? 12.334  10.486  -20.468 1.00 12.89  ? 120  LEU A CD2 1 
ATOM   902  N  N   . THR A 1 121 ? 7.048   9.848   -20.951 1.00 15.00  ? 121  THR A N   1 
ATOM   903  C  CA  . THR A 1 121 ? 5.721   9.722   -20.353 1.00 14.96  ? 121  THR A CA  1 
ATOM   904  C  C   . THR A 1 121 ? 5.505   8.282   -19.872 1.00 17.25  ? 121  THR A C   1 
ATOM   905  O  O   . THR A 1 121 ? 4.946   8.043   -18.797 1.00 17.59  ? 121  THR A O   1 
ATOM   906  C  CB  . THR A 1 121 ? 4.599   10.133  -21.344 1.00 17.15  ? 121  THR A CB  1 
ATOM   907  O  OG1 . THR A 1 121 ? 4.830   11.467  -21.801 1.00 16.17  ? 121  THR A OG1 1 
ATOM   908  C  CG2 . THR A 1 121 ? 3.252   10.071  -20.688 1.00 17.55  ? 121  THR A CG2 1 
ATOM   909  N  N   . LEU A 1 122 ? 5.967   7.327   -20.663 1.00 14.99  ? 122  LEU A N   1 
ATOM   910  C  CA  . LEU A 1 122 ? 5.927   5.912   -20.257 1.00 18.98  ? 122  LEU A CA  1 
ATOM   911  C  C   . LEU A 1 122 ? 6.836   5.625   -19.064 1.00 19.15  ? 122  LEU A C   1 
ATOM   912  O  O   . LEU A 1 122 ? 6.455   4.878   -18.163 1.00 17.15  ? 122  LEU A O   1 
ATOM   913  C  CB  . LEU A 1 122 ? 6.266   4.983   -21.433 1.00 20.16  ? 122  LEU A CB  1 
ATOM   914  C  CG  . LEU A 1 122 ? 5.135   4.915   -22.466 1.00 21.77  ? 122  LEU A CG  1 
ATOM   915  C  CD1 . LEU A 1 122 ? 5.647   4.502   -23.831 1.00 23.28  ? 122  LEU A CD1 1 
ATOM   916  C  CD2 . LEU A 1 122 ? 4.037   3.972   -21.989 1.00 23.10  ? 122  LEU A CD2 1 
ATOM   917  N  N   . ALA A 1 123 ? 8.025   6.227   -19.038 1.00 20.36  ? 123  ALA A N   1 
ATOM   918  C  CA  . ALA A 1 123 ? 8.863   6.140   -17.845 1.00 21.36  ? 123  ALA A CA  1 
ATOM   919  C  C   . ALA A 1 123 ? 8.135   6.655   -16.599 1.00 21.84  ? 123  ALA A C   1 
ATOM   920  O  O   . ALA A 1 123 ? 8.161   6.000   -15.545 1.00 20.58  ? 123  ALA A O   1 
ATOM   921  C  CB  . ALA A 1 123 ? 10.235  6.872   -18.050 1.00 11.45  ? 123  ALA A CB  1 
ATOM   922  N  N   . LEU A 1 124 ? 7.485   7.817   -16.714 1.00 23.47  ? 124  LEU A N   1 
ATOM   923  C  CA  . LEU A 1 124 ? 6.755   8.414   -15.577 1.00 23.26  ? 124  LEU A CA  1 
ATOM   924  C  C   . LEU A 1 124 ? 5.650   7.510   -15.075 1.00 24.92  ? 124  LEU A C   1 
ATOM   925  O  O   . LEU A 1 124 ? 5.479   7.323   -13.875 1.00 27.77  ? 124  LEU A O   1 
ATOM   926  C  CB  . LEU A 1 124 ? 6.110   9.759   -15.946 1.00 21.31  ? 124  LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 124 ? 6.948   11.026  -15.945 1.00 28.19  ? 124  LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 124 ? 6.054   12.232  -16.283 1.00 27.51  ? 124  LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 124 ? 7.638   11.211  -14.604 1.00 29.56  ? 124  LEU A CD2 1 
ATOM   930  N  N   . LYS A 1 125 ? 4.878   6.981   -16.008 1.00 25.44  ? 125  LYS A N   1 
ATOM   931  C  CA  . LYS A 1 125 ? 3.792   6.077   -15.679 1.00 28.61  ? 125  LYS A CA  1 
ATOM   932  C  C   . LYS A 1 125 ? 4.299   4.911   -14.848 1.00 32.99  ? 125  LYS A C   1 
ATOM   933  O  O   . LYS A 1 125 ? 3.630   4.455   -13.927 1.00 36.19  ? 125  LYS A O   1 
ATOM   934  C  CB  . LYS A 1 125 ? 3.146   5.564   -16.962 1.00 24.24  ? 125  LYS A CB  1 
ATOM   935  C  CG  . LYS A 1 125 ? 2.158   4.420   -16.773 1.00 26.67  ? 125  LYS A CG  1 
ATOM   936  C  CD  . LYS A 1 125 ? 1.324   4.274   -18.037 1.00 30.02  ? 125  LYS A CD  1 
ATOM   937  C  CE  . LYS A 1 125 ? 0.469   3.030   -18.031 1.00 33.49  ? 125  LYS A CE  1 
ATOM   938  N  NZ  . LYS A 1 125 ? 0.014   2.743   -19.420 1.00 33.69  ? 125  LYS A NZ  1 
ATOM   939  N  N   . GLU A 1 126 ? 5.487   4.424   -15.175 1.00 35.81  ? 126  GLU A N   1 
ATOM   940  C  CA  . GLU A 1 126 ? 6.068   3.334   -14.411 1.00 39.76  ? 126  GLU A CA  1 
ATOM   941  C  C   . GLU A 1 126 ? 6.435   3.810   -13.004 1.00 42.47  ? 126  GLU A C   1 
ATOM   942  O  O   . GLU A 1 126 ? 6.085   3.160   -12.023 1.00 43.22  ? 126  GLU A O   1 
ATOM   943  C  CB  . GLU A 1 126 ? 7.293   2.760   -15.127 1.00 42.80  ? 126  GLU A CB  1 
ATOM   944  C  CG  . GLU A 1 126 ? 8.068   1.727   -14.310 1.00 46.06  ? 126  GLU A CG  1 
ATOM   945  C  CD  . GLU A 1 126 ? 7.263   0.465   -14.023 1.00 46.44  ? 126  GLU A CD  1 
ATOM   946  O  OE1 . GLU A 1 126 ? 6.215   0.263   -14.675 1.00 41.62  ? 126  GLU A OE1 1 
ATOM   947  O  OE2 . GLU A 1 126 ? 7.681   -0.324  -13.144 1.00 49.93  ? 126  GLU A OE2 1 
ATOM   948  N  N   . CYS A 1 127 ? 7.130   4.945   -12.905 1.00 44.90  ? 127  CYS A N   1 
ATOM   949  C  CA  . CYS A 1 127 ? 7.512   5.497   -11.595 1.00 45.26  ? 127  CYS A CA  1 
ATOM   950  C  C   . CYS A 1 127 ? 6.299   5.686   -10.690 1.00 47.17  ? 127  CYS A C   1 
ATOM   951  O  O   . CYS A 1 127 ? 6.346   5.358   -9.508  1.00 48.69  ? 127  CYS A O   1 
ATOM   952  C  CB  . CYS A 1 127 ? 8.263   6.825   -11.734 1.00 42.04  ? 127  CYS A CB  1 
ATOM   953  S  SG  . CYS A 1 127 ? 9.812   6.715   -12.661 1.00 48.26  ? 127  CYS A SG  1 
ATOM   954  N  N   . HIS A 1 128 ? 5.217   6.211   -11.255 1.00 47.63  ? 128  HIS A N   1 
ATOM   955  C  CA  . HIS A 1 128 ? 3.981   6.413   -10.508 1.00 49.98  ? 128  HIS A CA  1 
ATOM   956  C  C   . HIS A 1 128 ? 3.407   5.082   -10.048 1.00 55.62  ? 128  HIS A C   1 
ATOM   957  O  O   . HIS A 1 128 ? 2.941   4.953   -8.912  1.00 57.27  ? 128  HIS A O   1 
ATOM   958  C  CB  . HIS A 1 128 ? 2.949   7.144   -11.364 1.00 47.86  ? 128  HIS A CB  1 
ATOM   959  C  CG  . HIS A 1 128 ? 3.326   8.552   -11.691 1.00 47.29  ? 128  HIS A CG  1 
ATOM   960  N  ND1 . HIS A 1 128 ? 2.595   9.338   -12.556 1.00 47.00  ? 128  HIS A ND1 1 
ATOM   961  C  CD2 . HIS A 1 128 ? 4.356   9.320   -11.262 1.00 46.49  ? 128  HIS A CD2 1 
ATOM   962  C  CE1 . HIS A 1 128 ? 3.159   10.529  -12.646 1.00 47.62  ? 128  HIS A CE1 1 
ATOM   963  N  NE2 . HIS A 1 128 ? 4.228   10.545  -11.872 1.00 47.07  ? 128  HIS A NE2 1 
ATOM   964  N  N   . ARG A 1 129 ? 3.435   4.098   -10.943 1.00 57.50  ? 129  ARG A N   1 
ATOM   965  C  CA  . ARG A 1 129 ? 2.899   2.774   -10.648 1.00 59.38  ? 129  ARG A CA  1 
ATOM   966  C  C   . ARG A 1 129 ? 3.619   2.166   -9.447  1.00 61.48  ? 129  ARG A C   1 
ATOM   967  O  O   . ARG A 1 129 ? 2.986   1.669   -8.516  1.00 60.75  ? 129  ARG A O   1 
ATOM   968  C  CB  . ARG A 1 129 ? 3.034   1.862   -11.870 1.00 59.51  ? 129  ARG A CB  1 
ATOM   969  C  CG  . ARG A 1 129 ? 2.237   0.571   -11.778 1.00 61.00  ? 129  ARG A CG  1 
ATOM   970  C  CD  . ARG A 1 129 ? 2.605   -0.382  -12.904 1.00 61.91  ? 129  ARG A CD  1 
ATOM   971  N  NE  . ARG A 1 129 ? 3.991   -0.827  -12.797 1.00 62.77  ? 129  ARG A NE  1 
ATOM   972  C  CZ  . ARG A 1 129 ? 4.385   -1.871  -12.073 1.00 62.06  ? 129  ARG A CZ  1 
ATOM   973  N  NH1 . ARG A 1 129 ? 3.494   -2.582  -11.393 1.00 61.75  ? 129  ARG A NH1 1 
ATOM   974  N  NH2 . ARG A 1 129 ? 5.666   -2.207  -12.031 1.00 62.01  ? 129  ARG A NH2 1 
ATOM   975  N  N   . ARG A 1 130 ? 4.949   2.223   -9.474  1.00 64.69  ? 130  ARG A N   1 
ATOM   976  C  CA  . ARG A 1 130 ? 5.774   1.730   -8.378  1.00 66.63  ? 130  ARG A CA  1 
ATOM   977  C  C   . ARG A 1 130 ? 5.783   2.719   -7.211  1.00 71.36  ? 130  ARG A C   1 
ATOM   978  O  O   . ARG A 1 130 ? 6.845   3.090   -6.703  1.00 71.35  ? 130  ARG A O   1 
ATOM   979  C  CB  . ARG A 1 130 ? 7.200   1.472   -8.869  1.00 64.99  ? 130  ARG A CB  1 
ATOM   980  N  N   . SER A 1 131 ? 4.591   3.146   -6.799  1.00 74.74  ? 131  SER A N   1 
ATOM   981  C  CA  . SER A 1 131 ? 4.430   4.085   -5.692  1.00 77.15  ? 131  SER A CA  1 
ATOM   982  C  C   . SER A 1 131 ? 3.020   4.012   -5.116  1.00 78.77  ? 131  SER A C   1 
ATOM   983  O  O   . SER A 1 131 ? 2.728   4.620   -4.085  1.00 79.97  ? 131  SER A O   1 
ATOM   984  C  CB  . SER A 1 131 ? 4.736   5.519   -6.139  1.00 77.94  ? 131  SER A CB  1 
ATOM   985  O  OG  . SER A 1 131 ? 6.128   5.721   -6.314  1.00 78.57  ? 131  SER A OG  1 
ATOM   986  N  N   . ARG A 1 140 ? 12.275  10.372  -9.425  1.00 63.90  ? 140  ARG A N   1 
ATOM   987  C  CA  . ARG A 1 140 ? 13.384  10.705  -10.313 1.00 64.64  ? 140  ARG A CA  1 
ATOM   988  C  C   . ARG A 1 140 ? 13.221  12.103  -10.899 1.00 66.24  ? 140  ARG A C   1 
ATOM   989  O  O   . ARG A 1 140 ? 12.109  12.526  -11.223 1.00 68.58  ? 140  ARG A O   1 
ATOM   990  C  CB  . ARG A 1 140 ? 13.495  9.679   -11.439 1.00 63.92  ? 140  ARG A CB  1 
ATOM   991  C  CG  . ARG A 1 140 ? 13.885  8.282   -10.978 1.00 62.94  ? 140  ARG A CG  1 
ATOM   992  C  CD  . ARG A 1 140 ? 13.677  7.283   -12.094 1.00 62.94  ? 140  ARG A CD  1 
ATOM   993  N  NE  . ARG A 1 140 ? 13.992  5.926   -11.671 1.00 64.51  ? 140  ARG A NE  1 
ATOM   994  C  CZ  . ARG A 1 140 ? 15.174  5.352   -11.856 1.00 65.22  ? 140  ARG A CZ  1 
ATOM   995  N  NH1 . ARG A 1 140 ? 16.139  6.026   -12.460 1.00 65.57  ? 140  ARG A NH1 1 
ATOM   996  N  NH2 . ARG A 1 140 ? 15.390  4.108   -11.444 1.00 65.21  ? 140  ARG A NH2 1 
ATOM   997  N  N   . ASP A 1 141 ? 14.334  12.815  -11.035 1.00 65.44  ? 141  ASP A N   1 
ATOM   998  C  CA  . ASP A 1 141 ? 14.314  14.202  -11.488 1.00 64.02  ? 141  ASP A CA  1 
ATOM   999  C  C   . ASP A 1 141 ? 14.114  14.297  -12.995 1.00 57.58  ? 141  ASP A C   1 
ATOM   1000 O  O   . ASP A 1 141 ? 14.935  13.807  -13.777 1.00 55.75  ? 141  ASP A O   1 
ATOM   1001 C  CB  . ASP A 1 141 ? 15.607  14.915  -11.087 1.00 70.03  ? 141  ASP A CB  1 
ATOM   1002 C  CG  . ASP A 1 141 ? 15.355  16.292  -10.498 1.00 75.06  ? 141  ASP A CG  1 
ATOM   1003 O  OD1 . ASP A 1 141 ? 14.189  16.593  -10.151 1.00 75.60  ? 141  ASP A OD1 1 
ATOM   1004 O  OD2 . ASP A 1 141 ? 16.326  17.071  -10.376 1.00 77.39  ? 141  ASP A OD2 1 
ATOM   1005 N  N   . LEU A 1 142 ? 13.020  14.941  -13.394 1.00 52.09  ? 142  LEU A N   1 
ATOM   1006 C  CA  . LEU A 1 142 ? 12.670  15.075  -14.801 1.00 44.79  ? 142  LEU A CA  1 
ATOM   1007 C  C   . LEU A 1 142 ? 13.339  16.312  -15.370 1.00 42.81  ? 142  LEU A C   1 
ATOM   1008 O  O   . LEU A 1 142 ? 12.701  17.339  -15.594 1.00 47.47  ? 142  LEU A O   1 
ATOM   1009 C  CB  . LEU A 1 142 ? 11.157  15.165  -14.958 1.00 39.83  ? 142  LEU A CB  1 
ATOM   1010 C  CG  . LEU A 1 142 ? 10.560  14.740  -16.293 1.00 41.41  ? 142  LEU A CG  1 
ATOM   1011 C  CD1 . LEU A 1 142 ? 11.067  13.372  -16.684 1.00 41.98  ? 142  LEU A CD1 1 
ATOM   1012 C  CD2 . LEU A 1 142 ? 9.057   14.707  -16.156 1.00 41.13  ? 142  LEU A CD2 1 
ATOM   1013 N  N   . LYS A 1 143 ? 14.640  16.200  -15.595 1.00 38.65  ? 143  LYS A N   1 
ATOM   1014 C  CA  . LYS A 1 143 ? 15.432  17.296  -16.114 1.00 34.48  ? 143  LYS A CA  1 
ATOM   1015 C  C   . LYS A 1 143 ? 16.344  16.797  -17.231 1.00 29.85  ? 143  LYS A C   1 
ATOM   1016 O  O   . LYS A 1 143 ? 16.657  15.608  -17.299 1.00 27.90  ? 143  LYS A O   1 
ATOM   1017 C  CB  . LYS A 1 143 ? 16.224  17.965  -14.988 1.00 37.63  ? 143  LYS A CB  1 
ATOM   1018 C  CG  . LYS A 1 143 ? 17.127  17.038  -14.203 1.00 46.89  ? 143  LYS A CG  1 
ATOM   1019 C  CD  . LYS A 1 143 ? 18.106  17.835  -13.342 1.00 50.88  ? 143  LYS A CD  1 
ATOM   1020 C  CE  . LYS A 1 143 ? 18.962  16.921  -12.472 1.00 55.43  ? 143  LYS A CE  1 
ATOM   1021 N  NZ  . LYS A 1 143 ? 19.886  17.702  -11.595 1.00 58.68  ? 143  LYS A NZ  1 
ATOM   1022 N  N   . PRO A 1 144 ? 16.747  17.699  -18.138 1.00 26.79  ? 144  PRO A N   1 
ATOM   1023 C  CA  . PRO A 1 144 ? 17.490  17.243  -19.318 1.00 26.10  ? 144  PRO A CA  1 
ATOM   1024 C  C   . PRO A 1 144 ? 18.749  16.446  -18.947 1.00 29.31  ? 144  PRO A C   1 
ATOM   1025 O  O   . PRO A 1 144 ? 19.067  15.441  -19.584 1.00 28.27  ? 144  PRO A O   1 
ATOM   1026 C  CB  . PRO A 1 144 ? 17.862  18.553  -20.021 1.00 24.84  ? 144  PRO A CB  1 
ATOM   1027 C  CG  . PRO A 1 144 ? 16.770  19.513  -19.621 1.00 24.35  ? 144  PRO A CG  1 
ATOM   1028 C  CD  . PRO A 1 144 ? 16.441  19.142  -18.187 1.00 24.39  ? 144  PRO A CD  1 
ATOM   1029 N  N   . ALA A 1 145 ? 19.457  16.889  -17.916 1.00 29.08  ? 145  ALA A N   1 
ATOM   1030 C  CA  . ALA A 1 145 ? 20.705  16.251  -17.548 1.00 28.54  ? 145  ALA A CA  1 
ATOM   1031 C  C   . ALA A 1 145 ? 20.492  14.807  -17.106 1.00 28.39  ? 145  ALA A C   1 
ATOM   1032 O  O   . ALA A 1 145 ? 21.450  14.044  -16.999 1.00 26.55  ? 145  ALA A O   1 
ATOM   1033 C  CB  . ALA A 1 145 ? 21.413  17.058  -16.451 1.00 30.26  ? 145  ALA A CB  1 
ATOM   1034 N  N   . ASN A 1 146 ? 19.239  14.434  -16.846 1.00 29.06  ? 146  ASN A N   1 
ATOM   1035 C  CA  . ASN A 1 146 ? 18.923  13.100  -16.335 1.00 23.47  ? 146  ASN A CA  1 
ATOM   1036 C  C   . ASN A 1 146 ? 18.181  12.242  -17.361 1.00 20.80  ? 146  ASN A C   1 
ATOM   1037 O  O   . ASN A 1 146 ? 17.554  11.241  -17.026 1.00 21.22  ? 146  ASN A O   1 
ATOM   1038 C  CB  . ASN A 1 146 ? 18.101  13.208  -15.045 1.00 25.88  ? 146  ASN A CB  1 
ATOM   1039 C  CG  . ASN A 1 146 ? 17.933  11.868  -14.336 1.00 35.54  ? 146  ASN A CG  1 
ATOM   1040 O  OD1 . ASN A 1 146 ? 18.867  11.059  -14.268 1.00 40.03  ? 146  ASN A OD1 1 
ATOM   1041 N  ND2 . ASN A 1 146 ? 16.744  11.635  -13.788 1.00 36.86  ? 146  ASN A ND2 1 
ATOM   1042 N  N   . VAL A 1 147 ? 18.254  12.632  -18.619 1.00 23.16  ? 147  VAL A N   1 
ATOM   1043 C  CA  . VAL A 1 147 ? 17.576  11.880  -19.655 1.00 22.05  ? 147  VAL A CA  1 
ATOM   1044 C  C   . VAL A 1 147 ? 18.621  11.440  -20.649 1.00 21.04  ? 147  VAL A C   1 
ATOM   1045 O  O   . VAL A 1 147 ? 19.395  12.264  -21.131 1.00 20.40  ? 147  VAL A O   1 
ATOM   1046 C  CB  . VAL A 1 147 ? 16.538  12.735  -20.376 1.00 19.06  ? 147  VAL A CB  1 
ATOM   1047 C  CG1 . VAL A 1 147 ? 15.836  11.911  -21.462 1.00 12.71  ? 147  VAL A CG1 1 
ATOM   1048 C  CG2 . VAL A 1 147 ? 15.529  13.283  -19.383 1.00 18.93  ? 147  VAL A CG2 1 
ATOM   1049 N  N   . PHE A 1 148 ? 18.658  10.142  -20.936 1.00 18.91  ? 148  PHE A N   1 
ATOM   1050 C  CA  . PHE A 1 148 ? 19.720  9.599   -21.766 1.00 18.26  ? 148  PHE A CA  1 
ATOM   1051 C  C   . PHE A 1 148 ? 19.231  8.941   -23.046 1.00 18.75  ? 148  PHE A C   1 
ATOM   1052 O  O   . PHE A 1 148 ? 18.110  8.445   -23.119 1.00 21.09  ? 148  PHE A O   1 
ATOM   1053 C  CB  . PHE A 1 148 ? 20.594  8.659   -20.935 1.00 14.46  ? 148  PHE A CB  1 
ATOM   1054 C  CG  . PHE A 1 148 ? 21.120  9.304   -19.696 1.00 17.47  ? 148  PHE A CG  1 
ATOM   1055 C  CD1 . PHE A 1 148 ? 20.397  9.254   -18.516 1.00 20.22  ? 148  PHE A CD1 1 
ATOM   1056 C  CD2 . PHE A 1 148 ? 22.310  10.025  -19.726 1.00 18.73  ? 148  PHE A CD2 1 
ATOM   1057 C  CE1 . PHE A 1 148 ? 20.866  9.886   -17.380 1.00 20.19  ? 148  PHE A CE1 1 
ATOM   1058 C  CE2 . PHE A 1 148 ? 22.789  10.656  -18.598 1.00 19.89  ? 148  PHE A CE2 1 
ATOM   1059 C  CZ  . PHE A 1 148 ? 22.077  10.586  -17.421 1.00 18.94  ? 148  PHE A CZ  1 
ATOM   1060 N  N   . LEU A 1 149 ? 20.094  8.965   -24.057 1.00 15.79  ? 149  LEU A N   1 
ATOM   1061 C  CA  . LEU A 1 149 ? 19.807  8.388   -25.352 1.00 17.05  ? 149  LEU A CA  1 
ATOM   1062 C  C   . LEU A 1 149 ? 20.705  7.165   -25.607 1.00 19.29  ? 149  LEU A C   1 
ATOM   1063 O  O   . LEU A 1 149 ? 21.906  7.230   -25.387 1.00 19.52  ? 149  LEU A O   1 
ATOM   1064 C  CB  . LEU A 1 149 ? 20.084  9.436   -26.421 1.00 18.43  ? 149  LEU A CB  1 
ATOM   1065 C  CG  . LEU A 1 149 ? 19.353  10.761  -26.182 1.00 24.72  ? 149  LEU A CG  1 
ATOM   1066 C  CD1 . LEU A 1 149 ? 19.737  11.765  -27.248 1.00 26.72  ? 149  LEU A CD1 1 
ATOM   1067 C  CD2 . LEU A 1 149 ? 17.834  10.558  -26.127 1.00 27.12  ? 149  LEU A CD2 1 
ATOM   1068 N  N   . ASP A 1 150 ? 20.135  6.056   -26.078 1.00 14.99  ? 150  ASP A N   1 
ATOM   1069 C  CA  . ASP A 1 150 ? 20.964  4.931   -26.504 1.00 14.74  ? 150  ASP A CA  1 
ATOM   1070 C  C   . ASP A 1 150 ? 21.276  4.996   -28.011 1.00 14.60  ? 150  ASP A C   1 
ATOM   1071 O  O   . ASP A 1 150 ? 21.249  6.077   -28.619 1.00 13.81  ? 150  ASP A O   1 
ATOM   1072 C  CB  . ASP A 1 150 ? 20.346  3.587   -26.112 1.00 19.60  ? 150  ASP A CB  1 
ATOM   1073 C  CG  . ASP A 1 150 ? 19.099  3.254   -26.913 1.00 23.19  ? 150  ASP A CG  1 
ATOM   1074 O  OD1 . ASP A 1 150 ? 18.716  4.042   -27.813 1.00 22.73  ? 150  ASP A OD1 1 
ATOM   1075 O  OD2 . ASP A 1 150 ? 18.502  2.194   -26.637 1.00 21.11  ? 150  ASP A OD2 1 
ATOM   1076 N  N   . GLY A 1 151 ? 21.587  3.851   -28.607 1.00 14.01  ? 151  GLY A N   1 
ATOM   1077 C  CA  . GLY A 1 151 ? 22.019  3.821   -29.998 1.00 16.55  ? 151  GLY A CA  1 
ATOM   1078 C  C   . GLY A 1 151 ? 20.919  3.444   -30.982 1.00 18.78  ? 151  GLY A C   1 
ATOM   1079 O  O   . GLY A 1 151 ? 21.162  3.323   -32.177 1.00 16.79  ? 151  GLY A O   1 
ATOM   1080 N  N   . LYS A 1 152 ? 19.696  3.289   -30.490 1.00 17.06  ? 152  LYS A N   1 
ATOM   1081 C  CA  . LYS A 1 152 ? 18.597  2.863   -31.346 0.84 18.97  ? 152  LYS A CA  1 
ATOM   1082 C  C   . LYS A 1 152 ? 17.376  3.761   -31.221 1.00 25.30  ? 152  LYS A C   1 
ATOM   1083 O  O   . LYS A 1 152 ? 16.239  3.297   -31.342 1.00 25.44  ? 152  LYS A O   1 
ATOM   1084 C  CB  . LYS A 1 152 ? 18.219  1.436   -30.991 0.84 19.00  ? 152  LYS A CB  1 
ATOM   1085 C  CG  . LYS A 1 152 ? 19.411  0.499   -30.955 0.84 19.18  ? 152  LYS A CG  1 
ATOM   1086 C  CD  . LYS A 1 152 ? 19.011  -0.878  -30.474 0.84 22.55  ? 152  LYS A CD  1 
ATOM   1087 C  CE  . LYS A 1 152 ? 19.144  -0.999  -28.961 0.84 25.67  ? 152  LYS A CE  1 
ATOM   1088 N  NZ  . LYS A 1 152 ? 19.514  -2.403  -28.577 0.84 26.28  ? 152  LYS A NZ  1 
ATOM   1089 N  N   . GLN A 1 153 ? 17.619  5.040   -30.963 1.00 25.98  ? 153  GLN A N   1 
ATOM   1090 C  CA  . GLN A 1 153 ? 16.561  6.044   -30.872 1.00 24.26  ? 153  GLN A CA  1 
ATOM   1091 C  C   . GLN A 1 153 ? 15.700  5.897   -29.628 1.00 23.19  ? 153  GLN A C   1 
ATOM   1092 O  O   . GLN A 1 153 ? 14.550  6.355   -29.607 1.00 25.46  ? 153  GLN A O   1 
ATOM   1093 C  CB  . GLN A 1 153 ? 15.681  6.032   -32.131 1.00 25.25  ? 153  GLN A CB  1 
ATOM   1094 C  CG  . GLN A 1 153 ? 16.430  6.472   -33.384 1.00 26.02  ? 153  GLN A CG  1 
ATOM   1095 C  CD  . GLN A 1 153 ? 15.539  6.541   -34.603 1.00 30.60  ? 153  GLN A CD  1 
ATOM   1096 O  OE1 . GLN A 1 153 ? 14.698  5.655   -34.843 1.00 28.48  ? 153  GLN A OE1 1 
ATOM   1097 N  NE2 . GLN A 1 153 ? 15.709  7.601   -35.386 1.00 33.23  ? 153  GLN A NE2 1 
ATOM   1098 N  N   . ASN A 1 154 ? 16.244  5.257   -28.595 1.00 16.35  ? 154  ASN A N   1 
ATOM   1099 C  CA  . ASN A 1 154 ? 15.491  5.086   -27.353 1.00 15.22  ? 154  ASN A CA  1 
ATOM   1100 C  C   . ASN A 1 154 ? 15.872  6.131   -26.324 1.00 14.55  ? 154  ASN A C   1 
ATOM   1101 O  O   . ASN A 1 154 ? 16.993  6.613   -26.323 1.00 15.32  ? 154  ASN A O   1 
ATOM   1102 C  CB  . ASN A 1 154 ? 15.642  3.679   -26.792 1.00 17.43  ? 154  ASN A CB  1 
ATOM   1103 C  CG  . ASN A 1 154 ? 15.218  2.620   -27.787 1.00 22.56  ? 154  ASN A CG  1 
ATOM   1104 O  OD1 . ASN A 1 154 ? 14.249  2.802   -28.524 1.00 23.12  ? 154  ASN A OD1 1 
ATOM   1105 N  ND2 . ASN A 1 154 ? 15.966  1.523   -27.843 1.00 22.74  ? 154  ASN A ND2 1 
ATOM   1106 N  N   . VAL A 1 155 ? 14.916  6.475   -25.469 1.00 12.45  ? 155  VAL A N   1 
ATOM   1107 C  CA  . VAL A 1 155 ? 15.064  7.549   -24.507 1.00 14.64  ? 155  VAL A CA  1 
ATOM   1108 C  C   . VAL A 1 155 ? 14.897  6.950   -23.117 1.00 19.74  ? 155  VAL A C   1 
ATOM   1109 O  O   . VAL A 1 155 ? 13.942  6.198   -22.869 1.00 18.94  ? 155  VAL A O   1 
ATOM   1110 C  CB  . VAL A 1 155 ? 13.986  8.627   -24.764 1.00 12.28  ? 155  VAL A CB  1 
ATOM   1111 C  CG1 . VAL A 1 155 ? 14.123  9.790   -23.800 1.00 8.18   ? 155  VAL A CG1 1 
ATOM   1112 C  CG2 . VAL A 1 155 ? 14.071  9.112   -26.216 1.00 10.27  ? 155  VAL A CG2 1 
ATOM   1113 N  N   . LYS A 1 156 ? 15.838  7.253   -22.220 1.00 21.05  ? 156  LYS A N   1 
ATOM   1114 C  CA  . LYS A 1 156 ? 15.888  6.597   -20.918 1.00 20.95  ? 156  LYS A CA  1 
ATOM   1115 C  C   . LYS A 1 156 ? 16.050  7.550   -19.732 1.00 25.72  ? 156  LYS A C   1 
ATOM   1116 O  O   . LYS A 1 156 ? 16.909  8.424   -19.731 1.00 27.45  ? 156  LYS A O   1 
ATOM   1117 C  CB  . LYS A 1 156 ? 16.987  5.533   -20.908 1.00 21.97  ? 156  LYS A CB  1 
ATOM   1118 C  CG  . LYS A 1 156 ? 16.595  4.248   -21.643 1.00 24.47  ? 156  LYS A CG  1 
ATOM   1119 C  CD  . LYS A 1 156 ? 17.643  3.816   -22.628 1.00 24.39  ? 156  LYS A CD  1 
ATOM   1120 C  CE  . LYS A 1 156 ? 17.207  2.565   -23.385 1.00 25.08  ? 156  LYS A CE  1 
ATOM   1121 N  NZ  . LYS A 1 156 ? 17.187  1.322   -22.552 1.00 22.82  ? 156  LYS A NZ  1 
ATOM   1122 N  N   . LEU A 1 157 ? 15.211  7.365   -18.721 1.00 24.17  ? 157  LEU A N   1 
ATOM   1123 C  CA  . LEU A 1 157 ? 15.273  8.168   -17.507 1.00 24.31  ? 157  LEU A CA  1 
ATOM   1124 C  C   . LEU A 1 157 ? 16.308  7.593   -16.521 1.00 26.25  ? 157  LEU A C   1 
ATOM   1125 O  O   . LEU A 1 157 ? 16.326  6.388   -16.258 1.00 24.19  ? 157  LEU A O   1 
ATOM   1126 C  CB  . LEU A 1 157 ? 13.884  8.224   -16.867 1.00 26.27  ? 157  LEU A CB  1 
ATOM   1127 C  CG  . LEU A 1 157 ? 13.692  9.187   -15.697 1.00 29.30  ? 157  LEU A CG  1 
ATOM   1128 C  CD1 . LEU A 1 157 ? 14.092  10.608  -16.103 1.00 30.61  ? 157  LEU A CD1 1 
ATOM   1129 C  CD2 . LEU A 1 157 ? 12.240  9.141   -15.234 1.00 25.97  ? 157  LEU A CD2 1 
ATOM   1130 N  N   . GLY A 1 158 ? 17.175  8.460   -16.002 1.00 28.06  ? 158  GLY A N   1 
ATOM   1131 C  CA  . GLY A 1 158 ? 18.194  8.080   -15.034 1.00 34.10  ? 158  GLY A CA  1 
ATOM   1132 C  C   . GLY A 1 158 ? 17.772  8.276   -13.584 1.00 39.81  ? 158  GLY A C   1 
ATOM   1133 O  O   . GLY A 1 158 ? 16.621  8.625   -13.305 1.00 37.77  ? 158  GLY A O   1 
ATOM   1134 N  N   . ASP A 1 159 ? 18.704  8.068   -12.653 1.00 47.07  ? 159  ASP A N   1 
ATOM   1135 C  CA  . ASP A 1 159 ? 18.346  7.898   -11.241 1.00 53.75  ? 159  ASP A CA  1 
ATOM   1136 C  C   . ASP A 1 159 ? 18.542  9.122   -10.364 1.00 58.29  ? 159  ASP A C   1 
ATOM   1137 O  O   . ASP A 1 159 ? 18.129  9.122   -9.202  1.00 57.47  ? 159  ASP A O   1 
ATOM   1138 C  CB  . ASP A 1 159 ? 19.113  6.712   -10.626 1.00 55.97  ? 159  ASP A CB  1 
ATOM   1139 C  CG  . ASP A 1 159 ? 20.594  7.023   -10.374 1.00 59.07  ? 159  ASP A CG  1 
ATOM   1140 O  OD1 . ASP A 1 159 ? 20.984  8.209   -10.411 1.00 58.15  ? 159  ASP A OD1 1 
ATOM   1141 O  OD2 . ASP A 1 159 ? 21.375  6.075   -10.130 1.00 63.24  ? 159  ASP A OD2 1 
ATOM   1142 N  N   . PHE A 1 160 ? 19.173  10.157  -10.911 1.00 64.56  ? 160  PHE A N   1 
ATOM   1143 C  CA  . PHE A 1 160 ? 19.667  11.252  -10.083 1.00 72.97  ? 160  PHE A CA  1 
ATOM   1144 C  C   . PHE A 1 160 ? 19.012  12.602  -10.363 1.00 74.56  ? 160  PHE A C   1 
ATOM   1145 O  O   . PHE A 1 160 ? 19.585  13.445  -11.055 1.00 74.51  ? 160  PHE A O   1 
ATOM   1146 C  CB  . PHE A 1 160 ? 21.195  11.359  -10.201 1.00 77.25  ? 160  PHE A CB  1 
ATOM   1147 C  CG  . PHE A 1 160 ? 21.687  11.617  -11.604 1.00 80.55  ? 160  PHE A CG  1 
ATOM   1148 C  CD1 . PHE A 1 160 ? 21.308  10.797  -12.657 1.00 81.42  ? 160  PHE A CD1 1 
ATOM   1149 C  CD2 . PHE A 1 160 ? 22.548  12.671  -11.865 1.00 82.31  ? 160  PHE A CD2 1 
ATOM   1150 C  CE1 . PHE A 1 160 ? 21.770  11.032  -13.943 1.00 81.74  ? 160  PHE A CE1 1 
ATOM   1151 C  CE2 . PHE A 1 160 ? 23.013  12.910  -13.148 1.00 82.25  ? 160  PHE A CE2 1 
ATOM   1152 C  CZ  . PHE A 1 160 ? 22.624  12.089  -14.187 1.00 81.96  ? 160  PHE A CZ  1 
ATOM   1153 N  N   . GLY A 1 161 ? 17.808  12.802  -9.828  1.00 75.02  ? 161  GLY A N   1 
ATOM   1154 C  CA  . GLY A 1 161 ? 17.094  11.762  -9.110  1.00 74.77  ? 161  GLY A CA  1 
ATOM   1155 C  C   . GLY A 1 161 ? 16.979  11.973  -7.614  1.00 74.05  ? 161  GLY A C   1 
ATOM   1156 O  O   . GLY A 1 161 ? 16.448  11.117  -6.904  1.00 73.59  ? 161  GLY A O   1 
ATOM   1157 N  N   . VAL A 1 177 ? 22.376  26.168  -5.757  1.00 60.14  ? 177  VAL A N   1 
ATOM   1158 C  CA  . VAL A 1 177 ? 22.947  27.330  -6.436  1.00 63.45  ? 177  VAL A CA  1 
ATOM   1159 C  C   . VAL A 1 177 ? 22.203  27.655  -7.730  1.00 66.45  ? 177  VAL A C   1 
ATOM   1160 O  O   . VAL A 1 177 ? 22.042  28.824  -8.095  1.00 67.42  ? 177  VAL A O   1 
ATOM   1161 C  CB  . VAL A 1 177 ? 24.447  27.126  -6.757  1.00 63.52  ? 177  VAL A CB  1 
ATOM   1162 C  CG1 . VAL A 1 177 ? 25.004  28.327  -7.515  1.00 63.06  ? 177  VAL A CG1 1 
ATOM   1163 C  CG2 . VAL A 1 177 ? 25.236  26.885  -5.484  1.00 65.25  ? 177  VAL A CG2 1 
ATOM   1164 N  N   . GLY A 1 178 ? 21.750  26.615  -8.424  1.00 65.70  ? 178  GLY A N   1 
ATOM   1165 C  CA  . GLY A 1 178 ? 21.052  26.794  -9.683  1.00 63.29  ? 178  GLY A CA  1 
ATOM   1166 C  C   . GLY A 1 178 ? 19.673  27.406  -9.526  1.00 61.56  ? 178  GLY A C   1 
ATOM   1167 O  O   . GLY A 1 178 ? 19.088  27.392  -8.440  1.00 61.22  ? 178  GLY A O   1 
ATOM   1168 N  N   . THR A 1 179 ? 19.157  27.961  -10.618 1.00 59.94  ? 179  THR A N   1 
ATOM   1169 C  CA  . THR A 1 179 ? 17.774  28.419  -10.666 1.00 56.89  ? 179  THR A CA  1 
ATOM   1170 C  C   . THR A 1 179 ? 16.901  27.200  -10.949 1.00 54.04  ? 179  THR A C   1 
ATOM   1171 O  O   . THR A 1 179 ? 17.225  26.397  -11.829 1.00 53.77  ? 179  THR A O   1 
ATOM   1172 C  CB  . THR A 1 179 ? 17.561  29.478  -11.772 1.00 55.01  ? 179  THR A CB  1 
ATOM   1173 O  OG1 . THR A 1 179 ? 18.655  30.407  -11.777 1.00 56.71  ? 179  THR A OG1 1 
ATOM   1174 C  CG2 . THR A 1 179 ? 16.267  30.240  -11.546 1.00 52.05  ? 179  THR A CG2 1 
ATOM   1175 N  N   . PRO A 1 180 ? 15.800  27.044  -10.194 1.00 51.19  ? 180  PRO A N   1 
ATOM   1176 C  CA  . PRO A 1 180 ? 14.883  25.906  -10.352 1.00 48.75  ? 180  PRO A CA  1 
ATOM   1177 C  C   . PRO A 1 180 ? 13.885  26.114  -11.497 1.00 43.93  ? 180  PRO A C   1 
ATOM   1178 O  O   . PRO A 1 180 ? 12.687  26.270  -11.238 1.00 41.95  ? 180  PRO A O   1 
ATOM   1179 C  CB  . PRO A 1 180 ? 14.118  25.878  -9.020  1.00 50.00  ? 180  PRO A CB  1 
ATOM   1180 C  CG  . PRO A 1 180 ? 14.612  27.050  -8.221  1.00 51.44  ? 180  PRO A CG  1 
ATOM   1181 C  CD  . PRO A 1 180 ? 15.349  27.962  -9.139  1.00 50.53  ? 180  PRO A CD  1 
ATOM   1182 N  N   . TYR A 1 181 ? 14.370  26.104  -12.737 1.00 44.45  ? 181  TYR A N   1 
ATOM   1183 C  CA  . TYR A 1 181 ? 13.526  26.371  -13.914 1.00 44.95  ? 181  TYR A CA  1 
ATOM   1184 C  C   . TYR A 1 181 ? 12.236  25.540  -13.994 1.00 41.27  ? 181  TYR A C   1 
ATOM   1185 O  O   . TYR A 1 181 ? 11.220  26.013  -14.516 1.00 39.92  ? 181  TYR A O   1 
ATOM   1186 C  CB  . TYR A 1 181 ? 14.328  26.180  -15.206 1.00 49.45  ? 181  TYR A CB  1 
ATOM   1187 C  CG  . TYR A 1 181 ? 15.471  27.161  -15.400 1.00 54.27  ? 181  TYR A CG  1 
ATOM   1188 C  CD1 . TYR A 1 181 ? 16.798  26.753  -15.253 1.00 54.65  ? 181  TYR A CD1 1 
ATOM   1189 C  CD2 . TYR A 1 181 ? 15.226  28.491  -15.733 1.00 53.95  ? 181  TYR A CD2 1 
ATOM   1190 C  CE1 . TYR A 1 181 ? 17.843  27.636  -15.434 1.00 54.83  ? 181  TYR A CE1 1 
ATOM   1191 C  CE2 . TYR A 1 181 ? 16.273  29.388  -15.915 1.00 55.23  ? 181  TYR A CE2 1 
ATOM   1192 C  CZ  . TYR A 1 181 ? 17.576  28.953  -15.766 1.00 56.69  ? 181  TYR A CZ  1 
ATOM   1193 O  OH  . TYR A 1 181 ? 18.618  29.838  -15.947 1.00 59.16  ? 181  TYR A OH  1 
ATOM   1194 N  N   . TYR A 1 182 ? 12.280  24.311  -13.481 1.00 39.30  ? 182  TYR A N   1 
ATOM   1195 C  CA  . TYR A 1 182 ? 11.168  23.365  -13.645 1.00 38.81  ? 182  TYR A CA  1 
ATOM   1196 C  C   . TYR A 1 182 ? 10.212  23.252  -12.450 1.00 39.86  ? 182  TYR A C   1 
ATOM   1197 O  O   . TYR A 1 182 ? 9.283   22.445  -12.480 1.00 39.96  ? 182  TYR A O   1 
ATOM   1198 C  CB  . TYR A 1 182 ? 11.698  21.968  -13.991 1.00 35.04  ? 182  TYR A CB  1 
ATOM   1199 C  CG  . TYR A 1 182 ? 12.323  21.865  -15.362 1.00 30.68  ? 182  TYR A CG  1 
ATOM   1200 C  CD1 . TYR A 1 182 ? 12.739  22.999  -16.049 1.00 30.15  ? 182  TYR A CD1 1 
ATOM   1201 C  CD2 . TYR A 1 182 ? 12.497  20.639  -15.966 1.00 27.15  ? 182  TYR A CD2 1 
ATOM   1202 C  CE1 . TYR A 1 182 ? 13.320  22.904  -17.299 1.00 29.34  ? 182  TYR A CE1 1 
ATOM   1203 C  CE2 . TYR A 1 182 ? 13.069  20.537  -17.214 1.00 26.16  ? 182  TYR A CE2 1 
ATOM   1204 C  CZ  . TYR A 1 182 ? 13.485  21.666  -17.870 1.00 25.42  ? 182  TYR A CZ  1 
ATOM   1205 O  OH  . TYR A 1 182 ? 14.048  21.550  -19.115 1.00 26.92  ? 182  TYR A OH  1 
ATOM   1206 N  N   . MET A 1 183 ? 10.443  24.036  -11.401 0.87 39.60  ? 183  MET A N   1 
ATOM   1207 C  CA  . MET A 1 183 ? 9.581   23.979  -10.225 0.91 37.57  ? 183  MET A CA  1 
ATOM   1208 C  C   . MET A 1 183 ? 8.150   24.383  -10.588 0.85 34.00  ? 183  MET A C   1 
ATOM   1209 O  O   . MET A 1 183 ? 7.929   25.411  -11.224 0.58 34.38  ? 183  MET A O   1 
ATOM   1210 C  CB  . MET A 1 183 ? 10.124  24.875  -9.109  1.00 37.93  ? 183  MET A CB  1 
ATOM   1211 N  N   . SER A 1 184 ? 7.187   23.561  -10.186 1.00 31.13  ? 184  SER A N   1 
ATOM   1212 C  CA  . SER A 1 184 ? 5.782   23.790  -10.509 1.00 30.50  ? 184  SER A CA  1 
ATOM   1213 C  C   . SER A 1 184 ? 5.153   24.756  -9.522  1.00 34.16  ? 184  SER A C   1 
ATOM   1214 O  O   . SER A 1 184 ? 5.657   24.919  -8.412  1.00 36.38  ? 184  SER A O   1 
ATOM   1215 C  CB  . SER A 1 184 ? 5.011   22.469  -10.494 1.00 28.89  ? 184  SER A CB  1 
ATOM   1216 O  OG  . SER A 1 184 ? 5.174   21.807  -9.253  1.00 28.57  ? 184  SER A OG  1 
ATOM   1217 N  N   . PRO A 1 185 ? 4.044   25.400  -9.923  1.00 34.09  ? 185  PRO A N   1 
ATOM   1218 C  CA  . PRO A 1 185 ? 3.311   26.358  -9.081  1.00 37.10  ? 185  PRO A CA  1 
ATOM   1219 C  C   . PRO A 1 185 ? 2.892   25.783  -7.726  1.00 41.12  ? 185  PRO A C   1 
ATOM   1220 O  O   . PRO A 1 185 ? 2.909   26.512  -6.728  1.00 42.63  ? 185  PRO A O   1 
ATOM   1221 C  CB  . PRO A 1 185 ? 2.070   26.684  -9.921  1.00 35.72  ? 185  PRO A CB  1 
ATOM   1222 C  CG  . PRO A 1 185 ? 2.494   26.418  -11.331 1.00 33.29  ? 185  PRO A CG  1 
ATOM   1223 C  CD  . PRO A 1 185 ? 3.435   25.261  -11.258 1.00 31.65  ? 185  PRO A CD  1 
ATOM   1224 N  N   . GLU A 1 186 ? 2.519   24.506  -7.693  1.00 42.91  ? 186  GLU A N   1 
ATOM   1225 C  CA  . GLU A 1 186 ? 2.148   23.854  -6.441  1.00 47.85  ? 186  GLU A CA  1 
ATOM   1226 C  C   . GLU A 1 186 ? 3.370   23.481  -5.621  1.00 51.73  ? 186  GLU A C   1 
ATOM   1227 O  O   . GLU A 1 186 ? 3.415   23.726  -4.420  1.00 53.33  ? 186  GLU A O   1 
ATOM   1228 C  CB  . GLU A 1 186 ? 1.274   22.610  -6.679  1.00 47.99  ? 186  GLU A CB  1 
ATOM   1229 C  CG  . GLU A 1 186 ? 1.926   21.505  -7.496  1.00 46.71  ? 186  GLU A CG  1 
ATOM   1230 C  CD  . GLU A 1 186 ? 1.612   21.613  -8.980  1.00 44.64  ? 186  GLU A CD  1 
ATOM   1231 O  OE1 . GLU A 1 186 ? 0.803   22.485  -9.368  1.00 43.78  ? 186  GLU A OE1 1 
ATOM   1232 O  OE2 . GLU A 1 186 ? 2.177   20.823  -9.756  1.00 43.53  ? 186  GLU A OE2 1 
ATOM   1233 N  N   . GLN A 1 187 ? 4.362   22.883  -6.268  1.00 54.81  ? 187  GLN A N   1 
ATOM   1234 C  CA  . GLN A 1 187 ? 5.569   22.471  -5.565  1.00 56.78  ? 187  GLN A CA  1 
ATOM   1235 C  C   . GLN A 1 187 ? 6.445   23.686  -5.309  1.00 57.66  ? 187  GLN A C   1 
ATOM   1236 O  O   . GLN A 1 187 ? 7.617   23.557  -4.962  1.00 61.19  ? 187  GLN A O   1 
ATOM   1237 C  CB  . GLN A 1 187 ? 6.331   21.398  -6.353  1.00 56.15  ? 187  GLN A CB  1 
ATOM   1238 N  N   . MET A 1 188 ? 5.861   24.868  -5.488  0.60 57.05  ? 188  MET A N   1 
ATOM   1239 C  CA  . MET A 1 188 ? 6.534   26.133  -5.208  1.00 60.02  ? 188  MET A CA  1 
ATOM   1240 C  C   . MET A 1 188 ? 5.796   26.921  -4.118  0.60 62.34  ? 188  MET A C   1 
ATOM   1241 O  O   . MET A 1 188 ? 6.327   27.883  -3.565  0.60 61.71  ? 188  MET A O   1 
ATOM   1242 C  CB  . MET A 1 188 ? 6.678   26.963  -6.489  1.00 60.22  ? 188  MET A CB  1 
ATOM   1243 C  CG  . MET A 1 188 ? 7.447   28.267  -6.313  1.00 62.86  ? 188  MET A CG  1 
ATOM   1244 S  SD  . MET A 1 188 ? 8.419   28.741  -7.766  1.00 112.92 ? 188  MET A SD  1 
ATOM   1245 C  CE  . MET A 1 188 ? 9.897   27.750  -7.545  1.00 25.68  ? 188  MET A CE  1 
ATOM   1246 N  N   . ASN A 1 189 ? 4.565   26.513  -3.827  1.00 65.75  ? 189  ASN A N   1 
ATOM   1247 C  CA  . ASN A 1 189 ? 3.849   26.991  -2.654  1.00 69.46  ? 189  ASN A CA  1 
ATOM   1248 C  C   . ASN A 1 189 ? 3.810   25.834  -1.668  1.00 74.74  ? 189  ASN A C   1 
ATOM   1249 O  O   . ASN A 1 189 ? 4.686   25.704  -0.813  1.00 77.08  ? 189  ASN A O   1 
ATOM   1250 C  CB  . ASN A 1 189 ? 2.427   27.420  -3.019  1.00 68.76  ? 189  ASN A CB  1 
ATOM   1251 C  CG  . ASN A 1 189 ? 2.390   28.426  -4.164  1.00 69.11  ? 189  ASN A CG  1 
ATOM   1252 O  OD1 . ASN A 1 189 ? 3.300   29.240  -4.323  1.00 71.67  ? 189  ASN A OD1 1 
ATOM   1253 N  ND2 . ASN A 1 189 ? 1.331   28.372  -4.967  1.00 66.38  ? 189  ASN A ND2 1 
ATOM   1254 N  N   . ARG A 1 190 ? 2.804   24.993  -1.849  1.00 76.60  ? 190  ARG A N   1 
ATOM   1255 C  CA  . ARG A 1 190 ? 2.847   23.647  -1.366  1.00 77.11  ? 190  ARG A CA  1 
ATOM   1256 C  C   . ARG A 1 190 ? 1.566   22.844  -1.522  1.00 74.47  ? 190  ARG A C   1 
ATOM   1257 O  O   . ARG A 1 190 ? 0.639   23.285  -2.160  1.00 72.32  ? 190  ARG A O   1 
ATOM   1258 C  CB  . ARG A 1 190 ? 3.366   23.661  0.046   1.00 81.18  ? 190  ARG A CB  1 
ATOM   1259 C  CG  . ARG A 1 190 ? 4.717   23.193  0.029   1.00 84.11  ? 190  ARG A CG  1 
ATOM   1260 C  CD  . ARG A 1 190 ? 4.748   22.161  -1.019  1.00 85.72  ? 190  ARG A CD  1 
ATOM   1261 N  NE  . ARG A 1 190 ? 6.091   21.771  -1.365  1.00 88.41  ? 190  ARG A NE  1 
ATOM   1262 C  CZ  . ARG A 1 190 ? 6.544   20.542  -1.223  1.00 91.26  ? 190  ARG A CZ  1 
ATOM   1263 N  NH1 . ARG A 1 190 ? 5.753   19.608  -0.710  1.00 92.55  ? 190  ARG A NH1 1 
ATOM   1264 N  NH2 . ARG A 1 190 ? 7.789   20.250  -1.571  1.00 91.58  ? 190  ARG A NH2 1 
ATOM   1265 N  N   . ASN A 1 194 ? 2.513   15.166  -5.770  1.00 52.39  ? 194  ASN A N   1 
ATOM   1266 C  CA  . ASN A 1 194 ? 1.543   15.410  -6.833  1.00 47.44  ? 194  ASN A CA  1 
ATOM   1267 C  C   . ASN A 1 194 ? 2.058   14.943  -8.190  1.00 40.62  ? 194  ASN A C   1 
ATOM   1268 O  O   . ASN A 1 194 ? 3.062   15.449  -8.690  1.00 42.59  ? 194  ASN A O   1 
ATOM   1269 C  CB  . ASN A 1 194 ? 1.177   16.896  -6.890  1.00 47.84  ? 194  ASN A CB  1 
ATOM   1270 C  CG  . ASN A 1 194 ? -0.089  17.157  -7.688  1.00 45.68  ? 194  ASN A CG  1 
ATOM   1271 O  OD1 . ASN A 1 194 ? -0.845  16.236  -7.991  1.00 45.54  ? 194  ASN A OD1 1 
ATOM   1272 N  ND2 . ASN A 1 194 ? -0.325  18.417  -8.030  1.00 44.82  ? 194  ASN A ND2 1 
ATOM   1273 N  N   . GLU A 1 195 ? 1.370   13.969  -8.776  1.00 33.99  ? 195  GLU A N   1 
ATOM   1274 C  CA  . GLU A 1 195 ? 1.735   13.435  -10.084 1.00 34.00  ? 195  GLU A CA  1 
ATOM   1275 C  C   . GLU A 1 195 ? 1.562   14.445  -11.231 1.00 29.95  ? 195  GLU A C   1 
ATOM   1276 O  O   . GLU A 1 195 ? 2.280   14.380  -12.228 1.00 29.02  ? 195  GLU A O   1 
ATOM   1277 C  CB  . GLU A 1 195 ? 0.935   12.162  -10.361 1.00 40.95  ? 195  GLU A CB  1 
ATOM   1278 C  CG  . GLU A 1 195 ? 1.041   11.158  -9.224  1.00 49.71  ? 195  GLU A CG  1 
ATOM   1279 C  CD  . GLU A 1 195 ? 0.171   9.939   -9.427  1.00 55.50  ? 195  GLU A CD  1 
ATOM   1280 O  OE1 . GLU A 1 195 ? -0.642  9.931   -10.379 1.00 58.75  ? 195  GLU A OE1 1 
ATOM   1281 O  OE2 . GLU A 1 195 ? 0.306   8.991   -8.627  1.00 55.65  ? 195  GLU A OE2 1 
ATOM   1282 N  N   . LYS A 1 196 ? 0.619   15.374  -11.098 1.00 27.24  ? 196  LYS A N   1 
ATOM   1283 C  CA  . LYS A 1 196 ? 0.504   16.446  -12.093 1.00 26.17  ? 196  LYS A CA  1 
ATOM   1284 C  C   . LYS A 1 196 ? 1.716   17.381  -12.045 1.00 25.73  ? 196  LYS A C   1 
ATOM   1285 O  O   . LYS A 1 196 ? 2.022   18.044  -13.020 1.00 27.93  ? 196  LYS A O   1 
ATOM   1286 C  CB  . LYS A 1 196 ? -0.813  17.230  -11.949 1.00 28.84  ? 196  LYS A CB  1 
ATOM   1287 C  CG  . LYS A 1 196 ? -2.067  16.420  -12.304 1.00 26.37  ? 196  LYS A CG  1 
ATOM   1288 C  CD  . LYS A 1 196 ? -1.971  15.841  -13.700 1.00 26.09  ? 196  LYS A CD  1 
ATOM   1289 C  CE  . LYS A 1 196 ? -3.153  14.950  -14.024 1.00 28.36  ? 196  LYS A CE  1 
ATOM   1290 N  NZ  . LYS A 1 196 ? -4.383  15.709  -14.268 1.00 28.68  ? 196  LYS A NZ  1 
ATOM   1291 N  N   . SER A 1 197 ? 2.426   17.404  -10.919 1.00 25.67  ? 197  SER A N   1 
ATOM   1292 C  CA  . SER A 1 197 ? 3.681   18.155  -10.825 1.00 23.66  ? 197  SER A CA  1 
ATOM   1293 C  C   . SER A 1 197 ? 4.747   17.620  -11.789 1.00 22.75  ? 197  SER A C   1 
ATOM   1294 O  O   . SER A 1 197 ? 5.526   18.380  -12.358 1.00 25.46  ? 197  SER A O   1 
ATOM   1295 C  CB  . SER A 1 197 ? 4.222   18.108  -9.399  1.00 29.93  ? 197  SER A CB  1 
ATOM   1296 O  OG  . SER A 1 197 ? 3.291   18.653  -8.489  1.00 31.95  ? 197  SER A OG  1 
ATOM   1297 N  N   . ASP A 1 198 ? 4.779   16.307  -11.976 1.00 19.72  ? 198  ASP A N   1 
ATOM   1298 C  CA  . ASP A 1 198 ? 5.708   15.709  -12.930 1.00 19.39  ? 198  ASP A CA  1 
ATOM   1299 C  C   . ASP A 1 198 ? 5.343   16.112  -14.340 1.00 19.19  ? 198  ASP A C   1 
ATOM   1300 O  O   . ASP A 1 198 ? 6.216   16.332  -15.172 1.00 17.26  ? 198  ASP A O   1 
ATOM   1301 C  CB  . ASP A 1 198 ? 5.691   14.179  -12.815 1.00 26.77  ? 198  ASP A CB  1 
ATOM   1302 C  CG  . ASP A 1 198 ? 6.291   13.682  -11.510 1.00 33.06  ? 198  ASP A CG  1 
ATOM   1303 O  OD1 . ASP A 1 198 ? 7.079   14.417  -10.874 1.00 34.81  ? 198  ASP A OD1 1 
ATOM   1304 O  OD2 . ASP A 1 198 ? 5.976   12.547  -11.122 1.00 36.89  ? 198  ASP A OD2 1 
ATOM   1305 N  N   . ILE A 1 199 ? 4.042   16.207  -14.609 1.00 18.12  ? 199  ILE A N   1 
ATOM   1306 C  CA  . ILE A 1 199 ? 3.566   16.624  -15.926 1.00 11.42  ? 199  ILE A CA  1 
ATOM   1307 C  C   . ILE A 1 199 ? 4.047   18.038  -16.260 1.00 11.27  ? 199  ILE A C   1 
ATOM   1308 O  O   . ILE A 1 199 ? 4.466   18.326  -17.387 1.00 13.48  ? 199  ILE A O   1 
ATOM   1309 C  CB  . ILE A 1 199 ? 2.010   16.523  -16.032 1.00 18.50  ? 199  ILE A CB  1 
ATOM   1310 C  CG1 . ILE A 1 199 ? 1.527   15.104  -15.668 1.00 19.94  ? 199  ILE A CG1 1 
ATOM   1311 C  CG2 . ILE A 1 199 ? 1.547   16.841  -17.431 1.00 15.84  ? 199  ILE A CG2 1 
ATOM   1312 C  CD1 . ILE A 1 199 ? 1.998   14.028  -16.635 1.00 16.72  ? 199  ILE A CD1 1 
ATOM   1313 N  N   . TRP A 1 200 ? 3.993   18.932  -15.284 1.00 13.79  ? 200  TRP A N   1 
ATOM   1314 C  CA  . TRP A 1 200 ? 4.506   20.282  -15.502 1.00 15.99  ? 200  TRP A CA  1 
ATOM   1315 C  C   . TRP A 1 200 ? 5.974   20.218  -15.910 1.00 14.67  ? 200  TRP A C   1 
ATOM   1316 O  O   . TRP A 1 200 ? 6.381   20.832  -16.896 1.00 18.39  ? 200  TRP A O   1 
ATOM   1317 C  CB  . TRP A 1 200 ? 4.346   21.130  -14.230 1.00 18.15  ? 200  TRP A CB  1 
ATOM   1318 C  CG  . TRP A 1 200 ? 5.034   22.456  -14.262 1.00 18.25  ? 200  TRP A CG  1 
ATOM   1319 C  CD1 . TRP A 1 200 ? 6.358   22.699  -14.006 1.00 22.36  ? 200  TRP A CD1 1 
ATOM   1320 C  CD2 . TRP A 1 200 ? 4.438   23.737  -14.530 1.00 22.65  ? 200  TRP A CD2 1 
ATOM   1321 N  NE1 . TRP A 1 200 ? 6.623   24.046  -14.106 1.00 26.45  ? 200  TRP A NE1 1 
ATOM   1322 C  CE2 . TRP A 1 200 ? 5.460   24.705  -14.426 1.00 26.00  ? 200  TRP A CE2 1 
ATOM   1323 C  CE3 . TRP A 1 200 ? 3.139   24.161  -14.841 1.00 24.46  ? 200  TRP A CE3 1 
ATOM   1324 C  CZ2 . TRP A 1 200 ? 5.226   26.068  -14.634 1.00 26.02  ? 200  TRP A CZ2 1 
ATOM   1325 C  CZ3 . TRP A 1 200 ? 2.904   25.518  -15.040 1.00 23.19  ? 200  TRP A CZ3 1 
ATOM   1326 C  CH2 . TRP A 1 200 ? 3.944   26.452  -14.940 1.00 25.62  ? 200  TRP A CH2 1 
ATOM   1327 N  N   . SER A 1 201 ? 6.766   19.461  -15.155 1.00 15.59  ? 201  SER A N   1 
ATOM   1328 C  CA  . SER A 1 201 ? 8.205   19.385  -15.397 1.00 18.52  ? 201  SER A CA  1 
ATOM   1329 C  C   . SER A 1 201 ? 8.513   18.812  -16.773 1.00 18.30  ? 201  SER A C   1 
ATOM   1330 O  O   . SER A 1 201 ? 9.442   19.264  -17.449 1.00 19.90  ? 201  SER A O   1 
ATOM   1331 C  CB  . SER A 1 201 ? 8.885   18.573  -14.296 1.00 25.61  ? 201  SER A CB  1 
ATOM   1332 O  OG  . SER A 1 201 ? 8.563   19.133  -13.030 1.00 32.68  ? 201  SER A OG  1 
ATOM   1333 N  N   . LEU A 1 202 ? 7.727   17.826  -17.197 1.00 17.38  ? 202  LEU A N   1 
ATOM   1334 C  CA  . LEU A 1 202 ? 7.893   17.254  -18.534 1.00 16.56  ? 202  LEU A CA  1 
ATOM   1335 C  C   . LEU A 1 202 ? 7.565   18.299  -19.582 1.00 13.67  ? 202  LEU A C   1 
ATOM   1336 O  O   . LEU A 1 202 ? 8.224   18.378  -20.625 1.00 15.66  ? 202  LEU A O   1 
ATOM   1337 C  CB  . LEU A 1 202 ? 6.977   16.038  -18.726 1.00 18.55  ? 202  LEU A CB  1 
ATOM   1338 C  CG  . LEU A 1 202 ? 6.949   15.466  -20.146 1.00 16.49  ? 202  LEU A CG  1 
ATOM   1339 C  CD1 . LEU A 1 202 ? 8.295   14.853  -20.512 1.00 13.47  ? 202  LEU A CD1 1 
ATOM   1340 C  CD2 . LEU A 1 202 ? 5.825   14.425  -20.303 1.00 19.56  ? 202  LEU A CD2 1 
ATOM   1341 N  N   . GLY A 1 203 ? 6.538   19.106  -19.296 1.00 14.25  ? 203  GLY A N   1 
ATOM   1342 C  CA  . GLY A 1 203 ? 6.170   20.213  -20.157 1.00 11.75  ? 203  GLY A CA  1 
ATOM   1343 C  C   . GLY A 1 203 ? 7.338   21.161  -20.340 1.00 12.85  ? 203  GLY A C   1 
ATOM   1344 O  O   . GLY A 1 203 ? 7.673   21.549  -21.469 1.00 14.15  ? 203  GLY A O   1 
ATOM   1345 N  N   . CYS A 1 204 ? 7.970   21.512  -19.223 1.00 11.78  ? 204  CYS A N   1 
ATOM   1346 C  CA  . CYS A 1 204 ? 9.117   22.415  -19.209 1.00 15.02  ? 204  CYS A CA  1 
ATOM   1347 C  C   . CYS A 1 204 ? 10.248  21.817  -20.019 1.00 16.26  ? 204  CYS A C   1 
ATOM   1348 O  O   . CYS A 1 204 ? 10.900  22.512  -20.795 1.00 15.07  ? 204  CYS A O   1 
ATOM   1349 C  CB  . CYS A 1 204 ? 9.597   22.656  -17.768 1.00 16.67  ? 204  CYS A CB  1 
ATOM   1350 S  SG  . CYS A 1 204 ? 8.523   23.728  -16.756 1.00 18.75  ? 204  CYS A SG  1 
ATOM   1351 N  N   . LEU A 1 205 ? 10.464  20.513  -19.849 1.00 19.46  ? 205  LEU A N   1 
ATOM   1352 C  CA  . LEU A 1 205 ? 11.534  19.808  -20.561 1.00 19.21  ? 205  LEU A CA  1 
ATOM   1353 C  C   . LEU A 1 205 ? 11.286  19.741  -22.072 1.00 19.18  ? 205  LEU A C   1 
ATOM   1354 O  O   . LEU A 1 205 ? 12.187  20.043  -22.866 1.00 19.35  ? 205  LEU A O   1 
ATOM   1355 C  CB  . LEU A 1 205 ? 11.737  18.402  -19.974 1.00 22.16  ? 205  LEU A CB  1 
ATOM   1356 C  CG  . LEU A 1 205 ? 12.810  17.505  -20.593 1.00 22.38  ? 205  LEU A CG  1 
ATOM   1357 C  CD1 . LEU A 1 205 ? 13.277  16.412  -19.617 1.00 23.19  ? 205  LEU A CD1 1 
ATOM   1358 C  CD2 . LEU A 1 205 ? 12.273  16.869  -21.842 1.00 21.94  ? 205  LEU A CD2 1 
ATOM   1359 N  N   . LEU A 1 206 ? 10.083  19.335  -22.483 1.00 14.59  ? 206  LEU A N   1 
ATOM   1360 C  CA  . LEU A 1 206 ? 9.778   19.307  -23.918 1.00 15.75  ? 206  LEU A CA  1 
ATOM   1361 C  C   . LEU A 1 206 ? 9.783   20.719  -24.497 1.00 16.19  ? 206  LEU A C   1 
ATOM   1362 O  O   . LEU A 1 206 ? 10.301  20.949  -25.592 1.00 16.11  ? 206  LEU A O   1 
ATOM   1363 C  CB  . LEU A 1 206 ? 8.432   18.633  -24.199 1.00 13.16  ? 206  LEU A CB  1 
ATOM   1364 C  CG  . LEU A 1 206 ? 8.267   17.206  -23.678 1.00 16.25  ? 206  LEU A CG  1 
ATOM   1365 C  CD1 . LEU A 1 206 ? 6.810   16.791  -23.761 1.00 16.11  ? 206  LEU A CD1 1 
ATOM   1366 C  CD2 . LEU A 1 206 ? 9.125   16.278  -24.497 1.00 17.19  ? 206  LEU A CD2 1 
ATOM   1367 N  N   . TYR A 1 207 ? 9.198   21.668  -23.774 1.00 12.27  ? 207  TYR A N   1 
ATOM   1368 C  CA  . TYR A 1 207 ? 9.261   23.066  -24.223 1.00 14.22  ? 207  TYR A CA  1 
ATOM   1369 C  C   . TYR A 1 207 ? 10.737  23.451  -24.455 1.00 16.86  ? 207  TYR A C   1 
ATOM   1370 O  O   . TYR A 1 207 ? 11.091  24.014  -25.494 1.00 14.22  ? 207  TYR A O   1 
ATOM   1371 C  CB  . TYR A 1 207 ? 8.577   24.023  -23.222 1.00 14.93  ? 207  TYR A CB  1 
ATOM   1372 C  CG  . TYR A 1 207 ? 8.551   25.464  -23.697 1.00 17.01  ? 207  TYR A CG  1 
ATOM   1373 C  CD1 . TYR A 1 207 ? 9.737   26.182  -23.843 1.00 18.15  ? 207  TYR A CD1 1 
ATOM   1374 C  CD2 . TYR A 1 207 ? 7.350   26.100  -24.020 1.00 15.99  ? 207  TYR A CD2 1 
ATOM   1375 C  CE1 . TYR A 1 207 ? 9.742   27.498  -24.287 1.00 16.72  ? 207  TYR A CE1 1 
ATOM   1376 C  CE2 . TYR A 1 207 ? 7.334   27.417  -24.466 1.00 14.19  ? 207  TYR A CE2 1 
ATOM   1377 C  CZ  . TYR A 1 207 ? 8.543   28.112  -24.599 1.00 16.48  ? 207  TYR A CZ  1 
ATOM   1378 O  OH  . TYR A 1 207 ? 8.562   29.412  -25.056 1.00 17.84  ? 207  TYR A OH  1 
ATOM   1379 N  N   . GLU A 1 208 ? 11.606  23.139  -23.501 1.00 15.42  ? 208  GLU A N   1 
ATOM   1380 C  CA  . GLU A 1 208 ? 13.001  23.541  -23.663 1.00 16.58  ? 208  GLU A CA  1 
ATOM   1381 C  C   . GLU A 1 208 ? 13.643  22.800  -24.842 1.00 17.50  ? 208  GLU A C   1 
ATOM   1382 O  O   . GLU A 1 208 ? 14.479  23.350  -25.546 1.00 16.11  ? 208  GLU A O   1 
ATOM   1383 C  CB  . GLU A 1 208 ? 13.802  23.366  -22.366 1.00 18.65  ? 208  GLU A CB  1 
ATOM   1384 C  CG  . GLU A 1 208 ? 15.215  23.959  -22.465 1.00 23.90  ? 208  GLU A CG  1 
ATOM   1385 C  CD  . GLU A 1 208 ? 16.045  23.761  -21.212 1.00 26.59  ? 208  GLU A CD  1 
ATOM   1386 O  OE1 . GLU A 1 208 ? 15.494  23.353  -20.166 1.00 22.94  ? 208  GLU A OE1 1 
ATOM   1387 O  OE2 . GLU A 1 208 ? 17.261  24.024  -21.274 1.00 33.57  ? 208  GLU A OE2 1 
ATOM   1388 N  N   . LEU A 1 209 ? 13.218  21.564  -25.089 1.00 20.12  ? 209  LEU A N   1 
ATOM   1389 C  CA  . LEU A 1 209 ? 13.705  20.832  -26.249 1.00 15.68  ? 209  LEU A CA  1 
ATOM   1390 C  C   . LEU A 1 209 ? 13.397  21.542  -27.543 1.00 13.08  ? 209  LEU A C   1 
ATOM   1391 O  O   . LEU A 1 209 ? 14.238  21.594  -28.454 1.00 15.45  ? 209  LEU A O   1 
ATOM   1392 C  CB  . LEU A 1 209 ? 13.106  19.415  -26.321 1.00 19.02  ? 209  LEU A CB  1 
ATOM   1393 C  CG  . LEU A 1 209 ? 13.885  18.264  -25.703 1.00 21.75  ? 209  LEU A CG  1 
ATOM   1394 C  CD1 . LEU A 1 209 ? 13.228  16.979  -26.141 1.00 22.52  ? 209  LEU A CD1 1 
ATOM   1395 C  CD2 . LEU A 1 209 ? 15.368  18.300  -26.113 1.00 19.39  ? 209  LEU A CD2 1 
ATOM   1396 N  N   . CYS A 1 210 ? 12.172  22.052  -27.650 1.00 12.00  ? 210  CYS A N   1 
ATOM   1397 C  CA  . CYS A 1 210 ? 11.746  22.760  -28.855 1.00 12.56  ? 210  CYS A CA  1 
ATOM   1398 C  C   . CYS A 1 210 ? 12.392  24.143  -29.030 1.00 17.93  ? 210  CYS A C   1 
ATOM   1399 O  O   . CYS A 1 210 ? 12.930  24.455  -30.105 1.00 17.72  ? 210  CYS A O   1 
ATOM   1400 C  CB  . CYS A 1 210 ? 10.213  22.894  -28.862 1.00 11.96  ? 210  CYS A CB  1 
ATOM   1401 S  SG  . CYS A 1 210 ? 9.358   21.298  -28.929 1.00 11.57  ? 210  CYS A SG  1 
ATOM   1402 N  N   . ALA A 1 211 ? 12.317  24.966  -27.981 1.00 14.77  ? 211  ALA A N   1 
ATOM   1403 C  CA  . ALA A 1 211 ? 12.702  26.383  -28.061 1.00 16.59  ? 211  ALA A CA  1 
ATOM   1404 C  C   . ALA A 1 211 ? 14.195  26.630  -27.790 1.00 20.36  ? 211  ALA A C   1 
ATOM   1405 O  O   . ALA A 1 211 ? 14.724  27.694  -28.110 1.00 22.43  ? 211  ALA A O   1 
ATOM   1406 C  CB  . ALA A 1 211 ? 11.838  27.223  -27.107 1.00 16.51  ? 211  ALA A CB  1 
ATOM   1407 N  N   . LEU A 1 212 ? 14.863  25.629  -27.218 1.00 19.42  ? 212  LEU A N   1 
ATOM   1408 C  CA  . LEU A 1 212 ? 16.285  25.692  -26.859 1.00 19.75  ? 212  LEU A CA  1 
ATOM   1409 C  C   . LEU A 1 212 ? 16.493  26.616  -25.679 1.00 24.23  ? 212  LEU A C   1 
ATOM   1410 O  O   . LEU A 1 212 ? 17.608  27.053  -25.399 1.00 31.25  ? 212  LEU A O   1 
ATOM   1411 C  CB  . LEU A 1 212 ? 17.185  26.070  -28.049 1.00 16.38  ? 212  LEU A CB  1 
ATOM   1412 C  CG  . LEU A 1 212 ? 17.146  25.121  -29.250 1.00 18.07  ? 212  LEU A CG  1 
ATOM   1413 C  CD1 . LEU A 1 212 ? 18.134  25.567  -30.318 1.00 22.20  ? 212  LEU A CD1 1 
ATOM   1414 C  CD2 . LEU A 1 212 ? 17.395  23.658  -28.847 1.00 16.55  ? 212  LEU A CD2 1 
ATOM   1415 N  N   . MET A 1 213 ? 15.396  26.889  -24.979 1.00 21.64  ? 213  MET A N   1 
ATOM   1416 C  CA  . MET A 1 213 ? 15.412  27.668  -23.756 1.00 20.55  ? 213  MET A CA  1 
ATOM   1417 C  C   . MET A 1 213 ? 14.155  27.267  -22.999 1.00 19.42  ? 213  MET A C   1 
ATOM   1418 O  O   . MET A 1 213 ? 13.190  26.828  -23.616 1.00 21.59  ? 213  MET A O   1 
ATOM   1419 C  CB  . MET A 1 213 ? 15.391  29.177  -24.073 1.00 23.90  ? 213  MET A CB  1 
ATOM   1420 C  CG  . MET A 1 213 ? 14.063  29.652  -24.642 1.00 25.34  ? 213  MET A CG  1 
ATOM   1421 S  SD  . MET A 1 213 ? 14.004  31.365  -25.234 1.00 50.91  ? 213  MET A SD  1 
ATOM   1422 C  CE  . MET A 1 213 ? 15.483  31.387  -26.239 1.00 27.33  ? 213  MET A CE  1 
ATOM   1423 N  N   . PRO A 1 214 ? 14.166  27.402  -21.661 1.00 19.81  ? 214  PRO A N   1 
ATOM   1424 C  CA  . PRO A 1 214 ? 13.035  27.057  -20.777 1.00 22.02  ? 214  PRO A CA  1 
ATOM   1425 C  C   . PRO A 1 214 ? 11.908  28.076  -20.921 1.00 22.89  ? 214  PRO A C   1 
ATOM   1426 O  O   . PRO A 1 214 ? 12.199  29.179  -21.357 1.00 25.40  ? 214  PRO A O   1 
ATOM   1427 C  CB  . PRO A 1 214 ? 13.625  27.168  -19.356 1.00 23.44  ? 214  PRO A CB  1 
ATOM   1428 C  CG  . PRO A 1 214 ? 15.094  27.418  -19.519 1.00 24.92  ? 214  PRO A CG  1 
ATOM   1429 C  CD  . PRO A 1 214 ? 15.326  27.929  -20.918 1.00 23.20  ? 214  PRO A CD  1 
ATOM   1430 N  N   . PRO A 1 215 ? 10.666  27.723  -20.522 1.00 21.63  ? 215  PRO A N   1 
ATOM   1431 C  CA  . PRO A 1 215 ? 9.494   28.582  -20.720 1.00 22.80  ? 215  PRO A CA  1 
ATOM   1432 C  C   . PRO A 1 215 ? 9.613   29.827  -19.873 1.00 23.92  ? 215  PRO A C   1 
ATOM   1433 O  O   . PRO A 1 215 ? 9.185   30.893  -20.304 1.00 26.10  ? 215  PRO A O   1 
ATOM   1434 C  CB  . PRO A 1 215 ? 8.309   27.727  -20.208 1.00 21.53  ? 215  PRO A CB  1 
ATOM   1435 C  CG  . PRO A 1 215 ? 8.861   26.403  -19.869 1.00 19.65  ? 215  PRO A CG  1 
ATOM   1436 C  CD  . PRO A 1 215 ? 10.341  26.513  -19.740 1.00 20.53  ? 215  PRO A CD  1 
ATOM   1437 N  N   . PHE A 1 216 ? 10.172  29.669  -18.674 1.00 23.86  ? 216  PHE A N   1 
ATOM   1438 C  CA  . PHE A 1 216 ? 10.376  30.774  -17.741 1.00 24.61  ? 216  PHE A CA  1 
ATOM   1439 C  C   . PHE A 1 216 ? 11.859  30.925  -17.390 1.00 28.87  ? 216  PHE A C   1 
ATOM   1440 O  O   . PHE A 1 216 ? 12.528  29.965  -16.988 1.00 26.01  ? 216  PHE A O   1 
ATOM   1441 C  CB  . PHE A 1 216 ? 9.576   30.547  -16.455 1.00 19.23  ? 216  PHE A CB  1 
ATOM   1442 C  CG  . PHE A 1 216 ? 8.169   30.117  -16.686 1.00 19.19  ? 216  PHE A CG  1 
ATOM   1443 C  CD1 . PHE A 1 216 ? 7.208   31.026  -17.069 1.00 19.48  ? 216  PHE A CD1 1 
ATOM   1444 C  CD2 . PHE A 1 216 ? 7.797   28.790  -16.509 1.00 20.57  ? 216  PHE A CD2 1 
ATOM   1445 C  CE1 . PHE A 1 216 ? 5.891   30.627  -17.272 1.00 16.78  ? 216  PHE A CE1 1 
ATOM   1446 C  CE2 . PHE A 1 216 ? 6.494   28.382  -16.714 1.00 21.60  ? 216  PHE A CE2 1 
ATOM   1447 C  CZ  . PHE A 1 216 ? 5.532   29.302  -17.096 1.00 21.78  ? 216  PHE A CZ  1 
ATOM   1448 N  N   . THR A 1 217 ? 12.370  32.136  -17.548 1.00 32.73  ? 217  THR A N   1 
ATOM   1449 C  CA  . THR A 1 217 ? 13.757  32.422  -17.225 1.00 36.11  ? 217  THR A CA  1 
ATOM   1450 C  C   . THR A 1 217 ? 13.789  33.653  -16.339 1.00 35.84  ? 217  THR A C   1 
ATOM   1451 O  O   . THR A 1 217 ? 12.891  34.499  -16.403 1.00 33.73  ? 217  THR A O   1 
ATOM   1452 C  CB  . THR A 1 217 ? 14.594  32.680  -18.493 1.00 41.00  ? 217  THR A CB  1 
ATOM   1453 O  OG1 . THR A 1 217 ? 14.064  33.809  -19.197 1.00 41.84  ? 217  THR A OG1 1 
ATOM   1454 C  CG2 . THR A 1 217 ? 14.553  31.474  -19.409 1.00 44.45  ? 217  THR A CG2 1 
ATOM   1455 N  N   . ALA A 1 218 ? 14.818  33.742  -15.507 1.00 35.90  ? 218  ALA A N   1 
ATOM   1456 C  CA  . ALA A 1 218 ? 14.961  34.852  -14.585 1.00 39.11  ? 218  ALA A CA  1 
ATOM   1457 C  C   . ALA A 1 218 ? 16.343  34.764  -13.942 1.00 40.05  ? 218  ALA A C   1 
ATOM   1458 O  O   . ALA A 1 218 ? 17.006  33.726  -14.027 1.00 38.52  ? 218  ALA A O   1 
ATOM   1459 C  CB  . ALA A 1 218 ? 13.870  34.805  -13.532 1.00 39.93  ? 218  ALA A CB  1 
ATOM   1460 N  N   . PHE A 1 219 ? 16.784  35.848  -13.314 1.00 40.61  ? 219  PHE A N   1 
ATOM   1461 C  CA  . PHE A 1 219 ? 18.107  35.857  -12.693 1.00 44.89  ? 219  PHE A CA  1 
ATOM   1462 C  C   . PHE A 1 219 ? 18.085  35.403  -11.225 1.00 45.26  ? 219  PHE A C   1 
ATOM   1463 O  O   . PHE A 1 219 ? 19.090  34.909  -10.707 1.00 46.87  ? 219  PHE A O   1 
ATOM   1464 C  CB  . PHE A 1 219 ? 18.780  37.225  -12.860 1.00 46.38  ? 219  PHE A CB  1 
ATOM   1465 C  CG  . PHE A 1 219 ? 18.961  37.634  -14.299 1.00 48.43  ? 219  PHE A CG  1 
ATOM   1466 C  CD1 . PHE A 1 219 ? 18.230  38.683  -14.837 1.00 50.87  ? 219  PHE A CD1 1 
ATOM   1467 C  CD2 . PHE A 1 219 ? 19.849  36.956  -15.117 1.00 48.44  ? 219  PHE A CD2 1 
ATOM   1468 C  CE1 . PHE A 1 219 ? 18.393  39.057  -16.167 1.00 50.90  ? 219  PHE A CE1 1 
ATOM   1469 C  CE2 . PHE A 1 219 ? 20.015  37.321  -16.443 1.00 48.53  ? 219  PHE A CE2 1 
ATOM   1470 C  CZ  . PHE A 1 219 ? 19.288  38.372  -16.970 1.00 49.95  ? 219  PHE A CZ  1 
ATOM   1471 N  N   . SER A 1 220 ? 16.934  35.554  -10.572 1.00 43.38  ? 220  SER A N   1 
ATOM   1472 C  CA  . SER A 1 220 ? 16.751  35.083  -9.196  1.00 41.30  ? 220  SER A CA  1 
ATOM   1473 C  C   . SER A 1 220 ? 15.507  34.213  -9.080  1.00 42.15  ? 220  SER A C   1 
ATOM   1474 O  O   . SER A 1 220 ? 14.601  34.312  -9.908  1.00 42.79  ? 220  SER A O   1 
ATOM   1475 C  CB  . SER A 1 220 ? 16.621  36.261  -8.241  1.00 39.23  ? 220  SER A CB  1 
ATOM   1476 O  OG  . SER A 1 220 ? 15.484  37.041  -8.564  1.00 37.06  ? 220  SER A OG  1 
ATOM   1477 N  N   . GLN A 1 221 ? 15.456  33.375  -8.047  1.00 44.20  ? 221  GLN A N   1 
ATOM   1478 C  CA  . GLN A 1 221 ? 14.309  32.498  -7.850  1.00 46.45  ? 221  GLN A CA  1 
ATOM   1479 C  C   . GLN A 1 221 ? 13.017  33.277  -7.606  1.00 45.42  ? 221  GLN A C   1 
ATOM   1480 O  O   . GLN A 1 221 ? 11.940  32.852  -8.035  1.00 44.48  ? 221  GLN A O   1 
ATOM   1481 C  CB  . GLN A 1 221 ? 14.546  31.491  -6.723  1.00 48.50  ? 221  GLN A CB  1 
ATOM   1482 C  CG  . GLN A 1 221 ? 13.348  30.571  -6.487  1.00 50.78  ? 221  GLN A CG  1 
ATOM   1483 C  CD  . GLN A 1 221 ? 13.649  29.408  -5.557  1.00 55.77  ? 221  GLN A CD  1 
ATOM   1484 O  OE1 . GLN A 1 221 ? 12.731  28.807  -4.993  1.00 59.10  ? 221  GLN A OE1 1 
ATOM   1485 N  NE2 . GLN A 1 221 ? 14.934  29.078  -5.396  1.00 54.67  ? 221  GLN A NE2 1 
ATOM   1486 N  N   . LYS A 1 222 ? 13.127  34.413  -6.926  1.00 43.37  ? 222  LYS A N   1 
ATOM   1487 C  CA  . LYS A 1 222 ? 11.962  35.253  -6.657  1.00 41.55  ? 222  LYS A CA  1 
ATOM   1488 C  C   . LYS A 1 222 ? 11.349  35.800  -7.947  1.00 37.14  ? 222  LYS A C   1 
ATOM   1489 O  O   . LYS A 1 222 ? 10.128  35.775  -8.118  1.00 35.45  ? 222  LYS A O   1 
ATOM   1490 C  CB  . LYS A 1 222 ? 12.330  36.397  -5.711  1.00 46.12  ? 222  LYS A CB  1 
ATOM   1491 C  CG  . LYS A 1 222 ? 11.235  37.435  -5.539  1.00 50.48  ? 222  LYS A CG  1 
ATOM   1492 C  CD  . LYS A 1 222 ? 11.696  38.568  -4.629  1.00 56.52  ? 222  LYS A CD  1 
ATOM   1493 C  CE  . LYS A 1 222 ? 10.614  39.625  -4.464  1.00 57.74  ? 222  LYS A CE  1 
ATOM   1494 N  NZ  . LYS A 1 222 ? 9.369   39.048  -3.888  1.00 58.39  ? 222  LYS A NZ  1 
ATOM   1495 N  N   . GLU A 1 223 ? 12.200  36.287  -8.850  1.00 34.49  ? 223  GLU A N   1 
ATOM   1496 C  CA  . GLU A 1 223 ? 11.750  36.748  -10.162 1.00 38.72  ? 223  GLU A CA  1 
ATOM   1497 C  C   . GLU A 1 223 ? 11.149  35.576  -10.951 1.00 37.34  ? 223  GLU A C   1 
ATOM   1498 O  O   . GLU A 1 223 ? 10.084  35.696  -11.559 1.00 35.90  ? 223  GLU A O   1 
ATOM   1499 C  CB  . GLU A 1 223 ? 12.912  37.366  -10.948 1.00 45.09  ? 223  GLU A CB  1 
ATOM   1500 C  CG  . GLU A 1 223 ? 12.519  37.910  -12.333 1.00 50.60  ? 223  GLU A CG  1 
ATOM   1501 C  CD  . GLU A 1 223 ? 13.723  38.214  -13.231 1.00 55.79  ? 223  GLU A CD  1 
ATOM   1502 O  OE1 . GLU A 1 223 ? 14.865  37.868  -12.850 1.00 57.29  ? 223  GLU A OE1 1 
ATOM   1503 O  OE2 . GLU A 1 223 ? 13.522  38.791  -14.324 1.00 56.11  ? 223  GLU A OE2 1 
ATOM   1504 N  N   . LEU A 1 224 ? 11.850  34.446  -10.929 1.00 35.87  ? 224  LEU A N   1 
ATOM   1505 C  CA  . LEU A 1 224 ? 11.359  33.208  -11.518 1.00 32.03  ? 224  LEU A CA  1 
ATOM   1506 C  C   . LEU A 1 224 ? 9.961   32.866  -11.000 1.00 29.20  ? 224  LEU A C   1 
ATOM   1507 O  O   . LEU A 1 224 ? 9.047   32.655  -11.783 1.00 25.92  ? 224  LEU A O   1 
ATOM   1508 C  CB  . LEU A 1 224 ? 12.322  32.048  -11.224 1.00 29.03  ? 224  LEU A CB  1 
ATOM   1509 C  CG  . LEU A 1 224 ? 11.886  30.728  -11.880 1.00 33.25  ? 224  LEU A CG  1 
ATOM   1510 C  CD1 . LEU A 1 224 ? 11.933  30.860  -13.407 1.00 33.26  ? 224  LEU A CD1 1 
ATOM   1511 C  CD2 . LEU A 1 224 ? 12.719  29.537  -11.419 1.00 33.69  ? 224  LEU A CD2 1 
ATOM   1512 N  N   . ALA A 1 225 ? 9.806   32.806  -9.679  1.00 31.63  ? 225  ALA A N   1 
ATOM   1513 C  CA  . ALA A 1 225 ? 8.509   32.516  -9.074  1.00 30.96  ? 225  ALA A CA  1 
ATOM   1514 C  C   . ALA A 1 225 ? 7.457   33.474  -9.608  1.00 30.78  ? 225  ALA A C   1 
ATOM   1515 O  O   . ALA A 1 225 ? 6.348   33.064  -9.957  1.00 29.86  ? 225  ALA A O   1 
ATOM   1516 C  CB  . ALA A 1 225 ? 8.589   32.605  -7.553  1.00 28.73  ? 225  ALA A CB  1 
ATOM   1517 N  N   . GLY A 1 226 ? 7.820   34.753  -9.682  1.00 32.80  ? 226  GLY A N   1 
ATOM   1518 C  CA  . GLY A 1 226 ? 6.945   35.758  -10.260 1.00 32.49  ? 226  GLY A CA  1 
ATOM   1519 C  C   . GLY A 1 226 ? 6.396   35.357  -11.621 1.00 32.78  ? 226  GLY A C   1 
ATOM   1520 O  O   . GLY A 1 226 ? 5.189   35.416  -11.857 1.00 35.25  ? 226  GLY A O   1 
ATOM   1521 N  N   . LYS A 1 227 ? 7.287   34.945  -12.516 1.00 30.10  ? 227  LYS A N   1 
ATOM   1522 C  CA  . LYS A 1 227 ? 6.905   34.598  -13.881 1.00 30.42  ? 227  LYS A CA  1 
ATOM   1523 C  C   . LYS A 1 227 ? 6.056   33.326  -13.974 1.00 33.21  ? 227  LYS A C   1 
ATOM   1524 O  O   . LYS A 1 227 ? 5.141   33.243  -14.797 1.00 29.86  ? 227  LYS A O   1 
ATOM   1525 C  CB  . LYS A 1 227 ? 8.147   34.481  -14.758 1.00 30.93  ? 227  LYS A CB  1 
ATOM   1526 C  CG  . LYS A 1 227 ? 8.809   35.814  -15.015 1.00 35.69  ? 227  LYS A CG  1 
ATOM   1527 C  CD  . LYS A 1 227 ? 10.039  35.681  -15.894 1.00 42.03  ? 227  LYS A CD  1 
ATOM   1528 C  CE  . LYS A 1 227 ? 10.679  37.055  -16.096 1.00 44.76  ? 227  LYS A CE  1 
ATOM   1529 N  NZ  . LYS A 1 227 ? 11.923  37.025  -16.910 1.00 45.50  ? 227  LYS A NZ  1 
ATOM   1530 N  N   . ILE A 1 228 ? 6.353   32.347  -13.124 1.00 31.93  ? 228  ILE A N   1 
ATOM   1531 C  CA  . ILE A 1 228 ? 5.594   31.099  -13.095 1.00 30.03  ? 228  ILE A CA  1 
ATOM   1532 C  C   . ILE A 1 228 ? 4.134   31.312  -12.696 1.00 34.45  ? 228  ILE A C   1 
ATOM   1533 O  O   . ILE A 1 228 ? 3.234   30.832  -13.379 1.00 34.51  ? 228  ILE A O   1 
ATOM   1534 C  CB  . ILE A 1 228 ? 6.225   30.070  -12.149 1.00 28.59  ? 228  ILE A CB  1 
ATOM   1535 C  CG1 . ILE A 1 228 ? 7.568   29.588  -12.700 1.00 28.47  ? 228  ILE A CG1 1 
ATOM   1536 C  CG2 . ILE A 1 228 ? 5.278   28.905  -11.939 1.00 27.25  ? 228  ILE A CG2 1 
ATOM   1537 C  CD1 . ILE A 1 228 ? 8.361   28.766  -11.726 1.00 31.50  ? 228  ILE A CD1 1 
ATOM   1538 N  N   . ARG A 1 229 ? 3.908   32.020  -11.590 1.00 36.29  ? 229  ARG A N   1 
ATOM   1539 C  CA  . ARG A 1 229 ? 2.555   32.310  -11.119 1.00 40.52  ? 229  ARG A CA  1 
ATOM   1540 C  C   . ARG A 1 229 ? 1.722   32.994  -12.199 1.00 37.96  ? 229  ARG A C   1 
ATOM   1541 O  O   . ARG A 1 229 ? 0.500   32.876  -12.217 1.00 38.02  ? 229  ARG A O   1 
ATOM   1542 C  CB  . ARG A 1 229 ? 2.577   33.154  -9.834  1.00 46.75  ? 229  ARG A CB  1 
ATOM   1543 C  CG  . ARG A 1 229 ? 2.904   32.345  -8.581  1.00 53.44  ? 229  ARG A CG  1 
ATOM   1544 C  CD  . ARG A 1 229 ? 2.836   33.165  -7.302  1.00 57.34  ? 229  ARG A CD  1 
ATOM   1545 N  NE  . ARG A 1 229 ? 3.809   34.254  -7.283  1.00 61.22  ? 229  ARG A NE  1 
ATOM   1546 C  CZ  . ARG A 1 229 ? 4.942   34.245  -6.586  1.00 62.23  ? 229  ARG A CZ  1 
ATOM   1547 N  NH1 . ARG A 1 229 ? 5.264   33.199  -5.831  1.00 61.78  ? 229  ARG A NH1 1 
ATOM   1548 N  NH2 . ARG A 1 229 ? 5.755   35.292  -6.642  1.00 61.57  ? 229  ARG A NH2 1 
ATOM   1549 N  N   . GLU A 1 230 ? 2.386   33.704  -13.099 1.00 33.61  ? 230  GLU A N   1 
ATOM   1550 C  CA  . GLU A 1 230 ? 1.685   34.344  -14.201 1.00 37.33  ? 230  GLU A CA  1 
ATOM   1551 C  C   . GLU A 1 230 ? 1.306   33.349  -15.319 1.00 32.80  ? 230  GLU A C   1 
ATOM   1552 O  O   . GLU A 1 230 ? 0.314   33.540  -16.009 1.00 36.13  ? 230  GLU A O   1 
ATOM   1553 C  CB  . GLU A 1 230 ? 2.513   35.503  -14.753 1.00 43.84  ? 230  GLU A CB  1 
ATOM   1554 C  CG  . GLU A 1 230 ? 1.674   36.696  -15.158 1.00 51.77  ? 230  GLU A CG  1 
ATOM   1555 C  CD  . GLU A 1 230 ? 0.753   37.169  -14.040 1.00 57.92  ? 230  GLU A CD  1 
ATOM   1556 O  OE1 . GLU A 1 230 ? 1.164   37.156  -12.859 1.00 59.36  ? 230  GLU A OE1 1 
ATOM   1557 O  OE2 . GLU A 1 230 ? -0.390  37.560  -14.347 1.00 59.29  ? 230  GLU A OE2 1 
ATOM   1558 N  N   . GLY A 1 231 ? 2.108   32.302  -15.492 1.00 26.14  ? 231  GLY A N   1 
ATOM   1559 C  CA  . GLY A 1 231 ? 1.800   31.229  -16.427 1.00 25.29  ? 231  GLY A CA  1 
ATOM   1560 C  C   . GLY A 1 231 ? 1.914   31.573  -17.901 1.00 23.29  ? 231  GLY A C   1 
ATOM   1561 O  O   . GLY A 1 231 ? 1.322   30.892  -18.730 1.00 24.60  ? 231  GLY A O   1 
ATOM   1562 N  N   . LYS A 1 232 ? 2.686   32.609  -18.232 1.00 19.62  ? 232  LYS A N   1 
ATOM   1563 C  CA  A LYS A 1 232 ? 2.816   33.058  -19.614 0.52 18.91  ? 232  LYS A CA  1 
ATOM   1564 C  CA  B LYS A 1 232 ? 2.823   33.086  -19.612 0.48 19.69  ? 232  LYS A CA  1 
ATOM   1565 C  C   . LYS A 1 232 ? 4.209   32.784  -20.173 1.00 17.76  ? 232  LYS A C   1 
ATOM   1566 O  O   . LYS A 1 232 ? 5.209   32.911  -19.471 1.00 14.97  ? 232  LYS A O   1 
ATOM   1567 C  CB  A LYS A 1 232 ? 2.508   34.557  -19.712 0.52 22.72  ? 232  LYS A CB  1 
ATOM   1568 C  CB  B LYS A 1 232 ? 2.609   34.605  -19.684 0.48 22.88  ? 232  LYS A CB  1 
ATOM   1569 C  CG  A LYS A 1 232 ? 1.115   34.930  -19.231 0.52 25.35  ? 232  LYS A CG  1 
ATOM   1570 C  CG  B LYS A 1 232 ? 1.233   35.120  -19.272 0.48 25.36  ? 232  LYS A CG  1 
ATOM   1571 C  CD  A LYS A 1 232 ? 0.912   36.436  -19.230 0.52 27.58  ? 232  LYS A CD  1 
ATOM   1572 C  CD  B LYS A 1 232 ? 1.210   36.646  -19.394 0.48 27.65  ? 232  LYS A CD  1 
ATOM   1573 C  CE  A LYS A 1 232 ? -0.556  36.792  -19.430 0.52 28.80  ? 232  LYS A CE  1 
ATOM   1574 C  CE  B LYS A 1 232 ? -0.148  37.257  -19.089 0.48 27.99  ? 232  LYS A CE  1 
ATOM   1575 N  NZ  A LYS A 1 232 ? -1.447  36.078  -18.478 0.52 30.59  ? 232  LYS A NZ  1 
ATOM   1576 N  NZ  B LYS A 1 232 ? -0.090  38.747  -19.157 0.48 25.32  ? 232  LYS A NZ  1 
ATOM   1577 N  N   . PHE A 1 233 ? 4.267   32.431  -21.452 1.00 17.23  ? 233  PHE A N   1 
ATOM   1578 C  CA  . PHE A 1 233 ? 5.528   32.072  -22.094 1.00 17.78  ? 233  PHE A CA  1 
ATOM   1579 C  C   . PHE A 1 233 ? 5.314   32.219  -23.587 1.00 15.68  ? 233  PHE A C   1 
ATOM   1580 O  O   . PHE A 1 233 ? 4.178   32.337  -24.036 1.00 15.41  ? 233  PHE A O   1 
ATOM   1581 C  CB  . PHE A 1 233 ? 5.896   30.613  -21.753 1.00 15.71  ? 233  PHE A CB  1 
ATOM   1582 C  CG  . PHE A 1 233 ? 4.728   29.662  -21.852 1.00 16.56  ? 233  PHE A CG  1 
ATOM   1583 C  CD1 . PHE A 1 233 ? 4.388   29.073  -23.068 1.00 17.33  ? 233  PHE A CD1 1 
ATOM   1584 C  CD2 . PHE A 1 233 ? 3.936   29.402  -20.748 1.00 15.93  ? 233  PHE A CD2 1 
ATOM   1585 C  CE1 . PHE A 1 233 ? 3.302   28.199  -23.166 1.00 16.50  ? 233  PHE A CE1 1 
ATOM   1586 C  CE2 . PHE A 1 233 ? 2.843   28.531  -20.841 1.00 13.96  ? 233  PHE A CE2 1 
ATOM   1587 C  CZ  . PHE A 1 233 ? 2.523   27.946  -22.055 1.00 11.50  ? 233  PHE A CZ  1 
ATOM   1588 N  N   . ARG A 1 234 ? 6.404   32.213  -24.354 1.00 15.65  ? 234  ARG A N   1 
ATOM   1589 C  CA  . ARG A 1 234 ? 6.318   32.259  -25.808 1.00 12.31  ? 234  ARG A CA  1 
ATOM   1590 C  C   . ARG A 1 234 ? 5.862   30.923  -26.416 1.00 17.25  ? 234  ARG A C   1 
ATOM   1591 O  O   . ARG A 1 234 ? 6.080   29.860  -25.833 1.00 15.84  ? 234  ARG A O   1 
ATOM   1592 C  CB  . ARG A 1 234 ? 7.679   32.647  -26.399 1.00 10.82  ? 234  ARG A CB  1 
ATOM   1593 C  CG  . ARG A 1 234 ? 8.233   33.956  -25.839 1.00 15.60  ? 234  ARG A CG  1 
ATOM   1594 C  CD  . ARG A 1 234 ? 9.475   34.401  -26.577 1.00 16.53  ? 234  ARG A CD  1 
ATOM   1595 N  NE  . ARG A 1 234 ? 9.244   34.523  -28.019 1.00 20.57  ? 234  ARG A NE  1 
ATOM   1596 C  CZ  . ARG A 1 234 ? 8.583   35.525  -28.591 1.00 23.58  ? 234  ARG A CZ  1 
ATOM   1597 N  NH1 . ARG A 1 234 ? 8.070   36.495  -27.847 1.00 23.65  ? 234  ARG A NH1 1 
ATOM   1598 N  NH2 . ARG A 1 234 ? 8.434   35.559  -29.910 1.00 23.04  ? 234  ARG A NH2 1 
ATOM   1599 N  N   . ARG A 1 235 ? 5.231   30.978  -27.588 1.00 15.35  ? 235  ARG A N   1 
ATOM   1600 C  CA  . ARG A 1 235 ? 4.895   29.760  -28.317 1.00 14.64  ? 235  ARG A CA  1 
ATOM   1601 C  C   . ARG A 1 235 ? 6.233   29.155  -28.683 1.00 15.67  ? 235  ARG A C   1 
ATOM   1602 O  O   . ARG A 1 235 ? 7.181   29.894  -28.936 1.00 14.86  ? 235  ARG A O   1 
ATOM   1603 C  CB  . ARG A 1 235 ? 4.143   30.101  -29.613 1.00 14.65  ? 235  ARG A CB  1 
ATOM   1604 C  CG  . ARG A 1 235 ? 3.461   28.916  -30.299 1.00 14.84  ? 235  ARG A CG  1 
ATOM   1605 C  CD  . ARG A 1 235 ? 3.337   29.138  -31.808 1.00 14.89  ? 235  ARG A CD  1 
ATOM   1606 N  NE  . ARG A 1 235 ? 2.726   27.999  -32.503 1.00 13.44  ? 235  ARG A NE  1 
ATOM   1607 C  CZ  . ARG A 1 235 ? 3.398   26.959  -32.998 1.00 17.16  ? 235  ARG A CZ  1 
ATOM   1608 N  NH1 . ARG A 1 235 ? 4.720   26.878  -32.877 1.00 15.37  ? 235  ARG A NH1 1 
ATOM   1609 N  NH2 . ARG A 1 235 ? 2.744   25.985  -33.613 1.00 17.01  ? 235  ARG A NH2 1 
ATOM   1610 N  N   . ILE A 1 236 ? 6.320   27.828  -28.723 1.00 12.99  ? 236  ILE A N   1 
ATOM   1611 C  CA  . ILE A 1 236 ? 7.518   27.164  -29.222 1.00 9.57   ? 236  ILE A CA  1 
ATOM   1612 C  C   . ILE A 1 236 ? 7.633   27.583  -30.680 1.00 12.13  ? 236  ILE A C   1 
ATOM   1613 O  O   . ILE A 1 236 ? 6.659   28.063  -31.256 1.00 11.78  ? 236  ILE A O   1 
ATOM   1614 C  CB  . ILE A 1 236 ? 7.373   25.624  -29.120 1.00 14.19  ? 236  ILE A CB  1 
ATOM   1615 C  CG1 . ILE A 1 236 ? 6.214   25.138  -29.993 1.00 11.55  ? 236  ILE A CG1 1 
ATOM   1616 C  CG2 . ILE A 1 236 ? 7.158   25.197  -27.657 1.00 13.41  ? 236  ILE A CG2 1 
ATOM   1617 C  CD1 . ILE A 1 236 ? 5.861   23.642  -29.824 1.00 14.04  ? 236  ILE A CD1 1 
ATOM   1618 N  N   . PRO A 1 237 ? 8.820   27.431  -31.284 1.00 13.42  ? 237  PRO A N   1 
ATOM   1619 C  CA  . PRO A 1 237 ? 9.013   27.937  -32.651 1.00 13.06  ? 237  PRO A CA  1 
ATOM   1620 C  C   . PRO A 1 237 ? 7.988   27.403  -33.649 1.00 17.15  ? 237  PRO A C   1 
ATOM   1621 O  O   . PRO A 1 237 ? 7.430   26.317  -33.462 1.00 19.74  ? 237  PRO A O   1 
ATOM   1622 C  CB  . PRO A 1 237 ? 10.433  27.452  -33.016 1.00 10.37  ? 237  PRO A CB  1 
ATOM   1623 C  CG  . PRO A 1 237 ? 11.135  27.385  -31.674 1.00 12.05  ? 237  PRO A CG  1 
ATOM   1624 C  CD  . PRO A 1 237 ? 10.066  26.907  -30.699 1.00 10.59  ? 237  PRO A CD  1 
ATOM   1625 N  N   . TYR A 1 238 ? 7.764   28.170  -34.713 1.00 13.75  ? 238  TYR A N   1 
ATOM   1626 C  CA  . TYR A 1 238 ? 6.700   27.888  -35.683 1.00 14.42  ? 238  TYR A CA  1 
ATOM   1627 C  C   . TYR A 1 238 ? 6.953   26.660  -36.550 1.00 18.77  ? 238  TYR A C   1 
ATOM   1628 O  O   . TYR A 1 238 ? 6.027   26.124  -37.182 1.00 18.21  ? 238  TYR A O   1 
ATOM   1629 C  CB  . TYR A 1 238 ? 6.414   29.128  -36.539 1.00 13.93  ? 238  TYR A CB  1 
ATOM   1630 C  CG  . TYR A 1 238 ? 5.752   30.224  -35.731 1.00 14.82  ? 238  TYR A CG  1 
ATOM   1631 C  CD1 . TYR A 1 238 ? 6.456   31.354  -35.329 1.00 17.31  ? 238  TYR A CD1 1 
ATOM   1632 C  CD2 . TYR A 1 238 ? 4.428   30.106  -35.335 1.00 13.69  ? 238  TYR A CD2 1 
ATOM   1633 C  CE1 . TYR A 1 238 ? 5.845   32.342  -34.567 1.00 16.05  ? 238  TYR A CE1 1 
ATOM   1634 C  CE2 . TYR A 1 238 ? 3.807   31.095  -34.599 1.00 14.17  ? 238  TYR A CE2 1 
ATOM   1635 C  CZ  . TYR A 1 238 ? 4.521   32.206  -34.204 1.00 16.92  ? 238  TYR A CZ  1 
ATOM   1636 O  OH  . TYR A 1 238 ? 3.897   33.171  -33.440 1.00 20.30  ? 238  TYR A OH  1 
ATOM   1637 N  N   . ARG A 1 239 ? 8.203   26.207  -36.571 1.00 19.44  ? 239  ARG A N   1 
ATOM   1638 C  CA  . ARG A 1 239 ? 8.540   24.947  -37.238 1.00 23.81  ? 239  ARG A CA  1 
ATOM   1639 C  C   . ARG A 1 239 ? 7.797   23.755  -36.600 1.00 20.83  ? 239  ARG A C   1 
ATOM   1640 O  O   . ARG A 1 239 ? 7.637   22.717  -37.232 1.00 22.17  ? 239  ARG A O   1 
ATOM   1641 C  CB  . ARG A 1 239 ? 10.049  24.711  -37.191 1.00 27.90  ? 239  ARG A CB  1 
ATOM   1642 C  CG  . ARG A 1 239 ? 10.483  23.974  -35.948 1.00 34.65  ? 239  ARG A CG  1 
ATOM   1643 C  CD  . ARG A 1 239 ? 11.991  24.000  -35.735 1.00 42.58  ? 239  ARG A CD  1 
ATOM   1644 N  NE  . ARG A 1 239 ? 12.773  23.673  -36.927 1.00 44.60  ? 239  ARG A NE  1 
ATOM   1645 C  CZ  . ARG A 1 239 ? 13.088  22.444  -37.327 1.00 43.41  ? 239  ARG A CZ  1 
ATOM   1646 N  NH1 . ARG A 1 239 ? 13.816  22.280  -38.426 1.00 43.04  ? 239  ARG A NH1 1 
ATOM   1647 N  NH2 . ARG A 1 239 ? 12.673  21.379  -36.647 1.00 40.67  ? 239  ARG A NH2 1 
ATOM   1648 N  N   . TYR A 1 240 ? 7.345   23.917  -35.358 1.00 16.89  ? 240  TYR A N   1 
ATOM   1649 C  CA  . TYR A 1 240 ? 6.586   22.887  -34.644 1.00 14.38  ? 240  TYR A CA  1 
ATOM   1650 C  C   . TYR A 1 240 ? 5.071   23.068  -34.799 1.00 19.33  ? 240  TYR A C   1 
ATOM   1651 O  O   . TYR A 1 240 ? 4.555   24.178  -34.716 1.00 16.38  ? 240  TYR A O   1 
ATOM   1652 C  CB  . TYR A 1 240 ? 6.984   22.830  -33.157 1.00 13.32  ? 240  TYR A CB  1 
ATOM   1653 C  CG  . TYR A 1 240 ? 8.464   22.609  -32.972 1.00 14.01  ? 240  TYR A CG  1 
ATOM   1654 C  CD1 . TYR A 1 240 ? 9.308   23.661  -32.634 1.00 11.50  ? 240  TYR A CD1 1 
ATOM   1655 C  CD2 . TYR A 1 240 ? 9.028   21.352  -33.165 1.00 14.53  ? 240  TYR A CD2 1 
ATOM   1656 C  CE1 . TYR A 1 240 ? 10.691  23.462  -32.490 1.00 14.30  ? 240  TYR A CE1 1 
ATOM   1657 C  CE2 . TYR A 1 240 ? 10.407  21.141  -33.012 1.00 15.09  ? 240  TYR A CE2 1 
ATOM   1658 C  CZ  . TYR A 1 240 ? 11.225  22.204  -32.680 1.00 16.59  ? 240  TYR A CZ  1 
ATOM   1659 O  OH  . TYR A 1 240 ? 12.578  22.003  -32.532 1.00 22.51  ? 240  TYR A OH  1 
ATOM   1660 N  N   . SER A 1 241 ? 4.377   21.957  -35.042 1.00 21.80  ? 241  SER A N   1 
ATOM   1661 C  CA  . SER A 1 241 ? 2.941   21.934  -35.310 1.00 19.89  ? 241  SER A CA  1 
ATOM   1662 C  C   . SER A 1 241 ? 2.124   22.503  -34.158 1.00 19.22  ? 241  SER A C   1 
ATOM   1663 O  O   . SER A 1 241 ? 2.560   22.495  -33.005 1.00 21.87  ? 241  SER A O   1 
ATOM   1664 C  CB  . SER A 1 241 ? 2.498   20.493  -35.585 1.00 17.32  ? 241  SER A CB  1 
ATOM   1665 O  OG  . SER A 1 241 ? 2.659   19.706  -34.419 1.00 12.10  ? 241  SER A OG  1 
ATOM   1666 N  N   . ASP A 1 242 ? 0.939   23.011  -34.480 1.00 19.70  ? 242  ASP A N   1 
ATOM   1667 C  CA  . ASP A 1 242 ? -0.025  23.451  -33.472 1.00 20.03  ? 242  ASP A CA  1 
ATOM   1668 C  C   . ASP A 1 242 ? -0.403  22.351  -32.459 1.00 17.80  ? 242  ASP A C   1 
ATOM   1669 O  O   . ASP A 1 242 ? -0.628  22.615  -31.270 1.00 20.62  ? 242  ASP A O   1 
ATOM   1670 C  CB  . ASP A 1 242 ? -1.290  23.968  -34.170 1.00 21.42  ? 242  ASP A CB  1 
ATOM   1671 C  CG  . ASP A 1 242 ? -1.077  25.324  -34.847 1.00 25.18  ? 242  ASP A CG  1 
ATOM   1672 O  OD1 . ASP A 1 242 ? -0.106  26.039  -34.504 1.00 23.92  ? 242  ASP A OD1 1 
ATOM   1673 O  OD2 . ASP A 1 242 ? -1.887  25.674  -35.721 1.00 30.37  ? 242  ASP A OD2 1 
ATOM   1674 N  N   . GLU A 1 243 ? -0.482  21.116  -32.931 1.00 15.76  ? 243  GLU A N   1 
ATOM   1675 C  CA  . GLU A 1 243 ? -0.767  19.992  -32.049 1.00 17.42  ? 243  GLU A CA  1 
ATOM   1676 C  C   . GLU A 1 243 ? 0.328   19.768  -31.014 1.00 14.81  ? 243  GLU A C   1 
ATOM   1677 O  O   . GLU A 1 243 ? 0.030   19.524  -29.846 1.00 15.71  ? 243  GLU A O   1 
ATOM   1678 C  CB  . GLU A 1 243 ? -1.037  18.710  -32.849 1.00 17.29  ? 243  GLU A CB  1 
ATOM   1679 C  CG  . GLU A 1 243 ? -2.303  18.792  -33.723 1.00 26.85  ? 243  GLU A CG  1 
ATOM   1680 C  CD  . GLU A 1 243 ? -2.057  19.467  -35.060 1.00 33.96  ? 243  GLU A CD  1 
ATOM   1681 O  OE1 . GLU A 1 243 ? -0.969  20.054  -35.243 1.00 34.82  ? 243  GLU A OE1 1 
ATOM   1682 O  OE2 . GLU A 1 243 ? -2.951  19.411  -35.933 1.00 39.41  ? 243  GLU A OE2 1 
ATOM   1683 N  N   . LEU A 1 244 ? 1.594   19.846  -31.421 1.00 18.09  ? 244  LEU A N   1 
ATOM   1684 C  CA  . LEU A 1 244 ? 2.679   19.742  -30.431 1.00 15.95  ? 244  LEU A CA  1 
ATOM   1685 C  C   . LEU A 1 244 ? 2.655   20.930  -29.453 1.00 19.30  ? 244  LEU A C   1 
ATOM   1686 O  O   . LEU A 1 244 ? 2.770   20.752  -28.235 1.00 20.93  ? 244  LEU A O   1 
ATOM   1687 C  CB  . LEU A 1 244 ? 4.049   19.642  -31.102 1.00 16.13  ? 244  LEU A CB  1 
ATOM   1688 C  CG  . LEU A 1 244 ? 5.226   19.450  -30.135 1.00 15.88  ? 244  LEU A CG  1 
ATOM   1689 C  CD1 . LEU A 1 244 ? 4.969   18.283  -29.206 1.00 10.88  ? 244  LEU A CD1 1 
ATOM   1690 C  CD2 . LEU A 1 244 ? 6.520   19.253  -30.884 1.00 15.88  ? 244  LEU A CD2 1 
ATOM   1691 N  N   . ASN A 1 245 ? 2.495   22.142  -29.983 1.00 17.27  ? 245  ASN A N   1 
ATOM   1692 C  CA  . ASN A 1 245 ? 2.408   23.313  -29.116 1.00 13.58  ? 245  ASN A CA  1 
ATOM   1693 C  C   . ASN A 1 245 ? 1.262   23.217  -28.116 1.00 11.51  ? 245  ASN A C   1 
ATOM   1694 O  O   . ASN A 1 245 ? 1.419   23.535  -26.931 1.00 14.02  ? 245  ASN A O   1 
ATOM   1695 C  CB  . ASN A 1 245 ? 2.286   24.607  -29.929 1.00 11.36  ? 245  ASN A CB  1 
ATOM   1696 C  CG  . ASN A 1 245 ? 2.148   25.834  -29.033 1.00 14.35  ? 245  ASN A CG  1 
ATOM   1697 O  OD1 . ASN A 1 245 ? 3.088   26.220  -28.331 1.00 16.80  ? 245  ASN A OD1 1 
ATOM   1698 N  ND2 . ASN A 1 245 ? 0.964   26.423  -29.027 1.00 11.14  ? 245  ASN A ND2 1 
ATOM   1699 N  N   . GLU A 1 246 ? 0.104   22.772  -28.590 0.97 8.84   ? 246  GLU A N   1 
ATOM   1700 C  CA  . GLU A 1 246 ? -1.054  22.606  -27.721 0.97 14.52  ? 246  GLU A CA  1 
ATOM   1701 C  C   . GLU A 1 246 ? -0.786  21.679  -26.529 0.97 13.22  ? 246  GLU A C   1 
ATOM   1702 O  O   . GLU A 1 246 ? -1.115  21.999  -25.381 0.97 16.23  ? 246  GLU A O   1 
ATOM   1703 C  CB  . GLU A 1 246 ? -2.244  22.077  -28.526 0.97 18.10  ? 246  GLU A CB  1 
ATOM   1704 C  CG  . GLU A 1 246 ? -3.514  21.843  -27.724 0.97 25.96  ? 246  GLU A CG  1 
ATOM   1705 C  CD  . GLU A 1 246 ? -4.679  21.362  -28.607 0.97 39.22  ? 246  GLU A CD  1 
ATOM   1706 O  OE1 . GLU A 1 246 ? -4.486  20.426  -29.418 0.97 38.88  ? 246  GLU A OE1 1 
ATOM   1707 O  OE2 . GLU A 1 246 ? -5.793  21.921  -28.492 0.97 44.97  ? 246  GLU A OE2 1 
ATOM   1708 N  N   . ILE A 1 247 ? -0.216  20.513  -26.785 1.00 11.22  ? 247  ILE A N   1 
ATOM   1709 C  CA  . ILE A 1 247 ? -0.060  19.553  -25.689 1.00 13.32  ? 247  ILE A CA  1 
ATOM   1710 C  C   . ILE A 1 247 ? 0.981   20.051  -24.663 1.00 9.68   ? 247  ILE A C   1 
ATOM   1711 O  O   . ILE A 1 247 ? 0.797   19.962  -23.447 1.00 15.68  ? 247  ILE A O   1 
ATOM   1712 C  CB  . ILE A 1 247 ? 0.262   18.121  -26.210 1.00 19.62  ? 247  ILE A CB  1 
ATOM   1713 C  CG1 . ILE A 1 247 ? 0.158   17.106  -25.075 1.00 22.28  ? 247  ILE A CG1 1 
ATOM   1714 C  CG2 . ILE A 1 247 ? 1.645   18.055  -26.865 1.00 21.13  ? 247  ILE A CG2 1 
ATOM   1715 C  CD1 . ILE A 1 247 ? 0.319   15.694  -25.532 1.00 27.12  ? 247  ILE A CD1 1 
ATOM   1716 N  N   . ILE A 1 248 ? 2.076   20.596  -25.156 1.00 7.38   ? 248  ILE A N   1 
ATOM   1717 C  CA  . ILE A 1 248 ? 3.052   21.176  -24.256 1.00 8.08   ? 248  ILE A CA  1 
ATOM   1718 C  C   . ILE A 1 248 ? 2.436   22.332  -23.468 1.00 13.60  ? 248  ILE A C   1 
ATOM   1719 O  O   . ILE A 1 248 ? 2.679   22.488  -22.272 1.00 16.71  ? 248  ILE A O   1 
ATOM   1720 C  CB  . ILE A 1 248 ? 4.280   21.677  -25.029 1.00 9.32   ? 248  ILE A CB  1 
ATOM   1721 C  CG1 . ILE A 1 248 ? 5.002   20.471  -25.632 1.00 10.18  ? 248  ILE A CG1 1 
ATOM   1722 C  CG2 . ILE A 1 248 ? 5.214   22.493  -24.078 1.00 8.94   ? 248  ILE A CG2 1 
ATOM   1723 C  CD1 . ILE A 1 248 ? 6.280   20.803  -26.388 1.00 5.23   ? 248  ILE A CD1 1 
ATOM   1724 N  N   . THR A 1 249 ? 1.639   23.149  -24.148 1.00 15.84  ? 249  THR A N   1 
ATOM   1725 C  CA  . THR A 1 249 ? 0.934   24.238  -23.482 1.00 13.92  ? 249  THR A CA  1 
ATOM   1726 C  C   . THR A 1 249 ? 0.019   23.720  -22.366 1.00 14.75  ? 249  THR A C   1 
ATOM   1727 O  O   . THR A 1 249 ? 0.014   24.285  -21.275 1.00 8.70   ? 249  THR A O   1 
ATOM   1728 C  CB  . THR A 1 249 ? 0.160   25.096  -24.501 1.00 18.55  ? 249  THR A CB  1 
ATOM   1729 O  OG1 . THR A 1 249 ? 1.102   25.718  -25.392 1.00 15.42  ? 249  THR A OG1 1 
ATOM   1730 C  CG2 . THR A 1 249 ? -0.659  26.163  -23.804 1.00 18.58  ? 249  THR A CG2 1 
ATOM   1731 N  N   . ARG A 1 250 ? -0.731  22.638  -22.622 1.00 16.07  ? 250  ARG A N   1 
ATOM   1732 C  CA  . ARG A 1 250 ? -1.593  22.031  -21.586 1.00 16.55  ? 250  ARG A CA  1 
ATOM   1733 C  C   . ARG A 1 250 ? -0.796  21.571  -20.364 1.00 15.00  ? 250  ARG A C   1 
ATOM   1734 O  O   . ARG A 1 250 ? -1.235  21.734  -19.231 1.00 17.22  ? 250  ARG A O   1 
ATOM   1735 C  CB  . ARG A 1 250 ? -2.367  20.814  -22.137 1.00 20.42  ? 250  ARG A CB  1 
ATOM   1736 C  CG  . ARG A 1 250 ? -3.704  21.138  -22.787 1.00 35.78  ? 250  ARG A CG  1 
ATOM   1737 C  CD  . ARG A 1 250 ? -4.509  19.865  -23.071 1.00 47.38  ? 250  ARG A CD  1 
ATOM   1738 N  NE  . ARG A 1 250 ? -4.362  19.422  -24.457 1.00 56.27  ? 250  ARG A NE  1 
ATOM   1739 C  CZ  . ARG A 1 250 ? -4.167  18.161  -24.843 1.00 57.70  ? 250  ARG A CZ  1 
ATOM   1740 N  NH1 . ARG A 1 250 ? -4.090  17.183  -23.947 1.00 57.94  ? 250  ARG A NH1 1 
ATOM   1741 N  NH2 . ARG A 1 250 ? -4.046  17.881  -26.137 1.00 56.24  ? 250  ARG A NH2 1 
ATOM   1742 N  N   . MET A 1 251 ? 0.340   20.927  -20.601 1.00 13.49  ? 251  MET A N   1 
ATOM   1743 C  CA  . MET A 1 251 ? 1.196   20.462  -19.512 1.00 14.31  ? 251  MET A CA  1 
ATOM   1744 C  C   . MET A 1 251 ? 1.653   21.615  -18.650 1.00 16.51  ? 251  MET A C   1 
ATOM   1745 O  O   . MET A 1 251 ? 1.850   21.469  -17.438 1.00 22.14  ? 251  MET A O   1 
ATOM   1746 C  CB  . MET A 1 251 ? 2.416   19.740  -20.064 1.00 8.88   ? 251  MET A CB  1 
ATOM   1747 C  CG  . MET A 1 251 ? 2.114   18.353  -20.656 1.00 10.48  ? 251  MET A CG  1 
ATOM   1748 S  SD  . MET A 1 251 ? 3.655   17.656  -21.327 1.00 22.07  ? 251  MET A SD  1 
ATOM   1749 C  CE  . MET A 1 251 ? 3.033   16.707  -22.704 1.00 17.76  ? 251  MET A CE  1 
ATOM   1750 N  N   . LEU A 1 252 ? 1.811   22.772  -19.281 1.00 16.31  ? 252  LEU A N   1 
ATOM   1751 C  CA  . LEU A 1 252 ? 2.163   23.988  -18.554 1.00 19.25  ? 252  LEU A CA  1 
ATOM   1752 C  C   . LEU A 1 252 ? 0.947   24.743  -18.015 1.00 18.46  ? 252  LEU A C   1 
ATOM   1753 O  O   . LEU A 1 252 ? 1.020   25.939  -17.762 1.00 19.02  ? 252  LEU A O   1 
ATOM   1754 C  CB  . LEU A 1 252 ? 3.027   24.908  -19.424 1.00 16.54  ? 252  LEU A CB  1 
ATOM   1755 C  CG  . LEU A 1 252 ? 4.350   24.252  -19.835 1.00 18.87  ? 252  LEU A CG  1 
ATOM   1756 C  CD1 . LEU A 1 252 ? 5.185   25.168  -20.736 1.00 14.76  ? 252  LEU A CD1 1 
ATOM   1757 C  CD2 . LEU A 1 252 ? 5.145   23.877  -18.599 1.00 17.85  ? 252  LEU A CD2 1 
ATOM   1758 N  N   . ASN A 1 253 ? -0.171  24.061  -17.798 1.00 20.19  ? 253  ASN A N   1 
ATOM   1759 C  CA  . ASN A 1 253 ? -1.310  24.770  -17.224 1.00 18.50  ? 253  ASN A CA  1 
ATOM   1760 C  C   . ASN A 1 253 ? -1.028  25.120  -15.772 1.00 22.68  ? 253  ASN A C   1 
ATOM   1761 O  O   . ASN A 1 253 ? -0.384  24.348  -15.062 1.00 23.35  ? 253  ASN A O   1 
ATOM   1762 C  CB  . ASN A 1 253 ? -2.599  23.958  -17.342 1.00 20.62  ? 253  ASN A CB  1 
ATOM   1763 C  CG  . ASN A 1 253 ? -3.828  24.835  -17.386 1.00 26.18  ? 253  ASN A CG  1 
ATOM   1764 O  OD1 . ASN A 1 253 ? -4.227  25.426  -16.376 1.00 27.60  ? 253  ASN A OD1 1 
ATOM   1765 N  ND2 . ASN A 1 253 ? -4.436  24.936  -18.565 1.00 28.15  ? 253  ASN A ND2 1 
ATOM   1766 N  N   . LEU A 1 254 ? -1.501  26.282  -15.324 1.00 23.64  ? 254  LEU A N   1 
ATOM   1767 C  CA  . LEU A 1 254 ? -1.320  26.680  -13.924 1.00 23.78  ? 254  LEU A CA  1 
ATOM   1768 C  C   . LEU A 1 254 ? -2.109  25.785  -12.964 1.00 26.01  ? 254  LEU A C   1 
ATOM   1769 O  O   . LEU A 1 254 ? -1.716  25.622  -11.814 1.00 26.61  ? 254  LEU A O   1 
ATOM   1770 C  CB  . LEU A 1 254 ? -1.715  28.143  -13.701 1.00 24.81  ? 254  LEU A CB  1 
ATOM   1771 C  CG  . LEU A 1 254 ? -0.801  29.198  -14.323 1.00 26.52  ? 254  LEU A CG  1 
ATOM   1772 C  CD1 . LEU A 1 254 ? -1.395  30.603  -14.155 1.00 31.50  ? 254  LEU A CD1 1 
ATOM   1773 C  CD2 . LEU A 1 254 ? 0.598   29.120  -13.723 1.00 24.19  ? 254  LEU A CD2 1 
ATOM   1774 N  N   . LYS A 1 255 ? -3.230  25.230  -13.427 1.00 27.65  ? 255  LYS A N   1 
ATOM   1775 C  CA  . LYS A 1 255 ? -4.014  24.298  -12.615 1.00 27.46  ? 255  LYS A CA  1 
ATOM   1776 C  C   . LYS A 1 255 ? -3.566  22.873  -12.916 1.00 25.28  ? 255  LYS A C   1 
ATOM   1777 O  O   . LYS A 1 255 ? -3.683  22.405  -14.046 1.00 24.02  ? 255  LYS A O   1 
ATOM   1778 C  CB  . LYS A 1 255 ? -5.514  24.422  -12.923 1.00 29.70  ? 255  LYS A CB  1 
ATOM   1779 C  CG  . LYS A 1 255 ? -6.093  25.831  -12.753 1.00 33.38  ? 255  LYS A CG  1 
ATOM   1780 C  CD  . LYS A 1 255 ? -6.009  26.266  -11.298 1.00 37.58  ? 255  LYS A CD  1 
ATOM   1781 C  CE  . LYS A 1 255 ? -6.547  27.676  -11.088 1.00 39.35  ? 255  LYS A CE  1 
ATOM   1782 N  NZ  . LYS A 1 255 ? -6.317  28.129  -9.681  1.00 39.56  ? 255  LYS A NZ  1 
ATOM   1783 N  N   . ASP A 1 256 ? -3.067  22.174  -11.908 1.00 25.05  ? 256  ASP A N   1 
ATOM   1784 C  CA  . ASP A 1 256 ? -2.675  20.784  -12.107 1.00 24.97  ? 256  ASP A CA  1 
ATOM   1785 C  C   . ASP A 1 256 ? -3.814  19.930  -12.650 1.00 24.09  ? 256  ASP A C   1 
ATOM   1786 O  O   . ASP A 1 256 ? -3.576  19.034  -13.447 1.00 29.95  ? 256  ASP A O   1 
ATOM   1787 C  CB  . ASP A 1 256 ? -2.084  20.170  -10.831 1.00 29.77  ? 256  ASP A CB  1 
ATOM   1788 C  CG  . ASP A 1 256 ? -3.004  20.283  -9.634  1.00 30.91  ? 256  ASP A CG  1 
ATOM   1789 O  OD1 . ASP A 1 256 ? -2.665  19.712  -8.584  1.00 35.42  ? 256  ASP A OD1 1 
ATOM   1790 O  OD2 . ASP A 1 256 ? -4.058  20.934  -9.726  1.00 27.69  ? 256  ASP A OD2 1 
ATOM   1791 N  N   . TYR A 1 257 ? -5.052  20.217  -12.248 1.00 26.11  ? 257  TYR A N   1 
ATOM   1792 C  CA  . TYR A 1 257 ? -6.177  19.411  -12.727 1.00 24.98  ? 257  TYR A CA  1 
ATOM   1793 C  C   . TYR A 1 257 ? -6.567  19.678  -14.186 1.00 25.77  ? 257  TYR A C   1 
ATOM   1794 O  O   . TYR A 1 257 ? -7.380  18.938  -14.745 1.00 27.16  ? 257  TYR A O   1 
ATOM   1795 C  CB  . TYR A 1 257 ? -7.392  19.506  -11.793 1.00 23.92  ? 257  TYR A CB  1 
ATOM   1796 C  CG  . TYR A 1 257 ? -7.791  20.931  -11.441 1.00 28.96  ? 257  TYR A CG  1 
ATOM   1797 C  CD1 . TYR A 1 257 ? -7.361  21.523  -10.265 1.00 31.42  ? 257  TYR A CD1 1 
ATOM   1798 C  CD2 . TYR A 1 257 ? -8.608  21.676  -12.289 1.00 33.58  ? 257  TYR A CD2 1 
ATOM   1799 C  CE1 . TYR A 1 257 ? -7.730  22.825  -9.939  1.00 34.25  ? 257  TYR A CE1 1 
ATOM   1800 C  CE2 . TYR A 1 257 ? -8.986  22.966  -11.971 1.00 33.55  ? 257  TYR A CE2 1 
ATOM   1801 C  CZ  . TYR A 1 257 ? -8.544  23.536  -10.797 1.00 35.42  ? 257  TYR A CZ  1 
ATOM   1802 O  OH  . TYR A 1 257 ? -8.916  24.825  -10.484 1.00 39.34  ? 257  TYR A OH  1 
ATOM   1803 N  N   . HIS A 1 258 ? -5.989  20.712  -14.804 1.00 24.61  ? 258  HIS A N   1 
ATOM   1804 C  CA  . HIS A 1 258 ? -6.178  20.934  -16.247 1.00 22.83  ? 258  HIS A CA  1 
ATOM   1805 C  C   . HIS A 1 258 ? -5.064  20.288  -17.059 1.00 23.34  ? 258  HIS A C   1 
ATOM   1806 O  O   . HIS A 1 258 ? -5.165  20.156  -18.283 1.00 25.71  ? 258  HIS A O   1 
ATOM   1807 C  CB  . HIS A 1 258 ? -6.237  22.426  -16.611 1.00 26.90  ? 258  HIS A CB  1 
ATOM   1808 C  CG  . HIS A 1 258 ? -7.495  23.115  -16.184 1.00 29.10  ? 258  HIS A CG  1 
ATOM   1809 N  ND1 . HIS A 1 258 ? -8.716  22.481  -16.137 1.00 31.88  ? 258  HIS A ND1 1 
ATOM   1810 C  CD2 . HIS A 1 258 ? -7.722  24.398  -15.807 1.00 28.77  ? 258  HIS A CD2 1 
ATOM   1811 C  CE1 . HIS A 1 258 ? -9.637  23.333  -15.725 1.00 32.53  ? 258  HIS A CE1 1 
ATOM   1812 N  NE2 . HIS A 1 258 ? -9.058  24.502  -15.512 1.00 31.07  ? 258  HIS A NE2 1 
ATOM   1813 N  N   . ARG A 1 259 ? -3.994  19.889  -16.388 1.00 21.04  ? 259  ARG A N   1 
ATOM   1814 C  CA  . ARG A 1 259 ? -2.903  19.229  -17.086 1.00 18.49  ? 259  ARG A CA  1 
ATOM   1815 C  C   . ARG A 1 259 ? -3.314  17.823  -17.450 1.00 18.71  ? 259  ARG A C   1 
ATOM   1816 O  O   . ARG A 1 259 ? -4.054  17.178  -16.713 1.00 19.98  ? 259  ARG A O   1 
ATOM   1817 C  CB  . ARG A 1 259 ? -1.639  19.223  -16.236 1.00 20.36  ? 259  ARG A CB  1 
ATOM   1818 C  CG  . ARG A 1 259 ? -1.232  20.626  -15.793 1.00 21.03  ? 259  ARG A CG  1 
ATOM   1819 C  CD  . ARG A 1 259 ? 0.031   20.592  -14.938 1.00 23.06  ? 259  ARG A CD  1 
ATOM   1820 N  NE  . ARG A 1 259 ? 0.141   21.806  -14.144 1.00 24.85  ? 259  ARG A NE  1 
ATOM   1821 C  CZ  . ARG A 1 259 ? 0.625   21.846  -12.906 1.00 22.50  ? 259  ARG A CZ  1 
ATOM   1822 N  NH1 . ARG A 1 259 ? 1.072   20.738  -12.314 1.00 21.70  ? 259  ARG A NH1 1 
ATOM   1823 N  NH2 . ARG A 1 259 ? 0.665   22.996  -12.265 1.00 22.87  ? 259  ARG A NH2 1 
ATOM   1824 N  N   . PRO A 1 260 ? -2.870  17.354  -18.616 1.00 14.93  ? 260  PRO A N   1 
ATOM   1825 C  CA  . PRO A 1 260 ? -3.230  15.996  -19.050 1.00 16.48  ? 260  PRO A CA  1 
ATOM   1826 C  C   . PRO A 1 260 ? -2.545  14.953  -18.164 1.00 20.24  ? 260  PRO A C   1 
ATOM   1827 O  O   . PRO A 1 260 ? -1.453  15.206  -17.620 1.00 19.18  ? 260  PRO A O   1 
ATOM   1828 C  CB  . PRO A 1 260 ? -2.664  15.913  -20.472 1.00 13.71  ? 260  PRO A CB  1 
ATOM   1829 C  CG  . PRO A 1 260 ? -1.514  16.889  -20.484 1.00 16.26  ? 260  PRO A CG  1 
ATOM   1830 C  CD  . PRO A 1 260 ? -1.947  18.030  -19.546 1.00 13.71  ? 260  PRO A CD  1 
ATOM   1831 N  N   . SER A 1 261 ? -3.189  13.801  -18.000 1.00 19.53  ? 261  SER A N   1 
ATOM   1832 C  CA  . SER A 1 261 ? -2.554  12.687  -17.308 1.00 20.32  ? 261  SER A CA  1 
ATOM   1833 C  C   . SER A 1 261 ? -1.693  11.946  -18.310 1.00 20.02  ? 261  SER A C   1 
ATOM   1834 O  O   . SER A 1 261 ? -1.798  12.153  -19.525 1.00 17.13  ? 261  SER A O   1 
ATOM   1835 C  CB  . SER A 1 261 ? -3.595  11.716  -16.783 1.00 22.10  ? 261  SER A CB  1 
ATOM   1836 O  OG  . SER A 1 261 ? -4.293  11.142  -17.879 1.00 21.08  ? 261  SER A OG  1 
ATOM   1837 N  N   . VAL A 1 262 ? -0.850  11.074  -17.782 1.00 21.21  ? 262  VAL A N   1 
ATOM   1838 C  CA  . VAL A 1 262 ? -0.071  10.156  -18.583 1.00 25.11  ? 262  VAL A CA  1 
ATOM   1839 C  C   . VAL A 1 262 ? -0.937  9.483   -19.653 1.00 22.74  ? 262  VAL A C   1 
ATOM   1840 O  O   . VAL A 1 262 ? -0.571  9.427   -20.826 1.00 23.38  ? 262  VAL A O   1 
ATOM   1841 C  CB  . VAL A 1 262 ? 0.571   9.091   -17.664 1.00 29.95  ? 262  VAL A CB  1 
ATOM   1842 C  CG1 . VAL A 1 262 ? 0.885   7.830   -18.437 1.00 32.05  ? 262  VAL A CG1 1 
ATOM   1843 C  CG2 . VAL A 1 262 ? 1.828   9.668   -16.999 1.00 29.08  ? 262  VAL A CG2 1 
ATOM   1844 N  N   . GLU A 1 263 ? -2.084  8.970   -19.232 1.00 22.24  ? 263  GLU A N   1 
ATOM   1845 C  CA  . GLU A 1 263 ? -3.039  8.343   -20.135 1.00 24.64  ? 263  GLU A CA  1 
ATOM   1846 C  C   . GLU A 1 263 ? -3.522  9.307   -21.221 1.00 22.57  ? 263  GLU A C   1 
ATOM   1847 O  O   . GLU A 1 263 ? -3.572  8.971   -22.405 1.00 21.21  ? 263  GLU A O   1 
ATOM   1848 C  CB  . GLU A 1 263 ? -4.250  7.833   -19.334 1.00 30.47  ? 263  GLU A CB  1 
ATOM   1849 C  CG  . GLU A 1 263 ? -4.006  6.567   -18.492 1.00 35.23  ? 263  GLU A CG  1 
ATOM   1850 C  CD  . GLU A 1 263 ? -3.251  6.823   -17.189 1.00 38.81  ? 263  GLU A CD  1 
ATOM   1851 O  OE1 . GLU A 1 263 ? -2.768  5.835   -16.584 1.00 39.47  ? 263  GLU A OE1 1 
ATOM   1852 O  OE2 . GLU A 1 263 ? -3.132  7.999   -16.769 1.00 37.96  ? 263  GLU A OE2 1 
ATOM   1853 N  N   . GLU A 1 264 ? -3.901  10.510  -20.814 1.00 14.95  ? 264  GLU A N   1 
ATOM   1854 C  CA  . GLU A 1 264 ? -4.403  11.482  -21.764 1.00 12.66  ? 264  GLU A CA  1 
ATOM   1855 C  C   . GLU A 1 264 ? -3.291  11.892  -22.725 1.00 12.31  ? 264  GLU A C   1 
ATOM   1856 O  O   . GLU A 1 264 ? -3.552  12.135  -23.896 1.00 13.77  ? 264  GLU A O   1 
ATOM   1857 C  CB  . GLU A 1 264 ? -5.025  12.692  -21.040 1.00 14.78  ? 264  GLU A CB  1 
ATOM   1858 C  CG  . GLU A 1 264 ? -6.384  12.366  -20.367 1.00 27.34  ? 264  GLU A CG  1 
ATOM   1859 C  CD  . GLU A 1 264 ? -6.843  13.430  -19.367 1.00 30.82  ? 264  GLU A CD  1 
ATOM   1860 O  OE1 . GLU A 1 264 ? -8.046  13.466  -19.041 1.00 35.75  ? 264  GLU A OE1 1 
ATOM   1861 O  OE2 . GLU A 1 264 ? -6.010  14.226  -18.889 1.00 28.41  ? 264  GLU A OE2 1 
ATOM   1862 N  N   . ILE A 1 265 ? -2.050  11.962  -22.239 1.00 11.36  ? 265  ILE A N   1 
ATOM   1863 C  CA  . ILE A 1 265 ? -0.924  12.297  -23.122 1.00 13.16  ? 265  ILE A CA  1 
ATOM   1864 C  C   . ILE A 1 265 ? -0.754  11.272  -24.248 1.00 13.48  ? 265  ILE A C   1 
ATOM   1865 O  O   . ILE A 1 265 ? -0.625  11.636  -25.413 1.00 15.50  ? 265  ILE A O   1 
ATOM   1866 C  CB  . ILE A 1 265 ? 0.415   12.424  -22.348 1.00 16.73  ? 265  ILE A CB  1 
ATOM   1867 C  CG1 . ILE A 1 265 ? 0.429   13.685  -21.481 1.00 14.60  ? 265  ILE A CG1 1 
ATOM   1868 C  CG2 . ILE A 1 265 ? 1.587   12.477  -23.318 1.00 13.07  ? 265  ILE A CG2 1 
ATOM   1869 C  CD1 . ILE A 1 265 ? 1.493   13.662  -20.361 1.00 14.88  ? 265  ILE A CD1 1 
ATOM   1870 N  N   . LEU A 1 266 ? -0.778  9.988   -23.894 1.00 16.90  ? 266  LEU A N   1 
ATOM   1871 C  CA  . LEU A 1 266 ? -0.501  8.894   -24.834 1.00 17.93  ? 266  LEU A CA  1 
ATOM   1872 C  C   . LEU A 1 266 ? -1.648  8.612   -25.821 1.00 20.03  ? 266  LEU A C   1 
ATOM   1873 O  O   . LEU A 1 266 ? -1.438  7.973   -26.859 1.00 19.00  ? 266  LEU A O   1 
ATOM   1874 C  CB  . LEU A 1 266 ? -0.165  7.608   -24.050 1.00 20.70  ? 266  LEU A CB  1 
ATOM   1875 C  CG  . LEU A 1 266 ? 1.059   7.705   -23.126 1.00 20.61  ? 266  LEU A CG  1 
ATOM   1876 C  CD1 . LEU A 1 266 ? 1.112   6.565   -22.098 1.00 22.46  ? 266  LEU A CD1 1 
ATOM   1877 C  CD2 . LEU A 1 266 ? 2.358   7.800   -23.935 1.00 13.05  ? 266  LEU A CD2 1 
ATOM   1878 N  N   . GLU A 1 267 ? -2.856  9.060   -25.478 1.00 23.22  ? 267  GLU A N   1 
ATOM   1879 C  CA  . GLU A 1 267 ? -4.010  9.023   -26.389 1.00 23.48  ? 267  GLU A CA  1 
ATOM   1880 C  C   . GLU A 1 267 ? -3.914  10.079  -27.496 1.00 24.43  ? 267  GLU A C   1 
ATOM   1881 O  O   . GLU A 1 267 ? -4.733  10.098  -28.404 1.00 24.08  ? 267  GLU A O   1 
ATOM   1882 C  CB  . GLU A 1 267 ? -5.315  9.274   -25.623 1.00 28.75  ? 267  GLU A CB  1 
ATOM   1883 C  CG  . GLU A 1 267 ? -5.767  8.149   -24.717 1.00 40.22  ? 267  GLU A CG  1 
ATOM   1884 C  CD  . GLU A 1 267 ? -6.858  8.588   -23.745 1.00 51.55  ? 267  GLU A CD  1 
ATOM   1885 O  OE1 . GLU A 1 267 ? -7.280  9.768   -23.805 1.00 51.03  ? 267  GLU A OE1 1 
ATOM   1886 O  OE2 . GLU A 1 267 ? -7.289  7.751   -22.918 1.00 59.20  ? 267  GLU A OE2 1 
ATOM   1887 N  N   . ASN A 1 268 ? -2.924  10.964  -27.421 1.00 26.01  ? 268  ASN A N   1 
ATOM   1888 C  CA  . ASN A 1 268 ? -2.822  12.057  -28.392 1.00 23.19  ? 268  ASN A CA  1 
ATOM   1889 C  C   . ASN A 1 268 ? -2.491  11.509  -29.776 1.00 20.07  ? 268  ASN A C   1 
ATOM   1890 O  O   . ASN A 1 268 ? -1.621  10.651  -29.908 1.00 11.30  ? 268  ASN A O   1 
ATOM   1891 C  CB  . ASN A 1 268 ? -1.786  13.108  -27.946 1.00 20.84  ? 268  ASN A CB  1 
ATOM   1892 C  CG  . ASN A 1 268 ? -1.888  14.415  -28.731 1.00 22.21  ? 268  ASN A CG  1 
ATOM   1893 O  OD1 . ASN A 1 268 ? -1.454  14.503  -29.883 1.00 21.11  ? 268  ASN A OD1 1 
ATOM   1894 N  ND2 . ASN A 1 268 ? -2.451  15.445  -28.097 1.00 21.10  ? 268  ASN A ND2 1 
ATOM   1895 N  N   . PRO A 1 269 ? -3.194  12.000  -30.812 1.00 22.46  ? 269  PRO A N   1 
ATOM   1896 C  CA  . PRO A 1 269 ? -3.002  11.493  -32.174 1.00 19.81  ? 269  PRO A CA  1 
ATOM   1897 C  C   . PRO A 1 269 ? -1.580  11.664  -32.694 1.00 17.09  ? 269  PRO A C   1 
ATOM   1898 O  O   . PRO A 1 269 ? -1.182  10.953  -33.632 1.00 13.93  ? 269  PRO A O   1 
ATOM   1899 C  CB  . PRO A 1 269 ? -3.995  12.325  -33.004 1.00 21.61  ? 269  PRO A CB  1 
ATOM   1900 C  CG  . PRO A 1 269 ? -5.080  12.704  -32.027 1.00 20.11  ? 269  PRO A CG  1 
ATOM   1901 C  CD  . PRO A 1 269 ? -4.350  12.916  -30.714 1.00 22.05  ? 269  PRO A CD  1 
ATOM   1902 N  N   . LEU A 1 270 ? -0.823  12.585  -32.108 1.00 16.79  ? 270  LEU A N   1 
ATOM   1903 C  CA  . LEU A 1 270 ? 0.582   12.769  -32.499 1.00 16.93  ? 270  LEU A CA  1 
ATOM   1904 C  C   . LEU A 1 270 ? 1.406   11.514  -32.255 1.00 17.60  ? 270  LEU A C   1 
ATOM   1905 O  O   . LEU A 1 270 ? 2.387   11.266  -32.952 1.00 20.69  ? 270  LEU A O   1 
ATOM   1906 C  CB  . LEU A 1 270 ? 1.229   13.924  -31.723 1.00 18.77  ? 270  LEU A CB  1 
ATOM   1907 C  CG  . LEU A 1 270 ? 1.007   15.363  -32.181 1.00 18.21  ? 270  LEU A CG  1 
ATOM   1908 C  CD1 . LEU A 1 270 ? 1.716   16.321  -31.236 1.00 18.80  ? 270  LEU A CD1 1 
ATOM   1909 C  CD2 . LEU A 1 270 ? 1.511   15.542  -33.599 1.00 19.57  ? 270  LEU A CD2 1 
ATOM   1910 N  N   . ILE A 1 271 ? 1.013   10.731  -31.258 1.00 15.67  ? 271  ILE A N   1 
ATOM   1911 C  CA  . ILE A 1 271 ? 1.882   9.671   -30.757 1.00 19.59  ? 271  ILE A CA  1 
ATOM   1912 C  C   . ILE A 1 271 ? 1.606   8.341   -31.444 1.00 15.68  ? 271  ILE A C   1 
ATOM   1913 O  O   . ILE A 1 271 ? 0.513   7.801   -31.339 1.00 17.63  ? 271  ILE A O   1 
ATOM   1914 C  CB  . ILE A 1 271 ? 1.806   9.541   -29.211 1.00 15.33  ? 271  ILE A CB  1 
ATOM   1915 C  CG1 . ILE A 1 271 ? 2.375   10.802  -28.547 1.00 15.69  ? 271  ILE A CG1 1 
ATOM   1916 C  CG2 . ILE A 1 271 ? 2.585   8.318   -28.739 1.00 15.20  ? 271  ILE A CG2 1 
ATOM   1917 C  CD1 . ILE A 1 271 ? 2.257   10.800  -27.019 1.00 11.62  ? 271  ILE A CD1 1 
ATOM   1918 N  N   . LEU A 1 272 ? 2.618   7.839   -32.153 1.00 16.19  ? 272  LEU A N   1 
ATOM   1919 C  CA  . LEU A 1 272 ? 2.509   6.646   -32.973 1.00 18.45  ? 272  LEU A CA  1 
ATOM   1920 C  C   . LEU A 1 272 ? 3.480   5.543   -32.532 1.00 20.64  ? 272  LEU A C   1 
ATOM   1921 O  O   . LEU A 1 272 ? 4.442   5.805   -31.795 1.00 20.77  ? 272  LEU A O   1 
ATOM   1922 C  CB  . LEU A 1 272 ? 2.757   7.020   -34.440 1.00 20.03  ? 272  LEU A CB  1 
ATOM   1923 C  CG  . LEU A 1 272 ? 1.790   8.053   -35.024 1.00 20.32  ? 272  LEU A CG  1 
ATOM   1924 C  CD1 . LEU A 1 272 ? 2.256   8.504   -36.418 1.00 18.28  ? 272  LEU A CD1 1 
ATOM   1925 C  CD2 . LEU A 1 272 ? 0.373   7.466   -35.060 1.00 24.51  ? 272  LEU A CD2 1 
ATOM   1926 N  N   . GLU A 1 273 ? 3.241   4.315   -32.994 1.00 19.45  ? 273  GLU A N   1 
ATOM   1927 C  CA  . GLU A 1 273 ? 4.067   3.170   -32.581 1.00 17.89  ? 273  GLU A CA  1 
ATOM   1928 C  C   . GLU A 1 273 ? 5.567   3.439   -32.691 1.00 18.55  ? 273  GLU A C   1 
ATOM   1929 O  O   . GLU A 1 273 ? 6.315   3.138   -31.769 1.00 16.58  ? 273  GLU A O   1 
ATOM   1930 C  CB  . GLU A 1 273 ? 3.726   1.896   -33.367 1.00 16.06  ? 273  GLU A CB  1 
ATOM   1931 C  CG  . GLU A 1 273 ? 4.147   0.596   -32.650 1.00 11.80  ? 273  GLU A CG  1 
ATOM   1932 C  CD  . GLU A 1 273 ? 5.650   0.334   -32.732 1.00 16.88  ? 273  GLU A CD  1 
ATOM   1933 O  OE1 . GLU A 1 273 ? 6.193   -0.357  -31.844 1.00 22.25  ? 273  GLU A OE1 1 
ATOM   1934 O  OE2 . GLU A 1 273 ? 6.289   0.806   -33.698 1.00 14.55  ? 273  GLU A OE2 1 
ATOM   1935 N  N   . HIS A 1 274 ? 5.997   4.016   -33.812 1.00 21.91  ? 274  HIS A N   1 
ATOM   1936 C  CA  . HIS A 1 274 ? 7.422   4.219   -34.054 1.00 21.10  ? 274  HIS A CA  1 
ATOM   1937 C  C   . HIS A 1 274 ? 8.082   5.196   -33.063 1.00 20.85  ? 274  HIS A C   1 
ATOM   1938 O  O   . HIS A 1 274 ? 9.304   5.288   -33.032 1.00 19.58  ? 274  HIS A O   1 
ATOM   1939 C  CB  . HIS A 1 274 ? 7.709   4.610   -35.531 1.00 20.78  ? 274  HIS A CB  1 
ATOM   1940 C  CG  . HIS A 1 274 ? 7.437   6.053   -35.864 1.00 14.58  ? 274  HIS A CG  1 
ATOM   1941 N  ND1 . HIS A 1 274 ? 6.162   6.548   -36.031 1.00 12.58  ? 274  HIS A ND1 1 
ATOM   1942 C  CD2 . HIS A 1 274 ? 8.280   7.098   -36.090 1.00 11.26  ? 274  HIS A CD2 1 
ATOM   1943 C  CE1 . HIS A 1 274 ? 6.223   7.839   -36.312 1.00 13.21  ? 274  HIS A CE1 1 
ATOM   1944 N  NE2 . HIS A 1 274 ? 7.500   8.195   -36.364 1.00 11.25  ? 274  HIS A NE2 1 
ATOM   1945 N  N   . HIS A 1 275 ? 7.279   5.896   -32.251 1.00 18.38  ? 275  HIS A N   1 
ATOM   1946 C  CA  . HIS A 1 275 ? 7.806   6.871   -31.279 1.00 18.70  ? 275  HIS A CA  1 
ATOM   1947 C  C   . HIS A 1 275 ? 8.211   6.218   -29.960 1.00 20.22  ? 275  HIS A C   1 
ATOM   1948 O  O   . HIS A 1 275 ? 8.821   6.871   -29.086 1.00 19.13  ? 275  HIS A O   1 
ATOM   1949 C  CB  . HIS A 1 275 ? 6.784   7.967   -30.976 1.00 16.89  ? 275  HIS A CB  1 
ATOM   1950 C  CG  . HIS A 1 275 ? 6.541   8.918   -32.106 1.00 16.07  ? 275  HIS A CG  1 
ATOM   1951 N  ND1 . HIS A 1 275 ? 5.269   9.219   -32.555 1.00 14.37  ? 275  HIS A ND1 1 
ATOM   1952 C  CD2 . HIS A 1 275 ? 7.390   9.661   -32.852 1.00 15.48  ? 275  HIS A CD2 1 
ATOM   1953 C  CE1 . HIS A 1 275 ? 5.348   10.102  -33.539 1.00 12.09  ? 275  HIS A CE1 1 
ATOM   1954 N  NE2 . HIS A 1 275 ? 6.625   10.381  -33.743 1.00 16.54  ? 275  HIS A NE2 1 
ATOM   1955 N  N   . HIS A 1 276 ? 7.841   4.943   -29.826 1.00 16.24  ? 276  HIS A N   1 
ATOM   1956 C  CA  . HIS A 1 276 ? 8.104   4.126   -28.646 1.00 12.94  ? 276  HIS A CA  1 
ATOM   1957 C  C   . HIS A 1 276 ? 9.458   3.477   -28.766 1.00 14.30  ? 276  HIS A C   1 
ATOM   1958 O  O   . HIS A 1 276 ? 10.116  3.595   -29.789 1.00 14.39  ? 276  HIS A O   1 
ATOM   1959 C  CB  . HIS A 1 276 ? 7.040   3.015   -28.502 1.00 10.66  ? 276  HIS A CB  1 
ATOM   1960 C  CG  . HIS A 1 276 ? 5.664   3.534   -28.235 1.00 9.57   ? 276  HIS A CG  1 
ATOM   1961 N  ND1 . HIS A 1 276 ? 4.951   4.252   -29.173 1.00 9.91   ? 276  HIS A ND1 1 
ATOM   1962 C  CD2 . HIS A 1 276 ? 4.876   3.460   -27.137 1.00 9.92   ? 276  HIS A CD2 1 
ATOM   1963 C  CE1 . HIS A 1 276 ? 3.776   4.586   -28.667 1.00 8.81   ? 276  HIS A CE1 1 
ATOM   1964 N  NE2 . HIS A 1 276 ? 3.702   4.118   -27.434 1.00 6.86   ? 276  HIS A NE2 1 
ATOM   1965 N  N   . HIS A 1 277 ? 9.863   2.767   -27.721 1.00 18.10  ? 277  HIS A N   1 
ATOM   1966 C  CA  . HIS A 1 277 ? 11.175  2.142   -27.701 1.00 18.93  ? 277  HIS A CA  1 
ATOM   1967 C  C   . HIS A 1 277 ? 11.184  0.949   -28.634 1.00 19.31  ? 277  HIS A C   1 
ATOM   1968 O  O   . HIS A 1 277 ? 10.164  0.268   -28.779 1.00 20.90  ? 277  HIS A O   1 
ATOM   1969 C  CB  . HIS A 1 277 ? 11.506  1.667   -26.289 1.00 23.21  ? 277  HIS A CB  1 
ATOM   1970 C  CG  . HIS A 1 277 ? 10.888  0.347   -25.945 1.00 26.56  ? 277  HIS A CG  1 
ATOM   1971 N  ND1 . HIS A 1 277 ? 9.665   0.238   -25.316 1.00 26.28  ? 277  HIS A ND1 1 
ATOM   1972 C  CD2 . HIS A 1 277 ? 11.313  -0.923  -26.161 1.00 29.01  ? 277  HIS A CD2 1 
ATOM   1973 C  CE1 . HIS A 1 277 ? 9.368   -1.042  -25.152 1.00 31.77  ? 277  HIS A CE1 1 
ATOM   1974 N  NE2 . HIS A 1 277 ? 10.348  -1.767  -25.662 1.00 32.04  ? 277  HIS A NE2 1 
ATOM   1975 N  N   . HIS A 1 278 ? 12.343  0.683   -29.240 1.00 17.02  ? 278  HIS A N   1 
ATOM   1976 C  CA  . HIS A 1 278 ? 12.553  -0.537  -30.008 1.00 21.33  ? 278  HIS A CA  1 
ATOM   1977 C  C   . HIS A 1 278 ? 13.914  -1.134  -29.681 1.00 29.64  ? 278  HIS A C   1 
ATOM   1978 O  O   . HIS A 1 278 ? 14.908  -0.412  -29.565 1.00 28.35  ? 278  HIS A O   1 
ATOM   1979 C  CB  . HIS A 1 278 ? 12.446  -0.277  -31.518 1.00 22.42  ? 278  HIS A CB  1 
ATOM   1980 C  CG  . HIS A 1 278 ? 11.161  0.374   -31.925 1.00 24.98  ? 278  HIS A CG  1 
ATOM   1981 N  ND1 . HIS A 1 278 ? 10.971  1.742   -31.866 1.00 25.82  ? 278  HIS A ND1 1 
ATOM   1982 C  CD2 . HIS A 1 278 ? 10.002  -0.152  -32.396 1.00 19.39  ? 278  HIS A CD2 1 
ATOM   1983 C  CE1 . HIS A 1 278 ? 9.745   2.027   -32.274 1.00 24.89  ? 278  HIS A CE1 1 
ATOM   1984 N  NE2 . HIS A 1 278 ? 9.138   0.898   -32.601 1.00 24.55  ? 278  HIS A NE2 1 
ATOM   1985 N  N   . HIS A 1 279 ? 13.945  -2.457  -29.542 1.00 33.77  ? 279  HIS A N   1 
ATOM   1986 C  CA  . HIS A 1 279 ? 15.169  -3.198  -29.269 1.00 40.48  ? 279  HIS A CA  1 
ATOM   1987 C  C   . HIS A 1 279 ? 16.034  -3.348  -30.514 1.00 45.45  ? 279  HIS A C   1 
ATOM   1988 O  O   . HIS A 1 279 ? 17.186  -3.773  -30.413 1.00 47.48  ? 279  HIS A O   1 
ATOM   1989 C  CB  . HIS A 1 279 ? 14.833  -4.583  -28.712 1.00 45.64  ? 279  HIS A CB  1 
ATOM   1990 C  CG  . HIS A 1 279 ? 14.100  -4.546  -27.407 1.00 52.04  ? 279  HIS A CG  1 
ATOM   1991 N  ND1 . HIS A 1 279 ? 14.722  -4.247  -26.214 1.00 55.77  ? 279  HIS A ND1 1 
ATOM   1992 C  CD2 . HIS A 1 279 ? 12.799  -4.768  -27.108 1.00 55.96  ? 279  HIS A CD2 1 
ATOM   1993 C  CE1 . HIS A 1 279 ? 13.835  -4.287  -25.235 1.00 58.03  ? 279  HIS A CE1 1 
ATOM   1994 N  NE2 . HIS A 1 279 ? 12.660  -4.600  -25.751 1.00 58.28  ? 279  HIS A NE2 1 
ATOM   1995 O  OXT . HIS A 1 279 ? 15.606  -3.068  -31.641 1.00 47.92  ? 279  HIS A OXT 1 
HETATM 1996 C  C01 . XK3 B 2 .   ? 28.548  9.085   -24.505 1.00 30.71  ? 1280 XK3 A C01 1 
HETATM 1997 C  C02 . XK3 B 2 .   ? 28.435  8.730   -23.064 1.00 28.19  ? 1280 XK3 A C02 1 
HETATM 1998 C  C03 . XK3 B 2 .   ? 27.846  9.800   -22.215 1.00 26.31  ? 1280 XK3 A C03 1 
HETATM 1999 C  C04 . XK3 B 2 .   ? 28.087  11.428  -22.402 1.00 27.57  ? 1280 XK3 A C04 1 
HETATM 2000 C  C05 . XK3 B 2 .   ? 27.280  12.150  -21.404 1.00 30.81  ? 1280 XK3 A C05 1 
HETATM 2001 S  S06 . XK3 B 2 .   ? 26.466  10.992  -20.500 1.00 28.76  ? 1280 XK3 A S06 1 
HETATM 2002 C  C07 . XK3 B 2 .   ? 26.859  9.603   -21.039 1.00 26.69  ? 1280 XK3 A C07 1 
HETATM 2003 C  C08 . XK3 B 2 .   ? 26.391  8.408   -20.508 1.00 23.69  ? 1280 XK3 A C08 1 
HETATM 2004 C  C09 . XK3 B 2 .   ? 26.370  7.210   -21.244 1.00 22.72  ? 1280 XK3 A C09 1 
HETATM 2005 N  N10 . XK3 B 2 .   ? 25.853  6.073   -20.640 1.00 22.23  ? 1280 XK3 A N10 1 
HETATM 2006 C  C11 . XK3 B 2 .   ? 25.339  6.120   -19.357 1.00 20.41  ? 1280 XK3 A C11 1 
HETATM 2007 N  N12 . XK3 B 2 .   ? 24.753  4.967   -18.764 1.00 23.84  ? 1280 XK3 A N12 1 
HETATM 2008 C  C13 . XK3 B 2 .   ? 25.334  7.332   -18.655 1.00 19.94  ? 1280 XK3 A C13 1 
HETATM 2009 C  C14 . XK3 B 2 .   ? 24.746  7.487   -17.279 1.00 23.29  ? 1280 XK3 A C14 1 
HETATM 2010 C  C15 . XK3 B 2 .   ? 25.403  8.451   -16.279 1.00 26.12  ? 1280 XK3 A C15 1 
HETATM 2011 C  C16 . XK3 B 2 .   ? 25.088  8.177   -14.819 1.00 31.67  ? 1280 XK3 A C16 1 
HETATM 2012 C  C17 . XK3 B 2 .   ? 23.603  7.957   -14.569 1.00 34.60  ? 1280 XK3 A C17 1 
HETATM 2013 C  C18 . XK3 B 2 .   ? 23.100  8.116   -13.184 1.00 44.95  ? 1280 XK3 A C18 1 
HETATM 2014 O  O19 . XK3 B 2 .   ? 23.452  9.077   -12.535 1.00 53.77  ? 1280 XK3 A O19 1 
HETATM 2015 O  O20 . XK3 B 2 .   ? 22.433  7.091   -12.565 1.00 47.01  ? 1280 XK3 A O20 1 
HETATM 2016 C  C21 . XK3 B 2 .   ? 22.976  6.908   -15.502 1.00 31.18  ? 1280 XK3 A C21 1 
HETATM 2017 C  C22 . XK3 B 2 .   ? 23.266  7.170   -16.980 1.00 28.21  ? 1280 XK3 A C22 1 
HETATM 2018 N  N23 . XK3 B 2 .   ? 25.848  8.468   -19.250 1.00 21.54  ? 1280 XK3 A N23 1 
HETATM 2019 CL CL  . CL  C 3 .   ? 8.550   31.959  -31.428 1.00 56.48  ? 1281 CL  A CL  1 
HETATM 2020 CL CL  . CL  D 3 .   ? 18.127  29.000  -33.488 1.00 67.26  ? 1282 CL  A CL  1 
HETATM 2021 O  O   . HOH E 4 .   ? 38.432  -3.392  -13.389 1.00 31.78  ? 2001 HOH A O   1 
HETATM 2022 O  O   . HOH E 4 .   ? 26.769  -7.204  -15.268 1.00 46.67  ? 2002 HOH A O   1 
HETATM 2023 O  O   . HOH E 4 .   ? 43.978  -6.647  -21.101 1.00 45.77  ? 2003 HOH A O   1 
HETATM 2024 O  O   . HOH E 4 .   ? 41.465  -0.806  -17.741 1.00 50.20  ? 2004 HOH A O   1 
HETATM 2025 O  O   . HOH E 4 .   ? 23.360  12.638  -3.992  1.00 47.70  ? 2005 HOH A O   1 
HETATM 2026 O  O   . HOH E 4 .   ? 38.214  10.869  -20.613 1.00 35.50  ? 2006 HOH A O   1 
HETATM 2027 O  O   . HOH E 4 .   ? 31.200  11.011  -7.494  1.00 58.39  ? 2007 HOH A O   1 
HETATM 2028 O  O   . HOH E 4 .   ? 31.575  1.539   -27.661 1.00 35.18  ? 2008 HOH A O   1 
HETATM 2029 O  O   . HOH E 4 .   ? 22.777  10.113  -3.329  1.00 67.09  ? 2009 HOH A O   1 
HETATM 2030 O  O   . HOH E 4 .   ? 28.387  12.117  -16.787 1.00 50.45  ? 2010 HOH A O   1 
HETATM 2031 O  O   . HOH E 4 .   ? 37.113  -8.224  -23.918 1.00 49.26  ? 2011 HOH A O   1 
HETATM 2032 O  O   . HOH E 4 .   ? 24.099  -8.466  -20.232 1.00 52.42  ? 2012 HOH A O   1 
HETATM 2033 O  O   . HOH E 4 .   ? 16.597  -2.580  -20.958 1.00 46.49  ? 2013 HOH A O   1 
HETATM 2034 O  O   . HOH E 4 .   ? 25.207  -1.534  -22.252 1.00 31.75  ? 2014 HOH A O   1 
HETATM 2035 O  O   . HOH E 4 .   ? 28.336  -4.158  -26.348 1.00 28.60  ? 2015 HOH A O   1 
HETATM 2036 O  O   . HOH E 4 .   ? 38.385  2.744   -11.882 1.00 35.46  ? 2016 HOH A O   1 
HETATM 2037 O  O   . HOH E 4 .   ? 24.813  15.657  -27.813 1.00 32.54  ? 2017 HOH A O   1 
HETATM 2038 O  O   . HOH E 4 .   ? 26.784  13.970  -24.718 1.00 33.92  ? 2018 HOH A O   1 
HETATM 2039 O  O   . HOH E 4 .   ? 27.493  16.996  -27.275 1.00 42.12  ? 2019 HOH A O   1 
HETATM 2040 O  O   . HOH E 4 .   ? 32.953  9.392   1.498   1.00 45.50  ? 2020 HOH A O   1 
HETATM 2041 O  O   . HOH E 4 .   ? -5.625  15.695  -34.516 1.00 54.20  ? 2021 HOH A O   1 
HETATM 2042 O  O   . HOH E 4 .   ? 18.960  29.657  -28.731 1.00 42.44  ? 2022 HOH A O   1 
HETATM 2043 O  O   . HOH E 4 .   ? 11.534  31.010  -28.565 1.00 43.33  ? 2023 HOH A O   1 
HETATM 2044 O  O   . HOH E 4 .   ? 32.814  4.631   5.936   1.00 44.90  ? 2024 HOH A O   1 
HETATM 2045 O  O   . HOH E 4 .   ? 19.350  17.745  -35.240 1.00 58.26  ? 2025 HOH A O   1 
HETATM 2046 O  O   . HOH E 4 .   ? 3.858   14.530  -36.313 1.00 43.75  ? 2026 HOH A O   1 
HETATM 2047 O  O   . HOH E 4 .   ? 7.799   16.068  -38.508 1.00 22.42  ? 2027 HOH A O   1 
HETATM 2048 O  O   . HOH E 4 .   ? 11.529  14.022  -39.564 1.00 46.86  ? 2028 HOH A O   1 
HETATM 2049 O  O   . HOH E 4 .   ? 28.657  -0.742  14.419  1.00 54.48  ? 2029 HOH A O   1 
HETATM 2050 O  O   . HOH E 4 .   ? 31.661  3.528   9.020   1.00 49.02  ? 2030 HOH A O   1 
HETATM 2051 O  O   . HOH E 4 .   ? 23.282  6.084   -5.433  1.00 50.43  ? 2031 HOH A O   1 
HETATM 2052 O  O   . HOH E 4 .   ? 20.214  9.562   -3.638  1.00 51.78  ? 2032 HOH A O   1 
HETATM 2053 O  O   . HOH E 4 .   ? 25.634  12.209  -16.231 1.00 69.96  ? 2033 HOH A O   1 
HETATM 2054 O  O   . HOH E 4 .   ? 20.487  -4.562  -2.796  1.00 62.98  ? 2034 HOH A O   1 
HETATM 2055 O  O   . HOH E 4 .   ? 17.433  -1.278  -13.439 1.00 45.89  ? 2035 HOH A O   1 
HETATM 2056 O  O   . HOH E 4 .   ? 15.272  -0.655  -16.503 1.00 17.75  ? 2036 HOH A O   1 
HETATM 2057 O  O   . HOH E 4 .   ? 15.382  -3.068  -18.139 1.00 46.15  ? 2037 HOH A O   1 
HETATM 2058 O  O   . HOH E 4 .   ? 8.528   3.190   -25.143 1.00 23.22  ? 2038 HOH A O   1 
HETATM 2059 O  O   . HOH E 4 .   ? 15.922  21.760  -15.107 1.00 37.76  ? 2039 HOH A O   1 
HETATM 2060 O  O   . HOH E 4 .   ? 37.755  0.995   -4.485  1.00 50.84  ? 2040 HOH A O   1 
HETATM 2061 O  O   . HOH E 4 .   ? 21.828  0.515   -23.840 1.00 44.91  ? 2041 HOH A O   1 
HETATM 2062 O  O   . HOH E 4 .   ? 5.269   37.142  -17.152 1.00 37.30  ? 2042 HOH A O   1 
HETATM 2063 O  O   . HOH E 4 .   ? -2.115  32.406  -19.534 1.00 32.49  ? 2043 HOH A O   1 
HETATM 2064 O  O   . HOH E 4 .   ? -1.915  27.987  -20.415 1.00 42.08  ? 2044 HOH A O   1 
HETATM 2065 O  O   . HOH E 4 .   ? 8.054   35.592  -21.489 1.00 41.16  ? 2045 HOH A O   1 
HETATM 2066 O  O   . HOH E 4 .   ? 11.345  37.537  -26.358 1.00 23.77  ? 2046 HOH A O   1 
HETATM 2067 O  O   . HOH E 4 .   ? 26.839  0.238   -31.530 1.00 38.65  ? 2047 HOH A O   1 
HETATM 2068 O  O   . HOH E 4 .   ? 24.113  2.635   -26.471 1.00 22.88  ? 2048 HOH A O   1 
HETATM 2069 O  O   . HOH E 4 .   ? 1.877   24.494  -38.527 1.00 51.19  ? 2049 HOH A O   1 
HETATM 2070 O  O   . HOH E 4 .   ? 3.788   21.136  -38.912 1.00 40.52  ? 2050 HOH A O   1 
HETATM 2071 O  O   . HOH E 4 .   ? 23.246  12.293  -28.922 1.00 44.43  ? 2051 HOH A O   1 
HETATM 2072 O  O   . HOH E 4 .   ? 24.220  13.937  -25.846 1.00 29.61  ? 2052 HOH A O   1 
HETATM 2073 O  O   . HOH E 4 .   ? -2.425  22.120  -38.566 1.00 43.94  ? 2053 HOH A O   1 
HETATM 2074 O  O   . HOH E 4 .   ? 1.300   20.153  -39.193 1.00 46.82  ? 2054 HOH A O   1 
HETATM 2075 O  O   . HOH E 4 .   ? -4.257  25.214  -22.554 1.00 24.62  ? 2055 HOH A O   1 
HETATM 2076 O  O   . HOH E 4 .   ? -7.513  15.031  -23.560 1.00 32.39  ? 2056 HOH A O   1 
HETATM 2077 O  O   . HOH E 4 .   ? 26.824  19.476  -26.274 1.00 42.45  ? 2057 HOH A O   1 
HETATM 2078 O  O   . HOH E 4 .   ? -5.728  29.734  -13.105 1.00 41.84  ? 2058 HOH A O   1 
HETATM 2079 O  O   . HOH E 4 .   ? 21.319  19.025  -31.086 1.00 37.46  ? 2059 HOH A O   1 
HETATM 2080 O  O   . HOH E 4 .   ? -2.651  11.856  -13.098 1.00 48.49  ? 2060 HOH A O   1 
HETATM 2081 O  O   . HOH E 4 .   ? -5.838  13.437  -27.314 1.00 33.15  ? 2061 HOH A O   1 
HETATM 2082 O  O   . HOH E 4 .   ? -2.155  15.427  -34.644 1.00 60.64  ? 2062 HOH A O   1 
HETATM 2083 O  O   . HOH E 4 .   ? -5.421  16.660  -31.547 1.00 36.47  ? 2063 HOH A O   1 
HETATM 2084 O  O   . HOH E 4 .   ? 26.112  26.779  -27.508 1.00 42.35  ? 2064 HOH A O   1 
HETATM 2085 O  O   . HOH E 4 .   ? 20.343  20.683  -32.895 1.00 37.77  ? 2065 HOH A O   1 
HETATM 2086 O  O   . HOH E 4 .   ? 22.655  21.471  -37.531 1.00 56.16  ? 2066 HOH A O   1 
HETATM 2087 O  O   . HOH E 4 .   ? 17.583  29.022  -30.864 1.00 59.73  ? 2067 HOH A O   1 
HETATM 2088 O  O   . HOH E 4 .   ? 16.734  25.378  -36.989 1.00 44.06  ? 2068 HOH A O   1 
HETATM 2089 O  O   . HOH E 4 .   ? 13.939  29.677  -29.664 1.00 20.38  ? 2069 HOH A O   1 
HETATM 2090 O  O   . HOH E 4 .   ? 14.907  22.560  -31.078 1.00 23.70  ? 2070 HOH A O   1 
HETATM 2091 O  O   . HOH E 4 .   ? 15.514  17.308  -40.692 1.00 48.51  ? 2071 HOH A O   1 
HETATM 2092 O  O   . HOH E 4 .   ? 16.784  16.103  -34.483 1.00 36.18  ? 2072 HOH A O   1 
HETATM 2093 O  O   . HOH E 4 .   ? 10.784  15.710  -37.936 1.00 23.56  ? 2073 HOH A O   1 
HETATM 2094 O  O   . HOH E 4 .   ? 6.675   14.731  -36.442 1.00 23.88  ? 2074 HOH A O   1 
HETATM 2095 O  O   . HOH E 4 .   ? 4.962   10.998  -37.074 1.00 14.39  ? 2075 HOH A O   1 
HETATM 2096 O  O   . HOH E 4 .   ? 11.759  5.693   -31.286 1.00 22.24  ? 2076 HOH A O   1 
HETATM 2097 O  O   . HOH E 4 .   ? 5.063   2.469   -18.724 1.00 18.97  ? 2077 HOH A O   1 
HETATM 2098 O  O   . HOH E 4 .   ? 1.213   4.421   -13.358 1.00 28.31  ? 2078 HOH A O   1 
HETATM 2099 O  O   . HOH E 4 .   ? -2.142  0.363   -18.582 1.00 34.12  ? 2079 HOH A O   1 
HETATM 2100 O  O   . HOH E 4 .   ? -1.890  4.131   -20.317 1.00 24.35  ? 2080 HOH A O   1 
HETATM 2101 O  O   . HOH E 4 .   ? 4.258   1.196   -16.198 1.00 37.43  ? 2081 HOH A O   1 
HETATM 2102 O  O   . HOH E 4 .   ? 17.616  4.387   -13.506 1.00 56.28  ? 2082 HOH A O   1 
HETATM 2103 O  O   . HOH E 4 .   ? 24.102  13.979  -17.600 1.00 24.15  ? 2083 HOH A O   1 
HETATM 2104 O  O   . HOH E 4 .   ? 19.410  19.640  -16.777 1.00 21.50  ? 2084 HOH A O   1 
HETATM 2105 O  O   . HOH E 4 .   ? 19.934  7.020   -31.067 1.00 25.51  ? 2085 HOH A O   1 
HETATM 2106 O  O   . HOH E 4 .   ? 18.447  7.741   -29.163 1.00 39.18  ? 2086 HOH A O   1 
HETATM 2107 O  O   . HOH E 4 .   ? 20.173  0.384   -25.739 1.00 35.02  ? 2087 HOH A O   1 
HETATM 2108 O  O   . HOH E 4 .   ? 22.050  1.020   -27.901 1.00 28.12  ? 2088 HOH A O   1 
HETATM 2109 O  O   . HOH E 4 .   ? 15.978  1.181   -32.893 1.00 30.14  ? 2089 HOH A O   1 
HETATM 2110 O  O   . HOH E 4 .   ? 13.716  3.192   -33.814 1.00 21.29  ? 2090 HOH A O   1 
HETATM 2111 O  O   . HOH E 4 .   ? 14.704  -0.526  -25.105 1.00 50.47  ? 2091 HOH A O   1 
HETATM 2112 O  O   . HOH E 4 .   ? 16.452  0.053   -20.191 1.00 25.64  ? 2092 HOH A O   1 
HETATM 2113 O  O   . HOH E 4 .   ? 17.344  -0.897  -24.697 1.00 37.02  ? 2093 HOH A O   1 
HETATM 2114 O  O   . HOH E 4 .   ? 16.944  8.711   -5.876  1.00 41.77  ? 2094 HOH A O   1 
HETATM 2115 O  O   . HOH E 4 .   ? 21.841  27.896  -1.735  1.00 38.39  ? 2095 HOH A O   1 
HETATM 2116 O  O   . HOH E 4 .   ? 14.331  22.874  -11.968 1.00 36.17  ? 2096 HOH A O   1 
HETATM 2117 O  O   . HOH E 4 .   ? 2.665   20.974  -2.341  1.00 43.85  ? 2097 HOH A O   1 
HETATM 2118 O  O   . HOH E 4 .   ? 4.156   17.314  -4.669  1.00 51.31  ? 2098 HOH A O   1 
HETATM 2119 O  O   . HOH E 4 .   ? -6.668  13.844  -15.132 1.00 42.37  ? 2099 HOH A O   1 
HETATM 2120 O  O   . HOH E 4 .   ? 5.464   11.005  -9.379  1.00 35.79  ? 2100 HOH A O   1 
HETATM 2121 O  O   . HOH E 4 .   ? 8.501   10.851  -10.478 1.00 46.92  ? 2101 HOH A O   1 
HETATM 2122 O  O   . HOH E 4 .   ? 8.453   26.089  -13.898 1.00 26.96  ? 2102 HOH A O   1 
HETATM 2123 O  O   . HOH E 4 .   ? 19.506  21.783  -20.596 1.00 46.18  ? 2103 HOH A O   1 
HETATM 2124 O  O   . HOH E 4 .   ? 16.922  23.466  -17.531 1.00 51.23  ? 2104 HOH A O   1 
HETATM 2125 O  O   . HOH E 4 .   ? 18.094  25.774  -18.683 1.00 37.94  ? 2105 HOH A O   1 
HETATM 2126 O  O   . HOH E 4 .   ? 18.595  26.223  -22.764 1.00 51.91  ? 2106 HOH A O   1 
HETATM 2127 O  O   . HOH E 4 .   ? 11.134  31.453  -23.798 1.00 37.22  ? 2107 HOH A O   1 
HETATM 2128 O  O   . HOH E 4 .   ? 8.961   32.201  -22.758 1.00 15.41  ? 2108 HOH A O   1 
HETATM 2129 O  O   . HOH E 4 .   ? 11.531  27.596  -17.104 1.00 29.85  ? 2109 HOH A O   1 
HETATM 2130 O  O   . HOH E 4 .   ? 10.443  33.891  -18.998 1.00 35.82  ? 2110 HOH A O   1 
HETATM 2131 O  O   . HOH E 4 .   ? 15.060  39.320  -10.134 1.00 46.22  ? 2111 HOH A O   1 
HETATM 2132 O  O   . HOH E 4 .   ? 10.398  32.621  -4.595  1.00 64.25  ? 2112 HOH A O   1 
HETATM 2133 O  O   . HOH E 4 .   ? 14.958  38.038  -16.975 1.00 37.58  ? 2113 HOH A O   1 
HETATM 2134 O  O   . HOH E 4 .   ? 9.156   38.209  -11.851 1.00 42.55  ? 2114 HOH A O   1 
HETATM 2135 O  O   . HOH E 4 .   ? 5.538   30.045  -8.280  1.00 48.09  ? 2115 HOH A O   1 
HETATM 2136 O  O   . HOH E 4 .   ? 4.899   34.260  -17.204 1.00 16.22  ? 2116 HOH A O   1 
HETATM 2137 O  O   . HOH E 4 .   ? 3.703   36.995  -7.618  1.00 77.12  ? 2117 HOH A O   1 
HETATM 2138 O  O   . HOH E 4 .   ? 8.101   36.410  -6.545  1.00 45.03  ? 2118 HOH A O   1 
HETATM 2139 O  O   . HOH E 4 .   ? -0.301  28.726  -18.150 1.00 23.03  ? 2119 HOH A O   1 
HETATM 2140 O  O   . HOH E 4 .   ? 0.003   31.199  -21.298 1.00 32.41  ? 2120 HOH A O   1 
HETATM 2141 O  O   . HOH E 4 .   ? 7.897   33.316  -19.414 1.00 25.07  ? 2121 HOH A O   1 
HETATM 2142 O  O   . HOH E 4 .   ? 8.799   37.123  -24.995 1.00 21.51  ? 2122 HOH A O   1 
HETATM 2143 O  O   . HOH E 4 .   ? 9.678   29.317  -27.833 1.00 27.32  ? 2123 HOH A O   1 
HETATM 2144 O  O   . HOH E 4 .   ? 3.278   26.465  -37.310 1.00 30.18  ? 2124 HOH A O   1 
HETATM 2145 O  O   . HOH E 4 .   ? 4.316   23.538  -38.913 1.00 38.44  ? 2125 HOH A O   1 
HETATM 2146 O  O   . HOH E 4 .   ? 9.920   30.411  -34.951 1.00 23.11  ? 2126 HOH A O   1 
HETATM 2147 O  O   . HOH E 4 .   ? 6.560   26.705  -40.742 1.00 49.92  ? 2127 HOH A O   1 
HETATM 2148 O  O   . HOH E 4 .   ? 10.654  19.343  -37.570 1.00 32.25  ? 2128 HOH A O   1 
HETATM 2149 O  O   . HOH E 4 .   ? 10.813  28.068  -36.624 1.00 17.84  ? 2129 HOH A O   1 
HETATM 2150 O  O   . HOH E 4 .   ? 7.244   20.132  -37.437 1.00 31.50  ? 2130 HOH A O   1 
HETATM 2151 O  O   . HOH E 4 .   ? 13.436  25.476  -38.643 1.00 52.11  ? 2131 HOH A O   1 
HETATM 2152 O  O   . HOH E 4 .   ? 0.255   23.079  -37.373 1.00 43.32  ? 2132 HOH A O   1 
HETATM 2153 O  O   . HOH E 4 .   ? -0.801  28.773  -36.732 1.00 35.40  ? 2133 HOH A O   1 
HETATM 2154 O  O   . HOH E 4 .   ? -0.316  27.901  -32.148 1.00 17.72  ? 2134 HOH A O   1 
HETATM 2155 O  O   . HOH E 4 .   ? 1.433   28.269  -36.492 1.00 42.12  ? 2135 HOH A O   1 
HETATM 2156 O  O   . HOH E 4 .   ? -2.294  18.112  -29.254 1.00 23.87  ? 2136 HOH A O   1 
HETATM 2157 O  O   . HOH E 4 .   ? 0.211   17.504  -36.586 1.00 42.96  ? 2137 HOH A O   1 
HETATM 2158 O  O   . HOH E 4 .   ? -1.175  25.505  -30.762 1.00 18.74  ? 2138 HOH A O   1 
HETATM 2159 O  O   . HOH E 4 .   ? -3.266  24.315  -24.964 1.00 38.40  ? 2139 HOH A O   1 
HETATM 2160 O  O   . HOH E 4 .   ? -7.759  20.470  -29.285 1.00 58.46  ? 2140 HOH A O   1 
HETATM 2161 O  O   . HOH E 4 .   ? -5.852  24.731  -28.907 1.00 22.72  ? 2141 HOH A O   1 
HETATM 2162 O  O   . HOH E 4 .   ? -4.198  21.806  -31.714 1.00 37.59  ? 2142 HOH A O   1 
HETATM 2163 O  O   . HOH E 4 .   ? -6.249  24.520  -26.059 1.00 34.03  ? 2143 HOH A O   1 
HETATM 2164 O  O   . HOH E 4 .   ? -2.342  25.526  -20.648 1.00 33.96  ? 2144 HOH A O   1 
HETATM 2165 O  O   . HOH E 4 .   ? -5.975  17.513  -21.423 1.00 44.20  ? 2145 HOH A O   1 
HETATM 2166 O  O   . HOH E 4 .   ? -5.161  28.082  -16.069 1.00 39.88  ? 2146 HOH A O   1 
HETATM 2167 O  O   . HOH E 4 .   ? -2.647  28.327  -17.117 1.00 23.03  ? 2147 HOH A O   1 
HETATM 2168 O  O   . HOH E 4 .   ? -1.553  27.371  -9.811  1.00 40.47  ? 2148 HOH A O   1 
HETATM 2169 O  O   . HOH E 4 .   ? -9.052  28.689  -8.633  1.00 52.86  ? 2149 HOH A O   1 
HETATM 2170 O  O   . HOH E 4 .   ? -8.565  16.499  -14.289 1.00 51.99  ? 2150 HOH A O   1 
HETATM 2171 O  O   . HOH E 4 .   ? -8.215  26.082  -8.142  1.00 57.41  ? 2151 HOH A O   1 
HETATM 2172 O  O   . HOH E 4 .   ? -10.863 26.043  -11.738 1.00 61.31  ? 2152 HOH A O   1 
HETATM 2173 O  O   . HOH E 4 .   ? -10.734 26.786  -14.816 1.00 22.67  ? 2153 HOH A O   1 
HETATM 2174 O  O   . HOH E 4 .   ? -7.632  17.790  -18.216 1.00 51.42  ? 2154 HOH A O   1 
HETATM 2175 O  O   . HOH E 4 .   ? -6.667  9.814   -17.341 1.00 44.09  ? 2155 HOH A O   1 
HETATM 2176 O  O   . HOH E 4 .   ? -0.749  10.932  -14.953 1.00 30.56  ? 2156 HOH A O   1 
HETATM 2177 O  O   . HOH E 4 .   ? -3.621  5.977   -23.590 1.00 22.06  ? 2157 HOH A O   1 
HETATM 2178 O  O   . HOH E 4 .   ? -3.585  14.659  -25.222 1.00 24.93  ? 2158 HOH A O   1 
HETATM 2179 O  O   . HOH E 4 .   ? -6.548  15.884  -16.694 1.00 57.47  ? 2159 HOH A O   1 
HETATM 2180 O  O   . HOH E 4 .   ? -0.064  5.759   -27.511 1.00 14.44  ? 2160 HOH A O   1 
HETATM 2181 O  O   . HOH E 4 .   ? -6.482  12.573  -24.682 1.00 25.29  ? 2161 HOH A O   1 
HETATM 2182 O  O   . HOH E 4 .   ? -2.701  15.859  -31.992 1.00 30.19  ? 2162 HOH A O   1 
HETATM 2183 O  O   . HOH E 4 .   ? 0.275   11.941  -36.615 1.00 43.69  ? 2163 HOH A O   1 
HETATM 2184 O  O   . HOH E 4 .   ? 2.946   12.039  -35.631 1.00 18.59  ? 2164 HOH A O   1 
HETATM 2185 O  O   . HOH E 4 .   ? 0.454   5.287   -30.034 1.00 12.11  ? 2165 HOH A O   1 
HETATM 2186 O  O   . HOH E 4 .   ? 7.914   -2.532  -32.215 1.00 16.59  ? 2166 HOH A O   1 
HETATM 2187 O  O   . HOH E 4 .   ? 7.009   1.117   -36.152 1.00 23.49  ? 2167 HOH A O   1 
HETATM 2188 O  O   . HOH E 4 .   ? 11.135  3.988   -34.617 1.00 20.45  ? 2168 HOH A O   1 
HETATM 2189 O  O   . HOH E 4 .   ? 4.167   4.393   -36.067 1.00 13.38  ? 2169 HOH A O   1 
HETATM 2190 O  O   . HOH E 4 .   ? 7.155   -0.154  -28.954 1.00 16.19  ? 2170 HOH A O   1 
HETATM 2191 O  O   . HOH E 4 .   ? 9.290   -2.450  -29.207 1.00 26.26  ? 2171 HOH A O   1 
HETATM 2192 O  O   . HOH E 4 .   ? 6.609   1.074   -25.071 1.00 20.08  ? 2172 HOH A O   1 
HETATM 2193 O  O   . HOH E 4 .   ? 13.128  3.260   -31.122 1.00 18.66  ? 2173 HOH A O   1 
HETATM 2194 O  O   . HOH E 4 .   ? 10.050  1.819   -35.923 1.00 25.81  ? 2174 HOH A O   1 
HETATM 2195 O  O   . HOH E 4 .   ? 10.260  -4.393  -26.277 1.00 35.47  ? 2175 HOH A O   1 
HETATM 2196 O  O   . HOH E 4 .   ? 10.528  -4.405  -23.863 1.00 30.66  ? 2176 HOH A O   1 
HETATM 2197 O  O   . HOH E 4 .   ? 15.705  -1.216  -33.834 1.00 47.63  ? 2177 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 3   ? 0.6998 0.8176 0.8748 0.0087  -0.0709 0.1572  3    SER A N   
2    C CA  . SER A 3   ? 0.7224 0.8328 0.9110 0.0095  -0.0727 0.1565  3    SER A CA  
3    C C   . SER A 3   ? 0.6750 0.7908 0.8548 0.0119  -0.0709 0.1503  3    SER A C   
4    O O   . SER A 3   ? 0.7154 0.8495 0.8908 0.0139  -0.0691 0.1553  3    SER A O   
5    C CB  . SER A 3   ? 0.7583 0.8458 0.9492 0.0075  -0.0754 0.1474  3    SER A CB  
6    O OG  . SER A 3   ? 0.7793 0.8632 0.9810 0.0051  -0.0782 0.1538  3    SER A OG  
7    N N   . ARG A 4   ? 0.5934 0.6947 0.7712 0.0120  -0.0715 0.1395  4    ARG A N   
8    C CA  . ARG A 4   ? 0.5324 0.6398 0.7046 0.0141  -0.0703 0.1339  4    ARG A CA  
9    C C   . ARG A 4   ? 0.4552 0.5469 0.6129 0.0134  -0.0698 0.1183  4    ARG A C   
10   O O   . ARG A 4   ? 0.4032 0.4762 0.5616 0.0126  -0.0708 0.1123  4    ARG A O   
11   C CB  . ARG A 4   ? 0.5210 0.6342 0.7138 0.0167  -0.0712 0.1412  4    ARG A CB  
12   N N   . ALA A 5   ? 0.4383 0.5382 0.5831 0.0140  -0.0684 0.1121  5    ALA A N   
13   C CA  . ALA A 5   ? 0.4201 0.5074 0.5506 0.0135  -0.0676 0.0981  5    ALA A CA  
14   C C   . ALA A 5   ? 0.4065 0.4810 0.5469 0.0136  -0.0670 0.0923  5    ALA A C   
15   O O   . ALA A 5   ? 0.3805 0.4358 0.5103 0.0114  -0.0642 0.0810  5    ALA A O   
16   C CB  . ALA A 5   ? 0.4245 0.5258 0.5426 0.0136  -0.0666 0.0935  5    ALA A CB  
17   N N   . GLU A 6   ? 0.4100 0.4939 0.5693 0.0157  -0.0681 0.0997  6    GLU A N   
18   C CA  . GLU A 6   ? 0.3962 0.4683 0.5651 0.0155  -0.0657 0.0945  6    GLU A CA  
19   C C   . GLU A 6   ? 0.3863 0.4350 0.5578 0.0146  -0.0658 0.0913  6    GLU A C   
20   O O   . GLU A 6   ? 0.4168 0.4508 0.5911 0.0143  -0.0631 0.0838  6    GLU A O   
21   C CB  . GLU A 6   ? 0.3821 0.4703 0.5720 0.0191  -0.0669 0.1054  6    GLU A CB  
22   N N   . ASP A 7   ? 0.3363 0.3824 0.5069 0.0143  -0.0688 0.0968  7    ASP A N   
23   C CA  . ASP A 7   ? 0.3397 0.3656 0.5124 0.0128  -0.0698 0.0936  7    ASP A CA  
24   C C   . ASP A 7   ? 0.3475 0.3560 0.4998 0.0104  -0.0673 0.0795  7    ASP A C   
25   O O   . ASP A 7   ? 0.3498 0.3411 0.5011 0.0090  -0.0679 0.0746  7    ASP A O   
26   C CB  . ASP A 7   ? 0.3622 0.3934 0.5414 0.0128  -0.0741 0.1047  7    ASP A CB  
27   C CG  . ASP A 7   ? 0.4267 0.4691 0.6284 0.0141  -0.0754 0.1186  7    ASP A CG  
28   O OD1 . ASP A 7   ? 0.3874 0.4259 0.6024 0.0166  -0.0745 0.1194  7    ASP A OD1 
29   O OD2 . ASP A 7   ? 0.4497 0.5042 0.6552 0.0126  -0.0762 0.1286  7    ASP A OD2 
30   N N   . TYR A 8   ? 0.3328 0.3460 0.4689 0.0099  -0.0643 0.0729  8    TYR A N   
31   C CA  . TYR A 8   ? 0.3216 0.3195 0.4371 0.0082  -0.0612 0.0607  8    TYR A CA  
32   C C   . TYR A 8   ? 0.3094 0.3050 0.4165 0.0072  -0.0561 0.0508  8    TYR A C   
33   O O   . TYR A 8   ? 0.2660 0.2769 0.3787 0.0074  -0.0555 0.0536  8    TYR A O   
34   C CB  . TYR A 8   ? 0.2735 0.2780 0.3740 0.0083  -0.0621 0.0627  8    TYR A CB  
35   C CG  . TYR A 8   ? 0.3031 0.3131 0.4111 0.0092  -0.0670 0.0731  8    TYR A CG  
36   C CD1 . TYR A 8   ? 0.3111 0.3405 0.4309 0.0105  -0.0697 0.0857  8    TYR A CD1 
37   C CD2 . TYR A 8   ? 0.3290 0.3258 0.4318 0.0083  -0.0684 0.0703  8    TYR A CD2 
38   C CE1 . TYR A 8   ? 0.3295 0.3637 0.4558 0.0086  -0.0714 0.0941  8    TYR A CE1 
39   C CE2 . TYR A 8   ? 0.3220 0.3248 0.4323 0.0081  -0.0726 0.0796  8    TYR A CE2 
40   C CZ  . TYR A 8   ? 0.3737 0.3950 0.4959 0.0072  -0.0731 0.0909  8    TYR A CZ  
41   O OH  . TYR A 8   ? 0.4448 0.4723 0.5749 0.0052  -0.0753 0.0993  8    TYR A OH  
42   N N   . GLU A 9   ? 0.3577 0.3353 0.4513 0.0060  -0.0523 0.0395  9    GLU A N   
43   C CA  . GLU A 9   ? 0.3919 0.3664 0.4763 0.0046  -0.0467 0.0299  9    GLU A CA  
44   C C   . GLU A 9   ? 0.3474 0.3142 0.4087 0.0034  -0.0432 0.0224  9    GLU A C   
45   O O   . GLU A 9   ? 0.3213 0.2734 0.3720 0.0040  -0.0427 0.0185  9    GLU A O   
46   C CB  . GLU A 9   ? 0.4699 0.4293 0.5591 0.0048  -0.0437 0.0229  9    GLU A CB  
47   C CG  . GLU A 9   ? 0.5535 0.5145 0.6411 0.0035  -0.0383 0.0161  9    GLU A CG  
48   C CD  . GLU A 9   ? 0.6348 0.5839 0.7307 0.0049  -0.0355 0.0113  9    GLU A CD  
49   O OE1 . GLU A 9   ? 0.6304 0.5688 0.7325 0.0066  -0.0380 0.0127  9    GLU A OE1 
50   O OE2 . GLU A 9   ? 0.6831 0.6339 0.7797 0.0040  -0.0308 0.0061  9    GLU A OE2 
51   N N   . VAL A 10  ? 0.3114 0.2878 0.3646 0.0017  -0.0407 0.0204  10   VAL A N   
52   C CA  . VAL A 10  ? 0.3587 0.3257 0.3899 0.0006  -0.0361 0.0127  10   VAL A CA  
53   C C   . VAL A 10  ? 0.4207 0.3688 0.4440 -0.0003 -0.0303 0.0022  10   VAL A C   
54   O O   . VAL A 10  ? 0.4700 0.4182 0.5020 -0.0016 -0.0280 -0.0011 10   VAL A O   
55   C CB  . VAL A 10  ? 0.3952 0.3751 0.4197 -0.0017 -0.0341 0.0112  10   VAL A CB  
56   C CG1 . VAL A 10  ? 0.4079 0.3749 0.4094 -0.0027 -0.0284 0.0029  10   VAL A CG1 
57   C CG2 . VAL A 10  ? 0.3723 0.3724 0.4036 -0.0002 -0.0396 0.0217  10   VAL A CG2 
58   N N   . LEU A 11  ? 0.4227 0.3554 0.4296 0.0010  -0.0278 -0.0024 11   LEU A N   
59   C CA  . LEU A 11  ? 0.4463 0.3610 0.4426 0.0007  -0.0216 -0.0121 11   LEU A CA  
60   C C   . LEU A 11  ? 0.5533 0.4640 0.5328 -0.0015 -0.0148 -0.0185 11   LEU A C   
61   O O   . LEU A 11  ? 0.6083 0.5128 0.5855 -0.0037 -0.0090 -0.0255 11   LEU A O   
62   C CB  . LEU A 11  ? 0.4315 0.3317 0.4192 0.0037  -0.0226 -0.0133 11   LEU A CB  
63   C CG  . LEU A 11  ? 0.3819 0.2819 0.3849 0.0051  -0.0287 -0.0090 11   LEU A CG  
64   C CD1 . LEU A 11  ? 0.3576 0.2457 0.3504 0.0075  -0.0303 -0.0107 11   LEU A CD1 
65   C CD2 . LEU A 11  ? 0.3526 0.2485 0.3676 0.0045  -0.0268 -0.0128 11   LEU A CD2 
66   N N   . TYR A 12  ? 0.5168 0.4304 0.4845 -0.0006 -0.0152 -0.0161 12   TYR A N   
67   C CA  . TYR A 12  ? 0.4879 0.3980 0.4399 -0.0028 -0.0090 -0.0217 12   TYR A CA  
68   C C   . TYR A 12  ? 0.4488 0.3637 0.3899 -0.0007 -0.0105 -0.0174 12   TYR A C   
69   O O   . TYR A 12  ? 0.4232 0.3424 0.3669 0.0028  -0.0158 -0.0102 12   TYR A O   
70   C CB  . TYR A 12  ? 0.4786 0.3681 0.4155 -0.0026 -0.0010 -0.0303 12   TYR A CB  
71   C CG  . TYR A 12  ? 0.4458 0.3222 0.3718 0.0023  -0.0011 -0.0296 12   TYR A CG  
72   C CD1 . TYR A 12  ? 0.4241 0.2951 0.3331 0.0053  0.0009  -0.0285 12   TYR A CD1 
73   C CD2 . TYR A 12  ? 0.4761 0.3486 0.4090 0.0042  -0.0031 -0.0290 12   TYR A CD2 
74   C CE1 . TYR A 12  ? 0.4262 0.2909 0.3265 0.0099  0.0005  -0.0256 12   TYR A CE1 
75   C CE2 . TYR A 12  ? 0.4795 0.3464 0.4033 0.0081  -0.0039 -0.0270 12   TYR A CE2 
76   C CZ  . TYR A 12  ? 0.4839 0.3470 0.3917 0.0109  -0.0023 -0.0252 12   TYR A CZ  
77   O OH  . TYR A 12  ? 0.5737 0.4315 0.4727 0.0149  -0.0035 -0.0234 12   TYR A OH  
78   N N   . THR A 13  ? 0.4046 0.3185 0.3335 -0.0030 -0.0055 -0.0221 13   THR A N   
79   C CA  . THR A 13  ? 0.4339 0.3520 0.3509 -0.0009 -0.0058 -0.0192 13   THR A CA  
80   C C   . THR A 13  ? 0.4212 0.3214 0.3190 0.0033  -0.0008 -0.0213 13   THR A C   
81   O O   . THR A 13  ? 0.3943 0.2779 0.2822 0.0026  0.0061  -0.0284 13   THR A O   
82   C CB  . THR A 13  ? 0.4288 0.3533 0.3410 -0.0057 -0.0024 -0.0243 13   THR A CB  
83   O OG1 . THR A 13  ? 0.4448 0.3892 0.3752 -0.0088 -0.0079 -0.0210 13   THR A OG1 
84   C CG2 . THR A 13  ? 0.4261 0.3523 0.3232 -0.0031 -0.0014 -0.0227 13   THR A CG2 
85   N N   . ILE A 14  ? 0.4535 0.3580 0.3467 0.0081  -0.0041 -0.0144 14   ILE A N   
86   C CA  . ILE A 14  ? 0.5577 0.4480 0.4325 0.0131  0.0003  -0.0151 14   ILE A CA  
87   C C   . ILE A 14  ? 0.6669 0.5530 0.5244 0.0136  0.0066  -0.0184 14   ILE A C   
88   O O   . ILE A 14  ? 0.7230 0.5933 0.5688 0.0128  0.0145  -0.0241 14   ILE A O   
89   C CB  . ILE A 14  ? 0.5479 0.4455 0.4262 0.0183  -0.0060 -0.0060 14   ILE A CB  
90   C CG1 . ILE A 14  ? 0.4538 0.3504 0.3458 0.0179  -0.0110 -0.0046 14   ILE A CG1 
91   C CG2 . ILE A 14  ? 0.6363 0.5228 0.4948 0.0242  -0.0013 -0.0057 14   ILE A CG2 
92   C CD1 . ILE A 14  ? 0.4379 0.3481 0.3424 0.0201  -0.0195 0.0053  14   ILE A CD1 
93   N N   . GLY A 15  ? 0.7157 0.6165 0.5743 0.0148  0.0030  -0.0131 15   GLY A N   
94   C CA  . GLY A 15  ? 0.7960 0.6939 0.6387 0.0153  0.0084  -0.0165 15   GLY A CA  
95   C C   . GLY A 15  ? 0.8749 0.7921 0.7250 0.0123  0.0042  -0.0147 15   GLY A C   
96   O O   . GLY A 15  ? 0.8816 0.8165 0.7491 0.0116  -0.0035 -0.0078 15   GLY A O   
97   N N   . THR A 16  ? 0.9364 0.8499 0.7731 0.0105  0.0096  -0.0209 16   THR A N   
98   C CA  . THR A 16  ? 0.9709 0.9028 0.8111 0.0081  0.0060  -0.0201 16   THR A CA  
99   C C   . THR A 16  ? 1.0056 0.9389 0.8314 0.0142  0.0078  -0.0167 16   THR A C   
100  O O   . THR A 16  ? 1.0290 0.9542 0.8513 0.0209  0.0092  -0.0114 16   THR A O   
101  C CB  . THR A 16  ? 0.9978 0.9272 0.8359 0.0000  0.0100  -0.0311 16   THR A CB  
102  O OG1 . THR A 16  ? 0.9956 0.9432 0.8341 -0.0017 0.0067  -0.0309 16   THR A OG1 
103  C CG2 . THR A 16  ? 1.0285 0.9335 0.8508 -0.0009 0.0200  -0.0388 16   THR A CG2 
104  N N   . ARG A 21  ? 0.5221 0.5326 0.4173 0.0124  -0.0219 0.0135  21   ARG A N   
105  C CA  . ARG A 21  ? 0.5332 0.5274 0.4331 0.0093  -0.0197 0.0081  21   ARG A CA  
106  C C   . ARG A 21  ? 0.5041 0.4964 0.4161 0.0125  -0.0240 0.0162  21   ARG A C   
107  O O   . ARG A 21  ? 0.5165 0.5248 0.4445 0.0139  -0.0305 0.0261  21   ARG A O   
108  C CB  . ARG A 21  ? 0.5517 0.5521 0.4634 0.0027  -0.0206 0.0028  21   ARG A CB  
109  C CG  . ARG A 21  ? 0.5784 0.5615 0.4929 -0.0004 -0.0171 -0.0039 21   ARG A CG  
110  C CD  . ARG A 21  ? 0.6238 0.6138 0.5485 -0.0069 -0.0169 -0.0097 21   ARG A CD  
111  N NE  . ARG A 21  ? 0.6326 0.6452 0.5774 -0.0068 -0.0243 -0.0014 21   ARG A NE  
112  C CZ  . ARG A 21  ? 0.6567 0.6779 0.6158 -0.0109 -0.0256 -0.0032 21   ARG A CZ  
113  N NH1 . ARG A 21  ? 0.6457 0.6552 0.6016 -0.0158 -0.0202 -0.0132 21   ARG A NH1 
114  N NH2 . ARG A 21  ? 0.6766 0.7185 0.6538 -0.0097 -0.0320 0.0056  21   ARG A NH2 
115  N N   . CYS A 22  ? 0.4356 0.4081 0.3399 0.0134  -0.0200 0.0117  22   CYS A N   
116  C CA  A CYS A 22  ? 0.3986 0.3673 0.3121 0.0158  -0.0237 0.0172  22   CYS A CA  
117  C CA  B CYS A 22  ? 0.4002 0.3683 0.3130 0.0159  -0.0235 0.0171  22   CYS A CA  
118  C C   . CYS A 22  ? 0.3779 0.3353 0.2991 0.0121  -0.0226 0.0110  22   CYS A C   
119  O O   . CYS A 22  ? 0.4207 0.3644 0.3320 0.0095  -0.0163 0.0015  22   CYS A O   
120  C CB  A CYS A 22  ? 0.4132 0.3706 0.3112 0.0212  -0.0209 0.0184  22   CYS A CB  
121  C CB  B CYS A 22  ? 0.4145 0.3692 0.3100 0.0210  -0.0196 0.0167  22   CYS A CB  
122  S SG  A CYS A 22  ? 0.3098 0.2844 0.2092 0.0272  -0.0250 0.0306  22   CYS A SG  
123  S SG  B CYS A 22  ? 0.4598 0.4146 0.3640 0.0248  -0.0253 0.0250  22   CYS A SG  
124  N N   . GLN A 23  ? 0.2830 0.2459 0.2223 0.0118  -0.0284 0.0166  23   GLN A N   
125  C CA  . GLN A 23  ? 0.2899 0.2432 0.2376 0.0088  -0.0275 0.0111  23   GLN A CA  
126  C C   . GLN A 23  ? 0.2783 0.2263 0.2353 0.0106  -0.0316 0.0147  23   GLN A C   
127  O O   . GLN A 23  ? 0.2604 0.2188 0.2277 0.0123  -0.0375 0.0239  23   GLN A O   
128  C CB  . GLN A 23  ? 0.3017 0.2685 0.2658 0.0051  -0.0298 0.0119  23   GLN A CB  
129  C CG  . GLN A 23  ? 0.3002 0.2766 0.2577 0.0026  -0.0273 0.0087  23   GLN A CG  
130  C CD  . GLN A 23  ? 0.3225 0.3133 0.2966 -0.0010 -0.0297 0.0094  23   GLN A CD  
131  O OE1 . GLN A 23  ? 0.3166 0.3240 0.3063 0.0004  -0.0356 0.0186  23   GLN A OE1 
132  N NE2 . GLN A 23  ? 0.3689 0.3542 0.3404 -0.0053 -0.0250 0.0001  23   GLN A NE2 
133  N N   . LYS A 24  ? 0.2697 0.2014 0.2229 0.0099  -0.0283 0.0073  24   LYS A N   
134  C CA  . LYS A 24  ? 0.2814 0.2067 0.2433 0.0108  -0.0320 0.0085  24   LYS A CA  
135  C C   . LYS A 24  ? 0.2936 0.2262 0.2767 0.0082  -0.0356 0.0108  24   LYS A C   
136  O O   . LYS A 24  ? 0.3039 0.2370 0.2900 0.0057  -0.0323 0.0061  24   LYS A O   
137  C CB  . LYS A 24  ? 0.3352 0.2409 0.2836 0.0116  -0.0265 -0.0008 24   LYS A CB  
138  C CG  . LYS A 24  ? 0.3869 0.2845 0.3418 0.0124  -0.0300 -0.0017 24   LYS A CG  
139  C CD  . LYS A 24  ? 0.4389 0.3185 0.3767 0.0141  -0.0238 -0.0105 24   LYS A CD  
140  C CE  . LYS A 24  ? 0.4934 0.3641 0.4356 0.0149  -0.0266 -0.0134 24   LYS A CE  
141  N NZ  . LYS A 24  ? 0.5335 0.3941 0.4573 0.0170  -0.0205 -0.0195 24   LYS A NZ  
142  N N   . ILE A 25  ? 0.2797 0.2184 0.2781 0.0088  -0.0420 0.0182  25   ILE A N   
143  C CA  . ILE A 25  ? 0.3107 0.2568 0.3303 0.0072  -0.0454 0.0222  25   ILE A CA  
144  C C   . ILE A 25  ? 0.3268 0.2642 0.3572 0.0073  -0.0491 0.0228  25   ILE A C   
145  O O   . ILE A 25  ? 0.3378 0.2685 0.3616 0.0083  -0.0511 0.0226  25   ILE A O   
146  C CB  . ILE A 25  ? 0.2814 0.2482 0.3131 0.0076  -0.0499 0.0335  25   ILE A CB  
147  C CG1 . ILE A 25  ? 0.2805 0.2516 0.3147 0.0093  -0.0549 0.0419  25   ILE A CG1 
148  C CG2 . ILE A 25  ? 0.2516 0.2281 0.2724 0.0073  -0.0467 0.0324  25   ILE A CG2 
149  C CD1 . ILE A 25  ? 0.2871 0.2785 0.3299 0.0104  -0.0584 0.0535  25   ILE A CD1 
150  N N   . ARG A 26  ? 0.3387 0.2767 0.3859 0.0063  -0.0502 0.0237  26   ARG A N   
151  C CA  . ARG A 26  ? 0.3760 0.3052 0.4352 0.0061  -0.0536 0.0239  26   ARG A CA  
152  C C   . ARG A 26  ? 0.3874 0.3284 0.4697 0.0059  -0.0584 0.0345  26   ARG A C   
153  O O   . ARG A 26  ? 0.4271 0.3761 0.5200 0.0061  -0.0572 0.0371  26   ARG A O   
154  C CB  . ARG A 26  ? 0.4332 0.3473 0.4902 0.0061  -0.0493 0.0136  26   ARG A CB  
155  C CG  . ARG A 26  ? 0.4505 0.3536 0.5183 0.0060  -0.0523 0.0122  26   ARG A CG  
156  C CD  . ARG A 26  ? 0.4797 0.3714 0.5492 0.0066  -0.0477 0.0038  26   ARG A CD  
157  N NE  . ARG A 26  ? 0.4792 0.3564 0.5294 0.0074  -0.0432 -0.0069 26   ARG A NE  
158  C CZ  . ARG A 26  ? 0.5155 0.3889 0.5602 0.0080  -0.0370 -0.0144 26   ARG A CZ  
159  N NH1 . ARG A 26  ? 0.5438 0.4110 0.5707 0.0089  -0.0328 -0.0220 26   ARG A NH1 
160  N NH2 . ARG A 26  ? 0.5242 0.4006 0.5816 0.0081  -0.0347 -0.0131 26   ARG A NH2 
161  N N   . ARG A 27  ? 0.3625 0.3049 0.4527 0.0054  -0.0636 0.0411  27   ARG A N   
162  C CA  . ARG A 27  ? 0.3663 0.3172 0.4789 0.0051  -0.0677 0.0516  27   ARG A CA  
163  C C   . ARG A 27  ? 0.3826 0.3210 0.5076 0.0049  -0.0668 0.0473  27   ARG A C   
164  O O   . ARG A 27  ? 0.4068 0.3287 0.5275 0.0040  -0.0668 0.0391  27   ARG A O   
165  C CB  . ARG A 27  ? 0.3771 0.3309 0.4948 0.0039  -0.0731 0.0588  27   ARG A CB  
166  C CG  . ARG A 27  ? 0.4269 0.3886 0.5683 0.0033  -0.0771 0.0708  27   ARG A CG  
167  C CD  . ARG A 27  ? 0.4558 0.4252 0.6012 0.0019  -0.0819 0.0795  27   ARG A CD  
168  N NE  . ARG A 27  ? 0.4846 0.4403 0.6251 -0.0008 -0.0844 0.0727  27   ARG A NE  
169  C CZ  . ARG A 27  ? 0.4958 0.4569 0.6345 -0.0021 -0.0882 0.0771  27   ARG A CZ  
170  N NH1 . ARG A 27  ? 0.4932 0.4723 0.6342 -0.0007 -0.0894 0.0885  27   ARG A NH1 
171  N NH2 . ARG A 27  ? 0.4984 0.4480 0.6326 -0.0046 -0.0908 0.0700  27   ARG A NH2 
172  N N   . LYS A 28  ? 0.3771 0.3238 0.5169 0.0062  -0.0658 0.0527  28   LYS A N   
173  C CA  . LYS A 28  ? 0.4568 0.3926 0.6086 0.0071  -0.0639 0.0492  28   LYS A CA  
174  C C   . LYS A 28  ? 0.4946 0.4183 0.6597 0.0058  -0.0675 0.0509  28   LYS A C   
175  O O   . LYS A 28  ? 0.4894 0.3963 0.6553 0.0059  -0.0658 0.0424  28   LYS A O   
176  C CB  . LYS A 28  ? 0.4787 0.4290 0.6449 0.0095  -0.0624 0.0567  28   LYS A CB  
177  C CG  . LYS A 28  ? 0.4553 0.4147 0.6105 0.0100  -0.0582 0.0521  28   LYS A CG  
178  C CD  . LYS A 28  ? 0.4593 0.4371 0.6300 0.0123  -0.0580 0.0610  28   LYS A CD  
179  C CE  . LYS A 28  ? 0.4612 0.4466 0.6231 0.0121  -0.0537 0.0545  28   LYS A CE  
180  N NZ  . LYS A 28  ? 0.4680 0.4751 0.6436 0.0142  -0.0543 0.0638  28   LYS A NZ  
181  N N   . SER A 29  ? 0.5268 0.4589 0.7025 0.0045  -0.0722 0.0617  29   SER A N   
182  C CA  . SER A 29  ? 0.5462 0.4677 0.7369 0.0024  -0.0757 0.0643  29   SER A CA  
183  C C   . SER A 29  ? 0.5653 0.4669 0.7456 -0.0001 -0.0765 0.0515  29   SER A C   
184  O O   . SER A 29  ? 0.5894 0.4758 0.7788 -0.0008 -0.0766 0.0471  29   SER A O   
185  C CB  . SER A 29  ? 0.4915 0.4261 0.6930 0.0007  -0.0804 0.0777  29   SER A CB  
186  O OG  . SER A 29  ? 0.4876 0.4266 0.6738 -0.0010 -0.0827 0.0760  29   SER A OG  
187  N N   . ASP A 30  ? 0.5371 0.4387 0.6979 -0.0010 -0.0770 0.0455  30   ASP A N   
188  C CA  . ASP A 30  ? 0.5164 0.4021 0.6661 -0.0031 -0.0785 0.0342  30   ASP A CA  
189  C C   . ASP A 30  ? 0.5013 0.3824 0.6269 -0.0012 -0.0744 0.0236  30   ASP A C   
190  O O   . ASP A 30  ? 0.4605 0.3311 0.5735 -0.0021 -0.0755 0.0149  30   ASP A O   
191  C CB  . ASP A 30  ? 0.5379 0.4281 0.6904 -0.0067 -0.0847 0.0394  30   ASP A CB  
192  C CG  . ASP A 30  ? 0.5666 0.4735 0.7085 -0.0057 -0.0853 0.0459  30   ASP A CG  
193  O OD1 . ASP A 30  ? 0.5619 0.4741 0.6917 -0.0026 -0.0808 0.0443  30   ASP A OD1 
194  O OD2 . ASP A 30  ? 0.5780 0.4929 0.7241 -0.0080 -0.0899 0.0527  30   ASP A OD2 
195  N N   . GLY A 31  ? 0.4839 0.3732 0.6030 0.0013  -0.0698 0.0246  31   GLY A N   
196  C CA  . GLY A 31  ? 0.4555 0.3404 0.5528 0.0030  -0.0650 0.0154  31   GLY A CA  
197  C C   . GLY A 31  ? 0.4841 0.3731 0.5645 0.0029  -0.0663 0.0154  31   GLY A C   
198  O O   . GLY A 31  ? 0.4928 0.3748 0.5542 0.0043  -0.0624 0.0073  31   GLY A O   
199  N N   . LYS A 32  ? 0.4433 0.3438 0.5304 0.0016  -0.0713 0.0250  32   LYS A N   
200  C CA  . LYS A 32  ? 0.4057 0.3113 0.4778 0.0022  -0.0726 0.0261  32   LYS A CA  
201  C C   . LYS A 32  ? 0.3558 0.2672 0.4118 0.0048  -0.0672 0.0252  32   LYS A C   
202  O O   . LYS A 32  ? 0.3728 0.2946 0.4347 0.0053  -0.0655 0.0304  32   LYS A O   
203  C CB  . LYS A 32  ? 0.4187 0.3379 0.5033 0.0005  -0.0786 0.0379  32   LYS A CB  
204  C CG  . LYS A 32  ? 0.4491 0.3749 0.5189 0.0019  -0.0797 0.0398  32   LYS A CG  
205  C CD  . LYS A 32  ? 0.4699 0.4026 0.5512 -0.0008 -0.0864 0.0471  32   LYS A CD  
206  C CE  . LYS A 32  ? 0.4889 0.4278 0.5546 0.0011  -0.0873 0.0481  32   LYS A CE  
207  N NZ  . LYS A 32  ? 0.4894 0.4147 0.5373 0.0024  -0.0858 0.0363  32   LYS A NZ  
208  N N   . ILE A 33  ? 0.3594 0.2641 0.3950 0.0066  -0.0645 0.0187  33   ILE A N   
209  C CA  . ILE A 33  ? 0.4055 0.3129 0.4241 0.0089  -0.0588 0.0171  33   ILE A CA  
210  C C   . ILE A 33  ? 0.3706 0.2927 0.3861 0.0103  -0.0607 0.0263  33   ILE A C   
211  O O   . ILE A 33  ? 0.3777 0.3020 0.3897 0.0111  -0.0641 0.0292  33   ILE A O   
212  C CB  . ILE A 33  ? 0.3093 0.2021 0.3066 0.0110  -0.0538 0.0067  33   ILE A CB  
213  C CG1 . ILE A 33  ? 0.3508 0.2297 0.3502 0.0103  -0.0510 -0.0024 33   ILE A CG1 
214  C CG2 . ILE A 33  ? 0.2703 0.1642 0.2511 0.0130  -0.0474 0.0052  33   ILE A CG2 
215  C CD1 . ILE A 33  ? 0.3198 0.2011 0.3260 0.0094  -0.0466 -0.0033 33   ILE A CD1 
216  N N   . LEU A 34  ? 0.3450 0.2780 0.3620 0.0106  -0.0587 0.0307  34   LEU A N   
217  C CA  . LEU A 34  ? 0.2820 0.2296 0.2959 0.0124  -0.0600 0.0394  34   LEU A CA  
218  C C   . LEU A 34  ? 0.2994 0.2479 0.2973 0.0139  -0.0538 0.0357  34   LEU A C   
219  O O   . LEU A 34  ? 0.3193 0.2563 0.3076 0.0134  -0.0484 0.0264  34   LEU A O   
220  C CB  . LEU A 34  ? 0.2868 0.2506 0.3218 0.0111  -0.0651 0.0509  34   LEU A CB  
221  C CG  . LEU A 34  ? 0.2773 0.2404 0.3295 0.0090  -0.0713 0.0558  34   LEU A CG  
222  C CD1 . LEU A 34  ? 0.2756 0.2497 0.3508 0.0073  -0.0747 0.0655  34   LEU A CD1 
223  C CD2 . LEU A 34  ? 0.3312 0.2999 0.3784 0.0090  -0.0737 0.0596  34   LEU A CD2 
224  N N   . VAL A 35  ? 0.1998 0.1607 0.1946 0.0157  -0.0541 0.0422  35   VAL A N   
225  C CA  . VAL A 35  ? 0.2488 0.2130 0.2291 0.0171  -0.0490 0.0400  35   VAL A CA  
226  C C   . VAL A 35  ? 0.1988 0.1830 0.1910 0.0166  -0.0516 0.0490  35   VAL A C   
227  O O   . VAL A 35  ? 0.2708 0.2658 0.2779 0.0150  -0.0548 0.0564  35   VAL A O   
228  C CB  . VAL A 35  ? 0.3511 0.3103 0.3113 0.0209  -0.0455 0.0385  35   VAL A CB  
229  C CG1 . VAL A 35  ? 0.3803 0.3425 0.3261 0.0224  -0.0404 0.0367  35   VAL A CG1 
230  C CG2 . VAL A 35  ? 0.3976 0.3379 0.3456 0.0217  -0.0424 0.0299  35   VAL A CG2 
231  N N   . TRP A 36  ? 0.2240 0.2146 0.2126 0.0161  -0.0492 0.0473  36   TRP A N   
232  C CA  . TRP A 36  ? 0.2293 0.2395 0.2231 0.0166  -0.0502 0.0548  36   TRP A CA  
233  C C   . TRP A 36  ? 0.2772 0.2887 0.2518 0.0183  -0.0461 0.0507  36   TRP A C   
234  O O   . TRP A 36  ? 0.2988 0.2971 0.2607 0.0167  -0.0411 0.0404  36   TRP A O   
235  C CB  . TRP A 36  ? 0.2644 0.2883 0.2788 0.0146  -0.0540 0.0612  36   TRP A CB  
236  C CG  . TRP A 36  ? 0.3206 0.3439 0.3363 0.0125  -0.0527 0.0549  36   TRP A CG  
237  C CD1 . TRP A 36  ? 0.3315 0.3475 0.3317 0.0108  -0.0472 0.0444  36   TRP A CD1 
238  C CD2 . TRP A 36  ? 0.3148 0.3461 0.3499 0.0109  -0.0553 0.0582  36   TRP A CD2 
239  N NE1 . TRP A 36  ? 0.3413 0.3611 0.3505 0.0077  -0.0465 0.0407  36   TRP A NE1 
240  C CE2 . TRP A 36  ? 0.3102 0.3396 0.3405 0.0081  -0.0513 0.0492  36   TRP A CE2 
241  C CE3 . TRP A 36  ? 0.3490 0.3882 0.4055 0.0115  -0.0601 0.0681  36   TRP A CE3 
242  C CZ2 . TRP A 36  ? 0.2943 0.3313 0.3405 0.0065  -0.0524 0.0500  36   TRP A CZ2 
243  C CZ3 . TRP A 36  ? 0.3447 0.3897 0.4163 0.0104  -0.0607 0.0691  36   TRP A CZ3 
244  C CH2 . TRP A 36  ? 0.3226 0.3673 0.3889 0.0082  -0.0569 0.0602  36   TRP A CH2 
245  N N   . LYS A 37  ? 0.3314 0.3584 0.3067 0.0196  -0.0450 0.0560  37   LYS A N   
246  C CA  . LYS A 37  ? 0.3497 0.3798 0.3079 0.0213  -0.0415 0.0524  37   LYS A CA  
247  C C   . LYS A 37  ? 0.3665 0.4162 0.3338 0.0200  -0.0444 0.0567  37   LYS A C   
248  O O   . LYS A 37  ? 0.3165 0.3821 0.3004 0.0201  -0.0466 0.0659  37   LYS A O   
249  C CB  . LYS A 37  ? 0.3801 0.4134 0.3310 0.0253  -0.0378 0.0549  37   LYS A CB  
250  C CG  . LYS A 37  ? 0.4439 0.4790 0.3769 0.0281  -0.0335 0.0512  37   LYS A CG  
251  C CD  . LYS A 37  ? 0.5140 0.5500 0.4408 0.0334  -0.0296 0.0535  37   LYS A CD  
252  C CE  . LYS A 37  ? 0.5377 0.5920 0.4832 0.0339  -0.0322 0.0646  37   LYS A CE  
253  N NZ  . LYS A 37  ? 0.5648 0.6214 0.5063 0.0389  -0.0289 0.0675  37   LYS A NZ  
254  N N   . GLU A 38  ? 0.4154 0.4638 0.3730 0.0177  -0.0428 0.0489  38   GLU A N   
255  C CA  . GLU A 38  ? 0.4988 0.5667 0.4640 0.0159  -0.0453 0.0508  38   GLU A CA  
256  C C   . GLU A 38  ? 0.5566 0.6359 0.5079 0.0188  -0.0442 0.0522  38   GLU A C   
257  O O   . GLU A 38  ? 0.6279 0.6950 0.5594 0.0192  -0.0389 0.0441  38   GLU A O   
258  C CB  . GLU A 38  ? 0.5507 0.6126 0.5143 0.0102  -0.0421 0.0392  38   GLU A CB  
259  C CG  . GLU A 38  ? 0.6128 0.6705 0.5933 0.0073  -0.0437 0.0385  38   GLU A CG  
260  C CD  . GLU A 38  ? 0.6640 0.7276 0.6479 0.0022  -0.0423 0.0310  38   GLU A CD  
261  O OE1 . GLU A 38  ? 0.6503 0.7125 0.6194 -0.0005 -0.0385 0.0223  38   GLU A OE1 
262  O OE2 . GLU A 38  ? 0.6962 0.7662 0.6978 0.0008  -0.0448 0.0337  38   GLU A OE2 
263  N N   . LEU A 39  ? 0.5623 0.6640 0.5252 0.0205  -0.0473 0.0614  39   LEU A N   
264  C CA  . LEU A 39  ? 0.5908 0.7056 0.5425 0.0233  -0.0455 0.0621  39   LEU A CA  
265  C C   . LEU A 39  ? 0.6065 0.7442 0.5663 0.0219  -0.0498 0.0650  39   LEU A C   
266  O O   . LEU A 39  ? 0.6117 0.7627 0.5918 0.0220  -0.0526 0.0745  39   LEU A O   
267  C CB  . LEU A 39  ? 0.5885 0.7101 0.5456 0.0280  -0.0431 0.0713  39   LEU A CB  
268  N N   . ASP A 40  ? 0.6248 0.7666 0.5685 0.0200  -0.0494 0.0563  40   ASP A N   
269  C CA  . ASP A 40  ? 0.6426 0.8079 0.5933 0.0183  -0.0530 0.0574  40   ASP A CA  
270  C C   . ASP A 40  ? 0.6239 0.8086 0.5678 0.0232  -0.0534 0.0634  40   ASP A C   
271  O O   . ASP A 40  ? 0.6099 0.7918 0.5329 0.0235  -0.0509 0.0553  40   ASP A O   
272  C CB  . ASP A 40  ? 0.6748 0.8339 0.6173 0.0110  -0.0501 0.0418  40   ASP A CB  
273  C CG  . ASP A 40  ? 0.7109 0.8963 0.6585 0.0089  -0.0541 0.0417  40   ASP A CG  
274  O OD1 . ASP A 40  ? 0.7120 0.9192 0.6757 0.0125  -0.0595 0.0544  40   ASP A OD1 
275  O OD2 . ASP A 40  ? 0.7205 0.9050 0.6562 0.0036  -0.0518 0.0289  40   ASP A OD2 
276  N N   . TYR A 41  ? 0.6283 0.8315 0.5906 0.0267  -0.0549 0.0770  41   TYR A N   
277  C CA  . TYR A 41  ? 0.6529 0.8757 0.6124 0.0320  -0.0538 0.0845  41   TYR A CA  
278  C C   . TYR A 41  ? 0.6655 0.9137 0.6243 0.0316  -0.0579 0.0846  41   TYR A C   
279  O O   . TYR A 41  ? 0.6717 0.9390 0.6278 0.0362  -0.0576 0.0907  41   TYR A O   
280  C CB  . TYR A 41  ? 0.6651 0.8955 0.6439 0.0353  -0.0524 0.0999  41   TYR A CB  
281  C CG  . TYR A 41  ? 0.6770 0.9165 0.6778 0.0330  -0.0557 0.1082  41   TYR A CG  
282  C CD1 . TYR A 41  ? 0.6726 0.9380 0.6813 0.0346  -0.0584 0.1159  41   TYR A CD1 
283  C CD2 . TYR A 41  ? 0.6823 0.9047 0.6954 0.0296  -0.0560 0.1084  41   TYR A CD2 
284  C CE1 . TYR A 41  ? 0.6837 0.9569 0.7123 0.0333  -0.0608 0.1242  41   TYR A CE1 
285  C CE2 . TYR A 41  ? 0.6916 0.9208 0.7242 0.0280  -0.0586 0.1160  41   TYR A CE2 
286  C CZ  . TYR A 41  ? 0.6972 0.9515 0.7378 0.0300  -0.0608 0.1242  41   TYR A CZ  
287  O OH  . TYR A 41  ? 0.7058 0.9664 0.7657 0.0292  -0.0628 0.1325  41   TYR A OH  
288  N N   . GLY A 42  ? 0.6622 0.9122 0.6243 0.0262  -0.0620 0.0778  42   GLY A N   
289  C CA  . GLY A 42  ? 0.6762 0.9519 0.6394 0.0251  -0.0666 0.0770  42   GLY A CA  
290  C C   . GLY A 42  ? 0.6905 0.9774 0.6325 0.0269  -0.0662 0.0712  42   GLY A C   
291  O O   . GLY A 42  ? 0.7170 1.0307 0.6616 0.0291  -0.0694 0.0758  42   GLY A O   
292  N N   . SER A 43  ? 0.6597 0.9259 0.5803 0.0264  -0.0618 0.0610  43   SER A N   
293  C CA  . SER A 43  ? 0.6539 0.9261 0.5516 0.0277  -0.0602 0.0531  43   SER A CA  
294  C C   . SER A 43  ? 0.6033 0.8767 0.4963 0.0363  -0.0557 0.0615  43   SER A C   
295  O O   . SER A 43  ? 0.5744 0.8466 0.4468 0.0385  -0.0528 0.0544  43   SER A O   
296  C CB  . SER A 43  ? 0.7169 0.9639 0.5958 0.0207  -0.0548 0.0337  43   SER A CB  
297  O OG  . SER A 43  ? 0.7734 1.0237 0.6299 0.0217  -0.0524 0.0248  43   SER A OG  
298  N N   . MET A 44  ? 0.5727 0.8484 0.4849 0.0408  -0.0546 0.0761  44   MET A N   
299  C CA  . MET A 44  ? 0.5512 0.8297 0.4621 0.0485  -0.0503 0.0848  44   MET A CA  
300  C C   . MET A 44  ? 0.5422 0.8522 0.4606 0.0541  -0.0521 0.0969  44   MET A C   
301  O O   . MET A 44  ? 0.5347 0.8632 0.4674 0.0526  -0.0563 0.1035  44   MET A O   
302  C CB  . MET A 44  ? 0.5582 0.8226 0.4850 0.0494  -0.0474 0.0933  44   MET A CB  
303  C CG  . MET A 44  ? 0.5874 0.8209 0.5049 0.0462  -0.0445 0.0826  44   MET A CG  
304  S SD  . MET A 44  ? 0.9407 1.1610 0.8762 0.0472  -0.0417 0.0921  44   MET A SD  
305  C CE  . MET A 44  ? 1.1565 1.3428 1.0769 0.0435  -0.0391 0.0775  44   MET A CE  
306  N N   . THR A 45  ? 0.5389 0.8549 0.4471 0.0611  -0.0484 0.1002  45   THR A N   
307  C CA  . THR A 45  ? 0.5672 0.9126 0.4818 0.0676  -0.0490 0.1132  45   THR A CA  
308  C C   . THR A 45  ? 0.5544 0.9044 0.4936 0.0694  -0.0471 0.1300  45   THR A C   
309  O O   . THR A 45  ? 0.5531 0.8826 0.5008 0.0662  -0.0451 0.1299  45   THR A O   
310  C CB  . THR A 45  ? 0.6197 0.9688 0.5153 0.0751  -0.0450 0.1113  45   THR A CB  
311  O OG1 . THR A 45  ? 0.6304 0.9646 0.5296 0.0788  -0.0397 0.1161  45   THR A OG1 
312  C CG2 . THR A 45  ? 0.6406 0.9766 0.5090 0.0722  -0.0451 0.0926  45   THR A CG2 
313  N N   . GLU A 46  ? 0.5348 0.9115 0.4846 0.0741  -0.0475 0.1441  46   GLU A N   
314  C CA  . GLU A 46  ? 0.5226 0.9038 0.4951 0.0749  -0.0452 0.1605  46   GLU A CA  
315  C C   . GLU A 46  ? 0.5531 0.9227 0.5239 0.0781  -0.0398 0.1630  46   GLU A C   
316  O O   . GLU A 46  ? 0.5141 0.8742 0.5008 0.0753  -0.0381 0.1701  46   GLU A O   
317  C CB  . GLU A 46  ? 0.5330 0.9458 0.5157 0.0797  -0.0461 0.1759  46   GLU A CB  
318  C CG  . GLU A 46  ? 0.5683 0.9940 0.5583 0.0765  -0.0514 0.1766  46   GLU A CG  
319  C CD  . GLU A 46  ? 0.6330 1.0886 0.6366 0.0816  -0.0517 0.1946  46   GLU A CD  
320  O OE1 . GLU A 46  ? 0.6812 1.1460 0.6901 0.0867  -0.0476 0.2071  46   GLU A OE1 
321  O OE2 . GLU A 46  ? 0.6128 1.0834 0.6222 0.0806  -0.0558 0.1968  46   GLU A OE2 
322  N N   . ALA A 47  ? 0.6122 0.9829 0.5635 0.0839  -0.0374 0.1569  47   ALA A N   
323  C CA  . ALA A 47  ? 0.6541 1.0150 0.6016 0.0882  -0.0322 0.1583  47   ALA A CA  
324  C C   . ALA A 47  ? 0.6718 1.0020 0.6179 0.0829  -0.0311 0.1483  47   ALA A C   
325  O O   . ALA A 47  ? 0.6794 1.0020 0.6371 0.0822  -0.0286 0.1543  47   ALA A O   
326  C CB  . ALA A 47  ? 0.6712 1.0385 0.5959 0.0961  -0.0300 0.1526  47   ALA A CB  
327  N N   . GLU A 48  ? 0.6709 0.9843 0.6023 0.0790  -0.0332 0.1331  48   GLU A N   
328  C CA  . GLU A 48  ? 0.6900 0.9745 0.6189 0.0742  -0.0322 0.1235  48   GLU A CA  
329  C C   . GLU A 48  ? 0.6626 0.9419 0.6144 0.0681  -0.0339 0.1303  48   GLU A C   
330  O O   . GLU A 48  ? 0.6611 0.9222 0.6166 0.0661  -0.0320 0.1286  48   GLU A O   
331  C CB  . GLU A 48  ? 0.7323 1.0019 0.6432 0.0698  -0.0342 0.1072  48   GLU A CB  
332  C CG  . GLU A 48  ? 0.7823 1.0504 0.6673 0.0744  -0.0318 0.0977  48   GLU A CG  
333  C CD  . GLU A 48  ? 0.8432 1.0995 0.7110 0.0681  -0.0339 0.0818  48   GLU A CD  
334  O OE1 . GLU A 48  ? 0.8493 1.1011 0.7264 0.0607  -0.0376 0.0790  48   GLU A OE1 
335  O OE2 . GLU A 48  ? 0.8862 1.1378 0.7314 0.0701  -0.0314 0.0719  48   GLU A OE2 
336  N N   . LYS A 49  ? 0.6503 0.9454 0.6166 0.0654  -0.0374 0.1382  49   LYS A N   
337  C CA  . LYS A 49  ? 0.5983 0.8872 0.5854 0.0596  -0.0391 0.1446  49   LYS A CA  
338  C C   . LYS A 49  ? 0.5781 0.8732 0.5813 0.0610  -0.0365 0.1587  49   LYS A C   
339  O O   . LYS A 49  ? 0.5398 0.8214 0.5553 0.0562  -0.0368 0.1607  49   LYS A O   
340  C CB  . LYS A 49  ? 0.5590 0.8616 0.5563 0.0568  -0.0435 0.1485  49   LYS A CB  
341  C CG  . LYS A 49  ? 0.5356 0.8315 0.5202 0.0535  -0.0469 0.1343  49   LYS A CG  
342  C CD  . LYS A 49  ? 0.5055 0.8086 0.5052 0.0495  -0.0511 0.1380  49   LYS A CD  
343  C CE  . LYS A 49  ? 0.5007 0.8332 0.5104 0.0534  -0.0524 0.1517  49   LYS A CE  
344  N NZ  . LYS A 49  ? 0.5024 0.8533 0.4977 0.0557  -0.0552 0.1457  49   LYS A NZ  
345  N N   . GLN A 50  ? 0.6115 0.9276 0.6143 0.0672  -0.0342 0.1684  50   GLN A N   
346  C CA  . GLN A 50  ? 0.6682 0.9927 0.6860 0.0685  -0.0316 0.1826  50   GLN A CA  
347  C C   . GLN A 50  ? 0.6917 0.9990 0.7044 0.0687  -0.0286 0.1773  50   GLN A C   
348  O O   . GLN A 50  ? 0.6773 0.9804 0.7043 0.0654  -0.0283 0.1845  50   GLN A O   
349  C CB  . GLN A 50  ? 0.7120 1.0642 0.7291 0.0760  -0.0295 0.1942  50   GLN A CB  
350  C CG  . GLN A 50  ? 0.7452 1.1087 0.7790 0.0772  -0.0269 0.2103  50   GLN A CG  
351  C CD  . GLN A 50  ? 0.7882 1.1518 0.8454 0.0706  -0.0295 0.2214  50   GLN A CD  
352  O OE1 . GLN A 50  ? 0.8052 1.1798 0.8696 0.0701  -0.0319 0.2271  50   GLN A OE1 
353  N NE2 . GLN A 50  ? 0.7919 1.1433 0.8610 0.0660  -0.0292 0.2248  50   GLN A NE2 
354  N N   . MET A 51  ? 0.7126 1.0101 0.7045 0.0727  -0.0267 0.1651  51   MET A N   
355  C CA  . MET A 51  ? 0.7030 0.9832 0.6877 0.0738  -0.0237 0.1589  51   MET A CA  
356  C C   . MET A 51  ? 0.6873 0.9444 0.6779 0.0661  -0.0260 0.1520  51   MET A C   
357  O O   . MET A 51  ? 0.6858 0.9344 0.6834 0.0642  -0.0251 0.1541  51   MET A O   
358  C CB  . MET A 51  ? 0.7097 0.9820 0.6697 0.0799  -0.0212 0.1469  51   MET A CB  
359  N N   . LEU A 52  ? 0.6700 0.9184 0.6576 0.0617  -0.0292 0.1440  52   LEU A N   
360  C CA  . LEU A 52  ? 0.6509 0.8783 0.6435 0.0549  -0.0316 0.1373  52   LEU A CA  
361  C C   . LEU A 52  ? 0.6376 0.8677 0.6528 0.0500  -0.0335 0.1484  52   LEU A C   
362  O O   . LEU A 52  ? 0.6233 0.8378 0.6431 0.0464  -0.0340 0.1459  52   LEU A O   
363  C CB  . LEU A 52  ? 0.6505 0.8736 0.6384 0.0515  -0.0349 0.1293  52   LEU A CB  
364  C CG  . LEU A 52  ? 0.6693 0.8679 0.6546 0.0462  -0.0364 0.1184  52   LEU A CG  
365  C CD1 . LEU A 52  ? 0.6781 0.8595 0.6419 0.0489  -0.0333 0.1061  52   LEU A CD1 
366  C CD2 . LEU A 52  ? 0.6851 0.8856 0.6738 0.0421  -0.0405 0.1152  52   LEU A CD2 
367  N N   . VAL A 53  ? 0.6232 0.8730 0.6520 0.0501  -0.0348 0.1609  53   VAL A N   
368  C CA  . VAL A 53  ? 0.5958 0.8486 0.6467 0.0456  -0.0368 0.1729  53   VAL A CA  
369  C C   . VAL A 53  ? 0.5923 0.8442 0.6486 0.0458  -0.0350 0.1785  53   VAL A C   
370  O O   . VAL A 53  ? 0.5576 0.7973 0.6247 0.0406  -0.0372 0.1792  53   VAL A O   
371  C CB  . VAL A 53  ? 0.5444 0.8208 0.6082 0.0472  -0.0377 0.1871  53   VAL A CB  
372  C CG1 . VAL A 53  ? 0.5096 0.7906 0.5960 0.0438  -0.0389 0.2018  53   VAL A CG1 
373  C CG2 . VAL A 53  ? 0.5170 0.7936 0.5807 0.0455  -0.0407 0.1830  53   VAL A CG2 
374  N N   . SER A 54  ? 0.6388 0.9043 0.6876 0.0521  -0.0312 0.1823  54   SER A N   
375  C CA  . SER A 54  ? 0.6819 0.9501 0.7359 0.0531  -0.0293 0.1886  54   SER A CA  
376  C C   . SER A 54  ? 0.7014 0.9479 0.7448 0.0520  -0.0288 0.1763  54   SER A C   
377  O O   . SER A 54  ? 0.7005 0.9407 0.7534 0.0482  -0.0303 0.1792  54   SER A O   
378  C CB  . SER A 54  ? 0.7058 0.9955 0.7542 0.0613  -0.0251 0.1963  54   SER A CB  
379  O OG  . SER A 54  ? 0.7200 1.0078 0.7471 0.0675  -0.0227 0.1855  54   SER A OG  
380  N N   . GLU A 55  ? 0.7088 0.9447 0.7326 0.0557  -0.0268 0.1633  55   GLU A N   
381  C CA  . GLU A 55  ? 0.7195 0.9335 0.7324 0.0549  -0.0263 0.1513  55   GLU A CA  
382  C C   . GLU A 55  ? 0.7031 0.9010 0.7264 0.0470  -0.0305 0.1484  55   GLU A C   
383  O O   . GLU A 55  ? 0.7255 0.9140 0.7497 0.0456  -0.0308 0.1466  55   GLU A O   
384  C CB  . GLU A 55  ? 0.7617 0.9648 0.7535 0.0588  -0.0244 0.1382  55   GLU A CB  
385  C CG  . GLU A 55  ? 0.8280 1.0086 0.8079 0.0587  -0.0233 0.1266  55   GLU A CG  
386  C CD  . GLU A 55  ? 0.8912 1.0584 0.8524 0.0603  -0.0224 0.1140  55   GLU A CD  
387  O OE1 . GLU A 55  ? 0.9037 1.0805 0.8556 0.0644  -0.0211 0.1134  55   GLU A OE1 
388  O OE2 . GLU A 55  ? 0.9120 1.0591 0.8677 0.0571  -0.0230 0.1048  55   GLU A OE2 
389  N N   . VAL A 56  ? 0.6649 0.8604 0.6960 0.0422  -0.0339 0.1482  56   VAL A N   
390  C CA  . VAL A 56  ? 0.6400 0.8195 0.6801 0.0356  -0.0379 0.1450  56   VAL A CA  
391  C C   . VAL A 56  ? 0.6638 0.8490 0.7229 0.0319  -0.0406 0.1564  56   VAL A C   
392  O O   . VAL A 56  ? 0.6191 0.7908 0.6846 0.0273  -0.0439 0.1539  56   VAL A O   
393  C CB  . VAL A 56  ? 0.6076 0.7851 0.6533 0.0323  -0.0409 0.1435  56   VAL A CB  
394  C CG1 . VAL A 56  ? 0.5940 0.7566 0.6515 0.0263  -0.0451 0.1421  56   VAL A CG1 
395  C CG2 . VAL A 56  ? 0.6006 0.7706 0.6284 0.0346  -0.0395 0.1314  56   VAL A CG2 
396  N N   . ASN A 57  ? 0.7183 0.9242 0.7862 0.0341  -0.0393 0.1693  57   ASN A N   
397  C CA  . ASN A 57  ? 0.7702 0.9852 0.8576 0.0309  -0.0417 0.1828  57   ASN A CA  
398  C C   . ASN A 57  ? 0.7656 0.9761 0.8507 0.0309  -0.0415 0.1817  57   ASN A C   
399  O O   . ASN A 57  ? 0.7670 0.9713 0.8647 0.0256  -0.0458 0.1849  57   ASN A O   
400  C CB  . ASN A 57  ? 0.8365 1.0766 0.9319 0.0345  -0.0395 0.1971  57   ASN A CB  
401  C CG  . ASN A 57  ? 0.8887 1.1361 1.0060 0.0303  -0.0431 0.2098  57   ASN A CG  
402  O OD1 . ASN A 57  ? 0.8755 1.1334 0.9950 0.0322  -0.0425 0.2142  57   ASN A OD1 
403  N ND2 . ASN A 57  ? 0.9232 1.1647 1.0570 0.0248  -0.0471 0.2157  57   ASN A ND2 
404  N N   . LEU A 58  ? 0.7524 0.9657 0.8211 0.0372  -0.0368 0.1768  58   LEU A N   
405  C CA  . LEU A 58  ? 0.7471 0.9562 0.8104 0.0388  -0.0359 0.1745  58   LEU A CA  
406  C C   . LEU A 58  ? 0.7448 0.9308 0.8013 0.0355  -0.0385 0.1622  58   LEU A C   
407  O O   . LEU A 58  ? 0.7440 0.9268 0.7988 0.0358  -0.0390 0.1615  58   LEU A O   
408  C CB  . LEU A 58  ? 0.7344 0.9503 0.7802 0.0479  -0.0297 0.1711  58   LEU A CB  
409  N N   . LEU A 59  ? 0.7358 0.9070 0.7879 0.0329  -0.0400 0.1530  59   LEU A N   
410  C CA  . LEU A 59  ? 0.6933 0.8429 0.7382 0.0304  -0.0421 0.1413  59   LEU A CA  
411  C C   . LEU A 59  ? 0.6790 0.8227 0.7411 0.0233  -0.0486 0.1452  59   LEU A C   
412  O O   . LEU A 59  ? 0.6616 0.7943 0.7218 0.0216  -0.0512 0.1406  59   LEU A O   
413  C CB  . LEU A 59  ? 0.6626 0.7994 0.6965 0.0307  -0.0411 0.1304  59   LEU A CB  
414  C CG  . LEU A 59  ? 0.6605 0.7881 0.6723 0.0365  -0.0362 0.1195  59   LEU A CG  
415  C CD1 . LEU A 59  ? 0.6644 0.8048 0.6695 0.0432  -0.0316 0.1238  59   LEU A CD1 
416  C CD2 . LEU A 59  ? 0.6636 0.7880 0.6686 0.0369  -0.0353 0.1138  59   LEU A CD2 
417  N N   . ARG A 60  ? 0.6736 0.8249 0.7526 0.0196  -0.0515 0.1541  60   ARG A N   
418  C CA  . ARG A 60  ? 0.6867 0.8321 0.7840 0.0133  -0.0581 0.1587  60   ARG A CA  
419  C C   . ARG A 60  ? 0.6889 0.8420 0.7961 0.0115  -0.0610 0.1673  60   ARG A C   
420  O O   . ARG A 60  ? 0.7064 0.8509 0.8241 0.0069  -0.0670 0.1677  60   ARG A O   
421  C CB  . ARG A 60  ? 0.6930 0.8463 0.8073 0.0108  -0.0600 0.1680  60   ARG A CB  
422  N N   . GLU A 61  ? 0.6670 0.8372 0.7713 0.0156  -0.0569 0.1745  61   GLU A N   
423  C CA  . GLU A 61  ? 0.6497 0.8308 0.7638 0.0144  -0.0592 0.1842  61   GLU A CA  
424  C C   . GLU A 61  ? 0.6336 0.8041 0.7372 0.0149  -0.0609 0.1757  61   GLU A C   
425  O O   . GLU A 61  ? 0.6001 0.7726 0.7149 0.0111  -0.0664 0.1811  61   GLU A O   
426  C CB  . GLU A 61  ? 0.6411 0.8449 0.7540 0.0199  -0.0536 0.1943  61   GLU A CB  
427  N N   . LEU A 62  ? 0.6323 0.7919 0.7148 0.0196  -0.0563 0.1630  62   LEU A N   
428  C CA  . LEU A 62  ? 0.6609 0.8117 0.7311 0.0218  -0.0566 0.1553  62   LEU A CA  
429  C C   . LEU A 62  ? 0.6289 0.7603 0.7003 0.0168  -0.0630 0.1469  62   LEU A C   
430  O O   . LEU A 62  ? 0.6371 0.7525 0.6992 0.0169  -0.0621 0.1363  62   LEU A O   
431  C CB  . LEU A 62  ? 0.7089 0.8549 0.7562 0.0297  -0.0489 0.1455  62   LEU A CB  
432  C CG  . LEU A 62  ? 0.7361 0.8978 0.7766 0.0370  -0.0435 0.1509  62   LEU A CG  
433  C CD1 . LEU A 62  ? 0.7601 0.9144 0.7791 0.0451  -0.0361 0.1410  62   LEU A CD1 
434  C CD2 . LEU A 62  ? 0.7313 0.8959 0.7735 0.0370  -0.0465 0.1536  62   LEU A CD2 
435  N N   . LYS A 63  ? 0.5611 0.6948 0.6440 0.0128  -0.0697 0.1520  63   LYS A N   
436  C CA  . LYS A 63  ? 0.5116 0.6283 0.5948 0.0091  -0.0765 0.1441  63   LYS A CA  
437  C C   . LYS A 63  ? 0.4732 0.5914 0.5466 0.0119  -0.0775 0.1416  63   LYS A C   
438  O O   . LYS A 63  ? 0.4799 0.6140 0.5617 0.0115  -0.0795 0.1512  63   LYS A O   
439  C CB  . LYS A 63  ? 0.4974 0.6146 0.6045 0.0018  -0.0853 0.1517  63   LYS A CB  
440  C CG  . LYS A 63  ? 0.5252 0.6459 0.6450 -0.0002 -0.0839 0.1579  63   LYS A CG  
441  C CD  . LYS A 63  ? 0.5741 0.6936 0.7187 -0.0065 -0.0925 0.1656  63   LYS A CD  
442  C CE  . LYS A 63  ? 0.6328 0.7629 0.7920 -0.0074 -0.0901 0.1766  63   LYS A CE  
443  N NZ  . LYS A 63  ? 0.6678 0.7914 0.8496 -0.0122 -0.0971 0.1815  63   LYS A NZ  
444  N N   . HIS A 64  ? 0.3524 0.3687 0.3672 0.0326  0.0087  0.0263  64   HIS A N   
445  C CA  . HIS A 64  ? 0.2877 0.3027 0.3033 0.0298  0.0075  0.0249  64   HIS A CA  
446  C C   . HIS A 64  ? 0.2331 0.2489 0.2491 0.0287  0.0066  0.0243  64   HIS A C   
447  O O   . HIS A 64  ? 0.2390 0.2579 0.2559 0.0295  0.0057  0.0247  64   HIS A O   
448  C CB  . HIS A 64  ? 0.3002 0.3170 0.3164 0.0291  0.0054  0.0241  64   HIS A CB  
449  C CG  . HIS A 64  ? 0.3312 0.3461 0.3480 0.0265  0.0045  0.0227  64   HIS A CG  
450  N ND1 . HIS A 64  ? 0.3021 0.3176 0.3195 0.0246  0.0028  0.0215  64   HIS A ND1 
451  C CD2 . HIS A 64  ? 0.3625 0.3749 0.3796 0.0255  0.0052  0.0223  64   HIS A CD2 
452  C CE1 . HIS A 64  ? 0.3352 0.3486 0.3526 0.0227  0.0023  0.0203  64   HIS A CE1 
453  N NE2 . HIS A 64  ? 0.3562 0.3678 0.3738 0.0231  0.0036  0.0207  64   HIS A NE2 
454  N N   . PRO A 65  ? 0.2378 0.2507 0.2533 0.0270  0.0070  0.0235  65   PRO A N   
455  C CA  . PRO A 65  ? 0.2645 0.2777 0.2800 0.0264  0.0066  0.0232  65   PRO A CA  
456  C C   . PRO A 65  ? 0.2527 0.2694 0.2699 0.0255  0.0045  0.0229  65   PRO A C   
457  O O   . PRO A 65  ? 0.2380 0.2562 0.2560 0.0258  0.0044  0.0234  65   PRO A O   
458  C CB  . PRO A 65  ? 0.3059 0.3152 0.3202 0.0249  0.0067  0.0218  65   PRO A CB  
459  C CG  . PRO A 65  ? 0.3084 0.3152 0.3228 0.0249  0.0076  0.0216  65   PRO A CG  
460  C CD  . PRO A 65  ? 0.2683 0.2776 0.2836 0.0258  0.0075  0.0226  65   PRO A CD  
461  N N   . ASN A 66  ? 0.1854 0.2032 0.2034 0.0247  0.0027  0.0221  66   ASN A N   
462  C CA  . ASN A 66  ? 0.2666 0.2873 0.2865 0.0236  0.0005  0.0215  66   ASN A CA  
463  C C   . ASN A 66  ? 0.2697 0.2942 0.2915 0.0250  -0.0010 0.0219  66   ASN A C   
464  O O   . ASN A 66  ? 0.2585 0.2854 0.2822 0.0242  -0.0032 0.0212  66   ASN A O   
465  C CB  . ASN A 66  ? 0.2579 0.2772 0.2774 0.0216  -0.0009 0.0201  66   ASN A CB  
466  C CG  . ASN A 66  ? 0.2261 0.2420 0.2440 0.0205  -0.0001 0.0194  66   ASN A CG  
467  O OD1 . ASN A 66  ? 0.2382 0.2512 0.2550 0.0197  0.0001  0.0184  66   ASN A OD1 
468  N ND2 . ASN A 66  ? 0.1445 0.1607 0.1625 0.0206  0.0003  0.0199  66   ASN A ND2 
469  N N   . ILE A 67  ? 0.2815 0.3065 0.3027 0.0272  0.0002  0.0229  67   ILE A N   
470  C CA  . ILE A 67  ? 0.2262 0.2547 0.2488 0.0292  -0.0012 0.0231  67   ILE A CA  
471  C C   . ILE A 67  ? 0.1861 0.2159 0.2095 0.0309  0.0000  0.0242  67   ILE A C   
472  O O   . ILE A 67  ? 0.2290 0.2566 0.2505 0.0318  0.0024  0.0251  67   ILE A O   
473  C CB  . ILE A 67  ? 0.2766 0.3046 0.2971 0.0311  -0.0009 0.0233  67   ILE A CB  
474  C CG1 . ILE A 67  ? 0.3284 0.3560 0.3487 0.0297  -0.0024 0.0223  67   ILE A CG1 
475  C CG2 . ILE A 67  ? 0.2839 0.3152 0.3051 0.0341  -0.0021 0.0236  67   ILE A CG2 
476  C CD1 . ILE A 67  ? 0.3404 0.3673 0.3587 0.0317  -0.0017 0.0228  67   ILE A CD1 
477  N N   . VAL A 68  ? 0.1982 0.2316 0.2250 0.0314  -0.0018 0.0240  68   VAL A N   
478  C CA  . VAL A 68  ? 0.2462 0.2812 0.2745 0.0330  -0.0009 0.0249  68   VAL A CA  
479  C C   . VAL A 68  ? 0.2999 0.3338 0.3251 0.0356  0.0008  0.0257  68   VAL A C   
480  O O   . VAL A 68  ? 0.3093 0.3438 0.3332 0.0374  -0.0001 0.0254  68   VAL A O   
481  C CB  . VAL A 68  ? 0.2539 0.2933 0.2870 0.0336  -0.0035 0.0244  68   VAL A CB  
482  C CG1 . VAL A 68  ? 0.2639 0.3051 0.2986 0.0357  -0.0026 0.0253  68   VAL A CG1 
483  C CG2 . VAL A 68  ? 0.2036 0.2438 0.2402 0.0310  -0.0045 0.0240  68   VAL A CG2 
484  N N   . ARG A 69  ? 0.3130 0.3450 0.3368 0.0361  0.0034  0.0268  69   ARG A N   
485  C CA  . ARG A 69  ? 0.3563 0.3868 0.3771 0.0385  0.0054  0.0278  69   ARG A CA  
486  C C   . ARG A 69  ? 0.3365 0.3702 0.3586 0.0413  0.0047  0.0281  69   ARG A C   
487  O O   . ARG A 69  ? 0.2754 0.3112 0.3003 0.0413  0.0045  0.0283  69   ARG A O   
488  C CB  . ARG A 69  ? 0.4295 0.4565 0.4484 0.0379  0.0082  0.0287  69   ARG A CB  
489  C CG  . ARG A 69  ? 0.5422 0.5673 0.5583 0.0402  0.0106  0.0298  69   ARG A CG  
490  C CD  . ARG A 69  ? 0.6515 0.6742 0.6655 0.0405  0.0114  0.0298  69   ARG A CD  
491  N NE  . ARG A 69  ? 0.7462 0.7671 0.7579 0.0430  0.0138  0.0311  69   ARG A NE  
492  C CZ  . ARG A 69  ? 0.7782 0.7998 0.7886 0.0457  0.0142  0.0318  69   ARG A CZ  
493  N NH1 . ARG A 69  ? 0.7884 0.8081 0.7967 0.0480  0.0168  0.0331  69   ARG A NH1 
494  N NH2 . ARG A 69  ? 0.7764 0.8006 0.7874 0.0464  0.0119  0.0311  69   ARG A NH2 
495  N N   . TYR A 70  ? 0.3614 0.3955 0.3815 0.0440  0.0045  0.0281  70   TYR A N   
496  C CA  . TYR A 70  ? 0.4718 0.5085 0.4922 0.0473  0.0040  0.0284  70   TYR A CA  
497  C C   . TYR A 70  ? 0.4853 0.5194 0.5023 0.0492  0.0073  0.0299  70   TYR A C   
498  O O   . TYR A 70  ? 0.4690 0.4995 0.4830 0.0490  0.0095  0.0307  70   TYR A O   
499  C CB  . TYR A 70  ? 0.5912 0.6301 0.6113 0.0497  0.0014  0.0273  70   TYR A CB  
500  C CG  . TYR A 70  ? 0.7029 0.7441 0.7265 0.0477  -0.0019 0.0257  70   TYR A CG  
501  C CD1 . TYR A 70  ? 0.7343 0.7794 0.7628 0.0479  -0.0048 0.0246  70   TYR A CD1 
502  C CD2 . TYR A 70  ? 0.7435 0.7829 0.7663 0.0454  -0.0021 0.0254  70   TYR A CD2 
503  C CE1 . TYR A 70  ? 0.7537 0.8007 0.7859 0.0460  -0.0077 0.0232  70   TYR A CE1 
504  C CE2 . TYR A 70  ? 0.7734 0.8147 0.7993 0.0435  -0.0050 0.0240  70   TYR A CE2 
505  C CZ  . TYR A 70  ? 0.7760 0.8211 0.8066 0.0438  -0.0078 0.0229  70   TYR A CZ  
506  O OH  . TYR A 70  ? 0.7605 0.8073 0.7946 0.0418  -0.0106 0.0216  70   TYR A OH  
507  N N   . TYR A 71  ? 0.4811 0.5169 0.4991 0.0510  0.0075  0.0303  71   TYR A N   
508  C CA  . TYR A 71  ? 0.4696 0.5032 0.4848 0.0525  0.0106  0.0318  71   TYR A CA  
509  C C   . TYR A 71  ? 0.5002 0.5349 0.5133 0.0567  0.0107  0.0321  71   TYR A C   
510  O O   . TYR A 71  ? 0.5603 0.5922 0.5699 0.0585  0.0135  0.0335  71   TYR A O   
511  C CB  . TYR A 71  ? 0.4639 0.4981 0.4812 0.0514  0.0114  0.0323  71   TYR A CB  
512  C CG  . TYR A 71  ? 0.5203 0.5519 0.5379 0.0480  0.0125  0.0324  71   TYR A CG  
513  C CD1 . TYR A 71  ? 0.5370 0.5703 0.5579 0.0455  0.0106  0.0315  71   TYR A CD1 
514  C CD2 . TYR A 71  ? 0.5748 0.6022 0.5893 0.0475  0.0152  0.0332  71   TYR A CD2 
515  C CE1 . TYR A 71  ? 0.5532 0.5840 0.5737 0.0429  0.0115  0.0315  71   TYR A CE1 
516  C CE2 . TYR A 71  ? 0.6112 0.6361 0.6255 0.0449  0.0158  0.0330  71   TYR A CE2 
517  C CZ  . TYR A 71  ? 0.5798 0.6064 0.5969 0.0427  0.0140  0.0322  71   TYR A CZ  
518  O OH  . TYR A 71  ? 0.5848 0.6088 0.6013 0.0405  0.0146  0.0319  71   TYR A OH  
519  N N   . ASP A 72  ? 0.4643 0.5030 0.4796 0.0586  0.0076  0.0309  72   ASP A N   
520  C CA  . ASP A 72  ? 0.4933 0.5335 0.5069 0.0630  0.0074  0.0310  72   ASP A CA  
521  C C   . ASP A 72  ? 0.5039 0.5484 0.5202 0.0650  0.0033  0.0291  72   ASP A C   
522  O O   . ASP A 72  ? 0.5336 0.5804 0.5544 0.0626  0.0006  0.0278  72   ASP A O   
523  C CB  . ASP A 72  ? 0.5611 0.6019 0.5760 0.0633  0.0089  0.0318  72   ASP A CB  
524  C CG  . ASP A 72  ? 0.6344 0.6749 0.6457 0.0676  0.0103  0.0327  72   ASP A CG  
525  O OD1 . ASP A 72  ? 0.6627 0.7021 0.6702 0.0705  0.0106  0.0329  72   ASP A OD1 
526  O OD2 . ASP A 72  ? 0.6281 0.6693 0.6402 0.0683  0.0113  0.0332  72   ASP A OD2 
527  N N   . ARG A 73  ? 0.4712 0.5164 0.4846 0.0696  0.0027  0.0289  73   ARG A N   
528  C CA  . ARG A 73  ? 0.4955 0.5449 0.5113 0.0724  -0.0015 0.0268  73   ARG A CA  
529  C C   . ARG A 73  ? 0.5577 0.6087 0.5735 0.0758  -0.0012 0.0269  73   ARG A C   
530  O O   . ARG A 73  ? 0.5636 0.6119 0.5748 0.0776  0.0022  0.0287  73   ARG A O   
531  C CB  . ARG A 73  ? 0.4977 0.5467 0.5096 0.0756  -0.0029 0.0262  73   ARG A CB  
532  C CG  . ARG A 73  ? 0.5012 0.5469 0.5063 0.0793  0.0006  0.0281  73   ARG A CG  
533  N N   . ILE A 74  ? 0.5745 0.6297 0.5955 0.0766  -0.0047 0.0251  74   ILE A N   
534  C CA  . ILE A 74  ? 0.5872 0.6443 0.6091 0.0796  -0.0048 0.0249  74   ILE A CA  
535  C C   . ILE A 74  ? 0.6384 0.6995 0.6626 0.0837  -0.0096 0.0222  74   ILE A C   
536  O O   . ILE A 74  ? 0.6432 0.7074 0.6736 0.0822  -0.0134 0.0202  74   ILE A O   
537  C CB  . ILE A 74  ? 0.5834 0.6420 0.6111 0.0763  -0.0040 0.0255  74   ILE A CB  
538  C CG1 . ILE A 74  ? 0.5708 0.6254 0.5956 0.0732  0.0006  0.0280  74   ILE A CG1 
539  C CG2 . ILE A 74  ? 0.5799 0.6415 0.6099 0.0796  -0.0051 0.0249  74   ILE A CG2 
540  C CD1 . ILE A 74  ? 0.5605 0.6162 0.5900 0.0705  0.0018  0.0288  74   ILE A CD1 
541  N N   . ILE A 75  ? 0.6902 0.7511 0.7096 0.0890  -0.0095 0.0221  75   ILE A N   
542  C CA  . ILE A 75  ? 0.7098 0.7742 0.7305 0.0937  -0.0143 0.0193  75   ILE A CA  
543  C C   . ILE A 75  ? 0.6936 0.7612 0.7186 0.0955  -0.0156 0.0183  75   ILE A C   
544  O O   . ILE A 75  ? 0.6384 0.7046 0.6600 0.0972  -0.0125 0.0199  75   ILE A O   
545  C CB  . ILE A 75  ? 0.7837 0.8460 0.7959 0.0995  -0.0139 0.0194  75   ILE A CB  
546  C CG1 . ILE A 75  ? 0.8010 0.8603 0.8093 0.0980  -0.0126 0.0204  75   ILE A CG1 
547  C CG2 . ILE A 75  ? 0.7634 0.8293 0.7767 0.1049  -0.0193 0.0161  75   ILE A CG2 
548  C CD1 . ILE A 75  ? 0.8070 0.8617 0.8110 0.0954  -0.0068 0.0238  75   ILE A CD1 
549  N N   . ASP A 76  ? 0.7400 0.8119 0.7731 0.0951  -0.0203 0.0156  76   ASP A N   
550  C CA  . ASP A 76  ? 0.7900 0.8656 0.8280 0.0976  -0.0224 0.0141  76   ASP A CA  
551  C C   . ASP A 76  ? 0.8380 0.9164 0.8766 0.1030  -0.0281 0.0105  76   ASP A C   
552  O O   . ASP A 76  ? 0.8318 0.9136 0.8781 0.1021  -0.0328 0.0077  76   ASP A O   
553  C CB  . ASP A 76  ? 0.7807 0.8591 0.8290 0.0927  -0.0231 0.0140  76   ASP A CB  
554  C CG  . ASP A 76  ? 0.7640 0.8457 0.8175 0.0947  -0.0241 0.0132  76   ASP A CG  
555  O OD1 . ASP A 76  ? 0.7451 0.8264 0.8003 0.0920  -0.0205 0.0155  76   ASP A OD1 
556  O OD2 . ASP A 76  ? 0.7579 0.8426 0.8135 0.0991  -0.0284 0.0103  76   ASP A OD2 
557  N N   . ARG A 77  ? 0.8861 0.9630 0.9165 0.1088  -0.0276 0.0105  77   ARG A N   
558  C CA  . ARG A 77  ? 0.9366 1.0155 0.9655 0.1150  -0.0327 0.0071  77   ARG A CA  
559  C C   . ARG A 77  ? 0.9566 1.0405 0.9942 0.1169  -0.0378 0.0037  77   ARG A C   
560  O O   . ARG A 77  ? 0.9424 1.0287 0.9818 0.1209  -0.0434 0.0001  77   ARG A O   
561  C CB  . ARG A 77  ? 0.9366 1.0125 0.9543 0.1212  -0.0304 0.0083  77   ARG A CB  
562  N N   . THR A 78  ? 0.9853 1.0706 1.0283 0.1142  -0.0359 0.0048  78   THR A N   
563  C CA  . THR A 78  ? 1.0207 1.1109 1.0730 0.1156  -0.0402 0.0019  78   THR A CA  
564  C C   . THR A 78  ? 1.0121 1.1058 1.0757 0.1123  -0.0449 -0.0007 78   THR A C   
565  O O   . THR A 78  ? 1.0307 1.1281 1.1002 0.1155  -0.0508 -0.0046 78   THR A O   
566  C CB  . THR A 78  ? 1.0505 1.1413 1.1063 0.1132  -0.0365 0.0042  78   THR A CB  
567  O OG1 . THR A 78  ? 1.0623 1.1501 1.1081 0.1169  -0.0326 0.0063  78   THR A OG1 
568  C CG2 . THR A 78  ? 1.0623 1.1584 1.1289 0.1145  -0.0410 0.0012  78   THR A CG2 
569  N N   . ASN A 79  ? 0.9629 1.0555 1.0296 0.1060  -0.0425 0.0013  79   ASN A N   
570  C CA  . ASN A 79  ? 0.8907 0.9860 0.9674 0.1027  -0.0465 -0.0008 79   ASN A CA  
571  C C   . ASN A 79  ? 0.8008 0.8938 0.8727 0.1020  -0.0475 -0.0012 79   ASN A C   
572  O O   . ASN A 79  ? 0.7793 0.8734 0.8580 0.0981  -0.0493 -0.0019 79   ASN A O   
573  C CB  . ASN A 79  ? 0.8866 0.9828 0.9719 0.0962  -0.0435 0.0016  79   ASN A CB  
574  N N   . THR A 80  ? 0.7328 0.8225 0.7932 0.1060  -0.0461 -0.0006 80   THR A N   
575  C CA  . THR A 80  ? 0.6824 0.7697 0.7370 0.1062  -0.0467 -0.0007 80   THR A CA  
576  C C   . THR A 80  ? 0.6290 0.7149 0.6867 0.0993  -0.0442 0.0013  80   THR A C   
577  O O   . THR A 80  ? 0.6201 0.7066 0.6805 0.0979  -0.0473 -0.0003 80   THR A O   
578  C CB  . THR A 80  ? 0.6492 0.7390 0.7060 0.1107  -0.0537 -0.0052 80   THR A CB  
579  O OG1 . THR A 80  ? 0.6426 0.7364 0.7121 0.1075  -0.0580 -0.0077 80   THR A OG1 
580  C CG2 . THR A 80  ? 0.6570 0.7480 0.7096 0.1183  -0.0563 -0.0074 80   THR A CG2 
581  N N   . THR A 81  ? 0.5748 0.6587 0.6319 0.0951  -0.0388 0.0048  81   THR A N   
582  C CA  . THR A 81  ? 0.5370 0.6193 0.5964 0.0888  -0.0362 0.0068  81   THR A CA  
583  C C   . THR A 81  ? 0.5130 0.5903 0.5628 0.0875  -0.0305 0.0102  81   THR A C   
584  O O   . THR A 81  ? 0.4756 0.5511 0.5204 0.0891  -0.0269 0.0122  81   THR A O   
585  C CB  . THR A 81  ? 0.4993 0.5837 0.5683 0.0843  -0.0351 0.0077  81   THR A CB  
586  O OG1 . THR A 81  ? 0.5155 0.6046 0.5948 0.0851  -0.0405 0.0045  81   THR A OG1 
587  C CG2 . THR A 81  ? 0.4760 0.5585 0.5464 0.0784  -0.0324 0.0098  81   THR A CG2 
588  N N   . LEU A 82  ? 0.4748 0.5500 0.5225 0.0848  -0.0301 0.0107  82   LEU A N   
589  C CA  . LEU A 82  ? 0.4426 0.5133 0.4832 0.0827  -0.0250 0.0137  82   LEU A CA  
590  C C   . LEU A 82  ? 0.4373 0.5073 0.4826 0.0764  -0.0227 0.0153  82   LEU A C   
591  O O   . LEU A 82  ? 0.4055 0.4774 0.4571 0.0736  -0.0254 0.0140  82   LEU A O   
592  C CB  . LEU A 82  ? 0.4582 0.5269 0.4930 0.0843  -0.0260 0.0132  82   LEU A CB  
593  C CG  . LEU A 82  ? 0.4960 0.5602 0.5248 0.0817  -0.0214 0.0160  82   LEU A CG  
594  C CD1 . LEU A 82  ? 0.5326 0.5937 0.5551 0.0835  -0.0166 0.0186  82   LEU A CD1 
595  C CD2 . LEU A 82  ? 0.5072 0.5703 0.5317 0.0835  -0.0230 0.0151  82   LEU A CD2 
596  N N   . TYR A 83  ? 0.4514 0.5186 0.4937 0.0744  -0.0179 0.0181  83   TYR A N   
597  C CA  . TYR A 83  ? 0.4036 0.4696 0.4489 0.0691  -0.0153 0.0197  83   TYR A CA  
598  C C   . TYR A 83  ? 0.3794 0.4409 0.4183 0.0671  -0.0121 0.0215  83   TYR A C   
599  O O   . TYR A 83  ? 0.3920 0.4506 0.4243 0.0690  -0.0092 0.0229  83   TYR A O   
600  C CB  . TYR A 83  ? 0.4208 0.4870 0.4682 0.0683  -0.0124 0.0214  83   TYR A CB  
601  C CG  . TYR A 83  ? 0.4733 0.5441 0.5280 0.0700  -0.0152 0.0200  83   TYR A CG  
602  C CD1 . TYR A 83  ? 0.5063 0.5781 0.5589 0.0744  -0.0156 0.0195  83   TYR A CD1 
603  C CD2 . TYR A 83  ? 0.4854 0.5592 0.5493 0.0672  -0.0173 0.0192  83   TYR A CD2 
604  C CE1 . TYR A 83  ? 0.5168 0.5929 0.5766 0.0760  -0.0183 0.0180  83   TYR A CE1 
605  C CE2 . TYR A 83  ? 0.5262 0.6043 0.5978 0.0687  -0.0198 0.0178  83   TYR A CE2 
606  C CZ  . TYR A 83  ? 0.5612 0.6405 0.6309 0.0730  -0.0204 0.0172  83   TYR A CZ  
607  O OH  . TYR A 83  ? 0.6043 0.6879 0.6823 0.0744  -0.0232 0.0156  83   TYR A OH  
608  N N   . ILE A 84  ? 0.3523 0.4132 0.3935 0.0632  -0.0125 0.0214  84   ILE A N   
609  C CA  . ILE A 84  ? 0.3212 0.3779 0.3572 0.0609  -0.0094 0.0229  84   ILE A CA  
610  C C   . ILE A 84  ? 0.2547 0.3101 0.2929 0.0569  -0.0067 0.0245  84   ILE A C   
611  O O   . ILE A 84  ? 0.2637 0.3209 0.3076 0.0542  -0.0080 0.0240  84   ILE A O   
612  C CB  . ILE A 84  ? 0.3605 0.4170 0.3960 0.0599  -0.0118 0.0216  84   ILE A CB  
613  C CG1 . ILE A 84  ? 0.3615 0.4186 0.3933 0.0646  -0.0140 0.0204  84   ILE A CG1 
614  C CG2 . ILE A 84  ? 0.3906 0.4429 0.4220 0.0571  -0.0086 0.0231  84   ILE A CG2 
615  C CD1 . ILE A 84  ? 0.3543 0.4144 0.3896 0.0653  -0.0189 0.0178  84   ILE A CD1 
616  N N   . VAL A 85  ? 0.2221 0.2742 0.2558 0.0568  -0.0028 0.0263  85   VAL A N   
617  C CA  . VAL A 85  ? 0.2506 0.3010 0.2852 0.0540  0.0000  0.0279  85   VAL A CA  
618  C C   . VAL A 85  ? 0.3027 0.3497 0.3348 0.0509  0.0014  0.0283  85   VAL A C   
619  O O   . VAL A 85  ? 0.2857 0.3298 0.3131 0.0514  0.0024  0.0285  85   VAL A O   
620  C CB  . VAL A 85  ? 0.2644 0.3128 0.2952 0.0559  0.0033  0.0295  85   VAL A CB  
621  C CG1 . VAL A 85  ? 0.2525 0.2992 0.2840 0.0534  0.0060  0.0310  85   VAL A CG1 
622  C CG2 . VAL A 85  ? 0.2838 0.3357 0.3167 0.0594  0.0018  0.0289  85   VAL A CG2 
623  N N   . MET A 86  ? 0.3115 0.3586 0.3469 0.0478  0.0014  0.0285  86   MET A N   
624  C CA  . MET A 86  ? 0.2860 0.3300 0.3193 0.0450  0.0024  0.0286  86   MET A CA  
625  C C   . MET A 86  ? 0.2413 0.2839 0.2756 0.0427  0.0044  0.0297  86   MET A C   
626  O O   . MET A 86  ? 0.2306 0.2748 0.2676 0.0431  0.0053  0.0305  86   MET A O   
627  C CB  . MET A 86  ? 0.3233 0.3690 0.3589 0.0437  -0.0008 0.0270  86   MET A CB  
628  C CG  . MET A 86  ? 0.3531 0.4027 0.3956 0.0427  -0.0033 0.0262  86   MET A CG  
629  S SD  . MET A 86  ? 0.4794 0.5313 0.5247 0.0423  -0.0077 0.0240  86   MET A SD  
630  C CE  . MET A 86  ? 0.2508 0.3055 0.2961 0.0467  -0.0103 0.0227  86   MET A CE  
631  N N   . GLU A 87  ? 0.1447 0.1842 0.1765 0.0404  0.0052  0.0296  87   GLU A N   
632  C CA  . GLU A 87  ? 0.1921 0.2298 0.2242 0.0383  0.0066  0.0302  87   GLU A CA  
633  C C   . GLU A 87  ? 0.1896 0.2307 0.2277 0.0373  0.0054  0.0304  87   GLU A C   
634  O O   . GLU A 87  ? 0.1823 0.2263 0.2242 0.0369  0.0027  0.0293  87   GLU A O   
635  C CB  . GLU A 87  ? 0.2966 0.3317 0.3263 0.0362  0.0062  0.0293  87   GLU A CB  
636  C CG  . GLU A 87  ? 0.3564 0.3875 0.3830 0.0349  0.0082  0.0297  87   GLU A CG  
637  C CD  . GLU A 87  ? 0.3366 0.3657 0.3618 0.0329  0.0072  0.0285  87   GLU A CD  
638  O OE1 . GLU A 87  ? 0.3987 0.4259 0.4232 0.0314  0.0077  0.0285  87   GLU A OE1 
639  O OE2 . GLU A 87  ? 0.2188 0.2481 0.2434 0.0330  0.0058  0.0277  87   GLU A OE2 
640  N N   . TYR A 88  ? 0.1660 0.2065 0.2048 0.0368  0.0075  0.0317  88   TYR A N   
641  C CA  . TYR A 88  ? 0.2039 0.2468 0.2483 0.0356  0.0072  0.0323  88   TYR A CA  
642  C C   . TYR A 88  ? 0.2675 0.3079 0.3102 0.0334  0.0074  0.0321  88   TYR A C   
643  O O   . TYR A 88  ? 0.2740 0.3105 0.3116 0.0332  0.0092  0.0324  88   TYR A O   
644  C CB  . TYR A 88  ? 0.2179 0.2613 0.2637 0.0368  0.0098  0.0343  88   TYR A CB  
645  C CG  . TYR A 88  ? 0.2485 0.2941 0.3002 0.0358  0.0102  0.0355  88   TYR A CG  
646  C CD1 . TYR A 88  ? 0.2412 0.2908 0.3002 0.0352  0.0078  0.0349  88   TYR A CD1 
647  C CD2 . TYR A 88  ? 0.2143 0.2576 0.2642 0.0357  0.0131  0.0372  88   TYR A CD2 
648  C CE1 . TYR A 88  ? 0.2127 0.2643 0.2779 0.0342  0.0084  0.0362  88   TYR A CE1 
649  C CE2 . TYR A 88  ? 0.1985 0.2437 0.2538 0.0351  0.0140  0.0387  88   TYR A CE2 
650  C CZ  . TYR A 88  ? 0.2165 0.2659 0.2798 0.0342  0.0118  0.0383  88   TYR A CZ  
651  O OH  . TYR A 88  ? 0.2720 0.3232 0.3417 0.0336  0.0129  0.0400  88   TYR A OH  
652  N N   . CYS A 89  ? 0.2216 0.2641 0.2686 0.0319  0.0053  0.0314  89   CYS A N   
653  C CA  . CYS A 89  ? 0.1943 0.2346 0.2399 0.0299  0.0053  0.0312  89   CYS A CA  
654  C C   . CYS A 89  ? 0.1924 0.2343 0.2429 0.0293  0.0064  0.0327  89   CYS A C   
655  O O   . CYS A 89  ? 0.1945 0.2395 0.2512 0.0285  0.0046  0.0324  89   CYS A O   
656  C CB  . CYS A 89  ? 0.1295 0.1706 0.1757 0.0286  0.0023  0.0293  89   CYS A CB  
657  S SG  . CYS A 89  ? 0.2267 0.2656 0.2671 0.0295  0.0015  0.0279  89   CYS A SG  
658  N N   . GLU A 90  ? 0.2138 0.2534 0.2618 0.0300  0.0094  0.0344  90   GLU A N   
659  C CA  . GLU A 90  ? 0.2789 0.3204 0.3320 0.0302  0.0112  0.0365  90   GLU A CA  
660  C C   . GLU A 90  ? 0.2978 0.3400 0.3546 0.0285  0.0104  0.0366  90   GLU A C   
661  O O   . GLU A 90  ? 0.2389 0.2834 0.3019 0.0285  0.0115  0.0383  90   GLU A O   
662  C CB  . GLU A 90  ? 0.3050 0.3437 0.3539 0.0319  0.0147  0.0383  90   GLU A CB  
663  C CG  . GLU A 90  ? 0.3403 0.3746 0.3829 0.0316  0.0159  0.0382  90   GLU A CG  
664  C CD  . GLU A 90  ? 0.3938 0.4262 0.4340 0.0336  0.0194  0.0404  90   GLU A CD  
665  O OE1 . GLU A 90  ? 0.4236 0.4555 0.4648 0.0337  0.0208  0.0419  90   GLU A OE1 
666  O OE2 . GLU A 90  ? 0.4304 0.4617 0.4676 0.0353  0.0207  0.0409  90   GLU A OE2 
667  N N   . GLY A 91  ? 0.2860 0.3262 0.3395 0.0270  0.0087  0.0349  91   GLY A N   
668  C CA  . GLY A 91  ? 0.2356 0.2761 0.2919 0.0254  0.0081  0.0349  91   GLY A CA  
669  C C   . GLY A 91  ? 0.2416 0.2861 0.3052 0.0242  0.0049  0.0339  91   GLY A C   
670  O O   . GLY A 91  ? 0.2012 0.2465 0.2686 0.0228  0.0042  0.0340  91   GLY A O   
671  N N   . GLY A 92  ? 0.2564 0.3033 0.3220 0.0249  0.0029  0.0327  92   GLY A N   
672  C CA  . GLY A 92  ? 0.2267 0.2773 0.2989 0.0242  -0.0006 0.0312  92   GLY A CA  
673  C C   . GLY A 92  ? 0.2088 0.2581 0.2775 0.0229  -0.0033 0.0290  92   GLY A C   
674  O O   . GLY A 92  ? 0.1992 0.2451 0.2606 0.0228  -0.0025 0.0285  92   GLY A O   
675  N N   . ASP A 93  ? 0.1996 0.2516 0.2739 0.0220  -0.0064 0.0277  93   ASP A N   
676  C CA  . ASP A 93  ? 0.2618 0.3133 0.3337 0.0211  -0.0094 0.0255  93   ASP A CA  
677  C C   . ASP A 93  ? 0.2639 0.3141 0.3363 0.0191  -0.0092 0.0258  93   ASP A C   
678  O O   . ASP A 93  ? 0.2433 0.2935 0.3193 0.0185  -0.0071 0.0276  93   ASP A O   
679  C CB  . ASP A 93  ? 0.3304 0.3858 0.4082 0.0217  -0.0134 0.0237  93   ASP A CB  
680  C CG  . ASP A 93  ? 0.3851 0.4435 0.4726 0.0208  -0.0143 0.0242  93   ASP A CG  
681  O OD1 . ASP A 93  ? 0.4366 0.4966 0.5290 0.0214  -0.0125 0.0259  93   ASP A OD1 
682  O OD2 . ASP A 93  ? 0.4496 0.5088 0.5401 0.0195  -0.0169 0.0230  93   ASP A OD2 
683  N N   . LEU A 94  ? 0.2385 0.2873 0.3073 0.0181  -0.0113 0.0240  94   LEU A N   
684  C CA  . LEU A 94  ? 0.2255 0.2726 0.2934 0.0163  -0.0112 0.0239  94   LEU A CA  
685  C C   . LEU A 94  ? 0.2643 0.3142 0.3403 0.0152  -0.0134 0.0237  94   LEU A C   
686  O O   . LEU A 94  ? 0.2107 0.2596 0.2879 0.0139  -0.0125 0.0245  94   LEU A O   
687  C CB  . LEU A 94  ? 0.2292 0.2741 0.2907 0.0158  -0.0128 0.0221  94   LEU A CB  
688  C CG  . LEU A 94  ? 0.3010 0.3429 0.3591 0.0142  -0.0119 0.0221  94   LEU A CG  
689  C CD1 . LEU A 94  ? 0.3225 0.3612 0.3761 0.0149  -0.0082 0.0237  94   LEU A CD1 
690  C CD2 . LEU A 94  ? 0.3445 0.3849 0.3979 0.0136  -0.0139 0.0201  94   LEU A CD2 
691  N N   . ALA A 95  ? 0.2855 0.3389 0.3669 0.0159  -0.0164 0.0224  95   ALA A N   
692  C CA  . ALA A 95  ? 0.2964 0.3527 0.3867 0.0150  -0.0188 0.0219  95   ALA A CA  
693  C C   . ALA A 95  ? 0.2822 0.3393 0.3790 0.0144  -0.0159 0.0246  95   ALA A C   
694  O O   . ALA A 95  ? 0.2541 0.3114 0.3555 0.0130  -0.0160 0.0251  95   ALA A O   
695  C CB  . ALA A 95  ? 0.2692 0.3291 0.3643 0.0164  -0.0225 0.0200  95   ALA A CB  
696  N N   . SER A 96  ? 0.2533 0.3106 0.3503 0.0157  -0.0131 0.0263  96   SER A N   
697  C CA  . SER A 96  ? 0.2529 0.3111 0.3562 0.0156  -0.0100 0.0291  96   SER A CA  
698  C C   . SER A 96  ? 0.2628 0.3175 0.3614 0.0149  -0.0065 0.0311  96   SER A C   
699  O O   . SER A 96  ? 0.2595 0.3145 0.3636 0.0144  -0.0044 0.0332  96   SER A O   
700  C CB  . SER A 96  ? 0.2854 0.3445 0.3891 0.0174  -0.0079 0.0304  96   SER A CB  
701  O OG  . SER A 96  ? 0.3275 0.3899 0.4352 0.0184  -0.0112 0.0285  96   SER A OG  
702  N N   . VAL A 97  ? 0.2920 0.3431 0.3806 0.0151  -0.0057 0.0304  97   VAL A N   
703  C CA  . VAL A 97  ? 0.2682 0.3157 0.3514 0.0148  -0.0029 0.0317  97   VAL A CA  
704  C C   . VAL A 97  ? 0.2246 0.2719 0.3103 0.0131  -0.0044 0.0312  97   VAL A C   
705  O O   . VAL A 97  ? 0.2234 0.2693 0.3098 0.0130  -0.0018 0.0332  97   VAL A O   
706  C CB  . VAL A 97  ? 0.2675 0.3112 0.3400 0.0154  -0.0024 0.0306  97   VAL A CB  
707  C CG1 . VAL A 97  ? 0.2278 0.2679 0.2947 0.0150  -0.0009 0.0309  97   VAL A CG1 
708  C CG2 . VAL A 97  ? 0.2377 0.2808 0.3074 0.0173  0.0000  0.0318  97   VAL A CG2 
709  N N   . ILE A 98  ? 0.2247 0.2734 0.3115 0.0121  -0.0085 0.0286  98   ILE A N   
710  C CA  . ILE A 98  ? 0.2219 0.2706 0.3110 0.0104  -0.0105 0.0277  98   ILE A CA  
711  C C   . ILE A 98  ? 0.2951 0.3469 0.3955 0.0099  -0.0105 0.0291  98   ILE A C   
712  O O   . ILE A 98  ? 0.3289 0.3799 0.4319 0.0089  -0.0094 0.0302  98   ILE A O   
713  C CB  . ILE A 98  ? 0.2214 0.2711 0.3090 0.0098  -0.0150 0.0245  98   ILE A CB  
714  C CG1 . ILE A 98  ? 0.2463 0.2924 0.3235 0.0098  -0.0148 0.0232  98   ILE A CG1 
715  C CG2 . ILE A 98  ? 0.1518 0.2032 0.2459 0.0084  -0.0178 0.0235  98   ILE A CG2 
716  C CD1 . ILE A 98  ? 0.2390 0.2859 0.3132 0.0101  -0.0182 0.0207  98   ILE A CD1 
717  N N   . THR A 99  ? 0.2727 0.3279 0.3799 0.0105  -0.0116 0.0289  99   THR A N   
718  C CA  . THR A 99  ? 0.3292 0.3875 0.4484 0.0100  -0.0118 0.0301  99   THR A CA  
719  C C   . THR A 99  ? 0.3529 0.4098 0.4737 0.0103  -0.0066 0.0339  99   THR A C   
720  O O   . THR A 99  ? 0.3417 0.3988 0.4685 0.0094  -0.0056 0.0354  99   THR A O   
721  C CB  . THR A 99  ? 0.3114 0.3734 0.4372 0.0111  -0.0137 0.0293  99   THR A CB  
722  O OG1 . THR A 99  ? 0.2440 0.3079 0.3706 0.0111  -0.0189 0.0258  99   THR A OG1 
723  C CG2 . THR A 99  ? 0.3262 0.3912 0.4648 0.0108  -0.0125 0.0314  99   THR A CG2 
724  N N   . LYS A 100 ? 0.3696 0.4249 0.4847 0.0119  -0.0033 0.0356  100  LYS A N   
725  C CA  . LYS A 100 ? 0.3910 0.4446 0.5061 0.0129  0.0019  0.0393  100  LYS A CA  
726  C C   . LYS A 100 ? 0.4255 0.4758 0.5362 0.0124  0.0036  0.0402  100  LYS A C   
727  O O   . LYS A 100 ? 0.4627 0.5129 0.5787 0.0125  0.0065  0.0430  100  LYS A O   
728  C CB  . LYS A 100 ? 0.3794 0.4311 0.4868 0.0148  0.0046  0.0402  100  LYS A CB  
729  C CG  . LYS A 100 ? 0.4034 0.4527 0.5085 0.0164  0.0099  0.0439  100  LYS A CG  
730  C CD  . LYS A 100 ? 0.4602 0.5074 0.5568 0.0185  0.0121  0.0443  100  LYS A CD  
731  C CE  . LYS A 100 ? 0.5198 0.5646 0.6141 0.0206  0.0173  0.0480  100  LYS A CE  
732  N NZ  . LYS A 100 ? 0.5823 0.6235 0.6654 0.0225  0.0188  0.0476  100  LYS A NZ  
733  N N   . GLY A 101 ? 0.3930 0.4405 0.4942 0.0120  0.0020  0.0380  101  GLY A N   
734  C CA  . GLY A 101 ? 0.3399 0.3841 0.4361 0.0117  0.0031  0.0383  101  GLY A CA  
735  C C   . GLY A 101 ? 0.3483 0.3943 0.4532 0.0101  0.0020  0.0388  101  GLY A C   
736  O O   . GLY A 101 ? 0.3512 0.3955 0.4568 0.0104  0.0050  0.0412  101  GLY A O   
737  N N   . THR A 102 ? 0.3894 0.4386 0.5009 0.0086  -0.0023 0.0364  102  THR A N   
738  C CA  . THR A 102 ? 0.4606 0.5114 0.5809 0.0070  -0.0041 0.0363  102  THR A CA  
739  C C   . THR A 102 ? 0.5652 0.6174 0.6955 0.0073  -0.0004 0.0401  102  THR A C   
740  O O   . THR A 102 ? 0.5984 0.6499 0.7326 0.0066  0.0008  0.0415  102  THR A O   
741  C CB  . THR A 102 ? 0.4403 0.4947 0.5667 0.0059  -0.0095 0.0331  102  THR A CB  
742  O OG1 . THR A 102 ? 0.4247 0.4778 0.5421 0.0057  -0.0127 0.0299  102  THR A OG1 
743  C CG2 . THR A 102 ? 0.4116 0.4676 0.5478 0.0043  -0.0114 0.0330  102  THR A CG2 
744  N N   . LYS A 103 ? 0.6614 0.7156 0.7960 0.0085  0.0015  0.0417  103  LYS A N   
745  C CA  . LYS A 103 ? 0.7484 0.8043 0.8935 0.0089  0.0051  0.0454  103  LYS A CA  
746  C C   . LYS A 103 ? 0.8261 0.8784 0.9666 0.0104  0.0108  0.0492  103  LYS A C   
747  O O   . LYS A 103 ? 0.8778 0.9298 1.0241 0.0099  0.0126  0.0513  103  LYS A O   
748  C CB  . LYS A 103 ? 0.7667 0.8253 0.9162 0.0101  0.0060  0.0462  103  LYS A CB  
749  N N   . GLU A 104 ? 0.8347 0.8843 0.9648 0.0124  0.0135  0.0501  104  GLU A N   
750  C CA  . GLU A 104 ? 0.8712 0.9172 0.9956 0.0145  0.0188  0.0535  104  GLU A CA  
751  C C   . GLU A 104 ? 0.8704 0.9129 0.9871 0.0142  0.0182  0.0524  104  GLU A C   
752  O O   . GLU A 104 ? 0.8988 0.9376 1.0080 0.0163  0.0219  0.0545  104  GLU A O   
753  C CB  . GLU A 104 ? 0.9197 0.9638 1.0348 0.0170  0.0212  0.0542  104  GLU A CB  
754  C CG  . GLU A 104 ? 0.9658 1.0132 1.0876 0.0176  0.0220  0.0553  104  GLU A CG  
755  C CD  . GLU A 104 ? 1.0136 1.0591 1.1255 0.0196  0.0230  0.0548  104  GLU A CD  
756  O OE1 . GLU A 104 ? 1.0276 1.0753 1.1435 0.0206  0.0243  0.0561  104  GLU A OE1 
757  O OE2 . GLU A 104 ? 1.0419 1.0837 1.1423 0.0202  0.0224  0.0531  104  GLU A OE2 
758  N N   . ARG A 105 ? 0.8268 0.8704 0.9452 0.0117  0.0135  0.0492  105  ARG A N   
759  C CA  . ARG A 105 ? 0.7700 0.8105 0.8815 0.0112  0.0123  0.0477  105  ARG A CA  
760  C C   . ARG A 105 ? 0.7222 0.7584 0.8199 0.0133  0.0142  0.0475  105  ARG A C   
761  O O   . ARG A 105 ? 0.7076 0.7405 0.7999 0.0146  0.0166  0.0488  105  ARG A O   
762  C CB  . ARG A 105 ? 0.7648 0.8048 0.8827 0.0110  0.0149  0.0506  105  ARG A CB  
763  N N   . GLN A 106 ? 0.6684 0.7044 0.7604 0.0138  0.0130  0.0457  106  GLN A N   
764  C CA  . GLN A 106 ? 0.6155 0.6475 0.6952 0.0158  0.0143  0.0451  106  GLN A CA  
765  C C   . GLN A 106 ? 0.5239 0.5555 0.5972 0.0145  0.0100  0.0409  106  GLN A C   
766  O O   . GLN A 106 ? 0.5158 0.5498 0.5914 0.0138  0.0079  0.0395  106  GLN A O   
767  C CB  . GLN A 106 ? 0.6925 0.7240 0.7706 0.0185  0.0182  0.0477  106  GLN A CB  
768  C CG  . GLN A 106 ? 0.7602 0.7876 0.8260 0.0208  0.0192  0.0468  106  GLN A CG  
769  C CD  . GLN A 106 ? 0.8010 0.8243 0.8599 0.0228  0.0216  0.0479  106  GLN A CD  
770  O OE1 . GLN A 106 ? 0.8267 0.8498 0.8894 0.0241  0.0251  0.0513  106  GLN A OE1 
771  N NE2 . GLN A 106 ? 0.7958 0.8157 0.8448 0.0234  0.0199  0.0451  106  GLN A NE2 
772  N N   . TYR A 107 ? 0.4517 0.4802 0.5171 0.0145  0.0088  0.0390  107  TYR A N   
773  C CA  . TYR A 107 ? 0.4018 0.4295 0.4614 0.0133  0.0051  0.0353  107  TYR A CA  
774  C C   . TYR A 107 ? 0.3273 0.3532 0.3800 0.0150  0.0060  0.0347  107  TYR A C   
775  O O   . TYR A 107 ? 0.3805 0.4043 0.4297 0.0174  0.0095  0.0367  107  TYR A O   
776  C CB  . TYR A 107 ? 0.4217 0.4467 0.4756 0.0127  0.0036  0.0335  107  TYR A CB  
777  C CG  . TYR A 107 ? 0.4338 0.4608 0.4938 0.0105  0.0012  0.0328  107  TYR A CG  
778  C CD1 . TYR A 107 ? 0.4531 0.4781 0.5120 0.0108  0.0025  0.0339  107  TYR A CD1 
779  C CD2 . TYR A 107 ? 0.4377 0.4682 0.5039 0.0084  -0.0024 0.0311  107  TYR A CD2 
780  C CE1 . TYR A 107 ? 0.4459 0.4725 0.5104 0.0088  0.0003  0.0333  107  TYR A CE1 
781  C CE2 . TYR A 107 ? 0.4084 0.4405 0.4800 0.0066  -0.0048 0.0304  107  TYR A CE2 
782  C CZ  . TYR A 107 ? 0.4140 0.4441 0.4848 0.0066  -0.0034 0.0314  107  TYR A CZ  
783  O OH  . TYR A 107 ? 0.3504 0.3819 0.4266 0.0048  -0.0058 0.0307  107  TYR A OH  
784  N N   . LEU A 108 ? 0.2232 0.2498 0.2739 0.0139  0.0030  0.0320  108  LEU A N   
785  C CA  . LEU A 108 ? 0.1979 0.2224 0.2420 0.0153  0.0036  0.0311  108  LEU A CA  
786  C C   . LEU A 108 ? 0.2633 0.2835 0.2983 0.0162  0.0035  0.0294  108  LEU A C   
787  O O   . LEU A 108 ? 0.2752 0.2945 0.3086 0.0150  0.0016  0.0278  108  LEU A O   
788  C CB  . LEU A 108 ? 0.2306 0.2575 0.2763 0.0140  0.0007  0.0291  108  LEU A CB  
789  C CG  . LEU A 108 ? 0.2894 0.3205 0.3438 0.0136  0.0006  0.0304  108  LEU A CG  
790  C CD1 . LEU A 108 ? 0.3374 0.3709 0.3937 0.0123  -0.0030 0.0281  108  LEU A CD1 
791  C CD2 . LEU A 108 ? 0.2052 0.2362 0.2597 0.0156  0.0039  0.0327  108  LEU A CD2 
792  N N   . ASP A 109 ? 0.2392 0.2567 0.2685 0.0184  0.0054  0.0296  109  ASP A N   
793  C CA  . ASP A 109 ? 0.2638 0.2770 0.2846 0.0195  0.0050  0.0276  109  ASP A CA  
794  C C   . ASP A 109 ? 0.1987 0.2118 0.2178 0.0175  0.0014  0.0243  109  ASP A C   
795  O O   . ASP A 109 ? 0.1960 0.2112 0.2177 0.0162  0.0000  0.0236  109  ASP A O   
796  C CB  . ASP A 109 ? 0.3546 0.3653 0.3704 0.0222  0.0071  0.0281  109  ASP A CB  
797  C CG  . ASP A 109 ? 0.4997 0.5099 0.5159 0.0249  0.0110  0.0315  109  ASP A CG  
798  O OD1 . ASP A 109 ? 0.5170 0.5274 0.5351 0.0252  0.0123  0.0333  109  ASP A OD1 
799  O OD2 . ASP A 109 ? 0.5263 0.5358 0.5408 0.0269  0.0129  0.0326  109  ASP A OD2 
800  N N   . GLU A 110 ? 0.1629 0.1734 0.1774 0.0173  0.0000  0.0223  110  GLU A N   
801  C CA  . GLU A 110 ? 0.1649 0.1748 0.1773 0.0157  -0.0030 0.0192  110  GLU A CA  
802  C C   . GLU A 110 ? 0.1873 0.1961 0.1976 0.0163  -0.0030 0.0182  110  GLU A C   
803  O O   . GLU A 110 ? 0.1512 0.1613 0.1629 0.0147  -0.0048 0.0168  110  GLU A O   
804  C CB  . GLU A 110 ? 0.1467 0.1532 0.1538 0.0161  -0.0041 0.0172  110  GLU A CB  
805  C CG  . GLU A 110 ? 0.1876 0.1935 0.1932 0.0144  -0.0070 0.0140  110  GLU A CG  
806  C CD  . GLU A 110 ? 0.2972 0.3016 0.3002 0.0137  -0.0089 0.0121  110  GLU A CD  
807  O OE1 . GLU A 110 ? 0.3230 0.3272 0.3259 0.0143  -0.0081 0.0133  110  GLU A OE1 
808  O OE2 . GLU A 110 ? 0.3525 0.3559 0.3539 0.0127  -0.0111 0.0096  110  GLU A OE2 
809  N N   . GLU A 111 ? 0.2267 0.2330 0.2333 0.0188  -0.0007 0.0191  111  GLU A N   
810  C CA  . GLU A 111 ? 0.2472 0.2523 0.2519 0.0196  -0.0005 0.0183  111  GLU A CA  
811  C C   . GLU A 111 ? 0.2545 0.2632 0.2643 0.0184  -0.0005 0.0193  111  GLU A C   
812  O O   . GLU A 111 ? 0.2647 0.2732 0.2741 0.0179  -0.0014 0.0180  111  GLU A O   
813  C CB  . GLU A 111 ? 0.2643 0.2665 0.2647 0.0229  0.0020  0.0193  111  GLU A CB  
814  C CG  . GLU A 111 ? 0.2697 0.2675 0.2636 0.0246  0.0013  0.0171  111  GLU A CG  
815  C CD  . GLU A 111 ? 0.3407 0.3362 0.3323 0.0241  -0.0008 0.0140  111  GLU A CD  
816  O OE1 . GLU A 111 ? 0.3605 0.3563 0.3531 0.0219  -0.0033 0.0119  111  GLU A OE1 
817  O OE2 . GLU A 111 ? 0.3632 0.3565 0.3522 0.0260  0.0000  0.0137  111  GLU A OE2 
818  N N   . PHE A 112 ? 0.1963 0.2082 0.2111 0.0182  0.0005  0.0216  112  PHE A N   
819  C CA  . PHE A 112 ? 0.1747 0.1901 0.1945 0.0173  0.0002  0.0225  112  PHE A CA  
820  C C   . PHE A 112 ? 0.1773 0.1947 0.1994 0.0151  -0.0028 0.0207  112  PHE A C   
821  O O   . PHE A 112 ? 0.1099 0.1286 0.1330 0.0147  -0.0037 0.0200  112  PHE A O   
822  C CB  . PHE A 112 ? 0.1843 0.2027 0.2095 0.0177  0.0019  0.0252  112  PHE A CB  
823  C CG  . PHE A 112 ? 0.1705 0.1928 0.2014 0.0170  0.0011  0.0257  112  PHE A CG  
824  C CD1 . PHE A 112 ? 0.1751 0.1975 0.2052 0.0182  0.0022  0.0262  112  PHE A CD1 
825  C CD2 . PHE A 112 ? 0.1643 0.1901 0.2011 0.0154  -0.0008 0.0256  112  PHE A CD2 
826  C CE1 . PHE A 112 ? 0.2147 0.2406 0.2497 0.0179  0.0014  0.0266  112  PHE A CE1 
827  C CE2 . PHE A 112 ? 0.1839 0.2131 0.2256 0.0151  -0.0019 0.0258  112  PHE A CE2 
828  C CZ  . PHE A 112 ? 0.2017 0.2310 0.2424 0.0165  -0.0008 0.0263  112  PHE A CZ  
829  N N   . VAL A 113 ? 0.1980 0.2156 0.2207 0.0138  -0.0042 0.0200  113  VAL A N   
830  C CA  . VAL A 113 ? 0.1980 0.2172 0.2223 0.0119  -0.0072 0.0182  113  VAL A CA  
831  C C   . VAL A 113 ? 0.1784 0.1953 0.1986 0.0118  -0.0081 0.0161  113  VAL A C   
832  O O   . VAL A 113 ? 0.2146 0.2330 0.2361 0.0110  -0.0096 0.0153  113  VAL A O   
833  C CB  . VAL A 113 ? 0.1789 0.1987 0.2046 0.0107  -0.0086 0.0178  113  VAL A CB  
834  C CG1 . VAL A 113 ? 0.1299 0.1512 0.1567 0.0090  -0.0116 0.0159  113  VAL A CG1 
835  C CG2 . VAL A 113 ? 0.1201 0.1425 0.1514 0.0107  -0.0075 0.0201  113  VAL A CG2 
836  N N   . LEU A 114 ? 0.1469 0.1601 0.1623 0.0127  -0.0073 0.0152  114  LEU A N   
837  C CA  . LEU A 114 ? 0.1552 0.1661 0.1677 0.0125  -0.0082 0.0132  114  LEU A CA  
838  C C   . LEU A 114 ? 0.1847 0.1959 0.1978 0.0132  -0.0071 0.0138  114  LEU A C   
839  O O   . LEU A 114 ? 0.1689 0.1803 0.1824 0.0125  -0.0080 0.0128  114  LEU A O   
840  C CB  . LEU A 114 ? 0.1817 0.1885 0.1893 0.0135  -0.0079 0.0118  114  LEU A CB  
841  C CG  . LEU A 114 ? 0.1697 0.1758 0.1760 0.0128  -0.0092 0.0108  114  LEU A CG  
842  C CD1 . LEU A 114 ? 0.1572 0.1590 0.1583 0.0144  -0.0090 0.0092  114  LEU A CD1 
843  C CD2 . LEU A 114 ? 0.1568 0.1642 0.1648 0.0107  -0.0116 0.0092  114  LEU A CD2 
844  N N   . ARG A 115 ? 0.1601 0.1715 0.1734 0.0147  -0.0050 0.0155  115  ARG A N   
845  C CA  A ARG A 115 ? 0.1701 0.1821 0.1842 0.0155  -0.0039 0.0163  115  ARG A CA  
846  C CA  B ARG A 115 ? 0.1717 0.1837 0.1858 0.0155  -0.0039 0.0163  115  ARG A CA  
847  C C   . ARG A 115 ? 0.1556 0.1713 0.1737 0.0147  -0.0051 0.0167  115  ARG A C   
848  O O   . ARG A 115 ? 0.1545 0.1702 0.1725 0.0148  -0.0053 0.0163  115  ARG A O   
849  C CB  A ARG A 115 ? 0.1969 0.2089 0.2109 0.0174  -0.0015 0.0183  115  ARG A CB  
850  C CB  B ARG A 115 ? 0.1949 0.2070 0.2090 0.0173  -0.0015 0.0184  115  ARG A CB  
851  C CG  A ARG A 115 ? 0.2086 0.2166 0.2179 0.0190  -0.0002 0.0179  115  ARG A CG  
852  C CG  B ARG A 115 ? 0.2036 0.2121 0.2134 0.0190  -0.0002 0.0182  115  ARG A CG  
853  C CD  A ARG A 115 ? 0.2264 0.2345 0.2354 0.0211  0.0023  0.0200  115  ARG A CD  
854  C CD  B ARG A 115 ? 0.2219 0.2298 0.2307 0.0211  0.0023  0.0199  115  ARG A CD  
855  N NE  A ARG A 115 ? 0.2282 0.2320 0.2320 0.0231  0.0033  0.0193  115  ARG A NE  
856  N NE  B ARG A 115 ? 0.1912 0.2019 0.2033 0.0218  0.0039  0.0225  115  ARG A NE  
857  C CZ  A ARG A 115 ? 0.2695 0.2714 0.2703 0.0249  0.0043  0.0197  115  ARG A CZ  
858  C CZ  B ARG A 115 ? 0.1636 0.1782 0.1807 0.0210  0.0037  0.0237  115  ARG A CZ  
859  N NH1 A ARG A 115 ? 0.2207 0.2242 0.2232 0.0246  0.0048  0.0211  115  ARG A NH1 
860  N NH1 B ARG A 115 ? 0.1787 0.1947 0.1973 0.0198  0.0021  0.0226  115  ARG A NH1 
861  N NH2 A ARG A 115 ? 0.3628 0.3607 0.3585 0.0271  0.0048  0.0186  115  ARG A NH2 
862  N NH2 B ARG A 115 ? 0.0973 0.1143 0.1181 0.0216  0.0052  0.0260  115  ARG A NH2 
863  N N   . VAL A 116 ? 0.1431 0.1619 0.1648 0.0140  -0.0060 0.0175  116  VAL A N   
864  C CA  . VAL A 116 ? 0.0941 0.1163 0.1193 0.0136  -0.0075 0.0176  116  VAL A CA  
865  C C   . VAL A 116 ? 0.1296 0.1515 0.1537 0.0126  -0.0095 0.0159  116  VAL A C   
866  O O   . VAL A 116 ? 0.1660 0.1890 0.1906 0.0131  -0.0099 0.0158  116  VAL A O   
867  C CB  . VAL A 116 ? 0.2010 0.2266 0.2312 0.0131  -0.0085 0.0185  116  VAL A CB  
868  C CG1 . VAL A 116 ? 0.2195 0.2484 0.2530 0.0128  -0.0108 0.0179  116  VAL A CG1 
869  C CG2 . VAL A 116 ? 0.1460 0.1726 0.1785 0.0143  -0.0062 0.0206  116  VAL A CG2 
870  N N   . MET A 117 ? 0.0835 0.1039 0.1060 0.0114  -0.0105 0.0146  117  MET A N   
871  C CA  . MET A 117 ? 0.0893 0.1092 0.1107 0.0105  -0.0123 0.0130  117  MET A CA  
872  C C   . MET A 117 ? 0.1019 0.1197 0.1213 0.0111  -0.0112 0.0127  117  MET A C   
873  O O   . MET A 117 ? 0.0910 0.1098 0.1110 0.0113  -0.0117 0.0125  117  MET A O   
874  C CB  . MET A 117 ? 0.1255 0.1435 0.1450 0.0093  -0.0133 0.0117  117  MET A CB  
875  C CG  . MET A 117 ? 0.1457 0.1630 0.1641 0.0083  -0.0149 0.0100  117  MET A CG  
876  S SD  . MET A 117 ? 0.2411 0.2571 0.2580 0.0069  -0.0166 0.0084  117  MET A SD  
877  C CE  . MET A 117 ? 0.1390 0.1508 0.1523 0.0077  -0.0149 0.0078  117  MET A CE  
878  N N   . THR A 118 ? 0.1434 0.1581 0.1604 0.0117  -0.0096 0.0125  118  THR A N   
879  C CA  . THR A 118 ? 0.1925 0.2047 0.2081 0.0122  -0.0086 0.0120  118  THR A CA  
880  C C   . THR A 118 ? 0.1921 0.2059 0.2090 0.0134  -0.0074 0.0134  118  THR A C   
881  O O   . THR A 118 ? 0.2210 0.2349 0.2384 0.0135  -0.0074 0.0133  118  THR A O   
882  C CB  . THR A 118 ? 0.1951 0.2039 0.2081 0.0129  -0.0073 0.0115  118  THR A CB  
883  O OG1 . THR A 118 ? 0.1883 0.1954 0.1995 0.0122  -0.0085 0.0101  118  THR A OG1 
884  C CG2 . THR A 118 ? 0.0917 0.0976 0.1039 0.0134  -0.0064 0.0107  118  THR A CG2 
885  N N   . GLN A 119 ? 0.1453 0.1604 0.1630 0.0144  -0.0063 0.0148  119  GLN A N   
886  C CA  . GLN A 119 ? 0.0872 0.1036 0.1058 0.0158  -0.0051 0.0162  119  GLN A CA  
887  C C   . GLN A 119 ? 0.1569 0.1767 0.1777 0.0162  -0.0064 0.0166  119  GLN A C   
888  O O   . GLN A 119 ? 0.1517 0.1718 0.1723 0.0174  -0.0056 0.0171  119  GLN A O   
889  C CB  . GLN A 119 ? 0.0885 0.1053 0.1073 0.0169  -0.0036 0.0175  119  GLN A CB  
890  C CG  . GLN A 119 ? 0.1356 0.1485 0.1514 0.0173  -0.0022 0.0170  119  GLN A CG  
891  C CD  . GLN A 119 ? 0.1706 0.1835 0.1859 0.0188  -0.0002 0.0186  119  GLN A CD  
892  O OE1 . GLN A 119 ? 0.1704 0.1849 0.1870 0.0199  0.0007  0.0198  119  GLN A OE1 
893  N NE2 . GLN A 119 ? 0.1714 0.1822 0.1847 0.0192  0.0004  0.0185  119  GLN A NE2 
894  N N   . LEU A 120 ? 0.1541 0.1764 0.1768 0.0154  -0.0084 0.0162  120  LEU A N   
895  C CA  . LEU A 120 ? 0.1693 0.1946 0.1936 0.0160  -0.0102 0.0161  120  LEU A CA  
896  C C   . LEU A 120 ? 0.1574 0.1816 0.1802 0.0157  -0.0108 0.0152  120  LEU A C   
897  O O   . LEU A 120 ? 0.2084 0.2340 0.2313 0.0172  -0.0112 0.0156  120  LEU A O   
898  C CB  . LEU A 120 ? 0.1976 0.2257 0.2249 0.0152  -0.0124 0.0158  120  LEU A CB  
899  C CG  . LEU A 120 ? 0.1758 0.2059 0.2061 0.0158  -0.0119 0.0169  120  LEU A CG  
900  C CD1 . LEU A 120 ? 0.1608 0.1939 0.1952 0.0150  -0.0142 0.0165  120  LEU A CD1 
901  C CD2 . LEU A 120 ? 0.1424 0.1739 0.1733 0.0179  -0.0110 0.0178  120  LEU A CD2 
902  N N   . THR A 121 ? 0.1757 0.1974 0.1970 0.0142  -0.0109 0.0142  121  THR A N   
903  C CA  . THR A 121 ? 0.1758 0.1963 0.1962 0.0138  -0.0112 0.0134  121  THR A CA  
904  C C   . THR A 121 ? 0.2056 0.2244 0.2253 0.0151  -0.0090 0.0143  121  THR A C   
905  O O   . THR A 121 ? 0.2098 0.2290 0.2294 0.0161  -0.0088 0.0147  121  THR A O   
906  C CB  . THR A 121 ? 0.2047 0.2228 0.2242 0.0119  -0.0119 0.0119  121  THR A CB  
907  O OG1 . THR A 121 ? 0.1916 0.2112 0.2116 0.0109  -0.0137 0.0113  121  THR A OG1 
908  C CG2 . THR A 121 ? 0.2101 0.2274 0.2294 0.0115  -0.0123 0.0112  121  THR A CG2 
909  N N   . LEU A 122 ? 0.1778 0.1946 0.1970 0.0154  -0.0071 0.0147  122  LEU A N   
910  C CA  . LEU A 122 ? 0.2291 0.2441 0.2478 0.0167  -0.0048 0.0157  122  LEU A CA  
911  C C   . LEU A 122 ? 0.2304 0.2479 0.2494 0.0189  -0.0043 0.0172  122  LEU A C   
912  O O   . LEU A 122 ? 0.2052 0.2222 0.2240 0.0203  -0.0029 0.0181  122  LEU A O   
913  C CB  . LEU A 122 ? 0.2452 0.2575 0.2632 0.0166  -0.0033 0.0156  122  LEU A CB  
914  C CG  . LEU A 122 ? 0.2669 0.2759 0.2844 0.0151  -0.0037 0.0138  122  LEU A CG  
915  C CD1 . LEU A 122 ? 0.2872 0.2940 0.3032 0.0152  -0.0031 0.0134  122  LEU A CD1 
916  C CD2 . LEU A 122 ? 0.2842 0.2908 0.3027 0.0151  -0.0026 0.0137  122  LEU A CD2 
917  N N   . ALA A 123 ? 0.2445 0.2648 0.2643 0.0195  -0.0053 0.0176  123  ALA A N   
918  C CA  . ALA A 123 ? 0.2562 0.2792 0.2764 0.0218  -0.0054 0.0186  123  ALA A CA  
919  C C   . ALA A 123 ? 0.2618 0.2862 0.2817 0.0227  -0.0068 0.0184  123  ALA A C   
920  O O   . ALA A 123 ? 0.2461 0.2707 0.2650 0.0251  -0.0057 0.0194  123  ALA A O   
921  C CB  . ALA A 123 ? 0.1290 0.1550 0.1511 0.0221  -0.0068 0.0187  123  ALA A CB  
922  N N   . LEU A 124 ? 0.2821 0.3072 0.3025 0.0212  -0.0090 0.0172  124  LEU A N   
923  C CA  . LEU A 124 ? 0.2792 0.3056 0.2990 0.0222  -0.0104 0.0169  124  LEU A CA  
924  C C   . LEU A 124 ? 0.3014 0.3255 0.3200 0.0229  -0.0083 0.0177  124  LEU A C   
925  O O   . LEU A 124 ? 0.3375 0.3624 0.3550 0.0253  -0.0079 0.0185  124  LEU A O   
926  C CB  . LEU A 124 ? 0.2540 0.2811 0.2746 0.0201  -0.0129 0.0154  124  LEU A CB  
927  C CG  . LEU A 124 ? 0.3395 0.3696 0.3620 0.0198  -0.0158 0.0145  124  LEU A CG  
928  C CD1 . LEU A 124 ? 0.3307 0.3609 0.3535 0.0177  -0.0179 0.0132  124  LEU A CD1 
929  C CD2 . LEU A 124 ? 0.3558 0.3888 0.3786 0.0227  -0.0172 0.0148  124  LEU A CD2 
930  N N   . LYS A 125 ? 0.3089 0.3299 0.3277 0.0209  -0.0068 0.0173  125  LYS A N   
931  C CA  . LYS A 125 ? 0.3499 0.3685 0.3687 0.0212  -0.0046 0.0180  125  LYS A CA  
932  C C   . LYS A 125 ? 0.4057 0.4239 0.4238 0.0239  -0.0021 0.0199  125  LYS A C   
933  O O   . LYS A 125 ? 0.4465 0.4641 0.4643 0.0256  -0.0005 0.0211  125  LYS A O   
934  C CB  . LYS A 125 ? 0.2954 0.3107 0.3151 0.0188  -0.0038 0.0170  125  LYS A CB  
935  C CG  . LYS A 125 ? 0.3267 0.3390 0.3476 0.0190  -0.0012 0.0177  125  LYS A CG  
936  C CD  . LYS A 125 ? 0.3696 0.3791 0.3919 0.0165  -0.0016 0.0159  125  LYS A CD  
937  C CE  . LYS A 125 ? 0.4139 0.4202 0.4384 0.0165  0.0008  0.0164  125  LYS A CE  
938  N NZ  . LYS A 125 ? 0.4170 0.4204 0.4425 0.0145  0.0002  0.0143  125  LYS A NZ  
939  N N   . GLU A 126 ? 0.4413 0.4599 0.4592 0.0246  -0.0015 0.0204  126  GLU A N   
940  C CA  . GLU A 126 ? 0.4918 0.5102 0.5088 0.0274  0.0008  0.0222  126  GLU A CA  
941  C C   . GLU A 126 ? 0.5256 0.5468 0.5411 0.0305  -0.0002 0.0229  126  GLU A C   
942  O O   . GLU A 126 ? 0.5357 0.5563 0.5502 0.0330  0.0017  0.0244  126  GLU A O   
943  C CB  . GLU A 126 ? 0.5304 0.5486 0.5473 0.0275  0.0015  0.0224  126  GLU A CB  
944  C CG  . GLU A 126 ? 0.5720 0.5904 0.5878 0.0306  0.0036  0.0241  126  GLU A CG  
945  C CD  . GLU A 126 ? 0.5778 0.5930 0.5937 0.0313  0.0068  0.0255  126  GLU A CD  
946  O OE1 . GLU A 126 ? 0.5172 0.5298 0.5345 0.0291  0.0074  0.0249  126  GLU A OE1 
947  O OE2 . GLU A 126 ? 0.6224 0.6376 0.6370 0.0343  0.0088  0.0272  126  GLU A OE2 
948  N N   . CYS A 127 ? 0.5552 0.5795 0.5710 0.0305  -0.0033 0.0217  127  CYS A N   
949  C CA  . CYS A 127 ? 0.5594 0.5865 0.5739 0.0337  -0.0050 0.0219  127  CYS A CA  
950  C C   . CYS A 127 ? 0.5843 0.6108 0.5973 0.0350  -0.0046 0.0224  127  CYS A C   
951  O O   . CYS A 127 ? 0.6039 0.6311 0.6149 0.0386  -0.0038 0.0236  127  CYS A O   
952  C CB  . CYS A 127 ? 0.5170 0.5473 0.5330 0.0330  -0.0087 0.0202  127  CYS A CB  
953  S SG  . CYS A 127 ? 0.5946 0.6261 0.6129 0.0320  -0.0091 0.0199  127  CYS A SG  
954  N N   . HIS A 128 ? 0.5900 0.6155 0.6041 0.0322  -0.0052 0.0215  128  HIS A N   
955  C CA  . HIS A 128 ? 0.6203 0.6452 0.6335 0.0330  -0.0047 0.0220  128  HIS A CA  
956  C C   . HIS A 128 ? 0.6928 0.7151 0.7056 0.0347  -0.0006 0.0243  128  HIS A C   
957  O O   . HIS A 128 ? 0.7141 0.7366 0.7252 0.0378  0.0006  0.0257  128  HIS A O   
958  C CB  . HIS A 128 ? 0.5932 0.6172 0.6080 0.0294  -0.0059 0.0206  128  HIS A CB  
959  C CG  . HIS A 128 ? 0.5851 0.6114 0.6002 0.0280  -0.0097 0.0186  128  HIS A CG  
960  N ND1 . HIS A 128 ? 0.5813 0.6070 0.5976 0.0248  -0.0112 0.0171  128  HIS A ND1 
961  C CD2 . HIS A 128 ? 0.5741 0.6034 0.5890 0.0294  -0.0124 0.0179  128  HIS A CD2 
962  C CE1 . HIS A 128 ? 0.5882 0.6164 0.6049 0.0242  -0.0144 0.0157  128  HIS A CE1 
963  N NE2 . HIS A 128 ? 0.5806 0.6109 0.5968 0.0269  -0.0153 0.0161  128  HIS A NE2 
964  N N   . ARG A 129 ? 0.7168 0.7366 0.7313 0.0328  0.0016  0.0246  129  ARG A N   
965  C CA  . ARG A 129 ? 0.7413 0.7584 0.7565 0.0340  0.0056  0.0266  129  ARG A CA  
966  C C   . ARG A 129 ? 0.7685 0.7864 0.7812 0.0385  0.0073  0.0287  129  ARG A C   
967  O O   . ARG A 129 ? 0.7598 0.7768 0.7718 0.0411  0.0098  0.0307  129  ARG A O   
968  C CB  . ARG A 129 ? 0.7431 0.7575 0.7605 0.0315  0.0070  0.0262  129  ARG A CB  
969  C CG  . ARG A 129 ? 0.7624 0.7735 0.7819 0.0317  0.0108  0.0279  129  ARG A CG  
970  C CD  . ARG A 129 ? 0.7742 0.7827 0.7953 0.0299  0.0119  0.0273  129  ARG A CD  
971  N NE  . ARG A 129 ? 0.7855 0.7950 0.8044 0.0318  0.0122  0.0280  129  ARG A NE  
972  C CZ  . ARG A 129 ? 0.7771 0.7858 0.7952 0.0346  0.0151  0.0302  129  ARG A CZ  
973  N NH1 . ARG A 129 ? 0.7734 0.7801 0.7929 0.0359  0.0182  0.0321  129  ARG A NH1 
974  N NH2 . ARG A 129 ? 0.7767 0.7865 0.7929 0.0363  0.0151  0.0305  129  ARG A NH2 
975  N N   . ARG A 130 ? 0.8090 0.8287 0.8203 0.0396  0.0059  0.0282  130  ARG A N   
976  C CA  . ARG A 130 ? 0.8340 0.8548 0.8426 0.0441  0.0069  0.0297  130  ARG A CA  
977  C C   . ARG A 130 ? 0.8939 0.9174 0.8999 0.0473  0.0045  0.0294  130  ARG A C   
978  O O   . ARG A 130 ? 0.8936 0.9196 0.8980 0.0498  0.0023  0.0287  130  ARG A O   
979  C CB  . ARG A 130 ? 0.8130 0.8349 0.8216 0.0441  0.0060  0.0290  130  ARG A CB  
980  N N   . SER A 131 ? 0.9370 0.9600 0.9429 0.0473  0.0048  0.0297  131  SER A N   
981  C CA  . SER A 131 ? 0.9677 0.9930 0.9708 0.0506  0.0025  0.0294  131  SER A CA  
982  C C   . SER A 131 ? 0.9888 1.0125 0.9915 0.0515  0.0048  0.0311  131  SER A C   
983  O O   . SER A 131 ? 1.0046 1.0296 1.0044 0.0549  0.0038  0.0314  131  SER A O   
984  C CB  . SER A 131 ? 0.9765 1.0043 0.9806 0.0483  -0.0023 0.0266  131  SER A CB  
985  O OG  . SER A 131 ? 0.9837 1.0136 0.9880 0.0487  -0.0046 0.0253  131  SER A OG  
986  N N   . ARG A 140 ? 0.7869 0.8312 0.8100 0.0398  -0.0227 0.0151  140  ARG A N   
987  C CA  . ARG A 140 ? 0.7942 0.8400 0.8220 0.0377  -0.0235 0.0146  140  ARG A CA  
988  C C   . ARG A 140 ? 0.8128 0.8597 0.8443 0.0348  -0.0262 0.0131  140  ARG A C   
989  O O   . ARG A 140 ? 0.8435 0.8889 0.8735 0.0328  -0.0260 0.0130  140  ARG A O   
990  C CB  . ARG A 140 ? 0.7859 0.8293 0.8134 0.0356  -0.0196 0.0162  140  ARG A CB  
991  C CG  . ARG A 140 ? 0.7748 0.8171 0.7995 0.0383  -0.0169 0.0177  140  ARG A CG  
992  C CD  . ARG A 140 ? 0.7760 0.8153 0.7999 0.0361  -0.0132 0.0191  140  ARG A CD  
993  N NE  . ARG A 140 ? 0.7972 0.8352 0.8185 0.0386  -0.0104 0.0206  140  ARG A NE  
994  C CZ  . ARG A 140 ? 0.8055 0.8445 0.8280 0.0396  -0.0096 0.0211  140  ARG A CZ  
995  N NH1 . ARG A 140 ? 0.8079 0.8491 0.8344 0.0383  -0.0113 0.0204  140  ARG A NH1 
996  N NH2 . ARG A 140 ? 0.8067 0.8443 0.8265 0.0420  -0.0071 0.0225  140  ARG A NH2 
997  N N   . ASP A 141 ? 0.8000 0.8498 0.8366 0.0346  -0.0286 0.0121  141  ASP A N   
998  C CA  . ASP A 141 ? 0.7802 0.8313 0.8211 0.0322  -0.0314 0.0108  141  ASP A CA  
999  C C   . ASP A 141 ? 0.6987 0.7480 0.7411 0.0282  -0.0290 0.0118  141  ASP A C   
1000 O O   . ASP A 141 ? 0.6749 0.7242 0.7193 0.0274  -0.0270 0.0129  141  ASP A O   
1001 C CB  . ASP A 141 ? 0.8530 0.9078 0.9000 0.0334  -0.0348 0.0094  141  ASP A CB  
1002 C CG  . ASP A 141 ? 0.9153 0.9719 0.9647 0.0337  -0.0392 0.0072  141  ASP A CG  
1003 O OD1 . ASP A 141 ? 0.9240 0.9792 0.9693 0.0337  -0.0398 0.0068  141  ASP A OD1 
1004 O OD2 . ASP A 141 ? 0.9418 1.0012 0.9975 0.0339  -0.0423 0.0059  141  ASP A OD2 
1005 N N   . LEU A 142 ? 0.6301 0.6779 0.6710 0.0260  -0.0294 0.0114  142  LEU A N   
1006 C CA  . LEU A 142 ? 0.5382 0.5840 0.5796 0.0227  -0.0273 0.0121  142  LEU A CA  
1007 C C   . LEU A 142 ? 0.5106 0.5584 0.5578 0.0209  -0.0293 0.0115  142  LEU A C   
1008 O O   . LEU A 142 ? 0.5693 0.6170 0.6172 0.0193  -0.0309 0.0106  142  LEU A O   
1009 C CB  . LEU A 142 ? 0.4776 0.5209 0.5148 0.0213  -0.0268 0.0118  142  LEU A CB  
1010 C CG  . LEU A 142 ? 0.4993 0.5394 0.5346 0.0188  -0.0239 0.0126  142  LEU A CG  
1011 C CD1 . LEU A 142 ? 0.5074 0.5461 0.5414 0.0196  -0.0207 0.0141  142  LEU A CD1 
1012 C CD2 . LEU A 142 ? 0.4978 0.5357 0.5293 0.0181  -0.0237 0.0121  142  LEU A CD2 
1013 N N   . LYS A 143 ? 0.4558 0.5054 0.5075 0.0214  -0.0290 0.0121  143  LYS A N   
1014 C CA  . LYS A 143 ? 0.4000 0.4517 0.4584 0.0199  -0.0304 0.0119  143  LYS A CA  
1015 C C   . LYS A 143 ? 0.3407 0.3920 0.4015 0.0190  -0.0272 0.0138  143  LYS A C   
1016 O O   . LYS A 143 ? 0.3172 0.3676 0.3754 0.0202  -0.0248 0.0149  143  LYS A O   
1017 C CB  . LYS A 143 ? 0.4370 0.4923 0.5005 0.0219  -0.0344 0.0102  143  LYS A CB  
1018 C CG  . LYS A 143 ? 0.5538 0.6106 0.6174 0.0249  -0.0344 0.0103  143  LYS A CG  
1019 C CD  . LYS A 143 ? 0.6008 0.6613 0.6710 0.0266  -0.0386 0.0085  143  LYS A CD  
1020 C CE  . LYS A 143 ? 0.6581 0.7202 0.7279 0.0300  -0.0390 0.0082  143  LYS A CE  
1021 N NZ  . LYS A 143 ? 0.6958 0.7615 0.7722 0.0320  -0.0436 0.0060  143  LYS A NZ  
1022 N N   . PRO A 144 ? 0.3001 0.3519 0.3659 0.0171  -0.0270 0.0144  144  PRO A N   
1023 C CA  . PRO A 144 ? 0.2911 0.3421 0.3584 0.0164  -0.0235 0.0165  144  PRO A CA  
1024 C C   . PRO A 144 ? 0.3302 0.3832 0.4003 0.0184  -0.0228 0.0172  144  PRO A C   
1025 O O   . PRO A 144 ? 0.3183 0.3699 0.3860 0.0188  -0.0196 0.0188  144  PRO A O   
1026 C CB  . PRO A 144 ? 0.2726 0.3248 0.3463 0.0146  -0.0241 0.0169  144  PRO A CB  
1027 C CG  . PRO A 144 ? 0.2671 0.3188 0.3394 0.0136  -0.0269 0.0151  144  PRO A CG  
1028 C CD  . PRO A 144 ? 0.2682 0.3209 0.3378 0.0155  -0.0296 0.0133  144  PRO A CD  
1029 N N   . ALA A 145 ? 0.3244 0.3808 0.3996 0.0197  -0.0261 0.0159  145  ALA A N   
1030 C CA  . ALA A 145 ? 0.3157 0.3744 0.3944 0.0217  -0.0258 0.0163  145  ALA A CA  
1031 C C   . ALA A 145 ? 0.3167 0.3737 0.3884 0.0237  -0.0241 0.0167  145  ALA A C   
1032 O O   . ALA A 145 ? 0.2924 0.3506 0.3656 0.0252  -0.0229 0.0175  145  ALA A O   
1033 C CB  . ALA A 145 ? 0.3339 0.3964 0.4195 0.0230  -0.0303 0.0143  145  ALA A CB  
1034 N N   . ASN A 146 ? 0.3283 0.3827 0.3930 0.0237  -0.0238 0.0162  146  ASN A N   
1035 C CA  . ASN A 146 ? 0.2602 0.3129 0.3186 0.0256  -0.0221 0.0166  146  ASN A CA  
1036 C C   . ASN A 146 ? 0.2296 0.2784 0.2826 0.0243  -0.0183 0.0181  146  ASN A C   
1037 O O   . ASN A 146 ? 0.2373 0.2839 0.2849 0.0253  -0.0169 0.0183  146  ASN A O   
1038 C CB  . ASN A 146 ? 0.2919 0.3447 0.3468 0.0274  -0.0246 0.0150  146  ASN A CB  
1039 C CG  . ASN A 146 ? 0.4165 0.4680 0.4659 0.0300  -0.0230 0.0155  146  ASN A CG  
1040 O OD1 . ASN A 146 ? 0.4729 0.5251 0.5229 0.0316  -0.0217 0.0164  146  ASN A OD1 
1041 N ND2 . ASN A 146 ? 0.4357 0.4852 0.4798 0.0305  -0.0229 0.0152  146  ASN A ND2 
1042 N N   . VAL A 147 ? 0.2593 0.3070 0.3139 0.0222  -0.0167 0.0190  147  VAL A N   
1043 C CA  . VAL A 147 ? 0.2481 0.2921 0.2976 0.0212  -0.0136 0.0201  147  VAL A CA  
1044 C C   . VAL A 147 ? 0.2346 0.2786 0.2861 0.0213  -0.0109 0.0219  147  VAL A C   
1045 O O   . VAL A 147 ? 0.2241 0.2699 0.2810 0.0206  -0.0111 0.0225  147  VAL A O   
1046 C CB  . VAL A 147 ? 0.2112 0.2533 0.2595 0.0189  -0.0139 0.0195  147  VAL A CB  
1047 C CG1 . VAL A 147 ? 0.1340 0.1721 0.1770 0.0183  -0.0110 0.0203  147  VAL A CG1 
1048 C CG2 . VAL A 147 ? 0.2100 0.2525 0.2568 0.0188  -0.0167 0.0178  147  VAL A CG2 
1049 N N   . PHE A 148 ? 0.2099 0.2516 0.2572 0.0224  -0.0083 0.0228  148  PHE A N   
1050 C CA  . PHE A 148 ? 0.2012 0.2429 0.2499 0.0230  -0.0057 0.0246  148  PHE A CA  
1051 C C   . PHE A 148 ? 0.2102 0.2480 0.2542 0.0226  -0.0028 0.0255  148  PHE A C   
1052 O O   . PHE A 148 ? 0.2425 0.2773 0.2814 0.0222  -0.0025 0.0247  148  PHE A O   
1053 C CB  . PHE A 148 ? 0.1523 0.1957 0.2015 0.0253  -0.0054 0.0249  148  PHE A CB  
1054 C CG  . PHE A 148 ? 0.1876 0.2349 0.2414 0.0262  -0.0086 0.0237  148  PHE A CG  
1055 C CD1 . PHE A 148 ? 0.2233 0.2706 0.2745 0.0272  -0.0107 0.0222  148  PHE A CD1 
1056 C CD2 . PHE A 148 ? 0.1999 0.2507 0.2610 0.0263  -0.0096 0.0241  148  PHE A CD2 
1057 C CE1 . PHE A 148 ? 0.2205 0.2713 0.2755 0.0285  -0.0140 0.0209  148  PHE A CE1 
1058 C CE2 . PHE A 148 ? 0.2119 0.2661 0.2776 0.0274  -0.0130 0.0226  148  PHE A CE2 
1059 C CZ  . PHE A 148 ? 0.2010 0.2552 0.2634 0.0286  -0.0154 0.0209  148  PHE A CZ  
1060 N N   . LEU A 149 ? 0.1721 0.2100 0.2180 0.0228  -0.0006 0.0272  149  LEU A N   
1061 C CA  . LEU A 149 ? 0.1907 0.2250 0.2321 0.0230  0.0021  0.0281  149  LEU A CA  
1062 C C   . LEU A 149 ? 0.2197 0.2535 0.2598 0.0249  0.0045  0.0295  149  LEU A C   
1063 O O   . LEU A 149 ? 0.2201 0.2569 0.2648 0.0258  0.0049  0.0307  149  LEU A O   
1064 C CB  . LEU A 149 ? 0.2072 0.2417 0.2513 0.0222  0.0029  0.0292  149  LEU A CB  
1065 C CG  . LEU A 149 ? 0.2858 0.3212 0.3320 0.0203  0.0005  0.0280  149  LEU A CG  
1066 C CD1 . LEU A 149 ? 0.3102 0.3457 0.3594 0.0198  0.0018  0.0295  149  LEU A CD1 
1067 C CD2 . LEU A 149 ? 0.3193 0.3515 0.3596 0.0195  -0.0006 0.0261  149  LEU A CD2 
1068 N N   . ASP A 150 ? 0.1684 0.1985 0.2027 0.0256  0.0061  0.0293  150  ASP A N   
1069 C CA  . ASP A 150 ? 0.1661 0.1953 0.1987 0.0275  0.0085  0.0307  150  ASP A CA  
1070 C C   . ASP A 150 ? 0.1656 0.1928 0.1966 0.0282  0.0109  0.0322  150  ASP A C   
1071 O O   . ASP A 150 ? 0.1546 0.1824 0.1877 0.0274  0.0109  0.0327  150  ASP A O   
1072 C CB  . ASP A 150 ? 0.2302 0.2566 0.2579 0.0283  0.0090  0.0299  150  ASP A CB  
1073 C CG  . ASP A 150 ? 0.2789 0.3008 0.3016 0.0277  0.0092  0.0287  150  ASP A CG  
1074 O OD1 . ASP A 150 ? 0.2736 0.2944 0.2957 0.0269  0.0091  0.0285  150  ASP A OD1 
1075 O OD2 . ASP A 150 ? 0.2544 0.2737 0.2738 0.0282  0.0095  0.0279  150  ASP A OD2 
1076 N N   . GLY A 151 ? 0.1601 0.1849 0.1874 0.0299  0.0131  0.0330  151  GLY A N   
1077 C CA  . GLY A 151 ? 0.1935 0.2165 0.2188 0.0313  0.0156  0.0345  151  GLY A CA  
1078 C C   . GLY A 151 ? 0.2255 0.2436 0.2443 0.0317  0.0158  0.0333  151  GLY A C   
1079 O O   . GLY A 151 ? 0.2020 0.2180 0.2180 0.0334  0.0178  0.0343  151  GLY A O   
1080 N N   . LYS A 152 ? 0.2051 0.2215 0.2218 0.0304  0.0138  0.0310  152  LYS A N   
1081 C CA  . LYS A 152 ? 0.2326 0.2444 0.2438 0.0307  0.0136  0.0294  152  LYS A CA  
1082 C C   . LYS A 152 ? 0.3130 0.3241 0.3241 0.0287  0.0114  0.0275  152  LYS A C   
1083 O O   . LYS A 152 ? 0.3170 0.3250 0.3248 0.0283  0.0103  0.0255  152  LYS A O   
1084 C CB  . LYS A 152 ? 0.2348 0.2440 0.2430 0.0314  0.0137  0.0283  152  LYS A CB  
1085 C CG  . LYS A 152 ? 0.2368 0.2467 0.2451 0.0334  0.0157  0.0300  152  LYS A CG  
1086 C CD  . LYS A 152 ? 0.2811 0.2887 0.2870 0.0339  0.0158  0.0290  152  LYS A CD  
1087 C CE  . LYS A 152 ? 0.3185 0.3290 0.3278 0.0329  0.0150  0.0291  152  LYS A CE  
1088 N NZ  . LYS A 152 ? 0.3272 0.3365 0.3350 0.0344  0.0163  0.0295  152  LYS A NZ  
1089 N N   . GLN A 153 ? 0.3193 0.3336 0.3344 0.0274  0.0106  0.0282  153  GLN A N   
1090 C CA  . GLN A 153 ? 0.2975 0.3115 0.3128 0.0255  0.0085  0.0266  153  GLN A CA  
1091 C C   . GLN A 153 ? 0.2834 0.2981 0.2996 0.0238  0.0063  0.0248  153  GLN A C   
1092 O O   . GLN A 153 ? 0.3130 0.3264 0.3280 0.0225  0.0047  0.0231  153  GLN A O   
1093 C CB  . GLN A 153 ? 0.3131 0.3229 0.3233 0.0263  0.0087  0.0255  153  GLN A CB  
1094 C CG  . GLN A 153 ? 0.3234 0.3327 0.3325 0.0282  0.0109  0.0274  153  GLN A CG  
1095 C CD  . GLN A 153 ? 0.3847 0.3897 0.3882 0.0294  0.0108  0.0261  153  GLN A CD  
1096 O OE1 . GLN A 153 ? 0.3604 0.3619 0.3597 0.0300  0.0099  0.0239  153  GLN A OE1 
1097 N NE2 . GLN A 153 ? 0.4180 0.4231 0.4215 0.0300  0.0117  0.0273  153  GLN A NE2 
1098 N N   . ASN A 154 ? 0.1955 0.2122 0.2137 0.0241  0.0064  0.0253  154  ASN A N   
1099 C CA  . ASN A 154 ? 0.1807 0.1980 0.1995 0.0231  0.0047  0.0240  154  ASN A CA  
1100 C C   . ASN A 154 ? 0.1693 0.1908 0.1927 0.0222  0.0029  0.0242  154  ASN A C   
1101 O O   . ASN A 154 ? 0.1768 0.2013 0.2039 0.0226  0.0033  0.0256  154  ASN A O   
1102 C CB  . ASN A 154 ? 0.2096 0.2258 0.2269 0.0243  0.0058  0.0242  154  ASN A CB  
1103 C CG  . ASN A 154 ? 0.2775 0.2893 0.2906 0.0253  0.0071  0.0237  154  ASN A CG  
1104 O OD1 . ASN A 154 ? 0.2862 0.2953 0.2970 0.0246  0.0065  0.0222  154  ASN A OD1 
1105 N ND2 . ASN A 154 ? 0.2803 0.2915 0.2924 0.0269  0.0089  0.0247  154  ASN A ND2 
1106 N N   . VAL A 155 ? 0.1425 0.1644 0.1661 0.0210  0.0010  0.0228  155  VAL A N   
1107 C CA  . VAL A 155 ? 0.1678 0.1933 0.1952 0.0203  -0.0012 0.0225  155  VAL A CA  
1108 C C   . VAL A 155 ? 0.2320 0.2586 0.2593 0.0211  -0.0020 0.0221  155  VAL A C   
1109 O O   . VAL A 155 ? 0.2238 0.2478 0.2481 0.0211  -0.0016 0.0214  155  VAL A O   
1110 C CB  . VAL A 155 ? 0.1383 0.1631 0.1653 0.0185  -0.0030 0.0212  155  VAL A CB  
1111 C CG1 . VAL A 155 ? 0.0839 0.1122 0.1148 0.0177  -0.0055 0.0207  155  VAL A CG1 
1112 C CG2 . VAL A 155 ? 0.1137 0.1368 0.1398 0.0181  -0.0019 0.0217  155  VAL A CG2 
1113 N N   . LYS A 156 ? 0.2464 0.2765 0.2771 0.0220  -0.0030 0.0226  156  LYS A N   
1114 C CA  . LYS A 156 ? 0.2449 0.2760 0.2751 0.0236  -0.0034 0.0225  156  LYS A CA  
1115 C C   . LYS A 156 ? 0.3031 0.3378 0.3363 0.0240  -0.0063 0.0217  156  LYS A C   
1116 O O   . LYS A 156 ? 0.3226 0.3602 0.3602 0.0239  -0.0076 0.0217  156  LYS A O   
1117 C CB  . LYS A 156 ? 0.2578 0.2892 0.2879 0.0255  -0.0014 0.0238  156  LYS A CB  
1118 C CG  . LYS A 156 ? 0.2921 0.3196 0.3182 0.0258  0.0012  0.0243  156  LYS A CG  
1119 C CD  . LYS A 156 ? 0.2910 0.3182 0.3174 0.0265  0.0032  0.0256  156  LYS A CD  
1120 C CE  . LYS A 156 ? 0.3026 0.3256 0.3248 0.0269  0.0054  0.0258  156  LYS A CE  
1121 N NZ  . LYS A 156 ? 0.2749 0.2969 0.2953 0.0285  0.0065  0.0261  156  LYS A NZ  
1122 N N   . LEU A 157 ? 0.2843 0.3186 0.3154 0.0247  -0.0072 0.0209  157  LEU A N   
1123 C CA  . LEU A 157 ? 0.2844 0.3217 0.3174 0.0257  -0.0100 0.0200  157  LEU A CA  
1124 C C   . LEU A 157 ? 0.3080 0.3475 0.3418 0.0286  -0.0102 0.0204  157  LEU A C   
1125 O O   . LEU A 157 ? 0.2835 0.3214 0.3143 0.0302  -0.0081 0.0213  157  LEU A O   
1126 C CB  . LEU A 157 ? 0.3108 0.3465 0.3407 0.0256  -0.0107 0.0192  157  LEU A CB  
1127 C CG  . LEU A 157 ? 0.3480 0.3863 0.3790 0.0266  -0.0138 0.0180  157  LEU A CG  
1128 C CD1 . LEU A 157 ? 0.3624 0.4031 0.3977 0.0250  -0.0164 0.0171  157  LEU A CD1 
1129 C CD2 . LEU A 157 ? 0.3076 0.3440 0.3353 0.0265  -0.0138 0.0176  157  LEU A CD2 
1130 N N   . GLY A 158 ? 0.3615 0.3484 0.3562 0.0524  0.0316  0.0640  158  GLY A N   
1131 C CA  . GLY A 158 ? 0.4366 0.4245 0.4346 0.0560  0.0250  0.0706  158  GLY A CA  
1132 C C   . GLY A 158 ? 0.5167 0.4996 0.4963 0.0589  0.0189  0.0728  158  GLY A C   
1133 O O   . GLY A 158 ? 0.4971 0.4757 0.4622 0.0584  0.0218  0.0695  158  GLY A O   
1134 N N   . ASP A 159 ? 0.6087 0.5911 0.5886 0.0622  0.0105  0.0786  159  ASP A N   
1135 C CA  . ASP A 159 ? 0.7024 0.6771 0.6628 0.0662  0.0063  0.0821  159  ASP A CA  
1136 C C   . ASP A 159 ? 0.7659 0.7375 0.7113 0.0668  -0.0061 0.0803  159  ASP A C   
1137 O O   . ASP A 159 ? 0.7654 0.7282 0.6901 0.0702  -0.0090 0.0823  159  ASP A O   
1138 C CB  . ASP A 159 ? 0.7291 0.7022 0.6951 0.0704  0.0047  0.0903  159  ASP A CB  
1139 C CG  . ASP A 159 ? 0.7630 0.7402 0.7412 0.0713  -0.0082 0.0938  159  ASP A CG  
1140 O OD1 . ASP A 159 ? 0.7504 0.7302 0.7288 0.0692  -0.0173 0.0901  159  ASP A OD1 
1141 O OD2 . ASP A 159 ? 0.8120 0.7898 0.8010 0.0740  -0.0096 0.1004  159  ASP A OD2 
1142 N N   . PHE A 160 ? 0.8401 0.8178 0.7953 0.0636  -0.0129 0.0765  160  PHE A N   
1143 C CA  . PHE A 160 ? 0.9506 0.9258 0.8960 0.0643  -0.0270 0.0754  160  PHE A CA  
1144 C C   . PHE A 160 ? 0.9736 0.9490 0.9103 0.0609  -0.0280 0.0678  160  PHE A C   
1145 O O   . PHE A 160 ? 0.9663 0.9483 0.9165 0.0577  -0.0324 0.0647  160  PHE A O   
1146 C CB  . PHE A 160 ? 0.9959 0.9774 0.9620 0.0642  -0.0377 0.0788  160  PHE A CB  
1147 C CG  . PHE A 160 ? 1.0262 1.0175 1.0169 0.0601  -0.0327 0.0764  160  PHE A CG  
1148 C CD1 . PHE A 160 ? 1.0329 1.0271 1.0337 0.0588  -0.0187 0.0761  160  PHE A CD1 
1149 C CD2 . PHE A 160 ? 1.0425 1.0390 1.0459 0.0579  -0.0419 0.0745  160  PHE A CD2 
1150 C CE1 . PHE A 160 ? 1.0282 1.0291 1.0485 0.0557  -0.0135 0.0740  160  PHE A CE1 
1151 C CE2 . PHE A 160 ? 1.0319 1.0361 1.0571 0.0547  -0.0361 0.0729  160  PHE A CE2 
1152 C CZ  . PHE A 160 ? 1.0253 1.0311 1.0576 0.0537  -0.0216 0.0727  160  PHE A CZ  
1153 N N   . GLY A 161 ? 0.9888 0.9570 0.9047 0.0615  -0.0229 0.0647  161  GLY A N   
1154 C CA  . GLY A 161 ? 0.9926 0.9530 0.8952 0.0654  -0.0155 0.0687  161  GLY A CA  
1155 C C   . GLY A 161 ? 0.9958 0.9445 0.8733 0.0697  -0.0222 0.0702  161  GLY A C   
1156 O O   . GLY A 161 ? 0.9968 0.9376 0.8615 0.0737  -0.0160 0.0744  161  GLY A O   
1157 N N   . VAL A 177 ? 0.8217 0.7585 0.7046 0.0461  -0.1525 0.0179  177  VAL A N   
1158 C CA  . VAL A 177 ? 0.8538 0.7980 0.7590 0.0415  -0.1578 0.0144  177  VAL A CA  
1159 C C   . VAL A 177 ? 0.8842 0.8390 0.8014 0.0377  -0.1410 0.0119  177  VAL A C   
1160 O O   . VAL A 177 ? 0.8948 0.8504 0.8165 0.0347  -0.1412 0.0069  177  VAL A O   
1161 C CB  . VAL A 177 ? 0.8410 0.7946 0.7779 0.0401  -0.1696 0.0194  177  VAL A CB  
1162 C CG1 . VAL A 177 ? 0.8242 0.7857 0.7860 0.0354  -0.1734 0.0163  177  VAL A CG1 
1163 C CG2 . VAL A 177 ? 0.8700 0.8127 0.7967 0.0437  -0.1888 0.0218  177  VAL A CG2 
1164 N N   . GLY A 178 ? 0.8707 0.8328 0.7928 0.0379  -0.1271 0.0154  178  GLY A N   
1165 C CA  . GLY A 178 ? 0.8338 0.8048 0.7661 0.0346  -0.1121 0.0134  178  GLY A CA  
1166 C C   . GLY A 178 ? 0.8210 0.7850 0.7329 0.0345  -0.1034 0.0077  178  GLY A C   
1167 O O   . GLY A 178 ? 0.8289 0.7810 0.7164 0.0379  -0.1053 0.0061  178  GLY A O   
1168 N N   . THR A 179 ? 0.7947 0.7655 0.7172 0.0310  -0.0939 0.0048  179  THR A N   
1169 C CA  . THR A 179 ? 0.7623 0.7285 0.6709 0.0309  -0.0838 0.0004  179  THR A CA  
1170 C C   . THR A 179 ? 0.7272 0.6950 0.6311 0.0324  -0.0711 0.0029  179  THR A C   
1171 O O   . THR A 179 ? 0.7161 0.6925 0.6343 0.0312  -0.0662 0.0064  179  THR A O   
1172 C CB  . THR A 179 ? 0.7316 0.7041 0.6543 0.0266  -0.0791 -0.0032 179  THR A CB  
1173 O OG1 . THR A 179 ? 0.7485 0.7227 0.6835 0.0248  -0.0906 -0.0040 179  THR A OG1 
1174 C CG2 . THR A 179 ? 0.7007 0.6669 0.6100 0.0270  -0.0729 -0.0077 179  THR A CG2 
1175 N N   . PRO A 180 ? 0.7007 0.6595 0.5848 0.0352  -0.0658 0.0016  180  PRO A N   
1176 C CA  . PRO A 180 ? 0.6711 0.6302 0.5511 0.0369  -0.0539 0.0041  180  PRO A CA  
1177 C C   . PRO A 180 ? 0.6044 0.5696 0.4952 0.0338  -0.0427 0.0016  180  PRO A C   
1178 O O   . PRO A 180 ? 0.5838 0.5439 0.4660 0.0349  -0.0359 -0.0002 180  PRO A O   
1179 C CB  . PRO A 180 ? 0.6998 0.6453 0.5546 0.0414  -0.0534 0.0036  180  PRO A CB  
1180 C CG  . PRO A 180 ? 0.7241 0.6617 0.5686 0.0420  -0.0651 0.0002  180  PRO A CG  
1181 C CD  . PRO A 180 ? 0.7027 0.6497 0.5677 0.0373  -0.0704 -0.0022 180  PRO A CD  
1182 N N   . TYR A 181 ? 0.6017 0.5766 0.5108 0.0304  -0.0410 0.0020  181  TYR A N   
1183 C CA  . TYR A 181 ? 0.6030 0.5827 0.5221 0.0274  -0.0322 -0.0004 181  TYR A CA  
1184 C C   . TYR A 181 ? 0.5584 0.5360 0.4737 0.0287  -0.0224 0.0003  181  TYR A C   
1185 O O   . TYR A 181 ? 0.5399 0.5177 0.4593 0.0271  -0.0174 -0.0020 181  TYR A O   
1186 C CB  . TYR A 181 ? 0.6516 0.6401 0.5872 0.0245  -0.0314 0.0011  181  TYR A CB  
1187 C CG  . TYR A 181 ? 0.7086 0.7002 0.6532 0.0225  -0.0398 0.0005  181  TYR A CG  
1188 C CD1 . TYR A 181 ? 0.7095 0.7045 0.6623 0.0231  -0.0471 0.0045  181  TYR A CD1 
1189 C CD2 . TYR A 181 ? 0.7037 0.6948 0.6512 0.0201  -0.0406 -0.0035 181  TYR A CD2 
1190 C CE1 . TYR A 181 ? 0.7066 0.7048 0.6717 0.0213  -0.0551 0.0044  181  TYR A CE1 
1191 C CE2 . TYR A 181 ? 0.7158 0.7096 0.6730 0.0183  -0.0482 -0.0038 181  TYR A CE2 
1192 C CZ  . TYR A 181 ? 0.7300 0.7273 0.6966 0.0188  -0.0555 0.0001  181  TYR A CZ  
1193 O OH  . TYR A 181 ? 0.7557 0.7560 0.7360 0.0171  -0.0633 0.0002  181  TYR A OH  
1194 N N   . TYR A 182 ? 0.5363 0.5117 0.4453 0.0317  -0.0203 0.0040  182  TYR A N   
1195 C CA  . TYR A 182 ? 0.5309 0.5046 0.4393 0.0328  -0.0109 0.0054  182  TYR A CA  
1196 C C   . TYR A 182 ? 0.5526 0.5167 0.4451 0.0365  -0.0078 0.0059  182  TYR A C   
1197 O O   . TYR A 182 ? 0.5546 0.5166 0.4471 0.0377  0.0000  0.0077  182  TYR A O   
1198 C CB  . TYR A 182 ? 0.4804 0.4575 0.3935 0.0339  -0.0081 0.0099  182  TYR A CB  
1199 C CG  . TYR A 182 ? 0.4175 0.4025 0.3457 0.0306  -0.0075 0.0099  182  TYR A CG  
1200 C CD1 . TYR A 182 ? 0.4070 0.3958 0.3425 0.0274  -0.0113 0.0067  182  TYR A CD1 
1201 C CD2 . TYR A 182 ? 0.3700 0.3573 0.3041 0.0311  -0.0025 0.0134  182  TYR A CD2 
1202 C CE1 . TYR A 182 ? 0.3913 0.3855 0.3380 0.0251  -0.0099 0.0073  182  TYR A CE1 
1203 C CE2 . TYR A 182 ? 0.3522 0.3444 0.2975 0.0288  -0.0012 0.0138  182  TYR A CE2 
1204 C CZ  . TYR A 182 ? 0.3399 0.3354 0.2907 0.0260  -0.0048 0.0109  182  TYR A CZ  
1205 O OH  . TYR A 182 ? 0.3548 0.3533 0.3146 0.0244  -0.0026 0.0121  182  TYR A OH  
1206 N N   . MET A 183 ? 0.5563 0.5135 0.4348 0.0385  -0.0136 0.0047  183  MET A N   
1207 C CA  . MET A 183 ? 0.5405 0.4863 0.4006 0.0426  -0.0100 0.0054  183  MET A CA  
1208 C C   . MET A 183 ? 0.4941 0.4389 0.3587 0.0413  -0.0020 0.0035  183  MET A C   
1209 O O   . MET A 183 ? 0.4946 0.4434 0.3683 0.0378  -0.0039 0.0002  183  MET A O   
1210 C CB  . MET A 183 ? 0.5539 0.4908 0.3965 0.0448  -0.0188 0.0037  183  MET A CB  
1211 N N   . SER A 184 ? 0.4617 0.4007 0.3205 0.0440  0.0068  0.0063  184  SER A N   
1212 C CA  . SER A 184 ? 0.4523 0.3898 0.3167 0.0427  0.0144  0.0056  184  SER A CA  
1213 C C   . SER A 184 ? 0.5076 0.4346 0.3559 0.0451  0.0158  0.0040  184  SER A C   
1214 O O   . SER A 184 ? 0.5452 0.4631 0.3739 0.0490  0.0126  0.0043  184  SER A O   
1215 C CB  . SER A 184 ? 0.4319 0.3672 0.2986 0.0447  0.0240  0.0097  184  SER A CB  
1216 O OG  . SER A 184 ? 0.4373 0.3629 0.2854 0.0502  0.0272  0.0133  184  SER A OG  
1217 N N   . PRO A 185 ? 0.5042 0.4314 0.3598 0.0428  0.0202  0.0024  185  PRO A N   
1218 C CA  . PRO A 185 ? 0.5503 0.4673 0.3919 0.0448  0.0233  0.0009  185  PRO A CA  
1219 C C   . PRO A 185 ? 0.6136 0.5159 0.4328 0.0511  0.0312  0.0040  185  PRO A C   
1220 O O   . PRO A 185 ? 0.6434 0.5342 0.4423 0.0544  0.0304  0.0026  185  PRO A O   
1221 C CB  . PRO A 185 ? 0.5261 0.4475 0.3837 0.0410  0.0289  0.0002  185  PRO A CB  
1222 C CG  . PRO A 185 ? 0.4839 0.4186 0.3625 0.0359  0.0236  -0.0004 185  PRO A CG  
1223 C CD  . PRO A 185 ? 0.4630 0.3996 0.3401 0.0379  0.0221  0.0020  185  PRO A CD  
1224 N N   . GLU A 186 ? 0.6357 0.5371 0.4576 0.0531  0.0391  0.0084  186  GLU A N   
1225 C CA  . GLU A 186 ? 0.7100 0.5970 0.5109 0.0595  0.0480  0.0124  186  GLU A CA  
1226 C C   . GLU A 186 ? 0.7674 0.6489 0.5493 0.0634  0.0408  0.0137  186  GLU A C   
1227 O O   . GLU A 186 ? 0.8012 0.6678 0.5571 0.0685  0.0418  0.0144  186  GLU A O   
1228 C CB  . GLU A 186 ? 0.7078 0.5955 0.5201 0.0604  0.0599  0.0171  186  GLU A CB  
1229 C CG  . GLU A 186 ? 0.6827 0.5815 0.5104 0.0582  0.0564  0.0189  186  GLU A CG  
1230 C CD  . GLU A 186 ? 0.6433 0.5554 0.4973 0.0517  0.0537  0.0164  186  GLU A CD  
1231 O OE1 . GLU A 186 ? 0.6298 0.5427 0.4909 0.0487  0.0549  0.0137  186  GLU A OE1 
1232 O OE2 . GLU A 186 ? 0.6225 0.5430 0.4886 0.0496  0.0504  0.0171  186  GLU A OE2 
1233 N N   . GLN A 187 ? 0.7987 0.6913 0.5926 0.0610  0.0334  0.0143  187  GLN A N   
1234 C CA  . GLN A 187 ? 0.8301 0.7187 0.6087 0.0642  0.0255  0.0161  187  GLN A CA  
1235 C C   . GLN A 187 ? 0.8446 0.7315 0.6146 0.0630  0.0126  0.0115  187  GLN A C   
1236 O O   . GLN A 187 ? 0.8919 0.7783 0.6547 0.0640  0.0024  0.0121  187  GLN A O   
1237 C CB  . GLN A 187 ? 0.8124 0.7131 0.6080 0.0620  0.0228  0.0187  187  GLN A CB  
1238 N N   . MET A 188 ? 0.8365 0.7227 0.6086 0.0609  0.0130  0.0073  188  MET A N   
1239 C CA  . MET A 188 ? 0.8776 0.7610 0.6418 0.0599  0.0018  0.0027  188  MET A CA  
1240 C C   . MET A 188 ? 0.9212 0.7872 0.6604 0.0640  0.0058  0.0011  188  MET A C   
1241 O O   . MET A 188 ? 0.9203 0.7788 0.6454 0.0647  -0.0033 -0.0024 188  MET A O   
1242 C CB  . MET A 188 ? 0.8666 0.7650 0.6564 0.0533  -0.0025 -0.0011 188  MET A CB  
1243 C CG  . MET A 188 ? 0.9020 0.7989 0.6877 0.0519  -0.0140 -0.0056 188  MET A CG  
1244 S SD  . MET A 188 ? 1.5199 1.4354 1.3351 0.0452  -0.0221 -0.0078 188  MET A SD  
1245 C CE  . MET A 188 ? 0.4148 0.3326 0.2285 0.0465  -0.0306 -0.0048 188  MET A CE  
1246 N N   . ASN A 189 ? 0.9683 0.8273 0.7027 0.0666  0.0198  0.0037  189  ASN A N   
1247 C CA  . ASN A 189 ? 1.0309 0.8704 0.7378 0.0719  0.0267  0.0036  189  ASN A CA  
1248 C C   . ASN A 189 ? 1.1094 0.9356 0.7947 0.0785  0.0335  0.0091  189  ASN A C   
1249 O O   . ASN A 189 ? 1.1502 0.9659 0.8126 0.0823  0.0252  0.0097  189  ASN A O   
1250 C CB  . ASN A 189 ? 1.0183 0.8582 0.7361 0.0704  0.0394  0.0031  189  ASN A CB  
1251 C CG  . ASN A 189 ? 1.0096 0.8645 0.7519 0.0635  0.0333  -0.0013 189  ASN A CG  
1252 O OD1 . ASN A 189 ? 1.0405 0.8993 0.7833 0.0612  0.0208  -0.0052 189  ASN A OD1 
1253 N ND2 . ASN A 189 ? 0.9654 0.8281 0.7285 0.0602  0.0419  -0.0006 189  ASN A ND2 
1254 N N   . ARG A 190 ? 1.1296 0.9567 0.8242 0.0795  0.0481  0.0134  190  ARG A N   
1255 C CA  . ARG A 190 ? 1.1405 0.9623 0.8271 0.0839  0.0547  0.0196  190  ARG A CA  
1256 C C   . ARG A 190 ? 1.1033 0.9246 0.8015 0.0851  0.0725  0.0242  190  ARG A C   
1257 O O   . ARG A 190 ? 1.0680 0.8953 0.7845 0.0817  0.0788  0.0225  190  ARG A O   
1258 C CB  . ARG A 190 ? 1.2116 1.0127 0.8602 0.0909  0.0515  0.0210  190  ARG A CB  
1259 C CG  . ARG A 190 ? 1.2473 1.0538 0.8946 0.0903  0.0372  0.0218  190  ARG A CG  
1260 C CD  . ARG A 190 ? 1.2516 1.0764 0.9291 0.0865  0.0403  0.0248  190  ARG A CD  
1261 N NE  . ARG A 190 ? 1.2798 1.1146 0.9648 0.0843  0.0265  0.0251  190  ARG A NE  
1262 C CZ  . ARG A 190 ? 1.3156 1.1515 1.0004 0.0865  0.0272  0.0307  190  ARG A CZ  
1263 N NH1 . ARG A 190 ? 1.3377 1.1647 1.0142 0.0911  0.0412  0.0364  190  ARG A NH1 
1264 N NH2 . ARG A 190 ? 1.3135 1.1589 1.0071 0.0843  0.0145  0.0311  190  ARG A NH2 
1265 N N   . ASN A 194 ? 0.7623 0.6481 0.5802 0.0747  0.0849  0.0458  194  ASN A N   
1266 C CA  . ASN A 194 ? 0.6892 0.5825 0.5308 0.0696  0.0884  0.0426  194  ASN A CA  
1267 C C   . ASN A 194 ? 0.5907 0.4981 0.4544 0.0642  0.0815  0.0405  194  ASN A C   
1268 O O   . ASN A 194 ? 0.6130 0.5278 0.4774 0.0614  0.0702  0.0369  194  ASN A O   
1269 C CB  . ASN A 194 ? 0.6958 0.5880 0.5336 0.0674  0.0845  0.0372  194  ASN A CB  
1270 C CG  . ASN A 194 ? 0.6605 0.5563 0.5189 0.0633  0.0905  0.0354  194  ASN A CG  
1271 O OD1 . ASN A 194 ? 0.6536 0.5500 0.5268 0.0630  0.0992  0.0386  194  ASN A OD1 
1272 N ND2 . ASN A 194 ? 0.6484 0.5464 0.5084 0.0600  0.0855  0.0304  194  ASN A ND2 
1273 N N   . GLU A 195 ? 0.5000 0.4099 0.3816 0.0629  0.0888  0.0427  195  GLU A N   
1274 C CA  . GLU A 195 ? 0.4901 0.4106 0.3910 0.0581  0.0836  0.0407  195  GLU A CA  
1275 C C   . GLU A 195 ? 0.4327 0.3603 0.3449 0.0520  0.0759  0.0344  195  GLU A C   
1276 O O   . GLU A 195 ? 0.4156 0.3510 0.3362 0.0485  0.0684  0.0317  195  GLU A O   
1277 C CB  . GLU A 195 ? 0.5733 0.4928 0.4897 0.0582  0.0934  0.0446  195  GLU A CB  
1278 C CG  . GLU A 195 ? 0.6904 0.6022 0.5961 0.0644  0.1021  0.0517  195  GLU A CG  
1279 C CD  . GLU A 195 ? 0.7586 0.6688 0.6813 0.0647  0.1129  0.0558  195  GLU A CD  
1280 O OE1 . GLU A 195 ? 0.7921 0.7059 0.7343 0.0601  0.1138  0.0529  195  GLU A OE1 
1281 O OE2 . GLU A 195 ? 0.7646 0.6692 0.6809 0.0695  0.1202  0.0620  195  GLU A OE2 
1282 N N   . LYS A 196 ? 0.3996 0.3239 0.3115 0.0509  0.0783  0.0322  196  LYS A N   
1283 C CA  . LYS A 196 ? 0.3813 0.3116 0.3013 0.0453  0.0704  0.0266  196  LYS A CA  
1284 C C   . LYS A 196 ? 0.3779 0.3121 0.2876 0.0450  0.0596  0.0234  196  LYS A C   
1285 O O   . LYS A 196 ? 0.4011 0.3419 0.3184 0.0405  0.0519  0.0194  196  LYS A O   
1286 C CB  . LYS A 196 ? 0.4154 0.3415 0.3390 0.0442  0.0760  0.0255  196  LYS A CB  
1287 C CG  . LYS A 196 ? 0.3787 0.3034 0.3199 0.0429  0.0855  0.0278  196  LYS A CG  
1288 C CD  . LYS A 196 ? 0.3672 0.2991 0.3249 0.0377  0.0802  0.0256  196  LYS A CD  
1289 C CE  . LYS A 196 ? 0.3902 0.3207 0.3668 0.0365  0.0889  0.0277  196  LYS A CE  
1290 N NZ  . LYS A 196 ? 0.3903 0.3206 0.3788 0.0337  0.0918  0.0256  196  LYS A NZ  
1291 N N   . SER A 197 ? 0.3845 0.3140 0.2767 0.0496  0.0591  0.0254  197  SER A N   
1292 C CA  . SER A 197 ? 0.3607 0.2939 0.2446 0.0493  0.0486  0.0227  197  SER A CA  
1293 C C   . SER A 197 ? 0.3422 0.2849 0.2373 0.0467  0.0425  0.0223  197  SER A C   
1294 O O   . SER A 197 ? 0.3732 0.3221 0.2718 0.0438  0.0343  0.0189  197  SER A O   
1295 C CB  . SER A 197 ? 0.4504 0.3748 0.3119 0.0549  0.0487  0.0256  197  SER A CB  
1296 O OG  . SER A 197 ? 0.4840 0.3975 0.3323 0.0579  0.0551  0.0259  197  SER A OG  
1297 N N   . ASP A 198 ? 0.3016 0.2450 0.2027 0.0478  0.0475  0.0260  198  ASP A N   
1298 C CA  . ASP A 198 ? 0.2912 0.2424 0.2031 0.0456  0.0435  0.0259  198  ASP A CA  
1299 C C   . ASP A 198 ? 0.2823 0.2383 0.2086 0.0403  0.0409  0.0217  198  ASP A C   
1300 O O   . ASP A 198 ? 0.2540 0.2159 0.1859 0.0378  0.0353  0.0197  198  ASP A O   
1301 C CB  . ASP A 198 ? 0.3840 0.3336 0.2995 0.0481  0.0504  0.0310  198  ASP A CB  
1302 C CG  . ASP A 198 ? 0.4704 0.4151 0.3706 0.0533  0.0517  0.0362  198  ASP A CG  
1303 O OD1 . ASP A 198 ? 0.4971 0.4409 0.3847 0.0546  0.0447  0.0357  198  ASP A OD1 
1304 O OD2 . ASP A 198 ? 0.5200 0.4609 0.4206 0.0562  0.0592  0.0411  198  ASP A OD2 
1305 N N   . ILE A 199 ? 0.2680 0.2206 0.1998 0.0385  0.0451  0.0208  199  ILE A N   
1306 C CA  . ILE A 199 ? 0.1784 0.1339 0.1215 0.0330  0.0419  0.0171  199  ILE A CA  
1307 C C   . ILE A 199 ? 0.1758 0.1353 0.1170 0.0305  0.0340  0.0132  199  ILE A C   
1308 O O   . ILE A 199 ? 0.2002 0.1638 0.1481 0.0270  0.0291  0.0108  199  ILE A O   
1309 C CB  . ILE A 199 ? 0.2674 0.2185 0.2169 0.0313  0.0481  0.0173  199  ILE A CB  
1310 C CG1 . ILE A 199 ? 0.2855 0.2327 0.2394 0.0339  0.0570  0.0216  199  ILE A CG1 
1311 C CG2 . ILE A 199 ? 0.2295 0.1832 0.1892 0.0255  0.0443  0.0137  199  ILE A CG2 
1312 C CD1 . ILE A 199 ? 0.2413 0.1906 0.2036 0.0322  0.0561  0.0219  199  ILE A CD1 
1313 N N   . TRP A 200 ? 0.2116 0.1691 0.1433 0.0325  0.0331  0.0126  200  TRP A N   
1314 C CA  . TRP A 200 ? 0.2385 0.1998 0.1692 0.0304  0.0258  0.0091  200  TRP A CA  
1315 C C   . TRP A 200 ? 0.2192 0.1864 0.1519 0.0302  0.0204  0.0087  200  TRP A C   
1316 O O   . TRP A 200 ? 0.2622 0.2341 0.2024 0.0268  0.0160  0.0062  200  TRP A O   
1317 C CB  . TRP A 200 ? 0.2719 0.2282 0.1894 0.0333  0.0260  0.0087  200  TRP A CB  
1318 C CG  . TRP A 200 ? 0.2728 0.2323 0.1885 0.0318  0.0185  0.0054  200  TRP A CG  
1319 C CD1 . TRP A 200 ? 0.3252 0.2875 0.2368 0.0327  0.0126  0.0049  200  TRP A CD1 
1320 C CD2 . TRP A 200 ? 0.3274 0.2874 0.2459 0.0290  0.0163  0.0025  200  TRP A CD2 
1321 N NE1 . TRP A 200 ? 0.3762 0.3404 0.2884 0.0307  0.0072  0.0016  200  TRP A NE1 
1322 C CE2 . TRP A 200 ? 0.3695 0.3325 0.2858 0.0285  0.0095  0.0002  200  TRP A CE2 
1323 C CE3 . TRP A 200 ? 0.3494 0.3076 0.2724 0.0267  0.0197  0.0017  200  TRP A CE3 
1324 C CZ2 . TRP A 200 ? 0.3686 0.3328 0.2874 0.0261  0.0062  -0.0026 200  TRP A CZ2 
1325 C CZ3 . TRP A 200 ? 0.3321 0.2919 0.2570 0.0242  0.0162  -0.0010 200  TRP A CZ3 
1326 C CH2 . TRP A 200 ? 0.3625 0.3254 0.2854 0.0241  0.0096  -0.0030 200  TRP A CH2 
1327 N N   . SER A 201 ? 0.2334 0.1999 0.1592 0.0339  0.0214  0.0116  201  SER A N   
1328 C CA  . SER A 201 ? 0.2682 0.2401 0.1954 0.0338  0.0168  0.0120  201  SER A CA  
1329 C C   . SER A 201 ? 0.2599 0.2361 0.1994 0.0311  0.0177  0.0118  201  SER A C   
1330 O O   . SER A 201 ? 0.2770 0.2580 0.2212 0.0293  0.0139  0.0106  201  SER A O   
1331 C CB  . SER A 201 ? 0.3622 0.3317 0.2791 0.0381  0.0173  0.0164  201  SER A CB  
1332 O OG  . SER A 201 ? 0.4590 0.4217 0.3610 0.0409  0.0163  0.0165  201  SER A OG  
1333 N N   . LEU A 202 ? 0.2478 0.2209 0.1918 0.0310  0.0229  0.0132  202  LEU A N   
1334 C CA  . LEU A 202 ? 0.2340 0.2080 0.1871 0.0284  0.0236  0.0128  202  LEU A CA  
1335 C C   . LEU A 202 ? 0.1958 0.1705 0.1532 0.0240  0.0196  0.0090  202  LEU A C   
1336 O O   . LEU A 202 ? 0.2191 0.1953 0.1806 0.0221  0.0180  0.0082  202  LEU A O   
1337 C CB  . LEU A 202 ? 0.2598 0.2288 0.2160 0.0286  0.0295  0.0146  202  LEU A CB  
1338 C CG  . LEU A 202 ? 0.2322 0.1992 0.1950 0.0254  0.0301  0.0136  202  LEU A CG  
1339 C CD1 . LEU A 202 ? 0.1926 0.1620 0.1574 0.0269  0.0307  0.0155  202  LEU A CD1 
1340 C CD2 . LEU A 202 ? 0.2718 0.2334 0.2381 0.0246  0.0355  0.0147  202  LEU A CD2 
1341 N N   . GLY A 203 ? 0.2042 0.1772 0.1601 0.0226  0.0186  0.0073  203  GLY A N   
1342 C CA  . GLY A 203 ? 0.1708 0.1451 0.1305 0.0186  0.0147  0.0044  203  GLY A CA  
1343 C C   . GLY A 203 ? 0.1828 0.1621 0.1435 0.0184  0.0104  0.0030  203  GLY A C   
1344 O O   . GLY A 203 ? 0.1973 0.1778 0.1625 0.0157  0.0085  0.0020  203  GLY A O   
1345 N N   . CYS A 204 ? 0.1702 0.1516 0.1257 0.0212  0.0091  0.0033  204  CYS A N   
1346 C CA  . CYS A 204 ? 0.2096 0.1955 0.1656 0.0209  0.0050  0.0021  204  CYS A CA  
1347 C C   . CYS A 204 ? 0.2230 0.2117 0.1831 0.0209  0.0057  0.0035  204  CYS A C   
1348 O O   . CYS A 204 ? 0.2057 0.1970 0.1699 0.0190  0.0039  0.0023  204  CYS A O   
1349 C CB  . CYS A 204 ? 0.2340 0.2192 0.1804 0.0240  0.0029  0.0027  204  CYS A CB  
1350 S SG  . CYS A 204 ? 0.2645 0.2449 0.2032 0.0245  0.0018  0.0007  204  CYS A SG  
1351 N N   . LEU A 205 ? 0.2644 0.2519 0.2232 0.0231  0.0093  0.0064  205  LEU A N   
1352 C CA  . LEU A 205 ? 0.2594 0.2488 0.2219 0.0235  0.0115  0.0088  205  LEU A CA  
1353 C C   . LEU A 205 ? 0.2585 0.2444 0.2260 0.0208  0.0131  0.0075  205  LEU A C   
1354 O O   . LEU A 205 ? 0.2593 0.2464 0.2295 0.0200  0.0135  0.0078  205  LEU A O   
1355 C CB  . LEU A 205 ? 0.2976 0.2861 0.2584 0.0266  0.0156  0.0131  205  LEU A CB  
1356 C CG  . LEU A 205 ? 0.2981 0.2880 0.2642 0.0274  0.0193  0.0171  205  LEU A CG  
1357 C CD1 . LEU A 205 ? 0.3089 0.2989 0.2732 0.0307  0.0208  0.0232  205  LEU A CD1 
1358 C CD2 . LEU A 205 ? 0.2931 0.2772 0.2635 0.0259  0.0233  0.0154  205  LEU A CD2 
1359 N N   . LEU A 206 ? 0.2023 0.1826 0.1695 0.0191  0.0143  0.0065  206  LEU A N   
1360 C CA  . LEU A 206 ? 0.2182 0.1935 0.1867 0.0159  0.0149  0.0053  206  LEU A CA  
1361 C C   . LEU A 206 ? 0.2228 0.1999 0.1925 0.0133  0.0111  0.0031  206  LEU A C   
1362 O O   . LEU A 206 ? 0.2225 0.1972 0.1923 0.0120  0.0118  0.0029  206  LEU A O   
1363 C CB  . LEU A 206 ? 0.1875 0.1573 0.1550 0.0141  0.0165  0.0048  206  LEU A CB  
1364 C CG  . LEU A 206 ? 0.2277 0.1950 0.1949 0.0165  0.0211  0.0071  206  LEU A CG  
1365 C CD1 . LEU A 206 ? 0.2272 0.1905 0.1944 0.0144  0.0226  0.0063  206  LEU A CD1 
1366 C CD2 . LEU A 206 ? 0.2404 0.2044 0.2083 0.0171  0.0248  0.0085  206  LEU A CD2 
1367 N N   . TYR A 207 ? 0.1718 0.1523 0.1421 0.0128  0.0079  0.0017  207  TYR A N   
1368 C CA  . TYR A 207 ? 0.1948 0.1778 0.1676 0.0107  0.0049  0.0001  207  TYR A CA  
1369 C C   . TYR A 207 ? 0.2269 0.2131 0.2007 0.0117  0.0048  0.0005  207  TYR A C   
1370 O O   . TYR A 207 ? 0.1936 0.1783 0.1683 0.0100  0.0049  0.0001  207  TYR A O   
1371 C CB  . TYR A 207 ? 0.2027 0.1887 0.1759 0.0107  0.0026  -0.0011 207  TYR A CB  
1372 C CG  . TYR A 207 ? 0.2271 0.2156 0.2037 0.0087  0.0003  -0.0023 207  TYR A CG  
1373 C CD1 . TYR A 207 ? 0.2400 0.2316 0.2180 0.0090  -0.0008 -0.0028 207  TYR A CD1 
1374 C CD2 . TYR A 207 ? 0.2139 0.2015 0.1921 0.0066  -0.0001 -0.0027 207  TYR A CD2 
1375 C CE1 . TYR A 207 ? 0.2204 0.2137 0.2013 0.0075  -0.0021 -0.0036 207  TYR A CE1 
1376 C CE2 . TYR A 207 ? 0.1894 0.1792 0.1705 0.0053  -0.0014 -0.0033 207  TYR A CE2 
1377 C CZ  . TYR A 207 ? 0.2172 0.2095 0.1996 0.0058  -0.0023 -0.0038 207  TYR A CZ  
1378 O OH  . TYR A 207 ? 0.2331 0.2269 0.2179 0.0048  -0.0031 -0.0042 207  TYR A OH  
1379 N N   . GLU A 208 ? 0.2077 0.1979 0.1804 0.0145  0.0049  0.0015  208  GLU A N   
1380 C CA  . GLU A 208 ? 0.2206 0.2149 0.1946 0.0152  0.0049  0.0025  208  GLU A CA  
1381 C C   . GLU A 208 ? 0.2329 0.2234 0.2086 0.0153  0.0104  0.0047  208  GLU A C   
1382 O O   . GLU A 208 ? 0.2141 0.2054 0.1927 0.0148  0.0124  0.0053  208  GLU A O   
1383 C CB  . GLU A 208 ? 0.2461 0.2451 0.2175 0.0175  0.0023  0.0049  208  GLU A CB  
1384 C CG  . GLU A 208 ? 0.3084 0.3118 0.2876 0.0175  -0.0016 0.0080  208  GLU A CG  
1385 C CD  . GLU A 208 ? 0.3402 0.3470 0.3231 0.0198  -0.0082 0.0115  208  GLU A CD  
1386 O OE1 . GLU A 208 ? 0.2978 0.3026 0.2712 0.0212  -0.0100 0.0113  208  GLU A OE1 
1387 O OE2 . GLU A 208 ? 0.4229 0.4334 0.4190 0.0200  -0.0113 0.0142  208  GLU A OE2 
1388 N N   . LEU A 209 ? 0.2682 0.2535 0.2427 0.0160  0.0137  0.0059  209  LEU A N   
1389 C CA  . LEU A 209 ? 0.2139 0.1929 0.1891 0.0161  0.0194  0.0075  209  LEU A CA  
1390 C C   . LEU A 209 ? 0.1841 0.1567 0.1564 0.0134  0.0194  0.0054  209  LEU A C   
1391 O O   . LEU A 209 ? 0.2150 0.1840 0.1881 0.0138  0.0242  0.0066  209  LEU A O   
1392 C CB  . LEU A 209 ? 0.2588 0.2320 0.2318 0.0168  0.0224  0.0084  209  LEU A CB  
1393 C CG  . LEU A 209 ? 0.2911 0.2671 0.2683 0.0201  0.0268  0.0122  209  LEU A CG  
1394 C CD1 . LEU A 209 ? 0.3043 0.2723 0.2789 0.0200  0.0304  0.0124  209  LEU A CD1 
1395 C CD2 . LEU A 209 ? 0.2577 0.2365 0.2426 0.0215  0.0317  0.0155  209  LEU A CD2 
1396 N N   . CYS A 210 ? 0.1718 0.1428 0.1414 0.0108  0.0151  0.0031  210  CYS A N   
1397 C CA  . CYS A 210 ? 0.1818 0.1473 0.1480 0.0083  0.0147  0.0019  210  CYS A CA  
1398 C C   . CYS A 210 ? 0.2478 0.2171 0.2163 0.0077  0.0133  0.0014  210  CYS A C   
1399 O O   . CYS A 210 ? 0.2481 0.2117 0.2137 0.0076  0.0168  0.0017  210  CYS A O   
1400 C CB  . CYS A 210 ? 0.1747 0.1396 0.1399 0.0059  0.0112  0.0008  210  CYS A CB  
1401 S SG  . CYS A 210 ? 0.1729 0.1323 0.1346 0.0060  0.0137  0.0013  210  CYS A SG  
1402 N N   . ALA A 211 ? 0.2035 0.1812 0.1764 0.0076  0.0088  0.0004  211  ALA A N   
1403 C CA  . ALA A 211 ? 0.2244 0.2061 0.1998 0.0067  0.0066  -0.0005 211  ALA A CA  
1404 C C   . ALA A 211 ? 0.2696 0.2561 0.2481 0.0085  0.0089  0.0003  211  ALA A C   
1405 O O   . ALA A 211 ? 0.2944 0.2828 0.2751 0.0079  0.0091  -0.0003 211  ALA A O   
1406 C CB  . ALA A 211 ? 0.2203 0.2078 0.1993 0.0059  0.0019  -0.0019 211  ALA A CB  
1407 N N   . LEU A 212 ? 0.2560 0.2451 0.2366 0.0111  0.0119  0.0025  212  LEU A N   
1408 C CA  . LEU A 212 ? 0.2541 0.2497 0.2468 0.0130  0.0135  0.0058  212  LEU A CA  
1409 C C   . LEU A 212 ? 0.3070 0.3096 0.3042 0.0124  0.0042  0.0053  212  LEU A C   
1410 O O   . LEU A 212 ? 0.3898 0.3972 0.4005 0.0128  0.0011  0.0081  212  LEU A O   
1411 C CB  . LEU A 212 ? 0.2097 0.2024 0.2101 0.0131  0.0199  0.0078  212  LEU A CB  
1412 C CG  . LEU A 212 ? 0.2366 0.2191 0.2306 0.0141  0.0290  0.0088  212  LEU A CG  
1413 C CD1 . LEU A 212 ? 0.2878 0.2667 0.2889 0.0150  0.0367  0.0113  212  LEU A CD1 
1414 C CD2 . LEU A 212 ? 0.2166 0.1991 0.2132 0.0162  0.0320  0.0115  212  LEU A CD2 
1415 N N   . MET A 213 ? 0.2778 0.2803 0.2641 0.0116  -0.0004 0.0018  213  MET A N   
1416 C CA  . MET A 213 ? 0.2627 0.2693 0.2486 0.0114  -0.0091 0.0007  213  MET A CA  
1417 C C   . MET A 213 ? 0.2520 0.2552 0.2307 0.0117  -0.0073 -0.0022 213  MET A C   
1418 O O   . MET A 213 ? 0.2807 0.2804 0.2591 0.0113  -0.0032 -0.0026 213  MET A O   
1419 C CB  . MET A 213 ? 0.3041 0.3112 0.2929 0.0089  -0.0117 -0.0024 213  MET A CB  
1420 C CG  . MET A 213 ? 0.3250 0.3275 0.3103 0.0076  -0.0073 -0.0053 213  MET A CG  
1421 S SD  . MET A 213 ? 0.6476 0.6501 0.6365 0.0057  -0.0085 -0.0068 213  MET A SD  
1422 C CE  . MET A 213 ? 0.3463 0.3513 0.3407 0.0050  -0.0088 -0.0051 213  MET A CE  
1423 N N   . PRO A 214 ? 0.2577 0.2612 0.2337 0.0127  -0.0116 -0.0025 214  PRO A N   
1424 C CA  . PRO A 214 ? 0.2888 0.2889 0.2589 0.0141  -0.0102 -0.0036 214  PRO A CA  
1425 C C   . PRO A 214 ? 0.3000 0.2982 0.2715 0.0127  -0.0094 -0.0058 214  PRO A C   
1426 O O   . PRO A 214 ? 0.3303 0.3296 0.3052 0.0112  -0.0109 -0.0069 214  PRO A O   
1427 C CB  . PRO A 214 ? 0.3089 0.3084 0.2734 0.0158  -0.0164 -0.0030 214  PRO A CB  
1428 C CG  . PRO A 214 ? 0.3239 0.3275 0.2955 0.0153  -0.0222 -0.0008 214  PRO A CG  
1429 C CD  . PRO A 214 ? 0.2985 0.3048 0.2782 0.0130  -0.0192 -0.0011 214  PRO A CD  
1430 N N   . PRO A 215 ? 0.2857 0.2813 0.2547 0.0133  -0.0074 -0.0057 215  PRO A N   
1431 C CA  . PRO A 215 ? 0.3002 0.2947 0.2713 0.0118  -0.0068 -0.0065 215  PRO A CA  
1432 C C   . PRO A 215 ? 0.3157 0.3096 0.2834 0.0123  -0.0100 -0.0083 215  PRO A C   
1433 O O   . PRO A 215 ? 0.3419 0.3366 0.3132 0.0108  -0.0102 -0.0091 215  PRO A O   
1434 C CB  . PRO A 215 ? 0.2863 0.2777 0.2538 0.0127  -0.0045 -0.0056 215  PRO A CB  
1435 C CG  . PRO A 215 ? 0.2641 0.2546 0.2280 0.0149  -0.0033 -0.0042 215  PRO A CG  
1436 C CD  . PRO A 215 ? 0.2745 0.2678 0.2377 0.0157  -0.0058 -0.0043 215  PRO A CD  
1437 N N   . PHE A 216 ? 0.3184 0.3101 0.2781 0.0146  -0.0132 -0.0088 216  PHE A N   
1438 C CA  . PHE A 216 ? 0.3308 0.3197 0.2846 0.0154  -0.0179 -0.0108 216  PHE A CA  
1439 C C   . PHE A 216 ? 0.3849 0.3744 0.3376 0.0157  -0.0242 -0.0111 216  PHE A C   
1440 O O   . PHE A 216 ? 0.3497 0.3392 0.2992 0.0171  -0.0260 -0.0094 216  PHE A O   
1441 C CB  . PHE A 216 ? 0.2687 0.2516 0.2104 0.0180  -0.0178 -0.0110 216  PHE A CB  
1442 C CG  . PHE A 216 ? 0.2680 0.2500 0.2111 0.0177  -0.0122 -0.0100 216  PHE A CG  
1443 C CD1 . PHE A 216 ? 0.2701 0.2527 0.2175 0.0158  -0.0109 -0.0108 216  PHE A CD1 
1444 C CD2 . PHE A 216 ? 0.2870 0.2674 0.2272 0.0192  -0.0086 -0.0080 216  PHE A CD2 
1445 C CE1 . PHE A 216 ? 0.2358 0.2172 0.1846 0.0150  -0.0068 -0.0098 216  PHE A CE1 
1446 C CE2 . PHE A 216 ? 0.3002 0.2788 0.2419 0.0186  -0.0041 -0.0071 216  PHE A CE2 
1447 C CZ  . PHE A 216 ? 0.3008 0.2800 0.2468 0.0163  -0.0035 -0.0080 216  PHE A CZ  
1448 N N   . THR A 217 ? 0.4324 0.4224 0.3888 0.0144  -0.0282 -0.0127 217  THR A N   
1449 C CA  . THR A 217 ? 0.4744 0.4649 0.4327 0.0141  -0.0362 -0.0127 217  THR A CA  
1450 C C   . THR A 217 ? 0.4743 0.4601 0.4272 0.0147  -0.0429 -0.0154 217  THR A C   
1451 O O   . THR A 217 ? 0.4486 0.4328 0.4001 0.0145  -0.0400 -0.0171 217  THR A O   
1452 C CB  . THR A 217 ? 0.5303 0.5262 0.5014 0.0116  -0.0355 -0.0117 217  THR A CB  
1453 O OG1 . THR A 217 ? 0.5395 0.5356 0.5144 0.0101  -0.0326 -0.0133 217  THR A OG1 
1454 C CG2 . THR A 217 ? 0.5718 0.5710 0.5461 0.0112  -0.0291 -0.0093 217  THR A CG2 
1455 N N   . ALA A 218 ? 0.4768 0.4601 0.4272 0.0156  -0.0526 -0.0155 218  ALA A N   
1456 C CA  . ALA A 218 ? 0.5217 0.4989 0.4655 0.0164  -0.0609 -0.0185 218  ALA A CA  
1457 C C   . ALA A 218 ? 0.5332 0.5092 0.4794 0.0168  -0.0732 -0.0177 218  ALA A C   
1458 O O   . ALA A 218 ? 0.5111 0.4906 0.4618 0.0170  -0.0745 -0.0144 218  ALA A O   
1459 C CB  . ALA A 218 ? 0.5407 0.5099 0.4667 0.0193  -0.0591 -0.0200 218  ALA A CB  
1460 N N   . PHE A 219 ? 0.5424 0.5136 0.4870 0.0168  -0.0831 -0.0204 219  PHE A N   
1461 C CA  . PHE A 219 ? 0.5954 0.5651 0.5449 0.0170  -0.0970 -0.0196 219  PHE A CA  
1462 C C   . PHE A 219 ? 0.6106 0.5698 0.5394 0.0207  -0.1053 -0.0202 219  PHE A C   
1463 O O   . PHE A 219 ? 0.6304 0.5887 0.5618 0.0216  -0.1159 -0.0180 219  PHE A O   
1464 C CB  . PHE A 219 ? 0.6102 0.5802 0.5720 0.0149  -0.1053 -0.0219 219  PHE A CB  
1465 C CG  . PHE A 219 ? 0.6263 0.6057 0.6080 0.0116  -0.0978 -0.0206 219  PHE A CG  
1466 C CD1 . PHE A 219 ? 0.6573 0.6366 0.6390 0.0106  -0.0918 -0.0232 219  PHE A CD1 
1467 C CD2 . PHE A 219 ? 0.6177 0.6055 0.6174 0.0100  -0.0967 -0.0163 219  PHE A CD2 
1468 C CE1 . PHE A 219 ? 0.6501 0.6365 0.6475 0.0081  -0.0852 -0.0217 219  PHE A CE1 
1469 C CE2 . PHE A 219 ? 0.6112 0.6060 0.6267 0.0075  -0.0895 -0.0149 219  PHE A CE2 
1470 C CZ  . PHE A 219 ? 0.6304 0.6239 0.6436 0.0065  -0.0840 -0.0177 219  PHE A CZ  
1471 N N   . SER A 220 ? 0.5964 0.5472 0.5048 0.0232  -0.1004 -0.0226 220  SER A N   
1472 C CA  . SER A 220 ? 0.5822 0.5207 0.4665 0.0274  -0.1060 -0.0230 220  SER A CA  
1473 C C   . SER A 220 ? 0.5980 0.5344 0.4691 0.0297  -0.0929 -0.0216 220  SER A C   
1474 O O   . SER A 220 ? 0.6017 0.5440 0.4803 0.0281  -0.0811 -0.0217 220  SER A O   
1475 C CB  . SER A 220 ? 0.5652 0.4915 0.4339 0.0289  -0.1148 -0.0277 220  SER A CB  
1476 O OG  . SER A 220 ? 0.5386 0.4646 0.4049 0.0283  -0.1050 -0.0303 220  SER A OG  
1477 N N   . GLN A 221 ? 0.6335 0.5608 0.4853 0.0337  -0.0955 -0.0200 221  GLN A N   
1478 C CA  . GLN A 221 ? 0.6670 0.5913 0.5065 0.0363  -0.0833 -0.0182 221  GLN A CA  
1479 C C   . GLN A 221 ? 0.6600 0.5776 0.4883 0.0372  -0.0757 -0.0213 221  GLN A C   
1480 O O   . GLN A 221 ? 0.6460 0.5669 0.4771 0.0372  -0.0633 -0.0200 221  GLN A O   
1481 C CB  . GLN A 221 ? 0.7034 0.6174 0.5222 0.0410  -0.0875 -0.0154 221  GLN A CB  
1482 C CG  . GLN A 221 ? 0.7376 0.6476 0.5441 0.0440  -0.0741 -0.0130 221  GLN A CG  
1483 C CD  . GLN A 221 ? 0.8094 0.7111 0.5984 0.0486  -0.0767 -0.0089 221  GLN A CD  
1484 O OE1 . GLN A 221 ? 0.8599 0.7533 0.6321 0.0524  -0.0676 -0.0072 221  GLN A OE1 
1485 N NE2 . GLN A 221 ? 0.7933 0.6969 0.5869 0.0485  -0.0889 -0.0068 221  GLN A NE2 
1486 N N   . LYS A 222 ? 0.6409 0.5491 0.4578 0.0381  -0.0836 -0.0252 222  LYS A N   
1487 C CA  . LYS A 222 ? 0.6237 0.5250 0.4301 0.0390  -0.0771 -0.0280 222  LYS A CA  
1488 C C   . LYS A 222 ? 0.5556 0.4702 0.3852 0.0347  -0.0684 -0.0283 222  LYS A C   
1489 O O   . LYS A 222 ? 0.5346 0.4492 0.3630 0.0350  -0.0578 -0.0278 222  LYS A O   
1490 C CB  . LYS A 222 ? 0.6916 0.5797 0.4810 0.0406  -0.0886 -0.0325 222  LYS A CB  
1491 C CG  . LYS A 222 ? 0.7516 0.6336 0.5328 0.0410  -0.0824 -0.0358 222  LYS A CG  
1492 C CD  . LYS A 222 ? 0.8384 0.7066 0.6025 0.0426  -0.0948 -0.0407 222  LYS A CD  
1493 C CE  . LYS A 222 ? 0.8587 0.7206 0.6146 0.0430  -0.0882 -0.0439 222  LYS A CE  
1494 N NZ  . LYS A 222 ? 0.8767 0.7289 0.6130 0.0467  -0.0754 -0.0423 222  LYS A NZ  
1495 N N   . GLU A 223 ? 0.5117 0.4367 0.3622 0.0309  -0.0731 -0.0286 223  GLU A N   
1496 C CA  . GLU A 223 ? 0.5542 0.4911 0.4258 0.0271  -0.0654 -0.0283 223  GLU A CA  
1497 C C   . GLU A 223 ? 0.5310 0.4759 0.4117 0.0264  -0.0547 -0.0246 223  GLU A C   
1498 O O   . GLU A 223 ? 0.5094 0.4582 0.3965 0.0251  -0.0460 -0.0240 223  GLU A O   
1499 C CB  . GLU A 223 ? 0.6261 0.5709 0.5161 0.0239  -0.0721 -0.0287 223  GLU A CB  
1500 C CG  . GLU A 223 ? 0.6860 0.6413 0.5952 0.0204  -0.0644 -0.0281 223  GLU A CG  
1501 C CD  . GLU A 223 ? 0.7433 0.7061 0.6704 0.0176  -0.0688 -0.0274 223  GLU A CD  
1502 O OE1 . GLU A 223 ? 0.7622 0.7240 0.6906 0.0178  -0.0777 -0.0269 223  GLU A OE1 
1503 O OE2 . GLU A 223 ? 0.7408 0.7101 0.6809 0.0153  -0.0635 -0.0270 223  GLU A OE2 
1504 N N   . LEU A 224 ? 0.5115 0.4585 0.3930 0.0271  -0.0563 -0.0220 224  LEU A N   
1505 C CA  . LEU A 224 ? 0.4590 0.4116 0.3464 0.0269  -0.0472 -0.0188 224  LEU A CA  
1506 C C   . LEU A 224 ? 0.4291 0.3755 0.3047 0.0292  -0.0391 -0.0183 224  LEU A C   
1507 O O   . LEU A 224 ? 0.3825 0.3342 0.2682 0.0275  -0.0310 -0.0172 224  LEU A O   
1508 C CB  . LEU A 224 ? 0.4217 0.3747 0.3068 0.0283  -0.0513 -0.0160 224  LEU A CB  
1509 C CG  . LEU A 224 ? 0.4709 0.4297 0.3627 0.0281  -0.0422 -0.0127 224  LEU A CG  
1510 C CD1 . LEU A 224 ? 0.4606 0.4302 0.3728 0.0241  -0.0376 -0.0125 224  LEU A CD1 
1511 C CD2 . LEU A 224 ? 0.4784 0.4365 0.3654 0.0303  -0.0458 -0.0094 224  LEU A CD2 
1512 N N   . ALA A 225 ? 0.4714 0.4054 0.3250 0.0333  -0.0415 -0.0189 225  ALA A N   
1513 C CA  . ALA A 225 ? 0.4701 0.3959 0.3103 0.0361  -0.0330 -0.0181 225  ALA A CA  
1514 C C   . ALA A 225 ? 0.4641 0.3926 0.3127 0.0336  -0.0278 -0.0198 225  ALA A C   
1515 O O   . ALA A 225 ? 0.4504 0.3806 0.3037 0.0331  -0.0189 -0.0181 225  ALA A O   
1516 C CB  . ALA A 225 ? 0.4569 0.3662 0.2686 0.0411  -0.0369 -0.0191 225  ALA A CB  
1517 N N   . GLY A 226 ? 0.4888 0.4177 0.3399 0.0320  -0.0338 -0.0229 226  GLY A N   
1518 C CA  . GLY A 226 ? 0.4805 0.4130 0.3409 0.0294  -0.0299 -0.0243 226  GLY A CA  
1519 C C   . GLY A 226 ? 0.4729 0.4178 0.3548 0.0258  -0.0237 -0.0219 226  GLY A C   
1520 O O   . GLY A 226 ? 0.5031 0.4483 0.3879 0.0249  -0.0172 -0.0212 226  GLY A O   
1521 N N   . LYS A 227 ? 0.4312 0.3852 0.3273 0.0237  -0.0261 -0.0206 227  LYS A N   
1522 C CA  . LYS A 227 ? 0.4258 0.3899 0.3402 0.0204  -0.0213 -0.0185 227  LYS A CA  
1523 C C   . LYS A 227 ? 0.4612 0.4250 0.3755 0.0210  -0.0148 -0.0160 227  LYS A C   
1524 O O   . LYS A 227 ? 0.4141 0.3821 0.3384 0.0186  -0.0106 -0.0149 227  LYS A O   
1525 C CB  . LYS A 227 ? 0.4260 0.3972 0.3521 0.0186  -0.0245 -0.0180 227  LYS A CB  
1526 C CG  . LYS A 227 ? 0.4841 0.4569 0.4150 0.0172  -0.0295 -0.0201 227  LYS A CG  
1527 C CD  . LYS A 227 ? 0.5588 0.5375 0.5006 0.0155  -0.0317 -0.0193 227  LYS A CD  
1528 C CE  . LYS A 227 ? 0.5917 0.5710 0.5382 0.0143  -0.0367 -0.0214 227  LYS A CE  
1529 N NZ  . LYS A 227 ? 0.5961 0.5799 0.5528 0.0127  -0.0391 -0.0205 227  LYS A NZ  
1530 N N   . ILE A 228 ? 0.4509 0.4090 0.3532 0.0242  -0.0145 -0.0149 228  ILE A N   
1531 C CA  . ILE A 228 ? 0.4278 0.3844 0.3288 0.0253  -0.0080 -0.0123 228  ILE A CA  
1532 C C   . ILE A 228 ? 0.4875 0.4382 0.3830 0.0259  -0.0016 -0.0122 228  ILE A C   
1533 O O   . ILE A 228 ? 0.4841 0.4379 0.3892 0.0239  0.0033  -0.0107 228  ILE A O   
1534 C CB  . ILE A 228 ? 0.4160 0.3668 0.3034 0.0294  -0.0085 -0.0107 228  ILE A CB  
1535 C CG1 . ILE A 228 ? 0.4094 0.3672 0.3051 0.0283  -0.0134 -0.0101 228  ILE A CG1 
1536 C CG2 . ILE A 228 ? 0.4014 0.3486 0.2855 0.0313  -0.0003 -0.0078 228  ILE A CG2 
1537 C CD1 . ILE A 228 ? 0.4542 0.4066 0.3361 0.0320  -0.0163 -0.0084 228  ILE A CD1 
1538 N N   . ARG A 229 ? 0.5196 0.4605 0.3988 0.0287  -0.0015 -0.0138 229  ARG A N   
1539 C CA  . ARG A 229 ? 0.5779 0.5114 0.4503 0.0297  0.0060  -0.0139 229  ARG A CA  
1540 C C   . ARG A 229 ? 0.5372 0.4785 0.4267 0.0250  0.0072  -0.0147 229  ARG A C   
1541 O O   . ARG A 229 ? 0.5383 0.4769 0.4295 0.0245  0.0145  -0.0140 229  ARG A O   
1542 C CB  . ARG A 229 ? 0.6682 0.5889 0.5190 0.0334  0.0053  -0.0163 229  ARG A CB  
1543 C CG  . ARG A 229 ? 0.7646 0.6730 0.5929 0.0392  0.0072  -0.0148 229  ARG A CG  
1544 C CD  . ARG A 229 ? 0.8277 0.7203 0.6307 0.0433  0.0068  -0.0172 229  ARG A CD  
1545 N NE  . ARG A 229 ? 0.8767 0.7707 0.6785 0.0419  -0.0045 -0.0210 229  ARG A NE  
1546 C CZ  . ARG A 229 ? 0.8963 0.7841 0.6839 0.0443  -0.0136 -0.0221 229  ARG A CZ  
1547 N NH1 . ARG A 229 ? 0.8985 0.7784 0.6703 0.0485  -0.0129 -0.0196 229  ARG A NH1 
1548 N NH2 . ARG A 229 ? 0.8870 0.7762 0.6762 0.0426  -0.0238 -0.0256 229  ARG A NH2 
1549 N N   . GLU A 230 ? 0.4747 0.4254 0.3769 0.0217  0.0007  -0.0159 230  GLU A N   
1550 C CA  . GLU A 230 ? 0.5142 0.4724 0.4318 0.0174  0.0011  -0.0162 230  GLU A CA  
1551 C C   . GLU A 230 ? 0.4501 0.4149 0.3811 0.0147  0.0031  -0.0139 230  GLU A C   
1552 O O   . GLU A 230 ? 0.4885 0.4561 0.4282 0.0118  0.0053  -0.0139 230  GLU A O   
1553 C CB  . GLU A 230 ? 0.5921 0.5565 0.5172 0.0156  -0.0052 -0.0178 230  GLU A CB  
1554 C CG  . GLU A 230 ? 0.6898 0.6564 0.6209 0.0132  -0.0045 -0.0193 230  GLU A CG  
1555 C CD  . GLU A 230 ? 0.7756 0.7321 0.6931 0.0151  -0.0003 -0.0212 230  GLU A CD  
1556 O OE1 . GLU A 230 ? 0.8025 0.7495 0.7032 0.0189  -0.0006 -0.0223 230  GLU A OE1 
1557 O OE2 . GLU A 230 ? 0.7910 0.7480 0.7138 0.0132  0.0039  -0.0217 230  GLU A OE2 
1558 N N   . GLY A 231 ? 0.3648 0.3315 0.2968 0.0156  0.0019  -0.0123 231  GLY A N   
1559 C CA  . GLY A 231 ? 0.3496 0.3202 0.2911 0.0136  0.0038  -0.0103 231  GLY A CA  
1560 C C   . GLY A 231 ? 0.3168 0.2957 0.2725 0.0098  0.0008  -0.0102 231  GLY A C   
1561 O O   . GLY A 231 ? 0.3307 0.3112 0.2927 0.0077  0.0023  -0.0092 231  GLY A O   
1562 N N   . LYS A 232 ? 0.2679 0.2506 0.2271 0.0093  -0.0029 -0.0111 232  LYS A N   
1563 C CA  A LYS A 232 ? 0.2532 0.2420 0.2235 0.0067  -0.0042 -0.0105 232  LYS A CA  
1564 C CA  B LYS A 232 ? 0.2631 0.2519 0.2334 0.0067  -0.0042 -0.0105 232  LYS A CA  
1565 C C   . LYS A 232 ? 0.2367 0.2280 0.2099 0.0072  -0.0058 -0.0097 232  LYS A C   
1566 O O   . LYS A 232 ? 0.2033 0.1936 0.1719 0.0091  -0.0077 -0.0106 232  LYS A O   
1567 C CB  A LYS A 232 ? 0.3001 0.2905 0.2726 0.0060  -0.0054 -0.0119 232  LYS A CB  
1568 C CB  B LYS A 232 ? 0.3022 0.2926 0.2745 0.0061  -0.0056 -0.0119 232  LYS A CB  
1569 C CG  A LYS A 232 ? 0.3351 0.3229 0.3053 0.0052  -0.0033 -0.0130 232  LYS A CG  
1570 C CG  B LYS A 232 ? 0.3349 0.3232 0.3054 0.0052  -0.0037 -0.0131 232  LYS A CG  
1571 C CD  A LYS A 232 ? 0.3623 0.3514 0.3340 0.0047  -0.0046 -0.0147 232  LYS A CD  
1572 C CD  B LYS A 232 ? 0.3625 0.3527 0.3354 0.0048  -0.0055 -0.0146 232  LYS A CD  
1573 C CE  A LYS A 232 ? 0.3767 0.3660 0.3517 0.0029  -0.0023 -0.0157 232  LYS A CE  
1574 C CE  B LYS A 232 ? 0.3676 0.3561 0.3400 0.0037  -0.0034 -0.0163 232  LYS A CE  
1575 N NZ  A LYS A 232 ? 0.4039 0.3865 0.3719 0.0033  0.0022  -0.0166 232  LYS A NZ  
1576 N NZ  B LYS A 232 ? 0.3325 0.3226 0.3068 0.0035  -0.0052 -0.0179 232  LYS A NZ  
1577 N N   . PHE A 233 ? 0.2271 0.2208 0.2068 0.0056  -0.0050 -0.0084 233  PHE A N   
1578 C CA  . PHE A 233 ? 0.2329 0.2279 0.2146 0.0058  -0.0055 -0.0077 233  PHE A CA  
1579 C C   . PHE A 233 ? 0.2045 0.2004 0.1909 0.0040  -0.0046 -0.0065 233  PHE A C   
1580 O O   . PHE A 233 ? 0.2009 0.1962 0.1885 0.0030  -0.0040 -0.0061 233  PHE A O   
1581 C CB  . PHE A 233 ? 0.2082 0.2017 0.1870 0.0069  -0.0047 -0.0069 233  PHE A CB  
1582 C CG  . PHE A 233 ? 0.2199 0.2111 0.1981 0.0061  -0.0028 -0.0060 233  PHE A CG  
1583 C CD1 . PHE A 233 ? 0.2287 0.2196 0.2103 0.0043  -0.0020 -0.0049 233  PHE A CD1 
1584 C CD2 . PHE A 233 ? 0.2147 0.2029 0.1875 0.0072  -0.0017 -0.0064 233  PHE A CD2 
1585 C CE1 . PHE A 233 ? 0.2193 0.2078 0.2001 0.0033  -0.0005 -0.0045 233  PHE A CE1 
1586 C CE2 . PHE A 233 ? 0.1909 0.1764 0.1632 0.0062  0.0008  -0.0058 233  PHE A CE2 
1587 C CZ  . PHE A 233 ? 0.1579 0.1441 0.1350 0.0041  0.0010  -0.0051 233  PHE A CZ  
1588 N N   . ARG A 234 ? 0.2037 0.1999 0.1912 0.0039  -0.0046 -0.0060 234  ARG A N   
1589 C CA  . ARG A 234 ? 0.1616 0.1562 0.1501 0.0026  -0.0040 -0.0047 234  ARG A CA  
1590 C C   . ARG A 234 ? 0.2258 0.2173 0.2125 0.0019  -0.0030 -0.0036 234  ARG A C   
1591 O O   . ARG A 234 ? 0.2083 0.1994 0.1939 0.0025  -0.0026 -0.0036 234  ARG A O   
1592 C CB  . ARG A 234 ? 0.1425 0.1374 0.1312 0.0025  -0.0041 -0.0047 234  ARG A CB  
1593 C CG  . ARG A 234 ? 0.2018 0.1992 0.1918 0.0032  -0.0054 -0.0061 234  ARG A CG  
1594 C CD  . ARG A 234 ? 0.2133 0.2109 0.2039 0.0028  -0.0055 -0.0061 234  ARG A CD  
1595 N NE  . ARG A 234 ? 0.2660 0.2605 0.2552 0.0014  -0.0044 -0.0047 234  ARG A NE  
1596 C CZ  . ARG A 234 ? 0.3045 0.2977 0.2935 0.0009  -0.0047 -0.0045 234  ARG A CZ  
1597 N NH1 . ARG A 234 ? 0.3040 0.2995 0.2950 0.0016  -0.0057 -0.0056 234  ARG A NH1 
1598 N NH2 . ARG A 234 ? 0.3007 0.2890 0.2858 -0.0003 -0.0043 -0.0033 234  ARG A NH2 
1599 N N   . ARG A 235 ? 0.2034 0.1915 0.1884 0.0010  -0.0031 -0.0029 235  ARG A N   
1600 C CA  . ARG A 235 ? 0.1971 0.1808 0.1785 0.0005  -0.0026 -0.0023 235  ARG A CA  
1601 C C   . ARG A 235 ? 0.2116 0.1930 0.1907 0.0005  -0.0016 -0.0018 235  ARG A C   
1602 O O   . ARG A 235 ? 0.2010 0.1832 0.1805 0.0005  -0.0016 -0.0019 235  ARG A O   
1603 C CB  . ARG A 235 ? 0.2001 0.1789 0.1775 0.0000  -0.0039 -0.0021 235  ARG A CB  
1604 C CG  . ARG A 235 ? 0.2060 0.1793 0.1783 -0.0002 -0.0043 -0.0022 235  ARG A CG  
1605 C CD  . ARG A 235 ? 0.2122 0.1770 0.1765 -0.0003 -0.0063 -0.0022 235  ARG A CD  
1606 N NE  . ARG A 235 ? 0.1983 0.1563 0.1562 -0.0002 -0.0077 -0.0030 235  ARG A NE  
1607 C CZ  . ARG A 235 ? 0.2495 0.2016 0.2008 -0.0004 -0.0059 -0.0028 235  ARG A CZ  
1608 N NH1 . ARG A 235 ? 0.2270 0.1791 0.1780 -0.0005 -0.0025 -0.0018 235  ARG A NH1 
1609 N NH2 . ARG A 235 ? 0.2519 0.1973 0.1971 -0.0002 -0.0077 -0.0042 235  ARG A NH2 
1610 N N   . ILE A 236 ? 0.1796 0.1580 0.1560 0.0006  -0.0005 -0.0015 236  ILE A N   
1611 C CA  . ILE A 236 ? 0.1387 0.1134 0.1116 0.0009  0.0012  -0.0012 236  ILE A CA  
1612 C C   . ILE A 236 ? 0.1754 0.1432 0.1421 0.0001  0.0017  -0.0009 236  ILE A C   
1613 O O   . ILE A 236 ? 0.1725 0.1380 0.1369 -0.0004 0.0001  -0.0009 236  ILE A O   
1614 C CB  . ILE A 236 ? 0.1993 0.1705 0.1693 0.0013  0.0029  -0.0009 236  ILE A CB  
1615 C CG1 . ILE A 236 ? 0.1693 0.1351 0.1343 0.0004  0.0028  -0.0009 236  ILE A CG1 
1616 C CG2 . ILE A 236 ? 0.1864 0.1627 0.1604 0.0024  0.0025  -0.0011 236  ILE A CG2 
1617 C CD1 . ILE A 236 ? 0.2026 0.1656 0.1652 0.0006  0.0046  -0.0010 236  ILE A CD1 
1618 N N   . PRO A 237 ? 0.1946 0.1579 0.1573 0.0004  0.0041  -0.0007 237  PRO A N   
1619 C CA  . PRO A 237 ? 0.1957 0.1503 0.1502 0.0001  0.0054  -0.0006 237  PRO A CA  
1620 C C   . PRO A 237 ? 0.2537 0.1990 0.1987 -0.0002 0.0048  -0.0006 237  PRO A C   
1621 O O   . PRO A 237 ? 0.2873 0.2316 0.2312 0.0000  0.0047  -0.0008 237  PRO A O   
1622 C CB  . PRO A 237 ? 0.1644 0.1141 0.1153 0.0013  0.0104  -0.0003 237  PRO A CB  
1623 C CG  . PRO A 237 ? 0.1791 0.1392 0.1396 0.0021  0.0095  -0.0005 237  PRO A CG  
1624 C CD  . PRO A 237 ? 0.1572 0.1229 0.1222 0.0018  0.0062  -0.0007 237  PRO A CD  
1625 N N   . TYR A 238 ? 0.2159 0.1536 0.1531 -0.0003 0.0039  -0.0008 238  TYR A N   
1626 C CA  . TYR A 238 ? 0.2311 0.1591 0.1578 -0.0002 0.0013  -0.0014 238  TYR A CA  
1627 C C   . TYR A 238 ? 0.2947 0.2099 0.2084 0.0007  0.0041  -0.0019 238  TYR A C   
1628 O O   . TYR A 238 ? 0.2932 0.2005 0.1983 0.0010  0.0009  -0.0031 238  TYR A O   
1629 C CB  . TYR A 238 ? 0.2288 0.1509 0.1496 -0.0003 -0.0012 -0.0015 238  TYR A CB  
1630 C CG  . TYR A 238 ? 0.2322 0.1659 0.1650 -0.0009 -0.0045 -0.0013 238  TYR A CG  
1631 C CD1 . TYR A 238 ? 0.2593 0.1995 0.1987 -0.0014 -0.0033 -0.0009 238  TYR A CD1 
1632 C CD2 . TYR A 238 ? 0.2151 0.1528 0.1524 -0.0007 -0.0083 -0.0018 238  TYR A CD2 
1633 C CE1 . TYR A 238 ? 0.2370 0.1867 0.1862 -0.0015 -0.0056 -0.0009 238  TYR A CE1 
1634 C CE2 . TYR A 238 ? 0.2150 0.1615 0.1619 -0.0007 -0.0100 -0.0018 238  TYR A CE2 
1635 C CZ  . TYR A 238 ? 0.2461 0.1984 0.1985 -0.0011 -0.0084 -0.0013 238  TYR A CZ  
1636 O OH  . TYR A 238 ? 0.2836 0.2436 0.2443 -0.0007 -0.0096 -0.0016 238  TYR A OH  
1637 N N   . ARG A 239 ? 0.3046 0.2172 0.2168 0.0015  0.0100  -0.0013 239  ARG A N   
1638 C CA  . ARG A 239 ? 0.3676 0.2685 0.2686 0.0029  0.0144  -0.0016 239  ARG A CA  
1639 C C   . ARG A 239 ? 0.3268 0.2325 0.2322 0.0025  0.0124  -0.0022 239  ARG A C   
1640 O O   . ARG A 239 ? 0.3506 0.2461 0.2456 0.0033  0.0140  -0.0033 239  ARG A O   
1641 C CB  . ARG A 239 ? 0.4195 0.3187 0.3217 0.0045  0.0223  -0.0005 239  ARG A CB  
1642 C CG  . ARG A 239 ? 0.4967 0.4076 0.4121 0.0046  0.0235  0.0001  239  ARG A CG  
1643 C CD  . ARG A 239 ? 0.5951 0.5072 0.5156 0.0067  0.0302  0.0014  239  ARG A CD  
1644 N NE  . ARG A 239 ? 0.6295 0.5267 0.5383 0.0091  0.0388  0.0022  239  ARG A NE  
1645 C CZ  . ARG A 239 ? 0.6195 0.5078 0.5220 0.0110  0.0450  0.0027  239  ARG A CZ  
1646 N NH1 . ARG A 239 ? 0.6237 0.4971 0.5147 0.0136  0.0540  0.0035  239  ARG A NH1 
1647 N NH2 . ARG A 239 ? 0.5817 0.4750 0.4887 0.0104  0.0430  0.0025  239  ARG A NH2 
1648 N N   . TYR A 240 ? 0.2673 0.1874 0.1870 0.0014  0.0095  -0.0019 240  TYR A N   
1649 C CA  . TYR A 240 ? 0.2322 0.1574 0.1568 0.0012  0.0082  -0.0024 240  TYR A CA  
1650 C C   . TYR A 240 ? 0.2946 0.2205 0.2192 0.0006  0.0023  -0.0040 240  TYR A C   
1651 O O   . TYR A 240 ? 0.2546 0.1847 0.1832 0.0002  -0.0011 -0.0038 240  TYR A O   
1652 C CB  . TYR A 240 ? 0.2101 0.1479 0.1482 0.0011  0.0092  -0.0013 240  TYR A CB  
1653 C CG  . TYR A 240 ? 0.2187 0.1558 0.1579 0.0023  0.0139  -0.0003 240  TYR A CG  
1654 C CD1 . TYR A 240 ? 0.1834 0.1256 0.1280 0.0026  0.0136  0.0001  240  TYR A CD1 
1655 C CD2 . TYR A 240 ? 0.2286 0.1599 0.1638 0.0036  0.0187  0.0001  240  TYR A CD2 
1656 C CE1 . TYR A 240 ? 0.2184 0.1603 0.1647 0.0044  0.0180  0.0008  240  TYR A CE1 
1657 C CE2 . TYR A 240 ? 0.2350 0.1657 0.1725 0.0056  0.0238  0.0012  240  TYR A CE2 
1658 C CZ  . TYR A 240 ? 0.2503 0.1866 0.1936 0.0061  0.0233  0.0016  240  TYR A CZ  
1659 O OH  . TYR A 240 ? 0.3238 0.2608 0.2708 0.0085  0.0286  0.0030  240  TYR A OH  
1660 N N   . SER A 241 ? 0.3288 0.2501 0.2494 0.0007  0.0012  -0.0059 241  SER A N   
1661 C CA  . SER A 241 ? 0.3049 0.2248 0.2259 0.0005  -0.0053 -0.0083 241  SER A CA  
1662 C C   . SER A 241 ? 0.2873 0.2206 0.2226 0.0000  -0.0071 -0.0081 241  SER A C   
1663 O O   . SER A 241 ? 0.3148 0.2577 0.2585 -0.0002 -0.0032 -0.0065 241  SER A O   
1664 C CB  . SER A 241 ? 0.2757 0.1892 0.1930 0.0007  -0.0058 -0.0110 241  SER A CB  
1665 O OG  . SER A 241 ? 0.2030 0.1261 0.1306 0.0005  -0.0013 -0.0104 241  SER A OG  
1666 N N   . ASP A 242 ? 0.2929 0.2252 0.2303 0.0000  -0.0132 -0.0099 242  ASP A N   
1667 C CA  . ASP A 242 ? 0.2893 0.2321 0.2398 -0.0001 -0.0146 -0.0105 242  ASP A CA  
1668 C C   . ASP A 242 ? 0.2562 0.2050 0.2153 -0.0005 -0.0116 -0.0118 242  ASP A C   
1669 O O   . ASP A 242 ? 0.2859 0.2439 0.2538 -0.0007 -0.0088 -0.0113 242  ASP A O   
1670 C CB  . ASP A 242 ? 0.3079 0.2460 0.2598 0.0001  -0.0225 -0.0128 242  ASP A CB  
1671 C CG  . ASP A 242 ? 0.3588 0.2930 0.3049 0.0004  -0.0248 -0.0113 242  ASP A CG  
1672 O OD1 . ASP A 242 ? 0.3415 0.2802 0.2870 0.0004  -0.0200 -0.0087 242  ASP A OD1 
1673 O OD2 . ASP A 242 ? 0.4283 0.3544 0.3712 0.0007  -0.0321 -0.0129 242  ASP A OD2 
1674 N N   . GLU A 243 ? 0.2337 0.1758 0.1895 -0.0006 -0.0120 -0.0137 243  GLU A N   
1675 C CA  . GLU A 243 ? 0.2505 0.1966 0.2147 -0.0010 -0.0083 -0.0148 243  GLU A CA  
1676 C C   . GLU A 243 ? 0.2156 0.1677 0.1795 -0.0008 -0.0009 -0.0118 243  GLU A C   
1677 O O   . GLU A 243 ? 0.2223 0.1805 0.1942 -0.0009 0.0025  -0.0116 243  GLU A O   
1678 C CB  . GLU A 243 ? 0.2532 0.1894 0.2145 -0.0011 -0.0104 -0.0175 243  GLU A CB  
1679 C CG  . GLU A 243 ? 0.3756 0.3046 0.3401 -0.0015 -0.0198 -0.0208 243  GLU A CG  
1680 C CD  . GLU A 243 ? 0.4744 0.3924 0.4235 -0.0009 -0.0255 -0.0208 243  GLU A CD  
1681 O OE1 . GLU A 243 ? 0.4889 0.4066 0.4276 -0.0004 -0.0214 -0.0180 243  GLU A OE1 
1682 O OE2 . GLU A 243 ? 0.5470 0.4554 0.4951 -0.0011 -0.0344 -0.0236 243  GLU A OE2 
1683 N N   . LEU A 244 ? 0.2610 0.2099 0.2163 -0.0004 0.0014  -0.0094 244  LEU A N   
1684 C CA  . LEU A 244 ? 0.2319 0.1854 0.1889 -0.0001 0.0065  -0.0064 244  LEU A CA  
1685 C C   . LEU A 244 ? 0.2696 0.2311 0.2326 -0.0003 0.0056  -0.0049 244  LEU A C   
1686 O O   . LEU A 244 ? 0.2875 0.2529 0.2547 0.0000  0.0079  -0.0038 244  LEU A O   
1687 C CB  . LEU A 244 ? 0.2384 0.1862 0.1881 0.0005  0.0088  -0.0046 244  LEU A CB  
1688 C CG  . LEU A 244 ? 0.2330 0.1840 0.1864 0.0014  0.0124  -0.0021 244  LEU A CG  
1689 C CD1 . LEU A 244 ? 0.1679 0.1205 0.1250 0.0021  0.0156  -0.0018 244  LEU A CD1 
1690 C CD2 . LEU A 244 ? 0.2369 0.1816 0.1848 0.0025  0.0153  -0.0011 244  LEU A CD2 
1691 N N   . ASN A 245 ? 0.2439 0.2060 0.2064 -0.0005 0.0022  -0.0048 245  ASN A N   
1692 C CA  . ASN A 245 ? 0.1929 0.1617 0.1612 -0.0005 0.0015  -0.0039 245  ASN A CA  
1693 C C   . ASN A 245 ? 0.1633 0.1366 0.1374 -0.0008 0.0020  -0.0054 245  ASN A C   
1694 O O   . ASN A 245 ? 0.1931 0.1698 0.1698 -0.0007 0.0035  -0.0045 245  ASN A O   
1695 C CB  . ASN A 245 ? 0.1655 0.1334 0.1327 -0.0005 -0.0016 -0.0039 245  ASN A CB  
1696 C CG  . ASN A 245 ? 0.1991 0.1736 0.1725 -0.0004 -0.0019 -0.0035 245  ASN A CG  
1697 O OD1 . ASN A 245 ? 0.2285 0.2058 0.2041 -0.0001 -0.0008 -0.0025 245  ASN A OD1 
1698 N ND2 . ASN A 245 ? 0.1569 0.1333 0.1332 -0.0003 -0.0039 -0.0049 245  ASN A ND2 
1699 N N   . GLU A 246 ? 0.1293 0.1011 0.1056 -0.0011 0.0005  -0.0081 246  GLU A N   
1700 C CA  . GLU A 246 ? 0.1974 0.1722 0.1820 -0.0014 0.0019  -0.0103 246  GLU A CA  
1701 C C   . GLU A 246 ? 0.1808 0.1555 0.1661 -0.0013 0.0078  -0.0092 246  GLU A C   
1702 O O   . GLU A 246 ? 0.2177 0.1938 0.2053 -0.0012 0.0108  -0.0087 246  GLU A O   
1703 C CB  . GLU A 246 ? 0.2418 0.2131 0.2329 -0.0016 -0.0018 -0.0137 246  GLU A CB  
1704 C CG  . GLU A 246 ? 0.3361 0.3091 0.3411 -0.0021 0.0003  -0.0157 246  GLU A CG  
1705 C CD  . GLU A 246 ? 0.5018 0.4705 0.5176 -0.0025 -0.0055 -0.0185 246  GLU A CD  
1706 O OE1 . GLU A 246 ? 0.5007 0.4636 0.5131 -0.0025 -0.0080 -0.0193 246  GLU A OE1 
1707 O OE2 . GLU A 246 ? 0.5701 0.5402 0.5985 -0.0028 -0.0079 -0.0198 246  GLU A OE2 
1708 N N   . ILE A 247 ? 0.1577 0.1287 0.1399 -0.0009 0.0099  -0.0085 247  ILE A N   
1709 C CA  . ILE A 247 ? 0.1845 0.1538 0.1679 0.0002  0.0158  -0.0068 247  ILE A CA  
1710 C C   . ILE A 247 ? 0.1403 0.1097 0.1179 0.0016  0.0162  -0.0034 247  ILE A C   
1711 O O   . ILE A 247 ? 0.2169 0.1848 0.1943 0.0035  0.0195  -0.0020 247  ILE A O   
1712 C CB  . ILE A 247 ? 0.2657 0.2308 0.2488 0.0008  0.0182  -0.0069 247  ILE A CB  
1713 C CG1 . ILE A 247 ? 0.2989 0.2621 0.2858 0.0027  0.0250  -0.0046 247  ILE A CG1 
1714 C CG2 . ILE A 247 ? 0.2886 0.2515 0.2628 0.0011  0.0168  -0.0051 247  ILE A CG2 
1715 C CD1 . ILE A 247 ? 0.3605 0.3201 0.3498 0.0034  0.0278  -0.0047 247  ILE A CD1 
1716 N N   . ILE A 248 ? 0.1121 0.0822 0.0860 0.0017  0.0126  -0.0024 248  ILE A N   
1717 C CA  . ILE A 248 ? 0.1212 0.0924 0.0933 0.0040  0.0113  -0.0010 248  ILE A CA  
1718 C C   . ILE A 248 ? 0.1900 0.1638 0.1631 0.0039  0.0100  -0.0018 248  ILE A C   
1719 O O   . ILE A 248 ? 0.2304 0.2039 0.2007 0.0066  0.0109  -0.0012 248  ILE A O   
1720 C CB  . ILE A 248 ? 0.1367 0.1090 0.1084 0.0040  0.0084  -0.0008 248  ILE A CB  
1721 C CG1 . ILE A 248 ? 0.1499 0.1180 0.1190 0.0047  0.0109  0.0001  248  ILE A CG1 
1722 C CG2 . ILE A 248 ? 0.1306 0.1067 0.1026 0.0063  0.0066  -0.0006 248  ILE A CG2 
1723 C CD1 . ILE A 248 ? 0.0877 0.0553 0.0558 0.0051  0.0101  0.0004  248  ILE A CD1 
1724 N N   . THR A 249 ? 0.2164 0.1928 0.1926 0.0015  0.0081  -0.0032 249  THR A N   
1725 C CA  . THR A 249 ? 0.1909 0.1694 0.1686 0.0013  0.0077  -0.0041 249  THR A CA  
1726 C C   . THR A 249 ? 0.2029 0.1778 0.1798 0.0023  0.0128  -0.0043 249  THR A C   
1727 O O   . THR A 249 ? 0.1279 0.1015 0.1012 0.0043  0.0140  -0.0040 249  THR A O   
1728 C CB  . THR A 249 ? 0.2469 0.2291 0.2290 -0.0006 0.0052  -0.0056 249  THR A CB  
1729 O OG1 . THR A 249 ? 0.2070 0.1903 0.1885 -0.0003 0.0022  -0.0045 249  THR A OG1 
1730 C CG2 . THR A 249 ? 0.2458 0.2299 0.2302 -0.0009 0.0055  -0.0069 249  THR A CG2 
1731 N N   . ARG A 250 ? 0.2189 0.1917 0.1998 0.0018  0.0168  -0.0049 250  ARG A N   
1732 C CA  . ARG A 250 ? 0.2255 0.1941 0.2092 0.0037  0.0241  -0.0040 250  ARG A CA  
1733 C C   . ARG A 250 ? 0.2101 0.1747 0.1850 0.0081  0.0270  -0.0007 250  ARG A C   
1734 O O   . ARG A 250 ? 0.2404 0.2016 0.2123 0.0110  0.0319  0.0007  250  ARG A O   
1735 C CB  . ARG A 250 ? 0.2713 0.2391 0.2653 0.0030  0.0279  -0.0048 250  ARG A CB  
1736 C CG  . ARG A 250 ? 0.4602 0.4306 0.4686 0.0010  0.0269  -0.0083 250  ARG A CG  
1737 C CD  . ARG A 250 ? 0.6031 0.5715 0.6257 0.0013  0.0301  -0.0086 250  ARG A CD  
1738 N NE  . ARG A 250 ? 0.7148 0.6841 0.7389 -0.0002 0.0230  -0.0114 250  ARG A NE  
1739 C CZ  . ARG A 250 ? 0.7332 0.6997 0.7595 0.0002  0.0238  -0.0111 250  ARG A CZ  
1740 N NH1 . ARG A 250 ? 0.7363 0.7002 0.7651 0.0021  0.0317  -0.0078 250  ARG A NH1 
1741 N NH2 . ARG A 250 ? 0.7157 0.6808 0.7404 -0.0009 0.0168  -0.0137 250  ARG A NH2 
1742 N N   . MET A 251 ? 0.1922 0.1571 0.1634 0.0093  0.0247  0.0006  251  MET A N   
1743 C CA  . MET A 251 ? 0.2055 0.1685 0.1696 0.0141  0.0265  0.0033  251  MET A CA  
1744 C C   . MET A 251 ? 0.2353 0.1996 0.1926 0.0161  0.0236  0.0027  251  MET A C   
1745 O O   . MET A 251 ? 0.3101 0.2714 0.2596 0.0203  0.0267  0.0045  251  MET A O   
1746 C CB  . MET A 251 ? 0.1364 0.1010 0.1001 0.0147  0.0239  0.0041  251  MET A CB  
1747 C CG  . MET A 251 ? 0.1559 0.1179 0.1243 0.0139  0.0281  0.0052  251  MET A CG  
1748 S SD  . MET A 251 ? 0.3028 0.2659 0.2699 0.0149  0.0257  0.0060  251  MET A SD  
1749 C CE  . MET A 251 ? 0.2475 0.2077 0.2197 0.0110  0.0279  0.0048  251  MET A CE  
1750 N N   . LEU A 252 ? 0.2306 0.1988 0.1904 0.0131  0.0180  0.0003  252  LEU A N   
1751 C CA  . LEU A 252 ? 0.2690 0.2385 0.2241 0.0144  0.0152  -0.0007 252  LEU A CA  
1752 C C   . LEU A 252 ? 0.2604 0.2269 0.2140 0.0140  0.0184  -0.0016 252  LEU A C   
1753 O O   . LEU A 252 ? 0.2678 0.2356 0.2194 0.0137  0.0156  -0.0032 252  LEU A O   
1754 C CB  . LEU A 252 ? 0.2310 0.2064 0.1911 0.0121  0.0089  -0.0023 252  LEU A CB  
1755 C CG  . LEU A 252 ? 0.2593 0.2370 0.2205 0.0131  0.0073  -0.0015 252  LEU A CG  
1756 C CD1 . LEU A 252 ? 0.2038 0.1863 0.1706 0.0111  0.0033  -0.0026 252  LEU A CD1 
1757 C CD2 . LEU A 252 ? 0.2495 0.2261 0.2029 0.0174  0.0081  -0.0005 252  LEU A CD2 
1758 N N   . ASN A 253 ? 0.2832 0.2453 0.2386 0.0143  0.0252  -0.0006 253  ASN A N   
1759 C CA  . ASN A 253 ? 0.2629 0.2217 0.2182 0.0144  0.0300  -0.0013 253  ASN A CA  
1760 C C   . ASN A 253 ? 0.3223 0.2754 0.2641 0.0193  0.0330  -0.0002 253  ASN A C   
1761 O O   . ASN A 253 ? 0.3345 0.2845 0.2681 0.0232  0.0348  0.0021  253  ASN A O   
1762 C CB  . ASN A 253 ? 0.2876 0.2434 0.2524 0.0139  0.0382  -0.0004 253  ASN A CB  
1763 C CG  . ASN A 253 ? 0.3555 0.3110 0.3282 0.0120  0.0415  -0.0024 253  ASN A CG  
1764 O OD1 . ASN A 253 ? 0.3772 0.3277 0.3440 0.0148  0.0467  -0.0018 253  ASN A OD1 
1765 N ND2 . ASN A 253 ? 0.3744 0.3349 0.3605 0.0077  0.0386  -0.0049 253  ASN A ND2 
1766 N N   . LEU A 254 ? 0.3364 0.2873 0.2746 0.0193  0.0337  -0.0019 254  LEU A N   
1767 C CA  . LEU A 254 ? 0.3459 0.2891 0.2683 0.0242  0.0370  -0.0013 254  LEU A CA  
1768 C C   . LEU A 254 ? 0.3791 0.3132 0.2960 0.0286  0.0487  0.0021  254  LEU A C   
1769 O O   . LEU A 254 ? 0.3947 0.3211 0.2954 0.0337  0.0517  0.0037  254  LEU A O   
1770 C CB  . LEU A 254 ? 0.3603 0.3022 0.2800 0.0231  0.0358  -0.0041 254  LEU A CB  
1771 C CG  . LEU A 254 ? 0.3785 0.3279 0.3011 0.0202  0.0253  -0.0068 254  LEU A CG  
1772 C CD1 . LEU A 254 ? 0.4424 0.3904 0.3641 0.0190  0.0254  -0.0093 254  LEU A CD1 
1773 C CD2 . LEU A 254 ? 0.3528 0.3015 0.2650 0.0232  0.0199  -0.0066 254  LEU A CD2 
1774 N N   . LYS A 255 ? 0.3952 0.3296 0.3259 0.0269  0.0557  0.0032  255  LYS A N   
1775 C CA  . LYS A 255 ? 0.3956 0.3220 0.3258 0.0310  0.0682  0.0073  255  LYS A CA  
1776 C C   . LYS A 255 ? 0.3657 0.2944 0.3002 0.0316  0.0684  0.0100  255  LYS A C   
1777 O O   . LYS A 255 ? 0.3427 0.2780 0.2919 0.0274  0.0649  0.0090  255  LYS A O   
1778 C CB  . LYS A 255 ? 0.4182 0.3441 0.3661 0.0291  0.0768  0.0073  255  LYS A CB  
1779 C CG  . LYS A 255 ? 0.4656 0.3899 0.4128 0.0281  0.0775  0.0045  255  LYS A CG  
1780 C CD  . LYS A 255 ? 0.5297 0.4425 0.4559 0.0340  0.0844  0.0059  255  LYS A CD  
1781 C CE  . LYS A 255 ? 0.5535 0.4636 0.4779 0.0334  0.0857  0.0029  255  LYS A CE  
1782 N NZ  . LYS A 255 ? 0.5688 0.4659 0.4684 0.0393  0.0912  0.0036  255  LYS A NZ  
1783 N N   . ASP A 256 ? 0.3694 0.2919 0.2903 0.0370  0.0726  0.0135  256  ASP A N   
1784 C CA  . ASP A 256 ? 0.3665 0.2906 0.2917 0.0381  0.0739  0.0165  256  ASP A CA  
1785 C C   . ASP A 256 ? 0.3485 0.2733 0.2935 0.0362  0.0819  0.0184  256  ASP A C   
1786 O O   . ASP A 256 ? 0.4177 0.3473 0.3729 0.0339  0.0792  0.0187  256  ASP A O   
1787 C CB  . ASP A 256 ? 0.4360 0.3523 0.3428 0.0447  0.0785  0.0204  256  ASP A CB  
1788 C CG  . ASP A 256 ? 0.4576 0.3620 0.3547 0.0496  0.0913  0.0235  256  ASP A CG  
1789 O OD1 . ASP A 256 ? 0.5230 0.4191 0.4038 0.0554  0.0965  0.0273  256  ASP A OD1 
1790 O OD2 . ASP A 256 ? 0.4147 0.3173 0.3200 0.0481  0.0967  0.0224  256  ASP A OD2 
1791 N N   . TYR A 257 ? 0.3734 0.2933 0.3254 0.0370  0.0918  0.0196  257  TYR A N   
1792 C CA  . TYR A 257 ? 0.3510 0.2719 0.3261 0.0353  0.0995  0.0215  257  TYR A CA  
1793 C C   . TYR A 257 ? 0.3515 0.2814 0.3462 0.0285  0.0916  0.0170  257  TYR A C   
1794 O O   . TYR A 257 ? 0.3614 0.2934 0.3772 0.0266  0.0953  0.0177  257  TYR A O   
1795 C CB  . TYR A 257 ? 0.3387 0.2513 0.3188 0.0391  0.1144  0.0250  257  TYR A CB  
1796 C CG  . TYR A 257 ? 0.4056 0.3153 0.3794 0.0391  0.1151  0.0223  257  TYR A CG  
1797 C CD1 . TYR A 257 ? 0.4482 0.3488 0.3968 0.0441  0.1182  0.0232  257  TYR A CD1 
1798 C CD2 . TYR A 257 ? 0.4558 0.3713 0.4488 0.0342  0.1125  0.0188  257  TYR A CD2 
1799 C CE1 . TYR A 257 ? 0.4873 0.3844 0.4297 0.0441  0.1191  0.0205  257  TYR A CE1 
1800 C CE2 . TYR A 257 ? 0.4578 0.3707 0.4461 0.0343  0.1136  0.0165  257  TYR A CE2 
1801 C CZ  . TYR A 257 ? 0.4931 0.3967 0.4561 0.0392  0.1172  0.0173  257  TYR A CZ  
1802 O OH  . TYR A 257 ? 0.5455 0.4458 0.5035 0.0393  0.1186  0.0148  257  TYR A OH  
1803 N N   . HIS A 258 ? 0.3373 0.2723 0.3255 0.0251  0.0807  0.0124  258  HIS A N   
1804 C CA  . HIS A 258 ? 0.3072 0.2502 0.3099 0.0191  0.0722  0.0081  258  HIS A CA  
1805 C C   . HIS A 258 ? 0.3139 0.2611 0.3117 0.0172  0.0637  0.0071  258  HIS A C   
1806 O O   . HIS A 258 ? 0.3387 0.2911 0.3469 0.0129  0.0579  0.0040  258  HIS A O   
1807 C CB  . HIS A 258 ? 0.3584 0.3047 0.3587 0.0162  0.0657  0.0039  258  HIS A CB  
1808 C CG  . HIS A 258 ? 0.3836 0.3272 0.3948 0.0168  0.0732  0.0039  258  HIS A CG  
1809 N ND1 . HIS A 258 ? 0.4124 0.3542 0.4447 0.0173  0.0820  0.0060  258  HIS A ND1 
1810 C CD2 . HIS A 258 ? 0.3818 0.3239 0.3875 0.0169  0.0732  0.0021  258  HIS A CD2 
1811 C CE1 . HIS A 258 ? 0.4189 0.3582 0.4587 0.0180  0.0878  0.0058  258  HIS A CE1 
1812 N NE2 . HIS A 258 ? 0.4061 0.3454 0.4290 0.0178  0.0828  0.0033  258  HIS A NE2 
1813 N N   . ARG A 259 ? 0.2909 0.2356 0.2731 0.0208  0.0631  0.0096  259  ARG A N   
1814 C CA  . ARG A 259 ? 0.2583 0.2065 0.2375 0.0196  0.0564  0.0092  259  ARG A CA  
1815 C C   . ARG A 259 ? 0.2574 0.2048 0.2487 0.0194  0.0616  0.0112  259  ARG A C   
1816 O O   . ARG A 259 ? 0.2729 0.2161 0.2702 0.0223  0.0711  0.0147  259  ARG A O   
1817 C CB  . ARG A 259 ? 0.2880 0.2348 0.2508 0.0239  0.0540  0.0112  259  ARG A CB  
1818 C CG  . ARG A 259 ? 0.2998 0.2472 0.2520 0.0243  0.0488  0.0089  259  ARG A CG  
1819 C CD  . ARG A 259 ? 0.3305 0.2770 0.2686 0.0286  0.0458  0.0103  259  ARG A CD  
1820 N NE  . ARG A 259 ? 0.3576 0.3017 0.2848 0.0301  0.0439  0.0087  259  ARG A NE  
1821 C CZ  . ARG A 259 ? 0.3349 0.2734 0.2466 0.0351  0.0456  0.0103  259  ARG A CZ  
1822 N NH1 . ARG A 259 ? 0.3278 0.2633 0.2333 0.0391  0.0492  0.0138  259  ARG A NH1 
1823 N NH2 . ARG A 259 ? 0.3442 0.2793 0.2455 0.0362  0.0436  0.0083  259  ARG A NH2 
1824 N N   . PRO A 260 ? 0.2067 0.1580 0.2025 0.0161  0.0558  0.0090  260  PRO A N   
1825 C CA  . PRO A 260 ? 0.2225 0.1732 0.2305 0.0157  0.0600  0.0102  260  PRO A CA  
1826 C C   . PRO A 260 ? 0.2738 0.2207 0.2747 0.0205  0.0652  0.0152  260  PRO A C   
1827 O O   . PRO A 260 ? 0.2653 0.2119 0.2514 0.0233  0.0620  0.0164  260  PRO A O   
1828 C CB  . PRO A 260 ? 0.1857 0.1407 0.1944 0.0116  0.0518  0.0061  260  PRO A CB  
1829 C CG  . PRO A 260 ? 0.2228 0.1792 0.2160 0.0116  0.0448  0.0054  260  PRO A CG  
1830 C CD  . PRO A 260 ? 0.1922 0.1477 0.1811 0.0131  0.0459  0.0057  260  PRO A CD  
1831 N N   . SER A 261 ? 0.2615 0.2061 0.2745 0.0216  0.0728  0.0180  261  SER A N   
1832 C CA  . SER A 261 ? 0.2741 0.2157 0.2821 0.0260  0.0777  0.0228  261  SER A CA  
1833 C C   . SER A 261 ? 0.2693 0.2134 0.2779 0.0239  0.0726  0.0212  261  SER A C   
1834 O O   . SER A 261 ? 0.2298 0.1771 0.2441 0.0192  0.0668  0.0166  261  SER A O   
1835 C CB  . SER A 261 ? 0.2931 0.2311 0.3156 0.0281  0.0887  0.0268  261  SER A CB  
1836 O OG  . SER A 261 ? 0.2727 0.2134 0.3151 0.0238  0.0875  0.0239  261  SER A OG  
1837 N N   . VAL A 262 ? 0.2869 0.2294 0.2895 0.0278  0.0751  0.0251  262  VAL A N   
1838 C CA  . VAL A 262 ? 0.3353 0.2789 0.3399 0.0267  0.0728  0.0248  262  VAL A CA  
1839 C C   . VAL A 262 ? 0.2995 0.2437 0.3207 0.0223  0.0740  0.0218  262  VAL A C   
1840 O O   . VAL A 262 ? 0.3068 0.2531 0.3286 0.0190  0.0685  0.0175  262  VAL A O   
1841 C CB  . VAL A 262 ? 0.3985 0.3400 0.3996 0.0321  0.0784  0.0305  262  VAL A CB  
1842 C CG1 . VAL A 262 ? 0.4223 0.3634 0.4319 0.0309  0.0800  0.0309  262  VAL A CG1 
1843 C CG2 . VAL A 262 ? 0.3919 0.3355 0.3773 0.0357  0.0738  0.0316  262  VAL A CG2 
1844 N N   . GLU A 263 ? 0.2891 0.2315 0.3245 0.0231  0.0812  0.0237  263  GLU A N   
1845 C CA  . GLU A 263 ? 0.3126 0.2557 0.3677 0.0199  0.0808  0.0203  263  GLU A CA  
1846 C C   . GLU A 263 ? 0.2844 0.2304 0.3427 0.0153  0.0716  0.0135  263  GLU A C   
1847 O O   . GLU A 263 ? 0.2657 0.2115 0.3289 0.0124  0.0651  0.0089  263  GLU A O   
1848 C CB  . GLU A 263 ? 0.3817 0.3221 0.4539 0.0219  0.0901  0.0243  263  GLU A CB  
1849 C CG  . GLU A 263 ? 0.4426 0.3793 0.5167 0.0263  0.0997  0.0309  263  GLU A CG  
1850 C CD  . GLU A 263 ? 0.4953 0.4293 0.5498 0.0318  0.1043  0.0366  263  GLU A CD  
1851 O OE1 . GLU A 263 ? 0.5055 0.4369 0.5574 0.0357  0.1100  0.0417  263  GLU A OE1 
1852 O OE2 . GLU A 263 ? 0.4889 0.4230 0.5305 0.0324  0.1015  0.0357  263  GLU A OE2 
1853 N N   . GLU A 264 ? 0.1886 0.1361 0.2433 0.0150  0.0708  0.0130  264  GLU A N   
1854 C CA  . GLU A 264 ? 0.1574 0.1078 0.2157 0.0112  0.0622  0.0072  264  GLU A CA  
1855 C C   . GLU A 264 ? 0.1576 0.1096 0.2003 0.0093  0.0539  0.0035  264  GLU A C   
1856 O O   . GLU A 264 ? 0.1751 0.1276 0.2206 0.0064  0.0461  -0.0014 264  GLU A O   
1857 C CB  . GLU A 264 ? 0.1841 0.1354 0.2421 0.0116  0.0643  0.0078  264  GLU A CB  
1858 C CG  . GLU A 264 ? 0.3371 0.2862 0.4154 0.0128  0.0725  0.0108  264  GLU A CG  
1859 C CD  . GLU A 264 ? 0.3828 0.3307 0.4575 0.0147  0.0779  0.0130  264  GLU A CD  
1860 O OE1 . GLU A 264 ? 0.4396 0.3861 0.5328 0.0151  0.0836  0.0144  264  GLU A OE1 
1861 O OE2 . GLU A 264 ? 0.3592 0.3067 0.4133 0.0161  0.0764  0.0134  264  GLU A OE2 
1862 N N   . ILE A 265 ? 0.1510 0.1030 0.1777 0.0113  0.0553  0.0064  265  ILE A N   
1863 C CA  . ILE A 265 ? 0.1775 0.1307 0.1917 0.0099  0.0489  0.0039  265  ILE A CA  
1864 C C   . ILE A 265 ? 0.1814 0.1319 0.1991 0.0088  0.0469  0.0013  265  ILE A C   
1865 O O   . ILE A 265 ? 0.2085 0.1582 0.2220 0.0065  0.0404  -0.0029 265  ILE A O   
1866 C CB  . ILE A 265 ? 0.2276 0.1801 0.2278 0.0127  0.0498  0.0083  265  ILE A CB  
1867 C CG1 . ILE A 265 ? 0.2029 0.1563 0.1957 0.0138  0.0477  0.0093  265  ILE A CG1 
1868 C CG2 . ILE A 265 ? 0.1840 0.1366 0.1760 0.0115  0.0450  0.0068  265  ILE A CG2 
1869 C CD1 . ILE A 265 ? 0.2100 0.1624 0.1930 0.0189  0.0482  0.0133  265  ILE A CD1 
1870 N N   . LEU A 266 ? 0.2232 0.1712 0.2479 0.0107  0.0528  0.0041  266  LEU A N   
1871 C CA  . LEU A 266 ? 0.2369 0.1807 0.2638 0.0101  0.0518  0.0021  266  LEU A CA  
1872 C C   . LEU A 266 ? 0.2606 0.2010 0.2994 0.0074  0.0463  -0.0028 266  LEU A C   
1873 O O   . LEU A 266 ? 0.2502 0.1852 0.2867 0.0065  0.0428  -0.0058 266  LEU A O   
1874 C CB  . LEU A 266 ? 0.2709 0.2131 0.3025 0.0132  0.0600  0.0073  266  LEU A CB  
1875 C CG  . LEU A 266 ? 0.2731 0.2171 0.2930 0.0165  0.0637  0.0127  266  LEU A CG  
1876 C CD1 . LEU A 266 ? 0.2952 0.2376 0.3207 0.0203  0.0719  0.0188  266  LEU A CD1 
1877 C CD2 . LEU A 266 ? 0.1812 0.1245 0.1900 0.0160  0.0603  0.0114  266  LEU A CD2 
1878 N N   . GLU A 267 ? 0.2961 0.2385 0.3476 0.0064  0.0455  -0.0032 267  GLU A N   
1879 C CA  . GLU A 267 ? 0.2961 0.2356 0.3605 0.0038  0.0381  -0.0077 267  GLU A CA  
1880 C C   . GLU A 267 ? 0.3120 0.2509 0.3653 0.0017  0.0279  -0.0125 267  GLU A C   
1881 O O   . GLU A 267 ? 0.3066 0.2415 0.3667 -0.0002 0.0197  -0.0163 267  GLU A O   
1882 C CB  . GLU A 267 ? 0.3553 0.2976 0.4393 0.0036  0.0410  -0.0060 267  GLU A CB  
1883 C CG  . GLU A 267 ? 0.4957 0.4368 0.5955 0.0056  0.0505  -0.0012 267  GLU A CG  
1884 C CD  . GLU A 267 ? 0.6331 0.5766 0.7489 0.0064  0.0566  0.0020  267  GLU A CD  
1885 O OE1 . GLU A 267 ? 0.6258 0.5721 0.7410 0.0051  0.0527  0.0001  267  GLU A OE1 
1886 O OE2 . GLU A 267 ? 0.7262 0.6681 0.8552 0.0085  0.0659  0.0069  267  GLU A OE2 
1887 N N   . ASN A 268 ? 0.3366 0.2786 0.3730 0.0022  0.0282  -0.0118 268  ASN A N   
1888 C CA  . ASN A 268 ? 0.3046 0.2462 0.3304 0.0006  0.0198  -0.0152 268  ASN A CA  
1889 C C   . ASN A 268 ? 0.2710 0.2038 0.2876 0.0000  0.0140  -0.0184 268  ASN A C   
1890 O O   . ASN A 268 ? 0.1636 0.0926 0.1733 0.0011  0.0183  -0.0174 268  ASN A O   
1891 C CB  . ASN A 268 ? 0.2778 0.2246 0.2895 0.0013  0.0219  -0.0130 268  ASN A CB  
1892 C CG  . ASN A 268 ? 0.2972 0.2450 0.3016 0.0000  0.0143  -0.0153 268  ASN A CG  
1893 O OD1 . ASN A 268 ? 0.2886 0.2311 0.2823 -0.0004 0.0095  -0.0170 268  ASN A OD1 
1894 N ND2 . ASN A 268 ? 0.2795 0.2330 0.2890 -0.0004 0.0139  -0.0149 268  ASN A ND2 
1895 N N   . PRO A 269 ? 0.3032 0.2313 0.3190 -0.0014 0.0044  -0.0220 269  PRO A N   
1896 C CA  . PRO A 269 ? 0.2773 0.1936 0.2819 -0.0017 -0.0018 -0.0253 269  PRO A CA  
1897 C C   . PRO A 269 ? 0.2511 0.1637 0.2345 -0.0006 0.0014  -0.0242 269  PRO A C   
1898 O O   . PRO A 269 ? 0.2184 0.1197 0.1911 -0.0001 0.0001  -0.0261 269  PRO A O   
1899 C CB  . PRO A 269 ? 0.3008 0.2133 0.3069 -0.0029 -0.0132 -0.0282 269  PRO A CB  
1900 C CG  . PRO A 269 ? 0.2714 0.1933 0.2993 -0.0037 -0.0125 -0.0272 269  PRO A CG  
1901 C CD  . PRO A 269 ? 0.2928 0.2248 0.3202 -0.0026 -0.0013 -0.0231 269  PRO A CD  
1902 N N   . LEU A 270 ? 0.2464 0.1672 0.2243 0.0000  0.0056  -0.0211 270  LEU A N   
1903 C CA  . LEU A 270 ? 0.2543 0.1725 0.2163 0.0010  0.0095  -0.0191 270  LEU A CA  
1904 C C   . LEU A 270 ? 0.2640 0.1793 0.2253 0.0024  0.0171  -0.0177 270  LEU A C   
1905 O O   . LEU A 270 ? 0.3097 0.2178 0.2588 0.0034  0.0198  -0.0172 270  LEU A O   
1906 C CB  . LEU A 270 ? 0.2747 0.2030 0.2354 0.0012  0.0123  -0.0156 270  LEU A CB  
1907 C CG  . LEU A 270 ? 0.2687 0.1986 0.2247 0.0004  0.0065  -0.0158 270  LEU A CG  
1908 C CD1 . LEU A 270 ? 0.2726 0.2121 0.2297 0.0005  0.0098  -0.0121 270  LEU A CD1 
1909 C CD2 . LEU A 270 ? 0.2949 0.2133 0.2355 0.0007  0.0036  -0.0166 270  LEU A CD2 
1910 N N   . ILE A 271 ? 0.2334 0.1535 0.2083 0.0029  0.0213  -0.0164 271  ILE A N   
1911 C CA  . ILE A 271 ? 0.2829 0.2026 0.2588 0.0048  0.0295  -0.0135 271  ILE A CA  
1912 C C   . ILE A 271 ? 0.2362 0.1458 0.2139 0.0050  0.0295  -0.0161 271  ILE A C   
1913 O O   . ILE A 271 ? 0.2571 0.1655 0.2471 0.0041  0.0268  -0.0179 271  ILE A O   
1914 C CB  . ILE A 271 ? 0.2220 0.1511 0.2093 0.0059  0.0352  -0.0093 271  ILE A CB  
1915 C CG1 . ILE A 271 ? 0.2259 0.1625 0.2079 0.0061  0.0352  -0.0067 271  ILE A CG1 
1916 C CG2 . ILE A 271 ? 0.2201 0.1478 0.2097 0.0083  0.0428  -0.0059 271  ILE A CG2 
1917 C CD1 . ILE A 271 ? 0.1697 0.1128 0.1589 0.0076  0.0399  -0.0025 271  ILE A CD1 
1918 N N   . LEU A 272 ? 0.2492 0.1509 0.2152 0.0062  0.0328  -0.0161 272  LEU A N   
1919 C CA  . LEU A 272 ? 0.2827 0.1722 0.2463 0.0065  0.0328  -0.0190 272  LEU A CA  
1920 C C   . LEU A 272 ? 0.3097 0.1988 0.2758 0.0089  0.0424  -0.0157 272  LEU A C   
1921 O O   . LEU A 272 ? 0.3086 0.2054 0.2750 0.0105  0.0483  -0.0110 272  LEU A O   
1922 C CB  . LEU A 272 ? 0.3135 0.1895 0.2579 0.0063  0.0280  -0.0226 272  LEU A CB  
1923 C CG  . LEU A 272 ? 0.3190 0.1933 0.2599 0.0043  0.0175  -0.0257 272  LEU A CG  
1924 C CD1 . LEU A 272 ? 0.3054 0.1651 0.2239 0.0048  0.0144  -0.0279 272  LEU A CD1 
1925 C CD2 . LEU A 272 ? 0.3684 0.2400 0.3228 0.0028  0.0101  -0.0293 272  LEU A CD2 
1926 N N   . GLU A 273 ? 0.2971 0.1767 0.2654 0.0093  0.0432  -0.0179 273  GLU A N   
1927 C CA  . GLU A 273 ? 0.2760 0.1549 0.2487 0.0117  0.0524  -0.0146 273  GLU A CA  
1928 C C   . GLU A 273 ? 0.2878 0.1668 0.2502 0.0139  0.0591  -0.0113 273  GLU A C   
1929 O O   . GLU A 273 ? 0.2577 0.1445 0.2276 0.0159  0.0658  -0.0060 273  GLU A O   
1930 C CB  . GLU A 273 ? 0.2575 0.1228 0.2300 0.0118  0.0519  -0.0184 273  GLU A CB  
1931 C CG  . GLU A 273 ? 0.1988 0.0661 0.1833 0.0140  0.0607  -0.0146 273  GLU A CG  
1932 C CD  . GLU A 273 ? 0.2664 0.1320 0.2430 0.0168  0.0696  -0.0111 273  GLU A CD  
1933 O OE1 . GLU A 273 ? 0.3287 0.2007 0.3159 0.0191  0.0768  -0.0058 273  GLU A OE1 
1934 O OE2 . GLU A 273 ? 0.2451 0.1023 0.2053 0.0171  0.0695  -0.0132 273  GLU A OE2 
1935 N N   . HIS A 274 ? 0.3389 0.2086 0.2848 0.0136  0.0573  -0.0139 274  HIS A N   
1936 C CA  . HIS A 274 ? 0.3320 0.1998 0.2698 0.0158  0.0646  -0.0106 274  HIS A CA  
1937 C C   . HIS A 274 ? 0.3219 0.2042 0.2659 0.0162  0.0659  -0.0054 274  HIS A C   
1938 O O   . HIS A 274 ? 0.3060 0.1889 0.2490 0.0181  0.0719  -0.0017 274  HIS A O   
1939 C CB  . HIS A 274 ? 0.3399 0.1920 0.2575 0.0159  0.0634  -0.0143 274  HIS A CB  
1940 C CG  . HIS A 274 ? 0.2635 0.1177 0.1728 0.0141  0.0568  -0.0152 274  HIS A CG  
1941 N ND1 . HIS A 274 ? 0.2381 0.0927 0.1472 0.0116  0.0467  -0.0188 274  HIS A ND1 
1942 C CD2 . HIS A 274 ? 0.2234 0.0788 0.1258 0.0146  0.0590  -0.0126 274  HIS A CD2 
1943 C CE1 . HIS A 274 ? 0.2478 0.1044 0.1497 0.0107  0.0429  -0.0184 274  HIS A CE1 
1944 N NE2 . HIS A 274 ? 0.2244 0.0812 0.1219 0.0124  0.0503  -0.0146 274  HIS A NE2 
1945 N N   . HIS A 275 ? 0.2848 0.1777 0.2360 0.0144  0.0603  -0.0051 275  HIS A N   
1946 C CA  . HIS A 275 ? 0.2834 0.1882 0.2390 0.0147  0.0602  -0.0007 275  HIS A CA  
1947 C C   . HIS A 275 ? 0.2959 0.2088 0.2635 0.0169  0.0648  0.0046  275  HIS A C   
1948 O O   . HIS A 275 ? 0.2786 0.1991 0.2491 0.0179  0.0643  0.0088  275  HIS A O   
1949 C CB  . HIS A 275 ? 0.2580 0.1691 0.2145 0.0122  0.0526  -0.0027 275  HIS A CB  
1950 C CG  . HIS A 275 ? 0.2535 0.1587 0.1983 0.0103  0.0471  -0.0063 275  HIS A CG  
1951 N ND1 . HIS A 275 ? 0.2331 0.1360 0.1770 0.0083  0.0399  -0.0106 275  HIS A ND1 
1952 C CD2 . HIS A 275 ? 0.2510 0.1518 0.1856 0.0106  0.0477  -0.0056 275  HIS A CD2 
1953 C CE1 . HIS A 275 ? 0.2102 0.1072 0.1421 0.0074  0.0358  -0.0123 275  HIS A CE1 
1954 N NE2 . HIS A 275 ? 0.2691 0.1644 0.1948 0.0088  0.0410  -0.0093 275  HIS A NE2 
1955 N N   . HIS A 276 ? 0.2444 0.1542 0.2185 0.0179  0.0684  0.0045  276  HIS A N   
1956 C CA  . HIS A 276 ? 0.1970 0.1126 0.1821 0.0204  0.0732  0.0098  276  HIS A CA  
1957 C C   . HIS A 276 ? 0.2147 0.1279 0.2006 0.0233  0.0796  0.0137  276  HIS A C   
1958 O O   . HIS A 276 ? 0.2207 0.1270 0.1990 0.0233  0.0814  0.0118  276  HIS A O   
1959 C CB  . HIS A 276 ? 0.1661 0.0789 0.1600 0.0202  0.0744  0.0083  276  HIS A CB  
1960 C CG  . HIS A 276 ? 0.1500 0.0657 0.1479 0.0178  0.0690  0.0055  276  HIS A CG  
1961 N ND1 . HIS A 276 ? 0.1577 0.0694 0.1494 0.0149  0.0621  -0.0003 276  HIS A ND1 
1962 C CD2 . HIS A 276 ? 0.1491 0.0707 0.1570 0.0182  0.0698  0.0081  276  HIS A CD2 
1963 C CE1 . HIS A 276 ? 0.1397 0.0556 0.1396 0.0134  0.0586  -0.0012 276  HIS A CE1 
1964 N NE2 . HIS A 276 ? 0.1098 0.0313 0.1195 0.0154  0.0638  0.0038  276  HIS A NE2 
1965 N N   . HIS A 277 ? 0.2581 0.1763 0.2534 0.0261  0.0835  0.0193  277  HIS A N   
1966 C CA  . HIS A 277 ? 0.2677 0.1850 0.2668 0.0293  0.0893  0.0238  277  HIS A CA  
1967 C C   . HIS A 277 ? 0.2757 0.1831 0.2749 0.0296  0.0952  0.0212  277  HIS A C   
1968 O O   . HIS A 277 ? 0.2965 0.1999 0.2976 0.0284  0.0947  0.0180  277  HIS A O   
1969 C CB  . HIS A 277 ? 0.3161 0.2410 0.3248 0.0326  0.0908  0.0306  277  HIS A CB  
1970 C CG  . HIS A 277 ? 0.3566 0.2796 0.3730 0.0336  0.0954  0.0319  277  HIS A CG  
1971 N ND1 . HIS A 277 ? 0.3515 0.2764 0.3708 0.0327  0.0938  0.0313  277  HIS A ND1 
1972 C CD2 . HIS A 277 ? 0.3869 0.3057 0.4098 0.0356  0.1020  0.0338  277  HIS A CD2 
1973 C CE1 . HIS A 277 ? 0.4191 0.3411 0.4469 0.0340  0.0990  0.0330  277  HIS A CE1 
1974 N NE2 . HIS A 277 ? 0.4231 0.3414 0.4528 0.0357  0.1037  0.0343  277  HIS A NE2 
1975 N N   . HIS A 278 ? 0.2487 0.1513 0.2468 0.0315  0.1007  0.0227  278  HIS A N   
1976 C CA  . HIS A 278 ? 0.3065 0.1988 0.3049 0.0328  0.1076  0.0212  278  HIS A CA  
1977 C C   . HIS A 278 ? 0.4079 0.3024 0.4159 0.0366  0.1150  0.0277  278  HIS A C   
1978 O O   . HIS A 278 ? 0.3894 0.2884 0.3992 0.0378  0.1154  0.0310  278  HIS A O   
1979 C CB  . HIS A 278 ? 0.3300 0.2087 0.3132 0.0312  0.1078  0.0147  278  HIS A CB  
1980 C CG  . HIS A 278 ? 0.3663 0.2425 0.3404 0.0277  0.0993  0.0086  278  HIS A CG  
1981 N ND1 . HIS A 278 ? 0.3769 0.2587 0.3455 0.0257  0.0931  0.0078  278  HIS A ND1 
1982 C CD2 . HIS A 278 ? 0.2989 0.1675 0.2702 0.0258  0.0954  0.0031  278  HIS A CD2 
1983 C CE1 . HIS A 278 ? 0.3681 0.2465 0.3310 0.0229  0.0860  0.0023  278  HIS A CE1 
1984 N NE2 . HIS A 278 ? 0.3658 0.2362 0.3307 0.0228  0.0868  -0.0006 278  HIS A NE2 
1985 N N   . HIS A 279 ? 0.4587 0.3499 0.4745 0.0385  0.1206  0.0294  279  HIS A N   
1986 C CA  . HIS A 279 ? 0.5395 0.4321 0.5664 0.0423  0.1282  0.0356  279  HIS A CA  
1987 C C   . HIS A 279 ? 0.6081 0.4892 0.6294 0.0434  0.1357  0.0337  279  HIS A C   
1988 O O   . HIS A 279 ? 0.6301 0.5124 0.6615 0.0466  0.1426  0.0390  279  HIS A O   
1989 C CB  . HIS A 279 ? 0.6014 0.4939 0.6387 0.0439  0.1319  0.0381  279  HIS A CB  
1990 C CG  . HIS A 279 ? 0.6771 0.5797 0.7205 0.0438  0.1268  0.0415  279  HIS A CG  
1991 N ND1 . HIS A 279 ? 0.7181 0.6318 0.7689 0.0465  0.1249  0.0486  279  HIS A ND1 
1992 C CD2 . HIS A 279 ? 0.7269 0.6292 0.7701 0.0419  0.1235  0.0388  279  HIS A CD2 
1993 C CE1 . HIS A 279 ? 0.7446 0.6634 0.7970 0.0464  0.1215  0.0502  279  HIS A CE1 
1994 N NE2 . HIS A 279 ? 0.7510 0.6634 0.8001 0.0435  0.1211  0.0445  279  HIS A NE2 
1995 O OXT . HIS A 279 ? 0.6482 0.5179 0.6547 0.0415  0.1355  0.0272  279  HIS A OXT 
1996 C C01 . XK3 B .   ? 0.4046 0.3442 0.4179 -0.0224 -0.0198 0.0253  1280 XK3 A C01 
1997 C C02 . XK3 B .   ? 0.3745 0.3112 0.3856 -0.0226 -0.0189 0.0252  1280 XK3 A C02 
1998 C C03 . XK3 B .   ? 0.3515 0.2862 0.3619 -0.0230 -0.0177 0.0254  1280 XK3 A C03 
1999 C C04 . XK3 B .   ? 0.3676 0.3023 0.3775 -0.0235 -0.0175 0.0256  1280 XK3 A C04 
2000 C C05 . XK3 B .   ? 0.4100 0.3418 0.4189 -0.0238 -0.0159 0.0258  1280 XK3 A C05 
2001 S S06 . XK3 B .   ? 0.3847 0.3147 0.3935 -0.0236 -0.0150 0.0256  1280 XK3 A S06 
2002 C C07 . XK3 B .   ? 0.3575 0.2893 0.3672 -0.0232 -0.0161 0.0254  1280 XK3 A C07 
2003 C C08 . XK3 B .   ? 0.3201 0.2507 0.3296 -0.0230 -0.0156 0.0251  1280 XK3 A C08 
2004 C C09 . XK3 B .   ? 0.3069 0.2389 0.3176 -0.0226 -0.0162 0.0249  1280 XK3 A C09 
2005 N N10 . XK3 B .   ? 0.3015 0.2317 0.3115 -0.0225 -0.0155 0.0246  1280 XK3 A N10 
2006 C C11 . XK3 B .   ? 0.2797 0.2072 0.2884 -0.0228 -0.0143 0.0247  1280 XK3 A C11 
2007 N N12 . XK3 B .   ? 0.3241 0.2497 0.3322 -0.0227 -0.0135 0.0244  1280 XK3 A N12 
2008 C C13 . XK3 B .   ? 0.2746 0.2009 0.2823 -0.0231 -0.0138 0.0249  1280 XK3 A C13 
2009 C C14 . XK3 B .   ? 0.3185 0.2418 0.3247 -0.0234 -0.0124 0.0250  1280 XK3 A C14 
2010 C C15 . XK3 B .   ? 0.3558 0.2774 0.3594 -0.0239 -0.0122 0.0252  1280 XK3 A C15 
2011 C C16 . XK3 B .   ? 0.4277 0.3463 0.4293 -0.0241 -0.0110 0.0251  1280 XK3 A C16 
2012 C C17 . XK3 B .   ? 0.4648 0.3821 0.4679 -0.0240 -0.0097 0.0251  1280 XK3 A C17 
2013 C C18 . XK3 B .   ? 0.5974 0.5116 0.5987 -0.0243 -0.0083 0.0251  1280 XK3 A C18 
2014 O O19 . XK3 B .   ? 0.7103 0.6229 0.7097 -0.0248 -0.0079 0.0252  1280 XK3 A O19 
2015 O O20 . XK3 B .   ? 0.6240 0.5368 0.6253 -0.0242 -0.0076 0.0249  1280 XK3 A O20 
2016 C C21 . XK3 B .   ? 0.4200 0.3391 0.4255 -0.0236 -0.0099 0.0249  1280 XK3 A C21 
2017 C C22 . XK3 B .   ? 0.3807 0.3029 0.3882 -0.0234 -0.0111 0.0249  1280 XK3 A C22 
2018 N N23 . XK3 B .   ? 0.2942 0.2220 0.3023 -0.0232 -0.0144 0.0252  1280 XK3 A N23 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  SER 18  18  ?   ?   ?   A . n 
A 1 19  TYR 19  19  ?   ?   ?   A . n 
A 1 20  GLY 20  20  ?   ?   ?   A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 HIS 128 128 128 HIS HIS A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 ASP 132 132 ?   ?   ?   A . n 
A 1 133 GLY 133 133 ?   ?   ?   A . n 
A 1 134 GLY 134 134 ?   ?   ?   A . n 
A 1 135 HIS 135 135 ?   ?   ?   A . n 
A 1 136 THR 136 136 ?   ?   ?   A . n 
A 1 137 VAL 137 137 ?   ?   ?   A . n 
A 1 138 LEU 138 138 ?   ?   ?   A . n 
A 1 139 HIS 139 139 ?   ?   ?   A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 ?   ?   ?   A . n 
A 1 163 ALA 163 163 ?   ?   ?   A . n 
A 1 164 ARG 164 164 ?   ?   ?   A . n 
A 1 165 ILE 165 165 ?   ?   ?   A . n 
A 1 166 LEU 166 166 ?   ?   ?   A . n 
A 1 167 ASN 167 167 ?   ?   ?   A . n 
A 1 168 HIS 168 168 ?   ?   ?   A . n 
A 1 169 ASP 169 169 ?   ?   ?   A . n 
A 1 170 THR 170 170 ?   ?   ?   A . n 
A 1 171 SER 171 171 ?   ?   ?   A . n 
A 1 172 PHE 172 172 ?   ?   ?   A . n 
A 1 173 ALA 173 173 ?   ?   ?   A . n 
A 1 174 LYS 174 174 ?   ?   ?   A . n 
A 1 175 THR 175 175 ?   ?   ?   A . n 
A 1 176 PHE 176 176 ?   ?   ?   A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 MET 188 188 188 MET MET A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 MET 191 191 ?   ?   ?   A . n 
A 1 192 SER 192 192 ?   ?   ?   A . n 
A 1 193 TYR 193 193 ?   ?   ?   A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 TRP 200 200 200 TRP TRP A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 CYS 210 210 210 CYS CYS A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 MET 213 213 213 MET MET A . n 
A 1 214 PRO 214 214 214 PRO PRO A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 ARG 239 239 239 ARG ARG A . n 
A 1 240 TYR 240 240 240 TYR TYR A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 HIS 274 274 274 HIS HIS A . n 
A 1 275 HIS 275 275 275 HIS HIS A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 HIS 277 277 277 HIS HIS A . n 
A 1 278 HIS 278 278 278 HIS HIS A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 XK3 1   1280 1280 XK3 XK3 A . 
C 3 CL  1   1281 1281 CL  CL  A . 
D 3 CL  1   1282 1282 CL  CL  A . 
E 4 HOH 1   2001 2001 HOH HOH A . 
E 4 HOH 2   2002 2002 HOH HOH A . 
E 4 HOH 3   2003 2003 HOH HOH A . 
E 4 HOH 4   2004 2004 HOH HOH A . 
E 4 HOH 5   2005 2005 HOH HOH A . 
E 4 HOH 6   2006 2006 HOH HOH A . 
E 4 HOH 7   2007 2007 HOH HOH A . 
E 4 HOH 8   2008 2008 HOH HOH A . 
E 4 HOH 9   2009 2009 HOH HOH A . 
E 4 HOH 10  2010 2010 HOH HOH A . 
E 4 HOH 11  2011 2011 HOH HOH A . 
E 4 HOH 12  2012 2012 HOH HOH A . 
E 4 HOH 13  2013 2013 HOH HOH A . 
E 4 HOH 14  2014 2014 HOH HOH A . 
E 4 HOH 15  2015 2015 HOH HOH A . 
E 4 HOH 16  2016 2016 HOH HOH A . 
E 4 HOH 17  2017 2017 HOH HOH A . 
E 4 HOH 18  2018 2018 HOH HOH A . 
E 4 HOH 19  2019 2019 HOH HOH A . 
E 4 HOH 20  2020 2020 HOH HOH A . 
E 4 HOH 21  2021 2021 HOH HOH A . 
E 4 HOH 22  2022 2022 HOH HOH A . 
E 4 HOH 23  2023 2023 HOH HOH A . 
E 4 HOH 24  2024 2024 HOH HOH A . 
E 4 HOH 25  2025 2025 HOH HOH A . 
E 4 HOH 26  2026 2026 HOH HOH A . 
E 4 HOH 27  2027 2027 HOH HOH A . 
E 4 HOH 28  2028 2028 HOH HOH A . 
E 4 HOH 29  2029 2029 HOH HOH A . 
E 4 HOH 30  2030 2030 HOH HOH A . 
E 4 HOH 31  2031 2031 HOH HOH A . 
E 4 HOH 32  2032 2032 HOH HOH A . 
E 4 HOH 33  2033 2033 HOH HOH A . 
E 4 HOH 34  2034 2034 HOH HOH A . 
E 4 HOH 35  2035 2035 HOH HOH A . 
E 4 HOH 36  2036 2036 HOH HOH A . 
E 4 HOH 37  2037 2037 HOH HOH A . 
E 4 HOH 38  2038 2038 HOH HOH A . 
E 4 HOH 39  2039 2039 HOH HOH A . 
E 4 HOH 40  2040 2040 HOH HOH A . 
E 4 HOH 41  2041 2041 HOH HOH A . 
E 4 HOH 42  2042 2042 HOH HOH A . 
E 4 HOH 43  2043 2043 HOH HOH A . 
E 4 HOH 44  2044 2044 HOH HOH A . 
E 4 HOH 45  2045 2045 HOH HOH A . 
E 4 HOH 46  2046 2046 HOH HOH A . 
E 4 HOH 47  2047 2047 HOH HOH A . 
E 4 HOH 48  2048 2048 HOH HOH A . 
E 4 HOH 49  2049 2049 HOH HOH A . 
E 4 HOH 50  2050 2050 HOH HOH A . 
E 4 HOH 51  2051 2051 HOH HOH A . 
E 4 HOH 52  2052 2052 HOH HOH A . 
E 4 HOH 53  2053 2053 HOH HOH A . 
E 4 HOH 54  2054 2054 HOH HOH A . 
E 4 HOH 55  2055 2055 HOH HOH A . 
E 4 HOH 56  2056 2056 HOH HOH A . 
E 4 HOH 57  2057 2057 HOH HOH A . 
E 4 HOH 58  2058 2058 HOH HOH A . 
E 4 HOH 59  2059 2059 HOH HOH A . 
E 4 HOH 60  2060 2060 HOH HOH A . 
E 4 HOH 61  2061 2061 HOH HOH A . 
E 4 HOH 62  2062 2062 HOH HOH A . 
E 4 HOH 63  2063 2063 HOH HOH A . 
E 4 HOH 64  2064 2064 HOH HOH A . 
E 4 HOH 65  2065 2065 HOH HOH A . 
E 4 HOH 66  2066 2066 HOH HOH A . 
E 4 HOH 67  2067 2067 HOH HOH A . 
E 4 HOH 68  2068 2068 HOH HOH A . 
E 4 HOH 69  2069 2069 HOH HOH A . 
E 4 HOH 70  2070 2070 HOH HOH A . 
E 4 HOH 71  2071 2071 HOH HOH A . 
E 4 HOH 72  2072 2072 HOH HOH A . 
E 4 HOH 73  2073 2073 HOH HOH A . 
E 4 HOH 74  2074 2074 HOH HOH A . 
E 4 HOH 75  2075 2075 HOH HOH A . 
E 4 HOH 76  2076 2076 HOH HOH A . 
E 4 HOH 77  2077 2077 HOH HOH A . 
E 4 HOH 78  2078 2078 HOH HOH A . 
E 4 HOH 79  2079 2079 HOH HOH A . 
E 4 HOH 80  2080 2080 HOH HOH A . 
E 4 HOH 81  2081 2081 HOH HOH A . 
E 4 HOH 82  2082 2082 HOH HOH A . 
E 4 HOH 83  2083 2083 HOH HOH A . 
E 4 HOH 84  2084 2084 HOH HOH A . 
E 4 HOH 85  2085 2085 HOH HOH A . 
E 4 HOH 86  2086 2086 HOH HOH A . 
E 4 HOH 87  2087 2087 HOH HOH A . 
E 4 HOH 88  2088 2088 HOH HOH A . 
E 4 HOH 89  2089 2089 HOH HOH A . 
E 4 HOH 90  2090 2090 HOH HOH A . 
E 4 HOH 91  2091 2091 HOH HOH A . 
E 4 HOH 92  2092 2092 HOH HOH A . 
E 4 HOH 93  2093 2093 HOH HOH A . 
E 4 HOH 94  2094 2094 HOH HOH A . 
E 4 HOH 95  2095 2095 HOH HOH A . 
E 4 HOH 96  2096 2096 HOH HOH A . 
E 4 HOH 97  2097 2097 HOH HOH A . 
E 4 HOH 98  2098 2098 HOH HOH A . 
E 4 HOH 99  2099 2099 HOH HOH A . 
E 4 HOH 100 2100 2100 HOH HOH A . 
E 4 HOH 101 2101 2101 HOH HOH A . 
E 4 HOH 102 2102 2102 HOH HOH A . 
E 4 HOH 103 2103 2103 HOH HOH A . 
E 4 HOH 104 2104 2104 HOH HOH A . 
E 4 HOH 105 2105 2105 HOH HOH A . 
E 4 HOH 106 2106 2106 HOH HOH A . 
E 4 HOH 107 2107 2107 HOH HOH A . 
E 4 HOH 108 2108 2108 HOH HOH A . 
E 4 HOH 109 2109 2109 HOH HOH A . 
E 4 HOH 110 2110 2110 HOH HOH A . 
E 4 HOH 111 2111 2111 HOH HOH A . 
E 4 HOH 112 2112 2112 HOH HOH A . 
E 4 HOH 113 2113 2113 HOH HOH A . 
E 4 HOH 114 2114 2114 HOH HOH A . 
E 4 HOH 115 2115 2115 HOH HOH A . 
E 4 HOH 116 2116 2116 HOH HOH A . 
E 4 HOH 117 2117 2117 HOH HOH A . 
E 4 HOH 118 2118 2118 HOH HOH A . 
E 4 HOH 119 2119 2119 HOH HOH A . 
E 4 HOH 120 2120 2120 HOH HOH A . 
E 4 HOH 121 2121 2121 HOH HOH A . 
E 4 HOH 122 2122 2122 HOH HOH A . 
E 4 HOH 123 2123 2123 HOH HOH A . 
E 4 HOH 124 2124 2124 HOH HOH A . 
E 4 HOH 125 2125 2125 HOH HOH A . 
E 4 HOH 126 2126 2126 HOH HOH A . 
E 4 HOH 127 2127 2127 HOH HOH A . 
E 4 HOH 128 2128 2128 HOH HOH A . 
E 4 HOH 129 2129 2129 HOH HOH A . 
E 4 HOH 130 2130 2130 HOH HOH A . 
E 4 HOH 131 2131 2131 HOH HOH A . 
E 4 HOH 132 2132 2132 HOH HOH A . 
E 4 HOH 133 2133 2133 HOH HOH A . 
E 4 HOH 134 2134 2134 HOH HOH A . 
E 4 HOH 135 2135 2135 HOH HOH A . 
E 4 HOH 136 2136 2136 HOH HOH A . 
E 4 HOH 137 2137 2137 HOH HOH A . 
E 4 HOH 138 2138 2138 HOH HOH A . 
E 4 HOH 139 2139 2139 HOH HOH A . 
E 4 HOH 140 2140 2140 HOH HOH A . 
E 4 HOH 141 2141 2141 HOH HOH A . 
E 4 HOH 142 2142 2142 HOH HOH A . 
E 4 HOH 143 2143 2143 HOH HOH A . 
E 4 HOH 144 2144 2144 HOH HOH A . 
E 4 HOH 145 2145 2145 HOH HOH A . 
E 4 HOH 146 2146 2146 HOH HOH A . 
E 4 HOH 147 2147 2147 HOH HOH A . 
E 4 HOH 148 2148 2148 HOH HOH A . 
E 4 HOH 149 2149 2149 HOH HOH A . 
E 4 HOH 150 2150 2150 HOH HOH A . 
E 4 HOH 151 2151 2151 HOH HOH A . 
E 4 HOH 152 2152 2152 HOH HOH A . 
E 4 HOH 153 2153 2153 HOH HOH A . 
E 4 HOH 154 2154 2154 HOH HOH A . 
E 4 HOH 155 2155 2155 HOH HOH A . 
E 4 HOH 156 2156 2156 HOH HOH A . 
E 4 HOH 157 2157 2157 HOH HOH A . 
E 4 HOH 158 2158 2158 HOH HOH A . 
E 4 HOH 159 2159 2159 HOH HOH A . 
E 4 HOH 160 2160 2160 HOH HOH A . 
E 4 HOH 161 2161 2161 HOH HOH A . 
E 4 HOH 162 2162 2162 HOH HOH A . 
E 4 HOH 163 2163 2163 HOH HOH A . 
E 4 HOH 164 2164 2164 HOH HOH A . 
E 4 HOH 165 2165 2165 HOH HOH A . 
E 4 HOH 166 2166 2166 HOH HOH A . 
E 4 HOH 167 2167 2167 HOH HOH A . 
E 4 HOH 168 2168 2168 HOH HOH A . 
E 4 HOH 169 2169 2169 HOH HOH A . 
E 4 HOH 170 2170 2170 HOH HOH A . 
E 4 HOH 171 2171 2171 HOH HOH A . 
E 4 HOH 172 2172 2172 HOH HOH A . 
E 4 HOH 173 2173 2173 HOH HOH A . 
E 4 HOH 174 2174 2174 HOH HOH A . 
E 4 HOH 175 2175 2175 HOH HOH A . 
E 4 HOH 176 2176 2176 HOH HOH A . 
E 4 HOH 177 2177 2177 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-10-27 
2 'Structure model' 1 1 2011-05-19 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 29.4059 0.9171  -10.2650 0.0671 0.1370 0.0874  0.0218  -0.0609 0.0859  1.0142 0.4908 0.9430 
-0.2561 -0.3338 -0.2164 0.0383  -0.3667 -0.3285 -0.0586 0.1234  -0.0627 -0.1295 -0.0331 -0.1038 
'X-RAY DIFFRACTION' 2 ? refined 18.0625 8.4331  -20.2511 0.0560 0.0950 0.0966  0.0242  -0.0067 0.0228  0.2404 0.3305 0.0724 
-0.3100 0.0022  0.0080  -0.0504 -0.0305 0.0376  -0.0110 0.0062  -0.0842 0.0436  0.0550  0.0397  
'X-RAY DIFFRACTION' 3 ? refined 5.9722  21.4459 -19.8257 0.0419 0.0202 -0.0231 0.0191  0.0204  -0.0015 0.4748 1.7496 0.1115 
-0.2506 -0.0623 -0.2188 -0.1059 -0.1305 -0.0998 0.1483  0.0166  0.0327  0.0332  0.0639  0.0617  
'X-RAY DIFFRACTION' 4 ? refined 25.5342 8.4299  -18.5647 0.1960 0.1223 0.2034  -0.0233 -0.0137 0.0251  0.0659 0.0211 0.2811 0.0364 
-0.1310 -0.0695 0.0079  0.0104  -0.0001 0.0481  -0.0040 0.0361  -0.0024 0.0130  -0.0024 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 3:63)'    
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 64:157)'  
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 158:279)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 1)'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
MOSFLM 'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 150 ? ? -92.83  -156.64 
2 1 PHE A 160 ? ? -116.44 79.34   
3 1 ASN A 189 ? ? -107.76 -85.85  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2005 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.58 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 4   ? CG  ? A ARG 4   CG  
2  1 Y 1 A ARG 4   ? CD  ? A ARG 4   CD  
3  1 Y 1 A ARG 4   ? NE  ? A ARG 4   NE  
4  1 Y 1 A ARG 4   ? CZ  ? A ARG 4   CZ  
5  1 Y 1 A ARG 4   ? NH1 ? A ARG 4   NH1 
6  1 Y 1 A ARG 4   ? NH2 ? A ARG 4   NH2 
7  1 Y 1 A GLU 6   ? CG  ? A GLU 6   CG  
8  1 Y 1 A GLU 6   ? CD  ? A GLU 6   CD  
9  1 Y 1 A GLU 6   ? OE1 ? A GLU 6   OE1 
10 1 Y 1 A GLU 6   ? OE2 ? A GLU 6   OE2 
11 1 Y 1 A LEU 39  ? CG  ? A LEU 39  CG  
12 1 Y 1 A LEU 39  ? CD1 ? A LEU 39  CD1 
13 1 Y 1 A LEU 39  ? CD2 ? A LEU 39  CD2 
14 1 Y 1 A MET 51  ? CG  ? A MET 51  CG  
15 1 Y 1 A MET 51  ? SD  ? A MET 51  SD  
16 1 Y 1 A MET 51  ? CE  ? A MET 51  CE  
17 1 Y 1 A LEU 58  ? CG  ? A LEU 58  CG  
18 1 Y 1 A LEU 58  ? CD1 ? A LEU 58  CD1 
19 1 Y 1 A LEU 58  ? CD2 ? A LEU 58  CD2 
20 1 Y 1 A ARG 60  ? CG  ? A ARG 60  CG  
21 1 Y 1 A ARG 60  ? CD  ? A ARG 60  CD  
22 1 Y 1 A ARG 60  ? NE  ? A ARG 60  NE  
23 1 Y 1 A ARG 60  ? CZ  ? A ARG 60  CZ  
24 1 Y 1 A ARG 60  ? NH1 ? A ARG 60  NH1 
25 1 Y 1 A ARG 60  ? NH2 ? A ARG 60  NH2 
26 1 Y 1 A GLU 61  ? CG  ? A GLU 61  CG  
27 1 Y 1 A GLU 61  ? CD  ? A GLU 61  CD  
28 1 Y 1 A GLU 61  ? OE1 ? A GLU 61  OE1 
29 1 Y 1 A GLU 61  ? OE2 ? A GLU 61  OE2 
30 1 Y 1 A ARG 73  ? CD  ? A ARG 73  CD  
31 1 Y 1 A ARG 73  ? NE  ? A ARG 73  NE  
32 1 Y 1 A ARG 73  ? CZ  ? A ARG 73  CZ  
33 1 Y 1 A ARG 73  ? NH1 ? A ARG 73  NH1 
34 1 Y 1 A ARG 73  ? NH2 ? A ARG 73  NH2 
35 1 Y 1 A ARG 77  ? CG  ? A ARG 77  CG  
36 1 Y 1 A ARG 77  ? CD  ? A ARG 77  CD  
37 1 Y 1 A ARG 77  ? NE  ? A ARG 77  NE  
38 1 Y 1 A ARG 77  ? CZ  ? A ARG 77  CZ  
39 1 Y 1 A ARG 77  ? NH1 ? A ARG 77  NH1 
40 1 Y 1 A ARG 77  ? NH2 ? A ARG 77  NH2 
41 1 Y 1 A ASN 79  ? CG  ? A ASN 79  CG  
42 1 Y 1 A ASN 79  ? OD1 ? A ASN 79  OD1 
43 1 Y 1 A ASN 79  ? ND2 ? A ASN 79  ND2 
44 1 Y 1 A LYS 103 ? CG  ? A LYS 103 CG  
45 1 Y 1 A LYS 103 ? CD  ? A LYS 103 CD  
46 1 Y 1 A LYS 103 ? CE  ? A LYS 103 CE  
47 1 Y 1 A LYS 103 ? NZ  ? A LYS 103 NZ  
48 1 Y 1 A ARG 105 ? CG  ? A ARG 105 CG  
49 1 Y 1 A ARG 105 ? CD  ? A ARG 105 CD  
50 1 Y 1 A ARG 105 ? NE  ? A ARG 105 NE  
51 1 Y 1 A ARG 105 ? CZ  ? A ARG 105 CZ  
52 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1 
53 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2 
54 1 Y 1 A ARG 130 ? CG  ? A ARG 130 CG  
55 1 Y 1 A ARG 130 ? CD  ? A ARG 130 CD  
56 1 Y 1 A ARG 130 ? NE  ? A ARG 130 NE  
57 1 Y 1 A ARG 130 ? CZ  ? A ARG 130 CZ  
58 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 
59 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 
60 1 Y 1 A MET 183 ? CG  ? A MET 183 CG  
61 1 Y 1 A MET 183 ? SD  ? A MET 183 SD  
62 1 Y 1 A MET 183 ? CE  ? A MET 183 CE  
63 1 Y 1 A GLN 187 ? CG  ? A GLN 187 CG  
64 1 Y 1 A GLN 187 ? CD  ? A GLN 187 CD  
65 1 Y 1 A GLN 187 ? OE1 ? A GLN 187 OE1 
66 1 Y 1 A GLN 187 ? NE2 ? A GLN 187 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A GLY 17  ? A GLY 17  
4  1 Y 1 A SER 18  ? A SER 18  
5  1 Y 1 A TYR 19  ? A TYR 19  
6  1 Y 1 A GLY 20  ? A GLY 20  
7  1 Y 1 A ASP 132 ? A ASP 132 
8  1 Y 1 A GLY 133 ? A GLY 133 
9  1 Y 1 A GLY 134 ? A GLY 134 
10 1 Y 1 A HIS 135 ? A HIS 135 
11 1 Y 1 A THR 136 ? A THR 136 
12 1 Y 1 A VAL 137 ? A VAL 137 
13 1 Y 1 A LEU 138 ? A LEU 138 
14 1 Y 1 A HIS 139 ? A HIS 139 
15 1 Y 1 A LEU 162 ? A LEU 162 
16 1 Y 1 A ALA 163 ? A ALA 163 
17 1 Y 1 A ARG 164 ? A ARG 164 
18 1 Y 1 A ILE 165 ? A ILE 165 
19 1 Y 1 A LEU 166 ? A LEU 166 
20 1 Y 1 A ASN 167 ? A ASN 167 
21 1 Y 1 A HIS 168 ? A HIS 168 
22 1 Y 1 A ASP 169 ? A ASP 169 
23 1 Y 1 A THR 170 ? A THR 170 
24 1 Y 1 A SER 171 ? A SER 171 
25 1 Y 1 A PHE 172 ? A PHE 172 
26 1 Y 1 A ALA 173 ? A ALA 173 
27 1 Y 1 A LYS 174 ? A LYS 174 
28 1 Y 1 A THR 175 ? A THR 175 
29 1 Y 1 A PHE 176 ? A PHE 176 
30 1 Y 1 A MET 191 ? A MET 191 
31 1 Y 1 A SER 192 ? A SER 192 
32 1 Y 1 A TYR 193 ? A TYR 193 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-[3-AMINO-6-(3-ETHYLTHIOPHEN-2-YL)PYRAZIN-2-YL]CYCLOHEXANE-1-CARBOXYLIC ACID' XK3 
3 'CHLORIDE ION'                                                                  CL  
4 water                                                                           HOH 
#